1EFNA

Hiv-1 nef protein in complex with r96i mutant fyn sh3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
b'ALFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FYN TYROSINE KINASE
publication title Crystal structure of the conserved core of HIV-1 Nef complexed with a Src family SH3 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (sh3 domain/viral enhancer)
total genus 9
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1996-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1efnA00
5L23A 2KR3A 5IHNA 1Y0MA 2ESWA 4OMMA 2D8JA 1MV3A 4F14A 2CT3A 4EIKA 1OV3A 2HDAA 1QKWA 4OMLA 2AZVA 2E5KA 3LH5A 2K7AA 2DMOA 1W1FA 2BTTA 1T0JA 1SRLA 2L3SA 1X6GA 4JZ4A 1HSQA 3U23A 1WYXA 1M3AA 2DL8A 2KE9A 2KYBA 1PKSA 1Z9ZA 2EYWA 2P4RA 3QWYA 2DJQA 4RTUA 2RF0A 2F2XA 4LE9A 1GFDA 1X27A 1U5SA 2ED1A 1WIEA 2FO0A 2K2MA 1BB9A 2J6KA 1G2BA 3M0PA 2I0NA 2LZ6B 2DL7A 1ZLMA 3NGPA 4Y92A 1UGVA 1NLOC 2A28A 4A63B 4M4ZA 1WXUA 2EYYA 2MIOA 2EVRA 5I22A 2IIMA 3H41A 1VYUA 2LJ0A 1I0CA 1UHFA 3VS3A 3M0TA 4JJDA 4J9EA 2DX1A 1AZEA 2GNCA 1WLPB 2H8HA 5FWCA 2L0AA 2DA9A 2CSIA 3EG0A 2RQWA 2JTEA 4CC4B 1JO8A 1WX6A 1B3QA 2KT8A 3M0QA 2RQTA 1WXBA 3VRYA 4AFQC 3KFVA 1AZGB 2C0TA 1E6HA 1RUWA 5GJVB 2JW4A 3ZL7C 1ABQA 2PNIA 2ROTA 1BK2A 1N5ZA 5GJWB 1AD5A 1QKXA 4WCIA 2C0OA 2LP5A 1RI9A 2L3QA 1ZUUA 2W0ZA 1JU5C 4J9IA 2O2OA 2DILA 2ENMA 1GFCA 1A0NB 2ECZA 4HVWA 1NEBA 2MCNA 3EG3A 1S1NA 2BZ8A 2KYMA 1SRMA 1XOVA 4LUEA 2NWMA 2GQIA 3C0CA 3VS6A 3ULRB 1UHCA 2K79A 1X43A 2FRWA 4Z8AA 2DL4A 3R6NA 1QWEA 1M3CA 4HXJA 1ZBJA 3EGUA 1KFZA 1UUEA 3EG1A 1U3OA 2RQVA 1GCQC 2SEMA 1K0SA 1JQQA 2CH4A 2DE0X 1E7OA 1CSKA 2VWFA 1K76A 2J06A 1UECA 3VS4A 2GTOA 2FRYA 1AWXA 3SHWA 2EW3A 4E6RA 3H0FA 1AWOA 2YSQA 1BBZA 4Z88A 1FMKA 1M8MA 1Y57A 2BZXA 3M0RA 4LUDA 2LNHB 2D0NA 2EGCA 2PTKA 2J6OA 1X2KA 3EG2A 2OJ2A 2EKHA 2DBKA 2V1RA 3PVLA 5IHIA 1UTIA 4ZNXA 2JT4A 1W70A 2EGEA 2KROA 4X1VA 2PZ1A 2V1QA 1LCKA 2FEIA 1AWJA 3RNJA 1NG2A 4RTTA 5EC7A 1M3BA 2W10A 1UE9A 2YT6A 3REAB 1X2QA 2GTJA 3I5SA 2FPDA 1GBQA 2O9SA 2EGAA 1WA7A 2DF6A 1AWWA 4OMQA 1YN8A 3I35A 1E6GA 2DYBA 4RTYA 2X3WD 2CDTA 1W6XA 1K1ZA 2EYXA 1QLYA 1UJ0A 1WFWA 4RTWA 4AFUC 2RQRA 2DNUA 2NUZA 1KIKA 4KRTA 5I11A 1H8KA 2SRCA 2LCSA 1YCSB 1B07A 2YUOA 4J9GA 2C0IA 2CSQA 2K3BA 2OI3A 1T3LA 1ZX6A 1K0XA 2LJ1A 4HVUA 1YWOA 2B86A 1AVZC 4OMPA 3RBBB 1OOTA 3H0HA 2RNAA 4J9FA 2M0YA 2AKLA 1ZUYA 3PE0A 2O31A 4CC2A 1I1JA 3UATA 2KEAA 4RUGA 5FW9A 2DL3A 1VYTA 1G83A 4AG2C 4DEXA 1ZUKA 3M0UA 2DRMA 2FPEA 1K4US 4AFSC 2AZSA 3I9QA 1SHGA 4ORZA 1GCQA 4LN2A 2HSPA 1UJYA 3EHRA 4QT7A 3A98A 1WXTA 1I07A 2EYZA 2KRMA 3QWXX 5HCKA 1PWTA 3VS2A 1M27C 4JPBW 2KNBB 2XMFA 2KRNA 2MOXA 2YUNA 2KRSA 1UDLA 3GBQA 1OPLA 4IIOA 2CT4A 5IH2A 2CREA 4ESRA 1HD3A 2KXDA 4DEYA 4J9BA 4LNPA 1T3SA 1X6BA 1NM7A 3VS7A 2KXCA 1BU1A 1ABOA 2DBMA 3UA7A 3I5RA 2JS2A 1V1CA 2F2VA 2J05A 3TVTA 2A08A 2LQWA 2DLPA 1T0HA 2D8HA 2EPDA 2HCKA 4HCKA 4Z89A 3CQTA 3O5ZA 2D1XA 2QDLA 2RPNA 2K9GA 3VS5A 1ARKA 2HBWA 1AOJA 1IO6A 4IIMA 3NMZC 1NEGA 2ABLA 2G6FX 1SEMA 3FJ5A 1YNZA 2L2PA 4RTZA 2O9VA 4HVVA 1VA7A 1OEBA 1PHTA 2EQIA 5ECAA 2YDLA 5IXFA 4FSSA 2KT1A 2VVKA 1UFFA 2J7IA 2CUDA 1J3TA 1VYVA 2X3XD 4AG1C 4JJCA 5FWBA 1MV0B 1QCFA 2CH4W 2HEQA 2JS0A 2K6DA 1HJDA 1PKTA 2YUQA 2GBQA 4AFZC 1TUDA 1JXOA 1PNJA 2A36A 1U06A 4R0KA 2RQUA 3TSZA 2JMAA 5IHKA 4D8DA 1Z9QA 4F16A 4D8KA 2DL5A 1SPKA 2KBTA 3JV3A 2L3PA 4J9CA 3REBB 1JXMA 2GGRA 2OAWA 2AK5A 2ROLA 2JMCA 1YP5A 3NPFA 2LMJA 4J9HA 1SSHA 2YUPA 1RLQC 1NLPC 2LJ3A 3EHQA 1JEGA 2VKNA 1PRMC 1TG0A 2JM9A 4RTVA 1GRIA 4RTXA 1CKBA 1NYGA 3TSWA 1K9AA 1WI7A 3THKA 2AKKA 1EFNA 1GL5A 1SHFA 3M0SA 4K11A 1H3HA 5IXBA 2DRKA 1NYFA 1OPKA 2DVJA 1MUZA 3H0IA 4JJBA 3NHNA 2JM8A 4OMOA 4JZ3A 4CC7A 1UG1A 1KJWA 1YWPA 2DM1A 1AEYA 2EBPA 3VS0A 1ZSGA 1WDXA 3VS1A 1CKAA 2KGTA 2JXBA 4F17A 1H92A 2FPFA 1GCPA 3IQLA 3PVQA 3UF4A 4J9DA 1RLPC 3VRZA 3UA6A 2RN8A 1GBRA 2F2WA 2A37A 1KSWA 1M30A 4GBQA 3SEMA 4OMNA 1QWFA 1X69A 2CUBA 1FYNA 1PRLC 2O88A 2M51A 1TUCA 2LX7A 2ED0A 2LQNA 4GLMA 2FG0A 4CC3A 2BZYA 2RMOA 2J6FA
chains in the Genus database with same CATH superfamily
1VQ7Q 2D8JA 4EMHA 1WQ7A 5GAN7 3G6EQ 4ATOA 1UB4A 2DMOA 5L8RE 2L3SA 1S72T 1X6GA 1QCNA 3L2RA 4JZ4A 3CC7Q 3BDLA 3U23A 3QYGB 1M3AA 3PIOA 5LJ5h 2LT4A 1KHIA 3SFMA 1VQ9A 5FU7C 4BI8B 2DJQA 5KYUA 3QZ5B 2F2XA 2ED1A 3CBPA 5KCHA 3CC2Q 1DJ7B 4JRPA 1D1CA 2K3YA 3QKJA 4NOYA 1ZLMA 3NGPA 4FM4B 1UGVA 4JUVA 4Y92A 1NLOC 3WVEB 4A63B 2QI2A 1IREB 2EKOA 1WXUA 2X35A 4BI4A 2IIMA 1VIEA 4M78C 4M78D 2LJ0A 1UGRB 2K5FA 5I21A 1AZEA 1WLPB 2H8HA 5GMKh 2CSIA 2L89A 1YJWA 2K4YA 2JTEA 5GAN8 5C0MA 5HY6A 4CRIA 3G1JA 2JN0A 3JCMV 1WX6A 3M0QA 3EFOB 2RQTA 3MKDA 2FZCB 3BDUA 4IUPA 2XKOC 3RDVA 4BE1A 3GOXA 1VIFA 2KDSA 2YLCA 1ABQA 2PNIA 1PG5B 1SF9A 3UDCA 2ROTA 2K2VA 1BK2A 3AT1B 4M7DE 1AD5A 2L3QA 1LOJA 1ZUUA 2QTXA 2QG9B 4ANJA 3FIFA 1D1AA 3PFSA 2V8KA 2ECZA 3GF5A 4LD6A 4XU3A 2P0PA 3JCMP 1VQLT 3CCRT 2LVMA 3S3MA 2DEUA 4FSXA 4LUEA 3C12A 3J80E 4NL2A 3CPFA 3VS6A 3ULRB 2KQWA 4DOVA 4MZTA 4M7AA 2DL4A 3CCLQ 1VQ4Q 1QWEA 4O6JA 4HKEA 1KFZA 4PK4A 2E5QA 4B9XA 2E65A 4N4HA 1GCQC 4F04B 2EQUA 3VYGA 1Y07A 2RHYA 2DTOA 5GANh 2DXBA 3SHWA 2EW3A 1YI2Q 2YSQA 3QXEB 1BI0A 4Z88A 4LUDA 3M0RA 3LGFA 2AIRB 1U1TA 2V1RA 3CCUQ 2EGEA 3VUZA 2Y90A 2FEIA 3OYFA 4C5HA 3RKXA 3RNJA 4FT2A 3C4SA 2JTMA 4E7ZA 5CKBA 3AHUA 4RTTA 3DLLA 1GBQA 3EH2A 3UT1A 1X01A 1D3BB 1M8VA 3I35A 4X34A 4ZGDB 1W6XA 1K1ZA 2EYXA 1TSFA 1UJ0A 1VQ8A 3CCSQ 2RQRA 3OB9A 3FC3A 4KRTA 2DO3A 5I11A 3X25B 2FL7A 2RH2A 1YJ9Q 4C92F 1NBEB 2LCSA 1B07A 4RMOA 2C0IA 3FRNA 2K3BA 2E4HA 1IGUA 5FRNA 4XTUA 2JUFA 1G5VA 2B86A 4OMPA 1YITQ 3H0HA 2O31A 4CC2A 1I1JA 2EFIA 5FW9A 2DL3A 1VYTA 1OYXA 1G3WA 2JVVA 2FPEA 2HNIA 4M77F 1SHGA 2FB7A 2X9HA 1UJYA 4C8QF 4RKUE 1WXTA 3G4SQ 1VOMA 2OTLT 3QO3A 4A53A 1ZA1B 3G71T 2EYZA 5HCKA 4F7UB 2MOXA 4ZN1A 1VQPT 1Q7YC 3FJPA 2ZPGB 1Q81U 1XNIA 1VUBA 2KXDA 2P84A 3CCQT 3NFCA 2EYQA 1VQ5A 4LNPA 1VQKA 1X6BA 2RHUA 5GAOm 1SKUB 4C8QB 1VQ7A 3I5RA 1V1CA 1Y71A 4M78A 3MHXA 3CCEA 4QVDA 2DLPA 1N6AA 4DOWA 1MMAA 1T0HA 2D8HA 2HSEB 3OYMA 2CKKA 2D1XA 2DTIA 2K9GA 4E7LA 3VS5A 2HBWA 1WHJA 1RAFB 3OQ5A 1AOJA 3CCVQ 4IIMA 3NMZC 2ABLA 1S72A 2Y4YA 1OI1A 3OYDA 1PHTA 5ECAA 2YDLA 4E7KA 2O4XB 2XI9A 5KYWA 5LJ3e 1KD1U 5A2QE 4OGCA 5GAOq 3H6ZA 3JCMc 4F7UE 4AG1C 1QCFA 5IT9E 4M75B 2CH4W 1YJWT 1NJIR 1D0YA 2K6DA 1B34B 5GAN4 3CPWA 1JXOA 4LDWA 4C0GA 1U06A 2QK0A 4D8DA 2V26A 1QVPA 4M77E 3E1SA 4J5YA 3MJXA 4EMGA 2L3PA 3CMEQ 4C8QE 3JCMd 1GXIE 1JXMA 1MHNA 2GGRA 2PU9B 2M0OA 2DPPB 1KQ2A 3E19A 2KY9A 4LDXA 3NPFA 2LMJA 1SSHA 3VUBA 1JRIA 1NLPC 1WNLA 3ZEHA 2VKNA 4RTVA 1TG0A 1GRIA 3O8VA 3OYGA 4E7HA 1UEBA 4WTOB 4QVCA 1K9AA 4II1A 4Y28E 3THKA 3OBYA 4RG2A 1XTDA 1SHFA 2CP6A 4K11A 3DB4A 1H3HA 5IXBA 2DRKA 2EJFA 5KCOA 3PNWC 2VASA 5GAMe 1NYFA 2K57A 3MCAB 4Y91A 3M4GA 3PMTA 1VQNT 3SWNB 4CC7A 4M75E 5KYXA 3M53A 1VQOQ 3JB9I 2L3RA 3BY7A 1CKAA 2JXBA 3SDZA 2FPFA 3BFMA 4PKCC 4V2SA 4XU1A 5FU6B 1RLPC 3A8GB 1D0ZA 1Q86R 1M30A 4HCCA 4PJLA 2WACA 4GBQA 3CCLA 2RI2A 1VQ4A 1X69A 2HBPA 1PRLC 2LRQA 2XU8A 2LQNA 4EDUA 4GLMA 4CC3A 2BZYA 1M2VB 2BKDN 3OA6A 5L23A 4HA8A 5IHNA 4PJOB 4FL6A 3GLXA 2BE7D 3PT9A 1WHGA 1WZOA 2JTFA 2CT3A 2DD5A 3RESA 2QASA 2HDAA 4OMLA 3LW5E 1LVKA 5LJ3g 2BTTA 4A4FA 3QIIA 2QA4Q 1SRLA 2KI7A 3JRZA 2BUDA 3L2QA 4BY6B 3OS2A 1N8RR 2LQKA 1HSQA 2RHIA 3CMAQ 2DL8A 2LT1A 2KE9A 1IHVA 4M7AC 4M7AD 1PKSA 1Z9ZA 3JCMX 3PGGA 5GAOp 2HMAA 3CCUA 3LWHA 5KYNA 1U5SA 4L5GA 1VQ8T 3LWIA 1YJNQ 5EG2A 1M1KR 5LJ3j 3CPWP 3M0PA 4RG8A 1TWBA 4PJJA 2A28A 2G3RA 3V8JA 4M4ZA 3CCJQ 3DB3A 2EQMA 2E41A 2XG8D 2LQ8A 2EVRA 5I22A 3H41A 1I0CA 5I2MA 1KK7A 3M0TA 3M55A 1X75C 4J9EA 2DX1A 3CCSA 2GNCA 1V76A 2RA2A 5LJ5d 4LDVA 1Q82U 2L0AA 2DFUA 3HTRA 1OX8A 2DA9A 2P0KA 3EG0A 3LLRA 2RQWA 2VGNA 4CC4B 3V8LA 2RJEA 4C5GA 1MNEA 2VB6A 5KE2A 1B3QA 2E12A 1YITA 1KC8R 4KUIA 5DM7R 5IAYA 4EMKB 3M4YA 2GFAA 2RJDA 3EG9B 3E2UA 2C0TA 1RUWA 5GJVB 3JB9D 2JJ9A 2ZPBB 5GAN2 1YIJQ 3V7SA 3CCMQ 2JW4A 3ZL7C 4MDWA 2MWOA 4P5NA 1N5ZA 4A4KA 1QKXA 4A4GA 2C0OA 4OGEA 4BDZA 1RI9A 1VQMQ 4B6MA 3UWNA 2LDMA 2W0ZA 3EFOA 4QQ6A 4KGZB 2ENMA 4ZGEB 3OMCA 5GAMf 2JNGA 4DBQA 4M75D 3EG3A 2ZPHB 2VXFA 1IXDA 1XOVA 3G71A 2GQIA 2F69A 2MYSA 2DVEA 4XTWA 1K8AC 1VQ7T 1X43A 3OYNA 1M1GA 3OSSC 2FRWA 3F70A 1K9MC 1VQPA 2HQXA 4J7IA 4HXJA 3EGUA 3G6ET 1UUEA 3EG1A 1U3OA 1G3YA 1M5Q1 1K0SA 3G7ZA 1WHMA 4XU0A 1ZSZB 3CCQA 3CC7T 3JB9J 7AT1B 2RO0A 5GMKi 3MO8A 2GTOA 1AWOA 1AWXA 1BI2A 4BB7A 1BBZA 1M8MA 1Y57A 2D0NA 2EGCA 3JAME 1K73C 2J6OA 1BKBA 3CC2T 2EKHA 3E9GA 1UTIA 4M7DB 2RJCA 1JJ2A 3HRSA 1VQ6Q 3HRUA 1BI3A 2BIVA 2V1QA 4J6WA 1LCKA 1TS9A 5GAOr 2AT1B 2HL3A 1NG2A 2NUTB 1NPRA 3X28B 1M3BA 1KQSA 1D1BA 5GANd 1PM3A 3I5SA 2E6ZA 2EAYA 4XTVA 2DYIA 5A0LA 1AWWA 2QQRA 3URGA 2A3LA 1E6GA 2DYBA 3QHSA 3A8LB 1K9MR 2DZ9A 4RTWA 1RAIB 2DNUA 5GAMd 2QXFA 4IUVA 4ZTJA 1QVGA 2MF2A 2RB6A 1YCSB 3TCJA 2YUOA 3CMEA 4PJOC 4PJOD 2LNVA 4J9GA 1D3BA 3M5AA 3A8OB 2COWA 2ZPIB 2CP5A 2OI3A 1T3LA 1HK9A 1ZX6A 5KH6A 4M78G 1AVZC 3QDFA 2RNAA 2M0YA 4LDUA 4OB0B 1K73R 5KE3A 2B8AA 2KEAA 3QYHB 3VYHB 3HKSA 4RUGA 1W2BA 1YBYA 4AG2C 1FWZA 3CXCA 1PSEA 1SG5A 3HRTA 4AFSC 3QBYA 1MMGA 2AZSA 2E1HA 3I9QA 3OY9A 4ORZA 1U8RA 4LN2A 2HSPA 1IZ6A 2AHJB 3KXTA 3EHRA 2RK2A 3A98A 4JLIA 1AT1B 1YHQQ 4WF2A 2HAXA 2KRMA 3CCLT 1VQ4T 2PVDB 3OW2A 1I8FA 4JPBW 3I55Q 1M2OA 3QJ6A 1BCMA 2DKGA 1VQOA 3OYEA 1VQNA 2OTJQ 3GBQA 1OPLA 4KGVB 2C06A 5IH2A 2QQBA 2CREA 4BD3A 4ESRA 2NUPB 3HP9A 3QPHA 5C6SA 1YI2T 2CP0A 2CP7A 4XTZA 1IRXA 1T3SA 3D7SB 1OU8A 2MWPA 2WSFE 3OMGA 4F7UA 1BU1A 2DBMA 2JS2A 4QVZA 3M56A 2DIQA 2MAMA 1JJ2P 3CCUT 2RHXA 3EAEA 2EPDA 4EMKC 1U1SA 2HCKA 4HCKA 3GPLA 3O5ZA 5GAMh 3L2VA 1TU0B 1ARKA 2EJ9A 2XICA 3A8HB 1WJQA 3X24B 2GQVA 5DY9A 1SEMA 2L2PA 4RTZA 4HVVA 1VA7A 2M1HA 3GNGA 2EQIA 4FSSA 4IURA 2VVKA 1UFFA 3UPUA 1J3TA 1VYVA 3CCST 2QDYB 2X3XD 2V8IA 5FWBA 1YJ9T 1C0MA 1V29B 1TXQA 3LGLA 1PKTA 2YUQA 2GBQA 1WJSA 4C0DB 1PNJA 2A36A 2O4XA 2LCCA 3TSZA 2JMAA 1Z9QA 1O75A 1ZHIA 4OB1B 1EX4A 1YITT 3L1AA 1RAEB 3MEUA 3EFSA 1Q95G 4M75A 3REBB 2OAWA 1W2BP 2AK5A 1MNDA 1P92A 4DA4A 1M4ZA 1TH7A 2X51A 5CQXA 2F5TX 3CXCP 3A1PA 4J9HA 1RLQC 5CCAA 1OQKA 1PC0A 3EHQA 3META 1JEGA 2JM9A 1BIAA 2MMPA 4XU2A 4RCBA 3G4ST 3KUFA 2K3XA 4M7DC 4M7DD 2EJGA 2VV5A 3RKWA 4N0AA 1EFNA 1QCOA 2F1LA 3INZA 3M0SA 1NJIU 3TREA 4C92B 4ELYC 3OW2P 4R56A 4KUDK 5KYYB 1RI0A 2VUBA 3HL8A 3H0IA 1N9RA 4JS5A 2M02A 3A5ZB 4A54A 3CC4Q 2DXTA 3ASKA 1YWPA 4EPCA 1KHCA 1HXDA 1MMDA 3VS0A 3CD6Q 5J26A 4F17A 2E6NA 1H92A 3UF4A 2KSSA 1OX9A 2QEXQ 2RN8A 3ER0A 2VGMA 4M77B 2D0QB 3SEMA 4OMNA 1PD0A 2CUBA 2O88A 3SWNA 4C5EA 2OX7A 3JCMQ 1TUCA 2DAQA 2FG0A 2RMOA 2J6FA 3E9FA 2KR3A 1RAAB 5LL6S 1MV3A 3MP6A 4F14A 1C1AA 3G6EA 3CCVT 5AYFA 4JS4A 3I56Q 4EIKA 1QKWA 2IVWA 2MK5A 2E5KA 1I5LA 3FLGA 3CC7A 3C95A 3OSVA 1Q81C 4A4EA 1OU9A 4XTYA 2R57A 1M90U 1M2VA 2LTOA 3EGDB 2KYBA 4C92E 3OYHA 4PJOA 2EYWA 2P4RA 4JDSA 4RTUA 3CC2A 1GFDA 3PIPA 1VQ9Q 2FO0A 1Q86U 1Q7YR 1BB9A 2E70A 2J6KA 3V7CA 2I0NA 1G8XA 2LZ6B 1Y96A 2DL7A 4PFOA 5GAN5 2EYYA 2MIOA 3L42A 4MZMA 3CMET 1UHFA 3VS3A 4JJDA 2F5KA 3M54A 3DKMA 1BI1A 3OYCA 4JLGA 4AMCA 1N8RU 3BE3A 3EGXB 5GAN6 1JO8A 3M59A 4YTLA 4PFPA 1RADB 4BUGA 1WXBA 1Q81R 4AFQC 1ACMB 1M1KU 1AZGB 1E6HA 5FROA 4M78F 1XJWB 4A4HA 5CKEA 1WGSA 4FT4A 3OS1A 1VQOT 3VKIA 4J9IA 2O2OA 3H9NA 2DILA 5FU7B 4EMKA 1I81A 3EG9A 2CZ6B 4IUUA 4HVWA 1NEBA 4IKFA 2MCNA 4D6WA 1S1NA 3I55A 3VV0A 2NWMA 3JB9H 3C0CA 3RERA 3LH0A 1UHCA 5CKFA 4Z8AA 3OS0A 3R6NA 3J7AF 1KC8U 3PTAA 4FU6A 2SEMA 2QA4T 1JQQA 2CH4A 1CSKA 3V7RA 1H641 2ZAEA 4LDYA 3WVDB 3CMAT 4XAXB 2M9UA 1YI2A 4L6V5 2FRYA 3H0FA 1FMKA 4XTXA 2LNHB 2FVUA 5GMKj 1NPPA 1YJNT 3EG2A 1FMVA 2OJ2A 2DBKA 4PFZA 1ZSZA 2PVGB 4C92D 3LYIA 2JT4A 1W70A 2MI6A 4IUQA 3CCJT 2YHTA 4UC4A 2D6FA 1AWJA 3L2ZA 3JCMW 5LJ3f 2QYZA 2PQWA 2DK3A 5EC7A 1UE9A 3REAB 1X2QA 1IB8A 4VUBA 4X9DA 2EGAA 4MZPA 4M7DA 2QTVA 2QGFB 2COZA 4M7AG 2XDBA 4RTYA 3MEWA 2E10A 2PUKB 3MP1A 4M77D 4M77C 4M78E 4X9CA 1RAGB 3GNFB 1YJ9A 1ZA2B 2NUTA 4J6XA 5CIUA 4C8QD 4C8QC 2XDPA 2SRCA 3HSBA 4F7UG 2FZGB 2EQKA 1YIJT 2L5QA 2NLUA 1I5OB 3CCMT 1K0XA 4JRKA 2LJ1A 4HVUA 1R77A 1OOTA 4J9FA 1R0CB 4N4IA 2AKLA 1ZUYA 3PE0A 1VQMT 4J7FA 3FDRA 1WHHA 2FHDA 2P0QA 1G83A 1XQHA 1ZUKA 2DRMA 1Q82C 1K4US 2Y4XA 2HQHA 1C6VX 3QJYA 4JRQA 2VYTA 3C94A 3G4SA 2CZ1B 4FYWB 5CR2A 4QT7A 1K9MU 5FLXE 4MMKA 4M75C 2HZYA 4PJMA 1I07A 1M1FA 3JB9G 1UGQB 3VS2A 2KNBB 1YCYA 4OP0A 4ELZC 3JCMb 3CD6A 3ZBDA 5J39A 1LPLA 3R6OA 1M9SA 4IIOA 4Q5WA 2RHZA 2ZCFB 2QEXA 5LJ3d 1PD1A 3NTHA 4J83A 4N0AC 2PUOB 5GAOn 4DEYA 4J9BA 2X4XA 4M75G 1QVFA 1NM7A 1VQ5Q 1W4SA 1RACB 1VQKQ 2F2VA 2I2LA 3TVTA 2A08A 4HCBA 3I56A 1VQ6T 1ZQ1A 2HD0A 1B7TA 2NUPA 2E3IA 2YXYA 3CCEQ 4QQDA 4C0ZA 2RI3A 3X20B 4KBMB 5GMKl 3CCVA 4QKUA 2RPNA 1RL2A 2KAFA 1Q82R 2WSCE 3EH1A 1KQ1A 4E7IA 1IO6A 1EZZB 2GFUA 3A8MB 1UGPB 2G6FX 3FJ5A 3N5BB 3SWNC 1S72Q 5CKDA 1YFNA 1IGQA 2QQAA 4PJNA 2J7IA 3TQ7P 2JZ2A 2CUDA 4O5VA 2XD0A 2YWWA 4BACA 1K8AR 2DZCA 2EIFA 4JJCA 3OYBA 5FU6C 3HFNA 2ZZDA 1OULA 1WHKA 2HEQA 2OAUA 4JRIA 3S3NA 2JS0A 4FCYA 4ME7A 4QQGA 2P4TA 1WPYA 3OYYA 1TUDA 1RABB 2X4WA 4RCCA 9ATCB 4R0KA 1NE8A 2RQUA 5IHKA 3KBGA 4F16A 2KBTA 2JOYA 2E3HA 2IPOB 1AHJB 4KULA 2X4JA 2ROLA 5CAIA 1YP5A 3RMQA 2DETA 4BY6C 4C0FA 2LJ3A 1WQWA 4JJNK 2CGHA 5LJ3h 4RTXA 3MEAA 2CP2A 1NYGA 2K5IA 3RMSA 1MGQA 3TSWA 2LCLA 1YHQT 1WI7A 1D09B 2AKKA 4PJOG 3SB2A 3I55T 1OPKA 2DVJA 4TVRA 4JJBA 2OTJT 3NHNA 2JM8A 4OMOA 2DD4A 5J3BA 4JZ3A 5HKCA 1UG1A 2LC4A 2DM1A 3L2WA 3JCMe 1AEYA 2DXUA 1WJRA 4CI0C 1WDXA 4C92A 3P8DA 1GCPA 3PMIA 3PVQA 4R55A 1QVFP 4AT1B 3VRZA 5KYYA 2XK0A 3UA6A 1KSWA 2H3EB 3QUIA 1OZ3A 1QWFA 1VQLQ 3CCRQ 3Q1JA 1D0XA 2M51A 3OYLA 2ED0A 1QQJA 2NYSA 2YRDA 3LX7A 1N9SA 1Y0MA 2ESWA 3MP8A 4OMMA 3BW1A 5KYUB 3MEVA 1OV3A 1O9SA 2QA4A 2AZVA 3LH5A 4M77A 2K7AA 1MMNA 1W1FA 1T0JA 5CK9A 8ATCB 3CMAA 4J8OA 4C8QA 1KQSP 4KH0B 4HCZA 2KK4A 1WYXA 5HK3A 2RK1A 3CEYA 3QWYA 4FYVB 2RF0A 3JSCA 3V8KA 4LE9A 1YJNA 4C5IA 1X27A 1WIEA 2CS7A 3HFOA 2K2MA 4DBHA 1G2BA 3CCJA 1QVGP 2L8DA 2VC8A 3EGDA 3GIBA 3DLMA 1VYUA 2FZKB 2HL5C 1TUGB 3EFRA 4MDXA 3VU3C 2E64A 1NZ9A 1ZSZC 5FWCA 3GP8A 1JB0E 4M7AF 1B34A 2V8JA 2DERA 2YRVA 1RAHB 3SD4A 3CPWS 2A7YA 1QMCA 5CQYA 1ZBXA 2DTHA 2H3JA 2QAZA 2KT8A 4OB3B 3VRYA 4F7UF 1YIJA 3TU4K 3H8ZA 3CCMA 3KFVA 1Q7YU 3P8BB 2FYKA 4BDYA 3JCMg 1VQMA 3EGXA 4NS5A 3OYKA 3CC4T 2R58A 5GJWB 4WCIA 2LP5A 2K5LA 1JBMA 5DLOA 2HKQB 2X4YA 3CD6T 1JU5C 4M7AB 1GFCA 2R5MA 5LJ5e 1A0NB 2QEXT 3QG1A 4E7SA 4FYYB 2PVOB 1WHLA 3RUXA 4BE0A 2ATCB 2QGGA 2BZ8A 2KYMA 4M7DG 1TTHB 4LXCA 1SRMA 1LNXA 1FX7A 2OTLQ 2K79A 3JCMf 3G71Q 4XQ3A 3ZFJA 3JB9F 1NJIC 3I56T 1M3CA 4IUTA 1ZBJA 5AT1B 3J81E 3FEOA 2RQVA 1VQPQ 4B9WA 1G3TA 2DE0X 1E7OA 2VWFA 5CO7A 4PNOA 1K76A 5A0DA 2J06A 5GMKe 3QDRB 2HKNA 1UECA 3CCQQ 3VS4A 4E6RA 4QW2A 4NL3A 2BZXA 3NTKA 4M75F 4HT8A 1H3ZA 1X6OA 1VQ9T 2PTKA 1X2KA 2RD1A 3QZ9B 3T9NA 1VQ6A 3PVLA 3HPWA 2HQEA 5IHIA 5I2SA 2CYZB 4ZNXA 4OMFB 3P8HA 3ME9A 3S6WA 2KROA 4X1VA 2DXCA 2PZ1A 4PLLA 4M7AE 4GY5A 1N27A 5HK0A 4MMLA 2KVQG 3NTIA 4E7JA 1KG1A 2W10A 2YT6A 3M9QA 2GTJA 1I4K1 2FPDA 2O9SA 1WA7A 2DF6A 5M9OA 4FW1A 4KGXB 5DLQE 2MPXC 4OMQA 5GAOl 1YN8A 3OBWA 2CZ7B 1EIFA 1UGSB 2X3WD 2CDTA 5CVIA 1M90C 5GAN3 4XK8E 1QLYA 1WFWA 4AFUC 4KH1B 2VXEA 2NUZA 4DBFA 1KIKA 1H8KA 2ZPEB 1KD1C 1YJWQ 2Z0WA 2CP3A 3MPUB 1Q86C 2CSQA 4KT0E 4FIBA 4J6YA 2DJZA 2RM4A 1YWOA 3RBBB 3UATA 5LJ5g 1QP2A 4PLIA 3JCMJ 2DEQA 3L2UA 5GANe 4DEXA 3OYIA 3CBMA 3M0UA 2M16A 1FXXA 4BE2A 4OVAA 3WXMB 1G3SA 1GCQA 1N8RC 1YHQA 5FRMA 5D6YA 3RKYA 5LJ5j 3QWXX 4PJOF 2ZGWA 3OYAA 2GCXA 1PWTA 4C0DC 5D6XA 1M27C 5LJ5f 2LX9A 2OTJA 4E2FB 2XMFA 1M90R 1M1KC 2KRNA 2YUNA 2KRSA 3CBOA 1R0BG 1UDLA 4M78B 5CKHA 1LJOA 2CT4A 1HD3A 1VQNQ 1KD1R 1Y7XA 2YLBA 4ZN3A 1VQLA 3CCRA 4PL6A 4HT9A 2YRCA 2KMTA 3VS7A 2KXCA 1ABOA 4GLKA 4OF1A 3UA7A 5A0GA 2J05A 1HYOA 1IHWA 2LQWA 5IN1A 3OYJA 5KYWB 2BE9B 1OZ2A 4Z89A 3CQTA 4FYXB 4ZTFA 2QDLA 4C92C 1QVFS 2XHCA 3VJPA 1KC8C 1Y96B 2DIGA 1NEGA 1YNZA 2O9VA 1OEBA 2R5AA 2XDDA 3JCMh 5IXFA 3X26B 1BCOA 2KT1A 5D7UA 2EQJA 1BIBA 1JJ2S 1MV0B 2COYA 3RIRA 3RR6A 4C92G 1HJDA 1VQ8Q 1PCXA 4AFZC 3FB9A 6AT1B 1BYMA 2A0FB 1KQSS 2ZPFB 4D8KA 2DL5A 1SPKA 3JV3A 2QQSA 5GANg 4J9CA 4FW2A 1R8OB 2O01E 2JMCA 4PJOE 2YUPA 2QQ9A 2XIDA 2WSEE 4OB2B 4E47A 1QVGS 4M77G 4BI3A 1PRMC 2D9TA 2GF7A 5GAMg 8AT1B 3TEEA 1CKBA 4C8QG 2RJFA 1K8AU 5KYXB 1PSFA 5GANj 2EWNA 2IG0A 1GL5A 3OS5A 3M57A 5D6WA 5GANf 3S3OA 3M58A 1FMWA 1QP3A 4DQ2A 1W2BS 1MUZA 3CXCS 3CC4A 4LD9K 5GAMj 5GMKm 1KJWA 4N4GA 1TOVA 2EBPA 4L59A 1ZSGA 3VS1A 2KGTA 3IQLA 1VQ5T 2RI5A 4J9DA 4DBRA 3HHTB 2CZ0B 1K73U 1VQKT 2OTLA 1GBRA 2F2WA 2A37A 1SSFA 3QSUA 3OW2S 4M7DF 1FYNA 4Z02A 1F1BB 2LX7A 3CCET 1QW1A 4ZGJB
chains in the Genus database with same CATH topology
5L23A 2KR3A 5IHNA 1Y0MA 2ESWA 4OMMA 2D8JA 1MV3A 4F14A 2CT3A 4EIKA 1OV3A 2HDAA 1QKWA 4OMLA 2AZVA 2E5KA 3LH5A 2K7AA 2DMOA 1W1FA 2BTTA 1T0JA 1SRLA 2L3SA 1X6GA 4JZ4A 1HSQA 3U23A 1WYXA 1M3AA 2DL8A 2KE9A 2KYBA 1PKSA 1Z9ZA 2EYWA 2P4RA 3QWYA 2DJQA 4RTUA 2RF0A 2F2XA 4LE9A 1GFDA 1X27A 1U5SA 2ED1A 1WIEA 2FO0A 2K2MA 1BB9A 2J6KA 1G2BA 3M0PA 2I0NA 2LZ6B 2DL7A 1ZLMA 3NGPA 4Y92A 1UGVA 1NLOC 2A28A 4A63B 4M4ZA 1WXUA 2EYYA 2MIOA 2EVRA 5I22A 2IIMA 3H41A 1VYUA 2LJ0A 1I0CA 1UHFA 3VS3A 3M0TA 4JJDA 4J9EA 2DX1A 1AZEA 2GNCA 1WLPB 2H8HA 5FWCA 2L0AA 2DA9A 2CSIA 3EG0A 2RQWA 2JTEA 4CC4B 1JO8A 1WX6A 1B3QA 2KT8A 3M0QA 2RQTA 1WXBA 3VRYA 4AFQC 3KFVA 1AZGB 2C0TA 1E6HA 1RUWA 5GJVB 2JW4A 3ZL7C 1ABQA 2PNIA 2ROTA 1BK2A 1N5ZA 5GJWB 1AD5A 1QKXA 4WCIA 2C0OA 2LP5A 1RI9A 2L3QA 1ZUUA 2W0ZA 1JU5C 4J9IA 2O2OA 2DILA 2ENMA 1GFCA 1A0NB 2ECZA 4HVWA 1NEBA 2MCNA 3EG3A 1S1NA 2BZ8A 2KYMA 1SRMA 1XOVA 4LUEA 2NWMA 2GQIA 3C0CA 3VS6A 3ULRB 1UHCA 2K79A 1X43A 2FRWA 4Z8AA 2DL4A 3R6NA 1QWEA 1M3CA 4HXJA 1ZBJA 3EGUA 1KFZA 1UUEA 3EG1A 1U3OA 2RQVA 1GCQC 2SEMA 1K0SA 1JQQA 2CH4A 2DE0X 1E7OA 1CSKA 2VWFA 1K76A 2J06A 1UECA 3VS4A 2GTOA 2FRYA 1AWXA 3SHWA 2EW3A 4E6RA 3H0FA 1AWOA 2YSQA 1BBZA 4Z88A 1FMKA 1M8MA 1Y57A 2BZXA 3M0RA 4LUDA 2LNHB 2D0NA 2EGCA 2PTKA 2J6OA 1X2KA 3EG2A 2OJ2A 2EKHA 2DBKA 2V1RA 3PVLA 5IHIA 1UTIA 4ZNXA 2JT4A 1W70A 2EGEA 2KROA 4X1VA 2PZ1A 2V1QA 1LCKA 2FEIA 1AWJA 3RNJA 1NG2A 4RTTA 5EC7A 1M3BA 2W10A 1UE9A 2YT6A 3REAB 1X2QA 2GTJA 3I5SA 2FPDA 1GBQA 2O9SA 2EGAA 1WA7A 2DF6A 1AWWA 4OMQA 1YN8A 3I35A 1E6GA 2DYBA 4RTYA 2X3WD 2CDTA 1W6XA 1K1ZA 2EYXA 1QLYA 1UJ0A 1WFWA 4RTWA 4AFUC 2RQRA 2DNUA 2NUZA 1KIKA 4KRTA 5I11A 1H8KA 2SRCA 2LCSA 1YCSB 1B07A 2YUOA 4J9GA 2C0IA 2CSQA 2K3BA 2OI3A 1T3LA 1ZX6A 1K0XA 2LJ1A 4HVUA 1YWOA 2B86A 1AVZC 4OMPA 3RBBB 1OOTA 3H0HA 2RNAA 4J9FA 2M0YA 2AKLA 1ZUYA 3PE0A 2O31A 4CC2A 1I1JA 3UATA 2KEAA 4RUGA 5FW9A 2DL3A 1VYTA 1G83A 4AG2C 4DEXA 1ZUKA 3M0UA 2DRMA 2FPEA 1K4US 4AFSC 2AZSA 3I9QA 1SHGA 4ORZA 1GCQA 4LN2A 2HSPA 1UJYA 3EHRA 4QT7A 3A98A 1WXTA 1I07A 2EYZA 2KRMA 3QWXX 5HCKA 1PWTA 3VS2A 1M27C 4JPBW 2KNBB 2XMFA 2KRNA 2MOXA 2YUNA 2KRSA 1UDLA 3GBQA 1OPLA 4IIOA 2CT4A 5IH2A 2CREA 4ESRA 1HD3A 2KXDA 4DEYA 4J9BA 4LNPA 1T3SA 1X6BA 1NM7A 3VS7A 2KXCA 1BU1A 1ABOA 2DBMA 3UA7A 3I5RA 2JS2A 1V1CA 2F2VA 2J05A 3TVTA 2A08A 2LQWA 2DLPA 1T0HA 2D8HA 2EPDA 2HCKA 4HCKA 4Z89A 3CQTA 3O5ZA 2D1XA 2QDLA 2RPNA 2K9GA 3VS5A 1ARKA 2HBWA 1AOJA 1IO6A 4IIMA 3NMZC 1NEGA 2ABLA 2G6FX 1SEMA 3FJ5A 1YNZA 2L2PA 4RTZA 2O9VA 4HVVA 1VA7A 1OEBA 1PHTA 2EQIA 5ECAA 2YDLA 5IXFA 4FSSA 2KT1A 2VVKA 1UFFA 2J7IA 2CUDA 1J3TA 1VYVA 2X3XD 4AG1C 4JJCA 5FWBA 1MV0B 1QCFA 2CH4W 2HEQA 2JS0A 2K6DA 1HJDA 1PKTA 2YUQA 2GBQA 4AFZC 1TUDA 1JXOA 1PNJA 2A36A 1U06A 4R0KA 2RQUA 3TSZA 2JMAA 5IHKA 4D8DA 1Z9QA 4F16A 4D8KA 2DL5A 1SPKA 2KBTA 3JV3A 2L3PA 4J9CA 3REBB 1JXMA 2GGRA 2OAWA 2AK5A 2ROLA 2JMCA 1YP5A 3NPFA 2LMJA 4J9HA 1SSHA 2YUPA 1RLQC 1NLPC 2LJ3A 3EHQA 1JEGA 2VKNA 1PRMC 1TG0A 2JM9A 4RTVA 1GRIA 4RTXA 1CKBA 1NYGA 3TSWA 1K9AA 1WI7A 3THKA 2AKKA 1EFNA 1GL5A 1SHFA 3M0SA 4K11A 1H3HA 5IXBA 2DRKA 1NYFA 1OPKA 2DVJA 1MUZA 3H0IA 4JJBA 3NHNA 2JM8A 4OMOA 4JZ3A 4CC7A 1UG1A 1KJWA 1YWPA 2DM1A 1AEYA 2EBPA 3VS0A 1ZSGA 1WDXA 3VS1A 1CKAA 2KGTA 2JXBA 4F17A 1H92A 2FPFA 1GCPA 3IQLA 3PVQA 3UF4A 4J9DA 1RLPC 3VRZA 3UA6A 2RN8A 1GBRA 2F2WA 2A37A 1KSWA 1M30A 4GBQA 3SEMA 4OMNA 1QWFA 1X69A 2CUBA 1FYNA 1PRLC 2O88A 2M51A 1TUCA 2LX7A 2ED0A 2LQNA 4GLMA 2FG0A 4CC3A 2BZYA 2RMOA 2J6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L23 A;  2KR3 A;  5IHN A;  1Y0M A;  2ESW A;  4OMM A;  2D8J A;  1MV3 A;  4F14 A;  2CT3 A;  4EIK A;  1OV3 A;  2HDA A;  1QKW A;  4OML A;  2AZV A;  2E5K A;  3LH5 A;  2K7A A;  2DMO A;  1W1F A;  2BTT A;  1T0J A;  1SRL A;  2L3S A;  1X6G A;  4JZ4 A;  1HSQ A;  3U23 A;  1WYX A;  1M3A A;  2DL8 A;  2KE9 A;  2KYB A;  1PKS A;  1Z9Z A;  2EYW A;  2P4R A;  3QWY A;  2DJQ A;  4RTU A;  2RF0 A;  2F2X A;  4LE9 A;  1GFD A;  1X27 A;  1U5S A;  2ED1 A;  1WIE A;  2FO0 A;  2K2M A;  1BB9 A;  2J6K A;  1G2B A;  3M0P A;  2I0N A;  2LZ6 B;  2DL7 A;  1ZLM A;  3NGP A;  4Y92 A;  1UGV A;  1NLO C;  2A28 A;  4A63 B;  4M4Z A;  1WXU A;  2EYY A;  2MIO A;  2EVR A;  5I22 A;  2IIM A;  3H41 A;  1VYU A;  2LJ0 A;  1I0C A;  1UHF A;  3VS3 A;  3M0T A;  4JJD A;  4J9E A;  2DX1 A;  1AZE A;  2GNC A;  1WLP B;  2H8H A;  5FWC A;  2L0A A;  2DA9 A;  2CSI A;  3EG0 A;  2RQW A;  2JTE A;  4CC4 B;  1JO8 A;  1WX6 A;  1B3Q A;  2KT8 A;  3M0Q A;  2RQT A;  1WXB A;  3VRY A;  4AFQ C;  3KFV A;  1AZG B;  2C0T A;  1E6H A;  1RUW A;  5GJV B;  2JW4 A;  3ZL7 C;  1ABQ A;  2PNI A;  2ROT A;  1BK2 A;  1N5Z A;  5GJW B;  1AD5 A;  1QKX A;  4WCI A;  2C0O A;  2LP5 A;  1RI9 A;  2L3Q A;  1ZUU A;  2W0Z A;  1JU5 C;  4J9I A;  2O2O A;  2DIL A;  2ENM A;  1GFC A;  1A0N B;  2ECZ A;  4HVW A;  1NEB A;  2MCN A;  3EG3 A;  1S1N A;  2BZ8 A;  2KYM A;  1SRM A;  1XOV A;  4LUE A;  2NWM A;  2GQI A;  3C0C A;  3VS6 A;  3ULR B;  1UHC A;  2K79 A;  1X43 A;  2FRW A;  4Z8A A;  2DL4 A;  3R6N A;  1QWE A;  1M3C A;  4HXJ A;  1ZBJ A;  3EGU A;  1KFZ A;  1UUE A;  3EG1 A;  1U3O A;  2RQV A;  1GCQ C;  2SEM A;  1K0S A;  1JQQ A;  2CH4 A;  2DE0 X;  1E7O A;  1CSK A;  2VWF A;  1K76 A;  2J06 A;  1UEC A;  3VS4 A;  2GTO A;  2FRY A;  1AWX A;  3SHW A;  2EW3 A;  4E6R A;  3H0F A;  1AWO A;  2YSQ A;  1BBZ A;  4Z88 A;  1FMK A;  1M8M A;  1Y57 A;  2BZX A;  3M0R A;  4LUD A;  2LNH B;  2D0N A;  2EGC A;  2PTK A;  2J6O A;  1X2K A;  3EG2 A;  2OJ2 A;  2EKH A;  2DBK A;  2V1R A;  3PVL A;  5IHI A;  1UTI A;  4ZNX A;  2JT4 A;  1W70 A;  2EGE A;  2KRO A;  4X1V A;  2PZ1 A;  2V1Q A;  1LCK A;  2FEI A;  1AWJ A;  3RNJ A;  1NG2 A;  4RTT A;  5EC7 A;  1M3B A;  2W10 A;  1UE9 A;  2YT6 A;  3REA B;  1X2Q A;  2GTJ A;  3I5S A;  2FPD A;  1GBQ A;  2O9S A;  2EGA A;  1WA7 A;  2DF6 A;  1AWW A;  4OMQ A;  1YN8 A;  3I35 A;  1E6G A;  2DYB A;  4RTY A;  2X3W D;  2CDT A;  1W6X A;  1K1Z A;  2EYX A;  1QLY A;  1UJ0 A;  1WFW A;  4RTW A;  4AFU C;  2RQR A;  2DNU A;  2NUZ A;  1KIK A;  4KRT A;  5I11 A;  1H8K A;  2SRC A;  2LCS A;  1YCS B;  1B07 A;  2YUO A;  4J9G A;  2C0I A;  2CSQ A;  2K3B A;  2OI3 A;  1T3L A;  1ZX6 A;  1K0X A;  2LJ1 A;  4HVU A;  1YWO A;  2B86 A;  1AVZ C;  4OMP A;  3RBB B;  1OOT A;  3H0H A;  2RNA A;  4J9F A;  2M0Y A;  2AKL A;  1ZUY A;  3PE0 A;  2O31 A;  4CC2 A;  1I1J A;  3UAT A;  2KEA A;  4RUG A;  5FW9 A;  2DL3 A;  1VYT A;  1G83 A;  4AG2 C;  4DEX A;  1ZUK A;  3M0U A;  2DRM A;  2FPE A;  1K4U S;  4AFS C;  2AZS A;  3I9Q A;  1SHG A;  4ORZ A;  1GCQ A;  4LN2 A;  2HSP A;  1UJY A;  3EHR A;  4QT7 A;  3A98 A;  1WXT A;  1I07 A;  2EYZ A;  2KRM A;  3QWX X;  5HCK A;  1PWT A;  3VS2 A;  1M27 C;  4JPB W;  2KNB B;  2XMF A;  2KRN A;  2MOX A;  2YUN A;  2KRS A;  1UDL A;  3GBQ A;  1OPL A;  4IIO A;  2CT4 A;  5IH2 A;  2CRE A;  4ESR A;  1HD3 A;  2KXD A;  4DEY A;  4J9B A;  4LNP A;  1T3S A;  1X6B A;  1NM7 A;  3VS7 A;  2KXC A;  1BU1 A;  1ABO A;  2DBM A;  3UA7 A;  3I5R A;  2JS2 A;  1V1C A;  2F2V A;  2J05 A;  3TVT A;  2A08 A;  2LQW A;  2DLP A;  1T0H A;  2D8H A;  2EPD A;  2HCK A;  4HCK A;  4Z89 A;  3CQT A;  3O5Z A;  2D1X A;  2QDL A;  2RPN A;  2K9G A;  3VS5 A;  1ARK A;  2HBW A;  1AOJ A;  1IO6 A;  4IIM A;  3NMZ C;  1NEG A;  2ABL A;  2G6F X;  1SEM A;  3FJ5 A;  1YNZ A;  2L2P A;  4RTZ A;  2O9V A;  4HVV A;  1VA7 A;  1OEB A;  1PHT A;  2EQI A;  5ECA A;  2YDL A;  5IXF A;  4FSS A;  2KT1 A;  2VVK A;  1UFF A;  2J7I A;  2CUD A;  1J3T A;  1VYV A;  2X3X D;  4AG1 C;  4JJC A;  5FWB A;  1MV0 B;  1QCF A;  2CH4 W;  2HEQ A;  2JS0 A;  2K6D A;  1HJD A;  1PKT A;  2YUQ A;  2GBQ A;  4AFZ C;  1TUD A;  1JXO A;  1PNJ A;  2A36 A;  1U06 A;  4R0K A;  2RQU A;  3TSZ A;  2JMA A;  5IHK A;  4D8D A;  1Z9Q A;  4F16 A;  4D8K A;  2DL5 A;  1SPK A;  2KBT A;  3JV3 A;  2L3P A;  4J9C A;  3REB B;  1JXM A;  2GGR A;  2OAW A;  2AK5 A;  2ROL A;  2JMC A;  1YP5 A;  3NPF A;  2LMJ A;  4J9H A;  1SSH A;  2YUP A;  1RLQ C;  1NLP C;  2LJ3 A;  3EHQ A;  1JEG A;  2VKN A;  1PRM C;  1TG0 A;  2JM9 A;  4RTV A;  1GRI A;  4RTX A;  1CKB A;  1NYG A;  3TSW A;  1K9A A;  1WI7 A;  3THK A;  2AKK A;  1EFN A;  1GL5 A;  1SHF A;  3M0S A;  4K11 A;  1H3H A;  5IXB A;  2DRK A;  1NYF A;  1OPK A;  2DVJ A;  1MUZ A;  3H0I A;  4JJB A;  3NHN A;  2JM8 A;  4OMO A;  4JZ3 A;  4CC7 A;  1UG1 A;  1KJW A;  1YWP A;  2DM1 A;  1AEY A;  2EBP A;  3VS0 A;  1ZSG A;  1WDX A;  3VS1 A;  1CKA A;  2KGT A;  2JXB A;  4F17 A;  1H92 A;  2FPF A;  1GCP A;  3IQL A;  3PVQ A;  3UF4 A;  4J9D A;  1RLP C;  3VRZ A;  3UA6 A;  2RN8 A;  1GBR A;  2F2W A;  2A37 A;  1KSW A;  1M30 A;  4GBQ A;  3SEM A;  4OMN A;  1QWF A;  1X69 A;  2CUB A;  1FYN A;  1PRL C;  2O88 A;  2M51 A;  1TUC A;  2LX7 A;  2ED0 A;  2LQN A;  4GLM A;  2FG0 A;  4CC3 A;  2BZY A;  2RMO A;  2J6F A; 
#chains in the Genus database with same CATH topology
 1VQ7 Q;  2D8J A;  4EMH A;  1WQ7 A;  5GAN 7;  3G6E Q;  4ATO A;  1UB4 A;  2DMO A;  5L8R E;  2L3S A;  1S72 T;  1X6G A;  1QCN A;  3L2R A;  4JZ4 A;  3CC7 Q;  3BDL A;  3U23 A;  3QYG B;  1M3A A;  3PIO A;  5LJ5 h;  2LT4 A;  1KHI A;  3SFM A;  1VQ9 A;  5FU7 C;  4BI8 B;  2DJQ A;  5KYU A;  3QZ5 B;  2F2X A;  2ED1 A;  3CBP A;  5KCH A;  3CC2 Q;  1DJ7 B;  4JRP A;  1D1C A;  2K3Y A;  3QKJ A;  4NOY A;  1ZLM A;  3NGP A;  4FM4 B;  1UGV A;  4JUV A;  4Y92 A;  1NLO C;  3WVE B;  4A63 B;  2QI2 A;  1IRE B;  2EKO A;  1WXU A;  2X35 A;  4BI4 A;  2IIM A;  1VIE A;  4M78 C;  4M78 D;  2LJ0 A;  1UGR B;  2K5F A;  5I21 A;  1AZE A;  1WLP B;  2H8H A;  5GMK h;  2CSI A;  2L89 A;  1YJW A;  2K4Y A;  2JTE A;  5GAN 8;  5C0M A;  5HY6 A;  4CRI A;  3G1J A;  2JN0 A;  3JCM V;  1WX6 A;  3M0Q A;  3EFO B;  2RQT A;  3MKD A;  2FZC B;  3BDU A;  4IUP A;  2XKO C;  3RDV A;  4BE1 A;  3GOX A;  1VIF A;  2KDS A;  2YLC A;  1ABQ A;  2PNI A;  1PG5 B;  1SF9 A;  3UDC A;  2ROT A;  2K2V A;  1BK2 A;  3AT1 B;  4M7D E;  1AD5 A;  2L3Q A;  1LOJ A;  1ZUU A;  2QTX A;  2QG9 B;  4ANJ A;  3FIF A;  1D1A A;  3PFS A;  2V8K A;  2ECZ A;  3GF5 A;  4LD6 A;  4XU3 A;  2P0P A;  3JCM P;  1VQL T;  3CCR T;  2LVM A;  3S3M A;  2DEU A;  4FSX A;  4LUE A;  3C12 A;  3J80 E;  4NL2 A;  3CPF A;  3VS6 A;  3ULR B;  2KQW A;  4DOV A;  4MZT A;  4M7A A;  2DL4 A;  3CCL Q;  1VQ4 Q;  1QWE A;  4O6J A;  4HKE A;  1KFZ A;  4PK4 A;  2E5Q A;  4B9X A;  2E65 A;  4N4H A;  1GCQ C;  4F04 B;  2EQU A;  3VYG A;  1Y07 A;  2RHY A;  2DTO A;  5GAN h;  2DXB A;  3SHW A;  2EW3 A;  1YI2 Q;  2YSQ A;  3QXE B;  1BI0 A;  4Z88 A;  4LUD A;  3M0R A;  3LGF A;  2AIR B;  1U1T A;  2V1R A;  3CCU Q;  2EGE A;  3VUZ A;  2Y90 A;  2FEI A;  3OYF A;  4C5H A;  3RKX A;  3RNJ A;  4FT2 A;  3C4S A;  2JTM A;  4E7Z A;  5CKB A;  3AHU A;  4RTT A;  3DLL A;  1GBQ A;  3EH2 A;  3UT1 A;  1X01 A;  1D3B B;  1M8V A;  3I35 A;  4X34 A;  4ZGD B;  1W6X A;  1K1Z A;  2EYX A;  1TSF A;  1UJ0 A;  1VQ8 A;  3CCS Q;  2RQR A;  3OB9 A;  3FC3 A;  4KRT A;  2DO3 A;  5I11 A;  3X25 B;  2FL7 A;  2RH2 A;  1YJ9 Q;  4C92 F;  1NBE B;  2LCS A;  1B07 A;  4RMO A;  2C0I A;  3FRN A;  2K3B A;  2E4H A;  1IGU A;  5FRN A;  4XTU A;  2JUF A;  1G5V A;  2B86 A;  4OMP A;  1YIT Q;  3H0H A;  2O31 A;  4CC2 A;  1I1J A;  2EFI A;  5FW9 A;  2DL3 A;  1VYT A;  1OYX A;  1G3W A;  2JVV A;  2FPE A;  2HNI A;  4M77 F;  1SHG A;  2FB7 A;  2X9H A;  1UJY A;  4C8Q F;  4RKU E;  1WXT A;  3G4S Q;  1VOM A;  2OTL T;  3QO3 A;  4A53 A;  1ZA1 B;  3G71 T;  2EYZ A;  5HCK A;  4F7U B;  2MOX A;  4ZN1 A;  1VQP T;  1Q7Y C;  3FJP A;  2ZPG B;  1Q81 U;  1XNI A;  1VUB A;  2KXD A;  2P84 A;  3CCQ T;  3NFC A;  2EYQ A;  1VQ5 A;  4LNP A;  1VQK A;  1X6B A;  2RHU A;  5GAO m;  1SKU B;  4C8Q B;  1VQ7 A;  3I5R A;  1V1C A;  1Y71 A;  4M78 A;  3MHX A;  3CCE A;  4QVD A;  2DLP A;  1N6A A;  4DOW A;  1MMA A;  1T0H A;  2D8H A;  2HSE B;  3OYM A;  2CKK A;  2D1X A;  2DTI A;  2K9G A;  4E7L A;  3VS5 A;  2HBW A;  1WHJ A;  1RAF B;  3OQ5 A;  1AOJ A;  3CCV Q;  4IIM A;  3NMZ C;  2ABL A;  1S72 A;  2Y4Y A;  1OI1 A;  3OYD A;  1PHT A;  5ECA A;  2YDL A;  4E7K A;  2O4X B;  2XI9 A;  5KYW A;  5LJ3 e;  1KD1 U;  5A2Q E;  4OGC A;  5GAO q;  3H6Z A;  3JCM c;  4F7U E;  4AG1 C;  1QCF A;  5IT9 E;  4M75 B;  2CH4 W;  1YJW T;  1NJI R;  1D0Y A;  2K6D A;  1B34 B;  5GAN 4;  3CPW A;  1JXO A;  4LDW A;  4C0G A;  1U06 A;  2QK0 A;  4D8D A;  2V26 A;  1QVP A;  4M77 E;  3E1S A;  4J5Y A;  3MJX A;  4EMG A;  2L3P A;  3CME Q;  4C8Q E;  3JCM d;  1GXI E;  1JXM A;  1MHN A;  2GGR A;  2PU9 B;  2M0O A;  2DPP B;  1KQ2 A;  3E19 A;  2KY9 A;  4LDX A;  3NPF A;  2LMJ A;  1SSH A;  3VUB A;  1JRI A;  1NLP C;  1WNL A;  3ZEH A;  2VKN A;  4RTV A;  1TG0 A;  1GRI A;  3O8V A;  3OYG A;  4E7H A;  1UEB A;  4WTO B;  4QVC A;  1K9A A;  4II1 A;  4Y28 E;  3THK A;  3OBY A;  4RG2 A;  1XTD A;  1SHF A;  2CP6 A;  4K11 A;  3DB4 A;  1H3H A;  5IXB A;  2DRK A;  2EJF A;  5KCO A;  3PNW C;  2VAS A;  5GAM e;  1NYF A;  2K57 A;  3MCA B;  4Y91 A;  3M4G A;  3PMT A;  1VQN T;  3SWN B;  4CC7 A;  4M75 E;  5KYX A;  3M53 A;  1VQO Q;  3JB9 I;  2L3R A;  3BY7 A;  1CKA A;  2JXB A;  3SDZ A;  2FPF A;  3BFM A;  4PKC C;  4V2S A;  4XU1 A;  5FU6 B;  1RLP C;  3A8G B;  1D0Z A;  1Q86 R;  1M30 A;  4HCC A;  4PJL A;  2WAC A;  4GBQ A;  3CCL A;  2RI2 A;  1VQ4 A;  1X69 A;  2HBP A;  1PRL C;  2LRQ A;  2XU8 A;  2LQN A;  4EDU A;  4GLM A;  4CC3 A;  2BZY A;  1M2V B;  2BKD N;  3OA6 A;  5L23 A;  4HA8 A;  5IHN A;  4PJO B;  4FL6 A;  3GLX A;  2BE7 D;  3PT9 A;  1WHG A;  1WZO A;  2JTF A;  2CT3 A;  2DD5 A;  3RES A;  2QAS A;  2HDA A;  4OML A;  3LW5 E;  1LVK A;  5LJ3 g;  2BTT A;  4A4F A;  3QII A;  2QA4 Q;  1SRL A;  2KI7 A;  3JRZ A;  2BUD A;  3L2Q A;  4BY6 B;  3OS2 A;  1N8R R;  2LQK A;  1HSQ A;  2RHI A;  3CMA Q;  2DL8 A;  2LT1 A;  2KE9 A;  1IHV A;  4M7A C;  4M7A D;  1PKS A;  1Z9Z A;  3JCM X;  3PGG A;  5GAO p;  2HMA A;  3CCU A;  3LWH A;  5KYN A;  1U5S A;  4L5G A;  1VQ8 T;  3LWI A;  1YJN Q;  5EG2 A;  1M1K R;  5LJ3 j;  3CPW P;  3M0P A;  4RG8 A;  1TWB A;  4PJJ A;  2A28 A;  2G3R A;  3V8J A;  4M4Z A;  3CCJ Q;  3DB3 A;  2EQM A;  2E41 A;  2XG8 D;  2LQ8 A;  2EVR A;  5I22 A;  3H41 A;  1I0C A;  5I2M A;  1KK7 A;  3M0T A;  3M55 A;  1X75 C;  4J9E A;  2DX1 A;  3CCS A;  2GNC A;  1V76 A;  2RA2 A;  5LJ5 d;  4LDV A;  1Q82 U;  2L0A A;  2DFU A;  3HTR A;  1OX8 A;  2DA9 A;  2P0K A;  3EG0 A;  3LLR A;  2RQW A;  2VGN A;  4CC4 B;  3V8L A;  2RJE A;  4C5G A;  1MNE A;  2VB6 A;  5KE2 A;  1B3Q A;  2E12 A;  1YIT A;  1KC8 R;  4KUI A;  5DM7 R;  5IAY A;  4EMK B;  3M4Y A;  2GFA A;  2RJD A;  3EG9 B;  3E2U A;  2C0T A;  1RUW A;  5GJV B;  3JB9 D;  2JJ9 A;  2ZPB B;  5GAN 2;  1YIJ Q;  3V7S A;  3CCM Q;  2JW4 A;  3ZL7 C;  4MDW A;  2MWO A;  4P5N A;  1N5Z A;  4A4K A;  1QKX A;  4A4G A;  2C0O A;  4OGE A;  4BDZ A;  1RI9 A;  1VQM Q;  4B6M A;  3UWN A;  2LDM A;  2W0Z A;  3EFO A;  4QQ6 A;  4KGZ B;  2ENM A;  4ZGE B;  3OMC A;  5GAM f;  2JNG A;  4DBQ A;  4M75 D;  3EG3 A;  2ZPH B;  2VXF A;  1IXD A;  1XOV A;  3G71 A;  2GQI A;  2F69 A;  2MYS A;  2DVE A;  4XTW A;  1K8A C;  1VQ7 T;  1X43 A;  3OYN A;  1M1G A;  3OSS C;  2FRW A;  3F70 A;  1K9M C;  1VQP A;  2HQX A;  4J7I A;  4HXJ A;  3EGU A;  3G6E T;  1UUE A;  3EG1 A;  1U3O A;  1G3Y A;  1M5Q 1;  1K0S A;  3G7Z A;  1WHM A;  4XU0 A;  1ZSZ B;  3CCQ A;  3CC7 T;  3JB9 J;  7AT1 B;  2RO0 A;  5GMK i;  3MO8 A;  2GTO A;  1AWO A;  1AWX A;  1BI2 A;  4BB7 A;  1BBZ A;  1M8M A;  1Y57 A;  2D0N A;  2EGC A;  3JAM E;  1K73 C;  2J6O A;  1BKB A;  3CC2 T;  2EKH A;  3E9G A;  1UTI A;  4M7D B;  2RJC A;  1JJ2 A;  3HRS A;  1VQ6 Q;  3HRU A;  1BI3 A;  2BIV A;  2V1Q A;  4J6W A;  1LCK A;  1TS9 A;  5GAO r;  2AT1 B;  2HL3 A;  1NG2 A;  2NUT B;  1NPR A;  3X28 B;  1M3B A;  1KQS A;  1D1B A;  5GAN d;  1PM3 A;  3I5S A;  2E6Z A;  2EAY A;  4XTV A;  2DYI A;  5A0L A;  1AWW A;  2QQR A;  3URG A;  2A3L A;  1E6G A;  2DYB A;  3QHS A;  3A8L B;  1K9M R;  2DZ9 A;  4RTW A;  1RAI B;  2DNU A;  5GAM d;  2QXF A;  4IUV A;  4ZTJ A;  1QVG A;  2MF2 A;  2RB6 A;  1YCS B;  3TCJ A;  2YUO A;  3CME A;  4PJO C;  4PJO D;  2LNV A;  4J9G A;  1D3B A;  3M5A A;  3A8O B;  2COW A;  2ZPI B;  2CP5 A;  2OI3 A;  1T3L A;  1HK9 A;  1ZX6 A;  5KH6 A;  4M78 G;  1AVZ C;  3QDF A;  2RNA A;  2M0Y A;  4LDU A;  4OB0 B;  1K73 R;  5KE3 A;  2B8A A;  2KEA A;  3QYH B;  3VYH B;  3HKS A;  4RUG A;  1W2B A;  1YBY A;  4AG2 C;  1FWZ A;  3CXC A;  1PSE A;  1SG5 A;  3HRT A;  4AFS C;  3QBY A;  1MMG A;  2AZS A;  2E1H A;  3I9Q A;  3OY9 A;  4ORZ A;  1U8R A;  4LN2 A;  2HSP A;  1IZ6 A;  2AHJ B;  3KXT A;  3EHR A;  2RK2 A;  3A98 A;  4JLI A;  1AT1 B;  1YHQ Q;  4WF2 A;  2HAX A;  2KRM A;  3CCL T;  1VQ4 T;  2PVD B;  3OW2 A;  1I8F A;  4JPB W;  3I55 Q;  1M2O A;  3QJ6 A;  1BCM A;  2DKG A;  1VQO A;  3OYE A;  1VQN A;  2OTJ Q;  3GBQ A;  1OPL A;  4KGV B;  2C06 A;  5IH2 A;  2QQB A;  2CRE A;  4BD3 A;  4ESR A;  2NUP B;  3HP9 A;  3QPH A;  5C6S A;  1YI2 T;  2CP0 A;  2CP7 A;  4XTZ A;  1IRX A;  1T3S A;  3D7S B;  1OU8 A;  2MWP A;  2WSF E;  3OMG A;  4F7U A;  1BU1 A;  2DBM A;  2JS2 A;  4QVZ A;  3M56 A;  2DIQ A;  2MAM A;  1JJ2 P;  3CCU T;  2RHX A;  3EAE A;  2EPD A;  4EMK C;  1U1S A;  2HCK A;  4HCK A;  3GPL A;  3O5Z A;  5GAM h;  3L2V A;  1TU0 B;  1ARK A;  2EJ9 A;  2XIC A;  3A8H B;  1WJQ A;  3X24 B;  2GQV A;  5DY9 A;  1SEM A;  2L2P A;  4RTZ A;  4HVV A;  1VA7 A;  2M1H A;  3GNG A;  2EQI A;  4FSS A;  4IUR A;  2VVK A;  1UFF A;  3UPU A;  1J3T A;  1VYV A;  3CCS T;  2QDY B;  2X3X D;  2V8I A;  5FWB A;  1YJ9 T;  1C0M A;  1V29 B;  1TXQ A;  3LGL A;  1PKT A;  2YUQ A;  2GBQ A;  1WJS A;  4C0D B;  1PNJ A;  2A36 A;  2O4X A;  2LCC A;  3TSZ A;  2JMA A;  1Z9Q A;  1O75 A;  1ZHI A;  4OB1 B;  1EX4 A;  1YIT T;  3L1A A;  1RAE B;  3MEU A;  3EFS A;  1Q95 G;  4M75 A;  3REB B;  2OAW A;  1W2B P;  2AK5 A;  1MND A;  1P92 A;  4DA4 A;  1M4Z A;  1TH7 A;  2X51 A;  5CQX A;  2F5T X;  3CXC P;  3A1P A;  4J9H A;  1RLQ C;  5CCA A;  1OQK A;  1PC0 A;  3EHQ A;  3MET A;  1JEG A;  2JM9 A;  1BIA A;  2MMP A;  4XU2 A;  4RCB A;  3G4S T;  3KUF A;  2K3X A;  4M7D C;  4M7D D;  2EJG A;  2VV5 A;  3RKW A;  4N0A A;  1EFN A;  1QCO A;  2F1L A;  3INZ A;  3M0S A;  1NJI U;  3TRE A;  4C92 B;  4ELY C;  3OW2 P;  4R56 A;  4KUD K;  5KYY B;  1RI0 A;  2VUB A;  3HL8 A;  3H0I A;  1N9R A;  4JS5 A;  2M02 A;  3A5Z B;  4A54 A;  3CC4 Q;  2DXT A;  3ASK A;  1YWP A;  4EPC A;  1KHC A;  1HXD A;  1MMD A;  3VS0 A;  3CD6 Q;  5J26 A;  4F17 A;  2E6N A;  1H92 A;  3UF4 A;  2KSS A;  1OX9 A;  2QEX Q;  2RN8 A;  3ER0 A;  2VGM A;  4M77 B;  2D0Q B;  3SEM A;  4OMN A;  1PD0 A;  2CUB A;  2O88 A;  3SWN A;  4C5E A;  2OX7 A;  3JCM Q;  1TUC A;  2DAQ A;  2FG0 A;  2RMO A;  2J6F A;  3E9F A;  2KR3 A;  1RAA B;  5LL6 S;  1MV3 A;  3MP6 A;  4F14 A;  1C1A A;  3G6E A;  3CCV T;  5AYF A;  4JS4 A;  3I56 Q;  4EIK A;  1QKW A;  2IVW A;  2MK5 A;  2E5K A;  1I5L A;  3FLG A;  3CC7 A;  3C95 A;  3OSV A;  1Q81 C;  4A4E A;  1OU9 A;  4XTY A;  2R57 A;  1M90 U;  1M2V A;  2LTO A;  3EGD B;  2KYB A;  4C92 E;  3OYH A;  4PJO A;  2EYW A;  2P4R A;  4JDS A;  4RTU A;  3CC2 A;  1GFD A;  3PIP A;  1VQ9 Q;  2FO0 A;  1Q86 U;  1Q7Y R;  1BB9 A;  2E70 A;  2J6K A;  3V7C A;  2I0N A;  1G8X A;  2LZ6 B;  1Y96 A;  2DL7 A;  4PFO A;  5GAN 5;  2EYY A;  2MIO A;  3L42 A;  4MZM A;  3CME T;  1UHF A;  3VS3 A;  4JJD A;  2F5K A;  3M54 A;  3DKM A;  1BI1 A;  3OYC A;  4JLG A;  4AMC A;  1N8R U;  3BE3 A;  3EGX B;  5GAN 6;  1JO8 A;  3M59 A;  4YTL A;  4PFP A;  1RAD B;  4BUG A;  1WXB A;  1Q81 R;  4AFQ C;  1ACM B;  1M1K U;  1AZG B;  1E6H A;  5FRO A;  4M78 F;  1XJW B;  4A4H A;  5CKE A;  1WGS A;  4FT4 A;  3OS1 A;  1VQO T;  3VKI A;  4J9I A;  2O2O A;  3H9N A;  2DIL A;  5FU7 B;  4EMK A;  1I81 A;  3EG9 A;  2CZ6 B;  4IUU A;  4HVW A;  1NEB A;  4IKF A;  2MCN A;  4D6W A;  1S1N A;  3I55 A;  3VV0 A;  2NWM A;  3JB9 H;  3C0C A;  3RER A;  3LH0 A;  1UHC A;  5CKF A;  4Z8A A;  3OS0 A;  3R6N A;  3J7A F;  1KC8 U;  3PTA A;  4FU6 A;  2SEM A;  2QA4 T;  1JQQ A;  2CH4 A;  1CSK A;  3V7R A;  1H64 1;  2ZAE A;  4LDY A;  3WVD B;  3CMA T;  4XAX B;  2M9U A;  1YI2 A;  4L6V 5;  2FRY A;  3H0F A;  1FMK A;  4XTX A;  2LNH B;  2FVU A;  5GMK j;  1NPP A;  1YJN T;  3EG2 A;  1FMV A;  2OJ2 A;  2DBK A;  4PFZ A;  1ZSZ A;  2PVG B;  4C92 D;  3LYI A;  2JT4 A;  1W70 A;  2MI6 A;  4IUQ A;  3CCJ T;  2YHT A;  4UC4 A;  2D6F A;  1AWJ A;  3L2Z A;  3JCM W;  5LJ3 f;  2QYZ A;  2PQW A;  2DK3 A;  5EC7 A;  1UE9 A;  3REA B;  1X2Q A;  1IB8 A;  4VUB A;  4X9D A;  2EGA A;  4MZP A;  4M7D A;  2QTV A;  2QGF B;  2COZ A;  4M7A G;  2XDB A;  4RTY A;  3MEW A;  2E10 A;  2PUK B;  3MP1 A;  4M77 D;  4M77 C;  4M78 E;  4X9C A;  1RAG B;  3GNF B;  1YJ9 A;  1ZA2 B;  2NUT A;  4J6X A;  5CIU A;  4C8Q D;  4C8Q C;  2XDP A;  2SRC A;  3HSB A;  4F7U G;  2FZG B;  2EQK A;  1YIJ T;  2L5Q A;  2NLU A;  1I5O B;  3CCM T;  1K0X A;  4JRK A;  2LJ1 A;  4HVU A;  1R77 A;  1OOT A;  4J9F A;  1R0C B;  4N4I A;  2AKL A;  1ZUY A;  3PE0 A;  1VQM T;  4J7F A;  3FDR A;  1WHH A;  2FHD A;  2P0Q A;  1G83 A;  1XQH A;  1ZUK A;  2DRM A;  1Q82 C;  1K4U S;  2Y4X A;  2HQH A;  1C6V X;  3QJY A;  4JRQ A;  2VYT A;  3C94 A;  3G4S A;  2CZ1 B;  4FYW B;  5CR2 A;  4QT7 A;  1K9M U;  5FLX E;  4MMK A;  4M75 C;  2HZY A;  4PJM A;  1I07 A;  1M1F A;  3JB9 G;  1UGQ B;  3VS2 A;  2KNB B;  1YCY A;  4OP0 A;  4ELZ C;  3JCM b;  3CD6 A;  3ZBD A;  5J39 A;  1LPL A;  3R6O A;  1M9S A;  4IIO A;  4Q5W A;  2RHZ A;  2ZCF B;  2QEX A;  5LJ3 d;  1PD1 A;  3NTH A;  4J83 A;  4N0A C;  2PUO B;  5GAO n;  4DEY A;  4J9B A;  2X4X A;  4M75 G;  1QVF A;  1NM7 A;  1VQ5 Q;  1W4S A;  1RAC B;  1VQK Q;  2F2V A;  2I2L A;  3TVT A;  2A08 A;  4HCB A;  3I56 A;  1VQ6 T;  1ZQ1 A;  2HD0 A;  1B7T A;  2NUP A;  2E3I A;  2YXY A;  3CCE Q;  4QQD A;  4C0Z A;  2RI3 A;  3X20 B;  4KBM B;  5GMK l;  3CCV A;  4QKU A;  2RPN A;  1RL2 A;  2KAF A;  1Q82 R;  2WSC E;  3EH1 A;  1KQ1 A;  4E7I A;  1IO6 A;  1EZZ B;  2GFU A;  3A8M B;  1UGP B;  2G6F X;  3FJ5 A;  3N5B B;  3SWN C;  1S72 Q;  5CKD A;  1YFN A;  1IGQ A;  2QQA A;  4PJN A;  2J7I A;  3TQ7 P;  2JZ2 A;  2CUD A;  4O5V A;  2XD0 A;  2YWW A;  4BAC A;  1K8A R;  2DZC A;  2EIF A;  4JJC A;  3OYB A;  5FU6 C;  3HFN A;  2ZZD A;  1OUL A;  1WHK A;  2HEQ A;  2OAU A;  4JRI A;  3S3N A;  2JS0 A;  4FCY A;  4ME7 A;  4QQG A;  2P4T A;  1WPY A;  3OYY A;  1TUD A;  1RAB B;  2X4W A;  4RCC A;  9ATC B;  4R0K A;  1NE8 A;  2RQU A;  5IHK A;  3KBG A;  4F16 A;  2KBT A;  2JOY A;  2E3H A;  2IPO B;  1AHJ B;  4KUL A;  2X4J A;  2ROL A;  5CAI A;  1YP5 A;  3RMQ A;  2DET A;  4BY6 C;  4C0F A;  2LJ3 A;  1WQW A;  4JJN K;  2CGH A;  5LJ3 h;  4RTX A;  3MEA A;  2CP2 A;  1NYG A;  2K5I A;  3RMS A;  1MGQ A;  3TSW A;  2LCL A;  1YHQ T;  1WI7 A;  1D09 B;  2AKK A;  4PJO G;  3SB2 A;  3I55 T;  1OPK A;  2DVJ A;  4TVR A;  4JJB A;  2OTJ T;  3NHN A;  2JM8 A;  4OMO A;  2DD4 A;  5J3B A;  4JZ3 A;  5HKC A;  1UG1 A;  2LC4 A;  2DM1 A;  3L2W A;  3JCM e;  1AEY A;  2DXU A;  1WJR A;  4CI0 C;  1WDX A;  4C92 A;  3P8D A;  1GCP A;  3PMI A;  3PVQ A;  4R55 A;  1QVF P;  4AT1 B;  3VRZ A;  5KYY A;  2XK0 A;  3UA6 A;  1KSW A;  2H3E B;  3QUI A;  1OZ3 A;  1QWF A;  1VQL Q;  3CCR Q;  3Q1J A;  1D0X A;  2M51 A;  3OYL A;  2ED0 A;  1QQJ A;  2NYS A;  2YRD A;  3LX7 A;  1N9S A;  1Y0M A;  2ESW A;  3MP8 A;  4OMM A;  3BW1 A;  5KYU B;  3MEV A;  1OV3 A;  1O9S A;  2QA4 A;  2AZV A;  3LH5 A;  4M77 A;  2K7A A;  1MMN A;  1W1F A;  1T0J A;  5CK9 A;  8ATC B;  3CMA A;  4J8O A;  4C8Q A;  1KQS P;  4KH0 B;  4HCZ A;  2KK4 A;  1WYX A;  5HK3 A;  2RK1 A;  3CEY A;  3QWY A;  4FYV B;  2RF0 A;  3JSC A;  3V8K A;  4LE9 A;  1YJN A;  4C5I A;  1X27 A;  1WIE A;  2CS7 A;  3HFO A;  2K2M A;  4DBH A;  1G2B A;  3CCJ A;  1QVG P;  2L8D A;  2VC8 A;  3EGD A;  3GIB A;  3DLM A;  1VYU A;  2FZK B;  2HL5 C;  1TUG B;  3EFR A;  4MDX A;  3VU3 C;  2E64 A;  1NZ9 A;  1ZSZ C;  5FWC A;  3GP8 A;  1JB0 E;  4M7A F;  1B34 A;  2V8J A;  2DER A;  2YRV A;  1RAH B;  3SD4 A;  3CPW S;  2A7Y A;  1QMC A;  5CQY A;  1ZBX A;  2DTH A;  2H3J A;  2QAZ A;  2KT8 A;  4OB3 B;  3VRY A;  4F7U F;  1YIJ A;  3TU4 K;  3H8Z A;  3CCM A;  3KFV A;  1Q7Y U;  3P8B B;  2FYK A;  4BDY A;  3JCM g;  1VQM A;  3EGX A;  4NS5 A;  3OYK A;  3CC4 T;  2R58 A;  5GJW B;  4WCI A;  2LP5 A;  2K5L A;  1JBM A;  5DLO A;  2HKQ B;  2X4Y A;  3CD6 T;  1JU5 C;  4M7A B;  1GFC A;  2R5M A;  5LJ5 e;  1A0N B;  2QEX T;  3QG1 A;  4E7S A;  4FYY B;  2PVO B;  1WHL A;  3RUX A;  4BE0 A;  2ATC B;  2QGG A;  2BZ8 A;  2KYM A;  4M7D G;  1TTH B;  4LXC A;  1SRM A;  1LNX A;  1FX7 A;  2OTL Q;  2K79 A;  3JCM f;  3G71 Q;  4XQ3 A;  3ZFJ A;  3JB9 F;  1NJI C;  3I56 T;  1M3C A;  4IUT A;  1ZBJ A;  5AT1 B;  3J81 E;  3FEO A;  2RQV A;  1VQP Q;  4B9W A;  1G3T A;  2DE0 X;  1E7O A;  2VWF A;  5CO7 A;  4PNO A;  1K76 A;  5A0D A;  2J06 A;  5GMK e;  3QDR B;  2HKN A;  1UEC A;  3CCQ Q;  3VS4 A;  4E6R A;  4QW2 A;  4NL3 A;  2BZX A;  3NTK A;  4M75 F;  4HT8 A;  1H3Z A;  1X6O A;  1VQ9 T;  2PTK A;  1X2K A;  2RD1 A;  3QZ9 B;  3T9N A;  1VQ6 A;  3PVL A;  3HPW A;  2HQE A;  5IHI A;  5I2S A;  2CYZ B;  4ZNX A;  4OMF B;  3P8H A;  3ME9 A;  3S6W A;  2KRO A;  4X1V A;  2DXC A;  2PZ1 A;  4PLL A;  4M7A E;  4GY5 A;  1N27 A;  5HK0 A;  4MML A;  2KVQ G;  3NTI A;  4E7J A;  1KG1 A;  2W10 A;  2YT6 A;  3M9Q A;  2GTJ A;  1I4K 1;  2FPD A;  2O9S A;  1WA7 A;  2DF6 A;  5M9O A;  4FW1 A;  4KGX B;  5DLQ E;  2MPX C;  4OMQ A;  5GAO l;  1YN8 A;  3OBW A;  2CZ7 B;  1EIF A;  1UGS B;  2X3W D;  2CDT A;  5CVI A;  1M90 C;  5GAN 3;  4XK8 E;  1QLY A;  1WFW A;  4AFU C;  4KH1 B;  2VXE A;  2NUZ A;  4DBF A;  1KIK A;  1H8K A;  2ZPE B;  1KD1 C;  1YJW Q;  2Z0W A;  2CP3 A;  3MPU B;  1Q86 C;  2CSQ A;  4KT0 E;  4FIB A;  4J6Y A;  2DJZ A;  2RM4 A;  1YWO A;  3RBB B;  3UAT A;  5LJ5 g;  1QP2 A;  4PLI A;  3JCM J;  2DEQ A;  3L2U A;  5GAN e;  4DEX A;  3OYI A;  3CBM A;  3M0U A;  2M16 A;  1FXX A;  4BE2 A;  4OVA A;  3WXM B;  1G3S A;  1GCQ A;  1N8R C;  1YHQ A;  5FRM A;  5D6Y A;  3RKY A;  5LJ5 j;  3QWX X;  4PJO F;  2ZGW A;  3OYA A;  2GCX A;  1PWT A;  4C0D C;  5D6X A;  1M27 C;  5LJ5 f;  2LX9 A;  2OTJ A;  4E2F B;  2XMF A;  1M90 R;  1M1K C;  2KRN A;  2YUN A;  2KRS A;  3CBO A;  1R0B G;  1UDL A;  4M78 B;  5CKH A;  1LJO A;  2CT4 A;  1HD3 A;  1VQN Q;  1KD1 R;  1Y7X A;  2YLB A;  4ZN3 A;  1VQL A;  3CCR A;  4PL6 A;  4HT9 A;  2YRC A;  2KMT A;  3VS7 A;  2KXC A;  1ABO A;  4GLK A;  4OF1 A;  3UA7 A;  5A0G A;  2J05 A;  1HYO A;  1IHW A;  2LQW A;  5IN1 A;  3OYJ A;  5KYW B;  2BE9 B;  1OZ2 A;  4Z89 A;  3CQT A;  4FYX B;  4ZTF A;  2QDL A;  4C92 C;  1QVF S;  2XHC A;  3VJP A;  1KC8 C;  1Y96 B;  2DIG A;  1NEG A;  1YNZ A;  2O9V A;  1OEB A;  2R5A A;  2XDD A;  3JCM h;  5IXF A;  3X26 B;  1BCO A;  2KT1 A;  5D7U A;  2EQJ A;  1BIB A;  1JJ2 S;  1MV0 B;  2COY A;  3RIR A;  3RR6 A;  4C92 G;  1HJD A;  1VQ8 Q;  1PCX A;  4AFZ C;  3FB9 A;  6AT1 B;  1BYM A;  2A0F B;  1KQS S;  2ZPF B;  4D8K A;  2DL5 A;  1SPK A;  3JV3 A;  2QQS A;  5GAN g;  4J9C A;  4FW2 A;  1R8O B;  2O01 E;  2JMC A;  4PJO E;  2YUP A;  2QQ9 A;  2XID A;  2WSE E;  4OB2 B;  4E47 A;  1QVG S;  4M77 G;  4BI3 A;  1PRM C;  2D9T A;  2GF7 A;  5GAM g;  8AT1 B;  3TEE A;  1CKB A;  4C8Q G;  2RJF A;  1K8A U;  5KYX B;  1PSF A;  5GAN j;  2EWN A;  2IG0 A;  1GL5 A;  3OS5 A;  3M57 A;  5D6W A;  5GAN f;  3S3O A;  3M58 A;  1FMW A;  1QP3 A;  4DQ2 A;  1W2B S;  1MUZ A;  3CXC S;  3CC4 A;  4LD9 K;  5GAM j;  5GMK m;  1KJW A;  4N4G A;  1TOV A;  2EBP A;  4L59 A;  1ZSG A;  3VS1 A;  2KGT A;  3IQL A;  1VQ5 T;  2RI5 A;  4J9D A;  4DBR A;  3HHT B;  2CZ0 B;  1K73 U;  1VQK T;  2OTL A;  1GBR A;  2F2W A;  2A37 A;  1SSF A;  3QSU A;  3OW2 S;  4M7D F;  1FYN A;  4Z02 A;  1F1B B;  2LX7 A;  3CCE T;  1QW1 A;  4ZGJ B; 
#chains in the Genus database with same CATH homology
 5L23 A;  2KR3 A;  5IHN A;  1Y0M A;  2ESW A;  4OMM A;  2D8J A;  1MV3 A;  4F14 A;  2CT3 A;  4EIK A;  1OV3 A;  2HDA A;  1QKW A;  4OML A;  2AZV A;  2E5K A;  3LH5 A;  2K7A A;  2DMO A;  1W1F A;  2BTT A;  1T0J A;  1SRL A;  2L3S A;  1X6G A;  4JZ4 A;  1HSQ A;  3U23 A;  1WYX A;  1M3A A;  2DL8 A;  2KE9 A;  2KYB A;  1PKS A;  1Z9Z A;  2EYW A;  2P4R A;  3QWY A;  2DJQ A;  4RTU A;  2RF0 A;  2F2X A;  4LE9 A;  1GFD A;  1X27 A;  1U5S A;  2ED1 A;  1WIE A;  2FO0 A;  2K2M A;  1BB9 A;  2J6K A;  1G2B A;  3M0P A;  2I0N A;  2LZ6 B;  2DL7 A;  1ZLM A;  3NGP A;  4Y92 A;  1UGV A;  1NLO C;  2A28 A;  4A63 B;  4M4Z A;  1WXU A;  2EYY A;  2MIO A;  2EVR A;  5I22 A;  2IIM A;  3H41 A;  1VYU A;  2LJ0 A;  1I0C A;  1UHF A;  3VS3 A;  3M0T A;  4JJD A;  4J9E A;  2DX1 A;  1AZE A;  2GNC A;  1WLP B;  2H8H A;  5FWC A;  2L0A A;  2DA9 A;  2CSI A;  3EG0 A;  2RQW A;  2JTE A;  4CC4 B;  1JO8 A;  1WX6 A;  1B3Q A;  2KT8 A;  3M0Q A;  2RQT A;  1WXB A;  3VRY A;  4AFQ C;  3KFV A;  1AZG B;  2C0T A;  1E6H A;  1RUW A;  5GJV B;  2JW4 A;  3ZL7 C;  1ABQ A;  2PNI A;  2ROT A;  1BK2 A;  1N5Z A;  5GJW B;  1AD5 A;  1QKX A;  4WCI A;  2C0O A;  2LP5 A;  1RI9 A;  2L3Q A;  1ZUU A;  2W0Z A;  1JU5 C;  4J9I A;  2O2O A;  2DIL A;  2ENM A;  1GFC A;  1A0N B;  2ECZ A;  4HVW A;  1NEB A;  2MCN A;  3EG3 A;  1S1N A;  2BZ8 A;  2KYM A;  1SRM A;  1XOV A;  4LUE A;  2NWM A;  2GQI A;  3C0C A;  3VS6 A;  3ULR B;  1UHC A;  2K79 A;  1X43 A;  2FRW A;  4Z8A A;  2DL4 A;  3R6N A;  1QWE A;  1M3C A;  4HXJ A;  1ZBJ A;  3EGU A;  1KFZ A;  1UUE A;  3EG1 A;  1U3O A;  2RQV A;  1GCQ C;  2SEM A;  1K0S A;  1JQQ A;  2CH4 A;  2DE0 X;  1E7O A;  1CSK A;  2VWF A;  1K76 A;  2J06 A;  1UEC A;  3VS4 A;  2GTO A;  2FRY A;  1AWX A;  3SHW A;  2EW3 A;  4E6R A;  3H0F A;  1AWO A;  2YSQ A;  1BBZ A;  4Z88 A;  1FMK A;  1M8M A;  1Y57 A;  2BZX A;  3M0R A;  4LUD A;  2LNH B;  2D0N A;  2EGC A;  2PTK A;  2J6O A;  1X2K A;  3EG2 A;  2OJ2 A;  2EKH A;  2DBK A;  2V1R A;  3PVL A;  5IHI A;  1UTI A;  4ZNX A;  2JT4 A;  1W70 A;  2EGE A;  2KRO A;  4X1V A;  2PZ1 A;  2V1Q A;  1LCK A;  2FEI A;  1AWJ A;  3RNJ A;  1NG2 A;  4RTT A;  5EC7 A;  1M3B A;  2W10 A;  1UE9 A;  2YT6 A;  3REA B;  1X2Q A;  2GTJ A;  3I5S A;  2FPD A;  1GBQ A;  2O9S A;  2EGA A;  1WA7 A;  2DF6 A;  1AWW A;  4OMQ A;  1YN8 A;  3I35 A;  1E6G A;  2DYB A;  4RTY A;  2X3W D;  2CDT A;  1W6X A;  1K1Z A;  2EYX A;  1QLY A;  1UJ0 A;  1WFW A;  4RTW A;  4AFU C;  2RQR A;  2DNU A;  2NUZ A;  1KIK A;  4KRT A;  5I11 A;  1H8K A;  2SRC A;  2LCS A;  1YCS B;  1B07 A;  2YUO A;  4J9G A;  2C0I A;  2CSQ A;  2K3B A;  2OI3 A;  1T3L A;  1ZX6 A;  1K0X A;  2LJ1 A;  4HVU A;  1YWO A;  2B86 A;  1AVZ C;  4OMP A;  3RBB B;  1OOT A;  3H0H A;  2RNA A;  4J9F A;  2M0Y A;  2AKL A;  1ZUY A;  3PE0 A;  2O31 A;  4CC2 A;  1I1J A;  3UAT A;  2KEA A;  4RUG A;  5FW9 A;  2DL3 A;  1VYT A;  1G83 A;  4AG2 C;  4DEX A;  1ZUK A;  3M0U A;  2DRM A;  2FPE A;  1K4U S;  4AFS C;  2AZS A;  3I9Q A;  1SHG A;  4ORZ A;  1GCQ A;  4LN2 A;  2HSP A;  1UJY A;  3EHR A;  4QT7 A;  3A98 A;  1WXT A;  1I07 A;  2EYZ A;  2KRM A;  3QWX X;  5HCK A;  1PWT A;  3VS2 A;  1M27 C;  4JPB W;  2KNB B;  2XMF A;  2KRN A;  2MOX A;  2YUN A;  2KRS A;  1UDL A;  3GBQ A;  1OPL A;  4IIO A;  2CT4 A;  5IH2 A;  2CRE A;  4ESR A;  1HD3 A;  2KXD A;  4DEY A;  4J9B A;  4LNP A;  1T3S A;  1X6B A;  1NM7 A;  3VS7 A;  2KXC A;  1BU1 A;  1ABO A;  2DBM A;  3UA7 A;  3I5R A;  2JS2 A;  1V1C A;  2F2V A;  2J05 A;  3TVT A;  2A08 A;  2LQW A;  2DLP A;  1T0H A;  2D8H A;  2EPD A;  2HCK A;  4HCK A;  4Z89 A;  3CQT A;  3O5Z A;  2D1X A;  2QDL A;  2RPN A;  2K9G A;  3VS5 A;  1ARK A;  2HBW A;  1AOJ A;  1IO6 A;  4IIM A;  3NMZ C;  1NEG A;  2ABL A;  2G6F X;  1SEM A;  3FJ5 A;  1YNZ A;  2L2P A;  4RTZ A;  2O9V A;  4HVV A;  1VA7 A;  1OEB A;  1PHT A;  2EQI A;  5ECA A;  2YDL A;  5IXF A;  4FSS A;  2KT1 A;  2VVK A;  1UFF A;  2J7I A;  2CUD A;  1J3T A;  1VYV A;  2X3X D;  4AG1 C;  4JJC A;  5FWB A;  1MV0 B;  1QCF A;  2CH4 W;  2HEQ A;  2JS0 A;  2K6D A;  1HJD A;  1PKT A;  2YUQ A;  2GBQ A;  4AFZ C;  1TUD A;  1JXO A;  1PNJ A;  2A36 A;  1U06 A;  4R0K A;  2RQU A;  3TSZ A;  2JMA A;  5IHK A;  4D8D A;  1Z9Q A;  4F16 A;  4D8K A;  2DL5 A;  1SPK A;  2KBT A;  3JV3 A;  2L3P A;  4J9C A;  3REB B;  1JXM A;  2GGR A;  2OAW A;  2AK5 A;  2ROL A;  2JMC A;  1YP5 A;  3NPF A;  2LMJ A;  4J9H A;  1SSH A;  2YUP A;  1RLQ C;  1NLP C;  2LJ3 A;  3EHQ A;  1JEG A;  2VKN A;  1PRM C;  1TG0 A;  2JM9 A;  4RTV A;  1GRI A;  4RTX A;  1CKB A;  1NYG A;  3TSW A;  1K9A A;  1WI7 A;  3THK A;  2AKK A;  1EFN A;  1GL5 A;  1SHF A;  3M0S A;  4K11 A;  1H3H A;  5IXB A;  2DRK A;  1NYF A;  1OPK A;  2DVJ A;  1MUZ A;  3H0I A;  4JJB A;  3NHN A;  2JM8 A;  4OMO A;  4JZ3 A;  4CC7 A;  1UG1 A;  1KJW A;  1YWP A;  2DM1 A;  1AEY A;  2EBP A;  3VS0 A;  1ZSG A;  1WDX A;  3VS1 A;  1CKA A;  2KGT A;  2JXB A;  4F17 A;  1H92 A;  2FPF A;  1GCP A;  3IQL A;  3PVQ A;  3UF4 A;  4J9D A;  1RLP C;  3VRZ A;  3UA6 A;  2RN8 A;  1GBR A;  2F2W A;  2A37 A;  1KSW A;  1M30 A;  4GBQ A;  3SEM A;  4OMN A;  1QWF A;  1X69 A;  2CUB A;  1FYN A;  1PRL C;  2O88 A;  2M51 A;  1TUC A;  2LX7 A;  2ED0 A;  2LQN A;  4GLM A;  2FG0 A;  4CC3 A;  2BZY A;  2RMO A;  2J6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...