3SWNC

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
68
Chain Sequence
LDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRLTGAIRKLGLVVVRGTTLVLIAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm7
total genus 10
structure length 68
sequence length 74
chains with identical sequence F, O, R
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnC00
2I2LA 3RIRA 4EMGA 3BW1A 4C92F 1U1TA 4M7AC 2RD1A 3L1AA 4N0AA 4M78B 4HT8A 4PJOC 3BY7A 4NL2A 3RKWA 3QSUA 3QHSA 3JCMV 4J5YA 5GAN2 3JCMd 4M77F 4X9DA 4M7AB 3JCMP 4M75B 2DJZA 4M7AA 4M77D 2EJFA 4M78C 4M7AG 3EFRA 4JUVA 4PJOB 1H641 2ZGWA 4Y91A 4JLIA 2EAYA 4C8QF 3JB9D 4V2SA 3SWNC 4XTUA 4M7AE 2DXUA 4C92D 5GMKh 2QTXA 4XTXA 5GAN4 5GAOp 5GAOn 5GANh 4M77A 4PJOE 2DVEA 4XU3A 4XU1A 3SB2A 4N0AC 2VC8A 3SWNB 3M4GA 1B34A 1JBMA 1I4K1 1Y96A 3V7RA 4M77E 5GMKe 5GAMj 4M78E 4HT9A 3HFNA 2RM4A 2E1HA 5LJ3j 5GAMg 3FB9A 3JB9F 4JRKA 2K57A 5GAN5 4NOYA 1WNLA 4M7DD 3JCMe 4J6WA 1LOJA 4XU0A 2YHTA 4X9CA 2RB6A 2HNIA 3V7SA 3RKXA 4XTVA 3EFSA 4F7UE 4M77C 5LJ5e 4XTZA 4MMKA 1D3BA 3RERA 4M7DG 5LJ3d 5GANf 5DY9A 5GMKi 3AHUA 4RCBA 4EMHA 4M7DA 1HXDA 2FB7A 4WF2A 5GAN6 4M78D 4PJOF 5GAN7 4M75E 1LNXA 5GAMd 3BFMA 4A54A 3JCMJ 2DZ9A 4F7UF 4M7DE 3V8KA 3JB9G 4EMKA 4M75G 3HSBA 2DKGA 1BIBA 1M5Q1 5CAIA 5LJ5j 3JB9I 4NL3A 2DTOA 5LJ3g 3PGGA 3JCMb 2E10A 2CGHA 4XU2A 4DQ2A 4F7UA 4M78F 4PJOD 3JB9J 4M75C 1JRIA 1N9SA 3FIFA 4M7DC 4EMKB 4M77G 3RKYA 1WPYA 4M7AD 4M78G 4C8QG 3V8LA 5GAMf 3JCMQ 2VXFA 2JN0A 1Y96B 3FJPA 3HFOA 3V7CA 3JCMg 5LJ5g 4M7DB 2VXEA 4EMKC 4M7AF 4M75D 2E41A 5LJ3f 4C92G 5LJ5d 1HK9A 4C92A 5GANd 2EWNA 4OP0A 5GAN3 1U1SA 4J6XA 3QUIA 4C92E 4F7UG 4XTYA 1KQ2A 3V8JA 3JCMX 4QVCA 2FYKA 2DXTA 2DTHA 1MGQA 4M75A 3VU3C 4QVDA 1B34B 2DTIA 5GAOq 4C8QA 5GAOl 3JB9H 5GANj 2Y90A 5GMKl 1YCYA 1TH7A 4J6YA 4C92B 1D3BB 5GAMe 5GMKj 5LJ5f 3BDUA 3GIBA 3JCMW 2E64A 2YLBA 3JCMc 1N9RA 5GAOr 5GAN8 4C8QC 2DEQA 4C92C 5GANe 4M77B 1I5LA 4A53A 1LJOA 4M75F 3RUXA 5LJ3h 4C8QD 5LJ5h 4MMLA 1M8VA 3QO3A 2RA2A 1WQ7A 4JRIA 3INZA 3RESA 5I21A 2DZCA 4C8QB 3L2ZA 4RCCA 4XQ3A 4PJOG 5GAMh 5GANg 2EJ9A 4HA8A 2YLCA 4M7DF 3JCMh 2EJGA 3JCMf 4C8QE 4F7UB 5LJ3e 1X01A 2E65A 5GAOm 4XTWA 4M78A 5GMKm 1I81A 1BIAA 1KQ1A 1WQWA 4PNOA 3SWNA 1I8FA 4PJOA
chains in the Genus database with same CATH superfamily
4ATOA 3LGLA 3P8DA 5KYUA 4F16A 3OSVA 3BY7A 3UA7A 1SG5A 4OMMA 4M78C 4PJOB 1XNIA 1E6HA 5KYUB 2LP5A 2DXUA 2QTXA 1AWOA 5KE2A 1F1BB 1Y96A 3KUFA 4HT9A 1VYTA 1GCQC 1K0SA 3JB9F 4JRKA 3OBWA 2DO3A 1BI3A 4HCBA 3CQTA 3QJ6A 3NFCA 1W70A 4JPBW 3CCSA 1YI2A 1QWFA 5IH2A 3CPFA 3VS5A 3M0UA 3RMSA 1BIBA 3OSSC 4FW1A 1H92A 8AT1B 5CVIA 2XG8D 1UECA 3PGGA 1UE9A 4M78F 4PJOD 2GFAA 4M75C 2HSEB 3V8LA 1N8RU 2X3XD 2E41A 2D8JA 4F7UG 4R0KA 2HEQA 2E5QA 2NUPA 2DTHA 3S3MA 5FWCA 3JB9H 2BE9B 1G5VA 3I56T 3A1PA 3OB9A 3GIBA 1C0MA 1G8XA 2LJ0A 5EG2A 3JCMc 5GAOr 2RO0A 1MMNA 3UT1A 1VQ7T 2E12A 3L2UA 4D6WA 4ZGDB 1WQ7A 3L2ZA 1VQ8A 1VYUA 4RG8A 4JS4A 2GF7A 1AHJB 4ZTFA 1EFNA 3MEUA 3X24B 4M78A 3OS1A 2QGGA 1QKWA 2NUZA 2CUDA 3HPWA 1IB8A 3JSCA 2KXDA 4J5YA 3ZEHA 1C6VX 4M7AA 2L3PA 1PWTA 2AHJB 4JJNK 2QK0A 3M0PA 4XTXA 3VS6A 1R0BG 4E7HA 3SWNB 1Z9ZA 3PIOA 3QIIA 2E1HA 2LT4A 1YI2T 1JJ2A 2LTOA 4D8KA 2VYTA 2HQHA 5GAN7 4AG1C 3BFMA 3EHRA 1ACMB 3URGA 4AFQC 2K5FA 1X43A 2O4XB 2PVGB 1GCPA 2HQEA 2QDYB 2DL8A 2JNGA 1S1NA 4ZGEB 1ZHIA 4QQDA 5LJ5g 1VQMA 2WSEE 2D6FA 5CKHA 2EQUA 1HK9A 2KQWA 4OP0A 4FSSA 3SHWA 2V8KA 3V8JA 4AFSC 3AT1B 3G7ZA 2X4XA 4C8QA 1QCNA 4J6YA 1BI2A 1KD1U 2XHCA 1VQ6T 3H41A 4M77B 4RTWA 2QA4A 3H8ZA 3RESA 3MHXA 3OYNA 1YIJQ 2EJ9A 3MJXA 3QBYA 3VS2A 3M53A 1NJIR 2BIVA 1VIFA 1WHLA 2DLPA 4RTYA 5C0MA 2K5IA 4RUGA 3GLXA 1D09B 1AWJA 2R57A 3UWNA 1RABB 3L1AA 3CMET 3JCMV 3ME9A 3CCVA 1QP3A 4FIBA 3JCMd 2L2PA 1R77A 3P8HA 2FHDA 4JZ3A 5DM7R 3VS1A 4C92D 1AD5A 3OYGA 5GAOp 3R6OA 1H8KA 1FMWA 1UHFA 2ECZA 2VC8A 4QT7A 2QASA 3FB9A 5CK9A 2HNIA 4PK4A 1PC0A 1X6BA 4M77C 9ATCB 4FYWB 3PMTA 4OB0B 2W0ZA 3C94A 3OS5A 2FB7A 1ZLMA 2GFUA 2H3JA 3QKJA 1N5ZA 1Y71A 4L59A 3MEVA 1WA7A 1RI9A 5CKFA 3GPLA 3JV3A 1YJWA 3TU4K 2DVJA 2KRSA 3CBOA 2LQ8A 4NL3A 2JW4A 3JCMb 1WHJA 2YRCA 1GRIA 4J83A 1TUGB 2FEIA 2L8DA 4HXJA 1YJWQ 2K79A 2YSQA 7AT1B 2QQBA 4DOWA 1D0XA 1B34B 3OYCA 2DTIA 3DLLA 1MUZA 3EGXB 4B9WA 1WI7A 4LXCA 2PVOB 4E7SA 3QPHA 3PE0A 1LJOA 2KE9A 1RUWA 3WXMB 3CXCA 1E6GA 2V8JA 5KYWB 1SRMA 3VV0A 3CCQT 1N8RC 2FO0A 2FVUA 3CCUT 1G3WA 3RIRA 1V1CA 3BW1A 2MI6A 2JM9A 4DEXA 5GAN2 3EH2A 4X9DA 4HVWA 1UJ0A 2RQRA 2A7YA 3VS3A 1XQHA 1ZSZB 2EIFA 3UA6A 5A0DA 1MV3A 1OPLA 1JQQA 4M77A 1KK7A 5IHNA 1QW1A 1JBMA 3L2WA 2PZ1A 1ZSZA 1Y57A 2F2WA 1S72T 3OYYA 2QG9B 2C06A 1GFCA 1X2KA 2QEXA 2M51A 2K57A 4NOYA 4J8OA 1O75A 5I2MA 5CIUA 4CC7A 2DL3A 3EFOA 4XTVA 2YUPA 4XTZA 1Q86R 3QDFA 2P0QA 3A8LB 2CREA 2LNVA 1SSHA 4OMQA 2KVQG 1YJ9Q 3I56Q 4PJNA 4DBRA 2RQTA 3M9QA 4BE2A 2IIMA 5D6YA 3CMAQ 2O88A 1CKBA 4IURA 2OI3A 3JCMQ 1YNZA 3NTKA 1VYVA 3EG3A 2JMAA 4Q5WA 1PKTA 1TUDA 4WCIA 2RHUA 4Z88A 1KG1A 1IZ6A 4J6XA 3E9FA 1NJIC 1K0XA 2CP6A 3H0IA 3CXCS 4PJLA 4OB2B 1JB0E 2O9VA 4Z89A 3ZL7C 1Q81C 5KH6A 1QVFP 5GANe 5FRNA 2RJEA 2RHXA 1M8VA 3M59A 3INZA 1VQKT 3CC7T 2COZA 2P0PA 3ZBDA 1WZOA 2QQSA 4EDUA 4C0FA 2DBMA 2KAFA 3EAEA 1M1FA 4PJOA 2HDAA 4EMGA 2RK2A 1KC8C 4II1A 3FDRA 4HKEA 1YJ9A 3UF4A 1M90C 2XDPA 1NE8A 2E5KA 2E70A 2X51A 3CCJA 1VQNQ 2K7AA 2OTJA 5GMKh 2OTLT 5KYXB 2CT3A 4M78E 4C0DC 1TS9A 3EG0A 3P8BB 2ZPEB 1OU8A 4HVVA 3SD4A 3VRZA 2XK0A 4M7DG 2E3HA 1NM7A 3ASKA 3C95A 2KNBB 4GLMA 2L0AA 3CCRA 3OYBA 2J06A 2NUPB 2DTOA 1PSFA 1S72Q 2YDLA 3I5RA 3EH1A 3HRUA 2CSQA 3M0TA 1IHWA 2QI2A 2CZ7B 2ZAEA 4C92G 4LD9K 3M55A 4FW2A 4LDXA 1W2BA 1VA7A 2A0FB 3CBMA 2L3QA 2NWMA 4RTZA 1NEBA 2E4HA 1O9SA 1I5LA 3TCJA 2EYYA 2RA2A 3MP1A 4LUDA 2E6ZA 2DD5A 3FC3A 1QMCA 1VQLQ 4HA8A 1WJQA 2VKNA 1Q95G 2EJGA 1ZBXA 2ED1A 2QQ9A 3E19A 1PNJA 2A28A 3GF5A 1VQ5A 3OYIA 4CC2A 2EKOA 1JO8A 4JRPA 4C92F 2QQRA 1X69A 3QWXX 4GY5A 4ZNXA 2J05A 2HBWA 1OX9A 2MPXC 2CS7A 1PG5B 4ZGJB 2M1HA 1K8AU 4M7AG 2ZGWA 2K5LA 4JLIA 3OYLA 1Q86C 5J39A 4BI3A 4BB7A 2DYBA 2JT4A 3M0QA 4ORZA 1UDLA 5AT1B 4DBHA 3LH5A 1JJ2S 3I9QA 1WNLA 2DYIA 1TXQA 2JTFA 1JXOA 4IUUA 5I11A 3RKXA 4F7UE 3EFSA 1NYGA 1TG0A 1VQ9Q 4KULA 1QVGA 3EG2A 3L42A 4WF2A 2DNUA 1K9MU 3CC7Q 5GAMd 1B3QA 3CCUQ 1VQPQ 1ZX6A 2F2VA 2R58A 4EIKA 3EG9B 2XDDA 1SHGA 4OMOA 3X26B 1UHCA 4F7UA 3FIFA 5KYYB 5I22A 2RI5A 1T3SA 1OX8A 3A8GB 5CO7A 4M75D 5LJ5d 1JEGA 1YJNT 4C92A 2EWNA 2HZYA 2DL4A 5J3BA 3CEYA 4KUIA 4M4ZA 1KQ2A 1A0NB 1WGSA 1K8AR 2OTJT 1FX7A 4C5HA 5GAOl 2DMOA 2MF2A 4DEYA 1YCYA 4C92B 4GLKA 4F17A 5LJ5f 4E6RA 4BE1A 1D1AA 5GAN8 4C8QC 2DL7A 4R55A 2X4WA 3BE3A 1KJWA 3H9NA 2AKLA 2E6NA 2EYZA 3GNGA 2NLUA 3M0RA 4RG2A 2EKHA 5ECAA 2MK5A 1HSQA 2EW3A 3DB3A 3VS0A 1NEGA 1MMDA 4HVUA 2FPDA 3OMCA 4A4KA 2ATCB 2K9GA 1VQ6Q 3NTHA 1M3AA 3MP6A 2KYMA 5FU6B 1NJIU 2CP7A 4XTUA 5A2QE 1BCOA 2JXBA 2JJ9A 2WACA 3EGDA 4QVDA 3SB2A 4N0AC 5IAYA 1K73R 4OB3B 1Q7YU 4CI0C 2ZPGB 1B07A 1YP5A 4QVZA 1G2BA 5KCOA 3OYEA 4OMFB 2OTLA 2CUBA 2M0YA 4J6WA 1R8OB 3M5AA 5GJWB 2YHTA 1VQKA 3M0SA 3V7SA 4E7IA 1B7TA 1OEBA 2O01E 2O2OA 1QQJA 3CPWA 3CC4T 2RHIA 3V8KA 3MP8A 3PT9A 3PFSA 1K8AC 5LJ5j 2HKQB 5LJ3g 3CMEA 3NGPA 3NMZC 1N9SA 2P4TA 3PIPA 4LDYA 2JTMA 3OBYA 2VXEA 4LD6A 2DPPB 3RBBB 5FLXE 1WX6A 3LX7A 1VQPT 5CKEA 2B86A 4HCKA 3LGFA 4KGVB 3VUBA 3G6ET 2PQWA 4BDZA 2PNIA 5FU7B 4ZN3A 1QVFA 3OYMA 2OJ2A 3OYKA 3QYHB 2KYBA 2VB6A 1N8RR 4AMCA 1IXDA 5AYFA 3EFOB 2JOYA 1AVZC 3CCUA 4DA4A 4M7DF 2LQWA 1AEYA 2LQKA 4C8QE 1QVPA 1G3TA 5IXFA 2YUOA 1QVGP 1LCKA 1ARKA 1M4ZA 2DERA 5A0GA 4ZN1A 3A8HB 2LJ3A 3G1JA 2AKKA 3CBPA 3I55T 4M7AC 3OYHA 4N0AA 1VQ5T 1OOTA 3G4ST 5KYXA 3A8MB 4N4IA 3EG9A 3JCMP 2CP5A 3QYGB 3CPWP 5KE3A 1FYNA 4OVAA 1YI2Q 1M3BA 4OB1B 3L2QA 1M3CA 4BY6C 4E7KA 3MO8A 3H6ZA 3SFMA 4M77E 3MPUB 1M1GA 4JRQA 1SRLA 2RQWA 2HL5C 3CMEQ 4J7IA 3I35A 1HYOA 1RLQC 1RAEB 1NLPC 3RR6A 4E2FB 1D3BA 5LJ3d 4RCBA 4M7DA 1LPLA 1QVGS 3G4SQ 4M78D 4PJOF 4KBMB 4A54A 1X75C 4AT1B 2LJ1A 4BI8B 4FYVB 3SEMA 3EGXA 4PFZA 2VVKA 2JUFA 1KIKA 2ZPBB 2X9HA 2D1XA 4XU2A 4Z8AA 2AT1B 3X28B 1KC8U 2OTLQ 4M7AD 1PD0A 4M7DB 2KXCA 2QAZA 2RMOA 4BDYA 4A63B 4ELZC 1U1SA 4MDWA 2DXCA 2CKKA 3QWYA 4MDXA 1MGQA 2CZ6B 1TH7A 3H0HA 3JCMW 2YLBA 3OYFA 2XICA 4E7LA 2PVDB 5IN1A 3OA6A 4M75F 3OW2A 5I21A 2FRWA 4J9CA 1PM3A 1SHFA 5D6WA 1YHQA 2RHZA 3REAB 2F5TX 3TSZA 4A4FA 4PL6A 2AZVA 1I1JA 3CXCP 3OMGA 4CC4B 1EX4A 4QW2A 2HCKA 1BU1A 3LWIA 3CD6Q 1UTIA 3VYGA 2X3WD 3CCMA 2I2LA 5HY6A 2DE0X 4E47A 2FG0A 1QP2A 1KD1C 4BUGA 2F5KA 2R5AA 3HRTA 2KT8A 1G3SA 4HT8A 5FU6C 1OULA 2X35A 2I0NA 4FYXB 4CRIA 1W2BS 2DJZA 2EJFA 1NPPA 4F14A 1AWXA 3M54A 1H641 8ATCB 2OTJQ 1Q82R 2BE7D 4FT2A 2GBQA 5GANh 3CCQQ 2DVEA 2LMJA 1VQ8Q 4LNPA 2C0TA 3HFNA 2P84A 4LUEA 3ER0A 2J7IA 3META 2ABLA 4JS5A 2ZPIB 5KYWA 3OYDA 2GTJA 1VQ7A 3PVQA 5FROA 4OF1A 2OAWA 4FM4B 4KRTA 4MZTA 3CPWS 2LCLA 3A5ZB 5DY9A 1WHGA 2OX7A 3CC7A 3ULRB 4M7DE 2CH4W 2CZ1B 3RMQA 3I5SA 5HK3A 1BCMA 3M56A 2LVMA 1RAAB 2DAQA 4DQ2A 1NLOC 4XAXB 1AT1B 1YWOA 2XU8A 4M77G 1WPYA 3DLMA 2WSFE 1ZA2B 3HFOA 1XJWB 1BI1A 4FCYA 5GANd 1P92A 2D0QB 4JJDA 4J9DA 1WFWA 5IHKA 4FT4A 4QVCA 2FYKA 4YTLA 5CR2A 2XD0A 1PKSA 1NZ9A 2A3LA 1D1BA 5GMKl 1NYFA 4Z02A 3REBB 2E64A 1SEMA 1YFNA 1M8MA 3CMAT 2ED0A 4C8QD 5HK0A 3QZ5B 1IO6A 2DZCA 2FZGB 1W2BP 1BK2A 1Q81R 2LX7A 2SRCA 1X01A 1K76A 1KQSS 1G83A 2O9SA 3SWNA 3GNFB 1WIEA 2BZXA 1Q81U 1GBQA 2CP2A 4X1VA 4M78B 3QSUA 3NHNA 4M75B 4Y92A 2K3BA 2BKDN 4RTTA 2VASA 1UUEA 2DA9A 1BYMA 4K11A 5CQYA 3CC2Q 1ZBJA 2MCNA 1ZSGA 2Y4YA 1KQSP 4J7FA 3TSWA 2VGMA 3V7RA 1JJ2P 4RMOA 1EZZB 1T0JA 2W10A 1WXUA 2D8HA 2ZPFB 4L6V5 3H0FA 4B6MA 1ZUUA 4X9CA 3J80E 1TU0B 3QZ9B 3CCLA 5LJ5e 4LDVA 3RERA 1UGPB 5GANf 2RJDA 5D7UA 2DRKA 2HQXA 1JU5C 2X4YA 3EGUA 3JCMJ 1U06A 3JB9G 3U23A 1UGRB 1Y0MA 3HSBA 3OS2A 3CC2T 2LRQA 1VQ4T 1C1AA 5CAIA 3CD6T 2MMPA 3JB9J 5GAMf 2DK3A 1M1KR 4M7AF 2RI2A 4C92E 2AIRB 4XTYA 4NS5A 3JAME 1UG1A 1KSWA 2JS2A 2Y90A 4OMPA 4ME7A 1WJRA 2LQNA 3G6EQ 2DEQA 3RUXA 1HD3A 3CCMQ 4BI4A 3QO3A 5IT9E 1J3TA 2LNHB 4C5EA 2LZ6B 2LDMA 2E3IA 2M16A 3M4YA 2BTTA 4OGEA 4XTWA 1YHQQ 2AZSA 4IIOA 3G71A 2MYSA 3VS7A 1VQKQ 3LYIA 3CCEA 3MEAA 1U1TA 1W1FA 1BI0A 4O5VA 2HMAA 1I07A 3CCMT 2MWOA 1YITA 1VQ4Q 1YBYA 2ZCFB 1UFFA 2Y4XA 2RJCA 2QYZA 2QEXT 3ZFJA 2QXFA 3E2UA 5GMKe 3CCVQ 3WVEB 2JM8A 1SF9A 2K2MA 1VQ6A 2JMCA 2FRYA 1EIFA 1SPKA 1FMKA 5HCKA 4IUQA 2LT1A 4IUTA 2RB6A 3MEWA 2DL5A 1FWZA 2QGFB 3X20B 1RI0A 3DKMA 2RQVA 4MMKA 1PHTA 5GAN6 4LE9A 4PLIA 2MWPA 3VS4A 1YIJT 1Z9QA 4RTXA 2K4YA 2YUNA 4DOVA 2DETA 3Q1JA 2RNAA 2CH4A 1VQNT 5LJ3f 2NYSA 3L2VA 3QXEB 4HCZA 4O6JA 1NBEB 2RN8A 2KY9A 4R56A 1WXTA 3OS0A 1KC8R 5GAOq 3LW5E 1W4SA 3OW2P 1VUBA 5I2SA 3DB4A 2EGCA 5GMKj 1WHMA 3O8VA 4C92C 3QJYA 2JZ2A 2ENMA 1MHNA 4PFOA 4C8QB 4PJOG 1E7OA 3EHQA 5FRMA 2XDBA 1WJSA 1MMGA 2GQVA 1VQ4A 2FZKB 1BIAA 3GP8A 3O5ZA 2X4JA 4PJJA 2PUOB 3VRYA 3CC4Q 2C0IA 2A37A 2K3YA 3QHSA 1UGQB 4MZPA 1UJYA 4M77F 2DF6A 2P0KA 2DBKA 2H3EB 4A4GA 4N4HA 4J9EA 4M7AE 3CCVT 3TQ7P 4CC3A 3KXTA 1RAIB 1BKBA 2CT4A 2XI9A 4XU1A 1NPRA 2YT6A 3M4GA 1B34A 2YWWA 1MNEA 4BE0A 2BZYA 1VQ7Q 3J81E 1GL5A 1IREB 4PJMA 1M2OA 1IRXA 1BBZA 3E1SA 2CZ0B 1LOJA 1VQ5Q 4VUBA 2KI7A 2RJFA 4EMHA 3KFVA 3HP9A 3A98A 1MMAA 1Q86U 1VQLA 2F69A 1WYXA 4DBQA 3CCLT 1Y07A 4IUPA 2KROA 4RKUE 6AT1B 2ZZDA 2L89A 4ELYC 1D0ZA 2PU9B 1ABOA 1XTDA 4PFPA 5L8RE 1K9MR 3HHTB 3V7CA 3S3OA 4ANJA 4EMKC 2JVVA 4AG2C 3OY9A 2CDTA 1T3LA 5C6SA 3JRZA 4AFZC 3C0CA 5KYNA 3VU3C 2YUQA 1YJNA 1UB4A 5GANj 3VYHB 2QA4T 3X25B 4RTUA 1QKXA 3BDUA 2CP3A 2DIQA 2CYZB 4GBQA 2BZ8A 5IHIA 2QDLA 1VQ9T 3NTIA 2FZCB 1U5SA 3HKSA 1S72A 4JRIA 4D8DA 5J26A 3CCST 2COYA 2AK5A 2YLCA 3JCMh 4F7UB 2ROTA 4PLLA 4OMLA 1VQ8T 1TTHB 4Y28E 5GMKm 1M30A 3THKA 2ESWA 1GBRA 1I8FA 4RTVA 2QTVA 5D6XA 1RL2A 5CQXA 1QVFS 4IKFA 1YWPA 1M9SA 2KBTA 3T9NA 3TEEA 2KGTA 4NL2A 3RKWA 5L23A 1OPKA 1IGUA 1M2VB 2MIOA 4M77D 2G3RA 5LL6S 2YRDA 4C8QF 3G4SA 1VQNA 4C0DB 1H3ZA 4PJOE 5GAOn 3M57A 1YITT 1VQMQ 5A0LA 3WVDB 2RHYA 2DIGA 3JCMe 2GGRA 4XU0A 1MV0B 4FU6A 1WHKA 2O31A 5CCAA 3A8OB 4KH1B 1K1ZA 4C0GA 2KRNA 5GMKi 2RI3A 4E7JA 2HSPA 1K9MC 1YHQT 2EQKA 2DXBA 4J9FA 4M75E 4HCCA 4F7UF 4EMKA 2DKGA 3SDZA 2EGAA 3I55A 1LVKA 3FEOA 3CC4A 2V1RA 1JRIA 5FWBA 2L5QA 4M7DC 2COWA 3BDLA 3GOXA 3I55Q 1I5OB 3LLRA 3JCMg 5KCHA 1N27A 2SEMA 1M1KU 1VQOQ 2C0OA 2KMTA 1VIEA 1G3YA 1ZA1B 2PTKA 2EVRA 2KK4A 1U3OA 1D3BB 2K2VA 2VUBA 1TUCA 1ZUKA 1ZUYA 1N9RA 3RDVA 2Z0WA 1X6OA 2XIDA 5LJ5h 5LJ3h 5FU7C 3I56A 1RAGB 2KRMA 3PMIA 1YN8A 4XQ3A 3CCQA 2RQUA 1OQKA 4ESRA 3JCMf 1PSEA 2MOXA 2E65A 5GAOm 2CSIA 4QKUA 2EYQA 2VGNA 1WQWA 2M9UA 4PNOA 1NG2A 2M0OA 2RK1A 3FLGA 2V1QA 5EC7A 1X2QA 1AZGB 4X34A 4QQGA 1TOVA 1K4US 2KEAA 2NUTA 1IGQA 1QCFA 3S3NA 3JB9D 1VQMT 1OZ3A 4TVRA 2G6FX 5HKCA 2KSSA 2J6KA 1Q7YR 4XU3A 5LJ3e 4J9BA 2MAMA 2OAUA 1UGSB 2RM4A 5LJ3j 3UATA 2IVWA 3PNWC 4M7DD 1DJ7B 3OYAA 1I0CA 2D9TA 1YJNQ 2EQJA 1KD1R 1YJWT 1OZ2A 1K73C 1HXDA 3TVTA 1YCSB 3E9GA 3CCSQ 1ABQA 2D0NA 4LDWA 4FYYB 1K9AA 2EQIA 4KGZB 2L3SA 1FXXA 2FPEA 4QQ6A 1X6GA 1M27C 2CGHA 2J6OA 4N4GA 3CCRT 3CCEQ 3VKIA 2V26A 2GCXA 4EMKB 3RKYA 4M78G 3G71Q 2HD0A 1VQOT 1Y96B 1XOVA 4XK8E 4ZTJA 2EBPA 5GAN3 3QUIA 3CCJQ 2LCSA 2XKOC 4KT0E 3JCMX 4J9GA 2DXTA 4J9HA 4C5GA 1Q82U 3KBGA 2HL3A 1MNDA 3FRNA 2A08A 4L5GA 3QDRB 4DBFA 2FL7A 1CKAA 1Q82C 4JJCA 1WLPB 4RCCA 5GAMh 3UDCA 4OMNA 2EPDA 5GANg 2KT1A 2B8AA 1ZQ1A 3G71T 2LC4A 1UGVA 2EFIA 2FPFA 2DRMA 1I81A 2RF0A 4EPCA 3UPUA 3HTRA 4F04B 4KUDK 4PJOC 4AFUC 1ZSZC 1SKUB 1V29B 1M2VA 1TSFA 4JUVA 1UEBA 1VOMA 2A36A 2EGEA 2P4RA 4BY6B 3GBQA 1VQPA 2EAYA 1OYXA 3SWNC 2K6DA 5GAN4 2VV5A 4P5NA 2DEUA 2GTOA 1K73U 3F70A 2YRVA 2DJQA 1I4K1 1KHCA 4FSXA 1PRMC 1GFDA 3CMAA 4C0ZA 5GAN5 5DLOA 3MKDA 3R6NA 4IIMA 1PRLC 1RLPC 1WXBA 2HBPA 3CC2A 2HKNA 3MCAB 3AHUA 1WDXA 4JZ4A 1R0CB 2KDSA 3VUZA 1LNXA 2IG0A 1WHHA 1OU9A 3C4SA 3OYJA 1M5Q1 2EYWA 3JB9I 2QA4Q 2E10A 2QEXQ 1T0HA 1CSKA 5KYYA 1Q7YC 2GQIA 3HRSA 4E7ZA 2VXFA 2JN0A 3FJPA 3OQ5A 4BACA 4IUVA 4MZMA 4UC4A 2LCCA 2V8IA 4KGXB 2DM1A 4JJBA 4A4EA 3HL8A 1HJDA 3OW2S 3L2RA 2PUKB 4A53A 3EG1A 5CKDA 4MMLA 2DX1A 1X27A 1M1KC 1QWEA 1IHVA 1YITQ 3QG1A 3EGDB 2ZPHB 3C12A 3IQLA 2RPNA 2RD1A 4J9IA 1OI1A 4JLGA 3LH0A 4C5IA 2BUDA 4M7AB 5DLQE 3LWHA 3CCRQ 3CCET 2CP0A 3N5BB 3EFRA 2DILA 4JDSA 2YXYA 4Y91A 2HAXA 4V2SA 5CKBA 1YJ9T 4LN2A 5M9OA 2R5MA 2M02A 3VJPA 1FMVA 1OV3A 1PCXA 2RH2A 5GAMj 3CCJT 1H3HA 2H8HA 1RAHB 1AOJA 2JS0A 4BD3A 2QQAA 1RAFB 5GAMg 3G6EA 1N6AA 3PTAA 1JXMA 2EYXA 1SSFA 2F1LA 1M90R 1VQLT 2J6FA 2IPOB 3RNJA 1TWBA 1QCOA 3PVLA 1GCQA 2DZ9A 2F2XA 2XMFA 3TREA 4M75G 2JTEA 2NUTB 4PKCC 1M90U 1V76A 2GNCA 4A4HA 1KHIA 1RADB 4C8QG 4OGCA 1AZEA 2L3RA 3S6WA 1BB9A 3CD6A 4WTOB 4FL6A 2ROLA 4B9XA 5GJVB 1AWWA 1D0YA 1VQOA 1D1CA 1RACB 4M75A 1VQ9A 3CCLQ 4KH0B 1GXIE 4LDUA 1PD1A 5GAMe 1QLYA 2O4XA 1U8RA 2VWFA 3J7AF 2K3XA 3NPFA 2LX9A 1KQSA 1KFZA 2EQMA 5FW9A 3D7SB 3M58A 2DFUA 2KR3A 1YIJA 1W6XA 1Y7XA 2DD4A 5IXBA 1KQ1A 3FJ5A 2WSCE
chains in the Genus database with same CATH topology
2I2LA 5HY6A 4E47A 4EMGA 1QVFS 2RK2A 4ATOA 3LGLA 1QP2A 1KC8C 1KD1C 3P8DA 4II1A 4IKFA 1M9SA 2F5KA 3FDRA 2R5AA 3HRTA 4HKEA 1G3SA 3OSVA 3T9NA 5FU6C 3BY7A 4NL2A 3RKWA 3TEEA 1YJ9A 4HT8A 2X35A 4CRIA 1M90C 1W2BS 2DJZA 2XDPA 2EJFA 4M77D 4M78C 1NPPA 4PJOB 3M54A 2G3RA 1H641 1NE8A 5LL6S 1XNIA 2E70A 4C8QF 3CCJA 3G4SA 1VQNA 2DXUA 2OTJA 5GMKh 2QTXA 2OTLT 4C0DB 1H3ZA 4FT2A 4PJOE 5GAOn 5GANh 3M57A 1YITT 2DVEA 5KE2A 5A0LA 1Y96A 3KUFA 4M78E 4C0DC 4HT9A 3HFNA 3WVDB 2RHYA 3ER0A 2DIGA 3META 3P8BB 3JB9F 4JRKA 3OBWA 4JS5A 2DO3A 3JCMe 1BI3A 2ZPEB 2ZPIB 4XU0A 3OYDA 4HCBA 3QJ6A 1VQ7A 4M7AF 4FU6A 3NFCA 5CCAA 5FROA 4OF1A 3SD4A 3A8OB 4FM4B 4MZTA 4C0GA 3CPWS 2XK0A 2LCLA 3A5ZB 4M7DG 5DY9A 5GMKi 2RI3A 4E7JA 1K9MC 3CC7A 3CCSA 1YHQT 1YI2A 3ASKA 2EQKA 2DXBA 4M75E 4HCCA 4M7DE 3C95A 2CZ1B 4F7UF 3RMQA 3CPFA 4EMKA 4BUGA 3CCRA 3OYBA 3RMSA 2DKGA 1BIBA 3SDZA 5HK3A 3M56A 3OSSC 3I55A 2LVMA 2DAQA 1PSFA 2DTOA 2XG8D 3FEOA 5CVIA 3CC4A 3PGGA 4DQ2A 4M78F 4PJOD 2GFAA 4XAXB 4M75C 1JRIA 4M7DC 2L5QA 3HRUA 2XU8A 3BDLA 4M77G 1WPYA 3DLMA 2WSFE 3GOXA 3V8LA 3HFOA 3LLRA 1BI1A 3JCMg 1N8RU 2QI2A 2CZ7B 2E41A 1P92A 2D0QB 4C92G 5KCHA 1N27A 5GANd 1M1KU 4LD9K 3M55A 4F7UG 4LDXA 1W2BA 2KMTA 4FT4A 1VIEA 2E5QA 1G3YA 2FYKA 3CBMA 4YTLA 2DTHA 4QVCA 2KK4A 2XD0A 3S3MA 1NZ9A 2A3LA 3JB9H 1G5VA 5GMKl 3OB9A 3I56T 1D3BB 2K2VA 3GIBA 1O9SA 4Z02A 2VUBA 2E64A 5EG2A 3JCMc 1N9RA 5GAOr 2RO0A 1X6OA 3UT1A 1I5LA 1VQ7T 2E12A 2XIDA 3L2UA 5LJ5h 3CMAT 5LJ3h 3TCJA 5FU7C 4C8QD 4D6WA 5HK0A 3I56A 4ZGDB 2RA2A 1WQ7A 3QZ5B 3MP1A 2DZCA 3PMIA 3L2ZA 1VQ8A 4XQ3A 3CCQA 2E6ZA 2DD5A 3FC3A 4RG8A 4JS4A 2GF7A 4HA8A 1AHJB 1WJQA 4ZTFA 2EJGA 3JCMf 3MEUA 1ZBXA 2QQ9A 1PSEA 3E19A 1X01A 1KQSS 3X24B 2E65A 5GAOm 4M78A 3GF5A 1VQ5A 2EYQA 2VGNA 1WQWA 3OYIA 2M9UA 4PNOA 2EKOA 3SWNA 3OS1A 2M0OA 2RK1A 3FLGA 3GNFB 4JRPA 4C92F 1Q81U 2QQRA 3HPWA 4GY5A 4M78B 4X34A 3EAEA 4QQGA 3QSUA 3JSCA 4J5YA 2CS7A 3ZEHA 4ZGJB 2M1HA 4M75B 4M7AA 1K8AU 4M7AG 2BKDN 2ZGWA 2K5LA 4JLIA 3OYLA 2AHJB 3S3NA 4JJNK 3JB9D 1VQMT 1OZ3A 1Q86C 4TVRA 1BYMA 5J39A 4BI3A 4XTXA 5CQYA 4BB7A 5HKCA 4E7HA 2KSSA 2Y4YA 4XU3A 3SWNB 5LJ3e 4J7FA 3PIOA 2VGMA 3V7RA 3QIIA 2MAMA 4RMOA 2OAUA 1UGSB 2E1HA 2RM4A 5LJ3j 1JJ2S 2ZPFB 2IVWA 2LT4A 4L6V5 3PNWC 1WNLA 1DJ7B 4M7DD 2JTFA 3OYAA 1YI2T 1JJ2A 4X9CA 3J80E 2LTOA 4IUUA 3RKXA 4F7UE 3EFSA 2D9TA 3QZ9B 3CCLA 5LJ5e 2EQJA 4LDVA 1YJWT 3RERA 1UGPB 5GANf 1OZ2A 2RJDA 4KULA 1QVGA 1HXDA 1K73C 3L42A 4WF2A 2HQXA 1K9MU 2VYTA 2X4YA 3E9GA 5GAMd 5GAN7 3BFMA 3JCMJ 3JB9G 2R58A 3URGA 1UGRB 4LDWA 3HSBA 3OS2A 3CC2T 2LRQA 2XDDA 2K5FA 2O4XB 1FXXA 5CAIA 1VQ4T 2PVGB 4QQ6A 3CD6T 2MMPA 3X26B 2CGHA 4N4GA 4F7UA 3JB9J 3CCRT 2HQEA 2QDYB 3FIFA 3VKIA 2GCXA 2JNGA 4EMKB 3RKYA 4ZGEB 2RI5A 4M78G 5GAMf 2HD0A 1ZHIA 4QQDA 1VQOT 1Y96B 1XOVA 2DK3A 5LJ5g 4XK8E 1VQMA 3A8GB 5CO7A 2WSEE 4M75D 4ZTJA 5LJ5d 2D6FA 5CKHA 2EQUA 1HK9A 4C92A 1YJNT 2EWNA 2KQWA 4OP0A 5GAN3 2RI2A 5J3BA 3CEYA 3QUIA 4C92E 2V8KA 2XKOC 4KUIA 4XTYA 5CR2A 4KT0E 3V8JA 3JCMX 1KQ2A 2DXTA 1WGSA 2OTJT 3G7ZA 1FX7A 4NS5A 4C5HA 3JAME 2X4XA 4C8QA 5GAOl 2MF2A 2Y90A 1YCYA 4J6YA 4GLKA 4C92B 4ME7A 4C5GA 1Q82U 3KBGA 5LJ5f 1BI2A 1WJRA 4BE1A 1KD1U 2XHCA 1VQ6T 5GAN8 4C8QC 2DEQA 3FRNA 4L5GA 4M77B 3QDRB 3RUXA 2FL7A 2QA4A 4BI4A 3QO3A 3H8ZA 3RESA 4R55A 5IT9E 3MHXA 1Q82C 4C5EA 2X4WA 4RCCA 2LDMA 3UDCA 5GAMh 3OYNA 5GANg 2EJ9A 2M16A 2E6NA 3QBYA 3GNGA 2B8AA 3M53A 1ZQ1A 2NLUA 3M4YA 4OGEA 2LC4A 4RG2A 3G71T 2BIVA 1VIFA 2EFIA 4XTWA 5C0MA 2K5IA 1I81A 3GLXA 4EPCA 3G71A 3DB3A 2R57A 3UPUA 3OMCA 3LYIA 3UWNA 3CCEA 4A4KA 3MEAA 1U1TA 4KUDK 1BI0A 3L1AA 3CMET 4O5VA 4PJOC 3JCMV 3ME9A 3NTHA 3CCVA 1QP3A 1V29B 4FIBA 3JCMd 3CCMT 2MWOA 3MP6A 1YITA 1YBYA 4JUVA 3P8HA 2FHDA 1UEBA 5FU6B 2ZCFB 4BY6B 1VQPA 2EAYA 1NJIU 1OYXA 5DM7R 3SWNC 2Y4XA 4XTUA 5A2QE 4C92D 2RJCA 2VV5A 4P5NA 5GAN4 3OYGA 5GAOp 1K73U 3F70A 3R6OA 2WACA 2YRVA 2QEXT 3ZFJA 4QVDA 3SB2A 4N0AC 2VC8A 5IAYA 1I4K1 2QXFA 1KHCA 4OB3B 5GMKe 1Q7YU 3WVEB 4CI0C 2ZPGB 1VQ6A 4FSXA 4QVZA 3CMAA 2OTLA 5KCOA 1EIFA 4OMFB 3OYEA 3FB9A 4C0ZA 5GAN5 4IUQA 2LT1A 4IUTA 4J6WA 1R8OB 3M5AA 5CK9A 2YHTA 5DLOA 1VQKA 2RB6A 2HNIA 3MEWA 3V7SA 4E7IA 1FWZA 2O01E 3X20B 4M77C 2HBPA 1RI0A 3DKMA 4MMKA 4OB0B 3PMTA 3OS5A 3C94A 3CC2A 3MCAB 3AHUA 2FB7A 2GFUA 2H3JA 3QKJA 5GAN6 1Y71A 4PLIA 2KDSA 3VUZA 1LNXA 3CPWA 3CC4T 2MWPA 3MEVA 4L59A 2IG0A 2RHIA 3V8KA 5CKFA 3GPLA 3MP8A 3PT9A 1YJWA 3PFSA 3C4SA 3OYJA 1K8AC 3TU4K 1M5Q1 3CBOA 2LQ8A 3JB9I 5LJ5j 4NL3A 1YIJT 5LJ3g 3CMEA 3JCMb 2E10A 4J83A 1N9SA 2P4TA 2K4YA 3PIPA 1Q7YC 4LDYA 4DOVA 3HRSA 2JTMA 2VXFA 3OBYA 2JN0A 3FJPA 2L8DA 2VXEA 3Q1JA 4LD6A 1VQNT 2DPPB 5LJ3f 3OQ5A 5FLXE 4BACA 3L2VA 3QXEB 4HCZA 4IUVA 4MZMA 4O6JA 3LX7A 4UC4A 2LCCA 2KY9A 2V8IA 5CKEA 1VQPT 4R56A 3OS0A 2QQBA 4A4EA 4DOWA 1B34B 3OYCA 3LGFA 3VUBA 2DTIA 5GAOq 3LW5E 3DLLA 1W4SA 3HL8A 1VUBA 3G6ET 5I2SA 2PQWA 3DB4A 4BDZA 5GMKj 5FU7B 4B9WA 4ZN3A 1QVFA 3OW2S 2PVOB 3L2RA 3OYMA 3O8VA 3OYKA 2PUKB 3QPHA 4C92C 3QJYA 3QYHB 4A53A 1LJOA 2JZ2A 5CKDA 1MHNA 4MMLA 5AYFA 4C8QB 4PJOG 2JOYA 3WXMB 3CXCA 5FRMA 3CCUA 4DA4A 4M7DF 2XDBA 1WJSA 2LQKA 2V8JA 4C8QE 1QVPA 1G3TA 2GQVA 1M1KC 1M4ZA 1VQ4A 5A0GA 3VV0A 3CCQT 1N8RC 4ZN1A 3A8HB 3QG1A 1BIAA 3GP8A 2FVUA 3CCUT 2X4JA 2ZPHB 1G3WA 3C12A 3CBPA 3RIRA 3BW1A 3I55T 2PUOB 4M7AC 2RD1A 2MI6A 3OYHA 1OI1A 4N0AA 4JLGA 1VQ5T 3LH0A 3G4ST 2K3YA 3QHSA 1UGQB 4MZPA 4C5IA 3A8MB 4N4IA 5GAN2 2BUDA 4M77F 2P0KA 4X9DA 5DLQE 4M7AB 3LWHA 3JCMP 3CCET 3N5BB 3EFRA 3QYGB 4JDSA 2A7YA 4Y91A 1XQHA 2EIFA 5A0DA 4A4GA 5KE3A 2HAXA 4N4HA 5CKBA 4V2SA 1YJ9T 4M7AE 4OVAA 4OB1B 3CCVT 3KXTA 3L2QA 5M9OA 1BKBA 2XI9A 2R5MA 4M77A 3MO8A 4BY6C 4E7KA 4XU1A 3H6ZA 3VJPA 2RH2A 1QW1A 1NPRA 3M4GA 1B34A 1JBMA 3L2WA 4BE0A 5GAMj 4M77E 3SFMA 3CCJT 1M1GA 3J81E 4JRQA 4BD3A 2QQAA 1IREB 3OYYA 1S72T 3G6EA 5GAMg 2C06A 1N6AA 3PTAA 2QEXA 2K57A 4NOYA 4J7IA 1I8FA 3E1SA 4J8OA 2CZ0B 1LOJA 1O75A 1SSFA 5I2MA 5CIUA 1VQLT 4VUBA 4XTVA 4XTZA 1D3BA 2RJFA 5LJ3d 4RCBA 4EMHA 4M7DA 1QVGS 3HP9A 4M78D 4PJOF 1VQLA 1Q86U 2P0QA 4KBMB 1X75C 2F69A 2DZ9A 3A8LB 4A54A 3CCLT 4BI8B 1Y07A 3TREA 2LNVA 4M75G 4IUPA 4PKCC 1M90U 2KVQG 4RKUE 2JUFA 2ZPBB 2ZZDA 3M9QA 4A4HA 2L89A 4ELYC 4BE2A 4XU2A 2PU9B 5D6YA 3X28B 1KC8U 1XTDA 5L8RE 5FRNA 4M7AD 4IURA 1KHIA 3HHTB 4C8QG 3JCMQ 4OGCA 3NTKA 3V7CA 2L3RA 3S6WA 3S3OA 3CD6A 4M7DB 4FL6A 4EMKC 2JVVA 4BDYA 4Q5WA 1KG1A 2RHUA 4ELZC 3OY9A 1IZ6A 1U1SA 4J6XA 4B9XA 3E9FA 1NJIC 4MDWA 2DXCA 1VQOA 2CKKA 5C6SA 3JRZA 4MDXA 1MGQA 4M75A 3VU3C 1VQ9A 2CZ6B 3CXCS 1YJNA 1UB4A 1GXIE 4OB2B 5GANj 1JB0E 3VYHB 2QA4T 1TH7A 3CCMA 3X25B 4LDUA 5GAMe 3BDUA 2DIQA 3JCMW 1Q81C 2CYZB 5KH6A 2O4XA 2YLBA 3OYFA 2XICA 1U8RA 4E7LA 5GANe 1VQ9T 2PVDB 2RJEA 3NTIA 5IN1A 3HKSA 4M75F 3OA6A 1S72A 2RHXA 3OW2A 2K3XA 4JRIA 3M59A 3J7AF 5I21A 3INZA 1M8VA 2LX9A 1KQSA 5D6WA 1VQKT 5J26A 3CCST 1YHQA 3CC7T 2EQMA 2RHZA 2F5TX 4A4FA 2P0PA 4PL6A 3ZBDA 2YLCA 2QQSA 3M58A 3JCMh 4F7UB 4EDUA 4PLLA 4C0FA 1VQ8T 3OMGA 1YIJA 4QW2A 1Y7XA 4Y28E 5GMKm 2KAFA 2DD4A 3LWIA 1KQ1A 3VYGA 2WSCE 1M1FA 4PJOA 5D6XA 1RL2A 5CQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2L A;  3RIR A;  4EMG A;  3BW1 A;  4C92 F;  1U1T A;  4M7A C;  2RD1 A;  3L1A A;  4N0A A;  4M78 B;  4HT8 A;  4PJO C;  3BY7 A;  4NL2 A;  3RKW A;  3QSU A;  3QHS A;  3JCM V;  4J5Y A;  5GAN 2;  3JCM d;  4M77 F;  4X9D A;  4M7A B;  3JCM P;  4M75 B;  2DJZ A;  4M7A A;  4M77 D;  2EJF A;  4M78 C;  4M7A G;  3EFR A;  4JUV A;  4PJO B;  1H64 1;  2ZGW A;  4Y91 A;  4JLI A;  2EAY A;  4C8Q F;  3JB9 D;  4V2S A;  3SWN C;  4XTU A;  4M7A E;  2DXU A;  4C92 D;  5GMK h;  2QTX A;  4XTX A;  5GAN 4;  5GAO p;  5GAO n;  5GAN h;  4M77 A;  4PJO E;  2DVE A;  4XU3 A;  4XU1 A;  3SB2 A;  4N0A C;  2VC8 A;  3SWN B;  3M4G A;  1B34 A;  1JBM A;  1I4K 1;  1Y96 A;  3V7R A;  4M77 E;  5GMK e;  5GAM j;  4M78 E;  4HT9 A;  3HFN A;  2RM4 A;  2E1H A;  5LJ3 j;  5GAM g;  3FB9 A;  3JB9 F;  4JRK A;  2K57 A;  5GAN 5;  4NOY A;  1WNL A;  4M7D D;  3JCM e;  4J6W A;  1LOJ A;  4XU0 A;  2YHT A;  4X9C A;  2RB6 A;  2HNI A;  3V7S A;  3RKX A;  4XTV A;  3EFS A;  4F7U E;  4M77 C;  5LJ5 e;  4XTZ A;  4MMK A;  1D3B A;  3RER A;  4M7D G;  5LJ3 d;  5GAN f;  5DY9 A;  5GMK i;  3AHU A;  4RCB A;  4EMH A;  4M7D A;  1HXD A;  2FB7 A;  4WF2 A;  5GAN 6;  4M78 D;  4PJO F;  5GAN 7;  4M75 E;  1LNX A;  5GAM d;  3BFM A;  4A54 A;  3JCM J;  2DZ9 A;  4F7U F;  4M7D E;  3V8K A;  3JB9 G;  4EMK A;  4M75 G;  3HSB A;  2DKG A;  1BIB A;  1M5Q 1;  5CAI A;  5LJ5 j;  3JB9 I;  4NL3 A;  2DTO A;  5LJ3 g;  3PGG A;  3JCM b;  2E10 A;  2CGH A;  4XU2 A;  4DQ2 A;  4F7U A;  4M78 F;  4PJO D;  3JB9 J;  4M75 C;  1JRI A;  1N9S A;  3FIF A;  4M7D C;  4EMK B;  4M77 G;  3RKY A;  1WPY A;  4M7A D;  4M78 G;  4C8Q G;  3V8L A;  5GAM f;  3JCM Q;  2VXF A;  2JN0 A;  1Y96 B;  3FJP A;  3HFO A;  3V7C A;  3JCM g;  5LJ5 g;  4M7D B;  2VXE A;  4EMK C;  4M7A F;  4M75 D;  2E41 A;  5LJ3 f;  4C92 G;  5LJ5 d;  1HK9 A;  4C92 A;  5GAN d;  2EWN A;  4OP0 A;  5GAN 3;  1U1S A;  4J6X A;  3QUI A;  4C92 E;  4F7U G;  4XTY A;  1KQ2 A;  3V8J A;  3JCM X;  4QVC A;  2FYK A;  2DXT A;  2DTH A;  1MGQ A;  4M75 A;  3VU3 C;  4QVD A;  1B34 B;  2DTI A;  5GAO q;  4C8Q A;  5GAO l;  3JB9 H;  5GAN j;  2Y90 A;  5GMK l;  1YCY A;  1TH7 A;  4J6Y A;  4C92 B;  1D3B B;  5GAM e;  5GMK j;  5LJ5 f;  3BDU A;  3GIB A;  3JCM W;  2E64 A;  2YLB A;  3JCM c;  1N9R A;  5GAO r;  5GAN 8;  4C8Q C;  2DEQ A;  4C92 C;  5GAN e;  4M77 B;  1I5L A;  4A53 A;  1LJO A;  4M75 F;  3RUX A;  5LJ3 h;  4C8Q D;  5LJ5 h;  4MML A;  1M8V A;  3QO3 A;  2RA2 A;  1WQ7 A;  4JRI A;  3INZ A;  3RES A;  5I21 A;  2DZC A;  4C8Q B;  3L2Z A;  4RCC A;  4XQ3 A;  4PJO G;  5GAM h;  5GAN g;  2EJ9 A;  4HA8 A;  2YLC A;  4M7D F;  3JCM h;  2EJG A;  3JCM f;  4C8Q E;  4F7U B;  5LJ3 e;  1X01 A;  2E65 A;  5GAO m;  4XTW A;  4M78 A;  5GMK m;  1I81 A;  1BIA A;  1KQ1 A;  1WQW A;  4PNO A;  3SWN A;  1I8F A;  4PJO A; 
#chains in the Genus database with same CATH topology
 4ATO A;  3LGL A;  3P8D A;  5KYU A;  4F16 A;  3OSV A;  3BY7 A;  3UA7 A;  1SG5 A;  4OMM A;  4M78 C;  4PJO B;  1XNI A;  1E6H A;  5KYU B;  2LP5 A;  2DXU A;  2QTX A;  1AWO A;  5KE2 A;  1F1B B;  1Y96 A;  3KUF A;  4HT9 A;  1VYT A;  1GCQ C;  1K0S A;  3JB9 F;  4JRK A;  3OBW A;  2DO3 A;  1BI3 A;  4HCB A;  3CQT A;  3QJ6 A;  3NFC A;  1W70 A;  4JPB W;  3CCS A;  1YI2 A;  1QWF A;  5IH2 A;  3CPF A;  3VS5 A;  3M0U A;  3RMS A;  1BIB A;  3OSS C;  4FW1 A;  1H92 A;  8AT1 B;  5CVI A;  2XG8 D;  1UEC A;  3PGG A;  1UE9 A;  4M78 F;  4PJO D;  2GFA A;  4M75 C;  2HSE B;  3V8L A;  1N8R U;  2X3X D;  2E41 A;  2D8J A;  4F7U G;  4R0K A;  2HEQ A;  2E5Q A;  2NUP A;  2DTH A;  3S3M A;  5FWC A;  3JB9 H;  2BE9 B;  1G5V A;  3I56 T;  3A1P A;  3OB9 A;  3GIB A;  1C0M A;  1G8X A;  2LJ0 A;  5EG2 A;  3JCM c;  5GAO r;  2RO0 A;  1MMN A;  3UT1 A;  1VQ7 T;  2E12 A;  3L2U A;  4D6W A;  4ZGD B;  1WQ7 A;  3L2Z A;  1VQ8 A;  1VYU A;  4RG8 A;  4JS4 A;  2GF7 A;  1AHJ B;  4ZTF A;  1EFN A;  3MEU A;  3X24 B;  4M78 A;  3OS1 A;  2QGG A;  1QKW A;  2NUZ A;  2CUD A;  3HPW A;  1IB8 A;  3JSC A;  2KXD A;  4J5Y A;  3ZEH A;  1C6V X;  4M7A A;  2L3P A;  1PWT A;  2AHJ B;  4JJN K;  2QK0 A;  3M0P A;  4XTX A;  3VS6 A;  1R0B G;  4E7H A;  3SWN B;  1Z9Z A;  3PIO A;  3QII A;  2E1H A;  2LT4 A;  1YI2 T;  1JJ2 A;  2LTO A;  4D8K A;  2VYT A;  2HQH A;  5GAN 7;  4AG1 C;  3BFM A;  3EHR A;  1ACM B;  3URG A;  4AFQ C;  2K5F A;  1X43 A;  2O4X B;  2PVG B;  1GCP A;  2HQE A;  2QDY B;  2DL8 A;  2JNG A;  1S1N A;  4ZGE B;  1ZHI A;  4QQD A;  5LJ5 g;  1VQM A;  2WSE E;  2D6F A;  5CKH A;  2EQU A;  1HK9 A;  2KQW A;  4OP0 A;  4FSS A;  3SHW A;  2V8K A;  3V8J A;  4AFS C;  3AT1 B;  3G7Z A;  2X4X A;  4C8Q A;  1QCN A;  4J6Y A;  1BI2 A;  1KD1 U;  2XHC A;  1VQ6 T;  3H41 A;  4M77 B;  4RTW A;  2QA4 A;  3H8Z A;  3RES A;  3MHX A;  3OYN A;  1YIJ Q;  2EJ9 A;  3MJX A;  3QBY A;  3VS2 A;  3M53 A;  1NJI R;  2BIV A;  1VIF A;  1WHL A;  2DLP A;  4RTY A;  5C0M A;  2K5I A;  4RUG A;  3GLX A;  1D09 B;  1AWJ A;  2R57 A;  3UWN A;  1RAB B;  3L1A A;  3CME T;  3JCM V;  3ME9 A;  3CCV A;  1QP3 A;  4FIB A;  3JCM d;  2L2P A;  1R77 A;  3P8H A;  2FHD A;  4JZ3 A;  5DM7 R;  3VS1 A;  4C92 D;  1AD5 A;  3OYG A;  5GAO p;  3R6O A;  1H8K A;  1FMW A;  1UHF A;  2ECZ A;  2VC8 A;  4QT7 A;  2QAS A;  3FB9 A;  5CK9 A;  2HNI A;  4PK4 A;  1PC0 A;  1X6B A;  4M77 C;  9ATC B;  4FYW B;  3PMT A;  4OB0 B;  2W0Z A;  3C94 A;  3OS5 A;  2FB7 A;  1ZLM A;  2GFU A;  2H3J A;  3QKJ A;  1N5Z A;  1Y71 A;  4L59 A;  3MEV A;  1WA7 A;  1RI9 A;  5CKF A;  3GPL A;  3JV3 A;  1YJW A;  3TU4 K;  2DVJ A;  2KRS A;  3CBO A;  2LQ8 A;  4NL3 A;  2JW4 A;  3JCM b;  1WHJ A;  2YRC A;  1GRI A;  4J83 A;  1TUG B;  2FEI A;  2L8D A;  4HXJ A;  1YJW Q;  2K79 A;  2YSQ A;  7AT1 B;  2QQB A;  4DOW A;  1D0X A;  1B34 B;  3OYC A;  2DTI A;  3DLL A;  1MUZ A;  3EGX B;  4B9W A;  1WI7 A;  4LXC A;  2PVO B;  4E7S A;  3QPH A;  3PE0 A;  1LJO A;  2KE9 A;  1RUW A;  3WXM B;  3CXC A;  1E6G A;  2V8J A;  5KYW B;  1SRM A;  3VV0 A;  3CCQ T;  1N8R C;  2FO0 A;  2FVU A;  3CCU T;  1G3W A;  3RIR A;  1V1C A;  3BW1 A;  2MI6 A;  2JM9 A;  4DEX A;  5GAN 2;  3EH2 A;  4X9D A;  4HVW A;  1UJ0 A;  2RQR A;  2A7Y A;  3VS3 A;  1XQH A;  1ZSZ B;  2EIF A;  3UA6 A;  5A0D A;  1MV3 A;  1OPL A;  1JQQ A;  4M77 A;  1KK7 A;  5IHN A;  1QW1 A;  1JBM A;  3L2W A;  2PZ1 A;  1ZSZ A;  1Y57 A;  2F2W A;  1S72 T;  3OYY A;  2QG9 B;  2C06 A;  1GFC A;  1X2K A;  2QEX A;  2M51 A;  2K57 A;  4NOY A;  4J8O A;  1O75 A;  5I2M A;  5CIU A;  4CC7 A;  2DL3 A;  3EFO A;  4XTV A;  2YUP A;  4XTZ A;  1Q86 R;  3QDF A;  2P0Q A;  3A8L B;  2CRE A;  2LNV A;  1SSH A;  4OMQ A;  2KVQ G;  1YJ9 Q;  3I56 Q;  4PJN A;  4DBR A;  2RQT A;  3M9Q A;  4BE2 A;  2IIM A;  5D6Y A;  3CMA Q;  2O88 A;  1CKB A;  4IUR A;  2OI3 A;  3JCM Q;  1YNZ A;  3NTK A;  1VYV A;  3EG3 A;  2JMA A;  4Q5W A;  1PKT A;  1TUD A;  4WCI A;  2RHU A;  4Z88 A;  1KG1 A;  1IZ6 A;  4J6X A;  3E9F A;  1NJI C;  1K0X A;  2CP6 A;  3H0I A;  3CXC S;  4PJL A;  4OB2 B;  1JB0 E;  2O9V A;  4Z89 A;  3ZL7 C;  1Q81 C;  5KH6 A;  1QVF P;  5GAN e;  5FRN A;  2RJE A;  2RHX A;  1M8V A;  3M59 A;  3INZ A;  1VQK T;  3CC7 T;  2COZ A;  2P0P A;  3ZBD A;  1WZO A;  2QQS A;  4EDU A;  4C0F A;  2DBM A;  2KAF A;  3EAE A;  1M1F A;  4PJO A;  2HDA A;  4EMG A;  2RK2 A;  1KC8 C;  4II1 A;  3FDR A;  4HKE A;  1YJ9 A;  3UF4 A;  1M90 C;  2XDP A;  1NE8 A;  2E5K A;  2E70 A;  2X51 A;  3CCJ A;  1VQN Q;  2K7A A;  2OTJ A;  5GMK h;  2OTL T;  5KYX B;  2CT3 A;  4M78 E;  4C0D C;  1TS9 A;  3EG0 A;  3P8B B;  2ZPE B;  1OU8 A;  4HVV A;  3SD4 A;  3VRZ A;  2XK0 A;  4M7D G;  2E3H A;  1NM7 A;  3ASK A;  3C95 A;  2KNB B;  4GLM A;  2L0A A;  3CCR A;  3OYB A;  2J06 A;  2NUP B;  2DTO A;  1PSF A;  1S72 Q;  2YDL A;  3I5R A;  3EH1 A;  3HRU A;  2CSQ A;  3M0T A;  1IHW A;  2QI2 A;  2CZ7 B;  2ZAE A;  4C92 G;  4LD9 K;  3M55 A;  4FW2 A;  4LDX A;  1W2B A;  1VA7 A;  2A0F B;  3CBM A;  2L3Q A;  2NWM A;  4RTZ A;  1NEB A;  2E4H A;  1O9S A;  1I5L A;  3TCJ A;  2EYY A;  2RA2 A;  3MP1 A;  4LUD A;  2E6Z A;  2DD5 A;  3FC3 A;  1QMC A;  1VQL Q;  4HA8 A;  1WJQ A;  2VKN A;  1Q95 G;  2EJG A;  1ZBX A;  2ED1 A;  2QQ9 A;  3E19 A;  1PNJ A;  2A28 A;  3GF5 A;  1VQ5 A;  3OYI A;  4CC2 A;  2EKO A;  1JO8 A;  4JRP A;  4C92 F;  2QQR A;  1X69 A;  3QWX X;  4GY5 A;  4ZNX A;  2J05 A;  2HBW A;  1OX9 A;  2MPX C;  2CS7 A;  1PG5 B;  4ZGJ B;  2M1H A;  1K8A U;  4M7A G;  2ZGW A;  2K5L A;  4JLI A;  3OYL A;  1Q86 C;  5J39 A;  4BI3 A;  4BB7 A;  2DYB A;  2JT4 A;  3M0Q A;  4ORZ A;  1UDL A;  5AT1 B;  4DBH A;  3LH5 A;  1JJ2 S;  3I9Q A;  1WNL A;  2DYI A;  1TXQ A;  2JTF A;  1JXO A;  4IUU A;  5I11 A;  3RKX A;  4F7U E;  3EFS A;  1NYG A;  1TG0 A;  1VQ9 Q;  4KUL A;  1QVG A;  3EG2 A;  3L42 A;  4WF2 A;  2DNU A;  1K9M U;  3CC7 Q;  5GAM d;  1B3Q A;  3CCU Q;  1VQP Q;  1ZX6 A;  2F2V A;  2R58 A;  4EIK A;  3EG9 B;  2XDD A;  1SHG A;  4OMO A;  3X26 B;  1UHC A;  4F7U A;  3FIF A;  5KYY B;  5I22 A;  2RI5 A;  1T3S A;  1OX8 A;  3A8G B;  5CO7 A;  4M75 D;  5LJ5 d;  1JEG A;  1YJN T;  4C92 A;  2EWN A;  2HZY A;  2DL4 A;  5J3B A;  3CEY A;  4KUI A;  4M4Z A;  1KQ2 A;  1A0N B;  1WGS A;  1K8A R;  2OTJ T;  1FX7 A;  4C5H A;  5GAO l;  2DMO A;  2MF2 A;  4DEY A;  1YCY A;  4C92 B;  4GLK A;  4F17 A;  5LJ5 f;  4E6R A;  4BE1 A;  1D1A A;  5GAN 8;  4C8Q C;  2DL7 A;  4R55 A;  2X4W A;  3BE3 A;  1KJW A;  3H9N A;  2AKL A;  2E6N A;  2EYZ A;  3GNG A;  2NLU A;  3M0R A;  4RG2 A;  2EKH A;  5ECA A;  2MK5 A;  1HSQ A;  2EW3 A;  3DB3 A;  3VS0 A;  1NEG A;  1MMD A;  4HVU A;  2FPD A;  3OMC A;  4A4K A;  2ATC B;  2K9G A;  1VQ6 Q;  3NTH A;  1M3A A;  3MP6 A;  2KYM A;  5FU6 B;  1NJI U;  2CP7 A;  4XTU A;  5A2Q E;  1BCO A;  2JXB A;  2JJ9 A;  2WAC A;  3EGD A;  4QVD A;  3SB2 A;  4N0A C;  5IAY A;  1K73 R;  4OB3 B;  1Q7Y U;  4CI0 C;  2ZPG B;  1B07 A;  1YP5 A;  4QVZ A;  1G2B A;  5KCO A;  3OYE A;  4OMF B;  2OTL A;  2CUB A;  2M0Y A;  4J6W A;  1R8O B;  3M5A A;  5GJW B;  2YHT A;  1VQK A;  3M0S A;  3V7S A;  4E7I A;  1B7T A;  1OEB A;  2O01 E;  2O2O A;  1QQJ A;  3CPW A;  3CC4 T;  2RHI A;  3V8K A;  3MP8 A;  3PT9 A;  3PFS A;  1K8A C;  5LJ5 j;  2HKQ B;  5LJ3 g;  3CME A;  3NGP A;  3NMZ C;  1N9S A;  2P4T A;  3PIP A;  4LDY A;  2JTM A;  3OBY A;  2VXE A;  4LD6 A;  2DPP B;  3RBB B;  5FLX E;  1WX6 A;  3LX7 A;  1VQP T;  5CKE A;  2B86 A;  4HCK A;  3LGF A;  4KGV B;  3VUB A;  3G6E T;  2PQW A;  4BDZ A;  2PNI A;  5FU7 B;  4ZN3 A;  1QVF A;  3OYM A;  2OJ2 A;  3OYK A;  3QYH B;  2KYB A;  2VB6 A;  1N8R R;  4AMC A;  1IXD A;  5AYF A;  3EFO B;  2JOY A;  1AVZ C;  3CCU A;  4DA4 A;  4M7D F;  2LQW A;  1AEY A;  2LQK A;  4C8Q E;  1QVP A;  1G3T A;  5IXF A;  2YUO A;  1QVG P;  1LCK A;  1ARK A;  1M4Z A;  2DER A;  5A0G A;  4ZN1 A;  3A8H B;  2LJ3 A;  3G1J A;  2AKK A;  3CBP A;  3I55 T;  4M7A C;  3OYH A;  4N0A A;  1VQ5 T;  1OOT A;  3G4S T;  5KYX A;  3A8M B;  4N4I A;  3EG9 A;  3JCM P;  2CP5 A;  3QYG B;  3CPW P;  5KE3 A;  1FYN A;  4OVA A;  1YI2 Q;  1M3B A;  4OB1 B;  3L2Q A;  1M3C A;  4BY6 C;  4E7K A;  3MO8 A;  3H6Z A;  3SFM A;  4M77 E;  3MPU B;  1M1G A;  4JRQ A;  1SRL A;  2RQW A;  2HL5 C;  3CME Q;  4J7I A;  3I35 A;  1HYO A;  1RLQ C;  1RAE B;  1NLP C;  3RR6 A;  4E2F B;  1D3B A;  5LJ3 d;  4RCB A;  4M7D A;  1LPL A;  1QVG S;  3G4S Q;  4M78 D;  4PJO F;  4KBM B;  4A54 A;  1X75 C;  4AT1 B;  2LJ1 A;  4BI8 B;  4FYV B;  3SEM A;  3EGX A;  4PFZ A;  2VVK A;  2JUF A;  1KIK A;  2ZPB B;  2X9H A;  2D1X A;  4XU2 A;  4Z8A A;  2AT1 B;  3X28 B;  1KC8 U;  2OTL Q;  4M7A D;  1PD0 A;  4M7D B;  2KXC A;  2QAZ A;  2RMO A;  4BDY A;  4A63 B;  4ELZ C;  1U1S A;  4MDW A;  2DXC A;  2CKK A;  3QWY A;  4MDX A;  1MGQ A;  2CZ6 B;  1TH7 A;  3H0H A;  3JCM W;  2YLB A;  3OYF A;  2XIC A;  4E7L A;  2PVD B;  5IN1 A;  3OA6 A;  4M75 F;  3OW2 A;  5I21 A;  2FRW A;  4J9C A;  1PM3 A;  1SHF A;  5D6W A;  1YHQ A;  2RHZ A;  3REA B;  2F5T X;  3TSZ A;  4A4F A;  4PL6 A;  2AZV A;  1I1J A;  3CXC P;  3OMG A;  4CC4 B;  1EX4 A;  4QW2 A;  2HCK A;  1BU1 A;  3LWI A;  3CD6 Q;  1UTI A;  3VYG A;  2X3W D;  3CCM A;  2I2L A;  5HY6 A;  2DE0 X;  4E47 A;  2FG0 A;  1QP2 A;  1KD1 C;  4BUG A;  2F5K A;  2R5A A;  3HRT A;  2KT8 A;  1G3S A;  4HT8 A;  5FU6 C;  1OUL A;  2X35 A;  2I0N A;  4FYX B;  4CRI A;  1W2B S;  2DJZ A;  2EJF A;  1NPP A;  4F14 A;  1AWX A;  3M54 A;  1H64 1;  8ATC B;  2OTJ Q;  1Q82 R;  2BE7 D;  4FT2 A;  2GBQ A;  5GAN h;  3CCQ Q;  2DVE A;  2LMJ A;  1VQ8 Q;  4LNP A;  2C0T A;  3HFN A;  2P84 A;  4LUE A;  3ER0 A;  2J7I A;  3MET A;  2ABL A;  4JS5 A;  2ZPI B;  5KYW A;  3OYD A;  2GTJ A;  1VQ7 A;  3PVQ A;  5FRO A;  4OF1 A;  2OAW A;  4FM4 B;  4KRT A;  4MZT A;  3CPW S;  2LCL A;  3A5Z B;  5DY9 A;  1WHG A;  2OX7 A;  3CC7 A;  3ULR B;  4M7D E;  2CH4 W;  2CZ1 B;  3RMQ A;  3I5S A;  5HK3 A;  1BCM A;  3M56 A;  2LVM A;  1RAA B;  2DAQ A;  4DQ2 A;  1NLO C;  4XAX B;  1AT1 B;  1YWO A;  2XU8 A;  4M77 G;  1WPY A;  3DLM A;  2WSF E;  1ZA2 B;  3HFO A;  1XJW B;  1BI1 A;  4FCY A;  5GAN d;  1P92 A;  2D0Q B;  4JJD A;  4J9D A;  1WFW A;  5IHK A;  4FT4 A;  4QVC A;  2FYK A;  4YTL A;  5CR2 A;  2XD0 A;  1PKS A;  1NZ9 A;  2A3L A;  1D1B A;  5GMK l;  1NYF A;  4Z02 A;  3REB B;  2E64 A;  1SEM A;  1YFN A;  1M8M A;  3CMA T;  2ED0 A;  4C8Q D;  5HK0 A;  3QZ5 B;  1IO6 A;  2DZC A;  2FZG B;  1W2B P;  1BK2 A;  1Q81 R;  2LX7 A;  2SRC A;  1X01 A;  1K76 A;  1KQS S;  1G83 A;  2O9S A;  3SWN A;  3GNF B;  1WIE A;  2BZX A;  1Q81 U;  1GBQ A;  2CP2 A;  4X1V A;  4M78 B;  3QSU A;  3NHN A;  4M75 B;  4Y92 A;  2K3B A;  2BKD N;  4RTT A;  2VAS A;  1UUE A;  2DA9 A;  1BYM A;  4K11 A;  5CQY A;  3CC2 Q;  1ZBJ A;  2MCN A;  1ZSG A;  2Y4Y A;  1KQS P;  4J7F A;  3TSW A;  2VGM A;  3V7R A;  1JJ2 P;  4RMO A;  1EZZ B;  1T0J A;  2W10 A;  1WXU A;  2D8H A;  2ZPF B;  4L6V 5;  3H0F A;  4B6M A;  1ZUU A;  4X9C A;  3J80 E;  1TU0 B;  3QZ9 B;  3CCL A;  5LJ5 e;  4LDV A;  3RER A;  1UGP B;  5GAN f;  2RJD A;  5D7U A;  2DRK A;  2HQX A;  1JU5 C;  2X4Y A;  3EGU A;  3JCM J;  1U06 A;  3JB9 G;  3U23 A;  1UGR B;  1Y0M A;  3HSB A;  3OS2 A;  3CC2 T;  2LRQ A;  1VQ4 T;  1C1A A;  5CAI A;  3CD6 T;  2MMP A;  3JB9 J;  5GAM f;  2DK3 A;  1M1K R;  4M7A F;  2RI2 A;  4C92 E;  2AIR B;  4XTY A;  4NS5 A;  3JAM E;  1UG1 A;  1KSW A;  2JS2 A;  2Y90 A;  4OMP A;  4ME7 A;  1WJR A;  2LQN A;  3G6E Q;  2DEQ A;  3RUX A;  1HD3 A;  3CCM Q;  4BI4 A;  3QO3 A;  5IT9 E;  1J3T A;  2LNH B;  4C5E A;  2LZ6 B;  2LDM A;  2E3I A;  2M16 A;  3M4Y A;  2BTT A;  4OGE A;  4XTW A;  1YHQ Q;  2AZS A;  4IIO A;  3G71 A;  2MYS A;  3VS7 A;  1VQK Q;  3LYI A;  3CCE A;  3MEA A;  1U1T A;  1W1F A;  1BI0 A;  4O5V A;  2HMA A;  1I07 A;  3CCM T;  2MWO A;  1YIT A;  1VQ4 Q;  1YBY A;  2ZCF B;  1UFF A;  2Y4X A;  2RJC A;  2QYZ A;  2QEX T;  3ZFJ A;  2QXF A;  3E2U A;  5GMK e;  3CCV Q;  3WVE B;  2JM8 A;  1SF9 A;  2K2M A;  1VQ6 A;  2JMC A;  2FRY A;  1EIF A;  1SPK A;  1FMK A;  5HCK A;  4IUQ A;  2LT1 A;  4IUT A;  2RB6 A;  3MEW A;  2DL5 A;  1FWZ A;  2QGF B;  3X20 B;  1RI0 A;  3DKM A;  2RQV A;  4MMK A;  1PHT A;  5GAN 6;  4LE9 A;  4PLI A;  2MWP A;  3VS4 A;  1YIJ T;  1Z9Q A;  4RTX A;  2K4Y A;  2YUN A;  4DOV A;  2DET A;  3Q1J A;  2RNA A;  2CH4 A;  1VQN T;  5LJ3 f;  2NYS A;  3L2V A;  3QXE B;  4HCZ A;  4O6J A;  1NBE B;  2RN8 A;  2KY9 A;  4R56 A;  1WXT A;  3OS0 A;  1KC8 R;  5GAO q;  3LW5 E;  1W4S A;  3OW2 P;  1VUB A;  5I2S A;  3DB4 A;  2EGC A;  5GMK j;  1WHM A;  3O8V A;  4C92 C;  3QJY A;  2JZ2 A;  2ENM A;  1MHN A;  4PFO A;  4C8Q B;  4PJO G;  1E7O A;  3EHQ A;  5FRM A;  2XDB A;  1WJS A;  1MMG A;  2GQV A;  1VQ4 A;  2FZK B;  1BIA A;  3GP8 A;  3O5Z A;  2X4J A;  4PJJ A;  2PUO B;  3VRY A;  3CC4 Q;  2C0I A;  2A37 A;  2K3Y A;  3QHS A;  1UGQ B;  4MZP A;  1UJY A;  4M77 F;  2DF6 A;  2P0K A;  2DBK A;  2H3E B;  4A4G A;  4N4H A;  4J9E A;  4M7A E;  3CCV T;  3TQ7 P;  4CC3 A;  3KXT A;  1RAI B;  1BKB A;  2CT4 A;  2XI9 A;  4XU1 A;  1NPR A;  2YT6 A;  3M4G A;  1B34 A;  2YWW A;  1MNE A;  4BE0 A;  2BZY A;  1VQ7 Q;  3J81 E;  1GL5 A;  1IRE B;  4PJM A;  1M2O A;  1IRX A;  1BBZ A;  3E1S A;  2CZ0 B;  1LOJ A;  1VQ5 Q;  4VUB A;  2KI7 A;  2RJF A;  4EMH A;  3KFV A;  3HP9 A;  3A98 A;  1MMA A;  1Q86 U;  1VQL A;  2F69 A;  1WYX A;  4DBQ A;  3CCL T;  1Y07 A;  4IUP A;  2KRO A;  4RKU E;  6AT1 B;  2ZZD A;  2L89 A;  4ELY C;  1D0Z A;  2PU9 B;  1ABO A;  1XTD A;  4PFP A;  5L8R E;  1K9M R;  3HHT B;  3V7C A;  3S3O A;  4ANJ A;  4EMK C;  2JVV A;  4AG2 C;  3OY9 A;  2CDT A;  1T3L A;  5C6S A;  3JRZ A;  4AFZ C;  3C0C A;  5KYN A;  3VU3 C;  2YUQ A;  1YJN A;  1UB4 A;  5GAN j;  3VYH B;  2QA4 T;  3X25 B;  4RTU A;  1QKX A;  3BDU A;  2CP3 A;  2DIQ A;  2CYZ B;  4GBQ A;  2BZ8 A;  5IHI A;  2QDL A;  1VQ9 T;  3NTI A;  2FZC B;  1U5S A;  3HKS A;  1S72 A;  4JRI A;  4D8D A;  5J26 A;  3CCS T;  2COY A;  2AK5 A;  2YLC A;  3JCM h;  4F7U B;  2ROT A;  4PLL A;  4OML A;  1VQ8 T;  1TTH B;  4Y28 E;  5GMK m;  1M30 A;  3THK A;  2ESW A;  1GBR A;  1I8F A;  4RTV A;  2QTV A;  5D6X A;  1RL2 A;  5CQX A;  1QVF S;  4IKF A;  1YWP A;  1M9S A;  2KBT A;  3T9N A;  3TEE A;  2KGT A;  4NL2 A;  3RKW A;  5L23 A;  1OPK A;  1IGU A;  1M2V B;  2MIO A;  4M77 D;  2G3R A;  5LL6 S;  2YRD A;  4C8Q F;  3G4S A;  1VQN A;  4C0D B;  1H3Z A;  4PJO E;  5GAO n;  3M57 A;  1YIT T;  1VQM Q;  5A0L A;  3WVD B;  2RHY A;  2DIG A;  3JCM e;  2GGR A;  4XU0 A;  1MV0 B;  4FU6 A;  1WHK A;  2O31 A;  5CCA A;  3A8O B;  4KH1 B;  1K1Z A;  4C0G A;  2KRN A;  5GMK i;  2RI3 A;  4E7J A;  2HSP A;  1K9M C;  1YHQ T;  2EQK A;  2DXB A;  4J9F A;  4M75 E;  4HCC A;  4F7U F;  4EMK A;  2DKG A;  3SDZ A;  2EGA A;  3I55 A;  1LVK A;  3FEO A;  3CC4 A;  2V1R A;  1JRI A;  5FWB A;  2L5Q A;  4M7D C;  2COW A;  3BDL A;  3GOX A;  3I55 Q;  1I5O B;  3LLR A;  3JCM g;  5KCH A;  1N27 A;  2SEM A;  1M1K U;  1VQO Q;  2C0O A;  2KMT A;  1VIE A;  1G3Y A;  1ZA1 B;  2PTK A;  2EVR A;  2KK4 A;  1U3O A;  1D3B B;  2K2V A;  2VUB A;  1TUC A;  1ZUK A;  1ZUY A;  1N9R A;  3RDV A;  2Z0W A;  1X6O A;  2XID A;  5LJ5 h;  5LJ3 h;  5FU7 C;  3I56 A;  1RAG B;  2KRM A;  3PMI A;  1YN8 A;  4XQ3 A;  3CCQ A;  2RQU A;  1OQK A;  4ESR A;  3JCM f;  1PSE A;  2MOX A;  2E65 A;  5GAO m;  2CSI A;  4QKU A;  2EYQ A;  2VGN A;  1WQW A;  2M9U A;  4PNO A;  1NG2 A;  2M0O A;  2RK1 A;  3FLG A;  2V1Q A;  5EC7 A;  1X2Q A;  1AZG B;  4X34 A;  4QQG A;  1TOV A;  1K4U S;  2KEA A;  2NUT A;  1IGQ A;  1QCF A;  3S3N A;  3JB9 D;  1VQM T;  1OZ3 A;  4TVR A;  2G6F X;  5HKC A;  2KSS A;  2J6K A;  1Q7Y R;  4XU3 A;  5LJ3 e;  4J9B A;  2MAM A;  2OAU A;  1UGS B;  2RM4 A;  5LJ3 j;  3UAT A;  2IVW A;  3PNW C;  4M7D D;  1DJ7 B;  3OYA A;  1I0C A;  2D9T A;  1YJN Q;  2EQJ A;  1KD1 R;  1YJW T;  1OZ2 A;  1K73 C;  1HXD A;  3TVT A;  1YCS B;  3E9G A;  3CCS Q;  1ABQ A;  2D0N A;  4LDW A;  4FYY B;  1K9A A;  2EQI A;  4KGZ B;  2L3S A;  1FXX A;  2FPE A;  4QQ6 A;  1X6G A;  1M27 C;  2CGH A;  2J6O A;  4N4G A;  3CCR T;  3CCE Q;  3VKI A;  2V26 A;  2GCX A;  4EMK B;  3RKY A;  4M78 G;  3G71 Q;  2HD0 A;  1VQO T;  1Y96 B;  1XOV A;  4XK8 E;  4ZTJ A;  2EBP A;  5GAN 3;  3QUI A;  3CCJ Q;  2LCS A;  2XKO C;  4KT0 E;  3JCM X;  4J9G A;  2DXT A;  4J9H A;  4C5G A;  1Q82 U;  3KBG A;  2HL3 A;  1MND A;  3FRN A;  2A08 A;  4L5G A;  3QDR B;  4DBF A;  2FL7 A;  1CKA A;  1Q82 C;  4JJC A;  1WLP B;  4RCC A;  5GAM h;  3UDC A;  4OMN A;  2EPD A;  5GAN g;  2KT1 A;  2B8A A;  1ZQ1 A;  3G71 T;  2LC4 A;  1UGV A;  2EFI A;  2FPF A;  2DRM A;  1I81 A;  2RF0 A;  4EPC A;  3UPU A;  3HTR A;  4F04 B;  4KUD K;  4PJO C;  4AFU C;  1ZSZ C;  1SKU B;  1V29 B;  1M2V A;  1TSF A;  4JUV A;  1UEB A;  1VOM A;  2A36 A;  2EGE A;  2P4R A;  4BY6 B;  3GBQ A;  1VQP A;  2EAY A;  1OYX A;  3SWN C;  2K6D A;  5GAN 4;  2VV5 A;  4P5N A;  2DEU A;  2GTO A;  1K73 U;  3F70 A;  2YRV A;  2DJQ A;  1I4K 1;  1KHC A;  4FSX A;  1PRM C;  1GFD A;  3CMA A;  4C0Z A;  5GAN 5;  5DLO A;  3MKD A;  3R6N A;  4IIM A;  1PRL C;  1RLP C;  1WXB A;  2HBP A;  3CC2 A;  2HKN A;  3MCA B;  3AHU A;  1WDX A;  4JZ4 A;  1R0C B;  2KDS A;  3VUZ A;  1LNX A;  2IG0 A;  1WHH A;  1OU9 A;  3C4S A;  3OYJ A;  1M5Q 1;  2EYW A;  3JB9 I;  2QA4 Q;  2E10 A;  2QEX Q;  1T0H A;  1CSK A;  5KYY A;  1Q7Y C;  2GQI A;  3HRS A;  4E7Z A;  2VXF A;  2JN0 A;  3FJP A;  3OQ5 A;  4BAC A;  4IUV A;  4MZM A;  4UC4 A;  2LCC A;  2V8I A;  4KGX B;  2DM1 A;  4JJB A;  4A4E A;  3HL8 A;  1HJD A;  3OW2 S;  3L2R A;  2PUK B;  4A53 A;  3EG1 A;  5CKD A;  4MML A;  2DX1 A;  1X27 A;  1M1K C;  1QWE A;  1IHV A;  1YIT Q;  3QG1 A;  3EGD B;  2ZPH B;  3C12 A;  3IQL A;  2RPN A;  2RD1 A;  4J9I A;  1OI1 A;  4JLG A;  3LH0 A;  4C5I A;  2BUD A;  4M7A B;  5DLQ E;  3LWH A;  3CCR Q;  3CCE T;  2CP0 A;  3N5B B;  3EFR A;  2DIL A;  4JDS A;  2YXY A;  4Y91 A;  2HAX A;  4V2S A;  5CKB A;  1YJ9 T;  4LN2 A;  5M9O A;  2R5M A;  2M02 A;  3VJP A;  1FMV A;  1OV3 A;  1PCX A;  2RH2 A;  5GAM j;  3CCJ T;  1H3H A;  2H8H A;  1RAH B;  1AOJ A;  2JS0 A;  4BD3 A;  2QQA A;  1RAF B;  5GAM g;  3G6E A;  1N6A A;  3PTA A;  1JXM A;  2EYX A;  1SSF A;  2F1L A;  1M90 R;  1VQL T;  2J6F A;  2IPO B;  3RNJ A;  1TWB A;  1QCO A;  3PVL A;  1GCQ A;  2DZ9 A;  2F2X A;  2XMF A;  3TRE A;  4M75 G;  2JTE A;  2NUT B;  4PKC C;  1M90 U;  1V76 A;  2GNC A;  4A4H A;  1KHI A;  1RAD B;  4C8Q G;  4OGC A;  1AZE A;  2L3R A;  3S6W A;  1BB9 A;  3CD6 A;  4WTO B;  4FL6 A;  2ROL A;  4B9X A;  5GJV B;  1AWW A;  1D0Y A;  1VQO A;  1D1C A;  1RAC B;  4M75 A;  1VQ9 A;  3CCL Q;  4KH0 B;  1GXI E;  4LDU A;  1PD1 A;  5GAM e;  1QLY A;  2O4X A;  1U8R A;  2VWF A;  3J7A F;  2K3X A;  3NPF A;  2LX9 A;  1KQS A;  1KFZ A;  2EQM A;  5FW9 A;  3D7S B;  3M58 A;  2DFU A;  2KR3 A;  1YIJ A;  1W6X A;  1Y7X A;  2DD4 A;  5IXB A;  1KQ1 A;  3FJ5 A;  2WSC E; 
#chains in the Genus database with same CATH homology
 2I2L A;  5HY6 A;  4E47 A;  4EMG A;  1QVF S;  2RK2 A;  4ATO A;  3LGL A;  1QP2 A;  1KC8 C;  1KD1 C;  3P8D A;  4II1 A;  4IKF A;  1M9S A;  2F5K A;  3FDR A;  2R5A A;  3HRT A;  4HKE A;  1G3S A;  3OSV A;  3T9N A;  5FU6 C;  3BY7 A;  4NL2 A;  3RKW A;  3TEE A;  1YJ9 A;  4HT8 A;  2X35 A;  4CRI A;  1M90 C;  1W2B S;  2DJZ A;  2XDP A;  2EJF A;  4M77 D;  4M78 C;  1NPP A;  4PJO B;  3M54 A;  2G3R A;  1H64 1;  1NE8 A;  5LL6 S;  1XNI A;  2E70 A;  4C8Q F;  3CCJ A;  3G4S A;  1VQN A;  2DXU A;  2OTJ A;  5GMK h;  2QTX A;  2OTL T;  4C0D B;  1H3Z A;  4FT2 A;  4PJO E;  5GAO n;  5GAN h;  3M57 A;  1YIT T;  2DVE A;  5KE2 A;  5A0L A;  1Y96 A;  3KUF A;  4M78 E;  4C0D C;  4HT9 A;  3HFN A;  3WVD B;  2RHY A;  3ER0 A;  2DIG A;  3MET A;  3P8B B;  3JB9 F;  4JRK A;  3OBW A;  4JS5 A;  2DO3 A;  3JCM e;  1BI3 A;  2ZPE B;  2ZPI B;  4XU0 A;  3OYD A;  4HCB A;  3QJ6 A;  1VQ7 A;  4M7A F;  4FU6 A;  3NFC A;  5CCA A;  5FRO A;  4OF1 A;  3SD4 A;  3A8O B;  4FM4 B;  4MZT A;  4C0G A;  3CPW S;  2XK0 A;  2LCL A;  3A5Z B;  4M7D G;  5DY9 A;  5GMK i;  2RI3 A;  4E7J A;  1K9M C;  3CC7 A;  3CCS A;  1YHQ T;  1YI2 A;  3ASK A;  2EQK A;  2DXB A;  4M75 E;  4HCC A;  4M7D E;  3C95 A;  2CZ1 B;  4F7U F;  3RMQ A;  3CPF A;  4EMK A;  4BUG A;  3CCR A;  3OYB A;  3RMS A;  2DKG A;  1BIB A;  3SDZ A;  5HK3 A;  3M56 A;  3OSS C;  3I55 A;  2LVM A;  2DAQ A;  1PSF A;  2DTO A;  2XG8 D;  3FEO A;  5CVI A;  3CC4 A;  3PGG A;  4DQ2 A;  4M78 F;  4PJO D;  2GFA A;  4XAX B;  4M75 C;  1JRI A;  4M7D C;  2L5Q A;  3HRU A;  2XU8 A;  3BDL A;  4M77 G;  1WPY A;  3DLM A;  2WSF E;  3GOX A;  3V8L A;  3HFO A;  3LLR A;  1BI1 A;  3JCM g;  1N8R U;  2QI2 A;  2CZ7 B;  2E41 A;  1P92 A;  2D0Q B;  4C92 G;  5KCH A;  1N27 A;  5GAN d;  1M1K U;  4LD9 K;  3M55 A;  4F7U G;  4LDX A;  1W2B A;  2KMT A;  4FT4 A;  1VIE A;  2E5Q A;  1G3Y A;  2FYK A;  3CBM A;  4YTL A;  2DTH A;  4QVC A;  2KK4 A;  2XD0 A;  3S3M A;  1NZ9 A;  2A3L A;  3JB9 H;  1G5V A;  5GMK l;  3OB9 A;  3I56 T;  1D3B B;  2K2V A;  3GIB A;  1O9S A;  4Z02 A;  2VUB A;  2E64 A;  5EG2 A;  3JCM c;  1N9R A;  5GAO r;  2RO0 A;  1X6O A;  3UT1 A;  1I5L A;  1VQ7 T;  2E12 A;  2XID A;  3L2U A;  5LJ5 h;  3CMA T;  5LJ3 h;  3TCJ A;  5FU7 C;  4C8Q D;  4D6W A;  5HK0 A;  3I56 A;  4ZGD B;  2RA2 A;  1WQ7 A;  3QZ5 B;  3MP1 A;  2DZC A;  3PMI A;  3L2Z A;  1VQ8 A;  4XQ3 A;  3CCQ A;  2E6Z A;  2DD5 A;  3FC3 A;  4RG8 A;  4JS4 A;  2GF7 A;  4HA8 A;  1AHJ B;  1WJQ A;  4ZTF A;  2EJG A;  3JCM f;  3MEU A;  1ZBX A;  2QQ9 A;  1PSE A;  3E19 A;  1X01 A;  1KQS S;  3X24 B;  2E65 A;  5GAO m;  4M78 A;  3GF5 A;  1VQ5 A;  2EYQ A;  2VGN A;  1WQW A;  3OYI A;  2M9U A;  4PNO A;  2EKO A;  3SWN A;  3OS1 A;  2M0O A;  2RK1 A;  3FLG A;  3GNF B;  4JRP A;  4C92 F;  1Q81 U;  2QQR A;  3HPW A;  4GY5 A;  4M78 B;  4X34 A;  3EAE A;  4QQG A;  3QSU A;  3JSC A;  4J5Y A;  2CS7 A;  3ZEH A;  4ZGJ B;  2M1H A;  4M75 B;  4M7A A;  1K8A U;  4M7A G;  2BKD N;  2ZGW A;  2K5L A;  4JLI A;  3OYL A;  2AHJ B;  3S3N A;  4JJN K;  3JB9 D;  1VQM T;  1OZ3 A;  1Q86 C;  4TVR A;  1BYM A;  5J39 A;  4BI3 A;  4XTX A;  5CQY A;  4BB7 A;  5HKC A;  4E7H A;  2KSS A;  2Y4Y A;  4XU3 A;  3SWN B;  5LJ3 e;  4J7F A;  3PIO A;  2VGM A;  3V7R A;  3QII A;  2MAM A;  4RMO A;  2OAU A;  1UGS B;  2E1H A;  2RM4 A;  5LJ3 j;  1JJ2 S;  2ZPF B;  2IVW A;  2LT4 A;  4L6V 5;  3PNW C;  1WNL A;  1DJ7 B;  4M7D D;  2JTF A;  3OYA A;  1YI2 T;  1JJ2 A;  4X9C A;  3J80 E;  2LTO A;  4IUU A;  3RKX A;  4F7U E;  3EFS A;  2D9T A;  3QZ9 B;  3CCL A;  5LJ5 e;  2EQJ A;  4LDV A;  1YJW T;  3RER A;  1UGP B;  5GAN f;  1OZ2 A;  2RJD A;  4KUL A;  1QVG A;  1HXD A;  1K73 C;  3L42 A;  4WF2 A;  2HQX A;  1K9M U;  2VYT A;  2X4Y A;  3E9G A;  5GAM d;  5GAN 7;  3BFM A;  3JCM J;  3JB9 G;  2R58 A;  3URG A;  1UGR B;  4LDW A;  3HSB A;  3OS2 A;  3CC2 T;  2LRQ A;  2XDD A;  2K5F A;  2O4X B;  1FXX A;  5CAI A;  1VQ4 T;  2PVG B;  4QQ6 A;  3CD6 T;  2MMP A;  3X26 B;  2CGH A;  4N4G A;  4F7U A;  3JB9 J;  3CCR T;  2HQE A;  2QDY B;  3FIF A;  3VKI A;  2GCX A;  2JNG A;  4EMK B;  3RKY A;  4ZGE B;  2RI5 A;  4M78 G;  5GAM f;  2HD0 A;  1ZHI A;  4QQD A;  1VQO T;  1Y96 B;  1XOV A;  2DK3 A;  5LJ5 g;  4XK8 E;  1VQM A;  3A8G B;  5CO7 A;  2WSE E;  4M75 D;  4ZTJ A;  5LJ5 d;  2D6F A;  5CKH A;  2EQU A;  1HK9 A;  4C92 A;  1YJN T;  2EWN A;  2KQW A;  4OP0 A;  5GAN 3;  2RI2 A;  5J3B A;  3CEY A;  3QUI A;  4C92 E;  2V8K A;  2XKO C;  4KUI A;  4XTY A;  5CR2 A;  4KT0 E;  3V8J A;  3JCM X;  1KQ2 A;  2DXT A;  1WGS A;  2OTJ T;  3G7Z A;  1FX7 A;  4NS5 A;  4C5H A;  3JAM E;  2X4X A;  4C8Q A;  5GAO l;  2MF2 A;  2Y90 A;  1YCY A;  4J6Y A;  4GLK A;  4C92 B;  4ME7 A;  4C5G A;  1Q82 U;  3KBG A;  5LJ5 f;  1BI2 A;  1WJR A;  4BE1 A;  1KD1 U;  2XHC A;  1VQ6 T;  5GAN 8;  4C8Q C;  2DEQ A;  3FRN A;  4L5G A;  4M77 B;  3QDR B;  3RUX A;  2FL7 A;  2QA4 A;  4BI4 A;  3QO3 A;  3H8Z A;  3RES A;  4R55 A;  5IT9 E;  3MHX A;  1Q82 C;  4C5E A;  2X4W A;  4RCC A;  2LDM A;  3UDC A;  5GAM h;  3OYN A;  5GAN g;  2EJ9 A;  2M16 A;  2E6N A;  3QBY A;  3GNG A;  2B8A A;  3M53 A;  1ZQ1 A;  2NLU A;  3M4Y A;  4OGE A;  2LC4 A;  4RG2 A;  3G71 T;  2BIV A;  1VIF A;  2EFI A;  4XTW A;  5C0M A;  2K5I A;  1I81 A;  3GLX A;  4EPC A;  3G71 A;  3DB3 A;  2R57 A;  3UPU A;  3OMC A;  3LYI A;  3UWN A;  3CCE A;  4A4K A;  3MEA A;  1U1T A;  4KUD K;  1BI0 A;  3L1A A;  3CME T;  4O5V A;  4PJO C;  3JCM V;  3ME9 A;  3NTH A;  3CCV A;  1QP3 A;  1V29 B;  4FIB A;  3JCM d;  3CCM T;  2MWO A;  3MP6 A;  1YIT A;  1YBY A;  4JUV A;  3P8H A;  2FHD A;  1UEB A;  5FU6 B;  2ZCF B;  4BY6 B;  1VQP A;  2EAY A;  1NJI U;  1OYX A;  5DM7 R;  3SWN C;  2Y4X A;  4XTU A;  5A2Q E;  4C92 D;  2RJC A;  2VV5 A;  4P5N A;  5GAN 4;  3OYG A;  5GAO p;  1K73 U;  3F70 A;  3R6O A;  2WAC A;  2YRV A;  2QEX T;  3ZFJ A;  4QVD A;  3SB2 A;  4N0A C;  2VC8 A;  5IAY A;  1I4K 1;  2QXF A;  1KHC A;  4OB3 B;  5GMK e;  1Q7Y U;  3WVE B;  4CI0 C;  2ZPG B;  1VQ6 A;  4FSX A;  4QVZ A;  3CMA A;  2OTL A;  5KCO A;  1EIF A;  4OMF B;  3OYE A;  3FB9 A;  4C0Z A;  5GAN 5;  4IUQ A;  2LT1 A;  4IUT A;  4J6W A;  1R8O B;  3M5A A;  5CK9 A;  2YHT A;  5DLO A;  1VQK A;  2RB6 A;  2HNI A;  3MEW A;  3V7S A;  4E7I A;  1FWZ A;  2O01 E;  3X20 B;  4M77 C;  2HBP A;  1RI0 A;  3DKM A;  4MMK A;  4OB0 B;  3PMT A;  3OS5 A;  3C94 A;  3CC2 A;  3MCA B;  3AHU A;  2FB7 A;  2GFU A;  2H3J A;  3QKJ A;  5GAN 6;  1Y71 A;  4PLI A;  2KDS A;  3VUZ A;  1LNX A;  3CPW A;  3CC4 T;  2MWP A;  3MEV A;  4L59 A;  2IG0 A;  2RHI A;  3V8K A;  5CKF A;  3GPL A;  3MP8 A;  3PT9 A;  1YJW A;  3PFS A;  3C4S A;  3OYJ A;  1K8A C;  3TU4 K;  1M5Q 1;  3CBO A;  2LQ8 A;  3JB9 I;  5LJ5 j;  4NL3 A;  1YIJ T;  5LJ3 g;  3CME A;  3JCM b;  2E10 A;  4J83 A;  1N9S A;  2P4T A;  2K4Y A;  3PIP A;  1Q7Y C;  4LDY A;  4DOV A;  3HRS A;  2JTM A;  2VXF A;  3OBY A;  2JN0 A;  3FJP A;  2L8D A;  2VXE A;  3Q1J A;  4LD6 A;  1VQN T;  2DPP B;  5LJ3 f;  3OQ5 A;  5FLX E;  4BAC A;  3L2V A;  3QXE B;  4HCZ A;  4IUV A;  4MZM A;  4O6J A;  3LX7 A;  4UC4 A;  2LCC A;  2KY9 A;  2V8I A;  5CKE A;  1VQP T;  4R56 A;  3OS0 A;  2QQB A;  4A4E A;  4DOW A;  1B34 B;  3OYC A;  3LGF A;  3VUB A;  2DTI A;  5GAO q;  3LW5 E;  3DLL A;  1W4S A;  3HL8 A;  1VUB A;  3G6E T;  5I2S A;  2PQW A;  3DB4 A;  4BDZ A;  5GMK j;  5FU7 B;  4B9W A;  4ZN3 A;  1QVF A;  3OW2 S;  2PVO B;  3L2R A;  3OYM A;  3O8V A;  3OYK A;  2PUK B;  3QPH A;  4C92 C;  3QJY A;  3QYH B;  4A53 A;  1LJO A;  2JZ2 A;  5CKD A;  1MHN A;  4MML A;  5AYF A;  4C8Q B;  4PJO G;  2JOY A;  3WXM B;  3CXC A;  5FRM A;  3CCU A;  4DA4 A;  4M7D F;  2XDB A;  1WJS A;  2LQK A;  2V8J A;  4C8Q E;  1QVP A;  1G3T A;  2GQV A;  1M1K C;  1M4Z A;  1VQ4 A;  5A0G A;  3VV0 A;  3CCQ T;  1N8R C;  4ZN1 A;  3A8H B;  3QG1 A;  1BIA A;  3GP8 A;  2FVU A;  3CCU T;  2X4J A;  2ZPH B;  1G3W A;  3C12 A;  3CBP A;  3RIR A;  3BW1 A;  3I55 T;  2PUO B;  4M7A C;  2RD1 A;  2MI6 A;  3OYH A;  1OI1 A;  4N0A A;  4JLG A;  1VQ5 T;  3LH0 A;  3G4S T;  2K3Y A;  3QHS A;  1UGQ B;  4MZP A;  4C5I A;  3A8M B;  4N4I A;  5GAN 2;  2BUD A;  4M77 F;  2P0K A;  4X9D A;  5DLQ E;  4M7A B;  3LWH A;  3JCM P;  3CCE T;  3N5B B;  3EFR A;  3QYG B;  4JDS A;  2A7Y A;  4Y91 A;  1XQH A;  2EIF A;  5A0D A;  4A4G A;  5KE3 A;  2HAX A;  4N4H A;  5CKB A;  4V2S A;  1YJ9 T;  4M7A E;  4OVA A;  4OB1 B;  3CCV T;  3KXT A;  3L2Q A;  5M9O A;  1BKB A;  2XI9 A;  2R5M A;  4M77 A;  3MO8 A;  4BY6 C;  4E7K A;  4XU1 A;  3H6Z A;  3VJP A;  2RH2 A;  1QW1 A;  1NPR A;  3M4G A;  1B34 A;  1JBM A;  3L2W A;  4BE0 A;  5GAM j;  4M77 E;  3SFM A;  3CCJ T;  1M1G A;  3J81 E;  4JRQ A;  4BD3 A;  2QQA A;  1IRE B;  3OYY A;  1S72 T;  3G6E A;  5GAM g;  2C06 A;  1N6A A;  3PTA A;  2QEX A;  2K57 A;  4NOY A;  4J7I A;  1I8F A;  3E1S A;  4J8O A;  2CZ0 B;  1LOJ A;  1O75 A;  1SSF A;  5I2M A;  5CIU A;  1VQL T;  4VUB A;  4XTV A;  4XTZ A;  1D3B A;  2RJF A;  5LJ3 d;  4RCB A;  4EMH A;  4M7D A;  1QVG S;  3HP9 A;  4M78 D;  4PJO F;  1VQL A;  1Q86 U;  2P0Q A;  4KBM B;  1X75 C;  2F69 A;  2DZ9 A;  3A8L B;  4A54 A;  3CCL T;  4BI8 B;  1Y07 A;  3TRE A;  2LNV A;  4M75 G;  4IUP A;  4PKC C;  1M90 U;  2KVQ G;  4RKU E;  2JUF A;  2ZPB B;  2ZZD A;  3M9Q A;  4A4H A;  2L89 A;  4ELY C;  4BE2 A;  4XU2 A;  2PU9 B;  5D6Y A;  3X28 B;  1KC8 U;  1XTD A;  5L8R E;  5FRN A;  4M7A D;  4IUR A;  1KHI A;  3HHT B;  4C8Q G;  3JCM Q;  4OGC A;  3NTK A;  3V7C A;  2L3R A;  3S6W A;  3S3O A;  3CD6 A;  4M7D B;  4FL6 A;  4EMK C;  2JVV A;  4BDY A;  4Q5W A;  1KG1 A;  2RHU A;  4ELZ C;  3OY9 A;  1IZ6 A;  1U1S A;  4J6X A;  4B9X A;  3E9F A;  1NJI C;  4MDW A;  2DXC A;  1VQO A;  2CKK A;  5C6S A;  3JRZ A;  4MDX A;  1MGQ A;  4M75 A;  3VU3 C;  1VQ9 A;  2CZ6 B;  3CXC S;  1YJN A;  1UB4 A;  1GXI E;  4OB2 B;  5GAN j;  1JB0 E;  3VYH B;  2QA4 T;  1TH7 A;  3CCM A;  3X25 B;  4LDU A;  5GAM e;  3BDU A;  2DIQ A;  3JCM W;  1Q81 C;  2CYZ B;  5KH6 A;  2O4X A;  2YLB A;  3OYF A;  2XIC A;  1U8R A;  4E7L A;  5GAN e;  1VQ9 T;  2PVD B;  2RJE A;  3NTI A;  5IN1 A;  3HKS A;  4M75 F;  3OA6 A;  1S72 A;  2RHX A;  3OW2 A;  2K3X A;  4JRI A;  3M59 A;  3J7A F;  5I21 A;  3INZ A;  1M8V A;  2LX9 A;  1KQS A;  5D6W A;  1VQK T;  5J26 A;  3CCS T;  1YHQ A;  3CC7 T;  2EQM A;  2RHZ A;  2F5T X;  4A4F A;  2P0P A;  4PL6 A;  3ZBD A;  2YLC A;  2QQS A;  3M58 A;  3JCM h;  4F7U B;  4EDU A;  4PLL A;  4C0F A;  1VQ8 T;  3OMG A;  1YIJ A;  4QW2 A;  1Y7X A;  4Y28 E;  5GMK m;  2KAF A;  2DD4 A;  3LWI A;  1KQ1 A;  3VYG A;  2WSC E;  1M1F A;  4PJO A;  5D6X A;  1RL2 A;  5CQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...