3NTIA

Crystal structure of tudor and aubergine [r15(me2s)] complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
163
Chain Sequence
ELHNCVVVQFDGPMSFYVQMESDVPALEQMTDKLLDAEQDLPAFSDLKEGALCVAQFPEDEVFYRAQIRKVLDDGKCEVHFIDFGNNAVTQQFRQLPEELAKPARYSRHCELDASTISAALLQSFIDTRFSETFQVEILATKGTGTHVVRLFYQSKNISEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for methylarginine-dependent recognition of Aubergine by Tudor
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords Maternal protein tudor
total genus 36
structure length 163
sequence length 166
ec nomenclature
pdb deposition date 2010-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ntiA02
2.40.50.790 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ntiA01
1OYXA 4IUVA 2EKOA 3OYLA 2MWOA 3MP6A 5FRMA 2E5QA 3EAEA 3NTHA 3L42A 3PNWC 3DB4A 2LDMA 2RJEA 2K3YA 2EQJA 2CKKA 4N4IA 2RHXA 2EQMA 4C5GA 5CIUA 2VYTA 4L59A 4B9WA 3MEAA 5J26A 3OYBA 4N4HA 2LTOA 2YRVA 3UT1A 4E7KA 4PLIA 2L89A 3OYEA 3LLRA 2K3XA 1WGSA 3C4SA 4IUTA 5IN1A 3OYNA 3OYGA 2EQUA 4B9XA 4EDUA 4RG2A 2F5KA 3FEOA 4IUPA 4II1A 4N4GA 5FROA 1WJSA 4IURA 2JTFA 3DB3A 5M9OA 3OMGA 3F70A 2R5AA 3PMIA 1H3ZA 1RI0A 3MO8A 2G3RA 4IKFA 1MHNA 5D6YA 3OYCA 2XDPA 3FC3A 3M9QA 3OS1A 1N27A 3E9FA 3P8DA 2RHYA 3L2VA 2RI2A 3L2QA 4BDZA 3FLGA 2BKDN 4BE2A 3PFSA 3OYJA 2GFUA 5KCHA 3OS2A 2M1HA 3L2RA 3MEWA 2B8AA 1KHCA 2E6NA 2GFAA 5J39A 2RJDA 3BDLA 3OYHA 1SSFA 4ZTFA 3OB9A 4X34A 1OZ3A 3QJ6A 4QQDA 4PL6A 4QW2A 2RO0A 3OMCA 4BE0A 2X4XA 4Z02A 2X4YA 2LCCA 4E7HA 4QVZA 2R5MA 2LRQA 2WACA 3OQ5A 4BE1A 2XK0A 4A4FA 1G5VA 3OYAA 2HQEA 2DIGA 2IG0A 1OI1A 3OS0A 3P8HA 4E7LA 3UWNA 3ME9A 2HQXA 1WJQA 3Q1JA 3LYIA 2RHZA 2PQWA 2M16A 2BIVA 3DLMA 3OA6A 4IUUA 2BUDA 3META 3SD4A 3E9GA 4ZTJA 3LGFA 2QQSA 4BD3A 3OY9A 2DIQA 4C5HA 3KUFA 2MWPA 5KH6A 3MP1A 3LGLA 2QQRA 2X35A 3OYDA 4BDYA 3PMTA 3NTIA 4IUQA 2NLUA 4PLLA 3OYKA 5FRNA 3H6ZA 4OVAA 2L3RA 2RHIA 4QQ6A 2P0KA 5C0MA 3MEUA 4CRIA 2DAQA 4Q5WA 4BACA 3OYFA 3FDRA 2EQKA 4FL6A 4E7JA 3O8VA 4C5IA 2LVMA 3QBYA 5KE3A 2L8DA 3QKJA 4LD6A 3GOXA 4A4GA 3S3MA 3OYIA 3L2WA 3LH0A 2RJFA 2O4XB 3S6WA 2RHUA 5C6SA 3H8ZA 2EFIA 3S3OA 4A4EA 2R58A 2RJCA 4C5EA 5D6WA 2M0OA 1OZ2A 2R57A 2X4WA 3MP8A 4E7IA 2RI3A 3NTKA 2FHDA 3OYMA 3S3NA 4GY5A 3MEVA 3L2UA 1WJRA 1XNIA 4HCZA 3ZEHA 2GF7A 2RI5A 3ASKA 2D9TA 3LX7A 5KCOA 5D6XA 3QIIA 4FU6A 3CEYA 4QQGA 5IAYA 5KE2A 2O4XA 2JZ2A 4NS5A 4UC4A 4A4HA
chains in the Genus database with same CATH superfamily
4OMMA 4HVWA 1KQSP 4HMJA 3GTMH 4C92F 2JEAI 4RFBA 2H4OA 3I7FA 3CCRA 2SNMA 1Z9ZA 2X4JA 3QO3A 5DAUA 4CHTB 3CCRT 3I8ZA 3CCVT 4BB7A 3GP7A 1UE1A 1N9RA 2R7ZH 2JA8B 3CCEQ 5I21A 5EC7A 3VA7A 2CZ1B 4HIDA 4DF7A 1BK2A 3CCMT 2KNBB 2EQIA 2EQSA 3M9BA 3NEMA 5DLOA 3MEAA 2R93H 3OYBA 2PZWA 2L5TA 2ES2A 3M7GA 3GIBA 4V2SA 1CI3M 4K5WA 3JB9H 1C7YA 2GGRA 1WFWA 2UUAL 2DA9A 2CP0A 4J7FA 2DYIA 3KLWA 2N88A 4OB1B 4XYQA 5JEAG 2LC4A 5IP9G 4IUPA 1ZYRC 3VYGA 3R93A 4DV4Q 3CCSQ 2VB3X 4J7IA 1N8RU 1H3ZA 1GUGA 2R5AA 2E6ZA 4IO9A 1R9TB 2FYKA 1QB5D 2QEXQ 2DXTA 5HK0A 3A7AB 1AEXA 2IHEA 4CDEC 2ZJQA 2PPBC 4A93B 2KSSA 1H9SB 3DM3A 4K6DA 4BDZA 4NP5A 1E24A 1PTOB 4JRIA 1OX9A 3OBWA 1G2TA 4M78G 4IFDH 5EPLA 1WX6A 4RUGA 4A3MB 3VS4A 2RJDA 1Q81C 2B2YA 1TTHB 1SYFA 2LQNA 1C48A 4X34A 2NB0A 2QGGA 1U8RA 4PL6A 2UU9Q 1HA6A 4OMPA 3OMCA 4UPAA 4M77G 5KYIA 5GAMg 1FNVA 1EEID 4LF4Q 4H44C 5HGQA 4IJHA 3GTKB 4B3RL 5IGGA 1PFMA 2ZZDA 1UJYA 3GV3A 1E6HA 2OAWA 1PRTB 3RKXA 4XK8E 1WJQA 2RB6A 1I4PA 5EQ0A 1PHJA 5LL6X 3BZKA 2ZT9C 4K8JA 2LKVA 2B39A 3I72A 1TS5A 4N9TA 4DBFA 3A8KE 5JOBA 4KHPL 4NPSA 2WSFE 1V8QA 2H8HA 2RK2A 1KQ2A 3HFNA 2Z6BA 3FMCA 4G4KA 4L6TB 1X2KA 3VU3C 2D5DA 1Q7YU 1JWUD 2BCOA 4QB4A 2DN8A 3K5MA 2HHHL 3D4DA 4C3HH 1W6JA 1RJTA 1TT2A 1V9PA 2VQFL 2B63G 3X20B 3ZFJA 1DCZA 4JG2A 1RAAB 3ERQA 4ATOA 4Q5WA 1YEZA 2QF7A 4RHSA 1SBBB 2F1LA 4E7JA 4M7AE 1PZJD 3UE1A 4ZLTF 5IP9H 2VW9A 4HIOA 3QKJA 1JJ2P 3MA2B 2M02A 4JI5L 3LH0A 4L5RC 5D3IB 5C6SA 4LUDA 5GAMj 4XYOA 2EYOA 3DEOA 4EQ5A 2HZYA 4M75A 1EZ6A 3A8MB 2BH8A 4GN4B 1EY4A 5T1IA 1I6VC 1OEBA 5G3LD 2W10A 2ZPBB 1EY7A 1PFBA 3VYHB 3HOWH 2FHDA 1FXXA 4XAXB 1CHPD 2A0FB 4GY5A 2K32A 3NP8A 3MXNA 4DNRB 4LF9L 4JI2Q 3VS6A 2IX3A 4F7UG 2AHOB 1ZA1B 1VQ7A 4C3JH 1A3TA 1PH5A 3CBPA 2K75A 2Z0SA 3HRSA 1N33Q 4EMGA 3EFRA 4ME7A 5BR8L 3A8GB 1GVPA 2JXBA 4LDYA 4XXEA 3RMQA 3EAEA 3MC0B 4NL2A 5IIFA 1JJ2S 2AQ2B 3M53A 2AUJD 1OOTA 1EFNA 1CZGA 2AKLA 4UHVA 4ULLA 2RHXA 4ZCKA 4PFOA 3A0JA 4Q5VA 2QW7A 2RQVA 3SE0A 4NKLA 1SMXA 2CDTA 2D9UA 5JVG3 1NG2A 3AEVA 2E2JB 4B3SL 3LGJA 3INZA 1Y1WB 4M7DB 1K8AU 3OS5A 1LTSD 2DTHA 1GXIE 4A93G 2KEDA 2N49A 3M3YH 1RLQC 4ORZA 3HOVG 3OMGA 3NENA 2B2VA 2GA4B 2XDPA 2OAUA 3A8IE 2OTLQ 1WCMG 3MXUA 1GM5A 2CQOA 2RA4A 4DNTB 2YT6A 1E2ZA 3FLGA 4MHEA 3BDOA 3HRTA 3U58A 1QKWA 3L2RA 3S16H 3CC2A 3CC2T 4QIWE 1SKUB 2MNAA 4LD9K 2F0KA 1QNKA 1RL2A 2O9SA 1VQMA 3K6OA 5CV6A 5TSSA 2E74C 3SR1A 3K57A 4KBMB 3A8OB 5HURA 2F0JA 1HFNA 4QT7A 3SK5A 4DEXA 1I81A 5GQOA 2RO0A 1FJGL 3OSSC 4FYXB 2EAYA 2K01A 2KA7A 2F0IA 4J9IA 2K04A 2PCFB 3DKMA 3QXEB 1NR4A 2VXEA 1G5VA 5FLXc 4YY3Q 2CP7A 4LE9A 1B7TA 2ZPEB 2A74C 2CWAA 3C2PA 4CDCC 2YUQA 2FEIA 3MXGA 4X64L 2YRCA 2LT1A 5GAOl 1YITT 4L5SA 5DNFA 2RQRA 2KRSA 4RWSC 3NWSA 4BBSH 3VYUA 1M4ZA 5LJ3j 2KCCA 2YUOA 3S1RB 1PHTA 3META 4N8X1 2RH2A 3BW1A 1HNXQ 2R92H 1AH9A 3M85A 2FMCA 2MI6A 2YDLA 2IIMA 4IUNA 4JI7Q 5EKIA 1GCPA 2V8JA 4C5HA 1QZGA 1BR9A 4BDYA 4PLLA 1SEMA 1V1PB 1GL5A 2A6HD 2KCTA 1QNUA 4L5GA 1WTPA 1ABOA 2WKDA 5D3DA 2K5QA 2YLBA 2F4VL 3KLRA 3PUVA 4FIBA 4IFDJ 1GFCA 5A0DA 3SEBA 3FDRA 4GNXB 4MIUA 1QWYA 4LD6A 1Q90A 3RLFA 2XGTA 2Q2UA 5HCKA 1E0BA 1D8LA 1GUTA 3LWEA 1LTID 4O1NA 1G2SA 2GTOA 4BY7B 1ARKA 1JORA 4OB3B 1TOVA 1KNAA 3K7UC 5I2YA 1B53A 1SR3A 1TS9A 4A54A 3ONAB 4J83A 4DKAC 1PRTD 2RBMA 3RN2A 4PJOF 1YWPA 4YWKA 1A3VA 4K0KL 4JS4A 1K73R 3I4MB 3T51B 1B8AA 4PJOG 1ICFB 3S24A 5LMNL 3CQZB 3S17B 5D6XA 4HXJA 4OMNA 4GNXA 5GAOr 5ISRA 1TXYA 4AMCA 1U5KA 1V29B 4RG1A 2VS1A 4DFAA 1QP2A 4M8AA 4WTOB 4JI0Q 4FSSA 1F1BB 1D1BA 1EX4A 1RADB 2E5QA 2QDYB 1YJWT 1M8VA 3QR8A 4MN3A 5H1SE 4RAUC 1PRLC 5LMNW 3HOYG 1AE2A 4L5QA 4QQBX 2RPNA 3EQLC 3OW2P 2JT4A 3GTOB 4FF1A 1PVOA 2HBPA 2EDGA 4PMWA 1WHJA 3NQTA 5K5PA 1BYMA 4R9WA 1JXOA 2MCNA 2VYTA 5GMKe 5LMNQ 4GS3A 1YWOA 4B3MQ 4M75B 5T1GA 5IGDA 4K5XA 1TWGB 3C3LA 4LF9Q 2L89A 5CCAA 1OO9B 4C3IB 1TWCB 3LWUA 3GTGB 3I35A 1BCMA 3D4WA 2E65A 5C0XI 4DOWA 1KRTA 3U4ZA 3T56B 1BCPF 1N33L 1ESFA 4RTZA 4BA2I 1T5EA 1NR2A 1KLGD 2QQBA 1XWEA 2L11A 2Q2TA 2F2XA 1QVFP 1NJIR 4EMKB 1X6GA 3U4VA 4A3GG 5JJKA 2DZ9A 3CRLC 1YHQT 1GRIA 5FLXE 1QCFA 1HD3A 2YRDA 1VQLQ 1U4PA 2LY7A 1A6XA 2J0TD 3M4QA 3OYJA 4FP5D 1NBWA 1XNRL 1BVSA 4Y92A 1STBA 4X6AH 1NYFA 1IHVA 1KHCA 2F1MA 4POFA 1FMWA 2GFAA 3W1GA 1WTXA 1H9KA 3TS2A 3I91A 4CDDC 1PH6A 1I0CA 2VY3A 4C8QC 2DBMA 1UE6A 2K4KA 4AYBG 3PQIA 4G7OC 4E7HA 1EWCA 1OTCA 2A3LA 3I4NH 3KXTA 4DUYL 2EY1A 3ZL7C 2ATWA 2GBQA 3JB9I 1WHGA 2DZCA 5LJ3h 4E7LA 2LSSA 4JI8L 3A8JE 4OGEA 3TRZA 2CP5A 3PVLA 3J7YW 5GJVB 1KD1C 3OSVA 2R61A 5I2XA 2JP1A 1D5ZC 4KJOA 4A3KH 1SE8A 4HSVA 3AT1B 4EVOA 1G3WA 1MKHA 5EJWA 5CGKA 1K8GA 5JEAH 1N32Q 5I6WA 5D65A 4AFQC 2JEBI 4BD3A 2KRNA 1BI0A 1H9MA 3JAMc 2PI2E 3HFZB 5M5WH 5IP7G 1LM0A 2K5NA 1DD2A 1KQSA 1HR0W 2LZ6B 4JJDA 1LTRD 4P71A 2GCXA 2E2DC 1B2TA 1WNLA 1YHBA 3T1YQ 1MGSA 2DL4A 3CKIB 3SFMA 3CMEQ 1K73U 1C9OA 1KL9A 2L15A 4OXPA 5CC4A 4JV5Q 1UE9A 2VB2X 1G83A 2EBPA 5IGBA 3M0PA 3EBEA 3PO3H 2NUPA 1G8XA 1I5FA 4CC4B 4GKKQ 4NDXA 3GQBA 1TXQA 3SEMA 4F14A 1RAFB 3D6WA 1RLPC 1SPKA 4OWWB 4JS5A 4MTKA 4FO2A 1PMRA 4E7IA 1N5ZA 2ED0A 4HIKA 1I5LA 3X3NA 3S15H 5KYXB 3NBHB 4AIMA 3FKIB 2B63H 5KCOA 4Z9CB 3QIIA 3CEYA 1QVPA 2XIDA 2KHIA 1XMOL 1YNJD 1D2BA 1S5ED 1G3SA 1EUJA 1STGA 2XICA 2NUPB 2UUCL 4JI4L 4IQZA 3QWNA 3MKDA 3CCVA 1FWZA 1TU0B 2RJEA 3RMHA 4O6JA 3TSSA 3I4NG 2EQJA 4UP9A 4EQOA 5C6AA 2F4IA 1L1OB 4BBSG 4K2LA 3PSIA 1MIUA 1EEFD 2C35B 5FU6B 3CC4A 4ZNXA 2F0EA 3LLRA 1Q81U 1K73C 4IUTA 3OYNA 1HJPA 1TS3A 4C2MB 5C4JH 3KJOA 2XDBA 4GKKL 4X62L 1U06A 2DL3A 1KFZA 1E2VA 1P16A 2EYHA 5M5WB 1E3PA 5CKFA 2AQ1B 1K0RA 2LS01 1ZXTA 3C1EA 3Q0AA 3GD7A 3C94A 1GUWA 1IREB 3G6ET 4IURA 2JXMB 5M9OA 1AHJB 1ZSZC 1JWSD 4HIMA 3UPUA 1EQQA 1SLJA 1PH9A 2E5KA 3OSOA 1VUBA 4FXGC 5IGCA 2OX7A 4FCYA 4WJ3M 2PUKB 1W70A 1A63A 5IHIA 3GTLH 1ET6A 2HDLA 1Q86R 1SYBA 2BKDN 4MZTA 4BE2A 2RM4A 2VC8A 4XQ3A 4F04B 2KBNA 2MIOA 3D8GA 4BUGA 4R4CA 5HGTA 5EG2A 4IOCA 1U4MA 1ZKOA 3OTOL 3M55A 3CCEA 1CUKA 1MSHA 4JJNK 1A3UA 1J9OA 4OL7A 2E5LQ 4FXDA 2E2HB 1JO8A 3OYHA 4C3JB 5I9PA 5FOBB 3REAB 3CCVQ 4EMKA 2HMAA 3K58A 4M7AC 2NZOA 3A56A 4MDXA 2WV6D 2XHCA 2ZTCA 2J4XA 2D6FA 4CGYB 2COWA 5I2SA 2D8JA 1E7ZA 2DXBA 2Y90A 3V7RA 1YNJC 4FSXA 2FFKB 4OO1G 1YIJA 1A0IA 1I4XA 2WAQG 1Y71A 1L0XB 3BVGA 4LJZC 4YTLA 8ATCB 3HOXB 2PQWA 2K1BA 2OF1A 2CGHA 3JRZA 4G7ZC 3AYHB 1AT1B 2BUDA 3HOYH 2NZHA 4DR6L 4ABNA 1ASYA 3G71Q 2PU9B 1O75A 2LXKA 5BN4A 2LJ0A 3G4ST 1H9SA 1NPPA 3C1FA 2QGFB 3QOJA 4HTHA 3CD6Q 4JI2L 1G291 5IE8A 2MWPA 5A2QE 1N8RC 1I4RA 2KXDA 4DXFA 5CR2A 4TVAB 3UDGA 4HR7B 3UA7A 4C3HB 1WYDA 2NTSA 3GTGH 4LNPA 5C0MA 2P0KA 5HY6A 2MMPA 4RMOA 4JZ4A 1NSNS 3DHQA 4E6IA 3G6JB 4RTYA 4LN2A 4JI8Q 1S72A 4DR6Q 2DBKA 1K83H 5GAGC 3O8VA 3QBYA 2DERA 1YP5A 3H91A 4DAPA 4APVA 3E5SA 4PJLA 4QY7A 4DBRA 1X6OA 2FJ2A 4IPCA 3H8ZA 2BE9B 2YU9H 3GBQA 3D0FA 4UDUC 2DEUA 4PKCC 2VGNA 1GFDA 4M75G 1TY2A 4LF7Q 1GO3E 1QILA 1EOVA 5NUCA 1PH1A 2CH4W 2R57A 3JB9D 2EVBA 4GOPB 2EYMA 3ND8A 2YYZA 4H02A 2Q8IB 3VS3A 4DU9A 1WPYA 2EE1A 2CT4A 1XPUA 2KE9A 1PFNA 1K8AC 1B34B 2CREA 3ULRB 4X9CA 1VQ5A 3T1HL 3A8LB 1VCIA 2O4XA 4JCVE 3G6EQ 4C5GA 4LUZA 1CKMA 2E64A 2CH4A 1EQTA 2MWOA 3JSCA 2QK0A 5FRMA 2E76C 1HHVA 1O7LA 2RVLA 2Z4HA 4GLVB 2C0OA 5FKAC 2LDMA 3TP5A 1OXSC 3C12A 5ELOA 4XTWA 3CCJA 3CCSA 4F7UE 3KJPA 4TRDA 2E4HA 1IW7C 3CPWP 5KIXA 2EXDA 1H95A 2UXBL 1QUQA 5J26A 1O7IA 2LTOA 2C0IA 4JOIC 1TUDA 4A3IH 1SE4A 3Q22A 3EG3A 3TBIB 3KFUA 1GUNA 5G3LF 1F9PA 4R56A 3EG9A 2D62A 1QCOA 5EGTA 1QQJA 2ED1A 1AFPA 3ULJA 3DB3A 4RCBA 2DXUA 2KROA 3WXMB 3CC2Q 4DR1Q 3I2ZA 3M59A 3SB2A 1Y8PB 1IRXA 2DETA 1BKBA 2NVXB 2MAMA 2D8HA 4O2DA 4GZYC 2DO3A 4X66Q 1MV3A 4M75E 5IYBH 2M1HA 5CR3A 2YSQA 1M9SA 4HA8A 4C92G 3H9NA 1MMDA 3VS1A 3CCQA 1L1OA 5IYCH 3J80c 1M4VA 2SEBD 4DR1L 4KKSA 4M78C 4F16A 1DZ1A 3JCMV 5FWBA 2ICIA 4QF4A 3ULLA 4A3DB 2EXZA 1ESRA 4PFZA 3SGIA 1K0XA 2AT1B 2KT1A 1F9SA 2SDFA 1B70B 2X6GA 4M7DA 3CHBD 3L9AX 1XPOA 1HNXL 2I0NA 2ALYB 7AT1B 2VQEL 1L2FA 1LABA 1E7OA 1Z6HA 4HKEA 1LLRD 1CK1A 3SWNB 2JA5B 5FK9C 1GUOA 5DM7R 3MZ5A 3OOCA 2M0YA 3E9GA 3HHTB 3M0RA 2JE6I 4HT9A 3D6CA 1XX8A 3OIPA 3KLSA 4YHHL 2DKGA 1KQSS 2UUBQ 2P84A 1LPLA 2ZM6L 2QQRA 3HS0C 4N0AC 4PMCA 5IT9c 4RKUE 3H94A 4M7AF 5KRUA 5KEEA 4R8IA 4M7AG 1SNDA 1J5EQ 4XTCS 4K14A 4GNXC 2X6LA 1K28A 1UE5A 2EKHA 1PRTF 4FT2A 2SNSA 1IBLL 4A3FH 3JB9F 4FYDA 4OMLA 3RKYA 4HVVA 2RHUA 3HSBA 1IHZA 1VMCA 2MGSA 3D4RA 2Y0SG 1D0YA 1HNWQ 1I4HA 2D0OA 2AIRB 4X3SA 1ASZA 2PNIA 1VS0A 4AH6A 5IT9E 2M9UA 4KY6A 5D6WA 1WD0A 2ZAEA 3A1PA 4DV1Q 2CS7A 1NMGA 3E1SA 5LJ3g 4JI1L 3R8BA 4PJOA 3VR6A 1DXMA 2XIWA 5CV8A 5BR8Q 5IAYA 3S2HB 1SAPA 4EQNA 2E70A 3E19A 4NS5A 1ONLA 3LX0A 3T4AC 4DK1A 1TH7A 2NWMA 4MMLA 1GD7A 3WOFA 3FB9A 2CQAA 3Q24A 2F0TA 2K3BA 2XMFA 3HPWA 1S4ZA 3BYTB 3MVVA 3M4PA 2VZAA 4Y7NH 2DD4A 1Q95G 4GOPA 2WAQE 4IALA 4PJOE 2K5FA 3MXPA 4MNOA 1WTRA 2F0NA 1TIID 3RZDH 1RAGB 3EG0A 2K5IA 2MJ8A 3K81C 2A6ED 3KDFB 4U68A 4B6MA 3KF8B 5FW9A 2RDGA 1Q7YC 2LNVA 1KC8C 2M51A 1M1KC 4DK3C 1EWHA 1JCKB 2BOSA 4PK4A 2F52A 2L0CA 4JC0A 3PGGA 4OMFB 1SE2A 4K5VA 4ZAIA 1D7QA 1XQHA 4EDUA 2F0QA 1D5XC 3FEOA 5FROA 1SFOB 1KDBA 3QB3A 3E2UA 2GNCA 3QZ9B 1EIFA 3U9SA 4PJOD 2K9GA 2NUTB 3I55Q 1KAWA 2RHSB 2ZCFB 1ML0D 1UFFA 1SFOH 4A3GH 3BZCA 1Y57A 1EWIA 5IYCG 1HQMC 2H1EA 5GAMd 4KUDK 3EGXA 1SJHD 5ELFA 4BWGB 2EY5A 2E6NA 3UDFA 3X3MA 1R77A 1BI1A 3DWAA 4CDFC 4QW2A 4ZQ3A 2D0PA 2J06A 1JE4A 5ELEA 2A5HA 3JCMe 3ITPA 3U9OA 1W2BS 2WP8J 1PDQA 2O31A 1U4RA 2LRQA 1GHKA 2KOLA 1WXUA 1II3A 2B2UA 1FMKA 3X24B 1LCKA 3P8HA 1EY5A 2FXQA 2OT2A 5EPJA 4LFAQ 3RUZA 5C3XA 2UXBQ 3GNFB 2PZ1A 2MO1A 4KK7A 1R0BG 3Q1JA 4FM4B 2JTEA 2MPMA 3VA5A 5KYYA 2EPDA 3IAYA 1PKSA 4X65Q 3PIOA 4OO1H 3LH5A 4ILWA 3U23A 1EOTA 4RGMA 4OGCA 3L0OA 3T16A 2QQSA 1VQOT 3PGZA 2W0ZA 4ELZC 1M90R 3DM1A 2DIQA 1KDAA 1M3BA 3L2ZA 1N36Q 2HQHA 1CA6A 1N6AA 1UGVA 1HSQA 2F4VQ 1NPRA 4OVAA 1UGPB 1BB9A 5CQYA 1I6HH 3UI2A 1U1TA 1QW1A 3Q8DA 4A3IG 1N34Q 1H9JA 1CKOA 4EX5A 2RD1A 2R93B 4CJ0B 3MXNB 1VYTA 1K8MA 1NCVA 2NVYH 1JOKA 4J5YA 2FRYA 1VQ8T 2LVMA 2IHFA 4HCBA 1VQ8A 1CSQA 3OWFA 5FU7C 1AWXA 2XKOC 3S6WA 1M1KR 2AKKA 2X51A 2XD0A 2E8GA 1X43A 1PTOF 4AFZC 3GTMB 5CQXA 4CBVA 1J8IA 5LJ3e 3CXCP 5GAOn 5IYDG 1D0ZA 2DTIA 2X4WA 2A37A 1RKNA 2KR3A 4C8QB 3NTKA 4ESRA 1TQOA 1XNQQ 3THKA 3F8TA 3LWHA 4ZYSA 1M2VB 5GADC 1XNIA 4F7UA 2DNEA 3I73A 4G7HC 3GTLB 1SMYD 2LMCB 1STAA 1JB0E 2FZGB 5C4HA 2H3EB 2RKSA 1HUNA 4A4HA 5DY9A 3OYEA 3H09A 3S14B 1VQOQ 2KGTA 2ECZA 3OYLA 1SSOA 1G3TA 3CMAT 2JJQA 1A8VA 2PUOB 1RHPA 1V1CA 3CMAA 2NZ1D 3ZYYX 1B07A 3D7SB 1DONA 4DN4M 1M8AA 1H641 3JCMW 2EQMA 1SE3A 3CC7T 1AZPA 3SDZA 2HCIA 2OXPA 3CCMA 2ATCB 3P8BB 1Q86U 3BG3A 2YRVA 4HJ7A 1HTPA 4LF5L 2UXCL 4RA8A 1LTLA 2YTYA 4WRDA 2CP6A 2CCZA 3C4SA 1AZGB 4LDUA 3HOVB 2WB1G 1NZ9A 1YJNQ 2ZXRA 4R0KA 4KKUA 3RNJA 2JM8A 5IODA 2CUBA 2JA5H 2DJZA 2OWOA 1K76A 1NM7A 4OIKA 3JCMf 3JCMb 1H9RA 3LNNA 5A35A 1ZSZB 4IKFA 3RN5A 1CSPA 1EFWA 4VUBA 3M4GA 5GMKl 1CZWA 4F8MA 2AQ3B 4XTYA 2JA7H 3OS1A 3P8DA 1HZAA 4JRQA 4KD4A 4A3DH 1MMNA 3M0QA 3S15B 4NL3A 1VYUA 3EN2A 4H7BA 5COYA 2GFUA 2EJGC 2VL6A 3NMZC 1RAIB 2JK8A 3EJIA 1Q8KA 3EGUA 2E41A 3PO2G 1TUCA 4HCSA 1BBUA 4QUCA 1NTGA 3X28B 1SF9A 3QG1A 3J7ZC 4IJLA 3CPFA 1Y07A 3UDIA 2L9HA 5LJ5f 2NUTA 4RCNA 4NXNL 1MJEA 2NVXH 2N3SA 3EH2A 1JC7A 4KTAA 2YWWA 2HD0A 2X4YA 2O5JC 2IL8A 4N9PA 4A63B 2IG0A 4C8QF 5KYUB 3I90A 1FNWA 1IYUA 4DV3Q 3TQ7P 3UWNA 2ZGWA 2CZ6B 4BI4A 1SMYC 2XRSD 1CSKA 1SXTA 3BVMA 4RTVA 1WIEA 2BIVA 2PVDB 3DLMA 3HKZG 2VVKA 2K5WA 1QCNA 2F0OA 1Q46A 2CWPA 3NUCA 5JJZA 2CKZB 4DUZL 4A3IB 1BI2A 3H6MA 1UTIA 1M1KU 1VIEA 1E6GA 2GQIA 3VS2A 4C1NI 2M00A 2K03A 4A3LG 1UE7A 3I56A 2EGAA 2HHHQ 3B6YA 1WTWA 4OX9Q 4HJAA 3EFXD 3S1MH 4A3GB 4C3HG 1KTKA 4GN5A 3CMET 1Z47A 4QL5A 1K9MC 2OCEA 1AVZC 2CUDA 1I07A 4I7AA 4C5IA 1EYCA 4BXXG 2L8DA 2OTLA 1K83B 5IYBG 1VQFA 4OEMB 3RNUA 3M4OH 2OTLT 1VQNQ 1SRLA 4DEYA 5GAEC 1DM0B 3NSWA 3PUZA 4LF6Q 1XJVA 1KLUD 5IYDH 4XU3A 4JRKA 1Q82C 3MEFA 2RJCA 1YBYA 4S3SA 1UGSB 1PA6A 4DBQA 2M0OA 1YNZA 2QEJC 3S3NA 1O80A 2VNUD 2JM9A 2XTIA 1CQVA 4IPHA 1JU5C 2F0MA 1WHKA 3H3VH 3F2CA 2ENMA 3J81c 4DR7Q 2AK5A 4Q0FA 3HOYB 2PQAA 1XXGA 1VQ7T 4H13C 3HP9A 3FVQA 1IYJB 4IUVA 1XTDA 1N36L 3HOUB 5JEAJ 1S5DD 1CT1D 2ZXPA 2O88A 1AOJA 3DB4A 3M58A 1GUSA 4A3EB 3C46A 1YNNC 2DK3A 1FR3A 2Z1CA 1VQ4A 2QAZA 5FLXL 1M27C 1RUWA 1Q7YR 1JXMA 2X3WD 4IPGA 1T0JA 3QDFA 5CIUA 3AHUA 1PWTA 4BY6C 2RN8A 1TVXA 5FO7B 1VQ7Q 5CKDA 1TWGH 1F2YA 2NVTB 2F0UA 4AG1C 3FIFA 1A0NB 1K9MU 4QGUA 3GTQH 4HCKA 1PD0A 1L1OC 2YHTA 2EZVA 1V76A 1HA5A 2QDBA 2F0HA 3PMFA 4A3FG 3SK4A 1IZ6A 1BBWA 4A3DG 4HT8A 5CBEE 5CKHA 1I94Q 1IBLQ 1GHJA 1IO6A 4JJBA 5CORA 5I22A 5AYFA 5EBCA 3OYCA 4DR2L 1L0YB 2NBFA 3JCMQ 1FJGQ 3QWYA 1WQ7A 4LFCQ 1VQ9Q 2RHYA 2DF6A 4KULA 4FW1A 1VQKQ 3PUYA 4A3MG 2AZSA 3ER0A 1JT8A 1PXUA 2HKQB 1M1GA 3ICEA 3LWIA 2B8AA 3J80E 4UAIA 1ZSGA 4L5TA 4LF8L 2Y4YA 3Q6SA 2CHBD 5EPKA 2LJ3A 1MGQA 4O5VA 2F0DA 1AWWA 5CV5A 2QI2A 2KK4A 2B2TA 3M57A 1M90C 5CKBA 2L3QA 1QUQB 4QIWB 1D1KA 3G71A 3F2UA 1VQCA 2K05A 1S5FD 4B08A 3OQ5A 1NLPC 1YI2T 3OYAA 4M75F 2QA4A 4M7DG 1EY9A 1EIGA 2Z9HA 4JJCA 1ZSZA 1S72T 2COYA 2KAFA 2RHZA 3RIRA 5AT1B 5A0GA 1ENCA 3EH1A 3GDEA 4LF4L 4LFBQ 3EG1A 4DK6C 1PSFA 3K59A 4U673 1W2BA 3EVQA 1EZ8A 4C0DB 4L8JA 4YIJA 4BA1I 2TSSA 2HIXA 1G6ZA 2EYYA 1LT5D 1RIPA 2XN9C 2DTOA 1EFID 4K8IA 2EYWA 4NXNQ 2XRQD 1QVGP 2YLCA 1BCPB 2RHIA 2DM1A 3MEHA 4C8QG 3RD4A 4EMKC 2DAQA 4R4TA 1NBEB 4M7AA 3F1ZA 4HAEA 4OWTB 2I0QA 1X69A 1MD2D 4LDWA 1SNCA 3NBHA 5KE3A 1TWFH 5M3MG 1VQHA 4XU1A 4RTUA 2RJFA 2HIVA 2PVOB 2J6OA 2P5ZX 4DA2A 2RQTA 1LVKA 1X54A 1EY8A 2R58A 3CCST 2JTMA 1M5Q1 5IHKA 3OW7A 2BE5D 2MQHA 3QPHA 3JCMJ 4CKCA 1U1SA 4DR4L 1XOVA 3QUIA 3SWNA 4B3RQ 1W6KA 4PZ8A 2DNUA 1WJRA 5CVIA 2B2WC 3HKSA 3ZEHA 2DGYA 2FPEA 4JLIA 4K2KA 3ULPA 1IBML 2K5LA 4QVDA 1ZA2B 4TSSA 2JZ2A 4ELYC 5L23A 3K5OA 5CV7A 3ND9A 2VB6A 3R6NA 4FYVB 4DOVA 1B4OA 1RI9A 3G4SQ 1HTLD 2LX9A 1W6XA 4M77E 1K8OA 3CCRQ 4R1JA 5LHY1 4J9CA 1D1CA 4A3BB 1F2ZA 2DVEA 1H3HA 1UEAB 2BZXA 2O01E 1LTGD 3TQYA 2Z4IA 4J6XA 1JRIA 5FJ8H 4KRTA 2OQKA 3W3AA 2FZCB 2E2JH 2WB1E 3SXHA 4RCCA 1DYQA 3BZDB 1V1QA 1KRSA 3HG9A 3CD6T 1W1FA 2BE5C 2K4YA 3RDVA 2EOTA 2O5IC 3BE3A 4NB3A 1VQMT 2C5CA 2Q2IA 4F87A 1PSEA 2YU9B 3NPFA 1BCOA 2XU8A 4CC7A 4RTXA 1STHA 2JTFA 4UY8C 3M0SA 1Y7XA 3S1QB 2D2CC 4ZN1A 3I4NB 2ROLA 5C3WA 1O9SA 2IJ0A 3CCUQ 3E9FA 1ZLMA 1BQQT 5GAMf 2V26A 3MFGA 1PH2A 1CKNB 3WOEA 1J3TA 3UATA 4XT1B 1M3CA 3MHXA 4JZ3A 1LTBD 3DEPA 1JE5A 2JA7G 2PMZE 2K5DA 3D3RA 4E7ZA 3E9IA 5IT9L 1TWCH 1Y1VG 1QOHA 1JQQA 3E3XA 4OONA 4DXGA 1HFGA 3OB9A 4QQDA 2CP3A 4FYYB 1B9MA 4GKJQ 4BI3A 1UWVA 1P8LA 1Z9FA 4ME3A 3A98A 3M5AA 2PMZB 1GJXA 4QKUA 1I94L 5E4XA 4YCVA 5IWAL 2F0FA 2JN0A 1ZEQX 4KMUC 2IVWA 3CP0A 2VUMG 4LDVA 2E10A 3VYRA 4R55A 1QZHA 3NFCA 5CV4A 3GPLA 1BU1A 2IWHA 1STNA 4Z89A 4EPCA 4IOAA 1GCQA 1JMCA 4C8QE 3OA6A 3GP8A 2DL8A 3CQZH 3A5UA 5M3FB 4PMBA 4GKJL 4ZTJA 3P75A 4QCLA 3OW2A 4WJ4A 2ICEC 5K36G 5KNDA 3M54A 1HJDA 3I70A 4OMQA 1OXTA 4C92D 3OY9A 2D0NA 3KBXA 3KUFA 4C56C 1I4K1 3PF4A 2Y4XA 3IFDA 5IH2A 1UNSA 2FHTA 5IGEA 3VR5A 3OYKA 3HP3A 2B2YC 3GTOH 4FYWB 4KV6A 1PH4A 1VQJA 1QE6A 2XG8D 3PF5A 4A3LH 4BACA 5D7UA 4M75D 2AZVA 2EQKA 4FF2A 1ABQA 3JCMg 2WAQB 1FL0A 3RKWA 1HQRD 1PZID 2Z6KA 3M56A 2O4XB 4M7DC 3S17H 1M8MA 2DPPB 1SHGA 1VQMQ 4AQYQ 4ZUJA 2A7YA 1JJ2A 1TY0A 5CV9A 2E1HA 1S5BD 2HNIA 2V1CC 2E12A 1ZUYA 4J1MA 2LNHB 2J7IA 1Q86C 2HSPA 4A3BH 1RF2D 4DV6L 4PQXA 4KUIA 3V7SA 2KQ3A 3L2UA 1M90U 2PO4A 2IX0A 4QMGA 1HZCA 4KLKA 3ASKA 5GAHC 1C0MA 2CT3A 2K7AA 5GAN8 1MHWC 2F0SA 1V1PA 5KE2A 1BBZA 2BDNA 4UC4A 5CKEA 1VQ6Q 4MZPA 3H15A 5CMDA 3RLNA 5M5XB 1WOCA 4YY3L 4O42A 3V8LA 3PNWC 3NQIA 2LQ8A 1S1NA 1TUGB 2FPFA 2QTVA 1YHQA 1VQAA 2IT1A 4XDXA 1BDOA 3JAMi 1WYXA 3FKIH 2IY5B 2HDMA 1N9SA 1D5MC 4J9EA 1IL8A 2UXDL 3IKJA 1C4QA 4AT1B 1E1TA 2EJMA 3K0YA 1IBKQ 1ZUKA 2DX1A 2B8FA 1BIBA 3RMSA 2CP2A 4KI0A 2JA7B 2RQUA 1TWFB 2NN6G 4I7ZC 2N55A 2JS2A 3CU7A 3HEJA 2Z0WA 4II1A 1STEA 4OHJA 3JV3A 4PJOC 2L5QA 3H0IA 2YTVA 3G6EA 3MO8A 1AEYA 2KUMA 1BBXC 2EJFA 3VS0A 2K7VA 3H3VI 1S40A 1VQIA 2XVSA 5AFWA 3HL8A 1A2UA 3BU2A 1PFSA 4RKBA 2TMPA 1RAHB 2XDDA 1PTOC 4XU2A 4DQ2A 1KXLA 1KG1A 2RDHA 3GNGA 2VKNA 4C92A 4WFN3 4PZ6A 1R8OB 2V8KA 1Q82R 2KECA 4EQPA 1Y1WH 4JI5Q 1B44D 2DL5A 1SSFA 3PO2B 2CSQA 1XYIA 1QJOA 3S14H 1PYWD 3S1NB 2MF2A 1HPCA 4QVZA 3V7CA 2QA4Q 1QP3A 1PC0A 3EGDB 2BE7D 5ELCA 2EYZA 4JI0L 3BVZA 4KHPQ 4E2FB 3L3OC 1ZBJA 1HRJA 3CC4Q 1C0AA 3KYHC 4X65L 1W4SA 3DLLA 4A3CH 1SDFA 1IL2A 1SN8A 3CCET 3I4OA 2H5XA 1KIKA 5EKKA 2F03A 3VV0A 3MPUB 2BTTA 1VMPA 3OWEB 4CC2A 1KC8U 3A55A 1MI2A 3BJUA 3FPPA 2MOXA 3CMAQ 3HOWB 2K57A 2F5TX 3LGLA 3MAQA 5GAOp 1YIJQ 5IWAQ 3S2DB 3RR5A 2BZ8A 2HT1A 2LQWA 1Q12A 1GBQA 3WDNA 1D3BB 3AB9A 1YNND 1JOOA 1FNUA 5JAVA 2KDSA 4PJOB 2F2WA 3GTQB 1ILQA 1KJWA 2HKNA 2BA1A 1GXDC 2B2UC 3TP6A 1HNZL 4ZKBB 1HZBA 1Y96A 4BS9A 1Q8IA 3G4SA 1G6PA 2NYZD 4JBJA 4PG3A 3CC7A 2BDOA 5HKCA 1NUCA 2EWNA 3OYMA 2XI9A 3X25B 2ID0A 3MEVA 5FWCA 1V43A 2LMJA 1F9RA 1TWHB 2RSNA 2ZTDA 1PH8A 3EG2A 3PUXA 2GF7A 2L1BA 2WINB 1CA5A 4C92E 2QEXA 4PJNA 2R7ZB 3KF8A 3L2PA 2Y0SE 1SSHA 2JA6G 5D6YA 3GOXA 3PIO3 3RESA 1QWEA 4M7DD 1KIXA 1Q1EA 2JA9A 4JDSA 3STBD 2SOBA 3M0TA 1LO5D 3FKIG 2JNGA 5ECAA 5FLMG 1MMAA 2MPXC 2F2VA 2Y0SB 1XMOQ 5E1FA 2MUYA 3CCJT 2QGQA 5F2DA 4M4ZA 5IY0A 4LAAA 5LMUQ 2E2IB 2WIIB 1WHLA 3G1JA 3RZOH 4XTXA 3QJYA 4DV6Q 4AYBB 3I4MH 1VQPT 4F7UF 1VQPQ 2PI2A 1KSWA 2VXWA 3QO2A 2KRMA 1VQPA 3X26B 3VUBA 2CVRA 1WGSA 1VQ5T 3BS1A 1IXDA 5LJ5d 1B7YB 4Y91A 1PTOH 1PCXA 1C6VX 2F5KA 4J9GA 4RG2A 1U5SA 1HR0Q 4BY7H 5KYNA 1QVCA 3D31A 1G2BA 3S1MB 4QJFA 3PMIA 3HOZB 1G51A 4P75A 5LMUL 1NEBA 2E2IH 1MHNA 1VQ4T 1NE3A 3FJPA 4PZ7A 1R9TH 1YITQ 4A4KA 3IL8A 3QIAA 4C0GA 4XIGS 3L2VA 4BBRH 1PM3A 4UP7A 2OI3A 4J9DA 1YJ9Q 1JJCB 4A3JG 4HVUA 2J6KA 2A6HC 2LFNA 3SHWA 1ICWA 4ZRZA 4E6RA 5GMKh 4A3MH 4LK1C 2QQAA 3I55T 3BDLA 3W5OA 3AFQA 1B1ZA 3VR3A 2RSOA 4ME5A 1AWJA 2OTJT 3S1RH 4KJNA 1X3QA 2A68D 2A08A 4BE0A 2B2VC 1N9WA 1VQ6A 2EY2A 4YHHQ 3G71T 2HBWA 2WACA 1VQ6T 4X3UA 1Y0MA 4DV7L 1QWFA 3JCMX 1NEGA 5J1ZA 2HQEA 4X9DA 2DRKA 1JQYD 4EMHA 4C92B 3ME9A 4GLAC 2VUBA 1WLPB 1VQ9A 2UXDQ 3J81L 2JMAA 1LT6D 1QKXA 4OB0B 3KF6B 4KHVA 2DE0X 5FJ8G 2M16A 2PNHA 4IUUA 5FO8B 3M4YA 1M1FA 1WTHA 2L3SA 2K14A 5FLMH 4DR4Q 2BZYA 3OHXC 1PYSB 4R4OA 4Y28E 4R4IA 3TMEA 4C0DC 5C3EH 1UECA 3G7LA 4R4QA 3VKIA 4JI3Q 2VQFQ 4YWLA 1TS2A 2ENBA 1HNWL 1VQDA 3TU4K 2E3IA 3PMTA 2JA8H 3I5RA 3CCLT 1EL0A 5GANd 4BI8B 1OV3A 3MEUA 3WVDB 5GMKj 4C8QA 4FT4A 2B2WA 4MTNA 1LJOA 3T9NA 3VYSA 2JA5G 1KHIA 2K33A 1GBRA 4F7UB 1J5EL 5M5YB 5FU6C 4HN7A 1SROA 3NGPA 1EQRA 2NVQH 5L37A 3FRNA 1X56A 4K0KQ 3M3YB 4LMQD 3S3OA 2FL7A 4ODGA 3NHNA 2Q2HA 3R2IA 2DEQA 4BY1G 3S1NH 4M77F 3MP8A 4AG2C 2DMOA 4XU0A 1RTOA 1I3QB 4JBWA 4LF5Q 4O0AA 1PYBA 3PV0A 5LJ5j 1XNRQ 1YHQQ 2RI5A 4M78B 2C06A 4ZGJB 1Y8OB 2O2LD 1H92A 1WI7A 1MUZA 3PUWA 3REBB 2X3XD 4P2CB 2RK1A 3MP6A 3HGBA 1EIYB 4J6WA 1WCMB 1Y69U 2QASA 2ABLA 3NTHA 1AN8A 4IIMA 2DUDA 2HEQA 1QVGS 4M7AB 2PQEA 2WFWA 2B29A 2DD5A 1WXTA 4LXCA 2QYZA 3TP7A 4JYAQ 4B3SQ 4B9WA 3CQTA 3UT1A 1I50H 3BY7A 4RTWA 2KEEA 5GANh 3QYHB 1PV4A 1OPKA 4M7DF 1XJWB 1I4GA 3CCUT 1YVCA 4BY6B 2EGCA 1OX8A 4B9XA 1NAPA 2E3HA 5GANf 4JV5L 1VDZA 3IFTA 1OXXK 4DPGA 1UGQB 5DEHA 3U50C 3PVQA 3STBC 3T13A 3F70A 4M77B 1I6HB 1QVFA 5C0XG 3DUZA 1WZOA 2KXCA 5FU7B 3UF4A 1KNEA 3G7ZA 1QCBD 4IN3A 3JCMd 5GROA 4PNOA 4L63B 2C0TA 1YI2A 2QQ9A 1N27A 4KGZB 2MK5A 1PZKD 2RI2A 1SRMA 2C9OA 1UG1A 1YITA 5KYYB 2NWGA 1SG5A 3OS2A 3HOZG 1BXTA 3C0CA 1GCQC 3PE0A 4DAYA 3AMUA 1K1ZA 2HD3A 4PJJA 3I4LA 2K28A 1R0CB 1VYVA 2COZA 2CZ7B 5KYLA 2QXFA 1BI3A 4BY1H 3HKZE 3TEEA 1FMVA 3OIQA 5AJ3L 1Y1VH 4LW1A 1A62A 4M77A 2X4XA 3EG9B 4CI0C 4NMZA 4FF4A 4OX9L 5I2MA 2UUCQ 4JI4Q 2PZUA 4XQNA 3HZXA 1V1OA 3PCOB 3K80C 3TP8A 2DILA 1RAEB 1BNZA 4MZ9A 1WI5A 4DV5L 3CAMA 3VR4A 1X9NA 4FDBA 4V190 1N34L 4H0LC 4POGA 1PD1A 1G8ZD 2MYSA 3JB9G 3I5SA 3MTSA 5EBDA 1JJGA 3SD4A 4KD3A 2F0LA 2NN6H 4JI7L 2JA8G 4G57A 1TU2B 3IRBA 5KYXA 2A1AA 1YJNA 1KAAA 3JCMP 2X35A 3BYYB 5IP7H 1RDPD 3VUZA 1CFMA 1M2OA 1T3SA 2KQWA 3H6ZA 5HK3A 5K36H 4WJWA 3KF6A 3CCMQ 3E0EA 4LUOA 4RH6A 3CC7Q 2V1RA 2F69A 5LL6S 1HK9A 2N78A 3KUPA 4KY7A 3GLXA 1WTVA 1IHWA 2KCMA 2YV5A 1EU3A 5M3FH 4ANJA 2P0PA 4M77D 2PQAB 3MHBA 2RF4A 1D0XA 3VR2A 1ACMB 3N6RA 3PIPA 4JOIA 1SNQA 4X62Q 2LCSA 3SHLA 3RZDB 5LJ5h 1NY4A 2VQEQ 3TEHB 5GAMh 4J9BA 5BN3A 3K0XA 2A36A 4JK1C 4Y7NB 1UJ0A 5KGUA 4E7SA 1EQVA 1S72Q 1VIFA 1OXVA 1UB4A 2NUZA 1TWHH 2RQXA 2MHVA 2PVGB 3OPOA 1FYNA 1KQ1A 1A2TA 4C0ZA 3L2QA 2QDLA 1PRMC 4EIKA 2F3VA 3R3OA 2M9VA 4PNYA 4GLXA 3S2HH 2JA6B 2K2MA 2KCNA 2PW7A 4OIJA 4P73A 4B3TQ 3DWQA 3TZUA 1XPRA 1BF4A 4F17A 1STYA 3OTOQ 1BOSA 5LJ3d 2MP1A 2K3YA 2B8GA 2RQWA 2EJFC 4B3ML 2G6FX 3J81E 1JB3A 3QDRB 3S1QH 1K9AA 3KFVA 1IKLA 1UUPA 4OMOA 2AKWB 2ROTA 4M78A 1YJ9A 3PT9A 3N52A 1AWOA 4CJ2C 4P72A 3A5ZB 4C92C 4P5NA 2UXCQ 3BDCA 1PRTC 3OYGA 2VV5A 4X1VA 5IN1A 1Q82U 2B3GA 1MNDA 2EQUA 1Y14B 3SWNC 2XWJB 3O5ZA 2VUMB 1XMQL 2OJ2A 3TCJA 1H8KA 1LUZA 2EGEA 2NN6I 1RI0A 1MSGA 1VQGA 5C4XB 3SVMA 3H0GH 1EIHA 5GAN7 4DR5L 4V0BA 1OULA 1HCZA 3NK9A 5KYUA 1O7YA 3AQQA 1NJIU 2E5LL 5I11A 4KKTA 3KBGA 1ENAA 1UHFA 2WB1B 1DJ7B 1UAPA 2A68C 4JI1Q 1JBMA 1PH3A 5ELDA 2F0GA 3J81j 1UEBA 3NHHA 2V8IA 4MZMA 5J39A 1WQWA 1F2MA 4XQJA 2ZPHB 1BIAA 3KDFA 1KD1R 2DVJA 1NYGA 3QJ6A 5J3BA 3RUXA 3PO2H 5C4XG 1KC8R 4E47A 1FD7D 3SK8A 3EFSA 4CC3A 4RKLA 2L55A 4XT3B 1C8CA 4RG8A 4A4FA 4X3KA 1B3AA 3O13A 3CF5A 4HJ5A 2B63B 2EJ9A 3UA6A 1OI1A 4A3KG 1F77A 5GAMe 2RF0A 2R3ZA 5ELNA 1RCVD 3SK6A 4DAYB 3GTJH 2L12A 1RD9D 3RBBB 1JICA 5A2QL 2BA0A 1LNXA 2OTJQ 1B9NA 2MO0A 3V96A 1PKTA 1QLYA 4KY5A 4LFAL 2KEAA 1DJRD 2K5HA 2MFIA 3TDQA 4PV1C 1EY0A 2GVBA 1M30A 4CKBA 5CK9A 1R4PB 4J9HA 1VQNA 4IZ8A 3MP1A 1J6QA 4IUQA 1VQNT 2NLUA 2DXCA 5GAN5 2F0PA 1IW7D 4M78F 4CRIA 3GTJB 1NJIC 1IBMQ 4IFDI 3TSWA 4J15A 3C95A 4NOYA 1AZQA 3OYFA 2HAXA 2JS0A 1Y8NB 2KENA 5LJ5e 2F0VA 2HQLA 4JBKA 4LF7L 1YI2Q 1SYGA 2GN5A 1JOQA 2HSEB 2RMOA 4WF2A 4OGQC 2OEOA 2M2LA 5JJLA 4KGXB 1Z7TA 2CW0C 2IPKD 3P20A 4F88A 2LX7A 1YHAA 2EIFA 3ERSX 4M78D 2FMMA 1WVLA 2NUCA 4BXXH 1OU8A 2KHSA 3FPUB 3FRPB 3HKZB 5M5XH 4C5EA 1X3FA 3QSUA 2XNAC 3MCAB 1OZ2A 3OYYA 3H0FA 1IB8A 2V4DA 3DXJC 3JC66 4C0FA 5GJWB 4DV5Q 4ALPA 2RI3A 2K52A 4AFSC 2YUNA 4TQUS 2KI7A 1VQEA 4DV2Q 3TREA 2QEXT 3FJ5A 2KYBA 2H3JA 3GF5A 3WVEB 3CMEA 3CCJQ 2IW3A 4GN3B 3PIP3 2PTKA 4FU6A 4QQGA 1VQKT 2EYJA 1YCYA 2EFIA 3FHWA 1VQKA 2DFUA 4MDWA 4XQQA 4D8DA 2Z8LA 2SEMA 4GLMA 4YWMA 4ZGEB 3L42A 3ZBDA 1VQ5Q 1E2WA 1SJED 3W1BA 2R92G 2A8VA 4LDXA 4RMFA 2VUMH 3V05A 4N4IA 2L3PA 4KT0E 5C3EG 5JJIA 2B86A 5LJ5g 3J80L 4N8FA 3CW2C 5LJ3f 2DL7A 3ZJYC 9ATCB 2I2LA 2X69A 1ZBXA 3GV6A 1HXDA 4HMIA 4L59A 4RGTA 3RLOA 3EHQA 3UE0A 5DM63 3J81i 1IBKL 1K3BC 2KJXA 2ZM6Q 4YCWA 1SYEA 2ESWA 1BCPC 4PJMA 4KHZA 5C0XJ 2DRMA 1QVGA 1TWAB 2DJFC 1MJCA 1HUMA 1W2BP 4FXKC 5C5LA 2NVTH 1DGSA 3V2TA 1KD1U 1XNQL 4ZN3A 1F2LA 2EY6A 3BFMA 1BUVT 1Q3LA 2R7DA 1T3LA 1WHHA 4XTZA 3FDTA 4X66L 2G3RA 1YFNA 5GANe 2QILA 1WA7A 2GTJA 3M9QA 2SRCA 2LT4A 4C3IH 2UUBL 5E4WC 1YIJT 2V1QA 1LYLA 4LFCL 4XTUA 4DAMA 2DJQA 1CQFA 2R6GA 1CM9A 4AYBE 2ZJPA 1VQLT 2HCKA 3H41A 1TWAH 4GOPC 2G9HD 1VQLA 3GTPB 4DV1L 4BBRG 1T5XD 2JJ9A 1HZ9A 4NW2A 3V8JA 3HOXH 2BH2A 1TWBA 1VF5C 3GTPH 4QUFA 4LFBL 4A3JH 1JR0D 4ZTFA 1OZ3A 1JEGA 4QVCA 1XMQQ 4X3TA 3Q23A 1TKWB 2K5VA 2A19A 1D1AA 1OXUA 4A3BG 1XTCD 1HR0L 3JCMc 1SYDA 2OQ0A 1JB7A 3QHSA 2XK0A 2Q8TA 2VASA 3JB9J 2WSCE 1S3OA 2I5LX 4GLKA 3RERA 1RACB 2E2HH 2RCFA 1WTQA 3M4OB 2A69C 1WTOA 5GANg 1K9MR 3CCQT 3KK7A 3CXCS 2ZTEA 4DR5Q 3PTAA 2FINB 3LGFA 3UDCA 3VS7A 3K7AB 2EYFA 1ET9A 1BO0A 2OTJA 2PW5A 4KN4C 5KH6A 1X32A 3A7LA 3V8KA 5GAN4 2NTTA 2G5DA 3M0UA 5C0XH 3VYTA 4OO1I 1LTAD 2LCLA 2L3RA 5CO7A 5GAN6 2CW0D 4TVRA 2X9HA 2JQOA 3EA6A 2QA4T 4EGVA 1MMGA 1LTTD 4RGNA 4A75A 2CZ0B 2IX1A 4HJ8A 4MMKA 2HCCA 1E1OA 4FL6A 2FG0A 2PYKA 4DV7Q 5ELBA 4UP8A 5DM73 4C2MH 5C4JB 3S3MA 1SHFA 1FX7A 1PG5B 4RTTA 3CXCA 1EYGA 4NXMQ 4JLGA 5M3FG 3CBMA 4OB2B 1KDCA 2LQKA 1T9HA 2JVVA 4IIOA 4YCUA 5M3MH 4BY1B 4JYAL 1KK7A 2GQVA 3EIVA 4DV0L 2R92B 2JN4A 1LACA 3TVTA 1I8FA 4P74A 4KH0B 5CBAE 5KNCA 1WHMA 2QG9B 4M78E 4N0AA 1X3GA 3QOLA 3CCLA 2HL3A 1X27A 1EZZB 1YNXA 1PTOD 5D14A 1T0HA 4HCCA 3T1HQ 4J9FA 5C44B 3T1YL 1YCSB 4Y52H 4DR3L 1OQKA 1DOKA 1MNEA 2PNRC 4HEDA 4IPDA 4J8OA 1OYXA 1CHQD 5IOCA 2EKOA 4F7XA 2G9DA 3W2DA 2ZPFB 4FVMA 2FZKB 4M75C 5KYWB 1U3OA 2HL5C 2R93G 2CKKA 2K2VA 2A28A 1CKBA 1B3QA 4A53A 1AE3A 1EY6A 3EGXB 3URYA 2F3WA 5C44H 2QCPX 1IGUA 1CKNA 5EAYA 3KLSX 2P4TA 4OELB 2JUFA 1IKMA 1SNOA 1I50B 4A3CG 4ZGDB 4PLIA 2L2PA 4LF6L 1TG0A 5I4DA 3H3VC 4I65A 4TKOB 3CCUA 1X2QA 3UDXA 3VDYA 1L0WA 3PO3B 3EFOA 3E6ZX 3AU7A 5AJ3Q 1I5OB 3F2DA 3HOVH 1K4US 3I55A 1SRUA 3CD6A 3DMUA 5M3MB 1C1AA 2RCNA 1I1JA 1WJSA 1YJWA 1WCMH 3R6OA 4K11A 2EW3A 1YZ6A 1W3SA 3L7ZC 4A4IA 4M77C 1IXRA 4M1UB 3H0GB 4CJ1B 3EROA 4LUEA 3FC3A 2VXFA 1E22A 2QTXA 1ENFA 2XWBB 1HXYD 2KMTA 4XTVA 4D6WA 4CKEA 5C4ZA 5FO9B 4OP0A 4PFPA 3HOXG 1VQ9T 3PFSA 1FGUA 3T53B 1FYCA 1I3QH 5CYUA 3MEWA 4DR2Q 4A3KB 1ZUUA 2RNAA 2DNCA 2K6DA 1K8AR 3EFOB 3K8AA 1TS4A 3J7A5 4JPBW 3K7AH 4ZK9B 1U9RA 2R7FA 4C1NK 3P1HA 4L6V5 1X3PA 4ZUIA 5L8RE 2ZXOA 2RDFA 2L0AA 2LCCA 1U0LA 3I3CA 4BE1A 4FNFA 4HCEA 5C4XH 4B3TL 4HJ9A 5GAN3 3OS0A 1VQ8Q 1O7ZA 5KNBA 4J6YA 2JSOA 2JA6H 3A8HB 3VRZA 2KBTA 4FW2A 1X6BA 2AUKA 3FP9A 1D3BA 2LJ1A 2ZPGB 4JBMA 3J80i 2JW4A 1LOJA 1OPLA 5GAOq 2NVYB 3R2TA 2FPDA 3AFPA 1A15A 4JI3L 5C3EB 4A3JB 1M2VA 3TZDA 2EJGA 3HFOA 4JUVA 1N32L 3FEWX 3J7AF 5E3FA 1S5CD 3OYDA 1X65A 3VRYA 2ZJRA 4AQYL 3NTIA 4OWXB 1LT4D 3E0JA 3I4MG 2E75C 2XSCA 2J6FA 3OW2S 4ID6A 1KABA 4A76A 3M7NA 5DLQE 4LF8Q 4KH1B 5IHNA 1UDLA 2D1XA 3MJXA 1PLFA 2AWNA 5E7NA 2LXJA 4ZKCB 4BY7G 3VS5A 2ZPIB 4LNQA 1P92A 1GKHA 3CCLQ 1PNJA 3OYIA 1K0SA 1QG7A 4A3EH 2EYPA 1B50A 1I4QA 1NNXA 1SEBD 1Z9QA 2O9VA 2FVUA 2JMCA 4A4EA 1QMCA 3CBOA 1NMFA 3HOUH 2YUPA 3JAME 3MFYA 1QVFS 4OF1A 4DGZA 1M3AA 3N5BB 4DV4L 5EKLA 5JPMC 3H0HA 4HCZA 1VA7A 1X55A 1Q1BA 4DA4A 4BBRB 2UUAQ 5A0LA 2HUGA 3LX7A 4WORA 3GTKH 5CAIA 3CPWA 4DBHA 2KT8A 1YJWQ 2EYLA 3NBIA 2I5HA 3HOZH 2AWOA 1WDXA 2RA2A 5C44G 3QWXX 5GMKm 4X64Q 2K6AA 4M7AD 3L1AA 1WJJA 4DNIA 3BDUA 3A54A 3NE5B 2UU9L 2DJGC 4M7DE 5GANj 2P4RA 4DV3L 2O2OA 1B34A 4N4HA 4E7KA 2B2TC 1AW7A 2HDAA 1HH2P 2KHJA 4Z88A 1K3RA 2DY7A 1CTMA 4RGOS 3K5LA 4A93H 2K3XA 4JI6L 1WFQA 2IPOB 1CKAA 1Q81R 4DV0Q 2ASBA 1NE8A 3IQLA 3NPPA 3A74A 2JOYA 1IYVA 1NLOC 4N4GA 5KYWA 2VWFA 4NXML 1SYCA 2FRWA 1R4QB 5I9OA 1PH7A 1X01A 4AFUC 5JPNC 1TSFA 2DY8A 4DAVA 4JRPA 1VOMA 4JW0A 2WKCA 2L4NA 3EGDA 2QKIC 4DUZQ 1Y1VB 5GMKi 4DR3Q 1AP0A 1F9QA 1LT3D 2J7ZA 2KVMA 4JVZA 3E9HA 3TN2A 4JI6Q 3HOWG 1YJ9T 3H0GG 1WXBA 3QZ5B 1BCPD 4J6HA 5KCHA 2A73B 2Q8RE 4A3EG 4C3IG 3HRZC 2F3IA 2GVAA 4C3JG 2A6EC 4LUVA 1VQ4Q 1HYOA 4BBSB 1ILPA 1DOMA 3NELA 1JWMD 1ZX6A 1N8RR 1D09B 1Y1WG 3RR6A 2FO0A 3CPWS 2F0WA 1MV0B 1YJNT 5GAN2 3MWYW 3QYGB 4HSPA 4KN7C 4Z02A 1O78A 2VGMA 3CRKC 1AD5A 2R5MA 3KOJA 2AMCB 2DIGA 2YXYA 1D1IA 4GBQA 4LWCA 4R8NA 3HRUA 4RHRA 1UHCA 2HQXA 4KGVB 3LYIA 3URGA 3LW5E 1RTNA 1VF7A 2J05A 5C5MA 3S2DH 4A3FB 5BN5A 2KYMA 2N8NA 3DWPA 5IXFA 5IXBA 2Z6KC 3S16B 3RZOB 3I9QA 1FVIA 1Y96B 1ZHIA 2YTXA 3GO5A 1VQOA 2I46A 3WWVA 2WSEE 3CCQQ 4Z8AA 4C8QD 2JYOA 1EYDA 1RODA 3G48A 3TSZA 4DV2L 2R7ZG 3HTRA 5J22A 2K79A 2A69D 2PZTA 5FRNA 4DK0A 3EHRA 4QQ6A 1WD1A 3S9WA 2D0QB 3P7JA 3OBYA 2EYXA 2DYBA 2KVQG 1MBYA 3PO3G 1SNPA 4D8KA 1YN8A 2EPBA 4RCOA 2FB7A 2CYZB 2I07B 2DLPA 1OU9A 2LP5A 3K5NA 1FGBD 3NWTA 5M5YH 2CSIA 4DUYQ 3I56Q 4A4GA 1EYAA 5I6YA 3JAML 3HOUG 3L2WA 4IFDG 3NXWA 1DOLA 1G3YA 4J8QA 2EYQA 1HNZQ 3VJPA 1ZYRD 8AT1B 2P0QA 1IGQA 2EVRA 2K50A 3J7AV 5JVH3 4DR7L 1RABB 2KY9A 6AT1B 1G91A 2CFMA 5IGFA 4WCIA 1VQBA 1SNMA 3I56T 1X75C 1U4LA 1UGRB 1D6EC 1UUEA 1AZEA 4FF3A 1GOZA 2RHQB 4K6LA 1LV9A 5GAOm 1EU4A 3CC4T 2AHJB 2D9TA 2NYSA 3JCMh 3TS0A 3F2BA 2I5MX 2NVQB 1TR5A 1X3EA 1ZQ1A
chains in the Genus database with same CATH topology
4HMJA 4C92F 2JEAI 4RFBA 2H4OA 3CCRA 2SNMA 2X4JA 3QO3A 5DAUA 4CHTB 3CCRT 3I8ZA 3CCVT 4BB7A 3GP7A 1N9RA 2JA8B 5I21A 3VA7A 2CZ1B 4DF7A 3CCMT 5DLOA 3MEAA 3OYBA 2PZWA 2L5TA 3M7GA 3GIBA 4V2SA 1CI3M 4K5WA 3JB9H 4J7FA 5JEAG 4XYQA 2N88A 4OB1B 2LC4A 4IUPA 1ZYRC 3VYGA 3R93A 2VB3X 4J7IA 1N8RU 1H3ZA 1GUGA 2R5AA 2E6ZA 1R9TB 2FYKA 1QB5D 2DXTA 5HK0A 3A7AB 1AEXA 2PPBC 4A93B 2KSSA 1H9SB 4K6DA 4BDZA 4NP5A 1PTOB 4JRIA 3OBWA 1G2TA 4M78G 4IFDH 5EPLA 4A3MB 1Q81C 2RJDA 2B2YA 1SYFA 1C48A 4X34A 2NB0A 1U8RA 4PL6A 1HA6A 3OMCA 4M77G 5KYIA 5GAMg 1FNVA 1EEID 4H44C 3GTKB 5IGGA 1PFMA 2ZZDA 3GV3A 1PRTB 3RKXA 4XK8E 1WJQA 2RB6A 1I4PA 5EQ0A 5LL6X 2ZT9C 4K8JA 2LKVA 2B39A 3I72A 1TS5A 4N9TA 3A8KE 5JOBA 2WSFE 1V8QA 2RK2A 1KQ2A 3HFNA 3FMCA 4G4KA 4L6TB 2D5DA 3VU3C 1Q7YU 1JWUD 2BCOA 4QB4A 2DN8A 3K5MA 3D4DA 1W6JA 1RJTA 1TT2A 3X20B 3ZFJA 1DCZA 3ERQA 4ATOA 4Q5WA 2QF7A 4RHSA 1SBBB 4E7JA 1PZJD 4M7AE 4ZLTF 3QKJA 3MA2B 3LH0A 5D3IB 5C6SA 4XYOA 5GAMj 2EYOA 3DEOA 4M75A 1EZ6A 3A8MB 5T1IA 1EY4A 1I6VC 5G3LD 2ZPBB 1EY7A 1PFBA 3VYHB 2FHDA 1FXXA 4XAXB 1CHPD 4GY5A 2K32A 3NP8A 3MXNA 4DNRB 2IX3A 4F7UG 1VQ7A 1A3TA 3CBPA 3HRSA 4EMGA 3EFRA 4ME7A 3A8GB 4LDYA 4XXEA 3RMQA 3EAEA 3MC0B 4NL2A 5IIFA 1JJ2S 2AQ2B 3M53A 2AUJD 1CZGA 4ULLA 2RHXA 4Q5VA 3SE0A 4NKLA 2E2JB 5JVG3 2D9UA 3INZA 1Y1WB 4M7DB 1K8AU 3OS5A 1LTSD 2DTHA 1GXIE 2KEDA 3OMGA 2B2VA 2GA4B 2XDPA 2OAUA 3A8IE 3MXUA 2RA4A 4DNTB 1E2ZA 3FLGA 4MHEA 3BDOA 3HRTA 3L2RA 3CC2A 3CC2T 4LD9K 2F0KA 1QNKA 1RL2A 3K6OA 1VQMA 5CV6A 5TSSA 2E74C 3K57A 4KBMB 3A8OB 5HURA 2F0JA 1HFNA 3SK5A 1I81A 2RO0A 3OSSC 2EAYA 2K01A 2KA7A 2F0IA 2K04A 2PCFB 3DKMA 3QXEB 1NR4A 2VXEA 1G5VA 2ZPEB 2A74C 3C2PA 3MXGA 2LT1A 5GAOl 1YITT 5DNFA 4RWSC 3NWSA 3VYUA 1M4ZA 5LJ3j 2KCCA 3S1RB 3META 2RH2A 3BW1A 3M85A 2FMCA 2MI6A 4IUNA 5EKIA 2V8JA 4C5HA 1BR9A 4BDYA 4PLLA 1V1PB 2A6HD 1QNUA 4L5GA 1WTPA 2WKDA 5D3DA 2K5QA 2YLBA 3KLRA 3PUVA 4FIBA 4IFDJ 5A0DA 3SEBA 3FDRA 4MIUA 1QWYA 4LD6A 1Q90A 3RLFA 1E0BA 1GUTA 3LWEA 1LTID 4O1NA 1G2SA 4BY7B 1JORA 4OB3B 1KNAA 5I2YA 1B53A 4A54A 3ONAB 4J83A 1PRTD 2RBMA 4PJOF 1A3VA 4JS4A 3I4MB 3T51B 4PJOG 3CQZB 3S17B 5D6XA 5GAOr 5ISRA 1V29B 4DFAA 1QP2A 4M8AA 1M8VA 2E5QA 2QDYB 1YJWT 4MN3A 4RAUC 3EQLC 3GTOB 4FF1A 2HBPA 2EDGA 4PMWA 3NQTA 5K5PA 1BYMA 4R9WA 5GMKe 2VYTA 4M75B 5T1GA 5IGDA 4K5XA 1TWGB 3C3LA 2L89A 5CCAA 1OO9B 4C3IB 1TWCB 3LWUA 3GTGB 3D4WA 2E65A 5C0XI 4DOWA 3T56B 1BCPF 1ESFA 4BA2I 1T5EA 1NR2A 1KLGD 2QQBA 1XWEA 2L11A 4EMKB 2DZ9A 3CRLC 1YHQT 5FLXE 1U4PA 2LY7A 1A6XA 2J0TD 4FP5D 3OYJA 1STBA 2F1MA 1KHCA 2GFAA 1WTXA 1H9KA 3I91A 4C8QC 4G7OC 4E7HA 1EWCA 2A3LA 3KXTA 2EY1A 3JB9I 2DZCA 5LJ3h 4E7LA 3A8JE 4OGEA 3J7YW 1KD1C 3OSVA 2R61A 5I2XA 2JP1A 1D5ZC 4KJOA 4HSVA 4EVOA 1G3WA 5EJWA 5CGKA 5JEAH 5I6WA 5D65A 2JEBI 4BD3A 1BI0A 1H9MA 1DD2A 1KQSA 1LTRD 2GCXA 2E2DC 1B2TA 1WNLA 1MGSA 3CKIB 3SFMA 1K73U 5CC4A 2VB2X 5IGBA 4NDXA 3GQBA 3D6WA 4JS5A 4FO2A 1PMRA 4E7IA 1I5LA 3X3NA 3FKIB 5KCOA 4Z9CB 3QIIA 3CEYA 1QVPA 2XIDA 1YNJD 1D2BA 1S5ED 1G3SA 1STGA 2XICA 4IQZA 3QWNA 3CCVA 1FWZA 2RJEA 3RMHA 4O6JA 3TSSA 2EQJA 4EQOA 5C6AA 2F4IA 4K2LA 1EEFD 5FU6B 3CC4A 2F0EA 3LLRA 1Q81U 1K73C 4IUTA 3OYNA 1TS3A 4C2MB 2XDBA 1E2VA 5M5WB 2EYHA 2AQ1B 5CKFA 2LS01 1GUWA 1ZXTA 3C1EA 3Q0AA 3GD7A 3C94A 1IREB 3G6ET 4IURA 2JXMB 5M9OA 1AHJB 1JWSD 3UPUA 3OSOA 1VUBA 4FXGC 5IGCA 2PUKB 1ET6A 2HDLA 1SYBA 2BKDN 4MZTA 4BE2A 2RM4A 2VC8A 4XQ3A 2OEOA 4ZKBB 5HGTA 3D8GA 4BUGA 5EG2A 1U4MA 1ZKOA 3M55A 3CCEA 4OL7A 1MSHA 4JJNK 1A3UA 1J9OA 4FXDA 2E2HB 3OYHA 4C3JB 5I9PA 5FOBB 4EMKA 3K58A 4M7AC 3A56A 4MDXA 2WV6D 2XHCA 2J4XA 2D6FA 4CGYB 5I2SA 2FFKB 2DXBA 2Y90A 3V7RA 1YNJC 4FSXA 4OO1G 1YIJA 1I4XA 3BVGA 1Y71A 1L0XB 4LJZC 3HOXB 4YTLA 2PQWA 2K1BA 2OF1A 2CGHA 3JRZA 4G7ZC 2BUDA 4ABNA 2PU9B 1O75A 5BN4A 3G4ST 1H9SA 1NPPA 3C1FA 3QOJA 4HTHA 1G291 2MWPA 5A2QE 1N8RC 1I4RA 4DXFA 5CR2A 4HR7B 4C3HB 2NTSA 5C0MA 2P0KA 5HY6A 2MMPA 4RMOA 1NSNS 3DHQA 4E6IA 3G6JB 1S72A 3O8VA 3QBYA 3H91A 4DAPA 3E5SA 1X6OA 2FJ2A 3H8ZA 4UDUC 4PKCC 2VGNA 4M75G 1TY2A 1QILA 5NUCA 2R57A 3JB9D 2EVBA 2EYMA 3ND8A 2YYZA 2Q8IB 4DU9A 1WPYA 2EE1A 1PFNA 1K8AC 1B34B 4X9CA 1VQ5A 3A8LB 1VCIA 2O4XA 4C5GA 2E64A 1EQTA 2MWOA 3JSCA 5FRMA 2E76C 1HHVA 1O7LA 2RVLA 2Z4HA 5FKAC 3TP5A 2LDMA 1OXSC 3C12A 4XTWA 3CCJA 3CCSA 4F7UE 4TRDA 1IW7C 5KIXA 5J26A 2LTOA 1SE4A 3Q22A 3TBIB 1GUNA 5G3LF 1F9PA 4R56A 2D62A 5EGTA 1AFPA 3DB3A 4RCBA 2DXUA 3WXMB 3M59A 3SB2A 1Y8PB 1BKBA 2NVXB 2MAMA 4GZYC 2DO3A 4M75E 2M1HA 5CR3A 1M9SA 4HA8A 4C92G 3CCQA 1M4VA 2SEBD 4KKSA 4M78C 1DZ1A 3JCMV 2ICIA 4QF4A 4A3DB 2EXZA 1ESRA 1F9SA 2SDFA 2X6GA 3CHBD 4M7DA 3L9AX 1LABA 1Z6HA 4HKEA 1LLRD 1CK1A 3SWNB 2JA5B 5FK9C 1GUOA 5DM7R 3MZ5A 3OOCA 3E9GA 3HHTB 2JE6I 4HT9A 3D6CA 1XX8A 3OIPA 3KLSA 2DKGA 1KQSS 2QQRA 3HS0C 4N0AC 4PMCA 4RKUE 3H94A 4M7AF 5KRUA 5KEEA 4R8IA 4M7AG 1SNDA 4XTCS 4K14A 2X6LA 2SNSA 1PRTF 4FYDA 4FT2A 3JB9F 3RKYA 2RHUA 3HSBA 1IHZA 1VMCA 2MGSA 3D4RA 1I4HA 4X3SA 5IT9E 2M9UA 4KY6A 5D6WA 1WD0A 2CS7A 3E1SA 5LJ3g 3R8BA 4PJOA 3VR6A 1DXMA 2XIWA 5CV8A 5IAYA 3S2HB 1SAPA 4EQNA 2E70A 3E19A 4NS5A 1ONLA 3LX0A 3T4AC 4DK1A 1TH7A 4MMLA 3WOFA 3Q24A 3FB9A 2CQAA 2F0TA 3HPWA 1S4ZA 3BYTB 3MVVA 2DD4A 4IALA 4PJOE 2K5FA 3MXPA 1WTRA 2F0NA 1TIID 2MJ8A 2K5IA 2A6ED 4U68A 2RDGA 1Q7YC 2LNVA 1KC8C 1M1KC 1EWHA 1JCKB 2BOSA 2L0CA 3PGGA 4OMFB 1SE2A 4K5VA 4ZAIA 1XQHA 4EDUA 2F0QA 1D5XC 3FEOA 5FROA 1SFOB 1KDBA 3QB3A 3QZ9B 1EIFA 3U9SA 4PJOD 2ZCFB 1ML0D 1HQMC 2H1EA 5GAMd 4KUDK 1SJHD 5ELFA 4BWGB 2EY5A 2E6NA 3X3MA 1BI1A 3DWAA 4QW2A 4ZQ3A 1JE4A 5ELEA 2A5HA 3JCMe 3ITPA 3U9OA 1W2BS 2WP8J 1PDQA 1U4RA 2LRQA 1GHKA 2KOLA 1II3A 2B2UA 3X24B 5EPJA 1EY5A 3P8HA 2OT2A 3RUZA 5C3XA 3GNFB 3VA5A 4KK7A 3Q1JA 4FM4B 2MPMA 3IAYA 3PIOA 4OO1H 4ILWA 1EOTA 4RGMA 4OGCA 3T16A 2QQSA 1VQOT 4ELZC 3DM1A 2DIQA 1KDAA 3L2ZA 1CA6A 1N6AA 1NPRA 4OVAA 1UGPB 5CQYA 3UI2A 1U1TA 1QW1A 1H9JA 2RD1A 2R93B 4CJ0B 1K8MA 1NCVA 1JOKA 4J5YA 1VQ8T 2LVMA 4HCBA 1VQ8A 3OWFA 5FU7C 2XKOC 3S6WA 2XD0A 1PTOF 3GTMB 5CQXA 4CBVA 1J8IA 5LJ3e 5GAOn 2DTIA 2X4WA 1RKNA 4C8QB 3NTKA 1TQOA 3LWHA 4ZYSA 1XNIA 4F7UA 2DNEA 3I73A 4G7HC 3GTLB 1SMYD 2LMCB 1STAA 1JB0E 5C4HA 2RKSA 1HUNA 4A4HA 5DY9A 3OYEA 3H09A 3S14B 3OYLA 1SSOA 1G3TA 3CMAT 2PUOB 1RHPA 3CMAA 2NZ1D 3ZYYX 1DONA 4DN4M 1M8AA 1H641 3JCMW 2EQMA 1SE3A 3CC7T 1AZPA 3SDZA 2HCIA 2OXPA 3CCMA 3P8BB 1Q86U 3BG3A 2YRVA 1HTPA 4RA8A 4WRDA 3C4SA 4LDUA 3HOVB 2ZXRA 1NZ9A 4KKUA 5IODA 2DJZA 4OIKA 3JCMf 3JCMb 1H9RA 3LNNA 5A35A 4IKFA 4VUBA 3M4GA 5GMKl 1CZWA 4F8MA 2AQ3B 4XTYA 3OS1A 3P8DA 4JRQA 4KD4A 3S15B 4NL3A 4H7BA 5COYA 2GFUA 2EJGC 3EJIA 2E41A 4HCSA 4QUCA 3X28B 3QG1A 3CPFA 1Y07A 2L9HA 5LJ5f 4RCNA 4KTAA 1JC7A 2HD0A 2X4YA 2O5JC 2IL8A 4N9PA 2IG0A 4C8QF 3I90A 1FNWA 1IYUA 3UWNA 2ZGWA 2CZ6B 4BI4A 1SMYC 2XRSD 3BVMA 1SXTA 2BIVA 2PVDB 3DLMA 2K5WA 2F0OA 5JJZA 3NUCA 4A3IB 1BI2A 3H6MA 1M1KU 1VIEA 4C1NI 2M00A 2K03A 3I56A 1WTWA 3EFXD 4A3GB 4C3HG 1KTKA 3CMET 1Z47A 1K9MC 4C5IA 1EYCA 2L8DA 2OTLA 1K83B 2OTLT 1DM0B 3NSWA 3PUZA 1KLUD 4XU3A 4JRKA 1Q82C 2RJCA 1YBYA 4S3SA 1UGSB 2M0OA 2QEJC 3S3NA 1O80A 2VNUD 1CQVA 2F0MA 4Q0FA 3HOYB 1XXGA 1VQ7T 4H13C 3HP9A 3FVQA 3HOUB 4IUVA 1XTDA 5JEAJ 1S5DD 1CT1D 2ZXPA 3DB4A 3M58A 1GUSA 4A3EB 3C46A 1YNNC 2DK3A 1FR3A 2Z1CA 1VQ4A 5FLXL 5CIUA 3AHUA 4BY6C 1TVXA 5FO7B 5CKDA 1F2YA 2NVTB 2F0UA 3FIFA 1K9MU 2YHTA 2EZVA 1HA5A 2QDBA 2F0HA 3PMFA 3SK4A 1IZ6A 4HT8A 5CBEE 5CKHA 1GHJA 5CORA 5AYFA 5EBCA 3OYCA 1L0YB 2NBFA 3JCMQ 1WQ7A 2RHYA 4KULA 3PUYA 3ER0A 1PXUA 1M1GA 3LWIA 2B8AA 3J80E 4UAIA 2Y4YA 3Q6SA 2CHBD 5EPKA 1MGQA 4O5VA 2F0DA 5CV5A 2QI2A 2KK4A 2B2TA 3M57A 1M90C 5CKBA 4QIWB 1D1KA 3G71A 3F2UA 2K05A 1S5FD 4B08A 3OQ5A 1YI2T 3OYAA 4M75F 2QA4A 4M7DG 1EY9A 1EIGA 1S72T 2KAFA 2RHZA 3RIRA 5A0GA 1ENCA 3K59A 1PSFA 4U673 1W2BA 3EVQA 1EZ8A 4C0DB 4L8JA 4YIJA 4BA1I 2TSSA 1G6ZA 1LT5D 2XN9C 4K8IA 2DTOA 1EFID 2XRQD 2YLCA 1BCPB 2RHIA 3MEHA 4C8QG 3RD4A 4EMKC 2DAQA 4M7AA 4HAEA 1MD2D 4LDWA 1SNCA 3NBHA 5KE3A 4XU1A 2RJFA 2PVOB 4DA2A 1EY8A 2R58A 3CCST 2JTMA 1M5Q1 3OW7A 2BE5D 3QPHA 3JCMJ 4CKCA 1U1SA 1XOVA 3QUIA 3SWNA 1W6KA 1WJRA 5CVIA 2B2WC 3HKSA 3ZEHA 4K2KA 4JLIA 2K5LA 4QVDA 4TSSA 2JZ2A 4ELYC 3K5OA 5CV7A 3ND9A 4DOVA 1B4OA 1HTLD 2LX9A 4M77E 1K8OA 5LHY1 4A3BB 1F2ZA 2DVEA 1UEAB 2O01E 1LTGD 2Z4IA 4J6XA 1JRIA 3W3AA 3SXHA 4RCCA 1DYQA 3BZDB 3HG9A 3CD6T 2BE5C 2EOTA 2K4YA 2O5IC 1VQMT 2C5CA 4F87A 1PSEA 2YU9B 2XU8A 1STHA 2JTFA 1Y7XA 3S1QB 2D2CC 4ZN1A 3I4NB 5C3WA 1O9SA 2IJ0A 3E9FA 1BQQT 5GAMf 3MFGA 3WOEA 4XT1B 3MHXA 1LTBD 3DEPA 2K5DA 3D3RA 5IT9L 1QOHA 4DXGA 1HFGA 3OB9A 4QQDA 1B9MA 4BI3A 2PMZB 3M5AA 1GJXA 5E4XA 2F0FA 2JN0A 1ZEQX 4KMUC 2IVWA 4LDVA 2E10A 3VYRA 4R55A 3NFCA 5CV4A 3GPLA 2IWHA 1STNA 4EPCA 4C8QE 3OA6A 3GP8A 5M3FB 4PMBA 4ZTJA 3P75A 4QCLA 3OW2A 2ICEC 5K36G 5KNDA 3M54A 3I70A 1OXTA 4C92D 3OY9A 3KBXA 3KUFA 4C56C 1I4K1 2Y4XA 3IFDA 1UNSA 2FHTA 5IGEA 3VR5A 3OYKA 3HP3A 2B2YC 4KV6A 1QE6A 2XG8D 4BACA 4M75D 2EQKA 4FF2A 3JCMg 2WAQB 1HQRD 3RKWA 1PZID 3M56A 2O4XB 4M7DC 2DPPB 4ZUJA 2A7YA 1JJ2A 1TY0A 5CV9A 2E1HA 1S5BD 2HNIA 2E12A 4J1MA 1Q86C 1RF2D 4PQXA 4KUIA 3V7SA 2KQ3A 3L2UA 1M90U 2PO4A 2IX0A 4QMGA 3ASKA 5GAN8 2F0SA 1V1PA 5KE2A 2BDNA 4UC4A 5CKEA 4MZPA 5CMDA 5M5XB 4O42A 3V8LA 3PNWC 3NQIA 2LQ8A 1YHQA 2IT1A 4XDXA 1BDOA 2HDMA 1N9SA 1D5MC 1IL8A 3IKJA 1C4QA 3K0YA 2EJMA 2JA7B 2B8FA 1BIBA 3RMSA 4KI0A 1TWFB 2NN6G 4I7ZC 2N55A 3CU7A 3HEJA 4II1A 1STEA 4OHJA 4PJOC 2L5QA 3G6EA 3MO8A 1BBXC 2KUMA 2EJFA 2K7VA 2XVSA 5AFWA 3HL8A 1A2UA 4RKBA 2TMPA 1PTOC 2XDDA 4XU2A 4DQ2A 1KG1A 2RDHA 3GNGA 4WFN3 4C92A 1R8OB 2V8KA 2KECA 4EQPA 1B44D 1SSFA 3PO2B 1XYIA 1QJOA 1PYWD 3S1NB 2MF2A 1HPCA 4QVZA 3V7CA 1QP3A 5ELCA 3BVZA 3L3OC 1HRJA 1W4SA 3DLLA 1SDFA 3CCET 5EKKA 2F03A 3VV0A 1VMPA 3OWEB 1KC8U 3A55A 3FPPA 1MI2A 3HOWB 2K57A 2F5TX 3LGLA 3MAQA 5GAOp 3S2DB 1Q12A 3WDNA 5JAVA 1D3BB 3AB9A 1YNND 1JOOA 1FNUA 2KDSA 4PJOB 3GTQB 1ILQA 2BA1A 1GXDC 2B2UC 3TP6A 1Y96A 4BS9A 1Q8IA 3G4SA 2NYZD 3CC7A 2BDOA 5HKCA 1NUCA 2EWNA 3OYMA 2XI9A 3X25B 2ID0A 3MEVA 1V43A 1F9RA 1TWHB 2RSNA 3PUXA 2GF7A 2L1BA 2WINB 1CA5A 4C92E 2QEXA 2R7ZB 3KF8A 5D6YA 3GOXA 3PIO3 3RESA 4M7DD 1Q1EA 4JDSA 2SOBA 1LO5D 2JNGA 2Y0SB 5E1FA 2MUYA 3CCJT 5F2DA 4LAAA 2E2IB 2WIIB 4XTXA 3QJYA 4AYBB 1VQPT 4F7UF 2VXWA 3QO2A 1VQPA 3X26B 3VUBA 2CVRA 1WGSA 1VQ5T 3BS1A 5LJ5d 4Y91A 1PTOH 4RG2A 2F5KA 3D31A 3S1MB 3PMIA 3HOZB 1MHNA 1VQ4T 3FJPA 4A4KA 3IL8A 3QIAA 4C0GA 4XIGS 3L2VA 2A6HC 2LFNA 1ICWA 4ZRZA 5GMKh 4LK1C 2QQAA 3I55T 3BDLA 1B1ZA 3VR3A 2RSOA 4ME5A 2OTJT 4KJNA 1X3QA 2A68D 4BE0A 2B2VC 1VQ6A 2EY2A 3G71T 4X3UA 2WACA 1VQ6T 3JCMX 5J1ZA 2HQEA 4X9DA 1JQYD 4EMHA 4C92B 3ME9A 2VUBA 1VQ9A 3J81L 1LT6D 4KHVA 4OB0B 2M16A 4IUUA 5FO8B 3M4YA 1M1FA 3OHXC 3TMEA 4Y28E 4C0DC 3G7LA 3VKIA 1TS2A 2ENBA 3TU4K 3PMTA 1EL0A 3CCLT 5GANd 4BI8B 3WVDB 3MEUA 5GMKj 4C8QA 4FT4A 2B2WA 1LJOA 3T9NA 3VYSA 1KHIA 2K33A 4F7UB 5M5YB 5FU6C 4HN7A 3FRNA 3M3YB 4LMQD 3S3OA 2FL7A 4ODGA 3R2IA 2DEQA 4M77F 3MP8A 4XU0A 1RTOA 1I3QB 4JBWA 3PV0A 5LJ5j 2RI5A 4M78B 2C06A 4ZGJB 1Y8OB 2O2LD 3PUWA 4P2CB 2RK1A 3MP6A 3HGBA 4J6WA 1WCMB 1Y69U 3NTHA 1AN8A 1QVGS 4M7AB 2PQEA 2DD5A 3TP7A 4B9WA 3UT1A 3BY7A 2KEEA 5GANh 3QYHB 4M7DF 1I4GA 3CCUT 4BY6B 4B9XA 1NAPA 5GANf 1VDZA 3IFTA 1OXXK 1UGQB 5DEHA 3T13A 1I6HB 3F70A 4M77B 1QVFA 5C0XG 3DUZA 1KNEA 5FU7B