2I0NA

Structure of dictyostelium discoideum myosin vii sh3 domain with adjacent proline rich region
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
80
structure length
80
Chain Sequence
MGPLGSPEFAKYARALKDYNVSDTSLLPFKRNDIITITFKDQENKWFMGQLNGKEGSFPVDHVEILLSDVPPPQPVHPVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Class VII unconventional myosin
publication title The SH3 domain of a M7 interacts with its C-terminal proline-rich region.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 7
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2i0nA01
1Z9ZA 2L3SA 1SEMA 3THKA 1WXTA 1I07A 2DMOA 3H0FA 1PRLC 2HDAA 4D8DA 1ZX6A 2EGEA 2JS0A 5I22A 2IIMA 1WYXA 1KFZA 1ABOA 2D8JA 4OMMA 4DEYA 4OMLA 2GBQA 1QWEA 1GCPA 3VS5A 1SHGA 4QT7A 1CSKA 1OPLA 2DRKA 2D8HA 3UA7A 3EG0A 1NEGA 2PTKA 1QCFA 1PKSA 1T3LA 2JXBA 3FJ5A 1T0JA 2DLPA 5FW9A 1XOVA 2YUOA 1S1NA 3UF4A 2JM9A 2HSPA 4KRTA 3GBQA 4AFSC 4D8KA 4GLMA 1OV3A 2J6FA 2YUQA 3VRZA 2DBKA 2DNUA 2OI3A 1UHCA 4LN2A 4M4ZA 5IHKA 2O9SA 3VS6A 4CC2A 1Y57A 1UECA 1RUWA 5IXBA 1ZSGA 2LQNA 4HVUA 2JTEA 1K1ZA 1FMKA 1M3BA 2SEMA 1QKWA 1K76A 5IXFA 5L23A 2O2OA 2YDLA 1X6GA 2D1XA 1M3CA 3H0HA 3M0SA 1BU1A 4HVWA 2J6KA 3UA6A 4RUGA 2FPFA 1U5SA 4J9DA 2LJ1A 1NYFA 4JPBW 2EGAA 2V1RA 2O88A 1E6GA 2FRYA 2GQIA 2CH4W 1AWJA 2RQVA 4Y92A 3VRYA 1AWXA 4AFQC 4F16A 1RLPC 1GFDA 1WIEA 2EPDA 2BZXA 4LUDA 2KRNA 2DX1A 1NEBA 1T3SA 1WFWA 4JJDA 2JW4A 3A98A 1U06A 2BZ8A 4LUEA 4X1VA 2BTTA 2HEQA 2CDTA 1RLQC 4J9CA 4R0KA 5IHNA 2PNIA 4IIMA 2ENMA 3ULRB 2LQWA 3M0UA 1QWFA 3KFVA 1M27C 3M0TA 2LNHB 3PE0A 1B3QA 1SPKA 1PWTA 2A37A 2KXDA 2MOXA 4K11A 2FPEA 4RTZA 4JJBA 3O5ZA 2JM8A 2FEIA 4WCIA 3RNJA 3IQLA 2KT1A 1H3HA 1K9AA 1UGVA 3VS2A 2MCNA 4AG1C 1A0NB 2EYYA 4FSSA 1K4US 2PZ1A 2OJ2A 1M3AA 3QWYA 2RQTA 4RTXA 4J9GA 3U23A 1BK2A 4JJCA 1LCKA 2ED0A 2RF0A 2E5KA 1B07A 2C0IA 2KYBA 2DL8A 2LP5A 4DEXA 1UUEA 2JS2A 1UFFA 4J9FA 4Z8AA 2KRMA 2DF6A 2W10A 4CC3A 2RMOA 2H8HA 1YN8A 2DL7A 5EC7A 2C0OA 1ZLMA 3EG1A 1JXMA 5I11A 4HXJA 4HVVA 4OMPA 4CC7A 4HCKA 2O31A 1X2QA 2FG0A 2EQIA 2K9GA 2CT4A 1YNZA 2YUPA 2DVJA 3NHNA 1T0HA 4RTUA 3JV3A 2DYBA 1JO8A 2EYWA 1UJ0A 1AD5A 3EHRA 2A36A 1JXOA 1OOTA 1UJYA 3VS1A 2L3QA 2YSQA 2YT6A 1YWPA 2GTOA 2KYMA 5GJVB 1MV0B 1VA7A 2I0NA 4JZ4A 2EYZA 3NPFA 1Y0MA 1ZBJA 1SRMA 2F2WA 1VYTA 3EG2A 1HJDA 4Z88A 2RN8A 1V1CA 1EFNA 2GNCA 2MIOA 2DRMA 1X2KA 2M51A 3SEMA 1KIKA 3NMZC 1H92A 2DL5A 2EGCA 1PRMC 4LE9A 3I5SA 3REAB 1G83A 1AEYA 2FRWA 2RNAA 1NLOC 1AZEA 4EIKA 1WXUA 1UDLA 1RI9A 3VS3A 1QKXA 2X3WD 2KROA 2HCKA 1KJWA 1WA7A 2DA9A 4OMQA 2J06A 2RPNA 3VS0A 1GBRA 1TUCA 2J7IA 3TSWA 2DJQA 4ZNXA 4JZ3A 2VKNA 1IO6A 1H8KA 2VWFA 5FWBA 2AK5A 3TSZA 3ZL7C 3M0RA 2QDLA 2AKKA 2XMFA 2F2VA 1WX6A 2FPDA 3H0IA 2KR3A 2K3BA 2V1QA 2LMJA 3PVQA 2W0ZA 4CC4B 1PHTA 2RQRA 1FYNA 2KE9A 1PNJA 4AFUC 2LZ6B 1X6BA 2AZVA 2SRCA 1KSWA 3QWXX 2K2MA 4LNPA 1W70A 1TUDA 1GBQA 3EGUA 2LX7A 1GCQA 2NWMA 2LJ0A 2KNBB 3NGPA 4A63B 2DE0X 1ARKA 2O9VA 5ECAA 1JU5C 1G2BA 4RTWA 3M0PA 2CREA 4AFZC 1AWOA 3UATA 2J05A 2JMAA 2CH4A 1W1FA 4J9BA 1OPKA 1WI7A 1N5ZA 1TG0A 1UE9A 2YUNA 3M0QA 1AOJA 1UG1A 3TVTA 2BZYA 3I35A 1VYVA 1CKBA 2C0TA 2DBMA 2DL3A 1GL5A 3VS4A 2EBPA 1AWWA 1SHFA 1PKTA 1E6HA 3EG3A 2OAWA 2GGRA 4IIOA 2GTJA 5FWCA 2CUDA 2EVRA 3C0CA 1SSHA 1U3OA 2X3XD 4OMNA 1I1JA 2D0NA 1ZUKA 4E6RA 2VVKA 4F17A 2LJ3A 2P4RA 1ZUUA 2NUZA 2KT8A 4J9EA 2J6OA 1AZGB 2ABLA 1VYUA 1M8MA 4ORZA 4GBQA 2M0YA 2DM1A 1BB9A 2LCSA 3SHWA 1BBZA 1GFCA 1K0SA 1OEBA 1NG2A 1YCSB 5IH2A 1ABQA 1J3TA 2B86A 2JMCA 2HBWA 1X43A 2EW3A 2ROTA 3PVLA 2KBTA 2K79A 4ESRA 2AKLA 2DL4A 2A28A 2KRSA 2JT4A 1MV3A 2DILA 4J9HA 4J9IA 1WXBA 1CKAA 2CT3A 2K6DA 1JQQA 1WDXA 1GRIA 1NM7A 2CUBA 1I0CA 5IHIA 4RTTA 3I5RA 5HCKA 5GJWB 3RBBB 1YWOA 2L3PA 3I9QA 4OMOA 4RTVA 4RTYA 2K7AA 2L2PA 2FO0A 2KGTA 1X27A 1HSQA 1K0XA 2ECZA 1WLPB 2CSQA 3H41A 1E7OA 2KXCA 1JEGA 2ESWA 2RQWA 2EKHA 1MUZA 1ZUYA 3R6NA 3CQTA 1UTIA 2A08A 2G6FX 1X69A 1NLPC 1NYGA 1UHFA 1YP5A 1Z9QA 1QLYA 4F14A 4Z89A 2EYXA 4AG2C 1AVZC 1M30A 2AZSA 2F2XA 1HD3A 2ED1A 1W6XA 3REBB 1SRLA 1GCQC 2CSIA 3EHQA 3LH5A 2KEAA 2RQUA 3VS7A 2ROLA 2L0AA
chains in the Genus database with same CATH superfamily
1SEMA 2CP7A 1MNEA 3MHXA 2X51A 3A8MB 3H0FA 3CMAA 1YJNT 1PRLC 2E41A 2RK2A 3E2UA 5IT9E 2M02A 3OYBA 2X4JA 3QUIA 3OYCA 1M2VA 3PMTA 1YIJA 4M77G 5I2SA 4OMLA 4DOWA 2ZGWA 3JSCA 1BI3A 3C4SA 4B9XA 2VUBA 4QT7A 3P8DA 2DRKA 5GAMg 3EG0A 1YJNA 2PTKA 4C8QB 1XNIA 1QCFA 2JXBA 3FJ5A 5FU6B 2DLPA 5FW9A 2P84A 5A0DA 2JM9A 4M78A 2M0OA 1MNDA 4KRTA 4AFSC 3BW1A 2HQXA 2YLCA 1WHHA 4ZGDB 2YLBA 4JRPA 2RJDA 2YUQA 4MMLA 3L2ZA 4FYYB 2BIVA 3OY9A 2DXTA 3OW2S 4CC2A 1ACMB 3OS5A 4M78F 3CXCS 2K5IA 4M77D 1SF9A 4HVUA 2RHYA 1M3BA 3VUBA 4A4KA 3META 4XTUA 4FL6A 2MK5A 1X6GA 5LJ3d 3TCJA 5GAN4 3OS1A 3UA6A 4RUGA 1U1SA 2AT1B 3O8VA 3HP9A 1NYFA 1TH7A 1VIEA 4M7DF 2E10A 2CH4W 3VRYA 1IREB 4Y92A 4PJMA 4M7DG 4M78E 1GFDA 3KUFA 4QVDA 3HTRA 2EPDA 1MHNA 1IRXA 4A4EA 2KRNA 1G8XA 1D0YA 1N8RC 4JJDA 4M7AB 4X9DA 3A98A 3R6OA 2CP2A 1IHVA 4OGEA 2XD0A 5IHNA 5GAOr 1YITQ 3M53A 1QWFA 3KFVA 3M0TA 2WSCE 3MKDA 3CC4Q 3FEOA 1Q86R 2D9TA 1SPKA 5FLXE 1I4K1 2KXDA 2Y90A 1Y71A 5J39A 2R5MA 2FPEA 4FYXB 5J3BA 4LDUA 1H3HA 1UGVA 5DLOA 5KYUB 2MCNA 1ZSZB 4BE2A 1A0NB 4M7DD 4C5IA 2F5KA 2PZ1A 4L6V5 2F1LA 2C06A 2X4WA 5GMKh 5FRNA 5KYYB 4JJCA 1V76A 3EG9B 4KGXB 3PFSA 5GMKm 1PCXA 2LP5A 4NOYA 5FROA 3OYEA 4Z8AA 2KRMA 4ME7A 2RMOA 3M9QA 3CCUQ 4PJOC 1VQMT 2PQWA 2KY9A 2NUPB 2PVDB 2K4YA 4PJOA 4IUUA 4OMPA 3C12A 4HCKA 4BE1A 3DLLA 1X2QA 3MEAA 2QXFA 2CT4A 5CAIA 2CP0A 2JTFA 4FU6A 4XK8E 4CRIA 2IPOB 4RG8A 3EHRA 4IUVA 3CCVT 2ZZDA 1VQMA 1UJYA 3VS1A 2DAQA 3MEVA 4Y91A 3MO8A 4XU1A 5GJVB 4JZ4A 2EYZA 1Y0MA 4C92G 1D1AA 2F2WA 2MIOA 3CBMA 1WZOA 1XJWB 3CCVA 2EGCA 2VASA 4VUBA 4PNOA 3REAB 2E6NA 2DTOA 4IUQA 1KC8R 1VQPQ 4PJOE 3V8KA 3QSUA 4XTVA 1NLOC 1AZEA 1VQ7T 4MDXA 3VS3A 4QKUA 5GAOn 2QQBA 1RI0A 2DD4A 2XDPA 3HRUA 2RPNA 1C1AA 3UWNA 4ZNXA 1OULA 4JZ3A 4C92D 4BD3A 5CR2A 2X35A 5DM7R 2A7YA 1VQ7A 5M9OA 3CBOA 4ZGJB 4N0AA 2FPDA 2KR3A 2K3BA 5GANg 2LMJA 1EZZB 1QW1A 4ZN3A 2QQSA 4DQ2A 1RAFB 4CC4B 4J6XA 3CC7Q 2RQRA 1FYNA 1PNJA 1WJSA 2LZ6B 3BFMA 1TUDA 3FDRA 3EGUA 8AT1B 3S3NA 4PJJA 3Q1JA 5ECAA 2QDYB 1G2BA 2VYTA 2DXBA 3CC2Q 3QYGB 1WQWA 3UATA 3A1PA 2DIQA 4OGCA 1JRIA 1OPKA 2MF2A 2D6FA 4B9WA 1FXXA 2JVVA 2E65A 3TVTA 5LJ5e 3I35A 1VQ4Q 3VS4A 1VQ8T 2CZ1B 3G71T 1TS9A 3JB9J 1Q86C 3GOXA 1NJIU 2GGRA 4IIOA 4DBFA 5FWCA 3CD6Q 2CUDA 3G6ET 3J7AF 3S6WA 1I1JA 4E6RA 4F17A 2GCXA 2LJ3A 2EQKA 2K57A 1ZUUA 2NUTB 2NUZA 4J9EA 2J6OA 5HK3A 2ABLA 1VYUA 1VQ8A 4E7SA 4ORZA 3G71A 4C0DC 2PUKB 5HK0A 1GFCA 1K0SA 1PSEA 1NG2A 3A8HB 3G6EA 4YTLA 1D1CA 1W4SA 4M75C 1X43A 4M75A 4MZTA 3SDZA 1HXDA 3C94A 2KBTA 5KYWA 2K79A 4ESRA 3OYKA 4BACA 2AKLA 1K9MR 3CCEA 2KRSA 4KT0E 5LJ5f 4BI8B 1O75A 3V8JA 3A8LB 4QW2A 5IN1A 1WXBA 1CKAA 2BE7D 3G1JA 1YJWQ 1JQQA 1GRIA 2B8AA 5HKCA 4PK4A 1VQKQ 1I0CA 4ZTFA 2EKOA 5GMKj 4KUIA 2V8KA 1HSQA 1K0XA 2ECZA 2FZKB 1WLPB 3OMCA 3PIPA 4KGVB 3H41A 1YJ9T 1E7OA 2KXCA 2WSFE 2QEXQ 2RQWA 3R6NA 1VQ5T 4C8QD 2A08A 2QTVA 2FZGB 1UHFA 1D1BA 1YP5A 4OVAA 1VQOQ 3CCRT 3JCMe 4M75E 2EYQA 2AZSA 3CCSQ 2F2XA 1TXQA 3L1AA 2DTHA 2L5QA 3G7ZA 2R5AA 1YJ9A 4C5GA 2HAXA 4MZPA 1KC8C 3REBB 1D0ZA 5DLQE 4JRIA 2CSIA 2DZ9A 3EHQA 3HRTA 4O6JA 1VQ5A 3CCQQ 4EPCA 2YHTA 1NPRA 3JB9F 1Z9ZA 2L3SA 5LJ3j 2QYZA 3OYJA 3THKA 1WXTA 3CCRA 1F1BB 2KI7A 3JB9G 4IKFA 4QQDA 4D8DA 1Y96B 4HCZA 1ZX6A 1VIFA 4OB0B 1WYXA 4BI3A 2Y4YA 3A8OB 4OP0A 4EMGA 4QVCA 4OMMA 1KD1R 1QWEA 1GCPA 3VS5A 2H3JA 1CSKA 2EFIA 3JCMf 3UA7A 4PJOB 1VUBA 3OW2P 3VYHB 3AT1B 1PKSA 4X9CA 1T0JA 3LLRA 3M4GA 2KAFA 1XOVA 1OZ2A 3JRZA 2OTLQ 5FU7C 4M7AD 1KQSA 3GBQA 5GAN7 4D8KA 4ELZC 1VQLQ 2J6FA 2BE9B 3VRZA 2MYSA 1S72Q 2EWNA 4WTOB 4LN2A 4M4ZA 5IHKA 3VS6A 1Y57A 4UC4A 2QGFB 5KYXA 5CKBA 2VC8A 3FJPA 1TWBA 4RKUE 3EFSA 2I2LA 1QKWA 1M90R 1RABB 2QA4Q 5L23A 2XK0A 4R55A 2D1XA 1M3CA 3H0HA 3M0SA 1XTDA 1BU1A 3HRSA 3HSBA 2J6KA 5GAMe 5GAN2 1U5SA 7AT1B 4J9DA 3JAME 2LJ1A 1VQ6Q 2M1HA 1BI1A 2EGAA 1BKBA 1TU0B 3VV0A 2FRYA 2FL7A 1H641 4F16A 3FIFA 2DD5A 2QTXA 1T3SA 1W2BA 1WFWA 1OI1A 4FYVB 2OAUA 4X1VA 2HEQA 2CDTA 1RLQC 1K9MC 1IGQA 3JCMP 2PNIA 4XQ3A 4KGZB 5KYNA 1QVFP 2ENMA 1M27C 3PE0A 1B3QA 3DB3A 4RTZA 2RHIA 3MP1A 1YIJT 3O5ZA 2F69A 3RNJA 2FEIA 3MEUA 3RIRA 5GAMf 2Y4XA 4JJNK 4M77A 2E5QA 3VS2A 1N27A 4AG1C 3BE3A 1K4US 2OJ2A 1YITT 1QQJA 2LVMA 3QWYA 3CC4T 2DZCA 4M77F 4PL6A 3U23A 4DBHA 3SWNA 2R58A 3EH1A 2KDSA 2P0QA 1FMWA 1B07A 3FC3A 2JS2A 3G4SQ 2DF6A 1QVGP 1YITA 1ZLMA 3EG1A 3CC4A 2Z0WA 2RJEA 4HVVA 2KK4A 1R8OB 4EMKC 2DXCA 4M78C 2O31A 2EAYA 4EMKA 2EQIA 1GXIE 1IGUA 4ZGEB 2MAMA 2YUPA 1I5LA 3NHNA 3N5BB 2CP6A 1T0HA 1JO8A 3CCUT 2LQKA 2EYWA 1UJ0A 2A36A 1BI2A 1RAAB 1R77A 2YSQA 3CCMQ 4C0DB 2DPPB 2YT6A 1YWPA 2GTOA 2KYMA 1MV0B 1KHCA 1VA7A 1B34A 4Y28E 1UGSB 1SRMA 3ZBDA 3E9FA 1VYTA 1G3SA 1HJDA 4M7DA 4M75B 4Z88A 2RN8A 1BI0A 1PD1A 5D6WA 1QVPA 1EFNA 1V1CA 1KD1C 2L3RA 2LCCA 5KYWB 3CCUA 1Q81R 5GAOm 4LE9A 5I2MA 3EAEA 4KH1B 2VXFA 1YI2Q 1PD0A 1AEYA 4X34A 2FYKA 2RNAA 4E7LA 4EIKA 3V7CA 2EQUA 2JOYA 1WHMA 1QKXA 2EQMA 2MPXC 2KROA 2X3WD 2HCKA 1KJWA 2E1HA 1G5VA 3OBYA 1TUCA 2J7IA 5KCHA 3QJ6A 1Q86U 2DJQA 2LNVA 2LTOA 2VKNA 1VQPT 4LDWA 1IO6A 3CPWP 3TSZA 3M0RA 2XMFA 3MPUB 1WX6A 4MMKA 1TOVA 4XTYA 1M90C 2QAZA 2VGNA 2JTMA 3QZ5B 3L42A 5LJ5h 4M7DE 4RMOA 3H6ZA 4XU0A 4AFUC 1X6BA 2AZVA 2SRCA 1VQPA 1WHGA 4LNPA 3UPUA 1W70A 3QYHB 1QVFS 1GBQA 3LWHA 5CKHA 1KG1A 3BDUA 2LJ0A 2KNBB 3TU4K 1ARKA 3X24B 2RHXA 2ZPBB 5CCAA 4PFPA 3CC7T 1I8FA 3BDLA 5GAN5 1DJ7B 4AFZC 4F04B 1AWOA 2J05A 2XKOC 2BKDN 2HD0A 3I55Q 3JCMb 2LC4A 3LX7A 4ZN1A 1TG0A 6AT1B 1UG1A 4FSXA 2PVOB 2BZYA 2VV5A 1VYVA 2O4XB 3AHUA 2DBMA 1GL5A 4E7HA 5CO7A 4LD6A 3OYHA 5GANe 1AWWA 3CC2T 3CC7A 3EG3A 3V7RA 2WSEE 1N6AA 4KULA 2P0PA 1NPPA 1YHQQ 3C0CA 2X3XD 1QVGS 4E47A 1BCMA 3M59A 5GAN6 1KQSS 2P4RA 1YBYA 2KT8A 1VQ4T 3H9NA 5FU7B 2COYA 1AZGB 4C92F 2M0YA 2DM1A 2COZA 5CKEA 3CC2A 3LGLA 5GMKi 1KC8U 2JMCA 1MMGA 5KE2A 2LQ8A 1Q82U 4JRKA 1VQ4A 3J80E 4Z02A 2QK0A 4FIBA 2DILA 3D7SB 3JCMh 3OBWA 4J9HA 5GANf 1BIAA 3EGXA 1R0BG 2K6DA 3OYIA 3OYLA 1Q82R 3CD6A 1XQHA 1NM7A 5IHIA 2LT4A 1X6OA 2WACA 2L3PA 2QQAA 4NL3A 3KXTA 1M1GA 3QG1A 5D6YA 1MMDA 3EFOB 2OTJQ 1K73R 3OYGA 1YJWT 4N0AC 4F7UF 4PJOD 2EKHA 2KQWA 1VQKT 1YFNA 3CQTA 4JUVA 1UTIA 2R57A 1X69A 4F7UG 3OA6A 1M1FA 3I56Q 2ZAEA 3VU3C 4F14A 1NBEB 3L2UA 4BY6C 3NTIA 1Q81C 4Z89A 4XTZA 4AT1B 3GF5A 5J26A 4AMCA 3CPWS 1W6XA 2QEXT 1YJWA 3EH2A 1VQKA 2ZPGB 1Q7YR 3VS7A 2ROLA 1VQOT 3BY7A 1UGQB 3DB4A 4V2SA 1I07A 2DMOA 3CCST 4Q5WA 1RACB 2G3RA 2HDAA 2EGEA 2QEXA 2JS0A 1M2VB 4ZTJA 2EQJA 3INZA 2K2VA 2IIMA 5KCOA 4JS4A 4IUPA 2MWOA 3CCQT 2D8JA 2HQHA 1VOMA 4HT8A 3QDFA 3LW5E 4WF2A 3OSSC 3VJPA 1VQOA 5CK9A 1RAHB 3RKXA 2XDDA 4NS5A 1SHGA 1WGSA 3CCSA 2DEQA 4OF1A 4QVZA 2QG9B 4O5VA 2M9UA 3WXMB 4EMKB 4J7IA 4M78B 5GAMh 1M9SA 3E9GA 3HHTB 1B7TA 1Y07A 3CCQA 2YUOA 1S1NA 3WVDB 3CCET 3UF4A 5KE3A 2HSPA 4GLMA 1OV3A 2DBKA 1K9MU 2DNUA 2D0QB 1FX7A 1UHCA 5I21A 3SB2A 2O9SA 4C8QF 4A4HA 4PJNA 3H8ZA 1UECA 2YRCA 1RUWA 1B34B 4C8QG 3PT9A 1OQKA 2HMAA 1JJ2A 2JTEA 3ZFJA 1K1ZA 1ZA2B 4HCCA 3CXCA 5LJ5j 3QPHA 1S72T 2O2OA 2YDLA 2KSSA 2M16A 4ATOA 2OX7A 2CZ0B 4HVWA 1ZHIA 3VYGA 2FPFA 3NFCA 5C0MA 3RESA 4QQGA 1JB0E 2P4TA 1E6GA 2YWWA 2GQIA 2HNIA 2RHUA 1QP2A 1VQLA 1AWXA 1S72A 1KK7A 1RLPC 2BZXA 3CEYA 4A54A 4LUDA 3EGDA 2DX1A 1NEBA 1VQ6T 2E12A 4OB3B 2JW4A 1U06A 4LUEA 3X28B 2BTTA 3L2WA 4BI4A 3RERA 1FMVA 2QA4A 1C6VX 4IIMA 3ULRB 2LQWA 2RB6A 2LNHB 3LWIA 1MGQA 3GIBA 1PWTA 2MOXA 4II1A 3CCLQ 1Q82C 3NTHA 4DA4A 4JJBA 1PSFA 4BE0A 4M7AF 3IQLA 1VQ6A 2LCLA 5A0GA 2KT1A 1QMCA 4M7AG 2EYYA 1BCOA 4FSSA 2JZ2A 2EJGA 5KYUA 3QXEB 1ZSZA 1KD1U 1M3AA 1P92A 4M75D 3QIIA 4J9GA 1K73C 4OB2B 5GANd 2RF0A 2DKGA 5DY9A 2E5KA 2RHZA 4JRQA 5KYYA 4DEXA 2DL8A 4J8OA 1UUEA 3GNFB 3EG9A 4IURA 4J9FA 3TREA 1IZ6A 4CC3A 5KH6A 3M54A 4KBMB 1YN8A 5CQXA 5I11A 1JXMA 1VQNQ 3JB9H 2VXEA 1OX9A 4FM4B 2FG0A 2K9GA 1O9SA 3T9NA 1YNZA 3A8GB 2DVJA 4C0FA 3G4ST 5LJ3g 2V8IA 3MP8A 4RTUA 3JV3A 1YCYA 1BIBA 3HKSA 3OSVA 1M90U 3X25B 1LOJA 3C95A 1OOTA 3RMQA 2IG0A 4CI0C 2L3QA 2LT1A 4BDYA 4KUDK 4XTXA 4RCCA 2FZCB 1R0CB 2LRQA 1ZBJA 2VB6A 3MCAB 4XU3A 4XTWA 3EG2A 2A0FB 3G4SA 1OX8A 2DTIA 2GNCA 1X2KA 2M51A 1KIKA 3RKYA 1H92A 3JCMW 2DL5A 3OYDA 4EMHA 1PRMC 3CCMT 3QHSA 1V29B 3EGXB 1M8VA 1OU9A 4JS5A 2FRWA 5CKFA 1WXUA 1UDLA 4FT2A 1TUGB 3E19A 3JCMQ 4OMQA 1PC0A 2J06A 5EG2A 3VS0A 2CGHA 1G3YA 4PKCC 3CCMA 3CCJQ 1YI2T 2L89A 1VQ9Q 2DFUA 2QASA 1H8KA 4FW2A 4C0GA 3ZL7C 2AKKA 3H0IA 1G3WA 2KVQG 4A4FA 1TTHB 2RM4A 3PVQA 4E7KA 2W0ZA 2V26A 4BY6B 4M77C 4PFZA 5GAMj 5GANh 2KE9A 1I5OB 1YI2A 2FVUA 1I81A 4DBRA 5FRMA 2LX7A 1GCQA 2K3YA 2DVEA 2NWMA 5LJ5d 2PUOB 2ZPHB 3NGPA 4MDWA 4L5GA 2DE0X 3SWNC 4A63B 4B6MA 1JU5C 3OYMA 4RTWA 3M0PA 4N4GA 3SFMA 4DOVA 4LDVA 2JMAA 2CH4A 1W1FA 3CPFA 4BUGA 1UE9A 2HL3A 4L59A 1TSFA 1Q95G 1K8AU 2H3EB 3L2VA 1KQSP 3CMEQ 1CKBA 2C0TA 2FHDA 2MMPA 5GAOq 1SHFA 3LGFA 1K8AR 1E6HA 4EDUA 3I55T 2EVRA 4XU2A 4M77E 1ZUKA 3X26B 2VVKA 3NTKA 3M5AA 2RI5A 3QKJA 3CBPA 3GPLA 1Q81U 2NUTA 1BBZA 3LYIA 1MMAA 5GAN3 1OEBA 1YCSB 1EX4A 1IB8A 4M7DC 2RI3A 5IH2A 1YHQT 1J3TA 3I55A 1JJ2S 2YXYA 2HL5C 2HBWA 3EFRA 2ROTA 2DXUA 2XU8A 2E6ZA 2ZPFB 2E70A 2DL4A 2RD1A 4M78G 4JLIA 3HFOA 4QQ6A 2JT4A 3ZEHA 1NE8A 2HQEA 5C6SA 2VGMA 1W2BP 3DKMA 2L8DA 5GAN8 1YHQA 2DYIA 2CUBA 2CZ6B 4RTTA 2MWPA 5GJWB 3RBBB 1YWOA 4OMOA 2EJ9A 1RL2A 3JCMc 4RTVA 3DLMA 4RTYA 2K7AA 2L2PA 4A4GA 5CKDA 2FO0A 3JCMd 2KGTA 2HBPA 2HZYA 3FRNA 4OB1B 3M55A 4BDZA 3CMAQ 3PGGA 1JEGA 2MI6A 3EGDB 1ZQ1A 2DIGA 1KQ2A 1NYGA 3TQ7P 1YIJQ 1HK9A 4M78D 1IXDA 3FB9A 1D3BA 2EYXA 4AG2C 2X4XA 3P8BB 1AVZC 3PNWC 1M30A 1M1KU 2OTJT 1ZBXA 1YJNQ 2ED1A 4E7ZA 2ZPIB 4N4HA 1SRLA 4J6YA 5GAOl 2F5TX 2KEAA 2CS7A 2RQUA 3V7SA 1M1KR 3I56T 2EJFA 5HY6A 4PFOA 1OZ3A 2GFUA 2OTJA 3PTAA 4J5YA 5I22A 1Y96A 3VUZA 1KFZA 1ABOA 1PG5B 1RAIB 2CP5A 3I56A 1WQ7A 1MMNA 3HL8A 4DEYA 3FLGA 2GBQA 4C92C 1NZ9A 4C92A 1KQ1A 1OPLA 2DETA 2D8HA 3RUXA 1NEGA 1IHWA 3GLXA 1T3LA 4P5NA 1LNXA 1U1TA 3VKIA 2LX9A 1Y7XA 1AHJB 4E7IA 3CD6T 4J7FA 4PJOF 2OI3A 3QO3A 3UT1A 3URGA 2QQ9A 1EIFA 5KYXB 4E2FB 5GAMd 4OMFB 2P0KA 1U8RA 3QDRB 4PJOG 5LJ3h 5IXBA 1AT1B 1ZSGA 5GMKl 2LQNA 1OU8A 2SEMA 1FMKA 5CIUA 1QCOA 3MEWA 3OYYA 1K76A 1WHKA 5IXFA 5GANj 2ATCB 1UGPB 2CKKA 2ZCFB 4HT9A 1K8AC 1N9SA 4C92E 4N4IA 1K73U 3V8LA 4F7UA 4JPBW 4C0ZA 4JLGA 3PMIA 2V1RA 2O88A 2XDBA 4D6WA 1WNLA 1AWJA 2RQVA 4AFQC 1W2BS 1WIEA 4HKEA 3QBYA 2K5LA 2DJZA 1X01A 2JN0A 2FB7A 2CYZB 2BZ8A 4LXCA 1Q7YU 4J83A 3HFNA 4J9CA 4R0KA 3M58A 5GAOp 4ELYC 5CVIA 3M0UA 4NL2A 2A37A 4K11A 4M77B 2PU9B 4C5HA 2JM8A 4WCIA 2GF7A 3OYAA 3GP8A 1K9AA 3ME9A 4F7UE 3SWNB 2RQTA 1VQMQ 4RTXA 2CP3A 3OMGA 2E3IA 1BYMA 5D6XA 2A3LA 5AT1B 3CCLT 1BK2A 3HPWA 1LCKA 2ED0A 3OYFA 5A0LA 2KMTA 2C0IA 2KYBA 3OYNA 1RAGB 1UFFA 3F70A 2W10A 3ER0A 2COWA 3OB9A 2H8HA 2DL7A 2HSEB 2C0OA 5EC7A 3CCVQ 2HKNA 4HXJA 4C8QC 1X75C 4C8QA 4CC7A 3CCLA 5FU6C 1LPLA 4HCBA 4C5EA 4HA8A 4LDYA 1HYOA 1WJRA 1M1KC 5L8RE 2DYBA 3JCMJ 5GMKe 1AD5A 1JXOA 2YRDA 1NJIR 1VQNT 3MJXA 3RKWA 1LVKA 3OW2A 2OTLT 2I0NA 2DERA 1D0XA 3NPFA 4M7DB 2X9HA 1VQLT 2X4YA 1VQ7Q 4R56A 4BB7A 3L2RA 3GNGA 2DRMA 2DK3A 3M57A 3SEMA 1FWZA 3NMZC 5A2QE 3L2QA 1VQNA 1ZA1B 2RH2A 1QP3A 1G3TA 3I5SA 1QCNA 5CQYA 2OTLA 1G83A 1WPYA 4C8QE 2AIRB 5D7UA 2QA4T 4M75F 3E1SA 4IUTA 1M2OA 3JCMV 3S3OA 1RI9A 2RI2A 3MP6A 4XAXB 3OS0A 1WA7A 5LJ3e 1SKUB 4TVRA 2DA9A 1RAEB 4M75G 1GBRA 4LD9K 1PM3A 3TSWA 2HKQB 1WJQA 2GFAA 4M7AC 4M7AA 3KBGA 2VWFA 5FWBA 2AK5A 2QDLA 4FW1A 2F2VA 5LJ5g 3M56A 1SSFA 9ATCB 2XIDA 2V1QA 1WHLA 1D09B 1D3BB 1LJOA 3JCMX 1PHTA 4E7JA 3CCJT 4RG2A 1VQ9T 1C0MA 1UB4A 1KSWA 3QWXX 2K2MA 1ZSZC 2RJFA 8ATCB 2K5FA 4J6WA 2RJCA 2O9VA 1QVFA 1VQ8Q 1SG5A 3G71Q 5LJ3f 2CREA 3SD4A 3CCJA 4PJLA 1M5Q1 3PIOA 1VQ9A 2O01E 4J9BA 2ZPEB 3G6EQ 1WI7A 2E64A 1N5ZA 3LH0A 4A53A 2YUNA 3OS2A 3M0QA 1AOJA 4M7AE 3WVEB 2RO0A 3TEEA 2DL3A 3RR6A 2EBPA 3CCEQ 2NUPA 4C92B 1PKTA 2O4XA 1OYXA 2AHJB 1Q7YC 2V8JA 3M4YA 4FT4A 2OAWA 2GTJA 1SSHA 1U3OA 4OMNA 5IAYA 2JJ9A 2D0NA 1JJ2P 3P8HA 3CXCP 3CMET 4FCYA 1N9RA 1QVGA 1N8RU 1H3ZA 4KH0B 1M8MA 4GBQA 2CZ7B 1BB9A 2LCSA 3SHWA 3JB9D 2E4HA 4ANJA 4GY5A 2YRVA 1ABQA 2B86A 3QZ9B 1M4ZA 1N8RR 2QGGA 2GQVA 2EW3A 3ASKA 3PVLA 3CMEA 3JCMg 2RK1A 4RCBA 4DBQA 1WHJA 2BUDA 2A28A 2XHCA 1MV3A 2XICA 1YJ9Q 4J9IA 2CT3A 2QI2A 1WDXA 3RDVA 4F7UB 2QQRA 2EIFA 1VQ5Q 2XI9A 3I5RA 4MZMA 5HCKA 3A5ZB 4PLLA 3I9QA 2XG8D 5AYFA 3J81E 2RA2A 3UDCA 3CCRQ 1NJIC 1UGRB 1X27A 2JUFA 1UEBA 2CSQA 3JB9I 2JNGA 5LL6S 4FYWB 2ESWA 2LDMA 3EFOA 1MUZA 1ZUYA 4JDSA 2G6FX 1KHIA 2PVGB 1NLPC 1Z9QA 3S3MA 2DEUA 1QLYA 4LDXA 3QJYA 2NYSA 1RADB 3OQ5A 2E3HA 1JBMA 2K3XA 3CMAT 1HD3A 4GLKA 2DO3A 3X20B 1GCQC 3RMSA 2NLUA 3CPWA 3LH5A 2IVWA 4PLIA 2L0AA
chains in the Genus database with same CATH topology
1Z9ZA 2L3SA 1SEMA 3THKA 1WXTA 1I07A 2DMOA 3H0FA 1PRLC 2HDAA 4D8DA 1ZX6A 2EGEA 2JS0A 5I22A 2IIMA 1WYXA 1KFZA 1ABOA 2D8JA 4OMMA 4DEYA 4OMLA 2GBQA 1QWEA 1GCPA 3VS5A 1SHGA 4QT7A 1CSKA 1OPLA 2DRKA 2D8HA 3UA7A 3EG0A 1NEGA 2PTKA 1QCFA 1PKSA 1T3LA 2JXBA 3FJ5A 1T0JA 2DLPA 5FW9A 1XOVA 2YUOA 1S1NA 3UF4A 2JM9A 2HSPA 4KRTA 3GBQA 4AFSC 4D8KA 4GLMA 1OV3A 2J6FA 2YUQA 3VRZA 2DBKA 2DNUA 2OI3A 1UHCA 4LN2A 4M4ZA 5IHKA 2O9SA 3VS6A 4CC2A 1Y57A 1UECA 1RUWA 5IXBA 1ZSGA 2LQNA 4HVUA 2JTEA 1K1ZA 1FMKA 1M3BA 2SEMA 1QKWA 1K76A 5IXFA 5L23A 2O2OA 2YDLA 1X6GA 2D1XA 1M3CA 3H0HA 3M0SA 1BU1A 4HVWA 2J6KA 3UA6A 4RUGA 2FPFA 1U5SA 4J9DA 2LJ1A 1NYFA 4JPBW 2EGAA 2V1RA 2O88A 1E6GA 2FRYA 2GQIA 2CH4W 1AWJA 2RQVA 4Y92A 3VRYA 1AWXA 4AFQC 4F16A 1RLPC 1GFDA 1WIEA 2EPDA 2BZXA 4LUDA 2KRNA 2DX1A 1NEBA 1T3SA 1WFWA 4JJDA 2JW4A 3A98A 1U06A 2BZ8A 4LUEA 4X1VA 2BTTA 2HEQA 2CDTA 1RLQC 4J9CA 4R0KA 5IHNA 2PNIA 4IIMA 2ENMA 3ULRB 2LQWA 3M0UA 1QWFA 3KFVA 1M27C 3M0TA 2LNHB 3PE0A 1B3QA 1SPKA 1PWTA 2A37A 2KXDA 2MOXA 4K11A 2FPEA 4RTZA 4JJBA 3O5ZA 2JM8A 2FEIA 4WCIA 3RNJA 3IQLA 2KT1A 1H3HA 1K9AA 1UGVA 3VS2A 2MCNA 4AG1C 1A0NB 2EYYA 4FSSA 1K4US 2PZ1A 2OJ2A 1M3AA 3QWYA 2RQTA 4RTXA 4J9GA 3U23A 1BK2A 4JJCA 1LCKA 2ED0A 2RF0A 2E5KA 1B07A 2C0IA 2KYBA 2DL8A 2LP5A 4DEXA 1UUEA 2JS2A 1UFFA 4J9FA 4Z8AA 2KRMA 2DF6A 2W10A 4CC3A 2RMOA 2H8HA 1YN8A 2DL7A 5EC7A 2C0OA 1ZLMA 3EG1A 1JXMA 5I11A 4HXJA 4HVVA 4OMPA 4CC7A 4HCKA 2O31A 1X2QA 2FG0A 2EQIA 2K9GA 2CT4A 1YNZA 2YUPA 2DVJA 3NHNA 1T0HA 4RTUA 3JV3A 2DYBA 1JO8A 2EYWA 1UJ0A 1AD5A 3EHRA 2A36A 1JXOA 1OOTA 1UJYA 3VS1A 2L3QA 2YSQA 2YT6A 1YWPA 2GTOA 2KYMA 5GJVB 1MV0B 1VA7A 2I0NA 4JZ4A 2EYZA 3NPFA 1Y0MA 1ZBJA 1SRMA 2F2WA 1VYTA 3EG2A 1HJDA 4Z88A 2RN8A 1V1CA 1EFNA 2GNCA 2MIOA 2DRMA 1X2KA 2M51A 3SEMA 1KIKA 3NMZC 1H92A 2DL5A 2EGCA 1PRMC 4LE9A 3I5SA 3REAB 1G83A 1AEYA 2FRWA 2RNAA 1NLOC 1AZEA 4EIKA 1WXUA 1UDLA 1RI9A 3VS3A 1QKXA 2X3WD 2KROA 2HCKA 1KJWA 1WA7A 2DA9A 4OMQA 2J06A 2RPNA 3VS0A 1GBRA 1TUCA 2J7IA 3TSWA 2DJQA 4ZNXA 4JZ3A 2VKNA 1IO6A 1H8KA 2VWFA 5FWBA 2AK5A 3TSZA 3ZL7C 3M0RA 2QDLA 2AKKA 2XMFA 2F2VA 1WX6A 2FPDA 3H0IA 2KR3A 2K3BA 2V1QA 2LMJA 3PVQA 2W0ZA 4CC4B 1PHTA 2RQRA 1FYNA 2KE9A 1PNJA 4AFUC 2LZ6B 1X6BA 2AZVA 2SRCA 1KSWA 3QWXX 2K2MA 4LNPA 1W70A 1TUDA 1GBQA 3EGUA 2LX7A 1GCQA 2NWMA 2LJ0A 2KNBB 3NGPA 4A63B 2DE0X 1ARKA 2O9VA 5ECAA 1JU5C 1G2BA 4RTWA 3M0PA 2CREA 4AFZC 1AWOA 3UATA 2J05A 2JMAA 2CH4A 1W1FA 4J9BA 1OPKA 1WI7A 1N5ZA 1TG0A 1UE9A 2YUNA 3M0QA 1AOJA 1UG1A 3TVTA 2BZYA 3I35A 1VYVA 1CKBA 2C0TA 2DBMA 2DL3A 1GL5A 3VS4A 2EBPA 1AWWA 1SHFA 1PKTA 1E6HA 3EG3A 2OAWA 2GGRA 4IIOA 2GTJA 5FWCA 2CUDA 2EVRA 3C0CA 1SSHA 1U3OA 2X3XD 4OMNA 1I1JA 2D0NA 1ZUKA 4E6RA 2VVKA 4F17A 2LJ3A 2P4RA 1ZUUA 2NUZA 2KT8A 4J9EA 2J6OA 1AZGB 2ABLA 1VYUA 1M8MA 4ORZA 4GBQA 2M0YA 2DM1A 1BB9A 2LCSA 3SHWA 1BBZA 1GFCA 1K0SA 1OEBA 1NG2A 1YCSB 5IH2A 1ABQA 1J3TA 2B86A 2JMCA 2HBWA 1X43A 2EW3A 2ROTA 3PVLA 2KBTA 2K79A 4ESRA 2AKLA 2DL4A 2A28A 2KRSA 2JT4A 1MV3A 2DILA 4J9HA 4J9IA 1WXBA 1CKAA 2CT3A 2K6DA 1JQQA 1WDXA 1GRIA 1NM7A 2CUBA 1I0CA 5IHIA 4RTTA 3I5RA 5HCKA 5GJWB 3RBBB 1YWOA 2L3PA 3I9QA 4OMOA 4RTVA 4RTYA 2K7AA 2L2PA 2FO0A 2KGTA 1X27A 1HSQA 1K0XA 2ECZA 1WLPB 2CSQA 3H41A 1E7OA 2KXCA 1JEGA 2ESWA 2RQWA 2EKHA 1MUZA 1ZUYA 3R6NA 3CQTA 1UTIA 2A08A 2G6FX 1X69A 1NLPC 1NYGA 1UHFA 1YP5A 1Z9QA 1QLYA 4F14A 4Z89A 2EYXA 4AG2C 1AVZC 1M30A 2AZSA 2F2XA 1HD3A 2ED1A 1W6XA 3REBB 1SRLA 1GCQC 2CSIA 3EHQA 3LH5A 2KEAA 2RQUA 3VS7A 2ROLA 2L0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9Z A;  2L3S A;  1SEM A;  3THK A;  1WXT A;  1I07 A;  2DMO A;  3H0F A;  1PRL C;  2HDA A;  4D8D A;  1ZX6 A;  2EGE A;  2JS0 A;  5I22 A;  2IIM A;  1WYX A;  1KFZ A;  1ABO A;  2D8J A;  4OMM A;  4DEY A;  4OML A;  2GBQ A;  1QWE A;  1GCP A;  3VS5 A;  1SHG A;  4QT7 A;  1CSK A;  1OPL A;  2DRK A;  2D8H A;  3UA7 A;  3EG0 A;  1NEG A;  2PTK A;  1QCF A;  1PKS A;  1T3L A;  2JXB A;  3FJ5 A;  1T0J A;  2DLP A;  5FW9 A;  1XOV A;  2YUO A;  1S1N A;  3UF4 A;  2JM9 A;  2HSP A;  4KRT A;  3GBQ A;  4AFS C;  4D8K A;  4GLM A;  1OV3 A;  2J6F A;  2YUQ A;  3VRZ A;  2DBK A;  2DNU A;  2OI3 A;  1UHC A;  4LN2 A;  4M4Z A;  5IHK A;  2O9S A;  3VS6 A;  4CC2 A;  1Y57 A;  1UEC A;  1RUW A;  5IXB A;  1ZSG A;  2LQN A;  4HVU A;  2JTE A;  1K1Z A;  1FMK A;  1M3B A;  2SEM A;  1QKW A;  1K76 A;  5IXF A;  5L23 A;  2O2O A;  2YDL A;  1X6G A;  2D1X A;  1M3C A;  3H0H A;  3M0S A;  1BU1 A;  4HVW A;  2J6K A;  3UA6 A;  4RUG A;  2FPF A;  1U5S A;  4J9D A;  2LJ1 A;  1NYF A;  4JPB W;  2EGA A;  2V1R A;  2O88 A;  1E6G A;  2FRY A;  2GQI A;  2CH4 W;  1AWJ A;  2RQV A;  4Y92 A;  3VRY A;  1AWX A;  4AFQ C;  4F16 A;  1RLP C;  1GFD A;  1WIE A;  2EPD A;  2BZX A;  4LUD A;  2KRN A;  2DX1 A;  1NEB A;  1T3S A;  1WFW A;  4JJD A;  2JW4 A;  3A98 A;  1U06 A;  2BZ8 A;  4LUE A;  4X1V A;  2BTT A;  2HEQ A;  2CDT A;  1RLQ C;  4J9C A;  4R0K A;  5IHN A;  2PNI A;  4IIM A;  2ENM A;  3ULR B;  2LQW A;  3M0U A;  1QWF A;  3KFV A;  1M27 C;  3M0T A;  2LNH B;  3PE0 A;  1B3Q A;  1SPK A;  1PWT A;  2A37 A;  2KXD A;  2MOX A;  4K11 A;  2FPE A;  4RTZ A;  4JJB A;  3O5Z A;  2JM8 A;  2FEI A;  4WCI A;  3RNJ A;  3IQL A;  2KT1 A;  1H3H A;  1K9A A;  1UGV A;  3VS2 A;  2MCN A;  4AG1 C;  1A0N B;  2EYY A;  4FSS A;  1K4U S;  2PZ1 A;  2OJ2 A;  1M3A A;  3QWY A;  2RQT A;  4RTX A;  4J9G A;  3U23 A;  1BK2 A;  4JJC A;  1LCK A;  2ED0 A;  2RF0 A;  2E5K A;  1B07 A;  2C0I A;  2KYB A;  2DL8 A;  2LP5 A;  4DEX A;  1UUE A;  2JS2 A;  1UFF A;  4J9F A;  4Z8A A;  2KRM A;  2DF6 A;  2W10 A;  4CC3 A;  2RMO A;  2H8H A;  1YN8 A;  2DL7 A;  5EC7 A;  2C0O A;  1ZLM A;  3EG1 A;  1JXM A;  5I11 A;  4HXJ A;  4HVV A;  4OMP A;  4CC7 A;  4HCK A;  2O31 A;  1X2Q A;  2FG0 A;  2EQI A;  2K9G A;  2CT4 A;  1YNZ A;  2YUP A;  2DVJ A;  3NHN A;  1T0H A;  4RTU A;  3JV3 A;  2DYB A;  1JO8 A;  2EYW A;  1UJ0 A;  1AD5 A;  3EHR A;  2A36 A;  1JXO A;  1OOT A;  1UJY A;  3VS1 A;  2L3Q A;  2YSQ A;  2YT6 A;  1YWP A;  2GTO A;  2KYM A;  5GJV B;  1MV0 B;  1VA7 A;  2I0N A;  4JZ4 A;  2EYZ A;  3NPF A;  1Y0M A;  1ZBJ A;  1SRM A;  2F2W A;  1VYT A;  3EG2 A;  1HJD A;  4Z88 A;  2RN8 A;  1V1C A;  1EFN A;  2GNC A;  2MIO A;  2DRM A;  1X2K A;  2M51 A;  3SEM A;  1KIK A;  3NMZ C;  1H92 A;  2DL5 A;  2EGC A;  1PRM C;  4LE9 A;  3I5S A;  3REA B;  1G83 A;  1AEY A;  2FRW A;  2RNA A;  1NLO C;  1AZE A;  4EIK A;  1WXU A;  1UDL A;  1RI9 A;  3VS3 A;  1QKX A;  2X3W D;  2KRO A;  2HCK A;  1KJW A;  1WA7 A;  2DA9 A;  4OMQ A;  2J06 A;  2RPN A;  3VS0 A;  1GBR A;  1TUC A;  2J7I A;  3TSW A;  2DJQ A;  4ZNX A;  4JZ3 A;  2VKN A;  1IO6 A;  1H8K A;  2VWF A;  5FWB A;  2AK5 A;  3TSZ A;  3ZL7 C;  3M0R A;  2QDL A;  2AKK A;  2XMF A;  2F2V A;  1WX6 A;  2FPD A;  3H0I A;  2KR3 A;  2K3B A;  2V1Q A;  2LMJ A;  3PVQ A;  2W0Z A;  4CC4 B;  1PHT A;  2RQR A;  1FYN A;  2KE9 A;  1PNJ A;  4AFU C;  2LZ6 B;  1X6B A;  2AZV A;  2SRC A;  1KSW A;  3QWX X;  2K2M A;  4LNP A;  1W70 A;  1TUD A;  1GBQ A;  3EGU A;  2LX7 A;  1GCQ A;  2NWM A;  2LJ0 A;  2KNB B;  3NGP A;  4A63 B;  2DE0 X;  1ARK A;  2O9V A;  5ECA A;  1JU5 C;  1G2B A;  4RTW A;  3M0P A;  2CRE A;  4AFZ C;  1AWO A;  3UAT A;  2J05 A;  2JMA A;  2CH4 A;  1W1F A;  4J9B A;  1OPK A;  1WI7 A;  1N5Z A;  1TG0 A;  1UE9 A;  2YUN A;  3M0Q A;  1AOJ A;  1UG1 A;  3TVT A;  2BZY A;  3I35 A;  1VYV A;  1CKB A;  2C0T A;  2DBM A;  2DL3 A;  1GL5 A;  3VS4 A;  2EBP A;  1AWW A;  1SHF A;  1PKT A;  1E6H A;  3EG3 A;  2OAW A;  2GGR A;  4IIO A;  2GTJ A;  5FWC A;  2CUD A;  2EVR A;  3C0C A;  1SSH A;  1U3O A;  2X3X D;  4OMN A;  1I1J A;  2D0N A;  1ZUK A;  4E6R A;  2VVK A;  4F17 A;  2LJ3 A;  2P4R A;  1ZUU A;  2NUZ A;  2KT8 A;  4J9E A;  2J6O A;  1AZG B;  2ABL A;  1VYU A;  1M8M A;  4ORZ A;  4GBQ A;  2M0Y A;  2DM1 A;  1BB9 A;  2LCS A;  3SHW A;  1BBZ A;  1GFC A;  1K0S A;  1OEB A;  1NG2 A;  1YCS B;  5IH2 A;  1ABQ A;  1J3T A;  2B86 A;  2JMC A;  2HBW A;  1X43 A;  2EW3 A;  2ROT A;  3PVL A;  2KBT A;  2K79 A;  4ESR A;  2AKL A;  2DL4 A;  2A28 A;  2KRS A;  2JT4 A;  1MV3 A;  2DIL A;  4J9H A;  4J9I A;  1WXB A;  1CKA A;  2CT3 A;  2K6D A;  1JQQ A;  1WDX A;  1GRI A;  1NM7 A;  2CUB A;  1I0C A;  5IHI A;  4RTT A;  3I5R A;  5HCK A;  5GJW B;  3RBB B;  1YWO A;  2L3P A;  3I9Q A;  4OMO A;  4RTV A;  4RTY A;  2K7A A;  2L2P A;  2FO0 A;  2KGT A;  1X27 A;  1HSQ A;  1K0X A;  2ECZ A;  1WLP B;  2CSQ A;  3H41 A;  1E7O A;  2KXC A;  1JEG A;  2ESW A;  2RQW A;  2EKH A;  1MUZ A;  1ZUY A;  3R6N A;  3CQT A;  1UTI A;  2A08 A;  2G6F X;  1X69 A;  1NLP C;  1NYG A;  1UHF A;  1YP5 A;  1Z9Q A;  1QLY A;  4F14 A;  4Z89 A;  2EYX A;  4AG2 C;  1AVZ C;  1M30 A;  2AZS A;  2F2X A;  1HD3 A;  2ED1 A;  1W6X A;  3REB B;  1SRL A;  1GCQ C;  2CSI A;  3EHQ A;  3LH5 A;  2KEA A;  2RQU A;  3VS7 A;  2ROL A;  2L0A A; 
#chains in the Genus database with same CATH topology
 1SEM A;  2CP7 A;  1MNE A;  3MHX A;  2X51 A;  3A8M B;  3H0F A;  3CMA A;  1YJN T;  1PRL C;  2E41 A;  2RK2 A;  3E2U A;  5IT9 E;  2M02 A;  3OYB A;  2X4J A;  3QUI A;  3OYC A;  1M2V A;  3PMT A;  1YIJ A;  4M77 G;  5I2S A;  4OML A;  4DOW A;  2ZGW A;  3JSC A;  1BI3 A;  3C4S A;  4B9X A;  2VUB A;  4QT7 A;  3P8D A;  2DRK A;  5GAM g;  3EG0 A;  1YJN A;  2PTK A;  4C8Q B;  1XNI A;  1QCF A;  2JXB A;  3FJ5 A;  5FU6 B;  2DLP A;  5FW9 A;  2P84 A;  5A0D A;  2JM9 A;  4M78 A;  2M0O A;  1MND A;  4KRT A;  4AFS C;  3BW1 A;  2HQX A;  2YLC A;  1WHH A;  4ZGD B;  2YLB A;  4JRP A;  2RJD A;  2YUQ A;  4MML A;  3L2Z A;  4FYY B;  2BIV A;  3OY9 A;  2DXT A;  3OW2 S;  4CC2 A;  1ACM B;  3OS5 A;  4M78 F;  3CXC S;  2K5I A;  4M77 D;  1SF9 A;  4HVU A;  2RHY A;  1M3B A;  3VUB A;  4A4K A;  3MET A;  4XTU A;  4FL6 A;  2MK5 A;  1X6G A;  5LJ3 d;  3TCJ A;  5GAN 4;  3OS1 A;  3UA6 A;  4RUG A;  1U1S A;  2AT1 B;  3O8V A;  3HP9 A;  1NYF A;  1TH7 A;  1VIE A;  4M7D F;  2E10 A;  2CH4 W;  3VRY A;  1IRE B;  4Y92 A;  4PJM A;  4M7D G;  4M78 E;  1GFD A;  3KUF A;  4QVD A;  3HTR A;  2EPD A;  1MHN A;  1IRX A;  4A4E A;  2KRN A;  1G8X A;  1D0Y A;  1N8R C;  4JJD A;  4M7A B;  4X9D A;  3A98 A;  3R6O A;  2CP2 A;  1IHV A;  4OGE A;  2XD0 A;  5IHN A;  5GAO r;  1YIT Q;  3M53 A;  1QWF A;  3KFV A;  3M0T A;  2WSC E;  3MKD A;  3CC4 Q;  3FEO A;  1Q86 R;  2D9T A;  1SPK A;  5FLX E;  1I4K 1;  2KXD A;  2Y90 A;  1Y71 A;  5J39 A;  2R5M A;  2FPE A;  4FYX B;  5J3B A;  4LDU A;  1H3H A;  1UGV A;  5DLO A;  5KYU B;  2MCN A;  1ZSZ B;  4BE2 A;  1A0N B;  4M7D D;  4C5I A;  2F5K A;  2PZ1 A;  4L6V 5;  2F1L A;  2C06 A;  2X4W A;  5GMK h;  5FRN A;  5KYY B;  4JJC A;  1V76 A;  3EG9 B;  4KGX B;  3PFS A;  5GMK m;  1PCX A;  2LP5 A;  4NOY A;  5FRO A;  3OYE A;  4Z8A A;  2KRM A;  4ME7 A;  2RMO A;  3M9Q A;  3CCU Q;  4PJO C;  1VQM T;  2PQW A;  2KY9 A;  2NUP B;  2PVD B;  2K4Y A;  4PJO A;  4IUU A;  4OMP A;  3C12 A;  4HCK A;  4BE1 A;  3DLL A;  1X2Q A;  3MEA A;  2QXF A;  2CT4 A;  5CAI A;  2CP0 A;  2JTF A;  4FU6 A;  4XK8 E;  4CRI A;  2IPO B;  4RG8 A;  3EHR A;  4IUV A;  3CCV T;  2ZZD A;  1VQM A;  1UJY A;  3VS1 A;  2DAQ A;  3MEV A;  4Y91 A;  3MO8 A;  4XU1 A;  5GJV B;  4JZ4 A;  2EYZ A;  1Y0M A;  4C92 G;  1D1A A;  2F2W A;  2MIO A;  3CBM A;  1WZO A;  1XJW B;  3CCV A;  2EGC A;  2VAS A;  4VUB A;  4PNO A;  3REA B;  2E6N A;  2DTO A;  4IUQ A;  1KC8 R;  1VQP Q;  4PJO E;  3V8K A;  3QSU A;  4XTV A;  1NLO C;  1AZE A;  1VQ7 T;  4MDX A;  3VS3 A;  4QKU A;  5GAO n;  2QQB A;  1RI0 A;  2DD4 A;  2XDP A;  3HRU A;  2RPN A;  1C1A A;  3UWN A;  4ZNX A;  1OUL A;  4JZ3 A;  4C92 D;  4BD3 A;  5CR2 A;  2X35 A;  5DM7 R;  2A7Y A;  1VQ7 A;  5M9O A;  3CBO A;  4ZGJ B;  4N0A A;  2FPD A;  2KR3 A;  2K3B A;  5GAN g;  2LMJ A;  1EZZ B;  1QW1 A;  4ZN3 A;  2QQS A;  4DQ2 A;  1RAF B;  4CC4 B;  4J6X A;  3CC7 Q;  2RQR A;  1FYN A;  1PNJ A;  1WJS A;  2LZ6 B;  3BFM A;  1TUD A;  3FDR A;  3EGU A;  8AT1 B;  3S3N A;  4PJJ A;  3Q1J A;  5ECA A;  2QDY B;  1G2B A;  2VYT A;  2DXB A;  3CC2 Q;  3QYG B;  1WQW A;  3UAT A;  3A1P A;  2DIQ A;  4OGC A;  1JRI A;  1OPK A;  2MF2 A;  2D6F A;  4B9W A;  1FXX A;  2JVV A;  2E65 A;  3TVT A;  5LJ5 e;  3I35 A;  1VQ4 Q;  3VS4 A;  1VQ8 T;  2CZ1 B;  3G71 T;  1TS9 A;  3JB9 J;  1Q86 C;  3GOX A;  1NJI U;  2GGR A;  4IIO A;  4DBF A;  5FWC A;  3CD6 Q;  2CUD A;  3G6E T;  3J7A F;  3S6W A;  1I1J A;  4E6R A;  4F17 A;  2GCX A;  2LJ3 A;  2EQK A;  2K57 A;  1ZUU A;  2NUT B;  2NUZ A;  4J9E A;  2J6O A;  5HK3 A;  2ABL A;  1VYU A;  1VQ8 A;  4E7S A;  4ORZ A;  3G71 A;  4C0D C;  2PUK B;  5HK0 A;  1GFC A;  1K0S A;  1PSE A;  1NG2 A;  3A8H B;  3G6E A;  4YTL A;  1D1C A;  1W4S A;  4M75 C;  1X43 A;  4M75 A;  4MZT A;  3SDZ A;  1HXD A;  3C94 A;  2KBT A;  5KYW A;  2K79 A;  4ESR A;  3OYK A;  4BAC A;  2AKL A;  1K9M R;  3CCE A;  2KRS A;  4KT0 E;  5LJ5 f;  4BI8 B;  1O75 A;  3V8J A;  3A8L B;  4QW2 A;  5IN1 A;  1WXB A;  1CKA A;  2BE7 D;  3G1J A;  1YJW Q;  1JQQ A;  1GRI A;  2B8A A;  5HKC A;  4PK4 A;  1VQK Q;  1I0C A;  4ZTF A;  2EKO A;  5GMK j;  4KUI A;  2V8K A;  1HSQ A;  1K0X A;  2ECZ A;  2FZK B;  1WLP B;  3OMC A;  3PIP A;  4KGV B;  3H41 A;  1YJ9 T;  1E7O A;  2KXC A;  2WSF E;  2QEX Q;  2RQW A;  3R6N A;  1VQ5 T;  4C8Q D;  2A08 A;  2QTV A;  2FZG B;  1UHF A;  1D1B A;  1YP5 A;  4OVA A;  1VQO Q;  3CCR T;  3JCM e;  4M75 E;  2EYQ A;  2AZS A;  3CCS Q;  2F2X A;  1TXQ A;  3L1A A;  2DTH A;  2L5Q A;  3G7Z A;  2R5A A;  1YJ9 A;  4C5G A;  2HAX A;  4MZP A;  1KC8 C;  3REB B;  1D0Z A;  5DLQ E;  4JRI A;  2CSI A;  2DZ9 A;  3EHQ A;  3HRT A;  4O6J A;  1VQ5 A;  3CCQ Q;  4EPC A;  2YHT A;  1NPR A;  3JB9 F;  1Z9Z A;  2L3S A;  5LJ3 j;  2QYZ A;  3OYJ A;  3THK A;  1WXT A;  3CCR A;  1F1B B;  2KI7 A;  3JB9 G;  4IKF A;  4QQD A;  4D8D A;  1Y96 B;  4HCZ A;  1ZX6 A;  1VIF A;  4OB0 B;  1WYX A;  4BI3 A;  2Y4Y A;  3A8O B;  4OP0 A;  4EMG A;  4QVC A;  4OMM A;  1KD1 R;  1QWE A;  1GCP A;  3VS5 A;  2H3J A;  1CSK A;  2EFI A;  3JCM f;  3UA7 A;  4PJO B;  1VUB A;  3OW2 P;  3VYH B;  3AT1 B;  1PKS A;  4X9C A;  1T0J A;  3LLR A;  3M4G A;  2KAF A;  1XOV A;  1OZ2 A;  3JRZ A;  2OTL Q;  5FU7 C;  4M7A D;  1KQS A;  3GBQ A;  5GAN 7;  4D8K A;  4ELZ C;  1VQL Q;  2J6F A;  2BE9 B;  3VRZ A;  2MYS A;  1S72 Q;  2EWN A;  4WTO B;  4LN2 A;  4M4Z A;  5IHK A;  3VS6 A;  1Y57 A;  4UC4 A;  2QGF B;  5KYX A;  5CKB A;  2VC8 A;  3FJP A;  1TWB A;  4RKU E;  3EFS A;  2I2L A;  1QKW A;  1M90 R;  1RAB B;  2QA4 Q;  5L23 A;  2XK0 A;  4R55 A;  2D1X A;  1M3C A;  3H0H A;  3M0S A;  1XTD A;  1BU1 A;  3HRS A;  3HSB A;  2J6K A;  5GAM e;  5GAN 2;  1U5S A;  7AT1 B;  4J9D A;  3JAM E;  2LJ1 A;  1VQ6 Q;  2M1H A;  1BI1 A;  2EGA A;  1BKB A;  1TU0 B;  3VV0 A;  2FRY A;  2FL7 A;  1H64 1;  4F16 A;  3FIF A;  2DD5 A;  2QTX A;  1T3S A;  1W2B A;  1WFW A;  1OI1 A;  4FYV B;  2OAU A;  4X1V A;  2HEQ A;  2CDT A;  1RLQ C;  1K9M C;  1IGQ A;  3JCM P;  2PNI A;  4XQ3 A;  4KGZ B;  5KYN A;  1QVF P;  2ENM A;  1M27 C;  3PE0 A;  1B3Q A;  3DB3 A;  4RTZ A;  2RHI A;  3MP1 A;  1YIJ T;  3O5Z A;  2F69 A;  3RNJ A;  2FEI A;  3MEU A;  3RIR A;  5GAM f;  2Y4X A;  4JJN K;  4M77 A;  2E5Q A;  3VS2 A;  1N27 A;  4AG1 C;  3BE3 A;  1K4U S;  2OJ2 A;  1YIT T;  1QQJ A;  2LVM A;  3QWY A;  3CC4 T;  2DZC A;  4M77 F;  4PL6 A;  3U23 A;  4DBH A;  3SWN A;  2R58 A;  3EH1 A;  2KDS A;  2P0Q A;  1FMW A;  1B07 A;  3FC3 A;  2JS2 A;  3G4S Q;  2DF6 A;  1QVG P;  1YIT A;  1ZLM A;  3EG1 A;  3CC4 A;  2Z0W A;  2RJE A;  4HVV A;  2KK4 A;  1R8O B;  4EMK C;  2DXC A;  4M78 C;  2O31 A;  2EAY A;  4EMK A;  2EQI A;  1GXI E;  1IGU A;  4ZGE B;  2MAM A;  2YUP A;  1I5L A;  3NHN A;  3N5B B;  2CP6 A;  1T0H A;  1JO8 A;  3CCU T;  2LQK A;  2EYW A;  1UJ0 A;  2A36 A;  1BI2 A;  1RAA B;  1R77 A;  2YSQ A;  3CCM Q;  4C0D B;  2DPP B;  2YT6 A;  1YWP A;  2GTO A;  2KYM A;  1MV0 B;  1KHC A;  1VA7 A;  1B34 A;  4Y28 E;  1UGS B;  1SRM A;  3ZBD A;  3E9F A;  1VYT A;  1G3S A;  1HJD A;  4M7D A;  4M75 B;  4Z88 A;  2RN8 A;  1BI0 A;  1PD1 A;  5D6W A;  1QVP A;  1EFN A;  1V1C A;  1KD1 C;  2L3R A;  2LCC A;  5KYW B;  3CCU A;  1Q81 R;  5GAO m;  4LE9 A;  5I2M A;  3EAE A;  4KH1 B;  2VXF A;  1YI2 Q;  1PD0 A;  1AEY A;  4X34 A;  2FYK A;  2RNA A;  4E7L A;  4EIK A;  3V7C A;  2EQU A;  2JOY A;  1WHM A;  1QKX A;  2EQM A;  2MPX C;  2KRO A;  2X3W D;  2HCK A;  1KJW A;  2E1H A;  1G5V A;  3OBY A;  1TUC A;  2J7I A;  5KCH A;  3QJ6 A;  1Q86 U;  2DJQ A;  2LNV A;  2LTO A;  2VKN A;  1VQP T;  4LDW A;  1IO6 A;  3CPW P;  3TSZ A;  3M0R A;  2XMF A;  3MPU B;  1WX6 A;  4MMK A;  1TOV A;  4XTY A;  1M90 C;  2QAZ A;  2VGN A;  2JTM A;  3QZ5 B;  3L42 A;  5LJ5 h;  4M7D E;  4RMO A;  3H6Z A;  4XU0 A;  4AFU C;  1X6B A;  2AZV A;  2SRC A;  1VQP A;  1WHG A;  4LNP A;  3UPU A;  1W70 A;  3QYH B;  1QVF S;  1GBQ A;  3LWH A;  5CKH A;  1KG1 A;  3BDU A;  2LJ0 A;  2KNB B;  3TU4 K;  1ARK A;  3X24 B;  2RHX A;  2ZPB B;  5CCA A;  4PFP A;  3CC7 T;  1I8F A;  3BDL A;  5GAN 5;  1DJ7 B;  4AFZ C;  4F04 B;  1AWO A;  2J05 A;  2XKO C;  2BKD N;  2HD0 A;  3I55 Q;  3JCM b;  2LC4 A;  3LX7 A;  4ZN1 A;  1TG0 A;  6AT1 B;  1UG1 A;  4FSX A;  2PVO B;  2BZY A;  2VV5 A;  1VYV A;  2O4X B;  3AHU A;  2DBM A;  1GL5 A;  4E7H A;  5CO7 A;  4LD6 A;  3OYH A;  5GAN e;  1AWW A;  3CC2 T;  3CC7 A;  3EG3 A;  3V7R A;  2WSE E;  1N6A A;  4KUL A;  2P0P A;  1NPP A;  1YHQ Q;  3C0C A;  2X3X D;  1QVG S;  4E47 A;  1BCM A;  3M59 A;  5GAN 6;  1KQS S;  2P4R A;  1YBY A;  2KT8 A;  1VQ4 T;  3H9N A;  5FU7 B;  2COY A;  1AZG B;  4C92 F;  2M0Y A;  2DM1 A;  2COZ A;  5CKE A;  3CC2 A;  3LGL A;  5GMK i;  1KC8 U;  2JMC A;  1MMG A;  5KE2 A;  2LQ8 A;  1Q82 U;  4JRK A;  1VQ4 A;  3J80 E;  4Z02 A;  2QK0 A;  4FIB A;  2DIL A;  3D7S B;  3JCM h;  3OBW A;  4J9H A;  5GAN f;  1BIA A;  3EGX A;  1R0B G;  2K6D A;  3OYI A;  3OYL A;  1Q82 R;  3CD6 A;  1XQH A;  1NM7 A;  5IHI A;  2LT4 A;  1X6O A;  2WAC A;  2L3P A;  2QQA A;  4NL3 A;  3KXT A;  1M1G A;  3QG1 A;  5D6Y A;  1MMD A;  3EFO B;  2OTJ Q;  1K73 R;  3OYG A;  1YJW T;  4N0A C;  4F7U F;  4PJO D;  2EKH A;  2KQW A;  1VQK T;  1YFN A;  3CQT A;  4JUV A;  1UTI A;  2R57 A;  1X69 A;  4F7U G;  3OA6 A;  1M1F A;  3I56 Q;  2ZAE A;  3VU3 C;  4F14 A;  1NBE B;  3L2U A;  4BY6 C;  3NTI A;  1Q81 C;  4Z89 A;  4XTZ A;  4AT1 B;  3GF5 A;  5J26 A;  4AMC A;  3CPW S;  1W6X A;  2QEX T;  1YJW A;  3EH2 A;  1VQK A;  2ZPG B;  1Q7Y R;  3VS7 A;  2ROL A;  1VQO T;  3BY7 A;  1UGQ B;  3DB4 A;  4V2S A;  1I07 A;  2DMO A;  3CCS T;  4Q5W A;  1RAC B;  2G3R A;  2HDA A;  2EGE A;  2QEX A;  2JS0 A;  1M2V B;  4ZTJ A;  2EQJ A;  3INZ A;  2K2V A;  2IIM A;  5KCO A;  4JS4 A;  4IUP A;  2MWO A;  3CCQ T;  2D8J A;  2HQH A;  1VOM A;  4HT8 A;  3QDF A;  3LW5 E;  4WF2 A;  3OSS C;  3VJP A;  1VQO A;  5CK9 A;  1RAH B;  3RKX A;  2XDD A;  4NS5 A;  1SHG A;  1WGS A;  3CCS A;  2DEQ A;  4OF1 A;  4QVZ A;  2QG9 B;  4O5V A;  2M9U A;  3WXM B;  4EMK B;  4J7I A;  4M78 B;  5GAM h;  1M9S A;  3E9G A;  3HHT B;  1B7T A;  1Y07 A;  3CCQ A;  2YUO A;  1S1N A;  3WVD B;  3CCE T;  3UF4 A;  5KE3 A;  2HSP A;  4GLM A;  1OV3 A;  2DBK A;  1K9M U;  2DNU A;  2D0Q B;  1FX7 A;  1UHC A;  5I21 A;  3SB2 A;  2O9S A;  4C8Q F;  4A4H A;  4PJN A;  3H8Z A;  1UEC A;  2YRC A;  1RUW A;  1B34 B;  4C8Q G;  3PT9 A;  1OQK A;  2HMA A;  1JJ2 A;  2JTE A;  3ZFJ A;  1K1Z A;  1ZA2 B;  4HCC A;  3CXC A;  5LJ5 j;  3QPH A;  1S72 T;  2O2O A;  2YDL A;  2KSS A;  2M16 A;  4ATO A;  2OX7 A;  2CZ0 B;  4HVW A;  1ZHI A;  3VYG A;  2FPF A;  3NFC A;  5C0M A;  3RES A;  4QQG A;  1JB0 E;  2P4T A;  1E6G A;  2YWW A;  2GQI A;  2HNI A;  2RHU A;  1QP2 A;  1VQL A;  1AWX A;  1S72 A;  1KK7 A;  1RLP C;  2BZX A;  3CEY A;  4A54 A;  4LUD A;  3EGD A;  2DX1 A;  1NEB A;  1VQ6 T;  2E12 A;  4OB3 B;  2JW4 A;  1U06 A;  4LUE A;  3X28 B;  2BTT A;  3L2W A;  4BI4 A;  3RER A;  1FMV A;  2QA4 A;  1C6V X;  4IIM A;  3ULR B;  2LQW A;  2RB6 A;  2LNH B;  3LWI A;  1MGQ A;  3GIB A;  1PWT A;  2MOX A;  4II1 A;  3CCL Q;  1Q82 C;  3NTH A;  4DA4 A;  4JJB A;  1PSF A;  4BE0 A;  4M7A F;  3IQL A;  1VQ6 A;  2LCL A;  5A0G A;  2KT1 A;  1QMC A;  4M7A G;  2EYY A;  1BCO A;  4FSS A;  2JZ2 A;  2EJG A;  5KYU A;  3QXE B;  1ZSZ A;  1KD1 U;  1M3A A;  1P92 A;  4M75 D;  3QII A;  4J9G A;  1K73 C;  4OB2 B;  5GAN d;  2RF0 A;  2DKG A;  5DY9 A;  2E5K A;  2RHZ A;  4JRQ A;  5KYY A;  4DEX A;  2DL8 A;  4J8O A;  1UUE A;  3GNF B;  3EG9 A;  4IUR A;  4J9F A;  3TRE A;  1IZ6 A;  4CC3 A;  5KH6 A;  3M54 A;  4KBM B;  1YN8 A;  5CQX A;  5I11 A;  1JXM A;  1VQN Q;  3JB9 H;  2VXE A;  1OX9 A;  4FM4 B;  2FG0 A;  2K9G A;  1O9S A;  3T9N A;  1YNZ A;  3A8G B;  2DVJ A;  4C0F A;  3G4S T;  5LJ3 g;  2V8I A;  3MP8 A;  4RTU A;  3JV3 A;  1YCY A;  1BIB A;  3HKS A;  3OSV A;  1M90 U;  3X25 B;  1LOJ A;  3C95 A;  1OOT A;  3RMQ A;  2IG0 A;  4CI0 C;  2L3Q A;  2LT1 A;  4BDY A;  4KUD K;  4XTX A;  4RCC A;  2FZC B;  1R0C B;  2LRQ A;  1ZBJ A;  2VB6 A;  3MCA B;  4XU3 A;  4XTW A;  3EG2 A;  2A0F B;  3G4S A;  1OX8 A;  2DTI A;  2GNC A;  1X2K A;  2M51 A;  1KIK A;  3RKY A;  1H92 A;  3JCM W;  2DL5 A;  3OYD A;  4EMH A;  1PRM C;  3CCM T;  3QHS A;  1V29 B;  3EGX B;  1M8V A;  1OU9 A;  4JS5 A;  2FRW A;  5CKF A;  1WXU A;  1UDL A;  4FT2 A;  1TUG B;  3E19 A;  3JCM Q;  4OMQ A;  1PC0 A;  2J06 A;  5EG2 A;  3VS0 A;  2CGH A;  1G3Y A;  4PKC C;  3CCM A;  3CCJ Q;  1YI2 T;  2L89 A;  1VQ9 Q;  2DFU A;  2QAS A;  1H8K A;  4FW2 A;  4C0G A;  3ZL7 C;  2AKK A;  3H0I A;  1G3W A;  2KVQ G;  4A4F A;  1TTH B;  2RM4 A;  3PVQ A;  4E7K A;  2W0Z A;  2V26 A;  4BY6 B;  4M77 C;  4PFZ A;  5GAM j;  5GAN h;  2KE9 A;  1I5O B;  1YI2 A;  2FVU A;  1I81 A;  4DBR A;  5FRM A;  2LX7 A;  1GCQ A;  2K3Y A;  2DVE A;  2NWM A;  5LJ5 d;  2PUO B;  2ZPH B;  3NGP A;  4MDW A;  4L5G A;  2DE0 X;  3SWN C;  4A63 B;  4B6M A;  1JU5 C;  3OYM A;  4RTW A;  3M0P A;  4N4G A;  3SFM A;  4DOV A;  4LDV A;  2JMA A;  2CH4 A;  1W1F A;  3CPF A;  4BUG A;  1UE9 A;  2HL3 A;  4L59 A;  1TSF A;  1Q95 G;  1K8A U;  2H3E B;  3L2V A;  1KQS P;  3CME Q;  1CKB A;  2C0T A;  2FHD A;  2MMP A;  5GAO q;  1SHF A;  3LGF A;  1K8A R;  1E6H A;  4EDU A;  3I55 T;  2EVR A;  4XU2 A;  4M77 E;  1ZUK A;  3X26 B;  2VVK A;  3NTK A;  3M5A A;  2RI5 A;  3QKJ A;  3CBP A;  3GPL A;  1Q81 U;  2NUT A;  1BBZ A;  3LYI A;  1MMA A;  5GAN 3;  1OEB A;  1YCS B;  1EX4 A;  1IB8 A;  4M7D C;  2RI3 A;  5IH2 A;  1YHQ T;  1J3T A;  3I55 A;  1JJ2 S;  2YXY A;  2HL5 C;  2HBW A;  3EFR A;  2ROT A;  2DXU A;  2XU8 A;  2E6Z A;  2ZPF B;  2E70 A;  2DL4 A;  2RD1 A;  4M78 G;  4JLI A;  3HFO A;  4QQ6 A;  2JT4 A;  3ZEH A;  1NE8 A;  2HQE A;  5C6S A;  2VGM A;  1W2B P;  3DKM A;  2L8D A;  5GAN 8;  1YHQ A;  2DYI A;  2CUB A;  2CZ6 B;  4RTT A;  2MWP A;  5GJW B;  3RBB B;  1YWO A;  4OMO A;  2EJ9 A;  1RL2 A;  3JCM c;  4RTV A;  3DLM A;  4RTY A;  2K7A A;  2L2P A;  4A4G A;  5CKD A;  2FO0 A;  3JCM d;  2KGT A;  2HBP A;  2HZY A;  3FRN A;  4OB1 B;  3M55 A;  4BDZ A;  3CMA Q;  3PGG A;  1JEG A;  2MI6 A;  3EGD B;  1ZQ1 A;  2DIG A;  1KQ2 A;  1NYG A;  3TQ7 P;  1YIJ Q;  1HK9 A;  4M78 D;  1IXD A;  3FB9 A;  1D3B A;  2EYX A;  4AG2 C;  2X4X A;  3P8B B;  1AVZ C;  3PNW C;  1M30 A;  1M1K U;  2OTJ T;  1ZBX A;  1YJN Q;  2ED1 A;  4E7Z A;  2ZPI B;  4N4H A;  1SRL A;  4J6Y A;  5GAO l;  2F5T X;  2KEA A;  2CS7 A;  2RQU A;  3V7S A;  1M1K R;  3I56 T;  2EJF A;  5HY6 A;  4PFO A;  1OZ3 A;  2GFU A;  2OTJ A;  3PTA A;  4J5Y A;  5I22 A;  1Y96 A;  3VUZ A;  1KFZ A;  1ABO A;  1PG5 B;  1RAI B;  2CP5 A;  3I56 A;  1WQ7 A;  1MMN A;  3HL8 A;  4DEY A;  3FLG A;  2GBQ A;  4C92 C;  1NZ9 A;  4C92 A;  1KQ1 A;  1OPL A;  2DET A;  2D8H A;  3RUX A;  1NEG A;  1IHW A;  3GLX A;  1T3L A;  4P5N A;  1LNX A;  1U1T A;  3VKI A;  2LX9 A;  1Y7X A;  1AHJ B;  4E7I A;  3CD6 T;  4J7F A;  4PJO F;  2OI3 A;  3QO3 A;  3UT1 A;  3URG A;  2QQ9 A;  1EIF A;  5KYX B;  4E2F B;  5GAM d;  4OMF B;  2P0K A;  1U8R A;  3QDR B;  4PJO G;  5LJ3 h;  5IXB A;  1AT1 B;  1ZSG A;  5GMK l;  2LQN A;  1OU8 A;  2SEM A;  1FMK A;  5CIU A;  1QCO A;  3MEW A;  3OYY A;  1K76 A;  1WHK A;  5IXF A;  5GAN j;  2ATC B;  1UGP B;  2CKK A;  2ZCF B;  4HT9 A;  1K8A C;  1N9S A;  4C92 E;  4N4I A;  1K73 U;  3V8L A;  4F7U A;  4JPB W;  4C0Z A;  4JLG A;  3PMI A;  2V1R A;  2O88 A;  2XDB A;  4D6W A;  1WNL A;  1AWJ A;  2RQV A;  4AFQ C;  1W2B S;  1WIE A;  4HKE A;  3QBY A;  2K5L A;  2DJZ A;  1X01 A;  2JN0 A;  2FB7 A;  2CYZ B;  2BZ8 A;  4LXC A;  1Q7Y U;  4J83 A;  3HFN A;  4J9C A;  4R0K A;  3M58 A;  5GAO p;  4ELY C;  5CVI A;  3M0U A;  4NL2 A;  2A37 A;  4K11 A;  4M77 B;  2PU9 B;  4C5H A;  2JM8 A;  4WCI A;  2GF7 A;  3OYA A;  3GP8 A;  1K9A A;  3ME9 A;  4F7U E;  3SWN B;  2RQT A;  1VQM Q;  4RTX A;  2CP3 A;  3OMG A;  2E3I A;  1BYM A;  5D6X A;  2A3L A;  5AT1 B;  3CCL T;  1BK2 A;  3HPW A;  1LCK A;  2ED0 A;  3OYF A;  5A0L A;  2KMT A;  2C0I A;  2KYB A;  3OYN A;  1RAG B;  1UFF A;  3F70 A;  2W10 A;  3ER0 A;  2COW A;  3OB9 A;  2H8H A;  2DL7 A;  2HSE B;  2C0O A;  5EC7 A;  3CCV Q;  2HKN A;  4HXJ A;  4C8Q C;  1X75 C;  4C8Q A;  4CC7 A;  3CCL A;  5FU6 C;  1LPL A;  4HCB A;  4C5E A;  4HA8 A;  4LDY A;  1HYO A;  1WJR A;  1M1K C;  5L8R E;  2DYB A;  3JCM J;  5GMK e;  1AD5 A;  1JXO A;  2YRD A;  1NJI R;  1VQN T;  3MJX A;  3RKW A;  1LVK A;  3OW2 A;  2OTL T;  2I0N A;  2DER A;  1D0X A;  3NPF A;  4M7D B;  2X9H A;  1VQL T;  2X4Y A;  1VQ7 Q;  4R56 A;  4BB7 A;  3L2R A;  3GNG A;  2DRM A;  2DK3 A;  3M57 A;  3SEM A;  1FWZ A;  3NMZ C;  5A2Q E;  3L2Q A;  1VQN A;  1ZA1 B;  2RH2 A;  1QP3 A;  1G3T A;  3I5S A;  1QCN A;  5CQY A;  2OTL A;  1G83 A;  1WPY A;  4C8Q E;  2AIR B;  5D7U A;  2QA4 T;  4M75 F;  3E1S A;  4IUT A;  1M2O A;  3JCM V;  3S3O A;  1RI9 A;  2RI2 A;  3MP6 A;  4XAX B;  3OS0 A;  1WA7 A;  5LJ3 e;  1SKU B;  4TVR A;  2DA9 A;  1RAE B;  4M75 G;  1GBR A;  4LD9 K;  1PM3 A;  3TSW A;  2HKQ B;  1WJQ A;  2GFA A;  4M7A C;  4M7A A;  3KBG A;  2VWF A;  5FWB A;  2AK5 A;  2QDL A;  4FW1 A;  2F2V A;  5LJ5 g;  3M56 A;  1SSF A;  9ATC B;  2XID A;  2V1Q A;  1WHL A;  1D09 B;  1D3B B;  1LJO A;  3JCM X;  1PHT A;  4E7J A;  3CCJ T;  4RG2 A;  1VQ9 T;  1C0M A;  1UB4 A;  1KSW A;  3QWX X;  2K2M A;  1ZSZ C;  2RJF A;  8ATC B;  2K5F A;  4J6W A;  2RJC A;  2O9V A;  1QVF A;  1VQ8 Q;  1SG5 A;  3G71 Q;  5LJ3 f;  2CRE A;  3SD4 A;  3CCJ A;  4PJL A;  1M5Q 1;  3PIO A;  1VQ9 A;  2O01 E;  4J9B A;  2ZPE B;  3G6E Q;  1WI7 A;  2E64 A;  1N5Z A;  3LH0 A;  4A53 A;  2YUN A;  3OS2 A;  3M0Q A;  1AOJ A;  4M7A E;  3WVE B;  2RO0 A;  3TEE A;  2DL3 A;  3RR6 A;  2EBP A;  3CCE Q;  2NUP A;  4C92 B;  1PKT A;  2O4X A;  1OYX A;  2AHJ B;  1Q7Y C;  2V8J A;  3M4Y A;  4FT4 A;  2OAW A;  2GTJ A;  1SSH A;  1U3O A;  4OMN A;  5IAY A;  2JJ9 A;  2D0N A;  1JJ2 P;  3P8H A;  3CXC P;  3CME T;  4FCY A;  1N9R A;  1QVG A;  1N8R U;  1H3Z A;  4KH0 B;  1M8M A;  4GBQ A;  2CZ7 B;  1BB9 A;  2LCS A;  3SHW A;  3JB9 D;  2E4H A;  4ANJ A;  4GY5 A;  2YRV A;  1ABQ A;  2B86 A;  3QZ9 B;  1M4Z A;  1N8R R;  2QGG A;  2GQV A;  2EW3 A;  3ASK A;  3PVL A;  3CME A;  3JCM g;  2RK1 A;  4RCB A;  4DBQ A;  1WHJ A;  2BUD A;  2A28 A;  2XHC A;  1MV3 A;  2XIC A;  1YJ9 Q;  4J9I A;  2CT3 A;  2QI2 A;  1WDX A;  3RDV A;  4F7U B;  2QQR A;  2EIF A;  1VQ5 Q;  2XI9 A;  3I5R A;  4MZM A;  5HCK A;  3A5Z B;  4PLL A;  3I9Q A;  2XG8 D;  5AYF A;  3J81 E;  2RA2 A;  3UDC A;  3CCR Q;  1NJI C;  1UGR B;  1X27 A;  2JUF A;  1UEB A;  2CSQ A;  3JB9 I;  2JNG A;  5LL6 S;  4FYW B;  2ESW A;  2LDM A;  3EFO A;  1MUZ A;  1ZUY A;  4JDS A;  2G6F X;  1KHI A;  2PVG B;  1NLP C;  1Z9Q A;  3S3M A;  2DEU A;  1QLY A;  4LDX A;  3QJY A;  2NYS A;  1RAD B;  3OQ5 A;  2E3H A;  1JBM A;  2K3X A;  3CMA T;  1HD3 A;  4GLK A;  2DO3 A;  3X20 B;  1GCQ C;  3RMS A;  2NLU A;  3CPW A;  3LH5 A;  2IVW A;  4PLI A;  2L0A A; 
#chains in the Genus database with same CATH homology
 1Z9Z A;  2L3S A;  1SEM A;  3THK A;  1WXT A;  1I07 A;  2DMO A;  3H0F A;  1PRL C;  2HDA A;  4D8D A;  1ZX6 A;  2EGE A;  2JS0 A;  5I22 A;  2IIM A;  1WYX A;  1KFZ A;  1ABO A;  2D8J A;  4OMM A;  4DEY A;  4OML A;  2GBQ A;  1QWE A;  1GCP A;  3VS5 A;  1SHG A;  4QT7 A;  1CSK A;  1OPL A;  2DRK A;  2D8H A;  3UA7 A;  3EG0 A;  1NEG A;  2PTK A;  1QCF A;  1PKS A;  1T3L A;  2JXB A;  3FJ5 A;  1T0J A;  2DLP A;  5FW9 A;  1XOV A;  2YUO A;  1S1N A;  3UF4 A;  2JM9 A;  2HSP A;  4KRT A;  3GBQ A;  4AFS C;  4D8K A;  4GLM A;  1OV3 A;  2J6F A;  2YUQ A;  3VRZ A;  2DBK A;  2DNU A;  2OI3 A;  1UHC A;  4LN2 A;  4M4Z A;  5IHK A;  2O9S A;  3VS6 A;  4CC2 A;  1Y57 A;  1UEC A;  1RUW A;  5IXB A;  1ZSG A;  2LQN A;  4HVU A;  2JTE A;  1K1Z A;  1FMK A;  1M3B A;  2SEM A;  1QKW A;  1K76 A;  5IXF A;  5L23 A;  2O2O A;  2YDL A;  1X6G A;  2D1X A;  1M3C A;  3H0H A;  3M0S A;  1BU1 A;  4HVW A;  2J6K A;  3UA6 A;  4RUG A;  2FPF A;  1U5S A;  4J9D A;  2LJ1 A;  1NYF A;  4JPB W;  2EGA A;  2V1R A;  2O88 A;  1E6G A;  2FRY A;  2GQI A;  2CH4 W;  1AWJ A;  2RQV A;  4Y92 A;  3VRY A;  1AWX A;  4AFQ C;  4F16 A;  1RLP C;  1GFD A;  1WIE A;  2EPD A;  2BZX A;  4LUD A;  2KRN A;  2DX1 A;  1NEB A;  1T3S A;  1WFW A;  4JJD A;  2JW4 A;  3A98 A;  1U06 A;  2BZ8 A;  4LUE A;  4X1V A;  2BTT A;  2HEQ A;  2CDT A;  1RLQ C;  4J9C A;  4R0K A;  5IHN A;  2PNI A;  4IIM A;  2ENM A;  3ULR B;  2LQW A;  3M0U A;  1QWF A;  3KFV A;  1M27 C;  3M0T A;  2LNH B;  3PE0 A;  1B3Q A;  1SPK A;  1PWT A;  2A37 A;  2KXD A;  2MOX A;  4K11 A;  2FPE A;  4RTZ A;  4JJB A;  3O5Z A;  2JM8 A;  2FEI A;  4WCI A;  3RNJ A;  3IQL A;  2KT1 A;  1H3H A;  1K9A A;  1UGV A;  3VS2 A;  2MCN A;  4AG1 C;  1A0N B;  2EYY A;  4FSS A;  1K4U S;  2PZ1 A;  2OJ2 A;  1M3A A;  3QWY A;  2RQT A;  4RTX A;  4J9G A;  3U23 A;  1BK2 A;  4JJC A;  1LCK A;  2ED0 A;  2RF0 A;  2E5K A;  1B07 A;  2C0I A;  2KYB A;  2DL8 A;  2LP5 A;  4DEX A;  1UUE A;  2JS2 A;  1UFF A;  4J9F A;  4Z8A A;  2KRM A;  2DF6 A;  2W10 A;  4CC3 A;  2RMO A;  2H8H A;  1YN8 A;  2DL7 A;  5EC7 A;  2C0O A;  1ZLM A;  3EG1 A;  1JXM A;  5I11 A;  4HXJ A;  4HVV A;  4OMP A;  4CC7 A;  4HCK A;  2O31 A;  1X2Q A;  2FG0 A;  2EQI A;  2K9G A;  2CT4 A;  1YNZ A;  2YUP A;  2DVJ A;  3NHN A;  1T0H A;  4RTU A;  3JV3 A;  2DYB A;  1JO8 A;  2EYW A;  1UJ0 A;  1AD5 A;  3EHR A;  2A36 A;  1JXO A;  1OOT A;  1UJY A;  3VS1 A;  2L3Q A;  2YSQ A;  2YT6 A;  1YWP A;  2GTO A;  2KYM A;  5GJV B;  1MV0 B;  1VA7 A;  2I0N A;  4JZ4 A;  2EYZ A;  3NPF A;  1Y0M A;  1ZBJ A;  1SRM A;  2F2W A;  1VYT A;  3EG2 A;  1HJD A;  4Z88 A;  2RN8 A;  1V1C A;  1EFN A;  2GNC A;  2MIO A;  2DRM A;  1X2K A;  2M51 A;  3SEM A;  1KIK A;  3NMZ C;  1H92 A;  2DL5 A;  2EGC A;  1PRM C;  4LE9 A;  3I5S A;  3REA B;  1G83 A;  1AEY A;  2FRW A;  2RNA A;  1NLO C;  1AZE A;  4EIK A;  1WXU A;  1UDL A;  1RI9 A;  3VS3 A;  1QKX A;  2X3W D;  2KRO A;  2HCK A;  1KJW A;  1WA7 A;  2DA9 A;  4OMQ A;  2J06 A;  2RPN A;  3VS0 A;  1GBR A;  1TUC A;  2J7I A;  3TSW A;  2DJQ A;  4ZNX A;  4JZ3 A;  2VKN A;  1IO6 A;  1H8K A;  2VWF A;  5FWB A;  2AK5 A;  3TSZ A;  3ZL7 C;  3M0R A;  2QDL A;  2AKK A;  2XMF A;  2F2V A;  1WX6 A;  2FPD A;  3H0I A;  2KR3 A;  2K3B A;  2V1Q A;  2LMJ A;  3PVQ A;  2W0Z A;  4CC4 B;  1PHT A;  2RQR A;  1FYN A;  2KE9 A;  1PNJ A;  4AFU C;  2LZ6 B;  1X6B A;  2AZV A;  2SRC A;  1KSW A;  3QWX X;  2K2M A;  4LNP A;  1W70 A;  1TUD A;  1GBQ A;  3EGU A;  2LX7 A;  1GCQ A;  2NWM A;  2LJ0 A;  2KNB B;  3NGP A;  4A63 B;  2DE0 X;  1ARK A;  2O9V A;  5ECA A;  1JU5 C;  1G2B A;  4RTW A;  3M0P A;  2CRE A;  4AFZ C;  1AWO A;  3UAT A;  2J05 A;  2JMA A;  2CH4 A;  1W1F A;  4J9B A;  1OPK A;  1WI7 A;  1N5Z A;  1TG0 A;  1UE9 A;  2YUN A;  3M0Q A;  1AOJ A;  1UG1 A;  3TVT A;  2BZY A;  3I35 A;  1VYV A;  1CKB A;  2C0T A;  2DBM A;  2DL3 A;  1GL5 A;  3VS4 A;  2EBP A;  1AWW A;  1SHF A;  1PKT A;  1E6H A;  3EG3 A;  2OAW A;  2GGR A;  4IIO A;  2GTJ A;  5FWC A;  2CUD A;  2EVR A;  3C0C A;  1SSH A;  1U3O A;  2X3X D;  4OMN A;  1I1J A;  2D0N A;  1ZUK A;  4E6R A;  2VVK A;  4F17 A;  2LJ3 A;  2P4R A;  1ZUU A;  2NUZ A;  2KT8 A;  4J9E A;  2J6O A;  1AZG B;  2ABL A;  1VYU A;  1M8M A;  4ORZ A;  4GBQ A;  2M0Y A;  2DM1 A;  1BB9 A;  2LCS A;  3SHW A;  1BBZ A;  1GFC A;  1K0S A;  1OEB A;  1NG2 A;  1YCS B;  5IH2 A;  1ABQ A;  1J3T A;  2B86 A;  2JMC A;  2HBW A;  1X43 A;  2EW3 A;  2ROT A;  3PVL A;  2KBT A;  2K79 A;  4ESR A;  2AKL A;  2DL4 A;  2A28 A;  2KRS A;  2JT4 A;  1MV3 A;  2DIL A;  4J9H A;  4J9I A;  1WXB A;  1CKA A;  2CT3 A;  2K6D A;  1JQQ A;  1WDX A;  1GRI A;  1NM7 A;  2CUB A;  1I0C A;  5IHI A;  4RTT A;  3I5R A;  5HCK A;  5GJW B;  3RBB B;  1YWO A;  2L3P A;  3I9Q A;  4OMO A;  4RTV A;  4RTY A;  2K7A A;  2L2P A;  2FO0 A;  2KGT A;  1X27 A;  1HSQ A;  1K0X A;  2ECZ A;  1WLP B;  2CSQ A;  3H41 A;  1E7O A;  2KXC A;  1JEG A;  2ESW A;  2RQW A;  2EKH A;  1MUZ A;  1ZUY A;  3R6N A;  3CQT A;  1UTI A;  2A08 A;  2G6F X;  1X69 A;  1NLP C;  1NYG A;  1UHF A;  1YP5 A;  1Z9Q A;  1QLY A;  4F14 A;  4Z89 A;  2EYX A;  4AG2 C;  1AVZ C;  1M30 A;  2AZS A;  2F2X A;  1HD3 A;  2ED1 A;  1W6X A;  3REB B;  1SRL A;  1GCQ C;  2CSI A;  3EHQ A;  3LH5 A;  2KEA A;  2RQU A;  3VS7 A;  2ROL A;  2L0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...