1EFNA

Hiv-1 nef protein in complex with r96i mutant fyn sh3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
ALFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FYN TYROSINE KINASE
publication title Crystal structure of the conserved core of HIV-1 Nef complexed with a Src family SH3 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (sh3 domain/viral enhancer)
total genus 9
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1996-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1efnA00
4RTZA 3I9QA 1TUDA 2ED0A 2KXDA 3VS4A 2L0AA 2FG0A 2W10A 1NM7A 1H3HA 2L3QA 1WXBA 2CSIA 3QWXX 4K11A 1FYNA 3CQTA 4CC4B 4J9CA 1U3OA 1E6GA 2HSPA 3THKA 2AKLA 4Z88A 5IHNA 4GBQA 5FWBA 4M4ZA 1UJ0A 1CSKA 1QCFA 1AWWA 2YT6A 2CUBA 2FPFA 4JZ4A 1ZUYA 2RQTA 1T3SA 3M0SA 1S1NA 1QWEA 3PVQA 3VS1A 2ROTA 2A36A 2DLPA 2IIMA 4AFSC 1UG1A 2VKNA 1V1CA 3M0TA 3H41A 3NPFA 4J9HA 1GFCA 2DL4A 1SPKA 2A08A 3GBQA 4OMPA 1UTIA 3C0CA 1Y0MA 2D1XA 2C0TA 1OEBA 2GTJA 3UA6A 1XOVA 3KFVA 1UECA 4ESRA 2DJQA 4HCKA 1GBRA 4AFQC 1AVZC 2J06A 4HVUA 2A28A 2M51A 4J9IA 1K76A 1PRLC 5IHIA 2J6KA 1GBQA 1WI7A 2LCSA 1OOTA 2G6FX 1HJDA 2O31A 2C0OA 5IXFA 1Z9ZA 2X3XD 2BZYA 4ZNXA 1J3TA 2CSQA 1JEGA 4RTUA 3VRZA 1PNJA 2ENMA 1PRMC 1G83A 2EQIA 2CT4A 2FEIA 3I35A 4RTYA 3EG2A 2L3SA 1T3LA 2GTOA 2D0NA 2YUOA 4F16A 2RQRA 2KE9A 2EGEA 1AZEA 1SHGA 1KFZA 5HCKA 2JTEA 4RTWA 4X1VA 5IH2A 2DNUA 1PHTA 4JJDA 4HVVA 3O5ZA 3EG3A 2J6FA 2PZ1A 4LE9A 2RQUA 2NUZA 1BU1A 1ABOA 1OPLA 2HEQA 1H8KA 3QWYA 4RUGA 1FMKA 4D8DA 1WIEA 3NGPA 1B07A 4CC2A 1JU5C 1AZGB 1ABQA 2CH4A 2EW3A 2YUPA 1WYXA 1BBZA 2RPNA 1X27A 1M27C 1QLYA 4OMLA 2AZSA 1MUZA 2PNIA 1H92A 1NG2A 2FRWA 1AWOA 1JQQA 2JS2A 3M0RA 1K0SA 1SSHA 1MV0B 3VS7A 1GFDA 4J9GA 1JO8A 2FRYA 2FPEA 2D8JA 4E6RA 3A98A 1GCQC 2KGTA 2BZ8A 1VYUA 1AEYA 2DRKA 2GBQA 3H0HA 2L2PA 1K0XA 1HSQA 2F2XA 1ZBJA 1G2BA 2DF6A 1AOJA 4JZ3A 4A63B 4GLMA 1YCSB 2DM1A 4CC7A 1JXOA 1Y57A 2FO0A 2OI3A 1UE9A 2AZVA 2YUQA 4IIOA 1PWTA 4RTTA 2KNBB 3H0IA 1WXTA 4DEXA 1KIKA 2J7IA 2BZXA 1K9AA 2O9SA 3VS2A 1KJWA 1MV3A 1I1JA 1YP5A 1T0HA 2ECZA 1U06A 2SEMA 3ULRB 2O9VA 2KBTA 2LMJA 1NEBA 1UUEA 1WFWA 2A37A 2EVRA 1WXUA 2HBWA 2JT4A 2I0NA 2DL8A 1BK2A 2MIOA 3EGUA 3EG1A 1SHFA 1VYTA 1NLPC 1PKTA 3PVLA 4AFUC 1K1ZA 1M30A 2DBKA 2VVKA 2CUDA 4J9FA 2MCNA 2JMAA 1IO6A 2EPDA 1RI9A 2V1QA 3JV3A 1UHFA 2CT3A 3EHRA 4RTVA 2EYWA 3H0FA 3RNJA 5EC7A 1GCQA 3TSWA 4Z8AA 5GJWB 3I5RA 1ZUKA 2DL5A 2M0YA 5GJVB 1N5ZA 1RUWA 1M8MA 2LQNA 1B3QA 5I22A 3UF4A 1UHCA 1OPKA 2AK5A 2J05A 2DBMA 1M3BA 4J9BA 1CKBA 3M0PA 2J6OA 2KYBA 2MOXA 1UJYA 2LJ1A 2ROLA 3TVTA 2KRNA 1RLQC 2JW4A 4RTXA 1W1FA 2K79A 3ZL7C 1X69A 1SEMA 2DRMA 2OAWA 2K3BA 2V1RA 1ZLMA 1K4US 3U23A 2RQVA 2EYYA 2SRCA 2K7AA 1ZUUA 2KRSA 4LUEA 2LQWA 4R0KA 1WLPB 3PE0A 3I5SA 4WCIA 2NWMA 4Y92A 2ABLA 2OJ2A 1WDXA 4OMQA 1LCKA 2B86A 2L3PA 2RN8A 1X43A 5IHKA 1QKWA 3NHNA 1ZSGA 2KXCA 2KEAA 2EBPA 2O88A 3RBBB 4JJCA 2HCKA 4AG2C 1X6GA 3NMZC 1VA7A 5IXBA 1QWFA 3TSZA 2EYZA 4LUDA 1T0JA 1TUCA 1U5SA 2KROA 4J9EA 1WX6A 2CDTA 1I0CA 2XMFA 2W0ZA 5FWCA 2LJ0A 4KRTA 4LN2A 1A0NB 2RF0A 1M3CA 4QT7A 1OV3A 2DVJA 1YWPA 3VS3A 2ESWA 4D8KA 4HVWA 1NEGA 1SRLA 4JPBW 2JM9A 3UA7A 5ECAA 2JMCA 2X3WD 2CREA 5I11A 3LH5A 5L23A 1X2KA 2QDLA 4CC3A 2JXBA 2LJ3A 4OMNA 2EGCA 4AG1C 1W6XA 2EYXA 1Z9QA 2PTKA 2LZ6B 2LP5A 3EHQA 1NYGA 4ORZA 2YDLA 1QKXA 4F17A 3UATA 2DL3A 2F2WA 2BTTA 2JS0A 2ED1A 4FSSA 2YSQA 1VYVA 1ZX6A 2AKKA 1X6BA 1YWOA 1JXMA 2LNHB 1GRIA 2YUNA 2H8HA 2KRMA 2F2VA 3REAB 1GCPA 3IQLA 2RMOA 4LNPA 2FPDA 3VS5A 2HDAA 4OMMA 3SHWA 3VS0A 1E7OA 1UGVA 4AFZC 1EFNA 2DA9A 1AWJA 3SEMA 2DX1A 1X2QA 1UDLA 1PKSA 1ARKA 3EG0A 2DYBA 2KT8A 4OMOA 1TG0A 1CKAA 2DE0X 2GQIA 3FJ5A 2C0IA 3VRYA 2DL7A 1YN8A 2K6DA 3REBB 5FW9A 2KR3A 2K2MA 2GNCA 1YNZA 2LX7A 1NLOC 2JM8A 1W70A 4J9DA 2RQWA 2E5KA 4HXJA 2DILA 2D8HA 2VWFA 4JJBA 2KT1A 1BB9A 2CH4W 4DEYA 2K9GA 1RLPC 1E6HA 2EGAA 1AWXA 2O2OA 3M0QA 1HD3A 1SRMA 1AD5A 4Z89A 3R6NA 4F14A 3M0UA 2KYMA 4IIMA 1WA7A 1M3AA 2GGRA 3VS6A 1I07A 1KSWA 2DMOA 1NYFA 1UFFA 2P4RA 4EIKA 1GL5A 2EKHA 2RNAA
chains in the Genus database with same CATH superfamily
4RTZA 1TUDA 2KXDA 3OBYA 1NM7A 3ER0A 1VQMA 1G3WA 2K5IA 1H3HA 3V8JA 1WXBA 2CSIA 2XD0A 5M9OA 1KC8R 2WSEE 4RCBA 1N8RR 3V7RA 2RD1A 3E9GA 2P0QA 2LX9A 5GAOl 4C0DC 4WF2A 1QW1A 4JZ4A 1HK9A 3VJPA 2RQTA 4WTOB 4O5VA 2CZ7B 3PVQA 2ROTA 2IIMA 1UG1A 3NPFA 3H41A 1GFCA 2DL4A 5FRMA 2C0TA 2XG8D 5AT1B 1XOVA 3KFVA 3G4ST 1OU9A 1UECA 2EIFA 3CCSQ 4AFQC 4HVUA 2A28A 5LL6S 3CC2A 4J9IA 5HY6A 1VQMT 3UDCA 4JRQA 3RERA 1QP3A 1GBQA 1XNIA 5DLQE 3VKIA 4M7AD 2G6FX 3NFCA 2EJFA 4O6JA 2NUTB 3D7SB 4E7IA 4C5GA 2QEXA 5IXFA 5KYWA 5GMKl 4JS5A 5D6YA 3MCAB 4ZNXA 4OB2B 1VQPQ 3VRZA 5GMKi 1AHJB 1G3SA 2EQIA 1G83A 3CCRA 4BY6B 3EG2A 2L3SA 5LJ3g 3JCMJ 2YHTA 4F16A 5CKHA 3CPWA 3S3MA 1KHCA 1SHGA 2JJ9A 4RTWA 4HVVA 2E64A 1N6AA 2KK4A 3N5BB 2RQUA 2NUZA 1BU1A 3CC2T 3QWYA 2BE9B 5CIUA 3HL8A 1MMGA 4L5GA 4CC2A 1TU0B 2QEXT 1ABQA 2CYZB 3M4GA 2EW3A 4C8QA 4JJNK 3LWIA 4M77C 1Y96B 1BBZA 1EIFA 2X4JA 4XTUA 1KD1C 3LGFA 5GAMe 5D6WA 1O9SA 5CQXA 2RJCA 5A0DA 1RAAB 1MUZA 2PNIA 4C5IA 1JQQA 2JS2A 4J8OA 1KQSS 1NJIU 1GFDA 1G3TA 3E1SA 2FRYA 3I55A 4C0GA 4E6RA 2KGTA 4OGCA 2ZPIB 4C92E 1WQ7A 2E6ZA 1AEYA 2ATCB 3CEYA 2RHZA 5GAN8 2OTJQ 1FMVA 3TQ7P 1ZBJA 5CCAA 1G2BA 1AOJA 4QVCA 4F04B 4CC7A 5HK0A 4ZTFA 3V7SA 3TEEA 2LQ8A 4IIOA 1PWTA 4XU2A 4PKCC 2QA4A 1QVFS 2YRVA 2CZ1B 4JDSA 4PFOA 2O9SA 3TREA 1OULA 3PIPA 4J7IA 3M9QA 4XTWA 4M7AA 2RHXA 5LJ5f 4BD3A 1WHJA 4VUBA 2ECZA 2SEMA 2PU9B 3A8GB 3H6ZA 4M7DA 4JS4A 3HPWA 2E12A 4J6WA 1M1FA 1WXUA 2K2VA 3EGUA 3FLGA 1VQKQ 2P0KA 1VQNA 1NLPC 3OYNA 2XHCA 4E7LA 4FSXA 4AFUC 4J6XA 2JN0A 1K1ZA 3QYHB 2VVKA 2K3XA 4QQDA 2MCNA 3OS1A 3X24B 4NL3A 2QTXA 4ELYC 1V29B 1RI9A 3C95A 1F1BB 2QQBA 2CT3A 1JB0E 4N0AA 2EYWA 3H0FA 2QA4T 4RG8A 4Z8AA 1YIJA 5GJWB 2RI2A 4PJOC 1VQ6A 5L8RE 3G4SQ 1YITA 1KD1R 3RKXA 3HFOA 3OS2A 4FT2A 5I2SA 2LQNA 5CKBA 1BIBA 1W2BP 1H641 4RKUE 3VYGA 3EG9B 1CKBA 4C92G 3CMAA 2KYBA 3OW2P 4XTXA 2CP0A 2CZ6B 1M2VA 2HBPA 4PJLA 4KGXB 3HTRA 1VQNT 4C0DB 3ZL7C 3U23A 3OYHA 2NLUA 1ZUUA 4QVDA 4LUEA 1WLPB 4WCIA 4Y92A 1QVGP 2ABLA 2OJ2A 4DBQA 1WDXA 1LCKA 1QKWA 3NHNA 1UEBA 2EBPA 2O88A 3RBBB 5FROA 1YITT 4OMFB 1NZ9A 4C92D 3QKJA 3CC2Q 1QWFA 3DLMA 3NTIA 1T0JA 1TUCA 1U5SA 3HSBA 2XMFA 5FWCA 4LN2A 1WHKA 1OV3A 1WHGA 2ZZDA 1YWPA 3VS3A 3FC3A 2WACA 3FEOA 4HVWA 3OYCA 3QIIA 4JPBW 2JMCA 3V8KA 5I11A 3CCRQ 5GMKe 1X2KA 4CC3A 5KYXA 2RHUA 3L2QA 2D0QB 1OQKA 2E3IA 2R5AA 4OMNA 1NJIC 2L5QA 3PT9A 3AT1B 2BKDN 2MPXC 2EYXA 3H9NA 1XQHA 2PTKA 2NUTA 1JJ2P 5FU7C 3CCJT 3RKWA 3HP9A 3CCUA 6AT1B 1W2BA 2ZPBB 3OW2A 3RUXA 5KCHA 4IUUA 3PNWC 4HT9A 3X28B 3A8OB 4EMKC 3JCMW 2F2VA 3BY7A 4M77B 1GCPA 5KE2A 4LNPA 3GPLA 1BCMA 4OMMA 2K5LA 3BDUA 3VS0A 1VQLA 1X6OA 4XU1A 1AWJA 2K57A 1WJSA 5LJ5h 1ARKA 5LJ3f 4OMOA 2KI7A 1QVGA 1TG0A 1CKAA 2DE0X 3FJ5A 4M75F 2MF2A 5GAOn 5GANj 4FW1A 3TCJA 1KHIA 4CI0C 4OP0A 2K6DA 2EJGA 4PL6A 3I55Q 4E47A 3CCVA 3VUZA 3M53A 1Y96A 2P0PA 3CCUT 2DILA 2D8HA 1VQ5A 1D0ZA 1BB9A 4DEYA 2K9GA 1RLPC 2LQKA 4C8QE 1AWXA 1BI2A 1HD3A 1ZSZC 2RB6A 3R6NA 2GF7A 3RR6A 2X4XA 4F14A 3OYDA 3M0UA 4LD6A 2KYMA 2QG9B 4DQ2A 3MJXA 4XU3A 1SKUB 3CCMQ 3L2RA 1KSWA 4QQ6A 2QA4Q 2NUPB 4XTYA 4EIKA 1GL5A 1LNXA 2RNAA 1ZA1B 1VQLT 1P92A 5GAN2 2X4YA 1D0XA 2EQUA 3I9QA 5CK9A 2L0AA 4BB7A 2LDMA 4BACA 3RESA 1JJ2A 2L3QA 2VXEA 3JCMg 2JTMA 1UGSB 3QWXX 2E3HA 4K11A 1FYNA 2CGHA 2JVVA 3EH2A 3CQTA 5GMKm 4J9CA 5GAMg 4XAXB 2Y4XA 3CCVT 1NJIR 2AKLA 4Z88A 3MHXA 1VQ5T 1CSKA 1QCFA 1JBMA 2Z0WA 5A0LA 1VQNQ 2FL7A 1W4SA 2CUBA 2QQAA 5GANf 4J7FA 2MI6A 3RMQA 3CBMA 2RJFA 3M0SA 1QWEA 4AFSC 2VKNA 1V1CA 1WPYA 2A08A 2RK2A 1PSFA 2D1XA 3OY9A 2FZGB 4ESRA 3G7ZA 1AVZC 1YIJQ 3EAEA 4PJOB 1PRLC 2HL3A 2HSEB 4M7DE 1VQ6Q 2J6KA 4LXCA 1K73U 1OOTA 1YITQ 2PVDB 2C0OA 1MMDA 3CD6A 3QDRB 3I56A 3OYAA 5CKFA 2LNVA 1J3TA 3CMAQ 1VQOT 1JEGA 4RTUA 3RIRA 2YWWA 4RTYA 4XU0A 4F7UF 4C8QG 2D0NA 4M78C 1VIEA 1FWZA 2KY9A 4FM4B 4CRIA 2RQRA 2KE9A 1YFNA 3CC4A 1AZEA 2ZAEA 5HCKA 2OX7A 2YLBA 1O75A 2K5FA 4JJDA 3EG9A 2GFUA 1YBYA 3KUFA 2J6FA 4LE9A 2QXFA 3QXEB 2HEQA 1YJNA 4FW2A 4DA4A 4RUGA 4D8DA 1WIEA 1S72A 1KK7A 1AZGB 2CH4A 3CD6T 3OYIA 2YUPA 2FZKB 3NTKA 4C8QD 1WYXA 1RAIB 1PCXA 4Y91A 4OMLA 2YRDA 4QVZA 2E65A 1H92A 3M55A 3JCMX 1R0CB 5LJ3h 5J26A 5CAIA 1SSHA 3VS7A 3VU3C 4E7KA 3G1JA 1YJWA 4X9DA 4KT0E 2LT4A 3CC4T 3QPHA 4M7AF 1IXDA 1WHLA 1K0XA 4M7AG 4M7DF 5FU7B 3X25B 2XDBA 3CCUQ 4M7DG 1YJNT 5KYUB 3UT1A 4GLMA 4QKUA 1JXOA 3EFRA 1G3YA 1S72T 2QI2A 4DOWA 2OI3A 1UE9A 3A8MB 4EMKB 2AZVA 4FYWB 4IUPA 1RAGB 2DXTA 4FIBA 1UGPB 2BZXA 1K9AA 1Q82U 3CCEQ 2D6FA 1I5OB 1B34B 1OU8A 1VQLQ 4PLIA 4MZPA 2VGMA 2O4XB 4C0FA 3FRNA 1YJWT 3ULRB 3CMEA 2O9VA 5IN1A 1Y07A 3OMCA 1NEBA 2DD5A 4M75C 4M7DD 5KE3A 2JT4A 2DL8A 2MIOA 1C0MA 3OS0A 2PQWA 5CVIA 1VYTA 2O01E 4M77A 3CCVQ 2DZCA 3PVLA 3MO8A 2IVWA 4Y28E 1ZQ1A 2QGGA 5GANh 1VQ5Q 3GF5A 2CUDA 2HKNA 2R57A 1IO6A 1ZSZB 4PLLA 2EPDA 3CC7A 2DEUA 3JV3A 1UHFA 3EHRA 4RTVA 4BDYA 3FIFA 1YCYA 3I5RA 1RABB 2DL5A 2H3EB 2M0YA 3OSVA 3A1PA 4A4EA 1K9MC 2RH2A 3GLXA 2OAUA 1B3QA 5I22A 1QP2A 1UHCA 3QZ9B 2AK5A 3MEWA 3CMET 1U8RA 1K73C 2JOYA 3S6WA 5LJ5j 2AIRB 1NBEB 3ZBDA 8AT1B 4ATOA 4FCYA 3JCMe 3X26B 2LJ1A 2ROLA 1RLQC 3MP8A 4RTXA 1W1FA 2K79A 4EMHA 1D1BA 5GANd 1ACMB 3LH0A 2NUPA 1K4US 2HL5C 2RQVA 3J80E 2EYYA 3QG1A 2SRCA 3RDVA 2F5KA 4R0KA 3CC7T 2A7YA 4XQ3A 4II1A 2E41A 4DBRA 2EQJA 1PD1A 2ZPEB 4OF1A 3SD4A 1H3ZA 2B86A 3SFMA 2RN8A 2KXCA 3C94A 3PMIA 3GNGA 2X35A 1VA7A 3QBYA 5IXBA 4KH0B 2EYZA 2M16A 2A3LA 2VGNA 4A4GA 2XI9A 2CP6A 2CDTA 1Q7YU 1MHNA 5A2QE 4FYXB 4KRTA 2G3RA 1M3CA 3CD6Q 3I56Q 4QT7A 3MP1A 2DJZA 2BIVA 1G5VA 1VQ9A 3URGA 2MMPA 2K4YA 1D1CA 2MAMA 3HKSA 2X3WD 2CREA 4C0ZA 3LH5A 2DXBA 4M78B 2L89A 2PVGB 1VQ7A 4PJOA 1W2BS 4B9WA 2JXBA 1PG5B 3BFMA 3OW2S 4OB3B 2DAQA 2DK3A 2ZCFB 2ZPHB 4TVRA 1NYGA 2A0FB 2YDLA 1QKXA 4ORZA 3UATA 1Y7XA 2DL3A 2WSFE 3LWHA 2ED1A 1V76A 1VYVA 1YJNQ 4HKEA 4OVAA 2X51A 2LNHB 1K9MR 1GRIA 1Q81U 1S72Q 1QVGS 1RAEB 3IQLA 1D3BB 2HMAA 2FPDA 2HDAA 1K73R 3MEAA 1UGVA 1WJRA 1VQ9T 2MWOA 3SEMA 5HK3A 1Q82C 2DYBA 2KT8A 2DERA 1VQ7T 2DD4A 1VQMQ 2DIGA 4C92F 2DL7A 4XTVA 4GY5A 2RHIA 3WXMB 1YJWQ 2KR3A 2K2MA 3KXTA 3L1AA 3J7AF 4IKFA 2JM8A 2XIDA 3HFNA 1PM3A 4J9DA 2V8JA 4J83A 4JJBA 3PTAA 2F5TX 3L2WA 2QYZA 2RJEA 5KYYB 5FU6C 3M0QA 1SRMA 2BUDA 4RCCA 4FT4A 2HZYA 1JJ2S 2GGRA 1WQWA 2Y4YA 1KC8U 2X4WA 2OTLA 2P4RA 2EKHA 3TSWA 3CCJA 4FL6A 1VQ8A 2I2LA 2ED0A 2RI5A 2FG0A 4NOYA 2W10A 1WJQA 2QK0A 3V7CA 5GMKj 2E4HA 1MGQA 1ZA2B 1YJ9T 5KYUA 5LJ3j 3CMEQ 4MMKA 4CC4B 4M75B 2KSSA 1E6GA 2QEXQ 4BDZA 2HSPA 2VUBA 4MZTA 3THKA 4EMKA 3P8HA 5IHNA 5FWBA 2E1HA 1AWWA 2VASA 1IZ6A 1ZUYA 2COWA 1T3SA 2JZ2A 2V8KA 5IT9E 4PNOA 4KBMB 1B34A 4ZN3A 1S1NA 3UWNA 2A36A 2DLPA 1IHWA 4J9HA 2O4XA 3GBQA 3CC7Q 1IGUA 3MEUA 2LCLA 3C0CA 5GAOr 3UA6A 2CP3A 2OTLT 1IREB 2DEQA 1VQ8T 1TUGB 2J06A 3NTHA 2M51A 5CQYA 2FVUA 3DB3A 1WI7A 1Q95G 1N9RA 3OYMA 1HJDA 2O31A 4J6YA 1Q82R 1Z9ZA 2X3XD 3E2UA 4M77E 2R58A 1ZSZA 2BZYA 1G8XA 5GAMh 1I4K1 4PJNA 3E9FA 1PRMC 4E7JA 3JRZA 4BI3A 1MMAA 2EQMA 2IPOB 4HCZA 4E7SA 1DJ7B 2NYSA 3JAME 1VUBA 3DB4A 2EGEA 2QGFB 1RI0A 1MNDA 2YXYA 1BKBA 2JTEA 3PGGA 4X1VA 3RKYA 2E6NA 2DNUA 2H3JA 2QTVA 3EG3A 2PZ1A 1NPPA 1TXQA 1OI1A 1WHHA 1H8KA 3OS5A 3GIBA 1FMKA 2L8DA 1M1KU 4KULA 1B07A 2C06A 4E7ZA 2DTHA 2PUKB 4C5HA 5DM7R 4IURA 3OYEA 2HNIA 1Q81C 3OQ5A 5GAOp 1M27C 2DTOA 1QLYA 2AZSA 4EMGA 1M8VA 4BE2A 2KQWA 5LJ5d 1VQ9Q 3M0RA 1TOVA 1K0SA 3VV0A 1MV0B 4J9GA 3EFSA 2YLCA 4F7UB 5FLXE 1JO8A 1OX8A 2DVEA 2FPEA 1VQ7Q 1BCOA 3A98A 1GCQC 4D6WA 1Q86U 1FMWA 1SSFA 1RAFB 1VOMA 2GBQA 3H0HA 2MWPA 4LDXA 4LD9K 1VQOA 1UGRB 4KUDK 2F2XA 3OYKA 2AT1B 2RK1A 3CXCP 3PIOA 4XTZA 5FRNA 5AYFA 2DZ9A 1EX4A 3SWNC 2FO0A 1SF9A 4M78A 4M77G 3T9NA 3JCMc 2YUQA 1OZ2A 1N9SA 1SG5A 2DKGA 1WXTA 2RM4A 2B8AA 1QCNA 1PSEA 1UB4A 4ANJA 4PJOE 1YHQA 1Q7YR 2RA2A 1KJWA 1MV3A 1YP5A 1T0HA 5KH6A 2KBTA 2LMJA 2COYA 1WFWA 2A37A 5C0MA 4C92C 2DYIA 1QVPA 1BK2A 4M7AB 4HCBA 4OGEA 3VYHB 1D3BA 4C8QF 2DXUA 4M77D 1RAHB 2DBKA 1M30A 5IAYA 5FU6B 3CPFA 2JMAA 4J5YA 4OB0B 1UGQB 3EGDB 3RNJA 3CCQA 4B6MA 4LDYA 3V8LA 1ZUKA 3L2ZA 4A53A 1YHQT 3CCJQ 5J3BA 1Q81R 1VQ8Q 1N5ZA 4R56A 1RUWA 1C1AA 4ZGJB 1WHMA 3TU4K 2DBMA 4LDUA 3BW1A 2FYKA 3CXCA 2MOXA 3OYGA 1UJYA 3Q1JA 2KRNA 3JB9G 3HRUA 2PUOB 2QQSA 5GMKh 1SEMA 1K8AU 4AMCA 1ZLMA 4DOVA 2L3RA 2P4TA 4BI4A 3ME9A 3MEVA 2K7AA 3FJPA 3WVDB 1D09B 4KH1B 1PD0A 2XDPA 2NWMA 1TWBA 4N4GA 4PJOF 3CCQT 4IUQA 3QUIA 4EDUA 4OMQA 1BIAA 3DLLA 4MZMA 2BE7D 2L3PA 4M75A 4PJOG 1ZSGA 1GXIE 2VB6A 1ZHIA 4JJCA 1X6GA 4KUIA 3NMZC 3OYBA 2LC4A 3TSZA 3JB9D 1NPRA 4ZTJA 9ATCB 4JUVA 3JB9J 1VQKT 1PC0A 2IG0A 2ZPGB 1M1KC 1A0NB 2RF0A 2V26A 4RG2A 2DETA 2JNGA 2DVJA 5DY9A 3OSSC 4A4KA 2VXFA 1SRLA 2COZA 2JM9A 5LJ3d 3UA7A 5ECAA 2JTFA 1HXDA 4EPCA 2DTIA 2LJ3A 4E2FB 3A8LB 1YI2A 4PJOD 4AG1C 1QCOA 1Z9QA 1Q86C 2LZ6B 3KBGA 2CS7A 3EHQA 5HKCA 1WGSA 2HQXA 5KYXB 2F2WA 2GFAA 4V2SA 2BTTA 1WNLA 2YSQA 1M2OA 1D0YA 2EAYA 1X6BA 2RI3A 4L59A 1I5LA 1YWOA 1EZZB 8ATCB 4ZN1A 2YRCA 2YUNA 2H8HA 2M0OA 3REAB 2RMOA 1TS9A 1I81A 1E7OA 3HRTA 5GAMj 2XDDA 1UDLA 4QQGA 2QASA 1PKSA 1HYOA 1KQ1A 2GQIA 1M1GA 1YI2T 1YN8A 3REBB 3ZFJA 4JLIA 1M4ZA 4ZGDB 2LX7A 5A0GA 1VQ4A 2XU8A 2RQWA 2Y90A 1VQOQ 5GAN4 2MYSA 1M90U 2KT1A 4MMLA 4BE1A 2CH4W 2LTOA 3RMSA 1E6HA 1TH7A 2EGAA 1R77A 2RO0A 1AD5A 3CCLA 7AT1B 3JCMP 3ZEHA 3SWNB 1WA7A 3LX7A 4F7UA 3VS6A 1X75C 2DXCA 3QZ5B 4JRIA 1UFFA 2M9UA 1M1KR 3CCRT 5GAN5 3VS4A 3P8DA 1YHQQ 4ME7A 1FX7A 1IGQA 2FB7A 3C12A 5LJ5e 1OZ3A 3JCMf 4A4HA 1U3OA 4C92B 3EGXB 5GAMf 3X20B 2WSCE 1RACB 1VQ4T 5GAN6 4GBQA 3PFSA 4M4ZA 3S3NA 1UJ0A 2EWNA 5GANg 1Q86R 3G71A 2YT6A 1Y71A 2FPFA 2CP2A 5J39A 3QJYA 5GAOq 2E5QA 3DKMA 4M78E 3OA6A 4C8QC 3QJ6A 1K8AC 4Q5WA 4A4FA 3CCLT 3QYGB 3QDFA 3VS1A 3CCMA 1VIFA 3M0TA 2MK5A 2HQEA 2VV5A 1SPKA 4OMPA 1BI3A 1UTIA 5DLOA 3CC4Q 1Y0MA 1RADB 2EYQA 1OEBA 2GTJA 2RHYA 3CCQQ 2DJQA 4HCKA 1GBRA 1XJWB 1K76A 5IHIA 2LCSA 4C5EA 1KQSP 3HHTB 3I55T 1KQ2A 4HCCA 1TSFA 1M5Q1 2CSQA 2XICA 1PNJA 2ENMA 3EGDA 1LVKA 5KCOA 2QAZA 2CT4A 2FEIA 3I35A 3QO3A 3G71T 1R0BG 1T3LA 2GTOA 3LLRA 3EFOB 2YUOA 4Z02A 2LT1A 2KDSA 2QQRA 3R6OA 5D6XA 2AHJB 3CCMT 1YJ9A 1IHVA 1KFZA 5IH2A 2E70A 2DPPB 1PHTA 1QVFP 3O5ZA 4M7AC 3C4SA 2CKKA 3LYIA 2VC8A 1ABOA 1OPLA 1RL2A 1IB8A 4M7DC 2R5MA 3NGPA 4XK8E 1JU5C 3L2VA 5KYNA 3ASKA 4ELZC 2LVMA 3M56A 5GAN3 4NL2A 2RPNA 1X27A 4NS5A 5I2MA 3INZA 4M78F 4A54A 1N8RU 1NG2A 2FRWA 2ZGWA 3META 1AWOA 3F70A 4M78G 3S3OA 4N0AC 1BYMA 2CP5A 4X34A 3MKDA 3PMTA 2D8JA 2D9TA 3UPUA 2FHDA 1YI2Q 4IUVA 1K8AR 4M75E 2BZ8A 1VYUA 2CZ0B 2DRKA 2L2PA 1YIJT 1HSQA 1WZOA 2P84A 2RJDA 1KQSA 1ZBXA 2FZCB 1VQ6T 2KAFA 2DF6A 4JZ3A 4PFZA 3M58A 4A63B 2F1LA 3GP8A 3BE3A 1YCSB 1XTDA 2DM1A 1M90C 1BI1A 1Y57A 4IUTA 3H8ZA 2HQHA 3CMAT 3FB9A 1QQJA 4N4HA 1FXXA 3O8VA 1LPLA 4RTTA 2KNBB 4M78D 3H0IA 1OX9A 1X01A 3G6EA 2M02A 2ZPFB 4DEXA 1KIKA 2J7IA 3M5AA 3VS2A 3L42A 3OMGA 3CBOA 2HAXA 3M4YA 1MMNA 3GNFB 1I1JA 2F69A 3LGLA 1QVFA 1U06A 5LJ3e 3JCMh 4MDWA 4KGVB 4QW2A 1UUEA 2EVRA 2HBWA 1BI0A 3JCMV 2I0NA 3EG1A 1SHFA 1Q7YC 4ZGEB 3JCMb 1PKTA 2QQ9A 1VQ4Q 4E7HA 3WVEB 3OBWA 4BE0A 4J9FA 5KYWB 4YTLA 4LDVA 4N4IA 2V1QA 3CCLQ 2VYTA 3G6ET 5EC7A 2DO3A 1LOJA 3CCEA 1GCQA 3AHUA 3CCSA 2DFUA 3CXCS 4PK4A 3BDLA 4OB1B 1D1AA 5GJVB 1M8MA 3LW5E 4JRPA 2HKQB 2GQVA 3UF4A 3JCMd 1OPKA 2J05A 5CR2A 2DIQA 1M3BA 4J9BA 4M75G 3JB9I 3M0PA 5GAMd 1VQPA 2J6OA 3SWNA 5GAOm 3TVTA 4PJJA 2JW4A 5CO7A 2X9HA 1X69A 4FYVB 1IRXA 2DRMA 2OAWA 2K3BA 4BI8B 4BY6C 3SB2A 2V1RA 1U1SA 3G71Q 1OYXA 4C8QB 3MP6A 4F7UE 5GANe 2KRSA 2LQWA 1N27A 3PE0A 3OYYA 1M90R 3I5SA 4HT8A 1QMCA 3CCET 3CCST 2KVQG 3GOXA 4MDXA 1X43A 5IHKA 2JUFA 4C92A 3EGXA 3OYLA 2KEAA 3M54A 4DBFA 5C6SA 4M75D 2HCKA 4AG2C 3EH1A 4FYYB 4LDWA 4DBHA 4LUDA 4M77F 2KROA 1LJOA 4J9EA 1WX6A 1I0CA 3MPUB 5D7UA 2W0ZA 2LJ0A 1VQPT 4JRKA 4GLKA 2GCXA 1R8OB 5EG2A 5CKDA 3L2UA 2ESWA 4B9XA 4D8KA 1KG1A 1NEGA 3JCMQ 1KC8C 5LJ5g 5L23A 2QDLA 1N8RC 3M59A 3JSCA 1I8FA 2EGCA 1M9SA 3OB9A 1W6XA 1YJ9Q 2OTJA 2EKOA 2LP5A 4M7AE 4F17A 1K9MU 3VUBA 1AT1B 4RMOA 2K3YA 3J81E 2JS0A 4P5NA 4AT1B 4FSSA 4R55A 4M7DB 1ZX6A 2AKKA 2XKOC 3P8BB 5GAN7 1JXMA 3CBPA 3E19A 3EFOA 2V8IA 4UC4A 2KRMA 1KD1U 3QSUA 2LCCA 3CPWS 3HRSA 2EFIA 3VS5A 4KGZB 1MNEA 1NE8A 3SHWA 1TTHB 4AFZC 1EFNA 2KMTA 2DA9A 3A8HB 4PJMA 2HD0A 2M1HA 2OTLQ 2DX1A 1X2QA 2CP7A 4L6V5 1B7TA 3EG0A 4F7UG 1C6VX 1U1TA 5I21A 2C0IA 3VRYA 2PVOB 2EQKA 5KYYA 5FW9A 2E10A 2GNCA 3QHSA 1VQKA 1YNZA 3JB9F 5CKEA 2LRQA 2OTJT 1NLOC 1W70A 2E5KA 4HXJA 4PFPA 2VWFA 3SDZA 3FDRA 3OYJA 4FU6A 2O2OA 4Z89A 1JRIA 2QDYB 3A5ZB 4X9CA 1M2VB 3I56T 4IIMA 4HA8A 1M3AA 4JLGA 2XK0A 3OYFA 3JB9H 4BUGA 1I07A 3M57A 2EJ9A 2DMOA 3CPWP 1NYFA 3G6EQ 3G4SA
chains in the Genus database with same CATH topology
4RTZA 3I9QA 1TUDA 2ED0A 2KXDA 3VS4A 2L0AA 2FG0A 2W10A 1NM7A 1H3HA 2L3QA 1WXBA 2CSIA 3QWXX 4K11A 1FYNA 3CQTA 4CC4B 4J9CA 1U3OA 1E6GA 2HSPA 3THKA 2AKLA 4Z88A 5IHNA 4GBQA 5FWBA 4M4ZA 1UJ0A 1CSKA 1QCFA 1AWWA 2YT6A 2CUBA 2FPFA 4JZ4A 1ZUYA 2RQTA 1T3SA 3M0SA 1S1NA 1QWEA 3PVQA 3VS1A 2ROTA 2A36A 2DLPA 2IIMA 4AFSC 1UG1A 2VKNA 1V1CA 3M0TA 3H41A 3NPFA 4J9HA 1GFCA 2DL4A 1SPKA 2A08A 3GBQA 4OMPA 1UTIA 3C0CA 1Y0MA 2D1XA 2C0TA 1OEBA 2GTJA 3UA6A 1XOVA 3KFVA 1UECA 4ESRA 2DJQA 4HCKA 1GBRA 4AFQC 1AVZC 2J06A 4HVUA 2A28A 2M51A 4J9IA 1K76A 1PRLC 5IHIA 2J6KA 1GBQA 1WI7A 2LCSA 1OOTA 2G6FX 1HJDA 2O31A 2C0OA 5IXFA 1Z9ZA 2X3XD 2BZYA 4ZNXA 1J3TA 2CSQA 1JEGA 4RTUA 3VRZA 1PNJA 2ENMA 1PRMC 1G83A 2EQIA 2CT4A 2FEIA 3I35A 4RTYA 3EG2A 2L3SA 1T3LA 2GTOA 2D0NA 2YUOA 4F16A 2RQRA 2KE9A 2EGEA 1AZEA 1SHGA 1KFZA 5HCKA 2JTEA 4RTWA 4X1VA 5IH2A 2DNUA 1PHTA 4JJDA 4HVVA 3O5ZA 3EG3A 2J6FA 2PZ1A 4LE9A 2RQUA 2NUZA 1BU1A 1ABOA 1OPLA 2HEQA 1H8KA 3QWYA 4RUGA 1FMKA 4D8DA 1WIEA 3NGPA 1B07A 4CC2A 1JU5C 1AZGB 1ABQA 2CH4A 2EW3A 2YUPA 1WYXA 1BBZA 2RPNA 1X27A 1M27C 1QLYA 4OMLA 2AZSA 1MUZA 2PNIA 1H92A 1NG2A 2FRWA 1AWOA 1JQQA 2JS2A 3M0RA 1K0SA 1SSHA 1MV0B 3VS7A 1GFDA 4J9GA 1JO8A 2FRYA 2FPEA 2D8JA 4E6RA 3A98A 1GCQC 2KGTA 2BZ8A 1VYUA 1AEYA 2DRKA 2GBQA 3H0HA 2L2PA 1K0XA 1HSQA 2F2XA 1ZBJA 1G2BA 2DF6A 1AOJA 4JZ3A 4A63B 4GLMA 1YCSB 2DM1A 4CC7A 1JXOA 1Y57A 2FO0A 2OI3A 1UE9A 2AZVA 2YUQA 4IIOA 1PWTA 4RTTA 2KNBB 3H0IA 1WXTA 4DEXA 1KIKA 2J7IA 2BZXA 1K9AA 2O9SA 3VS2A 1KJWA 1MV3A 1I1JA 1YP5A 1T0HA 2ECZA 1U06A 2SEMA 3ULRB 2O9VA 2KBTA 2LMJA 1NEBA 1UUEA 1WFWA 2A37A 2EVRA 1WXUA 2HBWA 2JT4A 2I0NA 2DL8A 1BK2A 2MIOA 3EGUA 3EG1A 1SHFA 1VYTA 1NLPC 1PKTA 3PVLA 4AFUC 1K1ZA 1M30A 2DBKA 2VVKA 2CUDA 4J9FA 2MCNA 2JMAA 1IO6A 2EPDA 1RI9A 2V1QA 3JV3A 1UHFA 2CT3A 3EHRA 4RTVA 2EYWA 3H0FA 3RNJA 5EC7A 1GCQA 3TSWA 4Z8AA 5GJWB 3I5RA 1ZUKA 2DL5A 2M0YA 5GJVB 1N5ZA 1RUWA 1M8MA 2LQNA 1B3QA 5I22A 3UF4A 1UHCA 1OPKA 2AK5A 2J05A 2DBMA 1M3BA 4J9BA 1CKBA 3M0PA 2J6OA 2KYBA 2MOXA 1UJYA 2LJ1A 2ROLA 3TVTA 2KRNA 1RLQC 2JW4A 4RTXA 1W1FA 2K79A 3ZL7C 1X69A 1SEMA 2DRMA 2OAWA 2K3BA 2V1RA 1ZLMA 1K4US 3U23A 2RQVA 2EYYA 2SRCA 2K7AA 1ZUUA 2KRSA 4LUEA 2LQWA 4R0KA 1WLPB 3PE0A 3I5SA 4WCIA 2NWMA 4Y92A 2ABLA 2OJ2A 1WDXA 4OMQA 1LCKA 2B86A 2L3PA 2RN8A 1X43A 5IHKA 1QKWA 3NHNA 1ZSGA 2KXCA 2KEAA 2EBPA 2O88A 3RBBB 4JJCA 2HCKA 4AG2C 1X6GA 3NMZC 1VA7A 5IXBA 1QWFA 3TSZA 2EYZA 4LUDA 1T0JA 1TUCA 1U5SA 2KROA 4J9EA 1WX6A 2CDTA 1I0CA 2XMFA 2W0ZA 5FWCA 2LJ0A 4KRTA 4LN2A 1A0NB 2RF0A 1M3CA 4QT7A 1OV3A 2DVJA 1YWPA 3VS3A 2ESWA 4D8KA 4HVWA 1NEGA 1SRLA 4JPBW 2JM9A 3UA7A 5ECAA 2JMCA 2X3WD 2CREA 5I11A 3LH5A 5L23A 1X2KA 2QDLA 4CC3A 2JXBA 2LJ3A 4OMNA 2EGCA 4AG1C 1W6XA 2EYXA 1Z9QA 2PTKA 2LZ6B 2LP5A 3EHQA 1NYGA 4ORZA 2YDLA 1QKXA 4F17A 3UATA 2DL3A 2F2WA 2BTTA 2JS0A 2ED1A 4FSSA 2YSQA 1VYVA 1ZX6A 2AKKA 1X6BA 1YWOA 1JXMA 2LNHB 1GRIA 2YUNA 2H8HA 2KRMA 2F2VA 3REAB 1GCPA 3IQLA 2RMOA 4LNPA 2FPDA 3VS5A 2HDAA 4OMMA 3SHWA 3VS0A 1E7OA 1UGVA 4AFZC 1EFNA 2DA9A 1AWJA 3SEMA 2DX1A 1X2QA 1UDLA 1PKSA 1ARKA 3EG0A 2DYBA 2KT8A 4OMOA 1TG0A 1CKAA 2DE0X 2GQIA 3FJ5A 2C0IA 3VRYA 2DL7A 1YN8A 2K6DA 3REBB 5FW9A 2KR3A 2K2MA 2GNCA 1YNZA 2LX7A 1NLOC 2JM8A 1W70A 4J9DA 2RQWA 2E5KA 4HXJA 2DILA 2D8HA 2VWFA 4JJBA 2KT1A 1BB9A 2CH4W 4DEYA 2K9GA 1RLPC 1E6HA 2EGAA 1AWXA 2O2OA 3M0QA 1HD3A 1SRMA 1AD5A 4Z89A 3R6NA 4F14A 3M0UA 2KYMA 4IIMA 1WA7A 1M3AA 2GGRA 3VS6A 1I07A 1KSWA 2DMOA 1NYFA 1UFFA 2P4RA 4EIKA 1GL5A 2EKHA 2RNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RTZ A;  3I9Q A;  1TUD A;  2ED0 A;  2KXD A;  3VS4 A;  2L0A A;  2FG0 A;  2W10 A;  1NM7 A;  1H3H A;  2L3Q A;  1WXB A;  2CSI A;  3QWX X;  4K11 A;  1FYN A;  3CQT A;  4CC4 B;  4J9C A;  1U3O A;  1E6G A;  2HSP A;  3THK A;  2AKL A;  4Z88 A;  5IHN A;  4GBQ A;  5FWB A;  4M4Z A;  1UJ0 A;  1CSK A;  1QCF A;  1AWW A;  2YT6 A;  2CUB A;  2FPF A;  4JZ4 A;  1ZUY A;  2RQT A;  1T3S A;  3M0S A;  1S1N A;  1QWE A;  3PVQ A;  3VS1 A;  2ROT A;  2A36 A;  2DLP A;  2IIM A;  4AFS C;  1UG1 A;  2VKN A;  1V1C A;  3M0T A;  3H41 A;  3NPF A;  4J9H A;  1GFC A;  2DL4 A;  1SPK A;  2A08 A;  3GBQ A;  4OMP A;  1UTI A;  3C0C A;  1Y0M A;  2D1X A;  2C0T A;  1OEB A;  2GTJ A;  3UA6 A;  1XOV A;  3KFV A;  1UEC A;  4ESR A;  2DJQ A;  4HCK A;  1GBR A;  4AFQ C;  1AVZ C;  2J06 A;  4HVU A;  2A28 A;  2M51 A;  4J9I A;  1K76 A;  1PRL C;  5IHI A;  2J6K A;  1GBQ A;  1WI7 A;  2LCS A;  1OOT A;  2G6F X;  1HJD A;  2O31 A;  2C0O A;  5IXF A;  1Z9Z A;  2X3X D;  2BZY A;  4ZNX A;  1J3T A;  2CSQ A;  1JEG A;  4RTU A;  3VRZ A;  1PNJ A;  2ENM A;  1PRM C;  1G83 A;  2EQI A;  2CT4 A;  2FEI A;  3I35 A;  4RTY A;  3EG2 A;  2L3S A;  1T3L A;  2GTO A;  2D0N A;  2YUO A;  4F16 A;  2RQR A;  2KE9 A;  2EGE A;  1AZE A;  1SHG A;  1KFZ A;  5HCK A;  2JTE A;  4RTW A;  4X1V A;  5IH2 A;  2DNU A;  1PHT A;  4JJD A;  4HVV A;  3O5Z A;  3EG3 A;  2J6F A;  2PZ1 A;  4LE9 A;  2RQU A;  2NUZ A;  1BU1 A;  1ABO A;  1OPL A;  2HEQ A;  1H8K A;  3QWY A;  4RUG A;  1FMK A;  4D8D A;  1WIE A;  3NGP A;  1B07 A;  4CC2 A;  1JU5 C;  1AZG B;  1ABQ A;  2CH4 A;  2EW3 A;  2YUP A;  1WYX A;  1BBZ A;  2RPN A;  1X27 A;  1M27 C;  1QLY A;  4OML A;  2AZS A;  1MUZ A;  2PNI A;  1H92 A;  1NG2 A;  2FRW A;  1AWO A;  1JQQ A;  2JS2 A;  3M0R A;  1K0S A;  1SSH A;  1MV0 B;  3VS7 A;  1GFD A;  4J9G A;  1JO8 A;  2FRY A;  2FPE A;  2D8J A;  4E6R A;  3A98 A;  1GCQ C;  2KGT A;  2BZ8 A;  1VYU A;  1AEY A;  2DRK A;  2GBQ A;  3H0H A;  2L2P A;  1K0X A;  1HSQ A;  2F2X A;  1ZBJ A;  1G2B A;  2DF6 A;  1AOJ A;  4JZ3 A;  4A63 B;  4GLM A;  1YCS B;  2DM1 A;  4CC7 A;  1JXO A;  1Y57 A;  2FO0 A;  2OI3 A;  1UE9 A;  2AZV A;  2YUQ A;  4IIO A;  1PWT A;  4RTT A;  2KNB B;  3H0I A;  1WXT A;  4DEX A;  1KIK A;  2J7I A;  2BZX A;  1K9A A;  2O9S A;  3VS2 A;  1KJW A;  1MV3 A;  1I1J A;  1YP5 A;  1T0H A;  2ECZ A;  1U06 A;  2SEM A;  3ULR B;  2O9V A;  2KBT A;  2LMJ A;  1NEB A;  1UUE A;  1WFW A;  2A37 A;  2EVR A;  1WXU A;  2HBW A;  2JT4 A;  2I0N A;  2DL8 A;  1BK2 A;  2MIO A;  3EGU A;  3EG1 A;  1SHF A;  1VYT A;  1NLP C;  1PKT A;  3PVL A;  4AFU C;  1K1Z A;  1M30 A;  2DBK A;  2VVK A;  2CUD A;  4J9F A;  2MCN A;  2JMA A;  1IO6 A;  2EPD A;  1RI9 A;  2V1Q A;  3JV3 A;  1UHF A;  2CT3 A;  3EHR A;  4RTV A;  2EYW A;  3H0F A;  3RNJ A;  5EC7 A;  1GCQ A;  3TSW A;  4Z8A A;  5GJW B;  3I5R A;  1ZUK A;  2DL5 A;  2M0Y A;  5GJV B;  1N5Z A;  1RUW A;  1M8M A;  2LQN A;  1B3Q A;  5I22 A;  3UF4 A;  1UHC A;  1OPK A;  2AK5 A;  2J05 A;  2DBM A;  1M3B A;  4J9B A;  1CKB A;  3M0P A;  2J6O A;  2KYB A;  2MOX A;  1UJY A;  2LJ1 A;  2ROL A;  3TVT A;  2KRN A;  1RLQ C;  2JW4 A;  4RTX A;  1W1F A;  2K79 A;  3ZL7 C;  1X69 A;  1SEM A;  2DRM A;  2OAW A;  2K3B A;  2V1R A;  1ZLM A;  1K4U S;  3U23 A;  2RQV A;  2EYY A;  2SRC A;  2K7A A;  1ZUU A;  2KRS A;  4LUE A;  2LQW A;  4R0K A;  1WLP B;  3PE0 A;  3I5S A;  4WCI A;  2NWM A;  4Y92 A;  2ABL A;  2OJ2 A;  1WDX A;  4OMQ A;  1LCK A;  2B86 A;  2L3P A;  2RN8 A;  1X43 A;  5IHK A;  1QKW A;  3NHN A;  1ZSG A;  2KXC A;  2KEA A;  2EBP A;  2O88 A;  3RBB B;  4JJC A;  2HCK A;  4AG2 C;  1X6G A;  3NMZ C;  1VA7 A;  5IXB A;  1QWF A;  3TSZ A;  2EYZ A;  4LUD A;  1T0J A;  1TUC A;  1U5S A;  2KRO A;  4J9E A;  1WX6 A;  2CDT A;  1I0C A;  2XMF A;  2W0Z A;  5FWC A;  2LJ0 A;  4KRT A;  4LN2 A;  1A0N B;  2RF0 A;  1M3C A;  4QT7 A;  1OV3 A;  2DVJ A;  1YWP A;  3VS3 A;  2ESW A;  4D8K A;  4HVW A;  1NEG A;  1SRL A;  4JPB W;  2JM9 A;  3UA7 A;  5ECA A;  2JMC A;  2X3W D;  2CRE A;  5I11 A;  3LH5 A;  5L23 A;  1X2K A;  2QDL A;  4CC3 A;  2JXB A;  2LJ3 A;  4OMN A;  2EGC A;  4AG1 C;  1W6X A;  2EYX A;  1Z9Q A;  2PTK A;  2LZ6 B;  2LP5 A;  3EHQ A;  1NYG A;  4ORZ A;  2YDL A;  1QKX A;  4F17 A;  3UAT A;  2DL3 A;  2F2W A;  2BTT A;  2JS0 A;  2ED1 A;  4FSS A;  2YSQ A;  1VYV A;  1ZX6 A;  2AKK A;  1X6B A;  1YWO A;  1JXM A;  2LNH B;  1GRI A;  2YUN A;  2H8H A;  2KRM A;  2F2V A;  3REA B;  1GCP A;  3IQL A;  2RMO A;  4LNP A;  2FPD A;  3VS5 A;  2HDA A;  4OMM A;  3SHW A;  3VS0 A;  1E7O A;  1UGV A;  4AFZ C;  1EFN A;  2DA9 A;  1AWJ A;  3SEM A;  2DX1 A;  1X2Q A;  1UDL A;  1PKS A;  1ARK A;  3EG0 A;  2DYB A;  2KT8 A;  4OMO A;  1TG0 A;  1CKA A;  2DE0 X;  2GQI A;  3FJ5 A;  2C0I A;  3VRY A;  2DL7 A;  1YN8 A;  2K6D A;  3REB B;  5FW9 A;  2KR3 A;  2K2M A;  2GNC A;  1YNZ A;  2LX7 A;  1NLO C;  2JM8 A;  1W70 A;  4J9D A;  2RQW A;  2E5K A;  4HXJ A;  2DIL A;  2D8H A;  2VWF A;  4JJB A;  2KT1 A;  1BB9 A;  2CH4 W;  4DEY A;  2K9G A;  1RLP C;  1E6H A;  2EGA A;  1AWX A;  2O2O A;  3M0Q A;  1HD3 A;  1SRM A;  1AD5 A;  4Z89 A;  3R6N A;  4F14 A;  3M0U A;  2KYM A;  4IIM A;  1WA7 A;  1M3A A;  2GGR A;  3VS6 A;  1I07 A;  1KSW A;  2DMO A;  1NYF A;  1UFF A;  2P4R A;  4EIK A;  1GL5 A;  2EKH A;  2RNA A; 
#chains in the Genus database with same CATH topology
 4RTZ A;  1TUD A;  2KXD A;  3OBY A;  1NM7 A;  3ER0 A;  1VQM A;  1G3W A;  2K5I A;  1H3H A;  3V8J A;  1WXB A;  2CSI A;  2XD0 A;  5M9O A;  1KC8 R;  2WSE E;  4RCB A;  1N8R R;  3V7R A;  2RD1 A;  3E9G A;  2P0Q A;  2LX9 A;  5GAO l;  4C0D C;  4WF2 A;  1QW1 A;  4JZ4 A;  1HK9 A;  3VJP A;  2RQT A;  4WTO B;  4O5V A;  2CZ7 B;  3PVQ A;  2ROT A;  2IIM A;  1UG1 A;  3NPF A;  3H41 A;  1GFC A;  2DL4 A;  5FRM A;  2C0T A;  2XG8 D;  5AT1 B;  1XOV A;  3KFV A;  3G4S T;  1OU9 A;  1UEC A;  2EIF A;  3CCS Q;  4AFQ C;  4HVU A;  2A28 A;  5LL6 S;  3CC2 A;  4J9I A;  5HY6 A;  1VQM T;  3UDC A;  4JRQ A;  3RER A;  1QP3 A;  1GBQ A;  1XNI A;  5DLQ E;  3VKI A;  4M7A D;  2G6F X;  3NFC A;  2EJF A;  4O6J A;  2NUT B;  3D7S B;  4E7I A;  4C5G A;  2QEX A;  5IXF A;  5KYW A;  5GMK l;  4JS5 A;  5D6Y A;  3MCA B;  4ZNX A;  4OB2 B;  1VQP Q;  3VRZ A;  5GMK i;  1AHJ B;  1G3S A;  2EQI A;  1G83 A;  3CCR A;  4BY6 B;  3EG2 A;  2L3S A;  5LJ3 g;  3JCM J;  2YHT A;  4F16 A;  5CKH A;  3CPW A;  3S3M A;  1KHC A;  1SHG A;  2JJ9 A;  4RTW A;  4HVV A;  2E64 A;  1N6A A;  2KK4 A;  3N5B B;  2RQU A;  2NUZ A;  1BU1 A;  3CC2 T;  3QWY A;  2BE9 B;  5CIU A;  3HL8 A;  1MMG A;  4L5G A;  4CC2 A;  1TU0 B;  2QEX T;  1ABQ A;  2CYZ B;  3M4G A;  2EW3 A;  4C8Q A;  4JJN K;  3LWI A;  4M77 C;  1Y96 B;  1BBZ A;  1EIF A;  2X4J A;  4XTU A;  1KD1 C;  3LGF A;  5GAM e;  5D6W A;  1O9S A;  5CQX A;  2RJC A;  5A0D A;  1RAA B;  1MUZ A;  2PNI A;  4C5I A;  1JQQ A;  2JS2 A;  4J8O A;  1KQS S;  1NJI U;  1GFD A;  1G3T A;  3E1S A;  2FRY A;  3I55 A;  4C0G A;  4E6R A;  2KGT A;  4OGC A;  2ZPI B;  4C92 E;  1WQ7 A;  2E6Z A;  1AEY A;  2ATC B;  3CEY A;  2RHZ A;  5GAN 8;  2OTJ Q;  1FMV A;  3TQ7 P;  1ZBJ A;  5CCA A;  1G2B A;  1AOJ A;  4QVC A;  4F04 B;  4CC7 A;  5HK0 A;  4ZTF A;  3V7S A;  3TEE A;  2LQ8 A;  4IIO A;  1PWT A;  4XU2 A;  4PKC C;  2QA4 A;  1QVF S;  2YRV A;  2CZ1 B;  4JDS A;  4PFO A;  2O9S A;  3TRE A;  1OUL A;  3PIP A;  4J7I A;  3M9Q A;  4XTW A;  4M7A A;  2RHX A;  5LJ5 f;  4BD3 A;  1WHJ A;  4VUB A;  2ECZ A;  2SEM A;  2PU9 B;  3A8G B;  3H6Z A;  4M7D A;  4JS4 A;  3HPW A;  2E12 A;  4J6W A;  1M1F A;  1WXU A;  2K2V A;  3EGU A;  3FLG A;  1VQK Q;  2P0K A;  1VQN A;  1NLP C;  3OYN A;  2XHC A;  4E7L A;  4FSX A;  4AFU C;  4J6X A;  2JN0 A;  1K1Z A;  3QYH B;  2VVK A;  2K3X A;  4QQD A;  2MCN A;  3OS1 A;  3X24 B;  4NL3 A;  2QTX A;  4ELY C;  1V29 B;  1RI9 A;  3C95 A;  1F1B B;  2QQB A;  2CT3 A;  1JB0 E;  4N0A A;  2EYW A;  3H0F A;  2QA4 T;  4RG8 A;  4Z8A A;  1YIJ A;  5GJW B;  2RI2 A;  4PJO C;  1VQ6 A;  5L8R E;  3G4S Q;  1YIT A;  1KD1 R;  3RKX A;  3HFO A;  3OS2 A;  4FT2 A;  5I2S A;  2LQN A;  5CKB A;  1BIB A;  1W2B P;  1H64 1;  4RKU E;  3VYG A;  3EG9 B;  1CKB A;  4C92 G;  3CMA A;  2KYB A;  3OW2 P;  4XTX A;  2CP0 A;  2CZ6 B;  1M2V A;  2HBP A;  4PJL A;  4KGX B;  3HTR A;  1VQN T;  4C0D B;  3ZL7 C;  3U23 A;  3OYH A;  2NLU A;  1ZUU A;  4QVD A;  4LUE A;  1WLP B;  4WCI A;  4Y92 A;  1QVG P;  2ABL A;  2OJ2 A;  4DBQ A;  1WDX A;  1LCK A;  1QKW A;  3NHN A;  1UEB A;  2EBP A;  2O88 A;  3RBB B;  5FRO A;  1YIT T;  4OMF B;  1NZ9 A;  4C92 D;  3QKJ A;  3CC2 Q;  1QWF A;  3DLM A;  3NTI A;  1T0J A;  1TUC A;  1U5S A;  3HSB A;  2XMF A;  5FWC A;  4LN2 A;  1WHK A;  1OV3 A;  1WHG A;  2ZZD A;  1YWP A;  3VS3 A;  3FC3 A;  2WAC A;  3FEO A;  4HVW A;  3OYC A;  3QII A;  4JPB W;  2JMC A;  3V8K A;  5I11 A;  3CCR Q;  5GMK e;  1X2K A;  4CC3 A;  5KYX A;  2RHU A;  3L2Q A;  2D0Q B;  1OQK A;  2E3I A;  2R5A A;  4OMN A;  1NJI C;  2L5Q A;  3PT9 A;  3AT1 B;  2BKD N;  2MPX C;  2EYX A;  3H9N A;  1XQH A;  2PTK A;  2NUT A;  1JJ2 P;  5FU7 C;  3CCJ T;  3RKW A;  3HP9 A;  3CCU A;  6AT1 B;  1W2B A;  2ZPB B;  3OW2 A;  3RUX A;  5KCH A;  4IUU A;  3PNW C;  4HT9 A;  3X28 B;  3A8O B;  4EMK C;  3JCM W;  2F2V A;  3BY7 A;  4M77 B;  1GCP A;  5KE2 A;  4LNP A;  3GPL A;  1BCM A;  4OMM A;  2K5L A;  3BDU A;  3VS0 A;  1VQL A;  1X6O A;  4XU1 A;  1AWJ A;  2K57 A;  1WJS A;  5LJ5 h;  1ARK A;  5LJ3 f;  4OMO A;  2KI7 A;  1QVG A;  1TG0 A;  1CKA A;  2DE0 X;  3FJ5 A;  4M75 F;  2MF2 A;  5GAO n;  5GAN j;  4FW1 A;  3TCJ A;  1KHI A;  4CI0 C;  4OP0 A;  2K6D A;  2EJG A;  4PL6 A;  3I55 Q;  4E47 A;  3CCV A;  3VUZ A;  3M53 A;  1Y96 A;  2P0P A;  3CCU T;  2DIL A;  2D8H A;  1VQ5 A;  1D0Z A;  1BB9 A;  4DEY A;  2K9G A;  1RLP C;  2LQK A;  4C8Q E;  1AWX A;  1BI2 A;  1HD3 A;  1ZSZ C;  2RB6 A;  3R6N A;  2GF7 A;  3RR6 A;  2X4X A;  4F14 A;  3OYD A;  3M0U A;  4LD6 A;  2KYM A;  2QG9 B;  4DQ2 A;  3MJX A;  4XU3 A;  1SKU B;  3CCM Q;  3L2R A;  1KSW A;  4QQ6 A;  2QA4 Q;  2NUP B;  4XTY A;  4EIK A;  1GL5 A;  1LNX A;  2RNA A;  1ZA1 B;  1VQL T;  1P92 A;  5GAN 2;  2X4Y A;  1D0X A;  2EQU A;  3I9Q A;  5CK9 A;  2L0A A;  4BB7 A;  2LDM A;  4BAC A;  3RES A;  1JJ2 A;  2L3Q A;  2VXE A;  3JCM g;  2JTM A;  1UGS B;  3QWX X;  2E3H A;  4K11 A;  1FYN A;  2CGH A;  2JVV A;  3EH2 A;  3CQT A;  5GMK m;  4J9C A;  5GAM g;  4XAX B;  2Y4X A;  3CCV T;  1NJI R;  2AKL A;  4Z88 A;  3MHX A;  1VQ5 T;  1CSK A;  1QCF A;  1JBM A;  2Z0W A;  5A0L A;  1VQN Q;  2FL7 A;  1W4S A;  2CUB A;  2QQA A;  5GAN f;  4J7F A;  2MI6 A;  3RMQ A;  3CBM A;  2RJF A;  3M0S A;  1QWE A;  4AFS C;  2VKN A;  1V1C A;  1WPY A;  2A08 A;  2RK2 A;  1PSF A;  2D1X A;  3OY9 A;  2FZG B;  4ESR A;  3G7Z A;  1AVZ C;  1YIJ Q;  3EAE A;  4PJO B;  1PRL C;  2HL3 A;  2HSE B;  4M7D E;  1VQ6 Q;  2J6K A;  4LXC A;  1K73 U;  1OOT A;  1YIT Q;  2PVD B;  2C0O A;  1MMD A;  3CD6 A;  3QDR B;  3I56 A;  3OYA A;  5CKF A;  2LNV A;  1J3T A;  3CMA Q;  1VQO T;  1JEG A;  4RTU A;  3RIR A;  2YWW A;  4RTY A;  4XU0 A;  4F7U F;  4C8Q G;  2D0N A;  4M78 C;  1VIE A;  1FWZ A;  2KY9 A;  4FM4 B;  4CRI A;  2RQR A;  2KE9 A;  1YFN A;  3CC4 A;  1AZE A;  2ZAE A;  5HCK A;  2OX7 A;  2YLB A;  1O75 A;  2K5F A;  4JJD A;  3EG9 A;  2GFU A;  1YBY A;  3KUF A;  2J6F A;  4LE9 A;  2QXF A;  3QXE B;  2HEQ A;  1YJN A;  4FW2 A;  4DA4 A;  4RUG A;  4D8D A;  1WIE A;  1S72 A;  1KK7 A;  1AZG B;  2CH4 A;  3CD6 T;  3OYI A;  2YUP A;  2FZK B;  3NTK A;  4C8Q D;  1WYX A;  1RAI B;  1PCX A;  4Y91 A;  4OML A;  2YRD A;  4QVZ A;  2E65 A;  1H92 A;  3M55 A;  3JCM X;  1R0C B;  5LJ3 h;  5J26 A;  5CAI A;  1SSH A;  3VS7 A;  3VU3 C;  4E7K A;  3G1J A;  1YJW A;  4X9D A;  4KT0 E;  2LT4 A;  3CC4 T;  3QPH A;  4M7A F;  1IXD A;  1WHL A;  1K0X A;  4M7A G;  4M7D F;  5FU7 B;  3X25 B;  2XDB A;  3CCU Q;  4M7D G;  1YJN T;  5KYU B;  3UT1 A;  4GLM A;  4QKU A;  1JXO A;  3EFR A;  1G3Y A;  1S72 T;  2QI2 A;  4DOW A;  2OI3 A;  1UE9 A;  3A8M B;  4EMK B;  2AZV A;  4FYW B;  4IUP A;  1RAG B;  2DXT A;  4FIB A;  1UGP B;  2BZX A;  1K9A A;  1Q82 U;  3CCE Q;  2D6F A;  1I5O B;  1B34 B;  1OU8 A;  1VQL Q;  4PLI A;  4MZP A;  2VGM A;  2O4X B;  4C0F A;  3FRN A;  1YJW T;  3ULR B;  3CME A;  2O9V A;  5IN1 A;  1Y07 A;  3OMC A;  1NEB A;  2DD5 A;  4M75 C;  4M7D D;  5KE3 A;  2JT4 A;  2DL8 A;  2MIO A;  1C0M A;  3OS0 A;  2PQW A;  5CVI A;  1VYT A;  2O01 E;  4M77 A;  3CCV Q;  2DZC A;  3PVL A;  3MO8 A;  2IVW A;  4Y28 E;  1ZQ1 A;  2QGG A;  5GAN h;  1VQ5 Q;  3GF5 A;  2CUD A;  2HKN A;  2R57 A;  1IO6 A;  1ZSZ B;  4PLL A;  2EPD A;  3CC7 A;  2DEU A;  3JV3 A;  1UHF A;  3EHR A;  4RTV A;  4BDY A;  3FIF A;  1YCY A;  3I5R A;  1RAB B;  2DL5 A;  2H3E B;  2M0Y A;  3OSV A;  3A1P A;  4A4E A;  1K9M C;  2RH2 A;  3GLX A;  2OAU A;  1B3Q A;  5I22 A;  1QP2 A;  1UHC A;  3QZ9 B;  2AK5 A;  3MEW A;  3CME T;  1U8R A;  1K73 C;  2JOY A;  3S6W A;  5LJ5 j;  2AIR B;  1NBE B;  3ZBD A;  8AT1 B;  4ATO A;  4FCY A;  3JCM e;  3X26 B;  2LJ1 A;  2ROL A;  1RLQ C;  3MP8 A;  4RTX A;  1W1F A;  2K79 A;  4EMH A;  1D1B A;  5GAN d;  1ACM B;  3LH0 A;  2NUP A;  1K4U S;  2HL5 C;  2RQV A;  3J80 E;  2EYY A;  3QG1 A;  2SRC A;  3RDV A;  2F5K A;  4R0K A;  3CC7 T;  2A7Y A;  4XQ3 A;  4II1 A;  2E41 A;  4DBR A;  2EQJ A;  1PD1 A;  2ZPE B;  4OF1 A;  3SD4 A;  1H3Z A;  2B86 A;  3SFM A;  2RN8 A;  2KXC A;  3C94 A;  3PMI A;  3GNG A;  2X35 A;  1VA7 A;  3QBY A;  5IXB A;  4KH0 B;  2EYZ A;  2M16 A;  2A3L A;  2VGN A;  4A4G A;  2XI9 A;  2CP6 A;  2CDT A;  1Q7Y U;  1MHN A;  5A2Q E;  4FYX B;  4KRT A;  2G3R A;  1M3C A;  3CD6 Q;  3I56 Q;  4QT7 A;  3MP1 A;  2DJZ A;  2BIV A;  1G5V A;  1VQ9 A;  3URG A;  2MMP A;  2K4Y A;  1D1C A;  2MAM A;  3HKS A;  2X3W D;  2CRE A;  4C0Z A;  3LH5 A;  2DXB A;  4M78 B;  2L89 A;  2PVG B;  1VQ7 A;  4PJO A;  1W2B S;  4B9W A;  2JXB A;  1PG5 B;  3BFM A;  3OW2 S;  4OB3 B;  2DAQ A;  2DK3 A;  2ZCF B;  2ZPH B;  4TVR A;  1NYG A;  2A0F B;  2YDL A;  1QKX A;  4ORZ A;  3UAT A;  1Y7X A;  2DL3 A;  2WSF E;  3LWH A;  2ED1 A;  1V76 A;  1VYV A;  1YJN Q;  4HKE A;  4OVA A;  2X51 A;  2LNH B;  1K9M R;  1GRI A;  1Q81 U;  1S72 Q;  1QVG S;  1RAE B;  3IQL A;  1D3B B;  2HMA A;  2FPD A;  2HDA A;  1K73 R;  3MEA A;  1UGV A;  1WJR A;  1VQ9 T;  2MWO A;  3SEM A;  5HK3 A;  1Q82 C;  2DYB A;  2KT8 A;  2DER A;  1VQ7 T;  2DD4 A;  1VQM Q;  2DIG A;  4C92 F;  2DL7 A;  4XTV A;  4GY5 A;  2RHI A;  3WXM B;  1YJW Q;  2KR3 A;  2K2M A;  3KXT A;  3L1A A;  3J7A F;  4IKF A;  2JM8 A;  2XID A;  3HFN A;  1PM3 A;  4J9D A;  2V8J A;  4J83 A;  4JJB A;  3PTA A;  2F5T X;  3L2W A;  2QYZ A;  2RJE A;  5KYY B;  5FU6 C;  3M0Q A;  1SRM A;  2BUD A;  4RCC A;  4FT4 A;  2HZY A;  1JJ2 S;  2GGR A;  1WQW A;  2Y4Y A;  1KC8 U;  2X4W A;  2OTL A;  2P4R A;  2EKH A;  3TSW A;  3CCJ A;  4FL6 A;  1VQ8 A;  2I2L A;  2ED0 A;  2RI5 A;  2FG0 A;  4NOY A;  2W10 A;  1WJQ A;  2QK0 A;  3V7C A;  5GMK j;  2E4H A;  1MGQ A;  1ZA2 B;  1YJ9 T;  5KYU A;  5LJ3 j;  3CME Q;  4MMK A;  4CC4 B;  4M75 B;  2KSS A;  1E6G A;  2QEX Q;  4BDZ A;  2HSP A;  2VUB A;  4MZT A;  3THK A;  4EMK A;  3P8H A;  5IHN A;  5FWB A;  2E1H A;  1AWW A;  2VAS A;  1IZ6 A;  1ZUY A;  2COW A;  1T3S A;  2JZ2 A;  2V8K A;  5IT9 E;  4PNO A;  4KBM B;  1B34 A;  4ZN3 A;  1S1N A;  3UWN A;  2A36 A;  2DLP A;  1IHW A;  4J9H A;  2O4X A;  3GBQ A;  3CC7 Q;  1IGU A;  3MEU A;  2LCL A;  3C0C A;  5GAO r;  3UA6 A;  2CP3 A;  2OTL T;  1IRE B;  2DEQ A;  1VQ8 T;  1TUG B;  2J06 A;  3NTH A;  2M51 A;  5CQY A;  2FVU A;  3DB3 A;  1WI7 A;  1Q95 G;  1N9R A;  3OYM A;  1HJD A;  2O31 A;  4J6Y A;  1Q82 R;  1Z9Z A;  2X3X D;  3E2U A;  4M77 E;  2R58 A;  1ZSZ A;  2BZY A;  1G8X A;  5GAM h;  1I4K 1;  4PJN A;  3E9F A;  1PRM C;  4E7J A;  3JRZ A;  4BI3 A;  1MMA A;  2EQM A;  2IPO B;  4HCZ A;  4E7S A;  1DJ7 B;  2NYS A;  3JAM E;  1VUB A;  3DB4 A;  2EGE A;  2QGF B;  1RI0 A;  1MND A;  2YXY A;  1BKB A;  2JTE A;  3PGG A;  4X1V A;  3RKY A;  2E6N A;  2DNU A;  2H3J A;  2QTV A;  3EG3 A;  2PZ1 A;  1NPP A;  1TXQ A;  1OI1 A;  1WHH A;  1H8K A;  3OS5 A;  3GIB A;  1FMK A;  2L8D A;  1M1K U;  4KUL A;  1B07 A;  2C06 A;  4E7Z A;  2DTH A;  2PUK B;  4C5H A;  5DM7 R;  4IUR A;  3OYE A;  2HNI A;  1Q81 C;  3OQ5 A;  5GAO p;  1M27 C;  2DTO A;  1QLY A;  2AZS A;  4EMG A;  1M8V A;  4BE2 A;  2KQW A;  5LJ5 d;  1VQ9 Q;  3M0R A;  1TOV A;  1K0S A;  3VV0 A;  1MV0 B;  4J9G A;  3EFS A;  2YLC A;  4F7U B;  5FLX E;  1JO8 A;  1OX8 A;  2DVE A;  2FPE A;  1VQ7 Q;  1BCO A;  3A98 A;  1GCQ C;  4D6W A;  1Q86 U;  1FMW A;  1SSF A;  1RAF B;  1VOM A;  2GBQ A;  3H0H A;  2MWP A;  4LDX A;  4LD9 K;  1VQO A;  1UGR B;  4KUD K;  2F2X A;  3OYK A;  2AT1 B;  2RK1 A;  3CXC P;  3PIO A;  4XTZ A;  5FRN A;  5AYF A;  2DZ9 A;  1EX4 A;  3SWN C;  2FO0 A;  1SF9 A;  4M78 A;  4M77 G;  3T9N A;  3JCM c;  2YUQ A;  1OZ2 A;  1N9S A;  1SG5 A;  2DKG A;  1WXT A;  2RM4 A;  2B8A A;  1QCN A;  1PSE A;  1UB4 A;  4ANJ A;  4PJO E;  1YHQ A;  1Q7Y R;  2RA2 A;  1KJW A;  1MV3 A;  1YP5 A;  1T0H A;  5KH6 A;  2KBT A;  2LMJ A;  2COY A;  1WFW A;  2A37 A;  5C0M A;  4C92 C;  2DYI A;  1QVP A;  1BK2 A;  4M7A B;  4HCB A;  4OGE A;  3VYH B;  1D3B A;  4C8Q F;  2DXU A;  4M77 D;  1RAH B;  2DBK A;  1M30 A;  5IAY A;  5FU6 B;  3CPF A;  2JMA A;  4J5Y A;  4OB0 B;  1UGQ B;  3EGD B;  3RNJ A;  3CCQ A;  4B6M A;  4LDY A;  3V8L A;  1ZUK A;  3L2Z A;  4A53 A;  1YHQ T;  3CCJ Q;  5J3B A;  1Q81 R;  1VQ8 Q;  1N5Z A;  4R56 A;  1RUW A;  1C1A A;  4ZGJ B;  1WHM A;  3TU4 K;  2DBM A;  4LDU A;  3BW1 A;  2FYK A;  3CXC A;  2MOX A;  3OYG A;  1UJY A;  3Q1J A;  2KRN A;  3JB9 G;  3HRU A;  2PUO B;  2QQS A;  5GMK h;  1SEM A;  1K8A U;  4AMC A;  1ZLM A;  4DOV A;  2L3R A;  2P4T A;  4BI4 A;  3ME9 A;  3MEV A;  2K7A A;  3FJP A;  3WVD B;  1D09 B;  4KH1 B;  1PD0 A;  2XDP A;  2NWM A;  1TWB A;  4N4G A;  4PJO F;  3CCQ T;  4IUQ A;  3QUI A;  4EDU A;  4OMQ A;  1BIA A;  3DLL A;  4MZM A;  2BE7 D;  2L3P A;  4M75 A;  4PJO G;  1ZSG A;  1GXI E;  2VB6 A;  1ZHI A;  4JJC A;  1X6G A;  4KUI A;  3NMZ C;  3OYB A;  2LC4 A;  3TSZ A;  3JB9 D;  1NPR A;  4ZTJ A;  9ATC B;  4JUV A;  3JB9 J;  1VQK T;  1PC0 A;  2IG0 A;  2ZPG B;  1M1K C;  1A0N B;  2RF0 A;  2V26 A;  4RG2 A;  2DET A;  2JNG A;  2DVJ A;  5DY9 A;  3OSS C;  4A4K A;  2VXF A;  1SRL A;  2COZ A;  2JM9 A;  5LJ3 d;  3UA7 A;  5ECA A;  2JTF A;  1HXD A;  4EPC A;  2DTI A;  2LJ3 A;  4E2F B;  3A8L B;  1YI2 A;  4PJO D;  4AG1 C;  1QCO A;  1Z9Q A;  1Q86 C;  2LZ6 B;  3KBG A;  2CS7 A;  3EHQ A;  5HKC A;  1WGS A;  2HQX A;  5KYX B;  2F2W A;  2GFA A;  4V2S A;  2BTT A;  1WNL A;  2YSQ A;  1M2O A;  1D0Y A;  2EAY A;  1X6B A;  2RI3 A;  4L59 A;  1I5L A;  1YWO A;  1EZZ B;  8ATC B;  4ZN1 A;  2YRC A;  2YUN A;  2H8H A;  2M0O A;  3REA B;  2RMO A;  1TS9 A;  1I81 A;  1E7O A;  3HRT A;  5GAM j;  2XDD A;  1UDL A;  4QQG A;  2QAS A;  1PKS A;  1HYO A;  1KQ1 A;  2GQI A;  1M1G A;  1YI2 T;  1YN8 A;  3REB B;  3ZFJ A;  4JLI A;  1M4Z A;  4ZGD B;  2LX7 A;  5A0G A;  1VQ4 A;  2XU8 A;  2RQW A;  2Y90 A;  1VQO Q;  5GAN 4;  2MYS A;  1M90 U;  2KT1 A;  4MML A;  4BE1 A;  2CH4 W;  2LTO A;  3RMS A;  1E6H A;  1TH7 A;  2EGA A;  1R77 A;  2RO0 A;  1AD5 A;  3CCL A;  7AT1 B;  3JCM P;  3ZEH A;  3SWN B;  1WA7 A;  3LX7 A;  4F7U A;  3VS6 A;  1X75 C;  2DXC A;  3QZ5 B;  4JRI A;  1UFF A;  2M9U A;  1M1K R;  3CCR T;  5GAN 5;  3VS4 A;  3P8D A;  1YHQ Q;  4ME7 A;  1FX7 A;  1IGQ A;  2FB7 A;  3C12 A;  5LJ5 e;  1OZ3 A;  3JCM f;  4A4H A;  1U3O A;  4C92 B;  3EGX B;  5GAM f;  3X20 B;  2WSC E;  1RAC B;  1VQ4 T;  5GAN 6;  4GBQ A;  3PFS A;  4M4Z A;  3S3N A;  1UJ0 A;  2EWN A;  5GAN g;  1Q86 R;  3G71 A;  2YT6 A;  1Y71 A;  2FPF A;  2CP2 A;  5J39 A;  3QJY A;  5GAO q;  2E5Q A;  3DKM A;  4M78 E;  3OA6 A;  4C8Q C;  3QJ6 A;  1K8A C;  4Q5W A;  4A4F A;  3CCL T;  3QYG B;  3QDF A;  3VS1 A;  3CCM A;  1VIF A;  3M0T A;  2MK5 A;  2HQE A;  2VV5 A;  1SPK A;  4OMP A;  1BI3 A;  1UTI A;  5DLO A;  3CC4 Q;  1Y0M A;  1RAD B;  2EYQ A;  1OEB A;  2GTJ A;  2RHY A;  3CCQ Q;  2DJQ A;  4HCK A;  1GBR A;  1XJW B;  1K76 A;  5IHI A;  2LCS A;  4C5E A;  1KQS P;  3HHT B;  3I55 T;  1KQ2 A;  4HCC A;  1TSF A;  1M5Q 1;  2CSQ A;  2XIC A;  1PNJ A;  2ENM A;  3EGD A;  1LVK A;  5KCO A;  2QAZ A;  2CT4 A;  2FEI A;  3I35 A;  3QO3 A;  3G71 T;  1R0B G;  1T3L A;  2GTO A;  3LLR A;  3EFO B;  2YUO A;  4Z02 A;  2LT1 A;  2KDS A;  2QQR A;  3R6O A;  5D6X A;  2AHJ B;  3CCM T;  1YJ9 A;  1IHV A;  1KFZ A;  5IH2 A;  2E70 A;  2DPP B;  1PHT A;  1QVF P;  3O5Z A;  4M7A C;  3C4S A;  2CKK A;  3LYI A;  2VC8 A;  1ABO A;  1OPL A;  1RL2 A;  1IB8 A;  4M7D C;  2R5M A;  3NGP A;  4XK8 E;  1JU5 C;  3L2V A;  5KYN A;  3ASK A;  4ELZ C;  2LVM A;  3M56 A;  5GAN 3;  4NL2 A;  2RPN A;  1X27 A;  4NS5 A;  5I2M A;  3INZ A;  4M78 F;  4A54 A;  1N8R U;  1NG2 A;  2FRW A;  2ZGW A;  3MET A;  1AWO A;  3F70 A;  4M78 G;  3S3O A;  4N0A C;  1BYM A;  2CP5 A;  4X34 A;  3MKD A;  3PMT A;  2D8J A;  2D9T A;  3UPU A;  2FHD A;  1YI2 Q;  4IUV A;  1K8A R;  4M75 E;  2BZ8 A;  1VYU A;  2CZ0 B;  2DRK A;  2L2P A;  1YIJ T;  1HSQ A;  1WZO A;  2P84 A;  2RJD A;  1KQS A;  1ZBX A;  2FZC B;  1VQ6 T;  2KAF A;  2DF6 A;  4JZ3 A;  4PFZ A;  3M58 A;  4A63 B;  2F1L A;  3GP8 A;  3BE3 A;  1YCS B;  1XTD A;  2DM1 A;  1M90 C;  1BI1 A;  1Y57 A;  4IUT A;  3H8Z A;  2HQH A;  3CMA T;  3FB9 A;  1QQJ A;  4N4H A;  1FXX A;  3O8V A;  1LPL A;  4RTT A;  2KNB B;  4M78 D;  3H0I A;  1OX9 A;  1X01 A;  3G6E A;  2M02 A;  2ZPF B;  4DEX A;  1KIK A;  2J7I A;  3M5A A;  3VS2 A;  3L42 A;  3OMG A;  3CBO A;  2HAX A;  3M4Y A;  1MMN A;  3GNF B;  1I1J A;  2F69 A;  3LGL A;  1QVF A;  1U06 A;  5LJ3 e;  3JCM h;  4MDW A;  4KGV B;  4QW2 A;  1UUE A;  2EVR A;  2HBW A;  1BI0 A;  3JCM V;  2I0N A;  3EG1 A;  1SHF A;  1Q7Y C;  4ZGE B;  3JCM b;  1PKT A;  2QQ9 A;  1VQ4 Q;  4E7H A;  3WVE B;  3OBW A;  4BE0 A;  4J9F A;  5KYW B;  4YTL A;  4LDV A;  4N4I A;  2V1Q A;  3CCL Q;  2VYT A;  3G6E T;  5EC7 A;  2DO3 A;  1LOJ A;  3CCE A;  1GCQ A;  3AHU A;  3CCS A;  2DFU A;  3CXC S;  4PK4 A;  3BDL A;  4OB1 B;  1D1A A;  5GJV B;  1M8M A;  3LW5 E;  4JRP A;  2HKQ B;  2GQV A;  3UF4 A;  3JCM d;  1OPK A;  2J05 A;  5CR2 A;  2DIQ A;  1M3B A;  4J9B A;  4M75 G;  3JB9 I;  3M0P A;  5GAM d;  1VQP A;  2J6O A;  3SWN A;  5GAO m;  3TVT A;  4PJJ A;  2JW4 A;  5CO7 A;  2X9H A;  1X69 A;  4FYV B;  1IRX A;  2DRM A;  2OAW A;  2K3B A;  4BI8 B;  4BY6 C;  3SB2 A;  2V1R A;  1U1S A;  3G71 Q;  1OYX A;  4C8Q B;  3MP6 A;  4F7U E;  5GAN e;  2KRS A;  2LQW A;  1N27 A;  3PE0 A;  3OYY A;  1M90 R;  3I5S A;  4HT8 A;  1QMC A;  3CCE T;  3CCS T;  2KVQ G;  3GOX A;  4MDX A;  1X43 A;  5IHK A;  2JUF A;  4C92 A;  3EGX A;  3OYL A;  2KEA A;  3M54 A;  4DBF A;  5C6S A;  4M75 D;  2HCK A;  4AG2 C;  3EH1 A;  4FYY B;  4LDW A;  4DBH A;  4LUD A;  4M77 F;  2KRO A;  1LJO A;  4J9E A;  1WX6 A;  1I0C A;  3MPU B;  5D7U A;  2W0Z A;  2LJ0 A;  1VQP T;  4JRK A;  4GLK A;  2GCX A;  1R8O B;  5EG2 A;  5CKD A;  3L2U A;  2ESW A;  4B9X A;  4D8K A;  1KG1 A;  1NEG A;  3JCM Q;  1KC8 C;  5LJ5 g;  5L23 A;  2QDL A;  1N8R C;  3M59 A;  3JSC A;  1I8F A;  2EGC A;  1M9S A;  3OB9 A;  1W6X A;  1YJ9 Q;  2OTJ A;  2EKO A;  2LP5 A;  4M7A E;  4F17 A;  1K9M U;  3VUB A;  1AT1 B;  4RMO A;  2K3Y A;  3J81 E;  2JS0 A;  4P5N A;  4AT1 B;  4FSS A;  4R55 A;  4M7D B;  1ZX6 A;  2AKK A;  2XKO C;  3P8B B;  5GAN 7;  1JXM A;  3CBP A;  3E19 A;  3EFO A;  2V8I A;  4UC4 A;  2KRM A;  1KD1 U;  3QSU A;  2LCC A;  3CPW S;  3HRS A;  2EFI A;  3VS5 A;  4KGZ B;  1MNE A;  1NE8 A;  3SHW A;  1TTH B;  4AFZ C;  1EFN A;  2KMT A;  2DA9 A;  3A8H B;  4PJM A;  2HD0 A;  2M1H A;  2OTL Q;  2DX1 A;  1X2Q A;  2CP7 A;  4L6V 5;  1B7T A;  3EG0 A;  4F7U G;  1C6V X;  1U1T A;  5I21 A;  2C0I A;  3VRY A;  2PVO B;  2EQK A;  5KYY A;  5FW9 A;  2E10 A;  2GNC A;  3QHS A;  1VQK A;  1YNZ A;  3JB9 F;  5CKE A;  2LRQ A;  2OTJ T;  1NLO C;  1W70 A;  2E5K A;  4HXJ A;  4PFP A;  2VWF A;  3SDZ A;  3FDR A;  3OYJ A;  4FU6 A;  2O2O A;  4Z89 A;  1JRI A;  2QDY B;  3A5Z B;  4X9C A;  1M2V B;  3I56 T;  4IIM A;  4HA8 A;  1M3A A;  4JLG A;  2XK0 A;  3OYF A;  3JB9 H;  4BUG A;  1I07 A;  3M57 A;  2EJ9 A;  2DMO A;  3CPW P;  1NYF A;  3G6E Q;  3G4S A; 
#chains in the Genus database with same CATH homology
 4RTZ A;  3I9Q A;  1TUD A;  2ED0 A;  2KXD A;  3VS4 A;  2L0A A;  2FG0 A;  2W10 A;  1NM7 A;  1H3H A;  2L3Q A;  1WXB A;  2CSI A;  3QWX X;  4K11 A;  1FYN A;  3CQT A;  4CC4 B;  4J9C A;  1U3O A;  1E6G A;  2HSP A;  3THK A;  2AKL A;  4Z88 A;  5IHN A;  4GBQ A;  5FWB A;  4M4Z A;  1UJ0 A;  1CSK A;  1QCF A;  1AWW A;  2YT6 A;  2CUB A;  2FPF A;  4JZ4 A;  1ZUY A;  2RQT A;  1T3S A;  3M0S A;  1S1N A;  1QWE A;  3PVQ A;  3VS1 A;  2ROT A;  2A36 A;  2DLP A;  2IIM A;  4AFS C;  1UG1 A;  2VKN A;  1V1C A;  3M0T A;  3H41 A;  3NPF A;  4J9H A;  1GFC A;  2DL4 A;  1SPK A;  2A08 A;  3GBQ A;  4OMP A;  1UTI A;  3C0C A;  1Y0M A;  2D1X A;  2C0T A;  1OEB A;  2GTJ A;  3UA6 A;  1XOV A;  3KFV A;  1UEC A;  4ESR A;  2DJQ A;  4HCK A;  1GBR A;  4AFQ C;  1AVZ C;  2J06 A;  4HVU A;  2A28 A;  2M51 A;  4J9I A;  1K76 A;  1PRL C;  5IHI A;  2J6K A;  1GBQ A;  1WI7 A;  2LCS A;  1OOT A;  2G6F X;  1HJD A;  2O31 A;  2C0O A;  5IXF A;  1Z9Z A;  2X3X D;  2BZY A;  4ZNX A;  1J3T A;  2CSQ A;  1JEG A;  4RTU A;  3VRZ A;  1PNJ A;  2ENM A;  1PRM C;  1G83 A;  2EQI A;  2CT4 A;  2FEI A;  3I35 A;  4RTY A;  3EG2 A;  2L3S A;  1T3L A;  2GTO A;  2D0N A;  2YUO A;  4F16 A;  2RQR A;  2KE9 A;  2EGE A;  1AZE A;  1SHG A;  1KFZ A;  5HCK A;  2JTE A;  4RTW A;  4X1V A;  5IH2 A;  2DNU A;  1PHT A;  4JJD A;  4HVV A;  3O5Z A;  3EG3 A;  2J6F A;  2PZ1 A;  4LE9 A;  2RQU A;  2NUZ A;  1BU1 A;  1ABO A;  1OPL A;  2HEQ A;  1H8K A;  3QWY A;  4RUG A;  1FMK A;  4D8D A;  1WIE A;  3NGP A;  1B07 A;  4CC2 A;  1JU5 C;  1AZG B;  1ABQ A;  2CH4 A;  2EW3 A;  2YUP A;  1WYX A;  1BBZ A;  2RPN A;  1X27 A;  1M27 C;  1QLY A;  4OML A;  2AZS A;  1MUZ A;  2PNI A;  1H92 A;  1NG2 A;  2FRW A;  1AWO A;  1JQQ A;  2JS2 A;  3M0R A;  1K0S A;  1SSH A;  1MV0 B;  3VS7 A;  1GFD A;  4J9G A;  1JO8 A;  2FRY A;  2FPE A;  2D8J A;  4E6R A;  3A98 A;  1GCQ C;  2KGT A;  2BZ8 A;  1VYU A;  1AEY A;  2DRK A;  2GBQ A;  3H0H A;  2L2P A;  1K0X A;  1HSQ A;  2F2X A;  1ZBJ A;  1G2B A;  2DF6 A;  1AOJ A;  4JZ3 A;  4A63 B;  4GLM A;  1YCS B;  2DM1 A;  4CC7 A;  1JXO A;  1Y57 A;  2FO0 A;  2OI3 A;  1UE9 A;  2AZV A;  2YUQ A;  4IIO A;  1PWT A;  4RTT A;  2KNB B;  3H0I A;  1WXT A;  4DEX A;  1KIK A;  2J7I A;  2BZX A;  1K9A A;  2O9S A;  3VS2 A;  1KJW A;  1MV3 A;  1I1J A;  1YP5 A;  1T0H A;  2ECZ A;  1U06 A;  2SEM A;  3ULR B;  2O9V A;  2KBT A;  2LMJ A;  1NEB A;  1UUE A;  1WFW A;  2A37 A;  2EVR A;  1WXU A;  2HBW A;  2JT4 A;  2I0N A;  2DL8 A;  1BK2 A;  2MIO A;  3EGU A;  3EG1 A;  1SHF A;  1VYT A;  1NLP C;  1PKT A;  3PVL A;  4AFU C;  1K1Z A;  1M30 A;  2DBK A;  2VVK A;  2CUD A;  4J9F A;  2MCN A;  2JMA A;  1IO6 A;  2EPD A;  1RI9 A;  2V1Q A;  3JV3 A;  1UHF A;  2CT3 A;  3EHR A;  4RTV A;  2EYW A;  3H0F A;  3RNJ A;  5EC7 A;  1GCQ A;  3TSW A;  4Z8A A;  5GJW B;  3I5R A;  1ZUK A;  2DL5 A;  2M0Y A;  5GJV B;  1N5Z A;  1RUW A;  1M8M A;  2LQN A;  1B3Q A;  5I22 A;  3UF4 A;  1UHC A;  1OPK A;  2AK5 A;  2J05 A;  2DBM A;  1M3B A;  4J9B A;  1CKB A;  3M0P A;  2J6O A;  2KYB A;  2MOX A;  1UJY A;  2LJ1 A;  2ROL A;  3TVT A;  2KRN A;  1RLQ C;  2JW4 A;  4RTX A;  1W1F A;  2K79 A;  3ZL7 C;  1X69 A;  1SEM A;  2DRM A;  2OAW A;  2K3B A;  2V1R A;  1ZLM A;  1K4U S;  3U23 A;  2RQV A;  2EYY A;  2SRC A;  2K7A A;  1ZUU A;  2KRS A;  4LUE A;  2LQW A;  4R0K A;  1WLP B;  3PE0 A;  3I5S A;  4WCI A;  2NWM A;  4Y92 A;  2ABL A;  2OJ2 A;  1WDX A;  4OMQ A;  1LCK A;  2B86 A;  2L3P A;  2RN8 A;  1X43 A;  5IHK A;  1QKW A;  3NHN A;  1ZSG A;  2KXC A;  2KEA A;  2EBP A;  2O88 A;  3RBB B;  4JJC A;  2HCK A;  4AG2 C;  1X6G A;  3NMZ C;  1VA7 A;  5IXB A;  1QWF A;  3TSZ A;  2EYZ A;  4LUD A;  1T0J A;  1TUC A;  1U5S A;  2KRO A;  4J9E A;  1WX6 A;  2CDT A;  1I0C A;  2XMF A;  2W0Z A;  5FWC A;  2LJ0 A;  4KRT A;  4LN2 A;  1A0N B;  2RF0 A;  1M3C A;  4QT7 A;  1OV3 A;  2DVJ A;  1YWP A;  3VS3 A;  2ESW A;  4D8K A;  4HVW A;  1NEG A;  1SRL A;  4JPB W;  2JM9 A;  3UA7 A;  5ECA A;  2JMC A;  2X3W D;  2CRE A;  5I11 A;  3LH5 A;  5L23 A;  1X2K A;  2QDL A;  4CC3 A;  2JXB A;  2LJ3 A;  4OMN A;  2EGC A;  4AG1 C;  1W6X A;  2EYX A;  1Z9Q A;  2PTK A;  2LZ6 B;  2LP5 A;  3EHQ A;  1NYG A;  4ORZ A;  2YDL A;  1QKX A;  4F17 A;  3UAT A;  2DL3 A;  2F2W A;  2BTT A;  2JS0 A;  2ED1 A;  4FSS A;  2YSQ A;  1VYV A;  1ZX6 A;  2AKK A;  1X6B A;  1YWO A;  1JXM A;  2LNH B;  1GRI A;  2YUN A;  2H8H A;  2KRM A;  2F2V A;  3REA B;  1GCP A;  3IQL A;  2RMO A;  4LNP A;  2FPD A;  3VS5 A;  2HDA A;  4OMM A;  3SHW A;  3VS0 A;  1E7O A;  1UGV A;  4AFZ C;  1EFN A;  2DA9 A;  1AWJ A;  3SEM A;  2DX1 A;  1X2Q A;  1UDL A;  1PKS A;  1ARK A;  3EG0 A;  2DYB A;  2KT8 A;  4OMO A;  1TG0 A;  1CKA A;  2DE0 X;  2GQI A;  3FJ5 A;  2C0I A;  3VRY A;  2DL7 A;  1YN8 A;  2K6D A;  3REB B;  5FW9 A;  2KR3 A;  2K2M A;  2GNC A;  1YNZ A;  2LX7 A;  1NLO C;  2JM8 A;  1W70 A;  4J9D A;  2RQW A;  2E5K A;  4HXJ A;  2DIL A;  2D8H A;  2VWF A;  4JJB A;  2KT1 A;  1BB9 A;  2CH4 W;  4DEY A;  2K9G A;  1RLP C;  1E6H A;  2EGA A;  1AWX A;  2O2O A;  3M0Q A;  1HD3 A;  1SRM A;  1AD5 A;  4Z89 A;  3R6N A;  4F14 A;  3M0U A;  2KYM A;  4IIM A;  1WA7 A;  1M3A A;  2GGR A;  3VS6 A;  1I07 A;  1KSW A;  2DMO A;  1NYF A;  1UFF A;  2P4R A;  4EIK A;  1GL5 A;  2EKH A;  2RNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...