3NTIA

Crystal structure of tudor and aubergine [r15(me2s)] complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
163
Chain Sequence
ELHNCVVVQFDGPMSFYVQMESDVPALEQMTDKLLDAEQDLPAFSDLKEGALCVAQFPEDEVFYRAQIRKVLDDGKCEVHFIDFGNNAVTQQFRQLPEELAKPARYSRHCELDASTISAALLQSFIDTRFSETFQVEILATKGTGTHVVRLFYQSKNISEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maternal protein tudor
publication title Structural basis for methylarginine-dependent recognition of Aubergine by Tudor
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 36
structure length 163
sequence length 166
ec nomenclature
pdb deposition date 2010-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ntiA02
2.40.50.790 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ntiA01
3PFSA 2LCCA 3UWNA 4A4HA 4IUQA 3C4SA 3MEUA 3FEOA 4IUUA 2GF7A 3L42A 2YRVA 3META 3MO8A 3PMTA 3OYLA 2RI2A 1OYXA 2M1HA 4C5HA 5C0MA 2GFUA 5CIUA 2RO0A 2L3RA 5KCOA 2RJCA 3OYEA 2LDMA 4C5IA 3MP6A 3LYIA 4N4HA 2EFIA 4GY5A 1N27A 2IG0A 2JZ2A 2EKOA 2JTFA 4X34A 3FDRA 3QKJA 3L2UA 4LD6A 2VYTA 4E7IA 4BDYA 3MP1A 4QQ6A 5M9OA 2P0KA 5KE2A 3E9GA 3S3OA 2QQRA 4IUPA 3LH0A 2RI5A 3F70A 2QQSA 3DB4A 1H3ZA 3NTIA 3O8VA 2F5KA 5D6YA 5KE3A 3OYBA 3OYKA 2EQUA 1G5VA 1KHCA 3M9QA 4OVAA 4C5GA 2DIGA 2R57A 3OYJA 5IAYA 4E7LA 3DB3A 1OZ2A 2B8AA 4IUTA 3E9FA 4L59A 4ZTJA 3OA6A 3QBYA 3MEWA 4N4IA 3OMCA 3NTHA 3EAEA 2M0OA 4N4GA 4QQGA 3OYCA 4UC4A 3OYIA 4IUVA 3QJ6A 3UT1A 3S3NA 1WGSA 4Z02A 1RI0A 2EQMA 3LX7A 4A4FA 5FROA 2XK0A 4A4GA 2RHZA 2GFAA 2BIVA 2O4XA 2X35A 2NLUA 5C6SA 3OS2A 3OYAA 4E7HA 2DIQA 4E7KA 3QIIA 3NTKA 3H8ZA 1MHNA 3P8HA 2FHDA 3ME9A 4Q5WA 2R5MA 4PL6A 3OQ5A 3BDLA 3L2QA 4BE0A 3L2RA 3LGLA 3LGFA 3L2VA 3MEVA 2X4WA 2RJDA 3OY9A 1OZ3A 3GOXA 4E7JA 5D6XA 3PMIA 5FRMA 2HQXA 4IURA 1WJSA 2LTOA 3S6WA 3OS0A 3FC3A 3MP8A 1XNIA 3OYFA 4BD3A 4QVZA 3MEAA 3OMGA 5D6WA 2E6NA 4BACA 2RHIA 2HQEA 4PLIA 4QW2A 3P8DA 4C5EA 3L2WA 2RI3A 1WJRA 1SSFA 4RG2A 2K3XA 2CKKA 5IN1A 2G3RA 5J39A 4PLLA 2LRQA 2M16A 2EQKA 2LVMA 4B9XA 2EQJA 4II1A 3ASKA 3KUFA 3ZEHA 3CEYA 3H6ZA 3FLGA 4BDZA 3OB9A 5KCHA 2MWOA 4FL6A 2RJEA 3S3MA 5J26A 3DLMA 4CRIA 4BE2A 2RHYA 3OYDA 3OYHA 3LLRA 2RHXA 5FRNA 1WJQA 2R58A 4NS5A 2D9TA 2K3YA 2RJFA 3OYMA 2X4XA 3Q1JA 2DAQA 4HCZA 5KH6A 2L89A 2MWPA 4BE1A 3OYNA 3PNWC 2PQWA 2R5AA 4QQDA 4B9WA 2L8DA 4ZTFA 2BUDA 3SD4A 4IKFA 4EDUA 1OI1A 3OYGA 2WACA 2X4YA 2RHUA 2E5QA 4FU6A 4A4EA 2O4XB 3OS1A 2BKDN 2XDPA
chains in the Genus database with same CATH superfamily
3PUXA 2OTLQ 2J05A 3A8HB 2EGEA 1K73R 2M00A 1HQMC 5I6YA 2FMCA 4A3CG 2GF7A 2Y4YA 2V26A 4GNXC 3KF6A 5T1GA 1TXQA 1FNVA 4KD4A 5EC7A 1DOLA 1LLRD 1YHQT 4GNXA 3PTAA 2ES2A 4IFDI 1W4SA 2GBQA 5M3FB 3L3OC 4PZ6A 1B9MA 3OWFA 2UUCL 3FIFA 4JS5A 1GUGA 2H3EB 4MN3A 5LJ5e 5JPMC 1GFCA 2EFIA 3QR8A 4C92G 2LMJA 3EGDB 2YUNA 4NPSA 4Y7NB 4CC2A 4A3CH 1A3VA 1PFMA 2LQ8A 4LD6A 1VQ8A 1Q86U 2F0OA 1GUTA 2IY5B 2B2WC 3EROA 4LF7Q 2OQKA 1IL2A 1YWOA 5CV4A 2JA6B 2MFIA 8AT1B 1Q7YU 3TZUA 4M77E 1JJCB 2CUBA 2B8FA 4LDWA 4OIJA 3HOZG 1H8KA 1UJYA 3T13A 5EAYA 4DR7Q 3R2TA 5FWBA 2KBTA 3CC2T 2O2OA 2M0OA 3EAEA 3QO3A 1WCMH 1VQ5T 1HCZA 4I7ZC 4M75B 3NWSA 3FJPA 1M1FA 1EYAA 3ERSX 4GZYC 1JJ2S 2KHJA 2CP0A 4G7ZC 4DUYL 2O4XA 1ZUYA 2XMFA 2MPXC 3S1MH 4PJOC 1Y8PB 1MSHA 2DIQA 1YITQ 3QIIA 1N33Q 3NFCA 3HRSA 5GQOA 2N78A 1MHNA 1PH2A 2IW3A 1Z6HA 1OU8A 1RAGB 2LCLA 5DEHA 1EY0A 2WB1B 1RAFB 1NJIR 3E9IA 4K14A 5JOBA 1WXUA 4DOVA 2NUCA 1EY9A 4IPDA 3DUZA 4JI4L 4KUIA 1AFPA 3V7CA 4JI0L 4P2CB 5CKFA 1IBKQ 1G2TA 3MEHA 2HUGA 2LJ1A 1RODA 4M75D 5GANd 3T51B 4IURA 1KC8R 2NN6H 4JRQA 3IRBA 1GXIE 1K3BC 4R1JA 4C3HH 2MAMA 2O31A 3HP9A 3MEAA 1X3QA 5IOCA 1EYCA 4R8IA 3C94A 4LXCA 3LH5A 2JA7B 1JO8A 2KQWA 3CPWA 3REAB 2QW7A 2I07B 1KDBA 4K5XA 3G71Q 3NBIA 3RNJA 5GAOp 4QUFA 4P5NA 4WFN3 2QEXT 2F0TA 3BVGA 4FDBA 4ZUIA 2F2VA 1YJNT 1W2BA 2KROA 2JT4A 5BN3A 1V76A 1NPPA 4J15A 4JBWA 4POFA 2KGTA 4CJ0B 3SK6A 1WTPA 4K2KA 2F5TX 3D31A 1JORA 1Q82C 4AFZC 2I5LX 1MNDA 3DKMA 4O5VA 1TS4A 2EYPA 4ESRA 1AE2A 2D62A 1VDZA 2HHHL 1UAPA 1O75A 3OYDA 1ZEQX 3M57A 2DXUA 4J9CA 2RJFA 3VYGA 1GD7A 3HKZE 3KLSA 4H44C 1N36L 4M7DE 4R4CA 5LMUL 2KEDA 4H02A 5C44B 1JR0D 2RDFA 4P75A 3P75A 3SK4A 3D4WA 4B9WA 1K3RA 1IBMQ 1ML0D 2NN6I 2KR3A 2A3LA 4GLKA 3OYGA 1JEGA 3OSSC 3VYTA 5CV6A 3S9WA 5KYYB 1PRTF 2MP1A 4GOPC 2LC4A 1TWAB 4A3JG 1CT1D 1IBLQ 3GTOH 2BOSA 1WHLA 4MZMA 1G3YA 2K5DA 3C12A 4ME5A 1EU4A 4GOPA 4HN7A 3BW1A 1M1GA 1CKAA 4F7UG 2YYZA 3C4SA 4J6XA 3LGJA 1W6XA 2KI7A 1JWUD 4C92B 4HEDA 3BYTB 1H9SA 1Q46A 3VS5A 4J8QA 2C06A 3SE0A 3G71A 4KY6A 4JI8L 1XPOA 3GTJB 2XKOC 3F2UA 1C0AA 2HZYA 5IE8A 2RQRA 1N27A 3TEEA 3UATA 1PRLC 3BS1A 3M53A 5ECAA 2ZCFB 1EY6A 3K7AB 5KYLA 3J7A5 1VQPT 4BA2I 3G4ST 2F0FA 2LXJA 1KK7A 4TSSA 1O7YA 1I94L 3CCJQ 1KAWA 5KIXA 1G91A 1AOJA 1D0YA 1C7YA 2HAXA 4L5TA 3CKIB 3HOZB 3CBMA 4KKSA 3OTOL 1WQWA 3OSVA 3U58A 1I1JA 4C3JB 4JPBW 4RTXA 2I0NA 2EQUA 1KNEA 3OW7A 1VQ4Q 5M5WH 2F1LA 2CP6A 2DIGA 1FMVA 3M0UA 4JW0A 1QVGS 1HQRD 2ZJRA 4X1VA 1NNXA 5IP7G 3EIVA 3KXTA 1TWHH 5C0XJ 4QQGA 2K5IA 2YRDA 3HZXA 4IUVA 3I91A 3K5LA 3RUXA 2OAUA 3VRZA 4EVOA 3GV3A 1N8RR 2A6EC 2GFAA 1S40A 5GMKi 2EDGA 3VUBA 2KHIA 1S5CD 3HOVH 2J7ZA 5IP7H 2RF0A 2H5XA 4EQOA 2K52A 1Q1EA 1O9SA 2PW5A 2W10A 4PL6A 3K6OA 2CCZA 1NE8A 2EJMA 3L2QA 4MZTA 1YITT 3BZCA 3MAQA 2G9DA 4XQJA 5FLMG 1VYTA 2X4WA 3MEVA 3KFVA 2F0HA 1PXUA 5FRMA 3ULJA 2NVQH 3NBHA 1E7ZA 4KN4C 3CXCS 1Q12A 1H92A 2O5IC 3QZ5B 4BD3A 3QB3A 5I21A 1DJ7B 1J6QA 3K5OA 2LNHB 2B63B 1ILPA 3TSZA 2QYZA 1SNOA 1EYDA 2HSPA 5C3WA 4XQNA 1N34Q 2JE6I 1B3AA 1XTCD 2ENBA 4IPHA 1NEGA 4OHJA 1NM7A 5CKHA 3RKYA 1VQ4A 1SNMA 4DV4L 2VGMA 2EYHA 4WCIA 3AU7A 1K8AC 1Y96B 1QVFP 5JJLA 4IN3A 3DWAA 5HK0A 3H41A 3S1QB 3JCMP 1D09B 1HJPA 3GTOB 2VB2X 3VS2A 2NVTH 5CK9A 3CCRQ 2BH8A 5ELEA 2YU9B 4HSPA 1GL5A 1D8LA 2LCSA 3FKIG 5M5YH 2RJEA 1GFDA 3GTGH 5J26A 4DFAA 4BE2A 2LJ3A 4XDXA 3GTLH 2D8JA 3VV0A 1IKMA 1L1OB 1JB0E 3EHRA 2K32A 1EZ6A 4A3FG 4JCVE 3Q1JA 4L5QA 3CW2C 4A3JB 1I4K1 1M2OA 1PWTA 3QHSA 2PQEA 4K6LA 3S1RH 4P74A 3J7AV 1KQ1A 4OMMA 1S5FD 1FL0A 2MIOA 3HRTA 1NEBA 2PVOB 3QYHB 4F7UB 2PMZB 3Q22A 1G6PA 1SMYD 3E6ZX 4WRDA 3FKIH 1XOVA 3PO2H 3HGBA 2HT1A 3CCLT 1J3TA 3KLSX 2ZPFB 1CI3M 1WTQA 1CKMA 5HKCA 1KDCA 2PI2E 4NW2A 3TSSA 4KKUA 1H9RA 5GAGC 5I2SA 3BVZA 5FLXL 3P20A 2ZXPA 1PFNA 3TEHB 4R0KA 3SEMA 2K28A 4KTAA 3JCMb 5C4HA 4A75A 3FJ5A 3I72A 3UA6A 4AH6A 2WP8J 1VQ6Q 1CSQA 1RIPA 3E19A 4RKBA 1ILQA 2CVRA 2VVKA 4C5IA 1TWHB 1WYDA 3RLNA 3LWUA 4A76A 4J9GA 1PTOH 4J9IA 1JOOA 5FO9B 3MKDA 3HL8A 1D0ZA 5CVIA 1ZXTA 3M7GA 2RSOA 1KLGD 4RGOS 1SE4A 1VQ7A 2D5DA 4Y28E 4EMKA 1IL8A 4QQ6A 3E3XA 1WNLA 1PLFA 3BY7A 3M0PA 1XWEA 1R77A 2QQRA 2SOBA 2JA5G 2YXYA 4FW2A 1S4ZA 1Q7YC 2NVXH 2O5JC 5KE3A 2F3VA 1TU2B 1QUQB 4LN2A 3CCMQ 1UG1A 4DEXA 4HT8A 3MXGA 1FXXA 4OEMB 2QQBA 1KRSA 3S24A 2E2HB 1LTGD 1YCSB 4MNOA 3M4GA 4ID6A 4A3MG 1U4MA 3D4RA 2JP1A 2KYMA 2KCCA 3M5AA 2UUAQ 3S17H 1M30A 1EEID 5FU7C 5CV7A 5A2QL 3WOFA 2X35A 4E7HA 1X9NA 2EYJA 3EG3A 1I07A 2JQOA 2A19A 2EVBA 1EIGA 2QDBA 1F9QA 2KT1A 2Y4XA 2FHDA 2QQ9A 2AKKA 4CKCA 2BE5D 1MKHA 3F2BA 4X65L 4IQZA 1YI2Q 1ZBXA 3K0YA 1NSNS 3OY9A 4XYQA 2NVTB 2DKGA 1VQ9A 5D6XA 1SYDA 4RUGA 1YNJD 1X01A 3WXMB 2JK8A 2RNAA 3SWNC 1O7IA 4JJBA 2MI6A 5DLQE 4IPCA 3GTLB 3EGDA 4QVZA 3AT1B 2KA7A 2LXKA 3WVDB 1BNZA 3A54A 2MYSA 1WDXA 4ZNXA 4X3KA 5GMKh 4HMIA 3S1RB 1QMCA 1Q90A 2XNAC 4LDXA 4RTZA 4BI3A 1RAHB 3F2DA 1X6OA 2YTVA 4DAVA 1AWOA 2Y0SE 4JI0Q 2A6HC 3CCMA 4QKUA 1I50H 2PNHA 3FKIB 5BR8L 4X6AH 1K0XA 2CT4A 3OW2P 4LF6Q 1Q81U 4A3FB 3ONAB 2DX1A 4RKUE 4BDZA 3I9QA 1QQJA 2K79A 1I4QA 4M75C 4CC4B 4FL6A 3S3MA 1SJHD 3HKSA 3B6YA 4DUZL 2ZJQA 1I4XA 3MEFA 3LLRA 4M75A 4X62L 2IPKD 4DV6L 2AQ3B 2SRCA 1AP0A 2D2CC 5C6AA 5IWAL 4JI5L 2F0QA 5IYDG 4BE1A 1PTOB 4LF5Q 2EZVA 1YI2A 1WTOA 3VYUA 4L6V5 3GD7A 3E0JA 1U0LA 2E5QA 4R55A 1CKBA 1T0JA 4KGZB 2NZHA 3TP6A 1E2WA 3DLLA 4GLAC 1F2YA 2AHOB 3GP7A 2ZPEB 2FZGB 2B2YA 2NVXB 5GAMg 2KVMA 3L42A 2K6DA 4MZPA 2E74C 3A8LB 1WTXA 4X9DA 5EGTA 1PTOD 1U4LA 3OW2A 1XTDA 2GQIA 3KDFA 5GAMj 2QA4T 2AUKA 1UE6A 2SDFA 2RJCA 2A8VA 4NXML 2DJFC 4N4HA 2XTIA 2MNAA 2HCCA 5DAUA 2JA5B 2JZ2A 2B2TA 4FNFA 5GMKe 3A74A 3TP5A 2BA0A 3S17B 3PF5A 4DK0A 2LFNA 2LKVA 1KD1U 4DEYA 2DYIA 4JI2Q 2I2LA 5JVH3 2ZPHB 2ZGWA 3LH0A 5K5PA 1WHJA 5FWCA 1UEAB 1JC7A 2K5QA 4M7AG 3L2ZA 4RA8A 4KHZA 4YIJA 4GKJL 1VQCA 2F0JA 3S2HH 5CYUA 1OTCA 2OTJT 5IP9G 1VIEA 4A3MB 2DE0X 1PHTA 2R92B 3LX0A 4LF7L 4L59A 4O1NA 1GCQC 4WJ3M 1IREB 2DXTA 2CP3A 4C8QG 4J9HA 1VCIA 3EFRA 3ERQA 4A3DB 1AT1B 2ZM6L 3IFTA 1HNXQ 1T9HA 2RA2A 3JAMc 3QJ6A 1Q8KA 2DEQA 5C4JB 1RLQC 4HJAA 1W6KA 2D0NA 3CC4T 1PNJA 4DR1L 4CC3A 3FMCA 2JJ9A 1WFWA 2NLUA 1GUSA 2VWFA 4PJOD 1H95A 4C92C 3ULRB 2CDTA 4XU0A 5FW9A 2YTYA 4LW1A 1TS9A 1QCBD 1AN8A 1NUCA 1TKWB 4L8JA 3Q6SA 4PQXA 4Y92A 2IX1A 4KH0B 2E70A 1UUEA 1LYLA 2FFKB 4DQ2A 1DGSA 2Z8LA 2XWBB 4A3KH 2HKQB 1YJ9A 2P4RA 1EIYB 3EG2A 1O78A 2VL6A 4BY1G 5IGGA 2K57A 4HIMA 2EY2A 5IT9c 5GAEC 4JYAL 2F2WA 1BCPF 4QW2A 2HQEA 2QXFA 1FD7D 3M4PA 1MMDA 4HCKA 3L2WA 1IBKL 4B3TQ 3KJOA 4DU9A 5NUCA 3AQQA 1K76A 3CCSA 2RKSA 5D65A 3J80L 3V8LA 2E2JH 3SHWA 4N8X1 4O0AA 4BY1H 3P1HA 2RM4A 4NMZA 2J6KA 1S5BD 2JEAI 4RTUA 1EZZB 4X9CA 4DBRA 4P71A 4GKKQ 2QGGA 1SEMA 2XI9A 3JB9H 4XU1A 2RHYA 2E75C 2YUQA 1PSEA 3QXEB 4JOIC 2P4TA 4DV4Q 4X3SA 1M90C 1GUOA 4M77G 1BBUA 1SE2A 3IKJA 4JOIA 1GHKA 3QWXX 3K58A 3L9AX 3QPHA 5KYWB 4HJ7A 2PZTA 1VQOQ 1NE3A 5M5XH 1CKNB 2HD0A 1SNDA 4Y52H 2EJGC 1JJ2P 1OO9B 2XU8A 2R93H 5GAN5 3S1NH 1G2SA 4WJ4A 3M4OB 3J7ZC 3INZA 2HDAA 2ZPGB 3MEUA 4IUUA 1IZ6A 5LJ5f 5JPNC 3QYGB 1K4US 3J7YW 3K81C 2FINB 4QVDA 3OYLA 5IH2A 4DR2Q 1IYVA 5C0MA 1VQNA 5GROA 2B3GA 2Z6KA 1R9TH 2Z4IA 1MIUA 5DM7R 1JXMA 2Q8RE 4NP5A 1WTVA 5IHNA 4A93G 4E6RA 4RCBA 3KF8B 3CD6T 4CKBA 3J81i 3BZDB 1D1AA 4JUVA 4PJMA 3PVLA 4M7AB 1D1IA 3JB9I 2EY5A 2QGFB 2C9OA 2A28A 3QDFA 3QKJA 3A0JA 5IY0A 3HOXH 1CA6A 5GAMd 4E7IA 2K1BA 5KYXB 1EY7A 3F2CA 4HR7B 5GAN6 2FMMA 5I9OA 1M3BA 3M3YH 1YNZA 4C8QB 1EUJA 2DTHA 1YHQQ 2E2IB 4A93H 2FZCB 2JNGA 4BY6B 4OVAA 3CCUT 1SE3A 4BXXG 2FPEA 1L1OA 3KBGA 1T3SA 2PNIA 3FB9A 4KHVA 1HA6A 3DB3A 2AKLA 4XTZA 4AMCA 4LUOA 3RESA 4AFUC 1FVIA 1K8MA 1UWVA 5E1FA 3X3NA 3GDEA 3VS1A 1N8RU 1LPLA 1M90R 3I73A 4IFDJ 3OPOA 4C1NI 1SJED 2WSCE 2RD1A 2KCMA 3I4NG 5FO7B 5FROA 2HIXA 2WAQE 5DM73 1I3QH 1I5FA 3J81L 1SHGA 3HKZG 1E2VA 4RCOA 2ENMA 1BBWA 1C1AA 1GUNA 3RLFA 3NP8A 2E2JB 1B8AA 4DNIA 4MZ9A 2GVBA 2DM1A 3BDLA 4TVAB 4BY1B 3C3LA 3CC2Q 4K0KQ 2AWOA 4RTTA 4OO1G 1VQ5Q 3RD4A 2XIDA 2K9GA 3X26B 2RF4A 3FC3A 5M3FH 1X2QA 1EEFD 1MV0B 3RKWA 3EVQA 2DETA 4R4OA 5T1IA 1UUPA 3K57A 2JA6G 4M4ZA 5AJ3Q 1RKNA 2AUJD 3S15B 2PQAB 1NZ9A 3VJPA 1HZAA 4R9WA 4C5EA 1WTWA 1ARKA 1PV4A 4X65Q 4Y7NH 1F77A 1OPLA 4LDYA 2VQEL 4KRTA 2HCKA 2RDGA 3SVMA 1YJWT 3X28B 4ILWA 3JCMV 2KRMA 1ICWA 3GTKB 2JA6H 2BE5C 2DVEA 4R4IA 1QCNA 2KAFA 5CQYA 4PLLA 1QUQA 3RUZA 2K05A 2DERA 1TUDA 2EXZA 2EGAA 3JB9D 1TTHB 4M77B 1N34L 3MTSA 1BU1A 1WX6A 1B2TA 2DJZA 3DLMA 1SHFA 4QMGA 4AQYQ 2RHXA 2ROLA 1S72A 1NMFA 1YP5A 4EQ5A 4DR4L 1SR3A 1YIJA 3PT9A 2QEXQ 1F9SA 2YWWA 1QVGP 2LNVA 2VW9A 1YJNQ 1ENCA 5KGUA 4QCLA 2FB7A 1KQ2A 4IKFA 3OIPA 3QOJA 4XTXA 3CC2A 2HIVA 1V1OA 4M77D 1VQ5A 2X3XD 2BKDN 4IO9A 2SNMA 1SYBA 2KK4A 4LF4Q 4X62Q 4JLGA 2EY6A 2L4NA 4IIOA 2Z4HA 4A4HA 4IUQA 1KFZA 1I4RA 4R56A 1G3WA 4FYXB 1D1KA 2ZTEA 1QJOA 1K8GA 3UDGA 4A93B 1LTRD 5LJ3g 2HL3A 1Q3LA 1K83B 3V96A 2R7ZB 1SSHA 2DD5A 4WTOB 1WHKA 3TRZA 1U3OA 1UE1A 4KY7A 3H3VH 3CF5A 3UPUA 5IYBH 5I2YA 1EWCA 5LJ3j 2PCFB 4OGCA 2JYOA 1K9AA 1TT2A 2DTIA 1VQJA 2L1BA 4GBQA 4M75F 2E76C 2VQFL 1BKBA 1V1PA 4MIUA 1AHJB 1F2LA 1TWBA 2ED1A 4FT4A 1FJGQ 3E9HA 3CPFA 2NBFA 3U4ZA 1KD1C 5CBEE 1UE5A 3EGUA 1ZA2B 1QVGA 1HK9A 3BJUA 3HRUA 5FU7B 1LM0A 5C44G 4DV0Q 3Q23A 1G5VA 4NXNQ 2NB0A 1NG2A 4NXMQ 2GTOA 4EIKA 5K36H 1N5ZA 3R6OA 2QEXA 3I4NB 2ZT9C 3WVEB 1YJNA 2Q2UA 2CFMA 4ELZC 1PTOC 1C4QA 1PYBA 3AHUA 1VQPQ 4F17A 3JAME 3G4SQ 3HKZB 1V8QA 2VUMG 2M0YA 4D8KA 5C44H 4JRIA 1KL9A 4M78F 4OF1A 2DL4A 3G6ET 4RTVA 4GKJQ 3EFXD 2YLBA 3SWNB 4C1NK 4A3EB 4R4TA 3RMQA 1EX4A 4HCBA 4I7AA 4YWMA 2B39A 5EBDA 3CAMA 4ZKCB 3H3VI 1R0CB 1TWAH 5E7NA 4A3BG 1HTPA 4QJFA 3U23A 4BI8B 1RAIB 2LQNA 4OX9L 2DXCA 2UUAL 2VUMH 2B2WA 1VS0A 4FYYB 3CXCA 2ZM6Q 1TWGH 4QY7A 1RDPD 3I5RA 1CQFA 2JMCA 1CM9A 1TS3A 1QZHA 1BI0A 2UU9L 2L9HA 4DR1Q 3CPWP 1DOKA 2X4JA 2EPDA 2M51A 3GTJH 5IT9E 2F2XA 1DONA 4C3JG 2MF2A 3EJIA 5IHKA 1W2BP 4NB3A 3JRZA 3T4AC 4IZ8A 3K7AH 2RI3A 2OTLA 2QI2A 2F0VA 3A8KE 1EL0A 1PVOA 3HOZH 1X6BA 5CO7A 1U5KA 1Y1VB 2A6HD 2F0NA 5CGKA 2DO3A 4PJOA 4PG3A 3VU3C 4C3JH 2CGHA 4C3IG 1VQPA 2CZ7B 3KOJA 4LFAQ 4GN4B 4X66Q 4JYAQ 1SMXA 3OB9A 1HYOA 4FT2A 5DM63 5KNCA 3JCMd 2V4DA 3OYHA 2AKWB 4JLIA 2R3ZA 4LF6L 1QE6A 2NUZA 5DY9A 4K5VA 1UNSA 2GTJA 1MI2A 3NGPA 1CSKA 2ID0A 3PUWA 2L89A 4HTHA 1LTSD 2IHEA 3CU7A 4JI1Q 4JI7Q 5GANh 2AZSA 4CHTB 4OMFB 4DBQA 3CCVT 1U9RA 1PH7A 4BY7G 1KTKA 2B63G 4LF5L 1FMWA 2EYFA 3H0IA 3VDYA 5HURA 4UDUC 1W6JA 1VQBA 2I46A 3VR5A 1N6AA 1VF5C 4MDXA 2HKNA 2QKIC 2A74C 2P84A 2EE1A 3H09A 4APVA 1AVZC 4V0BA 2L3RA 1X6GA 1G3TA 1YITA 3DEOA 4HJ9A 5CORA 1KQSS 2B63H 3CCLQ 5CCAA 5M3MG 4YY3Q 2VASA 4C0DC 3HEJA 4X34A 2DYBA 5KNDA 3L2UA 2VYTA 1EY4A 2E3HA 3I7FA 4LUVA 3M56A 5LJ3d 3MP1A 2P0KA 4IOAA 5G3LD 3U4VA 2Z1CA 3GO5A 2LZ6B 1ZSZB 4LUEA 3S1QH 2TSSA 2ZPBB 2MMPA 5J3BA 3VS3A 2F5KA 2M02A 2K14A 2LJ0A 3T1YL 5EKIA 4B3RL 2V8KA 1TWGB 1B70B 1WIEA 1WHMA 4FSXA 4JI2L 4F14A 1L0XB 2YTXA 1K9MU 1VQ8T 1CZWA 1NLPC 4N8FA 2EJ9A 5ELCA 4L5RC 3PGZA 4A3JH 4UC4A 3H9NA 5KYWA 1QP3A 1TWFB 3VR4A 5GAHC 1GOZA 5I22A 4A3BB 1HZBA 5FLXc 1RI0A 2KVQG 2EQMA 4EX5A 1X65A 3MCAB 2J6FA 2RHZA 1D5XC 2NTSA 4E7KA 4HA8A 3A55A 3OOCA 4OB2B 3ZBDA 5GANe 4L63B 3EA6A 2FYKA 4IIMA 1HPCA 1LUZA 3P8HA 1PG5B 6AT1B 2KJXA 3N6RA 3NPPA 3ME9A 3U9OA 1HNXL 1ET9A 4C92D 4DAYB 1II3A 1R8OB 1KHIA 2A68D 5EPLA 4BE0A 1M2VA 4A54A 3NENA 2F0PA 1KJWA 1Q82R 2RQUA 1A0NB 3CCLA 4PKCC 4HIKA 1GRIA 1TIID 3Q0AA 4M7AC 4TRDA 1Q8IA 3VA7A 3C46A 1E1OA 3KF8A 5CBAE 3FP9A 3EG9B 3MFGA 5I9PA 4BACA 4L6TB 3RMHA 2XDDA 4J6HA 1PH9A 3TS0A 1X54A 4XT1B 3ULLA 4C3IB 5KYXA 1QCFA 1ZUUA 2HL5C 4C8QC 4OWWB 1I6HB 1FGBD 3QUIA 2AT1B 2Q8IB 4XTVA 2AQ2B 1SF9A 4BY6C 4KI0A 1YWPA 2A08A 1UGSB 3UDCA 3EH1A 1E0BA 2W0ZA 3CCQT 3KBXA 3PUYA 2FXQA 1CUKA 4B3TL 1P92A 1H9JA 2RK2A 2EQKA 2FG0A 1RLPC 4NKLA 2CSQA 4KD3A 4KBMB 3MVVA 4MMKA 5EKKA 5CKBA 1WQ7A 3CEYA 3H6ZA 1QILA 3CRKC 3RNUA 2ATCB 2N88A 2AMCB 4YHHQ 2ZAEA 3I35A 1WHGA 1ENAA 4LF8Q 1WFQA 2GVAA 1SRLA 3EQLC 2E2HH 4DR6Q 4BBRG 2K3YA 1AZQA 2JN0A 3CCJA 1OX9A 4M78E 1QVCA 2KYBA 2VY3A 4U68A 4GKKL 4BY7B 3I5SA 1TOVA 2CH4W 4FW1A 3FRPB 2MWPA 1A2UA 3EBEA 4J9BA 3VA5A 1T0HA 5FLMH 4ZTFA 1JWMD 3SB2A 1PRTB 4FYWB 5LMNW 1RHPA 2Q8TA 3I55T 4QIWE 2GQVA 2NUTB 3KLWA 2PTKA 1HXDA 4BBRH 4CDEC 3KJPA 2K5WA 3EFOB 3I3CA 4DR4Q 1M9SA 1U1TA 2MK5A 3T53B 5M3MB 4E6IA 2OI3A 4CGYB 3MO8A 2F3WA 3MFYA 2PQAA 4JI6L 4B3MQ 1VYVA 4TVRA 1Y57A 3LYIA 3NELA 3GBQA 2YDLA 1ZA1B 3R8BA 4DR2L 1M1KU 2F0GA 4M77C 1PC0A 4HMJA 1K0SA 4KUDK 3C95A 3QZ9B 3RR5A 4M77A 1U1SA 1STEA 4GLVB 2JA8B 3RZOB 2K5LA 3NTIA 4A3FH 1MJEA 2X3WD 2SNSA 1KHCA 2QA4Q 4JZ4A 2L12A 4Z88A 2E8GA 2VQFQ 1WTRA 3HSBA 2P0QA 2MCNA 4DV1Q 1PKSA 2VGNA 5FJ8G 3OA6A 4O2DA 3RDVA 3MHBA 3QWYA 2L3SA 4OGQC 1ZLMA 2A1AA 4LFBQ 2FHTA 2KCNA 2UXCQ 3DWQA 4BA1I 2MO1A 4A4FA 1LNXA 2IVWA 2OT2A 4CBVA 5E4WC 3EFSA 2ALYB 3QWNA 4EGVA 1OXSC 2WKDA 1ZQ1A 2RMOA 3CCRA 2OTJQ 1EY5A 5FJ8H 1B9NA 1F2ZA 1Q86C 1FNUA 4DR5Q 2D0PA 1K8AR 4FSSA 3E5SA 3HOYG 1EOVA 3W1GA 1A8VA 4PMWA 2L55A 2CUDA 2XVSA 5J22A 3QIAA 1UTIA 4E7JA 1CA5A 2A0FB 2COWA 4FIBA 4LWCA 4FF2A 3TVTA 4GLMA 3EH2A 3S6WA 4DV2Q 2KEEA 2RQVA 3ZFJA 2KT8A 3CC4Q 3GTMB 5JEAG 4F04B 2CW0C 1Z9FA 1S1NA 2LSSA 4K0KL 1DXMA 3HOYH 2E6NA 2JA5H 5CAIA 1D1CA 2MHVA 2VS1A 4YWLA 1OXUA 4OX9Q 1FWZA 3G7LA 2R92G 1VQEA 2K3XA 1HJDA 1PTOF 4DOWA 1JU5C 4R8NA 1QNKA 2NVYB 3ULPA 4RG8A 4OMQA 1H9MA 5AJ3L 3E2UA 4FO2A 2UU9Q 1YCYA 4A3DG 2F69A 1M8VA 2LT4A 5JEAH 1GO3E 4J5YA 4S3SA 1OULA 4BBRB 3T1HQ 2Q2HA 2MO0A 2DL8A 1VQ6A 4A3MH 1I5OB 5A0DA 5HY6A 1BO0A 1LV9A 4M7DC 2MPMA 1KIKA 2R92H 2MWOA 1PH4A 3S14B 3V7RA 1HUNA 1UB4A 2GA4B 1ESRA 2UXDL 4UP9A 1HNZQ 3PQIA 4A3DH 3L2PA 3OYMA 3H91A 2OTJA 1TU0B 3SWNA 5C4JH 4LD9K 4ZLTF 1S3OA 1VQGA 3QOLA 2D1XA 2HEQA 4KGXB 3UDXA 2XN9C 1TSFA 1OQKA 1TG0A 2BUDA 2E12A 4AQYL 4KK7A 1BOSA 2O9SA 4DK6C 5KEEA 5CC4A 3SGIA 1Q86R 5FU6B 3TBIB 4N0AC 1PM3A 1IO6A 3CC4A 4J1MA 2WAQG 1OU9A 3CMAT 3HG9A 1YNXA 4N0AA 1Q7YR 1LTTD 4J9DA 4CKEA 3PIOA 4PJOF 1M3CA 2IJ0A 2OCEA 4NDXA 3NK9A 4DV7L 5C4ZA 1OYXA 4AG1C 4C5HA 1LABA 1D5MC 2DL5A 1L0WA 4CDDC 4DNTB 1O7ZA 3J80c 4LF4L 4ZAIA 3OYEA 2YRCA 1VQMT 2O88A 3FDTA 1LOJA 3G48A 1G291 3I2ZA 4JC0A 4QUCA 4X64L 2C35B 3HOUG 4HKEA 1TVXA 2EKOA 4KJOA 2PMZE 3M55A 2VUBA 2Q2IA 2WV6D 4DBFA 3AMUA 2CREA 4JBJA 1YBYA 3AYHB 1K73U 2HDMA 1VQDA 2N55A 5KYUB 5LMNL 3QO2A 1UE7A 1YVCA 3I56T 4A3GG 2JM9A 4OP0A 3PV0A 2VXEA 3H3VC 1FJGL 5IYDH 3DWPA 2DZ9A 1VQ7T 1SFOH 3KF6B 2B2VC 3CD6Q 3TU4K 2QEJC 4OWTB 1PH1A 4N4IA 1K9MC 2C0TA 3NTHA 4JI3Q 4UPAA 1L2FA 5FLXE 4JG2A 3H0FA 4K11A 4NXNL 1SNPA 4DV0L 4A3GH 3LX7A 3HOYB 5EJWA 4FCYA 2QF7A 4KKTA 3QG1A 3RIRA 3BDOA 4K8JA 5BN5A 1JOQA 1QVPA 2RQTA 1A0IA 3T1YQ 2DL7A 2ROTA 2EW3A 1AZEA 2DXBA 2WSEE 3CCUQ 4A63B 3JB9J 1EY8A 1NLOC 3MXNB 2DBKA 2FO0A 4Q5WA 1TY2A 1Y07A 2JTMA 2M9UA 3M4OH 5C5MA 2KSSA 3HFOA 4F16A 2Z9HA 4PZ8A 3CCET 1HZCA 2QK0A 2L2PA 1CTMA 3UI2A 1EFID 1TH7A 5J1ZA 4FF1A 2EYOA 3I90A 3ER0A 3JC66 1A6XA 1BK2A 1GCQA 4A3IB 5GJVB 2RHIA 4H7BA 3GNFB 2RCNA 2F0UA 1ZSZC 2K75A 3PCOB 1KLUD 4C0FA 5IP9H 1VQ9T 5KYYA 2L11A 1PH3A 1IHWA 1WTHA 2VNUD 3D0FA 1ZSZA 5IODA 5GAMf 1NJIU 3FEWX 2KRNA 1JWSD 4PFZA 2YSQA 1BIAA 4D6WA 2WFWA 1Y1WG 1UGPB 4V190 2A68C 2E2IH 4DN4M 2EPBA 4C92A 2N3SA 5IYCG 5A2QE 4JBKA 1U4PA 3I70A 1KC8U 1BBZA 2EYXA 1SG5A 1SYFA 2KUMA 1OXXK 5C4XG 3J81c 3PIO3 1RI9A 2EQIA 2PU9B 3C0CA 4XQQA 5FRNA 2XHCA 3VS0A 1Q95G 1Y1WH 8ATCB 4DF7A 1YJWQ 4LFAL 3CCUA 2RCFA 4X66L 2I5MX 4HCZA 1KNAA 1M8AA 2CWPA 2WAQB 1HR0Q 2XICA 1H641 1UEBA 5KNBA 5LL6S 1SEBD 4OWXB 2RBMA 4A4IA 4DNRB 4POGA 4HIDA 1YFNA 2HNIA 2OX7A 3JCMW 3T56B 4BB7A 2X69A 4C0DB 4PJNA 4NOYA 2LY7A 3A8IE 1VQIA 3U9SA 1VMPA 4JI1L 4JI7L 3FEOA 1XX8A 3VS6A 1GM5A 3CRLC 3HOUB 1QKWA 3SFMA 1GXDC 2K01A 2K4YA 3EG9A 1Y8NB 4XIGS 2KNBB 1WVLA 3GTPH 1OPKA 5LJ5g 2B29A 1SFOB 5CIUA 1NTGA 1EQTA 5KCOA 1RF2D 1UGQB 4ZGEB 2VB3X 3S15H 3PUZA 4FYDA 1CQVA 3S16B 3H15A 3CC7T 3CQZB 2CQAA 4DPGA 1AEYA 4A3GB 2VUMB 5E4XA 4IJLA 4BUGA 2E1HA 4LK1C 1M1KC 1TUGB 2EYLA 3A7LA 3DMUA 3GTKH 4IJHA 2FEIA 2JW4A 2EQSA 1N32L 3V2TA 1V9PA 1AE3A 4YY3L 3DB4A 1Z9QA 4JI6Q 1A3TA 2K7AA 4ZN3A 4AT1B 2EJGA 4IPGA 4YWKA 1YJWA 2KCTA 4TQUS 1BIBA 2GCXA 4ZCKA 4ME3A 2JJQA 2B8AA 4IUTA 3SR1A 1H9SB 3MA2B 1X69A 3JB9F 1PRTC 4PNYA 4CJ2C 3CMET 4E47A 1JRIA 3S3NA 2PZ1A 3HPWA 2D0OA 1F9PA 1BB9A 4A4GA 5C6SA 4J8OA 3OYAA 1FMKA 2NUTA 1U8RA 2R7ZG 2FJ2A 1S5ED 3BE3A 1Y96A 2O9VA 3V05A 3EFOA 1UECA 2R5MA 2FPDA 2NZ1D 5H1SE 3R93A 4PJOE 1QWFA 2DJQA 4ZGDB 2JMAA 1IW7C 4DV5Q 3TP8A 1MJCA 4M77F 1K83H 3A8GB 2R7ZH 5GAMh 2P5ZX 2EBPA 2QQAA 1I4PA 1TY0A 1OX8A 3G6EQ 2ZXOA 3PUVA 3L7ZC 1IHZA 5IGEA 4M7AD 3NHNA 1HSQA 1BCPB 3DEPA 3VYSA 5JVG3 1VQOA 1Y1WB 1STYA 5D3DA 2SEMA 4AG2C 4F7UA 3MPUB 1G8ZD 4JK1C 3GTQH 1Y71A 2VKNA 4C8QD 4BXXH 3BYYB 2WINB 5C4XB 1YJ9T 5EQ0A 4M7DG 1X43A 3G1JA 1YZ6A 2LRQA 4JRKA 4WF2A 2ABLA 2R6GA 4Z9CB 1BI2A 4A3EG 1RTOA 3I4NH 1FGUA 1G51A 1SPKA 5HK3A 2V8IA 1TWCB 2BH2A 4CRIA 2COYA 4DA2A 2K2MA 1BR9A 3CCST 2E41A 4NS5A 3M3YB 1G2BA 2EYZA 1AZGB 4Q0FA 3UE0A 3NXWA 1VQKT 5ISRA 1SAPA 4HJ8A 5GAOr 4K6DA 4YHHL 3OYNA 2D8HA 2R5AA 3M58A 4A3EH 3T16A 2KOLA 1YHQA 3SD4A 4LF8L 2Z0SA 4OO1H 1G83A 2EJFC 4DR6L 3NE5B 2UXDQ 4N9TA 3BZKA 1ZHIA 3CBOA 3G6EA 1ACMB 1MV3A 4LJZC 1EFWA 1LT6D 3EN2A 3GNGA 4EQPA 1Q81C 4WJWA 1JCKB 5D7UA 4ANJA 4LUDA 1KQSA 3PMTA 2R7FA 5D14A 4MDWA 5GAMe 3E1SA 3J80E 1RTNA 2M1HA 1Y1VG 1D7QA 3RKXA 4JV5Q 2RO0A 1Z9ZA 3UE1A 1WZOA 2KDSA 3CCVQ 1JQYD 1P16A 4FXKC 1QG7A 1FYCA 2EOTA 2LS01 3CP0A 4XQ3A 2E5KA 3M85A 4B3ML 1GCPA 1Y1VH 1R4PB 4AIMA 1STHA 1VQNT 2O2LD 4DV7Q 1WHHA 3F70A 3I4MB 5LJ5d 5IXBA 4M8AA 3O8VA 4ATOA 2DJGC 4C5GA 1I5LA 4QQBX 4OO1I 1H3HA 5IAYA 2NZOA 1RD9D 3HHTB 1EZ8A 2F0EA 1VQLT 3D3RA 2IIMA 2NYZD 4F87A 2PPBC 4IFDG 4RGTA 3JCMf 4NL3A 5GANf 1L0YB 5CKDA 4HCCA 1WXTA 2IX0A 4PFOA 5CV8A 1OOTA 2XWJB 5LMNQ 1V1QA 5FU6C 2RH2A 4KMUC 2DNUA 2K2VA 2JM8A 1E7OA 4AYBE 4C56C 4DV1L 1PD0A 3CXCP 3GTQB 1GKHA 4OONA 5IHIA 1K8AU 2CS7A 4D8DA 2R7DA 4M78G 4XTWA 4PJJA 4LFBL 2RN8A 1PHJA 2WKCA 1J5EQ 1Y7XA 1ZBJA 2B86A 1PD1A 4EMKB 1QB5D 2UXCL 5CV9A 1I81A 1V1CA 4V2SA 2E3IA 1A15A 3I4LA 1VQ8Q 2DL3A 2VC8A 3LGLA 1FYNA 1NR4A 3UDIA 2F0IA 1B07A 1FNWA 4HJ5A 2EKHA 3CCVA 2HQXA 1AZPA 4OMPA 4MMLA 1WJSA 2LTOA 1SDFA 3F1ZA 1M8MA 5I11A 4DR5L 1ESFA 2XRSD 3OYFA 3VR2A 4LF9L 2GNCA 1ZSGA 3MHXA 3KLRA 4M7DB 2CW0D 1XQHA 4PLIA 2HQLA 2EVRA 1LO5D 2K04A 3TQYA 2LQKA 3EHQA 4GS3A 1KIXA 4DV2L 2I0QA 4M1UB 3R6NA 3AFPA 1JBMA 1IRXA 3SHLA 5J39A 2YLCA 2RHSB 1NJIC 3LWIA 2V8JA 5LJ3f 1HTLD 3FHWA 2IPOB 4F8MA 1HR0W 2CH4A 3TMEA 4TKOB 3RN5A 3CBPA 3J81E 2XD0A 3FLGA 4Z89A 1KC8C 2K03A 4OXPA 4DV3Q 3IAYA 3TQ7P 4M7DD 1DJRD 2KE9A 5G3LF 1XYIA 4X64Q 4RG1A 3TS2A 2D9TA 1JB7A 1NYFA 2CZ1B 4RAUC 2UUBQ 1TWFH 3R3OA 4JDSA 3T1HL 4A3BH 2M2LA 2L0AA 1X55A 3V8JA 4LUZA 3CCQQ 2K3BA 4FXDA 5C5LA 3X3MA 2PQWA 3M0QA 4OB3B 1SYEA 2L8DA 3MXNA 2E6ZA 2KY9A 1HNZL 1B34B 1PRMC 4CI0C 1SKUB 4FP5D 2X4YA 3K0XA 3NHHA 1BVSA 1WCMG 1X32A 5DNFA 2J6OA 1KD1R 1S72T 2HCIA 4QT7A 1SYCA 3PFSA 4AFSC 4RGNA 2LCCA 1J9OA 1PH8A 2X6GA 3A7AB 3H6MA 1NMGA 2F52A 1F1BB 1T3LA 1YIJT 3G4SA 2LP5A 2MGSA 2F03A 2C0IA 1CSPA 3AFQA 2MUYA 5IIFA 1D0XA 1VOMA 4HVVA 5EPKA 4NL2A 4C92F 4Z8AA 1B7TA 1MMNA 4BBSG 1JT8A 5GAOn 1NCVA 2VXFA 5IXFA 1STBA 1MNEA 4EMGA 3WOEA 3IQLA 4GY5A 3I55Q 3IL8A 3STBC 1EYGA 4C3IH 2ZTDA 1I6HH 2QDLA 1SNQA 1NBWA 2NN6G 3A56A 4X3TA 2PZWA 1SN8A 4N9PA 3JCMh 4C3HG 4BBSH 4PFPA 5KE2A 3TN2A 2BZYA 2RI5A 2QQSA 4O42A 4OGEA 1DM0B 2AWNA 2Z6BA 4YCWA 1I6VC 1KAAA 3OYBA 3OYKA 3WDNA 1ABOA 1NAPA 1VUBA 1HXYD 3M4YA 3RMSA 1JB3A 3ZYYX 5CMDA 3QSUA 3PVQA 2IX3A 1HRJA 7AT1B 3CCQA 2RQWA 1VQFA 4CC7A 2XG8D 3QBYA 3C1FA 3F8TA 1I0CA 3EG1A 1STGA 4JBMA 1VF7A 4M78B 1T5XD 2JXMB 2FL7A 3I4OA 3KDFB 4BY7H 1WI5A 1RAEB 1RABB 2MJ8A 1N32Q 1QOHA 4QGUA 5KYNA 2COZA 2DLPA 4K5WA 2H3JA 3NUCA 5COYA 5FOBB 3CQTA 2BZ8A 4LNQA 1B50A 1LTID 1W3SA 4J9FA 4QIWB 5F2DA 1Y0MA 4JI3L 2JVVA 4LDVA 3NWTA 1HHVA 1C6VX 2DGYA 2XGTA 4ABNA 3LGFA 4OELB 4UAIA 5M3MH 1ZYRC 4M78D 3I55A 3BFMA 2Y0SG 2CP5A 3Q24A 1NYGA 4ZGJB 1ONLA 1H9KA 3MP8A 2KXCA 5LJ3h 2QTXA 2C5CA 1JMCA 1XNIA 4KHPL 2JA8G 2GN5A 2EY1A 1YNNC 5KRUA 3VRYA 5D6WA 5FKAC 1KDAA 1N8RC 1ZKOA 1PCXA 1SSFA 4RG2A 2CKKA 4FM4B 1CKNA 1EWIA 4FVMA 4RGMA 3THKA 5GAOq 3JCMe 2MQHA 1SXTA 2ECZA 3VUZA 4XU3A 3M54A 1R4QB 1U4RA 4AFQC 1XNQQ 3FPPA 4XAXB 2JA8H 1OV3A 4HT9A 3RZOH 2V1CC 3W3AA 4II1A 3HP3A 1D3BB 1IGQA 2M9VA 2DUDA 4RCNA 4BS9A 1PYSB 3A5UA 3A8MB 4OMLA 2OTLT 1GVPA 3RZDH 3AEVA 1X27A 1PSFA 4X3UA 2JSOA 1SYGA 3X20B 2ED0A 2UXBQ 1LT3D 2X4XA 1WCMB 2FVUA 2DAQA 1LT5D 2K7VA 4P72A 1VIFA 4M75E 4M7AA 5EPJA 4UHVA 5FO8B 4H13C 5KH6A 1IXRA 1PDQA 1IYUA 2DZCA 5I2XA 3S1MB 3ZL7C 2WACA 3GV6A 2RHUA 1A63A 3H0GG 4F7UF 4HIOA 1AWWA 4PMBA 1BCMA 4C8QA 5GMKm 4MTNA 4CDCC 2CP7A 2CYZB 2DNEA 2RVLA 2WB1E 4BBSB 4C2MH 1PZJD 3K8AA 2Y90A 2DEUA 1HR0L 5TSSA 1BCPC 1HD3A 3BG3A 1EQQA 1WD0A 5I4DA 5JJZA 3HOVG 1O7LA 4J7IA 5HCKA 5LJ3e 2DVJA 1A62A 5GAN4 3H0GH 1RL2A 2OWOA 1LVKA 1KRTA 2F4VQ 4C3HB 1CHQD 3WWVA 1U06A 4EMHA 3OBWA 4DBHA 1SROA 3SK8A 2EYMA 4K8IA 4E7ZA 2DTOA 3TDQA 4DGZA 2RSNA 4ULLA 2I5HA 1ET6A 2KQ3A 1RJTA 1VYUA 5GMKj 3CMAQ 2NVYH 5D3IB 3URYA 1EQRA 2FPFA 1HUMA 3EGXB 3M0SA 3E9GA 3M0RA 3S3OA 4OIKA 1B3QA 1EU3A 3TP7A 4XTCS 3HTRA 4OB1B 1AW7A 2H4OA 4PNOA 4ZN1A 1D5ZC 1LTLA 4G4KA 4MTKA 2PVGB 3OYJA 2R57A 1VQMQ 2K50A 3S14H 2NUPB 1AH9A 2CKZB 5GAOm 1AD5A 3J7AF 3KK7A 1UHCA 3GIBA 1XJWB 3OYCA 2JOYA 5EKLA 3W1BA 1PRTD 1N9WA 5JEAJ 3D4DA 1CZGA 4DR3Q 4L5GA 1MGSA 2PO4A 2RK1A 4IUNA 3OS2A 1X3PA 3FVQA 3JCMQ 4G7HC 3I56Q 2G9HD 2CWAA 1GBQA 1DZ1A 2WSFE 4JS4A 4LE9A 4XK8E 2Y0SB 4B3SL 2B2UC 2K33A 1WLPB 1HH2P 2BE9B 1XMQQ 2GGRA 3G71T 4OMNA 1VQ7Q 2B2UA 2F0WA 2Z0WA 2JA9A 3OQ5A 2RDHA 3OYYA 1MGQA 1PMRA 2DA9A 3PO2G 4Y91A 1IW7D 1OZ3A 1IHVA 3TREA 4C92E 1P8LA 4IALA 2ICEC 4RWSC 1PH5A 1KXLA 5C0XG 5GAN2 4FF4A 2X51A 1M90U 2A69C 5A35A 3RZDB 4YCVA 3A5ZB 2E4HA 2QTVA 3CMAA 1B1ZA 1DCZA 1S5DD 2ZXRA 1C8CA 4DV5L 2JUFA 1XMOL 4HSVA 3GTPB 2XDBA 1WJRA 4DAPA 2L3PA 1Z47A 2ZZDA 1TS5A 5IN1A 1WD1A 2AK5A 2TMPA 1CKOA 4RH6A 5C0XH 1VQMA 1LTBD 3CCEQ 3DHQA 2QASA 5GAN8 3CPWS 3T9NA 2CP2A 3N5BB 4DA4A 3Q8DA 4DKAC 4G7OC 3M59A 1U5SA 4LF9Q 3AB9A 4RCCA 5C3XA 4C2MB 3ZEHA 2V1QA 1W2BS 2F0LA 2PUKB 1E6HA 5M5WB 4KJNA 4UP8A 3V7SA 4HVUA 1QVFA 2L0CA 2DY7A 1HNWQ 1MD2D 3HS0C 4OL7A 2KRSA 2LX7A 2N49A 1QWEA 2J4XA 3I56A 2QG9B 4L5SA 3H0GB 3W5OA 4ZRZA 5IWAQ 1E6GA 1VQ9Q 4XYOA 1LCKA 4A3LG 2AZVA 3RLOA 2BDNA 2PW7A 5IGBA 3HRZC 4HVWA 4XTYA 4EMKC 1Y8OB 2JEBI 3MXPA 4QQDA 5ELBA 1BI3A 1E24A 3DXJC 1CHPD 1DD2A 1EFNA 1K0RA 1MUZA 2EYWA 2D0QB 2HMAA 4EPCA 2QA4A 2XRQD 3HOVB 2P0PA 3ITPA 4UP7A 4A3IG 3NEMA 2BZXA 4OB0B 2UUCQ 2ICIA 1ASYA 3CCJT 4A3LH 4ZQ3A 3OIQA 1QP2A 1HA5A 1RCVD 1PH6A 3ZJYC 3A98A 2IWHA 2PYKA 3META 5C0XI 2QILA 2X9HA 3PO3G 2NVQB 2B8GA 4KY5A 3LWEA 5CV5A 4M7DA 3VYRA 4U673 4PJOG 1VQ4T 4B3RQ 2G5DA 2LDMA 4J7FA 3MP6A 1PFBA 4Q5VA 5HGTA 5GADC 4A3IH 1XPRA 3CCEA 4DK1A 1XXGA 4H0LC 1PKTA 3S2DH 2EGCA 1GJXA 5JJIA 3CHBD 3ND8A 2YU9H 1J8IA 2JTFA 2ZTCA 4MHEA 1JJGA 3BU2A 3GLXA 1SNCA 2PVDB 1SRUA 1M4ZA 4JV5L 2IL8A 3PO3H 3PSIA 1W1FA 4PMCA 1NY4A 2DFUA 5M9OA 1UJ0A 9ATCB 4IUPA 2KMTA 2F1MA 1H3ZA 1K28A 1SE8A 4RMFA 1X75C 2ZPIB 2XIWA 3QDRB 3K5NA 3KFUA 1N9SA 2JXBA 1EIHA 2VV5A 2E65A 4E7LA 1OZ2A 3CC7Q 1D6EC 4DUYQ 3GTGB 4ZTJA 5M5YB 5CR3A 2NYSA 3X24B 1JICA 2OJ2A 3OMCA 4LMQD 2DRKA 2EIFA 4QL5A 3P8BB 1KG1A 1DOMA 4Z02A 1B34A 3UA7A 1QW1A 5GAN7 4JI4Q 2XK0A 2BIVA 2N8NA 2E5LL 4F7UE 2LMCB 3E0EA 3PO2B 1V1PB 2DMOA 3GP8A 4JJCA 1A3UA 1VMCA 1BDOA 3NPFA 2K5VA 2H8HA 2LX9A 2FRYA 5ELDA 4A4KA 3BVMA 3REBB 4K2LA 3MC0B 1EWHA 1IKLA 1B53A 2IHFA 3X25B 2EYYA 3HOUH 3HFZB 1WYXA 2QDYB 3FRNA 4J6YA 1XJVA 3GOXA 3CMEQ 4OMOA 3M9BA 3ICEA 2O01E 1V43A 4LFCL 4XT3B 3SXHA 1EIFA 1J5EL 1XNRL 4B6MA 3CCRT 2R61A 2DY8A 2VQEQ 4GNXB 2ASBA 5GAN3 3S16H 2B2VA 2DNCA 2CZ6B 2F0DA 3CQZH 2JN4A 1X56A 1MSGA 5AYFA 1RADB 1A2TA 4E7SA 5CKEA 2HBPA 3IFDA 2HHHQ 3KUPA 2B2YC 3CC7A 4ME7A 1LACA 2PZUA 1TR5A 1PZID 5AFWA 4KHPQ 2JS2A 3H94A 2M16A 4LNPA 1N36Q 2KBNA 5LMUQ 3KUFA 1JOKA 4M78C 1EOTA 4GLXA 3NQIA 4HCEA 1NR2A 4JVZA 1KABA 3M7NA 4F88A 4FXGC 5LHY1 4M78A 3RBBB 5GMKl 5ELNA 2B2TC 1NBEB 1IXDA 1IB8A 1I8FA 4JZ3A 2K5NA 1TXYA 1QKXA 1BBXC 1YJ9Q 4DV3L 3S2DB 3BDCA 1VQ6T 3PE0A 5JAVA 4P73A 3JCMX 1IYJB 5LL6X 1JQQA 4FU6A 4A4EA 5IGFA 2O4XB 3OS1A 3CMEA 2XDPA 2UUBL 1K8OA 1CFMA 2F0SA 3PO3B 4JI8Q 2PNRC 3UWNA 2YV5A 4RFBA 4AYBG 2JS0A 2MOXA 3CD6A 1MMGA 4YTLA 4PJOB 1T5EA 4GN3B 1K1ZA 4LAAA 3RR6A 3CCSQ 1OXVA 3N52A 1BXTA 2V1RA 2VZAA 2BE7D 1JE4A 1YHAA 4ZKBB 5I6WA 1SSOA 2L5QA 2X6LA 1VQKQ 4KV6A 1I94Q 1VA7A 4QVCA 2GFUA 3CCMT 1X3EA 1K9MR 2CQOA 3G7ZA 4ZK9B 3OTOQ 3C1EA 4HCSA 3OS5A 3PIPA 1QCOA 2IG0A 1BUVT 2LT1A 1QVFS 1C48A 1EQVA 3LWHA 1I4GA 3STBD 5IYCH 3V8KA 3VKIA 5EG2A 4BI4A 2OXPA 3J80i 2RA4A 1PA6A 4A3KG 4DR7L 5GAOl 3A8JE 4WORA 2KENA 4M7AF 3BDUA 4IOCA 5C4XH 2PI2A 4DAYA 4O6JA 1I50B 1LJOA 4DAMA 1D3BA 3TZDA 1OXTA 1BCOA 2CHBD 4ORZA 1QLYA 2DILA 5D6YA 3JCMJ 2F4IA 1GUWA 4C8QF 3M9QA 1N33L 1HFNA 1SBBB 3GPLA 3PF4A 1TWCH 2BA1A 3HOWG 3L0OA 3JSCA 1QWYA 1D1BA 1YI2T 3VR3A 2G6FX 4N4GA 2AQ1B 2RQXA 3OYIA 3UT1A 1O80A 4RHSA 1WGSA 2ZJPA 1M27C 1VQNQ 5I2MA 1BQQT 3JB9G 1Y14B 1HFGA 3K5MA 5LJ5j 1MBYA 5FK9C 4ELYC 4QF4A 5KYIA 3HOWH 3ND9A 1UGVA 4KN7C 1N9RA 1QNUA 4F7XA 2OQ0A 1VQKA 1VQLQ 2EWNA 3L2RA 3L2VA 1PYWD 3M4QA 3W2DA 2RJDA 2K5HA 4GOPB 3PMIA 1ZYRD 5GJWB 4CJ1B 1CK1A 2J06A 1VQAA 4HAEA 4B08A 3UDFA 2R93G 3I4MG 1GBRA 1MHWC 4KH1B 4ZUJA 3SEBA 1G6ZA 1DYQA 1ABQA 3OMGA 4KGVB 1TQOA 3A8OB 3NMZC 4J83A 2PUOB 2QCPX 4XTUA 1YNND 2DK3A 2ESWA 3JCMc 3MWYW 4B3SQ 4RTYA 2SEBD 3LW5E 2L15A 3EGXA 2BCOA 1YN8A 2WIIB 5C3EG 2YT6A 1NPRA 3GQBA 3JAMi 4RHRA 1B4OA 2J0TD 3I4MH 3VYHB 1X3GA 3A1PA 2EAYA 1Q82U 3DM1A 1AWJA 2H1EA 2DRMA 2JTEA 4B9XA 2EQJA 1SLJA 2NUPA 3NQTA 1IBML 3HOXG 1I4HA 4G57A 5CQXA 1M4VA 3D6WA 5CR2A 3S2HB 1M2VB 4HXJA 2Z6KC 1Z7TA 1XMOQ 3O13A 1IGUA 1STNA 1X3FA 1STAA 5C3EH 1IBLL 1XNQL 4GN5A 5IGDA 2R58A 3K59A 2HSEB 5EBCA 1QZGA 4RTWA 1UFFA 1R0BG 3HFNA 2Q2TA 1YHBA 4AYBB 3OBYA 2KECA 1SMYC 3J81j 3PIP3 3O5ZA 1VQLA 1UHFA 4YCUA 2BDOA 1BF4A 1ZUKA 1G3SA 3P7JA 4EDUA 1OI1A 1XPUA 1AEXA 4FYVB 2UXBL 1M1KR 3URGA 1KQSP 4KLKA 3H0HA 2OEOA 3JAML 1L1OC 3D6CA 2LQWA 3VS4A 3OWEB 2E64A 2KEAA 3SDZA 4RKLA 5ELFA 1BCPD 2IT1A 2YRVA 2A7YA 1JJ2A 1B7YB 4VUBA 5JJKA 2RI2A 2ATWA 1E22A 4A3KB 3K80C 4PV1C 1W70A 3PGGA 1BYMA 3OSOA 3NBHB 5E3FA 1WA7A 1TUCA 2L5TA 2RHQB 1BI1A 2QAZA 1MMAA 2D9UA 1OEBA 3NSWA 3KYHC 1F9RA 4QB4A 4R4QA 1S72Q 1KSWA 3OW2S 1E1TA 3FDRA 2A6ED 1TS2A 3R2IA 4LDUA 1PZKD 3MZ5A 2KXDA 2F0MA 2A5HA 2A73B 5M3FG 4ALPA 2F4VL 1YIJQ 1YEZA 4DXFA 4BDYA 4BWGB 1WOCA 3LNNA 3HOWB 2HBWA 5AT1B 4E2FB 2K4KA 2HQHA 4KT0E 2EJFA 5HGQA 5IT9L 3MJXA 1SRMA 2EXDA 5IGCA 1AWXA 1JXOA 2AIRB 1LT4D 2VXWA 2J7IA 3U50C 1WI7A 2D6FA 3VS7A 1FR3A 1Y69U 2NWGA 3E9FA 5ELOA 1C0MA 4XU2A 4ODGA 1D2BA 3MEWA 2NTTA 2AHJB 5L8RE 2XSCA 4XXEA 1X2KA 4DK3C 1WJJA 5DLOA 1HZ9A 3JCMg 5GANg 4M7DF 4C0GA 1M5Q1 1RAAB 2RPNA 5M5XB 3QJYA 3NTKA 3H8ZA 2L3QA 4M75G 5GANj 1GHJA 1V29B 4FF3A 5BN4A 1C9OA 3OHXC 2KHSA 1K73C 4DR3L 3G6JB 3S1NB 3RERA 2R93B 1RACB 4ZYSA 3M0TA 3RN2A 4A53A 1M3AA 1YNJC 2OAWA 2YUOA 2YUPA 5L37A 2DF6A 2FZKB 3D7SB 2CT3A 2E10A 3OS0A 2E5LQ 2WB1G 3TSWA 2CSIA 1XMQL 4CDFC 5C3EB 5BR8Q 3D8GA 2EYQA 2A69D 4J9EA 1R9TB 1LTAD 5LJ5h 1RUWA 2A37A 2RB6A 2QGQA 2VB6A 3C2PA 3GF5A 2NWMA 3P8DA 3PMFA 2E2DC 3K7UC 4M7AE 1JE5A 2K6AA 2HD3A 1ASZA 3HOXB 1B44D 2OF1A 3VR6A 1UGRB 4UY8C 2G3RA 1E2ZA 5IYBG 3EG0A 4DUZQ 2YHTA 1WPYA 4IFDH 4JRPA 4LFCQ 1F2MA 5A0GA 4PZ7A 4DV6Q 2C0OA 4C8QE 1XNRQ 1WXBA 2JA7G 2LVMA 1VQOT 2K5FA 3TCJA 4DXGA 3ASKA 3I8ZA 4EQNA 4RMOA 3FPUB 4I65A 1ZX6A 4JJDA 5KCHA 4JI5Q 1Q81R 1ENFA 1FX7A 2DPPB 2CZ0B 4PJLA 3UF4A 1VQHA 4J6WA 1UDLA 4PK4A 1PFSA 1WJQA 5A0LA 1E3PA 2FRWA 4C0ZA 4JJNK 2JA7H 5K36G 3DM3A 3SK5A 3GTMH 2DD4A 3JV3A 1ICFB 1UE9A 4KULA 3PNWC 5L23A 1I3QB 1HNWL 2F0KA 2A36A 3MXUA 2DN8A 2DBMA 3L1AA 5KYUA 2F3IA 1Q1BA 1G8XA 2HDLA 2BTTA
chains in the Genus database with same CATH topology
3PUXA 3A8HB 2M00A 1HQMC 5I6YA 2FMCA 2GF7A 2Y4YA 5T1GA 1FNVA 4KD4A 1DOLA 1LLRD 1YHQT 3PTAA 4IFDI 1W4SA 5M3FB 3L3OC 1B9MA 3OWFA 3FIFA 4JS5A 1GUGA 4MN3A 5LJ5e 5JPMC 2EFIA 4C92G 4Y7NB 1A3VA 1PFMA 2LQ8A 4LD6A 1VQ8A 1Q86U 2F0OA 1GUTA 2B2WC 3EROA 5CV4A 2JA6B 1Q7YU 3TZUA 4M77E 2B8FA 4LDWA 4OIJA 3T13A 3R2TA 3CC2T 3EAEA 2M0OA 3QO3A 1VQ5T 1HCZA 4I7ZC 4M75B 3NWSA 3FJPA 1M1FA 1EYAA 4GZYC 1JJ2S 4G7ZC 2O4XA 4PJOC 1Y8PB 1MSHA 2DIQA 3QIIA 3NFCA 3HRSA 1MHNA 2IW3A 1Z6HA 2LCLA 5DEHA 1EY0A 2WB1B 4K14A 5JOBA 4DOVA 2NUCA 1EY9A 3DUZA 4KUIA 1AFPA 3V7CA 4P2CB 5CKFA 1G2TA 3MEHA 2HUGA 1RODA 4M75D 5GANd 3T51B 4IURA 2NN6H 4JRQA 1GXIE 2MAMA 3HP9A 3MEAA 1X3QA 5IOCA 1EYCA 4R8IA 3C94A 2JA7B 2KQWA 3CPWA 2I07B 1KDBA 4K5XA 3NBIA 4QUFA 5GAOp 4P5NA 4WFN3 2QEXT 2F0TA 3BVGA 4ZUIA 1W2BA 1YJNT 5BN3A 4JBWA 1NPPA 4CJ0B 3SK6A 1WTPA 4K2KA 2F5TX 3D31A 1JORA 1Q82C 3DKMA 4O5VA 1TS4A 2EYPA 2D62A 1VDZA 1UAPA 1O75A 3OYDA 1ZEQX 3M57A 2DXUA 3VYGA 2RJFA 3KLSA 4H44C 4M7DE 2KEDA 5C44B 1JR0D 2RDFA 3P75A 3SK4A 3D4WA 4B9WA 1ML0D 2NN6I 4GLKA 2A3LA 3OYGA 3OSSC 3VYTA 5CV6A 3S9WA 1PRTF 2MP1A 2LC4A 1TWAB 1CT1D 2BOSA 4MZMA 1G3YA 2K5DA 3C12A 4ME5A 1EU4A 4HN7A 3BW1A 1M1GA 4F7UG 2YYZA 2VUMB 3C4SA 4J6XA 1JWUD 4C92B 4HEDA 3BYTB 1H9SA 4J8QA 2C06A 3SE0A 3G71A 4KY6A 3GTJB 2XKOC 3F2UA 3BS1A 1N27A 3TEEA 3M53A 1EY6A 2ZCFB 5KYLA 3K7AB 4BA2I 1VQPT 3G4ST 2F0FA 4TSSA 1O7YA 1G91A 5KIXA 2HAXA 3HOZB 3CKIB 3CBMA 4KKSA 1WQWA 3OSVA 4C3JB 2EQUA 1KNEA 3OW7A 2DIGA 1QVGS 1HQRD 3KXTA 5C0XJ 4QQGA 2K5IA 3HZXA 4IUVA 3I91A 3K5LA 3RUXA 2OAUA 4EVOA 3GV3A 2A6EC 2GFAA 5GMKi 2EDGA 3VUBA 1S5CD 2J7ZA 4EQOA 1Q1EA 1O9SA 2PW5A 4PL6A 3K6OA 1NE8A 2EJMA 3L2QA 4MZTA 1YITT 3MAQA 2G9DA 4XQJA 3MEVA 2X4WA 2F0HA 1PXUA 5FRMA 3NBHA 4KN4C 3CXCS 1Q12A 2O5IC 3QZ5B 4BD3A 3QB3A 5I21A 1DJ7B 3K5OA 2B63B 1ILPA 1SNOA 1EYDA 5C3WA 4XQNA 2JE6I 1B3AA 1XTCD 2ENBA 4OHJA 5CKHA 3RKYA 1VQ4A 1SNMA 2VGMA 2EYHA 3AU7A 1K8AC 1Y96B 4IN3A 3DWAA 5HK0A 3S1QB 3JCMP 3GTOB 2VB2X 5CK9A 5ELEA 2YU9B 4HSPA 2RJEA 5J26A 4DFAA 4BE2A 4XDXA 3VV0A 1IKMA 1JB0E 2K32A 1EZ6A 3Q1JA 4A3JB 1I4K1 3QHSA 2PQEA 4K6LA 3J7AV 1KQ1A 1S5FD 3HRTA 3Q22A 3QYHB 2PVOB 4F7UB 2PMZB 1SMYD 3E6ZX 4WRDA 1XOVA 3HGBA 3CCLT 3KLSX 2ZPFB 1CI3M 1WTQA 5HKCA 1KDCA 4NW2A 3TSSA 4KKUA 1H9RA 5I2SA 3BVZA 5FLXL 3P20A 2ZXPA 1PFNA 2K28A 4KTAA 3JCMb 5C4HA 3I72A 2WP8J 4RKBA 3E19A 1ILQA 2CVRA 4C5IA 1TWHB 3LWUA 1PTOH 1JOOA 5FO9B 3HL8A 5CVIA 1ZXTA 3M7GA 2RSOA 1KLGD 4RGOS 1SE4A 1VQ7A 2D5DA 4Y28E 4EMKA 1IL8A 4QQ6A 1WNLA 1PLFA 3BY7A 1XWEA 2SOBA 2QQRA 1S4ZA 1Q7YC 2O5JC 5KE3A 2F3VA 1TU2B 4HT8A 3MXGA 1FXXA 2QQBA 2E2HB 1LTGD 3M4GA 4ID6A 1U4MA 3D4RA 2JP1A 2KCCA 3M5AA 1EEID 5FU7C 5CV7A 5A2QL 3WOFA 2X35A 4E7HA 2EYJA 2EVBA 1EIGA 2QDBA 1F9QA 2Y4XA 2FHDA 2QQ9A 4CKCA 2BE5D 4IQZA 1ZBXA 3K0YA 1NSNS 3OY9A 4XYQA 2NVTB 2DKGA 1VQ9A 5D6XA 1SYDA 1YNJD 1X01A 3WXMB 3SWNC 2MI6A 5DLQE 3GTLB 2KA7A 4QVZA 3WVDB 1BNZA 3A54A 3S1RB 4X3KA 5GMKh 4HMIA 1Q90A 2XNAC 4LDXA 4BI3A 1X6OA 4DAVA 2A6HC 3CCMA 3FKIB 1Q81U 4A3FB 3ONAB 4RKUE 4BDZA 1I4QA 4ZUJA 1SJHD 4M75C 4FL6A 3S3MA 3HKSA 1I4XA 3LLRA 4M75A 2IPKD 2AQ3B 1AP0A 2D2CC 5C6AA 2F0QA 4BE1A 1PTOB 2EZVA 1YI2A 1WTOA 3VYUA 4L6V5 3GD7A 3E0JA 2E5QA 4R55A 3TP6A 1E2WA 3DLLA 1F2YA 3GP7A 2ZPEB 2B2YA 2NVXB 5GAMg 2KVMA 3L42A 4MZPA 2E74C 3A8LB 1WTXA 4X9DA 5EGTA 1PTOD 1U4LA 3OW2A 1XTDA 5GAMj 2QA4T 2AUKA 2SDFA 2RJCA 4N4HA 2HCCA 5DAUA 2JA5B 2JZ2A 2B2TA 4FNFA 5GMKe 3TP5A 2BA0A 3S17B 4DK0A 2LFNA 2LKVA 1KD1U 5JVH3 2I2LA 2ZPHB 2ZGWA 3LH0A 5K5PA 4YIJA 1UEAB 2K5QA 1JC7A 4RA8A 4M7AG 3L2ZA 4KHZA 2F0JA 5CYUA 2OTJT 4A3MB 1VIEA 2R92B 3LX0A 4L59A 4O1NA 1IREB 2DXTA 4C8QG 1VCIA 3ERQA 3EFRA 4A3DB 3IFTA 2RA2A 3QJ6A 2DEQA 5C4JB 1W6KA 3CC4T 3FMCA 2NLUA 1GUSA 4PJOD 4C92C 4XU0A 1QCBD 1TKWB 1AN8A 1NUCA 4L8JA 4PQXA 3Q6SA 2IX1A 2E70A 2FFKB 4DQ2A 2Z8LA 2XWBB 1YJ9A 5IGGA 1O78A 2K57A 2EY2A 1BCPF 4QW2A 2HQEA 2QXFA 1FD7D 3L2WA 4DU9A 5NUCA 3CCSA 2RKSA 5D65A 3J80L 3V8LA 3P1HA 2RM4A 4NMZA 1S5BD 2JEAI 4X9CA 2XI9A 3JB9H 4XU1A 2RHYA 2E75C 1PSEA 3QXEB 2P4TA 4X3SA 1M90C 1GUOA 4M77G 1SE2A 3IKJA 1GHKA 3K58A 3L9AX 3QPHA 2PZTA 2HD0A 1SNDA 2EJGC 1OO9B 2XU8A 5GAN5 1G2SA 3M4OB 3INZA 3MEUA 2ZPGB 4IUUA 1IZ6A 5LJ5f 5JPNC 3QYGB 3J7YW 2FINB 4QVDA 3OYLA 1IYVA 5C0MA 1VQNA 2Z4IA 4NP5A 5DM7R 1WTVA 2Q8RE 4RCBA 4CKBA 3CD6T 3BZDB 4JUVA 4M7AB 1D1IA 2ICIA 3JB9I 2EY5A 2C9OA 3QKJA 1CA6A 5GAMd 4E7IA 2K1BA 1EY7A 4HR7B 5GAN6 2FMMA 5I9OA 4C8QB 2DTHA 2E2IB 2JNGA 4BY6B 4OVAA 3CCUT 1SE3A 4KHVA 3KBGA 3FB9A 1HA6A 3DB3A 4XTZA 3RESA 1K8MA 5E1FA 3X3NA 1N8RU 3I73A 4IFDJ 3OPOA 4C1NI 1SJED 2WSCE 2RD1A 5FO7B 5FROA 5DM73 3J81L 1E2VA 4RCOA 1GUNA 3RLFA 3NP8A 2E2JB 4BY1B 3BDLA 3C3LA 2AWOA 4OO1G 3RD4A 2XIDA 3X26B 3FC3A 1EEFD 3RKWA 3EVQA 5T1IA 3GTPB 3K57A 1UUPA 1RKNA 2AUJD 3S15B 1NZ9A 3VJPA 4R9WA 4C5EA 1WTWA 1F77A 4LDYA 2RDGA 3SVMA 1YJWT 3X28B 4ILWA 3JCMV 1ICWA 3GTKB 2BE5C 2DVEA 5CQYA 2KAFA 3RUZA 4PLLA 2K05A 2EXZA 3JB9D 4M77B 3MTSA 1B2TA 2DJZA 3DLMA 4QMGA 2RHXA 1S72A 1YIJA 3PT9A 1F9SA 2LNVA 5KGUA 1ENCA 4QCLA 2FB7A 1KQ2A 4IKFA 3OIPA 3QOJA 4XTXA 3CC2A 1V1OA 4M77D 1VQ5A 2BKDN 2SNMA 1SYBA 2KK4A 4JLGA 2EY6A 2L4NA 2Z4HA 4A4HA 4IUQA 1I4RA 4R56A 1G3WA 1D1KA 4A93B 1QJOA 1LTRD 5LJ3g 1Q3LA 1K83B 3V96A 2R7ZB 2DD5A 4KY7A 3UPUA 5I2YA 1EWCA 5LJ3j 2PCFB 4OGCA 2JYOA 1TT2A 2DTIA 2L1BA 4M75F 2E76C 1BKBA 1V1PA 4MIUA 1AHJB 1F2LA 4FT4A 3CPFA 2NBFA 5CBEE 1KD1C 1QVGA 1HK9A 3HRUA 5FU7B 3Q23A 1G5VA 2NB0A 5K36H 3R6OA 2QEXA 3I4NB 2ZT9C 3WVEB 1YJNA 4ELZC 1PTOC 1C4QA 3AHUA 3JAME 3HKZB 1V8QA 4JRIA 4M78F 4OF1A 3G6ET 3EFXD 2YLBA 3SWNB 4C1NK 4A3EB 3RMQA 4HCBA 2B39A 5EBDA 4ZKCB 1HTPA 4BI8B 2DXCA 2B2WA 3CXCA 1RDPD 1CQFA 1CM9A 1TS3A 1BI0A 2L9HA 1DOKA 2X4JA 5IT9E 1DONA 4C3JG 2MF2A 3EJIA 3JRZA 3T4AC 4IZ8A 2RI3A 2OTLA 2QI2A 2F0VA 3A8KE 1EL0A 5CO7A 5CGKA 1Y1VB 2A6HD 2F0NA 2DO3A 4PJOA 3VU3C 2CGHA 4C3IG 1VQPA 2CZ7B 3OB9A 4FT2A 5DM63 5KNCA 3JCMd 2V4DA 3OYHA 4JLIA 2R3ZA 1QE6A 5DY9A 4K5VA 1UNSA 1MI2A 3PUWA 2ID0A 2L89A 4HTHA 1LTSD 3CU7A 5GANh 4CHTB 4OMFB 3CCVT 1U9RA 1KTKA 2EYFA 5HURA 4UDUC 1W6JA 2I46A 3VR5A 1N6AA 1VF5C 4MDXA 2QKIC 2A74C 2EE1A 3H09A 4V0BA 2L3RA 1G3TA 1YITA 3DEOA 5CORA 1KQSS 5CCAA 4C0DC 3HEJA 4X34A 5KNDA 3L2UA 2VYTA 1EY4A 3M56A 5LJ3d 3MP1A 2P0KA 5G3LD 2Z1CA 3GO5A 2TSSA 2ZPBB 2MMPA 5J3BA 2F5KA 5EKIA 2V8KA 1TWGB 4FSXA 1L0XB 1K9MU 1VQ8T 1CZWA 2EJ9A 5ELCA 4UC4A 1QP3A 1TWFB 3VR4A 4A3BB 1GOZA 1RI0A 2KVQG 2EQMA 3MCAB 1D5XC 2RHZA 2NTSA 4E7KA 4HA8A 3A55A 3OOCA 4OB2B 3ZBDA 5GANe 4L63B 3EA6A 2FYKA 3N6RA 1HPCA 3P8HA 2KJXA 3NPPA 3ME9A 3U9OA 1ET9A 4C92D 1II3A 1R8OB 1KHIA 2A68D 5EPLA 4BE0A 4A54A 2F0PA 3CCLA 4PKCC 1TIID 3Q0AA 4M7AC 4TRDA 1Q8IA 3VA7A 3C46A 3KF8A 5CBAE 3MFGA 5I9PA 4BACA 4L6TB 3RMHA 2XDDA 4J6HA 4XT1B 4C3IB 1I6HB 4C8QC 1FGBD 3QUIA 2Q8IB 4XTVA 2AQ2B 4BY6C 4KI0A 3UDCA 1UGSB 1E0BA 3PUYA 3CCQT 3KBXA 1P92A 1H9JA 2RK2A 2EQKA 4NKLA 4KD3A 4KBMB 3MVVA 4MMKA 5EKKA 5CKBA 1WQ7A 3CEYA 3H6ZA 1QILA 3CRKC 2N88A 1ENAA 3EQLC 2K3YA 1AZQA 2JN0A 3CCJA 4M78E 4U68A 4BY7B 3FRPB 2MWPA 1A2UA 3VA5A 4ZTFA 1JWMD 3SB2A 1PRTB 1RHPA 2Q8TA 3I55T 2GQVA 1HXDA 2K5WA 3I3CA 1M9SA 1U1TA 3T53B 5M3MB 4E6IA 4CGYB 3MO8A 2F3WA 3MFYA 4TVRA 3LYIA 3R8BA 1M1KU 2F0GA 4M77C 4HMJA 4KUDK 3C95A 3QZ9B 4M77A 1U1SA 1STEA 2JA8B 3RZOB 2K5LA 3NTIA 2SNSA 1KHCA 2L12A 1WTRA 3HSBA 2P0QA 2VGNA 3OA6A 3MHBA 4OGQC 2FHTA 2KCNA 3DWQA 4BA1I 4A4FA 1LNXA 2IVWA 2OT2A 4CBVA 5E4WC 3EFSA 3QWNA 4EGVA 1OXSC 2WKDA 1ZQ1A 3CCRA 1EY5A 1B9NA 1F2ZA 1Q86C 1FNUA 3E5SA 4PMWA 2L55A 2XVSA 5J22A 3QIAA 4E7JA 1CA5A 4FIBA 4FF2A 3S6WA 2KEEA 3ZFJA 3GTMB 5JEAG 2CW0C 1DXMA 2E6NA 5CAIA 2MHVA 1OXUA 1FWZA 3G7LA 2K3XA 1PTOF 4DOWA 4R8NA 1QNKA 2NVYB 4RG8A 1H9MA 4FO2A 1YCYA 2F69A 1M8VA 2LT4A 5JEAH 4J5YA 4S3SA 4BBRB 1VQ6A 5A0DA 2MPMA 5HY6A 1BO0A 1LV9A 4M7DC 2MWOA 3S14B 3V7RA 1HUNA 1UB4A 2GA4B 1ESRA 3OYMA 3H91A 2OTJA 3SWNA 4LD9K 4ZLTF 3QOLA 2XN9C 2E12A 2BUDA 4KK7A 1BOSA 5KEEA 5CC4A 3TBIB 5FU6B 4N0AC 3CC4A 4J1MA 3CMAT 3HG9A 4N0AA 1LTTD 4CKEA 3PIOA 4PJOF 2IJ0A 4NDXA 3NK9A 5C4ZA 1OYXA 4C5HA 1LABA 1D5MC 4DNTB 1O7ZA 4ZAIA 3OYEA 1VQMT 3FDTA 1LOJA 1G291 4QUCA 4HKEA 1TVXA 2EKOA 4KJOA 3M55A 2VUBA 2WV6D 3AMUA 1YBYA 1K73U 2HDMA 2N55A 3QO2A 3I56T 4OP0A 3PV0A 2VXEA 3H3VC 3DWPA 2DZ9A 1VQ7T 2B2VC 2QEJC 3TU4K 4N4IA 1K9MC 3NTHA 5FLXE 1SNPA 3LX7A 3HOYB 5EJWA 2QF7A 4KKTA 3QG1A 3RIRA 3BDOA 4K8JA 5BN5A 1JOQA 1QVPA 2DXBA 2WSEE 3JB9J 4FXKC 1EY8A 4Q5WA 1TY2A 1Y07A 2JTMA 2M9UA 5C5MA 2KSSA 3HFOA 3CCET 1CTMA 3UI2A 1EFID 1TH7A 5J1ZA 4FF1A 2EYOA 3I90A 3ER0A 1A6XA 4A3IB 2RHIA 4H7BA 3GNFB 2F0UA 1KLUD 4C0FA 1VQ9T 2L11A 2VNUD 5IODA 5GAMf 1NJIU 3FEWX 1JWSD 1BIAA 4D6WA 4V190 1UGPB 2A68C 4DN4M 2EPBA 4C92A 5A2QE 1U4PA 3I70A 1KC8U 1SYFA 2KUMA 1OXXK 3PIO3 2PU9B 4XQQA 5FRNA 2XHCA 4DF7A 3CCUA 4HCZA 1KNAA 1M8AA 2WAQB 2XICA 1H641 1UEBA 5KNBA 5LL6S 1SEBD 4DNRB 2RBMA 2HNIA 3JCMW 3T56B 4BB7A 2X69A 4C0DB 2LY7A 4NOYA 3A8IE 3U9SA 1VMPA 3FEOA 1XX8A 3HOUB 3CRLC 3SFMA 1GXDC 2K01A 2K4YA 1Y8NB 4XIGS 1WVLA 5LJ5g 1SFOB 5CIUA 1EQTA 5KCOA 1RF2D 1UGQB 4ZGEB 2VB3X 3PUZA 4FYDA 1CQVA 3S16B 3CC7T 3CQZB 2CQAA 4A3GB 5E4XA 4BUGA 2E1HA 4LK1C 1M1KC 2EYLA 3A7LA 3DMUA 3V2TA 3DB4A 1A3TA 4ZN3A 2EJGA 1YJWA 4TQUS 1BIBA 2GCXA 2B8AA 4IUTA 3SR1A 1H9SB 3MA2B 3JB9F 1PRTC 4PNYA 4CJ2C 3CMET 4E47A 1JRIA 3S3NA 3HPWA 1F9PA 4A4GA 5C6SA 4J8OA 3OYAA 1U8RA 2FJ2A 1S5ED 1Y96A 3V05A 2R5MA 2NZ1D 3R93A 4PJOE 4ZGDB 1IW7C 3TP8A 4M77F 3A8GB 5GAMh 2QQAA 1I4PA 1TY0A 2ZXOA 3PUVA 5IGEA 3L7ZC 1IHZA 4M7AD 1BCPB 3DEPA 3VYSA 5JVG3 1VQOA 1Y1WB 1STYA 5D3DA 4F7UA 1G8ZD 4JK1C 1Y71A 4C8QD 3BYYB 2WINB 5C4XB 1YJ9T 5EQ0A 4M7DG 2LRQA 4JRKA 4WF2A 2R6GA 4Z9CB 1BI2A 1RTOA 5HK3A 2V8IA 1TWCB 4CRIA 4DA2A 1BR9A 3CCST 2E41A 4NS5A 3M3YB 4Q0FA 3NXWA 1VQKT 5ISRA 1SAPA 5GAOr 4K6DA 3OYNA 2R5AA 3M58A 3T16A 2KOLA 1YHQA 3SD4A 4OO1H 2EJFC 3NE5B 4N9TA 1ZHIA 3CBOA 3G6EA 4LJZC 1LT6D 3GNGA 4EQPA 1Q81C 4WJWA 1JCKB 1KQSA 3PMTA 5D14A 4MDWA 5GAMe 3E1SA 3J80E 1RTNA 2M1HA 3RKXA 2RO0A 2KDSA 1JQYD 1QG7A 1FYCA 2EOTA 2LS01 4XQ3A 3M85A 1R4PB 1STHA 1VQNT 2O2LD 3F70A 3I4MB 5LJ5d 4M8AA 3O8VA 4ATOA 4C5GA 1I5LA 4OO1I 5IAYA 1RD9D 3HHTB 1EZ8A 2F0EA 1VQLT 3D3RA 2NYZD 4F87A 2PPBC 4IFDG 4RGTA 3JCMf 4NL3A 5GANf 1L0YB 5CKDA 4HCCA 2IX0A 5CV8A 2XWJB 5FU6C 2RH2A 4KMUC 2K2VA 4C56C 3GTQB 1K8AU 2CS7A 4M78G 4XTWA 2WKCA 1Y7XA 1QB5D 4EMKB 5CV9A 1I81A 4V2SA 1A15A 3I4LA 2VC8A 3LGLA 1NR4A 2F0IA 1FNWA 3CCVA 2HQXA 1AZPA 4MMLA 1WJSA 2LTOA 1SDFA 1ESFA 2XRSD 3OYFA 3VR2A 3MHXA 3KLRA 4M7DB 2CW0D 1XQHA 4PLIA 1LO5D 2K04A 2LQKA 4M1UB 3SHLA 1JBMA 5J39A 2YLCA 1NJIC 3LWIA 2V8JA 5LJ3f 1HTLD 4F8MA 3TMEA 4TKOB 3CBPA 3J81E 2XD0A 3FLGA 2K03A 1KC8C 3IAYA 4M7DD 1DJRD 5G3LF 1XYIA 2D9TA 2CZ1B 4RAUC 3R3OA 4JDSA 2M2LA 3V8JA 4FXDA 5C5LA 3X3MA 2PQWA 4OB3B 1SYEA 2L8DA 3MXNA 2E6ZA 2KY9A 1B34B 4CI0C 4FP5D 2X4YA 3NHHA 1X32A 5DNFA 2HCIA 1S72T 1SYCA 4RGNA 3PFSA 2LCCA 1J9OA 2X6GA 3A7AB 3H6MA 1YIJT 3G4SA 2F03A 2MGSA 2MUYA 5IIFA 5EPKA 4NL2A 4C92F 5GAOn 1NCVA 2VXFA 1STBA 4EMGA 3WOEA 4GY5A 3IL8A 1SNQA 2NN6G 3A56A 4X3TA 2PZWA 4N9PA 3JCMh 4C3HG 5KE2A 3TN2A 2RI5A 2QQSA 4O42A 4OGEA 1DM0B 2AWNA 1I6VC 1KAAA 3OYBA 3OYKA 3WDNA 1NAPA 3ZYYX 1VUBA 1HXYD 3M4YA 3RMSA 1JB3A 5CMDA 3QSUA 2IX3A 1HRJA 3CCQA 3C1FA 2XG8D 3QBYA 1STGA 1VF7A 4M78B 1T5XD 2JXMB 2FL7A 2MJ8A 1QOHA 4K5WA