2I0NA

Structure of dictyostelium discoideum myosin vii sh3 domain with adjacent proline rich region
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
80
structure length
80
Chain Sequence
MGPLGSPEFAKYARALKDYNVSDTSLLPFKRNDIITITFKDQENKWFMGQLNGKEGSFPVDHVEILLSDVPPPQPVHPVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class VII unconventional myosin
publication title The SH3 domain of a M7 interacts with its C-terminal proline-rich region.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Structural protein
total genus 7
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2i0nA01
2EQIA 1YNZA 1CSKA 1UJ0A 1UJYA 4AG2C 3VS0A 2VKNA 1H92A 2C0IA 1RLPC 2DM1A 1WXBA 2AK5A 3JV3A 2L3SA 3CQTA 4LUEA 2EGAA 4Y92A 2ENMA 1Z9QA 2JM8A 4J9DA 2P4RA 2YUNA 4HCKA 1K76A 5GJVB 2AKKA 4LN2A 4AFUC 4Z89A 1GCQC 2DRMA 4CC3A 1T0HA 2DVJA 1GFDA 1M3AA 1BK2A 1UGVA 2C0TA 3ULRB 1OV3A 2MOXA 2JW4A 2KYMA 2LQNA 2DL4A 2VVKA 3UA7A 2AZSA 1TUCA 3NPFA 2LJ3A 2KRMA 2X3WD 2KXCA 1BB9A 3VRYA 2CT4A 4IIOA 2KT1A 1VA7A 2H8HA 2KXDA 3VS4A 3A98A 1OPKA 2JS2A 2GBQA 1CKAA 1PRMC 4J9CA 2OI3A 2A08A 2LQWA 1JU5C 2F2XA 1UE9A 2DE0X 1T3SA 3PE0A 3M0UA 1ZLMA 1UDLA 1AOJA 1AZGB 1U3OA 2J7IA 4J9HA 1VYVA 3H0HA 1X27A 2FPDA 2DA9A 3H0IA 3QWYA 1HJDA 1Y57A 1KSWA 2KT8A 1HSQA 2BZXA 2JS0A 2EPDA 2KE9A 2RF0A 2K79A 1AWXA 2C0OA 2HCKA 1SHGA 3ZL7C 1WXUA 2LZ6B 1YP5A 2A36A 2L3QA 2RQWA 2CDTA 2E5KA 3EHRA 4J9FA 2J6OA 4F17A 3EG2A 1PHTA 1W1FA 4GLMA 2J6FA 1ZBJA 3REBB 2O9VA 1NLPC 1S1NA 3RBBB 3SEMA 1H8KA 2D8JA 2ABLA 2KYBA 2ESWA 1FMKA 3I5SA 3EHQA 1X6BA 2QDLA 1PKSA 2MIOA 2HEQA 1SHFA 1B3QA 2MCNA 2KBTA 5FWBA 1GFCA 2CUBA 2DL8A 3NGPA 1WIEA 2EYZA 1K0SA 2VWFA 4GBQA 3M0RA 2BZYA 3TVTA 1VYUA 1K4US 1QWFA 2FRYA 3RNJA 2F2WA 1GBQA 4JJCA 1WI7A 2DNUA 2PNIA 3H0FA 4J9BA 4HVUA 4CC4B 5HCKA 4CC7A 2J6KA 2PZ1A 2K6DA 4ESRA 1PNJA 1EFNA 2EVRA 2JXBA 1NG2A 1AZEA 2YDLA 4RTTA 1AWWA 2EW3A 1FYNA 1SRLA 4A63B 2CH4W 1QWEA 1V1CA 1Z9ZA 2A37A 2GTJA 2DX1A 2YT6A 4AFQC 1JXMA 1ABQA 1M30A 1WXTA 1UHCA 3FJ5A 1ZX6A 3REAB 4RTWA 4RTZA 2CSQA 3M0PA 2O9SA 4RTYA 1NEGA 1MV3A 2KEAA 2DL3A 2LP5A 3M0QA 1ZUYA 2LJ1A 2EYYA 3GBQA 2DLPA 2A28A 4J9EA 4D8KA 1MUZA 1G83A 1NM7A 1SPKA 2FPFA 2ROTA 2KROA 2DJQA 1K9AA 1VYTA 1A0NB 4JZ3A 5FWCA 1XOVA 1PWTA 2DILA 2DMOA 3TSZA 1WA7A 2HBWA 2BTTA 1WFWA 1M27C 4OMMA 1TG0A 2CSIA 5I11A 2EKHA 4DEXA 2CUDA 2J06A 3R6NA 5IXBA 4K11A 4IIMA 1PRLC 2YUOA 1U5SA 1UG1A 4OMQA 1QKXA 3VS5A 2RMOA 2OAWA 2GGRA 1E6GA 2BZ8A 2JMCA 1WYXA 3VS3A 1SRMA 4F16A 1JQQA 4F14A 3M0TA 2KR3A 2L0AA 1GL5A 2I0NA 1QKWA 1X43A 2D1XA 4R0KA 2JMAA 3EG0A 2EBPA 1AD5A 2FEIA 1I0CA 5IXFA 1ZUKA 3IQLA 2M0YA 2O31A 2DL5A 3PVLA 1IO6A 3VS6A 1GBRA 1X2QA 2RNAA 3PVQA 1LCKA 2OJ2A 2RQTA 2D0NA 4KRTA 2EYXA 2GNCA 2HSPA 4RTVA 4DEYA 1X69A 4EIKA 2X3XD 1WX6A 2D8HA 3C0CA 4JPBW 1AWOA 3KFVA 2K7AA 1N5ZA 3TSWA 1RI9A 4CC2A 2FG0A 4QT7A 1I1JA 2FPEA 3I5RA 1UTIA 1M3BA 3VS1A 4X1VA 4J9IA 4JJDA 3VS2A 3LH5A 2RN8A 4HVVA 2YUQA 4M4ZA 2K9GA 3O5ZA 4AFSC 4E6RA 1B07A 2KRNA 5IHKA 2LJ0A 2IIMA 1NYGA 3H41A 3M0SA 4ZNXA 2DBKA 2DYBA 1H3HA 2RQVA 1JO8A 3I9QA 1NEBA 2YSQA 2W0ZA 2F2VA 3QWXX 2V1RA 1ARKA 4HVWA 4D8DA 1W6XA 2JM9A 2ECZA 1UHFA 4FSSA 1RLQC 1GCPA 1M3CA 2RQUA 2LX7A 1KFZA 1I07A 3NMZC 2O88A 5I22A 1OOTA 2RQRA 2O2OA 4OMLA 2CH4A 1Y0MA 1AEYA 4Z88A 5IH2A 1QCFA 2KNBB 2EGCA 1GRIA 1U06A 1E6HA 4HXJA 1W70A 1G2BA 2K3BA 2M51A 4RTUA 1JXOA 3THKA 4ORZA 4WCIA 1YWOA 1K0XA 3UF4A 1X6GA 3U23A 3EGUA 4RUGA 2FRWA 2RPNA 2CREA 4LE9A 2XMFA 4LUDA 3VS7A 5GJWB 1E7OA 2DBMA 2YUPA 3EG1A 1ZUUA 3VRZA 2ROLA 1OPLA 1PKTA 1ABOA 4OMNA 2JTEA 1YCSB 2SEMA 1YN8A 1YWPA 2LCSA 1OEBA 1HD3A 5FW9A 1SSHA 2FO0A 1T0JA 1NYFA 1K1ZA 1BBZA 2KRSA 2J05A 1BU1A 2CT3A 2B86A 4Z8AA 5IHNA 2EGEA 2LNHB 4AFZC 2ED0A 4JZ4A 1JEGA 1M8MA 4OMOA 4LNPA 1WLPB 1KJWA 1UUEA 2LMJA 1X2KA 3EG3A 5EC7A 3UA6A 1ZSGA 1UECA 2SRCA 3UATA 5IHIA 2DL7A 1GCQA 2GQIA 4OMPA 4JJBA 1CKBA 1J3TA 1AWJA 2L3PA 2NWMA 2DRKA 4AG1C 1WDXA 2EYWA 1UFFA 3I35A 2AKLA 2GTOA 2L2PA 2KGTA 3NHNA 2HDAA 2PTKA 2ED1A 1AVZC 1RUWA 2W10A 1NLOC 2DF6A 3SHWA 1MV0B 2V1QA 1SEMA 5ECAA 2NUZA 2G6FX 2AZVA 5L23A 1TUDA 1KIKA 1T3LA 4RTXA 1QLYA 4J9GA 2K2MA 2JT4A
chains in the Genus database with same CATH superfamily
2QEXQ 1YNZA 2GF7A 3V7RA 3JB9H 2VKNA 1H92A 1Q95G 2DM1A 2X4YA 3C4SA 4DBHA 1M2VA 2B8AA 3CC4A 4XTVA 3QIIA 2ENMA 2OTJT 1Y71A 2JM8A 4M7DF 5GJVB 5I2SA 4AFUC 3H9NA 3OYYA 4RMOA 4CC3A 2OTJQ 3NTHA 2CP2A 3JB9F 1BK2A 1ZA2B 4GY5A 4E7JA 4C92E 2KYMA 1KD1U 3PIPA 2LJ3A 3CCRA 2KRMA 2X3WD 2D6FA 2KXCA 3VRYA 1M1GA 5GAN6 2CT4A 3L2QA 5A2QE 2MMPA 4M77E 3VS4A 2GBQA 1M9SA 1W2BS 1WHHA 1WHKA 4L6V5 3PE0A 1DJ7B 1KC8R 2C06A 2QQBA 3JCMh 1VYVA 3H0HA 2RD1A 2ZPFB 1HJDA 3X28B 3MP1A 3OW2S 4M7DG 1HSQA 2BZXA 2P0PA 2RHXA 2CS7A 2LDMA 2YRDA 2HCKA 2K3XA 2YLCA 1SHGA 3JB9G 2L3QA 2RQWA 4C92A 2CDTA 5C0MA 4F17A 1PHTA 1KQSS 1K73C 4HT9A 1ZBJA 4KGZB 5D6WA 3SEMA 2DFUA 3V7CA 2D8JA 4OVAA 4B9XA 3CMEA 3PGGA 4M77A 2LC4A 3CPWP 4ZTJA 2NLUA 3CCVA 1AHJB 1QVGA 4QVDA 1KC8U 5FWBA 1UEBA 2HNIA 2DL8A 1WIEA 3OYLA 1K0SA 2QYZA 1VQNT 4PNOA 1G5VA 4OGEA 4HT8A 1VYUA 3CXCA 2EWNA 4R56A 1OU9A 3RNJA 1VQNQ 2EKOA 1WI7A 3H0FA 3PTAA 4J9BA 4HVUA 5HCKA 4C8QB 4J83A 2K6DA 4IURA 1VQPA 4ESRA 2JXBA 4FCYA 2FZKB 4RTTA 1SRLA 4A63B 1MMDA 2L8DA 3TEEA 2VUBA 2LQKA 2M0OA 3SD4A 2R5AA 4PLIA 4AFQC 2CP7A 4HA8A 1JXMA 1VQ4A 3URGA 4BE1A 1UHCA 2KDSA 3FJ5A 3HP9A 3REAB 4RTWA 4NL3A 1ZSZC 3A5ZB 1YJNA 2JJ9A 2DIGA 1IHVA 2QXFA 4PLLA 4X34A 4N4HA 4RTYA 1NEGA 2DL3A 3BE3A 4KBMB 5FU7C 1VQ7T 2LJ1A 1NBEB 2EYYA 2VYTA 3A8LB 5GAOn 2XKOC 2A28A 4J9EA 6AT1B 2PVDB 2FPFA 1SPKA 3P8BB 1VUBA 2KROA 5GAMj 1VQ7Q 1RAFB 2F1LA 1A0NB 1OZ2A 1XOVA 2PUKB 1PWTA 2DILA 3TSZA 1WA7A 4BI8B 3VUZA 4E7LA 1SKUB 1TUGB 2CUDA 2J06A 3QYHB 1YI2T 4K11A 3QBYA 4OMQA 3EFOB 4F7UF 1KQ2A 2OAWA 1YI2Q 4NL2A 2BZ8A 2NYSA 2JMCA 1WGSA 2YHTA 4OB3B 4A54A 2DK3A 3M0TA 2KR3A 2G3RA 2VASA 1QKWA 1X43A 1AT1B 3SWNA 2E3IA 2BIVA 1TOVA 2DIQA 5GAMe 3G4SA 1PG5B 1I0CA 4KGVB 3HTRA 2DL5A 3MEUA 1X2QA 5CIUA 3PVQA 3ASKA 2X4JA 3LWIA 4M7DE 5GAOl 3WVDB 2D0NA 1HYOA 1X69A 3CCUT 2D8HA 4A4GA 4JDSA 3S3NA 1Q82R 3KFVA 1AWOA 2K7AA 3UT1A 2FG0A 1M1KR 3I5RA 2FPEA 3CCUQ 2QA4A 1K8AR 1M3BA 2ZGWA 2XHCA 4FW1A 2K57A 2DERA 4JJDA 4EMKA 3E2UA 3V7SA 3WVEB 4HVVA 3O5ZA 4E6RA 1Q86C 2KRNA 4J7IA 5IHKA 5CKFA 2IIMA 4ZNXA 1TWBA 3FEOA 2DYBA 1YCYA 5LJ5f 1VQ9T 4R55A 3G6EA 1H3HA 2RI5A 1R77A 3EGXB 2F2VA 4ZGEB 3QWXX 1M8VA 1IB8A 1YJWA 4HCZA 3NFCA 1D09B 1VQ9Q 2RQUA 3V8KA 1OX8A 3NMZC 2FL7A 5I22A 3MP8A 2O2OA 2CH4A 1Y0MA 3N5BB 3X20B 1D3BB 2OAUA 3I55T 1Q82U 4IUPA 4DBQA 2KNBB 1E6HA 1M1KU 1PSEA 1K8AU 3CCQT 4ZTFA 2M51A 3I55Q 1JXOA 3CPWA 5LJ5e 5GMKj 2DEQA 4X9CA 3EGUA 4M7AD 3CCQQ 3TQ7P 1OYXA 2FRWA 3H6ZA 5GMKh 4C0DC 2RK2A 1H641 2BUDA 3OB9A 1KHIA 5GJWB 1C6VX 2ATCB 2YUPA 4BACA 3EAEA 3RKXA 3J81E 1PKTA 1VQOA 1ABOA 1YCSB 2SEMA 1YN8A 2EJGA 1O75A 4E47A 2A0FB 2J05A 2E5QA 2YRVA 1BU1A 5IHNA 2EJ9A 2QASA 4JZ4A 4PJNA 1VQLT 1LVKA 1OU8A 3PFSA 2A7YA 4LNPA 1KJWA 5KYNA 3CCVT 4M75D 2BE7D 2XI9A 2ZCFB 4A4HA 3EG3A 2VB6A 3UATA 2XICA 3HFOA 2DL7A 4EMHA 1VQLQ 4PKCC 3CC7T 2DTOA 4OMPA 2NWMA 2DRKA 4BB7A 7AT1B 2FVUA 4FYWB 4MMKA 4MZMA 2L2PA 3CC7Q 2IPOB 1QQJA 2ED1A 1AVZC 3QJ6A 5KYXB 2LX9A 3SHWA 1QVPA 3DB3A 4JRQA 1SEMA 4Q5WA 4XTUA 4KULA 2K3YA 5CAIA 2NUZA 2AZVA 3HHTB 3VYGA 2DTIA 4JLIA 1C0MA 3EGDA 3M4GA 5J39A 8ATCB 1VQ6A 1YITA 2GQVA 4DOWA 1UJYA 1QVFP 3C95A 2AT1B 3VS0A 4FYVB 3BW1A 4M7DB 3MPUB 1G3WA 1WXBA 2AK5A 4E2FB 1MMGA 1KD1C 3CQTA 4ELZC 3FRNA 5KCOA 4J9DA 1IRXA 4AT1B 5CR2A 3MEVA 4Z89A 1T0HA 2QDYB 3DLLA 2DVJA 1JJ2P 4F7UE 1GFDA 4MZPA 3QKJA 4PJLA 3G71T 3TCJA 2C0TA 2MF2A 4KGXB 1WHJA 2DD5A 2MOXA 1VQMA 2LT1A 2P0KA 1R0BG 2VVKA 5LL6S 3G71Q 3DB4A 2JZ2A 2WACA 1EX4A 2JN0A 1BB9A 2O4XA 5FU6C 5KE2A 4IIOA 2DVEA 2MYSA 2M16A 2KXDA 2RO0A 1QMCA 1CKAA 3SB2A 4J9CA 2OI3A 2A08A 4XAXB 2JNGA 3PIOA 1NZ9A 4ATOA 1TU0B 1OULA 3M4YA 5GANf 4JRKA 1BCOA 2J7IA 4J9HA 1RI0A 3JB9J 5LJ3f 2HZYA 3L2UA 2ZAEA 2DYIA 2K2VA 1LJOA 4M78F 2HQEA 2WSFE 3G4ST 2JS0A 2EPDA 2KE9A 2HL3A 4F7UA 3CEYA 5KYWB 3ZL7C 1YHQA 1KC8C 2CYZB 2DD4A 2JTMA 2DO3A 1YIJA 1VQ8T 4XTWA 4GLMA 2VXEA 3CCJA 2O9VA 1NJIR 4C5EA 2CP6A 1ZSZA 4XU2A 2DETA 2ABLA 2Y90A 3EGDB 1VQ8Q 1FMKA 5CO7A 4PJOB 2DTHA 1LPLA 2E3HA 1X6BA 1UGPB 2QA4T 2HEQA 2E10A 2MCNA 2KBTA 1VQ5A 1GFCA 1O9SA 4C5GA 3OYAA 4FYYB 1IHWA 3TVTA 1K4US 1RAGB 4HCBA 1BCMA 1UB4A 2E41A 4RCCA 2L89A 3BDUA 5I2MA 5HK0A 5KE3A 2MWPA 2DNUA 1S72T 4RCBA 4E7IA 3PMIA 4C8QD 4M78G 4CC4B 2PZ1A 1XQHA 1FMVA 3UDCA 1S72Q 1B34B 2QQRA 5D7UA 1AWWA 1FYNA 1I5OB 3JCMP 1QWEA 1NJIU 2GFUA 1V1CA 1Z9ZA 2A37A 3MEWA 4M7AC 2GTJA 3BFMA 1W2BP 2JTFA 2EYQA 2BE9B 2RJEA 4FU6A 1M30A 1WXTA 1Y96B 1H3ZA 2RH2A 4NS5A 2CSQA 1D1AA 1YFNA 3M0PA 2CGHA 2JOYA 2E64A 3OW2P 2LP5A 3GBQA 4J7FA 2XDBA 2ROTA 1IREB 1K9AA 2LQ8A 4M75C 1KQSP 2HBWA 5GAOp 5GAOm 3CD6T 4J6WA 2P0QA 1ZHIA 2X9HA 3E9FA 2KMTA 2XD0A 1BI1A 5IXBA 3DKMA 3CD6Q 2YUOA 3CCMA 1BKBA 3JCMf 2Y4XA 3L2RA 2YWWA 4FT4A 1E6GA 1QVFA 4V2SA 4M7AF 3VS3A 4F16A 2RI2A 2L0AA 2EFIA 2RHYA 4BDZA 5D6YA 4R0KA 2JMAA 2EBPA 5KYUA 3L2VA 4Z02A 4DA4A 2BKDN 2MWOA 4F04B 2YRCA 5FLXE 3KUFA 3PVLA 1JJ2A 3VS6A 3JCMe 2MAMA 2RNAA 3RERA 1LCKA 1YJ9A 2RQTA 1BYMA 1M2VB 1X6OA 1YITT 2GNCA 4B6MA 4DEYA 1WJQA 4J5YA 4FW2A 4EIKA 4EPCA 3JAME 2X3XD 4C0GA 1BIBA 4JPBW 1N5ZA 1NE8A 3R6OA 2E70A 4QT7A 2F5TX 4LDVA 1UTIA 3JCMX 4RKUE 3GNGA 4X1VA 4M7AG 4J9IA 4OB2B 1VQKT 5AT1B 5GMKi 3VS2A 3O8VA 9ATCB 3I56T 3J80E 1B07A 1Q82C 1IZ6A 2LJ0A 3H41A 1VQKQ 5IN1A 1NPRA 3TREA 3F70A 3QXEB 2DBKA 1M1KC 1K8AC 4QQDA 3I56Q 1VQMT 1JO8A 4P5NA 1NEBA 1ARKA 2V1RA 4HVWA 4FL6A 3T9NA 1W6XA 3M57A 4D8DA 2M1HA 3VJPA 1GCPA 1PC0A 3MP6A 4DOVA 4ZGDB 3X24B 4M78E 2LVMA 2K5LA 4KT0E 5IH2A 2KK4A 3C12A 4EMGA 4ZGJB 3P8HA 3OS5A 2CZ6B 2K3BA 5HY6A 3E9GA 1WJSA 1XTDA 1YWOA 2DXTA 2COZA 3CCLT 1X6GA 1G8XA 2LTOA 5GAMf 3GPLA 2RPNA 4C92B 1N8RR 3CCLQ 1Y7XA 4LUDA 4RG8A 3VS7A 5GAOq 1E7OA 4QQGA 4OF1A 1YHQT 4OMNA 3CCET 3CC2T 5FW9A 2DJZA 2FO0A 2I2LA 2KI7A 4M77B 4O6JA 1LNXA 3QJYA 2FZCB 2JVVA 3CCEQ 4Z8AA 2B86A 3CC2Q 3GNFB 2EGEA 1PM3A 3A8GB 4M78A 2R57A 1W2BA 4C8QC 1UUEA 1X2KA 1ZSGA 5J26A 3OYMA 2GQIA 3D7SB 1AWJA 2L3PA 3CMAT 1EIFA 2L3RA 4PFPA 1WDXA 3M5AA 1N8RU 2HKQB 3OW2A 1UFFA 3OA6A 2AKLA 2GTOA 2KGTA 3CMAQ 2P4TA 2DXCA 2W10A 4LXCA 2KVQG 3X25B 4UC4A 4F7UG 3CC4T 2E1HA 3PMTA 3CCSA 1VIFA 1BIAA 2LRQA 2OTLA 1KQSA 2CZ7B 1M90C 4RTXA 1QLYA 3CC4Q 2RJCA 2K2MA 5FRNA 2CKKA 1UJ0A 1I4K1 4AG2C 1MNDA 2C0IA 4M7DD 4PFZA 5CCAA 1RLPC 3RMQA 2HAXA 3JV3A 3L42A 2L3SA 3M53A 4Y92A 2QEXA 2K5FA 3VYHB 3CCRT 4C8QF 2P4RA 2K5IA 2FYKA 1K76A 4TVRA 4A4KA 4ZN3A 1M1FA 2E6NA 1GCQC 2CP3A 3RR6A 4JLGA 4WTOB 3CCRQ 4HKEA 1M3AA 1UGVA 5CVIA 1ZA1B 4Y28E 5DM7R 2DKGA 4M7AE 3HRTA 3PT9A 2NUTA 4BE0A 2DL4A 4QVCA 2F5KA 3UA7A 1U1TA 2OTJA 2XG8D 1G3TA 1IGQA 3MCAB 3KBGA 1FWZA 1X75C 3A98A 1OPKA 3SWNB 3GF5A 2RJDA 5A0LA 2LQWA 1JU5C 2F2XA 2DE0X 5HK3A 3M0UA 1UDLA 1AZGB 2EQJA 2RJFA 3QHSA 3EG9A 4M75E 1X27A 2DA9A 3NTIA 2DXBA 3QWYA 1RABB 3FIFA 1KSWA 4C8QG 2KT8A 5KYYA 4II1A 1OI1A 3CMET 2KAFA 2C0OA 4J6XA 5L8RE 2LZ6B 4E7HA 1YP5A 3MKDA 2QAZA 1FMWA 4LDWA 4M7AA 3CMEQ 1B7TA 3VU3C 4FYXB 1RACB 2E5KA 5GMKe 1QCOA 3EG2A 1W1FA 1OZ3A 3CCVQ 3REBB 1NLPC 1S1NA 1ZBXA 4A4FA 1H8KA 1JBMA 2KSSA 3QG1A 5LJ5d 4PJOD 4EMKB 4CI0C 1FX7A 3I5SA 4JJNK 2QDLA 1PKSA 2VV5A 2MIOA 1VQPT 1SHFA 5DLQE 4BUGA 3JCMJ 1PD1A 1NJIC 2E4HA 3NGPA 2VWFA 3EH2A 3J7AF 1N27A 1VQPQ 2RM4A 5A0DA 2XDPA 2FRYA 4M75A 1GXIE 1LOJA 2QTVA 1VQ4T 1GBQA 4JJCA 1WQWA 3FLGA 2PNIA 2PVGB 4CC7A 2J6KA 3FJPA 2NUPA 1YJNT 1EFNA 5DY9A 1VQ4Q 1NG2A 1AZEA 2YDLA 1VQNA 2CH4W 1Q7YR 3OYKA 2DX1A 4KH1B 2YT6A 1ABQA 2PU9B 5GAN8 2X4XA 2HD0A 1OX9A 1N9SA 3VV0A 4GLKA 1MV3A 1C1AA 4MDXA 1ZUYA 2LCCA 1MUZA 1G83A 4OGCA 2DJQA 3LGFA 4JZ3A 3LGLA 3OY9A 1RAIB 3QPHA 2ZPEB 5D6XA 3CBOA 1WFWA 1M27C 4OMMA 3ME9A 1Q7YU 1VQ7A 4IIMA 4N0AC 3EFSA 1PRLC 3AHUA 1U5SA 1UG1A 5GANj 4FSXA 2FZGB 2MPXC 2GGRA 3E19A 1G3YA 5GANh 1WYXA 1SRMA 3M59A 4F14A 1QVGS 5LJ3h 3G4SQ 3HL8A 4DQ2A 2ZPGB 4ZN1A 2D1XA 4C0ZA 1I8FA 3OSVA 1YI2A 4MZTA 5CKDA 3CXCS 2M02A 2LT4A 5FRMA 3V8LA 3G1JA 5CKHA 4ANJA 4M7DC 1SSFA 5GAN7 3LYIA 3OYGA 4C8QE 4XU0A 2QA4Q 2EYXA 2HSPA 4RTVA 3WXMB 4XK8E 2RHZA 1WX6A 3C0CA 2COWA 1WHMA 3G6ET 4PK4A 4CC2A 4FIBA 3LX7A 2D9TA 1I1JA 2HKNA 4A53A 5LJ5g 2QEXT 2QQSA 1YJWT 1UGQB 2WSEE 4BI4A 3G6EQ 3ZBDA 2RN8A 1V29B 2YUQA 2K9GA 4AFSC 4XU1A 3CCUA 1YJWQ 2EAYA 3M0SA 2X51A 5GAOr 4BE2A 2O4XB 4KH0B 2RQVA 3M55A 2Y4YA 2YSQA 2YXYA 3G7ZA 1M5Q1 1TTHB 5GANd 4IKFA 3VKIA 2JM9A 2ECZA 3MJXA 3RKYA 3OMCA 1PD0A 2LX7A 1KFZA 2EIFA 5LJ3d 2O88A 3LW5E 4OMLA 4C8QA 1AEYA 2QTXA 1N6AA 4D6WA 1U06A 1VQ9A 1VQOT 1V76A 1G2BA 4X9DA 4BDYA 4RTUA 3THKA 4ORZA 3P8DA 4WCIA 1K0XA 3UF4A 4F7UB 2XIDA 1VQOQ 4Y91A 1MHNA 5C6SA 4RUGA 4C92D 5GAN2 2CREA 3I55A 2Z0WA 4PJOC 3OS2A 3E1SA 2RHIA 4OP0A 3EG1A 3VRZA 2ROLA 3OYJA 4E7KA 1ZSZB 2JTEA 3RDVA 3CCQA 4XTXA 3MHXA 1OEBA 5GAN4 5GAN5 4M77D 1NYFA 1BBZA 2KRSA 5FU7B 3HSBA 3QDRB 1N8RC 4BY6B 3HFNA 2LNHB 1JRIA 1JEGA 5CKEA 1HXDA 1MNEA 1WLPB 1ACMB 5EC7A 2DPPB 1UECA 2SRCA 1GCQA 4PFOA 2O01E 3EFOA 1CKBA 1K9MR 1J3TA 4XTYA 3UPUA 3OYCA 2YLBA 2D0QB 4XU3A 4OMFB 4BI3A 1VQ6T 3CPFA 4M75F 3I35A 5CKBA 1Q81R 2EQUA 2FHDA 3NHNA 1VQLA 1F1BB 4HCCA 2QG9B 1RUWA 1BI3A 1NLOC 1VQ6Q 1WHLA 3SFMA 1YITQ 1MV0B 1D0ZA 5HKCA 4PJOF 5GMKm 1TUDA 3CC7A 5IT9E 2CP5A 1KIKA 5CQYA 4IUQA 1TSFA 5CK9A 2JT4A 2EQIA 1JB0E 1CSKA 3L2ZA 8AT1B 3X26B 5GAN3 2JUFA 2K4YA 1KG1A 4XQ3A 1MMAA 1QW1A 4FT2A 4LUEA 2EGAA 3ER0A 3CPWS 1Z9QA 1K9MU 3QYGB 2V26A 1VQMQ 2YUNA 4HCKA 2AKKA 3JCMd 4LN2A 1I81A 1Q81U 2DRMA 4PL6A 1D0YA 4C0FA 4M75G 1RAAB 3QSUA 3ULRB 1OV3A 1BI2A 2JW4A 2RB6A 2LQNA 4JUVA 3JCMc 2RA2A 2QQ9A 2AZSA 1VIEA 1WZOA 3LLRA 1TUCA 1RADB 3NPFA 4BY6C 4PJOG 5GANg 2IG0A 2KT1A 1VA7A 1I5LA 2H8HA 3EGXA 2X4WA 3G71A 2JS2A 5LJ3g 3RESA 4LDYA 1PRMC 2DAQA 3KXTA 1UE9A 5GAMh 1T3SA 4M78D 5KYUB 1W4SA 1UGRB 4JRPA 1D3BA 3DLMA 1ZLMA 1YIJT 1AOJA 2KQWA 5AYFA 1U3OA 3GOXA 3CCJT 1YHQQ 2QK0A 2FPDA 3H0IA 1K73R 1Y57A 3RKWA 3C94A 1YIJQ 3A8HB 1PSFA 3INZA 3CCJQ 2RF0A 4DBFA 1WQ7A 2K79A 1AWXA 5J3BA 2VC8A 2ZPHB 1IGUA 1WXUA 3L1AA 3S3MA 1KK7A 4BD3A 2A36A 3Q1JA 3FDRA 3SDZA 4E7SA 1VQ5T 3EHRA 4J9FA 2J6OA 2CZ0B 2J6FA 2H3JA 1D1CA 1U1SA 4LD6A 4XTZA 3RBBB 1VQ5Q 4C0DB 4OB0B 2DXUA 1RAEB 2KYBA 2ESWA 1PCXA 3EHQA 4LDXA 4LDUA 1RAHB 2M9UA 4IUTA 4ELYC 1M4ZA 1X01A 1B3QA 2VGNA 2VGMA 2CUBA 2DZCA 5FROA 1VQ8A 2EYZA 4GBQA 3M0RA 2BZYA 1YBYA 1K73U 1QWFA 1RL2A 2R58A 2EQKA 1WPYA 2F2WA 4DBRA 2V8JA 3V8JA 1KQ1A 1QP3A 2XK0A 2AIRB 1PNJA 2EVRA 5EG2A 4N0AA 3GIBA 3BY7A 2PUOB 1G3SA 5GAMd 3JB9D 4ME7A 3LH0A 5LJ5j 2EW3A 1NPPA 1QP2A 1M2OA 3OYIA 5KYXA 3S3OA 5LJ5h 4C92C 2RI3A 1WHGA 2E6ZA 4L5GA 1S72A 2VXFA 2HQXA 3OS0A 2QGGA 3HKSA 1ZX6A 4QVZA 4QW2A 3RMSA 4O5VA 4RTZA 1Q7YC 3HPWA 2O9SA 4M77C 3M0QA 2KEAA 4JS5A 2DLPA 4M7DA 2PQWA 2FB7A 5GMKl 3CCMT 3HRUA 1BI0A 4D8KA 4IUUA 2XU8A 1R0CB 3RUXA 1NM7A 2HBPA 3JCMg 1SF9A 1VYTA 4MMLA 5FWCA 1OQKA 3CCMQ 2DMOA 4QKUA 3QDFA 2X35A 4M78B 2BTTA 2EJFA 3OMGA 1D0XA 1TG0A 2CSIA 1Y07A 5I11A 2EKHA 4DEXA 3OYHA 3JCMW 3MO8A 3R6NA 4E7ZA 4KUDK 1QKXA 3TU4K 2F69A 3VS5A 3BDLA 2RMOA 3A8MB 3HRSA 1HK9A 2GFAA 2ZPIB 3A1PA 4C92F 1JQQA 1WJRA 1UGSB 2XDDA 3CD6A 1YJ9T 4PJOE 2E65A 3JSCA 3VUBA 1GL5A 2I0NA 1N9RA 4J8OA 1XJWB 3EFRA 5FU6B 2ZPBB 3EG0A 1U8RA 1YJ9Q 1R8OB 4YTLA 3FB9A 4A4EA 3OSSC 1AD5A 1FXXA 2FEIA 1TS9A 4M77F 5IXFA 1ZUKA 3IQLA 3OYNA 2M0YA 2O31A 2HL5C 3OYEA 5DLOA 1IO6A 1GBRA 1KHCA 3GP8A 2OJ2A 2V8KA 4KRTA 3S6WA 3A8OB 2COYA 3ZFJA 1M90R 5KYWA 2GCXA 5CQXA 3H8ZA 3NTKA 4J6YA 4NOYA 4PJJA 1Q86R 4B9WA 3TSWA 1RI9A 3VS1A 4C92G 4PJOA 2NUTB 3LH5A 3CBMA 4OB1B 3ZEHA 4M4ZA 1YJNQ 3UWNA 2P84A 1NYGA 4AMCA 2KY9A 3QZ5B 3SWNC 4FM4B 3FC3A 3JB9I 4PJMA 3I9QA 4M77G 2W0ZA 4M78C 2H3EB 1IXDA 1UHFA 3OYFA 4FSSA 2LNVA 1VQKA 1RLQC 2IVWA 1M3CA 1I07A 2CP0A 3JRZA 1OOTA 2RQRA 4IUVA 3I56A 1M90U 3QUIA 2OX7A 5GAMg 5KCHA 4Z88A 1Q86U 3JCMb 1QCFA 3EG9B 3OBWA 1B34A 2EGCA 1GRIA 3OS1A 1QVGP 1EZZB 1XNIA 4HXJA 1QVFS 1W70A 3M58A 5KYYB 1TH7A 2PVOB 2QI2A 3RIRA 3OYDA 3CXCP 5A0GA 3M56A 2HSEB 5I21A 4JRIA 3U23A 3GLXA 4N4IA 2WSCE 4M7AB 1Y96A 4RG2A 3LWHA 2RK1A 4LE9A 2XMFA 3EH1A 3OBYA 4EDUA 2ZZDA 2AHJB 4EMKC 2MI6A 4LD9K 3AT1B 1ZQ1A 1WNLA 2DBMA 4QQ6A 4MDWA 1ZUUA 1OPLA 5LJ3j 2MK5A 3JCMQ 1JJ2S 1YWPA 2LCSA 1TXQA 1HD3A 1SSHA 2CZ1B 2QQAA 2DZ9A 2HMAA 1T0JA 3CCLA 1K1ZA 4N4GA 5KH6A 3PNWC 4C5HA 4L59A 2CT3A 3QZ9B 4AFZC 2ED0A 3QO3A 1M8MA 3OQ5A 3M54A 4C5IA 4OMOA 4VUBA 1VOMA 2LMJA 3JCMV 4M75B 2R5MA 3M9QA 3CCEA 2V8IA 3UA6A 3CC2A 5IHIA 3CCST 2DEUA 2OTLT 4JJBA 2QGFB 2LCLA 4AG1C 2NUPB 2HQHA 4CRIA 2EYWA 5GANe 1MMNA 3CCSQ 4JS4A 1D1BA 1P92A 2OTLQ 2A3LA 2HDAA 2PTKA 5LJ3e 5M9OA 3L2WA 2L5QA 4KUIA 2DF6A 1SG5A 2V1QA 5ECAA 1K9MC 2G6FX 1MGQA 3MEAA 2EQMA 4WF2A 5L23A 1KD1R 1T3LA 5IAYA 3OYBA 3CMAA 2E12A 3META 3CBPA 2RHUA 1Q81C 4J9GA 1QCNA
chains in the Genus database with same CATH topology
2EQIA 1YNZA 1CSKA 1UJ0A 1UJYA 4AG2C 3VS0A 2VKNA 1H92A 2C0IA 1RLPC 2DM1A 1WXBA 2AK5A 3JV3A 2L3SA 3CQTA 4LUEA 2EGAA 4Y92A 2ENMA 1Z9QA 2JM8A 4J9DA 2P4RA 2YUNA 4HCKA 1K76A 5GJVB 2AKKA 4LN2A 4AFUC 4Z89A 1GCQC 2DRMA 4CC3A 1T0HA 2DVJA 1GFDA 1M3AA 1BK2A 1UGVA 2C0TA 3ULRB 1OV3A 2MOXA 2JW4A 2KYMA 2LQNA 2DL4A 2VVKA 3UA7A 2AZSA 1TUCA 3NPFA 2LJ3A 2KRMA 2X3WD 2KXCA 1BB9A 3VRYA 2CT4A 4IIOA 2KT1A 1VA7A 2H8HA 2KXDA 3VS4A 3A98A 1OPKA 2JS2A 2GBQA 1CKAA 1PRMC 4J9CA 2OI3A 2A08A 2LQWA 1JU5C 2F2XA 1UE9A 2DE0X 1T3SA 3PE0A 3M0UA 1ZLMA 1UDLA 1AOJA 1AZGB 1U3OA 2J7IA 4J9HA 1VYVA 3H0HA 1X27A 2FPDA 2DA9A 3H0IA 3QWYA 1HJDA 1Y57A 1KSWA 2KT8A 1HSQA 2BZXA 2JS0A 2EPDA 2KE9A 2RF0A 2K79A 1AWXA 2C0OA 2HCKA 1SHGA 3ZL7C 1WXUA 2LZ6B 1YP5A 2A36A 2L3QA 2RQWA 2CDTA 2E5KA 3EHRA 4J9FA 2J6OA 4F17A 3EG2A 1PHTA 1W1FA 4GLMA 2J6FA 1ZBJA 3REBB 2O9VA 1NLPC 1S1NA 3RBBB 3SEMA 1H8KA 2D8JA 2ABLA 2KYBA 2ESWA 1FMKA 3I5SA 3EHQA 1X6BA 2QDLA 1PKSA 2MIOA 2HEQA 1SHFA 1B3QA 2MCNA 2KBTA 5FWBA 1GFCA 2CUBA 2DL8A 3NGPA 1WIEA 2EYZA 1K0SA 2VWFA 4GBQA 3M0RA 2BZYA 3TVTA 1VYUA 1K4US 1QWFA 2FRYA 3RNJA 2F2WA 1GBQA 4JJCA 1WI7A 2DNUA 2PNIA 3H0FA 4J9BA 4HVUA 4CC4B 5HCKA 4CC7A 2J6KA 2PZ1A 2K6DA 4ESRA 1PNJA 1EFNA 2EVRA 2JXBA 1NG2A 1AZEA 2YDLA 4RTTA 1AWWA 2EW3A 1FYNA 1SRLA 4A63B 2CH4W 1QWEA 1V1CA 1Z9ZA 2A37A 2GTJA 2DX1A 2YT6A 4AFQC 1JXMA 1ABQA 1M30A 1WXTA 1UHCA 3FJ5A 1ZX6A 3REAB 4RTWA 4RTZA 2CSQA 3M0PA 2O9SA 4RTYA 1NEGA 1MV3A 2KEAA 2DL3A 2LP5A 3M0QA 1ZUYA 2LJ1A 2EYYA 3GBQA 2DLPA 2A28A 4J9EA 4D8KA 1MUZA 1G83A 1NM7A 1SPKA 2FPFA 2ROTA 2KROA 2DJQA 1K9AA 1VYTA 1A0NB 4JZ3A 5FWCA 1XOVA 1PWTA 2DILA 2DMOA 3TSZA 1WA7A 2HBWA 2BTTA 1WFWA 1M27C 4OMMA 1TG0A 2CSIA 5I11A 2EKHA 4DEXA 2CUDA 2J06A 3R6NA 5IXBA 4K11A 4IIMA 1PRLC 2YUOA 1U5SA 1UG1A 4OMQA 1QKXA 3VS5A 2RMOA 2OAWA 2GGRA 1E6GA 2BZ8A 2JMCA 1WYXA 3VS3A 1SRMA 4F16A 1JQQA 4F14A 3M0TA 2KR3A 2L0AA 1GL5A 2I0NA 1QKWA 1X43A 2D1XA 4R0KA 2JMAA 3EG0A 2EBPA 1AD5A 2FEIA 1I0CA 5IXFA 1ZUKA 3IQLA 2M0YA 2O31A 2DL5A 3PVLA 1IO6A 3VS6A 1GBRA 1X2QA 2RNAA 3PVQA 1LCKA 2OJ2A 2RQTA 2D0NA 4KRTA 2EYXA 2GNCA 2HSPA 4RTVA 4DEYA 1X69A 4EIKA 2X3XD 1WX6A 2D8HA 3C0CA 4JPBW 1AWOA 3KFVA 2K7AA 1N5ZA 3TSWA 1RI9A 4CC2A 2FG0A 4QT7A 1I1JA 2FPEA 3I5RA 1UTIA 1M3BA 3VS1A 4X1VA 4J9IA 4JJDA 3VS2A 3LH5A 2RN8A 4HVVA 2YUQA 4M4ZA 2K9GA 3O5ZA 4AFSC 4E6RA 1B07A 2KRNA 5IHKA 2LJ0A 2IIMA 1NYGA 3H41A 3M0SA 4ZNXA 2DBKA 2DYBA 1H3HA 2RQVA 1JO8A 3I9QA 1NEBA 2YSQA 2W0ZA 2F2VA 3QWXX 2V1RA 1ARKA 4HVWA 4D8DA 1W6XA 2JM9A 2ECZA 1UHFA 4FSSA 1RLQC 1GCPA 1M3CA 2RQUA 2LX7A 1KFZA 1I07A 3NMZC 2O88A 5I22A 1OOTA 2RQRA 2O2OA 4OMLA 2CH4A 1Y0MA 1AEYA 4Z88A 5IH2A 1QCFA 2KNBB 2EGCA 1GRIA 1U06A 1E6HA 4HXJA 1W70A 1G2BA 2K3BA 2M51A 4RTUA 1JXOA 3THKA 4ORZA 4WCIA 1YWOA 1K0XA 3UF4A 1X6GA 3U23A 3EGUA 4RUGA 2FRWA 2RPNA 2CREA 4LE9A 2XMFA 4LUDA 3VS7A 5GJWB 1E7OA 2DBMA 2YUPA 3EG1A 1ZUUA 3VRZA 2ROLA 1OPLA 1PKTA 1ABOA 4OMNA 2JTEA 1YCSB 2SEMA 1YN8A 1YWPA 2LCSA 1OEBA 1HD3A 5FW9A 1SSHA 2FO0A 1T0JA 1NYFA 1K1ZA 1BBZA 2KRSA 2J05A 1BU1A 2CT3A 2B86A 4Z8AA 5IHNA 2EGEA 2LNHB 4AFZC 2ED0A 4JZ4A 1JEGA 1M8MA 4OMOA 4LNPA 1WLPB 1KJWA 1UUEA 2LMJA 1X2KA 3EG3A 5EC7A 3UA6A 1ZSGA 1UECA 2SRCA 3UATA 5IHIA 2DL7A 1GCQA 2GQIA 4OMPA 4JJBA 1CKBA 1J3TA 1AWJA 2L3PA 2NWMA 2DRKA 4AG1C 1WDXA 2EYWA 1UFFA 3I35A 2AKLA 2GTOA 2L2PA 2KGTA 3NHNA 2HDAA 2PTKA 2ED1A 1AVZC 1RUWA 2W10A 1NLOC 2DF6A 3SHWA 1MV0B 2V1QA 1SEMA 5ECAA 2NUZA 2G6FX 2AZVA 5L23A 1TUDA 1KIKA 1T3LA 4RTXA 1QLYA 4J9GA 2K2MA 2JT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQI A;  1YNZ A;  1CSK A;  1UJ0 A;  1UJY A;  4AG2 C;  3VS0 A;  2VKN A;  1H92 A;  2C0I A;  1RLP C;  2DM1 A;  1WXB A;  2AK5 A;  3JV3 A;  2L3S A;  3CQT A;  4LUE A;  2EGA A;  4Y92 A;  2ENM A;  1Z9Q A;  2JM8 A;  4J9D A;  2P4R A;  2YUN A;  4HCK A;  1K76 A;  5GJV B;  2AKK A;  4LN2 A;  4AFU C;  4Z89 A;  1GCQ C;  2DRM A;  4CC3 A;  1T0H A;  2DVJ A;  1GFD A;  1M3A A;  1BK2 A;  1UGV A;  2C0T A;  3ULR B;  1OV3 A;  2MOX A;  2JW4 A;  2KYM A;  2LQN A;  2DL4 A;  2VVK A;  3UA7 A;  2AZS A;  1TUC A;  3NPF A;  2LJ3 A;  2KRM A;  2X3W D;  2KXC A;  1BB9 A;  3VRY A;  2CT4 A;  4IIO A;  2KT1 A;  1VA7 A;  2H8H A;  2KXD A;  3VS4 A;  3A98 A;  1OPK A;  2JS2 A;  2GBQ A;  1CKA A;  1PRM C;  4J9C A;  2OI3 A;  2A08 A;  2LQW A;  1JU5 C;  2F2X A;  1UE9 A;  2DE0 X;  1T3S A;  3PE0 A;  3M0U A;  1ZLM A;  1UDL A;  1AOJ A;  1AZG B;  1U3O A;  2J7I A;  4J9H A;  1VYV A;  3H0H A;  1X27 A;  2FPD A;  2DA9 A;  3H0I A;  3QWY A;  1HJD A;  1Y57 A;  1KSW A;  2KT8 A;  1HSQ A;  2BZX A;  2JS0 A;  2EPD A;  2KE9 A;  2RF0 A;  2K79 A;  1AWX A;  2C0O A;  2HCK A;  1SHG A;  3ZL7 C;  1WXU A;  2LZ6 B;  1YP5 A;  2A36 A;  2L3Q A;  2RQW A;  2CDT A;  2E5K A;  3EHR A;  4J9F A;  2J6O A;  4F17 A;  3EG2 A;  1PHT A;  1W1F A;  4GLM A;  2J6F A;  1ZBJ A;  3REB B;  2O9V A;  1NLP C;  1S1N A;  3RBB B;  3SEM A;  1H8K A;  2D8J A;  2ABL A;  2KYB A;  2ESW A;  1FMK A;  3I5S A;  3EHQ A;  1X6B A;  2QDL A;  1PKS A;  2MIO A;  2HEQ A;  1SHF A;  1B3Q A;  2MCN A;  2KBT A;  5FWB A;  1GFC A;  2CUB A;  2DL8 A;  3NGP A;  1WIE A;  2EYZ A;  1K0S A;  2VWF A;  4GBQ A;  3M0R A;  2BZY A;  3TVT A;  1VYU A;  1K4U S;  1QWF A;  2FRY A;  3RNJ A;  2F2W A;  1GBQ A;  4JJC A;  1WI7 A;  2DNU A;  2PNI A;  3H0F A;  4J9B A;  4HVU A;  4CC4 B;  5HCK A;  4CC7 A;  2J6K A;  2PZ1 A;  2K6D A;  4ESR A;  1PNJ A;  1EFN A;  2EVR A;  2JXB A;  1NG2 A;  1AZE A;  2YDL A;  4RTT A;  1AWW A;  2EW3 A;  1FYN A;  1SRL A;  4A63 B;  2CH4 W;  1QWE A;  1V1C A;  1Z9Z A;  2A37 A;  2GTJ A;  2DX1 A;  2YT6 A;  4AFQ C;  1JXM A;  1ABQ A;  1M30 A;  1WXT A;  1UHC A;  3FJ5 A;  1ZX6 A;  3REA B;  4RTW A;  4RTZ A;  2CSQ A;  3M0P A;  2O9S A;  4RTY A;  1NEG A;  1MV3 A;  2KEA A;  2DL3 A;  2LP5 A;  3M0Q A;  1ZUY A;  2LJ1 A;  2EYY A;  3GBQ A;  2DLP A;  2A28 A;  4J9E A;  4D8K A;  1MUZ A;  1G83 A;  1NM7 A;  1SPK A;  2FPF A;  2ROT A;  2KRO A;  2DJQ A;  1K9A A;  1VYT A;  1A0N B;  4JZ3 A;  5FWC A;  1XOV A;  1PWT A;  2DIL A;  2DMO A;  3TSZ A;  1WA7 A;  2HBW A;  2BTT A;  1WFW A;  1M27 C;  4OMM A;  1TG0 A;  2CSI A;  5I11 A;  2EKH A;  4DEX A;  2CUD A;  2J06 A;  3R6N A;  5IXB A;  4K11 A;  4IIM A;  1PRL C;  2YUO A;  1U5S A;  1UG1 A;  4OMQ A;  1QKX A;  3VS5 A;  2RMO A;  2OAW A;  2GGR A;  1E6G A;  2BZ8 A;  2JMC A;  1WYX A;  3VS3 A;  1SRM A;  4F16 A;  1JQQ A;  4F14 A;  3M0T A;  2KR3 A;  2L0A A;  1GL5 A;  2I0N A;  1QKW A;  1X43 A;  2D1X A;  4R0K A;  2JMA A;  3EG0 A;  2EBP A;  1AD5 A;  2FEI A;  1I0C A;  5IXF A;  1ZUK A;  3IQL A;  2M0Y A;  2O31 A;  2DL5 A;  3PVL A;  1IO6 A;  3VS6 A;  1GBR A;  1X2Q A;  2RNA A;  3PVQ A;  1LCK A;  2OJ2 A;  2RQT A;  2D0N A;  4KRT A;  2EYX A;  2GNC A;  2HSP A;  4RTV A;  4DEY A;  1X69 A;  4EIK A;  2X3X D;  1WX6 A;  2D8H A;  3C0C A;  4JPB W;  1AWO A;  3KFV A;  2K7A A;  1N5Z A;  3TSW A;  1RI9 A;  4CC2 A;  2FG0 A;  4QT7 A;  1I1J A;  2FPE A;  3I5R A;  1UTI A;  1M3B A;  3VS1 A;  4X1V A;  4J9I A;  4JJD A;  3VS2 A;  3LH5 A;  2RN8 A;  4HVV A;  2YUQ A;  4M4Z A;  2K9G A;  3O5Z A;  4AFS C;  4E6R A;  1B07 A;  2KRN A;  5IHK A;  2LJ0 A;  2IIM A;  1NYG A;  3H41 A;  3M0S A;  4ZNX A;  2DBK A;  2DYB A;  1H3H A;  2RQV A;  1JO8 A;  3I9Q A;  1NEB A;  2YSQ A;  2W0Z A;  2F2V A;  3QWX X;  2V1R A;  1ARK A;  4HVW A;  4D8D A;  1W6X A;  2JM9 A;  2ECZ A;  1UHF A;  4FSS A;  1RLQ C;  1GCP A;  1M3C A;  2RQU A;  2LX7 A;  1KFZ A;  1I07 A;  3NMZ C;  2O88 A;  5I22 A;  1OOT A;  2RQR A;  2O2O A;  4OML A;  2CH4 A;  1Y0M A;  1AEY A;  4Z88 A;  5IH2 A;  1QCF A;  2KNB B;  2EGC A;  1GRI A;  1U06 A;  1E6H A;  4HXJ A;  1W70 A;  1G2B A;  2K3B A;  2M51 A;  4RTU A;  1JXO A;  3THK A;  4ORZ A;  4WCI A;  1YWO A;  1K0X A;  3UF4 A;  1X6G A;  3U23 A;  3EGU A;  4RUG A;  2FRW A;  2RPN A;  2CRE A;  4LE9 A;  2XMF A;  4LUD A;  3VS7 A;  5GJW B;  1E7O A;  2DBM A;  2YUP A;  3EG1 A;  1ZUU A;  3VRZ A;  2ROL A;  1OPL A;  1PKT A;  1ABO A;  4OMN A;  2JTE A;  1YCS B;  2SEM A;  1YN8 A;  1YWP A;  2LCS A;  1OEB A;  1HD3 A;  5FW9 A;  1SSH A;  2FO0 A;  1T0J A;  1NYF A;  1K1Z A;  1BBZ A;  2KRS A;  2J05 A;  1BU1 A;  2CT3 A;  2B86 A;  4Z8A A;  5IHN A;  2EGE A;  2LNH B;  4AFZ C;  2ED0 A;  4JZ4 A;  1JEG A;  1M8M A;  4OMO A;  4LNP A;  1WLP B;  1KJW A;  1UUE A;  2LMJ A;  1X2K A;  3EG3 A;  5EC7 A;  3UA6 A;  1ZSG A;  1UEC A;  2SRC A;  3UAT A;  5IHI A;  2DL7 A;  1GCQ A;  2GQI A;  4OMP A;  4JJB A;  1CKB A;  1J3T A;  1AWJ A;  2L3P A;  2NWM A;  2DRK A;  4AG1 C;  1WDX A;  2EYW A;  1UFF A;  3I35 A;  2AKL A;  2GTO A;  2L2P A;  2KGT A;  3NHN A;  2HDA A;  2PTK A;  2ED1 A;  1AVZ C;  1RUW A;  2W10 A;  1NLO C;  2DF6 A;  3SHW A;  1MV0 B;  2V1Q A;  1SEM A;  5ECA A;  2NUZ A;  2G6F X;  2AZV A;  5L23 A;  1TUD A;  1KIK A;  1T3L A;  4RTX A;  1QLY A;  4J9G A;  2K2M A;  2JT4 A; 
#chains in the Genus database with same CATH topology
 2QEX Q;  1YNZ A;  2GF7 A;  3V7R A;  3JB9 H;  2VKN A;  1H92 A;  1Q95 G;  2DM1 A;  2X4Y A;  3C4S A;  4DBH A;  1M2V A;  2B8A A;  3CC4 A;  4XTV A;  3QII A;  2ENM A;  2OTJ T;  1Y71 A;  2JM8 A;  4M7D F;  5GJV B;  5I2S A;  4AFU C;  3H9N A;  3OYY A;  4RMO A;  4CC3 A;  2OTJ Q;  3NTH A;  2CP2 A;  3JB9 F;  1BK2 A;  1ZA2 B;  4GY5 A;  4E7J A;  4C92 E;  2KYM A;  1KD1 U;  3PIP A;  2LJ3 A;  3CCR A;  2KRM A;  2X3W D;  2D6F A;  2KXC A;  3VRY A;  1M1G A;  5GAN 6;  2CT4 A;  3L2Q A;  5A2Q E;  2MMP A;  4M77 E;  3VS4 A;  2GBQ A;  1M9S A;  1W2B S;  1WHH A;  1WHK A;  4L6V 5;  3PE0 A;  1DJ7 B;  1KC8 R;  2C06 A;  2QQB A;  3JCM h;  1VYV A;  3H0H A;  2RD1 A;  2ZPF B;  1HJD A;  3X28 B;  3MP1 A;  3OW2 S;  4M7D G;  1HSQ A;  2BZX A;  2P0P A;  2RHX A;  2CS7 A;  2LDM A;  2YRD A;  2HCK A;  2K3X A;  2YLC A;  1SHG A;  3JB9 G;  2L3Q A;  2RQW A;  4C92 A;  2CDT A;  5C0M A;  4F17 A;  1PHT A;  1KQS S;  1K73 C;  4HT9 A;  1ZBJ A;  4KGZ B;  5D6W A;  3SEM A;  2DFU A;  3V7C A;  2D8J A;  4OVA A;  4B9X A;  3CME A;  3PGG A;  4M77 A;  2LC4 A;  3CPW P;  4ZTJ A;  2NLU A;  3CCV A;  1AHJ B;  1QVG A;  4QVD A;  1KC8 U;  5FWB A;  1UEB A;  2HNI A;  2DL8 A;  1WIE A;  3OYL A;  1K0S A;  2QYZ A;  1VQN T;  4PNO A;  1G5V A;  4OGE A;  4HT8 A;  1VYU A;  3CXC A;  2EWN A;  4R56 A;  1OU9 A;  3RNJ A;  1VQN Q;  2EKO A;  1WI7 A;  3H0F A;  3PTA A;  4J9B A;  4HVU A;  5HCK A;  4C8Q B;  4J83 A;  2K6D A;  4IUR A;  1VQP A;  4ESR A;  2JXB A;  4FCY A;  2FZK B;  4RTT A;  1SRL A;  4A63 B;  1MMD A;  2L8D A;  3TEE A;  2VUB A;  2LQK A;  2M0O A;  3SD4 A;  2R5A A;  4PLI A;  4AFQ C;  2CP7 A;  4HA8 A;  1JXM A;  1VQ4 A;  3URG A;  4BE1 A;  1UHC A;  2KDS A;  3FJ5 A;  3HP9 A;  3REA B;  4RTW A;  4NL3 A;  1ZSZ C;  3A5Z B;  1YJN A;  2JJ9 A;  2DIG A;  1IHV A;  2QXF A;  4PLL A;  4X34 A;  4N4H A;  4RTY A;  1NEG A;  2DL3 A;  3BE3 A;  4KBM B;  5FU7 C;  1VQ7 T;  2LJ1 A;  1NBE B;  2EYY A;  2VYT A;  3A8L B;  5GAO n;  2XKO C;  2A28 A;  4J9E A;  6AT1 B;  2PVD B;  2FPF A;  1SPK A;  3P8B B;  1VUB A;  2KRO A;  5GAM j;  1VQ7 Q;  1RAF B;  2F1L A;  1A0N B;  1OZ2 A;  1XOV A;  2PUK B;  1PWT A;  2DIL A;  3TSZ A;  1WA7 A;  4BI8 B;  3VUZ A;  4E7L A;  1SKU B;  1TUG B;  2CUD A;  2J06 A;  3QYH B;  1YI2 T;  4K11 A;  3QBY A;  4OMQ A;  3EFO B;  4F7U F;  1KQ2 A;  2OAW A;  1YI2 Q;  4NL2 A;  2BZ8 A;  2NYS A;  2JMC A;  1WGS A;  2YHT A;  4OB3 B;  4A54 A;  2DK3 A;  3M0T A;  2KR3 A;  2G3R A;  2VAS A;  1QKW A;  1X43 A;  1AT1 B;  3SWN A;  2E3I A;  2BIV A;  1TOV A;  2DIQ A;  5GAM e;  3G4S A;  1PG5 B;  1I0C A;  4KGV B;  3HTR A;  2DL5 A;  3MEU A;  1X2Q A;  5CIU A;  3PVQ A;  3ASK A;  2X4J A;  3LWI A;  4M7D E;  5GAO l;  3WVD B;  2D0N A;  1HYO A;  1X69 A;  3CCU T;  2D8H A;  4A4G A;  4JDS A;  3S3N A;  1Q82 R;  3KFV A;  1AWO A;  2K7A A;  3UT1 A;  2FG0 A;  1M1K R;  3I5R A;  2FPE A;  3CCU Q;  2QA4 A;  1K8A R;  1M3B A;  2ZGW A;  2XHC A;  4FW1 A;  2K57 A;  2DER A;  4JJD A;  4EMK A;  3E2U A;  3V7S A;  3WVE B;  4HVV A;  3O5Z A;  4E6R A;  1Q86 C;  2KRN A;  4J7I A;  5IHK A;  5CKF A;  2IIM A;  4ZNX A;  1TWB A;  3FEO A;  2DYB A;  1YCY A;  5LJ5 f;  1VQ9 T;  4R55 A;  3G6E A;  1H3H A;  2RI5 A;  1R77 A;  3EGX B;  2F2V A;  4ZGE B;  3QWX X;  1M8V A;  1IB8 A;  1YJW A;  4HCZ A;  3NFC A;  1D09 B;  1VQ9 Q;  2RQU A;  3V8K A;  1OX8 A;  3NMZ C;  2FL7 A;  5I22 A;  3MP8 A;  2O2O A;  2CH4 A;  1Y0M A;  3N5B B;  3X20 B;  1D3B B;  2OAU A;  3I55 T;  1Q82 U;  4IUP A;  4DBQ A;  2KNB B;  1E6H A;  1M1K U;  1PSE A;  1K8A U;  3CCQ T;  4ZTF A;  2M51 A;  3I55 Q;  1JXO A;  3CPW A;  5LJ5 e;  5GMK j;  2DEQ A;  4X9C A;  3EGU A;  4M7A D;  3CCQ Q;  3TQ7 P;  1OYX A;  2FRW A;  3H6Z A;  5GMK h;  4C0D C;  2RK2 A;  1H64 1;  2BUD A;  3OB9 A;  1KHI A;  5GJW B;  1C6V X;  2ATC B;  2YUP A;  4BAC A;  3EAE A;  3RKX A;  3J81 E;  1PKT A;  1VQO A;  1ABO A;  1YCS B;  2SEM A;  1YN8 A;  2EJG A;  1O75 A;  4E47 A;  2A0F B;  2J05 A;  2E5Q A;  2YRV A;  1BU1 A;  5IHN A;  2EJ9 A;  2QAS A;  4JZ4 A;  4PJN A;  1VQL T;  1LVK A;  1OU8 A;  3PFS A;  2A7Y A;  4LNP A;  1KJW A;  5KYN A;  3CCV T;  4M75 D;  2BE7 D;  2XI9 A;  2ZCF B;  4A4H A;  3EG3 A;  2VB6 A;  3UAT A;  2XIC A;  3HFO A;  2DL7 A;  4EMH A;  1VQL Q;  4PKC C;  3CC7 T;  2DTO A;  4OMP A;  2NWM A;  2DRK A;  4BB7 A;  7AT1 B;  2FVU A;  4FYW B;  4MMK A;  4MZM A;  2L2P A;  3CC7 Q;  2IPO B;  1QQJ A;  2ED1 A;  1AVZ C;  3QJ6 A;  5KYX B;  2LX9 A;  3SHW A;  1QVP A;  3DB3 A;  4JRQ A;  1SEM A;  4Q5W A;  4XTU A;  4KUL A;  2K3Y A;  5CAI A;  2NUZ A;  2AZV A;  3HHT B;  3VYG A;  2DTI A;  4JLI A;  1C0M A;  3EGD A;  3M4G A;  5J39 A;  8ATC B;  1VQ6 A;  1YIT A;  2GQV A;  4DOW A;  1UJY A;  1QVF P;  3C95 A;  2AT1 B;  3VS0 A;  4FYV B;  3BW1 A;  4M7D B;  3MPU B;  1G3W A;  1WXB A;  2AK5 A;  4E2F B;  1MMG A;  1KD1 C;  3CQT A;  4ELZ C;  3FRN A;  5KCO A;  4J9D A;  1IRX A;  4AT1 B;  5CR2 A;  3MEV A;  4Z89 A;  1T0H A;  2QDY B;  3DLL A;  2DVJ A;  1JJ2 P;  4F7U E;  1GFD A;  4MZP A;  3QKJ A;  4PJL A;  3G71 T;  3TCJ A;  2C0T A;  2MF2 A;  4KGX B;  1WHJ A;  2DD5 A;  2MOX A;  1VQM A;  2LT1 A;  2P0K A;  1R0B G;  2VVK A;  5LL6 S;  3G71 Q;  3DB4 A;  2JZ2 A;  2WAC A;  1EX4 A;  2JN0 A;  1BB9 A;  2O4X A;  5FU6 C;  5KE2 A;  4IIO A;  2DVE A;  2MYS A;  2M16 A;  2KXD A;  2RO0 A;  1QMC A;  1CKA A;  3SB2 A;  4J9C A;  2OI3 A;  2A08 A;  4XAX B;  2JNG A;  3PIO A;  1NZ9 A;  4ATO A;  1TU0 B;  1OUL A;  3M4Y A;  5GAN f;  4JRK A;  1BCO A;  2J7I A;  4J9H A;  1RI0 A;  3JB9 J;  5LJ3 f;  2HZY A;  3L2U A;  2ZAE A;  2DYI A;  2K2V A;  1LJO A;  4M78 F;  2HQE A;  2WSF E;  3G4S T;  2JS0 A;  2EPD A;  2KE9 A;  2HL3 A;  4F7U A;  3CEY A;  5KYW B;  3ZL7 C;  1YHQ A;  1KC8 C;  2CYZ B;  2DD4 A;  2JTM A;  2DO3 A;  1YIJ A;  1VQ8 T;  4XTW A;  4GLM A;  2VXE A;  3CCJ A;  2O9V A;  1NJI R;  4C5E A;  2CP6 A;  1ZSZ A;  4XU2 A;  2DET A;  2ABL A;  2Y90 A;  3EGD B;  1VQ8 Q;  1FMK A;  5CO7 A;  4PJO B;  2DTH A;  1LPL A;  2E3H A;  1X6B A;  1UGP B;  2QA4 T;  2HEQ A;  2E10 A;  2MCN A;  2KBT A;  1VQ5 A;  1GFC A;  1O9S A;  4C5G A;  3OYA A;  4FYY B;  1IHW A;  3TVT A;  1K4U S;  1RAG B;  4HCB A;  1BCM A;  1UB4 A;  2E41 A;  4RCC A;  2L89 A;  3BDU A;  5I2M A;  5HK0 A;  5KE3 A;  2MWP A;  2DNU A;  1S72 T;  4RCB A;  4E7I A;  3PMI A;  4C8Q D;  4M78 G;  4CC4 B;  2PZ1 A;  1XQH A;  1FMV A;  3UDC A;  1S72 Q;  1B34 B;  2QQR A;  5D7U A;  1AWW A;  1FYN A;  1I5O B;  3JCM P;  1QWE A;  1NJI U;  2GFU A;  1V1C A;  1Z9Z A;  2A37 A;  3MEW A;  4M7A C;  2GTJ A;  3BFM A;  1W2B P;  2JTF A;  2EYQ A;  2BE9 B;  2RJE A;  4FU6 A;  1M30 A;  1WXT A;  1Y96 B;  1H3Z A;  2RH2 A;  4NS5 A;  2CSQ A;  1D1A A;  1YFN A;  3M0P A;  2CGH A;  2JOY A;  2E64 A;  3OW2 P;  2LP5 A;  3GBQ A;  4J7F A;  2XDB A;  2ROT A;  1IRE B;  1K9A A;  2LQ8 A;  4M75 C;  1KQS P;  2HBW A;  5GAO p;  5GAO m;  3CD6 T;  4J6W A;  2P0Q A;  1ZHI A;  2X9H A;  3E9F A;  2KMT A;  2XD0 A;  1BI1 A;  5IXB A;  3DKM A;  3CD6 Q;  2YUO A;  3CCM A;  1BKB A;  3JCM f;  2Y4X A;  3L2R A;  2YWW A;  4FT4 A;  1E6G A;  1QVF A;  4V2S A;  4M7A F;  3VS3 A;  4F16 A;  2RI2 A;  2L0A A;  2EFI A;  2RHY A;  4BDZ A;  5D6Y A;  4R0K A;  2JMA A;  2EBP A;  5KYU A;  3L2V A;  4Z02 A;  4DA4 A;  2BKD N;  2MWO A;  4F04 B;  2YRC A;  5FLX E;  3KUF A;  3PVL A;  1JJ2 A;  3VS6 A;  3JCM e;  2MAM A;  2RNA A;  3RER A;  1LCK A;  1YJ9 A;  2RQT A;  1BYM A;  1M2V B;  1X6O A;  1YIT T;  2GNC A;  4B6M A;  4DEY A;  1WJQ A;  4J5Y A;  4FW2 A;  4EIK A;  4EPC A;  3JAM E;  2X3X D;  4C0G A;  1BIB A;  4JPB W;  1N5Z A;  1NE8 A;  3R6O A;  2E70 A;  4QT7 A;  2F5T X;  4LDV A;  1UTI A;  3JCM X;  4RKU E;  3GNG A;  4X1V A;  4M7A G;  4J9I A;  4OB2 B;  1VQK T;  5AT1 B;  5GMK i;  3VS2 A;  3O8V A;  9ATC B;  3I56 T;  3J80 E;  1B07 A;  1Q82 C;  1IZ6 A;  2LJ0 A;  3H41 A;  1VQK Q;  5IN1 A;  1NPR A;  3TRE A;  3F70 A;  3QXE B;  2DBK A;  1M1K C;  1K8A C;  4QQD A;  3I56 Q;  1VQM T;  1JO8 A;  4P5N A;  1NEB A;  1ARK A;  2V1R A;  4HVW A;  4FL6 A;  3T9N A;  1W6X A;  3M57 A;  4D8D A;  2M1H A;  3VJP A;  1GCP A;  1PC0 A;  3MP6 A;  4DOV A;  4ZGD B;  3X24 B;  4M78 E;  2LVM A;  2K5L A;  4KT0 E;  5IH2 A;  2KK4 A;  3C12 A;  4EMG A;  4ZGJ B;  3P8H A;  3OS5 A;  2CZ6 B;  2K3B A;  5HY6 A;  3E9G A;  1WJS A;  1XTD A;  1YWO A;  2DXT A;  2COZ A;  3CCL T;  1X6G A;  1G8X A;  2LTO A;  5GAM f;  3GPL A;  2RPN A;  4C92 B;  1N8R R;  3CCL Q;  1Y7X A;  4LUD A;  4RG8 A;  3VS7 A;  5GAO q;  1E7O A;  4QQG A;  4OF1 A;  1YHQ T;  4OMN A;  3CCE T;  3CC2 T;  5FW9 A;  2DJZ A;  2FO0 A;  2I2L A;  2KI7 A;  4M77 B;  4O6J A;  1LNX A;  3QJY A;  2FZC B;  2JVV A;  3CCE Q;  4Z8A A;  2B86 A;  3CC2 Q;  3GNF B;  2EGE A;  1PM3 A;  3A8G B;  4M78 A;  2R57 A;  1W2B A;  4C8Q C;  1UUE A;  1X2K A;  1ZSG A;  5J26 A;  3OYM A;  2GQI A;  3D7S B;  1AWJ A;  2L3P A;  3CMA T;  1EIF A;  2L3R A;  4PFP A;  1WDX A;  3M5A A;  1N8R U;  2HKQ B;  3OW2 A;  1UFF A;  3OA6 A;  2AKL A;  2GTO A;  2KGT A;  3CMA Q;  2P4T A;  2DXC A;  2W10 A;  4LXC A;  2KVQ G;  3X25 B;  4UC4 A;  4F7U G;  3CC4 T;  2E1H A;  3PMT A;  3CCS A;  1VIF A;  1BIA A;  2LRQ A;  2OTL A;  1KQS A;  2CZ7 B;  1M90 C;  4RTX A;  1QLY A;  3CC4 Q;  2RJC A;  2K2M A;  5FRN A;  2CKK A;  1UJ0 A;  1I4K 1;  4AG2 C;  1MND A;  2C0I A;  4M7D D;  4PFZ A;  5CCA A;  1RLP C;  3RMQ A;  2HAX A;  3JV3 A;  3L42 A;  2L3S A;  3M53 A;  4Y92 A;  2QEX A;  2K5F A;  3VYH B;  3CCR T;  4C8Q F;  2P4R A;  2K5I A;  2FYK A;  1K76 A;  4TVR A;  4A4K A;  4ZN3 A;  1M1F A;  2E6N A;  1GCQ C;  2CP3 A;  3RR6 A;  4JLG A;  4WTO B;  3CCR Q;  4HKE A;  1M3A A;  1UGV A;  5CVI A;  1ZA1 B;  4Y28 E;  5DM7 R;  2DKG A;  4M7A E;  3HRT A;  3PT9 A;  2NUT A;  4BE0 A;  2DL4 A;  4QVC A;  2F5K A;  3UA7 A;  1U1T A;  2OTJ A;  2XG8 D;  1G3T A;  1IGQ A;  3MCA B;  3KBG A;  1FWZ A;  1X75 C;  3A98 A;  1OPK A;  3SWN B;  3GF5 A;  2RJD A;  5A0L A;  2LQW A;  1JU5 C;  2F2X A;  2DE0 X;  5HK3 A;  3M0U A;  1UDL A;  1AZG B;  2EQJ A;  2RJF A;  3QHS A;  3EG9 A;  4M75 E;  1X27 A;  2DA9 A;  3NTI A;  2DXB A;  3QWY A;  1RAB B;  3FIF A;  1KSW A;  4C8Q G;  2KT8 A;  5KYY A;  4II1 A;  1OI1 A;  3CME T;  2KAF A;  2C0O A;  4J6X A;  5L8R E;  2LZ6 B;  4E7H A;  1YP5 A;  3MKD A;  2QAZ A;  1FMW A;  4LDW A;  4M7A A;  3CME Q;  1B7T A;  3VU3 C;  4FYX B;  1RAC B;  2E5K A;  5GMK e;  1QCO A;  3EG2 A;  1W1F A;  1OZ3 A;  3CCV Q;  3REB B;  1NLP C;  1S1N A;  1ZBX A;  4A4F A;  1H8K A;  1JBM A;  2KSS A;  3QG1 A;  5LJ5 d;  4PJO D;  4EMK B;  4CI0 C;  1FX7 A;  3I5S A;  4JJN K;  2QDL A;  1PKS A;  2VV5 A;  2MIO A;  1VQP T;  1SHF A;  5DLQ E;  4BUG A;  3JCM J;  1PD1 A;  1NJI C;  2E4H A;  3NGP A;  2VWF A;  3EH2 A;  3J7A F;  1N27 A;  1VQP Q;  2RM4 A;  5A0D A;  2XDP A;  2FRY A;  4M75 A;  1GXI E;  1LOJ A;  2QTV A;  1VQ4 T;  1GBQ A;  4JJC A;  1WQW A;  3FLG A;  2PNI A;  2PVG B;  4CC7 A;  2J6K A;  3FJP A;  2NUP A;  1YJN T;  1EFN A;  5DY9 A;  1VQ4 Q;  1NG2 A;  1AZE A;  2YDL A;  1VQN A;  2CH4 W;  1Q7Y R;  3OYK A;  2DX1 A;  4KH1 B;  2YT6 A;  1ABQ A;  2PU9 B;  5GAN 8;  2X4X A;  2HD0 A;  1OX9 A;  1N9S A;  3VV0 A;  4GLK A;  1MV3 A;  1C1A A;  4MDX A;  1ZUY A;  2LCC A;  1MUZ A;  1G83 A;  4OGC A;  2DJQ A;  3LGF A;  4JZ3 A;  3LGL A;  3OY9 A;  1RAI B;  3QPH A;  2ZPE B;  5D6X A;  3CBO A;  1WFW A;  1M27 C;  4OMM A;  3ME9 A;  1Q7Y U;  1VQ7 A;  4IIM A;  4N0A C;  3EFS A;  1PRL C;  3AHU A;  1U5S A;  1UG1 A;  5GAN j;  4FSX A;  2FZG B;  2MPX C;  2GGR A;  3E19 A;  1G3Y A;  5GAN h;  1WYX A;  1SRM A;  3M59 A;  4F14 A;  1QVG S;  5LJ3 h;  3G4S Q;  3HL8 A;  4DQ2 A;  2ZPG B;  4ZN1 A;  2D1X A;  4C0Z A;  1I8F A;  3OSV A;  1YI2 A;  4MZT A;  5CKD A;  3CXC S;  2M02 A;  2LT4 A;  5FRM A;  3V8L A;  3G1J A;  5CKH A;  4ANJ A;  4M7D C;  1SSF A;  5GAN 7;  3LYI A;  3OYG A;  4C8Q E;  4XU0 A;  2QA4 Q;  2EYX A;  2HSP A;  4RTV A;  3WXM B;  4XK8 E;  2RHZ A;  1WX6 A;  3C0C A;  2COW A;  1WHM A;  3G6E T;  4PK4 A;  4CC2 A;  4FIB A;  3LX7 A;  2D9T A;  1I1J A;  2HKN A;  4A53 A;  5LJ5 g;  2QEX T;  2QQS A;  1YJW T;  1UGQ B;  2WSE E;  4BI4 A;  3G6E Q;  3ZBD A;  2RN8 A;  1V29 B;  2YUQ A;  2K9G A;  4AFS C;  4XU1 A;  3CCU A;  1YJW Q;  2EAY A;  3M0S A;  2X51 A;  5GAO r;  4BE2 A;  2O4X B;  4KH0 B;  2RQV A;  3M55 A;  2Y4Y A;  2YSQ A;  2YXY A;  3G7Z A;  1M5Q 1;  1TTH B;  5GAN d;  4IKF A;  3VKI A;  2JM9 A;  2ECZ A;  3MJX A;  3RKY A;  3OMC A;  1PD0 A;  2LX7 A;  1KFZ A;  2EIF A;  5LJ3 d;  2O88 A;  3LW5 E;  4OML A;  4C8Q A;  1AEY A;  2QTX A;  1N6A A;  4D6W A;  1U06 A;  1VQ9 A;  1VQO T;  1V76 A;  1G2B A;  4X9D A;  4BDY A;  4RTU A;  3THK A;  4ORZ A;  3P8D A;  4WCI A;  1K0X A;  3UF4 A;  4F7U B;  2XID A;  1VQO Q;  4Y91 A;  1MHN A;  5C6S A;  4RUG A;  4C92 D;  5GAN 2;  2CRE A;  3I55 A;  2Z0W A;  4PJO C;  3OS2 A;  3E1S A;  2RHI A;  4OP0 A;  3EG1 A;  3VRZ A;  2ROL A;  3OYJ A;  4E7K A;  1ZSZ B;  2JTE A;  3RDV A;  3CCQ A;  4XTX A;  3MHX A;  1OEB A;  5GAN 4;  5GAN 5;  4M77 D;  1NYF A;  1BBZ A;  2KRS A;  5FU7 B;  3HSB A;  3QDR B;  1N8R C;  4BY6 B;  3HFN A;  2LNH B;  1JRI A;  1JEG A;  5CKE A;  1HXD A;  1MNE A;  1WLP B;  1ACM B;  5EC7 A;  2DPP B;  1UEC A;  2SRC A;  1GCQ A;  4PFO A;  2O01 E;  3EFO A;  1CKB A;  1K9M R;  1J3T A;  4XTY A;  3UPU A;  3OYC A;  2YLB A;  2D0Q B;  4XU3 A;  4OMF B;  4BI3 A;  1VQ6 T;  3CPF A;  4M75 F;  3I35 A;  5CKB A;  1Q81 R;  2EQU A;  2FHD A;  3NHN A;  1VQL A;  1F1B B;  4HCC A;  2QG9 B;  1RUW A;  1BI3 A;  1NLO C;  1VQ6 Q;  1WHL A;  3SFM A;  1YIT Q;  1MV0 B;  1D0Z A;  5HKC A;  4PJO F;  5GMK m;  1TUD A;  3CC7 A;  5IT9 E;  2CP5 A;  1KIK A;  5CQY A;  4IUQ A;  1TSF A;  5CK9 A;  2JT4 A;  2EQI A;  1JB0 E;  1CSK A;  3L2Z A;  8AT1 B;  3X26 B;  5GAN 3;  2JUF A;  2K4Y A;  1KG1 A;  4XQ3 A;  1MMA A;  1QW1 A;  4FT2 A;  4LUE A;  2EGA A;  3ER0 A;  3CPW S;  1Z9Q A;  1K9M U;  3QYG B;  2V26 A;  1VQM Q;  2YUN A;  4HCK A;  2AKK A;  3JCM d;  4LN2 A;  1I81 A;  1Q81 U;  2DRM A;  4PL6 A;  1D0Y A;  4C0F A;  4M75 G;  1RAA B;  3QSU A;  3ULR B;  1OV3 A;  1BI2 A;  2JW4 A;  2RB6 A;  2LQN A;  4JUV A;  3JCM c;  2RA2 A;  2QQ9 A;  2AZS A;  1VIE A;  1WZO A;  3LLR A;  1TUC A;  1RAD B;  3NPF A;  4BY6 C;  4PJO G;  5GAN g;  2IG0 A;  2KT1 A;  1VA7 A;  1I5L A;  2H8H A;  3EGX A;  2X4W A;  3G71 A;  2JS2 A;  5LJ3 g;  3RES A;  4LDY A;  1PRM C;  2DAQ A;  3KXT A;  1UE9 A;  5GAM h;  1T3S A;  4M78 D;  5KYU B;  1W4S A;  1UGR B;  4JRP A;  1D3B A;  3DLM A;  1ZLM A;  1YIJ T;  1AOJ A;  2KQW A;  5AYF A;  1U3O A;  3GOX A;  3CCJ T;  1YHQ Q;  2QK0 A;  2FPD A;  3H0I A;  1K73 R;  1Y57 A;  3RKW A;  3C94 A;  1YIJ Q;  3A8H B;  1PSF A;  3INZ A;  3CCJ Q;  2RF0 A;  4DBF A;  1WQ7 A;  2K79 A;  1AWX A;  5J3B A;  2VC8 A;  2ZPH B;  1IGU A;  1WXU A;  3L1A A;  3S3M A;  1KK7 A;  4BD3 A;  2A36 A;  3Q1J A;  3FDR A;  3SDZ A;  4E7S A;  1VQ5 T;  3EHR A;  4J9F A;  2J6O A;  2CZ0 B;  2J6F A;  2H3J A;  1D1C A;  1U1S A;  4LD6 A;  4XTZ A;  3RBB B;  1VQ5 Q;  4C0D B;  4OB0 B;  2DXU A;  1RAE B;  2KYB A;  2ESW A;  1PCX A;  3EHQ A;  4LDX A;  4LDU A;  1RAH B;  2M9U A;  4IUT A;  4ELY C;  1M4Z A;  1X01 A;  1B3Q A;  2VGN A;  2VGM A;  2CUB A;  2DZC A;  5FRO A;  1VQ8 A;  2EYZ A;  4GBQ A;  3M0R A;  2BZY A;  1YBY A;  1K73 U;  1QWF A;  1RL2 A;  2R58 A;  2EQK A;  1WPY A;  2F2W A;  4DBR A;  2V8J A;  3V8J A;  1KQ1 A;  1QP3 A;  2XK0 A;  2AIR B;  1PNJ A;  2EVR A;  5EG2 A;  4N0A A;  3GIB A;  3BY7 A;  2PUO B;  1G3S A;  5GAM d;  3JB9 D;  4ME7 A;  3LH0 A;  5LJ5 j;  2EW3 A;  1NPP A;  1QP2 A;  1M2O A;  3OYI A;  5KYX A;  3S3O A;  5LJ5 h;  4C92 C;  2RI3 A;  1WHG A;  2E6Z A;  4L5G A;  1S72 A;  2VXF A;  2HQX A;  3OS0 A;  2QGG A;  3HKS A;  1ZX6 A;  4QVZ A;  4QW2 A;  3RMS A;  4O5V A;  4RTZ A;  1Q7Y C;  3HPW A;  2O9S A;  4M77 C;  3M0Q A;  2KEA A;  4JS5 A;  2DLP A;  4M7D A;  2PQW A;  2FB7 A;  5GMK l;  3CCM T;  3HRU A;  1BI0 A;  4D8K A;  4IUU A;  2XU8 A;  1R0C B;  3RUX A;  1NM7 A;  2HBP A;  3JCM g;  1SF9 A;  1VYT A;  4MML A;  5FWC A;  1OQK A;  3CCM Q;  2DMO A;  4QKU A;  3QDF A;  2X35 A;  4M78 B;  2BTT A;  2EJF A;  3OMG A;  1D0X A;  1TG0 A;  2CSI A;  1Y07 A;  5I11 A;  2EKH A;  4DEX A;  3OYH A;  3JCM W;  3MO8 A;  3R6N A;  4E7Z A;  4KUD K;  1QKX A;  3TU4 K;  2F69 A;  3VS5 A;  3BDL A;  2RMO A;  3A8M B;  3HRS A;  1HK9 A;  2GFA A;  2ZPI B;  3A1P A;  4C92 F;  1JQQ A;  1WJR A;  1UGS B;  2XDD A;  3CD6 A;  1YJ9 T;  4PJO E;  2E65 A;  3JSC A;  3VUB A;  1GL5 A;  2I0N A;  1N9R A;  4J8O A;  1XJW B;  3EFR A;  5FU6 B;  2ZPB B;  3EG0 A;  1U8R A;  1YJ9 Q;  1R8O B;  4YTL A;  3FB9 A;  4A4E A;  3OSS C;  1AD5 A;  1FXX A;  2FEI A;  1TS9 A;  4M77 F;  5IXF A;  1ZUK A;  3IQL A;  3OYN A;  2M0Y A;  2O31 A;  2HL5 C;  3OYE A;  5DLO A;  1IO6 A;  1GBR A;  1KHC A;  3GP8 A;  2OJ2 A;  2V8K A;  4KRT A;  3S6W A;  3A8O B;  2COY A;  3ZFJ A;  1M90 R;  5KYW A;  2GCX A;  5CQX A;  3H8Z A;  3NTK A;  4J6Y A;  4NOY A;  4PJJ A;  1Q86 R;  4B9W A;  3TSW A;  1RI9 A;  3VS1 A;  4C92 G;  4PJO A;  2NUT B;  3LH5 A;  3CBM A;  4OB1 B;  3ZEH A;  4M4Z A;  1YJN Q;  3UWN A;  2P84 A;  1NYG A;  4AMC A;  2KY9 A;  3QZ5 B;  3SWN C;  4FM4 B;  3FC3 A;  3JB9 I;  4PJM A;  3I9Q A;  4M77 G;  2W0Z A;  4M78 C;  2H3E B;  1IXD A;  1UHF A;  3OYF A;  4FSS A;  2LNV A;  1VQK A;  1RLQ C;  2IVW A;  1M3C A;  1I07 A;  2CP0 A;  3JRZ A;  1OOT A;  2RQR A;  4IUV A;  3I56 A;  1M90 U;  3QUI A;  2OX7 A;  5GAM g;  5KCH A;  4Z88 A;  1Q86 U;  3JCM b;  1QCF A;  3EG9 B;  3OBW A;  1B34 A;  2EGC A;  1GRI A;  3OS1 A;  1QVG P;  1EZZ B;  1XNI A;  4HXJ A;  1QVF S;  1W70 A;  3M58 A;  5KYY B;  1TH7 A;  2PVO B;  2QI2 A;  3RIR A;  3OYD A;  3CXC P;  5A0G A;  3M56 A;  2HSE B;  5I21 A;  4JRI A;  3U23 A;  3GLX A;  4N4I A;  2WSC E;  4M7A B;  1Y96 A;  4RG2 A;  3LWH A;  2RK1 A;  4LE9 A;  2XMF A;  3EH1 A;  3OBY A;  4EDU A;  2ZZD A;  2AHJ B;  4EMK C;  2MI6 A;  4LD9 K;  3AT1 B;  1ZQ1 A;  1WNL A;  2DBM A;  4QQ6 A;  4MDW A;  1ZUU A;  1OPL A;  5LJ3 j;  2MK5 A;  3JCM Q;  1JJ2 S;  1YWP A;  2LCS A;  1TXQ A;  1HD3 A;  1SSH A;  2CZ1 B;  2QQA A;  2DZ9 A;  2HMA A;  1T0J A;  3CCL A;  1K1Z A;  4N4G A;  5KH6 A;  3PNW C;  4C5H A;  4L59 A;  2CT3 A;  3QZ9 B;  4AFZ C;  2ED0 A;  3QO3 A;  1M8M A;  3OQ5 A;  3M54 A;  4C5I A;  4OMO A;  4VUB A;  1VOM A;  2LMJ A;  3JCM V;  4M75 B;  2R5M A;  3M9Q A;  3CCE A;  2V8I A;  3UA6 A;  3CC2 A;  5IHI A;  3CCS T;  2DEU A;  2OTL T;  4JJB A;  2QGF B;  2LCL A;  4AG1 C;  2NUP B;  2HQH A;  4CRI A;  2EYW A;  5GAN e;  1MMN A;  3CCS Q;  4JS4 A;  1D1B A;  1P92 A;  2OTL Q;  2A3L A;  2HDA A;  2PTK A;  5LJ3 e;  5M9O A;  3L2W A;  2L5Q A;  4KUI A;  2DF6 A;  1SG5 A;  2V1Q A;  5ECA A;  1K9M C;  2G6F X;  1MGQ A;  3MEA A;  2EQM A;  4WF2 A;  5L23 A;  1KD1 R;  1T3L A;  5IAY A;  3OYB A;  3CMA A;  2E12 A;  3MET A;  3CBP A;  2RHU A;  1Q81 C;  4J9G A;  1QCN A; 
#chains in the Genus database with same CATH homology
 2EQI A;  1YNZ A;  1CSK A;  1UJ0 A;  1UJY A;  4AG2 C;  3VS0 A;  2VKN A;  1H92 A;  2C0I A;  1RLP C;  2DM1 A;  1WXB A;  2AK5 A;  3JV3 A;  2L3S A;  3CQT A;  4LUE A;  2EGA A;  4Y92 A;  2ENM A;  1Z9Q A;  2JM8 A;  4J9D A;  2P4R A;  2YUN A;  4HCK A;  1K76 A;  5GJV B;  2AKK A;  4LN2 A;  4AFU C;  4Z89 A;  1GCQ C;  2DRM A;  4CC3 A;  1T0H A;  2DVJ A;  1GFD A;  1M3A A;  1BK2 A;  1UGV A;  2C0T A;  3ULR B;  1OV3 A;  2MOX A;  2JW4 A;  2KYM A;  2LQN A;  2DL4 A;  2VVK A;  3UA7 A;  2AZS A;  1TUC A;  3NPF A;  2LJ3 A;  2KRM A;  2X3W D;  2KXC A;  1BB9 A;  3VRY A;  2CT4 A;  4IIO A;  2KT1 A;  1VA7 A;  2H8H A;  2KXD A;  3VS4 A;  3A98 A;  1OPK A;  2JS2 A;  2GBQ A;  1CKA A;  1PRM C;  4J9C A;  2OI3 A;  2A08 A;  2LQW A;  1JU5 C;  2F2X A;  1UE9 A;  2DE0 X;  1T3S A;  3PE0 A;  3M0U A;  1ZLM A;  1UDL A;  1AOJ A;  1AZG B;  1U3O A;  2J7I A;  4J9H A;  1VYV A;  3H0H A;  1X27 A;  2FPD A;  2DA9 A;  3H0I A;  3QWY A;  1HJD A;  1Y57 A;  1KSW A;  2KT8 A;  1HSQ A;  2BZX A;  2JS0 A;  2EPD A;  2KE9 A;  2RF0 A;  2K79 A;  1AWX A;  2C0O A;  2HCK A;  1SHG A;  3ZL7 C;  1WXU A;  2LZ6 B;  1YP5 A;  2A36 A;  2L3Q A;  2RQW A;  2CDT A;  2E5K A;  3EHR A;  4J9F A;  2J6O A;  4F17 A;  3EG2 A;  1PHT A;  1W1F A;  4GLM A;  2J6F A;  1ZBJ A;  3REB B;  2O9V A;  1NLP C;  1S1N A;  3RBB B;  3SEM A;  1H8K A;  2D8J A;  2ABL A;  2KYB A;  2ESW A;  1FMK A;  3I5S A;  3EHQ A;  1X6B A;  2QDL A;  1PKS A;  2MIO A;  2HEQ A;  1SHF A;  1B3Q A;  2MCN A;  2KBT A;  5FWB A;  1GFC A;  2CUB A;  2DL8 A;  3NGP A;  1WIE A;  2EYZ A;  1K0S A;  2VWF A;  4GBQ A;  3M0R A;  2BZY A;  3TVT A;  1VYU A;  1K4U S;  1QWF A;  2FRY A;  3RNJ A;  2F2W A;  1GBQ A;  4JJC A;  1WI7 A;  2DNU A;  2PNI A;  3H0F A;  4J9B A;  4HVU A;  4CC4 B;  5HCK A;  4CC7 A;  2J6K A;  2PZ1 A;  2K6D A;  4ESR A;  1PNJ A;  1EFN A;  2EVR A;  2JXB A;  1NG2 A;  1AZE A;  2YDL A;  4RTT A;  1AWW A;  2EW3 A;  1FYN A;  1SRL A;  4A63 B;  2CH4 W;  1QWE A;  1V1C A;  1Z9Z A;  2A37 A;  2GTJ A;  2DX1 A;  2YT6 A;  4AFQ C;  1JXM A;  1ABQ A;  1M30 A;  1WXT A;  1UHC A;  3FJ5 A;  1ZX6 A;  3REA B;  4RTW A;  4RTZ A;  2CSQ A;  3M0P A;  2O9S A;  4RTY A;  1NEG A;  1MV3 A;  2KEA A;  2DL3 A;  2LP5 A;  3M0Q A;  1ZUY A;  2LJ1 A;  2EYY A;  3GBQ A;  2DLP A;  2A28 A;  4J9E A;  4D8K A;  1MUZ A;  1G83 A;  1NM7 A;  1SPK A;  2FPF A;  2ROT A;  2KRO A;  2DJQ A;  1K9A A;  1VYT A;  1A0N B;  4JZ3 A;  5FWC A;  1XOV A;  1PWT A;  2DIL A;  2DMO A;  3TSZ A;  1WA7 A;  2HBW A;  2BTT A;  1WFW A;  1M27 C;  4OMM A;  1TG0 A;  2CSI A;  5I11 A;  2EKH A;  4DEX A;  2CUD A;  2J06 A;  3R6N A;  5IXB A;  4K11 A;  4IIM A;  1PRL C;  2YUO A;  1U5S A;  1UG1 A;  4OMQ A;  1QKX A;  3VS5 A;  2RMO A;  2OAW A;  2GGR A;  1E6G A;  2BZ8 A;  2JMC A;  1WYX A;  3VS3 A;  1SRM A;  4F16 A;  1JQQ A;  4F14 A;  3M0T A;  2KR3 A;  2L0A A;  1GL5 A;  2I0N A;  1QKW A;  1X43 A;  2D1X A;  4R0K A;  2JMA A;  3EG0 A;  2EBP A;  1AD5 A;  2FEI A;  1I0C A;  5IXF A;  1ZUK A;  3IQL A;  2M0Y A;  2O31 A;  2DL5 A;  3PVL A;  1IO6 A;  3VS6 A;  1GBR A;  1X2Q A;  2RNA A;  3PVQ A;  1LCK A;  2OJ2 A;  2RQT A;  2D0N A;  4KRT A;  2EYX A;  2GNC A;  2HSP A;  4RTV A;  4DEY A;  1X69 A;  4EIK A;  2X3X D;  1WX6 A;  2D8H A;  3C0C A;  4JPB W;  1AWO A;  3KFV A;  2K7A A;  1N5Z A;  3TSW A;  1RI9 A;  4CC2 A;  2FG0 A;  4QT7 A;  1I1J A;  2FPE A;  3I5R A;  1UTI A;  1M3B A;  3VS1 A;  4X1V A;  4J9I A;  4JJD A;  3VS2 A;  3LH5 A;  2RN8 A;  4HVV A;  2YUQ A;  4M4Z A;  2K9G A;  3O5Z A;  4AFS C;  4E6R A;  1B07 A;  2KRN A;  5IHK A;  2LJ0 A;  2IIM A;  1NYG A;  3H41 A;  3M0S A;  4ZNX A;  2DBK A;  2DYB A;  1H3H A;  2RQV A;  1JO8 A;  3I9Q A;  1NEB A;  2YSQ A;  2W0Z A;  2F2V A;  3QWX X;  2V1R A;  1ARK A;  4HVW A;  4D8D A;  1W6X A;  2JM9 A;  2ECZ A;  1UHF A;  4FSS A;  1RLQ C;  1GCP A;  1M3C A;  2RQU A;  2LX7 A;  1KFZ A;  1I07 A;  3NMZ C;  2O88 A;  5I22 A;  1OOT A;  2RQR A;  2O2O A;  4OML A;  2CH4 A;  1Y0M A;  1AEY A;  4Z88 A;  5IH2 A;  1QCF A;  2KNB B;  2EGC A;  1GRI A;  1U06 A;  1E6H A;  4HXJ A;  1W70 A;  1G2B A;  2K3B A;  2M51 A;  4RTU A;  1JXO A;  3THK A;  4ORZ A;  4WCI A;  1YWO A;  1K0X A;  3UF4 A;  1X6G A;  3U23 A;  3EGU A;  4RUG A;  2FRW A;  2RPN A;  2CRE A;  4LE9 A;  2XMF A;  4LUD A;  3VS7 A;  5GJW B;  1E7O A;  2DBM A;  2YUP A;  3EG1 A;  1ZUU A;  3VRZ A;  2ROL A;  1OPL A;  1PKT A;  1ABO A;  4OMN A;  2JTE A;  1YCS B;  2SEM A;  1YN8 A;  1YWP A;  2LCS A;  1OEB A;  1HD3 A;  5FW9 A;  1SSH A;  2FO0 A;  1T0J A;  1NYF A;  1K1Z A;  1BBZ A;  2KRS A;  2J05 A;  1BU1 A;  2CT3 A;  2B86 A;  4Z8A A;  5IHN A;  2EGE A;  2LNH B;  4AFZ C;  2ED0 A;  4JZ4 A;  1JEG A;  1M8M A;  4OMO A;  4LNP A;  1WLP B;  1KJW A;  1UUE A;  2LMJ A;  1X2K A;  3EG3 A;  5EC7 A;  3UA6 A;  1ZSG A;  1UEC A;  2SRC A;  3UAT A;  5IHI A;  2DL7 A;  1GCQ A;  2GQI A;  4OMP A;  4JJB A;  1CKB A;  1J3T A;  1AWJ A;  2L3P A;  2NWM A;  2DRK A;  4AG1 C;  1WDX A;  2EYW A;  1UFF A;  3I35 A;  2AKL A;  2GTO A;  2L2P A;  2KGT A;  3NHN A;  2HDA A;  2PTK A;  2ED1 A;  1AVZ C;  1RUW A;  2W10 A;  1NLO C;  2DF6 A;  3SHW A;  1MV0 B;  2V1Q A;  1SEM A;  5ECA A;  2NUZ A;  2G6F X;  2AZV A;  5L23 A;  1TUD A;  1KIK A;  1T3L A;  4RTX A;  1QLY A;  4J9G A;  2K2M A;  2JT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...