1EFNA

Hiv-1 nef protein in complex with r96i mutant fyn sh3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
ALFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (sh3 domain/viral enhancer)
molecule keywords FYN TYROSINE KINASE
publication title Crystal structure of the conserved core of HIV-1 Nef complexed with a Src family SH3 domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 57
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1996-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1efnA00
2ESWA 2YSQA 4ORZA 2I0NA 2RQWA 3VS4A 2GGRA 4LUEA 1NYFA 1J3TA 2DILA 2XMFA 2D8JA 4LE9A 1OV3A 4GLMA 4R0KA 3RNJA 3UF4A 3M0QA 2RQUA 4AFZC 1E6HA 2RQRA 2KYBA 2KROA 4JPBW 4OMLA 2JS0A 4OMNA 1RUWA 3VS0A 2RN8A 2DL8A 2ED1A 2KRNA 2X3XD 2GQIA 1I0CA 1VA7A 1YCSB 1CKAA 2J06A 1AWXA 2EYXA 2FG0A 1OPLA 2ABLA 4GBQA 1YWOA 1ZLMA 2F2VA 1UTIA 2DJQA 2C0IA 2C0OA 2FRWA 1B07A 2J05A 3UA7A 2DL4A 2YUQA 4FSSA 4LNPA 2K79A 4KRTA 1B3QA 2OAWA 1GCQA 3I35A 1H8KA 4Z88A 1W6XA 3SHWA 2CH4A 4HVVA 2AZVA 4D8KA 2O88A 2C0TA 4A63B 4RTXA 1G2BA 2BZYA 2ROTA 4JZ4A 3GBQA 1SPKA 2DE0X 1CSKA 1M3AA 3LH5A 1Y0MA 1Y57A 4RUGA 5ECAA 2HCKA 2DLPA 1I1JA 2KT1A 1X2QA 2J6FA 4WCIA 2VKNA 1SEMA 2JT4A 3REAB 1RLPC 3EG0A 3I9QA 4Y92A 4F16A 2JMAA 4J9EA 3THKA 2KBTA 4X1VA 4E6RA 1U5SA 2X3WD 1BBZA 3I5RA 2K2MA 2ED0A 1GBRA 1AWOA 1SHFA 3C0CA 1HSQA 2M0YA 4RTWA 4F17A 2LQNA 2DRMA 3NPFA 2EGEA 2O9VA 2RNAA 1T3SA 1NEBA 4OMOA 1OOTA 2KEAA 4AFSC 2NUZA 4ESRA 1JXMA 1U3OA 2ENMA 1AOJA 2LP5A 1X43A 2MCNA 2KRSA 1K0SA 2L2PA 3ZL7C 2KXDA 2JW4A 1NM7A 1UHCA 2D0NA 4JJBA 2YUPA 1UHFA 2EBPA 1BB9A 2PZ1A 1K9AA 3EHQA 5IH2A 2CDTA 2ROLA 1WXBA 1ARKA 1QKXA 5L23A 5GJWB 3M0PA 2CREA 2AZSA 1M3BA 2CUDA 1M27C 1NLOC 2GBQA 1T3LA 2D8HA 3EGUA 3H0IA 2DL3A 2DBMA 1QLYA 5IHIA 1UECA 1YNZA 2KRMA 2OJ2A 3JV3A 1ABOA 1OPKA 1PNJA 1JXOA 2F2XA 3O5ZA 4J9DA 4EIKA 4RTUA 2AK5A 2LJ3A 1UGVA 4LUDA 2L3QA 2FO0A 3TSZA 2M51A 4HCKA 1KIKA 1M8MA 1UJYA 2SRCA 1WI7A 1M3CA 1GRIA 2FPFA 1GFCA 1GCPA 1UFFA 2A37A 2JMCA 2GTOA 2EVRA 4RTVA 5EC7A 1BK2A 1NLPC 1PRLC 5IHNA 1MV0B 1Z9QA 2K6DA 4ZNXA 4QT7A 1H92A 3SEMA 3U23A 1ZSGA 1MV3A 1E6GA 1AEYA 2J7IA 1N5ZA 4J9GA 2K3BA 3VS3A 3EHRA 1AZGB 2CSQA 1WXTA 1I07A 2JS2A 3M0RA 1EFNA 2YT6A 2EGAA 2EPDA 1T0HA 1UJ0A 1KSWA 2PNIA 3NMZC 3VS7A 1T0JA 2KT8A 1ABQA 4HVWA 4D8DA 1S1NA 1PKTA 2DX1A 1U06A 1KJWA 1WLPB 2CUBA 2EGCA 2EYYA 2RQVA 4OMPA 1K4US 3ULRB 5IXFA 2RPNA 1GCQC 2AKKA 2LQWA 4Z8AA 5GJVB 2DVJA 2LJ0A 4CC2A 1AWWA 3FJ5A 2V1QA 2QDLA 5FW9A 3VRYA 4RTZA 3KFVA 2KYMA 2JM9A 2KR3A 2PTKA 4HVUA 1YP5A 2J6OA 1JQQA 1ZUKA 2MOXA 3TVTA 4F14A 1WXUA 4AG2C 3M0TA 1PHTA 4CC3A 2FPDA 1JO8A 3NGPA 2KGTA 3UA6A 4JZ3A 1UE9A 3M0UA 3EG2A 1JEGA 4RTTA 5I11A 1PKSA 3QWYA 3RBBB 2GNCA 2JXBA 1NG2A 2D1XA 1SRLA 2LNHB 1X27A 3A98A 1ZUUA 3H0FA 1M30A 1SHGA 2KNBB 2OI3A 1H3HA 4J9HA 2MIOA 1V1CA 2J6KA 2HBWA 2DF6A 2HDAA 2O2OA 2JM8A 3CQTA 3NHNA 1PRMC 1RLQC 1QWFA 1X6BA 1YN8A 1W1FA 1HJDA 1QCFA 4AG1C 4AFUC 4LN2A 2AKLA 2CT3A 4M4ZA 1RI9A 1AD5A 1MUZA 1LCKA 1Z9ZA 1X2KA 2YDLA 2EQIA 3R6NA 2CT4A 3EG1A 3QWXX 1VYTA 2YUNA 1E7OA 3VS1A 3PVLA 2RQTA 2DNUA 2LZ6B 4J9BA 2L3SA 2HEQA 2KE9A 2EKHA 2GTJA 4OMQA 1K76A 2B86A 2FEIA 1ZUYA 1SRMA 1WYXA 1WA7A 1VYUA 2VVKA 3VRZA 1SSHA 2SEMA 1WIEA 3VS5A 1AVZC 1NEGA 2RF0A 1TG0A 4DEYA 1KFZA 1X6GA 1G83A 2A08A 1GFDA 2DBKA 2HSPA 2F2WA 3PVQA 1JU5C 1K0XA 1UUEA 4RTYA 1XOVA 2W10A 2K7AA 2K9GA 3REBB 2FRYA 4CC7A 2EW3A 4J9IA 2DRKA 1AZEA 2IIMA 2EYWA 3EG3A 1OEBA 3H41A 4IIMA 4J9FA 1GBQA 4J9CA 1TUCA 2KXCA 5I22A 1CKBA 2VWFA 2EYZA 3UATA 2CH4W 1UG1A 2L3PA 3I5SA 4CC4B 2LMJA 2NWMA 3VS2A 2A36A 1W70A 2A28A 2G6FX 2FPEA 4HXJA 1VYVA 2BTTA 1QKWA 2DYBA 2DA9A 2O31A 2LCSA 2BZ8A 4IIOA 3H0HA 1HD3A 5IXBA 1GL5A 5HCKA 3M0SA 1WFWA 4OMMA 1FMKA 1BU1A 1IO6A 2BZXA 1PWTA 1K1ZA 2H8HA 3TSWA 1UDLA 2DL7A 1ZBJA 4DEXA 2YUOA 2DMOA 2LJ1A 1TUDA 2LX7A 3PE0A 1QWEA 1NYGA 5IHKA 5FWCA 1X69A 2W0ZA 2O9SA 2V1RA 4JJCA 2DL5A 2E5KA 2L0AA 5FWBA 1WX6A 1A0NB 4Z89A 1AWJA 2JTEA 1FYNA 4JJDA 4AFQC 3VS6A 2CSIA 3IQLA 2P4RA 1WDXA 1YWPA 2RMOA 1ZX6A 2ECZA 4K11A 2DM1A
chains in the Genus database with same CATH superfamily
2Y4XA 2RI3A 2YSQA 3ME9A 1PC0A 3G71Q 2GGRA 4PJOG 1G5VA 2XMFA 2ZPIB 2QQ9A 2CS7A 4GLMA 4ME7A 2WSCE 3RNJA 1MMDA 1R8OB 4C5EA 1M2VA 1VQ7Q 3NFCA 3QKJA 1MGQA 4OMLA 3OW2A 3E1SA 1RUWA 3VS0A 2RN8A 3CMEQ 3S3MA 2GQIA 1I0CA 1YCSB 2CP5A 1CKAA 2J06A 1YJ9T 2YRDA 3JB9D 2KMTA 1VIFA 4GBQA 1YWOA 1ZLMA 5CKDA 2FZKB 3CCUT 2OTLQ 4J5YA 2C0OA 2E70A 4PK4A 4M75F 2XI9A 3KXTA 3UA7A 1M1KC 2MWPA 2DL4A 5CAIA 2RHUA 4FSSA 3MCAB 4LNPA 2YLCA 1WHJA 1BCOA 2COWA 3URGA 1W6XA 1OX9A 3SHWA 2QQRA 2XDBA 1X75C 2AZVA 2O88A 4BY6B 5LJ5h 2BZYA 4DA4A 1M1KU 3RR6A 4J6XA 3JCMb 3LH5A 4JRIA 1YFNA 4E7KA 2DLPA 2KT1A 1X2QA 4M77E 3DKMA 1VQKQ 3GPLA 1M2VB 2E6NA 1NPRA 2WACA 3I9QA 4RMOA 3RDVA 1ACMB 4F16A 4J9EA 3GNFB 1YIJQ 1NBEB 3LYIA 5CKEA 1U5SA 1PM3A 5A2QE 2EJ9A 3I5RA 3JCMJ 1GBRA 1AWOA 1YJWQ 2QEXT 3F70A 3OS0A 1WHLA 3LWHA 4KT0E 2K3XA 2R57A 2LQNA 5FRNA 3CCJT 3JCMf 5KCOA 3G6EA 3RERA 1YI2A 1JXMA 3OYGA 3JCMQ 3ZL7C 2KXDA 1M90R 2BE7D 1AT1B 1UHCA 1OYXA 3V8KA 1QW1A 2RD1A 4O6JA 3MEVA 2EBPA 1WHGA 3EHQA 2EFIA 3WVEB 1RI0A 5L23A 3QZ5B 4RCCA 4BB7A 1PG5B 1ZHIA 2AZSA 2JOYA 1M3BA 4AMCA 5D6YA 5GANh 1MHNA 1VQ6A 1T3LA 2GBQA 3JSCA 4ZN3A 2QDYB 5GAMe 1D0XA 1RAIB 2DL3A 3Q1JA 4QW2A 4WF2A 5IHIA 6AT1B 5GAN7 2KRMA 3CCVQ 3CCQQ 5GANd 3HFNA 1JXOA 3O5ZA 4RTUA 2QQAA 2LJ3A 4FW1A 1UGVA 3HKSA 3QIIA 4F04B 3CCET 4F7UE 4C8QA 2LNVA 1LPLA 1M90C 1WI7A 4QKUA 2E12A 3M4GA 4A4GA 2A37A 4BY6C 3OYEA 2GTOA 3UDCA 5DY9A 1QVFS 1BK2A 5IHNA 3PT9A 2XIDA 3JB9G 3M57A 3SFMA 3BFMA 1M90U 2KI7A 1JJ2S 1U1TA 4E47A 2I2LA 4ZNXA 1YJ9A 3M53A 4VUBA 1AEYA 3H9NA 3G4SA 3CCUA 4E7SA 4M78D 4ZGDB 3CPWP 1AZGB 2JS2A 1EFNA 2YT6A 3SDZA 5KYYB 2EPDA 3TCJA 1T0HA 1KG1A 1UJ0A 2OTJT 1KSWA 3FEOA 4E7HA 1T0JA 4D8DA 1WJRA 3ZBDA 3S3OA 3O8VA 4O5VA 4OMPA 1Q86R 4C8QB 3C94A 4PL6A 2KSSA 2RHYA 5GJVB 4Z8AA 2DVJA 2RJCA 1IGUA 1QVGS 5CQYA 4A53A 1B34A 2V1QA 3QG1A 3BE3A 5FW9A 1K9MR 2EYQA 2KYMA 4C0DB 2PTKA 4HVUA 3PMIA 3JCMV 1PHTA 3OYMA 4CC3A 1TSFA 3NGPA 2KGTA 4JZ3A 2QQBA 3INZA 2E1HA 3OMCA 2CP6A 2QEXA 1EZZB 3OS1A 3QWYA 3MEUA 2D1XA 3A98A 1V29B 2JNGA 3CCJA 4LDUA 3H0FA 4IUUA 3L2UA 1IREB 1Q95G 2KNBB 1UGQB 1H3HA 5C6SA 4J9HA 1WJSA 1Q86C 4Q5WA 2IPOB 4IKFA 4PJOF 1X6BA 1OZ3A 1YN8A 1W1FA 4M75E 3OYDA 1HJDA 1QCFA 1VQOT 1K9MC 4BDYA 2AKLA 2VASA 1Q86U 1B34B 4JLIA 4M78E 4OGCA 2CT4A 2CZ1B 3QWXX 2HQHA 1VYTA 3VS1A 1K9MU 2LZ6B 3G6EQ 2L3SA 1YI2Q 2DXBA 3MO8A 2A7YA 2B86A 1TOVA 2DTOA 1ZUYA 1SRMA 2E4HA 2EJFA 1WIEA 1KQSP 4MZTA 2PVOB 5GANe 3JCMX 2A0FB 4DEYA 2R58A 2ZPGB 1IXDA 4FW2A 4KBMB 4A4HA 1FXXA 2DBKA 2HSPA 4JRKA 1VQ9A 3RKWA 1K0XA 1UUEA 2RJFA 2K9GA 3BDUA 3REBB 3DB3A 4C92D 4CC7A 2DRKA 1AZEA 3CEYA 1GBQA 4J9FA 3TQ7P 1NJIR 2VWFA 2Y4YA 4C0DC 3I56T 3OYYA 2MAMA 2RB6A 1UG1A 5I2MA 1QP2A 1RAEB 1KC8R 2L3PA 5KYWA 2VXFA 4OVAA 5GAN6 1KD1R 4TVRA 5LL6S 5IAYA 3CXCS 2DIGA 2FHDA 2NWMA 2OTJA 1I5LA 4HXJA 1H641 1YJNT 2F1LA 4M77A 1WPYA 4C0ZA 2RHIA 2LCSA 4IIOA 2NUPA 1IGQA 1U8RA 1YJ9Q 1TH7A 4M7DD 1G3SA 3JAME 3G4SQ 3CCUQ 4XTVA 5HKCA 2H8HA 1NJIC 5KYNA 2DMOA 2MWOA 1OU8A 5FWCA 2DEQA 2O9SA 4XQ3A 4ELZC 1OI1A 1KD1C 2E5KA 3E19A 2RHXA 1NZ9A 2H3JA 1Q7YU 1NJIU 5KYWB 4AFQC 3VUBA 3IQLA 2LRQA 2P4RA 3NTKA 1WDXA 1KD1U 4JJNK 2GFUA 2ESWA 4ORZA 4M77B 1Y07A 4FYXB 3VS4A 4C92E 2VUBA 4LUEA 1NYFA 2NUPB 2D8JA 4LE9A 1VQOA 1OV3A 5GANj 4B9WA 4R0KA 2DEUA 2F5KA 2CP0A 3OYLA 2FYKA 1E6HA 4A4FA 3CPWA 2QYZA 4XU1A 2KYBA 3JB9F 4HCZA 1WJQA 4OMNA 4KULA 2XHCA 5CO7A 2ED1A 3CCJQ 1VA7A 2R5MA 5A0DA 4E7JA 1AWXA 2FG0A 5GMKj 2ABLA 4F7UA 2F2VA 1UTIA 1BYMA 4HT8A 4EMGA 4E7ZA 1YBYA 2J05A 3GNGA 5GANf 1KQ2A 3M9QA 2LT1A 2DXCA 1B3QA 3MHXA 2P0QA 4Z88A 1H8KA 1K8AR 2MMPA 2C0TA 3V8LA 3A1PA 1VQMT 4C92G 1BI0A 2YRCA 2EWNA 2ROTA 5DM7R 1D3BA 4KH0B 1Y0MA 5ECAA 3OYHA 2WSEE 1Q81R 3LLRA 2J6FA 4B9XA 3X28B 1Q82R 2VKNA 1KHCA 1SEMA 4M7AD 5LJ3g 2QASA 3I56A 4Y92A 3VYGA 5GAN2 2VXEA 5AYFA 3X26B 2KBTA 1M4ZA 3DLMA 4X1VA 4PJOE 4XU0A 1HXDA 3M55A 5GMKi 4F7UB 4OMFB 4EPCA 1SHFA 1IB8A 1VQ9Q 1VQNT 4RTWA 4F17A 4ZGJB 1YJNA 4FSXA 1K8AC 4JS5A 4M7DG 2RNAA 2CZ0B 4Y91A 2KEAA 4AFSC 2NUZA 4ESRA 1U3OA 4P5NA 1AOJA 2LC4A 3FRNA 3LGLA 2KRSA 1K0SA 2L2PA 2JW4A 4JJBA 1Q81C 3VUZA 1UHFA 3CBOA 5HY6A 2LQKA 1K8AU 1VQPT 3QSUA 2E41A 1Q82C 1WXBA 1D3BB 1ARKA 2QK0A 2OTJQ 1KQSA 4R55A 2X51A 1ZBXA 3FIFA 1UEBA 2X9HA 1Q81U 1NLOC 5LJ3d 2COZA 2D8HA 4MMLA 2LVMA 1Q82U 3C12A 1PSEA 1UECA 3JV3A 1R0BG 4M75A 1SSFA 1PNJA 4ZN1A 5D7UA 2AK5A 4LUDA 4N4HA 3CC7T 2M51A 1KIKA 2XU8A 3QXEB 1C6VX 2SRCA 3TEEA 5A0GA 1M3CA 4C5IA 2EIFA 3EAEA 2FPFA 1UFFA 3HRSA 2FZCB 1YHQT 1UGPB 5IN1A 1BCMA 1NLPC 4BE1A 1NE8A 1MV0B 1Z9QA 5CKBA 2K6DA 3WVDB 2DK3A 4QT7A 1M8VA 4M78F 3SEMA 1MV3A 4FYVB 4ANJA 2L8DA 1WGSA 5A0LA 3VS3A 3HSBA 2QTXA 3EHRA 1VQ4T 1WXTA 4JUVA 2EGAA 1VQOQ 4IUVA 3X20B 3OBYA 4M75B 4HT9A 4OB2B 2QI2A 1ABQA 1YITT 1PKTA 3E2UA 5GMKm 1KJWA 1WLPB 2RA2A 2CUBA 3JCMW 2EGCA 3CC2A 4E2FB 4FU6A 4QVZA 4FT2A 5IXFA 1ZSZA 2DVEA 2LQWA 1D0YA 2LJ0A 4M7AG 1AWWA 3FJ5A 2ZAEA 2QDLA 4BI8B 4XK8E 3OW2S 3KFVA 2JM9A 3TU4K 5GAOp 1JQQA 3SD4A 3S3NA 4F14A 1WXUA 1JO8A 3L2VA 2EQJA 3UA6A 3M0UA 3OQ5A 2CKKA 5GMKl 4R56A 4OF1A 1KQ1A 1PKSA 2JXBA 1D0ZA 2LNHB 1X27A 4JRPA 3A8OB 1ZUUA 2AHJB 3OMGA 1M30A 3FLGA 2OI3A 4PJJA 1V1CA 2RM4A 2HBWA 2O2OA 5GAN3 3I55Q 2JM8A 5CR2A 3I56Q 3NHNA 1MNDA 2MI6A 1QWFA 4FM4B 2E3IA 5KYYA 1VQPA 1ZSZB 1O75A 4CRIA 4AG1C 3VU3C 4LN2A 2BIVA 2E3HA 1AD5A 1MUZA 2HL3A 1XTDA 4FYWB 2CYZB 2JVVA 1X2KA 5GMKh 2P0PA 3CCLT 4KUDK 1YJNQ 3JRZA 2EQIA 3EG1A 2GQVA 2HZYA 5GAN8 4C0GA 2HNIA 2RQTA 4X9CA 2DNUA 2KE9A 4IUQA 1MMNA 1WQWA 1WYXA 3A5ZB 3CC4T 2VVKA 4PFZA 3BY7A 3VRZA 2SEMA 3VS5A 2K57A 1D1CA 3CCRT 2EKOA 1NEGA 3ZEHA 3CC7A 1TG0A 2DIQA 4M75C 1KFZA 1X6GA 1G83A 1QMCA 3H6ZA 1VQ5T 2M0OA 2X35A 2YWWA 4C92F 1YHQA 5IT9E 3KBGA 3P8HA 4M78C 5GAOq 4KGZB 1R77A 1QCNA 2ZPEB 1ZQ1A 2FRYA 2JUFA 4J9IA 2GFAA 3HFOA 2DXUA 3EG3A 3H41A 1X01A 4X9DA 3GLXA 4J9CA 4KH1B 2QGFB 4PLIA 2XDDA 3CCMT 4A4EA 1CKBA 2M16A 1EX4A 4MZPA 2EJGA 2EYZA 1PD0A 3UATA 1QVPA 3UT1A 2F69A 1I5OB 2LTOA 4WTOB 1VQ4A 4CC4B 4BD3A 3OYNA 2VGNA 2QA4T 3CPFA 1W70A 1RAAB 5KE3A 3META 4M7DF 1YCYA 4OP0A 4IUPA 1FX7A 2DA9A 2PUKB 9ATCB 1ZA1B 5IXBA 5HCKA 1ZA2B 5C0MA 5HK3A 4PJNA 4PJOA 5GAN4 2A3LA 4GLKA 1BKBA 4J6YA 1IO6A 1PWTA 2DZ9A 3DB4A 1UDLA 1ZSZC 3NTHA 3MP6A 4FIBA 1QWEA 2Y90A 1NYGA 1X69A 2W0ZA 8AT1B 2DL5A 3CC2Q 5GAN5 3N5BB 3OSSC 4Z89A 3OYBA 4EMKA 3VS6A 1YWPA 3X24B 1ZX6A 4QQ6A 3CD6T 2QXFA 5LJ3j 2DETA 2RQWA 3M58A 4Z02A 2PUOB 2PVGB 1QQJA 4PFOA 3RIRA 4JS4A 4OB1B 2RQUA 4AFZC 4PJOB 3KUFA 4ZTFA 3JCMg 4JPBW 1G3WA 3CCLA 3C4SA 3GOXA 1I4K1 1W2BA 2X3XD 3CCEA 2DYIA 2DXTA 2E65A 1TTHB 2RHZA 2DJQA 1VQ6Q 2C0IA 1VOMA 1B07A 3QYGB 2RJEA 3CC4A 1WHKA 4MZMA 4DBRA 5GMKe 1VQPQ 2YLBA 2E6ZA 2HAXA 3OYCA 4C92C 1TU0B 2K79A 4EMKB 2OAWA 1GCQA 1LOJA 2CH4A 4HVVA 3UPUA 3OYIA 2ZPHB 1VQ5A 4A63B 3FDRA 2E5QA 4C8QD 4JZ4A 3GBQA 1SPKA 2DE0X 1LNXA 1Y57A 4RUGA 4M7AF 2QG9B 1I1JA 2LCLA 4QQDA 3CCMA 2L3RA 2HSEB 1OQKA 3JCMd 4II1A 4KGXB 4MDWA 2JMAA 2RJDA 2PVDB 2DFUA 3MP1A 4NL2A 1P92A 4E6RA 3CCVT 3CCQT 4M7DC 1DJ7B 2ED0A 2QA4A 1HSQA 2M0YA 1TWBA 2L5QA 2HBPA 2P0KA 4XU2A 2O9VA 1LVKA 3HL8A 3LWIA 4XTYA 3M56A 1OOTA 4OMOA 5J3BA 4LD6A 4XTUA 1KC8C 2LP5A 5FRMA 1FMVA 3MJXA 1NM7A 1IHVA 2D0NA 1BI2A 2YUPA 3X25B 2DTHA 1BB9A 2PZ1A 1K9AA 4HKEA 1D09B 3CBMA 1VQ4Q 2D0QB 2ROLA 5GJWB 1M5Q1 1KC8U 3LX7A 4J8OA 3M0PA 5KCHA 4PJOC 4D6WA 5M9OA 2CUDA 2DJZA 1RAFB 3FJPA 2DPPB 4JLGA 3AHUA 1XJWB 2LDMA 1S72T 3QJYA 1YNZA 1QVFP 1ABOA 1OPKA 2VYTA 5CKHA 2CZ6B 3ER0A 2QEXQ 4J9DA 3CD6A 4EIKA 3OYFA 2QGGA 1JJ2P 4EMHA 2X4JA 2MPXC 5KYUA 1WQ7A 3ZFJA 5I21A 1M8MA 4LDWA 4EMKC 5J26A 3GP8A 4DBFA 3QHSA 1GCPA 2JMCA 4BE2A 1RL2A 2EVRA 4RTVA 1OULA 5EC7A 3EFSA 1PRLC 5HK0A 3T9NA 1BIBA 4M7DE 5DLOA 3OBWA 1H92A 4N0AC 2K5IA 3CCST 3AT1B 1ZSGA 2JTMA 4FYYB 4OGEA 4J9GA 3L2WA 1QVGP 3M0RA 3V8JA 4BI4A 4DBHA 5GAMg 2X4XA 2PNIA 3NMZC 3VS7A 4HVWA 5CK9A 4C8QG 4QQGA 1F1BB 2EAYA 3CCEQ 5KYUB 2L89A 1H3ZA 1W4SA 1GCQC 3R6OA 2AKKA 4ZGEB 3CPWS 2JN0A 4NL3A 1XNIA 3VRYA 4RTZA 4B6MA 3CC4Q 2KR3A 4E7LA 3FC3A 2J6OA 1BI3A 4FT4A 2V8JA 2MOXA 3M0TA 3G6ET 4N4GA 3CCVA 5GAOm 1UE9A 1QP3A 3EG2A 3M5AA 1JEGA 3QYHB 4RTTA 1O9SA 5I11A 3RBBB 1SRLA 4JRQA 5LJ3h 2P84A 2E10A 5GAMd 1SHGA 3CCMQ 5CVIA 1KHIA 2MIOA 4DOVA 2J6KA 2DF6A 2HDAA 2ATCB 4M77D 4LDVA 2QAZA 1WHMA 1FMWA 4AFUC 3RKYA 2CT3A 2QA4Q 3L1AA 1LCKA 1N8RR 3OY9A 2YDLA 1HK9A 4QVDA 1VQ8T 4DQ2A 1MMAA 3R6NA 4L5GA 3RMQA 1SF9A 3ASKA 2YUNA 4M78A 7AT1B 2FL7A 3JB9J 1K73R 1S72A 2EKHA 2GTJA 1C1AA 5LJ5g 3OYAA 1NPPA 2FEIA 4M7AE 2LX9A 1SSHA 4PJMA 1AVZC 2RF0A 2CGHA 1D1BA 3EFOA 5CQXA 1TXQA 2RO0A 2QTVA 3L2ZA 4V2SA 3J81E 2F2WA 3G4ST 1KK7A 3CXCP 2W10A 3EH1A 1N6AA 1N8RC 3QJ6A 4L6V5 4IIMA 4XU3A 1KQSS 8ATCB 1W2BP 2KXCA 4UC4A 3CCSA 3CD6Q 3CMAT 3TREA 1K73C 1BIAA 1VQMA 2D9TA 4M78B 5KE2A 2V8KA 2LT4A 1N8RU 3I5SA 4QVCA 2LMJA 3MKDA 2VB6A 5LJ5d 3OSVA 5FU6C 2CP2A 1WHHA 3RKXA 3EGXA 1K73U 3HHTB 1QKWA 5CKFA 3QDFA 4LDYA 2K2VA 3V7RA 1RABB 1VQLT 3EFOB 4ELYC 1HD3A 1GL5A 1G8XA 2R5AA 2RK1A 3M0SA 1M2OA 2HMAA 5GANg 2OAUA 1WFWA 3OB9A 1I8FA 3WXMB 4PJLA 1VQNA 2D6FA 4N4IA 3M59A 1QVFA 1JBMA 1RAGB 2MK5A 2GCXA 3OS5A 2YUOA 1TUDA 3BDLA 3RESA 4ATOA 4BACA 1JJ2A 4XTZA 2MYSA 5IHKA 3E9GA 4JJCA 3HRUA 5CCAA 2L0AA 4AT1B 3GIBA 2JZ2A 4KUIA 4HCCA 2CSIA 4BE0A 4M77G 1UGRB 2RMOA 2ECZA 4K11A 2DM1A 1AHJB 3S6WA 2I0NA 2O01E 3EGXB 1UGSB 2ZPFB 1G3TA 1N9RA 1J3TA 3MP8A 2DILA 2P4TA 2VV5A 4C92A 4C0FA 4HCBA 3UF4A 4LDXA 3VYHB 5LJ3e 2DZCA 3M0QA 2RQRA 1QVGA 2KROA 2E64A 2JS0A 3A8GB 1VQ8A 2DL8A 2KRNA 2XKOC 2EYXA 1SG5A 1OPLA 4LD9K 1PD1A 3EGDA 4X34A 1VQ9T 2DAQA 2FRWA 4HA8A 3RUXA 5FU7B 2YUQA 3H8ZA 3PFSA 4PFPA 4KRTA 3I35A 4M75D 4M7DA 4C8QF 4D8KA 3BW1A 5FLXE 4RTXA 1G2BA 4RG8A 1M9SA 2V8IA 4FCYA 1CSKA 1M3AA 4C92B 1S72Q 3G7ZA 2HCKA 2HKNA 3HRTA 4WCIA 5EG2A 4PKCC 3PIPA 3C95A 3D7SB 2JT4A 2XG8D 1RLPC 4YTLA 3REAB 3OYKA 2YXYA 3EG0A 3CMAA 1YITA 3PGGA 3G71T 4A4KA 4F7UG 4CI0C 3THKA 2X3WD 1BBZA 5CIUA 2K2MA 1RACB 1VQ7T 3EGDB 3C0CA 2C06A 1U1SA 5KYXA 3PTAA 2OX7A 2DRMA 2JTFA 2LCCA 3NPFA 3CMET 1R0CB 2EGEA 3JCMP 5LJ5e 4J83A 3SB2A 1T3SA 1NEBA 2PQWA 5D6XA 1VQLA 2K5FA 2ENMA 4M7DB 3CCSQ 3V7SA 1X43A 4XTXA 2MCNA 4NOYA 2OTLT 2VC8A 2B8AA 2AT1B 1FWZA 3QDRB 5GAOr 1VQMQ 1B7TA 1X6OA 3MEWA 2MF2A 5IH2A 2CDTA 4RKUE 2ZPBB 5I2SA 1QKXA 5GAMj 1M1FA 2BKDN 3FB9A 2CREA 4A54A 2KY9A 5J39A 1M27C 3EGUA 3H0IA 1BI1A 2Z0WA 3QBYA 2HD0A 2DBMA 1QLYA 2M1HA 3HP9A 1IRXA 2OJ2A 4BUGA 4DBQA 2HL5C 4L59A 4N0AA 5DLQE 1VQKT 3CXCA 1Y96A 4J7FA 2F2XA 1JB0E 2IG0A 1RAHB 5KYXB 1QCOA 3HTRA 1VQNQ 2RK2A 5FU7C 5GAMf 2HQXA 2L3QA 2CP3A 2FO0A 2V26A 4HCKA 3TSZA 1YIJT 3MPUB 1UJYA 1I81A 2K5LA 2BE9B 3LW5E 4IURA 1GRIA 5LJ3f 2DD5A 1GFCA 1YJWT 1WZOA 2DTIA 3HPWA 4C5GA 2NUTA 2RI2A 2NYSA 3J80E 2ZGWA 4M7AA 1D1AA 1N9SA 3OA6A 3CCRA 3QO3A 3MEAA 3VJPA 1TS9A 3L42A 3U23A 2ZZDA 3OS2A 4GY5A 3L2RA 1E6GA 2RI5A 2J7IA 2M9UA 1N5ZA 2XK0A 1EIFA 2WSFE 2NLUA 2LQ8A 4E7IA 2DKGA 2K3BA 3JCMh 3PIOA 4M75G 4C8QC 2CSQA 1I07A 1OZ2A 3V7CA 3OW2P 3A8HB 2K3YA 3G1JA 1Y96B 3A8MB 2KT8A 1Q7YR 1S1NA 2HQEA 3I55T 4M78G 4J7IA 1LJOA 3EFRA 2PU9B 2DX1A 1U06A 1VQ8Q 2EYYA 1Y7XA 2RQVA 1K4US 3ULRB 1G3YA 3CC7Q 3M54A 4BDZA 2RPNA 1PCXA 3SWNA 3P8DA 4OB0B 2XICA 5LJ5j 3PMTA 2H3EB 3EG9A 4CC2A 2KVQG 1YHQQ 2NUTB 1W2BS 1YP5A 4M7AB 2HKQB 3M4YA 3G71A 1ZUKA 3TVTA 4AG2C 4RG2A 2AIRB 2G3RA 2FPDA 3PNWC 3E9FA 1VQ7A 4NS5A 2EQUA 1M1GA 2GNCA 1NG2A 4XAXB 2JJ9A 5LJ5f 3CMEA 5KH6A 1Q7YC 4M77F 4RCBA 1GXIE 4C5HA 3CMAQ 3JB9H 1YITQ 2OTLA 3CQTA 2BUDA 2DERA 2X4WA 4LXCA 1PRMC 1RLQC 3OYJA 4ZTJA 1VIEA 2EQMA 3QPHA 3CBPA 5FROA 3SWNB 2KAFA 3EG9B 4M4ZA 4PJOD 1RI9A 1Z9ZA 4PNOA 4C8QE 1E7OA 3PVLA 1SKUB 4J9BA 1PSFA 1VQLQ 2HEQA 2XD0A 1MMGA 4OMQA 1K76A 2K4YA 1VQKA 2M02A 1WA7A 1VYUA 2GF7A 1RADB 2DD4A 2O4XA 3EH2A 2FZGB 3LH0A 1YIJA 5AT1B 1OU9A 4JDSA 2YRVA 2VGMA 2A08A 1GFDA 3A8LB 1N27A 1YJWA 4XTWA 3PVQA 1JU5C 3GF5A 4RTYA 1XOVA 4Y28E 3DLLA 2XDPA 2K7AA 3VKIA 2EW3A 2CZ7B 2IIMA 2EYWA 1VUBA 1OEBA 1TUCA 1OX8A 5I22A 4MDXA 1IHWA 4DOWA 4IUTA 4BI3A 3CCLQ 2X4YA 4F7UF 4M7AC 2CH4W 2CP7A 3CC2T 2COYA 3J7AF 2KQWA 5L8RE 2KDSA 4KGVB 3NTIA 3JB9I 1XQHA 2FVUA 4MMKA 1UB4A 3VS2A 2A36A 2KK4A 2A28A 3RMSA 2G6FX 2FPEA 1VYVA 2RH2A 2BTTA 3I55A 2DO3A 2YHTA 3VV0A 2DYBA 1C0MA 1JRIA 2O31A 3CCRQ 2BZ8A 2O4XB 2IVWA 3H0HA 2F5TX 2ZCFB 3JCMe 1YI2T 5D6WA 3P8BB 3CCQA 1VQ5Q 4OMMA 1FMKA 2EQKA 1BU1A 3LGFA 5FU6B 5GAMh 1HYOA 2FB7A 2BZXA 1WNLA 1K1ZA 4OB3B 3TSWA 2QQSA 1V76A 1Y71A 2DL7A 1ZBJA 3SWNC 4DEXA 2LJ1A 3QZ9B 2LX7A 5GAOn 3PE0A 2V1RA 3QUIA 3UWNA 1VQ6T 4M77C 4J6WA 1IZ6A 5FWBA 1WX6A 1A0NB 1MNEA 1AWJA 2JTEA 1FYNA 4PLLA 3L2QA 4JJDA 1TUGB 3JCMc 4EDUA 1M1KR 4FL6A 5GAOl
chains in the Genus database with same CATH topology
2ESWA 2YSQA 4ORZA 2I0NA 2RQWA 3VS4A 2GGRA 4LUEA 1NYFA 1J3TA 2DILA 2XMFA 2D8JA 4LE9A 1OV3A 4GLMA 4R0KA 3RNJA 3UF4A 3M0QA 2RQUA 4AFZC 1E6HA 2RQRA 2KYBA 2KROA 4JPBW 4OMLA 2JS0A 4OMNA 1RUWA 3VS0A 2RN8A 2DL8A 2ED1A 2KRNA 2X3XD 2GQIA 1I0CA 1VA7A 1YCSB 1CKAA 2J06A 1AWXA 2EYXA 2FG0A 1OPLA 2ABLA 4GBQA 1YWOA 1ZLMA 2F2VA 1UTIA 2DJQA 2C0IA 2C0OA 2FRWA 1B07A 2J05A 3UA7A 2DL4A 2YUQA 4FSSA 4LNPA 2K79A 4KRTA 1B3QA 2OAWA 1GCQA 3I35A 1H8KA 4Z88A 1W6XA 3SHWA 2CH4A 4HVVA 2AZVA 4D8KA 2O88A 2C0TA 4A63B 4RTXA 1G2BA 2BZYA 2ROTA 4JZ4A 3GBQA 1SPKA 2DE0X 1CSKA 1M3AA 3LH5A 1Y0MA 1Y57A 4RUGA 5ECAA 2HCKA 2DLPA 1I1JA 2KT1A 1X2QA 2J6FA 4WCIA 2VKNA 1SEMA 2JT4A 3REAB 1RLPC 3EG0A 3I9QA 4Y92A 4F16A 2JMAA 4J9EA 3THKA 2KBTA 4X1VA 4E6RA 1U5SA 2X3WD 1BBZA 3I5RA 2K2MA 2ED0A 1GBRA 1AWOA 1SHFA 3C0CA 1HSQA 2M0YA 4RTWA 4F17A 2LQNA 2DRMA 3NPFA 2EGEA 2O9VA 2RNAA 1T3SA 1NEBA 4OMOA 1OOTA 2KEAA 4AFSC 2NUZA 4ESRA 1JXMA 1U3OA 2ENMA 1AOJA 2LP5A 1X43A 2MCNA 2KRSA 1K0SA 2L2PA 3ZL7C 2KXDA 2JW4A 1NM7A 1UHCA 2D0NA 4JJBA 2YUPA 1UHFA 2EBPA 1BB9A 2PZ1A 1K9AA 3EHQA 5IH2A 2CDTA 2ROLA 1WXBA 1ARKA 1QKXA 5L23A 5GJWB 3M0PA 2CREA 2AZSA 1M3BA 2CUDA 1M27C 1NLOC 2GBQA 1T3LA 2D8HA 3EGUA 3H0IA 2DL3A 2DBMA 1QLYA 5IHIA 1UECA 1YNZA 2KRMA 2OJ2A 3JV3A 1ABOA 1OPKA 1PNJA 1JXOA 2F2XA 3O5ZA 4J9DA 4EIKA 4RTUA 2AK5A 2LJ3A 1UGVA 4LUDA 2L3QA 2FO0A 3TSZA 2M51A 4HCKA 1KIKA 1M8MA 1UJYA 2SRCA 1WI7A 1M3CA 1GRIA 2FPFA 1GFCA 1GCPA 1UFFA 2A37A 2JMCA 2GTOA 2EVRA 4RTVA 5EC7A 1BK2A 1NLPC 1PRLC 5IHNA 1MV0B 1Z9QA 2K6DA 4ZNXA 4QT7A 1H92A 3SEMA 3U23A 1ZSGA 1MV3A 1E6GA 1AEYA 2J7IA 1N5ZA 4J9GA 2K3BA 3VS3A 3EHRA 1AZGB 2CSQA 1WXTA 1I07A 2JS2A 3M0RA 1EFNA 2YT6A 2EGAA 2EPDA 1T0HA 1UJ0A 1KSWA 2PNIA 3NMZC 3VS7A 1T0JA 2KT8A 1ABQA 4HVWA 4D8DA 1S1NA 1PKTA 2DX1A 1U06A 1KJWA 1WLPB 2CUBA 2EGCA 2EYYA 2RQVA 4OMPA 1K4US 3ULRB 5IXFA 2RPNA 1GCQC 2AKKA 2LQWA 4Z8AA 5GJVB 2DVJA 2LJ0A 4CC2A 1AWWA 3FJ5A 2V1QA 2QDLA 5FW9A 3VRYA 4RTZA 3KFVA 2KYMA 2JM9A 2KR3A 2PTKA 4HVUA 1YP5A 2J6OA 1JQQA 1ZUKA 2MOXA 3TVTA 4F14A 1WXUA 4AG2C 3M0TA 1PHTA 4CC3A 2FPDA 1JO8A 3NGPA 2KGTA 3UA6A 4JZ3A 1UE9A 3M0UA 3EG2A 1JEGA 4RTTA 5I11A 1PKSA 3QWYA 3RBBB 2GNCA 2JXBA 1NG2A 2D1XA 1SRLA 2LNHB 1X27A 3A98A 1ZUUA 3H0FA 1M30A 1SHGA 2KNBB 2OI3A 1H3HA 4J9HA 2MIOA 1V1CA 2J6KA 2HBWA 2DF6A 2HDAA 2O2OA 2JM8A 3CQTA 3NHNA 1PRMC 1RLQC 1QWFA 1X6BA 1YN8A 1W1FA 1HJDA 1QCFA 4AG1C 4AFUC 4LN2A 2AKLA 2CT3A 4M4ZA 1RI9A 1AD5A 1MUZA 1LCKA 1Z9ZA 1X2KA 2YDLA 2EQIA 3R6NA 2CT4A 3EG1A 3QWXX 1VYTA 2YUNA 1E7OA 3VS1A 3PVLA 2RQTA 2DNUA 2LZ6B 4J9BA 2L3SA 2HEQA 2KE9A 2EKHA 2GTJA 4OMQA 1K76A 2B86A 2FEIA 1ZUYA 1SRMA 1WYXA 1WA7A 1VYUA 2VVKA 3VRZA 1SSHA 2SEMA 1WIEA 3VS5A 1AVZC 1NEGA 2RF0A 1TG0A 4DEYA 1KFZA 1X6GA 1G83A 2A08A 1GFDA 2DBKA 2HSPA 2F2WA 3PVQA 1JU5C 1K0XA 1UUEA 4RTYA 1XOVA 2W10A 2K7AA 2K9GA 3REBB 2FRYA 4CC7A 2EW3A 4J9IA 2DRKA 1AZEA 2IIMA 2EYWA 3EG3A 1OEBA 3H41A 4IIMA 4J9FA 1GBQA 4J9CA 1TUCA 2KXCA 5I22A 1CKBA 2VWFA 2EYZA 3UATA 2CH4W 1UG1A 2L3PA 3I5SA 4CC4B 2LMJA 2NWMA 3VS2A 2A36A 1W70A 2A28A 2G6FX 2FPEA 4HXJA 1VYVA 2BTTA 1QKWA 2DYBA 2DA9A 2O31A 2LCSA 2BZ8A 4IIOA 3H0HA 1HD3A 5IXBA 1GL5A 5HCKA 3M0SA 1WFWA 4OMMA 1FMKA 1BU1A 1IO6A 2BZXA 1PWTA 1K1ZA 2H8HA 3TSWA 1UDLA 2DL7A 1ZBJA 4DEXA 2YUOA 2DMOA 2LJ1A 1TUDA 2LX7A 3PE0A 1QWEA 1NYGA 5IHKA 5FWCA 1X69A 2W0ZA 2O9SA 2V1RA 4JJCA 2DL5A 2E5KA 2L0AA 5FWBA 1WX6A 1A0NB 4Z89A 1AWJA 2JTEA 1FYNA 4JJDA 4AFQC 3VS6A 2CSIA 3IQLA 2P4RA 1WDXA 1YWPA 2RMOA 1ZX6A 2ECZA 4K11A 2DM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESW A;  2YSQ A;  4ORZ A;  2I0N A;  2RQW A;  3VS4 A;  2GGR A;  4LUE A;  1NYF A;  1J3T A;  2DIL A;  2XMF A;  2D8J A;  4LE9 A;  1OV3 A;  4GLM A;  4R0K A;  3RNJ A;  3UF4 A;  3M0Q A;  2RQU A;  4AFZ C;  1E6H A;  2RQR A;  2KYB A;  2KRO A;  4JPB W;  4OML A;  2JS0 A;  4OMN A;  1RUW A;  3VS0 A;  2RN8 A;  2DL8 A;  2ED1 A;  2KRN A;  2X3X D;  2GQI A;  1I0C A;  1VA7 A;  1YCS B;  1CKA A;  2J06 A;  1AWX A;  2EYX A;  2FG0 A;  1OPL A;  2ABL A;  4GBQ A;  1YWO A;  1ZLM A;  2F2V A;  1UTI A;  2DJQ A;  2C0I A;  2C0O A;  2FRW A;  1B07 A;  2J05 A;  3UA7 A;  2DL4 A;  2YUQ A;  4FSS A;  4LNP A;  2K79 A;  4KRT A;  1B3Q A;  2OAW A;  1GCQ A;  3I35 A;  1H8K A;  4Z88 A;  1W6X A;  3SHW A;  2CH4 A;  4HVV A;  2AZV A;  4D8K A;  2O88 A;  2C0T A;  4A63 B;  4RTX A;  1G2B A;  2BZY A;  2ROT A;  4JZ4 A;  3GBQ A;  1SPK A;  2DE0 X;  1CSK A;  1M3A A;  3LH5 A;  1Y0M A;  1Y57 A;  4RUG A;  5ECA A;  2HCK A;  2DLP A;  1I1J A;  2KT1 A;  1X2Q A;  2J6F A;  4WCI A;  2VKN A;  1SEM A;  2JT4 A;  3REA B;  1RLP C;  3EG0 A;  3I9Q A;  4Y92 A;  4F16 A;  2JMA A;  4J9E A;  3THK A;  2KBT A;  4X1V A;  4E6R A;  1U5S A;  2X3W D;  1BBZ A;  3I5R A;  2K2M A;  2ED0 A;  1GBR A;  1AWO A;  1SHF A;  3C0C A;  1HSQ A;  2M0Y A;  4RTW A;  4F17 A;  2LQN A;  2DRM A;  3NPF A;  2EGE A;  2O9V A;  2RNA A;  1T3S A;  1NEB A;  4OMO A;  1OOT A;  2KEA A;  4AFS C;  2NUZ A;  4ESR A;  1JXM A;  1U3O A;  2ENM A;  1AOJ A;  2LP5 A;  1X43 A;  2MCN A;  2KRS A;  1K0S A;  2L2P A;  3ZL7 C;  2KXD A;  2JW4 A;  1NM7 A;  1UHC A;  2D0N A;  4JJB A;  2YUP A;  1UHF A;  2EBP A;  1BB9 A;  2PZ1 A;  1K9A A;  3EHQ A;  5IH2 A;  2CDT A;  2ROL A;  1WXB A;  1ARK A;  1QKX A;  5L23 A;  5GJW B;  3M0P A;  2CRE A;  2AZS A;  1M3B A;  2CUD A;  1M27 C;  1NLO C;  2GBQ A;  1T3L A;  2D8H A;  3EGU A;  3H0I A;  2DL3 A;  2DBM A;  1QLY A;  5IHI A;  1UEC A;  1YNZ A;  2KRM A;  2OJ2 A;  3JV3 A;  1ABO A;  1OPK A;  1PNJ A;  1JXO A;  2F2X A;  3O5Z A;  4J9D A;  4EIK A;  4RTU A;  2AK5 A;  2LJ3 A;  1UGV A;  4LUD A;  2L3Q A;  2FO0 A;  3TSZ A;  2M51 A;  4HCK A;  1KIK A;  1M8M A;  1UJY A;  2SRC A;  1WI7 A;  1M3C A;  1GRI A;  2FPF A;  1GFC A;  1GCP A;  1UFF A;  2A37 A;  2JMC A;  2GTO A;  2EVR A;  4RTV A;  5EC7 A;  1BK2 A;  1NLP C;  1PRL C;  5IHN A;  1MV0 B;  1Z9Q A;  2K6D A;  4ZNX A;  4QT7 A;  1H92 A;  3SEM A;  3U23 A;  1ZSG A;  1MV3 A;  1E6G A;  1AEY A;  2J7I A;  1N5Z A;  4J9G A;  2K3B A;  3VS3 A;  3EHR A;  1AZG B;  2CSQ A;  1WXT A;  1I07 A;  2JS2 A;  3M0R A;  1EFN A;  2YT6 A;  2EGA A;  2EPD A;  1T0H A;  1UJ0 A;  1KSW A;  2PNI A;  3NMZ C;  3VS7 A;  1T0J A;  2KT8 A;  1ABQ A;  4HVW A;  4D8D A;  1S1N A;  1PKT A;  2DX1 A;  1U06 A;  1KJW A;  1WLP B;  2CUB A;  2EGC A;  2EYY A;  2RQV A;  4OMP A;  1K4U S;  3ULR B;  5IXF A;  2RPN A;  1GCQ C;  2AKK A;  2LQW A;  4Z8A A;  5GJV B;  2DVJ A;  2LJ0 A;  4CC2 A;  1AWW A;  3FJ5 A;  2V1Q A;  2QDL A;  5FW9 A;  3VRY A;  4RTZ A;  3KFV A;  2KYM A;  2JM9 A;  2KR3 A;  2PTK A;  4HVU A;  1YP5 A;  2J6O A;  1JQQ A;  1ZUK A;  2MOX A;  3TVT A;  4F14 A;  1WXU A;  4AG2 C;  3M0T A;  1PHT A;  4CC3 A;  2FPD A;  1JO8 A;  3NGP A;  2KGT A;  3UA6 A;  4JZ3 A;  1UE9 A;  3M0U A;  3EG2 A;  1JEG A;  4RTT A;  5I11 A;  1PKS A;  3QWY A;  3RBB B;  2GNC A;  2JXB A;  1NG2 A;  2D1X A;  1SRL A;  2LNH B;  1X27 A;  3A98 A;  1ZUU A;  3H0F A;  1M30 A;  1SHG A;  2KNB B;  2OI3 A;  1H3H A;  4J9H A;  2MIO A;  1V1C A;  2J6K A;  2HBW A;  2DF6 A;  2HDA A;  2O2O A;  2JM8 A;  3CQT A;  3NHN A;  1PRM C;  1RLQ C;  1QWF A;  1X6B A;  1YN8 A;  1W1F A;  1HJD A;  1QCF A;  4AG1 C;  4AFU C;  4LN2 A;  2AKL A;  2CT3 A;  4M4Z A;  1RI9 A;  1AD5 A;  1MUZ A;  1LCK A;  1Z9Z A;  1X2K A;  2YDL A;  2EQI A;  3R6N A;  2CT4 A;  3EG1 A;  3QWX X;  1VYT A;  2YUN A;  1E7O A;  3VS1 A;  3PVL A;  2RQT A;  2DNU A;  2LZ6 B;  4J9B A;  2L3S A;  2HEQ A;  2KE9 A;  2EKH A;  2GTJ A;  4OMQ A;  1K76 A;  2B86 A;  2FEI A;  1ZUY A;  1SRM A;  1WYX A;  1WA7 A;  1VYU A;  2VVK A;  3VRZ A;  1SSH A;  2SEM A;  1WIE A;  3VS5 A;  1AVZ C;  1NEG A;  2RF0 A;  1TG0 A;  4DEY A;  1KFZ A;  1X6G A;  1G83 A;  2A08 A;  1GFD A;  2DBK A;  2HSP A;  2F2W A;  3PVQ A;  1JU5 C;  1K0X A;  1UUE A;  4RTY A;  1XOV A;  2W10 A;  2K7A A;  2K9G A;  3REB B;  2FRY A;  4CC7 A;  2EW3 A;  4J9I A;  2DRK A;  1AZE A;  2IIM A;  2EYW A;  3EG3 A;  1OEB A;  3H41 A;  4IIM A;  4J9F A;  1GBQ A;  4J9C A;  1TUC A;  2KXC A;  5I22 A;  1CKB A;  2VWF A;  2EYZ A;  3UAT A;  2CH4 W;  1UG1 A;  2L3P A;  3I5S A;  4CC4 B;  2LMJ A;  2NWM A;  3VS2 A;  2A36 A;  1W70 A;  2A28 A;  2G6F X;  2FPE A;  4HXJ A;  1VYV A;  2BTT A;  1QKW A;  2DYB A;  2DA9 A;  2O31 A;  2LCS A;  2BZ8 A;  4IIO A;  3H0H A;  1HD3 A;  5IXB A;  1GL5 A;  5HCK A;  3M0S A;  1WFW A;  4OMM A;  1FMK A;  1BU1 A;  1IO6 A;  2BZX A;  1PWT A;  1K1Z A;  2H8H A;  3TSW A;  1UDL A;  2DL7 A;  1ZBJ A;  4DEX A;  2YUO A;  2DMO A;  2LJ1 A;  1TUD A;  2LX7 A;  3PE0 A;  1QWE A;  1NYG A;  5IHK A;  5FWC A;  1X69 A;  2W0Z A;  2O9S A;  2V1R A;  4JJC A;  2DL5 A;  2E5K A;  2L0A A;  5FWB A;  1WX6 A;  1A0N B;  4Z89 A;  1AWJ A;  2JTE A;  1FYN A;  4JJD A;  4AFQ C;  3VS6 A;  2CSI A;  3IQL A;  2P4R A;  1WDX A;  1YWP A;  2RMO A;  1ZX6 A;  2ECZ A;  4K11 A;  2DM1 A; 
#chains in the Genus database with same CATH topology
 2Y4X A;  2RI3 A;  2YSQ A;  3ME9 A;  1PC0 A;  3G71 Q;  2GGR A;  4PJO G;  1G5V A;  2XMF A;  2ZPI B;  2QQ9 A;  2CS7 A;  4GLM A;  4ME7 A;  2WSC E;  3RNJ A;  1MMD A;  1R8O B;  4C5E A;  1M2V A;  1VQ7 Q;  3NFC A;  3QKJ A;  1MGQ A;  4OML A;  3OW2 A;  3E1S A;  1RUW A;  3VS0 A;  2RN8 A;  3CME Q;  3S3M A;  2GQI A;  1I0C A;  1YCS B;  2CP5 A;  1CKA A;  2J06 A;  1YJ9 T;  2YRD A;  3JB9 D;  2KMT A;  1VIF A;  4GBQ A;  1YWO A;  1ZLM A;  5CKD A;  2FZK B;  3CCU T;  2OTL Q;  4J5Y A;  2C0O A;  2E70 A;  4PK4 A;  4M75 F;  2XI9 A;  3KXT A;  3UA7 A;  1M1K C;  2MWP A;  2DL4 A;  5CAI A;  2RHU A;  4FSS A;  3MCA B;  4LNP A;  2YLC A;  1WHJ A;  1BCO A;  2COW A;  3URG A;  1W6X A;  1OX9 A;  3SHW A;  2QQR A;  2XDB A;  1X75 C;  2AZV A;  2O88 A;  4BY6 B;  5LJ5 h;  2BZY A;  4DA4 A;  1M1K U;  3RR6 A;  4J6X A;  3JCM b;  3LH5 A;  4JRI A;  1YFN A;  4E7K A;  2DLP A;  2KT1 A;  1X2Q A;  4M77 E;  3DKM A;  1VQK Q;  3GPL A;  1M2V B;  2E6N A;  1NPR A;  2WAC A;  3I9Q A;  4RMO A;  3RDV A;  1ACM B;  4F16 A;  4J9E A;  3GNF B;  1YIJ Q;  1NBE B;  3LYI A;  5CKE A;  1U5S A;  1PM3 A;  5A2Q E;  2EJ9 A;  3I5R A;  3JCM J;  1GBR A;  1AWO A;  1YJW Q;  2QEX T;  3F70 A;  3OS0 A;  1WHL A;  3LWH A;  4KT0 E;  2K3X A;  2R57 A;  2LQN A;  5FRN A;  3CCJ T;  3JCM f;  5KCO A;  3G6E A;  3RER A;  1YI2 A;  1JXM A;  3OYG A;  3JCM Q;  3ZL7 C;  2KXD A;  1M90 R;  2BE7 D;  1AT1 B;  1UHC A;  1OYX A;  3V8K A;  1QW1 A;  2RD1 A;  4O6J A;  3MEV A;  2EBP A;  1WHG A;  3EHQ A;  2EFI A;  3WVE B;  1RI0 A;  5L23 A;  3QZ5 B;  4RCC A;  4BB7 A;  1PG5 B;  1ZHI A;  2AZS A;  2JOY A;  1M3B A;  4AMC A;  5D6Y A;  5GAN h;  1MHN A;  1VQ6 A;  1T3L A;  2GBQ A;  3JSC A;  4ZN3 A;  2QDY B;  5GAM e;  1D0X A;  1RAI B;  2DL3 A;  3Q1J A;  4QW2 A;  4WF2 A;  5IHI A;  6AT1 B;  5GAN 7;  2KRM A;  3CCV Q;  3CCQ Q;  5GAN d;  3HFN A;  1JXO A;  3O5Z A;  4RTU A;  2QQA A;  2LJ3 A;  4FW1 A;  1UGV A;  3HKS A;  3QII A;  4F04 B;  3CCE T;  4F7U E;  4C8Q A;  2LNV A;  1LPL A;  1M90 C;  1WI7 A;  4QKU A;  2E12 A;  3M4G A;  4A4G A;  2A37 A;  4BY6 C;  3OYE A;  2GTO A;  3UDC A;  5DY9 A;  1QVF S;  1BK2 A;  5IHN A;  3PT9 A;  2XID A;  3JB9 G;  3M57 A;  3SFM A;  3BFM A;  1M90 U;  2KI7 A;  1JJ2 S;  1U1T A;  4E47 A;  2I2L A;  4ZNX A;  1YJ9 A;  3M53 A;  4VUB A;  1AEY A;  3H9N A;  3G4S A;  3CCU A;  4E7S A;  4M78 D;  4ZGD B;  3CPW P;  1AZG B;  2JS2 A;  1EFN A;  2YT6 A;  3SDZ A;  5KYY B;  2EPD A;  3TCJ A;  1T0H A;  1KG1 A;  1UJ0 A;  2OTJ T;  1KSW A;  3FEO A;  4E7H A;  1T0J A;  4D8D A;  1WJR A;  3ZBD A;  3S3O A;  3O8V A;  4O5V A;  4OMP A;  1Q86 R;  4C8Q B;  3C94 A;  4PL6 A;  2KSS A;  2RHY A;  5GJV B;  4Z8A A;  2DVJ A;  2RJC A;  1IGU A;  1QVG S;  5CQY A;  4A53 A;  1B34 A;  2V1Q A;  3QG1 A;  3BE3 A;  5FW9 A;  1K9M R;  2EYQ A;  2KYM A;  4C0D B;  2PTK A;  4HVU A;  3PMI A;  3JCM V;  1PHT A;  3OYM A;  4CC3 A;  1TSF A;  3NGP A;  2KGT A;  4JZ3 A;  2QQB A;  3INZ A;  2E1H A;  3OMC A;  2CP6 A;  2QEX A;  1EZZ B;  3OS1 A;  3QWY A;  3MEU A;  2D1X A;  3A98 A;  1V29 B;  2JNG A;  3CCJ A;  4LDU A;  3H0F A;  4IUU A;  3L2U A;  1IRE B;  1Q95 G;  2KNB B;  1UGQ B;  1H3H A;  5C6S A;  4J9H A;  1WJS A;  1Q86 C;  4Q5W A;  2IPO B;  4IKF A;  4PJO F;  1X6B A;  1OZ3 A;  1YN8 A;  1W1F A;  4M75 E;  3OYD A;  1HJD A;  1QCF A;  1VQO T;  1K9M C;  4BDY A;  2AKL A;  2VAS A;  1Q86 U;  1B34 B;  4JLI A;  4M78 E;  4OGC A;  2CT4 A;  2CZ1 B;  3QWX X;  2HQH A;  1VYT A;  3VS1 A;  1K9M U;  2LZ6 B;  3G6E Q;  2L3S A;  1YI2 Q;  2DXB A;  3MO8 A;  2A7Y A;  2B86 A;  1TOV A;  2DTO A;  1ZUY A;  1SRM A;  2E4H A;  2EJF A;  1WIE A;  1KQS P;  4MZT A;  2PVO B;  5GAN e;  3JCM X;  2A0F B;  4DEY A;  2R58 A;  2ZPG B;  1IXD A;  4FW2 A;  4KBM B;  4A4H A;  1FXX A;  2DBK A;  2HSP A;  4JRK A;  1VQ9 A;  3RKW A;  1K0X A;  1UUE A;  2RJF A;  2K9G A;  3BDU A;  3REB B;  3DB3 A;  4C92 D;  4CC7 A;  2DRK A;  1AZE A;  3CEY A;  1GBQ A;  4J9F A;  3TQ7 P;  1NJI R;  2VWF A;  2Y4Y A;  4C0D C;  3I56 T;  3OYY A;  2MAM A;  2RB6 A;  1UG1 A;  5I2M A;  1QP2 A;  1RAE B;  1KC8 R;  2L3P A;  5KYW A;  2VXF A;  4OVA A;  5GAN 6;  1KD1 R;  4TVR A;  5LL6 S;  5IAY A;  3CXC S;  2DIG A;  2FHD A;  2NWM A;  2OTJ A;  1I5L A;  4HXJ A;  1H64 1;  1YJN T;  2F1L A;  4M77 A;  1WPY A;  4C0Z A;  2RHI A;  2LCS A;  4IIO A;  2NUP A;  1IGQ A;  1U8R A;  1YJ9 Q;  1TH7 A;  4M7D D;  1G3S A;  3JAM E;  3G4S Q;  3CCU Q;  4XTV A;  5HKC A;  2H8H A;  1NJI C;  5KYN A;  2DMO A;  2MWO A;  1OU8 A;  5FWC A;  2DEQ A;  2O9S A;  4XQ3 A;  4ELZ C;  1OI1 A;  1KD1 C;  2E5K A;  3E19 A;  2RHX A;  1NZ9 A;  2H3J A;  1Q7Y U;  1NJI U;  5KYW B;  4AFQ C;  3VUB A;  3IQL A;  2LRQ A;  2P4R A;  3NTK A;  1WDX A;  1KD1 U;  4JJN K;  2GFU A;  2ESW A;  4ORZ A;  4M77 B;  1Y07 A;  4FYX B;  3VS4 A;  4C92 E;  2VUB A;  4LUE A;  1NYF A;  2NUP B;  2D8J A;  4LE9 A;  1VQO A;  1OV3 A;  5GAN j;  4B9W A;  4R0K A;  2DEU A;  2F5K A;  2CP0 A;  3OYL A;  2FYK A;  1E6H A;  4A4F A;  3CPW A;  2QYZ A;  4XU1 A;  2KYB A;  3JB9 F;  4HCZ A;  1WJQ A;  4OMN A;  4KUL A;  2XHC A;  5CO7 A;  2ED1 A;  3CCJ Q;  1VA7 A;  2R5M A;  5A0D A;  4E7J A;  1AWX A;  2FG0 A;  5GMK j;  2ABL A;  4F7U A;  2F2V A;  1UTI A;  1BYM A;  4HT8 A;  4EMG A;  4E7Z A;  1YBY A;  2J05 A;  3GNG A;  5GAN f;  1KQ2 A;  3M9Q A;  2LT1 A;  2DXC A;  1B3Q A;  3MHX A;  2P0Q A;  4Z88 A;  1H8K A;  1K8A R;  2MMP A;  2C0T A;  3V8L A;  3A1P A;  1VQM T;  4C92 G;  1BI0 A;  2YRC A;  2EWN A;  2ROT A;  5DM7 R;  1D3B A;  4KH0 B;  1Y0M A;  5ECA A;  3OYH A;  2WSE E;  1Q81 R;  3LLR A;  2J6F A;  4B9X A;  3X28 B;  1Q82 R;  2VKN A;  1KHC A;  1SEM A;  4M7A D;  5LJ3 g;  2QAS A;  3I56 A;  4Y92 A;  3VYG A;  5GAN 2;  2VXE A;  5AYF A;  3X26 B;  2KBT A;  1M4Z A;  3DLM A;  4X1V A;  4PJO E;  4XU0 A;  1HXD A;  3M55 A;  5GMK i;  4F7U B;  4OMF B;  4EPC A;  1SHF A;  1IB8 A;  1VQ9 Q;  1VQN T;  4RTW A;  4F17 A;  4ZGJ B;  1YJN A;  4FSX A;  1K8A C;  4JS5 A;  4M7D G;  2RNA A;  2CZ0 B;  4Y91 A;  2KEA A;  4AFS C;  2NUZ A;  4ESR A;  1U3O A;  4P5N A;  1AOJ A;  2LC4 A;  3FRN A;  3LGL A;  2KRS A;  1K0S A;  2L2P A;  2JW4 A;  4JJB A;  1Q81 C;  3VUZ A;  1UHF A;  3CBO A;  5HY6 A;  2LQK A;  1K8A U;  1VQP T;  3QSU A;  2E41 A;  1Q82 C;  1WXB A;  1D3B B;  1ARK A;  2QK0 A;  2OTJ Q;  1KQS A;  4R55 A;  2X51 A;  1ZBX A;  3FIF A;  1UEB A;  2X9H A;  1Q81 U;  1NLO C;  5LJ3 d;  2COZ A;  2D8H A;  4MML A;  2LVM A;  1Q82 U;  3C12 A;  1PSE A;  1UEC A;  3JV3 A;  1R0B G;  4M75 A;  1SSF A;  1PNJ A;  4ZN1 A;  5D7U A;  2AK5 A;  4LUD A;  4N4H A;  3CC7 T;  2M51 A;  1KIK A;  2XU8 A;  3QXE B;  1C6V X;  2SRC A;  3TEE A;  5A0G A;  1M3C A;  4C5I A;  2EIF A;  3EAE A;  2FPF A;  1UFF A;  3HRS A;  2FZC B;  1YHQ T;  1UGP B;  5IN1 A;  1BCM A;  1NLP C;  4BE1 A;  1NE8 A;  1MV0 B;  1Z9Q A;  5CKB A;  2K6D A;  3WVD B;  2DK3 A;  4QT7 A;  1M8V A;  4M78 F;  3SEM A;  1MV3 A;  4FYV B;  4ANJ A;  2L8D A;  1WGS A;  5A0L A;  3VS3 A;  3HSB A;  2QTX A;  3EHR A;  1VQ4 T;  1WXT A;  4JUV A;  2EGA A;  1VQO Q;  4IUV A;  3X20 B;  3OBY A;  4M75 B;  4HT9 A;  4OB2 B;  2QI2 A;  1ABQ A;  1YIT T;  1PKT A;  3E2U A;  5GMK m;  1KJW A;  1WLP B;  2RA2 A;  2CUB A;  3JCM W;  2EGC A;  3CC2 A;  4E2F B;  4FU6 A;  4QVZ A;  4FT2 A;  5IXF A;  1ZSZ A;  2DVE A;  2LQW A;  1D0Y A;  2LJ0 A;  4M7A G;  1AWW A;  3FJ5 A;  2ZAE A;  2QDL A;  4BI8 B;  4XK8 E;  3OW2 S;  3KFV A;  2JM9 A;  3TU4 K;  5GAO p;  1JQQ A;  3SD4 A;  3S3N A;  4F14 A;  1WXU A;  1JO8 A;  3L2V A;  2EQJ A;  3UA6 A;  3M0U A;  3OQ5 A;  2CKK A;  5GMK l;  4R56 A;  4OF1 A;  1KQ1 A;  1PKS A;  2JXB A;  1D0Z A;  2LNH B;  1X27 A;  4JRP A;  3A8O B;  1ZUU A;  2AHJ B;  3OMG A;  1M30 A;  3FLG A;  2OI3 A;  4PJJ A;  1V1C A;  2RM4 A;  2HBW A;  2O2O A;  5GAN 3;  3I55 Q;  2JM8 A;  5CR2 A;  3I56 Q;  3NHN A;  1MND A;  2MI6 A;  1QWF A;  4FM4 B;  2E3I A;  5KYY A;  1VQP A;  1ZSZ B;  1O75 A;  4CRI A;  4AG1 C;  3VU3 C;  4LN2 A;  2BIV A;  2E3H A;  1AD5 A;  1MUZ A;  2HL3 A;  1XTD A;  4FYW B;  2CYZ B;  2JVV A;  1X2K A;  5GMK h;  2P0P A;  3CCL T;  4KUD K;  1YJN Q;  3JRZ A;  2EQI A;  3EG1 A;  2GQV A;  2HZY A;  5GAN 8;  4C0G A;  2HNI A;  2RQT A;  4X9C A;  2DNU A;  2KE9 A;  4IUQ A;  1MMN A;  1WQW A;  1WYX A;  3A5Z B;  3CC4 T;  2VVK A;  4PFZ A;  3BY7 A;  3VRZ A;  2SEM A;  3VS5 A;  2K57 A;  1D1C A;  3CCR T;  2EKO A;  1NEG A;  3ZEH A;  3CC7 A;  1TG0 A;  2DIQ A;  4M75 C;  1KFZ A;  1X6G A;  1G83 A;  1QMC A;  3H6Z A;  1VQ5 T;  2M0O A;  2X35 A;  2YWW A;  4C92 F;  1YHQ A;  5IT9 E;  3KBG A;  3P8H A;  4M78 C;  5GAO q;  4KGZ B;  1R77 A;  1QCN A;  2ZPE B;  1ZQ1 A;  2FRY A;  2JUF A;  4J9I A;  2GFA A;  3HFO A;  2DXU A;  3EG3 A;  3H41 A;  1X01 A;  4X9D A;  3GLX A;  4J9C A;  4KH1 B;  2QGF B;  4PLI A;  2XDD A;  3CCM T;  4A4E A;  1CKB A;  2M16 A;  1EX4 A;  4MZP A;  2EJG A;  2EYZ A;  1PD0 A;  3UAT A;  1QVP A;  3UT1 A;  2F69 A;  1I5O B;  2LTO A;  4WTO B;  1VQ4 A;  4CC4 B;  4BD3 A;  3OYN A;  2VGN A;  2QA4 T;  3CPF A;  1W70 A;  1RAA B;  5KE3 A;  3MET A;  4M7D F;  1YCY A;  4OP0 A;  4IUP A;  1FX7 A;  2DA9 A;  2PUK B;  9ATC B;  1ZA1 B;  5IXB A;  5HCK A;  1ZA2 B;  5C0M A;  5HK3 A;  4PJN A;  4PJO A;  5GAN 4;  2A3L A;  4GLK A;  1BKB A;  4J6Y A;  1IO6 A;  1PWT A;  2DZ9 A;  3DB4 A;  1UDL A;  1ZSZ C;  3NTH A;  3MP6 A;  4FIB A;  1QWE A;  2Y90 A;  1NYG A;  1X69 A;  2W0Z A;  8AT1 B;  2DL5 A;  3CC2 Q;  5GAN 5;  3N5B B;  3OSS C;  4Z89 A;  3OYB A;  4EMK A;  3VS6 A;  1YWP A;  3X24 B;  1ZX6 A;  4QQ6 A;  3CD6 T;  2QXF A;  5LJ3 j;  2DET A;  2RQW A;  3M58 A;  4Z02 A;  2PUO B;  2PVG B;  1QQJ A;  4PFO A;  3RIR A;  4JS4 A;  4OB1 B;  2RQU A;  4AFZ C;  4PJO B;  3KUF A;  4ZTF A;  3JCM g;  4JPB W;  1G3W A;  3CCL A;  3C4S A;  3GOX A;  1I4K 1;  1W2B A;  2X3X D;  3CCE A;  2DYI A;  2DXT A;  2E65 A;  1TTH B;  2RHZ A;  2DJQ A;  1VQ6 Q;  2C0I A;  1VOM A;  1B07 A;  3QYG B;  2RJE A;  3CC4 A;  1WHK A;  4MZM A;  4DBR A;  5GMK e;  1VQP Q;  2YLB A;  2E6Z A;  2HAX A;  3OYC A;  4C92 C;  1TU0 B;  2K79 A;  4EMK B;  2OAW A;  1GCQ A;  1LOJ A;  2CH4 A;  4HVV A;  3UPU A;  3OYI A;  2ZPH B;  1VQ5 A;  4A63 B;  3FDR A;  2E5Q A;  4C8Q D;  4JZ4 A;  3GBQ A;  1SPK A;  2DE0 X;  1LNX A;  1Y57 A;  4RUG A;  4M7A F;  2QG9 B;  1I1J A;  2LCL A;  4QQD A;  3CCM A;  2L3R A;  2HSE B;  1OQK A;  3JCM d;  4II1 A;  4KGX B;  4MDW A;  2JMA A;  2RJD A;  2PVD B;  2DFU A;  3MP1 A;  4NL2 A;  1P92 A;  4E6R A;  3CCV T;  3CCQ T;  4M7D C;  1DJ7 B;  2ED0 A;  2QA4 A;  1HSQ A;  2M0Y A;  1TWB A;  2L5Q A;  2HBP A;  2P0K A;  4XU2 A;  2O9V A;  1LVK A;  3HL8 A;  3LWI A;  4XTY A;  3M56 A;  1OOT A;  4OMO A;  5J3B A;  4LD6 A;  4XTU A;  1KC8 C;  2LP5 A;  5FRM A;  1FMV A;  3MJX A;  1NM7 A;  1IHV A;  2D0N A;  1BI2 A;  2YUP A;  3X25 B;  2DTH A;  1BB9 A;  2PZ1 A;  1K9A A;  4HKE A;  1D09 B;  3CBM A;  1VQ4 Q;  2D0Q B;  2ROL A;  5GJW B;  1M5Q 1;  1KC8 U;  3LX7 A;  4J8O A;  3M0P A;  5KCH A;  4PJO C;  4D6W A;  5M9O A;  2CUD A;  2DJZ A;  1RAF B;  3FJP A;  2DPP B;  4JLG A;  3AHU A;  1XJW B;  2LDM A;  1S72 T;  3QJY A;  1YNZ A;  1QVF P;  1ABO A;  1OPK A;  2VYT A;  5CKH A;  2CZ6 B;  3ER0 A;  2QEX Q;  4J9D A;  3CD6 A;  4EIK A;  3OYF A;  2QGG A;  1JJ2 P;  4EMH A;  2X4J A;  2MPX C;  5KYU A;  1WQ7 A;  3ZFJ A;  5I21 A;  1M8M A;  4LDW A;  4EMK C;  5J26 A;  3GP8 A;  4DBF A;  3QHS A;  1GCP A;  2JMC A;  4BE2 A;  1RL2 A;  2EVR A;  4RTV A;  1OUL A;  5EC7 A;  3EFS A;  1PRL C;  5HK0 A;  3T9N A;  1BIB A;  4M7D E;  5DLO A;  3OBW A;  1H92 A;  4N0A C;  2K5I A;  3CCS T;  3AT1 B;  1ZSG A;  2JTM A;  4FYY B;  4OGE A;  4J9G A;  3L2W A;  1QVG P;  3M0R A;  3V8J A;  4BI4 A;  4DBH A;  5GAM g;  2X4X A;  2PNI A;  3NMZ C;  3VS7 A;  4HVW A;  5CK9 A;  4C8Q G;  4QQG A;  1F1B B;  2EAY A;  3CCE Q;  5KYU B;  2L89 A;  1H3Z A;  1W4S A;  1GCQ C;  3R6O A;  2AKK A;  4ZGE B;  3CPW S;  2JN0 A;  4NL3 A;  1XNI A;  3VRY A;  4RTZ A;  4B6M A;  3CC4 Q;  2KR3 A;  4E7L A;  3FC3 A;  2J6O A;  1BI3 A;  4FT4 A;  2V8J A;  2MOX A;  3M0T A;  3G6E T;  4N4G A;  3CCV A;  5GAO m;  1UE9 A;  1QP3 A;  3EG2 A;  3M5A A;  1JEG A;  3QYH B;  4RTT A;  1O9S A;  5I11 A;  3RBB B;  1SRL A;  4JRQ A;  5LJ3 h;  2P84 A;  2E10 A;  5GAM d;  1SHG A;  3CCM Q;  5CVI A;  1KHI A;  2MIO A;  4DOV A;  2J6K A;  2DF6 A;  2HDA A;  2ATC B;  4M77 D;  4LDV A;  2QAZ A;  1WHM A;  1FMW A;  4AFU C;  3RKY A;  2CT3 A;  2QA4 Q;  3L1A A;  1LCK A;  1N8R R;  3OY9 A;  2YDL A;  1HK9 A;  4QVD A;  1VQ8 T;  4DQ2 A;  1MMA A;  3R6N A;  4L5G A;  3RMQ A;  1SF9 A;  3ASK A;  2YUN A;  4M78 A;  7AT1 B;  2FL7 A;  3JB9 J;  1K73 R;  1S72 A;  2EKH A;  2GTJ A;  1C1A A;  5LJ5 g;  3OYA A;  1NPP A;  2FEI A;  4M7A E;  2LX9 A;  1SSH A;  4PJM A;  1AVZ C;  2RF0 A;  2CGH A;  1D1B A;  3EFO A;  5CQX A;  1TXQ A;  2RO0 A;  2QTV A;  3L2Z A;  4V2S A;  3J81 E;  2F2W A;  3G4S T;  1KK7 A;  3CXC P;  2W10 A;  3EH1 A;  1N6A A;  1N8R C;  3QJ6 A;  4L6V 5;  4IIM A;  4XU3 A;  1KQS S;  8ATC B;  1W2B P;  2KXC A;  4UC4 A;  3CCS A;  3CD6 Q;  3CMA T;  3TRE A;  1K73 C;  1BIA A;  1VQM A;  2D9T A;  4M78 B;  5KE2 A;  2V8K A;  2LT4 A;  1N8R U;  3I5S A;  4QVC A;  2LMJ A;  3MKD A;  2VB6 A;  5LJ5 d;  3OSV A;  5FU6 C;  2CP2 A;  1WHH A;  3RKX A;  3EGX A;  1K73 U;  3HHT B;  1QKW A;  5CKF A;  3QDF A;  4LDY A;  2K2V A;  3V7R A;  1RAB B;  1VQL T;  3EFO B;  4ELY C;  1HD3 A;  1GL5 A;  1G8X A;  2R5A A;  2RK1 A;  3M0S A;  1M2O A;  2HMA A;  5GAN g;  2OAU A;  1WFW A;  3OB9 A;  1I8F A;  3WXM B;  4PJL A;  1VQN A;  2D6F A;  4N4I A;  3M59 A;  1QVF A;  1JBM A;  1RAG B;  2MK5 A;  2GCX A;  3OS5 A;  2YUO A;  1TUD A;  3BDL A;  3RES A;  4ATO A;  4BAC A;  1JJ2 A;  4XTZ A;  2MYS A;  5IHK A;  3E9G A;  4JJC A;  3HRU A;  5CCA A;  2L0A A;  4AT1 B;  3GIB A;  2JZ2 A;  4KUI A;  4HCC A;  2CSI A;  4BE0 A;  4M77 G;  1UGR B;  2RMO A;  2ECZ A;  4K11 A;  2DM1 A;  1AHJ B;  3S6W A;  2I0N A;  2O01 E;  3EGX B;  1UGS B;  2ZPF B;  1G3T A;  1N9R A;  1J3T A;  3MP8 A;  2DIL A;  2P4T A;  2VV5 A;  4C92 A;  4C0F A;  4HCB A;  3UF4 A;  4LDX A;  3VYH B;  5LJ3 e;  2DZC A;  3M0Q A;  2RQR A;  1QVG A;  2KRO A;  2E64 A;  2JS0 A;  3A8G B;  1VQ8 A;  2DL8 A;  2KRN A;  2XKO C;  2EYX A;  1SG5 A;  1OPL A;  4LD9 K;  1PD1 A;  3EGD A;  4X34 A;  1VQ9 T;  2DAQ A;  2FRW A;  4HA8 A;  3RUX A;  5FU7 B;  2YUQ A;  3H8Z A;  3PFS A;  4PFP A;  4KRT A;  3I35 A;  4M75 D;  4M7D A;  4C8Q F;  4D8K A;  3BW1 A;  5FLX E;  4RTX A;  1G2B A;  4RG8 A;  1M9S A;  2V8I A;  4FCY A;  1CSK A;  1M3A A;  4C92 B;  1S72 Q;  3G7Z A;  2HCK A;  2HKN A;  3HRT A;  4WCI A;  5EG2 A;  4PKC C;  3PIP A;  3C95 A;  3D7S B;  2JT4 A;  2XG8 D;  1RLP C;  4YTL A;  3REA B;  3OYK A;  2YXY A;  3EG0 A;  3CMA A;  1YIT A;  3PGG A;  3G71 T;  4A4K A;  4F7U G;  4CI0 C;  3THK A;  2X3W D;  1BBZ A;  5CIU A;  2K2M A;  1RAC B;  1VQ7 T;  3EGD B;  3C0C A;  2C06 A;  1U1S A;  5KYX A;  3PTA A;  2OX7 A;  2DRM A;  2JTF A;  2LCC A;  3NPF A;  3CME T;  1R0C B;  2EGE A;  3JCM P;  5LJ5 e;  4J83 A;  3SB2 A;  1T3S A;  1NEB A;  2PQW A;  5D6X A;  1VQL A;  2K5F A;  2ENM A;  4M7D B;  3CCS Q;  3V7S A;  1X43 A;  4XTX A;  2MCN A;  4NOY A;  2OTL T;  2VC8 A;  2B8A A;  2AT1 B;  1FWZ A;  3QDR B;  5GAO r;  1VQM Q;  1B7T A;  1X6O A;  3MEW A;  2MF2 A;  5IH2 A;  2CDT A;  4RKU E;  2ZPB B;  5I2S A;  1QKX A;  5GAM j;  1M1F A;  2BKD N;  3FB9 A;  2CRE A;  4A54 A;  2KY9 A;  5J39 A;  1M27 C;  3EGU A;  3H0I A;  1BI1 A;  2Z0W A;  3QBY A;  2HD0 A;  2DBM A;  1QLY A;  2M1H A;  3HP9 A;  1IRX A;  2OJ2 A;  4BUG A;  4DBQ A;  2HL5 C;  4L59 A;  4N0A A;  5DLQ E;  1VQK T;  3CXC A;  1Y96 A;  4J7F A;  2F2X A;  1JB0 E;  2IG0 A;  1RAH B;  5KYX B;  1QCO A;  3HTR A;  1VQN Q;  2RK2 A;  5FU7 C;  5GAM f;  2HQX A;  2L3Q A;  2CP3 A;  2FO0 A;  2V26 A;  4HCK A;  3TSZ A;  1YIJ T;  3MPU B;  1UJY A;  1I81 A;  2K5L A;  2BE9 B;  3LW5 E;  4IUR A;  1GRI A;  5LJ3 f;  2DD5 A;  1GFC A;  1YJW T;  1WZO A;  2DTI A;  3HPW A;  4C5G A;  2NUT A;  2RI2 A;  2NYS A;  3J80 E;  2ZGW A;  4M7A A;  1D1A A;  1N9S A;  3OA6 A;  3CCR A;  3QO3 A;  3MEA A;  3VJP A;  1TS9 A;  3L42 A;  3U23 A;  2ZZD A;  3OS2 A;  4GY5 A;  3L2R A;  1E6G A;  2RI5 A;  2J7I A;  2M9U A;  1N5Z A;  2XK0 A;  1EIF A;  2WSF E;  2NLU A;  2LQ8 A;  4E7I A;  2DKG A;  2K3B A;  3JCM h;  3PIO A;  4M75 G;  4C8Q C;  2CSQ A;  1I07 A;  1OZ2 A;  3V7C A;  3OW2 P;  3A8H B;  2K3Y A;  3G1J A;  1Y96 B;  3A8M B;  2KT8 A;  1Q7Y R;  1S1N A;  2HQE A;  3I55 T;  4M78 G;  4J7I A;  1LJO A;  3EFR A;  2PU9 B;  2DX1 A;  1U06 A;  1VQ8 Q;  2EYY A;  1Y7X A;  2RQV A;  1K4U S;  3ULR B;  1G3Y A;  3CC7 Q;  3M54 A;  4BDZ A;  2RPN A;  1PCX A;  3SWN A;  3P8D A;  4OB0 B;  2XIC A;  5LJ5 j;  3PMT A;  2H3E B;  3EG9 A;  4CC2 A;  2KVQ G;  1YHQ Q;  2NUT B;  1W2B S;  1YP5 A;  4M7A B;  2HKQ B;  3M4Y A;  3G71 A;  1ZUK A;  3TVT A;  4AG2 C;  4RG2 A;  2AIR B;  2G3R A;  2FPD A;  3PNW C;  3E9F A;  1VQ7 A;  4NS5 A;  2EQU A;  1M1G A;  2GNC A;  1NG2 A;  4XAX B;  2JJ9 A;  5LJ5 f;  3CME A;  5KH6 A;  1Q7Y C;  4M77 F;  4RCB A;  1GXI E;  4C5H A;  3CMA Q;  3JB9 H;  1YIT Q;  2OTL A;  3CQT A;  2BUD A;  2DER A;  2X4W A;  4LXC A;  1PRM C;  1RLQ C;  3OYJ A;  4ZTJ A;  1VIE A;  2EQM A;  3QPH A;  3CBP A;  5FRO A;  3SWN B;  2KAF A;  3EG9 B;  4M4Z A;  4PJO D;  1RI9 A;  1Z9Z A;  4PNO A;  4C8Q E;  1E7O A;  3PVL A;  1SKU B;  4J9B A;  1PSF A;  1VQL Q;  2HEQ A;  2XD0 A;  1MMG A;  4OMQ A;  1K76 A;  2K4Y A;  1VQK A;  2M02 A;  1WA7 A;  1VYU A;  2GF7 A;  1RAD B;  2DD4 A;  2O4X A;  3EH2 A;  2FZG B;  3LH0 A;  1YIJ A;  5AT1 B;  1OU9 A;  4JDS A;  2YRV A;  2VGM A;  2A08 A;  1GFD A;  3A8L B;  1N27 A;  1YJW A;  4XTW A;  3PVQ A;  1JU5 C;  3GF5 A;  4RTY A;  1XOV A;  4Y28 E;  3DLL A;  2XDP A;  2K7A A;  3VKI A;  2EW3 A;  2CZ7 B;  2IIM A;  2EYW A;  1VUB A;  1OEB A;  1TUC A;  1OX8 A;  5I22 A;  4MDX A;  1IHW A;  4DOW A;  4IUT A;  4BI3 A;  3CCL Q;  2X4Y A;  4F7U F;  4M7A C;  2CH4 W;  2CP7 A;  3CC2 T;  2COY A;  3J7A F;  2KQW A;  5L8R E;  2KDS A;  4KGV B;  3NTI A;  3JB9 I;  1XQH A;  2FVU A;  4MMK A;  1UB4 A;  3VS2 A;  2A36 A;  2KK4 A;  2A28 A;  3RMS A;  2G6F X;  2FPE A;  1VYV A;  2RH2 A;  2BTT A;  3I55 A;  2DO3 A;  2YHT A;  3VV0 A;  2DYB A;  1C0M A;  1JRI A;  2O31 A;  3CCR Q;  2BZ8 A;  2O4X B;  2IVW A;  3H0H A;  2F5T X;  2ZCF B;  3JCM e;  1YI2 T;  5D6W A;  3P8B B;  3CCQ A;  1VQ5 Q;  4OMM A;  1FMK A;  2EQK A;  1BU1 A;  3LGF A;  5FU6 B;  5GAM h;  1HYO A;  2FB7 A;  2BZX A;  1WNL A;  1K1Z A;  4OB3 B;  3TSW A;  2QQS A;  1V76 A;  1Y71 A;  2DL7 A;  1ZBJ A;  3SWN C;  4DEX A;  2LJ1 A;  3QZ9 B;  2LX7 A;  5GAO n;  3PE0 A;  2V1R A;  3QUI A;  3UWN A;  1VQ6 T;  4M77 C;  4J6W A;  1IZ6 A;  5FWB A;  1WX6 A;  1A0N B;  1MNE A;  1AWJ A;  2JTE A;  1FYN A;  4PLL A;  3L2Q A;  4JJD A;  1TUG B;  3JCM c;  4EDU A;  1M1K R;  4FL6 A;  5GAO l; 
#chains in the Genus database with same CATH homology
 2ESW A;  2YSQ A;  4ORZ A;  2I0N A;  2RQW A;  3VS4 A;  2GGR A;  4LUE A;  1NYF A;  1J3T A;  2DIL A;  2XMF A;  2D8J A;  4LE9 A;  1OV3 A;  4GLM A;  4R0K A;  3RNJ A;  3UF4 A;  3M0Q A;  2RQU A;  4AFZ C;  1E6H A;  2RQR A;  2KYB A;  2KRO A;  4JPB W;  4OML A;  2JS0 A;  4OMN A;  1RUW A;  3VS0 A;  2RN8 A;  2DL8 A;  2ED1 A;  2KRN A;  2X3X D;  2GQI A;  1I0C A;  1VA7 A;  1YCS B;  1CKA A;  2J06 A;  1AWX A;  2EYX A;  2FG0 A;  1OPL A;  2ABL A;  4GBQ A;  1YWO A;  1ZLM A;  2F2V A;  1UTI A;  2DJQ A;  2C0I A;  2C0O A;  2FRW A;  1B07 A;  2J05 A;  3UA7 A;  2DL4 A;  2YUQ A;  4FSS A;  4LNP A;  2K79 A;  4KRT A;  1B3Q A;  2OAW A;  1GCQ A;  3I35 A;  1H8K A;  4Z88 A;  1W6X A;  3SHW A;  2CH4 A;  4HVV A;  2AZV A;  4D8K A;  2O88 A;  2C0T A;  4A63 B;  4RTX A;  1G2B A;  2BZY A;  2ROT A;  4JZ4 A;  3GBQ A;  1SPK A;  2DE0 X;  1CSK A;  1M3A A;  3LH5 A;  1Y0M A;  1Y57 A;  4RUG A;  5ECA A;  2HCK A;  2DLP A;  1I1J A;  2KT1 A;  1X2Q A;  2J6F A;  4WCI A;  2VKN A;  1SEM A;  2JT4 A;  3REA B;  1RLP C;  3EG0 A;  3I9Q A;  4Y92 A;  4F16 A;  2JMA A;  4J9E A;  3THK A;  2KBT A;  4X1V A;  4E6R A;  1U5S A;  2X3W D;  1BBZ A;  3I5R A;  2K2M A;  2ED0 A;  1GBR A;  1AWO A;  1SHF A;  3C0C A;  1HSQ A;  2M0Y A;  4RTW A;  4F17 A;  2LQN A;  2DRM A;  3NPF A;  2EGE A;  2O9V A;  2RNA A;  1T3S A;  1NEB A;  4OMO A;  1OOT A;  2KEA A;  4AFS C;  2NUZ A;  4ESR A;  1JXM A;  1U3O A;  2ENM A;  1AOJ A;  2LP5 A;  1X43 A;  2MCN A;  2KRS A;  1K0S A;  2L2P A;  3ZL7 C;  2KXD A;  2JW4 A;  1NM7 A;  1UHC A;  2D0N A;  4JJB A;  2YUP A;  1UHF A;  2EBP A;  1BB9 A;  2PZ1 A;  1K9A A;  3EHQ A;  5IH2 A;  2CDT A;  2ROL A;  1WXB A;  1ARK A;  1QKX A;  5L23 A;  5GJW B;  3M0P A;  2CRE A;  2AZS A;  1M3B A;  2CUD A;  1M27 C;  1NLO C;  2GBQ A;  1T3L A;  2D8H A;  3EGU A;  3H0I A;  2DL3 A;  2DBM A;  1QLY A;  5IHI A;  1UEC A;  1YNZ A;  2KRM A;  2OJ2 A;  3JV3 A;  1ABO A;  1OPK A;  1PNJ A;  1JXO A;  2F2X A;  3O5Z A;  4J9D A;  4EIK A;  4RTU A;  2AK5 A;  2LJ3 A;  1UGV A;  4LUD A;  2L3Q A;  2FO0 A;  3TSZ A;  2M51 A;  4HCK A;  1KIK A;  1M8M A;  1UJY A;  2SRC A;  1WI7 A;  1M3C A;  1GRI A;  2FPF A;  1GFC A;  1GCP A;  1UFF A;  2A37 A;  2JMC A;  2GTO A;  2EVR A;  4RTV A;  5EC7 A;  1BK2 A;  1NLP C;  1PRL C;  5IHN A;  1MV0 B;  1Z9Q A;  2K6D A;  4ZNX A;  4QT7 A;  1H92 A;  3SEM A;  3U23 A;  1ZSG A;  1MV3 A;  1E6G A;  1AEY A;  2J7I A;  1N5Z A;  4J9G A;  2K3B A;  3VS3 A;  3EHR A;  1AZG B;  2CSQ A;  1WXT A;  1I07 A;  2JS2 A;  3M0R A;  1EFN A;  2YT6 A;  2EGA A;  2EPD A;  1T0H A;  1UJ0 A;  1KSW A;  2PNI A;  3NMZ C;  3VS7 A;  1T0J A;  2KT8 A;  1ABQ A;  4HVW A;  4D8D A;  1S1N A;  1PKT A;  2DX1 A;  1U06 A;  1KJW A;  1WLP B;  2CUB A;  2EGC A;  2EYY A;  2RQV A;  4OMP A;  1K4U S;  3ULR B;  5IXF A;  2RPN A;  1GCQ C;  2AKK A;  2LQW A;  4Z8A A;  5GJV B;  2DVJ A;  2LJ0 A;  4CC2 A;  1AWW A;  3FJ5 A;  2V1Q A;  2QDL A;  5FW9 A;  3VRY A;  4RTZ A;  3KFV A;  2KYM A;  2JM9 A;  2KR3 A;  2PTK A;  4HVU A;  1YP5 A;  2J6O A;  1JQQ A;  1ZUK A;  2MOX A;  3TVT A;  4F14 A;  1WXU A;  4AG2 C;  3M0T A;  1PHT A;  4CC3 A;  2FPD A;  1JO8 A;  3NGP A;  2KGT A;  3UA6 A;  4JZ3 A;  1UE9 A;  3M0U A;  3EG2 A;  1JEG A;  4RTT A;  5I11 A;  1PKS A;  3QWY A;  3RBB B;  2GNC A;  2JXB A;  1NG2 A;  2D1X A;  1SRL A;  2LNH B;  1X27 A;  3A98 A;  1ZUU A;  3H0F A;  1M30 A;  1SHG A;  2KNB B;  2OI3 A;  1H3H A;  4J9H A;  2MIO A;  1V1C A;  2J6K A;  2HBW A;  2DF6 A;  2HDA A;  2O2O A;  2JM8 A;  3CQT A;  3NHN A;  1PRM C;  1RLQ C;  1QWF A;  1X6B A;  1YN8 A;  1W1F A;  1HJD A;  1QCF A;  4AG1 C;  4AFU C;  4LN2 A;  2AKL A;  2CT3 A;  4M4Z A;  1RI9 A;  1AD5 A;  1MUZ A;  1LCK A;  1Z9Z A;  1X2K A;  2YDL A;  2EQI A;  3R6N A;  2CT4 A;  3EG1 A;  3QWX X;  1VYT A;  2YUN A;  1E7O A;  3VS1 A;  3PVL A;  2RQT A;  2DNU A;  2LZ6 B;  4J9B A;  2L3S A;  2HEQ A;  2KE9 A;  2EKH A;  2GTJ A;  4OMQ A;  1K76 A;  2B86 A;  2FEI A;  1ZUY A;  1SRM A;  1WYX A;  1WA7 A;  1VYU A;  2VVK A;  3VRZ A;  1SSH A;  2SEM A;  1WIE A;  3VS5 A;  1AVZ C;  1NEG A;  2RF0 A;  1TG0 A;  4DEY A;  1KFZ A;  1X6G A;  1G83 A;  2A08 A;  1GFD A;  2DBK A;  2HSP A;  2F2W A;  3PVQ A;  1JU5 C;  1K0X A;  1UUE A;  4RTY A;  1XOV A;  2W10 A;  2K7A A;  2K9G A;  3REB B;  2FRY A;  4CC7 A;  2EW3 A;  4J9I A;  2DRK A;  1AZE A;  2IIM A;  2EYW A;  3EG3 A;  1OEB A;  3H41 A;  4IIM A;  4J9F A;  1GBQ A;  4J9C A;  1TUC A;  2KXC A;  5I22 A;  1CKB A;  2VWF A;  2EYZ A;  3UAT A;  2CH4 W;  1UG1 A;  2L3P A;  3I5S A;  4CC4 B;  2LMJ A;  2NWM A;  3VS2 A;  2A36 A;  1W70 A;  2A28 A;  2G6F X;  2FPE A;  4HXJ A;  1VYV A;  2BTT A;  1QKW A;  2DYB A;  2DA9 A;  2O31 A;  2LCS A;  2BZ8 A;  4IIO A;  3H0H A;  1HD3 A;  5IXB A;  1GL5 A;  5HCK A;  3M0S A;  1WFW A;  4OMM A;  1FMK A;  1BU1 A;  1IO6 A;  2BZX A;  1PWT A;  1K1Z A;  2H8H A;  3TSW A;  1UDL A;  2DL7 A;  1ZBJ A;  4DEX A;  2YUO A;  2DMO A;  2LJ1 A;  1TUD A;  2LX7 A;  3PE0 A;  1QWE A;  1NYG A;  5IHK A;  5FWC A;  1X69 A;  2W0Z A;  2O9S A;  2V1R A;  4JJC A;  2DL5 A;  2E5K A;  2L0A A;  5FWB A;  1WX6 A;  1A0N B;  4Z89 A;  1AWJ A;  2JTE A;  1FYN A;  4JJD A;  4AFQ C;  3VS6 A;  2CSI A;  3IQL A;  2P4R A;  1WDX A;  1YWP A;  2RMO A;  1ZX6 A;  2ECZ A;  4K11 A;  2DM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...