2DIQA

Solution structure of the tudor domain of tudor and kh domain containing protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
GSSGSSGRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tudor and KH domain-containing protein
publication title Solution structure of the TUDOR domain of Tudor and KH domain containing protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 17
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2006-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2diqA01
3M9QA 2L89A 2MWPA 5KH6A 2EQUA 3MEAA 3SD4A 3QKJA 4BDZA 3OYHA 5CIUA 5KE3A 3OA6A 2X4WA 2RHYA 3FDRA 4PLIA 5IN1A 3UT1A 5D6WA 2HQEA 3E9GA 3LX7A 4A4GA 5C0MA 2RJDA 2LRQA 2XDPA 3FEOA 2JTFA 2LVMA 3LH0A 3E9FA 2EQJA 3CEYA 3DB3A 3META 5KCOA 2EQMA 3OS2A 4RG2A 5FRNA 2VYTA 3C4SA 3DLMA 2RHXA 4Q5WA 3H8ZA 3QJ6A 3LYIA 2G3RA 3MP8A 1WJSA 2QQSA 5M9OA 3QIIA 4IUUA 4Z02A 3OYEA 4E7LA 3OYJA 3PNWC 3P8HA 2R5AA 3NTIA 3OYLA 3OYNA 3OYFA 3OS0A 5D6YA 1WJQA 2BIVA 5IAYA 2IG0A 3MO8A 4B9WA 4N4GA 2QQRA 3OYBA 2O4XA 2RI3A 3MP6A 4HCZA 3OB9A 5KE2A 4N4HA 4NS5A 4A4HA 2MWOA 3S3NA 3OYAA 2F5KA 5FROA 5FRMA 2LTOA 4UC4A 4A4FA 4BDYA 1G5VA 2CKKA 2K3XA 3MEWA 3OMGA 3FC3A 2R58A 4ZTJA 3H6ZA 2EFIA 4BE1A 3BDLA 2M1HA 2NLUA 3S3OA 2XK0A 4E7JA 2JZ2A 2RI5A 2GFAA 2PQWA 2RJCA 3F70A 3OQ5A 3P8DA 3OYKA 2B8AA 3S3MA 1MHNA 3PFSA 3L2WA 4BACA 4FL6A 3ZEHA 3LGFA 4IUPA 2P0KA 4QVZA 2L3RA 1OZ3A 4IUQA 2R5MA 3L42A 4A4EA 2M16A 3NTKA 3PMIA 3OYGA 4BE2A 2O4XB 5J26A 4II1A 3KUFA 4C5HA 1OI1A 4IUVA 2WACA 4QQGA 3O8VA 2K3YA 2EKOA 2GF7A 2R57A 4QQDA 4BD3A 1H3ZA 5J39A 4IUTA 2BKDN 5C6SA 2M0OA 4CRIA 2RI2A 2FHDA 1KHCA 3PMTA 4OVAA 4QW2A 1OYXA 1XNIA 1OZ2A 2D9TA 3L2VA 3OS1A 4PLLA 2RHIA 3OYDA 1N27A 4EDUA 2X35A 4ZTFA 3OYIA 2EQKA 4PL6A 3S6WA 2BUDA 4E7KA 3NTHA 3OY9A 2L8DA 2YRVA 2GFUA 1SSFA 1WJRA 3MP1A 2DAQA 2RHUA 5KCHA 3L2RA 3GOXA 2RJEA 4LD6A 3OMCA 4BE0A 3QBYA 2E5QA 2X4YA 2HQXA 2RO0A 4X34A 2DIQA 4E7IA 4C5IA 3FLGA 4FU6A 3EAEA 2DIGA 4QQ6A 3L2QA 4GY5A 3MEVA 2RHZA 2RJFA 3Q1JA 3OYMA 5D6XA 1WGSA 3OYCA 4E7HA 4N4IA 3ASKA 4C5EA 2LDMA 4IURA 3DB4A 4B9XA 3LLRA 2E6NA 2LCCA 1RI0A 4C5GA 3L2UA 3UWNA 3ME9A 3MEUA 3LGLA 4IKFA 4L59A 2X4XA
chains in the Genus database with same CATH superfamily
1QVGA 2L89A 3ULRB 1DJ7B 4M7DB 4TVRA 3QWYA 1QP3A 2D8HA 1VQLT 4OB2B 3CQTA 1WXUA 2EQJA 2WSFE 6AT1B 3PE0A 3T9NA 1M90U 3CCLQ 2W0ZA 4KBMB 4AFSC 4BI4A 3CC7A 2EVRA 2K2VA 3JB9F 2VKNA 3HTRA 2FG0A 2EGEA 2DXUA 1BB9A 2BZ8A 2GTJA 5KE2A 3O5ZA 2M02A 1R8OB 3C0CA 4Z88A 4M77E 3JAME 7AT1B 1JB0E 4ZGDB 3JB9D 2CP5A 2PVDB 1N9RA 3VS4A 1YJNQ 3F70A 1BCMA 5LJ3j 1Q95G 1UUEA 4A4KA 3I55T 4FL6A 2KE9A 2CDTA 2DKGA 1Q81C 4HVUA 1CSKA 1R0BG 3M54A 1BK2A 3O8VA 1BYMA 1AWWA 1K4US 4QQDA 4Y28E 2LCSA 1NZ9A 1U1SA 3GNFB 2DA9A 3OW2A 1SHFA 1VQ6Q 5HKCA 2EYWA 4PLLA 2RN8A 3FB9A 4EMGA 1YWPA 2V1QA 2EPDA 2CYZB 3CD6T 2QEXA 4M77B 5GAOr 1PRMC 1QCOA 2J6KA 3QBYA 3CC2T 4WF2A 2FZCB 2E10A 2V8JA 4C92F 4NL2A 1HXDA 4RTUA 1K73C 3G4SA 3CCMT 4J9DA 3ER0A 1ZBXA 5FLXE 1UHCA 2YHTA 3OSVA 1E6HA 1OPLA 3LLRA 3CCJQ 4J9HA 3CPFA 3ZBDA 5KH6A 3J80E 2D1XA 2KXCA 3CBMA 5C0MA 1NJIU 3LW5E 1W2BS 2QQBA 4RTWA 3CCLT 2VYTA 4FSSA 4LDXA 3A8HB 1ZBJA 2P84A 2KBTA 4HVWA 2QA4T 2DD4A 1G8XA 3I56A 2G3RA 1WPYA 2XMFA 1LPLA 1IHVA 4L6V5 2DTOA 5GAN6 2LZ6B 2IVWA 5ECAA 2QQRA 4FYXB 4FCYA 4M7AF 1RAEB 2EYQA 4NS5A 2MYSA 2WSEE 2ZCFB 4KGZB 4A53A 4XTWA 3TSZA 1KK7A 1QKXA 2NLUA 1M4ZA 4F04B 2DVJA 1UECA 4OMQA 4JLGA 4M7AD 1WHJA 3JCMd 1N8RC 1OPKA 3VUBA 3L42A 4BE2A 3VS0A 4LUEA 3JCMJ 3SWNA 4C5HA 2EKHA 3CBPA 1BKBA 4CRIA 1SRMA 4J9BA 2O88A 1VQLA 3PMTA 5HCKA 2EJFA 2XI9A 2RHIA 4HT9A 4HXJA 3M4YA 3UF4A 1PSFA 4AT1B 2PZ1A 3E2UA 4RTYA 1WJRA 3FJ5A 1VYVA 3M4GA 2K5LA 2Y4XA 5GAOl 1BU1A 2RO0A 4A63B 4C5IA 4AFQC 1SHGA 3L2ZA 3A8GB 2QTXA 3OYCA 3ZL7C 2DVEA 2OTJQ 2LDMA 4ZGJB 5KYUA 5AT1B 4EMKC 3SHWA 2X4XA 1M30A 4J7FA 4RTZA 2ZAEA 3I55A 5CIUA 2RPNA 1I07A 5IN1A 1M1KU 4X1VA 3QJYA 8AT1B 3PVQA 2XIDA 3QG1A 3H8ZA 1M90C 3OYLA 2COZA 4YTLA 3WXMB 3CCVT 5GANe 3MP6A 5EG2A 1JO8A 2M0YA 5I2MA 1VQOQ 1JBMA 3TEEA 3CD6A 4C0DC 2F5KA 1Y0MA 4BDYA 1X6GA 1G5VA 5KYXA 3CC2A 3QPHA 3EFSA 1NM7A 3A1PA 3MJXA 4D8KA 1KIKA 5I21A 1VQPQ 2JZ2A 3VV0A 2KAFA 2LMJA 3CCMA 1PC0A 3JB9H 3OQ5A 3PFSA 3CXCP 1H8KA 3EGXA 3NGPA 3EG3A 4OF1A 2JMAA 3TU4K 1KQSP 1OI1A 1QVFA 2K3YA 4JJDA 4M78D 1SPKA 3BY7A 2JM9A 2ED1A 1OYXA 1FX7A 2D9TA 4LN2A 2A28A 2AT1B 4FW2A 2QA4A 1BBZA 3OY9A 2L8DA 4PJOF 4LD6A 3QWXX 2IPOB 5LJ3d 1QKWA 2X4YA 1UDLA 5GANg 2DIQA 2RH2A 2KT8A 3L2QA 2KRMA 2A37A 2C0TA 3C12A 2J05A 4N4IA 1G2BA 4DEYA 4JRPA 1NPPA 3CC7Q 4PJOD 3CPWP 2QGFB 4RCBA 2D6FA 3PGGA 2NUTA 1WA7A 1WNLA 2ENMA 3M9QA 3HL8A 1WHMA 5I22A 3QZ9B 1SRLA 1M2VA 1IREB 2GQVA 3OS2A 4KGXB 2DL4A 3RNJA 2A0FB 2GTOA 3A8MB 1NJIC 1E7OA 1GBRA 5KYUB 2KI7A 5FU6B 3MP8A 1WJSA 2P4RA 1MNDA 4Z02A 2C0OA 1YJWT 4J9FA 1VQ7T 1ZUYA 2I0NA 3JV3A 2F5TX 2BIVA 5IAYA 2KXDA 1AWJA 2GGRA 3JCMh 5GMKh 2CKKA 4E2FB 3OMGA 4ZTJA 2R58A 1VQPT 1FMWA 2D0QB 4KUIA 5FU7C 3V7RA 2VV5A 2YRDA 2DL5A 4ESRA 2AKKA 1VIFA 3CMEA 3LGFA 3X24B 2CP7A 4A4EA 1ZSZA 3V7SA 1W70A 5GAN3 3EFOA 1VA7A 3OW2S 1PWTA 1NYFA 1UE9A 2DMOA 3AHUA 5KYXB 4JRIA 3G4SQ 2DFUA 1TUCA 2JMCA 1R0CB 2JS0A 4OVAA 3X28B 5GAMg 3OYDA 1LOJA 2QASA 1Y07A 4OB1B 1VQKT 3RR6A 1Y7XA 3BW1A 1YHQT 4E7KA 4DBHA 4ZN3A 3HPWA 4ZN1A 3CCVA 1Q7YR 3I5SA 1JQQA 1WGSA 4M75A 2JUFA 2MCNA 3CC7T 1WXTA 3UATA 2DTIA 3DB4A 4XTUA 2ZGWA 4XTVA 3PT9A 5CKDA 3SD4A 3M53A 2FL7A 1HYOA 2AZVA 2RHYA 1AHJB 4FIBA 5D6WA 2VXFA 3LX7A 1VQ9T 1VQMA 3CBOA 1EZZB 2C0IA 3GLXA 5KCOA 2CS7A 2J06A 1M1KC 3C4SA 4M7DF 4PNOA 4LDWA 2JM8A 3OYEA 2RMOA 1I8FA 4IUUA 5M9OA 2HCKA 3H0IA 3OYJA 4E7LA 2NUTB 2PUOB 2IG0A 2DL8A 1TOVA 1W4SA 2KY9A 1JEGA 1E6GA 4M7DD 1F1BB 2LTOA 2RNAA 1FMKA 4HCCA 1VQLQ 2RQRA 3CCST 4ELZC 5KYWA 1ZA1B 2RJCA 2HNIA 1OU9A 2QEXT 1LJOA 3L2WA 4BACA 2OTLA 4QVZA 3M0SA 2X9HA 4OMLA 3UDCA 1UTIA 2EJGA 3I9QA 3KXTA 3E19A 2HL3A 4JDSA 3EHQA 5C6SA 1W6XA 4LNPA 5GAN4 2EYXA 2HBPA 4PFOA 1N9SA 1OZ2A 2EBPA 5LJ3h 2COYA 2V1RA 3VS6A 1ZA2B 4EDUA 5GAN2 3JCMV 4RG8A 2QDYB 3EFOB 3I55Q 1YJWA 1B7TA 1VQ7A 4FSXA 4X34A 2CZ0B 2A08A 1KFZA 3EAEA 4C8QA 1D1CA 4J83A 4C0DB 2X3XD 1KC8R 3DLLA 4M77F 3I56T 4XTYA 1BI1A 3PVLA 1UGVA 4C5EA 3REAB 2DERA 4OB0B 2AIRB 8ATCB 4L59A 2D0NA 5CKFA 3OYHA 3HSBA 2X4WA 3CD6Q 4AFZC 4A54A 1RAIB 1RAAB 4JJCA 4OGEA 1T3LA 3CC2Q 2AHJB 4M75B 3EG1A 1UJ0A 4O5VA 5CVIA 4Q5WA 3CCMQ 4F7UA 4BI8B 1T0JA 3JCMb 1M8MA 2R5AA 1YJ9A 1KQ2A 5IT9E 3H0HA 4CC2A 1VQKA 1X6OA 2FPEA 3OB9A 1YHQA 2EQIA 1TH7A 1EX4A 1PSEA 4QT7A 2P0QA 3M55A 3MCAB 1JRIA 2O9VA 5FROA 1Q82R 1QCNA 4LDVA 1XQHA 1I5LA 1GFCA 3EGDA 5EC7A 2NUZA 1M8VA 3S3MA 2O01E 3SWNC 1VOMA 1V76A 2JJ9A 2FZKB 5GAMh 2QA4Q 4JUVA 4IUQA 3CCQA 2DEQA 1W2BP 3M56A 1K0SA 2ED0A 3A8OB 2F2XA 2WACA 1X75C 2FRWA 2AK5A 1VQ5A 3QDFA 5KYWB 1VQ9A 3NHNA 4MDXA 3OBYA 3SB2A 1P92A 4ATOA 3EGUA 3DKMA 3NTHA 3M57A 3JCMW 1O75A 2LQ8A 3VS5A 2G6FX 1IGUA 3JCMc 4AMCA 3FLGA 4C0GA 2DIGA 5CQXA 3CXCA 5GANj 1Q81R 4HVVA 1QVPA 1BCOA 3VU3C 5FU6C 2OAWA 2E3HA 1U1TA 1X43A 2LC4A 1KQSA 2FRYA 1WHLA 1KHIA 5FU7B 3TCJA 1QP2A 2LCCA 3CCSA 4P5NA 2MWPA 1TUGB 2LJ3A 2H8HA 1K9MC 3E9GA 2GBQA 2LRQA 2CUDA 2ZPGB 4HKEA 1GXIE 3LH0A 2F2WA 3DB3A 3G7ZA 2PU9B 2RHXA 2DD5A 2DL3A 1QLYA 1D0YA 3CMEQ 2CUBA 4ME7A 4M4ZA 2XHCA 4FW1A 4DOWA 2BTTA 3OS0A 4C92D 5GMKe 3OYBA 2CT4A 3R6NA 2MMPA 2A7YA 2QXFA 3CPWA 4JJBA 2K3XA 2L3PA 3G6EA 4OP0A 3TREA 2XK0A 4DQ2A 1RAFB 2XDDA 4M78C 2RQWA 1M27C 2MPXC 1RL2A 2P0KA 3HKSA 3OSSC 3CCET 1UG1A 3JSCA 4GLKA 3CMAT 2ZZDA 3VRYA 5J3BA 3CCVQ 4CC7A 2YUOA 3EGDB 4F16A 2QDLA 1TUDA 4KGVB 4M7AA 2IIMA 3UA7A 1N27A 3OYIA 3HFNA 4JS5A 4J6YA 1KSWA 1B07A 3MP1A 2GFUA 3HRSA 4XU0A 3HFOA 1UB4A 3JCMg 4XAXB 1D3BA 1VQMQ 3OYYA 1YI2T 1N8RR 3MEVA 2K9GA 2YDLA 1Y71A 2RJFA 2KMTA 3N5BB 1YCYA 2E5KA 1QQJA 1QMCA 5HY6A 2DL7A 2PTKA 4IURA 4B9XA 3PIPA 2E6NA 4Y92A 1UGRB 1A0NB 2RM4A 4OMNA 2Z0WA 5GAOq 2KRNA 4D8DA 4RTTA 4OMMA 1GRIA 3FDRA 1BIAA 2RJDA 2LQWA 3FEOA 2JTFA 3SFMA 1RADB 5GANf 3EG9A 1AOJA 1VIEA 1M5Q1 2K5IA 4RG2A 1JXOA 2LP5A 1G3TA 1Q7YU 3CMET 1PM3A 1K8AC 1AZEA 2PVGB 1WZOA 4F14A 3PNWC 2OTLQ 2E41A 3JB9J 1RUWA 2LX9A 2O4XA 2EJ9A 3S3NA 3X25B 1WHHA 2GCXA 3LWIA 5CCAA 4DBRA 3H6ZA 3UPUA 2CT3A 2M1HA 5KYYA 2KEAA 3M0RA 1PD0A 5GJVB 5GAOm 1ZSZC 5LJ5d 2FPDA 1MGQA 2M16A 5LJ5g 1YJWQ 2VXEA 1VQ7Q 2ROTA 3A5ZB 4MZPA 2YUNA 4J8OA 2K5FA 2M0OA 1OQKA 2CGHA 1VQ4A 5I11A 1MNEA 2DBMA 5CKHA 4PFZA 1EFNA 2VUBA 3EH1A 4M78A 1VQMT 3CCRT 2GQIA 2RD1A 4LDYA 2CP0A 2MI6A 4E7IA 2ROLA 1KJWA 3JCMQ 4M75C 2BZYA 5IXBA 1Q86R 1VUBA 5D6XA 4BB7A 5A0LA 4C0FA 3VKIA 2SRCA 4RKUE 3UWNA 3OW2P 5GAMf 2XU8A 1YJ9Q 2JTMA 4M78G 2YRCA 3SWNB 1VQKQ 3V8JA 3G1JA 3QKJA 4N0AC 4PKCC 1WDXA 1YHQQ 1QWFA 2KK4A 5HK3A 2XICA 1D3BB 3CCEA 3CMAA 5LJ3g 2CP3A 4PJOA 1D09B 3E1SA 1PNJA 1WX6A 3VS1A 2V8IA 2OTLT 1M2OA 1KC8U 4JLIA 1QVGS 2FZGB 2YLCA 2RF0A 3CCQQ 3OYNA 5GAN7 3VS2A 4HA8A 4F17A 1NEGA 2CSIA 5CAIA 5FRMA 1C1AA 3THKA 4B6MA 4LUDA 3G71T 2L3QA 3BDUA 1VQ5Q 5GJWB 2DYIA 2ABLA 1VQ9Q 5GAMe 1NLOC 3GNGA 1U3OA 1YI2A 1IB8A 2KYMA 1WYXA 2OAUA 3INZA 2ZPHB 1SSHA 4JRKA 4HCKA 2EAYA 3TVTA 2ZPEB 5A0GA 4FT4A 1NJIR 1M3AA 2O4XB 2V8KA 2DETA 1Z9QA 1X69A 1G3WA 1WLPB 3EG2A 4BD3A 1WQWA 4M78E 3GF5A 1U06A 3RKWA 1FWZA 1YP5A 1Q82U 2L0AA 1ZQ1A 4ZTFA 2HBWA 3VRZA 3CCSQ 2CREA 3S6WA 1RABB 2BUDA 2QEXQ 3RUXA 4BE0A 3CXCS 4C8QC 1JJ2P 2HQXA 3C94A 4GY5A 4GLMA 2DRKA 1KQSS 2RHZA 3MPUB 2DEUA 1W2BA 3PTAA 4LE9A 1YJ9T 4O6JA 3URGA 1YCSB 4C5GA 1CKAA 4KULA 1IXDA 3EGXB 3LGLA 5KCHA 1ACMB 1XOVA 4M78B 4MMKA 3SEMA 2DTHA 3RMSA 2JTEA 4BDZA 1NYGA 1TU0B 1X01A 3OA6A 2FB7A 2E3IA 2PUKB 1JXMA 2HSPA 2P0PA 3QXEB 3G6EQ 1K9AA 4D6WA 4ORZA 1AT1B 1Q81U 1V1CA 4HCBA 3CCQT 3I56Q 1YITT 4ZNXA 4V2SA 3LH5A 1AEYA 4QKUA 2PNIA 5GAOp 1S72T 4KRTA 2ZPIB 1VQ5T 2YSQA 5LJ5h 1T0HA 4LXCA 4N0AA 1KD1R 3CCRA 4M75G 3GBQA 5D7UA 2BE7D 2YWWA 3QSUA 1VQ8T 2ECZA 5IHIA 1RACB 3TSWA 5GMKi 3L2RA 2AZSA 4JS4A 2CZ6B 4M7DA 2JS2A 4Y91A 4IUVA 4QQGA 2KDSA 1M2VB 2R57A 1PRLC 1H92A 2BKDN 1WHGA 1H641 3X26B 3LWHA 1PKSA 2LJ1A 1JU5C 3L2VA 2ZPBB 2LCLA 2WSCE 1HK9A 4JZ4A 4J5YA 4OMFB 4PL6A 2MK5A 1SKUB 2YRVA 1UHFA 2DYBA 1VYTA 3H0FA 1MMAA 1TXQA 1X2KA 3OMCA 3QYGB 2QK0A 3JRZA 2E5QA 2NWMA 2DZ9A 5GAOn 4Z89A 5GMKj 1UGSB 3Q1JA 3OYMA 2KVQG 3BFMA 1FXXA 3G71A 2Y90A 4FYYB 3RESA 3ASKA 4J9CA 3L2UA 3EH2A 2X51A 4M75E 4IKFA 1I0CA 5CK9A 2LNVA 4K11A 1ZSZB 4PLIA 3NFCA 4EIKA 1K76A 3G6ET 1W1FA 5DY9A 3QO3A 1D0ZA 3VS3A 2A3LA 3REBB 4C92C 4VUBA 5DM7R 3FIFA 1RLPC 2X4JA 3V8KA 1N8RU 3RMQA 3LYIA 2E70A 2QQSA 2O31A 3QIIA 4XU1A 4RMOA 1ZX6A 3NTIA 1KC8C 2DBKA 1MMGA 4N4GA 3MKDA 4B9WA 3ZFJA 1NEBA 2DM1A 5GMKl 1VQOA 2XDBA 4C8QG 2QAZA 3OYAA 4DOVA 4M77D 2JVVA 1C0MA 1KG1A 4XQ3A 3X20B 5IHKA 4R56A 2B8AA 4XTXA 3FRNA 4JZ3A 1I81A 2BZXA 1YBYA 1BI3A 1OEBA 2K6DA 4PJNA 2DXBA 1I4K1 3JB9I 1YIJT 1BIBA 2LQKA 4LDUA 3BE3A 1TWBA 1N6AA 2LT1A 1LCKA 4BY6C 4M7AC 1YNZA 2LNHB 1KHCA 2QQ9A 3CC4A 1XNIA 4F7UG 3OS1A 1I5OB 1Q82C 2YT6A 5L23A 3OS5A 1QVFS 4OB3B 1YITA 1D1AA 4J6XA 5CKBA 5CR2A 1Y57A 3CCEQ 1NPRA 1R77A 3VJPA 2MF2A 4QQ6A 4DBQA 2KSSA 3CMAQ 5A0DA 1S72A 3C95A 4C8QE 4XK8E 2F2VA 4IIOA 1ZLMA 2RK2A 1WI7A 4PFPA 1VQ8A 3ME9A 2QYZA 1UJYA 2FO0A 3QUIA 4XU2A 2KYBA 3A8LB 1B34A 4EPCA 3JB9G 1PHTA 1GCPA 2DPPB 4BUGA 4X9CA 4MZMA 3JCMf 3CEYA 5FRNA 3DLMA 3EHRA 1YI2Q 1OX9A 2JXBA 3QJ6A 1Q86U 2ESWA 4QVDA 5AYFA 2PVOB 1XJWB 2MIOA 1PKTA 5D6YA 1QWEA 4F7UE 2ATCB 2SEMA 2HZYA 2HMAA 3V7CA 1VQ4T 4QVCA 2NYSA 4NOYA 4C8QB 1SG5A 3BDLA 4CC3A 3I5RA 3MHXA 1K9MR 4C92A 4GBQA 1UGQB 1C6VX 1K73R 2AKLA 4X9DA 2HEQA 3PMIA 4J9IA 2C06A 1AVZC 5J26A 3KUFA 3JCMe 1K0XA 2RQVA 4IIMA 1O9SA 1NBEB 2EKOA 1FYNA 1H3HA 2KNBB 4ANJA 1OOTA 3VS7A 2K3BA 3M59A 1G3SA 4WCIA 4HT8A 4C92G 2COWA 4F7UB 2X35A 2EQKA 1FMVA 4MDWA 3AT1B 4E47A 2RHUA 1NG2A 3OBWA 2DNUA 3VUZA 3CCUA 2VVKA 1GCQC 1LVKA 4E6RA 2VASA 4FU6A 5LJ5f 1I1JA 2VGMA 2NUPA 2D8JA 2XD0A 3NMZC 3RKXA 5IHNA 1AWXA 3M0QA 4R55A 4J9EA 5CKEA 3RKYA 3I35A 4R0KA 1RAGB 5GAMj 4J6WA 4OMPA 4NL3A 1PCXA 2YUQA 2VB6A 4L5GA 2HQEA 2FVUA 4A4GA 2F1LA 4PJOC 1NE8A 2OX7A 1YIJA 3CCRQ 1YJNT 2B86A 3E9FA 1M3CA 4M7AG 5I2SA 1ZUUA 2E4HA 1VQNA 1JJ2A 4AG1C 2P4TA 3L1AA 2EGAA 3RDVA 4Z8AA 4C92E 5LJ5e 3MO8A 1B34B 3H9NA 1BI2A 1VQ6T 4UC4A 4E7SA 3MEWA 1RAHB 3PIOA 3FC3A 2YLBA 1HSQA 2K79A 1M3BA 3TQ7P 5LJ3f 1AD5A 2RI5A 2PQWA 3P8DA 3RIRA 1MHNA 1SEMA 3JCMP 2HL5C 1X27A 4IUPA 4FM4B 2ZPFB 3NTKA 2JN0A 2XG8D 1ZSGA 1MUZA 1K8AR 2KQWA 2YXYA 4RUGA 1Y96A 1M1GA 1X6BA 1KQ1A 1SF9A 1QVGP 2DZCA 2EYYA 3QHSA 2K7AA 2FHDA 2LQNA 2RI2A 3CCJT 3G71Q 2O9SA 1HJDA 1KD1U 4C92B 1OULA 2CZ7B 5HK0A 3QZ5B 2EYZA 4M7AE 1UGPB 1AWOA 1SSFA 2DAQA 2CZ1B 2RA2A 1G83A 5LJ3e 1M90R 1QCFA 2DE0X 2M9UA 2KGTA 1IO6A 1UFFA 2E65A 3R6OA 4FYVB 2KROA 2OI3A 4J9GA 2CH4A 4WTOB 1YFNA 1Z9ZA 1UEBA 1ZUKA 2DRMA 2VC8A 1GFDA 1WIEA 2RQTA 5DLQE 4DA4A 2DX1A 4EMHA 1YN8A 3A98A 2L3SA 2NUPB 1GCQA 1WHKA 1AZGB 3KBGA 2J7IA 4BY6B 1V29B 4M78F 4M7AB 3HRTA 1Q86C 3OYFA 1LNXA 3UA6A 4N4HA 3WVDB 2K2MA 4A4HA 5KYNA 1QW1A 4KT0E 4ZGEB 4KH0B 4RTVA 3CC4Q 2EFIA 1U5SA 3D7SB 2E12A 3CCLA 3HRUA 4M7DC 4OMOA 1XTDA 4KH1B 5GANd 1OZ3A 2R5MA 4BI3A 1J3TA 2H3JA 3J81E 4II1A 4FYWB 1YITQ 4PJLA 2K4YA 4MZTA 2GNCA 3VYHB 1H3ZA 3IQLA 2QI2A 4IUTA 4PJOG 1S72Q 3EG9B 2OTJT 2RQUA 2CH4W 4QW2A 2JNGA 1PD1A 1YJNA 1RI9A 1IGQA 2HD0A 3GP8A 1VQ8Q 3WVEB 2CP2A 2QG9B 5IXFA 2KR3A 4AG2C 2A36A 4KUDK 2QQAA 1Y96B 2BE9B 1OV3A 2W10A 3GPLA 2FYKA 2OJ2A 4DBFA 1S1NA 2EWNA 2FPFA 1VQ6A 1EIFA 5KYYB 3QDRB 1RLQC 4ELYC 2F69A 1RI0A 2LX7A 3MEUA 3HP9A 1VQOT 4EMKA 3MEAA 2JT4A 2FEIA 4XTZA 2EW3A 5KE3A 4C0ZA 1TS9A 2LVMA 1BI0A 1OU8A 2DXCA 5A2QE 2EGCA 1ARKA 3CCJA 4M77C 2DILA 4PJOE 5L8RE 2I2LA 3U23A 3RBBB 2XKOC 9ATCB 3J7AF 4HCZA 2RK1A 3HHTB 2HDAA 1ABOA 2MWOA 2QGGA 2M51A 3CC4T 4A4FA 5GAMd 2E1HA 4DEXA 5GAN8 2QTVA 3OYKA 1Q7YC 4CC4B 3CCUQ 4M75F 1T3SA 2KRSA 2MAMA 3CPWS 1NLPC 5CQYA 3M5AA 2DO3A 5IH2A 4PJOB 2KT1A 2H3EB 3FJPA 1MMNA 2DXTA 4M75D 1KD1C 1ZHIA 2E6ZA 1K9MU 3EG0A 2RJEA 1M1KR 2DF6A 3EFRA 1K73U 3RERA 1TTHB 1PG5B 3NPFA 4PJJA 1N5ZA 1YIJQ 1D1BA 4OGCA 1M1FA 1VQNQ 1IZ6A 2X3WD 2YUPA 3M0TA 3QYHB 3V8LA 1WXBA 2JOYA 4JRQA 2RB6A 4PK4A 2DJZA 4M7DG 4MMLA 5DLOA 2EQUA 1D0XA 1IHWA 2LJ0A 3UT1A 2J6OA 2XDPA 5CO7A 3GIBA 2V26A 1VYUA 3META 1GBQA 1JJ2S 2EQMA 1QVFP 2MOXA 2OTJA 2Y4YA 1MMDA 3KFVA 1HD3A 4AFUC 3P8HA 4EMKB 1WJQA 1IRXA 1OX8A 2HKNA 3JCMX 2RI3A 1ABQA 2JW4A 2L2PA 2HSEB 2K57A 3G4ST 2J6FA 5LL6S 1X2QA 4JPBW 5GANh 4XU3A 5GAN5 4BE1A 2CSQA 2EIFA 3S3OA 3M0UA 2O2OA 4E7JA 2DK3A 2GFAA 2DLPA 2HQHA 2VGNA 4JJNK 2VWFA 4C8QF 3CCUT 3ZEHA 4FT2A 3P8BB 2L3RA 3VYGA 3OYGA 4CI0C 4M77A 2E64A 3SDZA 2HKQB 2GF7A 5FWCA 2CP6A 4J7IA 5J39A 3M0PA 4M7DE 1B3QA 2L5QA 1VQ4Q 4C8QD 4RTXA 1VQPA 4LD9K 1M9SA 1G3YA 2DJQA 5FW9A 1U8RA 4M77G 3H41A 3GOXA 1WQ7A 3M58A 1MV3A 1GL5A 1CKBA 4F7UF 2HAXA 1K1ZA 5LJ5j 1VQNT 1K8AU 1MV0B 1TSFA 4E7HA 4RCCA 4E7ZA 1YWOA 5FWBA 1WFWA 1TG0A 4PJMA 5GMKm 2LT4A
chains in the Genus database with same CATH topology
1QVGA 2L89A 1DJ7B 3SWNB 5CKDA 3SD4A 3V8JA 4M7DB 3QKJA 4N0AC 4PKCC 4TVRA 3M53A 2FL7A 4NL3A 1QP3A 2KK4A 5HK3A 2RHYA 1AHJB 2XICA 1D3BB 4FIBA 4L5GA 2HQEA 5D6WA 2FVUA 2VXFA 3LX7A 4A4GA 3CCEA 1VQ9T 1VQMA 4OB2B 1VQLT 1NE8A 4PJOC 3CBOA 1YIJA 3CMAA 1YJNT 5LJ3g 3GLXA 3E9FA 2EQJA 5KCOA 2CS7A 2WSFE 4M7AG 4PJOA 1M1KC 5I2SA 3C4SA 4M7DF 4PNOA 1VQNA 3E1SA 3T9NA 1M90U 4LDWA 2V8IA 1JJ2A 2OTLT 4BI4A 4KBMB 1KC8U 4JLIA 3CC7A 1QVGS 3OYEA 5M9OA 1I8FA 2K2VA 2P4TA 4IUUA 4E7LA 3OYJA 3JB9F 2YLCA 3L1AA 2DXUA 3OYNA 2PUOB 5GAN7 4C92E 5LJ5e 2IG0A 3MO8A 1B34B 5KE2A 4HA8A 1W4SA 1R8OB 2KY9A 1BI2A 5CAIA 5FRMA 4M7DD 4M77E 2LTOA 4UC4A 3JAME 3G71T 1VQ6T 3MEWA 3PIOA 3BDUA 3FC3A 2YLBA 3CCUT 1JB0E 4HCCA 4ZGDB 5GAMe 3JB9D 3CCST 4ELZC 3GNGA 1YI2A 5LJ3f 2PVDB 1N9RA 2RI5A 2PQWA 2RJCA 3F70A 2HNIA 3P8DA 3RIRA 5LJ3j 1MHNA 2OAUA 3INZA 3JCMP 2QEXT 1LJOA 2ZPHB 3L2WA 4BACA 4A4KA 3I55T 4FL6A 4JRKA 2OTLA 4IUPA 2EAYA 4QVZA 4FM4B 2ZPFB 2DKGA 1Q81C 2ZPEB 3NTKA 5A0GA 2JN0A 2XG8D 2O4XB 2V8KA 4FT4A 3UDCA 3M54A 2KQWA 1G3WA 3O8VA 2EJGA 1BYMA 4QQDA 1Y96A 4BD3A 4Y28E 3KXTA 1M1GA 1WQWA 3E19A 1NZ9A 4M78E 4JDSA 5C6SA 1U1SA 1KQ1A 3GF5A 3GNFB 3RKWA 2DZCA 3OW2A 3QHSA 5GAN4 1FWZA 2FHDA 2RI2A 2HBPA 3CCJT 1Q82U 1N9SA 5HKCA 1OZ2A 5LJ3h 4PLLA 1KD1U 4C92B 3FB9A 4EDUA 5GAN2 1ZQ1A 2CZ7B 4EMGA 5HK0A 3JCMV 4ZTFA 3QZ5B 4RG8A 3S6WA 2BUDA 2CYZB 4M7AE 1UGPB 3CD6T 1SSFA 4M77B 2QEXA 2DAQA 5GAOr 2CZ1B 3RUXA 2QDYB 4BE0A 3CXCS 4C8QC 1YJWA 3QBYA 3CC2T 1VQ7A 4WF2A 2V8JA 2E10A 4FSXA 4C92F 2HQXA 2RA2A 3C94A 2CZ0B 4NL2A 4X34A 1HXDA 3EAEA 4C8QA 5LJ3e 1K73C 4GY5A 1KQSS 3G4SA 2RHZA 3CCMT 4J83A 2M9UA 3ER0A 4C0DB 3DLLA 4M77F 3I56T 1ZBXA 5FLXE 1W2BA 2E65A 1BI1A 3R6OA 4XTYA 2YHTA 3PTAA 4C5EA 3OSVA 1YJ9T 4O6JA 3URGA 3LLRA 4OB0B 4C5GA 4KULA 3CPFA 3LGLA 4L59A 5KCHA 3ZBDA 1XOVA 5KH6A 4M78B 4MMKA 3J80E 2DTHA 3RMSA 4BDZA 5CKFA 3OYHA 1UEBA 1X01A 2VC8A 3OA6A 2FB7A 2X4WA 5DLQE 3HSBA 4A54A 4DA4A 3CBMA 2PUKB 5C0MA 4EMHA 4OGEA 1NJIU 3LW5E 2P0PA 1W2BS 2QQBA 3QXEB 3CCLT 2AHJB 3KBGA 4M75B 4D6WA 4BY6B 2VYTA 1V29B 4M78F 4O5VA 4LDXA 3A8HB 4M7AB 5CVIA 2QA4T 2DD4A 4Q5WA 4F7UA 1Q81U 4M78G 4BI8B 4HCBA 3I56A 2G3RA 3CCQT 3HRTA 1WPYA 1YITT 4L6V5 3JCMb 4V2SA 2DTOA 2R5AA 5GAN6 1YJ9A 1Q86C 1KQ2A 2IVWA 3OYFA 5IT9E 1LNXA 1VQKA 1X6OA 2QQRA 4M7AF 3OB9A 1YHQA 4N4HA 2EYQA 4NS5A 1TH7A 1PSEA 2P0QA 3WVDB 5GAOp 2WSEE 5GAMj 4A4HA 3M55A 3MCAB 2ZPIB 2ZCFB 1JRIA 1VQ5T 5FROA 4A53A 1QW1A 4KT0E 4N0AA 4ZGEB 5LJ5h 4XTWA 4LDVA 1XQHA 3CCRA 4M75G 2EFIA 1I5LA 2NLUA 3QSUA 1VQ8T 2E12A 1M4ZA 3CCLA 1M8VA 3S3MA 3HRUA 4JLGA 2O01E 3SWNC 4M7DC 4M7AD 3JCMd 1XTDA 5GAMh 1N8RC 4JUVA 5GMKi 4IUQA 1OZ3A 5GANd 2R5MA 3L42A 3VUBA 4BI3A 2DEQA 2H3JA 3J81E 3CCQA 4JS4A 3SWNA 2CZ6B 4BE2A 3JCMJ 3M56A 4II1A 4C5HA 4M7DA 2K4YA 4Y91A 4MZTA 3A8OB 4IUVA 2WACA 4QQGA 1X75C 4XTVA 3VYHB 2KDSA 2R57A 1H3ZA 3CBPA 2QI2A 4IUTA 2BKDN 4PJOG 1BKBA 1H641 3X26B 2OTJT 1VQ5A 4CRIA 3LWHA 1VQLA 3PMTA 4QW2A 1VQ9A 2JNGA 2EJFA 2XI9A 3L2VA 2ZPBB 2LCLA 2RHIA 1YJNA 2WSCE 3OBYA 3SB2A 1HK9A 1P92A 4MDXA 4HT9A 4ATOA 3M4YA 2HD0A 3GP8A 4J5YA 4OMFB 1PSFA 4PL6A 3DKMA 3WVEB 3NTHA 3M57A 3JCMW 1O75A 2YRVA 1WJRA 2LQ8A 3M4GA 2K5LA 2Y4XA 3OMCA 3QYGB 3JRZA 2QQAA 5GAOl 3JCMc 4KUDK 2E5QA 1Y96B 2RO0A 4C5IA 2DZ9A 3FLGA 4C0GA 2DIGA 5CQXA 5GAOn 3CXCA 3GPLA 2FYKA 5GMKj 5GANj 1QVPA 1UGSB 3Q1JA 2EWNA 3L2ZA 3A8GB 3VU3C 3OYMA 2KVQG 2QTXA 5FU6C 1VQ6A 3BFMA 1FXXA 3OYCA 1U1TA 2Y90A 3G71A 3RESA 2LC4A 2DVEA 3ASKA 1EIFA 1KQSA 1KHIA 2LDMA 3QDRB 4ZGJB 5FU7B 4ELYC 3TCJA 1QP2A 2F69A 2LCCA 4EMKC 1RI0A 3L2UA 3CCSA 3MEUA 4M75E 4IKFA 4P5NA 2X4XA 3HP9A 1VQOT 2MWPA 4EMKA 5CK9A 2LNVA 3MEAA 4J7FA 4XTZA 3I55A 5CIUA 5KE3A 4C0ZA 4PLIA 1K9MC 5IN1A 3NFCA 3E9GA 3G6ET 1M1KU 5DY9A 3QO3A 2LRQA 2ZPGB 2LVMA 4HKEA 1BI0A 3QJYA 1GXIE 3LH0A 2A3LA 3DB3A 3G7ZA 4C92C 5DM7R 4VUBA 3FIFA 2PU9B 2X4JA 2XIDA 3QG1A 3V8KA 2DXCA 1N8RU 2RHXA 3RMQA 5A2QE 3H8ZA 2DD5A 3LYIA 2E70A 3CCJA 2QQSA 4M77C 3QIIA 4XU1A 4PJOE 4RMOA 1M90C 4ME7A 2XHCA 3NTIA 5L8RE 4DOWA 3OYLA 1KC8C 4YTLA 3WXMB 3OS0A 2I2LA 4C92D 2XKOC 5GMKe 4B9WA 4N4GA 3J7AF 3OYBA 5GANe 4HCZA 2RK1A 3HHTB 3MP6A 5EG2A 3ZFJA 3CCVT 1VQOA 5GMKl 5I2MA 1JBMA 3TEEA 4C8QG 2XDBA 2MWOA 3CD6A 4C0DC 3OYAA 2F5KA 2MMPA 4DOVA 1S72T 4M77D 2A7YA 3CC4T 2QXFA 4A4FA 5GAMd 3CPWA 4BDYA 2E1HA 2K3XA 2JVVA 1G5VA 3CC2A 1KG1A 3QPHA 5GAN8 3G6EA 3EFSA 4OP0A 4XQ3A 3TREA 2XK0A 3X20B 5I21A 2JZ2A 3VV0A 2KAFA 4R56A 3CCMA 3OYKA 3JB9H 3OQ5A 2B8AA 3PFSA 4DQ2A 2XDDA 4XTXA 4M78C 3FRNA 1Q7YC 1I81A 1YBYA 1RL2A 2P0KA 3HKSA 3OSSC 1BI3A 4OF1A 3CCET 2DXBA 1I4K1 3TU4K 3JSCA 4GLKA 4M75F 1OI1A 3JB9I 1YIJT 2MAMA 1BIBA 2LQKA 3CPWS 3CMAT 2ZZDA 1QVFA 2K3YA 4LDUA 5J3BA 1N6AA 2LT1A 4BY6C 4M78D 5CQYA 3BY7A 4M7AC 3M5AA 2DO3A 4PJOB 1KHCA 2QQ9A 3CC4A 1OYXA 1FX7A 1XNIA 4F7UG 2D9TA 4M7AA 3OS1A 3FJPA 1N27A 2DXTA 1Q82C 3OYIA 3HFNA 4M75D 4JS5A 2QA4A 3OS5A 4J6YA 1KD1C 3OY9A 1ZHIA 2E6ZA 2GFUA 2L8DA 3MP1A 1K9MU 4OB3B 4PJOF 1QVFS 2RJEA 3HRSA 4LD6A 4XU0A 1YITA 4J6XA 5CKBA 3EFRA 3HFOA 1UB4A 5LJ3d 3JCMg 5CR2A 2X4YA 1K73U 3RERA 5GANg 2DIQA 4XAXB 1NPRA 3VJPA 2MF2A 1D3BA 3OYYA 2RH2A 4QQ6A 3L2QA 1YI2T 2KSSA 3MEVA 5A0DA 1S72A 1Y71A 2RJFA 2KMTA 3N5BB 3C12A 4OGCA 1YCYA 1M1FA 4N4IA 4JRPA 1IZ6A 3C95A 4C8QE 1NPPA 5HY6A 4XK8E 4IURA 4B9XA 3PIPA 4PJOD 3V8LA 3QYHB 2E6NA 1UGRB 2RK2A 2RM4A 2JOYA 5GAOq 3ME9A 4RCBA 1VQ8A 2D6FA 3PGGA 2RB6A 2DJZA 4JRQA 4M7DG 4MMLA 1WNLA 3M9QA 3QUIA 3HL8A 4XU2A 5DLOA 3A8LB 2EQUA 1B34A 4EPCA 3JB9G 3QZ9B 3FDRA 3UT1A 2DPPB 4BUGA 4X9CA 1BIAA 2RJDA 1IREB 4MZMA 2GQVA 2XDPA 3JCMf 3FEOA 3SFMA 2JTFA 5CO7A 3GIBA 5GANf 3META 3CEYA 3OS2A 1VIEA 1M5Q1 1JJ2S 2EQMA 5FRNA 2K5IA 3A8MB 4RG2A 1NJIC 3DLMA 1G3TA 1Q7YU 3CMET 1K8AC 2OTJA 5FU6B 3QJ6A 1Q86U 2PVGB 2Y4YA 3MP8A 4QVDA 1WJSA 4Z02A 5AYFA 3PNWC 2PVOB 3P8HA 1YJWT 1VQ7T 4EMKB 2E41A 3JB9J 2F5TX 1WJQA 2BIVA 5D6YA 4F7UE 5IAYA 3JCMX 2LX9A 2O4XA 2RI3A 2K57A 3G4ST 3V7CA 2EJ9A 5LL6S 3S3NA 3X25B 1VQ4T 4QVCA 2GCXA 3LWIA 5CCAA 4NOYA 3JCMh 4C8QB 5GMKh 2CKKA 5GANh 3OMGA 4ZTJA 2R58A 4XU3A 1VQPT 3H6ZA 5GAN5 4BE1A 3UPUA 2D0QB 4KUIA 5FU7C 3V7RA 2EIFA 3BDLA 2M1HA 3S3OA 2VV5A 4E7JA 2DK3A 3MHXA 2GFAA 4C92A 2VGNA 4JJNK 1UGQB 5GAOm 1VIFA 4C8QF 5LJ5d 3ZEHA 4FT2A 3CMEA 3LGFA 3P8BB 3X24B 1MGQA 4X9DA 2L3RA 4A4EA 2M16A 3PMIA 3VYGA 3OYGA 2C06A 4CI0C 5J26A 4M77A 3KUFA 3V7SA 5LJ5g 3JCMe 2E64A 2VXEA 3SDZA 5GAN3 1O9SA 3A5ZB 4MZPA 3OW2S 2EKOA 2GF7A 4J8OA 2K5FA 3AHUA 4J7IA 5J39A 4M7DE 4JRIA 2M0OA 2CGHA 1VQ4A 3M59A 1G3SA 2L5QA 4OVAA 3X28B 4HT8A 4C92G 4C8QD 5CKHA 5GAMg 1VQPA 3OYDA 1LOJA 4F7UB 4LD9K 1M9SA 2X35A 1Y07A 1G3YA 4OB1B 1VQKT 1Y7XA 2EQKA 3BW1A 4MDWA 2VUBA 4M77G 1YHQT 1U8RA 4E7KA 3GOXA 4E47A 2RHUA 3L2RA 1WQ7A 3M58A 3OBWA 3VUZA 3CCUA 4M78A 1VQMT 4ZN3A 3CCRT 2RD1A 4F7UF 4LDYA 3HPWA 2MI6A 4ZN1A 4E7IA 4FU6A 5LJ5f 2HAXA 3CCVA 3JCMQ 4M75C 5LJ5j 1VQNT 2VGMA 1K8AU 1VUBA 5D6XA 1WGSA 4M75A 2JUFA 4E7HA 3RKXA 3CC7T 4BB7A 2XD0A 5A0LA 4C0FA 4RCCA 2DTIA 3DB4A 4XTUA 3VKIA 4R55A 5CKEA 4RKUE 3RKYA 3UWNA 5GMKm 5GAMf 2LT4A 2XU8A 2ZGWA 2JTMA 3PT9A 4J6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9Q A;  2L89 A;  2MWP A;  5KH6 A;  2EQU A;  3MEA A;  3SD4 A;  3QKJ A;  4BDZ A;  3OYH A;  5CIU A;  5KE3 A;  3OA6 A;  2X4W A;  2RHY A;  3FDR A;  4PLI A;  5IN1 A;  3UT1 A;  5D6W A;  2HQE A;  3E9G A;  3LX7 A;  4A4G A;  5C0M A;  2RJD A;  2LRQ A;  2XDP A;  3FEO A;  2JTF A;  2LVM A;  3LH0 A;  3E9F A;  2EQJ A;  3CEY A;  3DB3 A;  3MET A;  5KCO A;  2EQM A;  3OS2 A;  4RG2 A;  5FRN A;  2VYT A;  3C4S A;  3DLM A;  2RHX A;  4Q5W A;  3H8Z A;  3QJ6 A;  3LYI A;  2G3R A;  3MP8 A;  1WJS A;  2QQS A;  5M9O A;  3QII A;  4IUU A;  4Z02 A;  3OYE A;  4E7L A;  3OYJ A;  3PNW C;  3P8H A;  2R5A A;  3NTI A;  3OYL A;  3OYN A;  3OYF A;  3OS0 A;  5D6Y A;  1WJQ A;  2BIV A;  5IAY A;  2IG0 A;  3MO8 A;  4B9W A;  4N4G A;  2QQR A;  3OYB A;  2O4X A;  2RI3 A;  3MP6 A;  4HCZ A;  3OB9 A;  5KE2 A;  4N4H A;  4NS5 A;  4A4H A;  2MWO A;  3S3N A;  3OYA A;  2F5K A;  5FRO A;  5FRM A;  2LTO A;  4UC4 A;  4A4F A;  4BDY A;  1G5V A;  2CKK A;  2K3X A;  3MEW A;  3OMG A;  3FC3 A;  2R58 A;  4ZTJ A;  3H6Z A;  2EFI A;  4BE1 A;  3BDL A;  2M1H A;  2NLU A;  3S3O A;  2XK0 A;  4E7J A;  2JZ2 A;  2RI5 A;  2GFA A;  2PQW A;  2RJC A;  3F70 A;  3OQ5 A;  3P8D A;  3OYK A;  2B8A A;  3S3M A;  1MHN A;  3PFS A;  3L2W A;  4BAC A;  4FL6 A;  3ZEH A;  3LGF A;  4IUP A;  2P0K A;  4QVZ A;  2L3R A;  1OZ3 A;  4IUQ A;  2R5M A;  3L42 A;  4A4E A;  2M16 A;  3NTK A;  3PMI A;  3OYG A;  4BE2 A;  2O4X B;  5J26 A;  4II1 A;  3KUF A;  4C5H A;  1OI1 A;  4IUV A;  2WAC A;  4QQG A;  3O8V A;  2K3Y A;  2EKO A;  2GF7 A;  2R57 A;  4QQD A;  4BD3 A;  1H3Z A;  5J39 A;  4IUT A;  2BKD N;  5C6S A;  2M0O A;  4CRI A;  2RI2 A;  2FHD A;  1KHC A;  3PMT A;  4OVA A;  4QW2 A;  1OYX A;  1XNI A;  1OZ2 A;  2D9T A;  3L2V A;  3OS1 A;  4PLL A;  2RHI A;  3OYD A;  1N27 A;  4EDU A;  2X35 A;  4ZTF A;  3OYI A;  2EQK A;  4PL6 A;  3S6W A;  2BUD A;  4E7K A;  3NTH A;  3OY9 A;  2L8D A;  2YRV A;  2GFU A;  1SSF A;  1WJR A;  3MP1 A;  2DAQ A;  2RHU A;  5KCH A;  3L2R A;  3GOX A;  2RJE A;  4LD6 A;  3OMC A;  4BE0 A;  3QBY A;  2E5Q A;  2X4Y A;  2HQX A;  2RO0 A;  4X34 A;  2DIQ A;  4E7I A;  4C5I A;  3FLG A;  4FU6 A;  3EAE A;  2DIG A;  4QQ6 A;  3L2Q A;  4GY5 A;  3MEV A;  2RHZ A;  2RJF A;  3Q1J A;  3OYM A;  5D6X A;  1WGS A;  3OYC A;  4E7H A;  4N4I A;  3ASK A;  4C5E A;  2LDM A;  4IUR A;  3DB4 A;  4B9X A;  3LLR A;  2E6N A;  2LCC A;  1RI0 A;  4C5G A;  3L2U A;  3UWN A;  3ME9 A;  3MEU A;  3LGL A;  4IKF A;  4L59 A;  2X4X A; 
#chains in the Genus database with same CATH topology
 1QVG A;  2L89 A;  3ULR B;  1DJ7 B;  4M7D B;  4TVR A;  3QWY A;  1QP3 A;  2D8H A;  1VQL T;  4OB2 B;  3CQT A;  1WXU A;  2EQJ A;  2WSF E;  6AT1 B;  3PE0 A;  3T9N A;  1M90 U;  3CCL Q;  2W0Z A;  4KBM B;  4AFS C;  4BI4 A;  3CC7 A;  2EVR A;  2K2V A;  3JB9 F;  2VKN A;  3HTR A;  2FG0 A;  2EGE A;  2DXU A;  1BB9 A;  2BZ8 A;  2GTJ A;  5KE2 A;  3O5Z A;  2M02 A;  1R8O B;  3C0C A;  4Z88 A;  4M77 E;  3JAM E;  7AT1 B;  1JB0 E;  4ZGD B;  3JB9 D;  2CP5 A;  2PVD B;  1N9R A;  3VS4 A;  1YJN Q;  3F70 A;  1BCM A;  5LJ3 j;  1Q95 G;  1UUE A;  4A4K A;  3I55 T;  4FL6 A;  2KE9 A;  2CDT A;  2DKG A;  1Q81 C;  4HVU A;  1CSK A;  1R0B G;  3M54 A;  1BK2 A;  3O8V A;  1BYM A;  1AWW A;  1K4U S;  4QQD A;  4Y28 E;  2LCS A;  1NZ9 A;  1U1S A;  3GNF B;  2DA9 A;  3OW2 A;  1SHF A;  1VQ6 Q;  5HKC A;  2EYW A;  4PLL A;  2RN8 A;  3FB9 A;  4EMG A;  1YWP A;  2V1Q A;  2EPD A;  2CYZ B;  3CD6 T;  2QEX A;  4M77 B;  5GAO r;  1PRM C;  1QCO A;  2J6K A;  3QBY A;  3CC2 T;  4WF2 A;  2FZC B;  2E10 A;  2V8J A;  4C92 F;  4NL2 A;  1HXD A;  4RTU A;  1K73 C;  3G4S A;  3CCM T;  4J9D A;  3ER0 A;  1ZBX A;  5FLX E;  1UHC A;  2YHT A;  3OSV A;  1E6H A;  1OPL A;  3LLR A;  3CCJ Q;  4J9H A;  3CPF A;  3ZBD A;  5KH6 A;  3J80 E;  2D1X A;  2KXC A;  3CBM A;  5C0M A;  1NJI U;  3LW5 E;  1W2B S;  2QQB A;  4RTW A;  3CCL T;  2VYT A;  4FSS A;  4LDX A;  3A8H B;  1ZBJ A;  2P84 A;  2KBT A;  4HVW A;  2QA4 T;  2DD4 A;  1G8X A;  3I56 A;  2G3R A;  1WPY A;  2XMF A;  1LPL A;  1IHV A;  4L6V 5;  2DTO A;  5GAN 6;  2LZ6 B;  2IVW A;  5ECA A;  2QQR A;  4FYX B;  4FCY A;  4M7A F;  1RAE B;  2EYQ A;  4NS5 A;  2MYS A;  2WSE E;  2ZCF B;  4KGZ B;  4A53 A;  4XTW A;  3TSZ A;  1KK7 A;  1QKX A;  2NLU A;  1M4Z A;  4F04 B;  2DVJ A;  1UEC A;  4OMQ A;  4JLG A;  4M7A D;  1WHJ A;  3JCM d;  1N8R C;  1OPK A;  3VUB A;  3L42 A;  4BE2 A;  3VS0 A;  4LUE A;  3JCM J;  3SWN A;  4C5H A;  2EKH A;  3CBP A;  1BKB A;  4CRI A;  1SRM A;  4J9B A;  2O88 A;  1VQL A;  3PMT A;  5HCK A;  2EJF A;  2XI9 A;  2RHI A;  4HT9 A;  4HXJ A;  3M4Y A;  3UF4 A;  1PSF A;  4AT1 B;  2PZ1 A;  3E2U A;  4RTY A;  1WJR A;  3FJ5 A;  1VYV A;  3M4G A;  2K5L A;  2Y4X A;  5GAO l;  1BU1 A;  2RO0 A;  4A63 B;  4C5I A;  4AFQ C;  1SHG A;  3L2Z A;  3A8G B;  2QTX A;  3OYC A;  3ZL7 C;  2DVE A;  2OTJ Q;  2LDM A;  4ZGJ B;  5KYU A;  5AT1 B;  4EMK C;  3SHW A;  2X4X A;  1M30 A;  4J7F A;  4RTZ A;  2ZAE A;  3I55 A;  5CIU A;  2RPN A;  1I07 A;  5IN1 A;  1M1K U;  4X1V A;  3QJY A;  8AT1 B;  3PVQ A;  2XID A;  3QG1 A;  3H8Z A;  1M90 C;  3OYL A;  2COZ A;  4YTL A;  3WXM B;  3CCV T;  5GAN e;  3MP6 A;  5EG2 A;  1JO8 A;  2M0Y A;  5I2M A;  1VQO Q;  1JBM A;  3TEE A;  3CD6 A;  4C0D C;  2F5K A;  1Y0M A;  4BDY A;  1X6G A;  1G5V A;  5KYX A;  3CC2 A;  3QPH A;  3EFS A;  1NM7 A;  3A1P A;  3MJX A;  4D8K A;  1KIK A;  5I21 A;  1VQP Q;  2JZ2 A;  3VV0 A;  2KAF A;  2LMJ A;  3CCM A;  1PC0 A;  3JB9 H;  3OQ5 A;  3PFS A;  3CXC P;  1H8K A;  3EGX A;  3NGP A;  3EG3 A;  4OF1 A;  2JMA A;  3TU4 K;  1KQS P;  1OI1 A;  1QVF A;  2K3Y A;  4JJD A;  4M78 D;  1SPK A;  3BY7 A;  2JM9 A;  2ED1 A;  1OYX A;  1FX7 A;  2D9T A;  4LN2 A;  2A28 A;  2AT1 B;  4FW2 A;  2QA4 A;  1BBZ A;  3OY9 A;  2L8D A;  4PJO F;  4LD6 A;  3QWX X;  2IPO B;  5LJ3 d;  1QKW A;  2X4Y A;  1UDL A;  5GAN g;  2DIQ A;  2RH2 A;  2KT8 A;  3L2Q A;  2KRM A;  2A37 A;  2C0T A;  3C12 A;  2J05 A;  4N4I A;  1G2B A;  4DEY A;  4JRP A;  1NPP A;  3CC7 Q;  4PJO D;  3CPW P;  2QGF B;  4RCB A;  2D6F A;  3PGG A;  2NUT A;  1WA7 A;  1WNL A;  2ENM A;  3M9Q A;  3HL8 A;  1WHM A;  5I22 A;  3QZ9 B;  1SRL A;  1M2V A;  1IRE B;  2GQV A;  3OS2 A;  4KGX B;  2DL4 A;  3RNJ A;  2A0F B;  2GTO A;  3A8M B;  1NJI C;  1E7O A;  1GBR A;  5KYU B;  2KI7 A;  5FU6 B;  3MP8 A;  1WJS A;  2P4R A;  1MND A;  4Z02 A;  2C0O A;  1YJW T;  4J9F A;  1VQ7 T;  1ZUY A;  2I0N A;  3JV3 A;  2F5T X;  2BIV A;  5IAY A;  2KXD A;  1AWJ A;  2GGR A;  3JCM h;  5GMK h;  2CKK A;  4E2F B;  3OMG A;  4ZTJ A;  2R58 A;  1VQP T;  1FMW A;  2D0Q B;  4KUI A;  5FU7 C;  3V7R A;  2VV5 A;  2YRD A;  2DL5 A;  4ESR A;  2AKK A;  1VIF A;  3CME A;  3LGF A;  3X24 B;  2CP7 A;  4A4E A;  1ZSZ A;  3V7S A;  1W70 A;  5GAN 3;  3EFO A;  1VA7 A;  3OW2 S;  1PWT A;  1NYF A;  1UE9 A;  2DMO A;  3AHU A;  5KYX B;  4JRI A;  3G4S Q;  2DFU A;  1TUC A;  2JMC A;  1R0C B;  2JS0 A;  4OVA A;  3X28 B;  5GAM g;  3OYD A;  1LOJ A;  2QAS A;  1Y07 A;  4OB1 B;  1VQK T;  3RR6 A;  1Y7X A;  3BW1 A;  1YHQ T;  4E7K A;  4DBH A;  4ZN3 A;  3HPW A;  4ZN1 A;  3CCV A;  1Q7Y R;  3I5S A;  1JQQ A;  1WGS A;  4M75 A;  2JUF A;  2MCN A;  3CC7 T;  1WXT A;  3UAT A;  2DTI A;  3DB4 A;  4XTU A;  2ZGW A;  4XTV A;  3PT9 A;  5CKD A;  3SD4 A;  3M53 A;  2FL7 A;  1HYO A;  2AZV A;  2RHY A;  1AHJ B;  4FIB A;  5D6W A;  2VXF A;  3LX7 A;  1VQ9 T;  1VQM A;  3CBO A;  1EZZ B;  2C0I A;  3GLX A;  5KCO A;  2CS7 A;  2J06 A;  1M1K C;  3C4S A;  4M7D F;  4PNO A;  4LDW A;  2JM8 A;  3OYE A;  2RMO A;  1I8F A;  4IUU A;  5M9O A;  2HCK A;  3H0I A;  3OYJ A;  4E7L A;  2NUT B;  2PUO B;  2IG0 A;  2DL8 A;  1TOV A;  1W4S A;  2KY9 A;  1JEG A;  1E6G A;  4M7D D;  1F1B B;  2LTO A;  2RNA A;  1FMK A;  4HCC A;  1VQL Q;  2RQR A;  3CCS T;  4ELZ C;  5KYW A;  1ZA1 B;  2RJC A;  2HNI A;  1OU9 A;  2QEX T;  1LJO A;  3L2W A;  4BAC A;  2OTL A;  4QVZ A;  3M0S A;  2X9H A;  4OML A;  3UDC A;  1UTI A;  2EJG A;  3I9Q A;  3KXT A;  3E19 A;  2HL3 A;  4JDS A;  3EHQ A;  5C6S A;  1W6X A;  4LNP A;  5GAN 4;  2EYX A;  2HBP A;  4PFO A;  1N9S A;  1OZ2 A;  2EBP A;  5LJ3 h;  2COY A;  2V1R A;  3VS6 A;  1ZA2 B;  4EDU A;  5GAN 2;  3JCM V;  4RG8 A;  2QDY B;  3EFO B;  3I55 Q;  1YJW A;  1B7T A;  1VQ7 A;  4FSX A;  4X34 A;  2CZ0 B;  2A08 A;  1KFZ A;  3EAE A;  4C8Q A;  1D1C A;  4J83 A;  4C0D B;  2X3X D;  1KC8 R;  3DLL A;  4M77 F;  3I56 T;  4XTY A;  1BI1 A;  3PVL A;  1UGV A;  4C5E A;  3REA B;  2DER A;  4OB0 B;  2AIR B;  8ATC B;  4L59 A;  2D0N A;  5CKF A;  3OYH A;  3HSB A;  2X4W A;  3CD6 Q;  4AFZ C;  4A54 A;  1RAI B;  1RAA B;  4JJC A;  4OGE A;  1T3L A;  3CC2 Q;  2AHJ B;  4M75 B;  3EG1 A;  1UJ0 A;  4O5V A;  5CVI A;  4Q5W A;  3CCM Q;  4F7U A;  4BI8 B;  1T0J A;  3JCM b;  1M8M A;  2R5A A;  1YJ9 A;  1KQ2 A;  5IT9 E;  3H0H A;  4CC2 A;  1VQK A;  1X6O A;  2FPE A;  3OB9 A;  1YHQ A;  2EQI A;  1TH7 A;  1EX4 A;  1PSE A;  4QT7 A;  2P0Q A;  3M55 A;  3MCA B;  1JRI A;  2O9V A;  5FRO A;  1Q82 R;  1QCN A;  4LDV A;  1XQH A;  1I5L A;  1GFC A;  3EGD A;  5EC7 A;  2NUZ A;  1M8V A;  3S3M A;  2O01 E;  3SWN C;  1VOM A;  1V76 A;  2JJ9 A;  2FZK B;  5GAM h;  2QA4 Q;  4JUV A;  4IUQ A;  3CCQ A;  2DEQ A;  1W2B P;  3M56 A;  1K0S A;  2ED0 A;  3A8O B;  2F2X A;  2WAC A;  1X75 C;  2FRW A;  2AK5 A;  1VQ5 A;  3QDF A;  5KYW B;  1VQ9 A;  3NHN A;  4MDX A;  3OBY A;  3SB2 A;  1P92 A;  4ATO A;  3EGU A;  3DKM A;  3NTH A;  3M57 A;  3JCM W;  1O75 A;  2LQ8 A;  3VS5 A;  2G6F X;  1IGU A;  3JCM c;  4AMC A;  3FLG A;  4C0G A;  2DIG A;  5CQX A;  3CXC A;  5GAN j;  1Q81 R;  4HVV A;  1QVP A;  1BCO A;  3VU3 C;  5FU6 C;  2OAW A;  2E3H A;  1U1T A;  1X43 A;  2LC4 A;  1KQS A;  2FRY A;  1WHL A;  1KHI A;  5FU7 B;  3TCJ A;  1QP2 A;  2LCC A;  3CCS A;  4P5N A;  2MWP A;  1TUG B;  2LJ3 A;  2H8H A;  1K9M C;  3E9G A;  2GBQ A;  2LRQ A;  2CUD A;  2ZPG B;  4HKE A;  1GXI E;  3LH0 A;  2F2W A;  3DB3 A;  3G7Z A;  2PU9 B;  2RHX A;  2DD5 A;  2DL3 A;  1QLY A;  1D0Y A;  3CME Q;  2CUB A;  4ME7 A;  4M4Z A;  2XHC A;  4FW1 A;  4DOW A;  2BTT A;  3OS0 A;  4C92 D;  5GMK e;  3OYB A;  2CT4 A;  3R6N A;  2MMP A;  2A7Y A;  2QXF A;  3CPW A;  4JJB A;  2K3X A;  2L3P A;  3G6E A;  4OP0 A;  3TRE A;  2XK0 A;  4DQ2 A;  1RAF B;  2XDD A;  4M78 C;  2RQW A;  1M27 C;  2MPX C;  1RL2 A;  2P0K A;  3HKS A;  3OSS C;  3CCE T;  1UG1 A;  3JSC A;  4GLK A;  3CMA T;  2ZZD A;  3VRY A;  5J3B A;  3CCV Q;  4CC7 A;  2YUO A;  3EGD B;  4F16 A;  2QDL A;  1TUD A;  4KGV B;  4M7A A;  2IIM A;  3UA7 A;  1N27 A;  3OYI A;  3HFN A;  4JS5 A;  4J6Y A;  1KSW A;  1B07 A;  3MP1 A;  2GFU A;  3HRS A;  4XU0 A;  3HFO A;  1UB4 A;  3JCM g;  4XAX B;  1D3B A;  1VQM Q;  3OYY A;  1YI2 T;  1N8R R;  3MEV A;  2K9G A;  2YDL A;  1Y71 A;  2RJF A;  2KMT A;  3N5B B;  1YCY A;  2E5K A;  1QQJ A;  1QMC A;  5HY6 A;  2DL7 A;  2PTK A;  4IUR A;  4B9X A;  3PIP A;  2E6N A;  4Y92 A;  1UGR B;  1A0N B;  2RM4 A;  4OMN A;  2Z0W A;  5GAO q;  2KRN A;  4D8D A;  4RTT A;  4OMM A;  1GRI A;  3FDR A;  1BIA A;  2RJD A;  2LQW A;  3FEO A;  2JTF A;  3SFM A;  1RAD B;  5GAN f;  3EG9 A;  1AOJ A;  1VIE A;  1M5Q 1;  2K5I A;  4RG2 A;  1JXO A;  2LP5 A;  1G3T A;  1Q7Y U;  3CME T;  1PM3 A;  1K8A C;  1AZE A;  2PVG B;  1WZO A;  4F14 A;  3PNW C;  2OTL Q;  2E41 A;  3JB9 J;  1RUW A;  2LX9 A;  2O4X A;  2EJ9 A;  3S3N A;  3X25 B;  1WHH A;  2GCX A;  3LWI A;  5CCA A;  4DBR A;  3H6Z A;  3UPU A;  2CT3 A;  2M1H A;  5KYY A;  2KEA A;  3M0R A;  1PD0 A;  5GJV B;  5GAO m;  1ZSZ C;  5LJ5 d;  2FPD A;  1MGQ A;  2M16 A;  5LJ5 g;  1YJW Q;  2VXE A;  1VQ7 Q;  2ROT A;  3A5Z B;  4MZP A;  2YUN A;  4J8O A;  2K5F A;  2M0O A;  1OQK A;  2CGH A;  1VQ4 A;  5I11 A;  1MNE A;  2DBM A;  5CKH A;  4PFZ A;  1EFN A;  2VUB A;  3EH1 A;  4M78 A;  1VQM T;  3CCR T;  2GQI A;  2RD1 A;  4LDY A;  2CP0 A;  2MI6 A;  4E7I A;  2ROL A;  1KJW A;  3JCM Q;  4M75 C;  2BZY A;  5IXB A;  1Q86 R;  1VUB A;  5D6X A;  4BB7 A;  5A0L A;  4C0F A;  3VKI A;  2SRC A;  4RKU E;  3UWN A;  3OW2 P;  5GAM f;  2XU8 A;  1YJ9 Q;  2JTM A;  4M78 G;  2YRC A;  3SWN B;  1VQK Q;  3V8J A;  3G1J A;  3QKJ A;  4N0A C;  4PKC C;  1WDX A;  1YHQ Q;  1QWF A;  2KK4 A;  5HK3 A;  2XIC A;  1D3B B;  3CCE A;  3CMA A;  5LJ3 g;  2CP3 A;  4PJO A;  1D09 B;  3E1S A;  1PNJ A;  1WX6 A;  3VS1 A;  2V8I A;  2OTL T;  1M2O A;  1KC8 U;  4JLI A;  1QVG S;  2FZG B;  2YLC A;  2RF0 A;  3CCQ Q;  3OYN A;  5GAN 7;  3VS2 A;  4HA8 A;  4F17 A;  1NEG A;  2CSI A;  5CAI A;  5FRM A;  1C1A A;  3THK A;  4B6M A;  4LUD A;  3G71 T;  2L3Q A;  3BDU A;  1VQ5 Q;  5GJW B;  2DYI A;  2ABL A;  1VQ9 Q;  5GAM e;  1NLO C;  3GNG A;  1U3O A;  1YI2 A;  1IB8 A;  2KYM A;  1WYX A;  2OAU A;  3INZ A;  2ZPH B;  1SSH A;  4JRK A;  4HCK A;  2EAY A;  3TVT A;  2ZPE B;  5A0G A;  4FT4 A;  1NJI R;  1M3A A;  2O4X B;  2V8K A;  2DET A;  1Z9Q A;  1X69 A;  1G3W A;  1WLP B;  3EG2 A;  4BD3 A;  1WQW A;  4M78 E;  3GF5 A;  1U06 A;  3RKW A;  1FWZ A;  1YP5 A;  1Q82 U;  2L0A A;  1ZQ1 A;  4ZTF A;  2HBW A;  3VRZ A;  3CCS Q;  2CRE A;  3S6W A;  1RAB B;  2BUD A;  2QEX Q;  3RUX A;  4BE0 A;  3CXC S;  4C8Q C;  1JJ2 P;  2HQX A;  3C94 A;  4GY5 A;  4GLM A;  2DRK A;  1KQS S;  2RHZ A;  3MPU B;  2DEU A;  1W2B A;  3PTA A;  4LE9 A;  1YJ9 T;  4O6J A;  3URG A;  1YCS B;  4C5G A;  1CKA A;  4KUL A;  1IXD A;  3EGX B;  3LGL A;  5KCH A;  1ACM B;  1XOV A;  4M78 B;  4MMK A;  3SEM A;  2DTH A;  3RMS A;  2JTE A;  4BDZ A;  1NYG A;  1TU0 B;  1X01 A;  3OA6 A;  2FB7 A;  2E3I A;  2PUK B;  1JXM A;  2HSP A;  2P0P A;  3QXE B;  3G6E Q;  1K9A A;  4D6W A;  4ORZ A;  1AT1 B;  1Q81 U;  1V1C A;  4HCB A;  3CCQ T;  3I56 Q;  1YIT T;  4ZNX A;  4V2S A;  3LH5 A;  1AEY A;  4QKU A;  2PNI A;  5GAO p;  1S72 T;  4KRT A;  2ZPI B;  1VQ5 T;  2YSQ A;  5LJ5 h;  1T0H A;  4LXC A;  4N0A A;  1KD1 R;  3CCR A;  4M75 G;  3GBQ A;  5D7U A;  2BE7 D;  2YWW A;  3QSU A;  1VQ8 T;  2ECZ A;  5IHI A;  1RAC B;  3TSW A;  5GMK i;  3L2R A;  2AZS A;  4JS4 A;  2CZ6 B;  4M7D A;  2JS2 A;  4Y91 A;  4IUV A;  4QQG A;  2KDS A;  1M2V B;  2R57 A;  1PRL C;  1H92 A;  2BKD N;  1WHG A;  1H64 1;  3X26 B;  3LWH A;  1PKS A;  2LJ1 A;  1JU5 C;  3L2V A;  2ZPB B;  2LCL A;  2WSC E;  1HK9 A;  4JZ4 A;  4J5Y A;  4OMF B;  4PL6 A;  2MK5 A;  1SKU B;  2YRV A;  1UHF A;  2DYB A;  1VYT A;  3H0F A;  1MMA A;  1TXQ A;  1X2K A;  3OMC A;  3QYG B;  2QK0 A;  3JRZ A;  2E5Q A;  2NWM A;  2DZ9 A;  5GAO n;  4Z89 A;  5GMK j;  1UGS B;  3Q1J A;  3OYM A;  2KVQ G;  3BFM A;  1FXX A;  3G71 A;  2Y90 A;  4FYY B;  3RES A;  3ASK A;  4J9C A;  3L2U A;  3EH2 A;  2X51 A;  4M75 E;  4IKF A;  1I0C A;  5CK9 A;  2LNV A;  4K11 A;  1ZSZ B;  4PLI A;  3NFC A;  4EIK A;  1K76 A;  3G6E T;  1W1F A;  5DY9 A;  3QO3 A;  1D0Z A;  3VS3 A;  2A3L A;  3REB B;  4C92 C;  4VUB A;  5DM7 R;  3FIF A;  1RLP C;  2X4J A;  3V8K A;  1N8R U;  3RMQ A;  3LYI A;  2E70 A;  2QQS A;  2O31 A;  3QII A;  4XU1 A;  4RMO A;  1ZX6 A;  3NTI A;  1KC8 C;  2DBK A;  1MMG A;  4N4G A;  3MKD A;  4B9W A;  3ZFJ A;  1NEB A;  2DM1 A;  5GMK l;  1VQO A;  2XDB A;  4C8Q G;  2QAZ A;  3OYA A;  4DOV A;  4M77 D;  2JVV A;  1C0M A;  1KG1 A;  4XQ3 A;  3X20 B;  5IHK A;  4R56 A;  2B8A A;  4XTX A;  3FRN A;  4JZ3 A;  1I81 A;  2BZX A;  1YBY A;  1BI3 A;  1OEB A;  2K6D A;  4PJN A;  2DXB A;  1I4K 1;  3JB9 I;  1YIJ T;  1BIB A;  2LQK A;  4LDU A;  3BE3 A;  1TWB A;  1N6A A;  2LT1 A;  1LCK A;  4BY6 C;  4M7A C;  1YNZ A;  2LNH B;  1KHC A;  2QQ9 A;  3CC4 A;  1XNI A;  4F7U G;  3OS1 A;  1I5O B;  1Q82 C;  2YT6 A;  5L23 A;  3OS5 A;  1QVF S;  4OB3 B;  1YIT A;  1D1A A;  4J6X A;  5CKB A;  5CR2 A;  1Y57 A;  3CCE Q;  1NPR A;  1R77 A;  3VJP A;  2MF2 A;  4QQ6 A;  4DBQ A;  2KSS A;  3CMA Q;  5A0D A;  1S72 A;  3C95 A;  4C8Q E;  4XK8 E;  2F2V A;  4IIO A;  1ZLM A;  2RK2 A;  1WI7 A;  4PFP A;  1VQ8 A;  3ME9 A;  2QYZ A;  1UJY A;  2FO0 A;  3QUI A;  4XU2 A;  2KYB A;  3A8L B;  1B34 A;  4EPC A;  3JB9 G;  1PHT A;  1GCP A;  2DPP B;  4BUG A;  4X9C A;  4MZM A;  3JCM f;  3CEY A;  5FRN A;  3DLM A;  3EHR A;  1YI2 Q;  1OX9 A;  2JXB A;  3QJ6 A;  1Q86 U;  2ESW A;  4QVD A;  5AYF A;  2PVO B;  1XJW B;  2MIO A;  1PKT A;  5D6Y A;  1QWE A;  4F7U E;  2ATC B;  2SEM A;  2HZY A;  2HMA A;  3V7C A;  1VQ4 T;  4QVC A;  2NYS A;  4NOY A;  4C8Q B;  1SG5 A;  3BDL A;  4CC3 A;  3I5R A;  3MHX A;  1K9M R;  4C92 A;  4GBQ A;  1UGQ B;  1C6V X;  1K73 R;  2AKL A;  4X9D A;  2HEQ A;  3PMI A;  4J9I A;  2C06 A;  1AVZ C;  5J26 A;  3KUF A;  3JCM e;  1K0X A;  2RQV A;  4IIM A;  1O9S A;  1NBE B;  2EKO A;  1FYN A;  1H3H A;  2KNB B;  4ANJ A;  1OOT A;  3VS7 A;  2K3B A;  3M59 A;  1G3S A;  4WCI A;  4HT8 A;  4C92 G;  2COW A;  4F7U B;  2X35 A;  2EQK A;  1FMV A;  4MDW A;  3AT1 B;  4E47 A;  2RHU A;  1NG2 A;  3OBW A;  2DNU A;  3VUZ A;  3CCU A;  2VVK A;  1GCQ C;  1LVK A;  4E6R A;  2VAS A;  4FU6 A;  5LJ5 f;  1I1J A;  2VGM A;  2NUP A;  2D8J A;  2XD0 A;  3NMZ C;  3RKX A;  5IHN A;  1AWX A;  3M0Q A;  4R55 A;  4J9E A;  5CKE A;  3RKY A;  3I35 A;  4R0K A;  1RAG B;  5GAM j;  4J6W A;  4OMP A;  4NL3 A;  1PCX A;  2YUQ A;  2VB6 A;  4L5G A;  2HQE A;  2FVU A;  4A4G A;  2F1L A;  4PJO C;  1NE8 A;  2OX7 A;  1YIJ A;  3CCR Q;  1YJN T;  2B86 A;  3E9F A;  1M3C A;  4M7A G;  5I2S A;  1ZUU A;  2E4H A;  1VQN A;  1JJ2 A;  4AG1 C;  2P4T A;  3L1A A;  2EGA A;  3RDV A;  4Z8A A;  4C92 E;  5LJ5 e;  3MO8 A;  1B34 B;  3H9N A;  1BI2 A;  1VQ6 T;  4UC4 A;  4E7S A;  3MEW A;  1RAH B;  3PIO A;  3FC3 A;  2YLB A;  1HSQ A;  2K79 A;  1M3B A;  3TQ7 P;  5LJ3 f;  1AD5 A;  2RI5 A;  2PQW A;  3P8D A;  3RIR A;  1MHN A;  1SEM A;  3JCM P;  2HL5 C;  1X27 A;  4IUP A;  4FM4 B;  2ZPF B;  3NTK A;  2JN0 A;  2XG8 D;  1ZSG A;  1MUZ A;  1K8A R;  2KQW A;  2YXY A;  4RUG A;  1Y96 A;  1M1G A;  1X6B A;  1KQ1 A;  1SF9 A;  1QVG P;  2DZC A;  2EYY A;  3QHS A;  2K7A A;  2FHD A;  2LQN A;  2RI2 A;  3CCJ T;  3G71 Q;  2O9S A;  1HJD A;  1KD1 U;  4C92 B;  1OUL A;  2CZ7 B;  5HK0 A;  3QZ5 B;  2EYZ A;  4M7A E;  1UGP B;  1AWO A;  1SSF A;  2DAQ A;  2CZ1 B;  2RA2 A;  1G83 A;  5LJ3 e;  1M90 R;  1QCF A;  2DE0 X;  2M9U A;  2KGT A;  1IO6 A;  1UFF A;  2E65 A;  3R6O A;  4FYV B;  2KRO A;  2OI3 A;  4J9G A;  2CH4 A;  4WTO B;  1YFN A;  1Z9Z A;  1UEB A;  1ZUK A;  2DRM A;  2VC8 A;  1GFD A;  1WIE A;  2RQT A;  5DLQ E;  4DA4 A;  2DX1 A;  4EMH A;  1YN8 A;  3A98 A;  2L3S A;  2NUP B;  1GCQ A;  1WHK A;  1AZG B;  3KBG A;  2J7I A;  4BY6 B;  1V29 B;  4M78 F;  4M7A B;  3HRT A;  1Q86 C;  3OYF A;  1LNX A;  3UA6 A;  4N4H A;  3WVD B;  2K2M A;  4A4H A;  5KYN A;  1QW1 A;  4KT0 E;  4ZGE B;  4KH0 B;  4RTV A;  3CC4 Q;  2EFI A;  1U5S A;  3D7S B;  2E12 A;  3CCL A;  3HRU A;  4M7D C;  4OMO A;  1XTD A;  4KH1 B;  5GAN d;  1OZ3 A;  2R5M A;  4BI3 A;  1J3T A;  2H3J A;  3J81 E;  4II1 A;  4FYW B;  1YIT Q;  4PJL A;  2K4Y A;  4MZT A;  2GNC A;  3VYH B;  1H3Z A;  3IQL A;  2QI2 A;  4IUT A;  4PJO G;  1S72 Q;  3EG9 B;  2OTJ T;  2RQU A;  2CH4 W;  4QW2 A;  2JNG A;  1PD1 A;  1YJN A;  1RI9 A;  1IGQ A;  2HD0 A;  3GP8 A;  1VQ8 Q;  3WVE B;  2CP2 A;  2QG9 B;  5IXF A;  2KR3 A;  4AG2 C;  2A36 A;  4KUD K;  2QQA A;  1Y96 B;  2BE9 B;  1OV3 A;  2W10 A;  3GPL A;  2FYK A;  2OJ2 A;  4DBF A;  1S1N A;  2EWN A;  2FPF A;  1VQ6 A;  1EIF A;  5KYY B;  3QDR B;  1RLQ C;  4ELY C;  2F69 A;  1RI0 A;  2LX7 A;  3MEU A;  3HP9 A;  1VQO T;  4EMK A;  3MEA A;  2JT4 A;  2FEI A;  4XTZ A;  2EW3 A;  5KE3 A;  4C0Z A;  1TS9 A;  2LVM A;  1BI0 A;  1OU8 A;  2DXC A;  5A2Q E;  2EGC A;  1ARK A;  3CCJ A;  4M77 C;  2DIL A;  4PJO E;  5L8R E;  2I2L A;  3U23 A;  3RBB B;  2XKO C;  9ATC B;  3J7A F;  4HCZ A;  2RK1 A;  3HHT B;  2HDA A;  1ABO A;  2MWO A;  2QGG A;  2M51 A;  3CC4 T;  4A4F A;  5GAM d;  2E1H A;  4DEX A;  5GAN 8;  2QTV A;  3OYK A;  1Q7Y C;  4CC4 B;  3CCU Q;  4M75 F;  1T3S A;  2KRS A;  2MAM A;  3CPW S;  1NLP C;  5CQY A;  3M5A A;  2DO3 A;  5IH2 A;  4PJO B;  2KT1 A;  2H3E B;  3FJP A;  1MMN A;  2DXT A;  4M75 D;  1KD1 C;  1ZHI A;  2E6Z A;  1K9M U;  3EG0 A;  2RJE A;  1M1K R;  2DF6 A;  3EFR A;  1K73 U;  3RER A;  1TTH B;  1PG5 B;  3NPF A;  4PJJ A;  1N5Z A;  1YIJ Q;  1D1B A;  4OGC A;  1M1F A;  1VQN Q;  1IZ6 A;  2X3W D;  2YUP A;  3M0T A;  3QYH B;  3V8L A;  1WXB A;  2JOY A;  4JRQ A;  2RB6 A;  4PK4 A;  2DJZ A;  4M7D G;  4MML A;  5DLO A;  2EQU A;  1D0X A;  1IHW A;  2LJ0 A;  3UT1 A;  2J6O A;  2XDP A;  5CO7 A;  3GIB A;  2V26 A;  1VYU A;  3MET A;  1GBQ A;  1JJ2 S;  2EQM A;  1QVF P;  2MOX A;  2OTJ A;  2Y4Y A;  1MMD A;  3KFV A;  1HD3 A;  4AFU C;  3P8H A;  4EMK B;  1WJQ A;  1IRX A;  1OX8 A;  2HKN A;  3JCM X;  2RI3 A;  1ABQ A;  2JW4 A;  2L2P A;  2HSE B;  2K57 A;  3G4S T;  2J6F A;  5LL6 S;  1X2Q A;  4JPB W;  5GAN h;  4XU3 A;  5GAN 5;  4BE1 A;  2CSQ A;  2EIF A;  3S3O A;  3M0U A;  2O2O A;  4E7J A;  2DK3 A;  2GFA A;  2DLP A;  2HQH A;  2VGN A;  4JJN K;  2VWF A;  4C8Q F;  3CCU T;  3ZEH A;  4FT2 A;  3P8B B;  2L3R A;  3VYG A;  3OYG A;  4CI0 C;  4M77 A;  2E64 A;  3SDZ A;  2HKQ B;  2GF7 A;  5FWC A;  2CP6 A;  4J7I A;  5J39 A;  3M0P A;  4M7D E;  1B3Q A;  2L5Q A;  1VQ4 Q;  4C8Q D;  4RTX A;  1VQP A;  4LD9 K;  1M9S A;  1G3Y A;  2DJQ A;  5FW9 A;  1U8R A;  4M77 G;  3H41 A;  3GOX A;  1WQ7 A;  3M58 A;  1MV3 A;  1GL5 A;  1CKB A;  4F7U F;  2HAX A;  1K1Z A;  5LJ5 j;  1VQN T;  1K8A U;  1MV0 B;  1TSF A;  4E7H A;  4RCC A;  4E7Z A;  1YWO A;  5FWB A;  1WFW A;  1TG0 A;  4PJM A;  5GMK m;  2LT4 A; 
#chains in the Genus database with same CATH homology
 1QVG A;  2L89 A;  1DJ7 B;  3SWN B;  5CKD A;  3SD4 A;  3V8J A;  4M7D B;  3QKJ A;  4N0A C;  4PKC C;  4TVR A;  3M53 A;  2FL7 A;  4NL3 A;  1QP3 A;  2KK4 A;  5HK3 A;  2RHY A;  1AHJ B;  2XIC A;  1D3B B;  4FIB A;  4L5G A;  2HQE A;  5D6W A;  2FVU A;  2VXF A;  3LX7 A;  4A4G A;  3CCE A;  1VQ9 T;  1VQM A;  4OB2 B;  1VQL T;  1NE8 A;  4PJO C;  3CBO A;  1YIJ A;  3CMA A;  1YJN T;  5LJ3 g;  3GLX A;  3E9F A;  2EQJ A;  5KCO A;  2CS7 A;  2WSF E;  4M7A G;  4PJO A;  1M1K C;  5I2S A;  3C4S A;  4M7D F;  4PNO A;  1VQN A;  3E1S A;  3T9N A;  1M90 U;  4LDW A;  2V8I A;  1JJ2 A;  2OTL T;  4BI4 A;  4KBM B;  1KC8 U;  4JLI A;  3CC7 A;  1QVG S;  3OYE A;  5M9O A;  1I8F A;  2K2V A;  2P4T A;  4IUU A;  4E7L A;  3OYJ A;  3JB9 F;  2YLC A;  3L1A A;  2DXU A;  3OYN A;  2PUO B;  5GAN 7;  4C92 E;  5LJ5 e;  2IG0 A;  3MO8 A;  1B34 B;  5KE2 A;  4HA8 A;  1W4S A;  1R8O B;  2KY9 A;  1BI2 A;  5CAI A;  5FRM A;  4M7D D;  4M77 E;  2LTO A;  4UC4 A;  3JAM E;  3G71 T;  1VQ6 T;  3MEW A;  3PIO A;  3BDU A;  3FC3 A;  2YLB A;  3CCU T;  1JB0 E;  4HCC A;  4ZGD B;  5GAM e;  3JB9 D;  3CCS T;  4ELZ C;  3GNG A;  1YI2 A;  5LJ3 f;  2PVD B;  1N9R A;  2RI5 A;  2PQW A;  2RJC A;  3F70 A;  2HNI A;  3P8D A;  3RIR A;  5LJ3 j;  1MHN A;  2OAU A;  3INZ A;  3JCM P;  2QEX T;  1LJO A;  2ZPH B;  3L2W A;  4BAC A;  4A4K A;  3I55 T;  4FL6 A;  4JRK A;  2OTL A;  4IUP A;  2EAY A;  4QVZ A;  4FM4 B;  2ZPF B;  2DKG A;  1Q81 C;  2ZPE B;  3NTK A;  5A0G A;  2JN0 A;  2XG8 D;  2O4X B;  2V8K A;  4FT4 A;  3UDC A;  3M54 A;  2KQW A;  1G3W A;  3O8V A;  2EJG A;  1BYM A;  4QQD A;  1Y96 A;  4BD3 A;  4Y28 E;  3KXT A;  1M1G A;  1WQW A;  3E19 A;  1NZ9 A;  4M78 E;  4JDS A;  5C6S A;  1U1S A;  1KQ1 A;  3GF5 A;  3GNF B;  3RKW A;  2DZC A;  3OW2 A;  3QHS A;  5GAN 4;  1FWZ A;  2FHD A;  2RI2 A;  2HBP A;  3CCJ T;  1Q82 U;  1N9S A;  5HKC A;  1OZ2 A;  5LJ3 h;  4PLL A;  1KD1 U;  4C92 B;  3FB9 A;  4EDU A;  5GAN 2;  1ZQ1 A;  2CZ7 B;  4EMG A;  5HK0 A;  3JCM V;  4ZTF A;  3QZ5 B;  4RG8 A;  3S6W A;  2BUD A;  2CYZ B;  4M7A E;  1UGP B;  3CD6 T;  1SSF A;  4M77 B;  2QEX A;  2DAQ A;  5GAO r;  2CZ1 B;  3RUX A;  2QDY B;  4BE0 A;  3CXC S;  4C8Q C;  1YJW A;  3QBY A;  3CC2 T;  1VQ7 A;  4WF2 A;  2V8J A;  2E10 A;  4FSX A;  4C92 F;  2HQX A;  2RA2 A;  3C94 A;  2CZ0 B;  4NL2 A;  4X34 A;  1HXD A;  3EAE A;  4C8Q A;  5LJ3 e;  1K73 C;  4GY5 A;  1KQS S;  3G4S A;  2RHZ A;  3CCM T;  4J83 A;  2M9U A;  3ER0 A;  4C0D B;  3DLL A;  4M77 F;  3I56 T;  1ZBX A;  5FLX E;  1W2B A;  2E65 A;  1BI1 A;  3R6O A;  4XTY A;  2YHT A;  3PTA A;  4C5E A;  3OSV A;  1YJ9 T;  4O6J A;  3URG A;  3LLR A;  4OB0 B;  4C5G A;  4KUL A;  3CPF A;  3LGL A;  4L59 A;  5KCH A;  3ZBD A;  1XOV A;  5KH6 A;  4M78 B;  4MMK A;  3J80 E;  2DTH A;  3RMS A;  4BDZ A;  5CKF A;  3OYH A;  1UEB A;  1X01 A;  2VC8 A;  3OA6 A;  2FB7 A;  2X4W A;  5DLQ E;  3HSB A;  4A54 A;  4DA4 A;  3CBM A;  2PUK B;  5C0M A;  4EMH A;  4OGE A;  1NJI U;  3LW5 E;  2P0P A;  1W2B S;  2QQB A;  3QXE B;  3CCL T;  2AHJ B;  3KBG A;  4M75 B;  4D6W A;  4BY6 B;  2VYT A;  1V29 B;  4M78 F;  4O5V A;  4LDX A;  3A8H B;  4M7A B;  5CVI A;  2QA4 T;  2DD4 A;  4Q5W A;  4F7U A;  1Q81 U;  4M78 G;  4BI8 B;  4HCB A;  3I56 A;  2G3R A;  3CCQ T;  3HRT A;  1WPY A;  1YIT T;  4L6V 5;  3JCM b;  4V2S A;  2DTO A;  2R5A A;  5GAN 6;  1YJ9 A;  1Q86 C;  1KQ2 A;  2IVW A;  3OYF A;  5IT9 E;  1LNX A;  1VQK A;  1X6O A;  2QQR A;  4M7A F;  3OB9 A;  1YHQ A;  4N4H A;  2EYQ A;  4NS5 A;  1TH7 A;  1PSE A;  2P0Q A;  3WVD B;  5GAO p;  2WSE E;  5GAM j;  4A4H A;  3M55 A;  3MCA B;  2ZPI B;  2ZCF B;  1JRI A;  1VQ5 T;  5FRO A;  4A53 A;  1QW1 A;  4KT0 E;  4N0A A;  4ZGE B;  5LJ5 h;  4XTW A;  4LDV A;  1XQH A;  3CCR A;  4M75 G;  2EFI A;  1I5L A;  2NLU A;  3QSU A;  1VQ8 T;  2E12 A;  1M4Z A;  3CCL A;  1M8V A;  3S3M A;  3HRU A;  4JLG A;  2O01 E;  3SWN C;  4M7D C;  4M7A D;  3JCM d;  1XTD A;  5GAM h;  1N8R C;  4JUV A;  5GMK i;  4IUQ A;  1OZ3 A;  5GAN d;  2R5M A;  3L42 A;  3VUB A;  4BI3 A;  2DEQ A;  2H3J A;  3J81 E;  3CCQ A;  4JS4 A;  3SWN A;  2CZ6 B;  4BE2 A;  3JCM J;  3M56 A;  4II1 A;  4C5H A;  4M7D A;  2K4Y A;  4Y91 A;  4MZT A;  3A8O B;  4IUV A;  2WAC A;  4QQG A;  1X75 C;  4XTV A;  3VYH B;  2KDS A;  2R57 A;  1H3Z A;  3CBP A;  2QI2 A;  4IUT A;  2BKD N;  4PJO G;  1BKB A;  1H64 1;  3X26 B;  2OTJ T;  1VQ5 A;  4CRI A;  3LWH A;  1VQL A;  3PMT A;  4QW2 A;  1VQ9 A;  2JNG A;  2EJF A;  2XI9 A;  3L2V A;  2ZPB B;  2LCL A;  2RHI A;  1YJN A;  2WSC E;  3OBY A;  3SB2 A;  1HK9 A;  1P92 A;  4MDX A;  4HT9 A;  4ATO A;  3M4Y A;  2HD0 A;  3GP8 A;  4J5Y A;  4OMF B;  1PSF A;  4PL6 A;  3DKM A;  3WVE B;  3NTH A;  3M57 A;  3JCM W;  1O75 A;  2YRV A;  1WJR A;  2LQ8 A;  3M4G A;  2K5L A;  2Y4X A;  3OMC A;  3QYG B;  3JRZ A;  2QQA A;  5GAO l;  3JCM c;  4KUD K;  2E5Q A;  1Y96 B;  2RO0 A;  4C5I A;  2DZ9 A;  3FLG A;  4C0G A;  2DIG A;  5CQX A;  5GAO n;  3CXC A;  3GPL A;  2FYK A;  5GMK j;  5GAN j;  1QVP A;  1UGS B;  3Q1J A;  2EWN A;  3L2Z A;  3A8G B;  3VU3 C;  3OYM A;  2KVQ G;  2QTX A;  5FU6 C;  1VQ6 A;  3BFM A;  1FXX A;  3OYC A;  1U1T A;  2Y90 A;  3G71 A;  3RES A;  2LC4 A;  2DVE A;  3ASK A;  1EIF A;  1KQS A;  1KHI A;  2LDM A;  3QDR B;  4ZGJ B;  5FU7 B;  4ELY C;  3TCJ A;  1QP2 A;  2F69 A;  2LCC A;  4EMK C;  1RI0 A;  3L2U A;  3CCS A;  3MEU A;  4M75 E;  4IKF A;  4P5N A;  2X4X A;  3HP9 A;  1VQO T;  2MWP A;  4EMK A;  5CK9 A;  2LNV A;  3MEA A;  4J7F A;  4XTZ A;  3I55 A;  5CIU A;  5KE3 A;  4C0Z A;  4PLI A;  1K9M C;  5IN1 A;  3NFC A;  3E9G A;  3G6E T;  1M1K U;  5DY9 A;  3QO3 A;  2LRQ A;  2ZPG B;  2LVM A;  4HKE A;  1BI0 A;  3QJY A;  1GXI E;  3LH0 A;  2A3L A;  3DB3 A;  3G7Z A;  4C92 C;  5DM7 R;  4VUB A;  3FIF A;  2PU9 B;  2X4J A;  2XID A;  3QG1 A;  3V8K A;  2DXC A;  1N8R U;  2RHX A;  3RMQ A;  5A2Q E;  3H8Z A;  2DD5 A;  3LYI A;  2E70 A;  3CCJ A;  2QQS A;  4M77 C;  3QII A;  4XU1 A;  4PJO E;  4RMO A;  1M90 C;  4ME7 A;  2XHC A;  3NTI A;  5L8R E;  4DOW A;  3OYL A;  1KC8 C;  4YTL A;  3WXM B;  3OS0 A;  2I2L A;  4C92 D;  2XKO C;  5GMK e;  4B9W A;  4N4G A;  3J7A F;  3OYB A;  5GAN e;  4HCZ A;  2RK1 A;  3HHT B;  3MP6 A;  5EG2 A;  3ZFJ A;  3CCV T;  1VQO A;  5GMK l;  5I2M A;  1JBM A;  3TEE A;  4C8Q G;  2XDB A;  2MWO A;  3CD6 A;  4C0D C;  3OYA A;  2F5K A;  2MMP A;  4DOV A;  1S72 T;  4M77 D;  2A7Y A;  3CC4 T;  2QXF A;  4A4F A;  5GAM d;  3CPW A;  4BDY A;  2E1H A;  2K3X A;  2JVV A;  1G5V A;  3CC2 A;  1KG1 A;  3QPH A;  5GAN 8;  3G6E A;  3EFS A;  4OP0 A;  4XQ3 A;  3TRE A;  2XK0 A;  3X20 B;  5I21 A;  2JZ2 A;  3VV0 A;  2KAF A;  4R56 A;  3CCM A;  3OYK A;  3JB9 H;  3OQ5 A;  2B8A A;  3PFS A;  4DQ2 A;  2XDD A;  4XTX A;  4M78 C;  3FRN A;  1Q7Y C;  1I81 A;  1YBY A;  1RL2 A;  2P0K A;  3HKS A;  3OSS C;  1BI3 A;  4OF1 A;  3CCE T;  2DXB A;  1I4K 1;  3TU4 K;  3JSC A;  4GLK A;  4M75 F;  1OI1 A;  3JB9 I;  1YIJ T;  2MAM A;  1BIB A;  2LQK A;  3CPW S;  3CMA T;  2ZZD A;  1QVF A;  2K3Y A;  4LDU A;  5J3B A;  1N6A A;  2LT1 A;  4BY6 C;  4M78 D;  5CQY A;  3BY7 A;  4M7A C;  3M5A A;  2DO3 A;  4PJO B;  1KHC A;  2QQ9 A;  3CC4 A;  1OYX A;  1FX7 A;  1XNI A;  4F7U G;  2D9T A;  4M7A A;  3OS1 A;  3FJP A;  1N27 A;  2DXT A;  1Q82 C;  3OYI A;  3HFN A;  4M75 D;  4JS5 A;  2QA4 A;  3OS5 A;  4J6Y A;  1KD1 C;  3OY9 A;  1ZHI A;  2E6Z A;  2GFU A;  2L8D A;  3MP1 A;  1K9M U;  4OB3 B;  4PJO F;  1QVF S;  2RJE A;  3HRS A;  4LD6 A;  4XU0 A;  1YIT A;  4J6X A;  5CKB A;  3EFR A;  3HFO A;  1UB4 A;  5LJ3 d;  3JCM g;  5CR2 A;  2X4Y A;  1K73 U;  3RER A;  5GAN g;  2DIQ A;  4XAX B;  1NPR A;  3VJP A;  2MF2 A;  1D3B A;  3OYY A;  2RH2 A;  4QQ6 A;  3L2Q A;  1YI2 T;  2KSS A;  3MEV A;  5A0D A;  1S72 A;  1Y71 A;  2RJF A;  2KMT A;  3N5B B;  3C12 A;  4OGC A;  1YCY A;  1M1F A;  4N4I A;  4JRP A;  1IZ6 A;  3C95 A;  4C8Q E;  1NPP A;  5HY6 A;  4XK8 E;  4IUR A;  4B9X A;  3PIP A;  4PJO D;  3V8L A;  3QYH B;  2E6N A;  1UGR B;  2RK2 A;  2RM4 A;  2JOY A;  5GAO q;  3ME9 A;  4RCB A;  1VQ8 A;  2D6F A;  3PGG A;  2RB6 A;  2DJZ A;  4JRQ A;  4M7D G;  4MML A;  1WNL A;  3M9Q A;  3QUI A;  3HL8 A;  4XU2 A;  5DLO A;  3A8L B;  2EQU A;  1B34 A;  4EPC A;  3JB9 G;  3QZ9 B;  3FDR A;  3UT1 A;  2DPP B;  4BUG A;  4X9C A;  1BIA A;  2RJD A;  1IRE B;  4MZM A;  2GQV A;  2XDP A;  3JCM f;  3FEO A;  3SFM A;  2JTF A;  5CO7 A;  3GIB A;  5GAN f;  3MET A;  3CEY A;  3OS2 A;  1VIE A;  1M5Q 1;  1JJ2 S;  2EQM A;  5FRN A;  2K5I A;  3A8M B;  4RG2 A;  1NJI C;  3DLM A;  1G3T A;  1Q7Y U;  3CME T;  1K8A C;  2OTJ A;  5FU6 B;  3QJ6 A;  1Q86 U;  2PVG B;  2Y4Y A;  3MP8 A;  4QVD A;  1WJS A;  4Z02 A;  5AYF A;  3PNW C;  2PVO B;  3P8H A;  1YJW T;  1VQ7 T;  4EMK B;  2E41 A;  3JB9 J;  2F5T X;  1WJQ A;  2BIV A;  5D6Y A;  4F7U E;  5IAY A;  3JCM X;  2LX9 A;  2O4X A;  2RI3 A;  2K57 A;  3G4S T;  3V7C A;  2EJ9 A;  5LL6 S;  3S3N A;  3X25 B;  1VQ4 T;  4QVC A;  2GCX A;  3LWI A;  5CCA A;  4NOY A;  3JCM h;  4C8Q B;  5GMK h;  2CKK A;  5GAN h;  3OMG A;  4ZTJ A;  2R58 A;  4XU3 A;  1VQP T;  3H6Z A;  5GAN 5;  4BE1 A;  3UPU A;  2D0Q B;  4KUI A;  5FU7 C;  3V7R A;  2EIF A;  3BDL A;  2M1H A;  3S3O A;  2VV5 A;  4E7J A;  2DK3 A;  3MHX A;  2GFA A;  4C92 A;  2VGN A;  4JJN K;  1UGQ B;  5GAO m;  1VIF A;  4C8Q F;  5LJ5 d;  3ZEH A;  4FT2 A;  3CME A;  3LGF A;  3P8B B;  3X24 B;  1MGQ A;  4X9D A;  2L3R A;  4A4E A;  2M16 A;  3PMI A;  3VYG A;  3OYG A;  2C06 A;  4CI0 C;  5J26 A;  4M77 A;  3KUF A;  3V7S A;  5LJ5 g;  3JCM e;  2E64 A;  2VXE A;  3SDZ A;  5GAN 3;  1O9S A;  3A5Z B;  4MZP A;  3OW2 S;  2EKO A;  2GF7 A;  4J8O A;  2K5F A;  3AHU A;  4J7I A;  5J39 A;  4M7D E;  4JRI A;  2M0O A;  2CGH A;  1VQ4 A;  3M59 A;  1G3S A;  2L5Q A;  4OVA A;  3X28 B;  4HT8 A;  4C92 G;  4C8Q D;  5CKH A;  5GAM g;  1VQP A;  3OYD A;  1LOJ A;  4F7U B;  4LD9 K;  1M9S A;  2X35 A;  1Y07 A;  1G3Y A;  4OB1 B;  1VQK T;  1Y7X A;  2EQK A;  3BW1 A;  4MDW A;  2VUB A;  4M77 G;  1YHQ T;  1U8R A;  4E7K A;  3GOX A;  4E47 A;  2RHU A;  3L2R A;  1WQ7 A;  3M58 A;  3OBW A;  3VUZ A;  3CCU A;  4M78 A;  1VQM T;  4ZN3 A;  3CCR T;  2RD1 A;  4F7U F;  4LDY A;  3HPW A;  2MI6 A;  4ZN1 A;  4E7I A;  4FU6 A;  5LJ5 f;  2HAX A;  3CCV A;  3JCM Q;  4M75 C;  5LJ5 j;  1VQN T;  2VGM A;  1K8A U;  1VUB A;  5D6X A;  1WGS A;  4M75 A;  2JUF A;  4E7H A;  3RKX A;  3CC7 T;  4BB7 A;  2XD0 A;  5A0L A;  4C0F A;  4RCC A;  2DTI A;  3DB4 A;  4XTU A;  3VKI A;  4R55 A;  5CKE A;  4RKU E;  3RKY A;  3UWN A;  5GMK m;  5GAM f;  2LT4 A;  2XU8 A;  2ZGW A;  2JTM A;  3PT9 A;  4J6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...