3SWNC

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
68
Chain Sequence
LDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRLTGAIRKLGLVVVRGTTLVLIAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm7
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 10
structure length 68
sequence length 74
chains with identical sequence F, O, R
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnC00
5GAMg 4WF2A 4PJOD 2ZGWA 5CAIA 5LJ3d 4NL3A 1D3BA 1I4K1 3JCMQ 4XU2A 4V2SA 2E1HA 4M78E 4M78B 4J6XA 5GMKi 5LJ3e 4F7UG 1N9SA 3RKWA 5GAN6 4M7AE 2DVEA 4PJOF 4F7UA 5GAOp 2RD1A 3BFMA 1Y96A 2DTHA 4M7DD 5GANf 4M75D 2RB6A 4M77D 5LJ3h 4F7UB 2DZCA 3FIFA 4M78C 4NOYA 4HT8A 4C92D 4M7DF 2EAYA 4M75F 4M7AC 3RESA 4X9DA 5GANj 1I5LA 2K57A 4M77F 5LJ5d 5GAOr 1WQ7A 3M4GA 4M78G 1HXDA 5LJ5e 4XTXA 4EMHA 4C92F 4M78A 4XTUA 3V8JA 5I21A 3JB9H 3FJPA 1WPYA 2HNIA 1LNXA 4XQ3A 3SB2A 3JB9I 4M7AG 4QVCA 5GAOl 3RERA 4M7AA 1YCYA 2EJ9A 3JB9F 1LOJA 5LJ5g 2DJZA 2DXTA 2E41A 3FB9A 5LJ3f 4PJOE 3HSBA 5GAMh 5GAOm 4X9CA 2EJFA 3JCMW 3JCMd 4M7AB 3HFOA 4NL2A 3RKYA 3JCMe 4N0AC 1I8FA 4XTZA 5LJ3j 4XTWA 5GMKm 5GAN7 1HK9A 2VXFA 1LJOA 2DZ9A 4M7DE 2EWNA 2YLCA 4M7DB 4MMKA 4M75E 5GMKe 4PJOC 3JCMg 3JB9G 3RKXA 4M77E 2QTXA 4XU1A 1BIBA 4N0AA 3SWNC 4JRKA 2CGHA 3V8LA 4XTVA 4C92E 5GAMf 4RCCA 5GAN4 2VC8A 1WNLA 1WQWA 4PJOG 4C8QD 2DKGA 4PJOA 3EFRA 4M7DC 5GMKh 3BW1A 3SWNA 4J5YA 3JCMb 2DXUA 5GAMj 2E65A 2FB7A 4C8QF 5LJ5j 3PGGA 3EFSA 2DTIA 5GANd 4PJOB 4A54A 4M7DG 1JBMA 4M75G 5GMKl 5LJ5h 5GANe 3SWNB 2EJGA 5GAN5 1JRIA 4M77G 3QSUA 4M7DA 1B34B 3JCMf 4Y91A 3JCMJ 2Y90A 2JN0A 4HA8A 4C92G 3INZA 2RM4A 3V7RA 2VXEA 4F7UF 5GANg 3RUXA 2FYKA 3QHSA 4M75B 1TH7A 3JCMV 3BY7A 4M77B 4MMLA 3JCMX 4EMKB 4J6WA 2E10A 4XU0A 3JCMh 3V8KA 4C92B 5LJ5f 2I2LA 1H641 1M8VA 4M78D 5GMKj 4HT9A 3HFNA 4RCBA 4EMGA 4M7AD 4A53A 4C8QB 4M75C 4C8QE 1U1SA 5GAOn 1B34A 1X01A 4M77C 1I81A 2DTOA 4JUVA 4M78F 4EMKC 5DY9A 3GIBA 3VU3C 3JB9J 5GAOq 3QUIA 4JRIA 3V7SA 1D3BB 3L2ZA 4C92C 2YLBA 2YHTA 4OP0A 5LJ3g 1U1TA 2E64A 3JCMP 4M7AF 3QO3A 4M75A 1M5Q1 1KQ2A 4XU3A 4M77A 4XTYA 4F7UE 3BDUA 2RA2A 4EMKA 4C8QC 3JCMc 1Y96B 4C92A 5GAN8 5GAMd 1BIAA 3RIRA 1N9RA 2DEQA 5GAMe 4JLIA 1MGQA 1KQ1A 5GAN2 3JB9D 3AHUA 4C8QG 5GANh 4PNOA 4DQ2A 5GAN3 3L1AA 4C8QA 4QVDA 3V7CA 4J6YA
chains in the Genus database with same CATH superfamily
4JS4A 2LMJA 2KI7A 2IPOB 2J6KA 3MJXA 2RJFA 3RKWA 1S72Q 3U23A 1BCOA 1EIFA 3UA7A 3GOXA 4IKFA 3C94A 4HVVA 3QZ9B 3DKMA 2K3YA 4M78C 1Q82U 1VQ9Q 2EYWA 5IN1A 3A8GB 1YJWQ 4FYVB 1WGSA 1T3LA 3UF4A 1H3HA 3CCEA 2RN8A 4M7AA 1UUEA 3URGA 1NLOC 1YWPA 2EJFA 2DM1A 1MMGA 4FCYA 1CKBA 2DL7A 2VXFA 1LJOA 2DZ9A 2FO0A 2YXYA 5KYXB 4AFUC 5D6WA 1VQOQ 2BIVA 3OYDA 1HYOA 5CKFA 2E65A 1XOVA 4ZGJB 2Y90A 3OYBA 4FIBA 3OYHA 3V7RA 1PG5B 4AFSC 4F7UF 4ORZA 2FYKA 2ZPHB 2BE7D 2BZXA 2X4JA 2HSEB 2FRYA 3L2WA 2JS2A 4N4GA 2FZGB 3RNJA 1Z9QA 4JJDA 2NUPB 2YLBA 2QXFA 1SEMA 2QA4T 2V1RA 1N27A 2KQWA 3CC4A 1M1FA 4C5IA 3CCUT 4KGZB 2LC4A 3CMAT 2DJQA 2L2PA 1Y71A 3GNGA 2LX7A 3OYKA 4WF2A 4HCKA 4FYYB 4NL3A 4QQDA 2PTKA 4ZGDB 2MK5A 4IURA 3OW2S 3I55T 3D7SB 1TWBA 3LH5A 4HCCA 3M54A 4NOYA 3EG2A 5FWCA 2JOYA 3QG1A 4O5VA 1RI9A 1EX4A 3JB9H 1WHJA 2BUDA 4CC3A 3CCLQ 4ZGEB 2O4XB 3EFOB 2LZ6B 5GJVB 1MNEA 2HL5C 2L3SA 2MWOA 1HK9A 2JXBA 1RAEB 4OB0B 1IGQA 2AHJB 4IUQA 4CC2A 2E5QA 2L8DA 4IUTA 3UWNA 3VS1A 3G6EA 4PJOG 5CQXA 5KYWB 3S6WA 3EFRA 1YI2A 3CMAQ 1S72A 2HBPA 1X6BA 3KXTA 2IVWA 4PJOB 1RLQC 2X4WA 1UDLA 1NPRA 4HCBA 1D0XA 1VQ9A 3ZBDA 5KYXA 3I55Q 1MNDA 2PUOB 4FL6A 1IXDA 1J3TA 2LNHB 1U06A 4XU0A 2QDYB 1UEBA 2KXCA 4EMGA 2CH4W 4RMOA 4C8QE 2EQKA 1M1KC 3ME9A 4AFQC 2LCSA 1D3BB 1YJNT 1NZ9A 1M3CA 4XAXB 2CSIA 1Q86C 1ZSZB 1AVZC 1WJSA 1QP3A 2RA2A 1KD1U 1WLPB 2M0YA 1Y96B 3ER0A 4PFPA 3L42A 4PJJA 2DXCA 4KT0E 3FLGA 5CVIA 1X6OA 3M59A 3M0RA 3CCVT 4F17A 2EGCA 1DJ7B 1BI2A 2NUZA 1OULA 2K7AA 2V8KA 1ABOA 2NUPA 2E5KA 5LJ3e 2XKOC 2Y4XA 3RBBB 1PSFA 2C0IA 2EVRA 2MYSA 2ATCB 4MZPA 3VUZA 2LJ0A 2B86A 2O2OA 4BDYA 3EAEA 2CH4A 3NTHA 2FZKB 2ZPEB 4OB1B 2PVGB 5FRMA 4XTXA 5DLQE 3EH2A 2X35A 4C5GA 2A37A 3CBMA 3I56Q 2KYMA 1BI1A 2MI6A 4AG2C 1PSEA 1YCYA 4J9BA 1Q95G 2HQEA 5GAOm 5FROA 3VKIA 3OYEA 3H0FA 4N0AC 4XTZA 3WXMB 1C1AA 5GMKm 1M27C 2F2XA 2LDMA 2L3PA 4MMKA 4OMFB 5C0MA 5A0LA 2O4XA 4E7ZA 4DA4A 3EFOA 4C0ZA 4E47A 2DKGA 3TEEA 4BY6C 2KAFA 5DLOA 1T0JA 2MIOA 1D0YA 1NYFA 4BACA 2O9SA 3L2VA 3EFSA 1T0HA 4A4GA 3CPWA 3HHTB 2XG8D 2QEXT 1X69A 2DYIA 2FG0A 1C0MA 4C92G 1D1BA 1M3AA 5KYWA 2F5KA 2GCXA 2BTTA 3JCMh 4C92B 1KC8U 3CCLA 2I2LA 2E4HA 1IREB 4BI4A 4JUVA 2RK2A 3OMGA 3VS6A 1F1BB 3VYHB 4GY5A 3MP1A 1PM3A 5IXBA 2YRDA 4C8QC 2JS0A 2DEQA 1VQ5Q 2E12A 2F5TX 2COYA 2G6FX 1VQMA 3OYGA 1OZ3A 2F1LA 1D3BA 4E7SA 2K2MA 1ZSZA 3EG1A 4F7UA 2KK4A 1Y96A 3TSWA 1IZ6A 1JB0E 3PMIA 1KQSS 4RTWA 2DZCA 3M53A 2IG0A 5J3BA 3OS1A 1SPKA 3DLMA 2VV5A 2XU8A 3P8DA 1KHIA 3QWXX 3FJ5A 3FJPA 2HNIA 4QVCA 5GAOl 1MUZA 4BDZA 4R56A 3GPLA 4PJOE 1PCXA 2J6FA 5FLXE 4Z02A 2LQNA 4X34A 1NG2A 1MV3A 2XHCA 3JCMe 3UA6A 1I8FA 1SSHA 4KGVB 2QAZA 4BE1A 4Z89A 3RKXA 1PKTA 2C0OA 3OYJA 2CGHA 3MPUB 2AT1B 1JQQA 4OB3B 1IGUA 2XI9A 5HK3A 4J9DA 5GMKh 2MMPA 4MDXA 3QXEB 5GANd 3OYLA 1JBMA 2D0NA 3M0PA 1Q86R 5ECAA 4M77G 3CXCA 2RQRA 4JRPA 1Q82R 2E3HA 2KRMA 1WXBA 2D6FA 2EQIA 3J81E 5LL6S 1JJ2S 4M77B 4NS5A 4KH0B 3M56A 3I56A 1VQKQ 3V8KA 2DRKA 3OMCA 3LX7A 3PVLA 4HT9A 4RCBA 4M75C 2DE0X 1VQPT 1YCSB 3E1SA 8AT1B 1VIFA 4RTUA 4LUDA 3QUIA 1W2BS 2DMOA 5HKCA 4OP0A 3KFVA 2NUTB 2JW4A 3X24B 4C92A 3LYIA 1UGSB 3IQLA 1U8RA 2ENMA 2RJDA 4N4IA 1RAFB 2VYTA 3CC7T 1QQJA 4A54A 3OYYA 2DD5A 1K9MC 4PKCC 2D8JA 3CCSQ 1KFZA 4ZN3A 4MDWA 2WSEE 1RL2A 4KBMB 2R58A 3X26B 2KR3A 4F16A 4M7DF 3I35A 2EQMA 5M9OA 3EG9B 4EDUA 5LJ5d 5GAOr 3O8VA 4M7AG 4J9FA 2DETA 4JRQA 1T3SA 3FB9A 4J8OA 3O5ZA 5J26A 1K1ZA 4VUBA 4M7AB 1RADB 1VQ8A 2RI5A 4PJOC 1VQ5A 2B8AA 3V8LA 4C92E 1VUBA 2DL4A 1YHQQ 1WJQA 1W1FA 2HZYA 3JCMb 2LNVA 1QP2A 1VA7A 2AKKA 1JRIA 2BE9B 3G71Q 1MMNA 2ROLA 4RUGA 3JCMJ 4MZTA 1PRMC 1D1AA 9ATCB 3JCMX 2VGMA 5IT9E 1I0CA 4E7IA 1D1CA 1G3WA 1VQ4Q 1D0ZA 3M4YA 1YBYA 3NPFA 3HFNA 1QVGS 4ZTJA 3FDRA 1EZZB 1ACMB 1U1SA 2DTOA 4A4HA 1S1NA 4JRIA 1EFNA 3CCMQ 1ARKA 2RMOA 3G6ET 4M77A 2LCCA 4JPBW 5KH6A 4IUVA 5GAMd 2GBQA 3A8HB 4B6MA 2HDAA 5GAN5 3E9GA 4DEXA 1AWJA 2EQUA 2F2VA 2KVQG 2NUTA 2OTJT 1UJYA 2LT1A 1VQ7T 1N8RC 4BE0A 3CCJT 4HVUA 5EC7A 1NBEB 3PE0A 4HT8A 1R0BG 4M75F 1I5LA 2KT1A 1VQKA 2YRCA 2DO3A 2J06A 2J6OA 2CP5A 3H8ZA 2D9TA 3J7AF 3G4ST 1UECA 2OAUA 2K3XA 1PHTA 1QVFP 1M1KU 2HSPA 1QVGP 2RQTA 1QW1A 3OS5A 4A4EA 3RKYA 4JZ4A 1QCOA 1KD1R 1Q86U 5GAN7 1M90C 3EG9A 3TVTA 4M7DB 3M0TA 4RKUE 2P0KA 3JCMg 4M77E 1K8AC 4CRIA 1BIBA 3OBWA 4XTVA 3CCRQ 4RCCA 2LP5A 2VC8A 1YP5A 3CCSA 4GLKA 1AZEA 4C5EA 3ZEHA 3L2UA 1AWXA 2JMAA 1VQ6Q 1K76A 2R5AA 2RH2A 5IHNA 6AT1B 3CD6A 1E6GA 5I11A 1M9SA 4Y91A 2OTJQ 2ZPFB 3VS5A 4BE2A 1ZA2B 2LQ8A 2QQAA 1YJ9Q 4ELYC 3EGXB 2C06A 3G1JA 2QDLA 1YIJA 1ZUKA 1YITQ 1M3BA 2CP0A 2HQHA 1UGVA 3GIBA 3PMTA 5GAOq 3JB9J 1GL5A 4K11A 1GCQC 5FU7C 1PD1A 1AWOA 4QVZA 4HKEA 1VQLA 2O31A 4XTYA 1FMVA 4JLIA 3JB9D 3A5ZB 3WVEB 1YHQA 1AOJA 2CZ0B 1G5VA 4TVRA 2PNIA 2KRSA 3ZL7C 1N5ZA 4A63B 1UE9A 1OX9A 4RG2A 1N9SA 4DBQA 4M7AE 3G71A 4M7DD 2ZPGB 4WTOB 1GXIE 4HVWA 4E7JA 3EH1A 1GCPA 4LUEA 1VQ4A 1KC8R 1K4US 1X2KA 2RNAA 2M02A 1W4SA 2FPDA 1QWEA 2P4RA 2DPPB 4FT4A 4WCIA 1OU8A 4X9CA 3A8LB 2YUNA 3CCMA 1ZBXA 3SEMA 4M4ZA 3X28B 4OB2B 1PKSA 4XTWA 1PD0A 1WDXA 2J05A 3AT1B 5CKBA 2EKHA 2KY9A 4R55A 2HKNA 4AMCA 1M8MA 1VYVA 4UC4A 2YUPA 3BW1A 1GFCA 1NEBA 2XIDA 4BI3A 5LJ5j 4M7DA 2C0TA 3X25B 4OMPA 2L3RA 1ZX6A 3QBYA 4O6JA 1VQNA 2A36A 2QA4Q 2QGFB 2E10A 2RQUA 4B9WA 1ZQ1A 3EGDB 5GMKj 1BK2A 2KRNA 2CREA 2K3BA 3CCUQ 1G83A 4M78F 4L5GA 2GNCA 1TXQA 2CKKA 2R5MA 2KXDA 2FPEA 3EGXA 1V76A 3CCRA 1N9RA 3CCQT 1UGPB 5D7UA 1YJWA 4PNOA 3TQ7P 1KIKA 3MEWA 5FU6C 1OQKA 2DLPA 3OW2A 2DXBA 1VQ6A 4JJBA 1RLPC 5IXFA 3OSSC 4F7UG 1X43A 1O75A 3L2RA 3I9QA 4ZN1A 4M75D 4X1VA 1Q7YC 3H0IA 1OPKA 3VJPA 3OS0A 4F7UB 3FEOA 1K8AR 1YJ9A 2OTLT 3PFSA 4M7AC 4X9DA 5CQYA 4EMHA 1VQOA 4XQ3A 1YITA 2E6NA 2FRWA 2HEQA 1M30A 4L59A 1UHCA 2Y4YA 5HCKA 1Z9ZA 2KGTA 4CC4B 1PRLC 2YSQA 2EYXA 2QTXA 3CBOA 4XU1A 1KG1A 4KGXB 3S3MA 1KSWA 2P0PA 1G3TA 1K9MU 3CCQQ 2V8JA 5I2SA 2FB7A 5CK9A 2DL8A 2QQ9A 4OVAA 2DTIA 1E6HA 2AKLA 4LDUA 1AWWA 2RF0A 3EG0A 1LVKA 3NFCA 1OYXA 2ZPBB 2QG9B 3NTKA 4PFZA 4C0DC 5A2QE 2HQXA 1X75C 1YJNQ 2R57A 4J9GA 4HCZA 2HCKA 1BB9A 4IUUA 4EMKB 1HSQA 3S3OA 1ZSGA 4C5HA 4IUPA 1VQ8T 2CUDA 5DM7R 2DAQA 3QKJA 3CCVQ 4LDVA 2EYYA 3V7SA 4QQGA 2DBKA 1GRIA 3BDUA 2ABLA 3META 1GBRA 3CPWP 4II1A 3EGDA 3A1PA 2ZAEA 5GANh 5KCHA 1QVPA 4OF1A 3F70A 2Z0WA 4FYWB 4DOWA 4M78B 2DVEA 1XQHA 2RD1A 1QCNA 2HKQB 3OYIA 2PVDB 1OI1A 4CI0C 2QA4A 3HKSA 1OU9A 1SRMA 1IHWA 1ZBJA 3VS7A 3V8JA 3QZ5B 3CCUA 2O88A 2CDTA 1M2OA 2EGAA 3CMAA 2EJ9A 2E41A 1TUDA 1WXUA 3LWHA 2FZCB 1ZUYA 4F14A 4A4KA 2RQVA 3VUBA 2HD0A 1WA7A 3I55A 2RHIA 2K5LA 2JMCA 4RTYA 5HY6A 2FPFA 2QEXQ 3CC2T 1Y07A 2LJ3A 3M58A 3CMET 3DB3A 2V1QA 3CEYA 3SWNA 3EHRA 4AG1C 2OI3A 5GMKl 5LJ5h 5GANe 1N8RU 4ANJA 5CR2A 1BI3A 1QWFA 4LXCA 1AT1B 1IO6A 4FT2A 3SHWA 1PC0A 3VV0A 4M78D 2JT4A 3MP6A 1VIEA 3C4SA 2DK3A 2W0ZA 1X01A 4E7HA 1M1KR 2F69A 2QQBA 2FEIA 3L2ZA 1OX8A 1WHLA 3PT9A 1Q7YR 2YWWA 2RHUA 2QASA 4F7UE 4EMKA 1M90U 4JJNK 2KSSA 3LLRA 1BIAA 1JU5C 3CCET 2V8IA 2EQJA 1B07A 1MGQA 1KQ1A 5GAN2 1K8AU 4FW1A 3CXCP 4QVDA 1JXOA 3P8BB 3JCMQ 3QJYA 4E7KA 2KDSA 2A7YA 5GAOp 4LD9K 2QYZA 1ZHIA 3OB9A 2HMAA 3FIFA 1YJNA 2ZZDA 3NGPA 8ATCB 5KE3A 2X9HA 2DIQA 4HXJA 3ZFJA 3RESA 1I07A 3KBGA 2NWMA 5LJ5e 4M78A 3JB9I 3SB2A 1N6AA 2DRMA 3JB9F 4OGEA 3CCVA 5IAYA 1R8OB 2RQWA 5GAMh 1M2VB 2LRQA 1X27A 2VVKA 3PIOA 5GMKe 2JTEA 4KRTA 2K5FA 5AYFA 4E6RA 5GAN4 5L23A 1YFNA 2LJ1A 2YRVA 2PU9B 3DLLA 4PJLA 2KMTA 2DD4A 3M55A 2CP2A 1R0CB 4OMMA 2DYBA 4C8QF 4EPCA 4J9EA 3CC4T 2QQRA 5KYUB 2FL7A 1B34B 1TUCA 2BZ8A 4RG8A 3GP8A 2CT3A 2YT6A 2GQIA 1JJ2A 2K4YA 1VQPQ 3HPWA 2RHZA 2RHXA 5IHIA 3CBPA 1H641 1GBQA 1BKBA 5KYYB 1W2BA 5HK0A 1WHKA 2H8HA 3CC7Q 1K73C 4IIOA 1IRXA 1AHJB 2QEXA 3VS4A 2D1XA 5GAMe 3PIPA 1ZSZC 1TOVA 2VKNA 1QVFS 1GFDA 5D6XA 1I4K1 1UG1A 1ZLMA 2CZ6B 2GTJA 1NPPA 1QMCA 2PQWA 4KULA 2EGEA 2ED1A 1TSFA 2K6DA 1V29B 4PLLA 3A8OB 5GANf 1OEBA 3OYMA 4PFOA 4OMOA 3NHNA 2DA9A 2EAYA 1H92A 2K57A 4BUGA 2DNUA 1YI2T 5CIUA 1S72T 5CO7A 4J9IA 1WPYA 3JAME 2VASA 1Y0MA 1SRLA 2GFUA 2RI3A 3HSBA 2EKOA 5FRNA 1VQ9T 4JLGA 2AZVA 5GJWB 2J7IA 5IH2A 4BY6B 3C12A 4BI8B 3JB9G 3R6OA 1M1GA 2H3EB 1WNLA 1WQWA 2GQVA 1G2BA 1K0XA 3E9FA 1M2VA 2CP6A 1BBZA 2JM9A 2DXUA 3M57A 2LQWA 4M7DG 3QSUA 3MEAA 3VS0A 4Z8AA 2RM4A 1Q7YU 3OYAA 3TSZA 3KUFA 3VYGA 5GANg 1YWOA 3L2QA 3LGFA 3OBYA 3G6EQ 4Q5WA 1UHFA 5LJ5f 3OYFA 4ZTFA 3N5BB 5KYUA 4D6WA 1BCMA 2CZ1B 4C8QB 1B34A 2P84A 1YI2Q 1I81A 5CKEA 1G3YA 4ATOA 4KUDK 2CP3A 4LN2A 2CT4A 4C92C 2E64A 4OMNA 1M5Q1 4RTVA 3JCMc 3J80E 2AK5A 5GAN8 1VQ7Q 3C0CA 1H3ZA 4BB7A 4CC7A 3CCJQ 1X2QA 5FW9A 4PJMA 2HAXA 5KYYA 2MOXA 1K9MR 1E7OA 4J6XA 1KJWA 3M0QA 1WI7A 3M5AA 4PJOF 3SD4A 3BFMA 2DL5A 1XNIA 1RACB 2EIFA 2DX1A 4D8KA 1UGQB 1VQPA 1IB8A 1MMDA 3G4SQ 3JRZA 2XDPA 2ECZA 2RJEA 4PJNA 1QLYA 5GANj 2XDBA 2M16A 1HXDA 2QTVA 2JVVA 2QK0A 2QGGA 4XK8E 1SHFA 3VS2A 1WHMA 5LJ5g 3CC7A 3GLXA 2LQKA 2GTOA 3HFOA 3Q1JA 3H41A 4NL2A 3VS3A 1ZA1B 2LVMA 3G7ZA 4FSSA 2W10A 3CCLT 2JM8A 2K5IA 4DOVA 2EFIA 4N0AA 5GAMf 2RK1A 1PNJA 2O9VA 3HP9A 4PL6A 4C8QD 2ESWA 3RDVA 3LGLA 4E7LA 1SG5A 2MWPA 3PGGA 1K73R 4M75G 4HA8A 3HTRA 3QHSA 1VOMA 1WYXA 1VQMT 4M75B 1D09B 4FU6A 2QI2A 1LPLA 3M0UA 1WZOA 4Y28E 5KE2A 4FYXB 1YN8A 2DBMA 2X4XA 1R77A 3M0SA 3QIIA 2RHYA 4A53A 4M77C 2OX7A 5DY9A 2E3IA 1OV3A 2KEAA 3OSVA 1Q81C 1XTDA 1IHVA 2E70A 2XDDA 2KNBB 1Y7XA 4Z88A 3REBB 3PTAA 3OS2A 4DQ2A 3L1AA 4C8QA 1UTIA 4J6YA 2GFAA 5GAMg 2X3XD 3LWIA 2L3QA 3UPUA 2X51A 1N8RR 1RUWA 3RMSA 2RB6A 4ESRA 2A0FB 2DL3A 5LJ3h 2OAWA 1SHGA 4LDXA 1JXMA 3THKA 4C92F 4XTUA 5I21A 1VQMQ 2DF6A 1AD5A 1XJWB 4GLMA 1BYMA 3P8HA 2CUBA 1Y57A 1W70A 3OW2P 4F04B 5CCAA 2OTJA 1M90R 4LE9A 3RMQA 3I56T 1VQ7A 4M7DE 1RAAB 2YLCA 2PUKB 2MCNA 1NJIC 1TUGB 2ZCFB 4J83A 3CCJA 4JS5A 1G8XA 4JRKA 3WVDB 3A8MB 3MCAB 2JZ2A 1KK7A 1UGRB 1VYUA 1NYGA 4J7IA 1WIEA 5GAMj 2L5QA 5IHKA 1TS9A 3SWNB 3G4SA 2JNGA 3CPWS 1G3SA 2XD0A 1Q82C 4L6V5 3RUXA 3GF5A 1TH7A 2VWFA 2CYZB 2GF7A 3MO8A 2SEMA 1JEGA 3E19A 3QWYA 1V1CA 3VRYA 2RI2A 3HRUA 3HL8A 1FYNA 2COZA 2IIMA 1UFFA 4YTLA 3T9NA 2A08A 2CZ7B 2EYZA 4M75A 1KQ2A 2LT4A 2SRCA 4RTZA 3TU4K 3LW5E 3MP8A 2CSQA 3AHUA 3X20B 5D6YA 5GAN3 2YUQA 2HL3A 3V7CA 4PJOD 4ELZC 5LJ3d 4XU2A 2OTLQ 4V2SA 1OPLA 3OQ5A 2X4YA 2BKDN 1AEYA 4LDWA 4GBQA 5FWBA 1VQ5T 4BD3A 4D8DA 2AZSA 5I22A 4JDSA 4M77F 2M9UA 4M78G 2RPNA 3MEUA 1X6GA 3LH0A 3DB4A 2XMFA 1RABB 2KYBA 1HJDA 4FW2A 4RTTA 2M0OA 2FHDA 3MKDA 4FM4B 4J9HA 1K73U 2JJ9A 2WSFE 1H8KA 3REAB 4DBHA 4M75E 2HBWA 3H9NA 3CPFA 2H3JA 4PJOA 2VB6A 4M7DC 2KE9A 3NTIA 3JV3A 1NM7A 2VUBA 3PVQA 1NLPC 2K2VA 2EJGA 1OZ2A 5A0GA 4RTXA 1Q81R 1VQ8Q 2OJ2A 3INZA 4AT1B 3OA6A 5A0DA 4ME7A 1JO8A 3MHXA 3CXCS 2EPDA 3BY7A 2EYQA 1A0NB 5FU7B 3QDFA 1M8VA 3PNWC 4E2FB 3H0HA 3FRNA 3SFMA 1AZGB 3SDZA 2YHTA 4M7AF 1RAIB 2EW3A 4DBFA 3E2UA 4QT7A 4J9CA 1VQKT 4Y92A 4XU3A 3C95A 2KROA 2AIRB 4A4FA 3QYHB 7AT1B 2NYSA 2F2WA 3EHQA 2CP7A 1BI0A 2PVOB 4IIMA 3QYGB 2P0QA 3QPHA 1TU0B 1I5OB 5GAN6 1P92A 5KCOA 2WSCE 1PWTA 3TCJA 1NJIR 3CCST 1FXXA 3UDCA 1W6XA 4C92D 2COWA 3BDLA 1WQ7A 3M4GA 1WXTA 4QQ6A 3ULRB 4N4HA 2DFUA 3CCQA 3CD6T 2L0AA 2O01E 2DJZA 5LJ3f 3CC2Q 3CMEQ 2LTOA 3JCMd 1KQSA 2X3WD 2FVUA 1KD1C 2A28A 2ZPIB 1BU1A 4JJCA 2LX9A 4LNPA 2I0NA 4C0FA 5KYNA 4OMLA 1KQSP 1SF9A 1YIJT 1FWZA 1WJRA 2NLUA 2ROTA 2OTLA 4ZNXA 4J5YA 3MEVA 1VQLT 4OGCA 1RI0A 1MMAA 1C6VX 3I5SA 3M9QA 2LCLA 1VYTA 1QCFA 1U5SA 2JN0A 1YHQT 2VXEA 4KUIA 3ASKA 3RR6A 2E6ZA 3S3NA 4J6WA 4EIKA 4KH1B 1NEGA 3G71T 2YDLA 1K9AA 2GGRA 3CCEQ 5L8RE 5GAOn 1FX7A 1ABQA 3VU3C 3FC3A 5LJ3g 1U1TA 3CD6Q 3H6ZA 5FU6B 1VQ4T 4PK4A 5J39A 3NMZC 2DEUA 1KHCA 1GCQA 3HRTA 2P4TA 2JTMA 2YUOA 1TG0A 1WX6A 2BZYA 1JJ2P 2WACA 1B7TA 3EGUA 1UJ0A 3CCMT 2ZGWA 2A3LA 2DVJA 5CAIA 3OYNA 1YIJQ 2K79A 2E1HA 4M78E 5GMKi 2DERA 3I5RA 2MPXC 3GNFB 5EG2A 2L89A 2RO0A 2XK0A 1K0SA 2D8HA 2DTHA 1NE8A 1SSFA 3VRZA 1W2BP 1VQLQ 4M77D 1SKUB 4PLIA 2RJCA 4JZ3A 4P5NA 2KT8A 1KC8C 2DILA 1LCKA 4FSXA 2D0QB 4OMQA 1LNXA 3UT1A 3RERA 1LOJA 4DBRA 1MV0B 2DXTA 3TREA 4LD6A 1OOTA 3JCMW 1I1JA 5AT1B 3QJ6A 1QKXA 1VQNT 5LJ3j 1RAGB 3OY9A 2EWNA 1Q81U 2VGNA 3BE3A 5I2MA 1ZUUA 3CC4Q 1QKWA 4QKUA 3SWNC 3OYCA 1M4ZA 2M51A 5CKDA 3JSCA 4B9XA 3CQTA 3HRSA 2MF2A 4C0DB 1WHGA 2KBTA 3CCRT 3JCMf 1YJWT 2G3RA 1CSKA 2ED0A 1HD3A 1WFWA 3JCMV 4MMLA 2JTFA 1YNZA 1U3OA 2M1HA 5C6SA 1VQ6T 2CS7A 2EBPA 4LDYA 4QW2A 1TTHB 1FMWA 4J7FA 3R6NA 3CC2A 1CKAA 4M7AD 2DIGA 4R0KA 3CMEA 1MHNA 2K9GA 4EMKC 4C0GA 1RAHB 3JCMP 2V26A 3A98A 1YJ9T 3QO3A 2PZ1A 1O9SA 4AFZC 4MZMA 2MAMA 1UB4A 2QQSA 1WHHA 1B3QA 3QDRB 1VQOT 3EG3A 3RIRA 1NJIU 5CKHA 4DEYA 1YITT 2XICA 3GBQA 4C8QG 1VQNQ 2JUFA 1QVFA 1FMKA 3UATA 1QVGA
chains in the Genus database with same CATH topology
1K9MC 5GAMg 4PKCC 4JS4A 3LWIA 4ZN3A 4DOWA 4M78B 4MDWA 2WSEE 2RJFA 3UPUA 3RKWA 1RL2A 2DVEA 4KBMB 1XQHA 2RD1A 2R58A 3X26B 1EIFA 3RMSA 3GOXA 4IKFA 3C94A 2RB6A 3QZ9B 3OYIA 5LJ3h 2PVDB 3DKMA 2K3YA 4M78C 1OI1A 1Q82U 4CI0C 4M7DF 2QA4A 2EQMA 5IN1A 5M9OA 3HKSA 4EDUA 5LJ5d 4LDXA 5GAOr 3A8GB 1WGSA 4C92F 4XTUA 3V8JA 3O8VA 3QZ5B 5I21A 3CCUA 4M7AG 3CCEA 4M7AA 3CMAA 2EJ9A 4JRQA 2E41A 3P8HA 3FB9A 1BYMA 4J8OA 3URGA 5J26A 2EJFA 4VUBA 4M7AB 3LWHA 4A4KA 5CCAA 3VUBA 1VQ8A 2OTJA 2HD0A 3RMQA 2VXFA 1LJOA 2DZ9A 3I55A 3I56T 1VQ7A 2RI5A 2YLCA 2PUKB 1NJIC 4M7DE 2RHIA 2ZCFB 2K5LA 4J83A 3CCJA 1VQ5A 4JS5A 5HY6A 4PJOC 2B8AA 4JRKA 3V8LA 3WVDB 1Y07A 4C92E 3CC2T 3M58A 3CMET 1VUBA 3DB3A 3A8MB 3MCAB 5D6WA 1WJQA 2BIVA 1UGRB 2JZ2A 3OYDA 5CKFA 3CEYA 3SWNA 4J7IA 3JCMb 2LNVA 2E65A 5GAMj 2L5QA 1QP2A 1XOVA 4A54A 4ZGJB 5GMKl 5LJ5h 5GANe 3SWNB 3G4SA 1JRIA 2JNGA 1N8RU 3CPWS 3JCMJ 2Y90A 4MZTA 5CR2A 3OYBA 4FIBA 1G3SA 3V7RA 3OYHA 1BI3A 1Q82C 4L6V5 2XD0A 4F7UF 3RUXA 2FYKA 2ZPHB 3GF5A 1TH7A 2X4JA 2CYZB 3JCMX 2GF7A 3MO8A 2VGMA 5IT9E 4FT2A 4E7IA 1G3WA 3E19A 3VV0A 3L2WA 3M4YA 4M78D 1YBYA 3MP6A 1VIEA 3HFNA 3C4SA 1QVGS 4ZTJA 2DK3A 3FDRA 2RI2A 4N4GA 3HRUA 1U1SA 1X01A 3HL8A 2DTOA 4A4HA 4E7HA 2F69A 2QQBA 4JRIA 3L2ZA 2YLBA 4YTLA 2QXFA 3T9NA 3PT9A 2CZ7B 2QA4T 2RHUA 1N27A 4M75A 1KQ2A 2LT4A 3G6ET 4M77A 4F7UE 2KQWA 4EMKA 3CC4A 1M90U 2LCCA 1M1FA 4JJNK 2KSSA 4C5IA 5KH6A 4IUVA 3LLRA 5GAMd 3LW5E 1BIAA 3CCUT 3TU4K 3CCET 2V8IA 2EQJA 2LC4A 3MP8A 1MGQA 1KQ1A 5GAN2 1K8AU 3CMAT 3AHUA 1Y71A 3X20B 5D6YA 3A8HB 3GNGA 5GAN3 4QVDA 3V7CA 3E9GA 5GAN5 3OYKA 4WF2A 4PJOD 4ELZC 3P8BB 2EQUA 4QQDA 5LJ3d 3JCMQ 4NL3A 4XU2A 4V2SA 2KVQG 4ZGDB 2OTJT 3QJYA 4IURA 3OW2S 2LT1A 4E7KA 2KDSA 3OQ5A 2A7YA 3I55T 1VQ7T 2X4YA 5GAOp 4LD9K 1N8RC 2BKDN 4BE0A 3CCJT 4LDWA 1VQ5T 4BD3A 1ZHIA 3OB9A 4HCCA 5FRMA 3M54A 3FIFA 4NOYA 2ZZDA 1YJNA 4HT8A 5KE3A 2JOYA 2DIQA 3QG1A 4M75F 3RESA 3ZFJA 1I5LA 1VQKA 4JDSA 3KBGA 4M77F 4O5VA 2M9UA 4M78G 5LJ5e 2DO3A 4M78A 3JB9H 3MEUA 2BUDA 3SB2A 1N6AA 3JB9I 3H8ZA 4ZGEB 3LH0A 2O4XB 3DB4A 2D9TA 3J7AF 3G4ST 3JB9F 4OGEA 2OAUA 2K3XA 3CCVA 5IAYA 1R8OB 5GAMh 2MWOA 1M1KU 2LRQA 2M0OA 2FHDA 1QW1A 3OS5A 4A4EA 4FM4B 3RKYA 1K73U 2WSFE 5GAN7 1Q86U 1HK9A 1M90C 4OB0B 3PIOA 4M7DB 2AHJB 4IUQA 4RKUE 2E5QA 2P0KA 4M75E 5GMKe 3JCMg 2L8DA 4M77E 4IUTA 1K8AC 3UWNA 2K5FA 4CRIA 1BIBA 3CPFA 3OBWA 2D6FA 5AYFA 4XTVA 3G6EA 4RCCA 5GAN4 2VC8A 3CCSA 4PJOG 2H3JA 5CQXA 3S6WA 2YRVA 4PJOA 3EFRA 2PU9B 4GLKA 3DLLA 4M7DC 4C5EA 2KMTA 2DD4A 3M55A 3ZEHA 3L2UA 1YI2A 3NTIA 1S72A 2HBPA 4C8QF 3KXTA 2VUBA 4EPCA 2IVWA 4PJOB 2R5AA 3CC4T 2RH2A 2QQRA 2K2VA 3CD6A 2FL7A 2X4WA 2EJGA 1M9SA 1OZ2A 1NPRA 5A0GA 1B34B 4HCBA 4Y91A 4RG8A 3GP8A 3INZA 1JJ2A 3OA6A 2K4YA 2ZPFB 1VQ9A 5A0DA 3ZBDA 4ME7A 3HPWA 3MHXA 3CXCS 2PUOB 4FL6A 3BY7A 4BE2A 2EYQA 2LQ8A 2QQAA 4ELYC 4XU0A 2RHZA 2RHXA 2C06A 3CBPA 3F70A 2QDYB 5FU7B 1H641 1M8VA 3PNWC 1UEBA 1YIJA 1BKBA 4EMGA 4RMOA 3FRNA 1W2BA 4C8QE 2EQKA 3SFMA 1M1KC 5HK0A 3ME9A 3GIBA 3PMTA 3SDZA 5GAOq 3JB9J 1D3BB 1YJNT 1K73C 1NZ9A 2YHTA 4M7AF 4XAXB 5FU7C 1Q86C 4QVZA 4HKEA 1VQLA 1VQKT 4XU3A 1WJSA 4XTYA 1QP3A 2RA2A 3C95A 1KD1U 1Y96B 3ER0A 1AHJB 2QEXA 3L42A 2DXCA 4KT0E 3FLGA 5GAMe 4JLIA 5CVIA 3PIPA 4A4FA 3A5ZB 3JB9D 1QVGA 3WVEB 1X6OA 3M59A 3QYHB 3CCVT 1YHQA 2CZ0B 1G5VA 1DJ7B 1BI2A 4TVRA 2V8KA 1QVFS 5D6XA 1I4K1 1BI0A 2PVOB 2CZ6B 3QYGB 2P0QA 1NPPA 2XKOC 3QPHA 5LJ3e 2PQWA 4KULA 4RG2A 1N9SA 5GAN6 4M7AE 2Y4XA 3G71A 1V29B 1PSFA 1P92A 4PLLA 3A8OB 2ZPGB 5KCOA 2WSCE 5GANf 4M7DD 3OYMA 3TCJA 4MZPA 3VUZA 1GXIE 3CCST 1FXXA 3UDCA 4C92D 2EAYA 4E7JA 4BDYA 3EAEA 2K57A 3BDLA 4BUGA 1VQ4A 3NTHA 1YI2T 1WQ7A 2ZPEB 3M4GA 4OB1B 2PVGB 4QQ6A 4XTXA 5CIUA 5CO7A 2X35A 5DLQE 3CBMA 4C5GA 4N4HA 1S72T 1WPYA 3JAME 1BI1A 2MI6A 1W4SA 1PSEA 1YCYA 3CCQA 2GFUA 3CD6T 2RI3A 2O01E 2DJZA 2DPPB 4FT4A 5LJ3f 2HQEA 3HSBA 5GAOm 2EKOA 5FRNA 2LTOA 4X9CA 1VQ9T 3A8LB 4JLGA 3JCMd 3CCMA 5FROA 1ZBXA 1KQSA 2FVUA 3VKIA 3X28B 3OYEA 4N0AC 3WXMB 4XTZA 4OB2B 1KD1C 4XTWA 2ZPIB 5GMKm 4BY6B 2LX9A 3C12A 2LDMA 4MMKA 4OMFB 4C0FA 4BI8B 3JB9G 5C0MA 3R6OA 1M1GA 5CKBA 5A0LA 1YIJT 1FWZA 2KY9A 4R55A 2O4XA 4DA4A 4C0ZA 1WNLA 1WJRA 1WQWA 2GQVA 4E47A 2NLUA 2DKGA 3E9FA 3TEEA 4BY6C 2OTLA 2KAFA 4UC4A 5DLOA 3BW1A 4J5YA 2DXUA 3MEVA 1VQLT 2XIDA 4OGCA 1RI0A 4BACA 4BI3A 5LJ5j 3L2VA 3EFSA 3M57A 4A4GA 4M7DG 3CPWA 3HHTB 2XG8D 3M9QA 3QSUA 4M7DA 2LCLA 2QEXT 3MEAA 3X25B 3OYYA 2L3RA 2JN0A 4C92G 2RM4A 1YHQT 3OYAA 1Q7YU 2VXEA 4KUIA 3KUFA 3VYGA 5GANg 3QBYA 3L2QA 4O6JA 3ASKA 3LGFA 2F5KA 2E6ZA 3S3NA 1VQNA 2GCXA 4J6WA 3OBYA 2E10A 3JCMh 4B9WA 4Q5WA 4C92B 1KC8U 3CCLA 1ZQ1A 5LJ5f 2I2LA 3OYFA 5GMKj 4ZTFA 3G71T 3N5BB 4D6WA 2CZ1B 5L8RE 4C8QB 5GAOn 1IREB 1B34A 1I81A 4JUVA 1FX7A 1G3YA 4M78F 5CKEA 4BI4A 4L5GA 4KUDK 3VU3C 4ATOA 3FC3A 4C92C 2RK2A 3OMGA 5LJ3g 1U1TA 2E64A 3VYHB 3H6ZA 4GY5A 1M5Q1 3MP1A 2CKKA 5FU6B 1VQ4T 2R5MA 5J39A 4C8QC 3JCMc 3J80E 1KHCA 5GAN8 3HRTA 1N9RA 3CCRA 2DEQA 2P4TA 3CCQT 1UGPB 4BB7A 1YJWA 2JTMA 1H3ZA 2E12A 2F5TX 2HAXA 4PNOA 2WACA 3MEWA 5FU6C 1VQMA 3OYGA 1OZ3A 3CCMT 2ZGWA 2A3LA 5CAIA 3OYNA 1D3BA 2DXBA 3OW2A 2E1HA 4M78E 5GMKi 4J6XA 1VQ6A 3GNFB 3OSSC 5EG2A 1O75A 4F7UG 2L89A 2RO0A 3M5AA 4PJOF 2XK0A 4F7UA 3SD4A 2KK4A 3BFMA 1Y96A 1XNIA 3L2RA 2DTHA 2EIFA 1NE8A 4ZN1A 1UGQB 1SSFA 4M75D 1IZ6A 1VQPA 1JB0E 3PMIA 1Q7YC 1KQSS 4M77D 3VJPA 3JRZA 3OS0A 4F7UB 2DZCA 2XDPA 2IG0A 3M53A 2RJEA 5J3BA 3FEOA 4PLIA 2RJCA 1YJ9A 4P5NA 2OTLT 3PFSA 4M7AC 4X9DA 3OS1A 5GANj 2XDBA 2M16A 1KC8C 3DLMA 2VV5A 2XU8A 3P8DA 1HXDA 1KHIA 5CQYA 4FSXA 4EMHA 2D0QB 2JVVA 1VQOA 3FJPA 2HNIA 1LNXA 4XQ3A 4QVCA 4XK8E 3UT1A 5GAOl 4BDZA 1YITA 2E6NA 4R56A 3RERA 1LOJA 5LJ5g 3GPLA 3CC7A 2DXTA 3GLXA 4PJOE 2LQKA 3TREA 4LD6A 4L59A 5FLXE 4Z02A 3JCMW 3HFOA 3Q1JA 2Y4YA 3QJ6A 4X34A 4NL2A 2XHCA 3JCMe 1I8FA 1VQNT 5LJ3j 2LVMA 3G7ZA 3OY9A 2EWNA 3CCLT 1Q81U 2VGNA 4BE1A 2K5IA 4DOVA 5I2MA 3RKXA 2QTXA 3CBOA 4XU1A 2EFIA 3SWNC 4N0AA 3OYJA 2CGHA 3OYCA 1KG1A 5GAMf 1M4ZA 2RK1A 5CKDA 4OB3B 3HP9A 4PL6A 2XI9A 3JSCA 2P0PA 4C8QD 5HK3A 3S3MA 4B9XA 5GMKh 1G3TA 2MMPA 3LGLA 4E7LA 1K9MU 4MDXA 2V8JA 5I2SA 2FB7A 3HRSA 2MF2A 4C0DB 5CK9A 2MWPA 2QQ9A 2DTIA 3PGGA 3QXEB 4OVAA 5GANd 3OYLA 1JBMA 4M75G 4LDUA 4M77G 3CCRT 3JCMf 3CXCA 1YJWT 2G3RA 3NFCA 4HA8A 4JRPA 1OYXA 2ZPBB 3NTKA 4C0DC 5A2QE 2HQXA 3QHSA 1X75C 1VQMT 3J81E 4M75B 5LL6S 1JJ2S 3JCMV 2R57A 4M77B 4HCZA 4MMLA 4NS5A 4IUUA 4EMKB 3M56A 4FU6A 2JTFA 2M1HA 3I56A 2QI2A 5C6SA 3V8KA 3S3OA 4C5HA 2CS7A 1VQ6T 4Y28E 5KE2A 3OMCA 3LX7A 4IUPA 4LDYA 4HT9A 2X4XA 4QW2A 4RCBA 4J7FA 1VQ8T 3CC2A 4M7AD 3QIIA 2RHYA 2DIGA 4A53A 4M75C 3CMEA 1VQPT 5DM7R 1MHNA 4M77C 2DAQA 3E1SA 3QKJA 4EMKC 5DY9A 1VIFA 4C0GA 4LDVA 1W2BS 3QUIA 3V7SA 3JCMP 4QQGA 5HKCA 4OP0A 3OSVA 1YJ9T 3QO3A 1O9SA 4MZMA 1Q81C 3BDUA 2MAMA 3META 1UB4A 2QQSA 1XTDA 3X24B 3QDRB 2E70A 4C92A 1VQOT 2XDDA 3RIRA 1NJIU 3LYIA 1UGSB 4II1A 1Y7XA 5CKHA 1YITT 1U8RA 2RJDA 2XICA 4N4IA 4C8QG 2VYTA 5GANh 3OS2A 3PTAA 4DQ2A 3CC7T 2JUFA 3L1AA 4C8QA 5KCHA 1QVFA 1QVPA 4OF1A 4J6YA 2GFAA 2DD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM g;  4WF2 A;  4PJO D;  2ZGW A;  5CAI A;  5LJ3 d;  4NL3 A;  1D3B A;  1I4K 1;  3JCM Q;  4XU2 A;  4V2S A;  2E1H A;  4M78 E;  4M78 B;  4J6X A;  5GMK i;  5LJ3 e;  4F7U G;  1N9S A;  3RKW A;  5GAN 6;  4M7A E;  2DVE A;  4PJO F;  4F7U A;  5GAO p;  2RD1 A;  3BFM A;  1Y96 A;  2DTH A;  4M7D D;  5GAN f;  4M75 D;  2RB6 A;  4M77 D;  5LJ3 h;  4F7U B;  2DZC A;  3FIF A;  4M78 C;  4NOY A;  4HT8 A;  4C92 D;  4M7D F;  2EAY A;  4M75 F;  4M7A C;  3RES A;  4X9D A;  5GAN j;  1I5L A;  2K57 A;  4M77 F;  5LJ5 d;  5GAO r;  1WQ7 A;  3M4G A;  4M78 G;  1HXD A;  5LJ5 e;  4XTX A;  4EMH A;  4C92 F;  4M78 A;  4XTU A;  3V8J A;  5I21 A;  3JB9 H;  3FJP A;  1WPY A;  2HNI A;  1LNX A;  4XQ3 A;  3SB2 A;  3JB9 I;  4M7A G;  4QVC A;  5GAO l;  3RER A;  4M7A A;  1YCY A;  2EJ9 A;  3JB9 F;  1LOJ A;  5LJ5 g;  2DJZ A;  2DXT A;  2E41 A;  3FB9 A;  5LJ3 f;  4PJO E;  3HSB A;  5GAM h;  5GAO m;  4X9C A;  2EJF A;  3JCM W;  3JCM d;  4M7A B;  3HFO A;  4NL2 A;  3RKY A;  3JCM e;  4N0A C;  1I8F A;  4XTZ A;  5LJ3 j;  4XTW A;  5GMK m;  5GAN 7;  1HK9 A;  2VXF A;  1LJO A;  2DZ9 A;  4M7D E;  2EWN A;  2YLC A;  4M7D B;  4MMK A;  4M75 E;  5GMK e;  4PJO C;  3JCM g;  3JB9 G;  3RKX A;  4M77 E;  2QTX A;  4XU1 A;  1BIB A;  4N0A A;  3SWN C;  4JRK A;  2CGH A;  3V8L A;  4XTV A;  4C92 E;  5GAM f;  4RCC A;  5GAN 4;  2VC8 A;  1WNL A;  1WQW A;  4PJO G;  4C8Q D;  2DKG A;  4PJO A;  3EFR A;  4M7D C;  5GMK h;  3BW1 A;  3SWN A;  4J5Y A;  3JCM b;  2DXU A;  5GAM j;  2E65 A;  2FB7 A;  4C8Q F;  5LJ5 j;  3PGG A;  3EFS A;  2DTI A;  5GAN d;  4PJO B;  4A54 A;  4M7D G;  1JBM A;  4M75 G;  5GMK l;  5LJ5 h;  5GAN e;  3SWN B;  2EJG A;  5GAN 5;  1JRI A;  4M77 G;  3QSU A;  4M7D A;  1B34 B;  3JCM f;  4Y91 A;  3JCM J;  2Y90 A;  2JN0 A;  4HA8 A;  4C92 G;  3INZ A;  2RM4 A;  3V7R A;  2VXE A;  4F7U F;  5GAN g;  3RUX A;  2FYK A;  3QHS A;  4M75 B;  1TH7 A;  3JCM V;  3BY7 A;  4M77 B;  4MML A;  3JCM X;  4EMK B;  4J6W A;  2E10 A;  4XU0 A;  3JCM h;  3V8K A;  4C92 B;  5LJ5 f;  2I2L A;  1H64 1;  1M8V A;  4M78 D;  5GMK j;  4HT9 A;  3HFN A;  4RCB A;  4EMG A;  4M7A D;  4A53 A;  4C8Q B;  4M75 C;  4C8Q E;  1U1S A;  5GAO n;  1B34 A;  1X01 A;  4M77 C;  1I81 A;  2DTO A;  4JUV A;  4M78 F;  4EMK C;  5DY9 A;  3GIB A;  3VU3 C;  3JB9 J;  5GAO q;  3QUI A;  4JRI A;  3V7S A;  1D3B B;  3L2Z A;  4C92 C;  2YLB A;  2YHT A;  4OP0 A;  5LJ3 g;  1U1T A;  2E64 A;  3JCM P;  4M7A F;  3QO3 A;  4M75 A;  1M5Q 1;  1KQ2 A;  4XU3 A;  4M77 A;  4XTY A;  4F7U E;  3BDU A;  2RA2 A;  4EMK A;  4C8Q C;  3JCM c;  1Y96 B;  4C92 A;  5GAN 8;  5GAM d;  1BIA A;  3RIR A;  1N9R A;  2DEQ A;  5GAM e;  4JLI A;  1MGQ A;  1KQ1 A;  5GAN 2;  3JB9 D;  3AHU A;  4C8Q G;  5GAN h;  4PNO A;  4DQ2 A;  5GAN 3;  3L1A A;  4C8Q A;  4QVD A;  3V7C A;  4J6Y A; 
#chains in the Genus database with same CATH topology
 4JS4 A;  2LMJ A;  2KI7 A;  2IPO B;  2J6K A;  3MJX A;  2RJF A;  3RKW A;  1S72 Q;  3U23 A;  1BCO A;  1EIF A;  3UA7 A;  3GOX A;  4IKF A;  3C94 A;  4HVV A;  3QZ9 B;  3DKM A;  2K3Y A;  4M78 C;  1Q82 U;  1VQ9 Q;  2EYW A;  5IN1 A;  3A8G B;  1YJW Q;  4FYV B;  1WGS A;  1T3L A;  3UF4 A;  1H3H A;  3CCE A;  2RN8 A;  4M7A A;  1UUE A;  3URG A;  1NLO C;  1YWP A;  2EJF A;  2DM1 A;  1MMG A;  4FCY A;  1CKB A;  2DL7 A;  2VXF A;  1LJO A;  2DZ9 A;  2FO0 A;  2YXY A;  5KYX B;  4AFU C;  5D6W A;  1VQO Q;  2BIV A;  3OYD A;  1HYO A;  5CKF A;  2E65 A;  1XOV A;  4ZGJ B;  2Y90 A;  3OYB A;  4FIB A;  3OYH A;  3V7R A;  1PG5 B;  4AFS C;  4F7U F;  4ORZ A;  2FYK A;  2ZPH B;  2BE7 D;  2BZX A;  2X4J A;  2HSE B;  2FRY A;  3L2W A;  2JS2 A;  4N4G A;  2FZG B;  3RNJ A;  1Z9Q A;  4JJD A;  2NUP B;  2YLB A;  2QXF A;  1SEM A;  2QA4 T;  2V1R A;  1N27 A;  2KQW A;  3CC4 A;  1M1F A;  4C5I A;  3CCU T;  4KGZ B;  2LC4 A;  3CMA T;  2DJQ A;  2L2P A;  1Y71 A;  3GNG A;  2LX7 A;  3OYK A;  4WF2 A;  4HCK A;  4FYY B;  4NL3 A;  4QQD A;  2PTK A;  4ZGD B;  2MK5 A;  4IUR A;  3OW2 S;  3I55 T;  3D7S B;  1TWB A;  3LH5 A;  4HCC A;  3M54 A;  4NOY A;  3EG2 A;  5FWC A;  2JOY A;  3QG1 A;  4O5V A;  1RI9 A;  1EX4 A;  3JB9 H;  1WHJ A;  2BUD A;  4CC3 A;  3CCL Q;  4ZGE B;  2O4X B;  3EFO B;  2LZ6 B;  5GJV B;  1MNE A;  2HL5 C;  2L3S A;  2MWO A;  1HK9 A;  2JXB A;  1RAE B;  4OB0 B;  1IGQ A;  2AHJ B;  4IUQ A;  4CC2 A;  2E5Q A;  2L8D A;  4IUT A;  3UWN A;  3VS1 A;  3G6E A;  4PJO G;  5CQX A;  5KYW B;  3S6W A;  3EFR A;  1YI2 A;  3CMA Q;  1S72 A;  2HBP A;  1X6B A;  3KXT A;  2IVW A;  4PJO B;  1RLQ C;  2X4W A;  1UDL A;  1NPR A;  4HCB A;  1D0X A;  1VQ9 A;  3ZBD A;  5KYX A;  3I55 Q;  1MND A;  2PUO B;  4FL6 A;  1IXD A;  1J3T A;  2LNH B;  1U06 A;  4XU0 A;  2QDY B;  1UEB A;  2KXC A;  4EMG A;  2CH4 W;  4RMO A;  4C8Q E;  2EQK A;  1M1K C;  3ME9 A;  4AFQ C;  2LCS A;  1D3B B;  1YJN T;  1NZ9 A;  1M3C A;  4XAX B;  2CSI A;  1Q86 C;  1ZSZ B;  1AVZ C;  1WJS A;  1QP3 A;  2RA2 A;  1KD1 U;  1WLP B;  2M0Y A;  1Y96 B;  3ER0 A;  4PFP A;  3L42 A;  4PJJ A;  2DXC A;  4KT0 E;  3FLG A;  5CVI A;  1X6O A;  3M59 A;  3M0R A;  3CCV T;  4F17 A;  2EGC A;  1DJ7 B;  1BI2 A;  2NUZ A;  1OUL A;  2K7A A;  2V8K A;  1ABO A;  2NUP A;  2E5K A;  5LJ3 e;  2XKO C;  2Y4X A;  3RBB B;  1PSF A;  2C0I A;  2EVR A;  2MYS A;  2ATC B;  4MZP A;  3VUZ A;  2LJ0 A;  2B86 A;  2O2O A;  4BDY A;  3EAE A;  2CH4 A;  3NTH A;  2FZK B;  2ZPE B;  4OB1 B;  2PVG B;  5FRM A;  4XTX A;  5DLQ E;  3EH2 A;  2X35 A;  4C5G A;  2A37 A;  3CBM A;  3I56 Q;  2KYM A;  1BI1 A;  2MI6 A;  4AG2 C;  1PSE A;  1YCY A;  4J9B A;  1Q95 G;  2HQE A;  5GAO m;  5FRO A;  3VKI A;  3OYE A;  3H0F A;  4N0A C;  4XTZ A;  3WXM B;  1C1A A;  5GMK m;  1M27 C;  2F2X A;  2LDM A;  2L3P A;  4MMK A;  4OMF B;  5C0M A;  5A0L A;  2O4X A;  4E7Z A;  4DA4 A;  3EFO A;  4C0Z A;  4E47 A;  2DKG A;  3TEE A;  4BY6 C;  2KAF A;  5DLO A;  1T0J A;  2MIO A;  1D0Y A;  1NYF A;  4BAC A;  2O9S A;  3L2V A;  3EFS A;  1T0H A;  4A4G A;  3CPW A;  3HHT B;  2XG8 D;  2QEX T;  1X69 A;  2DYI A;  2FG0 A;  1C0M A;  4C92 G;  1D1B A;  1M3A A;  5KYW A;  2F5K A;  2GCX A;  2BTT A;  3JCM h;  4C92 B;  1KC8 U;  3CCL A;  2I2L A;  2E4H A;  1IRE B;  4BI4 A;  4JUV A;  2RK2 A;  3OMG A;  3VS6 A;  1F1B B;  3VYH B;  4GY5 A;  3MP1 A;  1PM3 A;  5IXB A;  2YRD A;  4C8Q C;  2JS0 A;  2DEQ A;  1VQ5 Q;  2E12 A;  2F5T X;  2COY A;  2G6F X;  1VQM A;  3OYG A;  1OZ3 A;  2F1L A;  1D3B A;  4E7S A;  2K2M A;  1ZSZ A;  3EG1 A;  4F7U A;  2KK4 A;  1Y96 A;  3TSW A;  1IZ6 A;  1JB0 E;  3PMI A;  1KQS S;  4RTW A;  2DZC A;  3M53 A;  2IG0 A;  5J3B A;  3OS1 A;  1SPK A;  3DLM A;  2VV5 A;  2XU8 A;  3P8D A;  1KHI A;  3QWX X;  3FJ5 A;  3FJP A;  2HNI A;  4QVC A;  5GAO l;  1MUZ A;  4BDZ A;  4R56 A;  3GPL A;  4PJO E;  1PCX A;  2J6F A;  5FLX E;  4Z02 A;  2LQN A;  4X34 A;  1NG2 A;  1MV3 A;  2XHC A;  3JCM e;  3UA6 A;  1I8F A;  1SSH A;  4KGV B;  2QAZ A;  4BE1 A;  4Z89 A;  3RKX A;  1PKT A;  2C0O A;  3OYJ A;  2CGH A;  3MPU B;  2AT1 B;  1JQQ A;  4OB3 B;  1IGU A;  2XI9 A;  5HK3 A;  4J9D A;  5GMK h;  2MMP A;  4MDX A;  3QXE B;  5GAN d;  3OYL A;  1JBM A;  2D0N A;  3M0P A;  1Q86 R;  5ECA A;  4M77 G;  3CXC A;  2RQR A;  4JRP A;  1Q82 R;  2E3H A;  2KRM A;  1WXB A;  2D6F A;  2EQI A;  3J81 E;  5LL6 S;  1JJ2 S;  4M77 B;  4NS5 A;  4KH0 B;  3M56 A;  3I56 A;  1VQK Q;  3V8K A;  2DRK A;  3OMC A;  3LX7 A;  3PVL A;  4HT9 A;  4RCB A;  4M75 C;  2DE0 X;  1VQP T;  1YCS B;  3E1S A;  8AT1 B;  1VIF A;  4RTU A;  4LUD A;  3QUI A;  1W2B S;  2DMO A;  5HKC A;  4OP0 A;  3KFV A;  2NUT B;  2JW4 A;  3X24 B;  4C92 A;  3LYI A;  1UGS B;  3IQL A;  1U8R A;  2ENM A;  2RJD A;  4N4I A;  1RAF B;  2VYT A;  3CC7 T;  1QQJ A;  4A54 A;  3OYY A;  2DD5 A;  1K9M C;  4PKC C;  2D8J A;  3CCS Q;  1KFZ A;  4ZN3 A;  4MDW A;  2WSE E;  1RL2 A;  4KBM B;  2R58 A;  3X26 B;  2KR3 A;  4F16 A;  4M7D F;  3I35 A;  2EQM A;  5M9O A;  3EG9 B;  4EDU A;  5LJ5 d;  5GAO r;  3O8V A;  4M7A G;  4J9F A;  2DET A;  4JRQ A;  1T3S A;  3FB9 A;  4J8O A;  3O5Z A;  5J26 A;  1K1Z A;  4VUB A;  4M7A B;  1RAD B;  1VQ8 A;  2RI5 A;  4PJO C;  1VQ5 A;  2B8A A;  3V8L A;  4C92 E;  1VUB A;  2DL4 A;  1YHQ Q;  1WJQ A;  1W1F A;  2HZY A;  3JCM b;  2LNV A;  1QP2 A;  1VA7 A;  2AKK A;  1JRI A;  2BE9 B;  3G71 Q;  1MMN A;  2ROL A;  4RUG A;  3JCM J;  4MZT A;  1PRM C;  1D1A A;  9ATC B;  3JCM X;  2VGM A;  5IT9 E;  1I0C A;  4E7I A;  1D1C A;  1G3W A;  1VQ4 Q;  1D0Z A;  3M4Y A;  1YBY A;  3NPF A;  3HFN A;  1QVG S;  4ZTJ A;  3FDR A;  1EZZ B;  1ACM B;  1U1S A;  2DTO A;  4A4H A;  1S1N A;  4JRI A;  1EFN A;  3CCM Q;  1ARK A;  2RMO A;  3G6E T;  4M77 A;  2LCC A;  4JPB W;  5KH6 A;  4IUV A;  5GAM d;  2GBQ A;  3A8H B;  4B6M A;  2HDA A;  5GAN 5;  3E9G A;  4DEX A;  1AWJ A;  2EQU A;  2F2V A;  2KVQ G;  2NUT A;  2OTJ T;  1UJY A;  2LT1 A;  1VQ7 T;  1N8R C;  4BE0 A;  3CCJ T;  4HVU A;  5EC7 A;  1NBE B;  3PE0 A;  4HT8 A;  1R0B G;  4M75 F;  1I5L A;  2KT1 A;  1VQK A;  2YRC A;  2DO3 A;  2J06 A;  2J6O A;  2CP5 A;  3H8Z A;  2D9T A;  3J7A F;  3G4S T;  1UEC A;  2OAU A;  2K3X A;  1PHT A;  1QVF P;  1M1K U;  2HSP A;  1QVG P;  2RQT A;  1QW1 A;  3OS5 A;  4A4E A;  3RKY A;  4JZ4 A;  1QCO A;  1KD1 R;  1Q86 U;  5GAN 7;  1M90 C;  3EG9 A;  3TVT A;  4M7D B;  3M0T A;  4RKU E;  2P0K A;  3JCM g;  4M77 E;  1K8A C;  4CRI A;  1BIB A;  3OBW A;  4XTV A;  3CCR Q;  4RCC A;  2LP5 A;  2VC8 A;  1YP5 A;  3CCS A;  4GLK A;  1AZE A;  4C5E A;  3ZEH A;  3L2U A;  1AWX A;  2JMA A;  1VQ6 Q;  1K76 A;  2R5A A;  2RH2 A;  5IHN A;  6AT1 B;  3CD6 A;  1E6G A;  5I11 A;  1M9S A;  4Y91 A;  2OTJ Q;  2ZPF B;  3VS5 A;  4BE2 A;  1ZA2 B;  2LQ8 A;  2QQA A;  1YJ9 Q;  4ELY C;  3EGX B;  2C06 A;  3G1J A;  2QDL A;  1YIJ A;  1ZUK A;  1YIT Q;  1M3B A;  2CP0 A;  2HQH A;  1UGV A;  3GIB A;  3PMT A;  5GAO q;  3JB9 J;  1GL5 A;  4K11 A;  1GCQ C;  5FU7 C;  1PD1 A;  1AWO A;  4QVZ A;  4HKE A;  1VQL A;  2O31 A;  4XTY A;  1FMV A;  4JLI A;  3JB9 D;  3A5Z B;  3WVE B;  1YHQ A;  1AOJ A;  2CZ0 B;  1G5V A;  4TVR A;  2PNI A;  2KRS A;  3ZL7 C;  1N5Z A;  4A63 B;  1UE9 A;  1OX9 A;  4RG2 A;  1N9S A;  4DBQ A;  4M7A E;  3G71 A;  4M7D D;  2ZPG B;  4WTO B;  1GXI E;  4HVW A;  4E7J A;  3EH1 A;  1GCP A;  4LUE A;  1VQ4 A;  1KC8 R;  1K4U S;  1X2K A;  2RNA A;  2M02 A;  1W4S A;  2FPD A;  1QWE A;  2P4R A;  2DPP B;  4FT4 A;  4WCI A;  1OU8 A;  4X9C A;  3A8L B;  2YUN A;  3CCM A;  1ZBX A;  3SEM A;  4M4Z A;  3X28 B;  4OB2 B;  1PKS A;  4XTW A;  1PD0 A;  1WDX A;  2J05 A;  3AT1 B;  5CKB A;  2EKH A;  2KY9 A;  4R55 A;  2HKN A;  4AMC A;  1M8M A;  1VYV A;  4UC4 A;  2YUP A;  3BW1 A;  1GFC A;  1NEB A;  2XID A;  4BI3 A;  5LJ5 j;  4M7D A;  2C0T A;  3X25 B;  4OMP A;  2L3R A;  1ZX6 A;  3QBY A;  4O6J A;  1VQN A;  2A36 A;  2QA4 Q;  2QGF B;  2E10 A;  2RQU A;  4B9W A;  1ZQ1 A;  3EGD B;  5GMK j;  1BK2 A;  2KRN A;  2CRE A;  2K3B A;  3CCU Q;  1G83 A;  4M78 F;  4L5G A;  2GNC A;  1TXQ A;  2CKK A;  2R5M A;  2KXD A;  2FPE A;  3EGX A;  1V76 A;  3CCR A;  1N9R A;  3CCQ T;  1UGP B;  5D7U A;  1YJW A;  4PNO A;  3TQ7 P;  1KIK A;  3MEW A;  5FU6 C;  1OQK A;  2DLP A;  3OW2 A;  2DXB A;  1VQ6 A;  4JJB A;  1RLP C;  5IXF A;  3OSS C;  4F7U G;  1X43 A;  1O75 A;  3L2R A;  3I9Q A;  4ZN1 A;  4M75 D;  4X1V A;  1Q7Y C;  3H0I A;  1OPK A;  3VJP A;  3OS0 A;  4F7U B;  3FEO A;  1K8A R;  1YJ9 A;  2OTL T;  3PFS A;  4M7A C;  4X9D A;  5CQY A;  4EMH A;  1VQO A;  4XQ3 A;  1YIT A;  2E6N A;  2FRW A;  2HEQ A;  1M30 A;  4L59 A;  1UHC A;  2Y4Y A;  5HCK A;  1Z9Z A;  2KGT A;  4CC4 B;  1PRL C;  2YSQ A;  2EYX A;  2QTX A;  3CBO A;  4XU1 A;  1KG1 A;  4KGX B;  3S3M A;  1KSW A;  2P0P A;  1G3T A;  1K9M U;  3CCQ Q;  2V8J A;  5I2S A;  2FB7 A;  5CK9 A;  2DL8 A;  2QQ9 A;  4OVA A;  2DTI A;  1E6H A;  2AKL A;  4LDU A;  1AWW A;  2RF0 A;  3EG0 A;  1LVK A;  3NFC A;  1OYX A;  2ZPB B;  2QG9 B;  3NTK A;  4PFZ A;  4C0D C;  5A2Q E;  2HQX A;  1X75 C;  1YJN Q;  2R57 A;  4J9G A;  4HCZ A;  2HCK A;  1BB9 A;  4IUU A;  4EMK B;  1HSQ A;  3S3O A;  1ZSG A;  4C5H A;  4IUP A;  1VQ8 T;  2CUD A;  5DM7 R;  2DAQ A;  3QKJ A;  3CCV Q;  4LDV A;  2EYY A;  3V7S A;  4QQG A;  2DBK A;  1GRI A;  3BDU A;  2ABL A;  3MET A;  1GBR A;  3CPW P;  4II1 A;  3EGD A;  3A1P A;  2ZAE A;  5GAN h;  5KCH A;  1QVP A;  4OF1 A;  3F70 A;  2Z0W A;  4FYW B;  4DOW A;  4M78 B;  2DVE A;  1XQH A;  2RD1 A;  1QCN A;  2HKQ B;  3OYI A;  2PVD B;  1OI1 A;  4CI0 C;  2QA4 A;  3HKS A;  1OU9 A;  1SRM A;  1IHW A;  1ZBJ A;  3VS7 A;  3V8J A;  3QZ5 B;  3CCU A;  2O88 A;  2CDT A;  1M2O A;  2EGA A;  3CMA A;  2EJ9 A;  2E41 A;  1TUD A;  1WXU A;  3LWH A;  2FZC B;  1ZUY A;  4F14 A;  4A4K A;  2RQV A;  3VUB A;  2HD0 A;  1WA7 A;  3I55 A;  2RHI A;  2K5L A;  2JMC A;  4RTY A;  5HY6 A;  2FPF A;  2QEX Q;  3CC2 T;  1Y07 A;  2LJ3 A;  3M58 A;  3CME T;  3DB3 A;  2V1Q A;  3CEY A;  3SWN A;  3EHR A;  4AG1 C;  2OI3 A;  5GMK l;  5LJ5 h;  5GAN e;  1N8R U;  4ANJ A;  5CR2 A;  1BI3 A;  1QWF A;  4LXC A;  1AT1 B;  1IO6 A;  4FT2 A;  3SHW A;  1PC0 A;  3VV0 A;  4M78 D;  2JT4 A;  3MP6 A;  1VIE A;  3C4S A;  2DK3 A;  2W0Z A;  1X01 A;  4E7H A;  1M1K R;  2F69 A;  2QQB A;  2FEI A;  3L2Z A;  1OX8 A;  1WHL A;  3PT9 A;  1Q7Y R;  2YWW A;  2RHU A;  2QAS A;  4F7U E;  4EMK A;  1M90 U;  4JJN K;  2KSS A;  3LLR A;  1BIA A;  1JU5 C;  3CCE T;  2V8I A;  2EQJ A;  1B07 A;  1MGQ A;  1KQ1 A;  5GAN 2;  1K8A U;  4FW1 A;  3CXC P;  4QVD A;  1JXO A;  3P8B B;  3JCM Q;  3QJY A;  4E7K A;  2KDS A;  2A7Y A;  5GAO p;  4LD9 K;  2QYZ A;  1ZHI A;  3OB9 A;  2HMA A;  3FIF A;  1YJN A;  2ZZD A;  3NGP A;  8ATC B;  5KE3 A;  2X9H A;  2DIQ A;  4HXJ A;  3ZFJ A;  3RES A;  1I07 A;  3KBG A;  2NWM A;  5LJ5 e;  4M78 A;  3JB9 I;  3SB2 A;  1N6A A;  2DRM A;  3JB9 F;  4OGE A;  3CCV A;  5IAY A;  1R8O B;  2RQW A;  5GAM h;  1M2V B;  2LRQ A;  1X27 A;  2VVK A;  3PIO A;  5GMK e;  2JTE A;  4KRT A;  2K5F A;  5AYF A;  4E6R A;  5GAN 4;  5L23 A;  1YFN A;  2LJ1 A;  2YRV A;  2PU9 B;  3DLL A;  4PJL A;  2KMT A;  2DD4 A;  3M55 A;  2CP2 A;  1R0C B;  4OMM A;  2DYB A;  4C8Q F;  4EPC A;  4J9E A;  3CC4 T;  2QQR A;  5KYU B;  2FL7 A;  1B34 B;  1TUC A;  2BZ8 A;  4RG8 A;  3GP8 A;  2CT3 A;  2YT6 A;  2GQI A;  1JJ2 A;  2K4Y A;  1VQP Q;  3HPW A;  2RHZ A;  2RHX A;  5IHI A;  3CBP A;  1H64 1;  1GBQ A;  1BKB A;  5KYY B;  1W2B A;  5HK0 A;  1WHK A;  2H8H A;  3CC7 Q;  1K73 C;  4IIO A;  1IRX A;  1AHJ B;  2QEX A;  3VS4 A;  2D1X A;  5GAM e;  3PIP A;  1ZSZ C;  1TOV A;  2VKN A;  1QVF S;  1GFD A;  5D6X A;  1I4K 1;  1UG1 A;  1ZLM A;  2CZ6 B;  2GTJ A;  1NPP A;  1QMC A;  2PQW A;  4KUL A;  2EGE A;  2ED1 A;  1TSF A;  2K6D A;  1V29 B;  4PLL A;  3A8O B;  5GAN f;  1OEB A;  3OYM A;  4PFO A;  4OMO A;  3NHN A;  2DA9 A;  2EAY A;  1H92 A;  2K57 A;  4BUG A;  2DNU A;  1YI2 T;  5CIU A;  1S72 T;  5CO7 A;  4J9I A;  1WPY A;  3JAM E;  2VAS A;  1Y0M A;  1SRL A;  2GFU A;  2RI3 A;  3HSB A;  2EKO A;  5FRN A;  1VQ9 T;  4JLG A;  2AZV A;  5GJW B;  2J7I A;  5IH2 A;  4BY6 B;  3C12 A;  4BI8 B;  3JB9 G;  3R6O A;  1M1G A;  2H3E B;  1WNL A;  1WQW A;  2GQV A;  1G2B A;  1K0X A;  3E9F A;  1M2V A;  2CP6 A;  1BBZ A;  2JM9 A;  2DXU A;  3M57 A;  2LQW A;  4M7D G;  3QSU A;  3MEA A;  3VS0 A;  4Z8A A;  2RM4 A;  1Q7Y U;  3OYA A;  3TSZ A;  3KUF A;  3VYG A;  5GAN g;  1YWO A;  3L2Q A;  3LGF A;  3OBY A;  3G6E Q;  4Q5W A;  1UHF A;  5LJ5 f;  3OYF A;  4ZTF A;  3N5B B;  5KYU A;  4D6W A;  1BCM A;  2CZ1 B;  4C8Q B;  1B34 A;  2P84 A;  1YI2 Q;  1I81 A;  5CKE A;  1G3Y A;  4ATO A;  4KUD K;  2CP3 A;  4LN2 A;  2CT4 A;  4C92 C;  2E64 A;  4OMN A;  1M5Q 1;  4RTV A;  3JCM c;  3J80 E;  2AK5 A;  5GAN 8;  1VQ7 Q;  3C0C A;  1H3Z A;  4BB7 A;  4CC7 A;  3CCJ Q;  1X2Q A;  5FW9 A;  4PJM A;  2HAX A;  5KYY A;  2MOX A;  1K9M R;  1E7O A;  4J6X A;  1KJW A;  3M0Q A;  1WI7 A;  3M5A A;  4PJO F;  3SD4 A;  3BFM A;  2DL5 A;  1XNI A;  1RAC B;  2EIF A;  2DX1 A;  4D8K A;  1UGQ B;  1VQP A;  1IB8 A;  1MMD A;  3G4S Q;  3JRZ A;  2XDP A;  2ECZ A;  2RJE A;  4PJN A;  1QLY A;  5GAN j;  2XDB A;  2M16 A;  1HXD A;  2QTV A;  2JVV A;  2QK0 A;  2QGG A;  4XK8 E;  1SHF A;  3VS2 A;  1WHM A;  5LJ5 g;  3CC7 A;  3GLX A;  2LQK A;  2GTO A;  3HFO A;  3Q1J A;  3H41 A;  4NL2 A;  3VS3 A;  1ZA1 B;  2LVM A;  3G7Z A;  4FSS A;  2W10 A;  3CCL T;  2JM8 A;  2K5I A;  4DOV A;  2EFI A;  4N0A A;  5GAM f;  2RK1 A;  1PNJ A;  2O9V A;  3HP9 A;  4PL6 A;  4C8Q D;  2ESW A;  3RDV A;  3LGL A;  4E7L A;  1SG5 A;  2MWP A;  3PGG A;  1K73 R;  4M75 G;  4HA8 A;  3HTR A;  3QHS A;  1VOM A;  1WYX A;  1VQM T;  4M75 B;  1D09 B;  4FU6 A;  2QI2 A;  1LPL A;  3M0U A;  1WZO A;  4Y28 E;  5KE2 A;  4FYX B;  1YN8 A;  2DBM A;  2X4X A;  1R77 A;  3M0S A;  3QII A;  2RHY A;  4A53 A;  4M77 C;  2OX7 A;  5DY9 A;  2E3I A;  1OV3 A;  2KEA A;  3OSV A;  1Q81 C;  1XTD A;  1IHV A;  2E70 A;  2XDD A;  2KNB B;  1Y7X A;  4Z88 A;  3REB B;  3PTA A;  3OS2 A;  4DQ2 A;  3L1A A;  4C8Q A;  1UTI A;  4J6Y A;  2GFA A;  5GAM g;  2X3X D;  3LWI A;  2L3Q A;  3UPU A;  2X51 A;  1N8R R;  1RUW A;  3RMS A;  2RB6 A;  4ESR A;  2A0F B;  2DL3 A;  5LJ3 h;  2OAW A;  1SHG A;  4LDX A;  1JXM A;  3THK A;  4C92 F;  4XTU A;  5I21 A;  1VQM Q;  2DF6 A;  1AD5 A;  1XJW B;  4GLM A;  1BYM A;  3P8H A;  2CUB A;  1Y57 A;  1W70 A;  3OW2 P;  4F04 B;  5CCA A;  2OTJ A;  1M90 R;  4LE9 A;  3RMQ A;  3I56 T;  1VQ7 A;  4M7D E;  1RAA B;  2YLC A;  2PUK B;  2MCN A;  1NJI C;  1TUG B;  2ZCF B;  4J83 A;  3CCJ A;  4JS5 A;  1G8X A;  4JRK A;  3WVD B;  3A8M B;  3MCA B;  2JZ2 A;  1KK7 A;  1UGR B;  1VYU A;  1NYG A;  4J7I A;  1WIE A;  5GAM j;  2L5Q A;  5IHK A;  1TS9 A;  3SWN B;  3G4S A;  2JNG A;  3CPW S;  1G3S A;  2XD0 A;  1Q82 C;  4L6V 5;  3RUX A;  3GF5 A;  1TH7 A;  2VWF A;  2CYZ B;  2GF7 A;  3MO8 A;  2SEM A;  1JEG A;  3E19 A;  3QWY A;  1V1C A;  3VRY A;  2RI2 A;  3HRU A;  3HL8 A;  1FYN A;  2COZ A;  2IIM A;  1UFF A;  4YTL A;  3T9N A;  2A08 A;  2CZ7 B;  2EYZ A;  4M75 A;  1KQ2 A;  2LT4 A;  2SRC A;  4RTZ A;  3TU4 K;  3LW5 E;  3MP8 A;  2CSQ A;  3AHU A;  3X20 B;  5D6Y A;  5GAN 3;  2YUQ A;  2HL3 A;  3V7C A;  4PJO D;  4ELZ C;  5LJ3 d;  4XU2 A;  2OTL Q;  4V2S A;  1OPL A;  3OQ5 A;  2X4Y A;  2BKD N;  1AEY A;  4LDW A;  4GBQ A;  5FWB A;  1VQ5 T;  4BD3 A;  4D8D A;  2AZS A;  5I22 A;  4JDS A;  4M77 F;  2M9U A;  4M78 G;  2RPN A;  3MEU A;  1X6G A;  3LH0 A;  3DB4 A;  2XMF A;  1RAB B;  2KYB A;  1HJD A;  4FW2 A;  4RTT A;  2M0O A;  2FHD A;  3MKD A;  4FM4 B;  4J9H A;  1K73 U;  2JJ9 A;  2WSF E;  1H8K A;  3REA B;  4DBH A;  4M75 E;  2HBW A;  3H9N A;  3CPF A;  2H3J A;  4PJO A;  2VB6 A;  4M7D C;  2KE9 A;  3NTI A;  3JV3 A;  1NM7 A;  2VUB A;  3PVQ A;  1NLP C;  2K2V A;  2EJG A;  1OZ2 A;  5A0G A;  4RTX A;  1Q81 R;  1VQ8 Q;  2OJ2 A;  3INZ A;  4AT1 B;  3OA6 A;  5A0D A;  4ME7 A;  1JO8 A;  3MHX A;  3CXC S;  2EPD A;  3BY7 A;  2EYQ A;  1A0N B;  5FU7 B;  3QDF A;  1M8V A;  3PNW C;  4E2F B;  3H0H A;  3FRN A;  3SFM A;  1AZG B;  3SDZ A;  2YHT A;  4M7A F;  1RAI B;  2EW3 A;  4DBF A;  3E2U A;  4QT7 A;  4J9C A;  1VQK T;  4Y92 A;  4XU3 A;  3C95 A;  2KRO A;  2AIR B;  4A4F A;  3QYH B;  7AT1 B;  2NYS A;  2F2W A;  3EHQ A;  2CP7 A;  1BI0 A;  2PVO B;  4IIM A;  3QYG B;  2P0Q A;  3QPH A;  1TU0 B;  1I5O B;  5GAN 6;  1P92 A;  5KCO A;  2WSC E;  1PWT A;  3TCJ A;  1NJI R;  3CCS T;  1FXX A;  3UDC A;  1W6X A;  4C92 D;  2COW A;  3BDL A;  1WQ7 A;  3M4G A;  1WXT A;  4QQ6 A;  3ULR B;  4N4H A;  2DFU A;  3CCQ A;  3CD6 T;  2L0A A;  2O01 E;  2DJZ A;  5LJ3 f;  3CC2 Q;  3CME Q;  2LTO A;  3JCM d;  1KQS A;  2X3W D;  2FVU A;  1KD1 C;  2A28 A;  2ZPI B;  1BU1 A;  4JJC A;  2LX9 A;  4LNP A;  2I0N A;  4C0F A;  5KYN A;  4OML A;  1KQS P;  1SF9 A;  1YIJ T;  1FWZ A;  1WJR A;  2NLU A;  2ROT A;  2OTL A;  4ZNX A;  4J5Y A;  3MEV A;  1VQL T;  4OGC A;  1RI0 A;  1MMA A;  1C6V X;  3I5S A;  3M9Q A;  2LCL A;  1VYT A;  1QCF A;  1U5S A;  2JN0 A;  1YHQ T;  2VXE A;  4KUI A;  3ASK A;  3RR6 A;  2E6Z A;  3S3N A;  4J6W A;  4EIK A;  4KH1 B;  1NEG A;  3G71 T;  2YDL A;  1K9A A;  2GGR A;  3CCE Q;  5L8R E;  5GAO n;  1FX7 A;  1ABQ A;  3VU3 C;  3FC3 A;  5LJ3 g;  1U1T A;  3CD6 Q;  3H6Z A;  5FU6 B;  1VQ4 T;  4PK4 A;  5J39 A;  3NMZ C;  2DEU A;  1KHC A;  1GCQ A;  3HRT A;  2P4T A;  2JTM A;  2YUO A;  1TG0 A;  1WX6 A;  2BZY A;  1JJ2 P;  2WAC A;  1B7T A;  3EGU A;  1UJ0 A;  3CCM T;  2ZGW A;  2A3L A;  2DVJ A;  5CAI A;  3OYN A;  1YIJ Q;  2K79 A;  2E1H A;  4M78 E;  5GMK i;  2DER A;  3I5R A;  2MPX C;  3GNF B;  5EG2 A;  2L89 A;  2RO0 A;  2XK0 A;  1K0S A;  2D8H A;  2DTH A;  1NE8 A;  1SSF A;  3VRZ A;  1W2B P;  1VQL Q;  4M77 D;  1SKU B;  4PLI A;  2RJC A;  4JZ3 A;  4P5N A;  2KT8 A;  1KC8 C;  2DIL A;  1LCK A;  4FSX A;  2D0Q B;  4OMQ A;  1LNX A;  3UT1 A;  3RER A;  1LOJ A;  4DBR A;  1MV0 B;  2DXT A;  3TRE A;  4LD6 A;  1OOT A;  3JCM W;  1I1J A;  5AT1 B;  3QJ6 A;  1QKX A;  1VQN T;  5LJ3 j;  1RAG B;  3OY9 A;  2EWN A;  1Q81 U;  2VGN A;  3BE3 A;  5I2M A;  1ZUU A;  3CC4 Q;  1QKW A;  4QKU A;  3SWN C;  3OYC A;  1M4Z A;  2M51 A;  5CKD A;  3JSC A;  4B9X A;  3CQT A;  3HRS A;  2MF2 A;  4C0D B;  1WHG A;  2KBT A;  3CCR T;  3JCM f;  1YJW T;  2G3R A;  1CSK A;  2ED0 A;  1HD3 A;  1WFW A;  3JCM V;  4MML A;  2JTF A;  1YNZ A;  1U3O A;  2M1H A;  5C6S A;  1VQ6 T;  2CS7 A;  2EBP A;  4LDY A;  4QW2 A;  1TTH B;  1FMW A;  4J7F A;  3R6N A;  3CC2 A;  1CKA A;  4M7A D;  2DIG A;  4R0K A;  3CME A;  1MHN A;  2K9G A;  4EMK C;  4C0G A;  1RAH B;  3JCM P;  2V26 A;  3A98 A;  1YJ9 T;  3QO3 A;  2PZ1 A;  1O9S A;  4AFZ C;  4MZM A;  2MAM A;  1UB4 A;  2QQS A;  1WHH A;  1B3Q A;  3QDR B;  1VQO T;  3EG3 A;  3RIR A;  1NJI U;  5CKH A;  4DEY A;  1YIT T;  2XIC A;  3GBQ A;  4C8Q G;  1VQN Q;  2JUF A;  1QVF A;  1FMK A;  3UAT A;  1QVG A; 
#chains in the Genus database with same CATH homology
 1K9M C;  5GAM g;  4PKC C;  4JS4 A;  3LWI A;  4ZN3 A;  4DOW A;  4M78 B;  4MDW A;  2WSE E;  2RJF A;  3UPU A;  3RKW A;  1RL2 A;  2DVE A;  4KBM B;  1XQH A;  2RD1 A;  2R58 A;  3X26 B;  1EIF A;  3RMS A;  3GOX A;  4IKF A;  3C94 A;  2RB6 A;  3QZ9 B;  3OYI A;  5LJ3 h;  2PVD B;  3DKM A;  2K3Y A;  4M78 C;  1OI1 A;  1Q82 U;  4CI0 C;  4M7D F;  2QA4 A;  2EQM A;  5IN1 A;  5M9O A;  3HKS A;  4EDU A;  5LJ5 d;  4LDX A;  5GAO r;  3A8G B;  1WGS A;  4C92 F;  4XTU A;  3V8J A;  3O8V A;  3QZ5 B;  5I21 A;  3CCU A;  4M7A G;  3CCE A;  4M7A A;  3CMA A;  2EJ9 A;  4JRQ A;  2E41 A;  3P8H A;  3FB9 A;  1BYM A;  4J8O A;  3URG A;  5J26 A;  2EJF A;  4VUB A;  4M7A B;  3LWH A;  4A4K A;  5CCA A;  3VUB A;  1VQ8 A;  2OTJ A;  2HD0 A;  3RMQ A;  2VXF A;  1LJO A;  2DZ9 A;  3I55 A;  3I56 T;  1VQ7 A;  2RI5 A;  2YLC A;  2PUK B;  1NJI C;  4M7D E;  2RHI A;  2ZCF B;  2K5L A;  4J83 A;  3CCJ A;  1VQ5 A;  4JS5 A;  5HY6 A;  4PJO C;  2B8A A;  4JRK A;  3V8L A;  3WVD B;  1Y07 A;  4C92 E;  3CC2 T;  3M58 A;  3CME T;  1VUB A;  3DB3 A;  3A8M B;  3MCA B;  5D6W A;  1WJQ A;  2BIV A;  1UGR B;  2JZ2 A;  3OYD A;  5CKF A;  3CEY A;  3SWN A;  4J7I A;  3JCM b;  2LNV A;  2E65 A;  5GAM j;  2L5Q A;  1QP2 A;  1XOV A;  4A54 A;  4ZGJ B;  5GMK l;  5LJ5 h;  5GAN e;  3SWN B;  3G4S A;  1JRI A;  2JNG A;  1N8R U;  3CPW S;  3JCM J;  2Y90 A;  4MZT A;  5CR2 A;  3OYB A;  4FIB A;  1G3S A;  3V7R A;  3OYH A;  1BI3 A;  1Q82 C;  4L6V 5;  2XD0 A;  4F7U F;  3RUX A;  2FYK A;  2ZPH B;  3GF5 A;  1TH7 A;  2X4J A;  2CYZ B;  3JCM X;  2GF7 A;  3MO8 A;  2VGM A;  5IT9 E;  4FT2 A;  4E7I A;  1G3W A;  3E19 A;  3VV0 A;  3L2W A;  3M4Y A;  4M78 D;  1YBY A;  3MP6 A;  1VIE A;  3HFN A;  3C4S A;  1QVG S;  4ZTJ A;  2DK3 A;  3FDR A;  2RI2 A;  4N4G A;  3HRU A;  1U1S A;  1X01 A;  3HL8 A;  2DTO A;  4A4H A;  4E7H A;  2F69 A;  2QQB A;  4JRI A;  3L2Z A;  2YLB A;  4YTL A;  2QXF A;  3T9N A;  3PT9 A;  2CZ7 B;  2QA4 T;  2RHU A;  1N27 A;  4M75 A;  1KQ2 A;  2LT4 A;  3G6E T;  4M77 A;  4F7U E;  2KQW A;  4EMK A;  3CC4 A;  1M90 U;  2LCC A;  1M1F A;  4JJN K;  2KSS A;  4C5I A;  5KH6 A;  4IUV A;  3LLR A;  5GAM d;  3LW5 E;  1BIA A;  3CCU T;  3TU4 K;  3CCE T;  2V8I A;  2EQJ A;  2LC4 A;  3MP8 A;  1MGQ A;  1KQ1 A;  5GAN 2;  1K8A U;  3CMA T;  3AHU A;  1Y71 A;  3X20 B;  5D6Y A;  3A8H B;  3GNG A;  5GAN 3;  4QVD A;  3V7C A;  3E9G A;  5GAN 5;  3OYK A;  4WF2 A;  4PJO D;  4ELZ C;  3P8B B;  2EQU A;  4QQD A;  5LJ3 d;  3JCM Q;  4NL3 A;  4XU2 A;  4V2S A;  2KVQ G;  4ZGD B;  2OTJ T;  3QJY A;  4IUR A;  3OW2 S;  2LT1 A;  4E7K A;  2KDS A;  3OQ5 A;  2A7Y A;  3I55 T;  1VQ7 T;  2X4Y A;  5GAO p;  4LD9 K;  1N8R C;  2BKD N;  4BE0 A;  3CCJ T;  4LDW A;  1VQ5 T;  4BD3 A;  1ZHI A;  3OB9 A;  4HCC A;  5FRM A;  3M54 A;  3FIF A;  4NOY A;  2ZZD A;  1YJN A;  4HT8 A;  5KE3 A;  2JOY A;  2DIQ A;  3QG1 A;  4M75 F;  3RES A;  3ZFJ A;  1I5L A;  1VQK A;  4JDS A;  3KBG A;  4M77 F;  4O5V A;  2M9U A;  4M78 G;  5LJ5 e;  2DO3 A;  4M78 A;  3JB9 H;  3MEU A;  2BUD A;  3SB2 A;  1N6A A;  3JB9 I;  3H8Z A;  4ZGE B;  3LH0 A;  2O4X B;  3DB4 A;  2D9T A;  3J7A F;  3G4S T;  3JB9 F;  4OGE A;  2OAU A;  2K3X A;  3CCV A;  5IAY A;  1R8O B;  5GAM h;  2MWO A;  1M1K U;  2LRQ A;  2M0O A;  2FHD A;  1QW1 A;  3OS5 A;  4A4E A;  4FM4 B;  3RKY A;  1K73 U;  2WSF E;  5GAN 7;  1Q86 U;  1HK9 A;  1M90 C;  4OB0 B;  3PIO A;  4M7D B;  2AHJ B;  4IUQ A;  4RKU E;  2E5Q A;  2P0K A;  4M75 E;  5GMK e;  3JCM g;  2L8D A;  4M77 E;  4IUT A;  1K8A C;  3UWN A;  2K5F A;  4CRI A;  1BIB A;  3CPF A;  3OBW A;  2D6F A;  5AYF A;  4XTV A;  3G6E A;  4RCC A;  5GAN 4;  2VC8 A;  3CCS A;  4PJO G;  2H3J A;  5CQX A;  3S6W A;  2YRV A;  4PJO A;  3EFR A;  2PU9 B;  4GLK A;  3DLL A;  4M7D C;  4C5E A;  2KMT A;  2DD4 A;  3M55 A;  3ZEH A;  3L2U A;  1YI2 A;  3NTI A;  1S72 A;  2HBP A;  4C8Q F;  3KXT A;  2VUB A;  4EPC A;  2IVW A;  4PJO B;  2R5A A;  3CC4 T;  2RH2 A;  2QQR A;  2K2V A;  3CD6 A;  2FL7 A;  2X4W A;  2EJG A;  1M9S A;  1OZ2 A;  1NPR A;  5A0G A;  1B34 B;  4HCB A;  4Y91 A;  4RG8 A;  3GP8 A;  3INZ A;  1JJ2 A;  3OA6 A;  2K4Y A;  2ZPF B;  1VQ9 A;  5A0D A;  3ZBD A;  4ME7 A;  3HPW A;  3MHX A;  3CXC S;  2PUO B;  4FL6 A;  3BY7 A;  4BE2 A;  2EYQ A;  2LQ8 A;  2QQA A;  4ELY C;  4XU0 A;  2RHZ A;  2RHX A;  2C06 A;  3CBP A;  3F70 A;  2QDY B;  5FU7 B;  1H64 1;  1M8V A;  3PNW C;  1UEB A;  1YIJ A;  1BKB A;  4EMG A;  4RMO A;  3FRN A;  1W2B A;  4C8Q E;  2EQK A;  3SFM A;  1M1K C;  5HK0 A;  3ME9 A;  3GIB A;  3PMT A;  3SDZ A;  5GAO q;  3JB9 J;  1D3B B;  1YJN T;  1K73 C;  1NZ9 A;  2YHT A;  4M7A F;  4XAX B;  5FU7 C;  1Q86 C;  4QVZ A;  4HKE A;  1VQL A;  1VQK T;  4XU3 A;  1WJS A;  4XTY A;  1QP3 A;  2RA2 A;  3C95 A;  1KD1 U;  1Y96 B;  3ER0 A;  1AHJ B;  2QEX A;  3L42 A;  2DXC A;  4KT0 E;  3FLG A;  5GAM e;  4JLI A;  5CVI A;  3PIP A;  4A4F A;  3A5Z B;  3JB9 D;  1QVG A;  3WVE B;  1X6O A;  3M59 A;  3QYH B;  3CCV T;  1YHQ A;  2CZ0 B;  1G5V A;  1DJ7 B;  1BI2 A;  4TVR A;  2V8K A;  1QVF S;  5D6X A;  1I4K 1;  1BI0 A;  2PVO B;  2CZ6 B;  3QYG B;  2P0Q A;  1NPP A;  2XKO C;  3QPH A;  5LJ3 e;  2PQW A;  4KUL A;  4RG2 A;  1N9S A;  5GAN 6;  4M7A E;  2Y4X A;  3G71 A;  1V29 B;  1PSF A;  1P92 A;  4PLL A;  3A8O B;  2ZPG B;  5KCO A;  2WSC E;  5GAN f;  4M7D D;  3OYM A;  3TCJ A;  4MZP A;  3VUZ A;  1GXI E;  3CCS T;  1FXX A;  3UDC A;  4C92 D;  2EAY A;  4E7J A;  4BDY A;  3EAE A;  2K57 A;  3BDL A;  4BUG A;  1VQ4 A;  3NTH A;  1YI2 T;  1WQ7 A;  2ZPE B;  3M4G A;  4OB1 B;  2PVG B;  4QQ6 A;  4XTX A;  5CIU A;  5CO7 A;  2X35 A;  5DLQ E;  3CBM A;  4C5G A;  4N4H A;  1S72 T;  1WPY A;  3JAM E;  1BI1 A;  2MI6 A;  1W4S A;  1PSE A;  1YCY A;  3CCQ A;  2GFU A;  3CD6 T;  2RI3 A;  2O01 E;  2DJZ A;  2DPP B;  4FT4 A;  5LJ3 f;  2HQE A;  3HSB A;  5GAO m;  2EKO A;  5FRN A;  2LTO A;  4X9C A;  1VQ9 T;  3A8L B;  4JLG A;  3JCM d;  3CCM A;  5FRO A;  1ZBX A;  1KQS A;  2FVU A;  3VKI A;  3X28 B;  3OYE A;  4N0A C;  3WXM B;  4XTZ A;  4OB2 B;  1KD1 C;  4XTW A;  2ZPI B;  5GMK m;  4BY6 B;  2LX9 A;  3C12 A;  2LDM A;  4MMK A;  4OMF B;  4C0F A;  4BI8 B;  3JB9 G;  5C0M A;  3R6O A;  1M1G A;  5CKB A;  5A0L A;  1YIJ T;  1FWZ A;  2KY9 A;  4R55 A;  2O4X A;  4DA4 A;  4C0Z A;  1WNL A;  1WJR A;  1WQW A;  2GQV A;  4E47 A;  2NLU A;  2DKG A;  3E9F A;  3TEE A;  4BY6 C;  2OTL A;  2KAF A;  4UC4 A;  5DLO A;  3BW1 A;  4J5Y A;  2DXU A;  3MEV A;  1VQL T;  2XID A;  4OGC A;  1RI0 A;  4BAC A;  4BI3 A;  5LJ5 j;  3L2V A;  3EFS A;  3M57 A;  4A4G A;  4M7D G;  3CPW A;  3HHT B;  2XG8 D;  3M9Q A;  3QSU A;  4M7D A;  2LCL A;  2QEX T;  3MEA A;  3X25 B;  3OYY A;  2L3R A;  2JN0 A;  4C92 G;  2RM4 A;  1YHQ T;  3OYA A;  1Q7Y U;  2VXE A;  4KUI A;  3KUF A;  3VYG A;  5GAN g;  3QBY A;  3L2Q A;  4O6J A;  3ASK A;  3LGF A;  2F5K A;  2E6Z A;  3S3N A;  1VQN A;  2GCX A;  4J6W A;  3OBY A;  2E10 A;  3JCM h;  4B9W A;  4Q5W A;  4C92 B;  1KC8 U;  3CCL A;  1ZQ1 A;  5LJ5 f;  2I2L A;  3OYF A;  5GMK j;  4ZTF A;  3G71 T;  3N5B B;  4D6W A;  2CZ1 B;  5L8R E;  4C8Q B;  5GAO n;  1IRE B;  1B34 A;  1I81 A;  4JUV A;  1FX7 A;  1G3Y A;  4M78 F;  5CKE A;  4BI4 A;  4L5G A;  4KUD K;  3VU3 C;  4ATO A;  3FC3 A;  4C92 C;  2RK2 A;  3OMG A;  5LJ3 g;  1U1T A;  2E64 A;  3VYH B;  3H6Z A;  4GY5 A;  1M5Q 1;  3MP1 A;  2CKK A;  5FU6 B;  1VQ4 T;  2R5M A;  5J39 A;  4C8Q C;  3JCM c;  3J80 E;  1KHC A;  5GAN 8;  3HRT A;  1N9R A;  3CCR A;  2DEQ A;  2P4T A;  3CCQ T;  1UGP B;  4BB7 A;  1YJW A;  2JTM A;  1H3Z A;  2E12 A;  2F5T X;  2HAX A;  4PNO A;  2WAC A;  3MEW A;  5FU6 C;  1VQM A;  3OYG A;  1OZ3 A;  3CCM T;  2ZGW A;  2A3L A;  5CAI A;  3OYN A;  1D3B A;  2DXB A;  3OW2 A;  2E1H A;  4M78 E;  5GMK i;  4J6X A;  1VQ6 A;  3GNF B;  3OSS C;  5EG2 A;  1O75 A;  4F7U G;  2L89 A;  2RO0 A;  3M5A A;  4PJO F;  2XK0 A;  4F7U A;  3SD4 A;  2KK4 A;  3BFM A;  1Y96 A;  1XNI A;  3L2R A;  2DTH A;  2EIF A;  1NE8 A;  4ZN1 A;  1UGQ B;  1SSF A;  4M75 D;  1IZ6 A;  1VQP A;  1JB0 E;  3PMI A;  1Q7Y C;  1KQS S;  4M77 D;  3VJP A;  3JRZ A;  3OS0 A;  4F7U B;  2DZC A;  2XDP A;  2IG0 A;  3M53 A;  2RJE A;  5J3B A;  3FEO A;  4PLI A;  2RJC A;  1YJ9 A;  4P5N A;  2OTL T;  3PFS A;  4M7A C;  4X9D A;  3OS1 A;  5GAN j;  2XDB A;  2M16 A;  1KC8 C;  3DLM A;  2VV5 A;  2XU8 A;  3P8D A;  1HXD A;  1KHI A;  5CQY A;  4FSX A;  4EMH A;  2D0Q B;  2JVV A;  1VQO A;  3FJP A;  2HNI A;  1LNX A;  4XQ3 A;  4QVC A;  4XK8 E;  3UT1 A;  5GAO l;  4BDZ A;  1YIT A;  2E6N A;  4R56 A;  3RER A;  1LOJ A;  5LJ5 g;  3GPL A;  3CC7 A;  2DXT A;  3GLX A;  4PJO E;  2LQK A;  3TRE A;  4LD6 A;  4L59 A;  5FLX E;  4Z02 A;  3JCM W;  3HFO A;  3Q1J A;  2Y4Y A;  3QJ6 A;  4X34 A;  4NL2 A;  2XHC A;  3JCM e;  1I8F A;  1VQN T;  5LJ3 j;  2LVM A;  3G7Z A;  3OY9 A;  2EWN A;  3CCL T;  1Q81 U;  2VGN A;  4BE1 A;  2K5I A;  4DOV A;  5I2M A;  3RKX A;  2QTX A;  3CBO A;  4XU1 A;  2EFI A;  3SWN C;  4N0A A;  3OYJ A;  2CGH A;  3OYC A;  1KG1 A;  5GAM f;  1M4Z A;  2RK1 A;  5CKD A;  4OB3 B;  3HP9 A;  4PL6 A;  2XI9 A;  3JSC A;  2P0P A;  4C8Q D;  5HK3 A;  3S3M A;  4B9X A;  5GMK h;  1G3T A;  2MMP A;  3LGL A;  4E7L A;  1K9M U;  4MDX A;  2V8J A;  5I2S A;  2FB7 A;  3HRS A;  2MF2 A;  4C0D B;  5CK9 A;  2MWP A;  2QQ9 A;  2DTI A;  3PGG A;  3QXE B;  4OVA A;  5GAN d;  3OYL A;  1JBM A;  4M75 G;  4LDU A;  4M77 G;  3CCR T;  3JCM f;  3CXC A;  1YJW T;  2G3R A;  3NFC A;  4HA8 A;  4JRP A;  1OYX A;  2ZPB B;  3NTK A;  4C0D C;  5A2Q E;  2HQX A;  3QHS A;  1X75 C;  1VQM T;  3J81 E;  4M75 B;  5LL6 S;  1JJ2 S;  3JCM V;  2R57 A;  4M77 B;  4HCZ A;  4MML A;  4NS5 A;  4IUU A;  4EMK B;  3M56 A;  4FU6 A;  2JTF A;  2M1H A;  3I56 A;  2QI2 A;  5C6S A;  3V8K A;  3S3O A;  4C5H A;  2CS7 A;  1VQ6 T;  4Y28 E;  5KE2 A;  3OMC A;  3LX7 A;  4IUP A;  4LDY A;  4HT9 A;  2X4X A;  4QW2 A;  4RCB A;  4J7F A;  1VQ8 T;  3CC2 A;  4M7A D;  3QII A;  2RHY A;  2DIG A;  4A53 A;  4M75 C;  3CME A;  1VQP T;  5DM7 R;  1MHN A;  4M77 C;  2DAQ A;  3E1S A;  3QKJ A;  4EMK C;  5DY9 A;  1VIF A;  4C0G A;  4LDV A;  1W2B S;  3QUI A;  3V7S A;  3JCM P;  4QQG A;  5HKC A;  4OP0 A;  3OSV A;  1YJ9 T;  3QO3 A;  1O9S A;  4MZM A;  1Q81 C;  3BDU A;  2MAM A;  3MET A;  1UB4 A;  2QQS A;  1XTD A;  3X24 B;  3QDR B;  2E70 A;  4C92 A;  1VQO T;  2XDD A;  3RIR A;  1NJI U;  3LYI A;  1UGS B;  4II1 A;  1Y7X A;  5CKH A;  1YIT T;  1U8R A;  2RJD A;  2XIC A;  4N4I A;  4C8Q G;  2VYT A;  5GAN h;  3OS2 A;  3PTA A;  4DQ2 A;  3CC7 T;  2JUF A;  3L1A A;  4C8Q A;  5KCH A;  1QVF A;  1QVP A;  4OF1 A;  4J6Y A;  2GFA A;  2DD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...