3NTIA

Crystal structure of tudor and aubergine [r15(me2s)] complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
163
Chain Sequence
b'ELHNCVVVQFDGPMSFYVQMESDVPALEQMTDKLLDAEQDLPAFSDLKEGALCVAQFPEDEVFYRAQIRKVLDDGKCEVHFIDFGNNAVTQQFRQLPEELAKPARYSRHCELDASTISAALLQSFIDTRFSETFQVEILATKGTGTHVVRLFYQSKNISEKLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maternal protein tudor
publication title Structural basis for methylarginine-dependent recognition of Aubergine by Tudor
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 36
structure length 163
sequence length 166
ec nomenclature
pdb deposition date 2010-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ntiA02
2.40.50.790 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ntiA01
2BIVA 5KE2A 3META 2RI2A 5IAYA 3P8HA 3FC3A 2MWOA 4E7HA 4II1A 2R57A 2X4XA 3OA6A 4E7IA 4CRIA 4BDZA 4IUQA 3LGFA 4QW2A 3NTIA 4N4IA 4B9WA 1WJQA 2GFUA 2RHXA 2K3YA 3LYIA 4IURA 2B8AA 2RJEA 2QQRA 3MP6A 4RG2A 3OYGA 2HQEA 3H6ZA 4HCZA 3OY9A 3L2RA 2LDMA 3MEWA 3QIIA 1WJRA 5M9OA 2IG0A 4IUUA 2DAQA 2LVMA 2RHYA 2X4YA 5D6XA 2FHDA 2O4XB 2QQSA 3PMIA 3OYIA 2EKOA 4BE1A 2O4XA 4NS5A 2EFIA 2R5MA 2BUDA 2EQKA 2RO0A 2JTFA 5CIUA 5C0MA 4X34A 3S3MA 2D9TA 4A4EA 2RHIA 4ZTJA 3QKJA 5D6YA 1RI0A 3ZEHA 3MO8A 2R5AA 3OS0A 4C5IA 4BACA 4IUTA 4BE0A 4FU6A 3OYNA 1H3ZA 3OYHA 4IUPA 3L2QA 4A4HA 2EQMA 5FRMA 2YRVA 3EAEA 4BE2A 1WJSA 2DIGA 4B9XA 3OQ5A 5D6WA 3MP1A 5KE3A 3LX7A 2M0OA 3SD4A 3C4SA 3L2VA 2P0KA 3CEYA 2XK0A 5FROA 5J39A 3OYFA 2VYTA 1OZ3A 2M1HA 2WACA 3MEUA 4PL6A 1OZ2A 3LGLA 4A4FA 4Z02A 5KH6A 4QQDA 2JZ2A 2LRQA 3MEAA 4UC4A 2L89A 3UWNA 2RJDA 3P8DA 3OYAA 2RI3A 2R58A 2LCCA 3PMTA 3L2WA 2XDPA 3OS2A 4N4GA 3OMCA 5FRNA 3FDRA 2RJFA 3M9QA 3PNWC 4BD3A 4N4HA 3QJ6A 4QVZA 3OYMA 2L3RA 3OYCA 3E9FA 1G5VA 3NTKA 3O8VA 2M16A 2CKKA 3OYJA 4C5EA 4C5GA 2F5KA 2GFAA 4C5HA 4LD6A 3DLMA 3LH0A 1KHCA 4EDUA 3S3NA 3OYBA 3OYDA 2RHUA 3E9GA 3OB9A 3OS1A 3MEVA 3KUFA 4QQ6A 2G3RA 1N27A 1OI1A 3OYEA 4E7LA 2MWPA 3UT1A 4OVAA 3ME9A 4BDYA 5C6SA 4FL6A 3S3OA 3OYLA 2E6NA 2X35A 2E5QA 3OMGA 2HQXA 2NLUA 2PQWA 3DB3A 3LLRA 4IUVA 3H8ZA 2RHZA 5J26A 4IKFA 1WGSA 2EQUA 3L42A 4GY5A 1SSFA 2K3XA 3OYKA 3MP8A 3S6WA 3GOXA 3FEOA 1MHNA 2RJCA 4PLIA 2GF7A 3F70A 4QQGA 5KCOA 2EQJA 2RI5A 1OYXA 4E7JA 3L2UA 3PFSA 2LTOA 4E7KA 4ZTFA 4PLLA 3FLGA 2L8DA 4L59A 3BDLA 3NTHA 3ASKA 1XNIA 2X4WA 3DB4A 4Q5WA 3QBYA 5IN1A 4A4GA 5KCHA 2DIQA 3Q1JA 2BKDN
chains in the Genus database with same CATH superfamily
1PTOH 2Q2TA 4BY7B 5IH2A 4F16A 1B1ZA 1KQ2A 2Q2IA 1KQSA 1XYIA 1QWFA 3GTQH 1WLPB 1ONLA 2MP1A 3RBBB 4NB3A 1XQHA 1STAA 1OO9B 4XU2A 2XU8A 4KULA 5I2MA 2KQ3A 4Y7NB 4DV1L 3NHNA 5ELDA 4X3KA 3HOYG 5HY6A 1B2TA 5K5PA 4YHHQ 3RLNA 1Y71A 3RMHA 4OMMA 1DJRD 4J6XA 1E1OA 1ZA2B 3PO2H 2HL5C 1STBA 2VVKA 1TR5A 2EKOA 4DQ2A 3C95A 2EY6A 2NN6H 5M5WH 1J9OA 2D9TA 5I2SA 3CU7A 1SAPA 1J5EL 4BBSB 1B7TA 1QZHA 3SFMA 3OYNA 2QEXA 1VQMQ 3PF4A 2F1LA 1Q90A 2V8KA 1VDZA 2E76C 2L0AA 4LD9K 3EROA 4PV1C 2PU9B 4IUPA 4WRDA 4DAMA 2CYZB 2PYKA 5FU7B 3VV0A 4RG1A 4XDXA 1LV9A 4TKOB 5D3IB 4ZGDB 4H7BA 5L8RE 4IPGA 4EQPA 1H3HA 1X32A 1JB3A 1SJHD 3JB9I 1CZGA 2R7ZG 1Q8KA 3LX7A 1UFFA 3O5ZA 3H94A 3S1RH 2NVQH 4D6WA 4JS4A 3PO3H 1RF2D 4A3BH 1YI2A 1HFNA 2VQFL 1RAEB 1XTDA 4DBHA 1S5CD 2ATCB 1QUQA 4GS3A 4IPCA 5JEAG 5C3EH 1U5SA 1IBLL 1TIID 1RIPA 2HIXA 1V29B 5CYUA 4ABNA 3K81C 5GAMj 1YHQA 2QYZA 3S24A 4Z02A 1KAAA 3MA2B 4I7ZC 1X43A 2LRQA 3OYKA 1ENCA 1H9SA 3T9NA 3G4SQ 2DVJA 3JCMW 4XTZA 4MZTA 5I2XA 5IODA 1Q3LA 4EQ5A 3L2WA 1U1TA 3JCMb 1B3AA 1JJ2A 1KNAA 3E6ZX 1VQNT 3VYTA 2I2LA 1VF5C 2K52A 3RNUA 1LO5D 3PNWC 4BD3A 2L3RA 1UEAB 2ZPHB 2B2YA 3I70A 3VS4A 3O8VA 3HS0C 4OONA 1B3QA 2DY8A 5LJ3h 4YCVA 1R9TH 3SK4A 3W1GA 2GN5A 2AUJD 4C3HH 1Q86R 3HZXA 1HHVA 2B8GA 4LXCA 2R7FA 2ZJRA 4LF5L 2L1BA 4JJNK 1SYEA 5K36H 3NUCA 4K5WA 4KI0A 3QIAA 4O1NA 3GF5A 1WQWA 1Z9ZA 2WB1B 3MC0B 3UE0A 4LF8L 4DV6Q 1AEXA 1OPLA 2RD1A 2F0EA 5H1SE 3G1JA 3M4OH 3Q24A 4XTYA 1WTXA 4L5SA 2CFMA 1VMCA 3GTPB 2E2HB 4XU1A 4KHVA 1JQQA 2WV6D 2ROTA 1KJWA 2NUPB 5CO7A 4DR7L 1OEBA 5IGGA 3VYGA 4IPHA 4GOPA 4KT0E 5D7UA 2OTJA 1S5FD 1TTHB 1KIKA 1YEZA 3S17H 1OV3A 3LWIA 1PFNA 2ED0A 3GBQA 5ISRA 2C5CA 1QCBD 3D4WA 3D8GA 5IY0A 1O75A 3QBYA 1HZBA 3TSSA 3SEMA 4A3FB 3GLXA 3JB9D 4OL7A 1JC7A 1UWVA 4HVWA 2NVTB 3J7A5 4E7HA 3HOUG 4M7DE 4C1NK 1J3TA 1I0CA 2RN8A 2RCNA 1SFOH 4B9WA 1SE8A 1WNLA 4XU0A 3I73A 3V8JA 3TBIB 1TS2A 1Q1BA 2QTVA 5DLQE 3CCJT 2COYA 3VRYA 2KA7A 2LFNA 2X4JA 3MP6A 3EGDB 2D9UA 1ARKA 4NXML 1SE3A 1UB4A 3TS0A 3OYIA 1A3VA 4LF4Q 4X9CA 2B3GA 4IIOA 4J1MA 3KJOA 2RO0A 2RPNA 3S3MA 2KUMA 3AQQA 2JQOA 4DA2A 1RI0A 1H95A 1VS0A 4BY1G 1HR0L 2EPBA 3M9BA 1SKUB 3DEOA 1Q7YU 3JB9J 1FNWA 1HNXL 2UU9Q 4WJWA 4A3KB 3M4YA 1N32Q 4JDSA 4XTWA 3CCJA 3NENA 1EWCA 3LWHA 2DTIA 2AKWB 2CVRA 1D1CA 4M75A 1WTPA 1PH2A 1WHMA 1QNKA 3PUYA 5LMNW 5EGTA 2F0DA 3RLOA 3OYFA 4DV4L 3SHWA 3KOJA 4IPDA 1K8MA 4IOAA 3DHQA 2CT4A 1ZUKA 2JT4A 1LTLA 2E8GA 1S4ZA 2B2YC 4ALPA 5IWAL 1AT1B 1DGSA 2DZ9A 1MD2D 1Y1VH 1Q8IA 3KXTA 4JI3Q 1PRTD 4X64L 4DR6L 2F3WA 4NL2A 3A8JE 5BN3A 3OW2S 2F0SA 1VQMT 2DJQA 4A3JG 1QWYA 1TWFH 2HKNA 2SNMA 1E6GA 2PUKB 2L5QA 4N4HA 1O80A 3WOFA 4F7UE 4KBMB 1R0CB 1M1KR 2Z0SA 3DWPA 2CKKA 2DTOA 3DXJC 3H09A 4IZ8A 1ACMB 4M7AB 3VS3A 1IRXA 3KFUA 1VQOQ 3HOWB 1XWEA 4LFAL 1BI3A 4C5HA 1M8AA 2M0YA 3E2UA 1I6VC 3LH0A 1B9MA 2NVYB 4BA1I 4HJ9A 1PRLC 3OSSC 1KDAA 5CK9A 1Z9FA 2FMMA 3KUPA 3I4NB 4B3RQ 5GANh 3PVLA 1M2OA 3I8ZA 3GIBA 1Y8NB 1NR2A 3ULLA 2UXBQ 4CDEC 3E0EA 1NYGA 4JJCA 4QF4A 1A63A 3QB3A 2E2IB 2RA2A 4JI5L 5CAIA 2HQXA 4X9DA 1S72A 3NWSA 4C2MB 3TP7A 1L1OB 2PQWA 2ZPFB 1GCQA 3A98A 1BUVT 2LT4A 3CC7A 1STNA 2EWNA 3OOCA 1YHBA 2VXWA 2RHSB 5HCKA 3VS5A 1CFMA 2DJGC 1XNRL 4RA8A 1ENFA 4V2SA 3CPFA 5JPNC 5CQXA 5CORA 3T1YL 1AWXA 4JI0L 1N9SA 1X3QA 1HZAA 4VUBA 2EDGA 2ENBA 2HCCA 1MHNA 2VUBA 4PLIA 5A0GA 1TWHB 1KRTA 4XQNA 2JA6H 3CCRQ 2EXDA 2GNCA 3WDNA 1WYDA 2DMOA 1TUCA 4R55A 1P16A 5CV7A 1CKNB 2Z6BA 3HKZE 3CPWA 1F9SA 4PJOA 1IBMQ 1N8RR 5HK3A 1W6JA 2B2UC 4V0BA 2Q8IB 1D1AA 1GHKA 5EBDA 3TU4K 4M7DG 2RI2A 1WVLA 5JJLA 4C0ZA 1K83B 2CP5A 3IKJA 3ZYYX 4UP9A 4ELZC 2K5VA 4WF2A 2E5LQ 1EZ6A 3NBHB 3C46A 1VQKQ 4MTNA 2QA4Q 1NJIU 1D7QA 1TWBA 2X3XD 4K8IA 2RCFA 3KJPA 3GPLA 2FL7A 2E3IA 4RG2A 3OYGA 1ESFA 3ULJA 1GO3E 2Y0SB 3WWVA 5BN4A 2IG0A 4IUUA 3G71Q 3GNGA 2I5HA 4Z88A 5I6YA 3PMIA 2IJ0A 4GNXC 2DY7A 3R93A 5DM7R 5C0MA 2K57A 4POGA 4A4EA 1U0LA 1MNEA 1EYGA 1RKNA 1PMRA 1PDQA 3A8LB 5EPLA 1EQVA 1R4PB 2JM8A 2NTSA 3A56A 1WFWA 4HAEA 5BN5A 3RKYA 2YT6A 3M7NA 3JCMX 1OULA 5GANj 4MDWA 4M78D 2DN8A 3OQ5A 5D6WA 4RWSC 4ZQ3A 5KRUA 1UNSA 1OPKA 4LFCL 5KE3A 1WOCA 4OMOA 1YNND 3K80C 4DR3Q 3MXUA 2BE5C 1BO0A 4NOYA 2L3PA 1B70B 4X66L 1HQRD 2A36A 2IIMA 2LQ8A 3JCMJ 4OB0B 2DEUA 1M8VA 1I3QB 4DK3C 4XYOA 2HD0A 5M3MG 1X69A 1AWOA 2DVEA 4C92C 2C0OA 1BBUA 4KJOA 5C4JB 5IXFA 1NLOC 5JAVA 1W2BP 1HTLD 2CP6A 1G6PA 3AYHB 4M75F 1QJOA 4K8JA 4XTCS 2L3SA 3HEJA 1UGVA 2OTLA 1UHFA 4N4GA 2JM9A 2MGSA 1FXXA 3U58A 1EIYB 4F7UG 1JWMD 3GTOB 2F0TA 3E9FA 4DV3Q 4M7AD 1IHWA 4DV2L 1UTIA 5FWCA 3T16A 3PCOB 1D8LA 4ULLA 2EQSA 1AE2A 1I4K1 2XSCA 5M5XH 1PRMC 1GL5A 4WFN3 2KVQG 4EMGA 1RD9D 2N8NA 2L2PA 4X6AH 1FNVA 1FVIA 1GCQC 4LF7Q 1BYMA 2AHJB 2LJ1A 3KUFA 4PJNA 3FB9A 3C1EA 2PQEA 3CCMT 4J9FA 3CCEQ 2W10A 1QCFA 2N49A 2C06A 1FL0A 1MBYA 3TSWA 2GA4B 2RDHA 4MZPA 4AQYL 3VS6A 1SMYC 1STGA 1EY6A 2CDTA 5LL6X 5KNDA 2KHIA 1VQ4Q 4J6YA 2E74C 1TS3A 2RDGA 5E7NA 5KEEA 2MJ8A 4J9HA 4PJOC 3DUZA 1EEID 1VQOT 4TQUS 2A68C 3VYSA 3S2DB 3CC4T 1QVGA 4CJ0B 1SSFA 2K3XA 4XTXA 3FEOA 2K01A 2B63G 2XRQD 1UUEA 2O2OA 4QVCA 1JR0D 5GAGC 3J7YW 4R8IA 4A4IA 4ZNXA 1OYXA 1VQ5T 1TH7A 3H6MA 5FO7B 1UE1A 3CCSA 3CCMA 4P75A 2B2TA 2MQHA 1W4SA 4UP7A 1BCPF 4MMLA 1U5KA 2EGEA 1Q81U 3ND8A 4HIDA 2BE9B 2P4RA 3FDTA 4A3JH 2MO1A 3HFZB 5KYYA 4IQZA 4YY3L 4IURA 1ZBJA 5CMDA 1LT3D 4HIMA 3GTMB 1LT5D 3S1QH 4BS9A 3IFDA 4FSSA 5FLXc 4JBMA 2OI3A 3S2HB 5C4HA 2EOTA 3V7RA 4UDUC 2BE7D 3HHTB 5CV8A 2GVAA 2X3WD 1QUQB 5IHNA 3OY9A 1UDLA 3SE0A 5LMNQ 3CCRT 2NVXB 1M90U 4B3ML 3CBMA 4Y92A 1E2ZA 2F4VQ 4YCWA 5IYDH 1G91A 2IHFA 2F4IA 1HZCA 4XT1B 2D0OA 1BIBA 2MF2A 4PZ7A 5ELCA 2JN0A 1KNEA 1FX7A 2OEOA 2LQWA 3J7AV 5GQOA 1M1GA 2F0JA 2J7IA 4DOWA 5IXBA 5CR3A 2H5XA 1ICWA 3TZUA 3I4MH 3MHBA 2YRVA 4X62L 4BY7G 2QA4T 2DK3A 1EZ8A 2F0VA 2RQTA 1FR3A 1QB5D 2ZTDA 2O9VA 3M85A 1QVFS 2I46A 6AT1B 3CXCP 2VXFA 1BQQT 1G83A 4FF4A 3SB2A 2VYTA 3CCVA 5IHIA 3G71T 3TDQA 1KDBA 1XMQQ 4PQXA 2AWNA 1KL9A 4A3GB 3BJUA 3HPWA 3HOZH 1B9NA 4JZ4A 2CUBA 1LTGD 2FINB 1EIFA 2COWA 2KBTA 1EY0A 1M4VA 3GTKH 1TS9A 2KOLA 4HCSA 3ZL7C 3OMCA 1YJNT 4C8QE 5GAOn 4PJLA 3OYCA 2C0TA 3QJ6A 3PV0A 4BBSG 2G6FX 2VUMH 2ROLA 3EFOA 1AD5A 4DGZA 2VNUD 1Y57A 2F52A 4LDXA 3ND9A 1M30A 4C5EA 3G48A 3JAML 3WOEA 4QQBX 1F9RA 3UATA 3JCMc 3RZDH 2HEQA 2DILA 4JRIA 2VWFA 2JS0A 5KYXB 1YWOA 7AT1B 1Q12A 4BI8B 4QIWB 3CMAT 1V1PB 2ZTCA 2QDBA 3JAME 2KGTA 3I91A 4A3LH 1BB9A 3P20A 2L11A 2EQIA 4XTVA 1YJNA 2B2VA 3W5OA 3NSWA 3L2ZA 2Z9HA 3GO5A 3A8OB 1R77A 1TUGB 4FL6A 2YU9H 5M3FH 4DNIA 3CCLA 4FSXA 2E5QA 4EVOA 4G7OC 4UY8C 2HSPA 3RUZA 2D1XA 4NPSA 4IO9A 1IBKL 1BR9A 4IUVA 5KGUA 1SSHA 4FVMA 1U4RA 2HBWA 2JOYA 1HJPA 1BBXC 4LFBQ 3KF6A 2FPDA 3GV3A 2ZM6L 1UE5A 5IE8A 4R4CA 1Q7YC 4PFOA 4HSVA 2CHBD 1HNZL 5LJ5j 1Q82U 4NP5A 1PRTC 1T0JA 3L3OC 1TWCH 2CWAA 4C8QA 1LJOA 4EMHA 1KD1U 2E10A 4J9EA 2LC4A 1JO8A 1RODA 2F2VA 3CCET 3CQZB 5J1ZA 3TEHB 1PH6A 1E1TA 3QO3A 2ZXPA 2KXCA 1IREB 3VS0A 3T13A 1HUNA 2JTEA 4RTWA 1VQ6A 4JI7Q 2YXYA 2F0LA 1II3A 4GNXB 5L23A 4ZKCB 2UUAL 1VQ4T 2WB1G 5KYWB 1WCMB 3LYIA 2QEXQ 3A5ZB 3F1ZA 3FRPB 2GBQA 2YLBA 1TXYA 1KHIA 2IT1A 1VQBA 4ANJA 1PTOC 3HOXB 2VB3X 1STHA 3GP8A 1GUSA 1Y96A 5M9OA 3JCMd 5D6XA 3A74A 1C0MA 3L2PA 4K0KQ 3NGPA 1JB7A 4E7ZA 4OX9L 3JCMf 1YI2Q 1C9OA 4HJ8A 1CA6A 3TZDA 3GTJB 5EAYA 1ZA1B 1S5DD 4A76A 2DBKA 1NY4A 4L6V5 1YHQQ 2KNBB 5A35A 4LF9L 2QQAA 3OTOQ 4J5YA 4C92B 2K05A 2EBPA 1GUNA 3CMEA 4A3FG 2JSOA 2RQWA 3MEHA 5GAOq 1X56A 2PI2E 2ESWA 1WA7A 2ZPGB 4OEMB 5CV4A 2HL3A 2F0UA 3RERA 3P75A 1TS4A 1F9QA 1HYOA 2WIIB 3J81i 1I4PA 4LJZC 1N34L 1OZ2A 1UHCA 3G7ZA 4O6JA 3MAQA 3WVEB 2CT3A 2KCCA 3MVVA 4A4FA 4M77E 1UECA 2DL5A 1Y8PB 2F2XA 2Y0SE 1G3TA 2JA5H 4UAIA 1SNOA 1UJYA 1MGQA 3BS1A 1IXDA 2YRDA 4HVVA 1CSPA 5GMKj 1KG1A 3NEMA 3M9QA 1T9HA 2R92H 1AWWA 1VQNQ 4O0AA 3HL8A 2RQVA 1VQCA 2AKKA 3EVQA 2FYKA 2M16A 5FU6C 2IWHA 5A2QL 1Q95G 4POFA 1OOTA 4A3KG 2YUNA 1YWPA 1JU5C 3E5SA 1CSQA 4GN4B 4N0AC 4IFDI 2FRYA 3HRTA 3OW2A 1M5Q1 3SWNC 5BR8Q 3A55A 4NXNL 2VY3A 2AKLA 2VGMA 2KBNA 3PQIA 2RDFA 4DV0L 3QXEB 4DAYB 2M00A 1XPOA 3M0QA 4PJOB 2F0NA 5JJZA 2DX1A 1NJIC 1LACA 1N27A 4K2LA 2B8FA 2MWPA 4C0DC 1KFZA 4BDYA 1IBLQ 3H41A 1SNMA 4F88A 1XNQQ 2LT1A 3REBB 3EH2A 4ZCKA 1XPRA 4DA4A 2PVOB 3EQLC 2DRMA 2EY5A 3OS5A 1K9MR 4JI1L 5FJ8H 2RF0A 1YNNC 2OQ0A 3E19A 3HG9A 1HPCA 3V96A 1K3BC 3I7FA 1K9AA 1WGSA 3BYYB 1SNCA 2CP2A 2E2JB 2K9GA 2PZTA 2OAWA 4IJHA 3MP8A 5JVH3 4M77A 4KMUC 2QQ9A 1E22A 2RJCA 3S16B 2BZYA 2D8HA 2EJGA 1X6GA 3KF8A 1PH3A 2QQBA 3UA6A 2IVWA 3PFSA 4KGZB 3HOWG 1TOVA 2LJ3A 3FKIH 3FLGA 1P92A 1TSFA 3J81L 2PMZB 1RAIB 4JI2Q 4A4GA 4K5VA 2WAQB 5IT9c 4KUDK 4O42A 2MPXC 5DNFA 1NJIR 2JP1A 4PMBA 4LF5Q 3UI2A 1OQKA 3I4NG 4LWCA 3RLFA 4OB2B 1VQ9A 2DM1A 2R7DA 1NYFA 2RH2A 5KNBA 3J81E 1YJ9A 2LCLA 4OWXB 1NBEB 4PFZA 3LGFA 4QW2A 1K8OA 2MI6A 1ZUUA 3H15A 4C8QF 2BDNA 2OCEA 3J7ZC 1B34B 3RN2A 4LF8Q 3A8MB 1WHJA 4ORZA 4LUEA 1Q46A 3EG9A 3A7LA 2IX1A 1NCVA 1G6ZA 3I3CA 3CCJQ 2VQEQ 1FGBD 2LDMA 1VYTA 1RAHB 1VF7A 2QGGA 2LVMA 2M2LA 2O4XB 3E1SA 3A8IE 5JPMC 2QG9B 3L1AA 4QY7A 1I6HH 3CW2C 1OXUA 1D3BB 5CQYA 4DEYA 4ZTJA 3BDCA 3CP0A 1JE4A 4C92D 1G51A 1WDXA 4BE0A 1IHVA 5C4XH 4ZN1A 1B4OA 3SXHA 1D09B 3M59A 2BOSA 5GAN7 3EAEA 1XX8A 2KR3A 2QEXT 4B9XA 1DXMA 1LVKA 3Q8DA 2PQAA 3LH5A 4FIBA 1YHAA 1I94L 3H0IA 2O31A 3Q0AA 3VS1A 3NFCA 1HJDA 2XK0A 2K5WA 2WFWA 2L3QA 1X54A 2WACA 3MZ5A 3SHLA 1N9WA 1MNDA 3AB9A 4BI3A 1JMCA 4UPAA 3S1NB 1CK1A 2VXEA 4M77G 1YI2T 3X20B 1I50B 4KH0B 1ZUYA 2Y0SG 4EQOA 4QGUA 4NXMQ 3T4AC 2IY5B 1SNDA 3MEAA 2X6GA 3I72A 1KQSP 3UPUA 3P8DA 3FJPA 2NUTB 2QXFA 2A3LA 1LTID 1YNZA 1YHQT 2MO0A 3D4DA 3OS2A 1QWEA 2VW9A 4OGCA 3K5NA 2UXCL 3HRSA 3AHUA 5FK9C 2KJXA 4C1NI 1IW7C 4ZRZA 5I6WA 1ASYA 1KLGD 3MXPA 4IFDJ 1Q81C 2XDBA 4C3JB 4RUGA 2CQAA 4HT9A 1SMYD 2VB6A 1S72Q 1SN8A 2PO4A 4A3EB 5D14A 4C5GA 4KGVB 4FT4A 4A3MB 3VYHB 1B7YB 2EYMA 4B3SL 3BW1A 4PJOD 1HUMA 2QDLA 4EMKA 2EYOA 2A68D 3H0GH 3S3NA 3M5AA 2KSSA 1BKBA 2GQIA 1UGQB 3E9GA 3VU3C 3OS1A 1H9KA 2CSQA 4QJFA 2NBFA 5GJWB 3QZ5B 4RAUC 4DV4Q 1IKMA 3OYEA 2ICIA 3U4VA 1N9RA 2BTTA 5GMKi 3F2UA 3TEEA 1ET9A 4A3FH 3G7LA 2F0GA 3EH1A 5J3BA 5DLOA 4ME3A 1M90C 4A75A 1WD0A 2NVTH 1SJED 1PRTB 2PZWA 2AZSA 3HOVB 1PD1A 2RHQB 3HSBA 4X64Q 1HZ9A 4LNQA 1SYGA 2BA0A 1N6AA 3VR2A 3JCMV 2JEBI 2ZJPA 4TSSA 2V1CC 1Q81R 1VOMA 4JI4Q 2PW5A 1TWAB 3N6RA 2GF7A 4RCBA 4BWGB 5CBAE 2KAFA 3S1MB 2DERA 5C5MA 2I5LX 2F03A 4A93B 1FJGL 4DR1L 1QOHA 4L5QA 2OTJT 4PJJA 4LFAQ 1M2VA 3BDLA 1JJ2P 2K5IA 3HRZC 1HRJA 1PTOB 2LNHB 5I21A 1TT2A 1N5ZA 2OQKA 2Q8RE 1CKMA 3TMEA 2ZZDA 3PTAA 1JOOA 2EVRA 4X3TA 4M77F 1GBQA 5IAYA 2PVGB 5HGQA 3GTQB 2CZ6B 3FMCA 1D0YA 4Q0FA 2EYHA 4LW1A 3EGXB 4KKUA 3B6YA 2GVBA 5C44H 1X2QA 5D65A 1H92A 1E0BA 4KD4A 5ELBA 2B2WC 1D1KA 2BCOA 4JI5Q 2HNIA 2E2DC 3PO2B 1IYVA 1AHJB 5CBEE 1PH1A 4JI6Q 4Z9CB 1HK9A 1PXUA 3PGGA 5I2YA 3I35A 2EYJA 2R93B 5M5WB 1X3FA 2HDAA 3M4GA 2DJFC 3T1YQ 3OIQA 2ATWA 4HMJA 4JI0Q 3AFPA 1EYCA 4KUIA 2ECZA 4IIMA 1WJJA 3BE3A 2F0WA 3QR8A 3J80c 3MKDA 3KDFA 3CCUT 1I07A 1F9PA 1AZEA 2AT1B 1P8LA 3IRBA 5CV6A 2EW3A 4HJ7A 3QDFA 2UUCL 3JCMh 5GAN3 1I4XA 2B86A 2O5IC 4LUDA 2VB2X 2XWBB 3A7AB 4G7ZC 2B29A 3PO3B 2E41A 2NVQB 5ELEA 4R4QA 4A3BB 2KY9A 4QUCA 5CV5A 1M27C 2ZT9C 4R0KA 3X25B 3HOWH 5GADC 4G4KA 4YTLA 5C3EB 5DAUA 2PTKA 4CC4B 4E7SA 2LQNA 1AZGB 1IL2A 1ZX6A 1YBYA 4WTOB 5C4ZA 1M8MA 5KYUA 1LTSD 2HQHA 5LJ3j 3CCUA 2XWJB 2CZ1B 2Y90A 3I9QA 4FM4B 4DXGA 4RTYA 2NN6I 2JZ2A 1A15A 3AT1B 1NNXA 2K03A 3PMTA 3SWNB 1QVFA 2EJFA 3DWAA 3VR4A 1BU1A 4EMKC 5LL6S 2QF7A 4TVRA 1EWHA 2E2IH 2JA8B 1Q82C 4QKUA 2DXUA 1E7ZA 1SHGA 2PZUA 2HHHL 2DLPA 1EOTA 4IALA 5CKFA 4C0DB 1KD1C 4F17A 5IP7G 4DUYQ 2VZAA 3UDGA 2D0QB 1XTCD 3MJXA 4C3HB 4ME7A 3GTLH 3C0CA 1VQJA 2LSSA 4M78B 2LKVA 2PW7A 2GTOA 4DV7L 3R8BA 1PC0A 2Z8LA 1IXRA 1CA5A 4LFCQ 4J7IA 4QCLA 2R61A 4XQJA 2K2VA 1EU3A 2FVUA 4JRQA 1K73U 4X66Q 4M7DA 5HGTA 2KMTA 1EY5A 1K76A 3EJIA 4A3GG 4GKKQ 1HNWL 1LTRD 3CCMQ 1OX8A 3TSZA 5T1IA 3IAYA 4DOVA 3S3OA 2D0PA 1M9SA 2E6NA 3OMGA 2DL3A 1K83H 3OHXC 4Z8AA 2ABLA 3HOYH 1UGPB 2MCNA 3QOJA 4ZUJA 5FW9A 1Q1EA 4BI4A 2YYZA 2QASA 2KRSA 1Q82R 1S72T 2N88A 4FW2A 4ILWA 3PUZA 1EZZB 1IL8A 5LMUQ 4OB1B 3GOXA 3CC7T 1MV0B 2CQOA 3CC4Q 4DV2Q 1NZ9A 3S17B 3K6OA 4C3IB 2KDSA 4E7JA 1G8ZD 3X3NA 3A1PA 1PTOD 1VQ5Q 1L0YB 1NBWA 2HDMA 2FJ2A 2P4TA 4Q5WA 1PNJA 1G2SA 2IHEA 4K5XA 3Q1JA 1VQPA 1RJTA 4GLKA 3E3XA 5CVIA 3EFRA 2D6FA 1BI0A 3QPHA 4GOPC 2GTJA 1CTMA 1SFOB 2J6KA 1SE4A 3C2PA 4KJNA 3QG1A 4J8OA 4O5VA 4FCYA 2ALYB 4OMFB 1L0WA 3H3VH 3N52A 2JMAA 3M4PA 4C56C 2R7ZH 3JV3A 2KK4A 3CCQT 3KBXA 2JK8A 2R6GA 4KN7C 1W1FA 1S5ED 2JYOA 4FF3A 4LK1C 4AQYQ 8ATCB 4Y28E 1EX4A 3SR1A 5JEAH 3L0OA 4FYWB 5IP9G 3MEWA 3RMQA 2DNUA 2LXJA 4BE1A 1I3QH 4DV6L 3I2ZA 4NS5A 3EHQA 1LTAD 2Y4XA 4HR7B 5C4JH 1F1BB 3CCVQ 1JQYD 1RHPA 1V43A 2R5AA 4F7UA 1TY2A 1GXDC 4DNTB 4DR4Q 2AIRB 4OIJA 1H3ZA 2IL8A 2QW7A 2IX0A 1QLYA 4K2KA 2PMZE 3CCQA 4A4HA 1ZHIA 2YLCA 5HURA 2WAQE 2JJ9A 2QILA 4YY3Q 5C0XG 3RZOH 1PA6A 2EKHA 4DN4M 4LNPA 5GAN4 2ZTEA 3UE1A 1EQQA 4AYBB 4FYYB 4M8AA 1Z7TA 4DUZQ 2EJFC 3CEYA 3FHWA 5FROA 1WCMG 2J0TD 3PUXA 1VQGA 4R9WA 3UDIA 4E6IA 5GAOr 3CPWP 1WTQA 3K5MA 4J6WA 1D5ZC 3HOXG 1Y1VB 2UXDL 2Z4HA 3EN2A 2IW3A 1RABB 4PZ6A 2YUOA 5KH6A 3DMUA 1BBZA 1PG5B 3UWNA 4M75C 2TMPA 1Y1WG 1AZQA 2EVBA 1TWFB 2JW4A 1X9NA 3G6EA 2MPMA 1GM5A 1S40A 3FDRA 1F2ZA 3C3LA 4O2DA 1AOJA 1YJNQ 1XXGA 1VIEA 4KN4C 4B3TL 3WVDB 2OTLT 1HCZA 4ZKBB 2YRCA 5I9PA 4A3DB 2CW0D 2HSEB 2JNGA 4RTVA 3OYJA 3CCLQ 4P5NA 1M3BA 3VUZA 1WHLA 4OP0A 3THKA 2XIWA 4CC2A 1WZOA 3GP7A 3K7AH 3MXNA 4X62Q 1PCXA 2CZ7B 3I5RA 1LABA 4JBKA 3QZ9B 4OO1G 4RGMA 1GOZA 1SG5A 2LX7A 3P1HA 2DL8A 3HFNA 3CMAQ 1TY0A 4QQ6A 1KC8U 4DR5Q 3J7AF 4E2FB 2K14A 2MOXA 1BF4A 3HOUH 2H8HA 3OBYA 1K28A 2FG0A 1TKWB 3CHBD 2V1QA 3OYLA 4JOIA 3TS2A 2A37A 1OXTA 1T3SA 3NXWA 1U9RA 4JI3L 4JI2L 2XDDA 1OX9A 3DB3A 1ABOA 1K4US 3EG9B 4LF6L 1U4PA 1VQ6Q 4M7DF 2F2WA 2HT1A 1GHJA 2EQUA 3H91A 3KLSX 2EY1A 2JA6B 1E2VA 2RSOA 1YCYA 3CC2T 2K5LA 1ZSZA 4AIMA 4QQGA 2J06A 2NVXH 4OMQA 4E7KA 4Q5VA 4PLLA 4JI8Q 1BCPC 1YNJC 3NTHA 4RTXA 5IN1A 1QCNA 5ELFA 1IYUA 4BY1H 3CCST 4L8JA 2DZCA 4DR2Q 2QTXA 2R3ZA 5DM63 3P8HA 3HP3A 2ZCFB 1RACB 2MIOA 3QWXX 2R57A 5JVG3 3VYRA 5GAN6 3M0PA 1V76A 2Y4YA 2ZAEA 4E7IA 1GVPA 3BDOA 3K7UC 3F2CA 2HBPA 2NWGA 4XXEA 3VYUA 2GFUA 2K3BA 2Z0WA 1QNUA 3E0JA 5FLXL 1WXBA 3CC2A 1M4ZA 5ECAA 1RUWA 3BDUA 1ZXTA 1V9PA 2KCTA 2HQEA 1TWGH 3S15H 1IBKQ 3QIIA 5C6AA 3V8KA 2ICEC 5D3DA 5FLXE 2RHYA 2FFKB 5FWBA 4XAXB 2KRNA 2MYSA 4HKEA 3QSUA 2ZPEB 5DY9A 3BVMA 3D31A 2ZM6Q 1XJVA 2K1BA 1SSOA 1TUDA 1YN8A 1VQLT 1STEA 1BOSA 1QVPA 3T56B 3GTGH 3DLLA 1EY8A 1X3GA 2K75A 1NTGA 3PT9A 4QT7A 2A74C 2A73B 1PH8A 2WAQG 3H9NA 5JOBA 3JAMi 2QGQA 1QVGP 4JLIA 1O7IA 4F7XA 3HP9A 4HCBA 1CHQD 1QP3A 2WB1E 1B53A 2NB0A 5CKBA 1IW7D 1D5MC 3L2VA 2HUGA 3CF5A 1SRUA 4F7UF 5GAN8 2UUAQ 2PNHA 1PH7A 4K6LA 3TVTA 4GLVB 4PNYA 2DXTA 1VQLA 3J81j 3CCVT 4HJ5A 3VR5A 4P73A 1PWTA 1Q86U 1H9SB 3AU7A 4MHEA 4QQDA 4UC4A 2DRKA 2L89A 1PFBA 5IIFA 5JJIA 1ZKOA 2DJZA 1VQ7A 5GAMf 4BXXG 1AFPA 1A2TA 1U3OA 3JRZA 3M56A 5GAOl 1Z6HA 4OX9Q 2MUYA 4RGTA 4XK8E 1T5XD 1VYUA 4MDXA 5L37A 4DPGA 5IYBG 3EHRA 1FMVA 5I11A 2KHSA 4YWLA 4LF9Q 2RQRA 1VUBA 4WCIA 3JB9G 2ID0A 1M3CA 1KAWA 3IFTA 5ELOA 2F5KA 2G9DA 4PMWA 3K58A 2WSCE 4WORA 2ZXRA 5GAMg 4M4ZA 4JOIC 3M57A 4GBQA 2AK5A 4RH6A 1V1CA 4Z89A 3QO2A 4UP8A 4RKUE 1EUJA 1M2VB 4APVA 1PV4A 3MEVA 4KGXB 5C5LA 3KLWA 4IOCA 1EFWA 2DXCA 1W6XA 2N55A 4KH1B 3BZKA 2CZ0B 4L5TA 2XHCA 3U9SA 2EYXA 4F04B 1CHPD 1B8AA 1YJWA 1NSNS 3ER0A 3QWYA 5C0XH 2EZVA 2NLUA 3H0HA 3ULRB 1SYBA 1W3SA 4XU3A 2YDLA 4AG2C 3REAB 1U06A 1LLRD 2SDFA 4NKLA 3T1HL 3CCLT 4LN2A 1VQ9Q 1WCMH 1PM3A 3OSOA 1YJ9Q 2X9HA 3A8HB 2EYZA 2NUPA 4GOPB 5M5YH 2RNAA 1IO6A 2EY2A 4C3JG 4D8KA 3MPUB 4A3EG 5GAMe 5IGFA 1Y1WH 2KXDA 1B44D 3STBC 5T1GA 4A3MG 1WTRA 3K8AA 2L8DA 2E3HA 1ET6A 4A3IB 4OWWB 4M78E 3S14B 3HTRA 4A3CH 3P8BB 3L7ZC 3URYA 2A19A 3S1QB 2VS1A 3V7SA 2EJMA 5I9OA 4J15A 4ELYC 5IGEA 2FZKB 4RMFA 4G57A 1PH5A 4BDZA 2A5HA 1HR0W 1SHFA 3VJPA 1DYQA 2B2TC 1G2TA 2HAXA 1VQ6T 2BZXA 2K3YA 4LF7L 4DK6C 3TCJA 3HOVG 1TG0A 3OYYA 4JI1Q 2V8JA 1T3LA 4OO1H 2HQLA 5M3MH 1KDCA 3EGDA 2EYPA 1BNZA 5KYUB 2A6EC 5FU7C 4JLGA 3EG0A 3MCAB 2EAYA 4M7AE 3DM3A 4N8X1 3TP5A 1N33Q 2F0PA 5IGCA 2RK1A 2G9HD 5AFWA 2VC8A 4A93G 3Q23A 4XYQA 3X3MA 1RTOA 4IUTA 3I4MB 1BK2A 4DV5L 2JTMA 3IL8A 4EQNA 3RNJA 3L2QA 4GLAC 4ID6A 1HSQA 2CGHA 3K0XA 1AZPA 2M9UA 2LNVA 2C35B 4MMKA 1S5BD 1K73C 1WJSA 2I07B 4M75B 1FMKA 2YWWA 1PZJD 3CMET 4HA8A 1GKHA 3R2IA 2XTIA 1XJWB 4R4OA 2KEAA 2P0KA 2JE6I 1M1KU 1WQ7A 2EPDA 3MEUA 1YITA 2PNRC 1D6EC 3ONAB 3HOZB 5NUCA 1SRMA 1AVZC 3PO2G 2A1AA 3LGLA 2LMCB 4IN3A 3HFOA 2DA9A 2NZOA 1Q7YR 4HT8A 1EY7A 5EJWA 4GLXA 2XRSD 2NN6G 4YWMA 3U50C 4PKCC 3LX0A 2R93G 4TRDA 3OWFA 2L0CA 1UG1A 1D1BA 4J9GA 5IOCA 4KHPQ 4WJ4A 1MI2A 2VUMB 1U8RA 2RJFA 2GQVA 2LJ0A 1YIJT 5LMNL 1RLQC 2AZVA 4CJ2C 1QE6A 1L0XB 1I4GA 3DKMA 4RTTA 3K5OA 4A63B 2KVMA 1H9RA 1WHKA 2B63H 3M58A 5EKLA 3QDRB 2MMPA 2V1RA 1I1JA 1PYSB 3PO3G 1GJXA 3W2DA 4A3BG 4H02A 4DV1Q 1I94Q 1ZYRC 4JC0A 4AYBE 1LT6D 1LOJA 1EU4A 1LM0A 4P2CB 4ZK9B 3BFMA 5C3EG 4JUVA 2F0KA 2V26A 2N3SA 3LGJA 2OWOA 1GRIA 2YU9B 3RR6A 5IGDA 3GDEA 5M3FB 4CKCA 1YIJA 5GAN5 1JXMA 3OIPA 2WSFE 2MHVA 3P7JA 1BDOA 1BCPB 1N8RU 4KY5A 1L1OA 5CGKA 1XMQL 2CP3A 1IKLA 1J5EQ 2Q2UA 2UXCQ 2F0IA 2JA8G 1W2BS 1I5OB 2O9SA 2B2VC 3MTSA 1XOVA 3S6WA 1I4QA 3U9OA 2VASA 4AFUC 4FF1A 1TWCB 4C3HG 1F2LA 5ELNA 1TVXA 2JUFA 2SEMA 4M78G 4ZUIA 4HSPA 1LCKA 5EPKA 1CKNA 4BXXH 1CQVA 3DB4A 4RCNA 2OTJQ 1JBMA 2AUKA 2HDLA 4B3SQ 2VQFQ 2K50A 5K36G 1HXYD 2DL7A 2ZJQA 3U23A 1DCZA 1UGRB 3NPFA 4BBRB 2MWOA 4OGEA 2PI2A 4MNOA 5IT9L 3AMUA 2CW0C 4BY7H 1DOKA 4CC3A 3GD7A 3NTIA 3JB9H 4JBWA 4C8QC 1VQ9T 3NBHA 2UUBL 3OW2P 4Y7NH 1YJ9T 5AJ3L 3M54A 5IT9E 4V190 2QQRA 4L5GA 3OSVA 2K4YA 3I55A 3H6ZA 4ZAIA 5FLMG 1CKAA 3VA7A 3GQBA 3NE5B 4N9PA 4PZ8A 2JMCA 3QYHB 1N36L 2EIFA 1K8AU 1D1IA 4M7AG 1L2FA 2BH2A 2K33A 1RDPD 2J05A 4H13C 5CIUA 4C3IG 1I50H 4LE9A 5EQ0A 3VR6A 4J9IA 2A08A 2CP0A 1F2YA 1FJGQ 1STYA 4DR1Q 1O7LA 4FU6A 1ZEQX 3VDYA 3CCUQ 4LFBL 4BBSH 2D62A 1PD0A 2DBMA 4M75D 5E4WC 2PPBC 3RDVA 3FIFA 5GAOm 1EFNA 3A8GB 2DIGA 1U4LA 1QMCA 1KC8C 4BUGA 1QP2A 1NUCA 2OX7A 4C3JH 2AHOB 4XT3B 2E5KA 1VQ8A 2M02A 3HKZB 1R0BG 3FJ5A 4RG8A 5CKEA 4AFQC 1QKWA 5GANf 1TS5A 4M7DD 1OZ3A 1OXXK 2V4DA 3MXGA 3PUWA 1EOVA 4J9CA 1K1ZA 2L9HA 3PSIA 4DR7Q 4UHVA 1AH9A 1ZQ1A 4K11A 2JA5B 4EX5A 1BI2A 4OMLA 2J4XA 3JSCA 3F2DA 4HXJA 2RI3A 3HGBA 2XDPA 2R92B 1Y8OB 1A62A 5GANg 1JT8A 1WX6A 4QVZA 1A3UA 4KKSA 3HOVH 2DF6A 1YNXA 4K0KL 1ENAA 1SE2A 2K6AA 4FP5D 2UUCQ 4TVAB 2F3IA 4YWKA 1X75C 2C0IA 1KC8R 3U4ZA 1ZSGA 3S9WA 3EFSA 2HCIA 3MFYA 4AYBG 3EGUA 4ZN3A 3M0TA 1JB0E 1FYCA 3OYBA 3OYDA 4K6DA 1YVCA 3J80i 3SK6A 4CJ1B 1Y1VG 4M7AF 2LS01 1BCPD 1YNJD 1A8VA 3CXCS 3I56T 1I5LA 3G6JB 3Q6SA 5GANe 1VQPQ 1PZID 2NYZD 2YTXA 3H8ZA 4JZ3A 4QB4A 1HR0Q 4JVZA 3OW7A 2RQXA 4QMGA 2P0PA 1A6XA 2E2HH 3GTPH 4A3DG 5CV9A 1I4HA 4LDYA 5J22A 1HNXQ 3ZJYC 2HHHQ 5FOBB 3CC7Q 2HD3A 1SPKA 4HIKA 3FKIB 4R8NA 2L4NA 3RN5A 4CGYB 3ZBDA 2L5TA 4ZTFA 2R93H 4S3SA 1S3OA 1J8IA 1XNIA 3URGA 4DV7Q 5KYYB 1J6QA 2EJ9A 1PFMA 1OU8A 1B07A 3I56A 1WTHA 8AT1B 1SR3A 2SEBD 2BIVA 4M77C 2X69A 1K0SA 2M9VA 5IWAQ 1MGSA 4X65L 4II1A 2EJGC 2JA7B 2PCFB 1G8XA 4JYAL 1UEBA 4JV5L 5BR8L 1HNWQ 5EBCA 4DR6Q 1MJCA 2RHXA 1K0XA 1Q86C 4AH6A 3PIPA 1PHTA 3I5SA 4HCKA 3PIOA 3CCQQ 1SXTA 2LXKA 4R4IA 1WTVA 3PUVA 1VYVA 4HCZA 1C4QA 3ITPA 3M0RA 2KEEA 3M3YB 4MIUA 1RADB 1XNQL 3TQYA 3CD6T 2JA6G 3H3VC 1I6HB 5TSSA 2EFIA 2JXBA 2BUDA 2JTFA 4G7HC 1MJEA 2RHIA 3F8TA 3QKJA 5C4XB 2K5NA 2L12A 4QIWE 2KRMA 1O7ZA 3J80L 3X28B 1PFSA 3N5BB 4J8QA 2XKOC 2KYBA 2EQMA 2JA8H 2FHTA 4RGNA 1T0HA 3G6EQ 2HCKA 1WYXA 3SK5A 1M90R 4LUZA 3RKWA 4A3KH 4DAPA 1KXLA 3MP1A 1HTPA 3J80E 1VQAA 3TP8A 2A8VA 3CD6A 2QGFB 1JEGA 2WINB 3CQTA 1FWZA 4KRTA 4PG3A 1VQFA 1XNRQ 2F3VA 2NUZA 4E47A 4RKLA 3V2TA 2Z1CA 2JVVA 4RFBA 4ATOA 1VQNA 1DOMA 1WTWA 3OYAA 2IPOB 1VQDA 4GKJL 1E3PA 2QDYB 5CKDA 2F0OA 3VR3A 2YSQA 1KTKA 2W0ZA 2Z6KA 1SEBD 5EPJA 1PVOA 2EYQA 1G5VA 3FEWX 4RHSA 3OYMA 2VQEL 3EFOB 1G2BA 3NTKA 2KQWA 2MNAA 2QAZA 1R8OB 4FXKC 5FLMH 2OTLQ 4QL5A 3S1RB 2NZ1D 4M1UB 1FNUA 4AT1B 4C0GA 1GUWA 4BB7A 5E4XA 2GFAA 2F0QA 3H0GB 1CKBA 1R4QB 1JXOA 3F2BA 1XMOL 3HKSA 1O9SA 4M75E 1NM7A 5CC4A 4C3IH 5KYXA 1HA6A 1PYBA 3QOLA 4KY7A 5KNCA 1V1PA 1WXUA 1JWUD 2NVYH 5FU6B 1M1FA 1EIHA 4E7LA 5COYA 4BY6C 2MFIA 4DFAA 3I4NH 2FXQA 1A2UA 3STBD 1MSHA 2UXDQ 4XQ3A 1KQ1A 1NEBA 4IUNA 4YHHL 1TU0B 4NL3A 4OGQC 2VGNA 4RHRA 4DBRA 4C2MH 1AE3A 2ASBA 3E9IA 3LLRA 4IKFA 2RVLA 3VKIA 2J6FA 3RUXA 1RAAB 3KF6B 1R9TB 2B2UA 3D6CA 1HFGA 4GY5A 3NWTA 2OJ2A 4C92E 2DPPB 4B3TQ 4E6RA 2O2LD 3F70A 2DUDA 3L2UA 3BY7A 3CC2Q 2LTOA 5EC7A 4A54A 1TWHH 2QKIC 1KIXA 4PJMA 4C8QB 3EBEA 4KY6A 5LJ5d 2M51A 4L59A 1QVFP 2H4OA 2X4WA 1E7OA 2HKQB 5KCHA 3A8KE 2DXBA 5LJ5f 2CWPA 2A6ED 4R1JA 2DKGA 2K5FA 4RTZA 3I4OA 1OU9A 3CCSQ 2O88A 2A0FB 1M1KC 1DM0B 1Z47A 5C44B 5GAEC 3M4OB 1VQPT 4JRKA 3PVQA 3OA6A 4CRIA 1PSFA 2D8JA 3LWEA 5C3WA 2ZGWA 4GNXA 1JOQA 1C8CA 1W70A 5KYWA 3H0FA 1NR4A 2WKCA 3CBPA 3SVMA 2C9OA 2RJEA 3CRLC 4DBQA 5LJ5g 4JG2A 3VS2A 1AWJA 2LCSA 2KROA 1QCOA 1AN8A 1Y96B 1KD1R 1E24A 4DUZL 1YZ6A 4J9BA 1HH2P 4N9TA 4LF6Q 4GZYC 5C3XA 2QQSA 1UAPA 3MFGA 4DNRB 1CSKA 1WI7A 3PE0A 2DYBA 3FRNA 2R5MA 5G3LF 1CQFA 3SDZA 1V1QA 4X34A 2A69C 3X26B 5D6YA 1EL0A 5F2DA 1MKHA 2J7ZA 1VQLQ 4IJLA 4HEDA 4A3IG 2DFUA 1GUTA 2DE0X 1Y69U 2CH4A 3KYHC 1EYDA 4PJOE 4N8FA 4C92A 5I22A 1I4RA 4JI4L 5FRMA 3TRZA 1VQ7Q 4ODGA 1BCOA 1PSEA 4A3DH 1DD2A 3AEVA 4JJBA 5GAN2 1SNQA 3D0FA 3KFVA 3SD4A 2IPKD 1NLPC 4FO2A 4YIJA 2Z6KC 4PFPA 1MMNA 3UDCA 5LJ5e 4MTKA 1PH9A 3NP8A 2DL4A 2XIDA 3VS7A 1N8RC 2AQ3B 1VQMA 2K4KA 3CKIB 3A5UA 1PHJA 3G4ST 4LMQD 4OIKA 4OF1A 4L5RC 1UE7A 4OMPA 5IYDG 2RMOA 1CKOA 1ZYRD 2DTHA 2R58A 2I0NA 4C0FA 2LCCA 4H44C 5GAHC 4JS5A 2A28A 2XICA 1C6VX 5FRNA 3QJYA 1JORA 2CCZA 2E1HA 2MAMA 4FDBA 4JI6L 3FPUB 3SGIA 3G6ET 3GTOH 3I4MG 4RCCA 2EYYA 2HMAA 1YJWQ 1LNXA 4ESRA 3GTLB 2LQKA 4JPBW 1K9MU 1H641 1CI3M 4B08A 5JJKA 2PVDB 9ATCB 4M75G 1HD3A 2RBMA 2I0QA 1MMDA 2DD4A 3G4SA 1KHCA 2LP5A 1BXTA 3UDFA 1NMFA 3OB9A 2RSNA 3BZCA 4DAYA 3I90A 3HOZG 1OI1A 1JE5A 2QK0A 1VQIA 4OVAA 2OAUA 4OMNA 4ZGEB 3QHSA 3VA5A 2EE1A 1NE3A 2AMCB 2RKSA 3PIP3 2K5QA 4B3MQ 3HOYB 3PIO3 2X35A 1YP5A 2NTTA 1K8AC 2YTYA 2DO3A 2YUQA 4P71A 4RMOA 1EWIA 1YFNA 2RHZA 4YCUA 2RK2A 4DK0A 2VUMG 4M7DC 2CUDA 2VKNA 4RTUA 4P74A 4C92G 1MIUA 4LF4L 4M77B 1PLFA 1BI1A 1LPLA 3S2DH 1KQSS 3KF8B 4C8QD 4PNOA 3RMSA 2WP8J 5KCOA 2E70A 4GLMA 1TU2B 2A6HC 5HKCA 2OT2A 3L9AX 4IFDG 3EIVA 4R56A 2JEAI 2HZYA 5HK0A 2KT1A 1F77A 3ASKA 1G3YA 4HMIA 1IHZA 2UU9L 2RF4A 2DIQA 2RM4A 4A3LG 4LUVA 1N32L 3JCMQ 3V05A 5GMKe 3K57A 1JJGA 1W2BA 4DUYL 4L6TB 1HA5A 2F0FA 1TXQA 5IGBA 1X6BA 2P5ZX 1K8GA 4DAVA 2MK5A 1XPUA 3I4LA 3R2TA 3ICEA 2R7ZB 2X4XA 1BVSA 5M3FG 3GTMH 2XNAC 1WJQA 4HVUA 1K8AR 1V8QA 3D3RA 3S2HH 2QEJC 3MEFA 2CREA 2ZPBB 1B34A 1IGUA 1GCPA 2CKZB 3RKXA 2O01E 3L2RA 1G3WA 4FXDA 4GKKL 1QZGA 4MZ9A 1C1AA 3Q22A 3T1HQ 1B50A 2XVSA 3BVZA 4ZLTF 5GAOp 2DGYA 4FW1A 2O4XA 1GUGA 3ERQA 2Q2HA 4P72A 1YITQ 3INZA 2Z4IA 3OS0A 4OXPA 1D3BA 1KK7A 3MO8A 3LWUA 4XTUA 1WFQA 1H8KA 4BACA 4LUOA 1O7YA 1X01A 3NK9A 2K32A 3R3OA 4PJOG 3MWYW 5AT1B 1SMXA 1SEMA 1MHWC 5FO8B 5LMUL 2D0NA 3RZOB 5IP7H 4U68A 2NWMA 2GGRA 2P0QA 1DOLA 1E6HA 1VQEA 2PQAB 2RA4A 2XGTA 3CRKC 4BBRG 2FB7A 3H3VI 2PZ1A 1JJ2S 1GFCA 1MSGA 3PMFA 5J39A 3CMEQ 2E75C 1I81A 2QCPX 4B3RL 2M1HA 3GV6A 1O78A 1C0AA 4PL6A 2UXBL 4DU9A 4DBFA 4C92F 3NPPA 5DM73 3M7GA 3SEBA 2DYIA 5E3FA 1A0IA 5GJVB 1K0RA 2K5HA 4A3GH 3R6NA 4HCCA 1HNZQ 2NUTA 1HXDA 4OHJA 1NAPA 3M0SA 4DF7A 2X51A 1S1NA 2BA1A 1PH4A 2XD0A 1VQHA 2RQUA 1FGUA 1K3RA 2BZ8A 1VQ7T 1Y0MA 2K04A 1YIJQ 1A3TA 1MUZA 4BY6B 2YTVA 4DV5Q 1QVCA 3K7AB 1KRSA 2JJQA 5E1FA 3V8LA 5IYCG 5KYLA 4Y91A 1RAFB 4EMKB 2LX9A 1UJ0A 1SBBB 3DLMA 4DR4L 1IBML 3D7SB 2DEQA 4EDUA 1GFDA 4FF2A 1WXTA 2K6DA 3HKZG 2RHUA 1IZ6A 2N78A 4LDUA 2WSEE 4H0LC 4RGOS 2F0MA 3HOUB 4CDCC 3K5LA 4A3IH 2E5LL 5GAMd 3UT1A 2JA9A 3S14H 3ME9A 4CDFC 1TQOA 2L55A 3ULPA 1JICA 2JA5G 5GMKl 1G3SA 2XN9C 4X1VA 1VQOA 4X3SA 3CC4A 3FVQA 2R92G 4M77D 1YJWT 1ILPA 1KABA 2KCNA 5M5XB 4PJOF 1NG2A 4A4KA 1VQ5A 5IP9H 4K14A 3W3AA 1WD1A 4B6MA 2YV5A 2IX3A 4BA2I 2DETA 3CXCA 3C94A 1AEYA 2F1MA 3M4QA 5AYFA 2FEIA 1T5EA 4BY1B 3I55Q 2ZPIB 1MMGA 1WTOA 2ENMA 2J6OA 3FPPA 4R4TA 3V7CA 3W1BA 4Y52H 3NQIA 1SYFA 4KTAA 5KYNA 1LTTD 1MV3A 1N34Q 1IB8A 2CSIA 3CQZH 2BKDN 1KSWA 3CBOA 3META 1UGSB 2H3EB 2KE9A 2DNCA 1OXSC 1WPYA 3CAMA 4I65A 4DR3L 1ZSZC 5KYIA 1AW7A 1VQKT 4FNFA 5LJ5h 3SK8A 2OXPA 3EGXA 4LDVA 4N4IA 2DNEA 1FYNA 1CZWA 5FJ8G 3CCRA 3MHXA 1TWGB 5I4DA 3S15B 3UDXA 2K28A 1MMAA 1Y07A 4DR5L 4J7FA 1I8FA 1X65A 3HOXH 2E12A 1JCKB 4RKBA 1ILQA 2FHDA 2EYFA 1VQ8Q 3M0UA 3WXMB 4A3JB 1ZLMA 2E64A 1EY4A 3GTGB 3FKIG 5FKAC 3QWNA 3KDFB 3OWEB 4DV3L 3ZEHA 3GTJH 2D2CC 1X27A 3E9HA 4ZYSA 4C5IA 1D0ZA 1OTCA 4NXNQ 1SNPA 1VQKA 2SOBA 5IHKA 2QA4A 1RTNA 3NQTA 4DV0Q 1RAGB 1M3AA 4GN5A 3QUIA 1YCSB 3RIRA 4DKAC 1VA7A 4DXFA 4BE2A 5LHY1 1PKTA 3ERSX 2CH4W 4J9DA 2WKDA 3G71A 1WI5A 2NYSA 5JEAJ 2JA7G 1LUZA 1F2MA 1IGQA 4JI8L 4IFDH 4AMCA 4NMZA 4CC7A 2X6LA 4FYDA 1SYDA 4DR2L 4EIKA 1BIAA 4F14A 2UUBQ 1NPPA 5AJ3Q 2K7AA 2QI2A 4JJDA 1LYLA 4NDXA 3JB9F 2F69A 4U673 1JRIA 1YITT 1JWSD 4I7AA 1ESRA 4CHTB 2EGAA 5LJ3d 1PZKD 2ZXOA 4CKEA 2RJDA 1U1SA 4KV6A 5A0DA 1N36Q 4N0AA 2I5MX 5LJ3f 3SWNA 2V8IA 4PMCA 3TREA 2KEDA 4A3CG 2XMFA 2EYLA 5C4XG 2YHTA 4HIOA 1FMWA 3JAMc 4DK1A 1EFID 1GD7A 4FYVB 1G291 3K59A 3RESA 2G5DA 1GBRA 2PNIA 3CMAA 2XI9A 4EPCA 3JCMP 1SRLA 1QILA 5CR2A 3BU2A 1AP0A 1KLUD 1C7YA 4LD6A 5LJ3g 4M78A 5GMKh 1X3EA 4CDDC 3A54A 4MZMA 2KHJA 4OB3B 3EG1A 3OPOA 2F5TX 1FD7D 4M7DB 2G3RA 3QYGB 3KLSA 3GTKB 1GXIE 1I5FA 4J83A 4PK4A 5DEHA 1X2KA 5C6SA 5G3LD 3K0YA 5FO9B 4XQQA 1EEFD 3UF4A 2YUPA 4BBRH 1Y14B 2KYMA 1ZBXA 1OXVA 2FPFA 3IQLA 2B39A 1SYCA 3I56Q 1GUOA 2CP7A 3CPWS 3NHHA 1QKXA 3EA6A 3BVGA 3DWQA 2E4HA 1E2WA 3DM1A 4CBVA 4WJ3M 5M5YB 2F4VL 4HN7A 2E6ZA 2JS2A 4LAAA 2JXMB 1K73R 1JJCB 3TN2A 4M7AA 3RZDB 2E2JH 1BCMA 1Y1WB 2RI5A 4L63B 1NE8A 3CCEA 4FT2A 3S16H 3M53A 5LJ3e 1VMPA 4KHZA 1PRTF 3T51B 1BBWA 3M55A 3H0GG 1DONA 1UUPA 2BDOA 2NZHA 1SLJA 2JN4A 1SDFA 2FRWA 5A0LA 3GNFB 1VQ4A 3NBIA 5KE2A 1ICFB 3FC3A 4AG1C 2A69D 2ES2A 5C0XI 4EGVA 1X55A 3FP9A 4IUQA 1UE6A 4FYXB 3JCMg 2VV5A 3BZDB 3TP6A 5IYCH 3UA7A 3LNNA 4AFSC 5M3MB 3NELA 2B8AA 4ZGJB 1PTOF 1RI9A 3D4RA 1DJ7B 1WJRA 1EY9A 1QW1A 3EFXD 2DAQA 2X4YA 2AQ1B 3R6OA 3I55T 1IYJB 3AFQA 1D2BA 2LMJA 1Z9QA 3CD6Q 2EQKA 4FXGC 2TSSA 1EIGA 4HTHA 1U4MA 1PYWD 4F7UB 1H9JA 2AQ2B 2SNSA 3X24B 1K9MC 3PF5A 4C8QG 1CUKA 3D6WA 1A0NB 2A7YA 2H3JA 2RB6A 3LW5E 3OYHA 4OELB 2EGCA 3KLRA 1RLPC 3RD4A 1V1OA 5IYBH 3C12A 1NEGA 3KK7A 4GN3B 4KLKA 3T53B 1ML0D 1EQRA 4QVDA 3BG3A 5C44G 3C1FA 4X65Q 3JCMe 4CKBA 2M0OA 3C4SA 4JYAQ 4JV5Q 2GCXA 4MN3A 4OO1I 2K79A 2FZGB 5A2QE 2D5DA 4RCOA 2K2MA 2CS7A 1VQ8T 2HIVA 1QQJA 3HRUA 1WHHA 3S1NH 1X6OA 1ASZA 1LTBD 1RL2A 1CM9A 2AWOA 4J6HA 5EKKA 5CKHA 4AFZC 1X3PA 2LY7A 5KIXA 2DD5A 3EG3A 4M78C 3PGZA 3ZFJA 2FZCB 4CI0C 2KT8A 2XG8D 2F0HA 3BYTB 4OWTB 2KI7A 5GMKm 2FMCA 2B63B 3VRZA 1QG7A 3DEPA 2KECA 1NMGA 5GANd 1NPRA 4KKTA 4F87A 3KBGA 1N33L 3MXNB 4HCEA 3O13A 5EKIA 4A3EH 4X3UA 2Q8TA 1DZ1A 4JCVE 4A3MH 2K7VA 4DEXA 5GROA 1WIEA 1D5XC 3TQ7P 1RCVD 3A0JA 4JW0A 1LT4D 4JI7L 2NUCA 2LZ6B 2A6HD 1UE9A 1QVGS 1H9MA 3EG2A 4F8MA 2O5JC 4KK7A 4JRPA 4NW2A 2ED1A 5EG2A 2EXZA 4M7AC 1SROA 1SF9A 1WHGA 2COZA 3RR5A 4JBJA 4ME5A 1PKSA 4M78F 1CT1D 2K5DA 4QUFA 2JA7H 2SRCA 4GKJQ 4HJAA 1C48A 2EYWA 3VUBA 5J26A 2BH8A 2OF1A 3JC66 4JK1C 5GAMh 2FO0A 1EQTA 3L42A 2FPEA 4LDWA 4XIGS 1D0XA 1ZSZB 4KD3A 2EQJA 2KENA 4A53A 1Y7XA 1EYAA 1W6KA 2BE5D 2E65A 2VL6A 1TWAH 3J81c 3M3YH 3S1MH 4KHPL 2PUOB 3OBWA 1HQMC 2P84A 1L1OC 4A93H 5CCAA 2B2WA 1ABQA 3OTOL 3NMZC 4D8DA 2H1EA 1XMOQ 2KCMA 1JOKA 1VCIA 5C0XJ 2L15A 1VIFA
chains in the Genus database with same CATH topology
1PTOH 4BY7B 1B1ZA 1KQ2A 1KQSA 1XYIA 1ONLA 2MP1A 1XQHA 1STAA 1OO9B 4XU2A 2XU8A 4KULA 5I2MA 2KQ3A 4Y7NB 5ELDA 4X3KA 5HY6A 1B2TA 5K5PA 1Y71A 3RMHA 1DJRD 4J6XA 1STBA 1TR5A 2EKOA 4DQ2A 3C95A 2EY6A 2NN6H 1J9OA 2D9TA 5I2SA 3CU7A 1SAPA 4BBSB 3SFMA 3OYNA 2QEXA 1Q90A 2V8KA 1VDZA 2E76C 3EROA 4LD9K 4PV1C 2PU9B 4IUPA 4WRDA 2CYZB 2PYKA 5FU7B 3VV0A 4XDXA 5D3IB 1LV9A 4TKOB 4ZGDB 4H7BA 5L8RE 4EQPA 1X32A 1JB3A 1SJHD 3JB9I 1CZGA 3LX7A 3H94A 4D6WA 4JS4A 1RF2D 1YI2A 1HFNA 1XTDA 1S5CD 5JEAG 1TIID 1V29B 5CYUA 4ABNA 5GAMj 1YHQA 4Z02A 1KAAA 3MA2B 4I7ZC 2LRQA 3OYKA 1ENCA 1H9SA 3T9NA 3JCMW 3MTSA 5I2XA 4XTZA 4MZTA 5IODA 1Q3LA 3L2WA 1U1TA 3JCMb 1B3AA 1JJ2A 1KNAA 3E6ZX 1VQNT 3VYTA 2I2LA 1VF5C 1LO5D 3PNWC 4BD3A 2L3RA 1UEAB 2ZPHB 2B2YA 3I70A 3O8VA 3HS0C 2DY8A 5LJ3h 3SK4A 2AUJD 3HZXA 1HHVA 2B8GA 2L1BA 4JJNK 1SYEA 5K36H 3NUCA 4K5WA 4KI0A 3QIAA 4O1NA 3GF5A 1WQWA 2WB1B 3MC0B 1AEXA 2RD1A 2F0EA 3Q24A 4XTYA 1WTXA 1VMCA 3GTPB 2E2HB 4XU1A 4KHVA 2WV6D 5CO7A 5IGGA 3VYGA 4KT0E 2OTJA 1S5FD 3LWIA 1PFNA 5ISRA 2C5CA 1QCBD 3D4WA 3D8GA 1O75A 3QBYA 3TSSA 4A3FB 3GLXA 3JB9D 4OL7A 1JC7A 2NVTB 4E7HA 4M7DE 4C1NK 4B9WA 1WNLA 4XU0A 3I73A 3V8JA 3TBIB 1TS2A 1Q1BA 5DLQE 3CCJT 2LFNA 2KA7A 2X4JA 3MP6A 2D9UA 1SE3A 1UB4A 3OYIA 1A3VA 4X9CA 4J1MA 2RO0A 3S3MA 2KUMA 4DA2A 1RI0A 2EPBA 3DEOA 1Q7YU 3JB9J 1FNWA 4WJWA 4A3KB 3M4YA 4JDSA 4XTWA 3CCJA 1EWCA 3LWHA 2DTIA 2CVRA 4M75A 1WTPA 1QNKA 3PUYA 5EGTA 2F0DA 3OYFA 1K8MA 3DHQA 1S4ZA 2B2YC 2DZ9A 1MD2D 1Q8IA 3KXTA 1PRTD 2F3WA 4NL2A 3A8JE 5BN3A 3OW2S 2F0SA 1VQMT 1QWYA 2SNMA 2PUKB 2L5QA 4N4HA 1O80A 3WOFA 4F7UE 4KBMB 3DWPA 3DXJC 2CKKA 2DTOA 3H09A 4IZ8A 4M7AB 3HOWB 1XWEA 1BI3A 4C5HA 1M8AA 1I6VC 3LH0A 1B9MA 2NVYB 4BA1I 1KDAA 3OSSC 5CK9A 2FMMA 3KUPA 3I4NB 5GANh 3I8ZA 3GIBA 1Y8NB 1NR2A 4QF4A 3QB3A 2E2IB 2RA2A 5CAIA 2HQXA 4X9DA 1S72A 3NWSA 4C2MB 3TP7A 2PQWA 2ZPFB 1BUVT 3OOCA 2LT4A 3CC7A 1STNA 2EWNA 2VXWA 1CFMA 4RA8A 1ENFA 4V2SA 3CPFA 5JPNC 5CQXA 5CORA 1N9SA 1X3QA 4VUBA 2EDGA 2ENBA 2HCCA 1MHNA 2VUBA 4PLIA 5A0GA 1TWHB 4XQNA 3WDNA 4R55A 5CV7A 3CPWA 1F9SA 4PJOA 2B2UC 5HK3A 1W6JA 4V0BA 2Q8IB 1GHKA 5EBDA 3TU4K 4M7DG 2RI2A 1WVLA 4C0ZA 1K83B 3IKJA 3ZYYX 4ELZC 4WF2A 1EZ6A 3C46A 1NJIU 4K8IA 3GPLA 2FL7A 4RG2A 3OYGA 1ESFA 2Y0SB 5BN4A 2IG0A 4IUUA 3GNGA 5I6YA 3PMIA 2IJ0A 2DY7A 3R93A 5DM7R 5C0MA 2K57A 4A4EA 1RKNA 1PMRA 1PDQA 3A8LB 5EPLA 1EQVA 1R4PB 3A56A 2NTSA 4HAEA 5BN5A 3RKYA 3M7NA 3JCMX 5GANj 4MDWA 4M78D 2DN8A 3OQ5A 5D6WA 4RWSC 4ZQ3A 5KRUA 1UNSA 5KE3A 1YNND 3MXUA 2BE5C 1BO0A 4NOYA 1HQRD 2LQ8A 3JCMJ 4OB0B 1M8VA 1I3QB 4XYOA 2HD0A 2DVEA 4C92C 4KJOA 5C4JB 5JAVA 1HTLD 4M75F 1QJOA 4K8JA 4XTCS 3HEJA 2OTLA 4N4GA 2MGSA 1FXXA 3GTOB 4F7UG 1JWMD 2F0TA 3E9FA 4M7AD 3T16A 4ULLA 1I4K1 2XSCA 4WFN3 2KVQG 4EMGA 1RD9D 1FNVA 1BYMA 2AHJB 3KUFA 3FB9A 3C1EA 2PQEA 3CCMT 2C06A 1MBYA 2GA4B 2RDHA 4MZPA 1SMYC 1STGA 1EY6A 5LL6X 5KNDA 2RDGA 4J6YA 2E74C 1TS3A 5KEEA 2MJ8A 4PJOC 3DUZA 1EEID 1VQOT 4TQUS 2A68C 3VYSA 3S2DB 3CC4T 1QVGA 4CJ0B 1SSFA 2K3XA 4XTXA 3FEOA 2K01A 2XRQD 4QVCA 1JR0D 3J7YW 4R8IA 1VQ5T 1OYXA 5FO7B 1TH7A 3H6MA 3CCSA 3CCMA 2B2TA 1W4SA 1BCPF 4MMLA 1Q81U 3ND8A 3FDTA 4IQZA 4IURA 5CMDA 1LT3D 3GTMB 1LT5D 4BS9A 3IFDA 3S2HB 5C4HA 2EOTA 3V7RA 4UDUC 3HHTB 5CV8A 3OY9A 3SE0A 3CCRT 2NVXB 1M90U 3CBMA 1E2ZA 1G91A 2F4IA 4XT1B 1BIBA 2MF2A 5ELCA 2JN0A 1KNEA 1FX7A 2OEOA 3J7AV 1M1GA 2F0JA 3TZUA 4DOWA 5CR3A 1ICWA 3MHBA 2YRVA 2QA4T 2DK3A 1EZ8A 2F0VA 1FR3A 1QB5D 3M85A 1QVFS 2I46A 2VXFA 1BQQT 4FF4A 3SB2A 2VYTA 3CCVA 3G71T 3TDQA 1KDBA 4PQXA 2AWNA 4A3GB 3HPWA 1B9NA 1LTGD 2FINB 1EIFA 1EY0A 1M4VA 2KOLA 4HCSA 3OMCA 1YJNT 4C8QE 5GAOn 3OYCA 3PV0A 3QJ6A 4DGZA 2VNUD 4LDXA 3ND9A 4C5EA 3JAML 3WOEA 1F9RA 3JCMc 4JRIA 1Q12A 4QIWB 4BI8B 3CMAT 1V1PB 2QDBA 3JAME 3I91A 3P20A 2L11A 4XTVA 1YJNA 2B2VA 3NSWA 3L2ZA 3GO5A 3A8OB 4FL6A 4EVOA 3CCLA 4FSXA 2E5QA 4G7OC 3RUZA 1BR9A 4IUVA 5KGUA 4FVMA 1U4RA 2JOYA 1BBXC 3GV3A 1Q7YC 4HSVA 2CHBD 5LJ5j 1Q82U 4NP5A 1PRTC 3L3OC 4C8QA 1LJOA 4EMHA 1KD1U 2E10A 1RODA 2LC4A 3CQZB 3CCET 5J1ZA 3QO3A 2ZXPA 1HUNA 1IREB 3T13A 1VQ6A 2F0LA 1II3A 4ZKCB 1VQ4T 1WCMB 3LYIA 3A5ZB 3FRPB 2YLBA 2IT1A 1KHIA 1PTOC 3HOXB 2VB3X 1STHA 3GP8A 1GUSA 1Y96A 5M9OA 3JCMd 5D6XA 3JCMf 1CA6A 3GTJB 3TZDA 1S5DD 4L6V5 5A35A 2QQAA 4J5YA 4C92B 2K05A 1GUNA 3CMEA 2JSOA 3MEHA 5GAOq 5CV4A 2ZPGB 2F0UA 3RERA 3P75A 1TS4A 1F9QA 2WIIB 1I4PA 4LJZC 1OZ2A 3G7ZA 4O6JA 3MAQA 3WVEB 2KCCA 3MVVA 4A4FA 4M77E 1Y8PB 1G3TA 4UAIA 1SNOA 1MGQA 3BS1A 5GMKj 1KG1A 3M9QA 3HL8A 3EVQA 2FYKA 2M16A 5FU6C 2IWHA 5A2QL 3E5SA 4N0AC 4IFDI 3HRTA 3OW2A 1M5Q1 3SWNC 3A55A 2VGMA 2RDFA 3QXEB 2M00A 5JJZA 4PJOB 2F0NA 1NJIC 4K2LA 1LACA 1N27A 2B8FA 2MWPA 4C0DC 4BDYA 1SNMA 4F88A 2LT1A 4DA4A 2PVOB 3EQLC 2EY5A 3OS5A 1YNNC 3E19A 3HG9A 1HPCA 3V96A 1WGSA 3BYYB 1SNCA 2E2JB 2PZTA 3MP8A 5JVH3 4M77A 4KMUC 2QQ9A 3S16B 2RJCA 2EJGA 3KF8A 2QQBA 2IVWA 3PFSA 3FLGA 1P92A 3J81L 2PMZB 4A4GA 4K5VA 2WAQB 4KUDK 4O42A 5DNFA 2JP1A 4PMBA 3UI2A 3RLFA 4OB2B 1VQ9A 2RH2A 5KNBA 3J81E 1YJ9A 2LCLA 3LGFA 4QW2A 1K8OA 2MI6A 4C8QF 2BDNA 1B34B 3A8MB 3A7LA 2IX1A 1NCVA 1G6ZA 3I3CA 1FGBD 2LDMA 1VF7A 2LVMA 2M2LA 2O4XB 3E1SA 3A8IE 5JPMC 3L1AA 1OXUA 1D3BB 5CQYA 4ZTJA 3BDCA 1JE4A 4C92D 4BE0A 4ZN1A 1B4OA 3SXHA 3M59A 2BOSA 5GAN7 3EAEA 1XX8A 1DXMA 2QEXT 4B9XA 4FIBA 3Q0AA 3NFCA 2XK0A 2K5WA 3SHLA 3MZ5A 2WACA 3AB9A 4BI3A 3S1NB 1CK1A 2VXEA 4M77G 1YI2T 3X20B 1I50B 4EQOA 3T4AC 1SNDA 3MEAA 2X6GA 3I72A 3UPUA 3P8DA 3FJPA 1LTID 2QXFA 2A3LA 3D4DA 1YHQT 3OS2A 4OGCA 3K5NA 3HRSA 3AHUA 5FK9C 2KJXA 4C1NI 1IW7C 4ZRZA 5I6WA 1KLGD 3MXPA 4IFDJ 1Q81C 2XDBA 4C3JB 2CQAA 4HT9A 1SMYD 2PO4A 4A3EB 5D14A 4C5GA 4FT4A 4A3MB 3VYHB 2EYMA 3BW1A 4PJOD 1HUMA 2EYOA 4EMKA 2A68D 3S3NA 3M5AA 2KSSA 1BKBA 3E9GA 1UGQB 3VU3C 3OS1A 1H9KA 2NBFA 4RAUC 3QZ5B 1IKMA 3OYEA 2ICIA 1N9RA 5GMKi 3F2UA 3TEEA 1ET9A 3G7LA 2F0GA 5J3BA 5DLOA 1M90C 1WD0A 1SJED 1PRTB 2PZWA 3HOVB 3HSBA 1SYGA 2BA0A 1N6AA 3VR2A 3JCMV 2JEBI 4TSSA 2PW5A 1TWAB 3N6RA 2GF7A 4RCBA 4BWGB 5CBAE 2KAFA 3S1MB 5C5MA 2F03A 4A93B 1QOHA 2OTJT 3BDLA 3HRZC 2K5IA 1HRJA 1PTOB 5I21A 1TT2A 2Q8RE 3TMEA 2ZZDA 3PTAA 1JOOA 4X3TA 4M77F 3GTQB 5IAYA 2PVGB 2CZ6B 3FMCA 4Q0FA 2EYHA 4KKUA 5D65A 1E0BA 4KD4A 5ELBA 2B2WC 1D1KA 2BCOA 2HNIA 2E2DC 3PO2B 1IYVA 1AHJB 5CBEE 4Z9CB 1HK9A 1PXUA 3PGGA 5I2YA 2EYJA 2R93B 5M5WB 3M4GA 3OIQA 4HMJA 1EYCA 4KUIA 2F0WA 3CCUT 1F9PA 5CV6A 3JCMh 5GAN3 1I4XA 2O5IC 2VB2X 2XWBB 3A7AB 4G7ZC 3PO3B 2E41A 2NVQB 5ELEA 4A3BB 2KY9A 4QUCA 5CV5A 2ZT9C 3X25B 4G4KA 4YTLA 5C3EB 5DAUA 1YBYA 5C4ZA 2XWJB 1LTSD 3CCUA 5LJ3j 4DXGA 2CZ1B 2Y90A 4FM4B 2NN6I 2JZ2A 1A15A 2K03A 3PMTA 3SWNB 1QVFA 2EJFA 3DWAA 3VR4A 4EMKC 5LL6S 2QF7A 4TVRA 1EWHA 2JA8B 1Q82C 2DXUA 2PZUA 4IALA 1EOTA 5CKFA 4C0DB 1KD1C 2D0QB 1XTCD 4C3HB 4ME7A 4M78B 2LKVA 2PW7A 3R8BA 2Z8LA 1CA5A 4QCLA 4J7IA 2R61A 4XQJA 2K2VA 1EU3A 2FVUA 4JRQA 1K73U 4M7DA 5HGTA 2KMTA 1EY5A 3EJIA 1LTRD 5T1IA 3IAYA 4DOVA 3S3OA 1M9SA 2E6NA 3OMGA 3OHXC 1UGPB 3QOJA 4ZUJA 1Q1EA 4BI4A 2YYZA 2N88A 1S72T 4ILWA 3PUZA 1IL8A 4OB1B 3GOXA 3CC7T 1NZ9A 3S17B 3K6OA 4C3IB 2KDSA 1G8ZD 4E7JA 3X3NA 1PTOD 1L0YB 2HDMA 2FJ2A 2P4TA 4Q5WA 1G2SA 4K5XA 3Q1JA 1VQPA 1RJTA 4GLKA 5CVIA 3EFRA 2D6FA 1BI0A 3QPHA 1CTMA 1SFOB 1SE4A 3C2PA 4KJNA 3QG1A 4J8OA 4O5VA 4OMFB 3N52A 4C56C 2KK4A 3CCQT 3KBXA 2R6GA 4KN7C 1S5ED 2JYOA 4FF3A 4LK1C 4Y28E 3SR1A 5JEAH 3MEWA 3RMQA 4BE1A 4NS5A 1LTAD 4HR7B 2Y4XA 1JQYD 1RHPA 1V43A 2R5AA 4F7UA 1TY2A 1GXDC 4DNTB 4OIJA 1H3ZA 2IL8A 2IX0A 4K2KA 3CCQA 4A4HA 1ZHIA 2YLCA 5HURA 2QILA 5C0XG 4DN4M 5GAN4 4AYBB 4M8AA 1Z7TA 2EJFC 3CEYA 5FROA 2J0TD 3PUXA 4R9WA 4E6IA 5GAOr 1WTQA 3K5MA 4J6WA 1D5ZC 1Y1VB 2Z4HA 2IW3A 3DMUA 5KH6A 3UWNA 4M75C 2TMPA 1AZQA 2EVBA 1TWFB 3G6EA 2MPMA 3FDRA 1F2ZA 3C3LA 1XXGA 1VIEA 4KN4C 3WVDB 2OTLT 1HCZA 4ZKBB 4A3DB 5I9PA 2CW0D 2JNGA 3OYJA 4P5NA 3VUZA 4OP0A 2XIWA 3GP7A 3MXNA 2CZ7B 1LABA 3QZ9B 4OO1G 4RGMA 1GOZA 3P1HA 3HFNA 1TY0A 4QQ6A 1KC8U 3J7AF 1BF4A 3OBYA 1TKWB 3CHBD 3OYLA 1OXTA 3NXWA 1U9RA 2XDDA 3DB3A 1U4PA 4M7DF 1GHJA 2EQUA 3H91A 3KLSX 2EY1A 2JA6B 1E2VA 2RSOA 1YCYA 3CC2T 2K5LA 4QQGA 4E7KA 4Q5VA 4PLLA 1BCPC 1YNJC 3NTHA 5IN1A 5ELFA 1IYUA 3CCST 4L8JA 2DZCA 2QTXA 2R3ZA 5DM63 3P8HA 3HP3A 2ZCFB 2R57A 5JVG3 3VYRA 5GAN6 2Y4YA 4E7IA 3BDOA 2HBPA 2NWGA 4XXEA 3VYUA 2GFUA 3E0JA 5FLXL 1QNUA 3CC2A 1M4ZA 3BDUA 1ZXTA 2HQEA 3QIIA 5C6AA 3V8KA 2ICEC 5D3DA 5FLXE 2RHYA 2FFKB 4XAXB 4HKEA 3QSUA 2ZPEB 5DY9A 3BVMA 3D31A 2K1BA 1SSOA 1VQLT 1STEA 1BOSA 1QVPA 3T56B 3DLLA 1EY8A 3PT9A 2A74C 2A73B 5JOBA 4JLIA 4F7XA 3HP9A 4HCBA 1CHQD 1QP3A 1B53A 2NB0A 5CKBA 1IW7D 1D5MC 3L2VA 2HUGA 4F7UF 5GAN8 4K6LA 4PNYA 2DXTA 1VQLA 3CCVT 3VR5A 3AU7A 1Q86U 1H9SB 4MHEA 4QQDA 4UC4A 2L89A 1PFBA 5IIFA 1ZKOA 2DJZA 1VQ7A 5GAMf 1AFPA 1A2TA 3JRZA 3M56A 5GAOl 1Z6HA 2MUYA 4RGTA 4XK8E 1T5XD 4MDXA 2KHSA 2ID0A 1VUBA 3IFTA 3JB9G 4PMWA 3K58A 2F5KA 2G9DA 2WSCE 4WORA 2ZXRA 5GAMg 3M57A 4RH6A 3QO2A 4RKUE 3MEVA 5C5LA 2DXCA 2N55A 2CZ0B 2XHCA 3U9SA 1NSNS 1CHPD 5C0XH 1YJWA 2EZVA 3ER0A 2NLUA 1SYBA 4XU3A 1LLRD 2SDFA 4NKLA 3CCLT 3OSOA 3A8HB 2EY2A 4C3JG 5GAMe 5IGFA 1B44D 5T1GA 1WTRA 2L8DA 1ET6A 4A3IB 3S14B 4M78E 3P8BB 3L7ZC 3URYA 3S1QB 3V7SA 2EJMA 5I9OA 4ELYC 5IGEA 4G57A 4BDZA 2A5HA 3VJPA 1DYQA 2B2TC 1G2TA 2HAXA 1VQ6T 2K3YA 3TCJA 3OYYA 2V8JA 4OO1H 1KDCA 2EYPA 1BNZA 2A6EC 5FU7C 4JLGA 3MCAB 2EAYA 4M7AE 3TP5A 2F0PA 5IGCA 2RK1A 2G9HD 5AFWA 2VC8A 3Q23A 4XYQA 3X3MA 1RTOA 4IUTA 3I4MB 2JTMA 3IL8A 4EQNA 3L2QA 4ID6A 2CGHA 1AZPA 2M9UA 2LNVA 4MMKA 1S5BD 1K73C 1WJSA 2I07B 4M75B 1PZJD 3CMET 4HA8A 3R2IA 2P0KA 2JE6I 1M1KU 1WQ7A 3MEUA 1YITA 2PNRC 3HOZB 1D6EC 3ONAB 5NUCA 2LMCB 3LGLA 4IN3A 3HFOA 4HT8A 1EY7A 5EJWA 2XRSD 2NN6G 4PKCC 3LX0A 4TRDA 3OWFA 2L0CA 5IOCA 1MI2A 2VUMB 1U8RA 2RJFA 2GQVA 1YIJT 4CJ2C 1QE6A 1L0XB 1I4GA 3DKMA 3K5OA 2KVMA 1H9RA 3M58A 5EKLA 3QDRB 2MMPA 1GJXA 3W2DA 1ZYRC 1LT6D 1LOJA 1EU4A 4P2CB 4ZK9B 3BFMA 4JUVA 2F0KA 2YU9B 5IGDA 5M3FB 4CKCA 1YIJA 5GAN5 3OIPA 2WSFE 2MHVA 3P7JA 1BDOA 1BCPB 1N8RU 4KY5A 5CGKA 1IKLA 2F0IA 1W2BS 2B2VC 3U9OA 1XOVA 3S6WA 1I4QA 4FF1A 1TWCB 4C3HG 1F2LA 1TVXA 2JUFA 4M78G 4ZUIA 4HSPA 5EPKA 1CQVA 3DB4A 4RCNA 2AUKA 1JBMA 2HDLA 5K36G 1HXYD 1DCZA 1UGRB 4BBRB 2MWOA 4OGEA 5IT9L 3AMUA 2CW0C 1DOKA 3GD7A 3NTIA 3JB9H 4JBWA 4C8QC 1VQ9T 3NBHA 1YJ9T 3M54A 5IT9E 4V190 2QQRA 4L5GA 3OSVA 2K4YA 3I55A 3H6ZA 4ZAIA 3VA7A 3GQBA 3NE5B 4N9PA 3QYHB 2EIFA 1K8AU 1D1IA 4M7AG 2K33A 1RDPD 4H13C 5CIUA 4C3IG 5EQ0A 3VR6A 1F2YA 1STYA 1O7LA 4FU6A 1ZEQX 2D62A 4M75D 5E4WC 2PPBC 1U4LA 3FIFA 5GAOm 3A8GB 2DIGA 1KC8C 4BUGA 1QP2A 1NUCA 4XT3B 1VQ8A 3HKZB 4RG8A 5CKEA 5GANf 1TS5A 2V4DA 3MXGA 4M7DD 1OZ3A 1OXXK 3PUWA 2L9HA 1ZQ1A 2JA5B 1BI2A 2J4XA 3JSCA 2RI3A 3HGBA 2XDPA 2R92B 1Y8OB 5GANg 4QVZA 1A3UA 4KKSA 1ENAA 1SE2A 2K6AA 4FP5D 1X75C 3S9WA 3EFSA 2HCIA 3MFYA 4ZN3A 1JB0E 1FYCA 3OYBA 3OYDA 4K6DA 3SK6A 4CJ1B 4M7AF 2LS01 1BCPD 1YNJD 3CXCS 3I56T 1I5LA 3G6JB 3Q6SA 5GANe 1PZID 2NYZD 4QB4A 3H8ZA 3OW7A 2RQXA 4QMGA 2P0PA 1A6XA 5CV9A 1I4HA 4LDYA 5J22A 5FOBB 3FKIB 4R8NA 2L4NA 4CGYB 3ZBDA 2L5TA 4ZTFA 1J8IA 4S3SA 1XNIA 3URGA 2EJ9A 1PFMA 3I56A 2SEBD 2BIVA 4M77C 2M9VA 1MGSA 4II1A 2EJGC 2JA7B 2PCFB 1UEBA 5EBCA 2RHXA 1Q86C 3PIPA 3PIOA 1SXTA 1WTVA 3PUVA 4HCZA 1C4QA 3ITPA 2KEEA 3M3YB 4MIUA 3CD6T 3H3VC 1I6HB 5TSSA 2EFIA 2BUDA 2JTFA 4G7HC