2DIQA

Solution structure of the tudor domain of tudor and kh domain containing protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
b'GSSGSSGRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tudor and KH domain-containing protein
molecule tags Rna binding protein
source organism Homo sapiens
publication title Solution structure of the TUDOR domain of Tudor and KH domain containing protein
rcsb
total genus 17
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2006-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2diqA01
2R5AA 3OQ5A 2GF7A 1WJSA 2YRVA 3O8VA 1H3ZA 2BUDA 3L2UA 5D6WA 4X34A 5KCOA 3NTKA 4E7JA 4IUUA 5CIUA 2K3YA 2CKKA 4E7HA 2E6NA 3QJ6A 2IG0A 2F5KA 3MEAA 5FRNA 3DB4A 2X4YA 3PFSA 3UWNA 2RJDA 3ASKA 3S3OA 3E9FA 2R57A 4QQ6A 3MP8A 2QQRA 2EQJA 3MEUA 3OYNA 3OYAA 2X4WA 3S3MA 2XK0A 3BDLA 3OYKA 3MEVA 5J26A 3OYFA 2RJEA 3P8HA 4UC4A 5KE2A 2DIQA 3OYCA 3OA6A 2RHIA 3S6WA 2EQKA 2L3RA 3L42A 3MP1A 4IUQA 2LDMA 3OYMA 3FDRA 2GFUA 3SD4A 3OYLA 2LCCA 2D9TA 5IN1A 3GOXA 1OI1A 4EDUA 2RHXA 4FL6A 3EAEA 2EKOA 5D6XA 3OMCA 2RI3A 2MWPA 2B8AA 3LGFA 3LH0A 3MEWA 2EQMA 3PMIA 3UT1A 2BIVA 3L2WA 1XNIA 4C5EA 3H6ZA 3NTIA 3QIIA 4FU6A 4IUVA 4A4EA 4C5IA 2HQXA 4HCZA 3ZEHA 3QKJA 4NS5A 3OYJA 4PL6A 3LLRA 3QBYA 5FROA 2M1HA 3LYIA 4BACA 2P0KA 3Q1JA 3OYDA 3OB9A 3F70A 2G3RA 5J39A 2RHZA 3OYBA 2NLUA 4PLLA 2JTFA 1N27A 3MP6A 4Z02A 4ZTJA 2LRQA 4E7KA 2FHDA 4II1A 4A4FA 3ME9A 2WACA 4CRIA 2X35A 4LD6A 1OZ3A 2M16A 2RI5A 3OS0A 3OS1A 4QW2A 3H8ZA 3NTHA 2EFIA 4E7IA 5M9OA 2M0OA 3PMTA 5D6YA 2RI2A 2DIGA 2EQUA 2PQWA 2RJFA 5C6SA 4IUPA 3L2QA 4ZTFA 1OZ2A 3PNWC 3DLMA 4B9WA 4QVZA 4BE0A 4BDZA 2BKDN 2E5QA 5KE3A 1G5VA 4IURA 4QQGA 4BD3A 3LX7A 3DB3A 2LTOA 4A4GA 3FEOA 4B9XA 2DAQA 5IAYA 1WJRA 3E9GA 2RHYA 3CEYA 2K3XA 1OYXA 1RI0A 2R58A 3P8DA 4L59A 2O4XB 2JZ2A 2R5MA 2GFAA 3OYEA 3FLGA 2L89A 2QQSA 2RO0A 3OYHA 3C4SA 3L2RA 2RHUA 4BDYA 1MHNA 2VYTA 3OYIA 1KHCA 4A4HA 1WGSA 3OY9A 4GY5A 2X4XA 5FRMA 2LVMA 3FC3A 4N4HA 3OS2A 4BE1A 4OVAA 2XDPA 4C5HA 2L8DA 5C0MA 1WJQA 3META 4N4IA 4RG2A 3L2VA 4PLIA 2RJCA 4Q5WA 3KUFA 3M9QA 5KH6A 3OYGA 2MWOA 4IKFA 4QQDA 2O4XA 4IUTA 3MO8A 4C5GA 3OMGA 5KCHA 4E7LA 4BE2A 2HQEA 3S3NA 4N4GA 3LGLA 1SSFA
chains in the Genus database with same CATH superfamily
5HY6A 2EJFA 2JTEA 4Z8AA 4BI3A 1K73C 4J9EA 1YJNT 3CMAQ 1X2QA 4DBFA 1X69A 4FYVB 2IG0A 3MEAA 4XTUA 2V26A 1NJIC 1EZZB 3CCJA 1QVFA 1SRLA 3E19A 1PWTA 3P8HA 2FZKB 3TCJA 2ESWA 2EQKA 1IXDA 4LDXA 1O9SA 2V1RA 1T3SA 4HA8A 5D7UA 1M27C 1VIFA 4M77C 1B7TA 1FMWA 3UT1A 3CPFA 3J7AF 4XK8E 3VUBA 3J81E 1QWEA 3V8LA 3VS5A 1PRLC 4YTLA 4ZGEB 3PIOA 1WDXA 1SPKA 1VQKT 2K57A 5J3BA 5GAN5 4LNPA 4II1A 4PJOG 2IVWA 3JV3A 1F1BB 2QXFA 4FT2A 3OS1A 3EG9A 1UJ0A 3CPWA 2EFIA 3CMET 3PGGA 2KK4A 2EBPA 1QCOA 3CCET 2K5FA 3CC7Q 3OBWA 3CCSQ 4OB2B 3CC7T 1M1KU 3QWXX 1Q82U 4B6MA 3X24B 1VA7A 4FYYB 4BDZA 1WQWA 1HSQA 4BD3A 1J3TA 4J6WA 4MZTA 3FJPA 2KRMA 5HKCA 2PU9B 4OMMA 3FLGA 4AMCA 1YI2Q 1AEYA 3REAB 2RQVA 3FRNA 4HVUA 2FYKA 1S72Q 2FVUA 5GANh 4ELYC 3AT1B 3RKWA 4PLIA 3OS5A 2FB7A 1Q86C 5GAN7 2DRMA 2IPOB 4OMNA 4E7LA 3LGLA 1WJSA 2VXEA 5LJ5e 2J6FA 2D8JA 1CSKA 2D0NA 2CKKA 1GL5A 3QYGB 1UHFA 2DEQA 5GMKh 1ACMB 3S3OA 2VC8A 5IXBA 3KXTA 3OYFA 1EIFA 1YJNQ 5KE2A 1Q81U 1VQMT 1M3AA 4XQ3A 1D3BB 2EIFA 2LDMA 5GANg 4DA4A 2L0AA 3JRZA 1ZSZB 1O75A 2EQMA 3CMEA 4ZNXA 4DBQA 3QIIA 4FU6A 1MGQA 5HCKA 2V8IA 4WTOB 2VVKA 1AOJA 4RUGA 2RHZA 2PVGB 2GCXA 1MMNA 1WYXA 2NUPA 4TVRA 2FHDA 4C0ZA 1G3SA 2DK3A 2ED0A 3CBMA 2KY9A 4LE9A 1D0YA 2GNCA 3H8ZA 6AT1B 1N5ZA 1T0JA 3QYHB 2EQUA 3M56A 3CXCA 4E47A 2DXCA 2O2OA 3A8GB 2MPXC 2E5QA 3JB9F 4FCYA 2YUQA 2XICA 3ZFJA 2ZZDA 5IAYA 2NUZA 2RB6A 3SB2A 1TUDA 2J05A 1ZLMA 4M7AE 2F2XA 1TXQA 4KT0E 2JOYA 3NFCA 1BU1A 3QXEB 1KHCA 1UGVA 3H0FA 3CCJQ 1WHLA 1JJ2P 1VQ7A 8ATCB 4C5HA 2VB6A 1WJQA 4MDWA 5GMKj 3CMAA 1RLPC 1B3QA 2MAMA 3GBQA 4ZGDB 1WHMA 4M77G 2Z0WA 4PNOA 5D6WA 1VOMA 2YRVA 1Y7XA 2C0IA 1SKUB 1RABB 2CDTA 1YCSB 2MI6A 3A8HB 5CIUA 4F7UA 3CCMQ 4C8QE 4XTWA 3DB4A 3OYNA 3FIFA 1YWPA 1U06A 4C92A 1W2BP 1VQNA 5KYUB 2DVEA 5L23A 2CZ1B 2LT4A 3G4SQ 1OOTA 2GFUA 1JXOA 1VQPQ 1TH7A 4M7AC 4FL6A 1YP5A 4MZMA 2CP0A 4JJCA 3LGFA 1WHKA 3LH0A 3O5ZA 3VS0A 4EMHA 2DA9A 5KYYB 4A4EA 3ZEHA 1R8OB 2CP6A 2J6KA 1JEGA 5LJ3h 4BACA 3OYDA 1N8RC 3GNFB 3RIRA 5KYWB 1D1CA 4A4FA 4X9DA 1MMGA 5GANj 4FSXA 1IREB 4CI0C 3M0RA 3R6NA 1S72A 4FIBA 3M5AA 1Y96A 4J9CA 4IUPA 4ZTFA 3BY7A 3EG0A 2A36A 1BCMA 5LJ3d 4O5VA 3I56Q 3X28B 3CEYA 4LDVA 5IHNA 2DTIA 3QG1A 2MYSA 2QTVA 4ANJA 1I4K1 1H641 3OYIA 2DRKA 4C92G 2IIMA 4M75B 5IHIA 3FC3A 3OS2A 2PVDB 2J7IA 2QAZA 2XDPA 4E7ZA 2DZ9A 2L8DA 4Y91A 2RJCA 1YBYA 5FU7C 2DERA 3KUFA 5EC7A 1RACB 3M9QA 4A4KA 1Y0MA 2K3BA 4C0DB 2ZPGB 5LJ3e 3MO8A 2OAWA 4RTYA 2HQEA 5GANd 5GANf 3O8VA 2CSIA 2JM9A 4EMKC 3CD6A 4BY6B 3X20B 3EGDB 2LJ0A 3G71T 4XTZA 4E7JA 2HL3A 1IRXA 3C95A 1QVFS 1H92A 1G3TA 5LJ5d 3GF5A 2K7AA 1X6BA 2ZPFB 3ULRB 1SEMA 1QVPA 2AK5A 4HXJA 3CMAT 2EJGA 1I07A 1KJWA 2ZAEA 3CCUT 4RTVA 1K9MR 2O31A 2YUOA 5KYXA 2D0QB 2JW4A 5IT9E 1GCQC 2M0YA 1BK2A 1KSWA 2AKLA 1JBMA 4C5IA 3CCMA 4J9FA 3D7SB 1K9MC 2A7YA 1TUCA 2BZXA 2CH4A 2K5LA 1UGQB 3G71Q 1BIAA 4LDWA 1U3OA 1T0HA 4E7KA 4M77B 2QDYB 3ME9A 4F14A 3VYHB 5CR2A 4M77F 2M16A 1RAEB 2A08A 2OJ2A 2M0OA 1PSFA 1DJ7B 2DTHA 4Y92A 2LP5A 3EG2A 2E12A 3PNWC 3EG1A 3M0QA 2L2PA 4RTUA 4C92F 1W1FA 1VQ6Q 5CVIA 2HZYA 1VQ7Q 3PVLA 3EGXB 2Y90A 4LXCA 1GFCA 5CAIA 2HBPA 5CQXA 1ZX6A 2O9VA 4A63B 1AWWA 1KFZA 3RDVA 3CD6T 1JJ2A 3HRSA 2VYTA 4MMKA 1WGSA 2VGNA 4GY5A 2HMAA 1YCYA 3M55A 2DEUA 2JMCA 2DLPA 3HRTA 2CGHA 2BTTA 2DL5A 1OPKA 1TG0A 1WPYA 2O4XA 2PVOB 3OQ5A 5GAMj 2V1QA 1Y07A 3JCMJ 4ATOA 3QDRB 2KAFA 4C0FA 3DLLA 1X01A 1NJIU 1NM7A 4PJMA 3VRZA 2M51A 3CCQA 3M4YA 2KVQG 2FZGB 4AFQC 2OI3A 1VYTA 5FWBA 2DF6A 1LJOA 3I55Q 2DL7A 2DVJA 5D6XA 5GANe 1IZ6A 1K8AC 3H41A 3TSZA 4RTTA 2DD4A 4NS5A 2DZCA 3TQ7P 2M1HA 5LJ3g 2JS2A 2FL7A 3OB9A 2CUBA 2BE9B 2ROLA 4A54A 1YN8A 1RAIB 4Z02A 1KD1U 4M7AB 4CRIA 1BBZA 4HKEA 1C1AA 2LJ3A 1H8KA 2ED1A 3SWNB 4JRIA 5CKEA 1W2BA 3WVEB 3HP9A 2LCSA 2DIGA 2CP5A 3LH5A 1M2VA 5C6SA 1D1AA 1OZ2A 4P5NA 1Q82C 1C6VX 2BKDN 1X43A 3HFOA 4A4GA 2E1HA 4M78B 2DAQA 4LN2A 5AT1B 4MDXA 2K3XA 4PJOA 2E64A 2JZ2A 2JM8A 5AYFA 2O88A 2GTJA 1VQ6T 2PZ1A 3JCMg 1LVKA 1VQ6A 2P84A 1R77A 1QMCA 2B86A 2AIRB 1KIKA 2D8HA 3EFRA 1MV0B 1MMDA 2L5QA 4OMLA 1KHIA 4HCBA 4J9BA 1SSFA 4M78G 4RCCA 3H0IA 1R0CB 2BUDA 3L2UA 4F7UG 5GAN2 3CCRQ 1YJWQ 1ARKA 3QJ6A 3AHUA 1WXUA 2RMOA 4NL3A 3UWNA 3CC2T 2R57A 2J6OA 4Z89A 3BDLA 1UGSB 3EFSA 1U1TA 4UC4A 4DEXA 4E6RA 4L6V5 2L3QA 5ECAA 1YITA 2H3EB 2D9TA 4EDUA 3UA6A 3H0HA 2KT1A 2MWPA 2RA2A 3C94A 2XD0A 1KC8U 1RL2A 2CREA 4PL6A 1Z9ZA 2C0OA 3CCRT 3G4SA 1M8MA 1ABQA 2G3RA 3A8MB 2NLUA 2QEXQ 4NOYA 2E70A 5GAOn 4OP0A 1VQNT 4KGVB 4M7DE 4E7IA 5HK3A 1KQ2A 2BZYA 5LJ5h 1QVGP 2E5KA 1QCFA 1ZUYA 2QK0A 3QSUA 4NL2A 5KE3A 3I9QA 3GPLA 3JB9D 2HNIA 3E9GA 4D8KA 2MK5A 1RI0A 2R58A 1MNDA 4L59A 2HSEB 1Q7YR 2KXCA 3WVDB 3M0PA 3C4SA 3GNGA 5A0DA 3UDCA 4DBHA 3CCVT 2X4XA 2DFUA 4KUIA 1BI1A 4N4IA 3META 4RG2A 2LQWA 2M02A 2RQRA 3MKDA 4QQDA 4DQ2A 5GMKm 4MMLA 3RBBB 1TOVA 1OV3A 4JDSA 4DOVA 1TTHB 1TU0B 2BE7D 4PJOC 2YUPA 2E65A 2EQJA 4WF2A 2LJ1A 2QEXA 4M7DC 2DIQA 1OQKA 3OW2A 3L42A 2E3HA 3KFVA 1MUZA 2EGAA 3EAEA 4HT9A 3VU3C 2ABLA 1PM3A 1M1KR 1Q82R 2VUBA 5GAMh 2BIVA 2LQKA 4C5EA 4IUVA 5CO7A 4CC4B 4C92B 9ATCB 2HQXA 4HCZA 1ZBXA 1TS9A 3F70A 1FYNA 1V1CA 4AG1C 2P4RA 1QVGS 1UB4A 2V8JA 2YSQA 3FB9A 1KQ1A 2EW3A 2X35A 1QP2A 2RM4A 3CXCP 2RN8A 1MV3A 3A8OB 3DKMA 3JCMd 3RUXA 2KRNA 4LUEA 3PMTA 1VQ5Q 2OTLQ 3G71A 1K0XA 4EMKA 2EGEA 4M78D 3A5ZB 1VQOT 3EFOB 3M57A 2NUTA 1JO8A 4RKUE 1NYGA 2ZPIB 2HL5C 4KH0B 4JLGA 4ELZC 1T3LA 3L1AA 4XTVA 1YHQA 1VQ7T 4C8QB 1Y96B 2JTMA 1Q7YU 4F04B 5LJ3f 1GRIA 1VQ9A 1ZA2B 4N4HA 4BE1A 1AWXA 1D0ZA 1QLYA 2KQWA 2JUFA 4LUDA 2CT3A 1QVFP 5CKDA 2AHJB 1B34B 4IKFA 1I5OB 2W10A 2X3WD 2OAUA 2CZ7B 3OMGA 3VJPA 1QVGA 4BE2A 2LNVA 3OW2P 3S3NA 1RAFB 1WHHA 3TEEA 1GCPA 2P0PA 1W70A 2X9HA 3JCMX 1H3ZA 3RESA 1AWJA 2EPDA 5GAN3 1M8VA 4KH1B 4FYXB 1GBQA 3CCVA 4IIOA 2KR3A 1ABOA 3E9FA 3MP8A 2QQRA 1K4US 5LL6S 1AT1B 4J9IA 2HCKA 4M7AF 1S72T 3SEMA 3U23A 2AKKA 1BYMA 1UGRB 4JRPA 2K9GA 2B8AA 4M7DA 1K1ZA 3SDZA 1UEBA 1M4ZA 1PKTA 5KYNA 3CCJT 3QBYA 2PUOB 1OX9A 5KYXB 3OYBA 2AT1B 4RCBA 3MP6A 1WHJA 1SRMA 4R0KA 4C8QC 1YHQQ 1VQ5T 2O9SA 1M3BA 4C8QF 1Q81R 2DYIA 4A53A 1W2BS 4M77D 1YJ9A 3V7RA 4L5GA 1UUEA 1HJDA 3M58A 4QVZA 3JCMP 4XAXB 1WNLA 1UJYA 3JB9J 5GAOp 3HRUA 2LTOA 1SSHA 2RQTA 3TSWA 2RHYA 5GJWB 2FPEA 3QO3A 4F17A 1QWFA 2EGCA 1TSFA 2CZ6B 2YLBA 2CSQA 3ZBDA 2RO0A 2QTXA 4GLKA 5FWCA 3CCST 3JCMe 4F7UF 2ECZA 1G8XA 2OTLT 3SHWA 4J7FA 2MWOA 1YNZA 3JSCA 3UF4A 4M78E 4N4GA 2A0FB 1VQ8A 1QQJA 2R5AA 2HDAA 1YJNA 1YITT 3EGUA 2COWA 1YI2T 5I2SA 4QVDA 4J9GA 3V7CA 3OYKA 3C0CA 4FSSA 4PJOF 1LCKA 2GBQA 2A28A 1NYFA 1RI9A 1WI7A 2KRSA 4O6JA 2RQUA 3G1JA 1B07A 2VGMA 5EG2A 4J6XA 3L2WA 3OBYA 4FT4A 5GAOl 2YXYA 3HFNA 3LLRA 3LYIA 5DLQE 2QQ9A 2JTFA 1G3YA 4C0GA 1KD1C 2KEAA 2DE0X 3GLXA 4Z88A 1VQ9Q 4XU0A 3MCAB 4JJNK 2RI2A 2HBWA 4FW2A 1SHGA 3V8KA 2QA4A 1KD1R 4GLMA 1UHCA 4BE0A 3REBB 2DMOA 4M7AA 1E6GA 2QASA 3DB3A 2DO3A 3SWNA 4XU2A 2VKNA 1G2BA 2QDLA 3EG9B 3I5SA 4OMFB 1WA7A 2OTJT 2RQWA 2EYXA 3ER0A 1OX8A 1IGQA 3JCMV 5FRMA 4DEYA 3A8LB 4M75F 3VS4A 1UE9A 1ZA1B 3TVTA 3HPWA 4OGCA 2ZPBB 3GP8A 1VQNQ 2GTOA 2LMJA 1K8AU 2CYZB 2FPFA 2KNBB 4M77E 1IGUA 3CQTA 5GAN4 1RAGB 1E7OA 3G6ET 2YLCA 1AHJB 1D3BA 1M2OA 4M7DD 1I0CA 5L8RE 2M9UA 2JS0A 2K3YA 1VUBA 2XI9A 2X4YA 2RJDA 4C8QG 2LX7A 3NGPA 5I22A 3WXMB 5GAMd 5GAMf 3CC4Q 2XK0A 1QW1A 3HHTB 1NBEB 1YFNA 3OA6A 2C06A 1FWZA 2E41A 2QQAA 1YJWA 1VQ8Q 2EKHA 3P8BB 1ZHIA 2DJQA 1YJ9Q 3OMCA 2YRCA 2RI3A 1H3HA 3M0UA 1MMAA 2VASA 1IHWA 3M54A 5GAOm 3CCEA 2X3XD 2RH2A 3EG3A 1OEBA 5LJ5g 3EH2A 1VQOA 3LW5E 4RTZA 4PKCC 2EYQA 1K9AA 2XIDA 3LWIA 1HXDA 2EYZA 5CKBA 2K2VA 3JB9I 2XDBA 3PE0A 1QKXA 2XKOC 2F5TX 2X51A 3A1PA 1QP3A 2RK1A 5HK0A 2BZ8A 3NHNA 3L2QA 2NUPB 1M1GA 2W0ZA 1PHTA 4J8OA 2FPDA 3MJXA 2E10A 2JMAA 3CBPA 1K73R 1OU8A 2XG8D 4KULA 3R6OA 4CC2A 3QZ5B 1X6OA 2LC4A 2HEQA 1NJIR 3UA7A 2YRDA 3VS7A 2LT1A 3I55T 4A4HA 4KBMB 2DETA 4BY6C 3G7ZA 1K0SA 3VRYA 4OMQA 2WSFE 2MMPA 4ZGJB 1VYUA 4BUGA 1WIEA 1VQMA 3CCLA 2ZCFB 3JB9G 2GF7A 1M30A 1NLOC 4X34A 3JCMb 4OMOA 1GBRA 3RMSA 1R0BG 1VQ4A 4D8DA 3GIBA 1YIJQ 3QPHA 2X4WA 3S3MA 2L3PA 3MEVA 1FXXA 4PFPA 2RHIA 4QKUA 3FDRA 3OYLA 5GAN8 3L2ZA 4F7UB 4OGEA 3JB9H 1RLQC 3CD6Q 4IIMA 2KDSA 3PMIA 4LDYA 2HD0A 1YIJT 3NMZC 1U8RA 3NTIA 4PJJA 3E1SA 2XMFA 7AT1B 1D0XA 3VS3A 5KYUA 4M7AD 1D09B 2DM1A 4EMGA 1OULA 1BKBA 3CCSA 4PLLA 4ZTJA 3V7SA 2DNUA 2AZVA 5GAOr 5KYYA 4OB3B 1X2KA 2KE9A 2DILA 2KBTA 1NE8A 1N8RR 2L3SA 1Q86R 1PD0A 1KG1A 1WFWA 3G4ST 5KYWA 3OSVA 3CCEQ 2CS7A 2KT8A 5A0LA 3JAME 1UGPB 2XHCA 1M1FA 2FEIA 1N9SA 3CPWS 3OYEA 2JJ9A 2KMTA 2QQSA 4EMKB 1HK9A 4MZPA 3SFMA 1VYVA 2WSCE 3EGDA 3QDFA 4J9HA 1JXMA 1EFNA 5CK9A 1S1NA 4HCCA 4JS5A 1W4SA 1VIEA 3CC2Q 4C8QA 1VQPT 5IH2A 1PRMC 3CCQT 2DL4A 1SG5A 2RK2A 1NEBA 5KCOA 5DM7R 3PTAA 3M0TA 4E7HA 5FRNA 3I55A 1JRIA 1FMKA 3PFSA 3ASKA 1B34A 1NEGA 3CCLQ 1XTDA 2VXFA 3OYAA 2Y4YA 4LD9K 1VQ4T 2RJEA 3THKA 4XU1A 1A0NB 2D1XA 2ZGWA 3S6WA 4IUQA 1VQKA 5A0GA 1AVZC 1OU9A 1X75C 5CCAA 1VQ4Q 4M77A 3VUZA 2A3LA 2YWWA 2GGRA 3BFMA 1TWBA 2I0NA 1RAHB 1YHQT 4AFUC 3OYJA 1PNJA 5IHKA 3HTRA 3CCVQ 2GQVA 2QEXT 2P0KA 4OMPA 5J39A 4J6YA 3G6EQ 4C92D 2A37A 3JCMf 2FRYA 1M9SA 1PSEA 4PJOD 1V76A 2WACA 3ZL7C 4KRTA 4LD6A 2HKNA 3I5RA 4M7DB 4PJNA 1V29B 2QGGA 3NTHA 3NPFA 2HAXA 3CPWP 1NPRA 1N8RU 1VQMQ 2GQIA 2D6FA 1G5VA 4R56A 1AZGB 1KC8R 1UECA 2F2WA 3CC4T 2RD1A 3FEOA 4B9XA 1WJRA 2H8HA 4HCKA 3JCMW 1GXIE 2LQNA 2GFAA 1EX4A 3L2RA 2RHUA 4M7DG 2YT6A 2KXDA 4JRKA 1W6XA 1WZOA 2MIOA 3CXCS 1YIJA 1N6AA 4E7SA 3CCRA 1ZUUA 2I2LA 4EPCA 5C0MA 2DXBA 4M78F 4Q5WA 2EVRA 3OYGA 3CCUA 2ZPEB 2LCLA 2G6FX 3TREA 4OF1A 1VQLA 5KCHA 3I56A 2K5IA 1Y71A 1FMVA 2DYBA 2RNAA 1PC0A 5I11A 1YITQ 5FU7B 3OSSC 4HVVA 4C92E 2DKGA 2E6NA 2SRCA 2P4TA 3UPUA 4PJOE 2XDDA 1BIBA 4AFZC 2RF0A 4LDUA 5J26A 3OYCA 2X4JA 2L3RA 1PG5B 2JVVA 3OYMA 4C8QD 3MPUB 1NZ9A 2LNHB 1UTIA 4KGZB 1CKBA 4ESRA 3QKJA 3M53A 4J5YA 1PKSA 1VQKQ 2COYA 3Q1JA 1AD5A 2QI2A 1Q95G 1BB9A 2LRQA 4WCIA 1Y57A 1Z9QA 1YWOA 5FU6B 1OZ3A 1ZQ1A 4M75G 8AT1B 1IO6A 3HSBA 3RKXA 4VUBA 4BI4A 2ATCB 2F69A 1ZSZC 3URGA 3N5BB 4JRQA 1M1KC 4M7AG 4BB7A 2DL8A 3E2UA 2FG0A 1VQLT 2CP7A 3BDUA 3MHXA 4FYWB 2KSSA 3SWNC 4JS4A 2R5MA 2EQIA 2L89A 2RPNA 4JZ4A 4J83A 4ZN3A 1YJ9T 3RNJA 1M2VB 1MHNA 2ZPHB 5CQYA 2MOXA 1UDLA 2VWFA 4ORZA 2PUKB 1VQ5A 5DY9A 4OVAA 4JJDA 3L2VA 2LZ6B 4M78A 5I2MA 1GFDA 2QA4Q 4PJOB 2F1LA 1D1BA 3OYYA 1P92A 3CC4A 1AWOA 2FO0A 1HYOA 3JCMc 1LPLA 1XOVA 2QYZA 1RAAB 4J9DA 4JJBA 4E2FB 1ZSZA 2KYMA 4X9CA 4M7DF 1I1JA 2J06A 3MEUA 1OPLA 1KQSA 5CKHA 3G6EA 1WXTA 4C92C 3EHRA 5FU6C 1NLPC 3SD4A 5IN1A 4KUDK 3JCMh 3C12A 1GCQA 3MEWA 2VV5A 1XNIA 2DL3A 1KC8C 4F16A 1RUWA 2CZ0B 2K4YA 2FRWA 2LX9A 1XQHA 2LQ8A 1N27A 3QUIA 4HT8A 5LJ3j 3VS2A 1E6HA 1G83A 3TU4K 1AZEA 1BI2A 3I35A 3KBGA 4DBRA 3OS0A 1VQ9T 2QA4T 2DD5A 1PD1A 5D6YA 3QWYA 2YHTA 1Q7YC 1JQQA 2RJFA 1JU5C 4J7IA 4B9WA 5GMKe 3CCUQ 1MNEA 3H9NA 2OTJQ 4IURA 3LX7A 2JXBA 2PNIA 2ROTA 2QGFB 3QZ9B 2EJ9A 3P8DA 1TUGB 3J80E 4AT1B 3QHSA 5GAMe 4OB1B 4XTXA 3RKYA 3V8JA 2K6DA 3OY9A 4D6WA 4RTWA 2LVMA 4K11A 3UATA 1K73U 2YDLA 2CT4A 4EIKA 2E4HA 3M4GA 4FW1A 1ZBJA 4M75D 1BI3A 3INZA 2K79A 1SHFA 2XU8A 1WX6A 1K8AR 1BCOA 5A2QE 1WLPB 1JJ2S 1CKAA 5LJ5j 2H3JA 2MCNA 3NTKA 2HSPA 1VQPA 2YUNA 2F5KA 3CCLT 3X25B 1JB0E 5FLXE 4ME7A 4PFZA 4QQ6A 1Q86U 1KQSS 1X27A 5FW9A 1K9MU 4M75C 1U1SA 4AFSC 2DJZA 2HQHA 2V8KA 3MP1A 2E3IA 1VQOQ 3VKIA 1OI1A 2EKOA 2P0QA 2DPPB 3VV0A 3H6ZA 4RTXA 1N9RA 3VS6A 4Y28E 5DLOA 1IB8A 1WQ7A 5FROA 2COZA 3BW1A 3OW2S 1SF9A 1XJWB 3EFOA 4CC3A 2JNGA 2Y4XA 1K76A 2QQBA 3HL8A 4XU3A 5LJ5f 3IQLA 3RERA 3BE3A 1RADB 2RI5A 2K2MA 2DXUA 4N0AC 4KGXB 4V2SA 2PQWA 2WSEE 1PCXA 1WXBA 2EAYA 3DLMA 4M75A 2MF2A 1M5Q1 2KYBA 4QQGA 2NWMA 4JZ3A 2JT4A 2DBKA 1OYXA 3CCMT 4CC7A 2C0TA 3CC7A 4QVCA 4F7UE 3OYHA 3PIPA 2JN0A 5GAOq 2NUTB 4DOWA 3FJ5A 4JLIA 2KROA 3RMQA 2EWNA 1C0MA 3VS1A 1FX7A 3PT9A 1BI0A 2EYYA 5KH6A 2OTJA 4IUTA 5GJVB 4C5GA 3RR6A 1YI2A 4N0AA 5I21A 1KQSP 2QG9B 3EH1A 1I8FA 2HKQB 4RG8A 4IUUA 4R55A 2E6ZA 1M90C 4XTYA 1HD3A 3EHQA 2CH4W 1QCNA 3PVQA 3QJYA 3JCMQ 2AZSA 1VQ8T 3A98A 3X26B 1NPPA 1KK7A 1M90R 2LCCA 2PTKA 4PFOA 1UFFA 3GOXA 4AG2C 4X1VA 2RHXA 5IXFA 3CBOA 1LOJA 1UG1A 5GAN6 4JUVA 1Q81C 4M78C 3I56T 2EYWA 1YJWT 2DTOA 5CKFA 2SEMA 1ZSGA 3M0SA 5GAMg 1NG2A 2F2VA 4PK4A 2KGTA 4RMOA 2O01E 1ZUKA 3CMEQ 3EGXA 4JPBW 4QW2A 5M9OA 2CP3A 1LNXA 4GBQA 5GMKi 1WHGA 4ZN1A 3HKSA 2DXTA 2FZCB 1M90U 2ENMA 5GMKl 2O4XB 3T9NA 1QKWA 2DBMA 4C0DC 1VQLQ 3CC2A 4M75E 4HVWA 3VYGA 4BDYA 1U5SA 1I81A 3LWHA 2OX7A 3M59A 3CCQQ 4BI8B 2OTLA 1IHVA 1X6GA 1I5LA 2CUDA 1G3WA 2NYSA 4PJLA 2KI7A 4QT7A 2CP2A 2DX1A 4FM4B 4M4ZA 1M3CA 4OB0B
chains in the Genus database with same CATH topology
2PVOB 2R5AA 3OQ5A 5GAMj 5HY6A 2EJFA 1YJNA 1YITT 1Y07A 4BI3A 1K73C 1YJNT 3JCMJ 4ATOA 1YI2T 3QDRB 2KAFA 5FU7B 3OSSC 4C0FA 2DKGA 2E6NA 4XTUA 1X01A 2IG0A 3MEAA 4C92E 3DLLA 1NJIU 2P4TA 1NJIC 3CCQA 3UPUA 5I2SA 3CCJA 3M4YA 2KVQG 1QVFA 4PJOE 4QVDA 3V7CA 3E19A 2XDDA 1BIBA 3OYKA 4LDUA 5J26A 4PJOF 3P8HA 3OYCA 3TCJA 2X4JA 2EQKA 2L3RA 2JVVA 4LDXA 3OYMA 4C8QD 1O9SA 4HA8A 4O6JA 1LJOA 5D6XA 1NZ9A 1VIFA 2VGMA 4M77C 4J6XA 1IZ6A 5EG2A 3UT1A 5GANe 3L2WA 3CPFA 3OBYA 4FT4A 1K8AC 3J7AF 4XK8E 3VUBA 5GAOl 3J81E 2DD4A 3V8LA 3QKJA 4NS5A 2DZCA 3HFNA 3LLRA 3M53A 2M1HA 3LYIA 4J5YA 4YTLA 2QQ9A 5DLQE 4ZGEB 3Q1JA 2FL7A 5LJ3g 3OB9A 3PIOA 4A54A 2QI2A 2JTFA 1VQKT 2K57A 1G3YA 4Z02A 2LRQA 5J3BA 5GAN5 1KD1U 4C0GA 4II1A 4PJOG 1KD1C 4M7AB 4CRIA 2IVWA 3GLXA 4HKEA 5FU6B 1OZ3A 1ZQ1A 3SWNB 2QXFA 4FT2A 4M75G 4JRIA 5CKEA 3OS1A 3CPWA 4XU0A 2EFIA 3HSBA 3MCAB 3CMET 1W2BA 3PGGA 3RKXA 2KK4A 3WVEB 3HP9A 4VUBA 4JJNK 2RI2A 2DIGA 3CCET 2K5FA 4BI4A 3OBWA 2F69A 4OB2B 3URGA 5C6SA 3V8KA 3CC7T 3N5BB 1M1KU 1OZ2A 2QA4A 1Q82U 4JRQA 1M1KC 4M7AG 4P5NA 4BE0A 1Q82C 4BB7A 3X24B 4BDZA 2BKDN 4M7AA 1WQWA 1VQLT 3HFOA 4BD3A 3BDUA 3DB3A 3MHXA 4A4GA 2E1HA 2DO3A 4J6WA 4M78B 3FJPA 4MZTA 2DAQA 4XU2A 3SWNA 4MDXA 2OTJA 2K3XA 2KSSA 4PJOA 2E64A 4OMFB 3SWNC 5HKCA 4JS4A 2PU9B 2JZ2A 2R5MA 5AYFA 3FLGA 2L89A 2OTJT 4J83A 4ZN3A 1YJ9T 1VQ6T 1MHNA 2ZPHB 3ER0A 3FRNA 5CQYA 3JCMg 1VQ6A 3JCMV 2FYKA 2PUKB 1VQ5A 5FRMA 2FVUA 3A8LB 5DY9A 4M75F 4ELYC 4OVAA 5GANh 3L2VA 3RKWA 3EFRA 3OS5A 4M78A 3HPWA 4PLIA 5I2MA 4OGCA 2ZPBB 3GP8A 2FB7A 1Q86C 4PJOB 5GAN7 1K8AU 2L5QA 2CYZB 1KHIA 4M77E 3OYYA 4HCBA 1P92A 3CC4A 4E7LA 3LGLA 5GAN4 1SSFA 3JCMc 1WJSA 4M78G 3G6ET 2YLCA 1AHJB 4RCCA 1D3BA 2VXEA 2BUDA 3L2UA 5LJ5e 1XOVA 4M7DD 5L8RE 4F7UG 2M9UA 5GAN2 2K3YA 2CKKA 1VUBA 3QJ6A 3QYGB 3AHUA 2DEQA 2XI9A 4X9CA 2X4YA 5GMKh 4NL3A 4M7DF 3UWNA 2RJDA 3S3OA 4C8QG 3CC2T 2VC8A 2R57A 3MEUA 3WXMB 5GAMd 5GAMf 1KQSA 2XK0A 3BDLA 3KXTA 5CKHA 1UGSB 1QW1A 3HHTB 3G6EA 3EFSA 3OYFA 1U1TA 1EIFA 4UC4A 4C92C 5KE2A 1Q81U 3OA6A 1VQMT 2C06A 1FWZA 4XQ3A 2E41A 1D3BB 2EIFA 2LDMA 2QQAA 4L6V5 5FU6C 1YJWA 3SD4A 1YITA 2D9TA 5IN1A 3P8BB 4EDUA 1ZHIA 5GANg 4DA4A 3JRZA 3OMCA 4KUDK 1O75A 3C12A 2RI3A 2MWPA 2RA2A 3MEWA 2VV5A 3JCMh 2EQMA 1XNIA 3CMEA 1KC8C 3C94A 2XD0A 1KC8U 1RL2A 3QIIA 1MGQA 3M54A 4FU6A 5GAOm 2V8IA 3CCEA 2CZ0B 2RH2A 4PL6A 2K4YA 5LJ5g 3CCRT 3G4SA 1VQOA 2LX9A 1XQHA 2G3RA 2LQ8A 2RHZA 2PVGB 2GCXA 3A8MB 2NLUA 3LW5E 1N27A 3QUIA 4NOYA 4PKCC 4TVRA 4HT8A 2FHDA 2EYQA 2E70A 4C0ZA 1G3SA 5LJ3j 2XIDA 5GAOn 1HXDA 3LWIA 2DK3A 4OP0A 5CKBA 3TU4K 3CBMA 2K2VA 2KY9A 1BI2A 1VQNT 3KBGA 3OS0A 3JB9I 1VQ9T 4M7DE 2QA4T 3H8ZA 4E7IA 2DD5A 2XDBA 2XKOC 5HK3A 1KQ2A 2F5TX 5D6YA 2YHTA 1QP3A 5LJ5h 2RK1A 5HK0A 1Q7YC 3QYHB 2EQUA 2RJFA 3L2QA 3M56A 3CXCA 4E47A 4J7IA 1M1GA 4B9WA 5GMKe 2DXCA 3A8GB 4J8OA 3QSUA 4NL2A 2E5QA 5KE3A 3JB9F 2E10A 4IURA 3CBPA 2XG8D 2XICA 3LX7A 3R6OA 4KULA 3GPLA 3ZFJA 2ZZDA 3JB9D 3QZ5B 2HNIA 5IAYA 3E9GA 1X6OA 3QZ9B 2RB6A 1RI0A 2EJ9A 2LC4A 2R58A 3P8DA 4L59A 3SB2A 3WVDB 4M7AE 3J80E 5GAMe 3QHSA 4OB1B 4KT0E 3C4SA 2JOYA 3GNGA 5A0DA 2LT1A 3NFCA 4XTXA 3UDCA 3I55T 3QXEB 1KHCA 3RKYA 3V8JA 4A4HA 3OY9A 4KBMB 4D6WA 3CCVT 2X4XA 2LVMA 1K73U 1VQ7A 4BY6C 3G7ZA 4C5HA 4KUIA 1BI1A 1WJQA 3META 4MDWA 4N4IA 4RG2A 5GMKj 3CMAA 2WSFE 2MMPA 3M4GA 2MAMA 4M75D 4ZGJB 1BI3A 3INZA 4BUGA 4ZGDB 4M77G 1VQMA 4IKFA 4QQDA 3CCLA 2ZCFB 4DQ2A 2XU8A 3JB9G 4PNOA 5GMKm 5D6WA 2GF7A 5A2QE 4MMLA 2YRVA 1Y7XA 1JJ2S 5LJ5j 2H3JA 4X34A 3JCMb 3NTKA 4JDSA 4DOVA 1VQPA 5CIUA 2MI6A 3A8HB 4F7UA 4C8QE 2F5KA 3RMSA 1VQ4A 4XTWA 4PJOC 3DB4A 3CCLT 3X25B 1JB0E 5FLXE 3GIBA 4ME7A 2E65A 4QQ6A 1Q86U 3OYNA 2EQJA 3QPHA 1KQSS 2X4WA 1K9MU 3S3MA 4WF2A 4M75C 3FIFA 1U1SA 3MEVA 4C92A 2QEXA 4M7DC 1FXXA 1VQNA 2DIQA 2DJZA 3OW2A 2RHIA 2V8KA 3L42A 3MP1A 2DVEA 2CZ1B 2LT4A 3FDRA 2GFUA 3OYLA 3VKIA 5GAN8 1TH7A 3L2ZA 4F7UB 1OI1A 4OGEA 4M7AC 3JB9H 4FL6A 3EAEA 2EKOA 4MZMA 3VU3C 2P0QA 4HT9A 2DPPB 3VV0A 2KDSA 3LGFA 3LH0A 3PMIA 2VUBA 2HD0A 2BIVA 4LDYA 4EMHA 5GAMh 1YIJT 2LQKA 4C5EA 1U8RA 3H6ZA 3NTIA 4IUVA 5CO7A 1N9RA 4A4EA 3E1SA 2HQXA 4HCZA 4Y28E 1ZBXA 3ZEHA 4C92B 5DLOA 1R8OB 1WQ7A 5FROA 5LJ3h 4M7AD 4BACA 3OYDA 1N8RC 4EMGA 3F70A 3GNFB 3BW1A 3CCSA 1BKBA 3RIRA 3OW2S 4PLLA 1QVGS 1UB4A 2V8JA 4ZTJA 3FB9A 1KQ1A 2JNGA 2Y4XA 4A4FA 2QQBA 3V7SA 4X9DA 3HL8A 4XU3A 2X35A 1QP2A 2RM4A 5LJ5f 5GAOr 3RERA 5GANj 4FSXA 2RI5A 1IREB 3A8OB 3DKMA 4OB3B 3JCMd 4CI0C 1NE8A 3RUXA 3PMTA 1S72A 2DXUA 4FIBA 4N0AC 3G71A 3M5AA 1KG1A 1Y96A 4V2SA 2PQWA 2WSEE 4EMKA 4IUPA 4ZTFA 4M78D 3A5ZB 3G4ST 3BY7A 2EAYA 3M57A 3OSVA 1VQOT 3DLMA 4M75A 4RKUE 2CS7A 2MF2A 5A0LA 1M5Q1 3JAME 5LJ3d 2ZPIB 4O5VA 1UGPB 4QQGA 4JLGA 3X28B 4ELZC 3CEYA 2XHCA 4LDVA 1M1FA 1OYXA 2DTIA 3L1AA 3QG1A 1N9SA 3CPWS 3OYEA 4XTVA 3CCMT 1YHQA 2KMTA 1VQ7T 4C8QB 1Y96B 3CC7A 2QQSA 1I4K1 4QVCA 4EMKB 2JTMA 1H641 1HK9A 4F7UE 3OYHA 3PIPA 3OYIA 2JN0A 1Q7YU 1VQ9A 5LJ3f 4C92G 5GAOq 4M75B 4MZPA 3SFMA 2WSCE 4DOWA 3FC3A 4N4HA 2PVDB 4JLIA 3OS2A 4BE1A 2XDPA 2DZ9A 2L8DA 2KQWA 2JUFA 4Y91A 5CK9A 3RMQA 2EWNA 2RJCA 1YBYA 5FU7C 1FX7A 3PT9A 1BI0A 3KUFA 3M9QA 4A4KA 5KH6A 4HCCA 5CKDA 2AHJB 1B34B 4JS5A 1W4SA 1VIEA 4C0DB 2ZPGB 4IUTA 3MO8A 2OAUA 2CZ7B 3OMGA 3VJPA 4C5GA 5LJ3e 1QVGA 4C8QA 2HQEA 2LNVA 4BE2A 3S3NA 1YI2A 4N0AA 5I21A 1VQPT 3TEEA 5GANd 5GANf 2P0PA 3O8VA 4EMKC 3CD6A 3JCMX 3CCQT 1H3ZA 2RK2A 1I8FA 4BY6B 3RESA 3X20B 5KCOA 5DM7R 3PTAA 3G71T 5GAN3 4XTZA 4E7JA 1M8VA 4RG8A 4IUUA 4R55A 4E7HA 2E6ZA 3C95A 1M90C 3I55A 5FRNA 4XTYA 1QVFS 1JRIA 3PFSA 1G3TA 3CCVA 5LJ5d 3ASKA 3GF5A 1B34A 3E9FA 1XTDA 2VXFA 2ZPFB 3MP8A 2QQRA 3OYAA 1QVPA 2Y4YA 5LL6S 3CMAT 3QJYA 4LD9K 2EJGA 3JCMQ 1VQ4T 2RJEA 4XU1A 2ZGWA 3CCUT 1VQ8T 3S6WA 3X26B 4M7AF 4IUQA 1VQKA 1NPPA 1S72T 2LCCA 5A0GA 2D0QB 3GOXA 1X75C 1UGRB 5CCAA 1BYMA 5IT9E 2RHXA 4JRPA 4M77A 3CBOA 2A3LA 3VUZA 1LOJA 2B8AA 4M7DA 1JBMA 3SDZA 3BFMA 5GAN6 4C5IA 3CCMA 1UEBA 1YHQT 4JUVA 3OYJA 1K9MC 1Q81C 1M4ZA 2A7YA 4M78C 3I56T 3CCJT 2K5LA 3QBYA 1UGQB 2GQVA 2PUOB 2QEXT 1YJWT 1BIAA 2DTOA 2P0KA 4LDWA 5CKFA 5J39A 5GAMg 3OYBA 4RCBA 3MP6A 4J6YA 4C92D 3JCMf 1M9SA 4E7KA 1PSEA 4PJOD 4M77B 2QDYB 3ME9A 2WACA 4C8QC 4RMOA 2O01E 4LD6A 3VYHB 5CR2A 1VQ5T 4M7DB 4C8QF 4M77F 4A53A 2M16A 1W2BS 1V29B 4QW2A 3NTHA 4M77D 2M0OA 5M9OA 1YJ9A 1PSFA 1DJ7B 4L5GA 3V7RA 2DTHA 2HAXA 1LNXA 5GMKi 1NPRA 4ZN1A 1N8RU 3HKSA 2E12A 3PNWC 4C92F 3M58A 4QVZA 2DXTA 3JCMP 5CVIA 4XAXB 1WNLA 2D6FA 3JB9J 5GAOp 1G5VA 4R56A 1VQ8A 1M90U 3HRUA 2LTOA 3CC4T 2RD1A 2Y90A 3FEOA 4B9XA 5CAIA 1WJRA 2HBPA 2RHYA 5GMKl 3JCMW 1GXIE 2O4XB 3T9NA 3QO3A 5CQXA 2GFAA 4C0DC 3ZBDA 2CZ6B 2YLBA 3CC2A 2RO0A 3CD6T 4M75E 3VYGA 2RHUA 3HRSA 3L2RA 2VYTA 4BDYA 1JJ2A 1I81A 4M7DG 3LWHA 2QTXA 1WGSA 4GLKA 2VGNA 3M59A 4GY5A 1YCYA 3M55A 4JRKA 4MMKA 4BI8B 3CCST 3CXCS 1YIJA 1N6AA 4F7UF 3JCMe 2OTLA 1I5LA 3CCRA 1G3WA 2I2LA 4EPCA 2OTLT 5C0MA 3HRTA 2DXBA 4M78F 2CGHA 4Q5WA 4FM4B 1WPYA 4J7FA 2MWOA 2ZPEB 3OYGA 3CCUA 2LCLA 2O4XA 3TREA 4OF1A 3JSCA 4OB0B 5KCHA 1VQLA 4M78E 3I56A 4N4GA 2K5IA 1Y71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5A A;  3OQ5 A;  2GF7 A;  1WJS A;  2YRV A;  3O8V A;  1H3Z A;  2BUD A;  3L2U A;  5D6W A;  4X34 A;  5KCO A;  3NTK A;  4E7J A;  4IUU A;  5CIU A;  2K3Y A;  2CKK A;  4E7H A;  2E6N A;  3QJ6 A;  2IG0 A;  2F5K A;  3MEA A;  5FRN A;  3DB4 A;  2X4Y A;  3PFS A;  3UWN A;  2RJD A;  3ASK A;  3S3O A;  3E9F A;  2R57 A;  4QQ6 A;  3MP8 A;  2QQR A;  2EQJ A;  3MEU A;  3OYN A;  3OYA A;  2X4W A;  3S3M A;  2XK0 A;  3BDL A;  3OYK A;  3MEV A;  5J26 A;  3OYF A;  2RJE A;  3P8H A;  4UC4 A;  5KE2 A;  2DIQ A;  3OYC A;  3OA6 A;  2RHI A;  3S6W A;  2EQK A;  2L3R A;  3L42 A;  3MP1 A;  4IUQ A;  2LDM A;  3OYM A;  3FDR A;  2GFU A;  3SD4 A;  3OYL A;  2LCC A;  2D9T A;  5IN1 A;  3GOX A;  1OI1 A;  4EDU A;  2RHX A;  4FL6 A;  3EAE A;  2EKO A;  5D6X A;  3OMC A;  2RI3 A;  2MWP A;  2B8A A;  3LGF A;  3LH0 A;  3MEW A;  2EQM A;  3PMI A;  3UT1 A;  2BIV A;  3L2W A;  1XNI A;  4C5E A;  3H6Z A;  3NTI A;  3QII A;  4FU6 A;  4IUV A;  4A4E A;  4C5I A;  2HQX A;  4HCZ A;  3ZEH A;  3QKJ A;  4NS5 A;  3OYJ A;  4PL6 A;  3LLR A;  3QBY A;  5FRO A;  2M1H A;  3LYI A;  4BAC A;  2P0K A;  3Q1J A;  3OYD A;  3OB9 A;  3F70 A;  2G3R A;  5J39 A;  2RHZ A;  3OYB A;  2NLU A;  4PLL A;  2JTF A;  1N27 A;  3MP6 A;  4Z02 A;  4ZTJ A;  2LRQ A;  4E7K A;  2FHD A;  4II1 A;  4A4F A;  3ME9 A;  2WAC A;  4CRI A;  2X35 A;  4LD6 A;  1OZ3 A;  2M16 A;  2RI5 A;  3OS0 A;  3OS1 A;  4QW2 A;  3H8Z A;  3NTH A;  2EFI A;  4E7I A;  5M9O A;  2M0O A;  3PMT A;  5D6Y A;  2RI2 A;  2DIG A;  2EQU A;  2PQW A;  2RJF A;  5C6S A;  4IUP A;  3L2Q A;  4ZTF A;  1OZ2 A;  3PNW C;  3DLM A;  4B9W A;  4QVZ A;  4BE0 A;  4BDZ A;  2BKD N;  2E5Q A;  5KE3 A;  1G5V A;  4IUR A;  4QQG A;  4BD3 A;  3LX7 A;  3DB3 A;  2LTO A;  4A4G A;  3FEO A;  4B9X A;  2DAQ A;  5IAY A;  1WJR A;  3E9G A;  2RHY A;  3CEY A;  2K3X A;  1OYX A;  1RI0 A;  2R58 A;  3P8D A;  4L59 A;  2O4X B;  2JZ2 A;  2R5M A;  2GFA A;  3OYE A;  3FLG A;  2L89 A;  2QQS A;  2RO0 A;  3OYH A;  3C4S A;  3L2R A;  2RHU A;  4BDY A;  1MHN A;  2VYT A;  3OYI A;  1KHC A;  4A4H A;  1WGS A;  3OY9 A;  4GY5 A;  2X4X A;  5FRM A;  2LVM A;  3FC3 A;  4N4H A;  3OS2 A;  4BE1 A;  4OVA A;  2XDP A;  4C5H A;  2L8D A;  5C0M A;  1WJQ A;  3MET A;  4N4I A;  4RG2 A;  3L2V A;  4PLI A;  2RJC A;  4Q5W A;  3KUF A;  3M9Q A;  5KH6 A;  3OYG A;  2MWO A;  4IKF A;  4QQD A;  2O4X A;  4IUT A;  3MO8 A;  4C5G A;  3OMG A;  5KCH A;  4E7L A;  4BE2 A;  2HQE A;  3S3N A;  4N4G A;  3LGL A;  1SSF A; 
#chains in the Genus database with same CATH topology
 5HY6 A;  2EJF A;  2JTE A;  4Z8A A;  4BI3 A;  1K73 C;  4J9E A;  1YJN T;  3CMA Q;  1X2Q A;  4DBF A;  1X69 A;  4FYV B;  2IG0 A;  3MEA A;  4XTU A;  2V26 A;  1NJI C;  1EZZ B;  3CCJ A;  1QVF A;  1SRL A;  3E19 A;  1PWT A;  3P8H A;  2FZK B;  3TCJ A;  2ESW A;  2EQK A;  1IXD A;  4LDX A;  1O9S A;  2V1R A;  1T3S A;  4HA8 A;  5D7U A;  1M27 C;  1VIF A;  4M77 C;  1B7T A;  1FMW A;  3UT1 A;  3CPF A;  3J7A F;  4XK8 E;  3VUB A;  3J81 E;  1QWE A;  3V8L A;  3VS5 A;  1PRL C;  4YTL A;  4ZGE B;  3PIO A;  1WDX A;  1SPK A;  1VQK T;  2K57 A;  5J3B A;  5GAN 5;  4LNP A;  4II1 A;  4PJO G;  2IVW A;  3JV3 A;  1F1B B;  2QXF A;  4FT2 A;  3OS1 A;  3EG9 A;  1UJ0 A;  3CPW A;  2EFI A;  3CME T;  3PGG A;  2KK4 A;  2EBP A;  1QCO A;  3CCE T;  2K5F A;  3CC7 Q;  3OBW A;  3CCS Q;  4OB2 B;  3CC7 T;  1M1K U;  3QWX X;  1Q82 U;  4B6M A;  3X24 B;  1VA7 A;  4FYY B;  4BDZ A;  1WQW A;  1HSQ A;  4BD3 A;  1J3T A;  4J6W A;  4MZT A;  3FJP A;  2KRM A;  5HKC A;  2PU9 B;  4OMM A;  3FLG A;  4AMC A;  1YI2 Q;  1AEY A;  3REA B;  2RQV A;  3FRN A;  4HVU A;  2FYK A;  1S72 Q;  2FVU A;  5GAN h;  4ELY C;  3AT1 B;  3RKW A;  4PLI A;  3OS5 A;  2FB7 A;  1Q86 C;  5GAN 7;  2DRM A;  2IPO B;  4OMN A;  4E7L A;  3LGL A;  1WJS A;  2VXE A;  5LJ5 e;  2J6F A;  2D8J A;  1CSK A;  2D0N A;  2CKK A;  1GL5 A;  3QYG B;  1UHF A;  2DEQ A;  5GMK h;  1ACM B;  3S3O A;  2VC8 A;  5IXB A;  3KXT A;  3OYF A;  1EIF A;  1YJN Q;  5KE2 A;  1Q81 U;  1VQM T;  1M3A A;  4XQ3 A;  1D3B B;  2EIF A;  2LDM A;  5GAN g;  4DA4 A;  2L0A A;  3JRZ A;  1ZSZ B;  1O75 A;  2EQM A;  3CME A;  4ZNX A;  4DBQ A;  3QII A;  4FU6 A;  1MGQ A;  5HCK A;  2V8I A;  4WTO B;  2VVK A;  1AOJ A;  4RUG A;  2RHZ A;  2PVG B;  2GCX A;  1MMN A;  1WYX A;  2NUP A;  4TVR A;  2FHD A;  4C0Z A;  1G3S A;  2DK3 A;  2ED0 A;  3CBM A;  2KY9 A;  4LE9 A;  1D0Y A;  2GNC A;  3H8Z A;  6AT1 B;  1N5Z A;  1T0J A;  3QYH B;  2EQU A;  3M56 A;  3CXC A;  4E47 A;  2DXC A;  2O2O A;  3A8G B;  2MPX C;  2E5Q A;  3JB9 F;  4FCY A;  2YUQ A;  2XIC A;  3ZFJ A;  2ZZD A;  5IAY A;  2NUZ A;  2RB6 A;  3SB2 A;  1TUD A;  2J05 A;  1ZLM A;  4M7A E;  2F2X A;  1TXQ A;  4KT0 E;  2JOY A;  3NFC A;  1BU1 A;  3QXE B;  1KHC A;  1UGV A;  3H0F A;  3CCJ Q;  1WHL A;  1JJ2 P;  1VQ7 A;  8ATC B;  4C5H A;  2VB6 A;  1WJQ A;  4MDW A;  5GMK j;  3CMA A;  1RLP C;  1B3Q A;  2MAM A;  3GBQ A;  4ZGD B;  1WHM A;  4M77 G;  2Z0W A;  4PNO A;  5D6W A;  1VOM A;  2YRV A;  1Y7X A;  2C0I A;  1SKU B;  1RAB B;  2CDT A;  1YCS B;  2MI6 A;  3A8H B;  5CIU A;  4F7U A;  3CCM Q;  4C8Q E;  4XTW A;  3DB4 A;  3OYN A;  3FIF A;  1YWP A;  1U06 A;  4C92 A;  1W2B P;  1VQN A;  5KYU B;  2DVE A;  5L23 A;  2CZ1 B;  2LT4 A;  3G4S Q;  1OOT A;  2GFU A;  1JXO A;  1VQP Q;  1TH7 A;  4M7A C;  4FL6 A;  1YP5 A;  4MZM A;  2CP0 A;  4JJC A;  3LGF A;  1WHK A;  3LH0 A;  3O5Z A;  3VS0 A;  4EMH A;  2DA9 A;  5KYY B;  4A4E A;  3ZEH A;  1R8O B;  2CP6 A;  2J6K A;  1JEG A;  5LJ3 h;  4BAC A;  3OYD A;  1N8R C;  3GNF B;  3RIR A;  5KYW B;  1D1C A;  4A4F A;  4X9D A;  1MMG A;  5GAN j;  4FSX A;  1IRE B;  4CI0 C;  3M0R A;  3R6N A;  1S72 A;  4FIB A;  3M5A A;  1Y96 A;  4J9C A;  4IUP A;  4ZTF A;  3BY7 A;  3EG0 A;  2A36 A;  1BCM A;  5LJ3 d;  4O5V A;  3I56 Q;  3X28 B;  3CEY A;  4LDV A;  5IHN A;  2DTI A;  3QG1 A;  2MYS A;  2QTV A;  4ANJ A;  1I4K 1;  1H64 1;  3OYI A;  2DRK A;  4C92 G;  2IIM A;  4M75 B;  5IHI A;  3FC3 A;  3OS2 A;  2PVD B;  2J7I A;  2QAZ A;  2XDP A;  4E7Z A;  2DZ9 A;  2L8D A;  4Y91 A;  2RJC A;  1YBY A;  5FU7 C;  2DER A;  3KUF A;  5EC7 A;  1RAC B;  3M9Q A;  4A4K A;  1Y0M A;  2K3B A;  4C0D B;  2ZPG B;  5LJ3 e;  3MO8 A;  2OAW A;  4RTY A;  2HQE A;  5GAN d;  5GAN f;  3O8V A;  2CSI A;  2JM9 A;  4EMK C;  3CD6 A;  4BY6 B;  3X20 B;  3EGD B;  2LJ0 A;  3G71 T;  4XTZ A;  4E7J A;  2HL3 A;  1IRX A;  3C95 A;  1QVF S;  1H92 A;  1G3T A;  5LJ5 d;  3GF5 A;  2K7A A;  1X6B A;  2ZPF B;  3ULR B;  1SEM A;  1QVP A;  2AK5 A;  4HXJ A;  3CMA T;  2EJG A;  1I07 A;  1KJW A;  2ZAE A;  3CCU T;  4RTV A;  1K9M R;  2O31 A;  2YUO A;  5KYX A;  2D0Q B;  2JW4 A;  5IT9 E;  1GCQ C;  2M0Y A;  1BK2 A;  1KSW A;  2AKL A;  1JBM A;  4C5I A;  3CCM A;  4J9F A;  3D7S B;  1K9M C;  2A7Y A;  1TUC A;  2BZX A;  2CH4 A;  2K5L A;  1UGQ B;  3G71 Q;  1BIA A;  4LDW A;  1U3O A;  1T0H A;  4E7K A;  4M77 B;  2QDY B;  3ME9 A;  4F14 A;  3VYH B;  5CR2 A;  4M77 F;  2M16 A;  1RAE B;  2A08 A;  2OJ2 A;  2M0O A;  1PSF A;  1DJ7 B;  2DTH A;  4Y92 A;  2LP5 A;  3EG2 A;  2E12 A;  3PNW C;  3EG1 A;  3M0Q A;  2L2P A;  4RTU A;  4C92 F;  1W1F A;  1VQ6 Q;  5CVI A;  2HZY A;  1VQ7 Q;  3PVL A;  3EGX B;  2Y90 A;  4LXC A;  1GFC A;  5CAI A;  2HBP A;  5CQX A;  1ZX6 A;  2O9V A;  4A63 B;  1AWW A;  1KFZ A;  3RDV A;  3CD6 T;  1JJ2 A;  3HRS A;  2VYT A;  4MMK A;  1WGS A;  2VGN A;  4GY5 A;  2HMA A;  1YCY A;  3M55 A;  2DEU A;  2JMC A;  2DLP A;  3HRT A;  2CGH A;  2BTT A;  2DL5 A;  1OPK A;  1TG0 A;  1WPY A;  2O4X A;  2PVO B;  3OQ5 A;  5GAM j;  2V1Q A;  1Y07 A;  3JCM J;  4ATO A;  3QDR B;  2KAF A;  4C0F A;  3DLL A;  1X01 A;  1NJI U;  1NM7 A;  4PJM A;  3VRZ A;  2M51 A;  3CCQ A;  3M4Y A;  2KVQ G;  2FZG B;  4AFQ C;  2OI3 A;  1VYT A;  5FWB A;  2DF6 A;  1LJO A;  3I55 Q;  2DL7 A;  2DVJ A;  5D6X A;  5GAN e;  1IZ6 A;  1K8A C;  3H41 A;  3TSZ A;  4RTT A;  2DD4 A;  4NS5 A;  2DZC A;  3TQ7 P;  2M1H A;  5LJ3 g;  2JS2 A;  2FL7 A;  3OB9 A;  2CUB A;  2BE9 B;  2ROL A;  4A54 A;  1YN8 A;  1RAI B;  4Z02 A;  1KD1 U;  4M7A B;  4CRI A;  1BBZ A;  4HKE A;  1C1A A;  2LJ3 A;  1H8K A;  2ED1 A;  3SWN B;  4JRI A;  5CKE A;  1W2B A;  3WVE B;  3HP9 A;  2LCS A;  2DIG A;  2CP5 A;  3LH5 A;  1M2V A;  5C6S A;  1D1A A;  1OZ2 A;  4P5N A;  1Q82 C;  1C6V X;  2BKD N;  1X43 A;  3HFO A;  4A4G A;  2E1H A;  4M78 B;  2DAQ A;  4LN2 A;  5AT1 B;  4MDX A;  2K3X A;  4PJO A;  2E64 A;  2JZ2 A;  2JM8 A;  5AYF A;  2O88 A;  2GTJ A;  1VQ6 T;  2PZ1 A;  3JCM g;  1LVK A;  1VQ6 A;  2P84 A;  1R77 A;  1QMC A;  2B86 A;  2AIR B;  1KIK A;  2D8H A;  3EFR A;  1MV0 B;  1MMD A;  2L5Q A;  4OML A;  1KHI A;  4HCB A;  4J9B A;  1SSF A;  4M78 G;  4RCC A;  3H0I A;  1R0C B;  2BUD A;  3L2U A;  4F7U G;  5GAN 2;  3CCR Q;  1YJW Q;  1ARK A;  3QJ6 A;  3AHU A;  1WXU A;  2RMO A;  4NL3 A;  3UWN A;  3CC2 T;  2R57 A;  2J6O A;  4Z89 A;  3BDL A;  1UGS B;  3EFS A;  1U1T A;  4UC4 A;  4DEX A;  4E6R A;  4L6V 5;  2L3Q A;  5ECA A;  1YIT A;  2H3E B;  2D9T A;  4EDU A;  3UA6 A;  3H0H A;  2KT1 A;  2MWP A;  2RA2 A;  3C94 A;  2XD0 A;  1KC8 U;  1RL2 A;  2CRE A;  4PL6 A;  1Z9Z A;  2C0O A;  3CCR T;  3G4S A;  1M8M A;  1ABQ A;  2G3R A;  3A8M B;  2NLU A;  2QEX Q;  4NOY A;  2E70 A;  5GAO n;  4OP0 A;  1VQN T;  4KGV B;  4M7D E;  4E7I A;  5HK3 A;  1KQ2 A;  2BZY A;  5LJ5 h;  1QVG P;  2E5K A;  1QCF A;  1ZUY A;  2QK0 A;  3QSU A;  4NL2 A;  5KE3 A;  3I9Q A;  3GPL A;  3JB9 D;  2HNI A;  3E9G A;  4D8K A;  2MK5 A;  1RI0 A;  2R58 A;  1MND A;  4L59 A;  2HSE B;  1Q7Y R;  2KXC A;  3WVD B;  3M0P A;  3C4S A;  3GNG A;  5A0D A;  3UDC A;  4DBH A;  3CCV T;  2X4X A;  2DFU A;  4KUI A;  1BI1 A;  4N4I A;  3MET A;  4RG2 A;  2LQW A;  2M02 A;  2RQR A;  3MKD A;  4QQD A;  4DQ2 A;  5GMK m;  4MML A;  3RBB B;  1TOV A;  1OV3 A;  4JDS A;  4DOV A;  1TTH B;  1TU0 B;  2BE7 D;  4PJO C;  2YUP A;  2E65 A;  2EQJ A;  4WF2 A;  2LJ1 A;  2QEX A;  4M7D C;  2DIQ A;  1OQK A;  3OW2 A;  3L42 A;  2E3H A;  3KFV A;  1MUZ A;  2EGA A;  3EAE A;  4HT9 A;  3VU3 C;  2ABL A;  1PM3 A;  1M1K R;  1Q82 R;  2VUB A;  5GAM h;  2BIV A;  2LQK A;  4C5E A;  4IUV A;  5CO7 A;  4CC4 B;  4C92 B;  9ATC B;  2HQX A;  4HCZ A;  1ZBX A;  1TS9 A;  3F70 A;  1FYN A;  1V1C A;  4AG1 C;  2P4R A;  1QVG S;  1UB4 A;  2V8J A;  2YSQ A;  3FB9 A;  1KQ1 A;  2EW3 A;  2X35 A;  1QP2 A;  2RM4 A;  3CXC P;  2RN8 A;  1MV3 A;  3A8O B;  3DKM A;  3JCM d;  3RUX A;  2KRN A;  4LUE A;  3PMT A;  1VQ5 Q;  2OTL Q;  3G71 A;  1K0X A;  4EMK A;  2EGE A;  4M78 D;  3A5Z B;  1VQO T;  3EFO B;  3M57 A;  2NUT A;  1JO8 A;  4RKU E;  1NYG A;  2ZPI B;  2HL5 C;  4KH0 B;  4JLG A;  4ELZ C;  1T3L A;  3L1A A;  4XTV A;  1YHQ A;  1VQ7 T;  4C8Q B;  1Y96 B;  2JTM A;  1Q7Y U;  4F04 B;  5LJ3 f;  1GRI A;  1VQ9 A;  1ZA2 B;  4N4H A;  4BE1 A;  1AWX A;  1D0Z A;  1QLY A;  2KQW A;  2JUF A;  4LUD A;  2CT3 A;  1QVF P;  5CKD A;  2AHJ B;  1B34 B;  4IKF A;  1I5O B;  2W10 A;  2X3W D;  2OAU A;  2CZ7 B;  3OMG A;  3VJP A;  1QVG A;  4BE2 A;  2LNV A;  3OW2 P;  3S3N A;  1RAF B;  1WHH A;  3TEE A;  1GCP A;  2P0P A;  1W70 A;  2X9H A;  3JCM X;  1H3Z A;  3RES A;  1AWJ A;  2EPD A;  5GAN 3;  1M8V A;  4KH1 B;  4FYX B;  1GBQ A;  3CCV A;  4IIO A;  2KR3 A;  1ABO A;  3E9F A;  3MP8 A;  2QQR A;  1K4U S;  5LL6 S;  1AT1 B;  4J9I A;  2HCK A;  4M7A F;  1S72 T;  3SEM A;  3U23 A;  2AKK A;  1BYM A;  1UGR B;  4JRP A;  2K9G A;  2B8A A;  4M7D A;  1K1Z A;  3SDZ A;  1UEB A;  1M4Z A;  1PKT A;  5KYN A;  3CCJ T;  3QBY A;  2PUO B;  1OX9 A;  5KYX B;  3OYB A;  2AT1 B;  4RCB A;  3MP6 A;  1WHJ A;  1SRM A;  4R0K A;  4C8Q C;  1YHQ Q;  1VQ5 T;  2O9S A;  1M3B A;  4C8Q F;  1Q81 R;  2DYI A;  4A53 A;  1W2B S;  4M77 D;  1YJ9 A;  3V7R A;  4L5G A;  1UUE A;  1HJD A;  3M58 A;  4QVZ A;  3JCM P;  4XAX B;  1WNL A;  1UJY A;  3JB9 J;  5GAO p;  3HRU A;  2LTO A;  1SSH A;  2RQT A;  3TSW A;  2RHY A;  5GJW B;  2FPE A;  3QO3 A;  4F17 A;  1QWF A;  2EGC A;  1TSF A;  2CZ6 B;  2YLB A;  2CSQ A;  3ZBD A;  2RO0 A;  2QTX A;  4GLK A;  5FWC A;  3CCS T;  3JCM e;  4F7U F;  2ECZ A;  1G8X A;  2OTL T;  3SHW A;  4J7F A;  2MWO A;  1YNZ A;  3JSC A;  3UF4 A;  4M78 E;  4N4G A;  2A0F B;  1VQ8 A;  1QQJ A;  2R5A A;  2HDA A;  1YJN A;  1YIT T;  3EGU A;  2COW A;  1YI2 T;  5I2S A;  4QVD A;  4J9G A;  3V7C A;  3OYK A;  3C0C A;  4FSS A;  4PJO F;  1LCK A;  2GBQ A;  2A28 A;  1NYF A;  1RI9 A;  1WI7 A;  2KRS A;  4O6J A;  2RQU A;  3G1J A;  1B07 A;  2VGM A;  5EG2 A;  4J6X A;  3L2W A;  3OBY A;  4FT4 A;  5GAO l;  2YXY A;  3HFN A;  3LLR A;  3LYI A;  5DLQ E;  2QQ9 A;  2JTF A;  1G3Y A;  4C0G A;  1KD1 C;  2KEA A;  2DE0 X;  3GLX A;  4Z88 A;  1VQ9 Q;  4XU0 A;  3MCA B;  4JJN K;  2RI2 A;  2HBW A;  4FW2 A;  1SHG A;  3V8K A;  2QA4 A;  1KD1 R;  4GLM A;  1UHC A;  4BE0 A;  3REB B;  2DMO A;  4M7A A;  1E6G A;  2QAS A;  3DB3 A;  2DO3 A;  3SWN A;  4XU2 A;  2VKN A;  1G2B A;  2QDL A;  3EG9 B;  3I5S A;  4OMF B;  1WA7 A;  2OTJ T;  2RQW A;  2EYX A;  3ER0 A;  1OX8 A;  1IGQ A;  3JCM V;  5FRM A;  4DEY A;  3A8L B;  4M75 F;  3VS4 A;  1UE9 A;  1ZA1 B;  3TVT A;  3HPW A;  4OGC A;  2ZPB B;  3GP8 A;  1VQN Q;  2GTO A;  2LMJ A;  1K8A U;  2CYZ B;  2FPF A;  2KNB B;  4M77 E;  1IGU A;  3CQT A;  5GAN 4;  1RAG B;  1E7O A;  3G6E T;  2YLC A;  1AHJ B;  1D3B A;  1M2O A;  4M7D D;  1I0C A;  5L8R E;  2M9U A;  2JS0 A;  2K3Y A;  1VUB A;  2XI9 A;  2X4Y A;  2RJD A;  4C8Q G;  2LX7 A;  3NGP A;  5I22 A;  3WXM B;  5GAM d;  5GAM f;  3CC4 Q;  2XK0 A;  1QW1 A;  3HHT B;  1NBE B;  1YFN A;  3OA6 A;  2C06 A;  1FWZ A;  2E41 A;  2QQA A;  1YJW A;  1VQ8 Q;  2EKH A;  3P8B B;  1ZHI A;  2DJQ A;  1YJ9 Q;  3OMC A;  2YRC A;  2RI3 A;  1H3H A;  3M0U A;  1MMA A;  2VAS A;  1IHW A;  3M54 A;  5GAO m;  3CCE A;  2X3X D;  2RH2 A;  3EG3 A;  1OEB A;  5LJ5 g;  3EH2 A;  1VQO A;  3LW5 E;  4RTZ A;  4PKC C;  2EYQ A;  1K9A A;  2XID A;  3LWI A;  1HXD A;  2EYZ A;  5CKB A;  2K2V A;  3JB9 I;  2XDB A;  3PE0 A;  1QKX A;  2XKO C;  2F5T X;  2X51 A;  3A1P A;  1QP3 A;  2RK1 A;  5HK0 A;  2BZ8 A;  3NHN A;  3L2Q A;  2NUP B;  1M1G A;  2W0Z A;  1PHT A;  4J8O A;  2FPD A;  3MJX A;  2E10 A;  2JMA A;  3CBP A;  1K73 R;  1OU8 A;  2XG8 D;  4KUL A;  3R6O A;  4CC2 A;  3QZ5 B;  1X6O A;  2LC4 A;  2HEQ A;  1NJI R;  3UA7 A;  2YRD A;  3VS7 A;  2LT1 A;  3I55 T;  4A4H A;  4KBM B;  2DET A;  4BY6 C;  3G7Z A;  1K0S A;  3VRY A;  4OMQ A;  2WSF E;  2MMP A;  4ZGJ B;  1VYU A;  4BUG A;  1WIE A;  1VQM A;  3CCL A;  2ZCF B;  3JB9 G;  2GF7 A;  1M30 A;  1NLO C;  4X34 A;  3JCM b;  4OMO A;  1GBR A;  3RMS A;  1R0B G;  1VQ4 A;  4D8D A;  3GIB A;  1YIJ Q;  3QPH A;  2X4W A;  3S3M A;  2L3P A;  3MEV A;  1FXX A;  4PFP A;  2RHI A;  4QKU A;  3FDR A;  3OYL A;  5GAN 8;  3L2Z A;  4F7U B;  4OGE A;  3JB9 H;  1RLQ C;  3CD6 Q;  4IIM A;  2KDS A;  3PMI A;  4LDY A;  2HD0 A;  1YIJ T;  3NMZ C;  1U8R A;  3NTI A;  4PJJ A;  3E1S A;  2XMF A;  7AT1 B;  1D0X A;  3VS3 A;  5KYU A;  4M7A D;  1D09 B;  2DM1 A;  4EMG A;  1OUL A;  1BKB A;  3CCS A;  4PLL A;  4ZTJ A;  3V7S A;  2DNU A;  2AZV A;  5GAO r;  5KYY A;  4OB3 B;  1X2K A;  2KE9 A;  2DIL A;  2KBT A;  1NE8 A;  1N8R R;  2L3S A;  1Q86 R;  1PD0 A;  1KG1 A;  1WFW A;  3G4S T;  5KYW A;  3OSV A;  3CCE Q;  2CS7 A;  2KT8 A;  5A0L A;  3JAM E;  1UGP B;  2XHC A;  1M1F A;  2FEI A;  1N9S A;  3CPW S;  3OYE A;  2JJ9 A;  2KMT A;  2QQS A;  4EMK B;  1HK9 A;  4MZP A;  3SFM A;  1VYV A;  2WSC E;  3EGD A;  3QDF A;  4J9H A;  1JXM A;  1EFN A;  5CK9 A;  1S1N A;  4HCC A;  4JS5 A;  1W4S A;  1VIE A;  3CC2 Q;  4C8Q A;  1VQP T;  5IH2 A;  1PRM C;  3CCQ T;  2DL4 A;  1SG5 A;  2RK2 A;  1NEB A;  5KCO A;  5DM7 R;  3PTA A;  3M0T A;  4E7H A;  5FRN A;  3I55 A;  1JRI A;  1FMK A;  3PFS A;  3ASK A;  1B34 A;  1NEG A;  3CCL Q;  1XTD A;  2VXF A;  3OYA A;  2Y4Y A;  4LD9 K;  1VQ4 T;  2RJE A;  3THK A;  4XU1 A;  1A0N B;  2D1X A;  2ZGW A;  3S6W A;  4IUQ A;  1VQK A;  5A0G A;  1AVZ C;  1OU9 A;  1X75 C;  5CCA A;  1VQ4 Q;  4M77 A;  3VUZ A;  2A3L A;  2YWW A;  2GGR A;  3BFM A;  1TWB A;  2I0N A;  1RAH B;  1YHQ T;  4AFU C;  3OYJ A;  1PNJ A;  5IHK A;  3HTR A;  3CCV Q;  2GQV A;  2QEX T;  2P0K A;  4OMP A;  5J39 A;  4J6Y A;  3G6E Q;  4C92 D;  2A37 A;  3JCM f;  2FRY A;  1M9S A;  1PSE A;  4PJO D;  1V76 A;  2WAC A;  3ZL7 C;  4KRT A;  4LD6 A;  2HKN A;  3I5R A;  4M7D B;  4PJN A;  1V29 B;  2QGG A;  3NTH A;  3NPF A;  2HAX A;  3CPW P;  1NPR A;  1N8R U;  1VQM Q;  2GQI A;  2D6F A;  1G5V A;  4R56 A;  1AZG B;  1KC8 R;  1UEC A;  2F2W A;  3CC4 T;  2RD1 A;  3FEO A;  4B9X A;  1WJR A;  2H8H A;  4HCK A;  3JCM W;  1GXI E;  2LQN A;  2GFA A;  1EX4 A;  3L2R A;  2RHU A;  4M7D G;  2YT6 A;  2KXD A;  4JRK A;  1W6X A;  1WZO A;  2MIO A;  3CXC S;  1YIJ A;  1N6A A;  4E7S A;  3CCR A;  1ZUU A;  2I2L A;  4EPC A;  5C0M A;  2DXB A;  4M78 F;  4Q5W A;  2EVR A;  3OYG A;  3CCU A;  2ZPE B;  2LCL A;  2G6F X;  3TRE A;  4OF1 A;  1VQL A;  5KCH A;  3I56 A;  2K5I A;  1Y71 A;  1FMV A;  2DYB A;  2RNA A;  1PC0 A;  5I11 A;  1YIT Q;  5FU7 B;  3OSS C;  4HVV A;  4C92 E;  2DKG A;  2E6N A;  2SRC A;  2P4T A;  3UPU A;  4PJO E;  2XDD A;  1BIB A;  4AFZ C;  2RF0 A;  4LDU A;  5J26 A;  3OYC A;  2X4J A;  2L3R A;  1PG5 B;  2JVV A;  3OYM A;  4C8Q D;  3MPU B;  1NZ9 A;  2LNH B;  1UTI A;  4KGZ B;  1CKB A;  4ESR A;  3QKJ A;  3M53 A;  4J5Y A;  1PKS A;  1VQK Q;  2COY A;  3Q1J A;  1AD5 A;  2QI2 A;  1Q95 G;  1BB9 A;  2LRQ A;  4WCI A;  1Y57 A;  1Z9Q A;  1YWO A;  5FU6 B;  1OZ3 A;  1ZQ1 A;  4M75 G;  8AT1 B;  1IO6 A;  3HSB A;  3RKX A;  4VUB A;  4BI4 A;  2ATC B;  2F69 A;  1ZSZ C;  3URG A;  3N5B B;  4JRQ A;  1M1K C;  4M7A G;  4BB7 A;  2DL8 A;  3E2U A;  2FG0 A;  1VQL T;  2CP7 A;  3BDU A;  3MHX A;  4FYW B;  2KSS A;  3SWN C;  4JS4 A;  2R5M A;  2EQI A;  2L89 A;  2RPN A;  4JZ4 A;  4J83 A;  4ZN3 A;  1YJ9 T;  3RNJ A;  1M2V B;  1MHN A;  2ZPH B;  5CQY A;  2MOX A;  1UDL A;  2VWF A;  4ORZ A;  2PUK B;  1VQ5 A;  5DY9 A;  4OVA A;  4JJD A;  3L2V A;  2LZ6 B;  4M78 A;  5I2M A;  1GFD A;  2QA4 Q;  4PJO B;  2F1L A;  1D1B A;  3OYY A;  1P92 A;  3CC4 A;  1AWO A;  2FO0 A;  1HYO A;  3JCM c;  1LPL A;  1XOV A;  2QYZ A;  1RAA B;  4J9D A;  4JJB A;  4E2F B;  1ZSZ A;  2KYM A;  4X9C A;  4M7D F;  1I1J A;  2J06 A;  3MEU A;  1OPL A;  1KQS A;  5CKH A;  3G6E A;  1WXT A;  4C92 C;  3EHR A;  5FU6 C;  1NLP C;  3SD4 A;  5IN1 A;  4KUD K;  3JCM h;  3C12 A;  1GCQ A;  3MEW A;  2VV5 A;  1XNI A;  2DL3 A;  1KC8 C;  4F16 A;  1RUW A;  2CZ0 B;  2K4Y A;  2FRW A;  2LX9 A;  1XQH A;  2LQ8 A;  1N27 A;  3QUI A;  4HT8 A;  5LJ3 j;  3VS2 A;  1E6H A;  1G83 A;  3TU4 K;  1AZE A;  1BI2 A;  3I35 A;  3KBG A;  4DBR A;  3OS0 A;  1VQ9 T;  2QA4 T;  2DD5 A;  1PD1 A;  5D6Y A;  3QWY A;  2YHT A;  1Q7Y C;  1JQQ A;  2RJF A;  1JU5 C;  4J7I A;  4B9W A;  5GMK e;  3CCU Q;  1MNE A;  3H9N A;  2OTJ Q;  4IUR A;  3LX7 A;  2JXB A;  2PNI A;  2ROT A;  2QGF B;  3QZ9 B;  2EJ9 A;  3P8D A;  1TUG B;  3J80 E;  4AT1 B;  3QHS A;  5GAM e;  4OB1 B;  4XTX A;  3RKY A;  3V8J A;  2K6D A;  3OY9 A;  4D6W A;  4RTW A;  2LVM A;  4K11 A;  3UAT A;  1K73 U;  2YDL A;  2CT4 A;  4EIK A;  2E4H A;  3M4G A;  4FW1 A;  1ZBJ A;  4M75 D;  1BI3 A;  3INZ A;  2K79 A;  1SHF A;  2XU8 A;  1WX6 A;  1K8A R;  1BCO A;  5A2Q E;  1WLP B;  1JJ2 S;  1CKA A;  5LJ5 j;  2H3J A;  2MCN A;  3NTK A;  2HSP A;  1VQP A;  2YUN A;  2F5K A;  3CCL T;  3X25 B;  1JB0 E;  5FLX E;  4ME7 A;  4PFZ A;  4QQ6 A;  1Q86 U;  1KQS S;  1X27 A;  5FW9 A;  1K9M U;  4M75 C;  1U1S A;  4AFS C;  2DJZ A;  2HQH A;  2V8K A;  3MP1 A;  2E3I A;  1VQO Q;  3VKI A;  1OI1 A;  2EKO A;  2P0Q A;  2DPP B;  3VV0 A;  3H6Z A;  4RTX A;  1N9R A;  3VS6 A;  4Y28 E;  5DLO A;  1IB8 A;  1WQ7 A;  5FRO A;  2COZ A;  3BW1 A;  3OW2 S;  1SF9 A;  1XJW B;  3EFO A;  4CC3 A;  2JNG A;  2Y4X A;  1K76 A;  2QQB A;  3HL8 A;  4XU3 A;  5LJ5 f;  3IQL A;  3RER A;  3BE3 A;  1RAD B;  2RI5 A;  2K2M A;  2DXU A;  4N0A C;  4KGX B;  4V2S A;  2PQW A;  2WSE E;  1PCX A;  1WXB A;  2EAY A;  3DLM A;  4M75 A;  2MF2 A;  1M5Q 1;  2KYB A;  4QQG A;  2NWM A;  4JZ3 A;  2JT4 A;  2DBK A;  1OYX A;  3CCM T;  4CC7 A;  2C0T A;  3CC7 A;  4QVC A;  4F7U E;  3OYH A;  3PIP A;  2JN0 A;  5GAO q;  2NUT B;  4DOW A;  3FJ5 A;  4JLI A;  2KRO A;  3RMQ A;  2EWN A;  1C0M A;  3VS1 A;  1FX7 A;  3PT9 A;  1BI0 A;  2EYY A;  5KH6 A;  2OTJ A;  4IUT A;  5GJV B;  4C5G A;  3RR6 A;  1YI2 A;  4N0A A;  5I21 A;  1KQS P;  2QG9 B;  3EH1 A;  1I8F A;  2HKQ B;  4RG8 A;  4IUU A;  4R55 A;  2E6Z A;  1M90 C;  4XTY A;  1HD3 A;  3EHQ A;  2CH4 W;  1QCN A;  3PVQ A;  3QJY A;  3JCM Q;  2AZS A;  1VQ8 T;  3A98 A;  3X26 B;  1NPP A;  1KK7 A;  1M90 R;  2LCC A;  2PTK A;  4PFO A;  1UFF A;  3GOX A;  4AG2 C;  4X1V A;  2RHX A;  5IXF A;  3CBO A;  1LOJ A;  1UG1 A;  5GAN 6;  4JUV A;  1Q81 C;  4M78 C;  3I56 T;  2EYW A;  1YJW T;  2DTO A;  5CKF A;  2SEM A;  1ZSG A;  3M0S A;  5GAM g;  1NG2 A;  2F2V A;  4PK4 A;  2KGT A;  4RMO A;  2O01 E;  1ZUK A;  3CME Q;  3EGX A;  4JPB W;  4QW2 A;  5M9O A;  2CP3 A;  1LNX A;  4GBQ A;  5GMK i;  1WHG A;  4ZN1 A;  3HKS A;  2DXT A;  2FZC B;  1M90 U;  2ENM A;  5GMK l;  2O4X B;  3T9N A;  1QKW A;  2DBM A;  4C0D C;  1VQL Q;  3CC2 A;  4M75 E;  4HVW A;  3VYG A;  4BDY A;  1U5S A;  1I81 A;  3LWH A;  2OX7 A;  3M59 A;  3CCQ Q;  4BI8 B;  2OTL A;  1IHV A;  1X6G A;  1I5L A;  2CUD A;  1G3W A;  2NYS A;  4PJL A;  2KI7 A;  4QT7 A;  2CP2 A;  2DX1 A;  4FM4 B;  4M4Z A;  1M3C A;  4OB0 B; 
#chains in the Genus database with same CATH homology
 2PVO B;  2R5A A;  3OQ5 A;  5GAM j;  5HY6 A;  2EJF A;  1YJN A;  1YIT T;  1Y07 A;  4BI3 A;  1K73 C;  1YJN T;  3JCM J;  4ATO A;  1YI2 T;  3QDR B;  2KAF A;  5FU7 B;  3OSS C;  4C0F A;  2DKG A;  2E6N A;  4XTU A;  1X01 A;  2IG0 A;  3MEA A;  4C92 E;  3DLL A;  1NJI U;  2P4T A;  1NJI C;  3CCQ A;  3UPU A;  5I2S A;  3CCJ A;  3M4Y A;  2KVQ G;  1QVF A;  4PJO E;  4QVD A;  3V7C A;  3E19 A;  2XDD A;  1BIB A;  3OYK A;  4LDU A;  5J26 A;  4PJO F;  3P8H A;  3OYC A;  3TCJ A;  2X4J A;  2EQK A;  2L3R A;  2JVV A;  4LDX A;  3OYM A;  4C8Q D;  1O9S A;  4HA8 A;  4O6J A;  1LJO A;  5D6X A;  1NZ9 A;  1VIF A;  2VGM A;  4M77 C;  4J6X A;  1IZ6 A;  5EG2 A;  3UT1 A;  5GAN e;  3L2W A;  3CPF A;  3OBY A;  4FT4 A;  1K8A C;  3J7A F;  4XK8 E;  3VUB A;  5GAO l;  3J81 E;  2DD4 A;  3V8L A;  3QKJ A;  4NS5 A;  2DZC A;  3HFN A;  3LLR A;  3M53 A;  2M1H A;  3LYI A;  4J5Y A;  4YTL A;  2QQ9 A;  5DLQ E;  4ZGE B;  3Q1J A;  2FL7 A;  5LJ3 g;  3OB9 A;  3PIO A;  4A54 A;  2QI2 A;  2JTF A;  1VQK T;  2K57 A;  1G3Y A;  4Z02 A;  2LRQ A;  5J3B A;  5GAN 5;  1KD1 U;  4C0G A;  4II1 A;  4PJO G;  1KD1 C;  4M7A B;  4CRI A;  2IVW A;  3GLX A;  4HKE A;  5FU6 B;  1OZ3 A;  1ZQ1 A;  3SWN B;  2QXF A;  4FT2 A;  4M75 G;  4JRI A;  5CKE A;  3OS1 A;  3CPW A;  4XU0 A;  2EFI A;  3HSB A;  3MCA B;  3CME T;  1W2B A;  3PGG A;  3RKX A;  2KK4 A;  3WVE B;  3HP9 A;  4VUB A;  4JJN K;  2RI2 A;  2DIG A;  3CCE T;  2K5F A;  4BI4 A;  3OBW A;  2F69 A;  4OB2 B;  3URG A;  5C6S A;  3V8K A;  3CC7 T;  3N5B B;  1M1K U;  1OZ2 A;  2QA4 A;  1Q82 U;  4JRQ A;  1M1K C;  4M7A G;  4P5N A;  4BE0 A;  1Q82 C;  4BB7 A;  3X24 B;  4BDZ A;  2BKD N;  4M7A A;  1WQW A;  1VQL T;  3HFO A;  4BD3 A;  3BDU A;  3DB3 A;  3MHX A;  4A4G A;  2E1H A;  2DO3 A;  4J6W A;  4M78 B;  3FJP A;  4MZT A;  2DAQ A;  4XU2 A;  3SWN A;  4MDX A;  2OTJ A;  2K3X A;  2KSS A;  4PJO A;  2E64 A;  4OMF B;  3SWN C;  5HKC A;  4JS4 A;  2PU9 B;  2JZ2 A;  2R5M A;  5AYF A;  3FLG A;  2L89 A;  2OTJ T;  4J83 A;  4ZN3 A;  1YJ9 T;  1VQ6 T;  1MHN A;  2ZPH B;  3ER0 A;  3FRN A;  5CQY A;  3JCM g;  1VQ6 A;  3JCM V;  2FYK A;  2PUK B;  1VQ5 A;  5FRM A;  2FVU A;  3A8L B;  5DY9 A;  4M75 F;  4ELY C;  4OVA A;  5GAN h;  3L2V A;  3RKW A;  3EFR A;  3OS5 A;  4M78 A;  3HPW A;  4PLI A;  5I2M A;  4OGC A;  2ZPB B;  3GP8 A;  2FB7 A;  1Q86 C;  4PJO B;  5GAN 7;  1K8A U;  2L5Q A;  2CYZ B;  1KHI A;  4M77 E;  3OYY A;  4HCB A;  1P92 A;  3CC4 A;  4E7L A;  3LGL A;  5GAN 4;  1SSF A;  3JCM c;  1WJS A;  4M78 G;  3G6E T;  2YLC A;  1AHJ B;  4RCC A;  1D3B A;  2VXE A;  2BUD A;  3L2U A;  5LJ5 e;  1XOV A;  4M7D D;  5L8R E;  4F7U G;  2M9U A;  5GAN 2;  2K3Y A;  2CKK A;  1VUB A;  3QJ6 A;  3QYG B;  3AHU A;  2DEQ A;  2XI9 A;  4X9C A;  2X4Y A;  5GMK h;  4NL3 A;  4M7D F;  3UWN A;  2RJD A;  3S3O A;  4C8Q G;  3CC2 T;  2VC8 A;  2R57 A;  3MEU A;  3WXM B;  5GAM d;  5GAM f;  1KQS A;  2XK0 A;  3BDL A;  3KXT A;  5CKH A;  1UGS B;  1QW1 A;  3HHT B;  3G6E A;  3EFS A;  3OYF A;  1U1T A;  1EIF A;  4UC4 A;  4C92 C;  5KE2 A;  1Q81 U;  3OA6 A;  1VQM T;  2C06 A;  1FWZ A;  4XQ3 A;  2E41 A;  1D3B B;  2EIF A;  2LDM A;  2QQA A;  4L6V 5;  5FU6 C;  1YJW A;  3SD4 A;  1YIT A;  2D9T A;  5IN1 A;  3P8B B;  4EDU A;  1ZHI A;  5GAN g;  4DA4 A;  3JRZ A;  3OMC A;  4KUD K;  1O75 A;  3C12 A;  2RI3 A;  2MWP A;  2RA2 A;  3MEW A;  2VV5 A;  3JCM h;  2EQM A;  1XNI A;  3CME A;  1KC8 C;  3C94 A;  2XD0 A;  1KC8 U;  1RL2 A;  3QII A;  1MGQ A;  3M54 A;  4FU6 A;  5GAO m;  2V8I A;  3CCE A;  2CZ0 B;  2RH2 A;  4PL6 A;  2K4Y A;  5LJ5 g;  3CCR T;  3G4S A;  1VQO A;  2LX9 A;  1XQH A;  2G3R A;  2LQ8 A;  2RHZ A;  2PVG B;  2GCX A;  3A8M B;  2NLU A;  3LW5 E;  1N27 A;  3QUI A;  4NOY A;  4PKC C;  4TVR A;  4HT8 A;  2FHD A;  2EYQ A;  2E70 A;  4C0Z A;  1G3S A;  5LJ3 j;  2XID A;  5GAO n;  1HXD A;  3LWI A;  2DK3 A;  4OP0 A;  5CKB A;  3TU4 K;  3CBM A;  2K2V A;  2KY9 A;  1BI2 A;  1VQN T;  3KBG A;  3OS0 A;  3JB9 I;  1VQ9 T;  4M7D E;  2QA4 T;  3H8Z A;  4E7I A;  2DD5 A;  2XDB A;  2XKO C;  5HK3 A;  1KQ2 A;  2F5T X;  5D6Y A;  2YHT A;  1QP3 A;  5LJ5 h;  2RK1 A;  5HK0 A;  1Q7Y C;  3QYH B;  2EQU A;  2RJF A;  3L2Q A;  3M56 A;  3CXC A;  4E47 A;  4J7I A;  1M1G A;  4B9W A;  5GMK e;  2DXC A;  3A8G B;  4J8O A;  3QSU A;  4NL2 A;  2E5Q A;  5KE3 A;  3JB9 F;  2E10 A;  4IUR A;  3CBP A;  2XG8 D;  2XIC A;  3LX7 A;  3R6O A;  4KUL A;  3GPL A;  3ZFJ A;  2ZZD A;  3JB9 D;  3QZ5 B;  2HNI A;  5IAY A;  3E9G A;  1X6O A;  3QZ9 B;  2RB6 A;  1RI0 A;  2EJ9 A;  2LC4 A;  2R58 A;  3P8D A;  4L59 A;  3SB2 A;  3WVD B;  4M7A E;  3J80 E;  5GAM e;  3QHS A;  4OB1 B;  4KT0 E;  3C4S A;  2JOY A;  3GNG A;  5A0D A;  2LT1 A;  3NFC A;  4XTX A;  3UDC A;  3I55 T;  3QXE B;  1KHC A;  3RKY A;  3V8J A;  4A4H A;  3OY9 A;  4KBM B;  4D6W A;  3CCV T;  2X4X A;  2LVM A;  1K73 U;  1VQ7 A;  4BY6 C;  3G7Z A;  4C5H A;  4KUI A;  1BI1 A;  1WJQ A;  3MET A;  4MDW A;  4N4I A;  4RG2 A;  5GMK j;  3CMA A;  2WSF E;  2MMP A;  3M4G A;  2MAM A;  4M75 D;  4ZGJ B;  1BI3 A;  3INZ A;  4BUG A;  4ZGD B;  4M77 G;  1VQM A;  4IKF A;  4QQD A;  3CCL A;  2ZCF B;  4DQ2 A;  2XU8 A;  3JB9 G;  4PNO A;  5GMK m;  5D6W A;  2GF7 A;  5A2Q E;  4MML A;  2YRV A;  1Y7X A;  1JJ2 S;  5LJ5 j;  2H3J A;  4X34 A;  3JCM b;  3NTK A;  4JDS A;  4DOV A;  1VQP A;  5CIU A;  2MI6 A;  3A8H B;  4F7U A;  4C8Q E;  2F5K A;  3RMS A;  1VQ4 A;  4XTW A;  4PJO C;  3DB4 A;  3CCL T;  3X25 B;  1JB0 E;  5FLX E;  3GIB A;  4ME7 A;  2E65 A;  4QQ6 A;  1Q86 U;  3OYN A;  2EQJ A;  3QPH A;  1KQS S;  2X4W A;  1K9M U;  3S3M A;  4WF2 A;  4M75 C;  3FIF A;  1U1S A;  3MEV A;  4C92 A;  2QEX A;  4M7D C;  1FXX A;  1VQN A;  2DIQ A;  2DJZ A;  3OW2 A;  2RHI A;  2V8K A;  3L42 A;  3MP1 A;  2DVE A;  2CZ1 B;  2LT4 A;  3FDR A;  2GFU A;  3OYL A;  3VKI A;  5GAN 8;  1TH7 A;  3L2Z A;  4F7U B;  1OI1 A;  4OGE A;  4M7A C;  3JB9 H;  4FL6 A;  3EAE A;  2EKO A;  4MZM A;  3VU3 C;  2P0Q A;  4HT9 A;  2DPP B;  3VV0 A;  2KDS A;  3LGF A;  3LH0 A;  3PMI A;  2VUB A;  2HD0 A;  2BIV A;  4LDY A;  4EMH A;  5GAM h;  1YIJ T;  2LQK A;  4C5E A;  1U8R A;  3H6Z A;  3NTI A;  4IUV A;  5CO7 A;  1N9R A;  4A4E A;  3E1S A;  2HQX A;  4HCZ A;  4Y28 E;  1ZBX A;  3ZEH A;  4C92 B;  5DLO A;  1R8O B;  1WQ7 A;  5FRO A;  5LJ3 h;  4M7A D;  4BAC A;  3OYD A;  1N8R C;  4EMG A;  3F70 A;  3GNF B;  3BW1 A;  3CCS A;  1BKB A;  3RIR A;  3OW2 S;  4PLL A;  1QVG S;  1UB4 A;  2V8J A;  4ZTJ A;  3FB9 A;  1KQ1 A;  2JNG A;  2Y4X A;  4A4F A;  2QQB A;  3V7S A;  4X9D A;  3HL8 A;  4XU3 A;  2X35 A;  1QP2 A;  2RM4 A;  5LJ5 f;  5GAO r;  3RER A;  5GAN j;  4FSX A;  2RI5 A;  1IRE B;  3A8O B;  3DKM A;  4OB3 B;  3JCM d;  4CI0 C;  1NE8 A;  3RUX A;  3PMT A;  1S72 A;  2DXU A;  4FIB A;  4N0A C;  3G71 A;  3M5A A;  1KG1 A;  1Y96 A;  4V2S A;  2PQW A;  2WSE E;  4EMK A;  4IUP A;  4ZTF A;  4M78 D;  3A5Z B;  3G4S T;  3BY7 A;  2EAY A;  3M57 A;  3OSV A;  1VQO T;  3DLM A;  4M75 A;  4RKU E;  2CS7 A;  2MF2 A;  5A0L A;  1M5Q 1;  3JAM E;  5LJ3 d;  2ZPI B;  4O5V A;  1UGP B;  4QQG A;  4JLG A;  3X28 B;  4ELZ C;  3CEY A;  2XHC A;  4LDV A;  1M1F A;  1OYX A;  2DTI A;  3L1A A;  3QG1 A;  1N9S A;  3CPW S;  3OYE A;  4XTV A;  3CCM T;  1YHQ A;  2KMT A;  1VQ7 T;  4C8Q B;  1Y96 B;  3CC7 A;  2QQS A;  1I4K 1;  4QVC A;  4EMK B;  2JTM A;  1H64 1;  1HK9 A;  4F7U E;  3OYH A;  3PIP A;  3OYI A;  2JN0 A;  1Q7Y U;  1VQ9 A;  5LJ3 f;  4C92 G;  5GAO q;  4M75 B;  4MZP A;  3SFM A;  2WSC E;  4DOW A;  3FC3 A;  4N4H A;  2PVD B;  4JLI A;  3OS2 A;  4BE1 A;  2XDP A;  2DZ9 A;  2L8D A;  2KQW A;  2JUF A;  4Y91 A;  5CK9 A;  3RMQ A;  2EWN A;  2RJC A;  1YBY A;  5FU7 C;  1FX7 A;  3PT9 A;  1BI0 A;  3KUF A;  3M9Q A;  4A4K A;  5KH6 A;  4HCC A;  5CKD A;  2AHJ B;  1B34 B;  4JS5 A;  1W4S A;  1VIE A;  4C0D B;  2ZPG B;  4IUT A;  3MO8 A;  2OAU A;  2CZ7 B;  3OMG A;  3VJP A;  4C5G A;  5LJ3 e;  1QVG A;  4C8Q A;  2HQE A;  2LNV A;  4BE2 A;  3S3N A;  1YI2 A;  4N0A A;  5I21 A;  1VQP T;  3TEE A;  5GAN d;  5GAN f;  2P0P A;  3O8V A;  4EMK C;  3CD6 A;  3JCM X;  3CCQ T;  1H3Z A;  2RK2 A;  1I8F A;  4BY6 B;  3RES A;  3X20 B;  5KCO A;  5DM7 R;  3PTA A;  3G71 T;  5GAN 3;  4XTZ A;  4E7J A;  1M8V A;  4RG8 A;  4IUU A;  4R55 A;  4E7H A;  2E6Z A;  3C95 A;  1M90 C;  3I55 A;  5FRN A;  4XTY A;  1QVF S;  1JRI A;  3PFS A;  1G3T A;  3CCV A;  5LJ5 d;  3ASK A;  3GF5 A;  1B34 A;  3E9F A;  1XTD A;  2VXF A;  2ZPF B;  3MP8 A;  2QQR A;  3OYA A;  1QVP A;  2Y4Y A;  5LL6 S;  3CMA T;  3QJY A;  4LD9 K;  2EJG A;  3JCM Q;  1VQ4 T;  2RJE A;  4XU1 A;  2ZGW A;  3CCU T;  1VQ8 T;  3S6W A;  3X26 B;  4M7A F;  4IUQ A;  1VQK A;  1NPP A;  1S72 T;  2LCC A;  5A0G A;  2D0Q B;  3GOX A;  1X75 C;  1UGR B;  5CCA A;  1BYM A;  5IT9 E;  2RHX A;  4JRP A;  4M77 A;  3CBO A;  2A3L A;  3VUZ A;  1LOJ A;  2B8A A;  4M7D A;  1JBM A;  3SDZ A;  3BFM A;  5GAN 6;  4C5I A;  3CCM A;  1UEB A;  1YHQ T;  4JUV A;  3OYJ A;  1K9M C;  1Q81 C;  1M4Z A;  2A7Y A;  4M78 C;  3I56 T;  3CCJ T;  2K5L A;  3QBY A;  1UGQ B;  2GQV A;  2PUO B;  2QEX T;  1YJW T;  1BIA A;  2DTO A;  2P0K A;  4LDW A;  5CKF A;  5J39 A;  5GAM g;  3OYB A;  4RCB A;  3MP6 A;  4J6Y A;  4C92 D;  3JCM f;  1M9S A;  4E7K A;  1PSE A;  4PJO D;  4M77 B;  2QDY B;  3ME9 A;  2WAC A;  4C8Q C;  4RMO A;  2O01 E;  4LD6 A;  3VYH B;  5CR2 A;  1VQ5 T;  4M7D B;  4C8Q F;  4M77 F;  4A53 A;  2M16 A;  1W2B S;  1V29 B;  4QW2 A;  3NTH A;  4M77 D;  2M0O A;  5M9O A;  1YJ9 A;  1PSF A;  1DJ7 B;  4L5G A;  3V7R A;  2DTH A;  2HAX A;  1LNX A;  5GMK i;  1NPR A;  4ZN1 A;  1N8R U;  3HKS A;  2E12 A;  3PNW C;  4C92 F;  3M58 A;  4QVZ A;  2DXT A;  3JCM P;  5CVI A;  4XAX B;  1WNL A;  2D6F A;  3JB9 J;  5GAO p;  1G5V A;  4R56 A;  1VQ8 A;  1M90 U;  3HRU A;  2LTO A;  3CC4 T;  2RD1 A;  2Y90 A;  3FEO A;  4B9X A;  5CAI A;  1WJR A;  2HBP A;  2RHY A;  5GMK l;  3JCM W;  1GXI E;  2O4X B;  3T9N A;  3QO3 A;  5CQX A;  2GFA A;  4C0D C;  3ZBD A;  2CZ6 B;  2YLB A;  3CC2 A;  2RO0 A;  3CD6 T;  4M75 E;  3VYG A;  2RHU A;  3HRS A;  3L2R A;  2VYT A;  4BDY A;  1JJ2 A;  1I81 A;  4M7D G;  3LWH A;  2QTX A;  1WGS A;  4GLK A;  2VGN A;  3M59 A;  4GY5 A;  1YCY A;  3M55 A;  4JRK A;  4MMK A;  4BI8 B;  3CCS T;  3CXC S;  1YIJ A;  1N6A A;  4F7U F;  3JCM e;  2OTL A;  1I5L A;  3CCR A;  1G3W A;  2I2L A;  4EPC A;  2OTL T;  5C0M A;  3HRT A;  2DXB A;  4M78 F;  2CGH A;  4Q5W A;  4FM4 B;  1WPY A;  4J7F A;  2MWO A;  2ZPE B;  3OYG A;  3CCU A;  2LCL A;  2O4X A;  3TRE A;  4OF1 A;  3JSC A;  4OB0 B;  5KCH A;  1VQL A;  4M78 E;  3I56 A;  4N4G A;  2K5I A;  1Y71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...