2DIQA

Solution structure of the tudor domain of tudor and kh domain containing protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
GSSGSSGRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Tudor and KH domain-containing protein
publication title Solution structure of the TUDOR domain of Tudor and KH domain containing protein
rcsb
source organism Homo sapiens
total genus 17
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2006-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2diqA01
2PQWA 3PNWC 3OYJA 3LX7A 2M1HA 3OYDA 2LDMA 4BD3A 3OYLA 2EKOA 3F70A 2QQSA 2FHDA 3GOXA 3OB9A 1XNIA 4N4HA 5FROA 3OYMA 2RHYA 1G5VA 3L2UA 4NS5A 2E6NA 2RJFA 4IURA 4OVAA 2NLUA 1OZ3A 5M9OA 3L2VA 4BE2A 4A4HA 5C0MA 2CKKA 4IUPA 4BE1A 2WACA 4PLLA 2GF7A 5FRMA 5KE2A 2RJEA 3Q1JA 2X35A 4QW2A 3OA6A 2RHUA 3E9FA 2EQKA 2XK0A 3MEAA 4A4EA 2HQXA 2HQEA 4IKFA 2X4YA 4GY5A 3MEUA 4FL6A 3M9QA 3L2QA 2X4XA 4II1A 2R5MA 3L42A 4BE0A 2DIQA 2YRVA 3OYHA 3DLMA 3OYKA 3FEOA 1KHCA 3PMTA 2GFUA 5IAYA 2M0OA 3OS1A 1OYXA 2K3YA 4QQGA 4C5HA 3OS0A 4IUUA 1WJSA 2IG0A 1N27A 2L89A 3BDLA 5J26A 2X4WA 3S6WA 2MWOA 2LRQA 4BDYA 3L2WA 2L3RA 3EAEA 1SSFA 2RHZA 3LLRA 2RHXA 2BKDN 3MO8A 3QBYA 5D6WA 4C5EA 3S3MA 3OY9A 2L8DA 1RI0A 2EQJA 2JZ2A 4BDZA 2G3RA 2R57A 2RI2A 2R5AA 3C4SA 1WJRA 2B8AA 3P8DA 3LH0A 4L59A 3MP1A 3OYBA 3OYIA 3E9GA 3QIIA 4E7HA 3OQ5A 4IUQA 3MP8A 4LD6A 5KE3A 3OS2A 3OMCA 3ME9A 4E7LA 3S3NA 2EFIA 4N4GA 2K3XA 4IUTA 4EDUA 5D6YA 2LCCA 2LVMA 2RJDA 5KCHA 5FRNA 2RO0A 3NTHA 3FLGA 4A4FA 2O4XB 2F5KA 2RI3A 4UC4A 3OYCA 3FC3A 3LYIA 3MEWA 4ZTJA 4PL6A 4A4GA 2DAQA 3LGLA 2P0KA 4HCZA 3UT1A 3QJ6A 3ZEHA 3MP6A 2BUDA 3MEVA 4PLIA 3DB3A 2QQRA 3PMIA 1MHNA 3CEYA 4Z02A 4BACA 2DIGA 4E7KA 2VYTA 2O4XA 2RI5A 3H6ZA 3O8VA 3P8HA 2XDPA 4N4IA 5D6XA 3META 4QQ6A 4X34A 3OMGA 3NTIA 5KCOA 5KH6A 3LGFA 2E5QA 3ASKA 2RJCA 4CRIA 3H8ZA 2EQMA 4E7JA 5J39A 3L2RA 3QKJA 2GFAA 4IUVA 4QVZA 5IN1A 3UWNA 3OYAA 3NTKA 5CIUA 3KUFA 3OYEA 4ZTFA 1OI1A 1OZ2A 1WGSA 3DB4A 4Q5WA 3FDRA 4RG2A 3SD4A 5C6SA 3S3OA 1H3ZA 4C5GA 2BIVA 3PFSA 4B9WA 4C5IA 2R58A 4E7IA 2EQUA 3OYFA 2MWPA 2M16A 2D9TA 4FU6A 2RHIA 3OYNA 3OYGA 1WJQA 2LTOA 4QQDA 4B9XA 2JTFA
chains in the Genus database with same CATH superfamily
4M7AA 5FU7B 2E41A 1W2BS 3KBGA 2H3EB 1Q7YR 1KD1R 2FHDA 3GOXA 3OB9A 2YDLA 2GNCA 3M0SA 2DILA 5CKHA 1VQMA 1YIJA 1Q81R 2L2PA 1VQNT 2EKHA 4PLLA 4J9HA 1VOMA 3OW2A 1QKWA 5FRMA 8ATCB 2DE0X 4JS4A 2FZCB 2MK5A 4XTXA 2FRYA 2X4YA 3JCMJ 1B7TA 2EW3A 2I2LA 5LJ3g 3JB9G 1Q82U 4KGZB 4PKCC 2GFUA 1NBEB 1RACB 1N27A 4KT0E 5DM7R 2LRQA 4C92F 2GQIA 4R0KA 3ER0A 2K6DA 1M1KR 2VXFA 1M30A 1M5Q1 4M77B 4M7DF 4RTTA 3I9QA 3WVDB 2AK5A 4E7HA 3CCJT 4IUQA 4LD6A 2F1LA 1JO8A 1UGRB 2E12A 4M77A 1QVGS 4MDXA 4HVWA 4FIBA 3X28B 4D8KA 4M78F 4PJOF 5CKEA 4PL6A 3LGLA 3UT1A 4M7DD 1WX6A 1M90R 1KD1U 1JJ2P 1D09B 5CVIA 3O8VA 2H3JA 5D6XA 4X34A 1R77A 3EHQA 2X3XD 2OTLA 5GAN5 3ASKA 2RF0A 2HNIA 2CZ7B 3V7RA 3JCMX 1N9RA 2RK2A 1XOVA 3V8KA 1K1ZA 3SD4A 4M78D 4PJOD 4LUEA 3SWNC 1VQ9Q 1GFCA 3M5AA 1AZGB 2A3LA 3PVLA 2JTFA 5CO7A 2JMAA 4RTVA 2K5IA 1TTHB 3BDUA 3X25B 3OYYA 3JCMf 2D6FA 1YFNA 4OB1B 2FPFA 4ME7A 1M1KU 2BTTA 4J5YA 1DJ7B 1G83A 2VXEA 3OS5A 3QG1A 2Y90A 4Z8AA 1J3TA 4QW2A 1I1JA 3E9FA 1HK9A 2GTJA 2HQXA 5IHIA 1GXIE 4GY5A 1V76A 3HHTB 4KGXB 3INZA 1ZA1B 1SG5A 1W2BA 1MNDA 4M7AF 2KRSA 2OX7A 1TSFA 2M0OA 2DETA 2K3YA 2DTIA 2AIRB 1GRIA 2FYKA 5KYUB 3VS7A 1IGUA 5LJ5g 5GAOq 1VQ5Q 3QXEB 1M90U 5D6WA 3H0HA 4C0GA 3OY9A 1YN8A 2VGNA 3CC4A 5KYUA 3E2UA 2V1QA 3M59A 4ATOA 4M7AD 3RIRA 3I55A 2DBKA 1YITQ 2JT4A 1X2QA 5GANf 4CI0C 3S3NA 1VQKQ 2HSEB 2FB7A 3N5BB 1SHFA 1WXUA 2F5KA 3CCET 1QP2A 1S72A 1YP5A 3ZEHA 2CZ0B 2CUDA 3PMIA 1E7OA 3PIPA 2X4JA 2O31A 2ZPBB 4MMLA 1G3WA 3I56T 1KFZA 3JCMV 3VUBA 9ATCB 2EYYA 1QVGA 4M77F 2PVGB 4A63B 5GAMd 4LDVA 1MNEA 2SRCA 3EG3A 4RG2A 3DB4A 1YBYA 4M75B 2A7YA 1M8VA 2K2MA 1G2BA 5GAOl 3RKWA 2OI3A 2XU8A 2P0QA 2VASA 4QQDA 1VQ4A 4XU1A 3CC7Q 4BY6C 1BB9A 1PNJA 3CCUA 2EPDA 1YJ9T 1AVZC 4BI4A 1EX4A 4N4HA 3BE3A 2CT3A 4M77D 2LT4A 3RDVA 1N6AA 1KQ2A 1JRIA 2B86A 1OX9A 3AT1B 2M02A 2F5TX 3E19A 3SHWA 1K0XA 4EMKB 5GMKe 1ZSZC 2R5MA 3RMQA 1FMWA 2DXBA 3PMTA 2SEMA 1Y57A 2HL3A 3OS1A 3I5RA 3PE0A 3OS0A 4EMKA 1NYFA 2IG0A 3RKYA 3L2ZA 4JJBA 3CCMQ 2QGFB 2HSPA 3L2WA 4KUDK 5I2SA 2V8KA 1RI9A 2EAYA 2DYIA 2W0ZA 3CCLQ 2D1XA 1VQLT 1ABQA 1WJRA 5GAN6 2KSSA 3KXTA 1N8RC 1KK7A 3THKA 3OSVA 2XDBA 3MP8A 3MJXA 1K8AC 4HA8A 1JU5C 5ECAA 2CZ6B 1VQOQ 4Y91A 5KCHA 2JM8A 4LD9K 2O4XB 1VIFA 1HSQA 2GBQA 2QEXA 3NPFA 5CQXA 4DA4A 4C0DC 4Z02A 2O4XA 7AT1B 5GAN8 3META 3G4SA 1M2OA 5KCOA 2RQWA 4E7JA 1ZBXA 4QVZA 1MMNA 1YHQQ 4C92E 1KQSA 5CIUA 3KUFA 3WVEB 1YWPA 5I21A 1UGSB 1NZ9A 3MPUB 1N9SA 1RLQC 3M57A 5A0DA 3CCVA 4MZMA 2M16A 3RR6A 4M7DE 3OYGA 4KULA 2PQWA 3U23A 4J9CA 2VKNA 2RNAA 4FT4A 1ZX6A 4J9BA 2KMTA 4MMKA 1ZA2B 4OVAA 5M9OA 4CC7A 3ZFJA 5LJ5h 1S72Q 2EGAA 2WACA 4KGVB 3JCMg 4M78E 4PJOE 3CXCP 1OQKA 3G71T 1N5ZA 3NGPA 4ELZC 1RAHB 4XAXB 3CMAQ 4RTWA 2NUTB 1KHCA 2QYZA 4MDWA 2K4YA 2DL7A 2JTMA 2CH4W 1PM3A 4M75F 5DLQE 1RABB 2YT6A 1LNXA 2DFUA 4F17A 4BDYA 2ATCB 2HKNA 2F2VA 3LLRA 1VYTA 2YRCA 3GP8A 1FMKA 4HCCA 1OOTA 5LJ3f 4C92C 1VQ8T 2L5QA 1MMAA 4L59A 5FU6B 2DZCA 1ZBJA 2EYXA 3QDRB 4M7DC 4M75D 1X01A 1BBZA 2YUQA 1W1FA 2LVMA 5HK3A 3NTHA 2ABLA 4UC4A 3GNGA 1NEBA 4AT1B 1X69A 1JXOA 1VIEA 3M55A 4M7AE 4PJOC 2DRKA 1M2VB 4X9CA 2I0NA 2BE7D 4E47A 3CCQA 3HL8A 1ARKA 3VU3C 3EH1A 5L8RE 3OSSC 3VS0A 4RCBA 1M2VA 3HFNA 5GJWB 4C0ZA 1AWOA 2CP6A 3EG1A 1WZOA 2BIVA 4AFSC 1JB0E 4D8DA 4J9IA 2K9GA 1Q82C 3QJYA 4FU6A 2EQIA 2KK4A 1RAEB 2DM1A 4WF2A 2FL7A 1N8RU 4CC2A 4N0AC 2HZYA 3TCJA 3RUXA 2QA4Q 1FX7A 4OMNA 1Q95G 2KXCA 2PU9B 8AT1B 1AHJB 1Y96B 3G4SQ 2ZPHB 1X43A 3SFMA 2HDAA 2FPEA 1WHKA 1H641 3CCST 3G7ZA 4F7UB 4BE0A 4RMOA 3M56A 4J7IA 2XG8D 2MYSA 1NJIC 1Y96A 4QKUA 3JCMc 4M77E 4M7AC 2HBWA 2CDTA 1Z9QA 4F7UA 3CCVQ 3BY7A 1PHTA 1U1TA 2ROLA 1SHGA 1Q7YC 1KD1C 1VQ9T 2DJZA 3VS2A 1E6GA 2R57A 1K76A 4FW1A 1UUEA 2DA9A 3PIOA 4XTYA 1PRMC 3VV0A 3GIBA 1Q81C 4QVCA 5LJ5f 3OMCA 1U8RA 4EMHA 2JMCA 1VQ6T 2HAXA 1D1CA 2E10A 4M78A 2LNVA 4A4GA 4J83A 3FRNA 2QQRA 3C12A 5IH2A 2WSEE 1M4ZA 2RA2A 1GBQA 2A37A 3RNJA 2COYA 1WIEA 2QTVA 4JZ4A 3CCRA 3JB9J 2MI6A 3OYAA 1TUGB 4JUVA 3JCMh 2HKQB 1VQ5T 1OI1A 4MZTA 4M77C 4AMCA 1XJWB 3VS1A 2O9SA 2QK0A 2MWPA 3OYNA 3OYJA 2E65A 2LDMA 1BI2A 3R6NA 3F70A 1YITT 1BYMA 3A5ZB 4PJMA 1XNIA 2V8JA 1AD5A 1VQKT 2PVDB 4ORZA 2JTEA 1M3AA 2E6NA 2VWFA 1X6BA 1M90C 2G6FX 4IUPA 2COZA 4HKEA 1NJIR 2OTJQ 2RHUA 5KYNA 1EZZB 4AFUC 4XTZA 2P4TA 2ZCFB 5GAMg 3L1AA 2EJ9A 1JBMA 1YI2Q 1HD3A 4L6V5 5DY9A 4C5HA 2KI7A 1W2BP 1OV3A 5GANh 1YJWT 1MUZA 2L8DA 2AHJB 3V7CA 4O6JA 3CC7T 4JRKA 2QG9B 3OYBA 3OYIA 3QIIA 4OGEA 2DTOA 2K3BA 2KVQG 1LCKA 2J6FA 2DXUA 1PG5B 3JAME 1TS9A 4XTWA 4F7UF 2K57A 2RI3A 2EWNA 1M3BA 1UTIA 2J6KA 2JUFA 1AWXA 1UGPB 3AHUA 3CD6A 4LDWA 5CK9A 2VYTA 3H6ZA 4Y92A 3NTIA 4M75E 3CBMA 2ZPFB 2DEUA 1YJNQ 5J39A 1PD0A 4RKUE 3CCMT 1NJIU 3EG9B 3HFOA 4HCKA 1QLYA 4ZTFA 1Y71A 4Q5WA 3FDRA 3FJPA 1W4SA 2K79A 2ZPGB 4OB0B 1ZQ1A 3CCLT 1VQNA 2J05A 2P0PA 3EG9A 4B9XA 1Q7YU 2YLCA 1E6HA 2Y4YA 5GMKi 1TU0B 4E7ZA 4EPCA 2KY9A 3OYMA 1Q81U 1VQOT 5J3BA 2LT1A 1VQPQ 2PNIA 1C6VX 2X35A 2XK0A 3QZ9B 3M4YA 1C1AA 1NYGA 2IPOB 3MCAB 5GANj 2YRVA 5LJ5e 1TXQA 3REBB 4KBMB 1QVFS 1TH7A 3FJ5A 1TG0A 4J6YA 2DL3A 1YHQT 2QI2A 1WJSA 3VJPA 2L3QA 2ED0A 3CCJA 5CAIA 2BKDN 5I22A 3GPLA 2GCXA 3SB2A 2ROTA 4TVRA 1OEBA 1ZLMA 2FEIA 1LJOA 2EVRA 3MP1A 1GBRA 3OQ5A 4X1VA 2DX1A 2LJ3A 1M8MA 2M0YA 3TEEA 2BZYA 3CPFA 2H8HA 2F2WA 3HRTA 1O75A 2HD0A 2V8IA 4RCCA 3CMET 3A8OB 4EMKC 3EGDB 3HRSA 4MZPA 1VYVA 4DBQA 1XQHA 5HK0A 3CMAT 2DIGA 1B34B 3EGDA 1VQMQ 1YIJQ 4CRIA 1KC8R 3QSUA 3JRZA 1QCFA 2C06A 3EG2A 3NTKA 1B34A 1KQSS 2KYMA 5C6SA 4C5GA 3PFSA 4ELYC 4E7IA 2EQUA 2MAMA 3MHXA 3VS4A 2DJQA 3VRZA 1K0SA 2ECZA 3TQ7P 3OYDA 5KYWB 4C92G 1UE9A 2CYZB 6AT1B 1OX8A 4PJNA 2X3WD 2RHYA 2CP2A 3HSBA 2XICA 1UFFA 1X75C 3J81E 4M7DG 2CH4A 4BE1A 3ZBDA 1PKSA 3J7AF 2RJEA 2W10A 1Q86R 3MEAA 4OB2B 2LX9A 2NWMA 3V7SA 3P8BB 5LJ3h 3EFOB 1AWJA 1HXDA 5L23A 2LCSA 3FEOA 1CKAA 4E2FB 2LC4A 4M75A 2LMJA 4M78G 4PJOG 4FW2A 4QQGA 4XU0A 5GMKl 2E4HA 4NL3A 2E6ZA 2EYQA 1ABOA 3EFOA 2J7IA 3O5ZA 3QBYA 4XK8E 4C5EA 2DKGA 1UGQB 3M54A 4BI8B 5FW9A 4JJCA 3CCEA 3CC2T 1M1GA 2OTLQ 2CGHA 2JXBA 1QVFA 4FT2A 4N4GA 2QA4T 3EFSA 2RJDA 5FRNA 2AT1B 3I56A 1KQ1A 3PVQA 2A28A 4LDXA 4C8QB 2L3PA 4OF1A 5CCAA 1VA7A 1A0NB 2RI5A 3I35A 4QQ6A 1FWZA 2Z0WA 2CP7A 4C8QA 1W70A 4IUVA 1UJYA 5IN1A 1IGQA 1V1CA 1YJ9A 2NUPB 1K73C 4M7AG 1OZ2A 4ESRA 1M9SA 1WHGA 1WFWA 2FRWA 5FU6C 1PSFA 2KAFA 2C0IA 2NUPA 2M1HA 2KXDA 1B07A 1D1BA 3JCMe 3ULRB 2XIDA 2ESWA 1D0XA 4IURA 2GGRA 4R55A 4F7UE 1SSHA 1LPLA 1T3SA 2XDDA 2JOYA 2DL8A 5LJ3j 3CC4Q 2CREA 2CT4A 1BKBA 5HY6A 4HT9A 2GF7A 1UHFA 2KE9A 3I55Q 2HQEA 2ENMA 3MEUA 4IIOA 1T3LA 1AWWA 4OMFB 3DLMA 3CQTA 3OYKA 5AT1B 1VQLA 1NLPC 2MCNA 1OYXA 5HCKA 3HTRA 4GLMA 3G1JA 2DVEA 4OP0A 1T0JA 5J26A 1AEYA 1BIAA 5A2QE 1UGVA 4YTLA 3QZ5B 3CPWP 4LDYA 1YWOA 1SSFA 2M9UA 2JVVA 3IQLA 5GAMf 2G3RA 3G6ET 4OMOA 2LCLA 2PUOB 3R6OA 4M77G 2RH2A 3EHRA 5GANe 1NPRA 1VQ7T 1QWEA 4FSSA 3CXCS 4ZN3A 1IRXA 5IHKA 1PD1A 3JV3A 2CZ1B 4A4FA 3I5SA 3PTAA 4LXCA 5A0LA 2NUTA 3FC3A 2OTJT 1VQ4Q 1KIKA 1RUWA 3CCUQ 5LJ5d 4FYVB 3DB3A 1WQWA 5LL6S 1K9AA 1M27C 1K73R 2A08A 1YI2T 3V8LA 2E5QA 1MGQA 1SKUB 3T9NA 1IHWA 2CS7A 3GBQA 5HKCA 3H0IA 5GAOr 3OYEA 2EYWA 2YUNA 3LH5A 5I2MA 1PRLC 4F16A 2E3IA 2XKOC 4J6WA 4K11A 4M78C 4ANJA 3OYLA 4RTXA 3G71A 3I56Q 1I07A 4C8QF 4LE9A 1MMDA 2NLUA 2YHTA 4NL2A 3JB9I 2E5KA 4BE2A 2LQWA 3A8MB 2LQKA 2EBPA 3VYGA 1GL5A 2CP0A 2PVOB 4KH1B 4OMLA 2YLBA 1Y7XA 3M9QA 2V1RA 5LJ5j 1PCXA 1PC0A 1BK2A 4ZN1A 1YJ9Q 1VQ8A 4C8QD 3JB9H 1YJNT 4EMGA 1OU9A 4J9GA 3VRYA 1HJDA 1U5SA 4CC3A 1FXXA 3D7SB 1RADB 1MV3A 4DOWA 2QEXQ 1AZEA 3JSCA 1K9MC 1I8FA 3QYHB 1WHHA 2RHXA 3M58A 3EG0A 1KSWA 1QWFA 3HRUA 1K73U 2ZPIB 3P8DA 4A4KA 3OW2P 4CC4B 1VUBA 3REAB 2GQVA 1ZHIA 2VV5A 5KE3A 3QPHA 2DTHA 1VQPT 2K3XA 1P92A 5D6YA 3JB9F 4HT8A 3M4GA 2RO0A 2MMPA 1MV0B 4ZTJA 5CKDA 5FU7C 2RM4A 2BUDA 3CEYA 4AG2C 5IT9E 1Y07A 3P8HA 5CKFA 2ZPEB 1I81A 3CBPA 1H92A 1BU1A 4XU2A 1CKBA 1OPKA 3RBBB 2RJCA 3CXCA 3H8ZA 1UJ0A 4PFPA 4PNOA 1WYXA 3JB9D 2YSQA 1PSEA 1FMVA 5IXBA 5EG2A 1IHVA 3S3OA 2DEQA 4ZGDB 2R58A 4J9FA 4M75G 1R0CB 4E7KA 2LTOA 1IO6A 1UG1A 2PZ1A 1JEGA 3OBYA 4FSXA 1ACMB 2QQSA 4LUDA 4NOYA 2FO0A 2HQHA 1U1SA 3CCSA 1PKTA 5GAOm 1OZ3A 5GAMe 2DZ9A 2LNHB 4J7FA 2XMFA 3Q1JA 4BUGA 2FZGB 2OJ2A 4A4EA 2EQKA 2O01E 1GCPA 1I0CA 3QO3A 1C0MA 3L42A 3OYHA 1VQ9A 1SF9A 1VQMT 1K9MR 2E64A 1Z9ZA 1YIJT 2MF2A 1D3BB 2EIFA 1TUCA 2MWOA 4OB3B 2L3RA 2VC8A 5LJ3e 3JCMQ 3TVTA 1VQ6A 1H8KA 2EQJA 3G71Q 2KBTA 1D3BA 1LVKA 3CCQQ 1D0YA 2EYZA 3JCMd 1UB4A 1F1BB 1SEMA 4JJDA 4KUIA 1RAAB 3RKXA 5CKBA 4JS5A 2D8JA 2PUKB 2MPXC 4FYWB 1WXTA 4HCZA 3QJ6A 1VQ5A 1MHNA 3ZL7C 4BACA 2MOXA 3UPUA 1RAIB 2QDYB 5KH6A 4L5GA 1NPPA 1WI7A 4GBQA 4LNPA 1YITA 4XTUA 3QWXX 4ZGJB 1VQKA 1ZSGA 4PFZA 2RQUA 2DD4A 2DK3A 1SPKA 1K9MU 2CSIA 2OTLT 1WJQA 4DBHA 5GANd 2EKOA 4DBFA 3H9NA 1WNLA 3KFVA 2KR3A 2CKKA 3X24B 3OA6A 1QVGP 1KC8C 4IKFA 2WSFE 1YJWA 4II1A 4J9EA 2DIQA 2Y4XA 2AKKA 3FIFA 2PTKA 4PK4A 3CC7A 2XHCA 2AZVA 2EGEA 3C0CA 1YCSB 2V26A 1ZUUA 4C92D 4LN2A 1RAGB 1JJ2S 3MO8A 4DOVA 3VS6A 4PJJA 1RI0A 2DBMA 5FWBA 3CCSQ 1X27A 3CCRQ 2DYBA 3E9GA 4KH0B 3LWHA 4C8QE 2L0AA 3UF4A 1Q86C 1LOJA 4E7LA 3CC4T 3QDFA 3UA7A 1QVFP 2BZXA 4M75C 1BIBA 1G3YA 3A1PA 4FYXB 1T0HA 3CCMA 4B6MA 3I55T 3NHNA 3M0QA 4R56A 3MP6A 1QCNA 4Z89A 1RL2A 3CCLA 4ZGEB 1WDXA 2WSCE 4JJNK 2KRMA 1EIFA 3A8GB 4QT7A 3BW1A 2FZKB 5CQYA 1S72T 4JDSA 1VQ6Q 1BI1A 4HVVA 1KJWA 2DMOA 1VQOA 3VKIA 2LQNA 2HCKA 1H3ZA 1HYOA 1FYNA 2HEQA 2YWWA 4E6RA 3TREA 1G8XA 3EFRA 4J9DA 4J6XA 4DEYA 2ZZDA 4JRPA 3WXMB 1WXBA 2QGGA 2JM9A 4D6WA 2ZGWA 4GLKA 4C8QC 2KNBB 1VQ4T 3VS5A 2OAWA 1YHQA 2J06A 2JW4A 1OU8A 2CP3A 1X6OA 3CCUT 1KQSP 3L2QA 4JPBW 2RK1A 5GAMh 4F7UG 2KGTA 1U06A 4F04B 1ZUYA 5GAN4 1M1FA 1V29B 2EJFA 1YCYA 2P4RA 5KYWA 2LX7A 4KRTA 3CD6Q 2QXFA 1K4US 1NLOC 5IHNA 2O88A 2NYSA 4A53A 1AT1B 3QUIA 4RTYA 3SWNB 3CMEA 1EFNA 1CSKA 2KT1A 2E3HA 2IIMA 4M4ZA 1IB8A 1UECA 4E7SA 3OS2A 4JRIA 1U3OA 3CMAA 2EJGA 1KHIA 4DEXA 4OMMA 1XTDA 4IUTA 1QVPA 3SWNA 5GAN2 2JN0A 1VQNQ 3HKSA 1YJWQ 2DL4A 1JJ2A 3LYIA 2D0QB 3C94A 2XDPA 1KC8U 3SEMA 2DPPB 2J6OA 3A98A 3BFMA 3QWYA 4O5VA 3QKJA 2DVJA 2DXTA 2QEXT 2QTXA 5LJ3d 2AKLA 2KEAA 2F69A 2DD5A 4A54A 1G3SA 2QQBA 4WCIA 1R0BG 5CR2A 2YRDA 1WHLA 3G4ST 2LP5A 3DLLA 2QQAA 4F14A 4RTZA 3VYHB 3EH2A 2MIOA 2QDLA 2C0TA 2YUPA 2JS2A 3M0PA 3CCJQ 1WHMA 4DQ2A 5FROA 1G5VA 3L2UA 2COWA 2RN8A 3JCMP 2RJFA 4OMQA 2F2XA 3CCVT 2QQ9A 1AOJA 1Q86U 1UEBA 5GAMj 4RTUA 2EGCA 3EGUA 3GF5A 4XQ3A 5KE2A 1VYUA 2BZ8A 4XTVA 1RAFB 4JLGA 1UHCA 2VGMA 1UDLA 2IVWA 2RPNA 5IAYA 2JNGA 3CC2A 2ZAEA 2E70A 1I5LA 4VUBA 2YXYA 2L89A 2ED1A 1ZUKA 2X4WA 2XI9A 1O9SA 1IZ6A 2JS0A 4ZNXA 2X51A 3EAEA 1YNZA 2RHZA 2VB6A 5GAN7 4BI3A 2QA4A 3S3MA 2L3SA 3LW5E 2JZ2A 1X6GA 2RI2A 3C4SA 1OULA 3LH0A 3RESA 3X26B 4RG8A 4BY6B 1NE8A 4IIMA 3C95A 3H0FA 3FLGA 2CUBA 2NUZA 4JLIA 3MEWA 2DAQA 2K7AA 1JXMA 3DKMA 4HVUA 2O9VA 3M0TA 3MEVA 4C0FA 2A0FB 4AG1C 3RERA 2RQVA 5D7UA 3CPWS 1ZSZB 1WA7A 3L2RA 1W6XA 5GJVB 4P5NA 5GAOn 1ZSZA 3CMEQ 4AFQC 3OBWA 2KQWA 2KRNA 4HCBA 4FYYB 1SRMA 3CCQT 2QAZA 2LZ6B 3GNFB 2DERA 3PNWC 4WTOB 2RQTA 1I4K1 2K5LA 1M3CA 4BD3A 3M53A 1S1NA 2DO3A 1QP3A 5FWCA 4NS5A 1N8RR 1OPLA 2DXCA 5C0MA 1GFDA 2E1HA 2LQ8A 3UA6A 3EGXB 1K8AR 3CCEQ 2DF6A 3QHSA 4AFZC 2D8HA 4FL6A 4DBRA 1WQ7A 2VUBA 2XD0A 3EGXA 4C0DB 3G6EA 4OMPA 5FLXE 4OGCA 3NFCA 4Z88A 3S6WA 1VQ7A 5GANg 3QYGB 3PGGA 3NMZC 1QMCA 1QKXA 4V2SA 4BDZA 1QCOA 3TSZA 2R5AA 4EIKA 1G3TA 4HXJA 2OTJA 2HMAA 2KT8A 1RLPC 2RMOA 3HP9A 3PT9A 5KYXB 2LJ0A 4LDUA 1TWBA 2FG0A 2JJ9A 5GAOp 4EDUA 2LCCA 1YI2A 2VVKA 4PJLA 2DL5A 3MKDA 3GLXA 5KYXA 2KROA 2DLPA 3TSWA 3A8HB 3URGA 1H3HA 2P0KA 2HBPA 3HPWA 4PLIA 3CC2Q 3LWIA 4N4IA 3OMGA 1IREB 1QQJA 2K2VA 2YUOA 1R8OB 3JCMb 2RB6A 4PFOA 1K8AU 2GTOA 3UWNA 1NG2A 5EC7A 1WLPB 5DLOA 3J80E 3OW2S 4FCYA 3RMSA 4C5IA 3E1SA 4B9WA 1I5OB 2D9TA 2RHIA 1VQLQ 1SRLA 3VS3A 2K5FA 3LX7A 1GCQC 4C92B 3CCRT 1Y0MA 3FB9A 1BI3A 3CPWA 3H41A 5IXFA 5GMKh 1NM7A 4M7DB 3L2VA 4C92A 5A0GA 4A4HA 2M51A 1YJNA 2RQRA 2D0NA 2FVUA 4M7DA 1B3QA 5KYYB 1D1AA 2X4XA 3VUZA 1TUDA 2HL5C 4FM4B 1KG1A 1D0ZA 4M78B 4PJOB 4QVDA 5KYYA 2RD1A 4IUUA 3BDLA 2C0OA 1IXDA 2OAUA 3M0RA 2AZSA 1JQQA 4PJOA 1BI0A 4Y28E 1VQPA 1NEGA 2CSQA 3TU4K 1BCMA 4J8OA 5GMKm 2P84A 2O2OA 2B8AA 5GAN3 1M1KC 3UDCA 2DRMA 3A8LB 2A36A 3ME9A 4X9DA 1Q82R 2EFIA 1WPYA 3X20B 1TOVA 3M0UA 2KYBA 4XU3A 2CP5A 2X9HA 3OYCA 3SDZA 1QW1A 5AYFA 4C8QG 3G6EQ 2BE9B 4N0AA 2DNUA 2KDSA 1BCOA 1VQ7Q 1MMGA 3LGFA 2QASA 2EQMA 4BB7A 4RUGA 3UATA 1X2KA 2GFAA 1WHJA 1PWTA 4JRQA 4JZ3A 4M7AB 3CD6T 1WGSA 3CBOA 3JCMW 1GCQA 2LJ1A 3OYFA 5GMKj 2FPDA 1VQ8Q 5I11A 3V8JA
chains in the Genus database with same CATH topology
2KAFA 4M7AA 5FU7B 2M1HA 2E41A 4WF2A 3TREA 1W2BS 2FL7A 3EFRA 4J6XA 3KBGA 3JCMe 1N8RU 2ZZDA 2FHDA 3GOXA 3OB9A 4JRPA 3WXMB 2XIDA 4N0AC 5CKHA 4D6WA 4IURA 2ZGWA 4R55A 3TCJA 4F7UE 4GLKA 3RUXA 1VQMA 1FX7A 2XDDA 4C8QC 2JOYA 1YIJA 1VQNT 5LJ3j 1BKBA 5HY6A 4PLLA 1VQ4T 4HT9A 3OW2A 2PU9B 1YHQA 2GF7A 5FRMA 1AHJB 1Y96B 1X6OA 2ZPHB 3CCUT 3SFMA 4JS4A 2HQEA 4XTXA 2X4YA 3MEUA 3L2QA 1H641 3CCST 3G7ZA 4F7UB 3JCMJ 4BE0A 2I2LA 2RK1A 5LJ3g 5GAMh 4F7UG 3JB9G 1Q82U 4RMOA 3M56A 4J7IA 4OMFB 2XG8D 3DLMA 3OYKA 4PKCC 1NJIC 1Y96A 2GFUA 1VQLA 1OYXA 3JCMc 2DVEA 4M77E 4M7AC 5GAN4 1M1FA 1V29B 4OP0A 2EJFA 5J26A 1N27A 1YCYA 4F7UA 4KT0E 1BIAA 3BY7A 5DM7R 5A2QE 2LRQA 4YTLA 3QZ5B 4C92F 1U1TA 4LDYA 1SSFA 2M9UA 3ER0A 2JVVA 1Q7YC 2QXFA 1KD1C 2VXFA 1VQ9T 2DJZA 5GAMf 1M5Q1 2G3RA 4E7IA 2R57A 4A53A 3G6ET 4M77B 3QUIA 3PIOA 2LCLA 4XTYA 3GIBA 3VV0A 2PUOB 4M7DF 3R6OA 4M77G 3SWNB 3CMEA 3WVDB 2RH2A 1Q81C 4E7HA 5GANe 3CCJT 4IUQA 1NPRA 1VQ7T 4LD6A 4QVCA 3OS2A 1UGRB 4JRIA 5LJ5f 3CXCS 3OMCA 2E12A 4ZN3A 3CMAA 1U8RA 4M77A 4EMHA 2EJGA 1KHIA 1QVGS 4MDXA 1XTDA 4IUTA 1QVPA 3SWNA 1VQ6T 5GAN2 2HAXA 2CZ1B 4FIBA 4A4FA 2JN0A 3PTAA 3HKSA 1JJ2A 5A0LA 3FC3A 2OTJT 3LYIA 2E10A 4M78A 3X28B 2LNVA 4M78F 4PJOF 5CKEA 4PL6A 4A4GA 3LGLA 2D0QB 3UT1A 4M7DD 4J83A 5LJ5d 3FRNA 1KD1U 3DB3A 2QQRA 1WQWA 3C12A 3C94A 5CVIA 5LL6S 3O8VA 2H3JA 2XDPA 5D6XA 2WSEE 4X34A 1KC8U 1M4ZA 2DPPB 1YI2T 3BFMA 2RA2A 3V8LA 2OTLA 5GAN5 2E5QA 3ASKA 1MGQA 4O5VA 3T9NA 3CCRA 2HNIA 2CZ7B 3QKJA 3V7RA 3JCMX 3JB9J 2DXTA 2MI6A 2QEXT 1N9RA 2CS7A 2QTXA 2RK2A 3OYAA 5LJ3d 1XOVA 5HKCA 5GAOr 4JUVA 3JCMh 2F69A 3V8KA 2DD5A 4A54A 3OYEA 1VQ5T 1G3SA 1OI1A 2QQBA 3SD4A 4MZTA 4M77C 4M78D 5CR2A 4PJOD 3SWNC 3G4ST 2MWPA 5I2MA 3M5AA 3DLLA 3OYNA 2A3LA 2XKOC 2QQAA 2JTFA 5CO7A 3OYJA 4J6WA 2E65A 2K5IA 2LDMA 4M78C 3VYHB 1BI2A 3OYLA 3F70A 3G71A 1YITT 1BYMA 3A5ZB 3BDUA 1XNIA 2V8JA 4C8QF 1VQKT 3X25B 2PVDB 5FROA 4DQ2A 1G5VA 3OYYA 3JCMf 2D6FA 3L2UA 2E6NA 2RJFA 3JCMP 2NLUA 2YHTA 4NL2A 4OB1B 2QQ9A 3JB9I 3CCVT 1M90C 4ME7A 4BE2A 3A8MB 1M1KU 1Q86U 1UEBA 2LQKA 4IUPA 4J5YA 3VYGA 5GAMj 1DJ7B 3GF5A 2VXEA 4HKEA 2PVOB 3OS5A 3QG1A 4XQ3A 2Y90A 5KE2A 4QW2A 2RHUA 2YLBA 1HK9A 3E9FA 4XTVA 2HQXA 1GXIE 1Y7XA 4GY5A 4JLGA 3M9QA 2VGMA 4XTZA 3HHTB 3INZA 2P4TA 5LJ5j 2ZCFB 5GAMg 1W2BA 3L1AA 4M7AF 2IVWA 1VQ8A 4ZN1A 5IAYA 2EJ9A 1JBMA 4C8QD 3JB9H 2JNGA 2M0OA 4EMGA 4L6V5 1YJNT 3CC2A 2K3YA 5DY9A 2DTIA 4C5HA 2E70A 1I5LA 2FYKA 1FXXA 4VUBA 2L89A 2X4WA 2XI9A 4DOWA 1O9SA 5LJ5g 5GAOq 1IZ6A 5GANh 3EAEA 3JSCA 1I8FA 1YJWT 1K9MC 3QYHB 2RHZA 3QXEB 2RHXA 3M58A 5GAN7 1M90U 5D6WA 4BI3A 4C0GA 2QA4A 3S3MA 3OY9A 2VGNA 2L8DA 3LW5E 3HRUA 3CC4A 2AHJB 2ZPIB 2JZ2A 1K73U 3V7CA 2RI2A 3C4SA 3P8DA 4A4KA 3LH0A 4O6JA 3RESA 3CC7T 3M59A 4ATOA 4JRKA 4M7AD 3RIRA 3OYBA 3I55A 3OYIA 3X26B 3QIIA 1VUBA 4OGEA 2DTOA 2GQVA 1ZHIA 2VV5A 2KVQG 3QPHA 2DTHA 4RG8A 4BY6B 5KE3A 5GANf 1NE8A 4CI0C 3S3NA 3C95A 2DXUA 1VQPT 2FB7A 2K3XA 3JAME 1P92A 3N5BB 4XTWA 5D6YA 3JB9F 4HT8A 3M4GA 2RO0A 4F7UF 2K57A 3FLGA 2MMPA 2F5KA 2RI3A 3CCET 4JLIA 2EWNA 3MEWA 1QP2A 1S72A 4ZTJA 2JUFA 5CKDA 2DAQA 1UGPB 5FU7C 2RM4A 3DKMA 3AHUA 3ZEHA 2CZ0B 3CD6A 2BUDA 3MEVA 3PMIA 4LDWA 3CEYA 5CK9A 3PIPA 5IT9E 4C0FA 1Y07A 2VYTA 2X4JA 3H6ZA 3P8HA 5CKFA 3RERA 2ZPEB 1I81A 3NTIA 2ZPBB 4MMLA 3CPWS 3CBPA 4M75E 1G3WA 3CBMA 4XU2A 2ZPFB 3I56T 2RJCA 3CXCA 3H8ZA 3JCMV 3VUBA 5J39A 3L2RA 4RKUE 3CCMT 1QVGA 4PNOA 1NJIU 4M77F 3JB9D 1PSEA 3HFOA 2PVGB 4P5NA 5GAMd 4LDVA 4ZTFA 1Y71A 4RG2A 3DB4A 5GAOn 4Q5WA 3FDRA 5EG2A 3FJPA 1W4SA 3OBWA 3S3OA 2KQWA 2DEQA 1YBYA 2ZPGB 2A7YA 2R58A 1ZQ1A 4M75B 4OB0B 4ZGDB 3CCLT 4HCBA 1M8VA 4M75G 5GAOl 3RKWA 3CCQT 1VQNA 2XU8A 2P0QA 2P0PA 4E7KA 2LTOA 3GNFB 4QQDA 4B9XA 3PNWC 1VQ4A 1Q7YU 4XU1A 1I4K1 4BY6C 2YLCA 2K5LA 2Y4YA 3OBYA 4BD3A 5GMKi 4FSXA 4EPCA 2QQSA 3M53A 3CCUA 1YJ9T 4BI4A 2DO3A 4NOYA 2KY9A 1QP3A 1U1SA 4N4HA 3OYMA 5GAOm 3CCSA 1Q81U 1VQOT 4NS5A 5J3BA 2LT1A 4M77D 1OZ3A 2LT4A 1N6AA 2DXCA 5C0MA 2E1HA 1KQ2A 2LQ8A 5GAMe 1JRIA 2DZ9A 4J7FA 3Q1JA 4BUGA 2X35A 4A4EA 2F5TX 2EQKA 2XK0A 3E19A 3QHSA 3M4YA 3QZ9B 2O01E 4EMKB 5GMKe 4FL6A 3MCAB 1WQ7A 2VUBA 2R5MA 3QO3A 3L42A 5GANj 2YRVA 3RMQA 5LJ5e 2XD0A 3OYHA 1VQ9A 1VQMT 2DXBA 2E64A 4C0DB 3PMTA 3G6EA 1YIJT 4KBMB 1QVFS 3OS1A 2MF2A 3OS0A 1TH7A 5FLXE 4EMKA 1YHQT 4OGCA 4J6YA 3NFCA 1D3BB 2QI2A 2EIFA 1WJSA 2IG0A 3S6WA 3VJPA 3RKYA 3L2ZA 3CCJA 1VQ7A 2MWOA 5GANg 3L2WA 3QYGB 4OB3B 2L3RA 5CAIA 3PGGA 2VC8A 5LJ3e 4KUDK 2BKDN 5I2SA 3GPLA 2GCXA 2V8KA 3SB2A 3JCMQ 2EAYA 4TVRA 1VQ6A 2EQJA 4V2SA 4BDZA 1D3BA 1VQLT 2R5AA 1WJRA 1N8RC 5GAN6 2KSSA 3KXTA 1G3TA 1LJOA 2OTJA 3MP1A 3JCMd 1UB4A 3HP9A 3OQ5A 3OSVA 3MP8A 3PT9A 1K8AC 2XDBA 4HA8A 4KUIA 4LDUA 3RKXA 2CZ6B 5CKBA 4JS5A 5GAOp 3TEEA 3CPFA 4EDUA 4Y91A 2LCCA 5KCHA 1YI2A 4LD9K 3HRTA 1O75A 2HD0A 2V8IA 4RCCA 2O4XB 2PUKB 3GLXA 1VIFA 3CMET 3A8OB 4EMKC 3HRSA 4MZPA 2QEXA 3A8HB 3URGA 1XQHA 2HBPA 2P0KA 3HPWA 4HCZA 3QJ6A 1VQ5A 4PLIA 5CQXA 4DA4A 3LWIA 1MHNA 4C0DC 4Z02A 5HK0A 4BACA 2DIGA 3CMAT 2O4XA 5GAN8 4N4IA 3UPUA 3META 1B34B 3OMGA 3G4SA 2QDYB 5KCOA 1IREB 5KH6A 4L5GA 1NPPA 2K2VA 4CRIA 4E7JA 1R8OB 1ZBXA 3QSUA 3JCMb 2RB6A 4QVZA 1K8AU 4C92E 3UWNA 1YITA 3JRZA 2C06A 1KQSA 3NTKA 1B34A 3KUFA 4XTUA 5CIUA 3WVEB 4ZGJB 1KQSS 1VQKA 5DLOA 3J80E 3OW2S 5I21A 1UGSB 1NZ9A 3RMSA 5C6SA 4C5GA 3PFSA 4C5IA 1N9SA 3E1SA 3M57A 4B9WA 2EQUA 4ELYC 2MAMA 5A0DA 3CCVA 3MHXA 2M16A 2DD4A 2DK3A 2D9TA 4MZMA 1K9MU 4M7DE 2RHIA 2OTLT 3OYGA 1WJQA 4KULA 2PQWA 5GANd 2K5FA 3LX7A 4C92B 3CCRT 3OYDA 4C92G 3FB9A 2CYZB 2EKOA 4FT4A 1BI3A 3CPWA 2KMTA 4MMKA 1WNLA 5GMKh 2RHYA 4M7DB 3HSBA 2XICA 4OVAA 5M9OA 5LJ5h 3ZFJA 1X75C 4C92A 3J81E 3L2VA 4M7DG 5A0GA 4A4HA 2CKKA 4BE1A 3X24B 1YJNA 2WACA 3JCMg 4M78E 4PJOE 3ZBDA 3J7AF 2RJEA 3OA6A 3G71T 1KC8C 2FVUA 3MEAA 4M7DA 4OB2B 2LX9A 4ELZC 4IKFA 2WSFE 3V7SA 1YJWA 3P8BB 2X4XA 4II1A 4XAXB 5LJ3h 2DIQA 2Y4XA 3VUZA 1HXDA 4FM4B 3FIFA 1KG1A 3FEOA 1KHCA 4MDWA 2K4YA 4M78B 4PJOB 2LC4A 2JTMA 4M75A 4M78G 4QVDA 4PJOG 4M75F 4QQGA 2XHCA 3CC7A 2RD1A 4XU0A 5GMKl 5DLQE 4IUUA 3BDLA 4C92D 1LNXA 2E6ZA 2EYQA 4NL3A 4BDYA 2OAUA 1JJ2S 3QBYA 3LLRA 3MO8A 4PJOA 4DOVA 4XK8E 1BI0A 4Y28E 4C5EA 1VQPA 2DKGA 3GP8A 1UGQB 3M54A 4BI8B 1RI0A 5LJ3f 4C92C 3TU4K 4HCCA 4J8OA 5GMKm 1VQ8T 2L5QA 2B8AA 3CCEA 3CC2T 1M1GA 5GAN3 4L59A 5FU6B 2DZCA 3E9GA 3LWHA 2CGHA 3QDRB 4C8QE 4M7DC 1M1KC 3UDCA 3A8LB 4M75D 1QVFA 1Q86C 3ME9A 1LOJA 1X01A 4X9DA 2EFIA 4E7LA 1WPYA 4FT2A 3X20B 4N4GA 2QA4T 3EFSA 2RJDA 2LVMA 3CC4T 5HK3A 5FRNA 3NTHA 4XU3A 3I56A 1BIBA 1KQ1A 1G3YA 4M75C 4UC4A 3OYCA 4LDXA 3GNGA 4C8QB 3CCMA 3I55T 3SDZA 1QW1A 5AYFA 4OF1A 4C8QG 5CCAA 4R56A 1VIEA 3MP6A 3M55A 4N0AA 4M7AE 4PJOC 2RI5A 1RL2A 4QQ6A 4X9CA 4ZGEB 3CCLA 2KDSA 2WSCE 1FWZA 4C8QA 4E47A 1EIFA 3CCQA 4JJNK 3A8GB 3LGFA 3HL8A 3BW1A 3VU3C 2EQMA 4BB7A 5L8RE 2GFAA 4IUVA 5CQYA 5IN1A 1S72T 3OSSC 4JDSA 4JRQA 1YJ9A 4RCBA 4M7AB 1K73C 3HFNA 1BI1A 4C0ZA 3CD6T 1WGSA 1OZ2A 3CBOA 4M7AG 1VQOA 1M9SA 3VKIA 3JCMW 1H3ZA 2BIVA 1JB0E 3OYFA 5GMKj 1Q82C 5FU6C 3QJYA 1PSFA 4FU6A 2KK4A 3V8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQW A;  3PNW C;  3OYJ A;  3LX7 A;  2M1H A;  3OYD A;  2LDM A;  4BD3 A;  3OYL A;  2EKO A;  3F70 A;  2QQS A;  2FHD A;  3GOX A;  3OB9 A;  1XNI A;  4N4H A;  5FRO A;  3OYM A;  2RHY A;  1G5V A;  3L2U A;  4NS5 A;  2E6N A;  2RJF A;  4IUR A;  4OVA A;  2NLU A;  1OZ3 A;  5M9O A;  3L2V A;  4BE2 A;  4A4H A;  5C0M A;  2CKK A;  4IUP A;  4BE1 A;  2WAC A;  4PLL A;  2GF7 A;  5FRM A;  5KE2 A;  2RJE A;  3Q1J A;  2X35 A;  4QW2 A;  3OA6 A;  2RHU A;  3E9F A;  2EQK A;  2XK0 A;  3MEA A;  4A4E A;  2HQX A;  2HQE A;  4IKF A;  2X4Y A;  4GY5 A;  3MEU A;  4FL6 A;  3M9Q A;  3L2Q A;  2X4X A;  4II1 A;  2R5M A;  3L42 A;  4BE0 A;  2DIQ A;  2YRV A;  3OYH A;  3DLM A;  3OYK A;  3FEO A;  1KHC A;  3PMT A;  2GFU A;  5IAY A;  2M0O A;  3OS1 A;  1OYX A;  2K3Y A;  4QQG A;  4C5H A;  3OS0 A;  4IUU A;  1WJS A;  2IG0 A;  1N27 A;  2L89 A;  3BDL A;  5J26 A;  2X4W A;  3S6W A;  2MWO A;  2LRQ A;  4BDY A;  3L2W A;  2L3R A;  3EAE A;  1SSF A;  2RHZ A;  3LLR A;  2RHX A;  2BKD N;  3MO8 A;  3QBY A;  5D6W A;  4C5E A;  3S3M A;  3OY9 A;  2L8D A;  1RI0 A;  2EQJ A;  2JZ2 A;  4BDZ A;  2G3R A;  2R57 A;  2RI2 A;  2R5A A;  3C4S A;  1WJR A;  2B8A A;  3P8D A;  3LH0 A;  4L59 A;  3MP1 A;  3OYB A;  3OYI A;  3E9G A;  3QII A;  4E7H A;  3OQ5 A;  4IUQ A;  3MP8 A;  4LD6 A;  5KE3 A;  3OS2 A;  3OMC A;  3ME9 A;  4E7L A;  3S3N A;  2EFI A;  4N4G A;  2K3X A;  4IUT A;  4EDU A;  5D6Y A;  2LCC A;  2LVM A;  2RJD A;  5KCH A;  5FRN A;  2RO0 A;  3NTH A;  3FLG A;  4A4F A;  2O4X B;  2F5K A;  2RI3 A;  4UC4 A;  3OYC A;  3FC3 A;  3LYI A;  3MEW A;  4ZTJ A;  4PL6 A;  4A4G A;  2DAQ A;  3LGL A;  2P0K A;  4HCZ A;  3UT1 A;  3QJ6 A;  3ZEH A;  3MP6 A;  2BUD A;  3MEV A;  4PLI A;  3DB3 A;  2QQR A;  3PMI A;  1MHN A;  3CEY A;  4Z02 A;  4BAC A;  2DIG A;  4E7K A;  2VYT A;  2O4X A;  2RI5 A;  3H6Z A;  3O8V A;  3P8H A;  2XDP A;  4N4I A;  5D6X A;  3MET A;  4QQ6 A;  4X34 A;  3OMG A;  3NTI A;  5KCO A;  5KH6 A;  3LGF A;  2E5Q A;  3ASK A;  2RJC A;  4CRI A;  3H8Z A;  2EQM A;  4E7J A;  5J39 A;  3L2R A;  3QKJ A;  2GFA A;  4IUV A;  4QVZ A;  5IN1 A;  3UWN A;  3OYA A;  3NTK A;  5CIU A;  3KUF A;  3OYE A;  4ZTF A;  1OI1 A;  1OZ2 A;  1WGS A;  3DB4 A;  4Q5W A;  3FDR A;  4RG2 A;  3SD4 A;  5C6S A;  3S3O A;  1H3Z A;  4C5G A;  2BIV A;  3PFS A;  4B9W A;  4C5I A;  2R58 A;  4E7I A;  2EQU A;  3OYF A;  2MWP A;  2M16 A;  2D9T A;  4FU6 A;  2RHI A;  3OYN A;  3OYG A;  1WJQ A;  2LTO A;  4QQD A;  4B9X A;  2JTF A; 
#chains in the Genus database with same CATH topology
 4M7A A;  5FU7 B;  2E41 A;  1W2B S;  3KBG A;  2H3E B;  1Q7Y R;  1KD1 R;  2FHD A;  3GOX A;  3OB9 A;  2YDL A;  2GNC A;  3M0S A;  2DIL A;  5CKH A;  1VQM A;  1YIJ A;  1Q81 R;  2L2P A;  1VQN T;  2EKH A;  4PLL A;  4J9H A;  1VOM A;  3OW2 A;  1QKW A;  5FRM A;  8ATC B;  2DE0 X;  4JS4 A;  2FZC B;  2MK5 A;  4XTX A;  2FRY A;  2X4Y A;  3JCM J;  1B7T A;  2EW3 A;  2I2L A;  5LJ3 g;  3JB9 G;  1Q82 U;  4KGZ B;  4PKC C;  2GFU A;  1NBE B;  1RAC B;  1N27 A;  4KT0 E;  5DM7 R;  2LRQ A;  4C92 F;  2GQI A;  4R0K A;  3ER0 A;  2K6D A;  1M1K R;  2VXF A;  1M30 A;  1M5Q 1;  4M77 B;  4M7D F;  4RTT A;  3I9Q A;  3WVD B;  2AK5 A;  4E7H A;  3CCJ T;  4IUQ A;  4LD6 A;  2F1L A;  1JO8 A;  1UGR B;  2E12 A;  4M77 A;  1QVG S;  4MDX A;  4HVW A;  4FIB A;  3X28 B;  4D8K A;  4M78 F;  4PJO F;  5CKE A;  4PL6 A;  3LGL A;  3UT1 A;  4M7D D;  1WX6 A;  1M90 R;  1KD1 U;  1JJ2 P;  1D09 B;  5CVI A;  3O8V A;  2H3J A;  5D6X A;  4X34 A;  1R77 A;  3EHQ A;  2X3X D;  2OTL A;  5GAN 5;  3ASK A;  2RF0 A;  2HNI A;  2CZ7 B;  3V7R A;  3JCM X;  1N9R A;  2RK2 A;  1XOV A;  3V8K A;  1K1Z A;  3SD4 A;  4M78 D;  4PJO D;  4LUE A;  3SWN C;  1VQ9 Q;  1GFC A;  3M5A A;  1AZG B;  2A3L A;  3PVL A;  2JTF A;  5CO7 A;  2JMA A;  4RTV A;  2K5I A;  1TTH B;  3BDU A;  3X25 B;  3OYY A;  3JCM f;  2D6F A;  1YFN A;  4OB1 B;  2FPF A;  4ME7 A;  1M1K U;  2BTT A;  4J5Y A;  1DJ7 B;  1G83 A;  2VXE A;  3OS5 A;  3QG1 A;  2Y90 A;  4Z8A A;  1J3T A;  4QW2 A;  1I1J A;  3E9F A;  1HK9 A;  2GTJ A;  2HQX A;  5IHI A;  1GXI E;  4GY5 A;  1V76 A;  3HHT B;  4KGX B;  3INZ A;  1ZA1 B;  1SG5 A;  1W2B A;  1MND A;  4M7A F;  2KRS A;  2OX7 A;  1TSF A;  2M0O A;  2DET A;  2K3Y A;  2DTI A;  2AIR B;  1GRI A;  2FYK A;  5KYU B;  3VS7 A;  1IGU A;  5LJ5 g;  5GAO q;  1VQ5 Q;  3QXE B;  1M90 U;  5D6W A;  3H0H A;  4C0G A;  3OY9 A;  1YN8 A;  2VGN A;  3CC4 A;  5KYU A;  3E2U A;  2V1Q A;  3M59 A;  4ATO A;  4M7A D;  3RIR A;  3I55 A;  2DBK A;  1YIT Q;  2JT4 A;  1X2Q A;  5GAN f;  4CI0 C;  3S3N A;  1VQK Q;  2HSE B;  2FB7 A;  3N5B B;  1SHF A;  1WXU A;  2F5K A;  3CCE T;  1QP2 A;  1S72 A;  1YP5 A;  3ZEH A;  2CZ0 B;  2CUD A;  3PMI A;  1E7O A;  3PIP A;  2X4J A;  2O31 A;  2ZPB B;  4MML A;  1G3W A;  3I56 T;  1KFZ A;  3JCM V;  3VUB A;  9ATC B;  2EYY A;  1QVG A;  4M77 F;  2PVG B;  4A63 B;  5GAM d;  4LDV A;  1MNE A;  2SRC A;  3EG3 A;  4RG2 A;  3DB4 A;  1YBY A;  4M75 B;  2A7Y A;  1M8V A;  2K2M A;  1G2B A;  5GAO l;  3RKW A;  2OI3 A;  2XU8 A;  2P0Q A;  2VAS A;  4QQD A;  1VQ4 A;  4XU1 A;  3CC7 Q;  4BY6 C;  1BB9 A;  1PNJ A;  3CCU A;  2EPD A;  1YJ9 T;  1AVZ C;  4BI4 A;  1EX4 A;  4N4H A;  3BE3 A;  2CT3 A;  4M77 D;  2LT4 A;  3RDV A;  1N6A A;  1KQ2 A;  1JRI A;  2B86 A;  1OX9 A;  3AT1 B;  2M02 A;  2F5T X;  3E19 A;  3SHW A;  1K0X A;  4EMK B;  5GMK e;  1ZSZ C;  2R5M A;  3RMQ A;  1FMW A;  2DXB A;  3PMT A;  2SEM A;  1Y57 A;  2HL3 A;  3OS1 A;  3I5R A;  3PE0 A;  3OS0 A;  4EMK A;  1NYF A;  2IG0 A;  3RKY A;  3L2Z A;  4JJB A;  3CCM Q;  2QGF B;  2HSP A;  3L2W A;  4KUD K;  5I2S A;  2V8K A;  1RI9 A;  2EAY A;  2DYI A;  2W0Z A;  3CCL Q;  2D1X A;  1VQL T;  1ABQ A;  1WJR A;  5GAN 6;  2KSS A;  3KXT A;  1N8R C;  1KK7 A;  3THK A;  3OSV A;  2XDB A;  3MP8 A;  3MJX A;  1K8A C;  4HA8 A;  1JU5 C;  5ECA A;  2CZ6 B;  1VQO Q;  4Y91 A;  5KCH A;  2JM8 A;  4LD9 K;  2O4X B;  1VIF A;  1HSQ A;  2GBQ A;  2QEX A;  3NPF A;  5CQX A;  4DA4 A;  4C0D C;  4Z02 A;  2O4X A;  7AT1 B;  5GAN 8;  3MET A;  3G4S A;  1M2O A;  5KCO A;  2RQW A;  4E7J A;  1ZBX A;  4QVZ A;  1MMN A;  1YHQ Q;  4C92 E;  1KQS A;  5CIU A;  3KUF A;  3WVE B;  1YWP A;  5I21 A;  1UGS B;  1NZ9 A;  3MPU B;  1N9S A;  1RLQ C;  3M57 A;  5A0D A;  3CCV A;  4MZM A;  2M16 A;  3RR6 A;  4M7D E;  3OYG A;  4KUL A;  2PQW A;  3U23 A;  4J9C A;  2VKN A;  2RNA A;  4FT4 A;  1ZX6 A;  4J9B A;  2KMT A;  4MMK A;  1ZA2 B;  4OVA A;  5M9O A;  4CC7 A;  3ZFJ A;  5LJ5 h;  1S72 Q;  2EGA A;  2WAC A;  4KGV B;  3JCM g;  4M78 E;  4PJO E;  3CXC P;  1OQK A;  3G71 T;  1N5Z A;  3NGP A;  4ELZ C;  1RAH B;  4XAX B;  3CMA Q;  4RTW A;  2NUT B;  1KHC A;  2QYZ A;  4MDW A;  2K4Y A;  2DL7 A;  2JTM A;  2CH4 W;  1PM3 A;  4M75 F;  5DLQ E;  1RAB B;  2YT6 A;  1LNX A;  2DFU A;  4F17 A;  4BDY A;  2ATC B;  2HKN A;  2F2V A;  3LLR A;  1VYT A;  2YRC A;  3GP8 A;  1FMK A;  4HCC A;  1OOT A;  5LJ3 f;  4C92 C;  1VQ8 T;  2L5Q A;  1MMA A;  4L59 A;  5FU6 B;  2DZC A;  1ZBJ A;  2EYX A;  3QDR B;  4M7D C;  4M75 D;  1X01 A;  1BBZ A;  2YUQ A;  1W1F A;  2LVM A;  5HK3 A;  3NTH A;  2ABL A;  4UC4 A;  3GNG A;  1NEB A;  4AT1 B;  1X69 A;  1JXO A;  1VIE A;  3M55 A;  4M7A E;  4PJO C;  2DRK A;  1M2V B;  4X9C A;  2I0N A;  2BE7 D;  4E47 A;  3CCQ A;  3HL8 A;  1ARK A;  3VU3 C;  3EH1 A;  5L8R E;  3OSS C;  3VS0 A;  4RCB A;  1M2V A;  3HFN A;  5GJW B;  4C0Z A;  1AWO A;  2CP6 A;  3EG1 A;  1WZO A;  2BIV A;  4AFS C;  1JB0 E;  4D8D A;  4J9I A;  2K9G A;  1Q82 C;  3QJY A;  4FU6 A;  2EQI A;  2KK4 A;  1RAE B;  2DM1 A;  4WF2 A;  2FL7 A;  1N8R U;  4CC2 A;  4N0A C;  2HZY A;  3TCJ A;  3RUX A;  2QA4 Q;  1FX7 A;  4OMN A;  1Q95 G;  2KXC A;  2PU9 B;  8AT1 B;  1AHJ B;  1Y96 B;  3G4S Q;  2ZPH B;  1X43 A;  3SFM A;  2HDA A;  2FPE A;  1WHK A;  1H64 1;  3CCS T;  3G7Z A;  4F7U B;  4BE0 A;  4RMO A;  3M56 A;  4J7I A;  2XG8 D;  2MYS A;  1NJI C;  1Y96 A;  4QKU A;  3JCM c;  4M77 E;  4M7A C;  2HBW A;  2CDT A;  1Z9Q A;  4F7U A;  3CCV Q;  3BY7 A;  1PHT A;  1U1T A;  2ROL A;  1SHG A;  1Q7Y C;  1KD1 C;  1VQ9 T;  2DJZ A;  3VS2 A;  1E6G A;  2R57 A;  1K76 A;  4FW1 A;  1UUE A;  2DA9 A;  3PIO A;  4XTY A;  1PRM C;  3VV0 A;  3GIB A;  1Q81 C;  4QVC A;  5LJ5 f;  3OMC A;  1U8R A;  4EMH A;  2JMC A;  1VQ6 T;  2HAX A;  1D1C A;  2E10 A;  4M78 A;  2LNV A;  4A4G A;  4J83 A;  3FRN A;  2QQR A;  3C12 A;  5IH2 A;  2WSE E;  1M4Z A;  2RA2 A;  1GBQ A;  2A37 A;  3RNJ A;  2COY A;  1WIE A;  2QTV A;  4JZ4 A;  3CCR A;  3JB9 J;  2MI6 A;  3OYA A;  1TUG B;  4JUV A;  3JCM h;  2HKQ B;  1VQ5 T;  1OI1 A;  4MZT A;  4M77 C;  4AMC A;  1XJW B;  3VS1 A;  2O9S A;  2QK0 A;  2MWP A;  3OYN A;  3OYJ A;  2E65 A;  2LDM A;  1BI2 A;  3R6N A;  3F70 A;  1YIT T;  1BYM A;  3A5Z B;  4PJM A;  1XNI A;  2V8J A;  1AD5 A;  1VQK T;  2PVD B;  4ORZ A;  2JTE A;  1M3A A;  2E6N A;  2VWF A;  1X6B A;  1M90 C;  2G6F X;  4IUP A;  2COZ A;  4HKE A;  1NJI R;  2OTJ Q;  2RHU A;  5KYN A;  1EZZ B;  4AFU C;  4XTZ A;  2P4T A;  2ZCF B;  5GAM g;  3L1A A;  2EJ9 A;  1JBM A;  1YI2 Q;  1HD3 A;  4L6V 5;  5DY9 A;  4C5H A;  2KI7 A;  1W2B P;  1OV3 A;  5GAN h;  1YJW T;  1MUZ A;  2L8D A;  2AHJ B;  3V7C A;  4O6J A;  3CC7 T;  4JRK A;  2QG9 B;  3OYB A;  3OYI A;  3QII A;  4OGE A;  2DTO A;  2K3B A;  2KVQ G;  1LCK A;  2J6F A;  2DXU A;  1PG5 B;  3JAM E;  1TS9 A;  4XTW A;  4F7U F;  2K57 A;  2RI3 A;  2EWN A;  1M3B A;  1UTI A;  2J6K A;  2JUF A;  1AWX A;  1UGP B;  3AHU A;  3CD6 A;  4LDW A;  5CK9 A;  2VYT A;  3H6Z A;  4Y92 A;  3NTI A;  4M75 E;  3CBM A;  2ZPF B;  2DEU A;  1YJN Q;  5J39 A;  1PD0 A;  4RKU E;  3CCM T;  1NJI U;  3EG9 B;  3HFO A;  4HCK A;  1QLY A;  4ZTF A;  1Y71 A;  4Q5W A;  3FDR A;  3FJP A;  1W4S A;  2K79 A;  2ZPG B;  4OB0 B;  1ZQ1 A;  3CCL T;  1VQN A;  2J05 A;  2P0P A;  3EG9 A;  4B9X A;  1Q7Y U;  2YLC A;  1E6H A;  2Y4Y A;  5GMK i;  1TU0 B;  4E7Z A;  4EPC A;  2KY9 A;  3OYM A;  1Q81 U;  1VQO T;  5J3B A;  2LT1 A;  1VQP Q;  2PNI A;  1C6V X;  2X35 A;  2XK0 A;  3QZ9 B;  3M4Y A;  1C1A A;  1NYG A;  2IPO B;  3MCA B;  5GAN j;  2YRV A;  5LJ5 e;  1TXQ A;  3REB B;  4KBM B;  1QVF S;  1TH7 A;  3FJ5 A;  1TG0 A;  4J6Y A;  2DL3 A;  1YHQ T;  2QI2 A;  1WJS A;  3VJP A;  2L3Q A;  2ED0 A;  3CCJ A;  5CAI A;  2BKD N;  5I22 A;  3GPL A;  2GCX A;  3SB2 A;  2ROT A;  4TVR A;  1OEB A;  1ZLM A;  2FEI A;  1LJO A;  2EVR A;  3MP1 A;  1GBR A;  3OQ5 A;  4X1V A;  2DX1 A;  2LJ3 A;  1M8M A;  2M0Y A;  3TEE A;  2BZY A;  3CPF A;  2H8H A;  2F2W A;  3HRT A;  1O75 A;  2HD0 A;  2V8I A;  4RCC A;  3CME T;  3A8O B;  4EMK C;  3EGD B;  3HRS A;  4MZP A;  1VYV A;  4DBQ A;  1XQH A;  5HK0 A;  3CMA T;  2DIG A;  1B34 B;  3EGD A;  1VQM Q;  1YIJ Q;  4CRI A;  1KC8 R;  3QSU A;  3JRZ A;  1QCF A;  2C06 A;  3EG2 A;  3NTK A;  1B34 A;  1KQS S;  2KYM A;  5C6S A;  4C5G A;  3PFS A;  4ELY C;  4E7I A;  2EQU A;  2MAM A;  3MHX A;  3VS4 A;  2DJQ A;  3VRZ A;  1K0S A;  2ECZ A;  3TQ7 P;  3OYD A;  5KYW B;  4C92 G;  1UE9 A;  2CYZ B;  6AT1 B;  1OX8 A;  4PJN A;  2X3W D;  2RHY A;  2CP2 A;  3HSB A;  2XIC A;  1UFF A;  1X75 C;  3J81 E;  4M7D G;  2CH4 A;  4BE1 A;  3ZBD A;  1PKS A;  3J7A F;  2RJE A;  2W10 A;  1Q86 R;  3MEA A;  4OB2 B;  2LX9 A;  2NWM A;  3V7S A;  3P8B B;  5LJ3 h;  3EFO B;  1AWJ A;  1HXD A;  5L23 A;  2LCS A;  3FEO A;  1CKA A;  4E2F B;  2LC4 A;  4M75 A;  2LMJ A;  4M78 G;  4PJO G;  4FW2 A;  4QQG A;  4XU0 A;  5GMK l;  2E4H A;  4NL3 A;  2E6Z A;  2EYQ A;  1ABO A;  3EFO A;  2J7I A;  3O5Z A;  3QBY A;  4XK8 E;  4C5E A;  2DKG A;  1UGQ B;  3M54 A;  4BI8 B;  5FW9 A;  4JJC A;  3CCE A;  3CC2 T;  1M1G A;  2OTL Q;  2CGH A;  2JXB A;  1QVF A;  4FT2 A;  4N4G A;  2QA4 T;  3EFS A;  2RJD A;  5FRN A;  2AT1 B;  3I56 A;  1KQ1 A;  3PVQ A;  2A28 A;  4LDX A;  4C8Q B;  2L3P A;  4OF1 A;  5CCA A;  1VA7 A;  1A0N B;  2RI5 A;  3I35 A;  4QQ6 A;  1FWZ A;  2Z0W A;  2CP7 A;  4C8Q A;  1W70 A;  4IUV A;  1UJY A;  5IN1 A;  1IGQ A;  1V1C A;  1YJ9 A;  2NUP B;  1K73 C;  4M7A G;  1OZ2 A;  4ESR A;  1M9S A;  1WHG A;  1WFW A;  2FRW A;  5FU6 C;  1PSF A;  2KAF A;  2C0I A;  2NUP A;  2M1H A;  2KXD A;  1B07 A;  1D1B A;  3JCM e;  3ULR B;  2XID A;  2ESW A;  1D0X A;  4IUR A;  2GGR A;  4R55 A;  4F7U E;  1SSH A;  1LPL A;  1T3S A;  2XDD A;  2JOY A;  2DL8 A;  5LJ3 j;  3CC4 Q;  2CRE A;  2CT4 A;  1BKB A;  5HY6 A;  4HT9 A;  2GF7 A;  1UHF A;  2KE9 A;  3I55 Q;  2HQE A;  2ENM A;  3MEU A;  4IIO A;  1T3L A;  1AWW A;  4OMF B;  3DLM A;  3CQT A;  3OYK A;  5AT1 B;  1VQL A;  1NLP C;  2MCN A;  1OYX A;  5HCK A;  3HTR A;  4GLM A;  3G1J A;  2DVE A;  4OP0 A;  1T0J A;  5J26 A;  1AEY A;  1BIA A;  5A2Q E;  1UGV A;  4YTL A;  3QZ5 B;  3CPW P;  4LDY A;  1YWO A;  1SSF A;  2M9U A;  2JVV A;  3IQL A;  5GAM f;  2G3R A;  3G6E T;  4OMO A;  2LCL A;  2PUO B;  3R6O A;  4M77 G;  2RH2 A;  3EHR A;  5GAN e;  1NPR A;  1VQ7 T;  1QWE A;  4FSS A;  3CXC S;  4ZN3 A;  1IRX A;  5IHK A;  1PD1 A;  3JV3 A;  2CZ1 B;  4A4F A;  3I5S A;  3PTA A;  4LXC A;  5A0L A;  2NUT A;  3FC3 A;  2OTJ T;  1VQ4 Q;  1KIK A;  1RUW A;  3CCU Q;  5LJ5 d;  4FYV B;  3DB3 A;  1WQW A;  5LL6 S;  1K9A A;  1M27 C;  1K73 R;  2A08 A;  1YI2 T;  3V8L A;  2E5Q A;  1MGQ A;  1SKU B;  3T9N A;  1IHW A;  2CS7 A;  3GBQ A;  5HKC A;  3H0I A;  5GAO r;  3OYE A;  2EYW A;  2YUN A;  3LH5 A;  5I2M A;  1PRL C;  4F16 A;  2E3I A;  2XKO C;  4J6W A;  4K11 A;  4M78 C;  4ANJ A;  3OYL A;  4RTX A;  3G71 A;  3I56 Q;  1I07 A;  4C8Q F;  4LE9 A;  1MMD A;  2NLU A;  2YHT A;  4NL2 A;  3JB9 I;  2E5K A;  4BE2 A;  2LQW A;  3A8M B;  2LQK A;  2EBP A;  3VYG A;  1GL5 A;  2CP0 A;  2PVO B;  4KH1 B;  4OML A;  2YLB A;  1Y7X A;  3M9Q A;  2V1R A;  5LJ5 j;  1PCX A;  1PC0 A;  1BK2 A;  4ZN1 A;  1YJ9 Q;  1VQ8 A;  4C8Q D;  3JB9 H;  1YJN T;  4EMG A;  1OU9 A;  4J9G A;  3VRY A;  1HJD A;  1U5S A;  4CC3 A;  1FXX A;  3D7S B;  1RAD B;  1MV3 A;  4DOW A;  2QEX Q;  1AZE A;  3JSC A;  1K9M C;  1I8F A;  3QYH B;  1WHH A;  2RHX A;  3M58 A;  3EG0 A;  1KSW A;  1QWF A;  3HRU A;  1K73 U;  2ZPI B;  3P8D A;  4A4K A;  3OW2 P;  4CC4 B;  1VUB A;  3REA B;  2GQV A;  1ZHI A;  2VV5 A;  5KE3 A;  3QPH A;  2DTH A;  1VQP T;  2K3X A;  1P92 A;  5D6Y A;  3JB9 F;  4HT8 A;  3M4G A;  2RO0 A;  2MMP A;  1MV0 B;  4ZTJ A;  5CKD A;  5FU7 C;  2RM4 A;  2BUD A;  3CEY A;  4AG2 C;  5IT9 E;  1Y07 A;  3P8H A;  5CKF A;  2ZPE B;  1I81 A;  3CBP A;  1H92 A;  1BU1 A;  4XU2 A;  1CKB A;  1OPK A;  3RBB B;  2RJC A;  3CXC A;  3H8Z A;  1UJ0 A;  4PFP A;  4PNO A;  1WYX A;  3JB9 D;  2YSQ A;  1PSE A;  1FMV A;  5IXB A;  5EG2 A;  1IHV A;  3S3O A;  2DEQ A;  4ZGD B;  2R58 A;  4J9F A;  4M75 G;  1R0C B;  4E7K A;  2LTO A;  1IO6 A;  1UG1 A;  2PZ1 A;  1JEG A;  3OBY A;  4FSX A;  1ACM B;  2QQS A;  4LUD A;  4NOY A;  2FO0 A;  2HQH A;  1U1S A;  3CCS A;  1PKT A;  5GAO m;  1OZ3 A;  5GAM e;  2DZ9 A;  2LNH B;  4J7F A;  2XMF A;  3Q1J A;  4BUG A;  2FZG B;  2OJ2 A;  4A4E A;  2EQK A;  2O01 E;  1GCP A;  1I0C A;  3QO3 A;  1C0M A;  3L42 A;  3OYH A;  1VQ9 A;  1SF9 A;  1VQM T;  1K9M R;  2E64 A;  1Z9Z A;  1YIJ T;  2MF2 A;  1D3B B;  2EIF A;  1TUC A;  2MWO A;  4OB3 B;  2L3R A;  2VC8 A;  5LJ3 e;  3JCM Q;  3TVT A;  1VQ6 A;  1H8K A;  2EQJ A;  3G71 Q;  2KBT A;  1D3B A;  1LVK A;  3CCQ Q;  1D0Y A;  2EYZ A;  3JCM d;  1UB4 A;  1F1B B;  1SEM A;  4JJD A;  4KUI A;  1RAA B;  3RKX A;  5CKB A;  4JS5 A;  2D8J A;  2PUK B;  2MPX C;  4FYW B;  1WXT A;  4HCZ A;  3QJ6 A;  1VQ5 A;  1MHN A;  3ZL7 C;  4BAC A;  2MOX A;  3UPU A;  1RAI B;  2QDY B;  5KH6 A;  4L5G A;  1NPP A;  1WI7 A;  4GBQ A;  4LNP A;  1YIT A;  4XTU A;  3QWX X;  4ZGJ B;  1VQK A;  1ZSG A;  4PFZ A;  2RQU A;  2DD4 A;  2DK3 A;  1SPK A;  1K9M U;  2CSI A;  2OTL T;  1WJQ A;  4DBH A;  5GAN d;  2EKO A;  4DBF A;  3H9N A;  1WNL A;  3KFV A;  2KR3 A;  2CKK A;  3X24 B;  3OA6 A;  1QVG P;  1KC8 C;  4IKF A;  2WSF E;  1YJW A;  4II1 A;  4J9E A;  2DIQ A;  2Y4X A;  2AKK A;  3FIF A;  2PTK A;  4PK4 A;  3CC7 A;  2XHC A;  2AZV A;  2EGE A;  3C0C A;  1YCS B;  2V26 A;  1ZUU A;  4C92 D;  4LN2 A;  1RAG B;  1JJ2 S;  3MO8 A;  4DOV A;  3VS6 A;  4PJJ A;  1RI0 A;  2DBM A;  5FWB A;  3CCS Q;  1X27 A;  3CCR Q;  2DYB A;  3E9G A;  4KH0 B;  3LWH A;  4C8Q E;  2L0A A;  3UF4 A;  1Q86 C;  1LOJ A;  4E7L A;  3CC4 T;  3QDF A;  3UA7 A;  1QVF P;  2BZX A;  4M75 C;  1BIB A;  1G3Y A;  3A1P A;  4FYX B;  1T0H A;  3CCM A;  4B6M A;  3I55 T;  3NHN A;  3M0Q A;  4R56 A;  3MP6 A;  1QCN A;  4Z89 A;  1RL2 A;  3CCL A;  4ZGE B;  1WDX A;  2WSC E;  4JJN K;  2KRM A;  1EIF A;  3A8G B;  4QT7 A;  3BW1 A;  2FZK B;  5CQY A;  1S72 T;  4JDS A;  1VQ6 Q;  1BI1 A;  4HVV A;  1KJW A;  2DMO A;  1VQO A;  3VKI A;  2LQN A;  2HCK A;  1H3Z A;  1HYO A;  1FYN A;  2HEQ A;  2YWW A;  4E6R A;  3TRE A;  1G8X A;  3EFR A;  4J9D A;  4J6X A;  4DEY A;  2ZZD A;  4JRP A;  3WXM B;  1WXB A;  2QGG A;  2JM9 A;  4D6W A;  2ZGW A;  4GLK A;  4C8Q C;  2KNB B;  1VQ4 T;  3VS5 A;  2OAW A;  1YHQ A;  2J06 A;  2JW4 A;  1OU8 A;  2CP3 A;  1X6O A;  3CCU T;  1KQS P;  3L2Q A;  4JPB W;  2RK1 A;  5GAM h;  4F7U G;  2KGT A;  1U06 A;  4F04 B;  1ZUY A;  5GAN 4;  1M1F A;  1V29 B;  2EJF A;  1YCY A;  2P4R A;  5KYW A;  2LX7 A;  4KRT A;  3CD6 Q;  2QXF A;  1K4U S;  1NLO C;  5IHN A;  2O88 A;  2NYS A;  4A53 A;  1AT1 B;  3QUI A;  4RTY A;  3SWN B;  3CME A;  1EFN A;  1CSK A;  2KT1 A;  2E3H A;  2IIM A;  4M4Z A;  1IB8 A;  1UEC A;  4E7S A;  3OS2 A;  4JRI A;  1U3O A;  3CMA A;  2EJG A;  1KHI A;  4DEX A;  4OMM A;  1XTD A;  4IUT A;  1QVP A;  3SWN A;  5GAN 2;  2JN0 A;  1VQN Q;  3HKS A;  1YJW Q;  2DL4 A;  1JJ2 A;  3LYI A;  2D0Q B;  3C94 A;  2XDP A;  1KC8 U;  3SEM A;  2DPP B;  2J6O A;  3A98 A;  3BFM A;  3QWY A;  4O5V A;  3QKJ A;  2DVJ A;  2DXT A;  2QEX T;  2QTX A;  5LJ3 d;  2AKL A;  2KEA A;  2F69 A;  2DD5 A;  4A54 A;  1G3S A;  2QQB A;  4WCI A;  1R0B G;  5CR2 A;  2YRD A;  1WHL A;  3G4S T;  2LP5 A;  3DLL A;  2QQA A;  4F14 A;  4RTZ A;  3VYH B;  3EH2 A;  2MIO A;  2QDL A;  2C0T A;  2YUP A;  2JS2 A;  3M0P A;  3CCJ Q;  1WHM A;  4DQ2 A;  5FRO A;  1G5V A;  3L2U A;  2COW A;  2RN8 A;  3JCM P;  2RJF A;  4OMQ A;  2F2X A;  3CCV T;  2QQ9 A;  1AOJ A;  1Q86 U;  1UEB A;  5GAM j;  4RTU A;  2EGC A;  3EGU A;  3GF5 A;  4XQ3 A;  5KE2 A;  1VYU A;  2BZ8 A;  4XTV A;  1RAF B;  4JLG A;  1UHC A;  2VGM A;  1UDL A;  2IVW A;  2RPN A;  5IAY A;  2JNG A;  3CC2 A;  2ZAE A;  2E70 A;  1I5L A;  4VUB A;  2YXY A;  2L89 A;  2ED1 A;  1ZUK A;  2X4W A;  2XI9 A;  1O9S A;  1IZ6 A;  2JS0 A;  4ZNX A;  2X51 A;  3EAE A;  1YNZ A;  2RHZ A;  2VB6 A;  5GAN 7;  4BI3 A;  2QA4 A;  3S3M A;  2L3S A;  3LW5 E;  2JZ2 A;  1X6G A;  2RI2 A;  3C4S A;  1OUL A;  3LH0 A;  3RES A;  3X26 B;  4RG8 A;  4BY6 B;  1NE8 A;  4IIM A;  3C95 A;  3H0F A;  3FLG A;  2CUB A;  2NUZ A;  4JLI A;  3MEW A;  2DAQ A;  2K7A A;  1JXM A;  3DKM A;  4HVU A;  2O9V A;  3M0T A;  3MEV A;  4C0F A;  2A0F B;  4AG1 C;  3RER A;  2RQV A;  5D7U A;  3CPW S;  1ZSZ B;  1WA7 A;  3L2R A;  1W6X A;  5GJV B;  4P5N A;  5GAO n;  1ZSZ A;  3CME Q;  4AFQ C;  3OBW A;  2KQW A;  2KRN A;  4HCB A;  4FYY B;  1SRM A;  3CCQ T;  2QAZ A;  2LZ6 B;  3GNF B;  2DER A;  3PNW C;  4WTO B;  2RQT A;  1I4K 1;  2K5L A;  1M3C A;  4BD3 A;  3M53 A;  1S1N A;  2DO3 A;  1QP3 A;  5FWC A;  4NS5 A;  1N8R R;  1OPL A;  2DXC A;  5C0M A;  1GFD A;  2E1H A;  2LQ8 A;  3UA6 A;  3EGX B;  1K8A R;  3CCE Q;  2DF6 A;  3QHS A;  4AFZ C;  2D8H A;  4FL6 A;  4DBR A;  1WQ7 A;  2VUB A;  2XD0 A;  3EGX A;  4C0D B;  3G6E A;  4OMP A;  5FLX E;  4OGC A;  3NFC A;  4Z88 A;  3S6W A;  1VQ7 A;  5GAN g;  3QYG B;  3PGG A;  3NMZ C;  1QMC A;  1QKX A;  4V2S A;  4BDZ A;  1QCO A;  3TSZ A;  2R5A A;  4EIK A;  1G3T A;  4HXJ A;  2OTJ A;  2HMA A;  2KT8 A;  1RLP C;  2RMO A;  3HP9 A;  3PT9 A;  5KYX B;  2LJ0 A;  4LDU A;  1TWB A;  2FG0 A;  2JJ9 A;  5GAO p;  4EDU A;  2LCC A;  1YI2 A;  2VVK A;  4PJL A;  2DL5 A;  3MKD A;  3GLX A;  5KYX A;  2KRO A;  2DLP A;  3TSW A;  3A8H B;  3URG A;  1H3H A;  2P0K A;  2HBP A;  3HPW A;  4PLI A;  3CC2 Q;  3LWI A;  4N4I A;  3OMG A;  1IRE B;  1QQJ A;  2K2V A;  2YUO A;  1R8O B;  3JCM b;  2RB6 A;  4PFO A;  1K8A U;  2GTO A;  3UWN A;  1NG2 A;  5EC7 A;  1WLP B;  5DLO A;  3J80 E;  3OW2 S;  4FCY A;  3RMS A;  4C5I A;  3E1S A;  4B9W A;  1I5O B;  2D9T A;  2RHI A;  1VQL Q;  1SRL A;  3VS3 A;  2K5F A;  3LX7 A;  1GCQ C;  4C92 B;  3CCR T;  1Y0M A;  3FB9 A;  1BI3 A;  3CPW A;  3H41 A;  5IXF A;  5GMK h;  1NM7 A;  4M7D B;  3L2V A;  4C92 A;  5A0G A;  4A4H A;  2M51 A;  1YJN A;  2RQR A;  2D0N A;  2FVU A;  4M7D A;  1B3Q A;  5KYY B;  1D1A A;  2X4X A;  3VUZ A;  1TUD A;  2HL5 C;  4FM4 B;  1KG1 A;  1D0Z A;  4M78 B;  4PJO B;  4QVD A;  5KYY A;  2RD1 A;  4IUU A;  3BDL A;  2C0O A;  1IXD A;  2OAU A;  3M0R A;  2AZS A;  1JQQ A;  4PJO A;  1BI0 A;  4Y28 E;  1VQP A;  1NEG A;  2CSQ A;  3TU4 K;  1BCM A;  4J8O A;  5GMK m;  2P84 A;  2O2O A;  2B8A A;  5GAN 3;  1M1K C;  3UDC A;  2DRM A;  3A8L B;  2A36 A;  3ME9 A;  4X9D A;  1Q82 R;  2EFI A;  1WPY A;  3X20 B;  1TOV A;  3M0U A;  2KYB A;  4XU3 A;  2CP5 A;  2X9H A;  3OYC A;  3SDZ A;  1QW1 A;  5AYF A;  4C8Q G;  3G6E Q;  2BE9 B;  4N0A A;  2DNU A;  2KDS A;  1BCO A;  1VQ7 Q;  1MMG A;  3LGF A;  2QAS A;  2EQM A;  4BB7 A;  4RUG A;  3UAT A;  1X2K A;  2GFA A;  1WHJ A;  1PWT A;  4JRQ A;  4JZ3 A;  4M7A B;  3CD6 T;  1WGS A;  3CBO A;  3JCM W;  1GCQ A;  2LJ1 A;  3OYF A;  5GMK j;  2FPD A;  1VQ8 Q;  5I11 A;  3V8J A; 
#chains in the Genus database with same CATH homology
 2KAF A;  4M7A A;  5FU7 B;  2M1H A;  2E41 A;  4WF2 A;  3TRE A;  1W2B S;  2FL7 A;  3EFR A;  4J6X A;  3KBG A;  3JCM e;  1N8R U;  2ZZD A;  2FHD A;  3GOX A;  3OB9 A;  4JRP A;  3WXM B;  2XID A;  4N0A C;  5CKH A;  4D6W A;  4IUR A;  2ZGW A;  4R55 A;  3TCJ A;  4F7U E;  4GLK A;  3RUX A;  1VQM A;  1FX7 A;  2XDD A;  4C8Q C;  2JOY A;  1YIJ A;  1VQN T;  5LJ3 j;  1BKB A;  5HY6 A;  4PLL A;  1VQ4 T;  4HT9 A;  3OW2 A;  2PU9 B;  1YHQ A;  2GF7 A;  5FRM A;  1AHJ B;  1Y96 B;  1X6O A;  2ZPH B;  3CCU T;  3SFM A;  4JS4 A;  2HQE A;  4XTX A;  2X4Y A;  3MEU A;  3L2Q A;  1H64 1;  3CCS T;  3G7Z A;  4F7U B;  3JCM J;  4BE0 A;  2I2L A;  2RK1 A;  5LJ3 g;  5GAM h;  4F7U G;  3JB9 G;  1Q82 U;  4RMO A;  3M56 A;  4J7I A;  4OMF B;  2XG8 D;  3DLM A;  3OYK A;  4PKC C;  1NJI C;  1Y96 A;  2GFU A;  1VQL A;  1OYX A;  3JCM c;  2DVE A;  4M77 E;  4M7A C;  5GAN 4;  1M1F A;  1V29 B;  4OP0 A;  2EJF A;  5J26 A;  1N27 A;  1YCY A;  4F7U A;  4KT0 E;  1BIA A;  3BY7 A;  5DM7 R;  5A2Q E;  2LRQ A;  4YTL A;  3QZ5 B;  4C92 F;  1U1T A;  4LDY A;  1SSF A;  2M9U A;  3ER0 A;  2JVV A;  1Q7Y C;  2QXF A;  1KD1 C;  2VXF A;  1VQ9 T;  2DJZ A;  5GAM f;  1M5Q 1;  2G3R A;  4E7I A;  2R57 A;  4A53 A;  3G6E T;  4M77 B;  3QUI A;  3PIO A;  2LCL A;  4XTY A;  3GIB A;  3VV0 A;  2PUO B;  4M7D F;  3R6O A;  4M77 G;  3SWN B;  3CME A;  3WVD B;  2RH2 A;  1Q81 C;  4E7H A;  5GAN e;  3CCJ T;  4IUQ A;  1NPR A;  1VQ7 T;  4LD6 A;  4QVC A;  3OS2 A;  1UGR B;  4JRI A;  5LJ5 f;  3CXC S;  3OMC A;  2E12 A;  4ZN3 A;  3CMA A;  1U8R A;  4M77 A;  4EMH A;  2EJG A;  1KHI A;  1QVG S;  4MDX A;  1XTD A;  4IUT A;  1QVP A;  3SWN A;  1VQ6 T;  5GAN 2;  2HAX A;  2CZ1 B;  4FIB A;  4A4F A;  2JN0 A;  3PTA A;  3HKS A;  1JJ2 A;  5A0L A;  3FC3 A;  2OTJ T;  3LYI A;  2E10 A;  4M78 A;  3X28 B;  2LNV A;  4M78 F;  4PJO F;  5CKE A;  4PL6 A;  4A4G A;  3LGL A;  2D0Q B;  3UT1 A;  4M7D D;  4J83 A;  5LJ5 d;  3FRN A;  1KD1 U;  3DB3 A;  2QQR A;  1WQW A;  3C12 A;  3C94 A;  5CVI A;  5LL6 S;  3O8V A;  2H3J A;  2XDP A;  5D6X A;  2WSE E;  4X34 A;  1KC8 U;  1M4Z A;  2DPP B;  1YI2 T;  3BFM A;  2RA2 A;  3V8L A;  2OTL A;  5GAN 5;  2E5Q A;  3ASK A;  1MGQ A;  4O5V A;  3T9N A;  3CCR A;  2HNI A;  2CZ7 B;  3QKJ A;  3V7R A;  3JCM X;  3JB9 J;  2DXT A;  2MI6 A;  2QEX T;  1N9R A;  2CS7 A;  2QTX A;  2RK2 A;  3OYA A;  5LJ3 d;  1XOV A;  5HKC A;  5GAO r;  4JUV A;  3JCM h;  2F69 A;  3V8K A;  2DD5 A;  4A54 A;  3OYE A;  1VQ5 T;  1G3S A;  1OI1 A;  2QQB A;  3SD4 A;  4MZT A;  4M77 C;  4M78 D;  5CR2 A;  4PJO D;  3SWN C;  3G4S T;  2MWP A;  5I2M A;  3M5A A;  3DLL A;  3OYN A;  2A3L A;  2XKO C;  2QQA A;  2JTF A;  5CO7 A;  3OYJ A;  4J6W A;  2E65 A;  2K5I A;  2LDM A;  4M78 C;  3VYH B;  1BI2 A;  3OYL A;  3F70 A;  3G71 A;  1YIT T;  1BYM A;  3A5Z B;  3BDU A;  1XNI A;  2V8J A;  4C8Q F;  1VQK T;  3X25 B;  2PVD B;  5FRO A;  4DQ2 A;  1G5V A;  3OYY A;  3JCM f;  2D6F A;  3L2U A;  2E6N A;  2RJF A;  3JCM P;  2NLU A;  2YHT A;  4NL2 A;  4OB1 B;  2QQ9 A;  3JB9 I;  3CCV T;  1M90 C;  4ME7 A;  4BE2 A;  3A8M B;  1M1K U;  1Q86 U;  1UEB A;  2LQK A;  4IUP A;  4J5Y A;  3VYG A;  5GAM j;  1DJ7 B;  3GF5 A;  2VXE A;  4HKE A;  2PVO B;  3OS5 A;  3QG1 A;  4XQ3 A;  2Y90 A;  5KE2 A;  4QW2 A;  2RHU A;  2YLB A;  1HK9 A;  3E9F A;  4XTV A;  2HQX A;  1GXI E;  1Y7X A;  4GY5 A;  4JLG A;  3M9Q A;  2VGM A;  4XTZ A;  3HHT B;  3INZ A;  2P4T A;  5LJ5 j;  2ZCF B;  5GAM g;  1W2B A;  3L1A A;  4M7A F;  2IVW A;  1VQ8 A;  4ZN1 A;  5IAY A;  2EJ9 A;  1JBM A;  4C8Q D;  3JB9 H;  2JNG A;  2M0O A;  4EMG A;  4L6V 5;  1YJN T;  3CC2 A;  2K3Y A;  5DY9 A;  2DTI A;  4C5H A;  2E70 A;  1I5L A;  2FYK A;  1FXX A;  4VUB A;  2L89 A;  2X4W A;  2XI9 A;  4DOW A;  1O9S A;  5LJ5 g;  5GAO q;  1IZ6 A;  5GAN h;  3EAE A;  3JSC A;  1I8F A;  1YJW T;  1K9M C;  3QYH B;  2RHZ A;  3QXE B;  2RHX A;  3M58 A;  5GAN 7;  1M90 U;  5D6W A;  4BI3 A;  4C0G A;  2QA4 A;  3S3M A;  3OY9 A;  2VGN A;  2L8D A;  3LW5 E;  3HRU A;  3CC4 A;  2AHJ B;  2ZPI B;  2JZ2 A;  1K73 U;  3V7C A;  2RI2 A;  3C4S A;  3P8D A;  4A4K A;  3LH0 A;  4O6J A;  3RES A;  3CC7 T;  3M59 A;  4ATO A;  4JRK A;  4M7A D;  3RIR A;  3OYB A;  3I55 A;  3OYI A;  3X26 B;  3QII A;  1VUB A;  4OGE A;  2DTO A;  2GQV A;  1ZHI A;  2VV5 A;  2KVQ G;  3QPH A;  2DTH A;  4RG8 A;  4BY6 B;  5KE3 A;  5GAN f;  1NE8 A;  4CI0 C;  3S3N A;  3C95 A;  2DXU A;  1VQP T;  2FB7 A;  2K3X A;  3JAM E;  1P92 A;  3N5B B;  4XTW A;  5D6Y A;  3JB9 F;  4HT8 A;  3M4G A;  2RO0 A;  4F7U F;  2K57 A;  3FLG A;  2MMP A;  2F5K A;  2RI3 A;  3CCE T;  4JLI A;  2EWN A;  3MEW A;  1QP2 A;  1S72 A;  4ZTJ A;  2JUF A;  5CKD A;  2DAQ A;  1UGP B;  5FU7 C;  2RM4 A;  3DKM A;  3AHU A;  3ZEH A;  2CZ0 B;  3CD6 A;  2BUD A;  3MEV A;  3PMI A;  4LDW A;  3CEY A;  5CK9 A;  3PIP A;  5IT9 E;  4C0F A;  1Y07 A;  2VYT A;  2X4J A;  3H6Z A;  3P8H A;  5CKF A;  3RER A;  2ZPE B;  1I81 A;  3NTI A;  2ZPB B;  4MML A;  3CPW S;  3CBP A;  4M75 E;  1G3W A;  3CBM A;  4XU2 A;  2ZPF B;  3I56 T;  2RJC A;  3CXC A;  3H8Z A;  3JCM V;  3VUB A;  5J39 A;  3L2R A;  4RKU E;  3CCM T;  1QVG A;  4PNO A;  1NJI U;  4M77 F;  3JB9 D;  1PSE A;  3HFO A;  2PVG B;  4P5N A;  5GAM d;  4LDV A;  4ZTF A;  1Y71 A;  4RG2 A;  3DB4 A;  5GAO n;  4Q5W A;  3FDR A;  5EG2 A;  3FJP A;  1W4S A;  3OBW A;  3S3O A;  2KQW A;  2DEQ A;  1YBY A;  2ZPG B;  2A7Y A;  2R58 A;  1ZQ1 A;  4M75 B;  4OB0 B;  4ZGD B;  3CCL T;  4HCB A;  1M8V A;  4M75 G;  5GAO l;  3RKW A;  3CCQ T;  1VQN A;  2XU8 A;  2P0Q A;  2P0P A;  4E7K A;  2LTO A;  3GNF B;  4QQD A;  4B9X A;  3PNW C;  1VQ4 A;  1Q7Y U;  4XU1 A;  1I4K 1;  4BY6 C;  2YLC A;  2K5L A;  2Y4Y A;  3OBY A;  4BD3 A;  5GMK i;  4FSX A;  4EPC A;  2QQS A;  3M53 A;  3CCU A;  1YJ9 T;  4BI4 A;  2DO3 A;  4NOY A;  2KY9 A;  1QP3 A;  1U1S A;  4N4H A;  3OYM A;  5GAO m;  3CCS A;  1Q81 U;  1VQO T;  4NS5 A;  5J3B A;  2LT1 A;  4M77 D;  1OZ3 A;  2LT4 A;  1N6A A;  2DXC A;  5C0M A;  2E1H A;  1KQ2 A;  2LQ8 A;  5GAM e;  1JRI A;  2DZ9 A;  4J7F A;  3Q1J A;  4BUG A;  2X35 A;  4A4E A;  2F5T X;  2EQK A;  2XK0 A;  3E19 A;  3QHS A;  3M4Y A;  3QZ9 B;  2O01 E;  4EMK B;  5GMK e;  4FL6 A;  3MCA B;  1WQ7 A;  2VUB A;  2R5M A;  3QO3 A;  3L42 A;  5GAN j;  2YRV A;  3RMQ A;  5LJ5 e;  2XD0 A;  3OYH A;  1VQ9 A;  1VQM T;  2DXB A;  2E64 A;  4C0D B;  3PMT A;  3G6E A;  1YIJ T;  4KBM B;  1QVF S;  3OS1 A;  2MF2 A;  3OS0 A;  1TH7 A;  5FLX E;  4EMK A;  1YHQ T;  4OGC A;  4J6Y A;  3NFC A;  1D3B B;  2QI2 A;  2EIF A;  1WJS A;  2IG0 A;  3S6W A;  3VJP A;  3RKY A;  3L2Z A;  3CCJ A;  1VQ7 A;  2MWO A;  5GAN g;  3L2W A;  3QYG B;  4OB3 B;  2L3R A;  5CAI A;  3PGG A;  2VC8 A;  5LJ3 e;  4KUD K;  2BKD N;  5I2S A;  3GPL A;  2GCX A;  2V8K A;  3SB2 A;  3JCM Q;  2EAY A;  4TVR A;  1VQ6 A;  2EQJ A;  4V2S A;  4BDZ A;  1D3B A;  1VQL T;  2R5A A;  1WJR A;  1N8R C;  5GAN 6;  2KSS A;  3KXT A;  1G3T A;  1LJO A;  2OTJ A;  3MP1 A;  3JCM d;  1UB4 A;  3HP9 A;  3OQ5 A;  3OSV A;  3MP8 A;  3PT9 A;  1K8A C;  2XDB A;  4HA8 A;  4KUI A;  4LDU A;  3RKX A;  2CZ6 B;  5CKB A;  4JS5 A;  5GAO p;  3TEE A;  3CPF A;  4EDU A;  4Y91 A;  2LCC A;  5KCH A;  1YI2 A;  4LD9 K;  3HRT A;  1O75 A;  2HD0 A;  2V8I A;  4RCC A;  2O4X B;  2PUK B;  3GLX A;  1VIF A;  3CME T;  3A8O B;  4EMK C;  3HRS A;  4MZP A;  2QEX A;  3A8H B;  3URG A;  1XQH A;  2HBP A;  2P0K A;  3HPW A;  4HCZ A;  3QJ6 A;  1VQ5 A;  4PLI A;  5CQX A;  4DA4 A;  3LWI A;  1MHN A;  4C0D C;  4Z02 A;  5HK0 A;  4BAC A;  2DIG A;  3CMA T;  2O4X A;  5GAN 8;  4N4I A;  3UPU A;  3MET A;  1B34 B;  3OMG A;  3G4S A;  2QDY B;  5KCO A;  1IRE B;  5KH6 A;  4L5G A;  1NPP A;  2K2V A;  4CRI A;  4E7J A;  1R8O B;  1ZBX A;  3QSU A;  3JCM b;  2RB6 A;  4QVZ A;  1K8A U;  4C92 E;  3UWN A;  1YIT A;  3JRZ A;  2C06 A;  1KQS A;  3NTK A;  1B34 A;  3KUF A;  4XTU A;  5CIU A;  3WVE B;  4ZGJ B;  1KQS S;  1VQK A;  5DLO A;  3J80 E;  3OW2 S;  5I21 A;  1UGS B;  1NZ9 A;  3RMS A;  5C6S A;  4C5G A;  3PFS A;  4C5I A;  1N9S A;  3E1S A;  3M57 A;  4B9W A;  2EQU A;  4ELY C;  2MAM A;  5A0D A;  3CCV A;  3MHX A;  2M16 A;  2DD4 A;  2DK3 A;  2D9T A;  4MZM A;  1K9M U;  4M7D E;  2RHI A;  2OTL T;  3OYG A;  1WJQ A;  4KUL A;  2PQW A;  5GAN d;  2K5F A;  3LX7 A;  4C92 B;  3CCR T;  3OYD A;  4C92 G;  3FB9 A;  2CYZ B;  2EKO A;  4FT4 A;  1BI3 A;  3CPW A;  2KMT A;  4MMK A;  1WNL A;  5GMK h;  2RHY A;  4M7D B;  3HSB A;  2XIC A;  4OVA A;  5M9O A;  5LJ5 h;  3ZFJ A;  1X75 C;  4C92 A;  3J81 E;  3L2V A;  4M7D G;  5A0G A;  4A4H A;  2CKK A;  4BE1 A;  3X24 B;  1YJN A;  2WAC A;  3JCM g;  4M78 E;  4PJO E;  3ZBD A;  3J7A F;  2RJE A;  3OA6 A;  3G71 T;  1KC8 C;  2FVU A;  3MEA A;  4M7D A;  4OB2 B;  2LX9 A;  4ELZ C;  4IKF A;  2WSF E;  3V7S A;  1YJW A;  3P8B B;  2X4X A;  4II1 A;  4XAX B;  5LJ3 h;  2DIQ A;  2Y4X A;  3VUZ A;  1HXD A;  4FM4 B;  3FIF A;  1KG1 A;  3FEO A;  1KHC A;  4MDW A;  2K4Y A;  4M78 B;  4PJO B;  2LC4 A;  2JTM A;  4M75 A;  4M78 G;  4QVD A;  4PJO G;  4M75 F;  4QQG A;  2XHC A;  3CC7 A;  2RD1 A;  4XU0 A;  5GMK l;  5DLQ E;  4IUU A;  3BDL A;  4C92 D;  1LNX A;  2E6Z A;  2EYQ A;  4NL3 A;  4BDY A;  2OAU A;  1JJ2 S;  3QBY A;  3LLR A;  3MO8 A;  4PJO A;  4DOV A;  4XK8 E;  1BI0 A;  4Y28 E;  4C5E A;  1VQP A;  2DKG A;  3GP8 A;  1UGQ B;  3M54 A;  4BI8 B;  1RI0 A;  5LJ3 f;  4C92 C;  3TU4 K;  4HCC A;  4J8O A;  5GMK m;  1VQ8 T;  2L5Q A;  2B8A A;  3CCE A;  3CC2 T;  1M1G A;  5GAN 3;  4L59 A;  5FU6 B;  2DZC A;  3E9G A;  3LWH A;  2CGH A;  3QDR B;  4C8Q E;  4M7D C;  1M1K C;  3UDC A;  3A8L B;  4M75 D;  1QVF A;  1Q86 C;  3ME9 A;  1LOJ A;  1X01 A;  4X9D A;  2EFI A;  4E7L A;  1WPY A;  4FT2 A;  3X20 B;  4N4G A;  2QA4 T;  3EFS A;  2RJD A;  2LVM A;  3CC4 T;  5HK3 A;  5FRN A;  3NTH A;  4XU3 A;  3I56 A;  1BIB A;  1KQ1 A;  1G3Y A;  4M75 C;  4UC4 A;  3OYC A;  4LDX A;  3GNG A;  4C8Q B;  3CCM A;  3I55 T;  3SDZ A;  1QW1 A;  5AYF A;  4OF1 A;  4C8Q G;  5CCA A;  4R56 A;  1VIE A;  3MP6 A;  3M55 A;  4N0A A;  4M7A E;  4PJO C;  2RI5 A;  1RL2 A;  4QQ6 A;  4X9C A;  4ZGE B;  3CCL A;  2KDS A;  2WSC E;  1FWZ A;  4C8Q A;  4E47 A;  1EIF A;  3CCQ A;  4JJN K;  3A8G B;  3LGF A;  3HL8 A;  3BW1 A;  3VU3 C;  2EQM A;  4BB7 A;  5L8R E;  2GFA A;  4IUV A;  5CQY A;  5IN1 A;  1S72 T;  3OSS C;  4JDS A;  4JRQ A;  1YJ9 A;  4RCB A;  4M7A B;  1K73 C;  3HFN A;  1BI1 A;  4C0Z A;  3CD6 T;  1WGS A;  1OZ2 A;  3CBO A;  4M7A G;  1VQO A;  1M9S A;  3VKI A;  3JCM W;  1H3Z A;  2BIV A;  1JB0 E;  3OYF A;  5GMK j;  1Q82 C;  5FU6 C;  3QJY A;  1PSF A;  4FU6 A;  2KK4 A;  3V8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...