2I0NA

Structure of dictyostelium discoideum myosin vii sh3 domain with adjacent proline rich region
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
80
structure length
80
Chain Sequence
MGPLGSPEFAKYARALKDYNVSDTSLLPFKRNDIITITFKDQENKWFMGQLNGKEGSFPVDHVEILLSDVPPPQPVHPVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The SH3 domain of a M7 interacts with its C-terminal proline-rich region.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Structural protein
molecule keywords Class VII unconventional myosin
total genus 7
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2i0nA01
1AD5A 2FRYA 2KT1A 2DYBA 3ULRB 2AZVA 3EG0A 2A28A 2A36A 1YNZA 1YP5A 1JU5C 4ORZA 3VRYA 2IIMA 4JZ4A 1Y0MA 2FG0A 3I35A 2D0NA 2DBKA 2SRCA 2C0IA 2JW4A 1V1CA 2J06A 1ARKA 2O31A 1WYXA 1WX6A 2A08A 3EG2A 1HD3A 1KJWA 1ZBJA 1WDXA 1BK2A 1NLPC 1CKAA 1AOJA 1PKTA 1UFFA 1BB9A 2HEQA 3O5ZA 1B07A 1AWWA 2DE0X 2D8JA 2GTJA 3M0PA 4Z89A 1GCQA 3U23A 2CH4A 2H8HA 2LMJA 1S1NA 1K0SA 5FWCA 3PVQA 1NYFA 1T3SA 4JJBA 3PE0A 2EBPA 2DJQA 1CKBA 1VYTA 1Z9ZA 1XOVA 2L3PA 2EKHA 2KT8A 1ABQA 4RTZA 2AK5A 2K79A 4RUGA 1I07A 5ECAA 1K1ZA 1GL5A 1ABOA 2OJ2A 3EG3A 2DX1A 1UJYA 1WXBA 2HDAA 2LJ0A 2RPNA 2ESWA 4AG1C 2KEAA 2GQIA 2J6FA 1PRLC 1UTIA 1ZUUA 2JM9A 2JS2A 1GRIA 2J05A 2BZ8A 2JMCA 1J3TA 4F17A 1QKWA 2FEIA 2J6OA 2BTTA 2NWMA 2L0AA 2DL5A 1NEGA 1H92A 4RTUA 1GBRA 1X2KA 1U06A 4AFUC 1K9AA 2EYZA 1I0CA 1UECA 2LJ1A 2AZSA 2VKNA 1WI7A 2L3QA 1U5SA 2KXDA 1ZUYA 2ED1A 1T0HA 1MV0B 1JXMA 3I5SA 1UDLA 3M0RA 1M3CA 1MV3A 1Z9QA 2ECZA 2LNHB 2LQNA 2QDLA 1M8MA 1W70A 2RQVA 2X3WD 2CUDA 3NHNA 4HXJA 3JV3A 2CUBA 2K2MA 4M4ZA 1RLQC 4OMNA 3VS5A 2LP5A 2F2XA 1NM7A 1TUDA 3EHRA 2VVKA 3NGPA 2ED0A 3GBQA 3VS6A 1Y57A 1AZGB 2O2OA 3UA6A 3CQTA 1NLOC 1JEGA 3KFVA 1ZSGA 1UUEA 1WLPB 1X6BA 1JO8A 5IHKA 2O88A 2KYBA 1M3AA 2L2PA 4OMPA 3NMZC 4J9GA 1PKSA 2DRMA 2V1QA 1PHTA 1VYVA 2W0ZA 1QKXA 1BU1A 1NEBA 2KNBB 2JXBA 1M3BA 5IH2A 2FPEA 4RTYA 4RTVA 2DL4A 2OI3A 2YDLA 2ROLA 2YUOA 3RNJA 4CC3A 3VS1A 1UHFA 1SPKA 2RNAA 2X3XD 3VRZA 3VS4A 2AKLA 4OMOA 1K4US 4LNPA 1X6GA 2RN8A 2YUPA 5I11A 4F14A 2C0TA 4Z88A 1VA7A 1QWEA 2KYMA 4LUEA 4WCIA 3EHQA 2JTEA 2EGAA 1SEMA 2DF6A 1PRMC 2E5KA 1N5ZA 1UHCA 1SRLA 2DRKA 2CH4W 2ROTA 1W6XA 3QWXX 2RMOA 1UJ0A 1WA7A 2LQWA 2I0NA 2OAWA 2FO0A 5GJVB 1E6GA 3REAB 3VS2A 4Z8AA 2EW3A 4X1VA 1B3QA 2YSQA 1YN8A 1GFCA 2DL7A 1QCFA 4D8KA 1RI9A 2DNUA 2HCKA 4LUDA 1BBZA 1YWPA 1GCPA 2C0OA 4J9DA 2DM1A 1OV3A 4AFZC 1M30A 5EC7A 3SHWA 2KR3A 2MOXA 4JJCA 2KBTA 5FWBA 2EPDA 3UATA 3M0TA 5I22A 1TG0A 2EYYA 5GJWB 2GBQA 1T0JA 3RBBB 3THKA 3UA7A 2K9GA 3UF4A 1T3LA 2JT4A 1OPLA 1X69A 2V1RA 2EQIA 1SSHA 2W10A 1AEYA 1YCSB 3TVTA 2LZ6B 2DLPA 4GLMA 1A0NB 1NG2A 2KE9A 4OMLA 2RQTA 1H3HA 1PWTA 3M0UA 1SHFA 3H41A 1ZUKA 2KRSA 4CC2A 2YT6A 3A98A 4F16A 1FYNA 1RLPC 3VS7A 2D8HA 1H8KA 1WXUA 4HVUA 2AKKA 1W1FA 2FRWA 1K76A 2K3BA 3I5RA 1LCKA 4JPBW 3TSZA 2A37A 3EGUA 1ZX6A 1YWOA 4E6RA 2DL8A 2ABLA 2LJ3A 4AG2C 2JMAA 2SEMA 2RQRA 1IO6A 3M0SA 2CSQA 3SEMA 1KIKA 2EYWA 5FW9A 1VYUA 2RQWA 4Y92A 2O9SA 1UE9A 4HCKA 1JXOA 2O9VA 2BZYA 2FPFA 3I9QA 1PNJA 3PVLA 4KRTA 1OOTA 3TSWA 4HVWA 2HBWA 4DEXA 5IXFA 1E6HA 4J9BA 2K6DA 4ZNXA 2PNIA 2EGCA 2D1XA 2DL3A 2F2VA 1WFWA 3H0HA 1FMKA 4OMQA 4DEYA 1X2QA 1X27A 2CSIA 1G2BA 2EGEA 1NYGA 2M51A 1UGVA 4RTWA 1KFZA 1HJDA 2YUQA 2XMFA 4RTTA 4K11A 1ZLMA 1AVZC 1JQQA 2KXCA 3VS0A 4A63B 1K0XA 4JZ3A 2J6KA 2CT4A 4J9HA 4LE9A 5L23A 2B86A 3H0IA 4IIOA 2RQUA 1GBQA 4OMMA 1GFDA 1QWFA 2EVRA 3C0CA 1TUCA 1CSKA 1HSQA 2G6FX 3IQLA 4J9FA 3M0QA 5IHNA 1RUWA 2KROA 1KSWA 2NUZA 2GTOA 1OEBA 2CREA 1E7OA 3H0FA 2DVJA 2HSPA 3FJ5A 4D8DA 2K7AA 5HCKA 4EIKA 2LX7A 4J9EA 1GCQC 4AFQC 1AWJA 1AZEA 4HVVA 3EG1A 2GNCA 2KGTA 3R6NA 1X43A 2L3SA 4CC4B 3QWYA 4CC7A 2FPDA 4FSSA 4QT7A 1MUZA 2BZXA 1I1JA 2EYXA 1AWXA 1SHGA 2P4RA 1G83A 2KRNA 1AWOA 1UG1A 3NPFA 2GGRA 1OPKA 2DMOA 2JS0A 4JJDA 1WIEA 5IHIA 2DBMA 3ZL7C 2VWFA 2PZ1A 2MCNA 4J9IA 2RF0A 4ESRA 4LN2A 1SRMA 2PTKA 4R0KA 1M27C 3REBB 2MIOA 2CT3A 2LCSA 1EFNA 3VS3A 2YUNA 5IXBA 2ENMA 2KRMA 2CDTA 4RTXA 4IIMA 4GBQA 2JM8A 2F2WA 2DILA 3LH5A 4J9CA 2J7IA 1QLYA 2DA9A 1WXTA 4AFSC 2M0YA 1U3OA
chains in the Genus database with same CATH superfamily
2KT1A 2JJ9A 3A8OB 1YNZA 1YP5A 3G6EQ 2ZZDA 4ORZA 3H9NA 2IIMA 4JZ4A 5KE2A 2D0NA 4V2SA 4PKCC 2C0IA 4PJOG 5FU6C 4M7DE 4RCCA 5CVIA 2A0FB 4JRQA 2RB6A 1WYXA 1N8RU 2PVGB 2QASA 3EG2A 2JTFA 1HD3A 1QP2A 1WDXA 1G8XA 3EGXB 1NJIU 3RERA 1YJ9A 3QJYA 1VQ6A 2HEQA 1YJ9T 3QSUA 4IUPA 3M0PA 4M78B 1YHQT 4M75E 1Q7YU 2M02A 4ZGJB 3VJPA 5FWCA 1R77A 1SSFA 2RJCA 1NYFA 3H8ZA 3QYHB 3CBMA 4WTOB 1Z9ZA 1RI0A 1XOVA 2JNGA 1VQPA 3EG9B 4RTZA 2AK5A 4XTWA 2OX7A 2QA4T 3FLGA 1IREB 1ABOA 2OJ2A 1UJYA 1WXBA 2HDAA 3GLXA 1X01A 1TSFA 4M78A 2DXCA 2KEAA 3PFSA 1Q7YC 2XDPA 1QVGA 3ME9A 1GRIA 3CCEA 2J05A 2L0AA 2YLCA 4N4IA 3EH2A 2RHUA 3OQ5A 3QIIA 3CCVQ 1GBRA 2XHCA 4Y91A 2ZPBB 3V8KA 2GF7A 4DQ2A 1I0CA 5EG2A 3OYAA 5HY6A 1U5SA 1T0HA 1VQOT 4O6JA 4KUIA 1JXMA 2M9UA 4KBMB 2YRCA 4M7DC 1MV3A 2LQNA 3CCVT 2ECZA 5AT1B 2K57A 3NHNA 1V29B 4FYXB 5D6WA 4M7DD 2GCXA 3ASKA 4F7UB 3HSBA 1RLQC 4FSXA 5D7UA 3VS5A 3OS1A 2F2XA 5FU6B 1YHQA 1TUDA 3NGPA 3OS0A 3VS6A 1Y57A 2QI2A 5GAMg 3UA6A 1NLOC 1R0CB 3WVDB 1JEGA 1VQ9T 1N9RA 2G3RA 4E7LA 1C6VX 1X6BA 3PNWC 2O88A 3G1JA 4PJOB 6AT1B 2CP3A 2RK2A 1D1BA 2DIQA 4M78E 3NMZC 1U8RA 3FJPA 4DBRA 1QKXA 1DJ7B 1BU1A 1WGSA 2KNBB 4XQ3A 1ZSZA 3L2UA 3EFOB 1VUBA 5GAN6 2E10A 2H3JA 5KYUA 2OI3A 1V76A 2YDLA 2COYA 4CC3A 1D09B 2RJFA 5C0MA 2OTLA 2RNAA 3X26B 3CCEQ 4C8QG 1X6GA 2RN8A 2YUPA 1D1CA 3EH1A 2DXBA 1VA7A 3JSCA 1VIEA 4LUEA 4XU1A 3EHQA 1K8AR 2ZPGB 2CZ1B 3R6OA 1VQPT 2V26A 4NOYA 1PRMC 2E5KA 1I4K1 2DRKA 3QKJA 4QQDA 4XTZA 3OYLA 1HK9A 3GF5A 2CP5A 4LDVA 4Z8AA 2EW3A 2YSQA 3CMEA 3CCRQ 3CCET 1PM3A 4M7AG 4Z02A 1QCFA 3LGFA 2DNUA 4ZGEB 1BBZA 5C6SA 4BE1A 3GOXA 2CZ6B 4KGZB 2QQRA 4OB0B 1K73R 1G5VA 2MK5A 3MCAB 4C92B 1OV3A 4AFZC 4IKFA 2KR3A 2NLUA 2DPPB 4JJCA 3QBYA 5GAMj 4E7ZA 2XDBA 4M77E 1T0JA 2QG9B 1TWBA 1T3LA 4KGXB 1VQ5T 1WHMA 4FL6A 1QVFP 3SD4A 1AEYA 2MAMA 4J6WA 1N27A 4XU3A 2JVVA 3CXCA 4FYYB 4OMLA 3SWNA 1H3HA 4OF1A 3M0UA 1SHFA 2NUPA 1OZ3A 5GMKi 4CC2A 2YT6A 4Y28E 1G3TA 3A98A 4VUBA 3MO8A 2D8HA 1VQ9A 1JJ2S 1W1FA 2LCCA 2FRWA 1LCKA 2A37A 2DEUA 1UEBA 2HL3A 3EGUA 1W2BA 2ATCB 4DBHA 2JMAA 3AHUA 2CSQA 3SEMA 4C5EA 2PQWA 1KIKA 2YXYA 5FW9A 3JB9F 2EYQA 5CK9A 3FEOA 2X9HA 2O9VA 3CC4A 3A8HB 1UGSB 4KRTA 5IAYA 1OOTA 3QDFA 4XAXB 2HBWA 3QXEB 2E1HA 2JUFA 1E6HA 3RUXA 2K6DA 3H0HA 1X27A 1FWZA 3MP1A 1Q86U 1G2BA 2EGEA 2MF2A 1KK7A 4BUGA 2M51A 4RTWA 3HHTB 3CC2A 2FVUA 2KSSA 4RTTA 4E7KA 4TVRA 2KMTA 1VQ5A 1IHVA 5A0GA 3DLLA 1JRIA 2KXCA 4A63B 4M7AB 3LLRA 2WACA 4BI8B 2CYZB 2VV5A 3JCMc 4J9HA 4LE9A 3G71T 4MDXA 1M90R 3H0IA 4IIOA 5CIUA 3VYGA 2LC4A 3C0CA 2QGFB 2DEQA 1I5LA 4DOVA 3HFNA 1HSQA 2G6FX 1SF9A 2X4YA 3V7SA 2KROA 2NUZA 1OEBA 3QO3A 1R0BG 2DVJA 2HSPA 3LW5E 4C0ZA 4N0AA 5FRMA 4M7AA 1ZBXA 1VQ8Q 1LVKA 2LVMA 5HCKA 5A0LA 5GANe 2COZA 4XTYA 2X4XA 2B8AA 1VQNT 1M1GA 1X43A 4A4EA 2E6ZA 2QDYB 2OTJA 3Q1JA 5CKHA 2V8KA 1VQ7Q 3MHXA 3CCQQ 2RJDA 5DLOA 2QK0A 1Q86R 2DTOA 2P4RA 4C5GA 4ME7A 1VQ8T 1ZQ1A 5GAN4 1MNEA 1OPKA 2VGMA 2JS0A 3GP8A 1M1FA 4M75C 4QVZA 3JB9J 3J80E 5GAOn 3CC4Q 3E9FA 4M77D 4M77F 1KHCA 4J9IA 5KYXB 4JUVA 5HK3A 4ESRA 1B34B 3E2UA 4HA8A 3LWIA 2MIOA 2CT3A 2ZPIB 3M58A 1EFNA 4IIMA 3HRSA 2JM8A 2F2WA 4PLLA 2J7IA 2XICA 2DA9A 5GAOp 3VUZA 5HKCA 3CCLT 1VQ7T 3M55A 1VQ7A 2FRYA 4J6YA 2HQHA 2AZVA 2OTJQ 2XKOC 2Y90A 3VU3C 2A36A 4C8QA 3VRYA 3CMEQ 3E1SA 1Y0MA 2F5TX 3L2VA 4FT2A 2FG0A 3I35A 2DBKA 1NE8A 3JCMb 1IRXA 4EDUA 2CGHA 1RAAB 4BI3A 3CCMQ 2A08A 1RAEB 1VOMA 2YRVA 1QVFS 2HQEA 4CRIA 1CKAA 3OW2P 1YIJT 1AOJA 3OYDA 2EJGA 3CD6T 1PKTA 3CD6A 1BB9A 3BDLA 3I55T 2DE0X 3FIFA 5GMKl 3RR6A 5DY9A 4N4GA 2CH4A 3J81E 1F1BB 2LT1A 1NJIR 3PVQA 5J39A 1T3SA 2A7YA 2YHTA 1VQKT 1VYTA 2E3IA 2EKHA 2KT8A 2K5FA 3BFMA 4M77A 3M53A 1N8RR 1ZSZC 1GXIE 4PK4A 1K9MU 5GANh 2DVEA 3JCMJ 4E2FB 1OYXA 2GQIA 4B9WA 3OYFA 1PRLC 1ZUUA 2JS2A 1WJSA 3G6ET 1OX9A 4MMLA 2JMCA 5GAN8 2J6OA 2BTTA 2NWMA 3GPLA 4JS5A 1NEGA 4PJOD 3QPHA 2ZPEB 4RTUA 2VXFA 1TS9A 1YI2A 3RKWA 2K3XA 4AFUC 1K9AA 1Q82U 1LPLA 2MWOA 1KQ1A 3GIBA 4PNOA 5FRNA 1VQ9Q 1QVGP 2DZCA 1VQLA 5GAMf 3I5SA 1UDLA 1Z9QA 2QDLA 2LNHB 2RQVA 2CUDA 1KHIA 5CR2A 3OY9A 1NPRA 1S72A 2K2MA 4FM4B 4OMNA 5CCAA 5FU7B 5AYFA 2VUBA 4C92C 1NM7A 4NL3A 4A53A 4L6V5 2YWWA 1KD1U 3EFRA 4Q5WA 3CQTA 3RESA 1B7TA 1U1SA 4N4HA 1ZSGA 3MP8A 1JO8A 2KAFA 1M3AA 4QKUA 4C8QE 5A0DA 5GAN3 3HPWA 4J9GA 2LQKA 2DRMA 3I56Q 1VYVA 4YTLA 3CCMT 3L42A 3UPUA 3OBYA 2JXBA 3LYIA 1RAGB 5IH2A 1WQWA 2FPEA 4IUVA 4F7UE 2DL4A 3RNJA 4QVCA 3VS1A 3VRZA 2X3XD 3VS4A 3CCJQ 2AKLA 2JTMA 1K4US 4B6MA 2K5IA 2QA4Q 5I11A 4F14A 5GMKe 4ATOA 5CAIA 2RM4A 4C92E 2DO3A 3I56A 2AHJB 2Z0WA 2JTEA 1M5Q1 2EAYA 1I8FA 4E7HA 1UHCA 1SRLA 1TOVA 4C92G 3PT9A 4HCZA 2CH4W 2ROTA 3QWXX 2RMOA 1UJ0A 3NFCA 1MMNA 2LQWA 1WHHA 3SWNB 2I0NA 2KK4A 3REAB 1B3QA 3P8DA 1VQNQ 1YN8A 2CP2A 2GQVA 1WHKA 4OB2B 2O01E 4D8KA 4FU6A 2M16A 4L59A 2QQ9A 4HKEA 2PVOB 5A2QE 4QQGA 2C0OA 4J9DA 1N9SA 1M30A 2P84A 4QQ6A 1WHLA 2D0QB 3SHWA 3HTRA 1VQMA 2KBTA 3EFOA 4J7FA 5GJWB 2GBQA 3CC7A 3JB9H 4BACA 2EQIA 2R5AA 2FL7A 2PUKB 2R58A 1D3BB 4PJOF 1P92A 4PFOA 3M57A 3QHSA 2RK1A 2KE9A 2XU8A 3QDRB 3CPFA 3H41A 2M1HA 2E3HA 2QQAA 1JBMA 2P0KA 2KQWA 1MMGA 1FYNA 1RLPC 2RA2A 1WXUA 1OZ2A 2QGGA 2AKKA 2AT1B 1M8VA 1K76A 1S72Q 2MMPA 4II1A 1OX8A 3I55Q 4X34A 5CQYA 3TSZA 4ZN3A 1YWOA 4M75G 2PUOB 2DL8A 3JAME 4AG2C 2E5QA 2RQRA 5D6XA 2DERA 3M0SA 3P8BB 1QVFA 2EYWA 3QJ6A 3OMCA 1Q82C 1VYUA 2RHYA 5LJ3g 2EQMA 4Y92A 3URGA 2D9TA 1LJOA 4HCKA 1JXOA 2DFUA 1OI1A 2RHIA 1PNJA 3PVLA 3VKIA 2QYZA 2BUDA 4DEXA 3CD6Q 4XK8E 3M59A 4F7UA 5IXFA 3CCSA 1QMCA 1YITA 5GMKh 2MI6A 2F2VA 4RKUE 2CSIA 3PGGA 4QVDA 3MKDA 2YRDA 4M78D 1NYGA 4N0AC 3JCMe 1M9SA 1HJDA 3DB3A 1PD0A 1VQOA 1ZHIA 4KGVB 1JQQA 3VS0A 1C1AA 3JB9I 3SWNC 1K0XA 2DTIA 1BIAA 4PJOA 1B34A 5L23A 2B86A 4EMKB 4MMKA 1D1AA 2XG8D 2KDSA 1TUCA 4J8OA 2ZGWA 5KYWA 1RUWA 4XU0A 3JRZA 5I2MA 2BKDN 1KSWA 4C5IA 2CREA 2CZ7B 1E7OA 3H0FA 1VQKQ 3G71Q 3M9QA 2K7AA 3CEYA 3ZBDA 3CPWP 2LX7A 4J9EA 1GCQC 1VQMT 2MYSA 4AFQC 3CPWS 1AZEA 3OYCA 2KGTA 3R6NA 2L3SA 3TEEA 1EIFA 3QWYA 2C06A 1Y7XA 2R5MA 1C0MA 4QT7A 3JCMd 4J83A 4DA4A 3MEVA 1VQMQ 1WJQA 4GLKA 5FU7C 1MMDA 4C0GA 1SHGA 2ZPFB 1G83A 2KRNA 1AWOA 2VYTA 2GGRA 4RG2A 4JJDA 1WIEA 1LNXA 3ZL7C 4OMFB 4LDUA 4PJNA 5LL6S 1UGQB 1Q82R 4E7JA 4JLIA 3A5ZB 1K73C 2LCSA 1VQ4A 5IXBA 2ENMA 4EMHA 4RTXA 4C8QD 4C8QF 4GBQA 3JCMX 3CMAA 4LDYA 3OW2A 2DJZA 3EAEA 3JCMQ 2M0YA 1OU9A 1AD5A 2K3YA 2DYBA 3FDRA 1QQJA 3C95A 3LH0A 4FT4A 4HT9A 5GAOm 1TH7A 4OGCA 4C8QB 2DK3A 2FYKA 1I5OB 1ACMB 4M75B 4XU2A 2L8DA 1ARKA 4RG8A 3O8VA 3NTHA 2IPOB 1WX6A 4M77C 4NS5A 5GAOl 3G7ZA 1RACB 1ZBJA 4M7AE 2M0OA 3E19A 2DD4A 3CCQT 5GMKm 2QQSA 3MP6A 4IUQA 1VQ6T 2D8JA 4PFPA 1RAHB 2GTJA 1PC0A 1OULA 4Z89A 1IGQA 1GCQA 3U23A 4BB7A 5GANj 1BI3A 4MZTA 1KC8R 2LMJA 1S1NA 1K0SA 4C5HA 4JJBA 2EBPA 2DJQA 2L89A 2OTLQ 2L3PA 2QTVA 1YJWA 2K79A 4LD6A 1I07A 1XQHA 1OQKA 3H6ZA 5ECAA 1K1ZA 1GL5A 3EG3A 2DX1A 3OYBA 3VYHB 2O4XB 4XTVA 4M78G 4C8QC 3OYYA 2J6FA 2RH2A 5CKEA 4BI4A 3ER0A 2R57A 3RMSA 3RMQA 3TREA 1UTIA 2JM9A 4JRIA 4ZTFA 4BY6B 1VQLQ 2BZ8A 2CP0A 2E6NA 4F17A 1QKWA 5GANf 3WVEB 2DL5A 1M1KC 1H92A 1XNIA 3MPUB 2IVWA 3OMGA 2OTLT 2CKKA 3LGLA 4BE0A 1YI2Q 3TCJA 4JRPA 1UECA 2EYZA 1Q81C 2LJ1A 2VXEA 3GNFB 2VKNA 4M7AC 3JB9G 2VB6A 2EQJA 2L3QA 1G3YA 2KXDA 1ZUYA 3OYKA 1JJ2A 4M7AD 2GFAA 2LQ8A 3BE3A 3BY7A 3M0RA 1XTDA 1M3CA 2DIGA 1W70A 4JJNK 4OVAA 1D3BA 3JV3A 4GY5A 2RI2A 1M1KU 3L2ZA 2LP5A 2HKQB 2DTHA 5D6YA 3EHRA 2VVKA 1YCYA 2ED0A 3DKMA 2O2OA 2EQUA 3MEAA 3RKXA 4CI0C 1QP3A 3KFVA 1YJWT 2HSEB 4BE2A 3SFMA 1UUEA 1YBYA 3C12A 5IHKA 2KYBA 2COWA 3MJXA 1WHJA 1YJNT 1PKSA 1YITQ 1PHTA 2W0ZA 1NEBA 3L2RA 1KQSS 2EKOA 1YIJQ 4UC4A 3G4SQ 4JRKA 5IN1A 4C92F 4C92D 5CO7A 3RIRA 2QTXA 1SPKA 3CCUA 2XIDA 4OMOA 3A8LB 4ZN1A 4X9CA 2C0TA 1M2VB 2KYMA 1QWEA 3CC2T 1Y71A 2EGAA 4EMGA 1IZ6A 1SEMA 2DF6A 4L5GA 4BY6C 2DZ9A 1WNLA 3V7RA 3OB9A 4WF2A 2KY9A 2EJ9A 2ZCFB 3EGDB 1N8RC 3L1AA 2E4HA 2GFUA 4M7DG 1E6GA 3VS2A 3QG1A 4B9XA 2QEXT 3S3MA 1GFCA 1NJIC 1RI9A 4KH0B 1JB0E 2L3RA 1YWPA 1GCPA 4E7SA 5LJ5h 2DM1A 1IGUA 1M90C 4ZTJA 2MOXA 3JCMV 1Y96A 4OB3B 2EPDA 3UATA 4A54A 1TG0A 1EZZB 2CP7A 4NL2A 3CCQA 1QVGS 1UGPB 4MZPA 5I21A 3CCVA 3DB4A 2HKNA 4C0FA 5J3BA 4IUUA 3G4SA 3PIPA 2D6FA 2FZKB 1RADB 2WSEE 4KH1B 1Q81R 1VQ8A 2KRSA 2RO0A 3CMAQ 5LJ3f 2XD0A 4HVUA 5LJ5f 4PL6A 2K3BA 1BI1A 4JPBW 2QA4A 5CQXA 1YJNA 3KUFA 3CCJA 2SEMA 3CCJT 2XI9A 3DLMA 3CMET 4F7UF 5KYWB 2O9SA 2LTOA 3CC4T 4F04B 2FPFA 3BDUA 2NYSA 3TSWA 5LJ3e 4BDYA 1TUGB 1M2OA 1OU8A 1X6OA 3N5BB 8ATCB 4HVWA 2BE7D 2LNVA 1PSEA 1BCMA 4J9BA 5LJ3j 2EGCA 2D1XA 3KBGA 2CS7A 9ATCB 1WFWA 1YI2T 4M78C 1FMKA 4OMQA 4DEYA 1K9MC 1D0YA 4M75D 1XJWB 4JS4A 1KFZA 1UGVA 2HZYA 2YUQA 4E7IA 5DLQE 1H641 1ZLMA 1AVZC 1KC8C 4FYWB 1VQLT 3JB9D 2J6KA 4EPCA 2CT4A 3G71A 2RQUA 1Q86C 1GBQA 4M7DB 1D0XA 2EVRA 2FZGB 3JCMP 3M54A 2P0PA 5HK0A 3IQLA 2QEXA 4XTUA 3M0QA 3PIOA 2EFIA 2GTOA 2OAUA 1SKUB 2PVDB 1KQSP 3FJ5A 4D8DA 3JCMg 1IXDA 3RDVA 4MDWA 3UT1A 3NTIA 5KCHA 2P4TA 4RMOA 1TTHB 4M7DA 4PJOE 4KUDK 1VQNA 2GNCA 3OS2A 4PFZA 4CC7A 3S3NA 7AT1B 3TU4K 1YIJA 1O9SA 3SB2A 1RL2A 3G4ST 2BZXA 3RKYA 2EYXA 3EFSA 3CCUT 1Q95G 4EMKA 5CKDA 2KI7A 4EMKC 1SG5A 5LJ5g 3NPFA 2MWPA 5LJ3d 1AT1B 2XK0A 5GAOq 1N6AA 5J26A 3C4SA 5IHIA 2VC8A 3QZ9B 2DBMA 1FXXA 4DBQA 2VWFA 2JOYA 2MCNA 2RF0A 3OYGA 4M7AF 2VGNA 4LN2A 2PTKA 3EG9A 1M27C 3OYIA 2KRMA 2QXFA 1MGQA 2MPXC 1VQOQ 1PG5B 5GAN7 4J7IA 1YJNQ 4J9CA 1QLYA 1R8OB 1K9MR 4AFSC 1U3OA 3BW1A 2LT4A 4AT1B 2RHZA 3ULRB 3EG0A 2A28A 1JU5C 5KYXA 2HQXA 2ZAEA 3OSVA 3MEUA 1RABB 2SRCA 2JW4A 2ZPHB 1V1CA 2J06A 1YFNA 2DKGA 2NUTB 2HL5C 4QW2A 2O31A 1ZA2B 1KJWA 5M9OA 2DXTA 1BK2A 1NLPC 3META 1VQ5Q 1WQ7A 1X75C 1UFFA 4KULA 4ELYC 3O5ZA 1B07A 3I55A 2HAXA 1AWWA 2JN0A 1Q7YR 3CPWA 2FHDA 3TQ7P 3HFOA 4JDSA 3CCLQ 2LRQA 2H8HA 1WZOA 2E64A 5CKFA 4M78F 3A8GB 2IG0A 1BIBA 3PMIA 3PE0A 4PJLA 3T9NA 1CKBA 3JCMh 3P8HA 1ABQA 4C0DB 4RUGA 4C0DC 1FX7A 3NTKA 3OS5A 2V8JA 3CBPA 5KYNA 1K73U 2LJ0A 2RPNA 2ESWA 4AG1C 2RJEA 4AMCA 1K8AC 4D6WA 2LCLA 5KE3A 1BCOA 2EWNA 3V8LA 2DYIA 1J3TA 2FEIA 4R56A 2CP6A 1MMAA 3E9GA 4R55A 2CZ0B 4M75F 3CCST 1HYOA 2WSCE 1X2KA 2JZ2A 5I2SA 1U06A 2QAZA 2AZSA 1WI7A 3HRUA 3EGXA 2ED1A 1MV0B 4FYVB 3CC7T 1K8AU 2DXUA 3CCSQ 4P5NA 3UA7A 4HXJA 5KYYA 1M8MA 2X3WD 5L8RE 2E41A 4A4GA 4A4FA 2CUBA 4M4ZA 4IURA 1W4SA 1S72T 3M4GA 3OSSC 2DETA 1QW1A 2EQKA 1LOJA 3A8MB 3EGDA 5LJ3h 2O4XA 5KCOA 2NUTA 3GBQA 5GAN5 1AZGB 3CCLA 1PD1A 2VASA 3X25B 1WLPB 3S3OA 4X9DA 2H3EB 1H3ZA 2L2PA 4OMPA 4O5VA 3S6WA 3PMTA 4HCCA 2V1QA 4ZGDB 4C92A 1KD1C 3X20B 2X51A 5GANg 3GNGA 1M90U 2FZCB 3J7AF 2X4JA 1M3BA 1ZSZB 3CXCS 2OTJT 3M5AA 2F69A 3OBWA 4RTYA 5FROA 4M77G 4RTVA 2P0QA 1UB4A 3KXTA 2ROLA 2YUOA 3D7SB 8AT1B 3X24B 1UHFA 1W2BP 1VIFA 2HMAA 4LNPA 1W2BS 4M7DF 2HBPA 4RCBA 4Z88A 1VQKA 4WCIA 2RD1A 3C94A 1U1TA 3OYEA 1KQ2A 2PU9B 1N5ZA 5FLXE 2V8IA 1KG1A 5CKBA 3VUBA 3M4YA 1W6XA 1FMWA 5LJ5e 1QCOA 1WA7A 3CCUQ 3JCMf 2FO0A 2OAWA 3A1PA 3HRTA 5GJVB 5LJ5j 2Y4XA 4X1VA 2BE9B 2LDMA 1JJ2P 2DL7A 3V7CA 1YJWQ 3CBOA 2HCKA 3L2WA 4LUDA 2I2LA 5KYUB 2AIRB 5DM7R 2Y4YA 3QUIA 1YITT 4FW1A 4OP0A 2XDDA 1Q81U 1YHQQ 2RI5A 3OA6A 1AHJB 3OYNA 1NBEB 5EC7A 1MHNA 5FWBA 4J6XA 4XTXA 3M0TA 4FW2A 5I22A 3CCMA 2EYYA 3FRNA 3RBBB 3THKA 3OYHA 3SDZA 1RAIB 2K9GA 3UF4A 2JT4A 1BKBA 1OPLA 4OB1B 1EX4A 1X69A 2V1RA 3WXMB 1PCXA 1BI2A 1SSHA 2W10A 3HKSA 3CCRA 1YCSB 1KC8U 3CCRT 3TVTA 4BDZA 2LZ6B 1WPYA 2DLPA 4GLMA 1KQSA 1A0NB 1NG2A 5GAMh 2NUPB 2QEXQ 2RQTA 2FB7A 1PWTA 3CC2Q 1ZUKA 4LXCA 3UDCA 3FC3A 4F7UG 4F16A 2L5QA 3I56T 3VS7A 1H8KA 3I5RA 2E70A 3ZFJA 1ZX6A 4E6RA 2ABLA 2LJ3A 3X28B 1IO6A 2K2VA 2RI3A 4LDWA 4FIBA 3L2QA 2X35A 2DD5A 4J5YA 2RQWA 3G6EA 5LJ5d 1QCNA 1UE9A 2LX9A 2BZYA 3I9QA 1G3WA 4HT8A 4KT0E 4PJOC 4A4HA 4ZNXA 1WHGA 2PNIA 1O75A 4DBFA 2DL3A 1FMVA 1X2QA 5IT9E 4MZMA 3PTAA 1VQ6Q 2KVQG 2XMFA 4K11A 1TXQA 3AT1B 3OW2S 1ZA1B 4JZ3A 3VV0A 4ANJA 2YLBA 4IUTA 1D0ZA 4M75A 1IHWA 2E65A 2K4YA 4LD9K 5KH6A 4OMMA 1GFDA 2DAQA 1QWFA 3CMAT 3OYJA 1CSKA 5GAMd 4A4KA 4J9FA 5IHNA 1M4ZA 3HP9A 3M56A 1MNDA 4FCYA 4PLIA 3CXCP 4ELZC 2RHXA 4EIKA 2EJFA 5GAOr 2E12A 3LWHA 2BIVA 1BI0A 3OYMA 1AWJA 2HNIA 3F70A 4E47A 4HVVA 5GANd 3EG1A 2A3LA 1M2VA 1Y96B 1M1KR 4CC4B 1WJRA 3HL8A 1UGRB 1KD1R 2FPDA 4FSSA 2HD0A 3FB9A 1MUZA 3MEWA 2K5LA 2X4WA 1RAFB 5GAMe 5GMKj 3QZ5B 1I1JA 4PJJA 4HCBA 3LX7A 3QYGB 1Y07A 1TU0B 1AWXA 3INZA 1VQ4Q 1NPPA 1UG1A 2EIFA 4JLGA 2DMOA 1QVPA 1NZ9A 5GAN2 2PZ1A 1VQPQ 3V8JA 1G3SA 3CC7Q 3UWNA 5KYYB 1SRMA 1IB8A 4R0KA 1I81A 1BYMA 4M77B 3REBB 1VQ4T 2F5KA 3VS3A 2YUNA 4OGEA 4BD3A 2CDTA 3JCMW 4DOWA 2WSFE 1HXDA 2DILA 3LH5A 4LDXA 2F1LA 1PSFA 2QQBA 4PJMA 1WXTA 3ZEHA 1YJ9Q
chains in the Genus database with same CATH topology
1AD5A 2FRYA 2KT1A 2DYBA 3ULRB 2AZVA 3EG0A 2A28A 2A36A 1YNZA 1YP5A 1JU5C 4ORZA 3VRYA 2IIMA 4JZ4A 1Y0MA 2FG0A 3I35A 2D0NA 2DBKA 2SRCA 2C0IA 2JW4A 1V1CA 2J06A 1ARKA 2O31A 1WYXA 1WX6A 2A08A 3EG2A 1HD3A 1KJWA 1ZBJA 1WDXA 1BK2A 1NLPC 1CKAA 1AOJA 1PKTA 1UFFA 1BB9A 2HEQA 3O5ZA 1B07A 1AWWA 2DE0X 2D8JA 2GTJA 3M0PA 4Z89A 1GCQA 3U23A 2CH4A 2H8HA 2LMJA 1S1NA 1K0SA 5FWCA 3PVQA 1NYFA 1T3SA 4JJBA 3PE0A 2EBPA 2DJQA 1CKBA 1VYTA 1Z9ZA 1XOVA 2L3PA 2EKHA 2KT8A 1ABQA 4RTZA 2AK5A 2K79A 4RUGA 1I07A 5ECAA 1K1ZA 1GL5A 1ABOA 2OJ2A 3EG3A 2DX1A 1UJYA 1WXBA 2HDAA 2LJ0A 2RPNA 2ESWA 4AG1C 2KEAA 2GQIA 2J6FA 1PRLC 1UTIA 1ZUUA 2JM9A 2JS2A 1GRIA 2J05A 2BZ8A 2JMCA 1J3TA 4F17A 1QKWA 2FEIA 2J6OA 2BTTA 2NWMA 2L0AA 2DL5A 1NEGA 1H92A 4RTUA 1GBRA 1X2KA 1U06A 4AFUC 1K9AA 2EYZA 1I0CA 1UECA 2LJ1A 2AZSA 2VKNA 1WI7A 2L3QA 1U5SA 2KXDA 1ZUYA 2ED1A 1T0HA 1MV0B 1JXMA 3I5SA 1UDLA 3M0RA 1M3CA 1MV3A 1Z9QA 2ECZA 2LNHB 2LQNA 2QDLA 1M8MA 1W70A 2RQVA 2X3WD 2CUDA 3NHNA 4HXJA 3JV3A 2CUBA 2K2MA 4M4ZA 1RLQC 4OMNA 3VS5A 2LP5A 2F2XA 1NM7A 1TUDA 3EHRA 2VVKA 3NGPA 2ED0A 3GBQA 3VS6A 1Y57A 1AZGB 2O2OA 3UA6A 3CQTA 1NLOC 1JEGA 3KFVA 1ZSGA 1UUEA 1WLPB 1X6BA 1JO8A 5IHKA 2O88A 2KYBA 1M3AA 2L2PA 4OMPA 3NMZC 4J9GA 1PKSA 2DRMA 2V1QA 1PHTA 1VYVA 2W0ZA 1QKXA 1BU1A 1NEBA 2KNBB 2JXBA 1M3BA 5IH2A 2FPEA 4RTYA 4RTVA 2DL4A 2OI3A 2YDLA 2ROLA 2YUOA 3RNJA 4CC3A 3VS1A 1UHFA 1SPKA 2RNAA 2X3XD 3VRZA 3VS4A 2AKLA 4OMOA 1K4US 4LNPA 1X6GA 2RN8A 2YUPA 5I11A 4F14A 2C0TA 4Z88A 1VA7A 1QWEA 2KYMA 4LUEA 4WCIA 3EHQA 2JTEA 2EGAA 1SEMA 2DF6A 1PRMC 2E5KA 1N5ZA 1UHCA 1SRLA 2DRKA 2CH4W 2ROTA 1W6XA 3QWXX 2RMOA 1UJ0A 1WA7A 2LQWA 2I0NA 2OAWA 2FO0A 5GJVB 1E6GA 3REAB 3VS2A 4Z8AA 2EW3A 4X1VA 1B3QA 2YSQA 1YN8A 1GFCA 2DL7A 1QCFA 4D8KA 1RI9A 2DNUA 2HCKA 4LUDA 1BBZA 1YWPA 1GCPA 2C0OA 4J9DA 2DM1A 1OV3A 4AFZC 1M30A 5EC7A 3SHWA 2KR3A 2MOXA 4JJCA 2KBTA 5FWBA 2EPDA 3UATA 3M0TA 5I22A 1TG0A 2EYYA 5GJWB 2GBQA 1T0JA 3RBBB 3THKA 3UA7A 2K9GA 3UF4A 1T3LA 2JT4A 1OPLA 1X69A 2V1RA 2EQIA 1SSHA 2W10A 1AEYA 1YCSB 3TVTA 2LZ6B 2DLPA 4GLMA 1A0NB 1NG2A 2KE9A 4OMLA 2RQTA 1H3HA 1PWTA 3M0UA 1SHFA 3H41A 1ZUKA 2KRSA 4CC2A 2YT6A 3A98A 4F16A 1FYNA 1RLPC 3VS7A 2D8HA 1H8KA 1WXUA 4HVUA 2AKKA 1W1FA 2FRWA 1K76A 2K3BA 3I5RA 1LCKA 4JPBW 3TSZA 2A37A 3EGUA 1ZX6A 1YWOA 4E6RA 2DL8A 2ABLA 2LJ3A 4AG2C 2JMAA 2SEMA 2RQRA 1IO6A 3M0SA 2CSQA 3SEMA 1KIKA 2EYWA 5FW9A 1VYUA 2RQWA 4Y92A 2O9SA 1UE9A 4HCKA 1JXOA 2O9VA 2BZYA 2FPFA 3I9QA 1PNJA 3PVLA 4KRTA 1OOTA 3TSWA 4HVWA 2HBWA 4DEXA 5IXFA 1E6HA 4J9BA 2K6DA 4ZNXA 2PNIA 2EGCA 2D1XA 2DL3A 2F2VA 1WFWA 3H0HA 1FMKA 4OMQA 4DEYA 1X2QA 1X27A 2CSIA 1G2BA 2EGEA 1NYGA 2M51A 1UGVA 4RTWA 1KFZA 1HJDA 2YUQA 2XMFA 4RTTA 4K11A 1ZLMA 1AVZC 1JQQA 2KXCA 3VS0A 4A63B 1K0XA 4JZ3A 2J6KA 2CT4A 4J9HA 4LE9A 5L23A 2B86A 3H0IA 4IIOA 2RQUA 1GBQA 4OMMA 1GFDA 1QWFA 2EVRA 3C0CA 1TUCA 1CSKA 1HSQA 2G6FX 3IQLA 4J9FA 3M0QA 5IHNA 1RUWA 2KROA 1KSWA 2NUZA 2GTOA 1OEBA 2CREA 1E7OA 3H0FA 2DVJA 2HSPA 3FJ5A 4D8DA 2K7AA 5HCKA 4EIKA 2LX7A 4J9EA 1GCQC 4AFQC 1AWJA 1AZEA 4HVVA 3EG1A 2GNCA 2KGTA 3R6NA 1X43A 2L3SA 4CC4B 3QWYA 4CC7A 2FPDA 4FSSA 4QT7A 1MUZA 2BZXA 1I1JA 2EYXA 1AWXA 1SHGA 2P4RA 1G83A 2KRNA 1AWOA 1UG1A 3NPFA 2GGRA 1OPKA 2DMOA 2JS0A 4JJDA 1WIEA 5IHIA 2DBMA 3ZL7C 2VWFA 2PZ1A 2MCNA 4J9IA 2RF0A 4ESRA 4LN2A 1SRMA 2PTKA 4R0KA 1M27C 3REBB 2MIOA 2CT3A 2LCSA 1EFNA 3VS3A 2YUNA 5IXBA 2ENMA 2KRMA 2CDTA 4RTXA 4IIMA 4GBQA 2JM8A 2F2WA 2DILA 3LH5A 4J9CA 2J7IA 1QLYA 2DA9A 1WXTA 4AFSC 2M0YA 1U3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AD5 A;  2FRY A;  2KT1 A;  2DYB A;  3ULR B;  2AZV A;  3EG0 A;  2A28 A;  2A36 A;  1YNZ A;  1YP5 A;  1JU5 C;  4ORZ A;  3VRY A;  2IIM A;  4JZ4 A;  1Y0M A;  2FG0 A;  3I35 A;  2D0N A;  2DBK A;  2SRC A;  2C0I A;  2JW4 A;  1V1C A;  2J06 A;  1ARK A;  2O31 A;  1WYX A;  1WX6 A;  2A08 A;  3EG2 A;  1HD3 A;  1KJW A;  1ZBJ A;  1WDX A;  1BK2 A;  1NLP C;  1CKA A;  1AOJ A;  1PKT A;  1UFF A;  1BB9 A;  2HEQ A;  3O5Z A;  1B07 A;  1AWW A;  2DE0 X;  2D8J A;  2GTJ A;  3M0P A;  4Z89 A;  1GCQ A;  3U23 A;  2CH4 A;  2H8H A;  2LMJ A;  1S1N A;  1K0S A;  5FWC A;  3PVQ A;  1NYF A;  1T3S A;  4JJB A;  3PE0 A;  2EBP A;  2DJQ A;  1CKB A;  1VYT A;  1Z9Z A;  1XOV A;  2L3P A;  2EKH A;  2KT8 A;  1ABQ A;  4RTZ A;  2AK5 A;  2K79 A;  4RUG A;  1I07 A;  5ECA A;  1K1Z A;  1GL5 A;  1ABO A;  2OJ2 A;  3EG3 A;  2DX1 A;  1UJY A;  1WXB A;  2HDA A;  2LJ0 A;  2RPN A;  2ESW A;  4AG1 C;  2KEA A;  2GQI A;  2J6F A;  1PRL C;  1UTI A;  1ZUU A;  2JM9 A;  2JS2 A;  1GRI A;  2J05 A;  2BZ8 A;  2JMC A;  1J3T A;  4F17 A;  1QKW A;  2FEI A;  2J6O A;  2BTT A;  2NWM A;  2L0A A;  2DL5 A;  1NEG A;  1H92 A;  4RTU A;  1GBR A;  1X2K A;  1U06 A;  4AFU C;  1K9A A;  2EYZ A;  1I0C A;  1UEC A;  2LJ1 A;  2AZS A;  2VKN A;  1WI7 A;  2L3Q A;  1U5S A;  2KXD A;  1ZUY A;  2ED1 A;  1T0H A;  1MV0 B;  1JXM A;  3I5S A;  1UDL A;  3M0R A;  1M3C A;  1MV3 A;  1Z9Q A;  2ECZ A;  2LNH B;  2LQN A;  2QDL A;  1M8M A;  1W70 A;  2RQV A;  2X3W D;  2CUD A;  3NHN A;  4HXJ A;  3JV3 A;  2CUB A;  2K2M A;  4M4Z A;  1RLQ C;  4OMN A;  3VS5 A;  2LP5 A;  2F2X A;  1NM7 A;  1TUD A;  3EHR A;  2VVK A;  3NGP A;  2ED0 A;  3GBQ A;  3VS6 A;  1Y57 A;  1AZG B;  2O2O A;  3UA6 A;  3CQT A;  1NLO C;  1JEG A;  3KFV A;  1ZSG A;  1UUE A;  1WLP B;  1X6B A;  1JO8 A;  5IHK A;  2O88 A;  2KYB A;  1M3A A;  2L2P A;  4OMP A;  3NMZ C;  4J9G A;  1PKS A;  2DRM A;  2V1Q A;  1PHT A;  1VYV A;  2W0Z A;  1QKX A;  1BU1 A;  1NEB A;  2KNB B;  2JXB A;  1M3B A;  5IH2 A;  2FPE A;  4RTY A;  4RTV A;  2DL4 A;  2OI3 A;  2YDL A;  2ROL A;  2YUO A;  3RNJ A;  4CC3 A;  3VS1 A;  1UHF A;  1SPK A;  2RNA A;  2X3X D;  3VRZ A;  3VS4 A;  2AKL A;  4OMO A;  1K4U S;  4LNP A;  1X6G A;  2RN8 A;  2YUP A;  5I11 A;  4F14 A;  2C0T A;  4Z88 A;  1VA7 A;  1QWE A;  2KYM A;  4LUE A;  4WCI A;  3EHQ A;  2JTE A;  2EGA A;  1SEM A;  2DF6 A;  1PRM C;  2E5K A;  1N5Z A;  1UHC A;  1SRL A;  2DRK A;  2CH4 W;  2ROT A;  1W6X A;  3QWX X;  2RMO A;  1UJ0 A;  1WA7 A;  2LQW A;  2I0N A;  2OAW A;  2FO0 A;  5GJV B;  1E6G A;  3REA B;  3VS2 A;  4Z8A A;  2EW3 A;  4X1V A;  1B3Q A;  2YSQ A;  1YN8 A;  1GFC A;  2DL7 A;  1QCF A;  4D8K A;  1RI9 A;  2DNU A;  2HCK A;  4LUD A;  1BBZ A;  1YWP A;  1GCP A;  2C0O A;  4J9D A;  2DM1 A;  1OV3 A;  4AFZ C;  1M30 A;  5EC7 A;  3SHW A;  2KR3 A;  2MOX A;  4JJC A;  2KBT A;  5FWB A;  2EPD A;  3UAT A;  3M0T A;  5I22 A;  1TG0 A;  2EYY A;  5GJW B;  2GBQ A;  1T0J A;  3RBB B;  3THK A;  3UA7 A;  2K9G A;  3UF4 A;  1T3L A;  2JT4 A;  1OPL A;  1X69 A;  2V1R A;  2EQI A;  1SSH A;  2W10 A;  1AEY A;  1YCS B;  3TVT A;  2LZ6 B;  2DLP A;  4GLM A;  1A0N B;  1NG2 A;  2KE9 A;  4OML A;  2RQT A;  1H3H A;  1PWT A;  3M0U A;  1SHF A;  3H41 A;  1ZUK A;  2KRS A;  4CC2 A;  2YT6 A;  3A98 A;  4F16 A;  1FYN A;  1RLP C;  3VS7 A;  2D8H A;  1H8K A;  1WXU A;  4HVU A;  2AKK A;  1W1F A;  2FRW A;  1K76 A;  2K3B A;  3I5R A;  1LCK A;  4JPB W;  3TSZ A;  2A37 A;  3EGU A;  1ZX6 A;  1YWO A;  4E6R A;  2DL8 A;  2ABL A;  2LJ3 A;  4AG2 C;  2JMA A;  2SEM A;  2RQR A;  1IO6 A;  3M0S A;  2CSQ A;  3SEM A;  1KIK A;  2EYW A;  5FW9 A;  1VYU A;  2RQW A;  4Y92 A;  2O9S A;  1UE9 A;  4HCK A;  1JXO A;  2O9V A;  2BZY A;  2FPF A;  3I9Q A;  1PNJ A;  3PVL A;  4KRT A;  1OOT A;  3TSW A;  4HVW A;  2HBW A;  4DEX A;  5IXF A;  1E6H A;  4J9B A;  2K6D A;  4ZNX A;  2PNI A;  2EGC A;  2D1X A;  2DL3 A;  2F2V A;  1WFW A;  3H0H A;  1FMK A;  4OMQ A;  4DEY A;  1X2Q A;  1X27 A;  2CSI A;  1G2B A;  2EGE A;  1NYG A;  2M51 A;  1UGV A;  4RTW A;  1KFZ A;  1HJD A;  2YUQ A;  2XMF A;  4RTT A;  4K11 A;  1ZLM A;  1AVZ C;  1JQQ A;  2KXC A;  3VS0 A;  4A63 B;  1K0X A;  4JZ3 A;  2J6K A;  2CT4 A;  4J9H A;  4LE9 A;  5L23 A;  2B86 A;  3H0I A;  4IIO A;  2RQU A;  1GBQ A;  4OMM A;  1GFD A;  1QWF A;  2EVR A;  3C0C A;  1TUC A;  1CSK A;  1HSQ A;  2G6F X;  3IQL A;  4J9F A;  3M0Q A;  5IHN A;  1RUW A;  2KRO A;  1KSW A;  2NUZ A;  2GTO A;  1OEB A;  2CRE A;  1E7O A;  3H0F A;  2DVJ A;  2HSP A;  3FJ5 A;  4D8D A;  2K7A A;  5HCK A;  4EIK A;  2LX7 A;  4J9E A;  1GCQ C;  4AFQ C;  1AWJ A;  1AZE A;  4HVV A;  3EG1 A;  2GNC A;  2KGT A;  3R6N A;  1X43 A;  2L3S A;  4CC4 B;  3QWY A;  4CC7 A;  2FPD A;  4FSS A;  4QT7 A;  1MUZ A;  2BZX A;  1I1J A;  2EYX A;  1AWX A;  1SHG A;  2P4R A;  1G83 A;  2KRN A;  1AWO A;  1UG1 A;  3NPF A;  2GGR A;  1OPK A;  2DMO A;  2JS0 A;  4JJD A;  1WIE A;  5IHI A;  2DBM A;  3ZL7 C;  2VWF A;  2PZ1 A;  2MCN A;  4J9I A;  2RF0 A;  4ESR A;  4LN2 A;  1SRM A;  2PTK A;  4R0K A;  1M27 C;  3REB B;  2MIO A;  2CT3 A;  2LCS A;  1EFN A;  3VS3 A;  2YUN A;  5IXB A;  2ENM A;  2KRM A;  2CDT A;  4RTX A;  4IIM A;  4GBQ A;  2JM8 A;  2F2W A;  2DIL A;  3LH5 A;  4J9C A;  2J7I A;  1QLY A;  2DA9 A;  1WXT A;  4AFS C;  2M0Y A;  1U3O A; 
#chains in the Genus database with same CATH topology
 2KT1 A;  2JJ9 A;  3A8O B;  1YNZ A;  1YP5 A;  3G6E Q;  2ZZD A;  4ORZ A;  3H9N A;  2IIM A;  4JZ4 A;  5KE2 A;  2D0N A;  4V2S A;  4PKC C;  2C0I A;  4PJO G;  5FU6 C;  4M7D E;  4RCC A;  5CVI A;  2A0F B;  4JRQ A;  2RB6 A;  1WYX A;  1N8R U;  2PVG B;  2QAS A;  3EG2 A;  2JTF A;  1HD3 A;  1QP2 A;  1WDX A;  1G8X A;  3EGX B;  1NJI U;  3RER A;  1YJ9 A;  3QJY A;  1VQ6 A;  2HEQ A;  1YJ9 T;  3QSU A;  4IUP A;  3M0P A;  4M78 B;  1YHQ T;  4M75 E;  1Q7Y U;  2M02 A;  4ZGJ B;  3VJP A;  5FWC A;  1R77 A;  1SSF A;  2RJC A;  1NYF A;  3H8Z A;  3QYH B;  3CBM A;  4WTO B;  1Z9Z A;  1RI0 A;  1XOV A;  2JNG A;  1VQP A;  3EG9 B;  4RTZ A;  2AK5 A;  4XTW A;  2OX7 A;  2QA4 T;  3FLG A;  1IRE B;  1ABO A;  2OJ2 A;  1UJY A;  1WXB A;  2HDA A;  3GLX A;  1X01 A;  1TSF A;  4M78 A;  2DXC A;  2KEA A;  3PFS A;  1Q7Y C;  2XDP A;  1QVG A;  3ME9 A;  1GRI A;  3CCE A;  2J05 A;  2L0A A;  2YLC A;  4N4I A;  3EH2 A;  2RHU A;  3OQ5 A;  3QII A;  3CCV Q;  1GBR A;  2XHC A;  4Y91 A;  2ZPB B;  3V8K A;  2GF7 A;  4DQ2 A;  1I0C A;  5EG2 A;  3OYA A;  5HY6 A;  1U5S A;  1T0H A;  1VQO T;  4O6J A;  4KUI A;  1JXM A;  2M9U A;  4KBM B;  2YRC A;  4M7D C;  1MV3 A;  2LQN A;  3CCV T;  2ECZ A;  5AT1 B;  2K57 A;  3NHN A;  1V29 B;  4FYX B;  5D6W A;  4M7D D;  2GCX A;  3ASK A;  4F7U B;  3HSB A;  1RLQ C;  4FSX A;  5D7U A;  3VS5 A;  3OS1 A;  2F2X A;  5FU6 B;  1YHQ A;  1TUD A;  3NGP A;  3OS0 A;  3VS6 A;  1Y57 A;  2QI2 A;  5GAM g;  3UA6 A;  1NLO C;  1R0C B;  3WVD B;  1JEG A;  1VQ9 T;  1N9R A;  2G3R A;  4E7L A;  1C6V X;  1X6B A;  3PNW C;  2O88 A;  3G1J A;  4PJO B;  6AT1 B;  2CP3 A;  2RK2 A;  1D1B A;  2DIQ A;  4M78 E;  3NMZ C;  1U8R A;  3FJP A;  4DBR A;  1QKX A;  1DJ7 B;  1BU1 A;  1WGS A;  2KNB B;  4XQ3 A;  1ZSZ A;  3L2U A;  3EFO B;  1VUB A;  5GAN 6;  2E10 A;  2H3J A;  5KYU A;  2OI3 A;  1V76 A;  2YDL A;  2COY A;  4CC3 A;  1D09 B;  2RJF A;  5C0M A;  2OTL A;  2RNA A;  3X26 B;  3CCE Q;  4C8Q G;  1X6G A;  2RN8 A;  2YUP A;  1D1C A;  3EH1 A;  2DXB A;  1VA7 A;  3JSC A;  1VIE A;  4LUE A;  4XU1 A;  3EHQ A;  1K8A R;  2ZPG B;  2CZ1 B;  3R6O A;  1VQP T;  2V26 A;  4NOY A;  1PRM C;  2E5K A;  1I4K 1;  2DRK A;  3QKJ A;  4QQD A;  4XTZ A;  3OYL A;  1HK9 A;  3GF5 A;  2CP5 A;  4LDV A;  4Z8A A;  2EW3 A;  2YSQ A;  3CME A;  3CCR Q;  3CCE T;  1PM3 A;  4M7A G;  4Z02 A;  1QCF A;  3LGF A;  2DNU A;  4ZGE B;  1BBZ A;  5C6S A;  4BE1 A;  3GOX A;  2CZ6 B;  4KGZ B;  2QQR A;  4OB0 B;  1K73 R;  1G5V A;  2MK5 A;  3MCA B;  4C92 B;  1OV3 A;  4AFZ C;  4IKF A;  2KR3 A;  2NLU A;  2DPP B;  4JJC A;  3QBY A;  5GAM j;  4E7Z A;  2XDB A;  4M77 E;  1T0J A;  2QG9 B;  1TWB A;  1T3L A;  4KGX B;  1VQ5 T;  1WHM A;  4FL6 A;  1QVF P;  3SD4 A;  1AEY A;  2MAM A;  4J6W A;  1N27 A;  4XU3 A;  2JVV A;  3CXC A;  4FYY B;  4OML A;  3SWN A;  1H3H A;  4OF1 A;  3M0U A;  1SHF A;  2NUP A;  1OZ3 A;  5GMK i;  4CC2 A;  2YT6 A;  4Y28 E;  1G3T A;  3A98 A;  4VUB A;  3MO8 A;  2D8H A;  1VQ9 A;  1JJ2 S;  1W1F A;  2LCC A;  2FRW A;  1LCK A;  2A37 A;  2DEU A;  1UEB A;  2HL3 A;  3EGU A;  1W2B A;  2ATC B;  4DBH A;  2JMA A;  3AHU A;  2CSQ A;  3SEM A;  4C5E A;  2PQW A;  1KIK A;  2YXY A;  5FW9 A;  3JB9 F;  2EYQ A;  5CK9 A;  3FEO A;  2X9H A;  2O9V A;  3CC4 A;  3A8H B;  1UGS B;  4KRT A;  5IAY A;  1OOT A;  3QDF A;  4XAX B;  2HBW A;  3QXE B;  2E1H A;  2JUF A;  1E6H A;  3RUX A;  2K6D A;  3H0H A;  1X27 A;  1FWZ A;  3MP1 A;  1Q86 U;  1G2B A;  2EGE A;  2MF2 A;  1KK7 A;  4BUG A;  2M51 A;  4RTW A;  3HHT B;  3CC2 A;  2FVU A;  2KSS A;  4RTT A;  4E7K A;  4TVR A;  2KMT A;  1VQ5 A;  1IHV A;  5A0G A;  3DLL A;  1JRI A;  2KXC A;  4A63 B;  4M7A B;  3LLR A;  2WAC A;  4BI8 B;  2CYZ B;  2VV5 A;  3JCM c;  4J9H A;  4LE9 A;  3G71 T;  4MDX A;  1M90 R;  3H0I A;  4IIO A;  5CIU A;  3VYG A;  2LC4 A;  3C0C A;  2QGF B;  2DEQ A;  1I5L A;  4DOV A;  3HFN A;  1HSQ A;  2G6F X;  1SF9 A;  2X4Y A;  3V7S A;  2KRO A;  2NUZ A;  1OEB A;  3QO3 A;  1R0B G;  2DVJ A;  2HSP A;  3LW5 E;  4C0Z A;  4N0A A;  5FRM A;  4M7A A;  1ZBX A;  1VQ8 Q;  1LVK A;  2LVM A;  5HCK A;  5A0L A;  5GAN e;  2COZ A;  4XTY A;  2X4X A;  2B8A A;  1VQN T;  1M1G A;  1X43 A;  4A4E A;  2E6Z A;  2QDY B;  2OTJ A;  3Q1J A;  5CKH A;  2V8K A;  1VQ7 Q;  3MHX A;  3CCQ Q;  2RJD A;  5DLO A;  2QK0 A;  1Q86 R;  2DTO A;  2P4R A;  4C5G A;  4ME7 A;  1VQ8 T;  1ZQ1 A;  5GAN 4;  1MNE A;  1OPK A;  2VGM A;  2JS0 A;  3GP8 A;  1M1F A;  4M75 C;  4QVZ A;  3JB9 J;  3J80 E;  5GAO n;  3CC4 Q;  3E9F A;  4M77 D;  4M77 F;  1KHC A;  4J9I A;  5KYX B;  4JUV A;  5HK3 A;  4ESR A;  1B34 B;  3E2U A;  4HA8 A;  3LWI A;  2MIO A;  2CT3 A;  2ZPI B;  3M58 A;  1EFN A;  4IIM A;  3HRS A;  2JM8 A;  2F2W A;  4PLL A;  2J7I A;  2XIC A;  2DA9 A;  5GAO p;  3VUZ A;  5HKC A;  3CCL T;  1VQ7 T;  3M55 A;  1VQ7 A;  2FRY A;  4J6Y A;  2HQH A;  2AZV A;  2OTJ Q;  2XKO C;  2Y90 A;  3VU3 C;  2A36 A;  4C8Q A;  3VRY A;  3CME Q;  3E1S A;  1Y0M A;  2F5T X;  3L2V A;  4FT2 A;  2FG0 A;  3I35 A;  2DBK A;  1NE8 A;  3JCM b;  1IRX A;  4EDU A;  2CGH A;  1RAA B;  4BI3 A;  3CCM Q;  2A08 A;  1RAE B;  1VOM A;  2YRV A;  1QVF S;  2HQE A;  4CRI A;  1CKA A;  3OW2 P;  1YIJ T;  1AOJ A;  3OYD A;  2EJG A;  3CD6 T;  1PKT A;  3CD6 A;  1BB9 A;  3BDL A;  3I55 T;  2DE0 X;  3FIF A;  5GMK l;  3RR6 A;  5DY9 A;  4N4G A;  2CH4 A;  3J81 E;  1F1B B;  2LT1 A;  1NJI R;  3PVQ A;  5J39 A;  1T3S A;  2A7Y A;  2YHT A;  1VQK T;  1VYT A;  2E3I A;  2EKH A;  2KT8 A;  2K5F A;  3BFM A;  4M77 A;  3M53 A;  1N8R R;  1ZSZ C;  1GXI E;  4PK4 A;  1K9M U;  5GAN h;  2DVE A;  3JCM J;  4E2F B;  1OYX A;  2GQI A;  4B9W A;  3OYF A;  1PRL C;  1ZUU A;  2JS2 A;  1WJS A;  3G6E T;  1OX9 A;  4MML A;  2JMC A;  5GAN 8;  2J6O A;  2BTT A;  2NWM A;  3GPL A;  4JS5 A;  1NEG A;  4PJO D;  3QPH A;  2ZPE B;  4RTU A;  2VXF A;  1TS9 A;  1YI2 A;  3RKW A;  2K3X A;  4AFU C;  1K9A A;  1Q82 U;  1LPL A;  2MWO A;  1KQ1 A;  3GIB A;  4PNO A;  5FRN A;  1VQ9 Q;  1QVG P;  2DZC A;  1VQL A;  5GAM f;  3I5S A;  1UDL A;  1Z9Q A;  2QDL A;  2LNH B;  2RQV A;  2CUD A;  1KHI A;  5CR2 A;  3OY9 A;  1NPR A;  1S72 A;  2K2M A;  4FM4 B;  4OMN A;  5CCA A;  5FU7 B;  5AYF A;  2VUB A;  4C92 C;  1NM7 A;  4NL3 A;  4A53 A;  4L6V 5;  2YWW A;  1KD1 U;  3EFR A;  4Q5W A;  3CQT A;  3RES A;  1B7T A;  1U1S A;  4N4H A;  1ZSG A;  3MP8 A;  1JO8 A;  2KAF A;  1M3A A;  4QKU A;  4C8Q E;  5A0D A;  5GAN 3;  3HPW A;  4J9G A;  2LQK A;  2DRM A;  3I56 Q;  1VYV A;  4YTL A;  3CCM T;  3L42 A;  3UPU A;  3OBY A;  2JXB A;  3LYI A;  1RAG B;  5IH2 A;  1WQW A;  2FPE A;  4IUV A;  4F7U E;  2DL4 A;  3RNJ A;  4QVC A;  3VS1 A;  3VRZ A;  2X3X D;  3VS4 A;  3CCJ Q;  2AKL A;  2JTM A;  1K4U S;  4B6M A;  2K5I A;  2QA4 Q;  5I11 A;  4F14 A;  5GMK e;  4ATO A;  5CAI A;  2RM4 A;  4C92 E;  2DO3 A;  3I56 A;  2AHJ B;  2Z0W A;  2JTE A;  1M5Q 1;  2EAY A;  1I8F A;  4E7H A;  1UHC A;  1SRL A;  1TOV A;  4C92 G;  3PT9 A;  4HCZ A;  2CH4 W;  2ROT A;  3QWX X;  2RMO A;  1UJ0 A;  3NFC A;  1MMN A;  2LQW A;  1WHH A;  3SWN B;  2I0N A;  2KK4 A;  3REA B;  1B3Q A;  3P8D A;  1VQN Q;  1YN8 A;  2CP2 A;  2GQV A;  1WHK A;  4OB2 B;  2O01 E;  4D8K A;  4FU6 A;  2M16 A;  4L59 A;  2QQ9 A;  4HKE A;  2PVO B;  5A2Q E;  4QQG A;  2C0O A;  4J9D A;  1N9S A;  1M30 A;  2P84 A;  4QQ6 A;  1WHL A;  2D0Q B;  3SHW A;  3HTR A;  1VQM A;  2KBT A;  3EFO A;  4J7F A;  5GJW B;  2GBQ A;  3CC7 A;  3JB9 H;  4BAC A;  2EQI A;  2R5A A;  2FL7 A;  2PUK B;  2R58 A;  1D3B B;  4PJO F;  1P92 A;  4PFO A;  3M57 A;  3QHS A;  2RK1 A;  2KE9 A;  2XU8 A;  3QDR B;  3CPF A;  3H41 A;  2M1H A;  2E3H A;  2QQA A;  1JBM A;  2P0K A;  2KQW A;  1MMG A;  1FYN A;  1RLP C;  2RA2 A;  1WXU A;  1OZ2 A;  2QGG A;  2AKK A;  2AT1 B;  1M8V A;  1K76 A;  1S72 Q;  2MMP A;  4II1 A;  1OX8 A;  3I55 Q;  4X34 A;  5CQY A;  3TSZ A;  4ZN3 A;  1YWO A;  4M75 G;  2PUO B;  2DL8 A;  3JAM E;  4AG2 C;  2E5Q A;  2RQR A;  5D6X A;  2DER A;  3M0S A;  3P8B B;  1QVF A;  2EYW A;  3QJ6 A;  3OMC A;  1Q82 C;  1VYU A;  2RHY A;  5LJ3 g;  2EQM A;  4Y92 A;  3URG A;  2D9T A;  1LJO A;  4HCK A;  1JXO A;  2DFU A;  1OI1 A;  2RHI A;  1PNJ A;  3PVL A;  3VKI A;  2QYZ A;  2BUD A;  4DEX A;  3CD6 Q;  4XK8 E;  3M59 A;  4F7U A;  5IXF A;  3CCS A;  1QMC A;  1YIT A;  5GMK h;  2MI6 A;  2F2V A;  4RKU E;  2CSI A;  3PGG A;  4QVD A;  3MKD A;  2YRD A;  4M78 D;  1NYG A;  4N0A C;  3JCM e;  1M9S A;  1HJD A;  3DB3 A;  1PD0 A;  1VQO A;  1ZHI A;  4KGV B;  1JQQ A;  3VS0 A;  1C1A A;  3JB9 I;  3SWN C;  1K0X A;  2DTI A;  1BIA A;  4PJO A;  1B34 A;  5L23 A;  2B86 A;  4EMK B;  4MMK A;  1D1A A;  2XG8 D;  2KDS A;  1TUC A;  4J8O A;  2ZGW A;  5KYW A;  1RUW A;  4XU0 A;  3JRZ A;  5I2M A;  2BKD N;  1KSW A;  4C5I A;  2CRE A;  2CZ7 B;  1E7O A;  3H0F A;  1VQK Q;  3G71 Q;  3M9Q A;  2K7A A;  3CEY A;  3ZBD A;  3CPW P;  2LX7 A;  4J9E A;  1GCQ C;  1VQM T;  2MYS A;  4AFQ C;  3CPW S;  1AZE A;  3OYC A;  2KGT A;  3R6N A;  2L3S A;  3TEE A;  1EIF A;  3QWY A;  2C06 A;  1Y7X A;  2R5M A;  1C0M A;  4QT7 A;  3JCM d;  4J83 A;  4DA4 A;  3MEV A;  1VQM Q;  1WJQ A;  4GLK A;  5FU7 C;  1MMD A;  4C0G A;  1SHG A;  2ZPF B;  1G83 A;  2KRN A;  1AWO A;  2VYT A;  2GGR A;  4RG2 A;  4JJD A;  1WIE A;  1LNX A;  3ZL7 C;  4OMF B;  4LDU A;  4PJN A;  5LL6 S;  1UGQ B;  1Q82 R;  4E7J A;  4JLI A;  3A5Z B;  1K73 C;  2LCS A;  1VQ4 A;  5IXB A;  2ENM A;  4EMH A;  4RTX A;  4C8Q D;  4C8Q F;  4GBQ A;  3JCM X;  3CMA A;  4LDY A;  3OW2 A;  2DJZ A;  3EAE A;  3JCM Q;  2M0Y A;  1OU9 A;  1AD5 A;  2K3Y A;  2DYB A;  3FDR A;  1QQJ A;  3C95 A;  3LH0 A;  4FT4 A;  4HT9 A;  5GAO m;  1TH7 A;  4OGC A;  4C8Q B;  2DK3 A;  2FYK A;  1I5O B;  1ACM B;  4M75 B;  4XU2 A;  2L8D A;  1ARK A;  4RG8 A;  3O8V A;  3NTH A;  2IPO B;  1WX6 A;  4M77 C;  4NS5 A;  5GAO l;  3G7Z A;  1RAC B;  1ZBJ A;  4M7A E;  2M0O A;  3E19 A;  2DD4 A;  3CCQ T;  5GMK m;  2QQS A;  3MP6 A;  4IUQ A;  1VQ6 T;  2D8J A;  4PFP A;  1RAH B;  2GTJ A;  1PC0 A;  1OUL A;  4Z89 A;  1IGQ A;  1GCQ A;  3U23 A;  4BB7 A;  5GAN j;  1BI3 A;  4MZT A;  1KC8 R;  2LMJ A;  1S1N A;  1K0S A;  4C5H A;  4JJB A;  2EBP A;  2DJQ A;  2L89 A;  2OTL Q;  2L3P A;  2QTV A;  1YJW A;  2K79 A;  4LD6 A;  1I07 A;  1XQH A;  1OQK A;  3H6Z A;  5ECA A;  1K1Z A;  1GL5 A;  3EG3 A;  2DX1 A;  3OYB A;  3VYH B;  2O4X B;  4XTV A;  4M78 G;  4C8Q C;  3OYY A;  2J6F A;  2RH2 A;  5CKE A;  4BI4 A;  3ER0 A;  2R57 A;  3RMS A;  3RMQ A;  3TRE A;  1UTI A;  2JM9 A;  4JRI A;  4ZTF A;  4BY6 B;  1VQL Q;  2BZ8 A;  2CP0 A;  2E6N A;  4F17 A;  1QKW A;  5GAN f;  3WVE B;  2DL5 A;  1M1K C;  1H92 A;  1XNI A;  3MPU B;  2IVW A;  3OMG A;  2OTL T;  2CKK A;  3LGL A;  4BE0 A;  1YI2 Q;  3TCJ A;  4JRP A;  1UEC A;  2EYZ A;  1Q81 C;  2LJ1 A;  2VXE A;  3GNF B;  2VKN A;  4M7A C;  3JB9 G;  2VB6 A;  2EQJ A;  2L3Q A;  1G3Y A;  2KXD A;  1ZUY A;  3OYK A;  1JJ2 A;  4M7A D;  2GFA A;  2LQ8 A;  3BE3 A;  3BY7 A;  3M0R A;  1XTD A;  1M3C A;  2DIG A;  1W70 A;  4JJN K;  4OVA A;  1D3B A;  3JV3 A;  4GY5 A;  2RI2 A;  1M1K U;  3L2Z A;  2LP5 A;  2HKQ B;  2DTH A;  5D6Y A;  3EHR A;  2VVK A;  1YCY A;  2ED0 A;  3DKM A;  2O2O A;  2EQU A;  3MEA A;  3RKX A;  4CI0 C;  1QP3 A;  3KFV A;  1YJW T;  2HSE B;  4BE2 A;  3SFM A;  1UUE A;  1YBY A;  3C12 A;  5IHK A;  2KYB A;  2COW A;  3MJX A;  1WHJ A;  1YJN T;  1PKS A;  1YIT Q;  1PHT A;  2W0Z A;  1NEB A;  3L2R A;  1KQS S;  2EKO A;  1YIJ Q;  4UC4 A;  3G4S Q;  4JRK A;  5IN1 A;  4C92 F;  4C92 D;  5CO7 A;  3RIR A;  2QTX A;  1SPK A;  3CCU A;  2XID A;  4OMO A;  3A8L B;  4ZN1 A;  4X9C A;  2C0T A;  1M2V B;  2KYM A;  1QWE A;  3CC2 T;  1Y71 A;  2EGA A;  4EMG A;  1IZ6 A;  1SEM A;  2DF6 A;  4L5G A;  4BY6 C;  2DZ9 A;  1WNL A;  3V7R A;  3OB9 A;  4WF2 A;  2KY9 A;  2EJ9 A;  2ZCF B;  3EGD B;  1N8R C;  3L1A A;  2E4H A;  2GFU A;  4M7D G;  1E6G A;  3VS2 A;  3QG1 A;  4B9X A;  2QEX T;  3S3M A;  1GFC A;  1NJI C;  1RI9 A;  4KH0 B;  1JB0 E;  2L3R A;  1YWP A;  1GCP A;  4E7S A;  5LJ5 h;  2DM1 A;  1IGU A;  1M90 C;  4ZTJ A;  2MOX A;  3JCM V;  1Y96 A;  4OB3 B;  2EPD A;  3UAT A;  4A54 A;  1TG0 A;  1EZZ B;  2CP7 A;  4NL2 A;  3CCQ A;  1QVG S;  1UGP B;  4MZP A;  5I21 A;  3CCV A;  3DB4 A;  2HKN A;  4C0F A;  5J3B A;  4IUU A;  3G4S A;  3PIP A;  2D6F A;  2FZK B;  1RAD B;  2WSE E;  4KH1 B;  1Q81 R;  1VQ8 A;  2KRS A;  2RO0 A;  3CMA Q;  5LJ3 f;  2XD0 A;  4HVU A;  5LJ5 f;  4PL6 A;  2K3B A;  1BI1 A;  4JPB W;  2QA4 A;  5CQX A;  1YJN A;  3KUF A;  3CCJ A;  2SEM A;  3CCJ T;  2XI9 A;  3DLM A;  3CME T;  4F7U F;  5KYW B;  2O9S A;  2LTO A;  3CC4 T;  4F04 B;  2FPF A;  3BDU A;  2NYS A;  3TSW A;  5LJ3 e;  4BDY A;  1TUG B;  1M2O A;  1OU8 A;  1X6O A;  3N5B B;  8ATC B;  4HVW A;  2BE7 D;  2LNV A;  1PSE A;  1BCM A;  4J9B A;  5LJ3 j;  2EGC A;  2D1X A;  3KBG A;  2CS7 A;  9ATC B;  1WFW A;  1YI2 T;  4M78 C;  1FMK A;  4OMQ A;  4DEY A;  1K9M C;  1D0Y A;  4M75 D;  1XJW B;  4JS4 A;  1KFZ A;  1UGV A;  2HZY A;  2YUQ A;  4E7I A;  5DLQ E;  1H64 1;  1ZLM A;  1AVZ C;  1KC8 C;  4FYW B;  1VQL T;  3JB9 D;  2J6K A;  4EPC A;  2CT4 A;  3G71 A;  2RQU A;  1Q86 C;  1GBQ A;  4M7D B;  1D0X A;  2EVR A;  2FZG B;  3JCM P;  3M54 A;  2P0P A;  5HK0 A;  3IQL A;  2QEX A;  4XTU A;  3M0Q A;  3PIO A;  2EFI A;  2GTO A;  2OAU A;  1SKU B;  2PVD B;  1KQS P;  3FJ5 A;  4D8D A;  3JCM g;  1IXD A;  3RDV A;  4MDW A;  3UT1 A;  3NTI A;  5KCH A;  2P4T A;  4RMO A;  1TTH B;  4M7D A;  4PJO E;  4KUD K;  1VQN A;  2GNC A;  3OS2 A;  4PFZ A;  4CC7 A;  3S3N A;  7AT1 B;  3TU4 K;  1YIJ A;  1O9S A;  3SB2 A;  1RL2 A;  3G4S T;  2BZX A;  3RKY A;  2EYX A;  3EFS A;  3CCU T;  1Q95 G;  4EMK A;  5CKD A;  2KI7 A;  4EMK C;  1SG5 A;  5LJ5 g;  3NPF A;  2MWP A;  5LJ3 d;  1AT1 B;  2XK0 A;  5GAO q;  1N6A A;  5J26 A;  3C4S A;  5IHI A;  2VC8 A;  3QZ9 B;  2DBM A;  1FXX A;  4DBQ A;  2VWF A;  2JOY A;  2MCN A;  2RF0 A;  3OYG A;  4M7A F;  2VGN A;  4LN2 A;  2PTK A;  3EG9 A;  1M27 C;  3OYI A;  2KRM A;  2QXF A;  1MGQ A;  2MPX C;  1VQO Q;  1PG5 B;  5GAN 7;  4J7I A;  1YJN Q;  4J9C A;  1QLY A;  1R8O B;  1K9M R;  4AFS C;  1U3O A;  3BW1 A;  2LT4 A;  4AT1 B;  2RHZ A;  3ULR B;  3EG0 A;  2A28 A;  1JU5 C;  5KYX A;  2HQX A;  2ZAE A;  3OSV A;  3MEU A;  1RAB B;  2SRC A;  2JW4 A;  2ZPH B;  1V1C A;  2J06 A;  1YFN A;  2DKG A;  2NUT B;  2HL5 C;  4QW2 A;  2O31 A;  1ZA2 B;  1KJW A;  5M9O A;  2DXT A;  1BK2 A;  1NLP C;  3MET A;  1VQ5 Q;  1WQ7 A;  1X75 C;  1UFF A;  4KUL A;  4ELY C;  3O5Z A;  1B07 A;  3I55 A;  2HAX A;  1AWW A;  2JN0 A;  1Q7Y R;  3CPW A;  2FHD A;  3TQ7 P;  3HFO A;  4JDS A;  3CCL Q;  2LRQ A;  2H8H A;  1WZO A;  2E64 A;  5CKF A;  4M78 F;  3A8G B;  2IG0 A;  1BIB A;  3PMI A;  3PE0 A;  4PJL A;  3T9N A;  1CKB A;  3JCM h;  3P8H A;  1ABQ A;  4C0D B;  4RUG A;  4C0D C;  1FX7 A;  3NTK A;  3OS5 A;  2V8J A;  3CBP A;  5KYN A;  1K73 U;  2LJ0 A;  2RPN A;  2ESW A;  4AG1 C;  2RJE A;  4AMC A;  1K8A C;  4D6W A;  2LCL A;  5KE3 A;  1BCO A;  2EWN A;  3V8L A;  2DYI A;  1J3T A;  2FEI A;  4R56 A;  2CP6 A;  1MMA A;  3E9G A;  4R55 A;  2CZ0 B;  4M75 F;  3CCS T;  1HYO A;  2WSC E;  1X2K A;  2JZ2 A;  5I2S A;  1U06 A;  2QAZ A;  2AZS A;  1WI7 A;  3HRU A;  3EGX A;  2ED1 A;  1MV0 B;  4FYV B;  3CC7 T;  1K8A U;  2DXU A;  3CCS Q;  4P5N A;  3UA7 A;  4HXJ A;  5KYY A;  1M8M A;  2X3W D;  5L8R E;  2E41 A;  4A4G A;  4A4F A;  2CUB A;  4M4Z A;  4IUR A;  1W4S A;  1S72 T;  3M4G A;  3OSS C;  2DET A;  1QW1 A;  2EQK A;  1LOJ A;  3A8M B;  3EGD A;  5LJ3 h;  2O4X A;  5KCO A;  2NUT A;  3GBQ A;  5GAN 5;  1AZG B;  3CCL A;  1PD1 A;  2VAS A;  3X25 B;  1WLP B;  3S3O A;  4X9D A;  2H3E B;  1H3Z A;  2L2P A;  4OMP A;  4O5V A;  3S6W A;  3PMT A;  4HCC A;  2V1Q A;  4ZGD B;  4C92 A;  1KD1 C;  3X20 B;  2X51 A;  5GAN g;  3GNG A;  1M90 U;  2FZC B;  3J7A F;  2X4J A;  1M3B A;  1ZSZ B;  3CXC S;  2OTJ T;  3M5A A;  2F69 A;  3OBW A;  4RTY A;  5FRO A;  4M77 G;  4RTV A;  2P0Q A;  1UB4 A;  3KXT A;  2ROL A;  2YUO A;  3D7S B;  8AT1 B;  3X24 B;  1UHF A;  1W2B P;  1VIF A;  2HMA A;  4LNP A;  1W2B S;  4M7D F;  2HBP A;  4RCB A;  4Z88 A;  1VQK A;  4WCI A;  2RD1 A;  3C94 A;  1U1T A;  3OYE A;  1KQ2 A;  2PU9 B;  1N5Z A;  5FLX E;  2V8I A;  1KG1 A;  5CKB A;  3VUB A;  3M4Y A;  1W6X A;  1FMW A;  5LJ5 e;  1QCO A;  1WA7 A;  3CCU Q;  3JCM f;  2FO0 A;  2OAW A;  3A1P A;  3HRT A;  5GJV B;  5LJ5 j;  2Y4X A;  4X1V A;  2BE9 B;  2LDM A;  1JJ2 P;  2DL7 A;  3V7C A;  1YJW Q;  3CBO A;  2HCK A;  3L2W A;  4LUD A;  2I2L A;  5KYU B;  2AIR B;  5DM7 R;  2Y4Y A;  3QUI A;  1YIT T;  4FW1 A;  4OP0 A;  2XDD A;  1Q81 U;  1YHQ Q;  2RI5 A;  3OA6 A;  1AHJ B;  3OYN A;  1NBE B;  5EC7 A;  1MHN A;  5FWB A;  4J6X A;  4XTX A;  3M0T A;  4FW2 A;  5I22 A;  3CCM A;  2EYY A;  3FRN A;  3RBB B;  3THK A;  3OYH A;  3SDZ A;  1RAI B;  2K9G A;  3UF4 A;  2JT4 A;  1BKB A;  1OPL A;  4OB1 B;  1EX4 A;  1X69 A;  2V1R A;  3WXM B;  1PCX A;  1BI2 A;  1SSH A;  2W10 A;  3HKS A;  3CCR A;  1YCS B;  1KC8 U;  3CCR T;  3TVT A;  4BDZ A;  2LZ6 B;  1WPY A;  2DLP A;  4GLM A;  1KQS A;  1A0N B;  1NG2 A;  5GAM h;  2NUP B;  2QEX Q;  2RQT A;  2FB7 A;  1PWT A;  3CC2 Q;  1ZUK A;  4LXC A;  3UDC A;  3FC3 A;  4F7U G;  4F16 A;  2L5Q A;  3I56 T;  3VS7 A;  1H8K A;  3I5R A;  2E70 A;  3ZFJ A;  1ZX6 A;  4E6R A;  2ABL A;  2LJ3 A;  3X28 B;  1IO6 A;  2K2V A;  2RI3 A;  4LDW A;  4FIB A;  3L2Q A;  2X35 A;  2DD5 A;  4J5Y A;  2RQW A;  3G6E A;  5LJ5 d;  1QCN A;  1UE9 A;  2LX9 A;  2BZY A;  3I9Q A;  1G3W A;  4HT8 A;  4KT0 E;  4PJO C;  4A4H A;  4ZNX A;  1WHG A;  2PNI A;  1O75 A;  4DBF A;  2DL3 A;  1FMV A;  1X2Q A;  5IT9 E;  4MZM A;  3PTA A;  1VQ6 Q;  2KVQ G;  2XMF A;  4K11 A;  1TXQ A;  3AT1 B;  3OW2 S;  1ZA1 B;  4JZ3 A;  3VV0 A;  4ANJ A;  2YLB A;  4IUT A;  1D0Z A;  4M75 A;  1IHW A;  2E65 A;  2K4Y A;  4LD9 K;  5KH6 A;  4OMM A;  1GFD A;  2DAQ A;  1QWF A;  3CMA T;  3OYJ A;  1CSK A;  5GAM d;  4A4K A;  4J9F A;  5IHN A;  1M4Z A;  3HP9 A;  3M56 A;  1MND A;  4FCY A;  4PLI A;  3CXC P;  4ELZ C;  2RHX A;  4EIK A;  2EJF A;  5GAO r;  2E12 A;  3LWH A;  2BIV A;  1BI0 A;  3OYM A;  1AWJ A;  2HNI A;  3F70 A;  4E47 A;  4HVV A;  5GAN d;  3EG1 A;  2A3L A;  1M2V A;  1Y96 B;  1M1K R;  4CC4 B;  1WJR A;  3HL8 A;  1UGR B;  1KD1 R;  2FPD A;  4FSS A;  2HD0 A;  3FB9 A;  1MUZ A;  3MEW A;  2K5L A;  2X4W A;  1RAF B;  5GAM e;  5GMK j;  3QZ5 B;  1I1J A;  4PJJ A;  4HCB A;  3LX7 A;  3QYG B;  1Y07 A;  1TU0 B;  1AWX A;  3INZ A;  1VQ4 Q;  1NPP A;  1UG1 A;  2EIF A;  4JLG A;  2DMO A;  1QVP A;  1NZ9 A;  5GAN 2;  2PZ1 A;  1VQP Q;  3V8J A;  1G3S A;  3CC7 Q;  3UWN A;  5KYY B;  1SRM A;  1IB8 A;  4R0K A;  1I81 A;  1BYM A;  4M77 B;  3REB B;  1VQ4 T;  2F5K A;  3VS3 A;  2YUN A;  4OGE A;  4BD3 A;  2CDT A;  3JCM W;  4DOW A;  2WSF E;  1HXD A;  2DIL A;  3LH5 A;  4LDX A;  2F1L A;  1PSF A;  2QQB A;  4PJM A;  1WXT A;  3ZEH A;  1YJ9 Q; 
#chains in the Genus database with same CATH homology
 1AD5 A;  2FRY A;  2KT1 A;  2DYB A;  3ULR B;  2AZV A;  3EG0 A;  2A28 A;  2A36 A;  1YNZ A;  1YP5 A;  1JU5 C;  4ORZ A;  3VRY A;  2IIM A;  4JZ4 A;  1Y0M A;  2FG0 A;  3I35 A;  2D0N A;  2DBK A;  2SRC A;  2C0I A;  2JW4 A;  1V1C A;  2J06 A;  1ARK A;  2O31 A;  1WYX A;  1WX6 A;  2A08 A;  3EG2 A;  1HD3 A;  1KJW A;  1ZBJ A;  1WDX A;  1BK2 A;  1NLP C;  1CKA A;  1AOJ A;  1PKT A;  1UFF A;  1BB9 A;  2HEQ A;  3O5Z A;  1B07 A;  1AWW A;  2DE0 X;  2D8J A;  2GTJ A;  3M0P A;  4Z89 A;  1GCQ A;  3U23 A;  2CH4 A;  2H8H A;  2LMJ A;  1S1N A;  1K0S A;  5FWC A;  3PVQ A;  1NYF A;  1T3S A;  4JJB A;  3PE0 A;  2EBP A;  2DJQ A;  1CKB A;  1VYT A;  1Z9Z A;  1XOV A;  2L3P A;  2EKH A;  2KT8 A;  1ABQ A;  4RTZ A;  2AK5 A;  2K79 A;  4RUG A;  1I07 A;  5ECA A;  1K1Z A;  1GL5 A;  1ABO A;  2OJ2 A;  3EG3 A;  2DX1 A;  1UJY A;  1WXB A;  2HDA A;  2LJ0 A;  2RPN A;  2ESW A;  4AG1 C;  2KEA A;  2GQI A;  2J6F A;  1PRL C;  1UTI A;  1ZUU A;  2JM9 A;  2JS2 A;  1GRI A;  2J05 A;  2BZ8 A;  2JMC A;  1J3T A;  4F17 A;  1QKW A;  2FEI A;  2J6O A;  2BTT A;  2NWM A;  2L0A A;  2DL5 A;  1NEG A;  1H92 A;  4RTU A;  1GBR A;  1X2K A;  1U06 A;  4AFU C;  1K9A A;  2EYZ A;  1I0C A;  1UEC A;  2LJ1 A;  2AZS A;  2VKN A;  1WI7 A;  2L3Q A;  1U5S A;  2KXD A;  1ZUY A;  2ED1 A;  1T0H A;  1MV0 B;  1JXM A;  3I5S A;  1UDL A;  3M0R A;  1M3C A;  1MV3 A;  1Z9Q A;  2ECZ A;  2LNH B;  2LQN A;  2QDL A;  1M8M A;  1W70 A;  2RQV A;  2X3W D;  2CUD A;  3NHN A;  4HXJ A;  3JV3 A;  2CUB A;  2K2M A;  4M4Z A;  1RLQ C;  4OMN A;  3VS5 A;  2LP5 A;  2F2X A;  1NM7 A;  1TUD A;  3EHR A;  2VVK A;  3NGP A;  2ED0 A;  3GBQ A;  3VS6 A;  1Y57 A;  1AZG B;  2O2O A;  3UA6 A;  3CQT A;  1NLO C;  1JEG A;  3KFV A;  1ZSG A;  1UUE A;  1WLP B;  1X6B A;  1JO8 A;  5IHK A;  2O88 A;  2KYB A;  1M3A A;  2L2P A;  4OMP A;  3NMZ C;  4J9G A;  1PKS A;  2DRM A;  2V1Q A;  1PHT A;  1VYV A;  2W0Z A;  1QKX A;  1BU1 A;  1NEB A;  2KNB B;  2JXB A;  1M3B A;  5IH2 A;  2FPE A;  4RTY A;  4RTV A;  2DL4 A;  2OI3 A;  2YDL A;  2ROL A;  2YUO A;  3RNJ A;  4CC3 A;  3VS1 A;  1UHF A;  1SPK A;  2RNA A;  2X3X D;  3VRZ A;  3VS4 A;  2AKL A;  4OMO A;  1K4U S;  4LNP A;  1X6G A;  2RN8 A;  2YUP A;  5I11 A;  4F14 A;  2C0T A;  4Z88 A;  1VA7 A;  1QWE A;  2KYM A;  4LUE A;  4WCI A;  3EHQ A;  2JTE A;  2EGA A;  1SEM A;  2DF6 A;  1PRM C;  2E5K A;  1N5Z A;  1UHC A;  1SRL A;  2DRK A;  2CH4 W;  2ROT A;  1W6X A;  3QWX X;  2RMO A;  1UJ0 A;  1WA7 A;  2LQW A;  2I0N A;  2OAW A;  2FO0 A;  5GJV B;  1E6G A;  3REA B;  3VS2 A;  4Z8A A;  2EW3 A;  4X1V A;  1B3Q A;  2YSQ A;  1YN8 A;  1GFC A;  2DL7 A;  1QCF A;  4D8K A;  1RI9 A;  2DNU A;  2HCK A;  4LUD A;  1BBZ A;  1YWP A;  1GCP A;  2C0O A;  4J9D A;  2DM1 A;  1OV3 A;  4AFZ C;  1M30 A;  5EC7 A;  3SHW A;  2KR3 A;  2MOX A;  4JJC A;  2KBT A;  5FWB A;  2EPD A;  3UAT A;  3M0T A;  5I22 A;  1TG0 A;  2EYY A;  5GJW B;  2GBQ A;  1T0J A;  3RBB B;  3THK A;  3UA7 A;  2K9G A;  3UF4 A;  1T3L A;  2JT4 A;  1OPL A;  1X69 A;  2V1R A;  2EQI A;  1SSH A;  2W10 A;  1AEY A;  1YCS B;  3TVT A;  2LZ6 B;  2DLP A;  4GLM A;  1A0N B;  1NG2 A;  2KE9 A;  4OML A;  2RQT A;  1H3H A;  1PWT A;  3M0U A;  1SHF A;  3H41 A;  1ZUK A;  2KRS A;  4CC2 A;  2YT6 A;  3A98 A;  4F16 A;  1FYN A;  1RLP C;  3VS7 A;  2D8H A;  1H8K A;  1WXU A;  4HVU A;  2AKK A;  1W1F A;  2FRW A;  1K76 A;  2K3B A;  3I5R A;  1LCK A;  4JPB W;  3TSZ A;  2A37 A;  3EGU A;  1ZX6 A;  1YWO A;  4E6R A;  2DL8 A;  2ABL A;  2LJ3 A;  4AG2 C;  2JMA A;  2SEM A;  2RQR A;  1IO6 A;  3M0S A;  2CSQ A;  3SEM A;  1KIK A;  2EYW A;  5FW9 A;  1VYU A;  2RQW A;  4Y92 A;  2O9S A;  1UE9 A;  4HCK A;  1JXO A;  2O9V A;  2BZY A;  2FPF A;  3I9Q A;  1PNJ A;  3PVL A;  4KRT A;  1OOT A;  3TSW A;  4HVW A;  2HBW A;  4DEX A;  5IXF A;  1E6H A;  4J9B A;  2K6D A;  4ZNX A;  2PNI A;  2EGC A;  2D1X A;  2DL3 A;  2F2V A;  1WFW A;  3H0H A;  1FMK A;  4OMQ A;  4DEY A;  1X2Q A;  1X27 A;  2CSI A;  1G2B A;  2EGE A;  1NYG A;  2M51 A;  1UGV A;  4RTW A;  1KFZ A;  1HJD A;  2YUQ A;  2XMF A;  4RTT A;  4K11 A;  1ZLM A;  1AVZ C;  1JQQ A;  2KXC A;  3VS0 A;  4A63 B;  1K0X A;  4JZ3 A;  2J6K A;  2CT4 A;  4J9H A;  4LE9 A;  5L23 A;  2B86 A;  3H0I A;  4IIO A;  2RQU A;  1GBQ A;  4OMM A;  1GFD A;  1QWF A;  2EVR A;  3C0C A;  1TUC A;  1CSK A;  1HSQ A;  2G6F X;  3IQL A;  4J9F A;  3M0Q A;  5IHN A;  1RUW A;  2KRO A;  1KSW A;  2NUZ A;  2GTO A;  1OEB A;  2CRE A;  1E7O A;  3H0F A;  2DVJ A;  2HSP A;  3FJ5 A;  4D8D A;  2K7A A;  5HCK A;  4EIK A;  2LX7 A;  4J9E A;  1GCQ C;  4AFQ C;  1AWJ A;  1AZE A;  4HVV A;  3EG1 A;  2GNC A;  2KGT A;  3R6N A;  1X43 A;  2L3S A;  4CC4 B;  3QWY A;  4CC7 A;  2FPD A;  4FSS A;  4QT7 A;  1MUZ A;  2BZX A;  1I1J A;  2EYX A;  1AWX A;  1SHG A;  2P4R A;  1G83 A;  2KRN A;  1AWO A;  1UG1 A;  3NPF A;  2GGR A;  1OPK A;  2DMO A;  2JS0 A;  4JJD A;  1WIE A;  5IHI A;  2DBM A;  3ZL7 C;  2VWF A;  2PZ1 A;  2MCN A;  4J9I A;  2RF0 A;  4ESR A;  4LN2 A;  1SRM A;  2PTK A;  4R0K A;  1M27 C;  3REB B;  2MIO A;  2CT3 A;  2LCS A;  1EFN A;  3VS3 A;  2YUN A;  5IXB A;  2ENM A;  2KRM A;  2CDT A;  4RTX A;  4IIM A;  4GBQ A;  2JM8 A;  2F2W A;  2DIL A;  3LH5 A;  4J9C A;  2J7I A;  1QLY A;  2DA9 A;  1WXT A;  4AFS C;  2M0Y A;  1U3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...