3MEUA

Crystal structure of sgf29 in complex with h3r2me2sk4me3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
175
structure length
175
Chain Sequence
GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3meuA02
1RI0A 3OYFA 4BACA 4ZTJA 3OYCA 4IKFA 2R58A 5KE2A 4E7LA 2RHXA 2R57A 2RI3A 3OYEA 3GOXA 5FRNA 2FHDA 2EQMA 2QQRA 4CRIA 1XNIA 3QKJA 3LLRA 4IUVA 3MEAA 2M16A 5D6XA 3OYKA 3OYLA 2R5MA 3OS1A 3H8ZA 3MP8A 2VYTA 3OQ5A 5KCOA 3OYIA 2JTFA 3OYAA 4E7KA 3E9FA 4LD6A 2RJCA 2G3RA 2EFIA 4A4FA 4C5EA 3L2VA 4BDZA 2RJEA 3MEUA 4PLIA 2RHZA 4RG2A 5M9OA 3OYJA 1MHNA 2NLUA 4BE1A 3OS2A 2QQSA 1WJRA 4ZTFA 2BKDN 4A4EA 4N4HA 3FDRA 3LGFA 3DB4A 1OZ3A 3MP6A 4NS5A 2MWOA 4QQ6A 4QQGA 4X34A 5CIUA 4Z02A 5J39A 3S3OA 2B8AA 3OMCA 3OYDA 3FEOA 4A4GA 3BDLA 2DIGA 2GFUA 3FLGA 2EQJA 2DAQA 4PL6A 3DB3A 2K3XA 2RO0A 3MEVA 2HQXA 3LH0A 5D6WA 5C0MA 5J26A 3E9GA 4BE2A 2E5QA 1KHCA 2PQWA 3MEWA 2L89A 4HCZA 4GY5A 1H3ZA 4A4HA 3P8HA 3L2WA 2HQEA 1G5VA 2XDPA 1WGSA 2JZ2A 3LYIA 3PFSA 3QJ6A 5IAYA 3OY9A 3OA6A 3L2RA 2IG0A 3MP1A 3O8VA 2M1HA 2YRVA 3PMIA 4QVZA 1N27A 3L2UA 2CKKA 4Q5WA 2RI5A 3L2QA 2O4XA 4IUQA 2RHUA 2RJDA 2RI2A 5IN1A 3NTHA 2L3RA 1WJQA 2GF7A 4E7IA 2BIVA 5KH6A 3S3NA 4BD3A 2GFAA 2X4XA 3CEYA 2F5KA 3PMTA 4B9WA 2D9TA 2RJFA 3ME9A 4IUPA 3EAEA 5FRMA 3C4SA 3UWNA 4E7JA 5KCHA 2K3YA 4E7HA 3SD4A 2M0OA 3M9QA 5KE3A 3OYNA 5FROA 3OYHA 2L8DA 1WJSA 3L42A 1OZ2A 4C5IA 4FL6A 1SSFA 3NTIA 2LTOA 2LDMA 3META 4FU6A 3OYGA 2LRQA 2BUDA 3PNWC 4OVAA 4N4IA 4N4GA 2XK0A 2LCCA 3ZEHA 4C5HA 3KUFA 2EKOA 4BE0A 4IUTA 3DLMA 3P8DA 3LGLA 4B9XA 3OS0A 4C5GA 3OB9A 3LX7A 2MWPA 3QIIA 4UC4A 4BDYA 2RHIA 2R5AA 2LVMA 2X4WA 3S3MA 2O4XB 4EDUA 3F70A 4QQDA 2EQKA 3S6WA 1OYXA 1OI1A 2EQUA 2X4YA 4IURA 5C6SA 3ASKA 3OMGA 2RHYA 2E6NA 2WACA 2P0KA 3H6ZA 3Q1JA 3QBYA 4PLLA 3UT1A 3OYBA 2X35A 5D6YA 4II1A 4IUUA 3MO8A 3NTKA 2DIQA 3OYMA 3FC3A 4QW2A 4L59A
chains in the Genus database with same CATH superfamily
2Y4YA 5A0LA 1M90C 4ZTJA 2X9HA 1FX7A 4KGZB 5GANe 1GFDA 2K4YA 5L8RE 1KQSP 4E47A 4RTVA 1PRMC 3LLRA 1K76A 2HSPA 1YBYA 4M7AF 3EG9B 1UJ0A 4LD6A 2LZ6B 4C5EA 3CCUQ 4BE1A 3OS2A 3CQTA 4R0KA 2HNIA 3H0HA 4QQGA 4PJOB 8AT1B 3OMCA 1UGQB 2JM9A 2J6KA 4A4GA 4HVUA 4DOWA 3CXCA 2CS7A 1D0YA 1U8RA 2DA9A 1XTDA 2RD1A 5D6WA 2DXTA 2A3LA 2RB6A 4HA8A 4GY5A 1S72T 2F2VA 3RR6A 3EFOB 1G5VA 1IGUA 1BCMA 1UDLA 2DL5A 3PMIA 3L2UA 1YJ9T 3T9NA 4IUQA 1VQ8T 3JCMg 2RI2A 4M7DA 4RTUA 1YNZA 4E7IA 1D1CA 2C0IA 4F7UF 1FWZA 3PMTA 1VQPQ 4B9WA 4J6WA 4EMKC 4A54A 2JNGA 2DERA 5L23A 5DY9A 1M4ZA 1U5SA 3NHNA 2ZGWA 2JOYA 2L5QA 2FYKA 2ZPFB 1SRMA 1N5ZA 2EYXA 2JT4A 5CQXA 1HSQA 1AOJA 2KY9A 3S6WA 2QQAA 1BYMA 2A0FB 1MMDA 4M7DB 4KH0B 1TWBA 1N8RU 2YUQA 4J83A 3OW2P 3CC2T 2CZ7B 2DYIA 2CP3A 3CCVT 3MO8A 1BKBA 1PHTA 4KGXB 1UEBA 1RI0A 2E6ZA 3NMZC 4QT7A 5I2MA 4E7LA 2ZPGB 2DVEA 3EG1A 2QXFA 1E6GA 2BE9B 4J6YA 4XTUA 3HP9A 3SDZA 3QSUA 2CDTA 4AFZC 1VYTA 2EWNA 2R5MA 2KGTA 4PJOC 2KNBB 4HCKA 2CUDA 4C92G 3GLXA 4FM4B 1VQNA 4KBMB 2QDYB 5ECAA 1YWPA 1BI3A 2BKDN 4HVVA 1M3BA 3SFMA 1OZ3A 4NS5A 2V1QA 4Z8AA 4LD9K 1VQ9T 1Z9QA 3TREA 2P0QA 3LWHA 2GBQA 3CC4T 1VQ5A 4PJOE 2GFUA 1FXXA 3PT9A 3VS1A 5GAOr 4KH1B 2ZZDA 3VS2A 1PCXA 3VS3A 1K73C 1M3CA 4HKEA 4PJNA 1MV3A 1BI0A 2W0ZA 3CMEQ 2DL8A 2O4XA 3TCJA 2HKQB 4KGVB 2LX9A 3C94A 3EGXA 5CO7A 1JJ2A 5IH2A 5LJ3g 4RTWA 2L2PA 3JCMc 3H9NA 1PG5B 1G2BA 2VASA 4XQ3A 5HY6A 4FL6A 4J9BA 4CC3A 2LDMA 1TU0B 1Q86C 4M7DC 3CMEA 1N6AA 2RK2A 4Z89A 3LGLA 2OTJQ 4UC4A 1GRIA 2LVMA 1JU5C 2O4XB 3EGXB 1OI1A 1W4SA 1YIJT 3GPLA 1VQMA 1M30A 2BZXA 2PUKB 3G6EQ 1JXMA 4M7DE 4EIKA 1R8OB 2IVWA 3JV3A 3G7ZA 1B34A 2VUBA 3SEMA 1VA7A 1K9MU 4OB1B 1BBZA 2ZAEA 1TOVA 2PVDB 2CT4A 4CI0C 1N9SA 3EHQA 1M27C 2VYTA 2CUBA 1GCQA 1Q82U 1QP2A 3E9FA 4OMOA 3G6EA 3G4ST 2V1RA 2DLPA 5KYYA 1QWEA 1ABQA 1RLPC 2KR3A 4JJCA 2RH2A 1C1AA 2K3XA 2W10A 1NPRA 2XIDA 4KULA 3VV0A 3I5SA 3CC7T 1VQ6T 4BE2A 2J6OA 2PQWA 5A0GA 3QDRB 1GXIE 2K79A 1ARKA 3P8HA 1V1CA 5LJ5f 2A7YA 3ULRB 2JZ2A 3OY9A 5AT1B 4QVZA 1N27A 2DM1A 4C0FA 2CKKA 1HK9A 4FW1A 1I81A 2MIOA 1X69A 2A36A 2I0NA 1VQ4Q 4J8OA 5KYYB 3JCMb 1IHWA 1AZGB 1RAAB 4J9FA 1NYGA 2ESWA 2K3YA 3HKSA 5FWBA 2DTOA 3PVQA 4XAXB 2HEQA 2M9UA 1HYOA 3I56T 4C0GA 4PJOF 1SPKA 3H0FA 2K7AA 4BI3A 2CZ6B 3CCET 3REAB 4JLIA 2QI2A 4MMKA 4EDUA 5CCAA 1VQ4A 4QQDA 5GANg 1W70A 4FYVB 2HQHA 2EQIA 4OMFB 2F1LA 3H6ZA 5IT9E 2EIFA 3JCMe 2QEXT 1K8AR 2DZCA 4JS5A 2DD5A 2DILA 2DBKA 3LH5A 3CBPA 3RMQA 4O6JA 1Q7YR 2CSIA 4C8QG 3P8BB 1NG2A 3CCMQ 2QQ9A 1VYUA 5IHKA 3U23A 2YDLA 4OMQA 3EG3A 2YLCA 2XHCA 3SHWA 3QWXX 5IHNA 1EX4A 2GTOA 1BI1A 1D3BA 1Q82C 2ZPBB 1WHGA 2LC4A 3FEOA 2RN8A 1Y07A 1X75C 1QVGA 2QASA 3CCMA 2DO3A 2M02A 4M7DF 1GCQC 3G71T 4ZN3A 2DMOA 1QVPA 1E7OA 3M0RA 4RTTA 4GLKA 2Y90A 3L2WA 4K11A 4ZNXA 2M1HA 1KQ2A 2COYA 1YCYA 4DBFA 1H92A 3EG2A 1YITQ 4L5GA 1T3LA 4PJOD 1D3BB 4JRIA 2KMTA 4FYWB 1IRXA 1KQSS 1IGQA 2PU9B 2QQBA 5IHIA 4BB7A 3C0CA 2DL3A 3A8HB 3NTIA 2MI6A 2KBTA 1WQWA 2CP5A 4OVAA 1W2BP 1NJIR 3PTAA 2EKOA 2V26A 3LX7A 4LUDA 1K0SA 1VIEA 1NEGA 5GAMe 4A63B 1YITA 4KUIA 2EQKA 1BU1A 1O9SA 4IURA 1NPPA 1UECA 1YP5A 2P0KA 3PVLA 4J6XA 4IUUA 1YJNQ 4M78G 1AD5A 3CMAT 1G8XA 4Y92A 5FRNA 2QDLA 2QQRA 4NOYA 1TUDA 2EKHA 4CC4B 1M90U 5CKDA 4M7DD 2DL4A 1VQ7Q 1KK7A 3JCMf 1Y7XA 1YJNA 4C92A 2K9GA 1YJWQ 1ZBXA 3CXCS 2FB7A 1VQNT 2BE7D 1U06A 1E6HA 4RTXA 4A4HA 1ZSGA 1QWFA 2FEIA 3OW2S 1VQ7A 3JB9D 1VQ5T 2EJGA 2RI5A 3V7RA 1JO8A 1RADB 3NTHA 2EBPA 3UPUA 2BIVA 5KH6A 2F5KA 1YJWA 4C92B 4E7JA 1ZUKA 2ATCB 2L3PA 2XMFA 4HVWA 3OYHA 1WJSA 1OZ2A 1SG5A 3QJYA 3FJPA 4FIBA 2BUDA 1FYNA 2IPOB 1M3AA 3BDUA 1PM3A 2HD0A 4LDWA 4RKUE 4KUDK 2O2OA 2GGRA 3FB9A 2FPFA 5FU6B 4X1VA 2YSQA 2MF2A 1KQSA 2GTJA 3OMGA 4AMCA 5I11A 4PJJA 1WPYA 5D6YA 4D6WA 1I5OB 4M7AG 1OX8A 2HL5C 3M4GA 5LL6S 5HK0A 4C0ZA 3OYCA 2FRWA 3M56A 1VOMA 1VQMT 4NL3A 2EQMA 5I2SA 2OTLQ 4CRIA 5HK3A 5GAMf 1W6XA 3I9QA 4AG1C 3OYIA 3J7AF 2DBMA 3RNJA 1OULA 2K57A 4ORZA 4J9CA 4BDZA 1MHNA 2DD4A 1X6OA 3WVEB 3LW5E 4JRQA 2QQSA 3QG1A 1I1JA 3QO3A 2X51A 3OSVA 3TQ7P 2P84A 3M53A 2B8AA 3OYDA 5LJ3f 2NUPA 3E2UA 2F2XA 4EMHA 2OTLA 2V8JA 2HQXA 3EFOA 1OOTA 4LNPA 4JRKA 4FYXB 3VS7A 1K8AC 4M75A 2OX7A 2XDPA 3L1AA 4A53A 3M0SA 2YRDA 1ZLMA 3UA7A 4MMLA 4C92C 1ZX6A 2E12A 2RJDA 1JJ2S 1LNXA 2GF7A 2ENMA 4XTZA 1TH7A 1D09B 1MMGA 1K73U 2EYYA 2LNHB 4ZGDB 2LQWA 1D0XA 3N5BB 4E7HA 1MV0B 1WHJA 2NUPB 3KFVA 4C92E 3OYNA 1ABOA 1NLOC 3RMSA 3OYGA 1VQKQ 3V8LA 2LRQA 3OW2A 1PRLC 5FU6C 4ZGEB 4X9DA 3CCUA 3MJXA 4M75B 1C0MA 4BDYA 3A1PA 1QLYA 1IREB 2VVKA 2EQUA 3CPWP 2CP6A 1Q86U 4FSXA 3RKXA 2KYMA 3FC3A 3CCJQ 1R0CB 1VQKA 3JRZA 1VQ4T 3OBYA 2YLBA 1AT1B 5LJ5h 2CYZB 4F04B 2KT8A 1K9AA 3PE0A 3OYKA 2E10A 5D6XA 1VQPA 1GBQA 5GAOp 3WVDB 1WFWA 2MYSA 3C95A 3L2VA 4PLIA 3R6NA 2LNVA 3OYJA 1Y96A 3ZBDA 2KXDA 4L6V5 4N4HA 3FDRA 4PJMA 3CCJA 4QQ6A 1QQJA 4DA4A 1UE9A 2LP5A 4OGEA 3ER0A 4CC7A 3BDLA 3H0IA 2FPEA 5FLXE 2E5QA 3REBB 4DEYA 2FZCB 1KC8R 1RL2A 1HXDA 1JRIA 1D1AA 3L2RA 3PFSA 3QJ6A 2DTIA 4C8QB 5GAOm 1KFZA 2NUTA 3TSZA 4AG2C 1OQKA 4OB0B 1NLPC 2AHJB 4ELZC 1Y96B 2RQUA 1QVFP 2F5TX 5GANf 2X4XA 3CCRQ 5CR2A 2CP7A 4XTYA 3UWNA 1WQ7A 5KCHA 2HL3A 5GAMg 3M9QA 2PZ1A 2QK0A 4M75C 3BY7A 3X26B 3VS6A 4EPCA 2J05A 3MHXA 1GBRA 3HTRA 2RK1A 4C5HA 1I4K1 3QPHA 4RCBA 2KSSA 4ZN1A 2FO0A 3VU3C 2NUTB 3QIIA 2ABLA 4M75E 2H8HA 3BW1A 1LOJA 5C6SA 2CP2A 2VKNA 5DLQE 2AT1B 2CH4A 5LJ5d 1W1FA 1RI9A 4FYYB 1SHGA 4A4KA 2K5FA 1QP3A 1MMAA 1AEYA 4IKFA 1YITT 2ROLA 5GAN7 2IIMA 1TTHB 1OX9A 3M54A 5AYFA 2Y4XA 4C92F 2DJZA 2HBWA 3LWIA 1R77A 2E4HA 3H8ZA 3OS1A 1U3OA 1PD1A 3INZA 2EFIA 2RHZA 4HCCA 3IQLA 4RTYA 4PK4A 4A4EA 2DL7A 2XICA 1W2BS 1ZA1B 1PC0A 2MOXA 1SF9A 4RMOA 1S1NA 2DIGA 3BE3A 1QVGS 2EQJA 1M2VA 3VUZA 2OTJA 4DBRA 1YN8A 3VRZA 1YJNT 2AZVA 2KRNA 4M78B 1IO6A 1NZ9A 1AZEA 2C0OA 4M77A 1QMCA 2E1HA 1B07A 2HDAA 2RHUA 4TVRA 4XTXA 2LCSA 3VS4A 1JBMA 1VQLQ 2V8IA 1SRLA 4J9EA 4IUPA 3UDCA 1QCNA 3QXEB 1RAFB 1YHQT 3L2ZA 3M5AA 2D8JA 1M2VB 4J9HA 2QG9B 1WIEA 3RUXA 2JJ9A 3META 1ACMB 3JSCA 3A8MB 3A98A 4RG8A 4Y28E 3DKMA 2Z0WA 3DLMA 1VQLA 4M77B 1Y57A 2A08A 2R5AA 1PWTA 2DX1A 3JCMh 2CSQA 1KSWA 3VJPA 3VUBA 4EMGA 3UT1A 1IHVA 1M1GA 4C92D 1PSFA 4E7SA 4WTOB 1GL5A 2VV5A 2EYWA 2AKLA 1WHHA 2JMCA 2KAFA 5GJWB 1WXBA 2R58A 2RI3A 2DTHA 2KE9A 4FSSA 2FHDA 2MPXC 2EJFA 5LJ5j 1MGQA 2M16A 4JJNK 5CVIA 4FCYA 4LDXA 3MP8A 1WLPB 3QYGB 2JUFA 1TG0A 3CC2Q 3CCVQ 4ESRA 5GMKe 3MP6A 2QA4Q 3UATA 4M75F 2J7IA 1NM7A 3FLGA 4M78C 1T0JA 1UGRB 4BI4A 3LH0A 5J26A 1VIFA 3EHRA 3EGDA 1A0NB 2KDSA 4M7AB 5EC7A 4DOVA 2D6FA 1NE8A 2CT3A 1ZUYA 2LMJA 2RM4A 3OA6A 2E41A 4D8KA 2CZ0B 5DM7R 1FMVA 4M78E 4Q5WA 3KXTA 5DLOA 5CQYA 1W2BA 2QA4A 3S3NA 1VQ9Q 2NYSA 3CC4Q 2H3JA 1LJOA 1TUCA 2M0YA 3C4SA 2VGMA 2OI3A 3VYGA 3CD6Q 1Y71A 1Q81R 3V8JA 2GCXA 1M8VA 3JCMQ 5GAOq 3EGUA 4M77C 3EGDB 3JCMd 1UGSB 4DBHA 2JW4A 2LCCA 4DQ2A 4LN2A 4RCCA 2K6DA 2MCNA 1I5LA 1MNDA 4IIOA 2P4TA 1KC8C 4BUGA 4M77E 3CD6A 3JB9F 1EFNA 2OAUA 5LJ3h 3CCUT 2XG8D 2XDBA 1H3HA 5J3BA 3HFNA 5GAN8 5GMKl 5GAN6 3BFMA 1LCKA 2DZ9A 4N0AA 1RAGB 4M75D 2KRSA 1TXQA 1KHIA 4PFZA 4FT2A 4LXCA 1YIJQ 3RDVA 1WXUA 3HRSA 3QHSA 1VQKT 3FRNA 2COZA 1IZ6A 3M57A 4RG2A 2KI7A 2ZPIB 3J81E 3NFCA 2FRYA 4RTZA 4E7KA 5CIUA 2FPDA 2E3IA 1XOVA 4JPBW 1DJ7B 1VQPT 3O5ZA 1VQOQ 2E65A 1X2QA 3RBBB 4PL6A 1VYVA 1Q95G 1XJWB 1GCPA 2ZPEB 6AT1B 1U1TA 2L89A 3CPWS 5GMKm 5FU7B 3JCMP 5HKCA 1YIJA 3RERA 1PNJA 2DRKA 3I35A 4LDYA 5IAYA 2O01E 3O8VA 3QYHB 1HJDA 2K5IA 3CCQQ 4ATOA 4B6MA 5IN1A 3GP8A 1WJQA 1GFCA 4QVDA 4BD3A 5GJVB 3CBOA 1VQOA 2V8KA 2VXEA 1K8AU 2E70A 4E6RA 3I55Q 2FZGB 4AFSC 2QTVA 1Q7YU 2EPDA 1OPLA 3C12A 4NL2A 1TS9A 4OMNA 2G6FX 1QKWA 2AZSA 4C8QD 4XTWA 2DYBA 4HCBA 5LJ3d 3OS0A 3CCQA 1JQQA 4P5NA 1TUGB 2X4WA 5GAN2 2RHYA 3TU4K 3I55A 2FVUA 2MAMA 1G3WA 4M78F 2HCKA 2CGHA 2LT1A 2LQNA 4L59A 3OYFA 5KYNA 4J7FA 3VRYA 4XU1A 3I56Q 4JJBA 4AFUC 4BI8B 3HL8A 4OB3B 2VGNA 1QVFS 2ED1A 1ZQ1A 3CBMA 3NGPA 5FW9A 5IXBA 1X6BA 5KCOA 2HSEB 5EG2A 2JTFA 2DVJA 1X2KA 2RJCA 4WCIA 4MZPA 4WF2A 5GANh 2LQ8A 3CMET 4QVCA 1ZSZA 2D0QB 2LX7A 2PTKA 2FL7A 2JTMA 2DETA 5I21A 1K0XA 2LQKA 5J39A 1N8RR 1BIAA 4N0AC 3M0QA 5FU7C 4M77F 3CCSQ 4Z88A 1NJIU 3GNFB 3X20B 1P92A 3NPFA 3QWYA 3OSSC 2QGGA 1BK2A 2SRCA 3GIBA 4C0DB 2EW3A 2RQVA 2LJ3A 2KRMA 4V2SA 2XD0A 2OTJT 1ZSZB 2XKOC 2L3SA 1EIFA 3EAEA 4BY6B 3CCSA 5KYWA 3G6ET 1RAEB 3X25B 4F7UG 3VS5A 1UGVA 3G71Q 4F16A 5FROA 2COWA 1T0HA 3CPWA 4JRPA 1SSFA 2WSCE 4PNOA 4N4IA 4N4GA 4M78D 3ZEHA 1YI2Q 1Q7YC 3A5ZB 5GAMj 4PFPA 4J5YA 4JZ3A 1UB4A 3QDFA 3EFRA 1YFNA 4C5GA 2CP0A 1M2OA 1K4US 3JB9I 1LVKA 3HRUA 1RAIB 2RA2A 3ASKA 2NUZA 3G71A 5KYWB 1IB8A 1MNEA 4AFQC 3OYMA 5LJ3j 1VQLT 1YI2A 1D1BA 1WZOA 5CKHA 5GANd 1WYXA 3RKYA 3MEAA 5GAOn 1Q81C 4M77D 2VC8A 3H41A 1OU8A 4FW2A 2EGAA 2RJEA 1MUZA 2NLUA 3V8KA 3TEEA 4ZTFA 2I2LA 1UTIA 3DB4A 3V7CA 4OB2B 1G83A 3CMAQ 4CC2A 2DF6A 2ROTA 4C0DC 4D8DA 4ZGJB 5GAOl 2P4RA 1QVFA 2RQRA 4KRTA 1K9MR 1X01A 4ELYC 1BI2A 4C8QA 4HCZA 2OAWA 2BZ8A 1ZSZC 2EJ9A 1NJIC 1JXOA 2IG0A 2WSEE 4BY6C 4XU0A 3L2QA 3EH1A 3CXCP 3URGA 2LJ1A 2LT4A 2JS2A 1Q82R 2L3RA 3KBGA 3M0UA 2GFAA 1OV3A 4GBQA 4OMPA 4RUGA 3CMAA 4IIMA 3CCLQ 2JMAA 2M51A 2XU8A 1VQNQ 3HHTB 4MDXA 4E7ZA 3EG0A 4M7AD 1ZHIA 2RNAA 2QA4T 4LUEA 4ME7A 1VQ5Q 3P8DA 3CCMT 1CSKA 2D1XA 1RUWA 3GBQA 2L0AA 2EYZA 2X4YA 4MZTA 1WHMA 1KD1R 4DBQA 3QBYA 3CCLA 3OYBA 5LJ5e 2X35A 3UA6A 2QYZA 2DIQA 3MCAB 2E64A 2HMAA 2NWMA 3VKIA 3VS0A 4YTLA 1WA7A 3GOXA 3CPFA 2YXYA 1HD3A 1ZA2B 3CD6T 3QKJA 4IUVA 3TVTA 3OYLA 3V7SA 3CCRA 4JLGA 1UG1A 1JB0E 5M9OA 1AWWA 3JCMV 4R55A 2EGEA 5GANj 3QUIA 2MWOA 4Z02A 5HCKA 1BB9A 1X43A 1VQMQ 1QKXA 1IXDA 3PIOA 2DXBA 3JB9H 4M78A 1B3QA 1KHCA 3VYHB 2AIRB 1KJWA 4DEXA 1D0ZA 1T3SA 3DLLA 1NEBA 2A37A 3HRTA 2PVOB 3FJ5A 2K3BA 2J06A 1M8MA 2D9TA 1UUEA 2RJFA 1WDXA 2K5LA 4C8QC 1SKUB 4J9IA 2M0OA 1X6GA 2L8DA 3QZ9B 3AT1B 4FU6A 1JJ2P 3J80E 1I8FA 1V29B 2CH4W 2X3XD 1M1KR 1N8RC 1VQOT 4IUTA 4C8QE 3OYYA 2JS0A 2DKGA 4PJOG 2DNUA 1OYXA 3PGGA 1WX6A 5KYXA 1I0CA 2QTXA 1VQ7T 2WACA 4PJLA 2BZYA 3MKDA 2DEUA 3HFOA 4F14A 3JB9J 1OEBA 4II1A 3UF4A 1KQ1A 2RPNA 5A2QE 1S72Q 3CCQT 5CKFA 4HXJA 2KXCA 4KT0E 4XK8E 9ATCB 2MK5A 1YJWT 1YJ9Q 1B34B 1KC8U 3R6OA 5CKEA 1VQ8Q 3SB2A 3SWNA 2VWFA 4M75G 3I55T 2GQIA 1RACB 2HKNA 1V76A 4PFOA 5GMKh 2RMOA 4F17A 3OBWA 2F69A 2FZKB 5KYXB 2QAZA 1WXTA 2O31A 1LPLA 1S72A 1BIBA 3LGFA 1KD1U 3RKWA 5KYUA 4LDUA 2SEMA 3X28B 4FT4A 2YRCA 2KROA 4OMMA 1YJ9A 4M7AA 1G3YA 1N9RA 3RESA 1VQ8A 2F2WA 1QW1A 5CAIA 3SWNB 2C06A 8ATCB 4OGCA 4M7DG 5D7UA 5CK9A 2GNCA 2KEAA 1FMWA 2YRVA 1BCOA 2E5KA 3D7SB 5GAN3 2DEQA 1M90R 1B7TA 1M5Q1 3THKA 3M0TA 2K2VA 2DFUA 3CEYA 5CKBA 5KYUB 2O88A 1SSHA 1WI7A 2JN0A 3EH2A 3SD4A 3A8GB 1XQHA 2RQWA 1RAHB 1G3SA 1K1ZA 4VUBA 3JB9G 4F7UA 2JM8A 1OU9A 3CC2A 1FMKA 1WHKA 2AKKA 1AHJB 1CKBA 3KUFA 2KVQG 2YT6A 3CCVA 2LJ0A 3CCST 2OTLT 4B9XA 2B86A 1UGPB 3M59A 4XU3A 1F1BB 5GAN4 3S3MA 2K2MA 2EVRA 1K9MC 2RQTA 2YUNA 2JTEA 5FWCA 3ZL7C 2C0TA 1ZBJA 2DPPB 3M4YA 2YHTA 1KIKA 2OJ2A 5GAMh 4BACA 2RHXA 3A8LB 4PKCC 4JDSA 3OYEA 1M1FA 2KYBA 4F7UB 2DXUA 7AT1B 3EFSA 1AVZC 2P0PA 1M1KU 1VQ9A 1QCFA 3OQ5A 3CC4A 3OYAA 1C6VX 1RABB 2G3RA 3MEUA 5GMKi 1YI2T 4LE9A 3E1SA 2X4JA 1TSFA 1WJRA 4C8QF 3FIFA 2QGFB 4J9DA 2ZPHB 3SWNC 1ZUUA 2J6FA 3TSWA 2DAQA 1VUBA 3DB3A 1WHLA 1KD1C 2PUOB 3E9GA 3E19A 1EZZB 2AK5A 4QKUA 1OPKA 3MPUB 2A28A 2DJQA 3G1JA 3GF5A 2XI9A 3LYIA 3MP1A 2BTTA 2D0NA 1MMNA 3GNGA 1QVGP 1JEGA 4M7AC 2DE0X 5IXFA 2KK4A 3ME9A 2CREA 2HBPA 4HT8A 2O9VA 3L42A 1U1SA 3CCJT 2LTOA 2ED0A 3I5RA 4AT1B 4M7AE 2MMPA 2EAYA 3PNWC 5LJ5g 1AWOA 2XK0A 3G4SQ 5LJ3e 4BE0A 1SHFA 3JCMW 3M55A 2RHIA 2JXBA 5GAMd 2FG0A 2YUPA 1YCSB 2EGCA 4PLLA 1YHQQ 3CC7Q 1UJYA 1VQ6Q 1UFFA 2YWWA 1G3TA 3NTKA 4R56A 1K73R 2WSFE 1PKSA 5KE2A 4X9CA 2R57A 3G4SA 1PD0A 4JZ4A 1PKTA 3CCLT 1XNIA 1H8KA 1SEMA 2DXCA 4E2FB 3HPWA 2JVVA 4F7UE 4M77G 1J3TA 2VXFA 4JJDA 4GLMA 5GMKj 4A4FA 1I07A 2LCLA 1VQ6A 1YHQA 3CC7A 4Y91A 4OF1A 1M1KC 2CZ1B 3PIPA 1NYFA 2HZYA 2GQVA 3S3OA 2PNIA 4X34A 1Q86R 4OMLA 3X24B 3JAME 1Q81U 3CCRT 2XDDA 4JS4A 2DRMA 2ZCFB 4J9GA 1NBEB 2RO0A 3CCEQ 3MEVA 5C0MA 1UHCA 2D8HA 1R0BG 2DK3A 3MEWA 2RF0A 1QCOA 2L3QA 4O5VA 4EMKA 3M58A 1H3ZA 1AWJA 3OS5A 2HQEA 2YUOA 1Z9ZA 1WGSA 5A0DA 2HAXA 3A8OB 4J7IA 1UHFA 4LDVA 1X27A 2QEXQ 2EYQA 2H3EB 2E3HA 3RIRA 4OP0A 3QZ5B 1KG1A 1CKAA 2ECZA 3WXMB 3I56A 1H641 1M9SA 2X3WD 5FRMA 3AHUA 4MZMA 3CCEA 2PVGB 3JCMX 5KE3A 4MDWA 3ZFJA 3HSBA 4C5IA 4EMKB 5GAN5 1PSEA 2QEXA 3M0PA 3OB9A 2MWPA 3JCMJ 4ANJA 1YWOA 3EG9A 3F70A 5I22A 1RLQC 2VB6A 4HT9A 2KQWA 2KT1A 4JUVA 4M4ZA 4XU2A 2E6NA 1O75A 3Q1JA 4PJOA 2O9SA 1Y0MA 1AWXA 4XTVA 1WNLA 4QW2A
chains in the Genus database with same CATH topology
2Y4YA 5A0LA 1M90C 4ZTJA 4M78G 3VKIA 2R58A 1FX7A 3CMAT 4YTLA 5GANe 2RI3A 2DTHA 3GOXA 3CPFA 5FRNA 2FHDA 2QQRA 2K4YA 5L8RE 4E47A 4NOYA 3CD6T 2EJFA 3QKJA 3LLRA 4IUVA 5LJ5j 1MGQA 2M16A 4JJNK 3OYLA 5CVIA 3V7SA 3CCRA 4JLGA 4LDXA 3MP8A 1YBYA 3QYGB 2JUFA 1M90U 4M7AF 5CKDA 1JB0E 4M7DD 4LD6A 4C5EA 5M9OA 3JCMV 4BE1A 4R55A 3JCMf 3OS2A 1Y7XA 5GANj 3QUIA 5GMKe 1YJNA 3MP6A 2HNIA 2MWOA 4QQGA 4Z02A 4C92A 4PJOB 4M75F 3OMCA 1UGQB 4A4GA 1ZBXA 3CXCS 4DOWA 3CXCA 2CS7A 3FLGA 4M78C 3PIOA 1UGRB 1XTDA 2DXBA 2FB7A 2RD1A 3LH0A 5D6WA 4BI4A 4M78A 5J26A 1VIFA 1VQNT 2DXTA 3JB9H 1KHCA 2KDSA 2A3LA 4M7AB 3VYHB 2RB6A 4HA8A 4DOVA 2D6FA 4GY5A 1NE8A 4A4HA 1S72T 2RM4A 3DLLA 1G5VA 3OW2S 3OA6A 2E41A 1VQ7A 3JB9D 2CZ0B 5DM7R 3PMIA 3L2UA 1YJ9T 1VQ5T 2EJGA 4M78E 3HRTA 2RI5A 4Q5WA 3T9NA 4IUQA 3V7RA 3KXTA 1VQ8T 3JCMg 2RI2A 4M7DA 3NTHA 2PVOB 3UPUA 5DLOA 5CQYA 4E7IA 1W2BA 2QA4A 2BIVA 5KH6A 4F7UF 3S3NA 1FWZA 2F5KA 3PMTA 4B9WA 1YJWA 2D9TA 2RJFA 2H3JA 4C92B 2K5LA 1LJOA 4J6WA 3C4SA 2VGMA 4C8QC 3VYGA 4EMKC 4E7JA 1Y71A 4A54A 2JNGA 2M0OA 3V8JA 5DY9A 3OYHA 2GCXA 1WJSA 2L8DA 1OZ2A 1M8VA 3JCMQ 3QZ9B 3QJYA 5GAOq 3FJPA 4FIBA 4FU6A 4M77C 1M4ZA 3JCMd 1I8FA 3J80E 1UGSB 1V29B 2BUDA 2ZGWA 2JOYA 2L5QA 2FYKA 2LCCA 2ZPFB 1N8RC 4DQ2A 1VQOT 3BDUA 4IUTA 4C8QE 2HD0A 4LDWA 3OYYA 4RCCA 4RKUE 4KUDK 5CQXA 2DKGA 2KY9A 4PJOG 3FB9A 3S6WA 2QQAA 1BYMA 1I5LA 1OYXA 4M7DB 5FU6B 2P4TA 3PGGA 1KC8C 4BUGA 4M77E 1KQSA 2MF2A 3OMGA 2QTXA 1VQ7T 2WACA 1N8RU 1WPYA 3HFOA 4J83A 3CC2T 5D6YA 3CD6A 3JB9F 4D6WA 2OAUA 5LJ3h 3JB9J 2CZ7B 3CCUT 4II1A 3CCVT 1KQ1A 3MO8A 4M7AG 1BKBA 5A2QE 3M4GA 2XG8D 3CCQT 2XDBA 1UEBA 5CKFA 5LL6S 5HK0A 1RI0A 2E6ZA 4C0ZA 4KT0E 3OYCA 5I2MA 5J3BA 3HFNA 4XK8E 5GAN8 1YJWT 4E7LA 2ZPGB 2DVEA 1B34B 3M56A 1KC8U 5GMKl 2QXFA 3R6OA 5GAN6 3BFMA 4J6YA 4XTUA 3HP9A 5CKEA 3SDZA 3SB2A 2DZ9A 2EQMA 4N0AA 3SWNA 5I2SA 4CRIA 4NL3A 3QSUA 4M75G 3I55T 5HK3A 4M75D 5GAMf 2EWNA 2R5MA 1KHIA 4FT2A 3OYIA 5GMKh 3J7AF 4PJOC 3QHSA 3HRSA 2K57A 4C92G 3GLXA 3OBWA 1VQKT 2F69A 3FRNA 4FM4B 4BDZA 1IZ6A 1VQNA 3M57A 4KBMB 4RG2A 1MHNA 2DD4A 1X6OA 2QDYB 3WVEB 2ZPIB 3LW5E 2QQSA 3QG1A 3J81E 1BI3A 3QO3A 2BKDN 4JRQA 3NFCA 1S72A 3OSVA 1BIBA 3LGFA 3SFMA 1OZ3A 4NS5A 4E7KA 5CIUA 3M53A 3RKWA 1KD1U 4LD9K 4LDUA 1XOVA 1DJ7B 2B8AA 3OYDA 3X28B 5LJ3f 1VQ9T 4FT4A 3TREA 2P0QA 3LWHA 3CC4T 2E65A 1VQPT 1VQ5A 1YJ9A 4M7AA 4PJOE 2GFUA 1G3YA 1N9RA 4PL6A 3RESA 1VQ8A 1FXXA 3PT9A 4EMHA 2OTLA 2V8JA 2HQXA 2ZPEB 5GAOr 1QW1A 1U1TA 5CAIA 3SWNB 2L89A 3CPWS 2C06A 2ZZDA 5GMKm 4OGCA 5FU7B 3JCMP 4M7DG 4JRKA 1K73C 5HKCA 1YIJA 3RERA 1K8AC 4M75A 5CK9A 2XDPA 3L1AA 4LDYA 4A53A 4HKEA 5IAYA 2O01E 3O8VA 3QYHB 1BI0A 2K5IA 2YRVA 4MMLA 4C92C 2O4XA 3TCJA 2E12A 5GAN3 2LX9A 2RJDA 3C94A 5CO7A 2DEQA 1JJ2S 4ATOA 5IN1A 3GP8A 1M5Q1 1JJ2A 1WJQA 1LNXA 2GF7A 2K2VA 4XTZA 4QVDA 1TH7A 4BD3A 3CEYA 5CKBA 3CBOA 5LJ3g 1VQOA 1K73U 2V8KA 2VXEA 1K8AU 3JCMc 4ZGDB 2E70A 3N5BB 2JN0A 4E7HA 3SD4A 1Q7YU 4C92E 3OYNA 3A8GB 3RMSA 4XQ3A 1XQHA 5HY6A 1G3SA 4FL6A 3OYGA 2LDMA 4VUBA 3JB9G 3C12A 2LRQA 3V8LA 4F7UA 3OW2A 4NL2A 1Q86C 3CC2A 4M7DC 5FU6C 1AHJB 4ZGEB 4X9DA 3KUFA 3CCUA 2KVQG 1N6AA 3CMEA 2RK2A 4M75B 4C8QD 4XTWA 3CCST 3CCVA 5LJ3d 2OTLT 3LGLA 4B9XA 3OS0A 1UGPB 3M59A 3CCQA 4HCBA 4BDYA 4UC4A 4XU3A 4P5NA 1U8RA 2LVMA 2X4WA 5GAN4 2O4XB 3S3MA 1IREB 1K9MC 1OI1A 2EQUA 1W4SA 1YIJT 3GPLA 1VQMA 2PUKB 5GAN2 1Q86U 2RHYA 3TU4K 3I55A 4M7DE 2FVUA 4FSXA 2MAMA 1R8OB 2IVWA 1G3WA 4M78F 3RKXA 2DPPB 3M4YA 3G7ZA 1B34A 2VUBA 2YHTA 3FC3A 2CGHA 2LT1A 4L59A 5GAMh 3OYFA 4BACA 4J7FA 1VQKA 4XU1A 3JRZA 1VQ4T 1K9MU 4OB1B 3OBYA 2YLBA 2RHXA 3A8LB 4PKCC 4JDSA 3OYEA 1M1FA 4BI8B 4F7UB 3HL8A 5LJ5h 2CYZB 2PVDB 2DXUA 4OB3B 2VGNA 1QVFS 1ZQ1A 4CI0C 1N9SA 2P0PA 3EFSA 3CBMA 2E10A 5D6XA 3OYKA 1M1KU 1VQ9A 1VQPA 3GIBA 3OQ5A 2VYTA 5KCOA 5GAOp 3CC4A 5EG2A 2JTFA 3WVDB 3OYAA 1Q82U 1QP2A 3E9FA 3C95A 2RJCA 3G6EA 2G3RA 4MZPA 3L2VA 4WF2A 3MEUA 5GMKi 4PLIA 5GANh 2LNVA 2LQ8A 3OYJA 4QVCA 3G4ST 1Y96A 3CMET 3E1SA 1YI2T 2X4JA 2D0QB 3ZBDA 1WJRA 4C8QF 3FIFA 2FL7A 2JTMA 4L6V5 3FDRA 4N4HA 3CCJA 4QQ6A 5I21A 2LQKA 5J39A 4DA4A 2ZPHB 1BIAA 4N0AC 3SWNC 4OGEA 3ER0A 5FU7C 2RH2A 3BDLA 4M77F 2DAQA 1VUBA 3DB3A 2K3XA 1NPRA 2XIDA 1NJIU 3GNFB 4KULA 3X20B 2PUOB 5FLXE 1P92A 3VV0A 1KD1C 3CC7T 1VQ6T 3E9GA 4BE2A 2E5QA 2PQWA 5A0GA 3QDRB 3E19A 1GXIE 3OSSC 1RL2A 1HXDA 3P8HA 5LJ5f 2A7YA 1JRIA 3GF5A 4C0DB 3L2RA 2JZ2A 2XI9A 3LYIA 3PFSA 3QJ6A 2DTIA 4C8QB 5GAOm 3MP1A 3OY9A 4QVZA 1N27A 4C0FA 2CKKA 1HK9A 4V2SA 3GNGA 4OB0B 2XD0A 1I81A 2OTJT 2AHJB 4ELZC 4M7AC 1Y96B 2F5TX 2XKOC 5GANf 2X4XA 4J8OA 2KK4A 3JCMb 3ME9A 1EIFA 3EAEA 4BY6B 5CR2A 3CCSA 3G6ET 3X25B 3UWNA 4XTYA 4F7UG 2HBPA 1WQ7A 5KCHA 2K3YA 4HT8A 3HKSA 5GAMg 3M9QA 5FROA 4M75C 2DTOA 3BY7A 3X26B 3L42A 4XAXB 4EPCA 3CPWA 1U1SA 3CCJT 4JRPA 1SSFA 2WSCE 2LTOA 2M9UA 4PNOA 2MMPA 4M7AE 3MHXA 2EAYA 3PNWC 5LJ5g 4N4IA 4N4GA 3I56T 2XK0A 2RK1A 4C0GA 4M78D 3ZEHA 1Q7YC 3A5ZB 4C5HA 1I4K1 5GAMj 4J5YA 3QPHA 4RCBA 4PJOF 1UB4A 2KSSA 4ZN1A 5LJ3e 4BE0A 3JCMW 3M55A 3EFRA 3VU3C 4BI3A 2CZ6B 4C5GA 3QIIA 3CCET 2RHIA 4JLIA 4M75E 2QI2A 4MMKA 4EDUA 5CCAA 1VQ4A 4QQDA 5GAMd 5GANg 3BW1A 3JB9I 1LOJA 3HRUA 5C6SA 2RA2A 3ASKA 4OMFB 3H6ZA 4PLLA 5IT9E 5DLQE 2EIFA 5LJ5d 3G71A 3CCLA 1G3TA 3NTKA 4R56A 3JCMe 3OYMA 2QEXT 5LJ3j 2WSFE 1VQMT 4A4KA 2K5FA 1QP3A 2DZCA 1VQLT 4JS5A 4IKFA 2DD5A 1YITT 5GAN7 3CBPA 3RMQA 4O6JA 5KE2A 4C8QG 4X9CA 2R57A 1YI2A 3G4SA 3P8BB 5CKHA 5GANd 3RKYA 3CCLT 2QQ9A 3M54A 5AYFA 1XNIA 2DXCA 2Y4XA 4C92F 2DJZA 2JVVA 3HPWA 3MEAA 4F7UE 4M77G 5GAOn 3LWIA 3OS1A 3H8ZA 4M77D 1Q81C 2VC8A 2VXFA 2YLCA 2XHCA 3INZA 5GMKj 4A4FA 2EFIA 2LCLA 2RJEA 1VQ6A 1YHQA 2RHZA 3CC7A 4HCCA 4Y91A 2NLUA 4OF1A 2CZ1B 3V8KA 3TEEA 3PIPA 1M1KC 4ZTFA 2I2LA 1BI1A 4A4EA 1D3BA 2XICA 2GQVA 3DB4A 1Q82C 3S3OA 2ZPBB 4X34A 1W2BS 3V7CA 2LC4A 3X24B 3JAME 3CCRT 1Q81U 3FEOA 4OB2B 4RMOA 2XDDA 4JS4A 2DIGA 1Y07A 2ZCFB 1QVGS 1X75C 2EQJA 1QVGA 4C0DC 3VUZA 3CCMA 2RO0A 2DO3A 4ZGJB 5GAOl 3MEVA 5C0MA 4M7DF 2OTJA 1QVFA 3G71T 2DK3A 3MEWA 4ZN3A 4O5VA 1X01A 4ELYC 1BI2A 4C8QA 4EMKA 1QVPA 4HCZA 3M58A 1H3ZA 1YJNT 4QW2A 4GLKA 2Y90A 3OS5A 4M78B 3L2WA 2HQEA 2EJ9A 1WGSA 1NZ9A 5A0DA 2HAXA 1NJIC 2IG0A 3A8OB 2WSEE 4J7IA 2M1HA 4LDVA 4M77A 1KQ2A 2E1HA 4BY6C 4XU0A 2EYQA 3L2QA 2RHUA 4TVRA 4XTXA 3URGA 3RIRA 1YCYA 2LT4A 1JBMA 4OP0A 3QZ5B 1KG1A 2L3RA 3WXMB 3KBGA 4L5GA 2V8IA 2GFAA 1H641 1M9SA 3I56A 4PJOD 1D3BB 4JRIA 3CMAA 2KMTA 4IUPA 3UDCA 3QXEB 1KQSS 5FRMA 3AHUA 4MZMA 1YHQT 3L2ZA 2PU9B 2QQBA 2XU8A 3M5AA 3CCEA 3HHTB 2PVGB 4BB7A 3JCMX 5KE3A 4MDXA 4MDWA 3ZFJA 3HSBA 4C5IA 3A8HB 3NTIA 3META 3RUXA 4M7AD 2MI6A 1ZHIA 1WQWA 3JSCA 4OVAA 4EMKB 2QA4T 5GAN5 1PSEA 3A8MB 4ME7A 4RG8A 2EKOA 3PTAA 4Y28E 3DKMA 3DLMA 3P8DA 2QEXA 3CCMT 3OB9A 3LX7A 2MWPA 1VQLA 1VIEA 4M77B 3JCMJ 5GAMe 1YITA 2R5AA 4KUIA 3F70A 2EQKA 3JCMh 2X4YA 1O9SA 4IURA 4MZTA 1NPPA 4HT9A 2KQWA 4JUVA 4XU2A 3VJPA 3VUBA 4EMGA 2E6NA 1O75A 2P0KA 3Q1JA 3QBYA 1M1GA 3UT1A 4C92D 5LJ5e 2X35A 3OYBA 1PSFA 4PJOA 2VV5A 4J6XA 4IUUA 4XTVA 2DIQA 3MCAB 1WNLA 2E64A 2KAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RI0 A;  3OYF A;  4BAC A;  4ZTJ A;  3OYC A;  4IKF A;  2R58 A;  5KE2 A;  4E7L A;  2RHX A;  2R57 A;  2RI3 A;  3OYE A;  3GOX A;  5FRN A;  2FHD A;  2EQM A;  2QQR A;  4CRI A;  1XNI A;  3QKJ A;  3LLR A;  4IUV A;  3MEA A;  2M16 A;  5D6X A;  3OYK A;  3OYL A;  2R5M A;  3OS1 A;  3H8Z A;  3MP8 A;  2VYT A;  3OQ5 A;  5KCO A;  3OYI A;  2JTF A;  3OYA A;  4E7K A;  3E9F A;  4LD6 A;  2RJC A;  2G3R A;  2EFI A;  4A4F A;  4C5E A;  3L2V A;  4BDZ A;  2RJE A;  3MEU A;  4PLI A;  2RHZ A;  4RG2 A;  5M9O A;  3OYJ A;  1MHN A;  2NLU A;  4BE1 A;  3OS2 A;  2QQS A;  1WJR A;  4ZTF A;  2BKD N;  4A4E A;  4N4H A;  3FDR A;  3LGF A;  3DB4 A;  1OZ3 A;  3MP6 A;  4NS5 A;  2MWO A;  4QQ6 A;  4QQG A;  4X34 A;  5CIU A;  4Z02 A;  5J39 A;  3S3O A;  2B8A A;  3OMC A;  3OYD A;  3FEO A;  4A4G A;  3BDL A;  2DIG A;  2GFU A;  3FLG A;  2EQJ A;  2DAQ A;  4PL6 A;  3DB3 A;  2K3X A;  2RO0 A;  3MEV A;  2HQX A;  3LH0 A;  5D6W A;  5C0M A;  5J26 A;  3E9G A;  4BE2 A;  2E5Q A;  1KHC A;  2PQW A;  3MEW A;  2L89 A;  4HCZ A;  4GY5 A;  1H3Z A;  4A4H A;  3P8H A;  3L2W A;  2HQE A;  1G5V A;  2XDP A;  1WGS A;  2JZ2 A;  3LYI A;  3PFS A;  3QJ6 A;  5IAY A;  3OY9 A;  3OA6 A;  3L2R A;  2IG0 A;  3MP1 A;  3O8V A;  2M1H A;  2YRV A;  3PMI A;  4QVZ A;  1N27 A;  3L2U A;  2CKK A;  4Q5W A;  2RI5 A;  3L2Q A;  2O4X A;  4IUQ A;  2RHU A;  2RJD A;  2RI2 A;  5IN1 A;  3NTH A;  2L3R A;  1WJQ A;  2GF7 A;  4E7I A;  2BIV A;  5KH6 A;  3S3N A;  4BD3 A;  2GFA A;  2X4X A;  3CEY A;  2F5K A;  3PMT A;  4B9W A;  2D9T A;  2RJF A;  3ME9 A;  4IUP A;  3EAE A;  5FRM A;  3C4S A;  3UWN A;  4E7J A;  5KCH A;  2K3Y A;  4E7H A;  3SD4 A;  2M0O A;  3M9Q A;  5KE3 A;  3OYN A;  5FRO A;  3OYH A;  2L8D A;  1WJS A;  3L42 A;  1OZ2 A;  4C5I A;  4FL6 A;  1SSF A;  3NTI A;  2LTO A;  2LDM A;  3MET A;  4FU6 A;  3OYG A;  2LRQ A;  2BUD A;  3PNW C;  4OVA A;  4N4I A;  4N4G A;  2XK0 A;  2LCC A;  3ZEH A;  4C5H A;  3KUF A;  2EKO A;  4BE0 A;  4IUT A;  3DLM A;  3P8D A;  3LGL A;  4B9X A;  3OS0 A;  4C5G A;  3OB9 A;  3LX7 A;  2MWP A;  3QII A;  4UC4 A;  4BDY A;  2RHI A;  2R5A A;  2LVM A;  2X4W A;  3S3M A;  2O4X B;  4EDU A;  3F70 A;  4QQD A;  2EQK A;  3S6W A;  1OYX A;  1OI1 A;  2EQU A;  2X4Y A;  4IUR A;  5C6S A;  3ASK A;  3OMG A;  2RHY A;  2E6N A;  2WAC A;  2P0K A;  3H6Z A;  3Q1J A;  3QBY A;  4PLL A;  3UT1 A;  3OYB A;  2X35 A;  5D6Y A;  4II1 A;  4IUU A;  3MO8 A;  3NTK A;  2DIQ A;  3OYM A;  3FC3 A;  4QW2 A;  4L59 A; 
#chains in the Genus database with same CATH topology
 2Y4Y A;  5A0L A;  1M90 C;  4ZTJ A;  2X9H A;  1FX7 A;  4KGZ B;  5GAN e;  1GFD A;  2K4Y A;  5L8R E;  1KQS P;  4E47 A;  4RTV A;  1PRM C;  3LLR A;  1K76 A;  2HSP A;  1YBY A;  4M7A F;  3EG9 B;  1UJ0 A;  4LD6 A;  2LZ6 B;  4C5E A;  3CCU Q;  4BE1 A;  3OS2 A;  3CQT A;  4R0K A;  2HNI A;  3H0H A;  4QQG A;  4PJO B;  8AT1 B;  3OMC A;  1UGQ B;  2JM9 A;  2J6K A;  4A4G A;  4HVU A;  4DOW A;  3CXC A;  2CS7 A;  1D0Y A;  1U8R A;  2DA9 A;  1XTD A;  2RD1 A;  5D6W A;  2DXT A;  2A3L A;  2RB6 A;  4HA8 A;  4GY5 A;  1S72 T;  2F2V A;  3RR6 A;  3EFO B;  1G5V A;  1IGU A;  1BCM A;  1UDL A;  2DL5 A;  3PMI A;  3L2U A;  1YJ9 T;  3T9N A;  4IUQ A;  1VQ8 T;  3JCM g;  2RI2 A;  4M7D A;  4RTU A;  1YNZ A;  4E7I A;  1D1C A;  2C0I A;  4F7U F;  1FWZ A;  3PMT A;  1VQP Q;  4B9W A;  4J6W A;  4EMK C;  4A54 A;  2JNG A;  2DER A;  5L23 A;  5DY9 A;  1M4Z A;  1U5S A;  3NHN A;  2ZGW A;  2JOY A;  2L5Q A;  2FYK A;  2ZPF B;  1SRM A;  1N5Z A;  2EYX A;  2JT4 A;  5CQX A;  1HSQ A;  1AOJ A;  2KY9 A;  3S6W A;  2QQA A;  1BYM A;  2A0F B;  1MMD A;  4M7D B;  4KH0 B;  1TWB A;  1N8R U;  2YUQ A;  4J83 A;  3OW2 P;  3CC2 T;  2CZ7 B;  2DYI A;  2CP3 A;  3CCV T;  3MO8 A;  1BKB A;  1PHT A;  4KGX B;  1UEB A;  1RI0 A;  2E6Z A;  3NMZ C;  4QT7 A;  5I2M A;  4E7L A;  2ZPG B;  2DVE A;  3EG1 A;  2QXF A;  1E6G A;  2BE9 B;  4J6Y A;  4XTU A;  3HP9 A;  3SDZ A;  3QSU A;  2CDT A;  4AFZ C;  1VYT A;  2EWN A;  2R5M A;  2KGT A;  4PJO C;  2KNB B;  4HCK A;  2CUD A;  4C92 G;  3GLX A;  4FM4 B;  1VQN A;  4KBM B;  2QDY B;  5ECA A;  1YWP A;  1BI3 A;  2BKD N;  4HVV A;  1M3B A;  3SFM A;  1OZ3 A;  4NS5 A;  2V1Q A;  4Z8A A;  4LD9 K;  1VQ9 T;  1Z9Q A;  3TRE A;  2P0Q A;  3LWH A;  2GBQ A;  3CC4 T;  1VQ5 A;  4PJO E;  2GFU A;  1FXX A;  3PT9 A;  3VS1 A;  5GAO r;  4KH1 B;  2ZZD A;  3VS2 A;  1PCX A;  3VS3 A;  1K73 C;  1M3C A;  4HKE A;  4PJN A;  1MV3 A;  1BI0 A;  2W0Z A;  3CME Q;  2DL8 A;  2O4X A;  3TCJ A;  2HKQ B;  4KGV B;  2LX9 A;  3C94 A;  3EGX A;  5CO7 A;  1JJ2 A;  5IH2 A;  5LJ3 g;  4RTW A;  2L2P A;  3JCM c;  3H9N A;  1PG5 B;  1G2B A;  2VAS A;  4XQ3 A;  5HY6 A;  4FL6 A;  4J9B A;  4CC3 A;  2LDM A;  1TU0 B;  1Q86 C;  4M7D C;  3CME A;  1N6A A;  2RK2 A;  4Z89 A;  3LGL A;  2OTJ Q;  4UC4 A;  1GRI A;  2LVM A;  1JU5 C;  2O4X B;  3EGX B;  1OI1 A;  1W4S A;  1YIJ T;  3GPL A;  1VQM A;  1M30 A;  2BZX A;  2PUK B;  3G6E Q;  1JXM A;  4M7D E;  4EIK A;  1R8O B;  2IVW A;  3JV3 A;  3G7Z A;  1B34 A;  2VUB A;  3SEM A;  1VA7 A;  1K9M U;  4OB1 B;  1BBZ A;  2ZAE A;  1TOV A;  2PVD B;  2CT4 A;  4CI0 C;  1N9S A;  3EHQ A;  1M27 C;  2VYT A;  2CUB A;  1GCQ A;  1Q82 U;  1QP2 A;  3E9F A;  4OMO A;  3G6E A;  3G4S T;  2V1R A;  2DLP A;  5KYY A;  1QWE A;  1ABQ A;  1RLP C;  2KR3 A;  4JJC A;  2RH2 A;  1C1A A;  2K3X A;  2W10 A;  1NPR A;  2XID A;  4KUL A;  3VV0 A;  3I5S A;  3CC7 T;  1VQ6 T;  4BE2 A;  2J6O A;  2PQW A;  5A0G A;  3QDR B;  1GXI E;  2K79 A;  1ARK A;  3P8H A;  1V1C A;  5LJ5 f;  2A7Y A;  3ULR B;  2JZ2 A;  3OY9 A;  5AT1 B;  4QVZ A;  1N27 A;  2DM1 A;  4C0F A;  2CKK A;  1HK9 A;  4FW1 A;  1I81 A;  2MIO A;  1X69 A;  2A36 A;  2I0N A;  1VQ4 Q;  4J8O A;  5KYY B;  3JCM b;  1IHW A;  1AZG B;  1RAA B;  4J9F A;  1NYG A;  2ESW A;  2K3Y A;  3HKS A;  5FWB A;  2DTO A;  3PVQ A;  4XAX B;  2HEQ A;  2M9U A;  1HYO A;  3I56 T;  4C0G A;  4PJO F;  1SPK A;  3H0F A;  2K7A A;  4BI3 A;  2CZ6 B;  3CCE T;  3REA B;  4JLI A;  2QI2 A;  4MMK A;  4EDU A;  5CCA A;  1VQ4 A;  4QQD A;  5GAN g;  1W70 A;  4FYV B;  2HQH A;  2EQI A;  4OMF B;  2F1L A;  3H6Z A;  5IT9 E;  2EIF A;  3JCM e;  2QEX T;  1K8A R;  2DZC A;  4JS5 A;  2DD5 A;  2DIL A;  2DBK A;  3LH5 A;  3CBP A;  3RMQ A;  4O6J A;  1Q7Y R;  2CSI A;  4C8Q G;  3P8B B;  1NG2 A;  3CCM Q;  2QQ9 A;  1VYU A;  5IHK A;  3U23 A;  2YDL A;  4OMQ A;  3EG3 A;  2YLC A;  2XHC A;  3SHW A;  3QWX X;  5IHN A;  1EX4 A;  2GTO A;  1BI1 A;  1D3B A;  1Q82 C;  2ZPB B;  1WHG A;  2LC4 A;  3FEO A;  2RN8 A;  1Y07 A;  1X75 C;  1QVG A;  2QAS A;  3CCM A;  2DO3 A;  2M02 A;  4M7D F;  1GCQ C;  3G71 T;  4ZN3 A;  2DMO A;  1QVP A;  1E7O A;  3M0R A;  4RTT A;  4GLK A;  2Y90 A;  3L2W A;  4K11 A;  4ZNX A;  2M1H A;  1KQ2 A;  2COY A;  1YCY A;  4DBF A;  1H92 A;  3EG2 A;  1YIT Q;  4L5G A;  1T3L A;  4PJO D;  1D3B B;  4JRI A;  2KMT A;  4FYW B;  1IRX A;  1KQS S;  1IGQ A;  2PU9 B;  2QQB A;  5IHI A;  4BB7 A;  3C0C A;  2DL3 A;  3A8H B;  3NTI A;  2MI6 A;  2KBT A;  1WQW A;  2CP5 A;  4OVA A;  1W2B P;  1NJI R;  3PTA A;  2EKO A;  2V26 A;  3LX7 A;  4LUD A;  1K0S A;  1VIE A;  1NEG A;  5GAM e;  4A63 B;  1YIT A;  4KUI A;  2EQK A;  1BU1 A;  1O9S A;  4IUR A;  1NPP A;  1UEC A;  1YP5 A;  2P0K A;  3PVL A;  4J6X A;  4IUU A;  1YJN Q;  4M78 G;  1AD5 A;  3CMA T;  1G8X A;  4Y92 A;  5FRN A;  2QDL A;  2QQR A;  4NOY A;  1TUD A;  2EKH A;  4CC4 B;  1M90 U;  5CKD A;  4M7D D;  2DL4 A;  1VQ7 Q;  1KK7 A;  3JCM f;  1Y7X A;  1YJN A;  4C92 A;  2K9G A;  1YJW Q;  1ZBX A;  3CXC S;  2FB7 A;  1VQN T;  2BE7 D;  1U06 A;  1E6H A;  4RTX A;  4A4H A;  1ZSG A;  1QWF A;  2FEI A;  3OW2 S;  1VQ7 A;  3JB9 D;  1VQ5 T;  2EJG A;  2RI5 A;  3V7R A;  1JO8 A;  1RAD B;  3NTH A;  2EBP A;  3UPU A;  2BIV A;  5KH6 A;  2F5K A;  1YJW A;  4C92 B;  4E7J A;  1ZUK A;  2ATC B;  2L3P A;  2XMF A;  4HVW A;  3OYH A;  1WJS A;  1OZ2 A;  1SG5 A;  3QJY A;  3FJP A;  4FIB A;  2BUD A;  1FYN A;  2IPO B;  1M3A A;  3BDU A;  1PM3 A;  2HD0 A;  4LDW A;  4RKU E;  4KUD K;  2O2O A;  2GGR A;  3FB9 A;  2FPF A;  5FU6 B;  4X1V A;  2YSQ A;  2MF2 A;  1KQS A;  2GTJ A;  3OMG A;  4AMC A;  5I11 A;  4PJJ A;  1WPY A;  5D6Y A;  4D6W A;  1I5O B;  4M7A G;  1OX8 A;  2HL5 C;  3M4G A;  5LL6 S;  5HK0 A;  4C0Z A;  3OYC A;  2FRW A;  3M56 A;  1VOM A;  1VQM T;  4NL3 A;  2EQM A;  5I2S A;  2OTL Q;  4CRI A;  5HK3 A;  5GAM f;  1W6X A;  3I9Q A;  4AG1 C;  3OYI A;  3J7A F;  2DBM A;  3RNJ A;  1OUL A;  2K57 A;  4ORZ A;  4J9C A;  4BDZ A;  1MHN A;  2DD4 A;  1X6O A;  3WVE B;  3LW5 E;  4JRQ A;  2QQS A;  3QG1 A;  1I1J A;  3QO3 A;  2X51 A;  3OSV A;  3TQ7 P;  2P84 A;  3M53 A;  2B8A A;  3OYD A;  5LJ3 f;  2NUP A;  3E2U A;  2F2X A;  4EMH A;  2OTL A;  2V8J A;  2HQX A;  3EFO A;  1OOT A;  4LNP A;  4JRK A;  4FYX B;  3VS7 A;  1K8A C;  4M75 A;  2OX7 A;  2XDP A;  3L1A A;  4A53 A;  3M0S A;  2YRD A;  1ZLM A;  3UA7 A;  4MML A;  4C92 C;  1ZX6 A;  2E12 A;  2RJD A;  1JJ2 S;  1LNX A;  2GF7 A;  2ENM A;  4XTZ A;  1TH7 A;  1D09 B;  1MMG A;  1K73 U;  2EYY A;  2LNH B;  4ZGD B;  2LQW A;  1D0X A;  3N5B B;  4E7H A;  1MV0 B;  1WHJ A;  2NUP B;  3KFV A;  4C92 E;  3OYN A;  1ABO A;  1NLO C;  3RMS A;  3OYG A;  1VQK Q;  3V8L A;  2LRQ A;  3OW2 A;  1PRL C;  5FU6 C;  4ZGE B;  4X9D A;  3CCU A;  3MJX A;  4M75 B;  1C0M A;  4BDY A;  3A1P A;  1QLY A;  1IRE B;  2VVK A;  2EQU A;  3CPW P;  2CP6 A;  1Q86 U;  4FSX A;  3RKX A;  2KYM A;  3FC3 A;  3CCJ Q;  1R0C B;  1VQK A;  3JRZ A;  1VQ4 T;  3OBY A;  2YLB A;  1AT1 B;  5LJ5 h;  2CYZ B;  4F04 B;  2KT8 A;  1K9A A;  3PE0 A;  3OYK A;  2E10 A;  5D6X A;  1VQP A;  1GBQ A;  5GAO p;  3WVD B;  1WFW A;  2MYS A;  3C95 A;  3L2V A;  4PLI A;  3R6N A;  2LNV A;  3OYJ A;  1Y96 A;  3ZBD A;  2KXD A;  4L6V 5;  4N4H A;  3FDR A;  4PJM A;  3CCJ A;  4QQ6 A;  1QQJ A;  4DA4 A;  1UE9 A;  2LP5 A;  4OGE A;  3ER0 A;  4CC7 A;  3BDL A;  3H0I A;  2FPE A;  5FLX E;  2E5Q A;  3REB B;  4DEY A;  2FZC B;  1KC8 R;  1RL2 A;  1HXD A;  1JRI A;  1D1A A;  3L2R A;  3PFS A;  3QJ6 A;  2DTI A;  4C8Q B;  5GAO m;  1KFZ A;  2NUT A;  3TSZ A;  4AG2 C;  1OQK A;  4OB0 B;  1NLP C;  2AHJ B;  4ELZ C;  1Y96 B;  2RQU A;  1QVF P;  2F5T X;  5GAN f;  2X4X A;  3CCR Q;  5CR2 A;  2CP7 A;  4XTY A;  3UWN A;  1WQ7 A;  5KCH A;  2HL3 A;  5GAM g;  3M9Q A;  2PZ1 A;  2QK0 A;  4M75 C;  3BY7 A;  3X26 B;  3VS6 A;  4EPC A;  2J05 A;  3MHX A;  1GBR A;  3HTR A;  2RK1 A;  4C5H A;  1I4K 1;  3QPH A;  4RCB A;  2KSS A;  4ZN1 A;  2FO0 A;  3VU3 C;  2NUT B;  3QII A;  2ABL A;  4M75 E;  2H8H A;  3BW1 A;  1LOJ A;  5C6S A;  2CP2 A;  2VKN A;  5DLQ E;  2AT1 B;  2CH4 A;  5LJ5 d;  1W1F A;  1RI9 A;  4FYY B;  1SHG A;  4A4K A;  2K5F A;  1QP3 A;  1MMA A;  1AEY A;  4IKF A;  1YIT T;  2ROL A;  5GAN 7;  2IIM A;  1TTH B;  1OX9 A;  3M54 A;  5AYF A;  2Y4X A;  4C92 F;  2DJZ A;  2HBW A;  3LWI A;  1R77 A;  2E4H A;  3H8Z A;  3OS1 A;  1U3O A;  1PD1 A;  3INZ A;  2EFI A;  2RHZ A;  4HCC A;  3IQL A;  4RTY A;  4PK4 A;  4A4E A;  2DL7 A;  2XIC A;  1W2B S;  1ZA1 B;  1PC0 A;  2MOX A;  1SF9 A;  4RMO A;  1S1N A;  2DIG A;  3BE3 A;  1QVG S;  2EQJ A;  1M2V A;  3VUZ A;  2OTJ A;  4DBR A;  1YN8 A;  3VRZ A;  1YJN T;  2AZV A;  2KRN A;  4M78 B;  1IO6 A;  1NZ9 A;  1AZE A;  2C0O A;  4M77 A;  1QMC A;  2E1H A;  1B07 A;  2HDA A;  2RHU A;  4TVR A;  4XTX A;  2LCS A;  3VS4 A;  1JBM A;  1VQL Q;  2V8I A;  1SRL A;  4J9E A;  4IUP A;  3UDC A;  1QCN A;  3QXE B;  1RAF B;  1YHQ T;  3L2Z A;  3M5A A;  2D8J A;  1M2V B;  4J9H A;  2QG9 B;  1WIE A;  3RUX A;  2JJ9 A;  3MET A;  1ACM B;  3JSC A;  3A8M B;  3A98 A;  4RG8 A;  4Y28 E;  3DKM A;  2Z0W A;  3DLM A;  1VQL A;  4M77 B;  1Y57 A;  2A08 A;  2R5A A;  1PWT A;  2DX1 A;  3JCM h;  2CSQ A;  1KSW A;  3VJP A;  3VUB A;  4EMG A;  3UT1 A;  1IHV A;  1M1G A;  4C92 D;  1PSF A;  4E7S A;  4WTO B;  1GL5 A;  2VV5 A;  2EYW A;  2AKL A;  1WHH A;  2JMC A;  2KAF A;  5GJW B;  1WXB A;  2R58 A;  2RI3 A;  2DTH A;  2KE9 A;  4FSS A;  2FHD A;  2MPX C;  2EJF A;  5LJ5 j;  1MGQ A;  2M16 A;  4JJN K;  5CVI A;  4FCY A;  4LDX A;  3MP8 A;  1WLP B;  3QYG B;  2JUF A;  1TG0 A;  3CC2 Q;  3CCV Q;  4ESR A;  5GMK e;  3MP6 A;  2QA4 Q;  3UAT A;  4M75 F;  2J7I A;  1NM7 A;  3FLG A;  4M78 C;  1T0J A;  1UGR B;  4BI4 A;  3LH0 A;  5J26 A;  1VIF A;  3EHR A;  3EGD A;  1A0N B;  2KDS A;  4M7A B;  5EC7 A;  4DOV A;  2D6F A;  1NE8 A;  2CT3 A;  1ZUY A;  2LMJ A;  2RM4 A;  3OA6 A;  2E41 A;  4D8K A;  2CZ0 B;  5DM7 R;  1FMV A;  4M78 E;  4Q5W A;  3KXT A;  5DLO A;  5CQY A;  1W2B A;  2QA4 A;  3S3N A;  1VQ9 Q;  2NYS A;  3CC4 Q;  2H3J A;  1LJO A;  1TUC A;  2M0Y A;  3C4S A;  2VGM A;  2OI3 A;  3VYG A;  3CD6 Q;  1Y71 A;  1Q81 R;  3V8J A;  2GCX A;  1M8V A;  3JCM Q;  5GAO q;  3EGU A;  4M77 C;  3EGD B;  3JCM d;  1UGS B;  4DBH A;  2JW4 A;  2LCC A;  4DQ2 A;  4LN2 A;  4RCC A;  2K6D A;  2MCN A;  1I5L A;  1MND A;  4IIO A;  2P4T A;  1KC8 C;  4BUG A;  4M77 E;  3CD6 A;  3JB9 F;  1EFN A;  2OAU A;  5LJ3 h;  3CCU T;  2XG8 D;  2XDB A;  1H3H A;  5J3B A;  3HFN A;  5GAN 8;  5GMK l;  5GAN 6;  3BFM A;  1LCK A;  2DZ9 A;  4N0A A;  1RAG B;  4M75 D;  2KRS A;  1TXQ A;  1KHI A;  4PFZ A;  4FT2 A;  4LXC A;  1YIJ Q;  3RDV A;  1WXU A;  3HRS A;  3QHS A;  1VQK T;  3FRN A;  2COZ A;  1IZ6 A;  3M57 A;  4RG2 A;  2KI7 A;  2ZPI B;  3J81 E;  3NFC A;  2FRY A;  4RTZ A;  4E7K A;  5CIU A;  2FPD A;  2E3I A;  1XOV A;  4JPB W;  1DJ7 B;  1VQP T;  3O5Z A;  1VQO Q;  2E65 A;  1X2Q A;  3RBB B;  4PL6 A;  1VYV A;  1Q95 G;  1XJW B;  1GCP A;  2ZPE B;  6AT1 B;  1U1T A;  2L89 A;  3CPW S;  5GMK m;  5FU7 B;  3JCM P;  5HKC A;  1YIJ A;  3RER A;  1PNJ A;  2DRK A;  3I35 A;  4LDY A;  5IAY A;  2O01 E;  3O8V A;  3QYH B;  1HJD A;  2K5I A;  3CCQ Q;  4ATO A;  4B6M A;  5IN1 A;  3GP8 A;  1WJQ A;  1GFC A;  4QVD A;  4BD3 A;  5GJV B;  3CBO A;  1VQO A;  2V8K A;  2VXE A;  1K8A U;  2E70 A;  4E6R A;  3I55 Q;  2FZG B;  4AFS C;  2QTV A;  1Q7Y U;  2EPD A;  1OPL A;  3C12 A;  4NL2 A;  1TS9 A;  4OMN A;  2G6F X;  1QKW A;  2AZS A;  4C8Q D;  4XTW A;  2DYB A;  4HCB A;  5LJ3 d;  3OS0 A;  3CCQ A;  1JQQ A;  4P5N A;  1TUG B;  2X4W A;  5GAN 2;  2RHY A;  3TU4 K;  3I55 A;  2FVU A;  2MAM A;  1G3W A;  4M78 F;  2HCK A;  2CGH A;  2LT1 A;  2LQN A;  4L59 A;  3OYF A;  5KYN A;  4J7F A;  3VRY A;  4XU1 A;  3I56 Q;  4JJB A;  4AFU C;  4BI8 B;  3HL8 A;  4OB3 B;  2VGN A;  1QVF S;  2ED1 A;  1ZQ1 A;  3CBM A;  3NGP A;  5FW9 A;  5IXB A;  1X6B A;  5KCO A;  2HSE B;  5EG2 A;  2JTF A;  2DVJ A;  1X2K A;  2RJC A;  4WCI A;  4MZP A;  4WF2 A;  5GAN h;  2LQ8 A;  3CME T;  4QVC A;  1ZSZ A;  2D0Q B;  2LX7 A;  2PTK A;  2FL7 A;  2JTM A;  2DET A;  5I21 A;  1K0X A;  2LQK A;  5J39 A;  1N8R R;  1BIA A;  4N0A C;  3M0Q A;  5FU7 C;  4M77 F;  3CCS Q;  4Z88 A;  1NJI U;  3GNF B;  3X20 B;  1P92 A;  3NPF A;  3QWY A;  3OSS C;  2QGG A;  1BK2 A;  2SRC A;  3GIB A;  4C0D B;  2EW3 A;  2RQV A;  2LJ3 A;  2KRM A;  4V2S A;  2XD0 A;  2OTJ T;  1ZSZ B;  2XKO C;  2L3S A;  1EIF A;  3EAE A;  4BY6 B;  3CCS A;  5KYW A;  3G6E T;  1RAE B;  3X25 B;  4F7U G;  3VS5 A;  1UGV A;  3G71 Q;  4F16 A;  5FRO A;  2COW A;  1T0H A;  3CPW A;  4JRP A;  1SSF A;  2WSC E;  4PNO A;  4N4I A;  4N4G A;  4M78 D;  3ZEH A;  1YI2 Q;  1Q7Y C;  3A5Z B;  5GAM j;  4PFP A;  4J5Y A;  4JZ3 A;  1UB4 A;  3QDF A;  3EFR A;  1YFN A;  4C5G A;  2CP0 A;  1M2O A;  1K4U S;  3JB9 I;  1LVK A;  3HRU A;  1RAI B;  2RA2 A;  3ASK A;  2NUZ A;  3G71 A;  5KYW B;  1IB8 A;  1MNE A;  4AFQ C;  3OYM A;  5LJ3 j;  1VQL T;  1YI2 A;  1D1B A;  1WZO A;  5CKH A;  5GAN d;  1WYX A;  3RKY A;  3MEA A;  5GAO n;  1Q81 C;  4M77 D;  2VC8 A;  3H41 A;  1OU8 A;  4FW2 A;  2EGA A;  2RJE A;  1MUZ A;  2NLU A;  3V8K A;  3TEE A;  4ZTF A;  2I2L A;  1UTI A;  3DB4 A;  3V7C A;  4OB2 B;  1G83 A;  3CMA Q;  4CC2 A;  2DF6 A;  2ROT A;  4C0D C;  4D8D A;  4ZGJ B;  5GAO l;  2P4R A;  1QVF A;  2RQR A;  4KRT A;  1K9M R;  1X01 A;  4ELY C;  1BI2 A;  4C8Q A;  4HCZ A;  2OAW A;  2BZ8 A;  1ZSZ C;  2EJ9 A;  1NJI C;  1JXO A;  2IG0 A;  2WSE E;  4BY6 C;  4XU0 A;  3L2Q A;  3EH1 A;  3CXC P;  3URG A;  2LJ1 A;  2LT4 A;  2JS2 A;  1Q82 R;  2L3R A;  3KBG A;  3M0U A;  2GFA A;  1OV3 A;  4GBQ A;  4OMP A;  4RUG A;  3CMA A;  4IIM A;  3CCL Q;  2JMA A;  2M51 A;  2XU8 A;  1VQN Q;  3HHT B;  4MDX A;  4E7Z A;  3EG0 A;  4M7A D;  1ZHI A;  2RNA A;  2QA4 T;  4LUE A;  4ME7 A;  1VQ5 Q;  3P8D A;  3CCM T;  1CSK A;  2D1X A;  1RUW A;  3GBQ A;  2L0A A;  2EYZ A;  2X4Y A;  4MZT A;  1WHM A;  1KD1 R;  4DBQ A;  3QBY A;  3CCL A;  3OYB A;  5LJ5 e;  2X35 A;  3UA6 A;  2QYZ A;  2DIQ A;  3MCA B;  2E64 A;  2HMA A;  2NWM A;  3VKI A;  3VS0 A;  4YTL A;  1WA7 A;  3GOX A;  3CPF A;  2YXY A;  1HD3 A;  1ZA2 B;  3CD6 T;  3QKJ A;  4IUV A;  3TVT A;  3OYL A;  3V7S A;  3CCR A;  4JLG A;  1UG1 A;  1JB0 E;  5M9O A;  1AWW A;  3JCM V;  4R55 A;  2EGE A;  5GAN j;  3QUI A;  2MWO A;  4Z02 A;  5HCK A;  1BB9 A;  1X43 A;  1VQM Q;  1QKX A;  1IXD A;  3PIO A;  2DXB A;  3JB9 H;  4M78 A;  1B3Q A;  1KHC A;  3VYH B;  2AIR B;  1KJW A;  4DEX A;  1D0Z A;  1T3S A;  3DLL A;  1NEB A;  2A37 A;  3HRT A;  2PVO B;  3FJ5 A;  2K3B A;  2J06 A;  1M8M A;  2D9T A;  1UUE A;  2RJF A;  1WDX A;  2K5L A;  4C8Q C;  1SKU B;  4J9I A;  2M0O A;  1X6G A;  2L8D A;  3QZ9 B;  3AT1 B;  4FU6 A;  1JJ2 P;  3J80 E;  1I8F A;  1V29 B;  2CH4 W;  2X3X D;  1M1K R;  1N8R C;  1VQO T;  4IUT A;  4C8Q E;  3OYY A;  2JS0 A;  2DKG A;  4PJO G;  2DNU A;  1OYX A;  3PGG A;  1WX6 A;  5KYX A;  1I0C A;  2QTX A;  1VQ7 T;  2WAC A;  4PJL A;  2BZY A;  3MKD A;  2DEU A;  3HFO A;  4F14 A;  3JB9 J;  1OEB A;  4II1 A;  3UF4 A;  1KQ1 A;  2RPN A;  5A2Q E;  1S72 Q;  3CCQ T;  5CKF A;  4HXJ A;  2KXC A;  4KT0 E;  4XK8 E;  9ATC B;  2MK5 A;  1YJW T;  1YJ9 Q;  1B34 B;  1KC8 U;  3R6O A;  5CKE A;  1VQ8 Q;  3SB2 A;  3SWN A;  2VWF A;  4M75 G;  3I55 T;  2GQI A;  1RAC B;  2HKN A;  1V76 A;  4PFO A;  5GMK h;  2RMO A;  4F17 A;  3OBW A;  2F69 A;  2FZK B;  5KYX B;  2QAZ A;  1WXT A;  2O31 A;  1LPL A;  1S72 A;  1BIB A;  3LGF A;  1KD1 U;  3RKW A;  5KYU A;  4LDU A;  2SEM A;  3X28 B;  4FT4 A;  2YRC A;  2KRO A;  4OMM A;  1YJ9 A;  4M7A A;  1G3Y A;  1N9R A;  3RES A;  1VQ8 A;  2F2W A;  1QW1 A;  5CAI A;  3SWN B;  2C06 A;  8ATC B;  4OGC A;  4M7D G;  5D7U A;  5CK9 A;  2GNC A;  2KEA A;  1FMW A;  2YRV A;  1BCO A;  2E5K A;  3D7S B;  5GAN 3;  2DEQ A;  1M90 R;  1B7T A;  1M5Q 1;  3THK A;  3M0T A;  2K2V A;  2DFU A;  3CEY A;  5CKB A;  5KYU B;  2O88 A;  1SSH A;  1WI7 A;  2JN0 A;  3EH2 A;  3SD4 A;  3A8G B;  1XQH A;  2RQW A;  1RAH B;  1G3S A;  1K1Z A;  4VUB A;  3JB9 G;  4F7U A;  2JM8 A;  1OU9 A;  3CC2 A;  1FMK A;  1WHK A;  2AKK A;  1AHJ B;  1CKB A;  3KUF A;  2KVQ G;  2YT6 A;  3CCV A;  2LJ0 A;  3CCS T;  2OTL T;  4B9X A;  2B86 A;  1UGP B;  3M59 A;  4XU3 A;  1F1B B;  5GAN 4;  3S3M A;  2K2M A;  2EVR A;  1K9M C;  2RQT A;  2YUN A;  2JTE A;  5FWC A;  3ZL7 C;  2C0T A;  1ZBJ A;  2DPP B;  3M4Y A;  2YHT A;  1KIK A;  2OJ2 A;  5GAM h;  4BAC A;  2RHX A;  3A8L B;  4PKC C;  4JDS A;  3OYE A;  1M1F A;  2KYB A;  4F7U B;  2DXU A;  7AT1 B;  3EFS A;  1AVZ C;  2P0P A;  1M1K U;  1VQ9 A;  1QCF A;  3OQ5 A;  3CC4 A;  3OYA A;  1C6V X;  1RAB B;  2G3R A;  3MEU A;  5GMK i;  1YI2 T;  4LE9 A;  3E1S A;  2X4J A;  1TSF A;  1WJR A;  4C8Q F;  3FIF A;  2QGF B;  4J9D A;  2ZPH B;  3SWN C;  1ZUU A;  2J6F A;  3TSW A;  2DAQ A;  1VUB A;  3DB3 A;  1WHL A;  1KD1 C;  2PUO B;  3E9G A;  3E19 A;  1EZZ B;  2AK5 A;  4QKU A;  1OPK A;  3MPU B;  2A28 A;  2DJQ A;  3G1J A;  3GF5 A;  2XI9 A;  3LYI A;  3MP1 A;  2BTT A;  2D0N A;  1MMN A;  3GNG A;  1QVG P;  1JEG A;  4M7A C;  2DE0 X;  5IXF A;  2KK4 A;  3ME9 A;  2CRE A;  2HBP A;  4HT8 A;  2O9V A;  3L42 A;  1U1S A;  3CCJ T;  2LTO A;  2ED0 A;  3I5R A;  4AT1 B;  4M7A E;  2MMP A;  2EAY A;  3PNW C;  5LJ5 g;  1AWO A;  2XK0 A;  3G4S Q;  5LJ3 e;  4BE0 A;  1SHF A;  3JCM W;  3M55 A;  2RHI A;  2JXB A;  5GAM d;  2FG0 A;  2YUP A;  1YCS B;  2EGC A;  4PLL A;  1YHQ Q;  3CC7 Q;  1UJY A;  1VQ6 Q;  1UFF A;  2YWW A;  1G3T A;  3NTK A;  4R56 A;  1K73 R;  2WSF E;  1PKS A;  5KE2 A;  4X9C A;  2R57 A;  3G4S A;  1PD0 A;  4JZ4 A;  1PKT A;  3CCL T;  1XNI A;  1H8K A;  1SEM A;  2DXC A;  4E2F B;  3HPW A;  2JVV A;  4F7U E;  4M77 G;  1J3T A;  2VXF A;  4JJD A;  4GLM A;  5GMK j;  4A4F A;  1I07 A;  2LCL A;  1VQ6 A;  1YHQ A;  3CC7 A;  4Y91 A;  4OF1 A;  1M1K C;  2CZ1 B;  3PIP A;  1NYF A;  2HZY A;  2GQV A;  3S3O A;  2PNI A;  4X34 A;  1Q86 R;  4OML A;  3X24 B;  3JAM E;  1Q81 U;  3CCR T;  2XDD A;  4JS4 A;  2DRM A;  2ZCF B;  4J9G A;  1NBE B;  2RO0 A;  3CCE Q;  3MEV A;  5C0M A;  1UHC A;  2D8H A;  1R0B G;  2DK3 A;  3MEW A;  2RF0 A;  1QCO A;  2L3Q A;  4O5V A;  4EMK A;  3M58 A;  1H3Z A;  1AWJ A;  3OS5 A;  2HQE A;  2YUO A;  1Z9Z A;  1WGS A;  5A0D A;  2HAX A;  3A8O B;  4J7I A;  1UHF A;  4LDV A;  1X27 A;  2QEX Q;  2EYQ A;  2H3E B;  2E3H A;  3RIR A;  4OP0 A;  3QZ5 B;  1KG1 A;  1CKA A;  2ECZ A;  3WXM B;  3I56 A;  1H64 1;  1M9S A;  2X3W D;  5FRM A;  3AHU A;  4MZM A;  3CCE A;  2PVG B;  3JCM X;  5KE3 A;  4MDW A;  3ZFJ A;  3HSB A;  4C5I A;  4EMK B;  5GAN 5;  1PSE A;  2QEX A;  3M0P A;  3OB9 A;  2MWP A;  3JCM J;  4ANJ A;  1YWO A;  3EG9 A;  3F70 A;  5I22 A;  1RLQ C;  2VB6 A;  4HT9 A;  2KQW A;  2KT1 A;  4JUV A;  4M4Z A;  4XU2 A;  2E6N A;  1O75 A;  3Q1J A;  4PJO A;  2O9S A;  1Y0M A;  1AWX A;  4XTV A;  1WNL A;  4QW2 A; 
#chains in the Genus database with same CATH homology
 2Y4Y A;  5A0L A;  1M90 C;  4ZTJ A;  4M78 G;  3VKI A;  2R58 A;  1FX7 A;  3CMA T;  4YTL A;  5GAN e;  2RI3 A;  2DTH A;  3GOX A;  3CPF A;  5FRN A;  2FHD A;  2QQR A;  2K4Y A;  5L8R E;  4E47 A;  4NOY A;  3CD6 T;  2EJF A;  3QKJ A;  3LLR A;  4IUV A;  5LJ5 j;  1MGQ A;  2M16 A;  4JJN K;  3OYL A;  5CVI A;  3V7S A;  3CCR A;  4JLG A;  4LDX A;  3MP8 A;  1YBY A;  3QYG B;  2JUF A;  1M90 U;  4M7A F;  5CKD A;  1JB0 E;  4M7D D;  4LD6 A;  4C5E A;  5M9O A;  3JCM V;  4BE1 A;  4R55 A;  3JCM f;  3OS2 A;  1Y7X A;  5GAN j;  3QUI A;  5GMK e;  1YJN A;  3MP6 A;  2HNI A;  2MWO A;  4QQG A;  4Z02 A;  4C92 A;  4PJO B;  4M75 F;  3OMC A;  1UGQ B;  4A4G A;  1ZBX A;  3CXC S;  4DOW A;  3CXC A;  2CS7 A;  3FLG A;  4M78 C;  3PIO A;  1UGR B;  1XTD A;  2DXB A;  2FB7 A;  2RD1 A;  3LH0 A;  5D6W A;  4BI4 A;  4M78 A;  5J26 A;  1VIF A;  1VQN T;  2DXT A;  3JB9 H;  1KHC A;  2KDS A;  2A3L A;  4M7A B;  3VYH B;  2RB6 A;  4HA8 A;  4DOV A;  2D6F A;  4GY5 A;  1NE8 A;  4A4H A;  1S72 T;  2RM4 A;  3DLL A;  1G5V A;  3OW2 S;  3OA6 A;  2E41 A;  1VQ7 A;  3JB9 D;  2CZ0 B;  5DM7 R;  3PMI A;  3L2U A;  1YJ9 T;  1VQ5 T;  2EJG A;  4M78 E;  3HRT A;  2RI5 A;  4Q5W A;  3T9N A;  4IUQ A;  3V7R A;  3KXT A;  1VQ8 T;  3JCM g;  2RI2 A;  4M7D A;  3NTH A;  2PVO B;  3UPU A;  5DLO A;  5CQY A;  4E7I A;  1W2B A;  2QA4 A;  2BIV A;  5KH6 A;  4F7U F;  3S3N A;  1FWZ A;  2F5K A;  3PMT A;  4B9W A;  1YJW A;  2D9T A;  2RJF A;  2H3J A;  4C92 B;  2K5L A;  1LJO A;  4J6W A;  3C4S A;  2VGM A;  4C8Q C;  3VYG A;  4EMK C;  4E7J A;  1Y71 A;  4A54 A;  2JNG A;  2M0O A;  3V8J A;  5DY9 A;  3OYH A;  2GCX A;  1WJS A;  2L8D A;  1OZ2 A;  1M8V A;  3JCM Q;  3QZ9 B;  3QJY A;  5GAO q;  3FJP A;  4FIB A;  4FU6 A;  4M77 C;  1M4Z A;  3JCM d;  1I8F A;  3J80 E;  1UGS B;  1V29 B;  2BUD A;  2ZGW A;  2JOY A;  2L5Q A;  2FYK A;  2LCC A;  2ZPF B;  1N8R C;  4DQ2 A;  1VQO T;  3BDU A;  4IUT A;  4C8Q E;  2HD0 A;  4LDW A;  3OYY A;  4RCC A;  4RKU E;  4KUD K;  5CQX A;  2DKG A;  2KY9 A;  4PJO G;  3FB9 A;  3S6W A;  2QQA A;  1BYM A;  1I5L A;  1OYX A;  4M7D B;  5FU6 B;  2P4T A;  3PGG A;  1KC8 C;  4BUG A;  4M77 E;  1KQS A;  2MF2 A;  3OMG A;  2QTX A;  1VQ7 T;  2WAC A;  1N8R U;  1WPY A;  3HFO A;  4J83 A;  3CC2 T;  5D6Y A;  3CD6 A;  3JB9 F;  4D6W A;  2OAU A;  5LJ3 h;  3JB9 J;  2CZ7 B;  3CCU T;  4II1 A;  3CCV T;  1KQ1 A;  3MO8 A;  4M7A G;  1BKB A;  5A2Q E;  3M4G A;  2XG8 D;  3CCQ T;  2XDB A;  1UEB A;  5CKF A;  5LL6 S;  5HK0 A;  1RI0 A;  2E6Z A;  4C0Z A;  4KT0 E;  3OYC A;  5I2M A;  5J3B A;  3HFN A;  4XK8 E;  5GAN 8;  1YJW T;  4E7L A;  2ZPG B;  2DVE A;  1B34 B;  3M56 A;  1KC8 U;  5GMK l;  2QXF A;  3R6O A;  5GAN 6;  3BFM A;  4J6Y A;  4XTU A;  3HP9 A;  5CKE A;  3SDZ A;  3SB2 A;  2DZ9 A;  2EQM A;  4N0A A;  3SWN A;  5I2S A;  4CRI A;  4NL3 A;  3QSU A;  4M75 G;  3I55 T;  5HK3 A;  4M75 D;  5GAM f;  2EWN A;  2R5M A;  1KHI A;  4FT2 A;  3OYI A;  5GMK h;  3J7A F;  4PJO C;  3QHS A;  3HRS A;  2K57 A;  4C92 G;  3GLX A;  3OBW A;  1VQK T;  2F69 A;  3FRN A;  4FM4 B;  4BDZ A;  1IZ6 A;  1VQN A;  3M57 A;  4KBM B;  4RG2 A;  1MHN A;  2DD4 A;  1X6O A;  2QDY B;  3WVE B;  2ZPI B;  3LW5 E;  2QQS A;  3QG1 A;  3J81 E;  1BI3 A;  3QO3 A;  2BKD N;  4JRQ A;  3NFC A;  1S72 A;  3OSV A;  1BIB A;  3LGF A;  3SFM A;  1OZ3 A;  4NS5 A;  4E7K A;  5CIU A;  3M53 A;  3RKW A;  1KD1 U;  4LD9 K;  4LDU A;  1XOV A;  1DJ7 B;  2B8A A;  3OYD A;  3X28 B;  5LJ3 f;  1VQ9 T;  4FT4 A;  3TRE A;  2P0Q A;  3LWH A;  3CC4 T;  2E65 A;  1VQP T;  1VQ5 A;  1YJ9 A;  4M7A A;  4PJO E;  2GFU A;  1G3Y A;  1N9R A;  4PL6 A;  3RES A;  1VQ8 A;  1FXX A;  3PT9 A;  4EMH A;  2OTL A;  2V8J A;  2HQX A;  2ZPE B;  5GAO r;  1QW1 A;  1U1T A;  5CAI A;  3SWN B;  2L89 A;  3CPW S;  2C06 A;  2ZZD A;  5GMK m;  4OGC A;  5FU7 B;  3JCM P;  4M7D G;  4JRK A;  1K73 C;  5HKC A;  1YIJ A;  3RER A;  1K8A C;  4M75 A;  5CK9 A;  2XDP A;  3L1A A;  4LDY A;  4A53 A;  4HKE A;  5IAY A;  2O01 E;  3O8V A;  3QYH B;  1BI0 A;  2K5I A;  2YRV A;  4MML A;  4C92 C;  2O4X A;  3TCJ A;  2E12 A;  5GAN 3;  2LX9 A;  2RJD A;  3C94 A;  5CO7 A;  2DEQ A;  1JJ2 S;  4ATO A;  5IN1 A;  3GP8 A;  1M5Q 1;  1JJ2 A;  1WJQ A;  1LNX A;  2GF7 A;  2K2V A;  4XTZ A;  4QVD A;  1TH7 A;  4BD3 A;  3CEY A;  5CKB A;  3CBO A;  5LJ3 g;  1VQO A;  1K73 U;  2V8K A;  2VXE A;  1K8A U;  3JCM c;  4ZGD B;  2E70 A;  3N5B B;  2JN0 A;  4E7H A;  3SD4 A;  1Q7Y U;  4C92 E;  3OYN A;  3A8G B;  3RMS A;  4XQ3 A;  1XQH A;  5HY6 A;  1G3S A;  4FL6 A;  3OYG A;  2LDM A;  4VUB A;  3JB9 G;  3C12 A;  2LRQ A;  3V8L A;  4F7U A;  3OW2 A;  4NL2 A;  1Q86 C;  3CC2 A;  4M7D C;  5FU6 C;  1AHJ B;  4ZGE B;  4X9D A;  3KUF A;  3CCU A;  2KVQ G;  1N6A A;  3CME A;  2RK2 A;  4M75 B;  4C8Q D;  4XTW A;  3CCS T;  3CCV A;  5LJ3 d;  2OTL T;  3LGL A;  4B9X A;  3OS0 A;  1UGP B;  3M59 A;  3CCQ A;  4HCB A;  4BDY A;  4UC4 A;  4XU3 A;  4P5N A;  1U8R A;  2LVM A;  2X4W A;  5GAN 4;  2O4X B;  3S3M A;  1IRE B;  1K9M C;  1OI1 A;  2EQU A;  1W4S A;  1YIJ T;  3GPL A;  1VQM A;  2PUK B;  5GAN 2;  1Q86 U;  2RHY A;  3TU4 K;  3I55 A;  4M7D E;  2FVU A;  4FSX A;  2MAM A;  1R8O B;  2IVW A;  1G3W A;  4M78 F;  3RKX A;  2DPP B;  3M4Y A;  3G7Z A;  1B34 A;  2VUB A;  2YHT A;  3FC3 A;  2CGH A;  2LT1 A;  4L59 A;  5GAM h;  3OYF A;  4BAC A;  4J7F A;  1VQK A;  4XU1 A;  3JRZ A;  1VQ4 T;  1K9M U;  4OB1 B;  3OBY A;  2YLB A;  2RHX A;  3A8L B;  4PKC C;  4JDS A;  3OYE A;  1M1F A;  4BI8 B;  4F7U B;  3HL8 A;  5LJ5 h;  2CYZ B;  2PVD B;  2DXU A;  4OB3 B;  2VGN A;  1QVF S;  1ZQ1 A;  4CI0 C;  1N9S A;  2P0P A;  3EFS A;  3CBM A;  2E10 A;  5D6X A;  3OYK A;  1M1K U;  1VQ9 A;  1VQP A;  3GIB A;  3OQ5 A;  2VYT A;  5KCO A;  5GAO p;  3CC4 A;  5EG2 A;  2JTF A;  3WVD B;  3OYA A;  1Q82 U;  1QP2 A;  3E9F A;  3C95 A;  2RJC A;  3G6E A;  2G3R A;  4MZP A;  3L2V A;  4WF2 A;  3MEU A;  5GMK i;  4PLI A;  5GAN h;  2LNV A;  2LQ8 A;  3OYJ A;  4QVC A;  3G4S T;  1Y96 A;  3CME T;  3E1S A;  1YI2 T;  2X4J A;  2D0Q B;  3ZBD A;  1WJR A;  4C8Q F;  3FIF A;  2FL7 A;  2JTM A;  4L6V 5;  3FDR A;  4N4H A;  3CCJ A;  4QQ6 A;  5I21 A;  2LQK A;  5J39 A;  4DA4 A;  2ZPH B;  1BIA A;  4N0A C;  3SWN C;  4OGE A;  3ER0 A;  5FU7 C;  2RH2 A;  3BDL A;  4M77 F;  2DAQ A;  1VUB A;  3DB3 A;  2K3X A;  1NPR A;  2XID A;  1NJI U;  3GNF B;  4KUL A;  3X20 B;  2PUO B;  5FLX E;  1P92 A;  3VV0 A;  1KD1 C;  3CC7 T;  1VQ6 T;  3E9G A;  4BE2 A;  2E5Q A;  2PQW A;  5A0G A;  3QDR B;  3E19 A;  1GXI E;  3OSS C;  1RL2 A;  1HXD A;  3P8H A;  5LJ5 f;  2A7Y A;  1JRI A;  3GF5 A;  4C0D B;  3L2R A;  2JZ2 A;  2XI9 A;  3LYI A;  3PFS A;  3QJ6 A;  2DTI A;  4C8Q B;  5GAO m;  3MP1 A;  3OY9 A;  4QVZ A;  1N27 A;  4C0F A;  2CKK A;  1HK9 A;  4V2S A;  3GNG A;  4OB0 B;  2XD0 A;  1I81 A;  2OTJ T;  2AHJ B;  4ELZ C;  4M7A C;  1Y96 B;  2F5T X;  2XKO C;  5GAN f;  2X4X A;  4J8O A;  2KK4 A;  3JCM b;  3ME9 A;  1EIF A;  3EAE A;  4BY6 B;  5CR2 A;  3CCS A;  3G6E T;  3X25 B;  3UWN A;  4XTY A;  4F7U G;  2HBP A;  1WQ7 A;  5KCH A;  2K3Y A;  4HT8 A;  3HKS A;  5GAM g;  3M9Q A;  5FRO A;  4M75 C;  2DTO A;  3BY7 A;  3X26 B;  3L42 A;  4XAX B;  4EPC A;  3CPW A;  1U1S A;  3CCJ T;  4JRP A;  1SSF A;  2WSC E;  2LTO A;  2M9U A;  4PNO A;  2MMP A;  4M7A E;  3MHX A;  2EAY A;  3PNW C;  5LJ5 g;  4N4I A;  4N4G A;  3I56 T;  2XK0 A;  2RK1 A;  4C0G A;  4M78 D;  3ZEH A;  1Q7Y C;  3A5Z B;  4C5H A;  1I4K 1;  5GAM j;  4J5Y A;  3QPH A;  4RCB A;  4PJO F;  1UB4 A;  2KSS A;  4ZN1 A;  5LJ3 e;  4BE0 A;  3JCM W;  3M55 A;  3EFR A;  3VU3 C;  4BI3 A;  2CZ6 B;  4C5G A;  3QII A;  3CCE T;  2RHI A;  4JLI A;  4M75 E;  2QI2 A;  4MMK A;  4EDU A;  5CCA A;  1VQ4 A;  4QQD A;  5GAM d;  5GAN g;  3BW1 A;  3JB9 I;  1LOJ A;  3HRU A;  5C6S A;  2RA2 A;  3ASK A;  4OMF B;  3H6Z A;  4PLL A;  5IT9 E;  5DLQ E;  2EIF A;  5LJ5 d;  3G71 A;  3CCL A;  1G3T A;  3NTK A;  4R56 A;  3JCM e;  3OYM A;  2QEX T;  5LJ3 j;  2WSF E;  1VQM T;  4A4K A;  2K5F A;  1QP3 A;  2DZC A;  1VQL T;  4JS5 A;  4IKF A;  2DD5 A;  1YIT T;  5GAN 7;  3CBP A;  3RMQ A;  4O6J A;  5KE2 A;  4C8Q G;  4X9C A;  2R57 A;  1YI2 A;  3G4S A;  3P8B B;  5CKH A;  5GAN d;  3RKY A;  3CCL T;  2QQ9 A;  3M54 A;  5AYF A;  1XNI A;  2DXC A;  2Y4X A;  4C92 F;  2DJZ A;  2JVV A;  3HPW A;  3MEA A;  4F7U E;  4M77 G;  5GAO n;  3LWI A;  3OS1 A;  3H8Z A;  4M77 D;  1Q81 C;  2VC8 A;  2VXF A;  2YLC A;  2XHC A;  3INZ A;  5GMK j;  4A4F A;  2EFI A;  2LCL A;  2RJE A;  1VQ6 A;  1YHQ A;  2RHZ A;  3CC7 A;  4HCC A;  4Y91 A;  2NLU A;  4OF1 A;  2CZ1 B;  3V8K A;  3TEE A;  3PIP A;  1M1K C;  4ZTF A;  2I2L A;  1BI1 A;  4A4E A;  1D3B A;  2XIC A;  2GQV A;  3DB4 A;  1Q82 C;  3S3O A;  2ZPB B;  4X34 A;  1W2B S;  3V7C A;  2LC4 A;  3X24 B;  3JAM E;  3CCR T;  1Q81 U;  3FEO A;  4OB2 B;  4RMO A;  2XDD A;  4JS4 A;  2DIG A;  1Y07 A;  2ZCF B;  1QVG S;  1X75 C;  2EQJ A;  1QVG A;  4C0D C;  3VUZ A;  3CCM A;  2RO0 A;  2DO3 A;  4ZGJ B;  5GAO l;  3MEV A;  5C0M A;  4M7D F;  2OTJ A;  1QVF A;  3G71 T;  2DK3 A;  3MEW A;  4ZN3 A;  4O5V A;  1X01 A;  4ELY C;  1BI2 A;  4C8Q A;  4EMK A;  1QVP A;  4HCZ A;  3M58 A;  1H3Z A;  1YJN T;  4QW2 A;  4GLK A;  2Y90 A;  3OS5 A;  4M78 B;  3L2W A;  2HQE A;  2EJ9 A;  1WGS A;  1NZ9 A;  5A0D A;  2HAX A;  1NJI C;  2IG0 A;  3A8O B;  2WSE E;  4J7I A;  2M1H A;  4LDV A;  4M77 A;  1KQ2 A;  2E1H A;  4BY6 C;  4XU0 A;  2EYQ A;  3L2Q A;  2RHU A;  4TVR A;  4XTX A;  3URG A;  3RIR A;  1YCY A;  2LT4 A;  1JBM A;  4OP0 A;  3QZ5 B;  1KG1 A;  2L3R A;  3WXM B;  3KBG A;  4L5G A;  2V8I A;  2GFA A;  1H64 1;  1M9S A;  3I56 A;  4PJO D;  1D3B B;  4JRI A;  3CMA A;  2KMT A;  4IUP A;  3UDC A;  3QXE B;  1KQS S;  5FRM A;  3AHU A;  4MZM A;  1YHQ T;  3L2Z A;  2PU9 B;  2QQB A;  2XU8 A;  3M5A A;  3CCE A;  3HHT B;  2PVG B;  4BB7 A;  3JCM X;  5KE3 A;  4MDX A;  4MDW A;  3ZFJ A;  3HSB A;  4C5I A;  3A8H B;  3NTI A;  3MET A;  3RUX A;  4M7A D;  2MI6 A;  1ZHI A;  1WQW A;  3JSC A;  4OVA A;  4EMK B;  2QA4 T;  5GAN 5;  1PSE A;  3A8M B;  4ME7 A;  4RG8 A;  2EKO A;  3PTA A;  4Y28 E;  3DKM A;  3DLM A;  3P8D A;  2QEX A;  3CCM T;  3OB9 A;  3LX7 A;  2MWP A;  1VQL A;  1VIE A;  4M77 B;  3JCM J;  5GAM e;  1YIT A;  2R5A A;  4KUI A;  3F70 A;  2EQK A;  3JCM h;  2X4Y A;  1O9S A;  4IUR A;  4MZT A;  1NPP A;  4HT9 A;  2KQW A;  4JUV A;  4XU2 A;  3VJP A;  3VUB A;  4EMG A;  2E6N A;  1O75 A;  2P0K A;  3Q1J A;  3QBY A;  1M1G A;  3UT1 A;  4C92 D;  5LJ5 e;  2X35 A;  3OYB A;  1PSF A;  4PJO A;  2VV5 A;  4J6X A;  4IUU A;  4XTV A;  2DIQ A;  3MCA B;  1WNL A;  2E64 A;  2KAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...