3NTIA

Crystal structure of tudor and aubergine [r15(me2s)] complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
163
Chain Sequence
ELHNCVVVQFDGPMSFYVQMESDVPALEQMTDKLLDAEQDLPAFSDLKEGALCVAQFPEDEVFYRAQIRKVLDDGKCEVHFIDFGNNAVTQQFRQLPEELAKPARYSRHCELDASTISAALLQSFIDTRFSETFQVEILATKGTGTHVVRLFYQSKNISEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Maternal protein tudor
publication title Structural basis for methylarginine-dependent recognition of Aubergine by Tudor
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 36
structure length 163
sequence length 166
ec nomenclature
pdb deposition date 2010-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ntiA02
2.40.50.790 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ntiA01
2RHUA 4IUUA 3OS1A 2X4XA 3OYJA 1RI0A 2RJEA 4IUTA 4X34A 4BE1A 2GFUA 3MP6A 4LD6A 1MHNA 5KCHA 3MO8A 4IUVA 3OYHA 2EQUA 2EKOA 3NTIA 4N4GA 5KE2A 3QJ6A 2HQEA 1WJRA 5J26A 1WGSA 2D9TA 2EFIA 4IKFA 4OVAA 2MWOA 3OS2A 3S3NA 1G5VA 2XK0A 2L8DA 2GF7A 4QW2A 3OB9A 4II1A 4B9XA 3P8DA 2PQWA 4BD3A 5C0MA 2EQKA 3NTHA 4C5EA 4BDZA 4E7KA 1OZ3A 5D6XA 4C5HA 4PLLA 2O4XA 2LDMA 3F70A 3MEUA 3FLGA 3L2VA 3ZEHA 3L2UA 3LX7A 2CKKA 2QQSA 2BUDA 3DB4A 2GFAA 2RO0A 4FU6A 3MEVA 3FEOA 4E7LA 3OYAA 4NS5A 3MP1A 4QQ6A 3L2WA 2EQMA 2M1HA 4Z02A 3C4SA 2QQRA 2RJDA 4B9WA 3OYIA 3DLMA 3UT1A 3S3OA 3LYIA 2LCCA 3LGLA 4UC4A 5J39A 3OY9A 2IG0A 2FHDA 4IUQA 4ZTFA 3PFSA 5KCOA 3ASKA 4QQGA 4A4GA 4E7IA 3EAEA 2F5KA 3OYEA 4A4FA 3L2RA 3QKJA 3P8HA 2M0OA 5IN1A 4C5GA 4C5IA 2LVMA 1N27A 3ME9A 3OQ5A 2E5QA 3OYDA 4ZTJA 4PLIA 2DAQA 5IAYA 4HCZA 4FL6A 2RJCA 2DIGA 2R5AA 3PMIA 4RG2A 3MEAA 3OS0A 4N4HA 2RI3A 3L2QA 3H8ZA 5C6SA 2K3YA 2RHIA 3O8VA 2L3RA 5CIUA 3META 2NLUA 2K3XA 2O4XB 3E9GA 2G3RA 5KH6A 3GOXA 2X4WA 1OYXA 2XDPA 2RHYA 3OMGA 3SD4A 5M9OA 2BKDN 4EDUA 4BE0A 3PNWC 1OZ2A 4L59A 3L42A 3E9FA 3OYNA 2L89A 5FROA 4QQDA 3DB3A 5KE3A 2BIVA 3NTKA 2JZ2A 2VYTA 5D6YA 5D6WA 4BACA 4BDYA 2R58A 2RI2A 3UWNA 3M9QA 1H3ZA 2X4YA 4GY5A 5FRMA 4CRIA 2LTOA 1WJSA 2RJFA 2WACA 2RHZA 2RHXA 2RI5A 3OMCA 3QIIA 4N4IA 4A4EA 1KHCA 4Q5WA 3S3MA 2R5MA 3MEWA 3OYBA 2LRQA 4PL6A 2M16A 1OI1A 2HQXA 1WJQA 4A4HA 4E7HA 1XNIA 2X35A 2P0KA 2JTFA 2B8AA 3OA6A 3FDRA 3BDLA 5FRNA 4IUPA 2EQJA 3KUFA 4IURA 3FC3A 3LLRA 3OYGA 2E6NA 3OYMA 3PMTA 4QVZA 1SSFA 2R57A 3Q1JA 3OYLA 4BE2A 3S6WA 4E7JA 3OYKA 3CEYA 2MWPA 3LGFA 2DIQA 3H6ZA 3OYCA 3OYFA 3MP8A 3QBYA 3LH0A 2YRVA
chains in the Genus database with same CATH superfamily
4OHJA 2J6OA 3EGDA 4A3KG 7AT1B 3PQIA 2GFUA 5ELBA 4Q0FA 3MP6A 3VR5A 2A8VA 1SAPA 2QAZA 3O5ZA 1EU4A 1DD2A 4J6XA 1K3BC 1YITT 3CPFA 1BR9A 4AQYL 1PH3A 4B3MQ 3RKYA 5J26A 3T9NA 1SSHA 2ZJPA 4M78E 2G9DA 2BA1A 1Y1VB 2DEQA 2L55A 1JOQA 1ASYA 3U4VA 3P8DA 5KYLA 1Q82C 4BD3A 2CW0C 3AEVA 1M1KR 1NAPA 2PU9B 1TU0B 2K01A 2J6FA 1LT5D 3ULRB 3L2UA 2FJ2A 3M54A 2JE6I 3QUIA 2QQSA 4DNIA 2YTVA 3NK9A 3JAMc 1DOKA 1EQQA 3PO3H 2OJ2A 3C4SA 2B2TC 1EOVA 2F0LA 5D3DA 5BN4A 3HOWG 2ZPEB 3LYIA 5HCKA 1VQMA 1VQ5T 2SOBA 3EJIA 2FHDA 4KUIA 3M0TA 1LOJA 3I55T 4C8QD 2WP8J 5K36H 4KUDK 2EOTA 2DVJA 2HL3A 4RUGA 2A0FB 5BR8L 2DTHA 4C5GA 1GCQC 1PHTA 3RD4A 4FW1A 2RDGA 3RNJA 1SNOA 3EA6A 3VYTA 3A55A 1MMGA 1R77A 3KBXA 3OIQA 2K5HA 4FNFA 3QXEB 1Q1EA 4LXCA 2RI3A 3MAQA 2NVTB 1STBA 3JCMP 5C6SA 3NP8A 1PLFA 5C3EH 2WKDA 4PJNA 4OMOA 3CP0A 1GKHA 2EYFA 4DR3L 2OQ0A 4XTVA 4C0FA 4JC0A 4ANJA 1YJNT 1NG2A 3SHLA 1AWOA 1IBKQ 1LLRD 4J15A 3PNWC 3STBD 1ET6A 3CCSQ 1GUOA 3E9FA 1C1AA 4F7UA 4N0AA 1W2BP 1V1PB 2MMPA 1PKSA 4G7OC 4C8QF 3QO2A 1OXSC 1UFFA 1VIFA 1E24A 1YP5A 2R58A 5CVIA 1F2ZA 1SSOA 2MIOA 1WCMH 2IPKD 3NQTA 4ZAIA 3Q22A 2QK0A 1HR0Q 4ZUIA 1ZBJA 2DK3A 4NDXA 4GKKQ 2BH8A 2G5DA 2LTOA 3RR6A 3MJXA 1KC8C 2R6GA 1ENAA 1Y71A 4HCCA 3KOJA 4LN2A 1EQRA 5EBCA 2O5IC 4XAXB 1MMDA 1VQ7Q 4H13C 3A8GB 1OI1A 2KXCA 4JI1Q 5FLMH 1B1ZA 4LUEA 1U06A 3G1JA 4E7HA 2COZA 2ROTA 1FNWA 3MC0B 5LMNL 1PH5A 4LF8Q 1WD1A 4HVUA 3AQQA 4RKBA 2K3BA 2GNCA 3QB3A 2QDYB 5C3WA 2VKNA 2LT4A 3S15H 4OMMA 3FC3A 2E6NA 3PMTA 2AWNA 1SSFA 2VASA 3A8OB 1H92A 1ICWA 5KYIA 2NUCA 1DONA 2F1LA 3OYLA 5HGQA 1YWPA 4E7JA 4E47A 1EWHA 2QILA 2M0YA 8AT1B 5C4HA 3EFRA 2NN6I 4GKJQ 4DU9A 3LH0A 3CCJT 1K28A 2ZM6L 4FSXA 4X34A 4DBQA 1GFDA 4DF7A 4LD6A 3GP7A 3QR8A 1VQCA 5KE2A 4GLKA 2HQEA 1TY2A 1WLPB 4LF5L 1KSWA 2D9TA 2R7DA 1BKBA 3VS7A 1UE5A 2CP5A 4MDWA 2XK0A 5HURA 5KNCA 2L9HA 2QA4T 1YHQT 1HD3A 1NPRA 2K75A 1C0MA 1KNAA 1X01A 2JA6G 3OSSC 1KDCA 5GQOA 2ED0A 1C4QA 1MUZA 3OHXC 4PMCA 3OS5A 2LDMA 3V8KA 2DRKA 5GAMh 1LTID 2N78A 4L8JA 3ZEHA 2PZ1A 2DKGA 1F9RA 3S17H 2RO0A 4JI3L 3SDZA 1WTWA 2NUPB 4LUDA 1Q7YC 2AHJB 1ZSGA 1NUCA 3T1HQ 2A74C 4LDYA 2RDHA 1LTSD 1J6QA 1K3RA 4C92D 2K04A 5KYWB 4C8QG 2PQAB 3KF6A 1LUZA 4A3MG 4IPHA 4JI4Q 1HHVA 4U68A 2KRSA 3H0GB 1BB9A 3WVDB 2A6EC 4FSSA 5I6YA 2EYPA 2LCLA 3CXCA 2DGYA 5EKKA 1GUWA 4C3JB 4KKTA 2O2LD 2K9GA 3CQZH 2QGGA 1S72T 4A3BH 4LWCA 1WTPA 2FPDA 3VS3A 1QNKA 1K73R 3H41A 4OIJA 1SJED 2FFKB 5C4JH 3HOYH 5KYYA 1FGUA 2A7YA 2PZTA 3LNNA 1A2UA 5CQXA 3ONAB 4EVOA 3A8LB 1FL0A 4A4IA 1IXDA 1M8VA 5BN3A 3RNUA 4N0AC 3OIPA 2JA5G 1QP2A 1MHWC 4KGZB 4N8X1 3M4OB 2BKDN 5CBEE 4RGOS 2EYJA 4F04B 1EYCA 2RKSA 1MV3A 4C92F 5LJ3f 2DJFC 3D4DA 1CK1A 3NE5B 1BOSA 4HMJA 3FB9A 1XYIA 3H91A 3I72A 4HVVA 5ELFA 2XIDA 4F88A 4C8QE 1SNPA 2DZ9A 1TWGH 3UDIA 4B3TL 3HPWA 1Y7XA 3ZYYX 4CKBA 3VDYA 4C3IB 1YJWA 3T53B 4A3DB 2D8HA 1WJSA 1XNQQ 4ZN3A 3KDFA 3S1QB 2B2VA 3MEFA 3TZUA 2X51A 1EFWA 2RB6A 1Z7TA 4MNOA 4I65A 2EBPA 5IHKA 3E9IA 1UUEA 3HKZB 2CP7A 2J06A 1YHBA 2ZTCA 2MK5A 5AFWA 4TVRA 3VR2A 2E2JH 2B8AA 4KBMB 3PMFA 2HMAA 1MNEA 2L1BA 4P72A 5AYFA 3BZCA 1MMAA 3W3AA 3TS0A 4IURA 3G6EA 2F3WA 4IFDH 2RHQB 1U5SA 1ARKA 2IW3A 3A8MB 1D5MC 2B2YC 5EKIA 1N5ZA 2LKVA 1Z9QA 1WZOA 4A63B 2DXBA 5M3MB 1NR4A 2MWPA 4PK4A 4HEDA 3H6ZA 2OEOA 4J6HA 4BBRG 4BY7B 3I3CA 2LJ1A 4RKLA 4DEYA 4IUUA 1GL5A 2UXBQ 1X54A 2KGTA 4F7UB 4FF3A 3E3XA 5CV7A 3CCLA 4R4CA 1MHNA 1IHWA 1F2LA 4A3FB 2NWMA 4M7DD 2HNIA 5CORA 1A8VA 2J05A 1EY0A 3ZBDA 1I4RA 2VQFQ 3S9WA 2K5QA 1G5VA 3M4QA 1IHVA 2KEAA 3FJ5A 2A68D 2ENBA 2QGQA 3R2TA 4LFCQ 1ZBXA 2D62A 2Q2IA 2PUKB 3SHWA 2H3EB 4BDZA 1E2WA 4C5HA 5I9OA 4PLLA 2O4XA 4YWKA 3URYA 4DV2Q 4X6AH 3MEUA 3P20A 4P75A 3OW2S 1OXTA 4DAMA 3LX7A 2HSPA 1BQQT 5IY0A 2VWFA 4A76A 3L1AA 3OYAA 3I4LA 4RG1A 1JBMA 2F2VA 5DLOA 5IE8A 1Y1WB 3W2DA 4JBMA 2NUZA 2M1HA 1LTTD 4L6V5 4C92G 5FK9C 3EG1A 3UT1A 1CFMA 4QIWB 4J9HA 1A63A 5CR3A 3CXCP 3T56B 1D09B 4IUQA 1VQOQ 2A3LA 4IZ8A 5FLXE 1LT3D 4RTWA 4ABNA 4A4FA 1X2QA 3FRPB 2NVTH 3S1MB 4BXXG 3PUYA 4UY8C 5K5PA 2AMCB 2LXJA 3DM1A 3ND9A 4P73A 4PZ6A 4DR4L 2RPNA 1SDFA 1HNZL 1RI9A 3M56A 2F0DA 3FMCA 4LUVA 3TSSA 4M75C 4DV4Q 1A0IA 1ZX6A 2VGNA 1WHMA 3EBEA 2CREA 2ZPFB 4O2DA 4LF7L 3S16B 3L9AX 1VYTA 1IBMQ 3QO3A 2SEMA 1PRMC 1HA5A 2NLUA 3SEMA 1SYDA 4DV3L 2G3RA 3GQBA 1N33Q 2JA7G 4C2MB 1M90R 3DXJC 2PZUA 4JI6L 4HCBA 3PT9A 4BE0A 1TUDA 2PI2A 1RIPA 2LNVA 1T0HA 3CMAQ 4LDWA 4HT8A 2FHTA 2JM9A 4J83A 3QIAA 4ULLA 4C92E 1KXLA 1BI1A 1RAIB 2AKLA 3INZA 5JJKA 5KE3A 4BACA 3C3LA 4NP5A 3RKWA 4NXML 2P4RA 3P8BB 4BUGA 1WHHA 1SYFA 2B2VC 3JB9J 3VR3A 3NEMA 4JBKA 3MCAB 1T5EA 2RQXA 2XD0A 4ME7A 2OX7A 3CCQT 1YNJC 1IXRA 4N4IA 2LXKA 3PUWA 5BN5A 4WJ3M 2UXCL 2EYQA 2ZAEA 1HFNA 2QDBA 2BZYA 3GF5A 2K28A 1FVIA 5I2SA 5FOBB 4YIJA 5CV9A 1XJWB 5E7NA 4RTTA 2E2IB 2IWHA 3F2BA 3FDRA 2CS7A 3KYHC 4DV7Q 3BDLA 4JZ3A 1UJ0A 1QKWA 4CC3A 5DY9A 3DUZA 1QB5D 4O6JA 5G3LD 1I4PA 5JEAH 5KYYB 1Q81U 1FMVA 4OGCA 3TP6A 3VYUA 3HRTA 2NZHA 1FR3A 2BCOA 1IGQA 3T1YQ 1Q8KA 2HHHL 3QOJA 2FRYA 1MGSA 1J8IA 4OEMB 3GTQB 1Y0MA 3FRNA 2NN6G 2XRQD 3T13A 3PO2G 4V2SA 4BI3A 1TWAB 4K8JA 4X62Q 3I4NH 4X64Q 3CC2T 4NXNL 1GHKA 2EYHA 2NB0A 4AT1B 4EMKA 4X3SA 1VQNT 2EKOA 4JRQA 3H09A 5CC4A 5LJ5d 1TXYA 1I1JA 5ELOA 1G6ZA 1EY8A 1HTLD 1O75A 3ND8A 4IKFA 3OS2A 2QEXA 1Q86R 3S3NA 1Y8PB 4LAAA 5IOCA 3KDFB 1U3OA 3CQTA 1GJXA 2XGTA 4RHRA 4CDFC 3GP8A 3QPHA 1RL2A 1I5FA 3G48A 1U4RA 2RA2A 1Z9FA 3DWAA 4LF6L 1GXDC 1JOOA 3L2VA 4AIMA 3CCEA 1YI2Q 4R9WA 5G3LF 9ATCB 2NYSA 2RH2A 4IFDI 3CCRQ 4FU6A 4KJNA 1IREB 4WF2A 5ECAA 3MXNB 4XYOA 3H0GH 5FKAC 1N34Q 2ES2A 2AWOA 3EVQA 2I5LX 2JK8A 2QGFB 1UE9A 3ITPA 3TVTA 4FW2A 1LO5D 1TWBA 2HKNA 2IX0A 1Q12A 3EFOA 3GPLA 2EGEA 4C3JH 2JTEA 3EG2A 4FO2A 3CU7A 4FYDA 2JA8B 2J7ZA 3H3VH 4DR6Q 4JRPA 2F0VA 5JPNC 1WTOA 4YWMA 1YIJT 1AZQA 3I2ZA 5DM63 1YHAA 4KHPQ 2VNUD 1HK9A 4E7ZA 3TDQA 2EWNA 1VQKA 2DA9A 4FT2A 4DA4A 1EU3A 2RNAA 4NL2A 2PMZB 2F69A 2JM8A 4JBWA 3GTPB 1VQ6Q 5GADC 1SR3A 5KNBA 1OXUA 4F16A 4JDSA 1RHPA 1WYDA 4DV6L 2EXDA 3M59A 2I46A 4Z8AA 1RJTA 1LCKA 4ATOA 2O4XB 4RCNA 3M4YA 1AT1B 2WAQB 2AHOB 2KBNA 3U50C 5C44B 1E6HA 4M7AD 2OF1A 4FP5D 3PO3G 1VQ8Q 2RSNA 4C3IH 4DK0A 1S5BD 4A3DH 2OT2A 1UGQB 3MHXA 3S1QH 3T4AC 1GXIE 4AYBG 2FZGB 3TP8A 2LJ3A 3DB3A 5FU6C 3J7A5 1VQBA 1GRIA 4LK1C 4K0KL 5K36G 2RI2A 1JJ2S 4LF9L 2OTJA 4F17A 2DL8A 5EG2A 2KJXA 3UDXA 2E74C 3A5UA 2DNEA 4CRIA 1KIKA 2EJGA 1YJ9Q 3OBWA 1WOCA 3CKIB 5AJ3Q 4XK8E 1EY5A 1W6XA 2HQXA 4ZUJA 5IT9L 3BE3A 4EIKA 1VQ9A 2LT1A 5FWBA 1BYMA 1BBZA 2ZPGB 5M3MH 1IW7D 3X3MA 4XDXA 3HRSA 2JN0A 1RTOA 3JAMi 1W1FA 4YCVA 3WVEB 3KUFA 4BY7H 1AVZC 2XVSA 2BZ8A 5C3EG 1VQPA 2KAFA 2X9HA 3CPWA 2F0KA 1PYSB 1QCNA 5IODA 2YU9B 1BNZA 4JYAQ 1JWMD 3V7CA 2DFUA 3PVQA 4M7AF 2YSQA 1K0XA 1II3A 1TS2A 3N52A 4DUZQ 2CP3A 4NB3A 4B3SQ 4OX9L 5IHIA 2Z4HA 1Q82R 5KGUA 3OYCA 3Q0AA 4EMKC 4L6TB 1JJCB 2DL4A 2VUBA 5GAN5 3OS1A 5ELCA 4AYBE 4R55A 1KHIA 1WCMG 3RLNA 4HA8A 4DFAA 2NBFA 2JS0A 3OTOQ 5KCHA 3EIVA 4HAEA 1B9NA 5J22A 4BA2I 1S1NA 3JSCA 1QVGP 2K03A 1JEGA 4X1VA 3P1HA 3D3RA 2NWGA 1VQ4A 4Q5VA 1VQMT 4CC2A 5FU6B 4GBQA 5CK9A 3PV0A 4KULA 3E0EA 5JAVA 4JI7Q 5FLMG 3HOZB 2BOSA 5DAUA 3TP7A 3A56A 1Y1WH 3CHBD 3DWPA 4XYQA 4E7KA 2D6FA 1OZ3A 1S5CD 1IHZA 2FXQA 1YNND 3DKMA 4CJ2C 2R92H 1D1BA 4PKCC 1V1OA 2DBKA 1BXTA 2V1CC 1O7IA 1CSKA 1XPRA 1SJHD 2BUDA 3EROA 1M27C 2VUMB 5IH2A 2M9UA 3JCMe 3M53A 4PJOG 2HDMA 4IOCA 3S1MH 2BZXA 1D0YA 2GGRA 4YY3Q 1X3EA 1PFNA 4KD3A 2RJDA 2YHTA 2JUFA 4X66L 1K9MC 2ZTDA 4FIBA 1K0RA 2F0NA 2HIVA 4ZK9B 5KCOA 1X3GA 1WHKA 2SNMA 3X26B 2GVAA 3KLRA 1RAEB 1GBRA 4IQZA 4ORZA 1TVXA 1GM5A 4GKKL 3CBMA 5GMKm 2BA0A 3SK6A 3S16H 2DJGC 3K59A 4B3RL 2EVRA 4RTXA 2MHVA 4IPDA 1JXMA 5EPLA 2AKWB 3OQ5A 3CC7Q 2K4YA 4EPCA 1M2VA 4FL6A 3M0UA 4C2MH 3BYTB 1NBWA 4YCUA 2P84A 4N4HA 4L5SA 4F7XA 1RTNA 2ICIA 3HOXB 2AT1B 2K2VA 1W2BS 2R93B 1M4ZA 1QOHA 1KC8R 2PW7A 2K3XA 1AWWA 1BI2A 4M7AG 2H4OA 1OV3A 5FJ8H 4ZLTF 5IYBH 2ZTEA 2TMPA 1K83B 1D5XC 1FJGQ 4PJOE 2I5HA 4GKJL 3I5RA 3BDUA 2YWWA 1CKNA 2Z4IA 1DOLA 4RTYA 3H3VI 1FMWA 2LQWA 3NTKA 1H9JA 2A69C 4R8NA 3TEHB 3EFOB 1Y8NB 3N5BB 1AW7A 2EJGC 4BY1B 3UWNA 1QILA 2K32A 2YUNA 1MKHA 1I6HB 3HHTB 2E2IH 5C5LA 1B3QA 1WPYA 2HD0A 1GCQA 4A4EA 4TSSA 1HNXL 1B4OA 3M9BA 1ZSZB 3C95A 3G4SQ 3PUVA 1I4XA 3OYBA 2OXPA 1Q95G 1JQQA 1CKOA 2RK1A 2YUQA 4J9IA 4M78C 3V2TA 4A3BG 2X35A 1IRXA 1Y07A 5TSSA 1UJYA 2CW0D 4KY7A 1LTLA 4QGUA 3PE0A 3FIFA 4J5YA 4J9FA 3CD6A 3TP5A 2DL3A 3CMEA 4E6IA 5C0XH 3GTQH 3JRZA 1TWAH 3KJPA 3K0XA 4Z89A 3TS2A 3I8ZA 2MAMA 2RF0A 3VS1A 2PYKA 2QASA 4PFZA 3CCMQ 4M7AE 2N8NA 2DJQA 2NUTB 3CCUA 2ZPIB 5JJIA 2EZVA 1PXUA 1TWHB 5DM73 1HJPA 1STEA 2VC8A 2FZKB 2RM4A 1HH2P 5DNFA 4ME3A 2XWBB 3EG3A 2PTKA 2XHCA 5CR2A 4DR5L 3RBBB 2E8GA 2E4HA 4R0KA 3QWYA 2K5LA 3GBQA 3VUZA 3OYHA 1Q7YR 1PD0A 4DK3C 4Y28E 4TQUS 4J7IA 4AG2C 1TKWB 1X2KA 2EFIA 3AB9A 4CBVA 4A3EB 4XQNA 4S3SA 2B29A 3VRZA 2KRNA 4EGVA 1NMFA 4XTWA 1UTIA 6AT1B 4HCKA 4MTNA 3SK5A 1SBBB 1QMCA 2M51A 3RR5A 2JMAA 2DXCA 1I0CA 1K73U 4BY6C 3E9HA 2ABLA 3X3NA 2JA8H 2GFAA 4IFDG 1JMCA 1MSGA 3OYIA 5FWCA 2JOYA 5I4DA 1EL0A 3LGLA 5I6WA 5E1FA 1HXDA 1XPOA 2I0NA 2K7AA 1B44D 4UP7A 2KENA 1NE3A 4HIMA 1NEGA 5T1GA 1BCPC 4L5GA 2CSQA 4M77A 2OTLQ 1E0BA 2F0UA 4I7ZC 1PZKD 1CA5A 3G71A 2LY7A 3GTPH 3JV3A 2DTOA 2PNIA 3P8HA 4LFBL 4G7ZC 1XNQL 4OGEA 4A3JG 1SEBD 2EXZA 2F1MA 1PHJA 3A74A 2E10A 3M5AA 4PMWA 2RHSB 4QVDA 4DR7Q 1VS0A 3I4MB 4C8QA 1KNEA 1G6PA 2JT4A 5GAN8 1T3LA 2FG0A 2R5AA 1RDPD 1RAGB 4ZGEB 5C44H 3MEAA 3V7RA 1SNDA 4E6RA 1RCVD 3SXHA 1W70A 1BBWA 4OMFB 5JEAJ 3TU4K 4MIUA 2RBMA 2B39A 1YJWT 2K50A 2BE9B 2Z0WA 2JEAI 3JCMX 2EY2A 3A0JA 1H641 3SD4A 4PNYA 3PIO3 2KECA 2HKQB 1SNQA 5GAGC 4LD9K 3M7GA 2MNAA 3G4SA 1D1IA 4DV0L 3GTMB 4JI8L 3NXWA 1XNRQ 2GQIA 4Y7NB 4LMQD 5D6YA 4BY6B 4ZYSA 4GNXA 2KYBA 3G6ET 1I4K1 4YHHL 2X4YA 3I56Q 3JAME 5FRMA 1QWEA 2EY5A 2MPXC 2VY3A 2VQFL 1GFCA 1VF5C 2D0PA 1Z6HA 3S24A 5IYCH 2O9VA 2EY6A 5LJ5j 2G6FX 1EIYB 4PL6A 3SB2A 3X24B 1BCPB 3VR4A 1TR5A 4V190 4RAUC 4MZMA 2B8GA 1ABOA 3MXUA 1MJEA 4IOAA 4EQPA 1CSQA 1VQJA 3CCLT 2CGHA 3CCVQ 1N32Q 1VQLA 4GN4B 2KCNA 3QDFA 2F4VQ 4KT0E 3HP3A 2JW4A 2PQEA 1W6KA 4C1NK 1QCOA 3M58A 4ELYC 4HR7B 5LJ5e 4HMIA 2QCPX 3DEOA 1WI5A 3G6JB 2RHUA 1OEBA 5A2QL 1KRSA 3WDNA 3BVGA 2X4XA 1CKNB 1TY0A 5T1IA 3LWUA 4QY7A 1ZLMA 2AZSA 2C0TA 5ELEA 1C7YA 2CWPA 4KI0A 1WHJA 3I4NB 2DM1A 2A6ED 3QJ6A 3L3OC 5GANe 2AKKA 3I90A 2LQ8A 4OGQC 1ZXTA 4OVAA 2KEDA 3GV6A 1YITQ 2B8FA 4QW2A 3OW7A 2QG9B 1P8LA 3LWEA 1JR0D 1K1ZA 1PVOA 4RA8A 1N36Q 3I5SA 1SHGA 5C0XI 1PH8A 2KT1A 3CXCS 2CQAA 2F0WA 2OTLA 1RADB 2N88A 2CSIA 5CO7A 3FEOA 1EYAA 1PMRA 3NWSA 4PMBA 5JEAG 1UB4A 4PJMA 1JE5A 2X3XD 1TXQA 2B2YA 4PJJA 4QQ6A 3A7AB 4KN7C 4BA1I 2EQMA 4M77C 2QQRA 3HOVG 3QOLA 1M90U 2KE9A 4JVZA 2UUCL 3OY9A 1G8XA 4ZTFA 1DJRD 2AUKA 3PFSA 3T16A 1FNUA 1LPLA 3JCMc 1B53A 3PVLA 3MA2B 1I5LA 2A08A 3EN2A 1VQ5Q 4TRDA 2A6HC 2NVYB 2CT4A 4C8QC 4KRTA 1XQHA 3I55Q 4X65Q 4DR1Q 4JI2L 1A15A 1CUKA 3HOXH 1NM7A 2R93H 4FYXB 1L0WA 2FVUA 1QWFA 4DV2L 1G2BA 1NE8A 4E2FB 4PZ8A 3S14H 2K79A 2JXBA 2K2MA 5LJ5g 1B50A 1K83H 3OBYA 2ATCB 2F0PA 2VB3X 2Q8RE 3W5OA 3HZXA 5CIUA 4DAPA 2VQEQ 2E5LQ 2KROA 3META 4Y92A 2CH4A 2EGAA 4BY1H 1D2BA 3S2HB 3NBHA 3T1YL 2QXFA 3RN2A 4F7UF 5GANg 4M1UB 4N9PA 4GNXC 1I6HH 5M9OA 1BU1A 5A0GA 1U4MA 1XX8A 3JCMd 1EIFA 3HL8A 4DKAC 3L42A 1AWJA 2EYLA 4BWGB 1YJNQ 3I7FA 4C3JG 3EGDB 1IBLQ 1U8RA 4BDYA 3RLOA 1EY6A 3W1BA 2C0IA 2AIRB 2AUJD 1ILQA 3EG0A 1PYWD 2C9OA 1BIAA 1SN8A 3EH2A 1OPKA 4M77B 2E65A 3NBIA 1N9SA 3M4PA 2RJFA 1WVLA 1SLJA 1SEMA 3CCSA 3JCMf 3VJPA 2JP1A 1B7YB 1I4HA 2M16A 4JZ4A 3BZKA 4HSVA 4M75A 1GD7A 2L4NA 1QZHA 2EQIA 4JLIA 1SRLA 4J9DA 1Q86U 2JTMA 3U23A 5FRNA 4P74A 1FXXA 1JC7A 1WI7A 1NR2A 3V96A 1RKNA 2E2DC 4EQOA 1VQIA 3AMUA 4RMOA 1VQ7A 2QEXT 2JYOA 5M5WB 3S1RB 4JJDA 1D0XA 4QT7A 4RH6A 4C3IG 4A3DG 1NPPA 3C2PA 2UXDQ 4CDCC 2R7ZB 1AWXA 3MP8A 1UECA 2BDOA 2KCCA 2YRVA 4XIGS 5GMKh 1EYDA 2L3SA 5COYA 4DAVA 4A3EH 1YITA 3FEWX 4FXKC 4LFAQ 2XI9A 3CCET 3WXMB 1RI0A 5KYNA 4KN4C 1Z47A 4GN5A 5LMUL 4HIDA 4XXEA 4GNXB 4H44C 3CCJQ 3J7AF 4KHPL 2EQUA 3VS4A 2J0TD 1AOJA 3FPPA 4L5QA 1ILPA 3HTRA 3GTKB 2K5FA 1SMYD 4DN4M 4C1NI 1X43A 2P0QA 1ICFB 1NYGA 1WJJA 1E6GA 4K11A 1HQMC 1OULA 2ZPBB 3QZ9B 4C5EA 5M3MG 1WXUA 4AQYQ 2CWAA 1XMQL 1ABQA 2KQ3A 2UUBL 3S1NB 3VYGA 2HBWA 4TKOB 2QA4Q 4BY7G 1YHQQ 3P7JA 3GNGA 2NYZD 1X75C 1VQKT 4F7UG 2ID0A 2E12A 1R4QB 1X6GA 2EAYA 3MP1A 1Y1VH 1PSEA 2EYYA 3M0PA 1O7YA 4JJBA 2WSCE 1RABB 4DOVA 1O78A 3SVMA 2KK4A 2PUOB 3I4MH 3J80L 1N8RC 1LM0A 4I7AA 4F8MA 3OYYA 1C9OA 3OYEA 4UP9A 3QKJA 2LP5A 2MQHA 1CHQD 3OWEB 2B2WA 1RD9D 4A3GG 2CDTA 3A8KE 3UE1A 5AJ3L 3VKIA 4IIMA 3OYDA 2CFMA 1YNJD 3LGJA 4HCZA 4J9BA 5GMKl 3PTAA 2RJCA 2ICEC 1J5EL 5BR8Q 1PWTA 3OS0A 4RCOA 1PDQA 1Y1WG 2A5HA 5KIXA 1QUQA 1KD1C 2OTJT 2JMCA 3C12A 3K81C 1S72Q 5H1SE 2H8HA 2CYZB 3GTMH 2PVDB 3A1PA 3QWXX 4OMPA 2R92G 2EJMA 4JYAL 3M3YB 2QEJC 2I5MX 4DUZL 2Z6BA 1OYXA 2CZ0B 3MPUB 2RHYA 3BVMA 1ESFA 1E2ZA 4F7UE 4FYWB 4EDUA 2VVKA 4HCEA 1EQVA 4Y91A 1VQ9T 3RESA 3I4OA 5HGTA 2NVQB 1G2TA 5C3XA 1YEZA 4AFUC 1QVFA 1NY4A 3PF5A 1KK7A 4M7DF 1K0SA 4DR3Q 3H0HA 1D5ZC 1Q82U 2FMCA 4RGNA 1R8OB 5ELNA 4DV1Q 3FPUB 4LF4L 1VQPT 4A93B 4QCLA 1AE2A 3K5NA 1AH9A 5CKDA 5C4XB 3BFMA 4D8KA 4CDEC 3NENA 1P92A 2CUBA 1UDLA 3OMCA 4Z88A 4ZGJB 5GMKj 3JC66 1FNVA 1Y57A 2KR3A 4Q5WA 2GVBA 2ZXRA 3UDFA 1EOTA 4EX5A 5IT9c 3NPFA 4DR2Q 3VS0A 2HL5C 3U58A 1X65A 2AQ2B 3BJUA 2E5KA 4KHZA 2A19A 4JRKA 3K5OA 4X3UA 2HDAA 2A36A 4BBSG 3D0FA 1ZA1B 4QIWE 2WIIB 3KLWA 2NVXB 2YUPA 1STGA 1VQ4T 2JEBI 3E0JA 2V26A 1S5ED 1WA7A 2ZXOA 5CCAA 3HG9A 5FJ8G 2VB6A 4GOPA 5IYBG 1I4GA 4JBJA 3D4WA 1PD1A 5GMKe 1QVGS 1ZYRC 3QDRB 5CV4A 1JO8A 2YUOA 2C35B 2D2CC 3NBHB 1Y69U 3KF6B 3ULPA 1X6OA 2L15A 3D6WA 3K6OA 2MO0A 4PFOA 5IT9E 2DETA 3QYGB 2EPDA 5EAYA 1BIBA 4ODGA 4CHTB 2RK2A 4IUTA 2ZCFB 1RAFB 3CC4T 5M3FB 4TVAB 4PG3A 4XTZA 2PO4A 3J7AV 4FYYB 2QA4A 4R4IA 3I73A 1V1QA 2JA7B 3PIOA 1B8AA 1TH7A 4JV5Q 2L3PA 4B6MA 2FB7A 2ZM6Q 1CQVA 2FINB 1K9MR 2L11A 4K5VA 3GTJB 1T9HA 3OB9A 4B9XA 3KFUA 4LUZA 2RQWA 1R4PB 5A0LA 4CJ0B 3J81L 4JS4A 1S40A 2K4KA 4M75B 2K7VA 4LF5Q 1Q1BA 2A28A 1OOTA 5L23A 3C1EA 4AFZC 5C0XG 1G91A 4E7LA 1CKMA 1GUNA 3HOUB 1LV9A 2KDSA 4XT1B 3TMEA 3SWNA 2NVYH 1KC8U 5FO9B 3ULJA 3F2CA 1UEBA 4MMLA 2CZ1B 1HZCA 1H3HA 4M7DG 3DWQA 2B2WC 3JCMb 1PFMA 5CGKA 3U9OA 4JI3Q 1NEBA 5C6AA 2K5VA 5LL6S 1ZEQX 2Q8IB 2F5KA 1AZPA 3PUZA 3RUZA 3D7SB 4DBHA 1H8KA 1MJCA 2UUAL 5GMKi 4PJOA 2BE7D 1HFGA 1MNDA 1C0AA 4DUYL 1N27A 2EGCA 2J7IA 2DL7A 4U673 3M4GA 1JU5C 3K57A 2EE1A 5CKHA 2B63B 3S2HH 4MHEA 5GANd 1VQOA 2DIGA 1PCXA 3C0CA 2VZAA 3PMIA 1JOKA 3GTOB 1CZGA 5LJ5f 4H7BA 3M7NA 3I91A 2LCSA 5AT1B 3PO2B 1RAAB 2DE0X 1PG5B 3BY7A 1QVFP 3K58A 3A98A 3L2ZA 3JCMh 2JA8G 2JJQA 1ZHIA 3OMGA 2BE5C 5GANf 1MD2D 1XPUA 1CQFA 1U5KA 4DBRA 2JZ2A 5HK3A 3CD6T 4M7DE 1GO3E 4OO1H 1M1FA 3CBOA 3CMET 3REAB 2E3IA 4BS9A 1JRIA 3M9QA 2K1BA 5CAIA 4M7AA 4MN3A 2FYKA 2RVLA 2HAXA 2KI7A 1AZEA 1O7ZA 1PM3A 4NMZA 1JB7A 3M4OH 4RG8A 3REBB 3CCUT 1I94L 2KCMA 3CMAA 2E64A 1Q7YU 4B3TQ 2JS2A 2B2UA 4A4HA 5M5WH 2WAQG 3CCQQ 3S1RH 2MO1A 2KQWA 2JXMB 2COWA 2FPFA 2JTFA 5IP9H 2P0PA 1HNWL 1HZBA 2R7ZH 1VCIA 4GOPC 2HIXA 1PRTC 4DK6C 1QUQB 3GTLB 2YXYA 5FLXL 2XTIA 3R3OA 2L2PA 1YCSB 2RCFA 2KYMA 1G51A 1YCYA 2KEEA 2PCFB 2SNSA 4OWTB 3R2IA 1DJ7B 1CTMA 5GAOl 3G7LA 1BBXC 3GTKH 1G3YA 4FT4A 5IGCA 5KYUA 2WB1B 4DV5Q 4B3ML 3VYHB 1R0BG 4DXGA 2XMFA 3NHHA 1AHJB 1P16A 1EFNA 5CKBA 4A3IB 4J8QA 3X20B 3TQ7P 2PMZE 2RQTA 1D8LA 4FF4A 3R6OA 3HRZC 3S1NH 2F0TA 2AZVA 1HUMA 2F52A 3CC2Q 3EG9A 2K14A 2WV6D 3QWNA 1VMPA 2KCTA 2LMJA 2MWOA 3UPUA 2D9UA 1VQNQ 4O1NA 4CDDC 3RZOB 2DBMA 5GAN7 2L8DA 4M78A 2N55A 2EIFA 2PQWA 1J3TA 3EHQA 1SF9A 4X9DA 1DCZA 2D0QB 2EQKA 3G71T 2WAQE 3L7ZC 4IJHA 4FCYA 4AYBB 4QQBX 2QF7A 3SWNC 1CSPA 3F70A 2UU9Q 2DN8A 4A3FH 2QQ9A 1I07A 1GHJA 1B07A 3UA6A 2RQRA 3DB4A 2Y0SG 4K8IA 3GD7A 4OELB 1Y96A 1J9OA 2OAUA 1DXMA 5D65A 3ULLA 4IIOA 1C48A 1TOVA 1TU2B 2BH2A 4IN3A 1AFPA 1L2FA 1YFNA 2V1QA 2X6LA 5EPJA 2DO3A 4GOPB 2F4IA 1PRTB 5CV8A 2JQOA 3H9NA 4PJOC 2XDBA 4KY6A 4PQXA 1YI2A 4E7IA 4CI0C 4R56A 2L5TA 5GAOr 4QF4A 1UG1A 3L2RA 3CCRA 2H1EA 4WORA 3GO5A 4M8AA 2DY8A 5EKLA 5GJVB 2ATWA 2F0JA 1CT1D 3M3YH 4PLIA 3G4ST 5IAYA 3THKA 1YIJQ 3VS6A 1EY9A 4R4OA 3JCMQ 1VQAA 3PUXA 4KJOA 2E2HB 2NVQH 1HJDA 1IBKL 1HNZQ 5LL6X 1SXTA 4XTUA 2VV5A 2RHIA 2V8KA 3M0QA 3QSUA 3O8VA 5I2XA 2ROLA 1LTBD 5KH6A 1VDZA 4P2CB 2N3SA 4A93H 2Y90A 2Y0SE 4HJ5A 2XDPA 5C4XH 1NNXA 2ZJQA 2Z6KA 4LF7Q 2JJ9A 1VQ6A 1STNA 2KOLA 1HR0L 2VXWA 1IYVA 3SWNB 2L89A 4M7AC 2W10A 2DMOA 3J80i 4CKCA 1MIUA 5D6WA 1D6EC 2F0QA 2VYTA 4DV3Q 1KDAA 1VQLT 4JI1L 4EMKB 5CKEA 2E75C 4JI6Q 4XQJA 1ZKOA 2JVVA 4F87A 2DILA 2B2UC 3GNFB 3O13A 3S15B 5GAN6 4LF8L 2MI6A 1VQ8A 2F0GA 2PPBC 3S2DB 3CF5A 1K8AC 1DM0B 4HJ8A 4FF1A 4PJOB 2R93G 2OI3A 5FO8B 4NXMQ 3T51B 1PH2A 2NVXH 4IFDJ 3DM3A 4DA2A 3RZDB 3KLSA 3D31A 5CV6A 1LABA 3R8BA 3E6ZX 2RD1A 4LDXA 5E4WC 4DNRB 3J81j 4NL3A 5LJ3e 1U9RA 2UXCQ 4X3KA 1R9TB 3BYYB 4KGXB 4APVA 3BS1A 4L5RC 3LLRA 1SROA 1YJ9A 3Q6SA 4DEXA 4BY1G 1S5FD 2ENMA 3HP9A 4RGTA 5M3FH 3HS0C 3OYKA 2EPBA 3MKDA 1SNCA 2DIQA 4JI0Q 1RLQC 3MHBA 1D7QA 4JRIA 4OO1I 1VQNA 1ENCA 1JCKB 1WNLA 1TS3A 1NJIC 2F03A 3JCMg 1I3QB 3GTJH 3E2UA 4LUOA 2OTLT 3CAMA 5IYDH 1BCPD 4DR1L 1TQOA 1ET9A 4A3LH 1F1BB 3CPWP 2EQSA 5KEEA 1RUWA 4J6WA 3MFGA 4OB1B 3L2PA 3HOUH 1I4QA 3FKIB 1WQWA 1M2OA 1HA6A 1SFOB 1EX4A 5C0MA 1BI0A 2O88A 2GTOA 1VQMQ 3T1HL 2R61A 4ALPA 5J3BA 1T3SA 5D6XA 5A2QE 4H0LC 3SK4A 4V0BA 3GLXA 1WTXA 2DL5A 2VQEL 2ALYB 2D0NA 4D8DA 1A3UA 4LW1A 2LQKA 1OU9A 3MEVA 1TS4A 3VS5A 2HSEB 4C3HB 4JI4L 4NS5A 3L2WA 4IPCA 2HBPA 5LJ5h 1B3AA 2QKIC 4ID6A 3UDCA 3DMUA 4K5WA 3S3OA 3A7LA 4MZ9A 1PA6A 2FRWA 1O9SA 2LCCA 4QKUA 3VYRA 2Z9HA 4AFSC 1I6VC 2MYSA 1B9MA 2B63H 2KT8A 1QVPA 3FHWA 4QQGA 4Z9CB 3GTOH 1DZ1A 1PV4A 1HSQA 4L63B 5C4JB 1PSFA 1V1CA 5GAOp 1WTHA 1HQRD 3HOYB 2F0SA 4HJ7A 4QUFA 5GANh 5GAN4 1B2TA 4FDBA 4JS5A 5IWAQ 1JJGA 2V8JA 2ASBA 3H15A 3UE0A 1PTOC 1CM9A 1HUNA 1SYGA 3EG9B 1QNUA 1VQDA 2ZT9C 3J81i 1BCMA 2WSEE 3H8ZA 1K9AA 1YNZA 4M78B 3NGPA 2Z6KC 4PJLA 1AE3A 2L0CA 1UAPA 3Q24A 2EVBA 3CC7A 3CCST 2IIMA 1WX6A 2X4WA 1KQSA 3GV3A 3K8AA 2DNUA 1D0ZA 3GTGB 3PIP3 4ME5A 2NUPA 4HKEA 1Y1VG 4ZRZA 4DV6Q 1Y96B 2XNAC 2YLCA 1I50B 1O80A 3H0IA 1SE3A 2MOXA 1LT4D 3P75A 1TIID 1MI2A 1WHLA 1N6AA 1E3PA 3UDGA 2LX7A 3I4MG 5HKCA 4DPGA 5IGBA 4JUVA 3ERQA 4XU0A 3RKXA 2IHFA 2EDGA 1VQ7T 2YTYA 1X56A 4B08A 1XJVA 4MZTA 4J9GA 2DXTA 3JCMJ 1EFID 2D1XA 1EWCA 4POGA 4FVMA 2HT1A 3GTLH 4J6YA 4VUBA 4K0KQ 4LF9Q 5HY6A 2CKZB 5D14A 4A3KB 3UA7A 1UEAB 3KK7A 4QVCA 3JB9H 4XU1A 3VS2A 1V43A 2P0KA 3VV0A 2RF4A 1MSHA 5GAOn 4RWSC 3CBPA 2DNCA 1M3BA 4KH0B 1QKXA 3SGIA 1ZQ1A 1X9NA 2I0QA 4A54A 4O42A 1PTOB 4A3IH 2SRCA 4A3JB 2DF6A 1YBYA 2UXBL 3FJPA 2H5XA 2IPOB 4FXDA 3QZ5B 3ERSX 1A62A 3S6WA 4CJ1B 1L1OA 2K5NA 4M77D 3EH1A 1H9SA 2LC4A 3QBYA 4JW0A 2E70A 2H3JA 3RZOH 1BCOA 4DBFA 5JOBA 1HTPA 3I35A 2DY7A 3D8GA 4LFCL 4OX9Q 3RMHA 2YU9H 3J7YW 3E5SA 2EJFA 3NTIA 2A6HD 3HOWB 3CCMA 1X69A 5EGTA 1M2VB 4AMCA 1RACB 3K80C 1TG0A 4PFPA 1O7LA 2X69A 2VXEA 1B34A 5GAN2 1BDOA 4PV1C 3IKJA 2IX3A 4NPSA 5LMNW 1OX8A 3IQLA 5EBDA 2Y4XA 4XQ3A 3RN5A 1N8RR 3J7ZC 1KL9A 5GAOm 5GANj 1AEYA 4HJ9A 2ZZDA 1RF2D 1EZZB 5GJWB 1OPLA 1Z9ZA 2ZPHB 1HZAA 2XRSD 4M4ZA 1FD7D 4HN7A 3ZL7C 1NYFA 3K5LA 3CRLC 4RTVA 1SRUA 3HRUA 2KHIA 3BDCA 2QQAA 5D7UA 1Q90A 3TN2A 3HOZH 4Z02A 4ZNXA 1TSFA 3I4NG 1G3TA 2F2WA 4M77F 2K57A 1KD1R 3CRKC 4QJFA 3AHUA 2A37A 1IB8A 3J80c 4FF2A 5M5YB 1OTCA 4DV1L 2CP6A 1KQ1A 4DGZA 5JJZA 2CCZA 1FWZA 4NOYA 3C94A 1A6XA 3MTSA 1UE7A 2E2HH 1Q81C 4DV4L 3SR1A 2VUMH 5CKFA 4WFN3 1LTAD 4X66Q 1BI3A 4ELZC 1G3WA 1F2MA 1XTCD 3FVQA 4LJZC 4XTCS 4AH6A 4DR2L 3TEEA 1IBML 1NZ9A 1N9RA 3TSWA 1ZUUA 1ZUYA 5LHY1 4OL7A 2MGSA 1DYQA 1W6JA 4NW2A 1M4VA 1N33L 1TUCA 1XTDA 4JJNK 2VL6A 1KQSP 4UHVA 3MFYA 4B3RQ 2KMTA 1QCFA 2K3YA 3F1ZA 4J9EA 2DERA 3J80E 4MZPA 3LH5A 2F3IA 4OB0B 1M30A 2F3VA 1G83A 1E1TA 2M2LA 1WXBA 1VQEA 2IHEA 1IZ6A 2C06A 1PH7A 1YJWQ 4N8FA 2K33A 3WOEA 4L59A 2B3GA 3S2DH 3QG1A 4CC7A 5FROA 1E1OA 3HGBA 4WJWA 3WWVA 3GDEA 5IXBA 4WTOB 2RSOA 1M5Q1 3M55A 4C92A 2NTSA 4K5XA 3RZDH 1XMOQ 2O31A 4LDVA 1PZID 1SPKA 1WYXA 5NUCA 1RODA 3BW1A 1E7ZA 4JV5L 2WACA 2RHZA 3G6EQ 1VMCA 3QIIA 4DV7L 1R9TH 3H3VC 1KHCA 3R93A 2DX1A 1EIHA 2RA4A 2V4DA 2OQKA 3KF8A 3HOVB 1V9PA 3JCMV 1CI3M 2L3QA 1ESRA 4ZGDB 1K9MU 1M3AA 1HNXQ 3I56A 2J4XA 3H0GG 5CMDA 1QW1A 5IGGA 5GAHC 2QQBA 4HXJA 1L1OC 1I3QH 1G291 4LE9A 2XU8A 3CCLQ 2HCIA 3M0RA 4X62L 3STBC 1LACA 1F9SA 2R3ZA 4GN3B 4X64L 4M77G 2JA6B 2SDFA 2EKHA 4NKLA 1FX7A 2ZJRA 3CCVA 2EJFC 3HOYG 2VW9A 1M8AA 3FKIH 4RTUA 3OYJA 4BB7A 1K8AU 5JVH3 4OO1G 1B7TA 5CBAE 5I2YA 1SFOH 1EYGA 5KYXA 1NSNS 1R0CB 2PVOB 2YLBA 4IJLA 4HIKA 3LW5E 5DLQE 3TRZA 3F2DA 2F0FA 3NQIA 1WGSA 4C8QB 4A3CH 3V7SA 4AG1C 1TWHH 4A3MB 3JB9I 4OWXB 1X6BA 4QUCA 4C3HH 3J81c 4DR5Q 4JI5L 4GLVB 1N34L 2E3HA 2X3WD 4KK7A 5IHNA 5IP9G 1LT6D 2CVRA 4DQ2A 2R7ZG 2KSSA 5DM7R 4KV6A 4WCIA 3M0SA 2IX1A 5LJ3d 4IALA 1WDXA 4BI8B 1PZJD 2CHBD 1ONLA 2RQVA 3RUXA 1X55A 2IY5B 1NJIU 1ENFA 3JAML 4DR6L 1VQOT 4B9WA 3NUCA 3Q8DA 2D5DA 3HKZG 1W4SA 2V1RA 1KABA 1CA6A 1WFQA 4M77E 1UGRB 1K8GA 2A73B 1L1OB 2HEQA 1SE2A 1UE1A 3ASKA 1KFZA 1EY7A 3J81E 3GIBA 3EAEA 1H9SB 1SMXA 1YVCA 2JA5B 1JORA 2CP2A 3M57A 1M1KC 2HUGA 1OO9B 4N9TA 5IGFA 1K8OA 5IN1A 1GBQA 2PNHA 4LNPA 1PKTA 3RMSA 3IFDA 1IYJB 3UF4A 4M75D 1UUPA 1QVFS 4ZTJA 4M7DA 4K6LA 1QZGA 3PCOB 1C8CA 3GTGH 1BF4A 4RG2A 4LFBQ 1B34B 4A53A 1VQ5A 3BG3A 1I50H 3ER0A 4XU3A 1T0JA 2K05A 1XOVA 3I55A 1IKMA 4HIOA 1AD5A 4IUNA 2M02A 3TBIB 4A3FG 1RAHB 2O2OA 3E9GA 1PH4A 3CMAT 5IP7H 2K5IA 4P5NA 4QB4A 2GBQA 3MXNA 1U1SA 4C92C 5CYUA 1OZ2A 2EW3A 1AN8A 4X3TA 1E7OA 4DV5L 2DLPA 1ZYRD 3H6MA 4DOWA 5I22A 1HYOA 3HKZE 2D8JA 1D3BA 3JCMW 2KA7A 4GLAC 4A3KH 4RKUE 2GTJA 3PGGA 3KXTA 5GAMj 1VQGA 4DXFA 1SHFA 4GY5A 4ESRA 3EFXD 3A8HB 2QTXA 4DV0Q 2DVEA 2RN8A 1FYNA 4RCBA 2E41A 2RHXA 4M75F 3G7ZA 1NCVA 1SE4A 4JI8Q 4BBRB 5C0XJ 8ATCB 1VQHA 2YRCA 4G4KA 1YJNA 1PTOH 1IL2A 1TWCB 4A3JH 2F2XA 4YHHQ 1EZ6A 2Q2TA 4Y7NH 2K5WA 3C1FA 2VB2X 4WJ4A 1HXYD 2VGMA 4KKSA 4EQNA 4B3SL 2I2LA 3HFNA 2UU9L 3VU3C 1G8ZD 4IUPA 2EQJA 1KLUD 3BDOA 5F2DA 5FLXc 1TWFB 2Q2UA 5I11A 2DPPB 3KBGA 1KAAA 5GAMe 4L5TA 1KDBA 1VIEA 3EQLC 4YWLA 4A3GB 4QVZA 2F0HA 2FMMA 4ZCKA 5FU7C 4A93G 3RIRA 2EYMA 5GROA 3H94A 3OSVA 5C4XG 4KH1B 2F0MA 1TS5A 3FP9A 3OTOL 2PW5A 3HOWH 2FL7A 2VXFA 1U0LA 4JCVE 2QEXQ 3NFCA 2DXUA 2CUDA 2EYOA 2RQUA 2W0ZA 1ML0D 4R4QA 3QYHB 2F0IA 3A54A 5L8RE 4X9CA 2AQ1B 4O0AA 4JI7L 1DGSA 3F8TA 3DHQA 5EC7A 2IL8A 4IUVA 2XICA 1GCPA 4C92B 1X3QA 2QW7A 2R92B 2YV5A 4FYVB 3PIPA 3CCEQ 1BO0A 4JPBW 1HPCA 4UDUC 4ZQ3A 2WSFE 3V05A 4KKUA 2XIWA 1SYCA 1H9RA 1AEXA 4HCSA 2BDNA 4MTKA 1V8QA 4RGMA 4OF1A 1CZWA 2XKOC 3HSBA 4II1A 3ZJYC 1SMYC 1YI2T 2K6AA 4YY3L 3Q23A 4A4KA 3CCRT 1UNSA 3JB9D 2HQHA 1IL8A 3KF8B 5LMNQ 3CCJA 5M5YH 1GUSA 4HJAA 3FLGA 4HT9A 2ED1A 2JN4A 1PH9A 1U1TA 3DLLA 5IGEA 3NELA 1PC0A 4HSPA 1PH6A 4OMNA 5EJWA 4ZKBB 2JSOA 3K0YA 4DAYA 5M3FG 3EGUA 1YZ6A 3PGZA 1VQKQ 2BE5D 1VYVA 5J39A 2JNGA 2LZ6B 3RLFA 2IG0A 5I2MA 1JWSD 1F77A 1LYLA 1TT2A 2EYXA 2DEUA 1YHQA 3AU7A 2P4TA 5FU7B 2DJZA 3TSZA 2NTTA 3MXGA 3SEBA 4M7DC 5IYDG 4LNQA 2OWOA 4BBSB 2Q8TA 5GAMg 3U4ZA 3VR6A 5ISRA 2UUCQ 4JG2A 4A3LG 4M75G 2MCNA 2KRMA 2LVMA 1OQKA 4C5IA 1SE8A 3HFOA 3OW2A 1VQ6T 4WRDA 1WIEA 1JXOA 5KYXB 3ME9A 3H0FA 2A68C 4EQ5A 4KD4A 3M85A 2DAQA 3HOUG 4O5VA 3VUBA 2YYZA 2CT3A 1STAA 1BUVT 4ZN1A 2PVGB 3RDVA 4JI2Q 5E4XA 4K6DA 5L37A 3JB9F 2HZYA 1QCBD 1FJGL 3R6NA 3HFZB 1TTHB 1I5OB 1Q46A 1PRLC 1YWOA 2ECZA 4J7FA 1VQ8T 1PRTD 1EUJA 2OTJQ 1K8AR 3EGXA 2YTXA 1M9SA 4LDUA 5JVG3 2B86A 2P5ZX 1TUGB 4H02A 3EHRA 4JI0L 4GLMA 2Q2HA 3VYSA 5I9PA 1I8FA 3AFQA 3OYNA 3F2UA 1WXTA 1OU8A 1IO6A 1S72A 1NTGA 2Z8LA 3NWTA 3WOFA 2KUMA 2IVWA 2DRMA 1VQ9Q 2B63G 4FM4B 3HOVH 1K73C 2MF2A 1ASZA 1YJ9T 4UPAA 1GUGA 3ZFJA 4J8OA 2A1AA 2CQOA 3K7UC 5DEHA 3D6CA 3AT1B 2RI5A 1VQPQ 4G57A 2R5MA 3MEWA 4M75E 4YTLA 3K7AB 1EZ8A 5M5XB 4JK1C 5IIFA 1WTRA 3VRYA 1QE6A 4MDXA 1NJIR 2V8IA 1QQJA 4M7DB 2PZWA 2JA6H 1SKUB 2NZOA 4J1MA 2F0OA 3IL8A 4QMGA 3MZ5A 3TREA 2XN9C 1PRTF 2PNRC 2ZGWA 4PNOA 1QVGA 2I07B 3OYGA 3PSIA 3OYMA 3LWIA 1A0NB 4Y52H 3TZDA 1S4ZA 3BVZA 3D4RA 2LMCB 3X25B 4BE2A 2XG8D 3AYHB 1KTKA 2D0OA 3CPWS 1VQ4Q 1QJOA 2KY9A 2HCCA 2K5DA 2EYWA 2YDLA 2IJ0A 1VQFA 4R8IA 1M8MA 4C0GA 2LSSA 1VUBA 4A3MH 3A5ZB 4XU2A 1IGUA 1SG5A 4PJOD 1D1KA 2BTTA 2ESWA 1Y8OB 2RJEA 2F0EA 4BE1A 2KHSA 4KY5A 4IO9A 3DEPA 1D3BB 3LWHA 5IWAL 5C44G 1WJRA 1PFBA 2SEBD 2E6ZA 1NMGA 3CC4Q 1UGVA 1KRTA 2KXDA 3HKSA 1F9QA 1VF7A 2FZCB 3BU2A 1ZUKA 1ZSZA 3TCJA 4JOIA 5LMUQ 4XT3B 3I9QA 3JB9G 4GZYC 5LJ3h 3A8JE 2OAWA 3NTHA 1D1CA 4C56C 2O01E 1F9PA 2C0OA 2WB1G 1WQ7A 1CKBA 2MPMA 3U9SA 2CKKA 2J6KA 2NZ1D 4CC4B 3TQYA 2JA5H 4A3IG 2R7FA 1CHPD 1X3PA 4OB3B 2LQNA 2GN5A 1XMQQ 1LVKA 5I21A 5IXFA 2UUBQ 2X4JA 4P71A 1JT8A 3DLMA 2XSCA 4PZ7A 4OWWB 2NUTA 1U4PA 5D3IB 4KGVB 3I70A 3OW2P 4J9CA 3MXPA 4PJOF 1QG7A 4DR7L 3SFMA 4A4GA 3MWYW 2L5QA 5CV5A 2WKCA 1H9KA 5IYCG 3CC7T 2TSSA 2DTIA 2CH4W 2FEIA 3PO3B 1JB0E 1VA7A 2XDDA 5C4ZA 1S5DD 2FO0A 4KLKA 2EYZA 1B70B 4BI4A 2DUDA 1AZGB 4QL5A 4XQQA 1WTQA 2RCNA 2MP1A 3E19A 4OB2B 1Q8IA 1UGSB 1LNXA 3RMQA 2EJ9A 2L3RA 2RMOA 1H9MA 2LNHB 1J5EQ 1XNRL 3GOXA 3A8IE 1MGQA 1A3TA 2WB1E 4RFBA 4K2KA 1ZA2B 1JWUD 1UGPB 2HCKA 4ZKCB 1LTRD 3OSOA 3HOZG 1RLPC 1HRJA 1M1KU 1JB3A 1QVCA 2A69D 4BBRH 4RMFA 4DAYB 2KVQG 1MBYA 3OOCA 5C3EB 1WD0A 2BIVA 1TWCH 4G7HC 3EFSA 1BVSA 1HR0W 1BK2A 1JQYD 1SYEA 1UWVA 5J1ZA 1L0XB 4XTYA 1UHCA 2VUMG 1T5XD 1IKLA 2WFWA 3CD6Q 2Y0SB 4DK1A 2MUYA 3CMEQ 2MJ8A 1H3ZA 1OXXK 1OX9A 1TWFH 4FXGC 5A35A 3S3MA 1GOZA 2QYZA 4M78D 1KG1A 4DR4Q 2DYBA 1M90C 2LRQA 2KVMA 2MFIA 4LF4Q 4A3GH 1N32L 1HCZA 2YRDA 2F4VL 1AP0A 1WCMB 1FYCA 3CCUQ 1XNIA 2K52A 2O5JC 4KHVA 1EIGA 1UHFA 1XXGA 4OMLA 2PI2E 4KTAA 1N8RU 3NMZC 2GA4B 1KQ2A 5CQYA 3CCMT 1QWYA 3FDTA 3UI2A 1JJ2A 3S14B 2QI2A 3VA5A 4F14A 5IGDA 2R57A 3Q1JA 1V76A 1W3SA 2CZ6B 5KNDA 3URGA 5LJ3j 4YCWA 3NPPA 2DZCA 3CCQA 3EGXB 5HK0A 1N9WA 3CEYA 1DOMA 2KBTA 3LGFA 5GAN3 3OYFA 3CC4A 3V8JA 4DNTB 2LX9A 4K14A 1EEFD 1F2YA 1WHGA 3HOXG 1KD1U 1D1AA 2FPEA 2LS01 4BXXH 1C6VX 1VOMA 3X28B 3MO8A 1ZSZC 4JOIC 3SK8A 4N4GA 4MMKA 4ILWA 5ELDA 2GQVA 1U4LA 4RTZA 1SNMA 1YNXA 1X3FA 4M78F 1N36L 2K6DA 1WTVA 4RCCA 1E2VA 3V8LA 2M9VA 2CP0A 2CZ7B 2RDFA 4UAIA 2GF7A 1IW7C 1PTOD 3QJYA 2LFNA 1BBUA 3W1GA 4CKEA 1A3VA 3CW2C 1ACMB 1Q81R 3K5MA 1QP3A 1S3OA 2QDLA 2Z1CA 3CC2A 3G71Q 2JA7H 2EY1A 5FW9A 2C5CA 5GAMd 3HEJA 1A2TA 4BBSH 4C0DC 2X6GA 1V1PA 1K76A 2Z0SA 4X65L 1QLYA 4UC4A 1Q86C 3IRBA 1E22A 4EMHA 2HHHQ 2KHJA 1XMOL 4OONA 3KFVA 1HZ9A 3S17B 1M3CA 4M7AB 2B2TA 3FKIG 5KRUA 3PF4A 1VYUA 5JPMC 1KQSS 2M0OA 4NXNQ 3NHNA 4POFA 1EY4A 2YT6A 5GAMf 1K4US 1M1GA 1NLPC 1EQTA 1XWEA 3OPOA 4R1JA 4KMUC 2E5QA 1KLGD 4D6WA 1V29B 2HQLA 3B6YA 5GAEC 1FMKA 4A3CG 1LTGD 4EMGA 4AFQC 2OCEA 1PTOF 3NSWA 4C3HG 3VA7A 2XWJB 2E5LL 2UUAQ 3RERA 4OIKA 1JICA 1LJOA 3E1SA 3L2QA 4JLGA 1KJWA 1YNNC 4DUYQ 4OXPA 1IYUA 2DD5A 1STYA 5C5MA 1OXVA 1TS9A 4JJCA 1CKAA 1X27A 1G3SA 1GVPA 2E76C 2ZXPA 3L0OA 3LX0A 3ICEA 5EPKA 2L0AA 4E7SA 1K8MA 4A75A 4IPGA 1IBLL 4LF6Q 2IT1A 3CQZB 1GUTA 1YIJA 4A3EG 4A3BB 4HVWA 5JJLA 2AK5A 2DD4A 4OMQA 4GS3A 5LJ3g 5KYUB 1BCPF 3UATA 4R4TA 1YN8A 5EQ0A 1H95A 4QQDA 1NLOC 5M5XH 3I56T 2NN6H 3K7AH 3PO2H 5FO7B 2F5TX 2JA9A 2Y4YA 3C46A 1PH1A 5A0DA 1SYBA 1KAWA 4C0DB 3KUPA 1W2BA 1Y14B 4M78G 1VQLQ 1PYBA 4K2LA 4C0ZA 2E1HA 3KLSX 2VS1A 3KJOA 2HD3A 1NBEB 3AFPA 4XTXA 2G9HD 1UE6A 3CCVT 1WJQA 3SE0A 4CGYB 1JJ2P 1X32A 1TWGB 1JE4A 5E3FA 4GLXA 2WINB 2HDLA 3MVVA 4JI5Q 1PFSA 1EWIA 2O9SA 2M00A 1WFWA 2DYIA 3OA6A 3BZDB 1Q3LA 1I94Q 1PNJA 3OWFA 2QTVA 2UXDL 4OP0A 2COYA 2GCXA 2N49A 3IFTA 2L12A 4RHSA 2AQ3B 3IAYA 5IP7G 3N6RA 4UP8A 1G2SA 4LFAL 1HNWQ 2LJ0A 5KYWA 1STHA 1MMNA 5GAOq 3QHSA 2KNBB 2PQAA 4HTHA 2E2JB 1MV0B 3MEHA 1KIXA 1FGBD 1EEID 1SRMA 1L0YB 1I81A
chains in the Genus database with same CATH topology
4OHJA 2GFUA 5ELBA 4Q0FA 3MP6A 1SAPA 1DD2A 1EU4A 4J6XA 1YITT 3CPFA 1BR9A 3RKYA 5J26A 3T9NA 4M78E 2G9DA 2BA1A 1Y1VB 2DEQA 2L55A 1JOQA 3P8DA 5KYLA 1Q82C 4BD3A 2CW0C 1NAPA 2PU9B 2K01A 1LT5D 3L2UA 2FJ2A 3M54A 2JE6I 3QUIA 2QQSA 3NK9A 1DOKA 3C4SA 2B2TC 5D3DA 5BN4A 2F0LA 2ZPEB 3LYIA 1VQMA 1VQ5T 2SOBA 3EJIA 2FHDA 4KUIA 1LOJA 3I55T 4C8QD 2WP8J 5K36H 4KUDK 2EOTA 2DTHA 4C5GA 3RD4A 2RDGA 1SNOA 3EA6A 3VYTA 3A55A 3KBXA 3OIQA 4FNFA 3QXEB 1Q1EA 3MAQA 2RI3A 2NVTB 1STBA 3JCMP 5C6SA 3NP8A 1PLFA 2WKDA 2EYFA 4XTVA 4C0FA 1YJNT 3SHLA 1LLRD 3PNWC 1ET6A 1GUOA 3E9FA 4F7UA 4N0AA 1V1PB 2MMPA 4G7OC 4C8QF 3QO2A 1OXSC 1F2ZA 1VIFA 1SSOA 2R58A 5CVIA 3NQTA 4ZAIA 2IPKD 3Q22A 4ZUIA 2DK3A 4NDXA 2LTOA 1KC8C 2R6GA 1ENAA 1Y71A 4HCCA 5EBCA 2O5IC 4XAXB 4H13C 3A8GB 1OI1A 1B1ZA 4E7HA 1FNWA 3MC0B 1WD1A 4RKBA 3QB3A 2QDYB 5C3WA 2LT4A 3FC3A 2E6NA 3PMTA 2AWNA 1SSFA 3A8OB 1ICWA 5KYIA 2NUCA 1DONA 3OYLA 4E7JA 4E47A 1EWHA 2QILA 5C4HA 3EFRA 2NN6I 4DU9A 3LH0A 3CCJT 4FSXA 4X34A 4DF7A 4LD6A 3GP7A 5KE2A 4GLKA 2HQEA 1TY2A 2D9TA 1BKBA 4MDWA 2XK0A 5HURA 5KNCA 2L9HA 2QA4T 1YHQT 1NPRA 1KNAA 1X01A 3OSSC 1KDCA 1C4QA 4PMCA 3OHXC 3OS5A 2LDMA 3V8KA 5GAMh 1LTID 3VR5A 4L8JA 3ZEHA 2DKGA 1F9RA 2RO0A 3SDZA 1WTWA 1Q7YC 1NUCA 2AHJB 2A74C 4LDYA 2RDHA 1LTSD 4C92D 2K04A 4C8QG 1HHVA 4U68A 3H0GB 3WVDB 2A6EC 5I6YA 2EYPA 2LCLA 3CXCA 5EKKA 1GUWA 4C3JB 4KKTA 2O2LD 1S72T 1WTPA 1QNKA 4OIJA 1SJED 2FFKB 2A7YA 2PZTA 3LNNA 1A2UA 5CQXA 3ONAB 4EVOA 3A8LB 5BN3A 1M8VA 4N0AC 3OIPA 1QP2A 3M4OB 2BKDN 5CBEE 4RGOS 2EYJA 1EYCA 2RKSA 4C92F 5LJ3f 3NE5B 3D4DA 1CK1A 1BOSA 4HMJA 3FB9A 1XYIA 3H91A 3I72A 5ELFA 2XIDA 4F88A 4C8QE 1SNPA 2DZ9A 3HPWA 1Y7XA 3ZYYX 4CKBA 4C3IB 1YJWA 3T53B 4A3DB 1WJSA 4ZN3A 3S1QB 2B2VA 3TZUA 2RB6A 1Z7TA 4I65A 3HKZB 5AFWA 4TVRA 3VR2A 2B8AA 4KBMB 3PMFA 2L1BA 5AYFA 3W3AA 4IURA 3G6EA 2F3WA 4IFDH 2IW3A 3A8MB 1D5MC 2B2YC 5EKIA 2LKVA 2DXBA 5M3MB 1NR4A 2MWPA 4HEDA 3H6ZA 2OEOA 4J6HA 4BY7B 3I3CA 4RKLA 4IUUA 4F7UB 4FF3A 5CV7A 3CCLA 1MHNA 1F2LA 4A3FB 4M7DD 2HNIA 5CORA 1EY0A 3ZBDA 1I4RA 3S9WA 2K5QA 1G5VA 2A68D 2ENBA 3R2TA 1ZBXA 2D62A 2PUKB 4BDZA 1E2WA 4C5HA 5I9OA 4PLLA 2O4XA 3URYA 3MEUA 3P20A 3OW2S 1OXTA 3LX7A 1BQQT 3L1AA 3OYAA 3I4LA 1JBMA 5DLOA 1Y1WB 3W2DA 5FK9C 2M1HA 1LTTD 4L6V5 4C92G 3UT1A 1CFMA 4QIWB 5CR3A 3T56B 4IUQA 4IZ8A 2A3LA 5FLXE 1LT3D 4ABNA 4A4FA 3S1MB 3FRPB 3PUYA 5K5PA 3DM1A 3ND9A 1SDFA 3M56A 2F0DA 3FMCA 3TSSA 4M75C 2VGNA 2ZPFB 3S16B 3L9AX 3QO3A 1HA5A 2NLUA 1SYDA 2G3RA 3GQBA 4C2MB 3DXJC 2PZUA 4HCBA 3PT9A 4BE0A 2LNVA 4HT8A 3QIAA 4LDWA 4ULLA 2FHTA 4J83A 4C92E 1BI1A 3INZA 5KE3A 4BACA 3C3LA 4NP5A 3RKWA 3P8BB 4BUGA 1SYFA 2B2VC 3JB9J 3VR3A 3MCAB 1T5EA 2RQXA 2XD0A 4ME7A 3CCQT 1YNJC 5BN5A 4N4IA 3PUWA 2EYQA 1HFNA 2QDBA 3GF5A 2K28A 5I2SA 5FOBB 4YIJA 5CV9A 2E2IB 2IWHA 3FDRA 2CS7A 3BDLA 5DY9A 3DUZA 1QB5D 4O6JA 5G3LD 1I4PA 5JEAH 1Q81U 4OGCA 3TP6A 3VYUA 3HRTA 1FR3A 2BCOA 3QOJA 1J8IA 1MGSA 3GTQB 2XRQD 3FRNA 2NN6G 3T13A 4V2SA 4BI3A 1TWAB 4K8JA 3CC2T 2EYHA 2NB0A 4EMKA 4X3SA 1VQNT 2EKOA 4JRQA 3H09A 5CC4A 5LJ5d 1G6ZA 1EY8A 1HTLD 1O75A 3ND8A 4IKFA 3OS2A 2QEXA 1Y8PB 3S3NA 4LAAA 5IOCA 1GJXA 4RHRA 3GP8A 3QPHA 1RL2A 1U4RA 2RA2A 3DWAA 1GXDC 1JOOA 3L2VA 4IFDI 3CCEA 4R9WA 5G3LF 2RH2A 4KJNA 4FU6A 5FKAC 1IREB 4WF2A 4XYOA 2AWOA 3EVQA 3ITPA 1LO5D 2IX0A 1Q12A 3GPLA 4FO2A 3CU7A 4FYDA 2JA8B 2J7ZA 4JRPA 2F0VA 5JPNC 1WTOA 1YIJT 1AZQA 5DM63 2VNUD 1HK9A 3TDQA 2EWNA 1VQKA 4FT2A 4DA4A 1EU3A 4NL2A 2PMZB 2F69A 4JBWA 3GTPB 5KNBA 1OXUA 4JDSA 1RHPA 3M59A 2I46A 1RJTA 4ATOA 2O4XB 4RCNA 3M4YA 2WAQB 5C44B 2OF1A 4M7AD 4FP5D 2RSNA 4DK0A 1S5BD 2OT2A 1UGQB 3MHXA 3T4AC 1GXIE 3TP8A 3DB3A 5FU6C 4LK1C 5K36G 2RI2A 1JJ2S 2OTJA 2KJXA 5EG2A 2E74C 2DNEA 4CRIA 2EJGA 3OBWA 3CKIB 4XK8E 1EY5A 2HQXA 4ZUJA 5IT9L 1VQ9A 2LT1A 1BYMA 2ZPGB 1IW7D 3X3MA 4XDXA 3HRSA 2JN0A 1RTOA 3WVEB 3KUFA 2XVSA 1VQPA 2KAFA 3CPWA 2F0KA 5IODA 2YU9B 1BNZA 1JWMD 3V7CA 4M7AF 1II3A 3N52A 1TS2A 2Z4HA 5KGUA 3OYCA 3Q0AA 4EMKC 4L6TB 2VUBA 5GAN5 3OS1A 5ELCA 4R55A 1KHIA 4HA8A 4DFAA 2NBFA 5KCHA 4HAEA 1B9NA 5J22A 4BA2I 3JSCA 2K03A 3P1HA 3D3RA 2NWGA 1VQ4A 4Q5VA 1VQMT 5FU6B 5CK9A 3PV0A 4KULA 5JAVA 3HOZB 2BOSA 5DAUA 3TP7A 3A56A 3CHBD 3DWPA 4XYQA 4E7KA 2D6FA 1OZ3A 1S5CD 1IHZA 1YNND 3DKMA 4CJ2C 1V1OA 4PKCC 1BXTA 1SJHD 2BUDA 3EROA 2VUMB 2M9UA 3JCMe 3M53A 4PJOG 2HDMA 1PFNA 4KD3A 2RJDA 2YHTA 2JUFA 1K9MC 4FIBA 2F0NA 4ZK9B 5KCOA 2SNMA 3KLRA 3X26B 4IQZA 1TVXA 3CBMA 5GMKm 2BA0A 3SK6A 3K59A 2MHVA 5EPLA 3OQ5A 2K4YA 4EPCA 1I81A 4FL6A 3BYTB 4N4HA 4F7XA 1RTNA 2ICIA 3HOXB 2K2VA 1W2BS 2R93B 1M4ZA 1QOHA 2PW7A 2K3XA 1BI2A 4M7AG 2H4OA 4ZLTF 2TMPA 1K83B 1D5XC 4PJOE 3BDUA 2Z4IA 1DOLA 3NTKA 1H9JA 2A69C 4R8NA 1Y8NB 3N5BB 1AW7A 2EJGC 4BY1B 3UWNA 1QILA 2K32A 1I6HB 3HHTB 5C5LA 2HD0A 1WPYA 4A4EA 4TSSA 1B4OA 3PUVA 3C95A 1I4XA 3OYBA 2OXPA 2RK1A 4M78C 3V2TA 2X35A 1Y07A 5TSSA 2CW0D 4KY7A 4E6IA 3FIFA 4J5YA 3CD6A 3TP5A 5C0XH 3CMEA 3JRZA 3I8ZA 2MAMA 2PYKA 4M7AE 3CCUA 2ZPIB 2EZVA 1PXUA 1TWHB 5DM73 1STEA 2VC8A 2RM4A 5DNFA 2XWBB 2XHCA 5CR2A 3OYHA 2K5LA 3VUZA 4Y28E 4TQUS 4J7IA 1TKWB 4CBVA 2EFIA 3AB9A 4A3EB 4XQNA 4S3SA 4EGVA 4XTWA 3SK5A 1SBBB 2DXCA 1K73U 4BY6C 3X3NA 2GFAA 4IFDG 1MSGA 3OYIA 2JOYA 5I4DA 1EL0A 3LGLA 5I6WA 5E1FA 1HXDA 1B44D 5T1GA 1BCPC 4L5GA 4M77A 4I7ZC 1E0BA 2F0UA 1PZKD 1CA5A 3G71A 2LY7A 2DTOA 3P8HA 4G7ZC 4OGEA 1SEBD 2EXZA 2F1MA 2E10A 3M5AA 4PMWA 4QVDA 3I4MB 4C8QA 1KNEA 5GAN8 2R5AA 1RDPD 4ZGEB 3MEAA 3V7RA 1SNDA 1RCVD 3SXHA 4OMFB 5JEAJ 3TU4K 4MIUA 2RBMA 2B39A 1YJWT 2JEAI 3JCMX 2EY2A 1H641 3SD4A 4PNYA 3PIO3 2KECA 1SNQA 4LD9K 3M7GA 3G4SA 1D1IA 3GTMB 3NXWA 4Y7NB 4LMQD 5D6YA 4BY6B 4ZYSA 3G6ET 1I4K1 2X4YA 3JAME 5FRMA 2EY5A 1VF5C 1Z6HA 2EY6A 5LJ5j 4PL6A 3SB2A 3X24B 1BCPB 3VR4A 1TR5A 4V190 4RAUC 4MZMA 2B8GA 3MXUA 4EQPA 3CCLT 2CGHA 1VQLA 2KCNA 4KT0E 3HP3A 2PQEA 1W6KA 4C1NK 3M58A 4ELYC 4HR7B 5LJ5e 4HMIA 2QCPX 3DEOA 3G6JB 2RHUA 5A2QL 3WDNA 3BVGA 2X4XA 1TY0A 5T1IA 3LWUA 5ELEA 4KI0A 3I4NB 2A6ED 3QJ6A 3L3OC 5GANe 3I90A 2LQ8A 4OGQC 1ZXTA 4OVAA 2KEDA 3GV6A 2B8FA 4QW2A 3OW7A 3LWEA 1JR0D 4RA8A 5C0XI 3CXCS 2CQAA 2F0WA 2OTLA 2N88A 1PMRA 5CO7A 3FEOA 1EYAA 5JEAG 3NWSA 4PMBA 1UB4A 2B2YA 4BA1I 3A7AB 4KN7C 4QQ6A 2EQMA 4M77C 2QQRA 3QOLA 1M90U 3OY9A 4ZTFA 1DJRD 2AUKA 3PFSA 3T16A 1FNUA 3JCMc 1B53A 3MA2B 4TRDA 1I5LA 2A6HC 2NVYB 4C8QC 1XQHA 1A15A 2FVUA 1NE8A 5LJ5g 1B50A 3OBYA 2F0PA 2VB3X 2Q8RE 3HZXA 5CIUA 4DAPA 1GHKA 1D2BA 3META 3S2HB 3NBHA 2QXFA 4F7UF 5GANg 4M1UB 4N9PA 5M9OA 5A0GA 1U4MA 1XX8A 3JCMd 1EIFA 3HL8A 3L42A 2EYLA 4BWGB 4C3JG 1U8RA 4BDYA 1EY6A 2AUJD 1ILQA 1PYWD 2C9OA 1BIAA 4M77B 2E65A 3NBIA 1N9SA 2RJFA 1WVLA 3CCSA 3JCMf 3VJPA 2JP1A 1I4HA 2M16A 4HSVA 4M75A 2L4NA 4JLIA 1Q86U 2JTMA 5FRNA 1FXXA 1JC7A 1NR2A 3V96A 1RKNA 2E2DC 4EQOA 3AMUA 4RMOA 1VQ7A 2QEXT 2JYOA 5M5WB 3S1RB 4RH6A 4C3IG 1NPPA 3C2PA 2R7ZB 3MP8A 2BDOA 2KCCA 2YRVA 4XIGS 5GMKh 1EYDA 5COYA 4DAVA 1YITA 3FEWX 4FXKC 2XI9A 3CCET 3WXMB 1RI0A 4KN4C 1Z47A 4XXEA 4H44C 3J7AF 2EQUA 2J0TD 3FPPA 1ILPA 3GTKB 2K5FA 1SMYD 4DN4M 4C1NI 2P0QA 1HQMC 2ZPBB 3QZ9B 4C5EA 3S1NB 2KQ3A 3VYGA 4TKOB 3P7JA 3GNGA 2NYZD 1X75C 1VQKT 4F7UG 2ID0A 2E12A 1R4QB 2EAYA 3MP1A 1PSEA 1O7YA 2WSCE 4DOVA 1O78A 3SVMA 2KK4A 2PUOB 3J80L 1N8RC 4F8MA 3OYYA 3OYEA 3QKJA 3OWEB 1CHQD 2B2WA 1RD9D 3A8KE 3OYDA 1YNJD 4HCZA 5GMKl 3PTAA 2RJCA 2ICEC 3OS0A 4RCOA 1PDQA 2A5HA 5KIXA 1KD1C 2OTJT 3C12A 2CYZB 2PVDB 2EJMA 3M3YB 2QEJC 1OYXA 2CZ0B 2RHYA 3BVMA 1ESFA 1E2ZA 4F7UE 4EDUA 4HCEA 1EQVA 4Y91A 1VQ9T 3RESA 5HGTA 2NVQB 1G2TA 5C3XA 1QVFA 4M7DF 1D5ZC 1Q82U 2FMCA 4RGNA 1R8OB 3FPUB 1VQPT 4A93B 4QCLA 3K5NA 5CKDA 5C4XB 3BFMA 1P92A 3OMCA 4ZGJB 5GMKj 1FNVA 2ZXRA 4Q5WA 1EOTA 2AQ2B 4KHZA 4JRKA 3K5OA 4X3UA 2WIIB 2NVXB 1STGA 1VQ4T 2JEBI 3E0JA 1S5ED 2ZXOA 3HG9A 5CCAA 1I4GA 3D4WA 5GMKe 1QVGS 1ZYRC 5CV4A 3QDRB 2D2CC 1Y69U 1X6OA 3D6WA 3K6OA 5IT9E 3QYGB 1BIBA 4ODGA 4CHTB 2RK2A 4IUTA 2ZCFB 3CC4T 5M3FB 4XTZA 2PO4A 3J7AV 2QA4A 3I73A 2JA7B 3PIOA 1TH7A 2FB7A 1CQVA 2FINB 2L11A 4K5VA 3GTJB 3OB9A 4B9XA 1R4PB 5A0LA 4CJ0B 3J81L 4JS4A 4M75B 2K7VA 1Q1BA 5C0XG 3C1EA 1G91A 4E7LA 1GUNA 3HOUB 1LV9A 2KDSA 4XT1B 3TMEA 3SWNA 1KC8U 5FO9B 1UEBA 4MMLA 2CZ1B 4M7DG 3DWQA 2B2WC 3JCMb 1PFMA 5CGKA 3U9OA 5C6AA 5LL6S 1ZEQX 2Q8IB 2F5KA 1AZPA 3PUZA 3RUZA 5GMKi 4PJOA 1HFGA 1N27A 4U673 3M4GA 3K57A 2EE1A 5CKHA 2B63B 4MHEA 5GANd 1VQOA 2DIGA 3GTOB 3PMIA 1JOKA 1CZGA 5LJ5f 4H7BA 3M7NA 3I91A 3PO2B 3BY7A 3K58A 3L2ZA 3JCMh 1ZHIA 3OMGA 2BE5C 5GANf 1MD2D 1CQFA 2JZ2A 5HK3A 3CD6T 4M7DE 4OO1H 1M1FA 3CBOA 3CMET 4BS9A 1JRIA 3M9QA 2K1BA 5CAIA 4M7AA 4MN3A 2FYKA 2RVLA 2HAXA 1O7ZA 4NMZA 4RG8A 3CCUT 3CMAA 2E64A 1Q7YU 2B2UA 4A4HA 2KQWA 2JXMB 2JTFA 2P0PA 1VCIA 1PRTC 3GTLB 5FLXL 3R3OA 1YCYA 2KEEA 2PCFB 2SNSA 3R2IA 1DJ7B 1CTMA 5GAOl 3G7LA 1BBXC 1G3YA 4FT4A 5IGCA 2WB1B 3VYHB 4DXGA 3NHHA 1AHJB 5CKBA 4A3IB 4J8QA 3X20B 4FF4A 3R6OA 3HRZC 2F0TA 1HUMA 2WV6D 3QWNA 1VMPA 2MWOA 3UPUA 2D9UA 4O1NA 3RZOB 5GAN7 2L8DA 4M78A 2N55A 2EIFA 2PQWA 4X9DA 1DCZA 2D0QB 2EQKA 3G71T 3L7ZC 4AYBB 2QF7A 3SWNC 3F70A 2DN8A 2QQ9A 1GHJA 3DB4A 4K8IA 3GD7A 1Y96A 1J9OA 2OAUA 1DXMA 5D65A 1C48A 1TU2B 4IN3A 2X6LA 5EPJA 2DO3A 2F4IA 1PRTB 5CV8A 4PJOC 2XDBA 4KY6A 4PQXA 1YI2A 4E7IA 4CI0C 4R56A 2L5TA 5GAOr 4QF4A 3L2RA 3CCRA 2H1EA 4WORA 3GO5A 4M8AA 2DY8A 5EKLA 2F0JA 1CT1D 4PLIA 3G4ST 5IAYA 1EY9A 3JCMQ 3PUXA 4KJOA 2E2HB 5LL6X 1SXTA 4XTUA 2VV5A 2RHIA 2V8KA 3QSUA 3O8VA 5I2XA 1LTBD 5KH6A 1VDZA 4P2CB 2Y90A 2XDPA 1VQ6A 1STNA 2KOLA 2VXWA 1IYVA 3SWNB 2L89A 4M7AC 4CKCA 5D6WA 1D6EC 2F0QA 2VYTA 1KDAA 1VQLT 4EMKB 5CKEA 2E75C 4XQJA 1ZKOA 2JVVA 4F87A 2B2UC 3GNFB 3O13A 3S15B 5GAN6 2MI6A 1VQ8A 2F0GA 2PPBC 3S2DB 1K8AC 1DM0B 4FF1A 4PJOB 5FO8B 3T51B 4IFDJ 4DA2A 3RZDB 3KLSA 3D31A 5CV6A 1LABA 3R8BA 3E6ZX 2RD1A 4LDXA 5E4WC 4DNRB 4NL3A 5LJ3e 1U9RA 4X3KA 1R9TB 3BYYB 3BS1A 3LLRA 1YJ9A 3Q6SA 1S5FD 3HP9A 4RGTA 3HS0C 2EPBA 1SNCA 2DIQA 3MHBA 4JRIA 4OO1I 1VQNA 1ENCA 1JCKB 1WNLA 1TS3A 1NJIC 2F03A 3JCMg 1I3QB 2OTLT 1BCPD 1TQOA 1ET9A 5KEEA 4J6WA 3MFGA 4OB1B 1I4QA 3FKIB 1WQWA 1HA6A 1SFOB 5C0MA 1BI0A 2R61A 5J3BA 5D6XA 5A2QE 4H0LC 3SK4A 4V0BA 3GLXA 1WTXA 1A3UA 2LQKA 3MEVA 1TS4A 4C3HB 4NS5A 3L2WA 2HBPA 5LJ5h 1B3AA 2QKIC 4ID6A 3UDCA 3DMUA 4K5WA 3S3OA 3A7LA 2LCCA 1O9SA 3VYRA 1I6VC 1B9MA 1QVPA 4QQGA 4Z9CB 1DZ1A 4L63B 5C4JB 1PSFA 5GAOp 3HOYB 1HQRD 2F0SA 4QUFA 5GANh 5GAN4 1B2TA 4JS5A 2V8JA 1PTOC 1CM9A 1HUNA 1SYGA 1QNUA 2ZT9C 2WSEE 3H8ZA 4M78B 2L0CA 1UAPA 3Q24A 2EVBA 3CC7A 3CCST 1KQSA 2X4WA 3GV3A 3GTGB 3PIP3 4ME5A 4HKEA 4ZRZA 1Y96B 2XNAC 2YLCA 1I50B 1O80A 1SE3A 1LT4D 3P75A 1TIID 1MI2A 1N6AA 5HKCA 5IGBA 4JUVA 3ERQA 4XU0A 3RKXA 2EDGA 1VQ7T 4B08A 4MZTA 3JCMJ 2DXTA 1EFID 1EWCA 4FVMA 4J6YA 4VUBA 5HY6A 4A3KB 5D14A 1UEAB 3KK7A 4QVCA 3JB9H 4XU1A 1V43A 2P0KA 3VV0A 1MSHA 5GAOn 4RWSC 3CBPA 2DNCA 1ZQ1A 4A54A 4O42A 1PTOB 4A3JB 1YBYA 3FJPA 4FXDA 3QZ5B 3S6WA 4CJ1B 4M77D 1H9SA 2LC4A 3QBYA 2E70A 2H3JA 5JOBA 1HTPA 3D8GA 2DY7A 3RMHA 3J7YW 3E5SA 2EJFA 3NTIA 2A6HD 3HOWB 3CCMA 5EGTA 4PV1C 1O7LA 2X69A 2VXEA 1B34A 5GAN2 1BDOA 2IX3A 3IKJA 5EBDA 2Y4XA 4XQ3A 5GAOm 5GANj 2ZZDA 1RF2D 2ZPHB 2XRSD 1FD7D 4HN7A 3K5LA 3CRLC 3HRUA 3BDCA 2QQAA 3TN2A 1Q90A 4Z02A 1G3TA 4M77F 2K57A 3CRKC 3AHUA 5M5YB 4FF2A 1KQ1A 4DGZA 5JJZA 1FWZA 4NOYA 3C94A 1A6XA 3MTSA 1Q81C 3SR1A 5CKFA 4WFN3