3NTIA

Crystal structure of tudor and aubergine [r15(me2s)] complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
163
Chain Sequence
ELHNCVVVQFDGPMSFYVQMESDVPALEQMTDKLLDAEQDLPAFSDLKEGALCVAQFPEDEVFYRAQIRKVLDDGKCEVHFIDFGNNAVTQQFRQLPEELAKPARYSRHCELDASTISAALLQSFIDTRFSETFQVEILATKGTGTHVVRLFYQSKNISEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for methylarginine-dependent recognition of Aubergine by Tudor
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords Maternal protein tudor
total genus 36
structure length 163
sequence length 166
ec nomenclature
pdb deposition date 2010-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ntiA02
2.40.50.790 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ntiA01
1WJQA 3OYEA 2RI3A 2R58A 4E7IA 3L2UA 2MWOA 5D6WA 2K3YA 5KE3A 2P0KA 2CKKA 4GY5A 5KE2A 2JZ2A 4A4GA 2E5QA 2HQXA 2M16A 3FEOA 3LYIA 5J26A 2RJCA 3DB4A 3OYKA 4ZTJA 2IG0A 4PL6A 4IUVA 5D6YA 3ZEHA 1KHCA 4BACA 3S3MA 4C5EA 2F5KA 3FC3A 2LDMA 2RHUA 3OMCA 5C0MA 4QQGA 2GFAA 3L42A 3MO8A 2G3RA 1WJRA 2RJDA 3LX7A 4Q5WA 3L2VA 2R57A 2RHXA 4A4EA 3GOXA 3OA6A 3EAEA 4IKFA 4QVZA 1WGSA 3M9QA 2BUDA 4UC4A 3PMTA 2EKOA 2M0OA 3KUFA 3MEUA 2EFIA 3PNWC 4N4GA 5C6SA 3BDLA 4CRIA 1MHNA 4EDUA 3QIIA 3FLGA 2RJFA 3QKJA 3NTKA 4A4HA 2R5MA 2DIGA 2L3RA 4B9WA 2LRQA 2D9TA 4LD6A 4N4IA 3PFSA 2B8AA 5FRNA 3OYHA 3OYFA 3OMGA 2E6NA 2BIVA 2LVMA 3DB3A 3E9GA 1OZ3A 3Q1JA 4PLLA 2HQEA 5D6XA 4A4FA 3META 2EQKA 2RJEA 3QJ6A 3OYIA 4BE1A 2O4XA 3MEWA 4QQ6A 3L2RA 2QQRA 2LTOA 2X4YA 3P8DA 4E7JA 2JTFA 4E7HA 2X4XA 1H3ZA 1WJSA 3S6WA 2K3XA 4BDZA 4BE2A 3NTHA 2R5AA 5IN1A 2BKDN 5FRMA 2RHIA 5IAYA 4IUQA 4QQDA 2EQJA 2M1HA 3MP1A 1OI1A 2EQMA 2O4XB 2XDPA 2WACA 2XK0A 4OVAA 3LGFA 4N4HA 3C4SA 4PLIA 2X35A 3OYCA 4ZTFA 4E7LA 3P8HA 4IUUA 3OYAA 3F70A 4L59A 4X34A 1RI0A 3OYBA 3OYJA 2EQUA 4NS5A 4E7KA 4IUPA 3OS2A 3NTIA 4HCZA 4FL6A 1G5VA 3DLMA 4II1A 3L2WA 4Z02A 3LH0A 5CIUA 3OYDA 2MWPA 2NLUA 4C5HA 3OYNA 2L8DA 2RI5A 3H6ZA 5M9OA 3OYLA 3OYMA 5KH6A 2RO0A 2FHDA 2RHZA 2VYTA 2X4WA 3LLRA 5FROA 2RHYA 3OS1A 5KCOA 3MEAA 2RI2A 2GFUA 3L2QA 2DAQA 2QQSA 3MP8A 1OZ2A 4IUTA 1SSFA 2L89A 4BE0A 3MEVA 3PMIA 3UT1A 3OYGA 3MP6A 4C5IA 2PQWA 3S3OA 3O8VA 3QBYA 1XNIA 5KCHA 4C5GA 1OYXA 3ASKA 3S3NA 4IURA 4QW2A 3UWNA 4B9XA 4RG2A 1N27A 4BDYA 3ME9A 4FU6A 3OQ5A 3H8ZA 3OB9A 2GF7A 2YRVA 3SD4A 3OS0A 3E9FA 4BD3A 3FDRA 3CEYA 5J39A 2DIQA 2LCCA 3LGLA 3OY9A
chains in the Genus database with same CATH superfamily
5LMUQ 4NOYA 1E2ZA 3CMAA 3TZDA 3GIBA 1IB8A 4LUZA 1YJ9Q 1UGPB 2P0KA 3WVDB 3X3MA 1ABQA 5KE2A 2UXCQ 3RNUA 1CHPD 1O80A 2HZYA 3M54A 2H8HA 2RJCA 2VGNA 3DB4A 4JJNK 1JWMD 1PXUA 4KBMB 1F9SA 2JYOA 4LF9Q 1QNKA 1I94L 4BACA 4R8IA 3CCLQ 4PJOE 2F03A 2CREA 4L63B 1ASYA 1U4RA 3EG0A 1EWHA 2D0OA 4ZRZA 5I6YA 1VQ5A 2LMCB 1MJCA 2EE1A 4OGQC 2FG0A 5CV8A 2EDGA 2RK1A 5KYUB 3G6EA 2BDOA 5DY9A 3OA6A 2C06A 3K57A 2K2VA 5G3LF 4QVZA 1SHFA 1X2KA 1BU1A 3TQ7P 1X6OA 4WJ3M 4JI1L 1UAPA 1JJ2P 4RH6A 2LJ3A 2DE0X 3MFYA 4TRDA 1NYFA 1K9AA 4C0DB 4C8QF 1M8MA 4CRIA 3JB9D 2KCNA 4A3BH 1BBWA 1QMCA 2RJFA 3QKJA 4O2DA 2DA9A 5D3IB 5LJ5e 1PDQA 3T1YL 4A76A 2W10A 2Q2HA 2Q8IB 4J9DA 4K8JA 1VUBA 2CH4A 4K5WA 1KC8U 4UDUC 1BBXC 1N32L 5COYA 1OU8A 3NBHA 1F77A 3C95A 1LT3D 1WQWA 1OPLA 4LDVA 3P8DA 1B70B 3KF6A 1ZYRD 1SYCA 4KGZB 3SFMA 4KKSA 1TS2A 1YP5A 2R61A 1WHGA 1D1KA 2R5AA 1PTOC 5CKFA 4LUEA 4ESRA 1I5LA 1ZEQX 2MPMA 3VA5A 1BF4A 3NENA 2XDPA 2DILA 1TT2A 2ATCB 2XK0A 2XD0A 2NBFA 3C4SA 4EX5A 4B3SL 2WB1B 3I73A 1R0CB 2LC4A 4Y92A 4QB4A 1TH7A 1PRMC 4OONA 4XTZA 3X28B 4MTKA 4YWKA 2WAQG 1PH9A 4KKUA 3RNJA 3M0QA 1PLFA 1BCPC 1KD1C 2OXPA 4R4QA 5IHNA 3CCVT 1NUCA 1LTID 2K01A 2MYSA 4XU1A 2MUYA 4QL5A 1W6JA 1XTDA 1C8CA 4KJOA 2NUCA 2TSSA 4RTZA 2E8GA 1BVSA 1K83H 3OYMA 1N8RR 1NLPC 5KYLA 3LLRA 4DR2L 1JE4A 5M5WB 1I3QB 3ULJA 5HK0A 1MSHA 2QEJC 2XTIA 4NXNQ 4DR3Q 2PZUA 5GAN6 2P0QA 4F7UG 1B1ZA 2DUDA 3QO2A 1GUTA 1KAAA 1SMYD 1AWJA 3NK9A 1RL2A 1B7TA 1TY2A 1B9MA 4G57A 1I6HB 4DR5L 3OW2S 3I55Q 1HNWL 4B9XA 4LFAQ 5C3WA 4M78A 1UUEA 2DETA 4DR3L 1WZOA 4LF5Q 4FSSA 4NPSA 1Q81R 2D8JA 1KDBA 1VQIA 1SLJA 2AKWB 2FZKB 2E2IH 2LCCA 1SBBB 1WJQA 3CP0A 3ZL7C 3S1RB 3M0RA 2JXMB 1N8RC 1G8ZD 1XPRA 3P20A 1YCSB 5KE3A 2YTYA 1SNOA 4GY5A 2MJ8A 4BY6C 1ZSZA 3QDRB 4J6XA 1A3VA 4Y7NB 4L5SA 2V8KA 1T5EA 2M16A 2DO3A 2B63H 1WI5A 3UDXA 3N5BB 1VQ6A 2RM4A 2Y0SE 3LH5A 1F2ZA 2CWPA 4XQJA 3JCMc 5D6YA 1EEID 1KHCA 4JJCA 2NUZA 4A53A 1PWTA 2B2UA 3K6OA 4ZCKA 1Q86U 4QQGA 4BXXG 3I4LA 5JPNC 3I4NB 1PC0A 2FPEA 5ELOA 1HNWQ 2JVVA 4C3IB 1ZXTA 1NJIC 2DN8A 4JV5Q 1QNUA 1D5ZC 2EJ9A 1U5KA 4DU9A 3WWVA 3M9QA 3S17B 2DFUA 4ELYC 3PO2B 4OMOA 1YHQT 1HXYD 1SYFA 2A68D 2M0OA 3PNWC 1W3SA 5KYWB 3REAB 3QIIA 3IQLA 2A73B 4IFDH 1IHZA 2PQAA 2P4RA 4DAYA 3T1YQ 2L3QA 3CCQQ 5J3BA 4JS5A 4DKAC 4A3JH 1S5CD 1WIEA 1TIID 4ME5A 1Y1WG 1MMAA 1QP2A 1KJWA 2ROTA 3CCRA 2O4XA 3CCST 2K57A 2F0JA 1TKWB 3M53A 3L2RA 3PO2H 1YEZA 3GTGB 2P84A 4BY7H 3R6OA 1M5Q1 1NJIR 5GMKe 3I56Q 5EC7A 3V7RA 3SE0A 1K28A 1Q82U 2HCIA 2LQ8A 4A3GG 3HP9A 1HSQA 2MNAA 4FM4B 1IGQA 4JLGA 1NE8A 2MOXA 5GANj 2B2YC 3EQLC 3S9WA 2WB1E 5IAYA 3GD7A 2C0TA 2LNHB 4OB3B 2MI6A 5H1SE 2QQ9A 2WACA 4N4HA 1PZJD 2VY3A 5AT1B 4A3DB 3P8HA 5EG2A 4EIKA 4RTWA 3OYAA 2JA7H 1PZID 4C2MH 1A2TA 3BS1A 1OTCA 2FZGB 3T53B 1AT1B 2BZYA 2DL7A 4JRKA 1N32Q 1NJIU 1SSOA 4DAPA 3QZ5B 2R93G 4N8FA 4M78C 1WXUA 4KMUC 2Q8TA 3HRUA 1LPLA 4UAIA 2Q2UA 1PSEA 3OYLA 1VQ8A 3GTMB 4JK1C 3K7AB 4ZUIA 1CKNB 2PCFB 2P0PA 5CR2A 4PZ8A 2C0OA 2KRSA 2DZCA 5IXFA 1UE5A 3CRKC 3GTKB 1SSFA 4HIOA 1FYNA 1I4PA 1S5BD 1VS0A 2E2DC 2QTVA 2VS1A 2RA2A 3ONAB 4IJHA 2DL5A 4HJ9A 4PFZA 2VC8A 2KJXA 1K9MC 3PIO3 4N9PA 4K6DA 3UWNA 3RMQA 2RNAA 2EY2A 3J80i 1VQOT 3TSWA 1C4QA 4YCUA 1LV9A 4C3HG 1VMCA 3VS1A 1NAPA 5L8RE 4JBKA 2MPXC 3CPFA 1EL0A 1K0RA 1PFBA 3RLNA 1ET6A 5J39A 3JV3A 1CFMA 4Y28E 1KRTA 4A3IG 1ZA2B 4IIOA 2IHFA 1VQFA 2B2WA 2K5QA 3VYTA 1D0XA 5FLXE 2CT3A 2RPNA 4KH0B 3A8OB 1SFOH 2AWOA 2NUTB 3V8KA 4BY7G 2KY9A 3VRZA 3N6RA 1WFQA 4M8AA 4C3JG 2BDNA 2EKHA 3OIQA 2WAQB 1VQ7Q 4GLVB 4M78G 4IALA 4R4OA 1Z9ZA 1SEMA 3ITPA 4QKUA 4L5QA 5LMUL 1XJVA 1HUMA 4LUDA 1KQ1A 4V2SA 3NP8A 1QVFP 1UUPA 3W5OA 3EFOA 3TZUA 3U4VA 1TWBA 1SFOB 4XQNA 1DYQA 3L2VA 1SMXA 3SK4A 2QCPX 1VQ5Q 3KUPA 2D1XA 4LDXA 2K5HA 1PFMA 5EPJA 2RB6A 4A4IA 2X69A 4C3IG 3H94A 3M57A 4X9CA 3KUFA 3MEUA 4HTHA 1AH9A 1OQKA 4OGEA 4XQQA 2QYZA 2BA0A 4DUYQ 1FYCA 4QY7A 2JM9A 2CP2A 3FLGA 4A4HA 5IWAL 3PO3H 2F2VA 2O88A 4L5RC 2E6ZA 4H13C 3FEWX 1AFPA 3VYSA 1EQVA 5IY0A 3PUYA 1M27C 4NXNL 4QMGA 4M4ZA 4DBQA 1YI2A 3CC4A 2EY5A 2JTMA 2X6LA 5I2XA 1AHJB 1VQAA 1LNXA 2QQRA 2AUJD 2HIVA 4UP9A 5FJ8H 3S1QB 4A93B 2ZGWA 3CCRQ 2NN6G 2R7ZB 4E7HA 2KK4A 1MMNA 5IYBG 5FLXc 3X20B 2HNIA 1X3QA 2QTXA 1EUJA 2PZ1A 3CPWS 2G9HD 4XXEA 2BKDN 4KHPL 4P72A 4POFA 2HT1A 2LJ1A 1M1KC 2EYHA 2DBKA 1V1OA 3FDTA 4FVMA 4A3GB 2JA7B 2ZJRA 1Y07A 2E4HA 3S14B 4FNFA 1WNLA 4IUUA 4DEYA 7AT1B 4HMIA 1CKNA 2K7VA 1VCIA 3GV6A 4NS5A 6AT1B 1VQPA 2DXCA 3EGUA 4LF5L 1BYMA 1KDCA 1BCOA 1MUZA 3P7JA 1G5VA 2GN5A 4M7AD 4GKKQ 1JMCA 5GMKj 2I5MX 1RLQC 2CYZB 3OYDA 1Y1WH 2EQIA 1MIUA 1W6KA 5GAOp 3CCMQ 1I07A 3P1HA 2SEBD 3JAMc 4J7IA 4DBFA 2Y90A 8ATCB 1SN8A 3MXPA 2IPOB 3OS1A 1EFID 4ILWA 2FRYA 3NPFA 1JU5C 4M7DA 1GFCA 1KLGD 2L1BA 1BCPB 3F8TA 3KLRA 3PGGA 1IHWA 1OZ2A 4IUTA 3NEMA 2LQKA 3PT9A 2NUTA 1QWFA 3SVMA 1SSHA 4Z88A 2I5LX 3V7SA 4AG2C 1AE3A 1NR4A 1VIEA 1K8AU 4L5TA 1U4PA 4EQPA 4FF4A 4XYOA 2D5DA 3RR6A 2VKNA 1H9SB 5A2QL 4M78E 2CZ1B 5FU7B 4EQOA 3M55A 3GDEA 3A8GB 2YXYA 2NVTH 4DV3L 1VQ8T 5ECAA 4DK1A 4DV2Q 3HOUH 2E5LQ 2GF7A 4ZN1A 5KYWA 3C0CA 3DUZA 4HJAA 4JI0Q 4JI1Q 3FDRA 2AHJB 4C8QD 3JB9F 2RH2A 3AHUA 4CDEC 2JN4A 2ZTCA 1M2VB 4UPAA 1KIKA 3EA6A 4FW1A 3H0GG 3UI2A 2EYQA 2BE5D 4QQBX 5D6WA 2WP8J 2L11A 1HA6A 2NYZD 4LNPA 4OEMB 4OXPA 1DJRD 2Z9HA 2KVQG 2WV6D 2HDMA 1L2FA 3RLFA 3GTQH 2K28A 3EG3A 5CKEA 2N49A 3OYKA 3BJUA 1LCKA 2AKKA 5GANh 2F0TA 1V76A 1Q82R 1STEA 4K14A 4N0AC 3CBMA 5LL6X 2RHUA 1X01A 4BI8B 4JW0A 5JJIA 4LD9K 2ZPGB 1D1BA 1FR3A 1NG2A 3VS2A 4DBRA 3G6EQ 1VQEA 2XRQD 3SGIA 2AK5A 1ZSZB 1IYJB 1FL0A 3RZOH 1AWWA 1M1FA 4JZ3A 2M9VA 5FLMG 5GAOn 3T4AC 3HOVB 2EAYA 3QXEB 1WQ7A 3EGXB 1WVLA 1AZPA 3PO2G 2JSOA 4JUVA 1IRXA 3CMET 2EOTA 4MZ9A 1CQFA 4HJ5A 4IJLA 4A3FH 2VW9A 2CUBA 2BUDA 2M02A 4UC4A 4J9IA 1SJED 5GAN4 3NSWA 5FO9B 1MKHA 1N9SA 4H02A 4X62L 4XK8E 1WOCA 4C92E 2RSOA 3OSVA 2NWMA 3G71T 4NL3A 4A3FB 4M77B 4GKJQ 1QKWA 3TP7A 4N4IA 2J4XA 5IWAQ 2LX9A 3OYFA 2CGHA 4J5YA 1E2VA 2C5CA 2DY7A 3I4NH 2CP5A 3GBQA 3NHNA 5E7NA 1SPKA 4KD4A 3ER0A 4MMKA 1SNDA 2ICEC 1JEGA 1EYCA 4C92D 2Z0WA 4UHVA 3WVEB 4CKBA 1AP0A 9ATCB 1D7QA 4DV5L 5M3MH 2J6FA 5GAOl 1SYEA 1UJ0A 3JSCA 3F1ZA 1I94Q 4LF9L 2X4XA 1YI2Q 1OX9A 1WJSA 1ZQ1A 2A36A 3S6WA 1S5FD 1GXDC 1DOKA 4ZNXA 2IPKD 3OOCA 3JRZA 1GCPA 4HSPA 2VZAA 3CW2C 2OAWA 2Z0SA 3DM3A 1WTWA 3VS5A 2OAUA 4IUNA 4J6YA 3CCJQ 1U0LA 1OI1A 2O4XB 4DV7L 1A0NB 1ZA1B 1X2QA 3GPLA 3CBOA 2JNGA 1LABA 2XVSA 3HOXB 3I9QA 2B63B 1RUWA 3AEVA 3VJPA 3VS6A 2QGGA 4M7AF 2X9HA 2G5DA 3HPWA 1S5ED 3WOEA 1JCKB 3M4OB 4JBMA 2WIIB 3H09A 3AMUA 3LH0A 4L6TB 2B39A 4FT2A 1TY0A 4F16A 1BK2A 2Q2TA 5CQYA 5LL6S 1T9HA 4XTCS 1WHLA 1DD2A 2RHYA 3G6JB 2A08A 3VS0A 1YJNA 1D1CA 3UATA 2X3XD 1FGUA 3L9AX 2A68C 2QAZA 2G9DA 1VQPT 3VR6A 1BB9A 3CD6A 3S17H 1XNIA 1FGBD 2E12A 3M0TA 3QYGB 2HSEB 4V190 4M75B 1EY7A 2DD5A 3CXCA 3MFGA 3R2TA 2OTLQ 5EKKA 1JB3A 2JA8B 1VQMT 2H3JA 4LUVA 2K2MA 4M75C 2LS01 1D2BA 3HOWG 1QB5D 1TU0B 4Z8AA 1BUVT 2KE9A 2OQ0A 1M2OA 1UDLA 4P5NA 1Q90A 2XNAC 4GN4B 5IT9c 2JA7G 1QLYA 1UE9A 1TR5A 2NVYH 4HN7A 3EHRA 1FNWA 2E64A 2EW3A 1VQ6Q 5A35A 5E4XA 4DAVA 3PIOA 3V05A 1IBKQ 2FFKB 2HQXA 3BFMA 1G51A 4RWSC 3DLLA 4JVZA 3U50C 4LF6Q 1JJCB 5GAOr 1A0IA 3M7GA 1IGUA 2W0ZA 3G71Q 3M3YB 3M0SA 4AQYL 1H641 1KDAA 4GOPB 4UY8C 2B2TA 1G83A 4RTVA 5J22A 2KQWA 1VQKQ 2HUGA 2Q2IA 2B3GA 2HQHA 4OMQA 4QT7A 1AN8A 1TWGH 1OOTA 1I4XA 4F87A 5C0XJ 3TRZA 4MTNA 3CCVQ 2NVYB 4KHZA 3C3LA 5K36G 2YRDA 1L1OC 4CDCC 3H0FA 4DR1L 4JI3Q 3WOFA 1NPRA 5I21A 4C92B 3HOVG 3JAME 1BBUA 3A8MB 1QJOA 4M77E 3VDYA 3A8JE 1TXQA 3PGZA 3TVTA 2HAXA 4PMWA 2DEQA 5GJWB 3BYTB 1TWHB 1ABOA 1UG1A 2XHCA 1QG7A 4P71A 3PUWA 4HIMA 4RKUE 4C1NI 2Y0SG 4LDWA 2GGRA 2K5VA 2BIVA 1W6XA 1Y96B 2LVMA 2D62A 2FJ2A 5G3LD 5GROA 2PPBC 3VA7A 2EZVA 2UXDL 2RBMA 2RJEA 1LT4D 3FHWA 1W2BA 4A3LH 2CSQA 5JEAG 2EVBA 4MZTA 5FU6B 1LO5D 2X4YA 1K9MR 4I7ZC 5IP9G 3T9NA 1I4HA 2MO1A 4CKEA 4PJOF 4M77C 3T16A 4X66Q 2ZM6Q 1PKTA 4F7XA 5KYYA 3TP8A 4GKKL 1GRIA 1A63A 2D9UA 5GMKl 3TBIB 4GLAC 1ET9A 1ILQA 3L2PA 2VQEL 2WFWA 3CBPA 4QQDA 2HIXA 1PMRA 3MTSA 4GNXB 2EYXA 5M3FH 1EQRA 1AEYA 4JRIA 2ICIA 3D31A 2XIDA 4ZTFA 4CKCA 4OWWB 1T3LA 1IW7C 2HCKA 2A3LA 2AKLA 3VR5A 5IYCH 2KRNA 1A8VA 3RMHA 4DPGA 3Q24A 1ZSZC 1IW7D 4E7KA 1KIXA 2RMOA 2XMFA 4KHPQ 5GANg 1GBQA 2B63G 1G6PA 4IZ8A 1RHPA 4CI0C 1RAGB 2F5TX 2A0FB 1CK1A 1YNJC 5IYDG 4A3BG 4GS3A 1GJXA 4U673 1BO0A 2F3IA 3QG1A 1SNPA 2GCXA 1JORA 4A54A 4ZGJB 1YJWT 1SJHD 3RBBB 1CKOA 4CHTB 5IGGA 3L2QA 2ZJQA 3CCMA 2QQSA 1HCZA 4KD3A 3DWQA 3OBWA 1YJNQ 2DM1A 5CYUA 3O8VA 3V7CA 1RJTA 1OULA 1NMGA 1ICFB 1ZX6A 4FF2A 1YIJT 3ASKA 1DONA 2KYMA 2Z6KC 5HY6A 2YU9H 2QILA 4OB1B 2A6ED 3A7LA 1HXDA 1ENCA 3HS0C 4ZGEB 4DQ2A 3CCEA 2DGYA 3OQ5A 1EQTA 3M4QA 3OYYA 1GUGA 1PTOB 5A0GA 4AFQC 4EVOA 3CEYA 2YRCA 3KBXA 1OPKA 2E3IA 1WJJA 1WHKA 3A54A 3GV3A 4OIKA 1CKBA 3M85A 4DUZQ 1M2VA 2V1CC 5C3EG 2D8HA 2RI3A 2PW7A 4RCCA 2K3YA 4WORA 1PH2A 4P75A 3QSUA 1R8OB 4DV6Q 1NLOC 1OX8A 3K8AA 5CGKA 1DM0B 4B3TQ 5CVIA 2VB2X 4CBVA 4PKCC 2CP0A 5C4ZA 5J26A 2I2LA 2ZT9C 4B3SQ 3GF5A 3I70A 3NGPA 2IL8A 2HHHQ 1VYVA 2E1HA 4D8DA 8AT1B 2IJ0A 2MFIA 4PQXA 2UUBL 1QP3A 2CWAA 5FLXL 1HNZL 3G71A 1N9RA 1K1ZA 2ABLA 2GFAA 1R4PB 1VDZA 4K2KA 2F4VQ 1M1KR 2JMCA 2BE7D 4KLKA 5C4XB 2IIMA 5CAIA 4OX9Q 4GKJL 1E7OA 1JJGA 2PUKB 5GAN3 2F2XA 3P8BB 3ULRB 3GOXA 4WJ4A 4X9DA 3MVVA 3RKWA 3CAMA 2SNSA 3KYHC 2UU9Q 4C92G 3NMZC 2EKOA 1LTGD 3HOUB 1QW1A 1RCVD 2KCTA 4K5VA 4PJMA 4EMKB 2PNHA 3NTKA 1KQSS 2F0FA 3UDGA 2MK5A 2DNEA 2MCNA 1RI9A 5KYIA 2JA6H 2L3RA 2OF1A 2VXFA 1LJOA 4F17A 5FRNA 3PV0A 2B8AA 3K0YA 5CV7A 4PFPA 3DB3A 5KYNA 1Y8NB 2EVRA 4JYAQ 2FYKA 2VUBA 3META 1F9QA 1SR3A 4OF1A 2LSSA 2QEXA 3TQYA 4DF7A 5IP7G 2VVKA 1ILPA 3PMFA 2GNCA 1U8RA 3G4SA 1A2UA 2V8IA 4KGXB 5FKAC 4K0KQ 5FO7B 1GFDA 4OMLA 3MXNA 5GAGC 4LMQD 1VQNA 1LT5D 1D6EC 1YNNC 3PF5A 3H3VC 3BG3A 1SMYC 5C0XI 4F88A 1G2TA 1YNND 2KI7A 2XGTA 4RFBA 3J80L 5KEEA 1N34Q 2DVEA 1ZLMA 5CQXA 3V2TA 2EJGA 1WYXA 4HJ7A 5CBEE 4CGYB 4BY7B 3OS5A 4R55A 2K5DA 3GTQB 4L59A 4QIWB 1RI0A 3K5NA 4AFUC 1JXMA 1G291 1I50H 1UJYA 3FRPB 5IT9L 1XJWB 4RG8A 5CCAA 2YTVA 4Z89A 4NW2A 4X65Q 4KK7A 3IKJA 1BR9A 2XSCA 3GTLH 1FMWA 2JA6B 4QVDA 3I90A 2RD1A 5IGDA 3K5MA 4PV1C 4DGZA 3MEAA 2RI2A 2F0MA 4G4KA 1IYUA 1XNRQ 2L89A 1F9PA 3HOZB 2PQWA 1I5FA 1FMVA 3D6CA 1I6HH 4LFBL 3IL8A 3MPUB 2VWFA 5EPKA 1U9RA 3J81i 1LM0A 1BXTA 1M4VA 3JC66 2UXBL 1VQGA 3H8ZA 2YRVA 4FO2A 2WSCE 5LJ5g 3I55T 1HTLD 3G7ZA 3SWNA 5DLOA 4M7AA 3BDUA 1CKMA 4RMFA 3EHQA 3TP5A 5EJWA 1PRLC 4KTAA 3RR5A 4G7HC 1X55A 2LXKA 5GJVB 3QHSA 1KAWA 2WAQE 1ML0D 3UDFA 2R7ZG 4FYVB 3PCOB 2IX0A 4MZMA 3JCMW 1ACMB 2GQVA 5EQ0A 2R93H 1VQKA 1A62A 3EH2A 4JBJA 4PG3A 4RHSA 1Q7YU 3JCMV 4LFCL 1UE7A 4C5EA 3VR4A 2C9OA 3A8LB 3C1EA 3CXCS 3S1MB 3MXGA 1YNJD 1OXSC 1YIJQ 1PH3A 4WTOB 1KG1A 2RHXA 4A4EA 2BCOA 4OELB 3L1AA 2VB6A 3K58A 1KQSP 1X27A 2EYYA 3EAEA 3PTAA 5BR8L 2L15A 1X6BA 2YUPA 4KH1B 2JA8H 4GOPA 2GBQA 5CV4A 5ELDA 1TUCA 3L0OA 1WDXA 1YHBA 3TEHB 1XWEA 2YLCA 4N0AA 3HOWH 3SK8A 2Y0SB 1NBWA 5L37A 1HRJA 2A7YA 1EIYB 4FT4A 2DL8A 3PFSA 1PD0A 2KNBB 5LJ3g 3OYHA 3OMGA 1IXRA 1UE6A 2JP1A 3A74A 3BE3A 5D6XA 1AWOA 1PM3A 3QJ6A 4E6RA 1TWGB 3UDIA 1E22A 2K52A 2UUAQ 5KNDA 2JS2A 1B53A 4C8QB 3A8KE 4C3JB 5JAVA 1PH1A 5DLQE 1H3ZA 4BA2I 3EG1A 3T1HQ 1I81A 2XU8A 4HA8A 4PJLA 3RKYA 2AQ3B 2K32A 1FXXA 2OTLT 2CUDA 3VR3A 1X3PA 3X24B 1H9JA 1N8RU 1RF2D 1KNAA 1BOSA 3GQBA 1L0WA 1ZUYA 2F0EA 2A69C 1C0MA 4FXKC 5GAN7 3VYUA 2MHVA 3I8ZA 3C46A 5C4XG 2FVUA 1G8XA 1RAHB 1YBYA 3OWEB 1Y57A 4DAYB 4PFOA 2R7ZH 4DR7L 4MNOA 1Y96A 4BXXH 1Z9QA 1E7ZA 4X34A 4H0LC 4AIMA 3BU2A 4A4KA 2WB1G 1BDOA 2KVMA 3KFUA 4S3SA 3E1SA 3OW2P 4A3CG 2LT4A 1MGQA 1UFFA 2AUKA 1FWZA 4X6AH 1WXBA 4M7AC 1G3SA 2F0LA 2CVRA 5IP7H 3GTGH 2VYTA 1D3BA 5A0LA 1VQ9T 4C3HH 2OT2A 1K0XA 3DEPA 2YWWA 4RTUA 1E1TA 3GP7A 3QUIA 1H3HA 3S3OA 3U4ZA 5I9PA 1JB0E 1I4K1 2FB7A 3GP8A 2LCSA 2NUPB 2PI2A 3C2PA 1YNXA 1BCPD 4NMZA 4DXGA 1UGSB 4B3RL 4BDYA 3ME9A 4A3FG 3OB9A 2RQRA 2NTSA 3FKIB 3MEFA 3E9FA 1XMOQ 4D8KA 1X43A 3TEEA 1HH2P 1JOOA 2K03A 3K7UC 4LF8L 1C1AA 1JXOA 1RD9D 1XX8A 1VQHA 2NVQB 5FU7C 2YTXA 4ANJA 2QASA 1UWVA 4C8QC 1EOTA 2EYWA 4M7DE 1SAPA 4I65A 1JQYD 4BY1G 3UE0A 1X75C 2ENMA 2F0NA 4A3KG 4AG1C 2FZCB 2EY1A 1XNQQ 4HVWA 1QWEA 3Q8DA 3QDFA 2CKZB 1DZ1A 5JPMC 1KK7A 3FEOA 2DERA 1VQLA 4JG2A 4LF4Q 3CCLA 1LUZA 2DBMA 1TS5A 4X3KA 5C5LA 1X65A 3U23A 2EXDA 1X9NA 3R3OA 3AT1B 3OW2A 4R4IA 3I5SA 4A3GH 1PH5A 2UXCL 5IYCG 3MO8A 4LW1A 1BI0A 1WJRA 2E41A 4JS4A 1HQRD 3M4YA 1ZBXA 3TMEA 2JK8A 4DOWA 4K8IA 1EYAA 5C6AA 2O5IC 1YVCA 1MBYA 2JUFA 2PTKA 1Q82C 1MHWC 1M30A 5GAMf 2MO0A 2R7FA 1L1OB 5IODA 2ZTDA 2R92H 1QCOA 1TTHB 3HOUG 3KDFB 1GL5A 3A5UA 1PHJA 3RERA 3FKIH 2IY5B 1G2SA 2F0IA 1GD7A 1OXTA 4EDUA 1SE3A 3K7AH 2DL3A 1J3TA 1GKHA 1W4SA 2K3BA 4YHHL 4R8NA 1QE6A 1H9KA 4JI5L 2E2HH 5HURA 2O31A 3RZOB 2J6KA 3Q1JA 1UTIA 1T5XD 3H0GB 3OPOA 4X64L 5BN3A 1K3RA 2EQKA 3ICEA 4A63B 1NEBA 2KGTA 3HOXH 4MHEA 2RCNA 3D0FA 1PHTA 3MCAB 1VQOA 1JJ2A 2J0TD 4H7BA 4NL2A 1BI2A 1VIFA 3FVQA 2ZTEA 3NPPA 1IXDA 4ODGA 3G1JA 1LT6D 2EJMA 1VQNQ 1CSQA 2K14A 1RLPC 1B07A 2KROA 1AZGB 4O5VA 3E5SA 4IUQA 1M90R 3EBEA 4A3LG 1RACB 2N78A 5ELNA 1ZBJA 4LDUA 4BUGA 1K9MU 1VQ5T 1EWIA 1NY4A 4JLIA 4PLIA 2CW0D 2ZPHB 3OW7A 5FOBB 2CZ6B 4DV0L 4A3IH 3S1RH 4DR4Q 3OYCA 1BI1A 2GVAA 2CW0C 4LF7L 3MJXA 2K4KA 2OWOA 4XQ3A 2L12A 1E2WA 2COYA 2JXBA 3UF4A 4IQZA 2XICA 4IUPA 5AJ3L 4L6V5 2FPFA 3E19A 2DYIA 3S1NB 4YIJA 1Q12A 1PNJA 2D2CC 2L5QA 1T3SA 3JCMP 1HR0Q 1C9OA 3SR1A 2K1BA 4AYBE 3S1QH 2VUMG 5KH6A 2RO0A 2FHDA 5FROA 1LTSD 4ID6A 3I4NG 1G2BA 1D1AA 3JB9H 1K0SA 3PUXA 4TVRA 1TUDA 1CZGA 2B8GA 2F52A 4APVA 2RSNA 2DAQA 3PO3G 5ELEA 1OXXK 4B3ML 3F2UA 2CP3A 3QBYA 1YITA 1GOZA 1TVXA 3EGXA 2E5KA 1JO8A 4HR7B 1WHHA 1N9WA 3KFVA 4IURA 3J7YW 3DKMA 5FW9A 1IO6A 3BY7A 1EY9A 4HT8A 1K4US 1NPPA 3BVZA 1NR2A 4QCLA 2ZPEB 1Z6HA 2A28A 3HGBA 5M5WH 3K5LA 4OO1G 1GUNA 4IOCA 3GTOB 3CC7Q 2QA4A 1ONLA 1HR0W 2GTJA 2UUCQ 2ENBA 4M75D 3F2DA 2F0HA 4HEDA 1PH4A 1Y1WB 2LX7A 4E7IA 3A8IE 2ZXRA 4F7UF 3IFDA 2CKKA 4NXMQ 4A4GA 3S2DB 4P2CB 2F0QA 3P75A 3JCMf 1TWCH 3SEBA 4NDXA 1QCFA 3KOJA 1Q3LA 3HEJA 1V43A 2F0OA 1HHVA 1KC8C 3D4WA 4E2FB 4DV4L 5L23A 4M78B 1FJGL 2DX1A 5EGTA 1S72A 4BBSH 3Q0AA 2BE9B 3NBHB 1L0YB 3JCMg 4DNIA 5CMDA 2RJDA 2KENA 3I4MH 4XTVA 1K8MA 3J80c 2UXBQ 1STNA 2K5NA 2ZPIB 2K75A 4Q0FA 2CCZA 2BZXA 3CC4T 4RA8A 2VQFL 1CA5A 3TDQA 2JN0A 3MHXA 3H3VH 2ZCFB 4BBRB 5LJ5d 4FW2A 3PMTA 4PJOA 4A3BB 5C6SA 4DBHA 2DJZA 3KXTA 2K7AA 3DWAA 2KCMA 3OIPA 2K4YA 3HFZB 5IGCA 2KBTA 2COZA 5M3MG 1GHKA 1FD7D 5CKBA 1RAFB 1GM5A 1EYGA 1IBMQ 3MA2B 4ZKBB 3MAQA 3CCSQ 2MAMA 3HOWB 2K6AA 4L5GA 5CORA 3G7LA 4JI2Q 3CC4Q 2JJQA 1GUOA 4M78F 2YSQA 1PD1A 3VUZA 3EIVA 4HCEA 3HZXA 2TMPA 5LJ3e 1J5EL 2COWA 3QWYA 4GBQA 4PNOA 4KKTA 1EY0A 1M4ZA 1MGSA 1K73R 5IT9E 5LJ5f 4O1NA 2JE6I 3A56A 5IGEA 2QGQA 1Y0MA 4AMCA 2V1QA 2AHOB 5CC4A 1VQOQ 4KULA 2M00A 1S40A 5GMKm 1STBA 2F1MA 5LMNQ 1BNZA 2EQJA 3R93A 4I7AA 5EKIA 4HIKA 1Y14B 2LKVA 3LGFA 1Q8IA 4CC7A 3OWFA 2X35A 2FEIA 1EZ6A 4KJNA 3QB3A 4HIDA 2OI3A 2BTTA 4C0FA 1TWAH 2AMCB 4J15A 2YT6A 2X3WD 4PJOD 1SEBD 3OYBA 1JBMA 2O01E 1JR0D 5DM63 3OS2A 3NTIA 3KJPA 4AYBB 2EBPA 2F3VA 4PZ6A 3J81E 3L2WA 1MNDA 5CIUA 5I6WA 4OL7A 1WTRA 3DMUA 1KNEA 1HK9A 2EYPA 1LLRD 3DEOA 1YZ6A 1WCMB 4RHRA 3I56T 2JS0A 4OB0B 3RESA 3RN5A 5KCOA 2DJGC 1QILA 4CDFC 1N36L 5AYFA 4JI4L 4BY6B 1TSFA 3JCMb 5M5YB 3MEVA 3PMIA 3QO3A 2K6DA 4XTXA 1D0YA 2VXEA 3UT1A 4A3JB 1J8IA 1GUSA 2SRCA 1ZKOA 1EZ8A 3BZDB 2KAFA 2DZ9A 3W3AA 4PNYA 3S16B 1V9PA 1KFZA 2LFNA 3CCQT 3SWNC 1VQMA 1YITQ 4DV1Q 4J9BA 1N27A 2ZPFB 3BDOA 4FSXA 1TWFB 1Y7XA 1EIGA 2ASBA 2A19A 1ZHIA 2YUQA 4E7SA 2UUBQ 1VQDA 1M8AA 3QJYA 3M0PA 4A3KB 1X54A 3ZYYX 1A6XA 2RK2A 1AOJA 2CT4A 2IX3A 1Y1VH 2GQIA 1E6HA 4B08A 2ROLA 2CZ0B 4IPCA 4DV6L 2OJ2A 5LJ5j 1HQMC 1EY6A 1JC7A 3HKZB 1BIBA 3LYIA 1STGA 4JI7Q 3BZCA 3PQIA 2FRWA 2FPDA 5KYXB 4ZTJA 2IG0A 2L55A 3NWTA 1OO9B 1EQQA 2HDAA 4RTXA 3JCMe 3OTOQ 3QPHA 4A3EH 4PJNA 1T0HA 2B2YA 3DXJC 2A6HD 5FJ8G 4GLXA 1D8LA 3L42A 2EGCA 1PYSB 2G3RA 5CK9A 1UE1A 3FPUB 1M8VA 1O7IA 3CCET 2LP5A 1CZWA 2A6HC 2FINB 4TKOB 5HGTA 2KYBA 2E2HB 2QQBA 1H95A 4C92C 4QGUA 4FXGC 2GTOA 2DPPB 4BI4A 4KGVB 3F2BA 3J7AF 3HFNA 3EG9B 2E2IB 2EQSA 3NELA 1PH6A 5I4DA 2YLBA 1F2MA 2KXDA 4N4GA 5FWBA 4XTWA 1XOVA 4CJ0B 4LXCA 5JJLA 4GLKA 3KLSA 1SYDA 4JI2L 4JBWA 3RDVA 2DKGA 1HUNA 1YFNA 2DRMA 2L2PA 1K8GA 1AD5A 5C44H 2KCCA 4KHVA 4NP5A 4Q5VA 1SF9A 2DY8A 4GN5A 1XTCD 2I46A 5FLMH 3LW5E 4FDBA 3F2CA 4A3MG 1RTOA 1C7YA 2IVWA 2HD3A 2B8FA 2J06A 3VRYA 2N8NA 2RDGA 2EGEA 1AVZC 1V1PB 4LFCQ 1D09B 2Z8LA 4OB2B 2K5LA 3NQTA 2KHSA 1N33Q 5HKCA 1P8LA 1HNXQ 3GNGA 1X3FA 2E76C 2DNUA 1IL8A 3J81L 2B86A 2F0VA 2NZOA 2YHTA 3EH1A 1F2YA 2EWNA 2YDLA 1Q8KA 5LMNW 2L0CA 4DV4Q 3CC2A 1DOLA 2V8JA 3BW1A 4QIWE 1K3BC 2OTJT 1PH8A 3CCJA 2EYOA 5I9OA 4HCCA 2WSEE 1WPYA 5C5MA 3GTPB 1D3BB 5IHKA 1WD0A 4NXML 3ND9A 1QUQB 1TWFH 3H0GH 2MIOA 1ZUKA 4RUGA 2ESWA 1KD1R 4BBRG 4ZK9B 5C0XH 1HNXL 1PRTD 4RCOA 4FF1A 3FPPA 1YJWA 1FVIA 3JCMQ 2VUMB 3OYNA 5GADC 2LZ6B 2L8DA 1IBML 3H6ZA 2KQ3A 1EFNA 3TS2A 3VV0A 1ZUUA 2G6FX 3HHTB 2QF7A 2DD4A 3CD6Q 1AE2A 1XNRL 2L9HA 4L8JA 4PJJA 3I3CA 4HT9A 4PMCA 2R92B 1E6GA 4GN3B 2L4NA 5E4WC 1PH7A 1PSFA 3TSZA 5KCHA 1CT1D 1PTOF 3KLSX 2XDBA 3SB2A 4C5GA 3NWSA 1H9MA 1YWPA 4K11A 1TWHH 3PUZA 1MMGA 1ESRA 1IREB 1BIAA 4Z9CB 1OXUA 1Q7YR 1EYDA 4F7UE 1HZCA 3ULLA 4M77G 4YTLA 3SHWA 1VQMQ 4XTYA 1LTAD 3KF6B 2F0SA 4A75A 3CMAQ 3VR2A 2OTLA 1Q81C 2EJFC 3NBIA 1WTPA 5DAUA 1GUWA 2HKQB 3CU7A 2PUOB 5IGBA 3HKZE 1X69A 1NE3A 3A1PA 1QVFS 1EZZB 4ZGDB 1VQLQ 2M51A 2NZ1D 1PCXA 2RF4A 3LX0A 2E5QA 5JJZA 2E2JH 3RD4A 4HAEA 1IL2A 3I7FA 5EBCA 4AYBG 3CMAT 4J9CA 2ZPBB 1GHJA 1RDPD 3Q23A 1UEBA 4O0AA 4X3UA 1CSPA 3EVQA 5E1FA 2HEQA 5DEHA 1B9NA 2PMZE 4ELZC 2DXTA 4M7AE 3H9NA 1E0BA 3CMEQ 4AH6A 4HXJA 4E6IA 1G3WA 1TQOA 2KT8A 2R57A 2B2UC 2VL6A 3G48A 2DJQA 4CC3A 2Q8RE 3D7SB 2KEDA 3CD6T 1WTXA 3Q22A 2ALYB 4PJOB 1IZ6A 2EFIA 4JJDA 1SRUA 3PIPA 5E3FA 2PVDB 3HFOA 3JAMi 1VMPA 3V8LA 3CCRT 3CCSA 2O9VA 2RHSB 2LRQA 3O5ZA 1YI2T 1UGQB 3MWYW 1GVPA 2E6NA 2V4DA 1RADB 1OU9A 3PSIA 5DNFA 5KYYB 4OMMA 2EPBA 1CKAA 3E0JA 1N36Q 4JI4Q 3X26B 1E24A 5KRUA 4JRPA 1KXLA 2E70A 3BDCA 3G6ET 4C8QE 1SKUB 1OXVA 3MEWA 1B34B 2ED1A 2HBWA 2O2LD 5HCKA 2HHHL 2KEAA 1ICWA 2D0NA 3FIFA 2B2WC 3VS3A 1MJEA 3M3YH 4XAXB 1UB4A 1HZ9A 4F7UA 4BE2A 2PZTA 2JJ9A 2PVGB 1NSNS 4DFAA 3A5ZB 2AQ1B 1QUQA 5FRMA 1K8AC 1SE4A 2Y4XA 1Q1EA 2CP7A 4BE0A 3HOXG 1QZHA 2V1RA 1CM9A 5GAHC 4C8QA 2RDHA 4C3JH 1D5XC 3H15A 4E7LA 1PA6A 4DV5Q 4NKLA 1TWCB 4M75F 4Y91A 1VQ6T 2CQOA 2E75C 2PI2E 4JRQA 3CF5A 5M5XB 1RAIB 2LCLA 1TU2B 2A6EC 5JEAH 1XNQL 3S2DH 4J6WA 4ZAIA 4FL6A 4FYWB 1EY8A 2WSFE 4II1A 1TS4A 2HCCA 5C3XA 4DV1L 5GMKh 4QF4A 3EG9A 1WCMG 2NLUA 2SNMA 5CO7A 3HP3A 4A3MH 1VQBA 1HPCA 3ZFJA 4LF8Q 3K0XA 1J5EQ 3RMSA 2GFUA 2DNCA 2JQOA 2F0PA 1UNSA 3L3OC 4R9WA 2XN9C 2CS7A 3K59A 1FNVA 1YHQA 1WFWA 1IBLQ 4HVUA 4B6MA 3QWNA 4ULLA 2K9GA 2KHJA 4HCBA 3GTMH 2R92G 4J8OA 1LVKA 3S3NA 3CCEQ 4QW2A 2HDLA 3CC2T 3TS0A 1IBLL 3C1FA 4DN4M 3U9SA 2J6OA 2X51A 1SROA 2XDDA 1VQ9Q 3CC7A 2QA4Q 2R6GA 2LXJA 1MV0B 1I50B 4BA1I 1VQ4T 2AIRB 1XYIA 4BD3A 1VYTA 2ECZA 1CUKA 1KL9A 3TP6A 1CHQD 1SXTA 3D4RA 4C2MB 2DIQA 3QWXX 1SNMA 1A3TA 1Y8PB 3I5RA 3UA7A 2JA5G 3K80C 3HOYB 1UGRB 1X56A 1IKLA 3RKXA 5C0XG 4A3IB 3AU7A 4R4TA 2MWOA 3QZ9B 3S2HH 5LJ3h 1JWUD 4BWGB 1K8AR 2JMAA 2QEXT 3VU3C 4RGNA 1KQSA 3AFPA 5ELBA 1W2BS 1FJGQ 3IRBA 2PMZB 1X6GA 1H9SA 4KI0A 3RZDB 3FRNA 4IUVA 4M7AB 4OIJA 3S3MA 1VQ7A 4WFN3 2JEBI 3FC3A 3OMCA 2PW5A 2DLPA 3NQIA 4RKLA 5IP9H 4FXDA 1WHJA 1VA7A 1YITT 1PRTC 4PJOC 2ID0A 4JI0L 2RQTA 4OHJA 3PE0A 3LX7A 3H41A 4N8X1 1UHCA 2RQXA 4MDWA 4M7DG 2K33A 1RAAB 1KQ2A 1K8OA 1B3AA 3URYA 4R0KA 3X25B 4IKFA 1PFNA 3FMCA 3MHBA 2UUAL 1KHIA 4RGMA 2F0GA 3M5AA 3KF8B 1QKXA 4JI8L 1FMKA 3LWUA 2F3WA 4EMGA 3WXMB 1XMQQ 2KMTA 3OBYA 2SOBA 2LQNA 4C56C 4CC2A 3I91A 2R5MA 1JOQA 2YUOA 5LJ3f 1DXMA 4R4CA 3CCLT 4B9WA 1QVFA 1R4QB 2KA7A 4WCIA 2D9TA 3C94A 4RKBA 3TCJA 1MNEA 1OZ3A 2H3EB 3M4OH 2HQEA 1I6VC 2P5ZX 3I2ZA 2M0YA 3RUXA 5CV9A 4KUIA 2H5XA 1A3UA 2EYZA 3TN2A 1NNXA 5GAOm 1T0JA 4JC0A 2C0IA 4GZYC 4O6JA 1E3PA 1XPOA 2RKSA 3J81j 4YY3Q 2RVLA 3NTHA 5TSSA 1IBKL 3I56A 2GVBA 4MDXA 3OSSC 1V1PA 1GXIE 3BZKA 3PUVA 5D14A 4M7DC 4POGA 2KSSA 2EPDA 2I5HA 3CRLC 2UUCL 3FJPA 4DV0Q 1QVGP 4Y52H 3RLOA 3F70A 1G6ZA 2FL7A 2NVQH 3NE5B 1NCVA 4FYXB 2EJFA 1PYBA 3SDZA 1YJWQ 4Y7NH 2F0UA 2IHEA 3B6YA 1STAA 4PMBA 1ENFA 4TQUS 1D5MC 4J1MA 3S2HB 4YY3L 2M9UA 4CJ2C 4PJOG 2DYBA 1ESFA 1WYDA 2BE5C 2A1AA 5CV5A 1JB7A 5GAMj 4KT0E 2K79A 1X32A 4ZUJA 3EROA 2A8VA 4M77D 4DUYL 2NTTA 3U9OA 3EFOB 2O5JC 1CI3M 3EN2A 4X64Q 2IX1A 4C5IA 3I55A 2NYSA 2YU9B 1SRMA 5I2SA 3PIP3 3HOZG 1OYXA 2KT1A 4LFBQ 1DGSA 4IIMA 1WTOA 5DM73 4RG2A 4XTUA 3JCMJ 4G7ZC 4XT1B 1XMQL 3HTRA 3OS0A 4JI8Q 4LK1C 5IE8A 4M78D 4JOIA 1FX7A 2PVOB 3C12A 5J1ZA 1HFNA 4ME3A 3ERSX 3EJIA 3LGLA 4LF7Q 2O9SA 4DR4L 4DV7Q 4ALPA 2IW3A 3STBC 2M2LA 1B8AA 2JA5B 1M9SA 1R0BG 4YWMA 5M3FG 5BN4A 3STBD 3SEMA 3AYHB 4P74A 1NEGA 2I0QA 1JT8A 1I1JA 4DNTB 4C1NK 2RQVA 4RCBA 3CC7T 4XU2A 4R1JA 5FK9C 4P73A 3ZEHA 1QOHA 1AWXA 5EBDA 3VKIA 2OEOA 2R3ZA 2QQAA 1RABB 2F5KA 1O9SA 5GANd 3CMEA 2CHBD 5C0MA 1HJDA 1N34L 1Q95G 1V8QA 5IH2A 1NMFA 5ELCA 2ZXPA 2NVXB 1JICA 2VASA 2XI9A 4OP0A 1MV3A 4K5XA 3J81c 1TXYA 1N33L 1ZSGA 3QOLA 1KABA 4J6HA 1PKSA 3D8GA 1HJPA 2FMMA 1OEBA 3M58A 1R9TH 1FNUA 4HSVA 1UEAB 4M7DB 2Z6BA 1EU3A 2H1EA 2NN6H 5K5PA 2KXCA 4C92F 2ZZDA 1PVOA 3HRSA 4IPGA 4OO1H 4JYAL 2OQKA 1VQ4Q 2N55A 2F0DA 1ASZA 4AFSC 3CCQA 1KRSA 4B3RQ 3EGDB 1D0ZA 1STHA 2VV5A 4IN3A 5KYUA 4RCNA 1R9TB 3J7AV 2FMCA 4BI3A 2QDYB 4IFDI 4D6WA 5LJ5h 3MEHA 2QEXQ 1RIPA 2AQ2B 1Z7TA 2RF0A 5C4HA 3V96A 1A15A 1VQ7T 1YHAA 4JJBA 2ZJPA 1RODA 1AZQA 5ISRA 3GTKH 4DK3C 1C0AA 4JOIC 3OYIA 4JDSA 5C4JH 4A93G 2UU9L 1Y71A 1UGVA 2QDBA 4IFDG 3U58A 3J7A5 4X1VA 1HFGA 3EFRA 1RTNA 2KBNA 4KY7A 3JAML 2Z6KA 4C0ZA 2CDTA 1Q86C 1PTOD 2BOSA 4EMKC 3THKA 3CCUQ 2Z1CA 1J6QA 4M7DF 1BQQT 4M7AG 5FO8B 2NVXH 1EEFD 4ZYSA 3H91A 1YNZA 3CC2Q 1JOKA 2KR3A 3E6ZX 2RQUA 2ED0A 1JWSD 3T51B 2B2TC 1C48A 3OTOL 2L0AA 4BBSB 5GAN2 4OVAA 4OWXB 4DR7Q 2X4JA 4KY6A 1M3BA 1VQPQ 1E1OA 3R6NA 4FF3A 1QVCA 2NZHA 2J7IA 4H44C 3EFSA 2EQUA 2LY7A 2B29A 4LWCA 4JI7L 1Y1VG 1PRTB 2E5LL 4AT1B 1YJNT 3VUBA 3M4GA 4HCZA 5GAN8 3J80E 1KSWA 5GANe 2RQWA 1HTPA 4C5HA 1MI2A 1IHVA 2RI5A 2K04A 1I4GA 3QIAA 5M3MB 5CR3A 1NM7A 2F0KA 1ENAA 4GNXA 1NZ9A 1KLUD 1VQCA 1YHQQ 4J9EA 1YJ9T 2A69D 3RUZA 3E9IA 5JEAJ 5IOCA 2A37A 3CPWA 2AWNA 3MXUA 5KNCA 4PZ7A 3JCMh 3CXCP 3OYGA 3KLWA 4BBRH 4BS9A 1CTMA 1SG5A 1JQQA 1Q46A 3FP9A 1CQVA 2BH2A 4JV5L 2VGMA 4M77A 5I2MA 5JJKA 2DXBA 4DEXA 4ME7A 3GO5A 4OX9L 4FU6A 1S5DD 3I4MB 3H6MA 2I07B 4M75G 3SD4A 1WTHA 5I22A 4J9HA 2DEUA 3MZ5A 4VUBA 2GA4B 1VF7A 4YCVA 1HNZQ 3A8HB 3E9HA 4F8MA 2QI2A 2XIWA 4LUOA 2JA8G 3W1GA 1VQJA 4FYDA 4ABNA 1B2TA 1S4ZA 2R58A 2K05A 2HQLA 2LT1A 2C35B 4BY1B 3IAYA 4M1UB 4M7DD 3GTPH 4NB3A 5GMKi 2J05A 2JOYA 3L2ZA 1QQJA 4MN3A 3PF4A 3T1HL 1SYGA 3TU4K 4PL6A 5HK3A 4RTTA 4UP8A 3DM1A 2F4IA 2JA9A 2JTEA 3L7ZC 1PV4A 2IWHA 2HBPA 2LDMA 2B2VC 2DVJA 2F2WA 2MMPA 1O7LA 3NXWA 3LNNA 1QVGS 4CC4B 2OTJQ 5ELFA 4AFZC 2YYZA 4WJWA 3RN2A 3GTJB 2NB0A 2ZM6L 3HRZC 3Q6SA 4CDDC 3J7ZC 1JJ2S 4A3KH 3CCVA 3JB9G 2PQEA 1B44D 5T1IA 4O42A 4XYQA 2EGAA 3HSBA 1SNQA 3V8JA 1N6AA 2JW4A 2K5FA 3HKSA 3CCUT 5GQOA 2UXDQ 2DF6A 3BDLA 1MHNA 2DTHA 1WHMA 3JB9I 1II3A 1L0XB 3D6WA 4ZQ3A 1LTRD 5IGFA 1QVPA 3IFTA 1O7ZA 4MZPA 4PK4A 2KECA 1TG0A 4C3IH 5GAMg 2VUMH 1PG5B 4X3SA 4A3CH 1O78A 3NFCA 2XWJB 3SHLA 2CP6A 3GNFB 1C6VX 1U4LA 3G4ST 5GAEC 4OO1I 3KBGA 2X6GA 4C0GA 1HZBA 4HKEA 3VYRA 2D0QB 4QQ6A 3PVLA 1JE5A 2KEEA 2MGSA 1QCBD 2VQFQ 4E7JA 2SDFA 1SE8A 1Z47A 2F0WA 2K50A 3RZDH 2CFMA 2DL4A 2EIFA 2K3XA 1VOMA 1U3OA 1YCYA 4R56A 3CQZB 3FKIG 5T1GA 3URGA 1YN8A 4J83A 2VQEQ 2NWGA 2RHIA 2XWBB 2XRSD 3BVMA 2QA4T 3LGJA 2M1HA 1I0CA 4FCYA 4X66L 4BBSG 3AFQA 2V26A 2FXQA 1EY4A 1L1OA 1SHGA 2RHQB 1LTBD 3OYJA 2CZ7B 4ORZA 4XU0A 2A5HA 3AQQA 4MIUA 3W1BA 4ZLTF 2CQAA 4GLMA 1U06A 3MC0B 3E2UA 4ZN3A 5A0DA 3CCMT 1BKBA 1H8KA 2OX7A 4OMNA 1J9OA 1GO3E 1KTKA 1GCQA 1Y1VB 2O2OA 4RMOA 3K81C 4C92A 3DHQA 5D3DA 1Y69U 1RAEB 5M9OA 3OHXC 1EIFA 4A93H 2LNVA 2WKDA 1H92A 1BI3A 4K0KL 2ZAEA 2KDSA 3RIRA 1AEXA 4RAUC 5C44G 1PTOH 3KDFA 4DAMA 3I4OA 3H3VI 3MP6A 2PU9B 3VS7A 4ATOA 1SE2A 2HMAA 4EMHA 4N9TA 1WCMH 4FIBA 3S16H 1X3GA 4A3MB 1W70A 1OV3A 1PRTF 5A2QE 4EQ5A 1VQ9A 4DR1Q 1K73C 1PYWD 4M75A 1HZAA 2DJFC 4J8QA 3CCJT 2VXWA 2QW7A 4LJZC 5EAYA 4DK0A 3M7NA 1G3YA 1LOJA 2AZSA 3EGDA 4KUDK 4KN4C 5C4JB 2VNUD 2P4TA 3OY9A 1QWYA 5CBAE 2JT4A 2NUPA 3OYEA 5M3FB 3E0EA 5KIXA 1MMDA 2DTOA 1Q7YC 2DRKA 4A3EG 4DOVA 1B7YB 3ERQA 5LJ3d 3UDCA 4M75E 5AJ3Q 2F4VL 3S15B 5M5XH 1NTGA 4G7OC 2HL5C 1YJ9A 3NHHA 3JB9J 1B3QA 4KV6A 5D65A 3HOYH 1IYVA 2R93B 4IFDJ 2E3HA 4MMLA 5IYBH 2ZXOA 4TVAB 2HSPA 3ULPA 4B3TL 3S15H 2EYJA 1YWOA 2QG9B 1EU4A 1I4RA 2KHIA 3K5OA 1S72Q 1V29B 1W1FA 1WXTA 4EMKA 1R77A 1WA7A 2KOLA 1WTQA 3PVQA 4E7ZA 2QDLA 2D6FA 2DMOA 2A74C 1Q81U 3TREA 5CV6A 1TS3A 4OWTB 1VQ4A 1VF5C 2QKIC 2EYFA 4V0BA 3TSSA 2JEAI 5C3EH 2KRMA 2LQWA 3NUCA 5EKLA 2BZ8A 2I0NA 4C3HB 2QK0A 3CKIB 4YCWA 2R7DA 4DR6Q 4YHHQ 2EJGC 1NYGA 1HD3A 5CKDA 1HA5A 1M3AA 2ATWA 4LD6A 3PO3B 4OMPA 1WX6A 3HOZH 4LN2A 1Y8OB 2Y4YA 1S3OA 5C3EB 4A4FA 3HL8A 4XT3B 4M77F 4J7FA 1CSKA 3LWEA 2F69A 3EG2A 3X3NA 3CCUA 1VQLT 1NBEB 1F2LA 2RA4A 2SEMA 1M1KU 2PO4A 3MXNB 4QUFA 3S14H 1U1TA 1WLPB 2L3PA 1SYBA 4BDZA 1U1SA 4RTYA 5GAMd 1M3CA 5IN1A 2N3SA 4OGCA 1RKNA 3R8BA 1WTVA 1EWCA 2JA5H 1KD1U 5JVH3 4XIGS 3M59A 4JI6L 1U5SA 3A0JA 4QJFA 4DUZL 1GBRA 3GTOH 4FYYB 4LF4L 5KGUA 1D1IA 1N5ZA 2K5WA 5LMNL 2ES2A 1EFWA 4HCKA 1DOMA 3INZA 2PYKA 4LFAL 3JCMd 4IPHA 4Z02A 4DR5Q 1K76A 2MWPA 3D4DA 2IT1A 1TS9A 2QGFB 3T56B 1GCQC 2X4WA 1AZEA 3M4PA 3VYGA 2KUMA 1VQ8Q 1XMOL 4LE9A 1PFSA 4QUCA 4QVCA 3R2IA 1VYUA 3MP8A 4RGOS 3WDNA 4BB7A 4DV3Q 4DV2L 2XKOC 2E74C 3ZJYC 1M1GA 1O7YA 2D0PA 4K2LA 2FHTA 4RGTA 4DR2Q 4J9GA 4E47A 4A3JG 4DK6C 1LTTD 2EY6A 5BN5A 3I4MG 3GTLB 4KRTA 4GNXC 1PZKD 1DCZA 3SK6A 1P16A 4DA2A 1WI7A 1QVGA 2RCFA 2LJ0A 4DNRB 5GAMh 3S1MH 1SDFA 1LACA 1WD1A 3SWNB 2RDFA 4FP5D 4TSSA 1O75A 1QZGA 3VS4A 5FU6C 3CHBD 4JI3L 3L2UA 1DJ7B 2VB3X 1ZYRC 3BVGA 5KNBA 3GTJH 4LNQA 4HJ8A 2E2JB 4RG1A 2JZ2A 3E3XA 1XXGA 2DK3A 2LMJA 1B34A 1IKMA 2MQHA 1HYOA 5GAN5 4DA4A 1I8FA 2F1LA 1KC8R 5IHIA 1STYA 3HKZG 3D3RA 4AQYQ 4A3DH 5AFWA 4EQNA 2L5TA 1B4OA 3N52A 4LF6L 1XPUA 3A98A 1BBZA 3KF8A 4HCSA 2JA6G 1U4MA 1TUGB 4JPBW 2PNRC 3HG9A 1TOVA 1M90U 3I72A 4KN7C 2AT1B 2L3SA 4JCVE 3O13A 3FB9A 4Q5WA 3A55A 3M0UA 3A7AB 5C44B 4F04B 1MD2D 2EYLA 2OTJA 3JCMX 1AW7A 1S72T 2RN8A 1YIJA 1WGSA 5IIFA 1B50A 3UA6A 4IOAA 4F14A 1W2BP 2FO0A 3UE1A 2BA1A 3ND8A 4HVVA 5HGQA 1F1BB 5JVG3 3ZBDA 3CQTA 2YV5A 2MF2A 2DTIA 5I11A 4WRDA 4GOPC 3QYHB 4J9FA 4X3TA 3KJOA 2DIGA 3HOVH 1BCMA 3T13A 2Z4HA 4HMJA 4B3MQ 5CKHA 4PLLA 3E9GA 5GAMe 3G4SQ 2BH8A 3QOJA 2DXUA 5M5YH 3HOYG 3LWIA 2WKCA 3S1NH 2NVTB 4BE1A 2QXFA 4YWLA 1P92A 1LYLA 4A3EB 2HD0A 2LTOA 3MKDA 4CJ1B 1EX4A 2E65A 5BR8Q 5LHY1 5KYXA 1EY5A 5D7UA 2JTFA 2XG8D 5IYDH 4JI6Q 1HR0L 3UPUA 1H9RA 1SNCA 2OCEA 2CSIA 1JRIA 2YUNA 4C0DC 3LWHA 3HRTA 4K6LA 1I4QA 5I2YA 4BY1H 2AZVA 5IXBA 5DM7R 3M9BA 1I5OB 3FJ5A 3M56A 3MP1A 2EQMA 3CPWP 1TWAB 2N88A 3CQZH 2PZWA 1LTLA 4JZ4A 4X65L 5LJ3j 1S1NA 5GANf 4XU3A 5GAOq 5JOBA 4A3DG 1VQKT 2E10A 2MP1A 2Z4IA 1UECA 1F9RA 4ZKCB 3REBB 3DLMA 1VQNT 2H4OA 4IO9A 4U68A 1V1CA 4OMFB 1V1QA 3GLXA 2PQAB 1BCPF 4KY5A 4UP7A 3H0HA 4DR6L 4WF2A 2HKNA 2RHZA 3I35A 2PNIA 4F7UB 3AB9A 3DWPA 4LAAA 2B2VA 1K73U 1Z9FA 1MSGA 2WINB 4EGVA 5FWCA 1I3QH 2CH4W 4JI5Q 1M90C 1G3TA 4LDYA 2EYMA 2EXZA 5NUCA 4DXFA 3QR8A 1X3EA 3OSOA 1Q1BA 1CA6A 5K36H 4EPCA 1Q86R 3S24A 4IPDA 1EOVA 3SK5A 3BYYB 2HL3A 4XDXA 3KK7A 1G91A 4C8QG 3H0IA 3SXHA 2K5IA 5C4XH 1EIHA 4X62Q 3EFXD 1SRLA 3VYHB 2JM8A 2J7ZA 1ARKA 5EPLA 2NN6I 5F2DA 1XQHA 3W2DA 1K83B 1QCNA 1UHFA
chains in the Genus database with same CATH topology
4NOYA 1E2ZA 3CMAA 3TZDA 3GIBA 1UGPB 2P0KA 3WVDB 3X3MA 5KE2A 1CHPD 1O80A 3M54A 2RJCA 2VGNA 3DB4A 4JJNK 1JWMD 1PXUA 4KBMB 1F9SA 2JYOA 1QNKA 4BACA 4R8IA 4PJOE 2F03A 4L63B 1U4RA 1EWHA 5I6YA 4ZRZA 1VQ5A 2LMCB 4OGQC 2EE1A 5CV8A 2EDGA 2RK1A 2BDOA 3G6EA 3K57A 5DY9A 3OA6A 2C06A 2K2VA 5G3LF 4QVZA 1X6OA 1UAPA 4RH6A 3MFYA 4TRDA 4C8QF 4C0DB 3JB9D 4CRIA 2KCNA 2RJFA 3QKJA 5D3IB 5LJ5e 1PDQA 2Q8IB 4K8JA 1VUBA 4K5WA 1KC8U 4UDUC 1BBXC 5COYA 3NBHA 1F77A 3C95A 1LT3D 1WQWA 4LDVA 3P8DA 1ZYRD 1SYCA 3SFMA 4KKSA 1TS2A 2R61A 1D1KA 2R5AA 1PTOC 5CKFA 1I5LA 1ZEQX 2MPMA 3VA5A 1BF4A 2XDPA 1TT2A 2XK0A 2XD0A 2NBFA 3C4SA 2WB1B 3I73A 2LC4A 4QB4A 1TH7A 4XTZA 3X28B 4KKUA 1PLFA 1BCPC 1KD1C 2OXPA 3CCVT 1NUCA 1LTID 2K01A 4XU1A 2MUYA 1W6JA 1XTDA 1C8CA 4KJOA 2NUCA 2TSSA 3OYMA 5KYLA 3LLRA 1JE4A 5M5WB 1I3QB 5HK0A 1MSHA 2QEJC 2PZUA 5GAN6 2P0QA 4F7UG 1B1ZA 3QO2A 1GUTA 1KAAA 1SMYD 3NK9A 1RL2A 1TY2A 1B9MA 4G57A 1I6HB 3OW2S 4B9XA 5C3WA 4M78A 1KDBA 2LCCA 1SBBB 1WJQA 3S1RB 2JXMB 1N8RC 1G8ZD 3P20A 5KE3A 1SNOA 4GY5A 2MJ8A 4BY6C 3QDRB 4J6XA 1A3VA 4Y7NB 2V8KA 1T5EA 2M16A 2DO3A 3N5BB 1VQ6A 2RM4A 1F2ZA 4XQJA 3JCMc 5D6YA 1EEID 1KHCA 4A53A 2B2UA 3K6OA 1Q86U 4QQGA 3I4LA 5JPNC 3I4NB 2JVVA 4C3IB 1ZXTA 1NJIC 2DN8A 1QNUA 1D5ZC 2EJ9A 4DU9A 3M9QA 3S17B 4ELYC 3PO2B 1YHQT 1HXYD 1SYFA 2A68D 2M0OA 3PNWC 3QIIA 2A73B 4IFDH 1IHZA 4DAYA 5J3BA 4JS5A 1S5CD 1TIID 4ME5A 1QP2A 3CCRA 3CCST 2F0JA 2O4XA 2K57A 1TKWB 3M53A 3L2RA 3GTGB 3R6OA 1M5Q1 5GMKe 3V7RA 3SE0A 1Q82U 2HCIA 2LQ8A 3HP9A 4FM4B 4JLGA 5GANj 1NE8A 3EQLC 2B2YC 3S9WA 5IAYA 3GD7A 4OB3B 2MI6A 2QQ9A 2WACA 4N4HA 1PZJD 4A3DB 3P8HA 5EG2A 3OYAA 1PZID 1A2TA 3BS1A 3T53B 4JRKA 1NJIU 1SSOA 4DAPA 3QZ5B 4M78C 2Q8TA 4KMUC 3HRUA 4UAIA 1PSEA 3OYLA 1VQ8A 3GTMB 4JK1C 3K7AB 4ZUIA 2PCFB 2P0PA 5CR2A 2DZCA 3CRKC 3GTKB 1SSFA 1I4PA 1S5BD 2E2DC 3ONAB 2RA2A 2VC8A 2KJXA 1K9MC 3PIO3 4N9PA 4K6DA 3UWNA 3RMQA 2EY2A 1VQOT 1C4QA 4C3HG 1LV9A 1VMCA 1NAPA 5L8RE 3CPFA 1EL0A 1PFBA 1ET6A 1CFMA 5J39A 4Y28E 2B2WA 2K5QA 3VYTA 5FLXE 3A8OB 2AWOA 3V8KA 2KY9A 3N6RA 4M8AA 4C3JG 2BDNA 3OIQA 2WAQB 4M78G 4IALA 3ITPA 1HUMA 1KQ1A 4V2SA 3NP8A 1UUPA 3TZUA 1SFOB 4XQNA 1DYQA 3L2VA 3SK4A 2QCPX 3KUPA 4LDXA 5EPJA 4C3IG 1PFMA 2RB6A 2X69A 3H94A 3M57A 4X9CA 3KUFA 3MEUA 4HTHA 4OGEA 4XQQA 2BA0A 1FYCA 3FLGA 4A4HA 2E6ZA 4H13C 3FEWX 1AFPA 3VYSA 1EQVA 3PUYA 4QMGA 1YI2A 3CC4A 5I2XA 2EY5A 2JTMA 2X6LA 1AHJB 1LNXA 2QQRA 2AUJD 4A93B 3S1QB 2R7ZB 2ZGWA 2NN6G 4E7HA 2KK4A 3X20B 2HNIA 1X3QA 2QTXA 3CPWS 2G9HD 4XXEA 2BKDN 1M1KC 2EYHA 1V1OA 3FDTA 4FVMA 2JA7B 1Y07A 3S14B 4FNFA 1WNLA 4IUUA 4HMIA 2K7VA 1VCIA 3GV6A 4NS5A 1VQPA 2DXCA 1BYMA 1KDCA 3P7JA 1G5VA 4M7AD 5GMKj 2CYZB 3OYDA 1W6KA 5GAOp 3P1HA 2SEBD 4J7IA 4ILWA 2Y90A 3MXPA 3OS1A 1EFID 4M7DA 4DFAA 1KLGD 3KLRA 2L1BA 1BCPB 3PGGA 1OZ2A 4IUTA 2LQKA 3PT9A 3SVMA 5IODA 3V7SA 1NR4A 4EQPA 1VIEA 1K8AU 4FF4A 1U4PA 4XYOA 2D5DA 1H9SB 5A2QL 4M78E 2CZ1B 5FU7B 4EQOA 3M55A 3A8GB 1VQ8T 4DK1A 2GF7A 4ZN1A 3DUZA 3FDRA 2AHJB 4C8QD 3JB9F 2RH2A 3AHUA 3UI2A 3EA6A 2EYQA 2BE5D 5D6WA 2WP8J 2L11A 1HA6A 2NYZD 1DJRD 2KVQG 2WV6D 2HDMA 3RLFA 2K28A 5CKEA 3OYKA 5GANh 2F0TA 1STEA 4K14A 4N0AC 3CBMA 5LL6X 2RHUA 1X01A 4BI8B 4LD9K 2ZPGB 1FR3A 2XRQD 2M9VA 1M1FA 5GAOn 3T4AC 3HOVB 2EAYA 3QXEB 1WQ7A 1WVLA 1AZPA 2JSOA 4JUVA 3CMET 2EOTA 1CQFA 2BUDA 3NSWA 4UC4A 5FO9B 1SJED 5GAN4 1N9SA 4XK8E 4C92E 2RSOA 3OSVA 3G71T 4NL3A 4A3FB 4M77B 3TP7A 4N4IA 2J4XA 2LX9A 3OYFA 2CGHA 4J5YA 1E2VA 2C5CA 2DY7A 4KD4A 3ER0A 4MMKA 1SNDA 2ICEC 4CKBA 1EYCA 4C92D 1AP0A 3WVEB 5GAOl 1SYEA 3JSCA 2X4XA 1WJSA 1ZQ1A 3S6WA 1S5FD 1GXDC 1DOKA 2IPKD 3OOCA 3JRZA 4HSPA 1WTWA 2OAUA 4IUNA 4J6YA 1OI1A 2O4XB 3GPLA 3CBOA 2JNGA 1LABA 2XVSA 3HOXB 2B63B 3VJPA 4M7AF 3HPWA 1S5ED 3WOEA 1JCKB 3M4OB 2WIIB 3H09A 3AMUA 3LH0A 4L6TB 2B39A 4FT2A 1TY0A 5CQYA 5LL6S 4XTCS 2RHYA 3G6JB 1YJNA 3L9AX 2A68C 2G9DA 1VQPT 3VR6A 3CD6A 1XNIA 1FGBD 2E12A 3QYGB 4V190 4M75B 1EY7A 2DD5A 3CXCA 3MFGA 3R2TA 5EKKA 1JB3A 2JA8B 1VQMT 2H3JA 4M75C 2LS01 1D2BA 1QB5D 1BUVT 4P5NA 2XNAC 1Q90A 1TR5A 4HN7A 1FNWA 2E64A 5A35A 4DAVA 5E4XA 3PIOA 3V05A 2FFKB 2HQXA 3BFMA 4RWSC 3DLLA 5GAOr 3M7GA 3M3YB 1H641 1KDAA 2B2TA 5J22A 2KQWA 2HUGA 5C4JB 4F87A 5C0XJ 1AN8A 1I4XA 2NVYB 4KHZA 3C3LA 5K36G 3WOFA 1NPRA 5I21A 4C92B 3JAME 3A8MB 1QJOA 4M77E 3A8JE 2HAXA 4PMWA 2DEQA 3BYTB 1TWHB 2XHCA 1QG7A 3PUWA 4RKUE 4C1NI 4LDWA 2BIVA 2LVMA 1Y96B 2D62A 2FJ2A 5G3LD 2PPBC 3VA7A 2EZVA 2RBMA 2RJEA 1LT4D 1W2BA 5JEAG 2EVBA 4MZTA 5FU6B 1LO5D 2X4YA 4I7ZC 3T9NA 1I4HA 4CKEA 4PJOF 4M77C 3T16A 4F7XA 3TP8A 2D9UA 5GMKl 3TBIB 1ET9A 1ILQA 3CBPA 4QQDA 1PMRA 3MTSA 3D31A 2ICIA 4JRIA 4CKCA 2XIDA 4ZTFA 1IW7C 2A3LA 3VR5A 3Q24A 3RMHA 1IW7D 4E7KA 5GANg 4IZ8A 1RHPA 4CI0C 1CK1A 2F5TX 1YNJC 1GJXA 4U673 1BO0A 3QG1A 1SNPA 2GCXA 1JORA 4A54A 4ZGJB 1YJWT 1SJHD 4CHTB 5IGGA 3L2QA 3CCMA 2QQSA 1HCZA 4KD3A 3DWQA 3OBWA 5CYUA 3O8VA 3V7CA 1RJTA 4FF2A 1YIJT 3ASKA 1DONA 5HY6A 2QILA 4OB1B 2A6ED 3A7LA 1HXDA 1ENCA 3HS0C 4ZGEB 4DQ2A 3CCEA 3OQ5A 1EQTA 3OYYA 1GUGA 1PTOB 5A0GA 4EVOA 3CEYA 3KBXA 3GV3A 3A54A 3M85A 4OIKA 2RI3A 2PW7A 4RCCA 2K3YA 4WORA 3QSUA 1R8OB 5CGKA 1DM0B 5CVIA 2VB2X 4CBVA 4PKCC 5C4ZA 5J26A 2I2LA 2ZT9C 3GF5A 3I70A 2IL8A 2E1HA 4PQXA 2IJ0A 1QP3A 5FLXL 3G71A 1N9RA 1R4PB 2GFAA 4K2KA 1VDZA 5C4XB 5CAIA 2PUKB 5GAN3 3P8BB 3GOXA 4X9DA 3MVVA 3RKWA 2SNSA 4C92G 2EKOA 1LTGD 3HOUB 1QW1A 1RCVD 4K5VA 4EMKB 3NTKA 1KQSS 2F0FA 2DNEA 5KYIA 2L3RA 2OF1A 2VXFA 1LJOA 5FRNA 3PV0A 2B8AA 3K0YA 5CV7A 3DB3A 1Y8NB 2FYKA 2VUBA 3META 1F9QA 4OF1A 1ILPA 2QEXA 4DF7A 3PMFA 1U8RA 3G4SA 1A2UA 2V8IA 5FKAC 5FO7B 3MXNA 4LMQD 1VQNA 1LT5D 1D6EC 1YNNC 3H3VC 3BG3A 1SMYC 5C0XI 4F88A 1G2TA 1YNND 4RFBA 3J80L 5KEEA 2DVEA 3V2TA 5CQXA 2EJGA 5CBEE 4CGYB 4BY7B 3OS5A 4R55A 2K5DA 3GTQB 4L59A 4QIWB 1RI0A 3K5NA 1G291 3FRPB 5IT9L 4RG8A 5CCAA 4NW2A 4KK7A 3IKJA 1BR9A 2XSCA 2JA6B 4QVDA 3I90A 2RD1A 5IGDA 3K5MA 4PV1C 4DGZA 3MEAA 2RI2A 2F0MA 4G4KA 1IYUA 2L89A 1F9PA 3HOZB 2PQWA 3D6CA 3IL8A 5EPKA 1U9RA 1BXTA 1M4VA 3H8ZA 2YRVA 4FO2A 2WSCE 5LJ5g 3I55T 1HTLD 3G7ZA 3SWNA 5DLOA 4M7AA 3BDUA 3TP5A 5EJWA 4KTAA 4G7HC 3QHSA 1ML0D 2IX0A 4MZMA 3JCMW 2GQVA 5EQ0A 1VQKA 4RHSA 1Q7YU 3JCMV 4C5EA 3VR4A 2C9OA 3A8LB 3C1EA 3CXCS 3S1MB 3MXGA 1YNJD 1OXSC 1KG1A 2RHXA 4A4EA 2BCOA 3K58A 3L1AA 3PTAA 3EAEA 5CV4A 5ELDA 1XWEA 2YLCA 4N0AA 3SK8A 2Y0SB 1HRJA 2A7YA 4FT4A 3PFSA 5LJ3g 3OYHA 2JP1A 3OMGA 5D6XA 3QJ6A 1TWGB 5KNDA 1B53A 3A8KE 4C8QB 4C3JB 4BA2I 5JAVA 5DLQE 1H3ZA 1I81A 2XU8A 4HA8A 3RKYA 2AQ3B 2K32A 1FXXA 2OTLT 3VR3A 1X3PA 3X24B 1H9JA 1N8RU 1RF2D 1KNAA 1BOSA 3GQBA 2F0EA 2A69C 4FXKC 5GAN7 3VYUA 2MHVA 3I8ZA 3C46A 2FVUA 3OWEB 1YBYA 1Y96A 4X34A 4H0LC 4A4KA 1BDOA 2KVMA 4S3SA 3E1SA 2LT4A 1MGQA 2AUKA 1FWZA 4M7AC 1G3SA 2F0LA 2CVRA 2VYTA 1D3BA 5A0LA 1VQ9T 2OT2A 3DEPA 3GP7A 3QUIA 3S3OA 5I9PA 1JB0E 1I4K1 2FB7A 3GP8A 3C2PA 1BCPD 4NMZA 4DXGA 1UGSB 4BDYA 3ME9A 3OB9A 2NTSA 3FKIB 3E9FA 2K03A 3TEEA 1JOOA 2NVQB 1RD9D 1XX8A 5FU7C 4C8QC 1EOTA 4I65A 4M7DE 1SAPA 1JQYD 1X75C 2F0NA 2EY1A 1DZ1A 5JPMC 3FEOA 1VQLA 3CCLA 1TS5A 4X3KA 5C5LA 3R3OA 3OW2A 3MO8A 1BI0A 1WJRA 2E41A 4JS4A 1HQRD 3M4YA 1ZBXA 3TMEA 5C6AA 4DOWA 4K8IA 1EYAA 2O5IC 1MBYA 2JUFA 1Q82C 5GAMf 3RERA 1G2SA 2F0IA 1OXTA 1SE3A 4EDUA 1W4SA 4R8NA 1QE6A 1H9KA 5HURA 3RZOB 3Q1JA 1T5XD 3H0GB 3OPOA 5BN3A 2EQKA 4MHEA 3MCAB 1VQOA 1JJ2A 2J0TD 4H7BA 4NL2A 1BI2A 1VIFA 3FVQA 3NPPA 4ODGA 1LT6D 2EJMA 4O5VA 3E5SA 4A3GB 4IUQA 1IKMA 4LDUA 1VQ5T 4BUGA 1K9MU 3OW7A 2CW0D 4JLIA 4PLIA 5FOBB 2ZPHB 2CZ6B 3OYCA 1BI1A 2CW0C 4XQ3A 2L12A 1E2WA 4IQZA 2XICA 4IUPA 4L6V5 3E19A 3S1NB 4YIJA 1Q12A 2D2CC 2L5QA 3JCMP 3SR1A 2K1BA 5KH6A 2RO0A 2FHDA 5FROA 1LTSD 4ID6A 3JB9H 3PUXA 4TVRA 1CZGA 2B8GA 2RSNA 2DAQA 5ELEA 1OXXK 3F2UA 3QBYA 1YITA 1GOZA 1TVXA 4HR7B 4IURA 3J7YW 3DKMA 3BY7A 1EY9A 4HT8A 1NPPA 3BVZA 1NR2A 4QCLA 2ZPEB 3HGBA 3K5LA 4OO1G 1GUNA 3GTOB 1ONLA 2QA4A 2ENBA 4M75D 2F0HA 4HEDA 1Y1WB 4E7IA 3A8IE 2ZXRA 4F7UF 3IFDA 2CKKA 3S2DB 4A4GA 4P2CB 2F0QA 3P75A 3JCMf 3SEBA 4NDXA 1Q3LA 3HEJA 1V43A 2F0OA 1HHVA 1KC8C 3D4WA 4M78B 5EGTA 1S72A 3Q0AA 1L0YB 3JCMg 5CMDA 2RJDA 4XTVA 1K8MA 1STNA 2ZPIB 4Q0FA 3CC4T 4RA8A 1CA5A 3TDQA 2JN0A 3MHXA 2ZCFB 4BBRB 5LJ5d 3PMTA 4PJOA 4A3BB 5C6SA 3KXTA 2DJZA 3DWAA 3OIPA 2K4YA 5IGCA 1GHKA 1FD7D 5CKBA 3MA2B 4ZKBB 3MAQA 2MAMA 3HOWB 2K6AA 4L5GA 5CORA 3G7LA 1GUOA 4M78F 3VUZA 4HCEA 3HZXA 2TMPA 5LJ3e 4PNOA 4KKTA 1EY0A 1M4ZA 1MGSA 5IT9E 5LJ5f 4O1NA 2JE6I 3A56A 5IGEA 5CC4A 4KULA 2M00A 5GMKm 1STBA 2F1MA 1BNZA 2EQJA 3R93A 5EKIA 2LKVA 3LGFA 1Q8IA 3OWFA 4KJNA 2X35A 1EZ6A 3QB3A 4C0FA 1SEBD 4PJOD 3OYBA 1JBMA 2O01E 1JR0D 5DM63 3OS2A 3NTIA 4AYBB 2F3VA 3J81E 3L2WA 5CIUA 5I6WA 4OL7A 1WTRA 3DMUA 1KNEA 1HK9A 2EYPA 1LLRD 3DEOA 1WCMB 4RHRA 3I56T 4OB0B 3RESA 5KCOA 1QILA 5AYFA 4BY6B 3JCMb 5M5YB 3MEVA 3PMIA 3QO3A 3UT1A 4XTXA 4A3JB 2VXEA 1J8IA 1GUSA 1ZKOA 3BZDB 1EZ8A 2KAFA 2DZ9A 3W3AA 4PNYA 3S16B 2LFNA 3CCQT 3SWNC 1VQMA 1N27A 2ZPFB 3BDOA 4FSXA 1TWFB 1Y7XA 1EIGA 1ZHIA 1M8AA 3QJYA 4A3KB 3ZYYX 1A6XA 2RK2A 2IX3A 4B08A 2CZ0B 1HQMC 5LJ5j 1EY6A 1JC7A 3HKZB 1BIBA 3LYIA 1STGA 2L55A 4ZTJA 3NWTA 2IG0A 1OO9B 3JCMe 3QPHA 2B2YA 3DXJC 2A6HD 3L42A 2G3RA 5CK9A 3FPUB 1M8VA 4TKOB 3CCET 2FINB 1CZWA 2A6HC 2E2HB 5HGTA 2QQBA 4C92C 4FXGC 2DPPB 4BI4A 3J7AF 3HFNA 2E2IB 5I4DA 2YLBA 1F2MA 4N4GA 4XTWA 4CJ0B 1XOVA 4GLKA 3KLSA 1SYDA 4JBWA 2DKGA 1HUNA 2KCCA 4KHVA 4NP5A 4Q5VA 2DY8A 1XTCD 2I46A 3LW5E 1RTOA 2IVWA 2B8FA 2RDGA 1V1PB 2Z8LA 4OB2B 2K5LA 3NQTA 2KHSA 5HKCA 3GNGA 2E76C 1IL8A 3J81L 2F0VA 2YHTA 1F2YA 2EWNA 2L0CA 3CC2A 1DOLA 2V8JA 3BW1A 2OTJT 3CCJA 2EYOA 5I9OA 4HCCA 2WSEE 1WPYA 5C5MA 3GTPB 1D3BB 1WD0A 3ND9A 4ZK9B 1DD2A 5C0XH 1PRTD 4RCOA 4FF1A 3FPPA 1YJWA 2VUMB 3JCMQ 3OYNA 2L8DA 3H6ZA 2KQ3A 3VV0A 3HHTB 2QF7A 2DD4A 2L9HA 4L8JA 3I3CA 4HT9A 4PMCA 2R92B 5E4WC 2L4NA 1PSFA 5KCHA 1CT1D 1PTOF 3KLSX 2XDBA 3SB2A 4C5GA 3NWSA 1H9MA 3PUZA 1ESRA 1IREB 1BIAA 4Z9CB 1OXUA 1EYDA 4F7UE 4M77G 4YTLA 4XTYA 1LTAD 2F0SA 3VR2A 2OTLA 1Q81C 2EJFC 3NBIA 1WTPA 5DAUA 1GUWA 3CU7A 2PUOB 5IGBA 1QVFS 4ZGDB 2NZ1D 3LX0A 2E5QA 5JJZA 3RD4A 4HAEA 5EBCA 3CMAT 2ZPBB 1GHJA 1RDPD 3Q23A 1UEBA 4X3UA 3EVQA 5E1FA 5DEHA 1B9NA 4ELZC 2DXTA 4M7AE 1E0BA 4E6IA 1G3WA 1TQOA 2R57A 2B2UC 2Q8RE 2KEDA 3CD6T 1WTXA 3Q22A 4PJOB 1IZ6A 2EFIA 5E3FA 3PIPA 2PVDB 3HFOA 1VMPA 3V8LA 3CCRT 3CCSA 2LRQA 1YI2T 1UGQB 3MWYW 2E6NA 2V4DA 5DNFA 3M7NA 2EPBA 3E0JA 3X26B 5KRUA 4JRPA 2E70A 3BDCA 3G6ET 4C8QE 1OXVA 3MEWA 1B34B 2O2LD 1ICWA 3FIFA 2B2WC 4XAXB 1UB4A 4F7UA 4BE2A 2PZTA 2PVGB 1NSNS 3A5ZB 2AQ1B 1SE4A 5FRMA 1K8AC 2Y4XA 1Q1EA 4BE0A 1CM9A 4C8QA 2RDHA 1D5XC 4E7LA 4NKLA 1TWCB 4M75F 4Y91A 1VQ6T 2E75C 4JRQA 5M5XB 2LCLA 1TU2B 2A6EC 5JEAH 4J6WA 4ZAIA 4FL6A 1TS4A 1EY8A 2WSFE 4II1A 2HCCA 5C3XA 5GMKh 4QF4A 2NLUA 2SNMA 5CO7A 3HP3A 1HPCA 3ZFJA 3RMSA 2GFUA 2DNCA 2F0PA 1UNSA 3L3OC 4R9WA 2XN9C 2CS7A 3K59A 1FNVA 1YHQA 3QWNA 4ULLA 4HCBA 4J8OA 3S3NA 4QW2A 2HDLA 3CC2T 3C1FA 4DN4M 3U9SA 2XDDA 3CC7A 2R6GA 4BA1I 1XYIA 1I50B 1VQ4T 4BD3A 4C2MB 3TP6A 1CHQD 1SXTA 3D4RA 2DIQA 1SNMA 1A3TA 1Y8PB 3HOYB 1UGRB 1IKLA 3RKXA 5C0XG 4A3IB 3AU7A 2MWOA 3QZ9B 5LJ3h 1JWUD 4BWGB 2QEXT 3VU3C 4RGNA 1KQSA 5ELBA 1W2BS 2PMZB 1H9SA 4KI0A 3RZDB 3FRNA 4IUVA 4M7AB 4OIJA 3S3MA 1VQ7A 4WFN3 2JEBI 3FC3A 3OMCA 2PW5A 4RKLA 3NQIA 4FXDA 2ID0A 1YITT