3SWNC

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
68
Chain Sequence
LDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRLTGAIRKLGLVVVRGTTLVLIAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm7
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 10
structure length 68
sequence length 74
chains with identical sequence F, O, R
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnC00
2DJZA 4JRKA 1MGQA 3JCMc 3JCMd 1WQWA 4HT8A 4PJOD 1M8VA 4A54A 3JB9I 1M5Q1 4F7UA 4EMKB 4M7DF 4RCCA 5GAMh 2Y90A 4A53A 4C92E 2E41A 3RIRA 3JCMg 5GMKh 1U1TA 1HXDA 4JRIA 3JB9G 3INZA 3QUIA 2EWNA 1Y96B 4M7AB 3V7CA 1X01A 2EAYA 5CAIA 5GAMj 5GAMd 2JN0A 2ZGWA 4M7DA 4C8QF 4C8QE 5GANe 5GMKj 4M7AG 3SWNA 4C92D 5LJ5e 2RM4A 4PJOF 5GMKl 3JCMh 5LJ3e 2DVEA 3AHUA 4M7DC 1B34B 4XU3A 3SWNC 2FYKA 3HSBA 4V2SA 4XTYA 2DEQA 4N0AA 4XU0A 1U1SA 3RKWA 3JB9F 4WF2A 4XTUA 4XU2A 2RB6A 4C8QA 4C8QD 4N0AC 2E1HA 4M75B 4EMGA 5LJ5f 2YLCA 4NL2A 4PJOA 4Y91A 3QO3A 2EJGA 5GMKm 4XTZA 1LNXA 4XTVA 3JCMb 1I81A 4C8QC 4M7AE 1WNLA 4C92F 2I2LA 4M75G 5GAN5 3VU3C 4PJOC 3JB9J 3JB9D 2RA2A 4EMHA 4EMKA 1HK9A 3V7SA 3V8LA 3PGGA 5GAMe 2DKGA 5GMKe 4EMKC 1LOJA 1KQ1A 5GAOr 1BIBA 1Y96A 3BW1A 4M7AD 4QVDA 4C92A 5GMKi 2YLBA 5I21A 3HFNA 2QTXA 4M77E 5LJ5g 2DTIA 3RESA 2DXUA 5GAN3 2E64A 4F7UB 3JB9H 4C92C 1BIAA 2VXEA 2DXTA 4J6YA 4M75E 4M75F 3RKXA 1D3BA 1KQ2A 5GAOq 3JCMW 4M77B 1B34A 1I4K1 4F7UG 3JCMe 3JCMP 3RERA 5GANf 2CGHA 2VC8A 4MMKA 4DQ2A 2E10A 3V8JA 4M77G 3HFOA 1LJOA 2DTHA 3EFSA 5LJ3f 5LJ5h 2FB7A 4M78E 5GAOn 4M7AF 4M7DB 3FJPA 2DTOA 4M75D 4M75A 4MMLA 4HT9A 1I8FA 4JLIA 3BFMA 4XU1A 4M7DG 3JCMf 4M75C 4JUVA 2E65A 4M78B 2K57A 4HA8A 3RUXA 1I5LA 5LJ5j 5GAN8 5LJ5d 3L2ZA 2EJ9A 4F7UE 1JBMA 4NL3A 4M78G 4M7AA 2HNIA 2DZCA 5GANg 4PJOB 4M77F 3RKYA 4X9DA 5GAN4 4J6XA 4M7AC 3QHSA 4XTWA 5GAN6 5LJ3g 3JCMQ 5GAMf 4PJOG 4J5YA 3V7RA 5GAOm 1H641 4M7DE 3BDUA 4X9CA 5GAOp 4QVCA 4XQ3A 3JCMX 3BY7A 2DZ9A 3FB9A 4M77D 4M77A 5GANh 4M78F 1WPYA 3FIFA 1TH7A 3SWNB 4C92B 5LJ3h 4M77C 3EFRA 1YCYA 5GAN2 4M7DD 2RD1A 3M4GA 4NOYA 2EJFA 4C92G 1N9SA 5GANj 3V8KA 5GAN7 5GANd 4PJOE 4RCBA 1D3BB 5GAOl 4F7UF 5GAMg 1N9RA 2YHTA 3SB2A 4M78D 2VXFA 4M78A 5LJ3d 4C8QB 5LJ3j 3JCMJ 3GIBA 4PNOA 4OP0A 1WQ7A 1JRIA 5DY9A 3L1AA 3JCMV 3QSUA 4XTXA 4J6WA 4M78C 4C8QG
chains in the Genus database with same CATH superfamily
3M53A 1WQWA 4A54A 3EGXB 2DO3A 3VS0A 1TU0B 1J3TA 1YWOA 3QZ9B 1UG1A 3S3NA 2KRMA 2PVOB 3X25B 2Y4XA 2EAYA 3WXMB 3CCLQ 2BKDN 3OMCA 3CCJQ 2LP5A 3EH2A 3SWNA 4C0FA 3M0SA 4HKEA 5HKCA 1I07A 3M0QA 1Q82U 1W2BA 1BU1A 4OGCA 2EYYA 2K5FA 4D8DA 2LX9A 4C92F 3VU3C 2K3XA 4FL6A 4MZMA 4WCIA 3V7SA 1WHHA 1NJIR 3EG0A 3ZL7C 4E7LA 2RO0A 2D0QB 3VRYA 3EG9A 3PVQA 1UEBA 2E64A 1W2BS 2QQSA 1BIAA 3H41A 4M75F 4C92C 2DBMA 1SG5A 4ZGEB 1K4US 1QLYA 1NYFA 1LVKA 1WJQA 4JZ4A 3EHQA 1M3BA 2BZYA 2XDBA 2X3XD 2DTOA 2K6DA 2YRVA 3X26B 4M75C 1QKXA 4HA8A 4BACA 1M27C 4R56A 4C0DC 2RHIA 3ZBDA 1NLPC 3RKYA 3CCMA 1G3SA 4J6XA 3QHSA 1I1JA 4PJOG 2ECZA 3PTAA 4Z8AA 2LCCA 4Z02A 4XQ3A 3JCMX 4DBQA 2R5MA 2KSSA 1M2VB 2WACA 2LMJA 3EG1A 1T3LA 3EG3A 1Q7YU 2HL3A 2DD5A 1UUEA 3LLRA 1JRIA 2FZCB 2CT4A 3KFVA 1MGQA 1D0XA 2VYTA 4PJOD 1U3OA 2EYXA 4HVUA 3JB9I 1WDXA 1GFDA 2EIFA 1N8RU 2X4XA 1M1KR 3MPUB 4ZN1A 3CCMT 4PJMA 4MZPA 2GNCA 2O4XB 4PFPA 2QXFA 2NUPB 5CQXA 5GMKj 4FW2A 1K8AC 2O01E 2O2OA 1D0ZA 4XU3A 1W70A 2LC4A 3VS2A 4BI3A 1ZUYA 5IXBA 3CCMQ 4N4IA 1QP2A 3OYDA 5LJ5f 1ZSGA 2EGCA 2F2WA 2FZKB 3DB4A 4HCCA 3F70A 3SHWA 4M75G 1UGSB 1HK9A 2PTKA 3PGGA 2QGFB 1VA7A 2P4TA 3C95A 4EMKC 2CZ7B 2K7AA 1YJ9Q 4C0GA 3FC3A 2P4RA 4KULA 2NLUA 1RADB 1Q86U 1SF9A 2L5QA 2P84A 1WJRA 4FT2A 4KGVB 4FU6A 1Z9ZA 1YJWA 2ESWA 2AKKA 4M75D 1UHFA 2GTOA 4M7DG 4M78B 2CT3A 1V29B 3I35A 1WHMA 5I22A 4F7UE 3OB9A 3H0IA 4HCBA 5J26A 2LQKA 1X6OA 2KQWA 2M9UA 3CC2A 1K0SA 3CCVQ 2R5AA 1MMAA 1WFWA 1G8XA 2LZ6B 2YRCA 3EHRA 2ABLA 5IHIA 3LX7A 4XAXB 3VUZA 3E9FA 1RAIB 1UFFA 3MJXA 4M7DD 1GCQA 2EJFA 5GANj 1SSFA 4FT4A 1YJWT 1F1BB 4PFOA 5LJ3j 1G2BA 3FRNA 2W10A 3EFOA 1S72Q 2XDPA 1Q82R 2YUPA 5CK9A 3CPWS 3OA6A 4LDWA 3REAB 4OB1B 3X28B 1M1GA 2DMOA 4C92E 2VB6A 3RIRA 2QEXQ 1YJWQ 1HXDA 2QG9B 2DVJA 3CC2T 5KYYA 4AMCA 2QGGA 2JXBA 2DPPB 2AZSA 4C8QF 3QWXX 1BI3A 3AHUA 4N0AA 4BE2A 2XK0A 4RTXA 1UGPB 2G6FX 1MMDA 5KYWB 2RQRA 2FG0A 4C8QC 4Q5WA 1WNLA 3CMEA 5FU7B 3OW2A 3V8LA 4ZN3A 2ZPBB 3M56A 3NTHA 4DEYA 1VQLQ 1I5OB 2AZVA 2QTXA 3RESA 2L8DA 3VS5A 4ELYC 1TXQA 3RMSA 4BDZA 2LJ1A 3RERA 1M8MA 7AT1B 2O31A 3H8ZA 3OW2S 2QYZA 4M7AF 4MMLA 1PCXA 4ORZA 2E65A 4FSXA 3KXTA 1NJIC 1Q7YR 4NL3A 2LTOA 1Y7XA 3CMET 2KGTA 2DL3A 4M7AC 3OYLA 1VOMA 4MDWA 3G6EA 1Z9QA 2C06A 2DAQA 3CMEQ 1N8RR 3FIFA 2A3LA 1OI1A 4J9BA 2P0QA 1VQ9A 1RACB 1B3QA 3EG9B 3T9NA 1N9SA 2HQHA 1YIJQ 5AT1B 1JJ2A 2LVMA 1YWPA 1IGUA 3HL8A 3H9NA 2EQMA 2DETA 4OMLA 3URGA 2DIQA 3GP8A 3QSUA 4C8QG 1RAEB 1EIFA 1MMNA 4HCKA 1MNDA 5KCHA 1SHFA 2A7YA 3M58A 5IAYA 4E7JA 3A8LB 3CMAQ 5GAMj 3QYGB 4PFZA 3G6ET 2JS0A 2V8IA 3P8BB 2HZYA 1B34B 2YSQA 3NHNA 1IHVA 1UJYA 2W0ZA 1VQ9T 4N4GA 4C8QD 1Q86R 3L2UA 2FO0A 1X6GA 3G6EQ 1LNXA 1OYXA 5GJVB 1M1FA 2L3SA 1M1KC 1G5VA 4FYYB 2V8KA 2X4WA 2DKGA 2JUFA 2LNVA 3C12A 2DD4A 1AWWA 2M1HA 4PKCC 1VQMQ 4L59A 2DEUA 2DX1A 4PK4A 1K9MU 2MWPA 5LL6S 5IH2A 1I4K1 3BDLA 3UWNA 1IGQA 2WSFE 4JRQA 3BE3A 2VGNA 2E3IA 4RKUE 1ACMB 5LJ5h 3QIIA 1M4ZA 3CC7A 3MP6A 1N27A 3QYHB 3M57A 4JUVA 2CP7A 2EJ9A 2CUBA 2R58A 1SPKA 4R55A 1WLPB 1NPRA 3TSZA 4JS5A 4DBRA 3CC4A 2DM1A 2RPNA 4J9FA 1PD1A 4JJDA 2KBTA 2ED0A 1FWZA 4NOYA 3UA6A 3LWHA 4JDSA 2D6FA 5CO7A 3JCMJ 3CC7T 4J6WA 2KR3A 3UATA 2ZZDA 4M4ZA 2KXCA 1NEBA 4F7UA 5I2MA 1QVGS 1ZA1B 1VQKA 2CZ1B 3QZ5B 4FIBA 4J9CA 3CC7Q 1PHTA 2WSEE 1ABQA 2ZGWA 5LJ5e 3L42A 2L89A 2EPDA 5KE2A 1MMGA 3CXCP 3CC4T 2D9TA 2PVDB 1D09B 1ZQ1A 4ME7A 2E5QA 2GQVA 1Q82C 2E1HA 4Z88A 3HPWA 4Y91A 2GBQA 4M7AE 5GAN5 1OPKA 3OSVA 1QVPA 2V26A 3MEVA 4E6RA 5KYXA 2CREA 5GMKe 1H8KA 1FXXA 1Y96A 2CZ0B 5GMKi 4C92A 2IVWA 4LNPA 2QQRA 5GAN3 4FCYA 1OX9A 4B9XA 4K11A 1WA7A 2G3RA 5D6XA 2VC8A 4ESRA 5IN1A 2XI9A 2A08A 1AWJA 2EW3A 3LW5E 1VQKQ 1UGQB 4M75A 1IO6A 4FYWB 2DL4A 3JCMf 2JJ9A 4MDXA 2VV5A 5IT9E 2J05A 1VQ5A 1Y71A 2X35A 5GANg 3G1JA 3LGFA 2QA4A 2EKOA 1UECA 3CBPA 1P92A 5CCAA 5FRMA 5LJ3g 1VQNA 3DLMA 4FW1A 1NYGA 1W6XA 1AEYA 1QCNA 2ENMA 1X2QA 4AG2C 2DE0X 4C5EA 3PVLA 2K4YA 2RD1A 3M4GA 3N5BB 5GAOl 1SEMA 1N9RA 1UHCA 4IUVA 1RLPC 2XIDA 4OMPA 4OP0A 5DY9A 4XTXA 3QWYA 2YDLA 1OU8A 1WHGA 4J9IA 1OU9A 1PRLC 1M5Q1 2VUBA 1AZEA 1VQ5T 8ATCB 3TCJA 4DOWA 4C5HA 2QQ9A 3VV0A 2COWA 2DYIA 2FVUA 3OQ5A 2D1XA 1NG2A 1N8RC 1VQNT 5GANe 4X1VA 1B7TA 4PJOF 3P8DA 5GMKl 3QDRB 5LJ3e 2RHYA 5A2QE 1ARKA 4V2SA 2DEQA 1YP5A 3A8HB 1C1AA 2QA4Q 3VS6A 4XU2A 1K9MR 1M90U 1YNZA 3L2WA 4XTZA 2RQWA 4PJOC 3LGLA 4QVZA 2HQXA 4EMKA 3HHTB 5C0MA 1MNEA 2FHDA 1BIBA 3BW1A 4GY5A 4QVDA 1G3TA 1K0XA 2QAZA 2F5TX 4LE9A 3I55A 4M77B 2JMAA 4CC4B 2DXBA 1Q86C 3M0TA 4ZGJB 2DTHA 1YJNA 4HT9A 4R0KA 4JLIA 1SKUB 1JBMA 2FZGB 2VVKA 2ZPEB 1E7OA 4RTYA 1UB4A 1VQ4A 5CIUA 2MYSA 2MK5A 5FWCA 5HK3A 2O88A 4IUPA 1H641 4AFUC 5KCOA 4M78F 1IHWA 1RAAB 1RAFB 3I55T 2J6KA 4QT7A 1UTIA 2RJDA 5CKEA 5GAN7 5GAMg 4WTOB 2JW4A 1YJNT 3OYNA 1WQ7A 4M78C 4A4EA 3I55Q 1R0BG 1R77A 4M7DF 4EDUA 4KT0E 1X43A 1D1CA 1AT1B 1R8OB 5DLQE 3QUIA 1VQ4T 1T3SA 3WVDB 2KRSA 5CKHA 4M7DC 2BUDA 4XU0A 1IREB 2X9HA 1K73U 4AFZC 4C8QA 3OBYA 4AT1B 4NL2A 2HMAA 2KVQG 2X3WD 4EMHA 1ZBXA 3DKMA 5GAMe 2C0TA 2IIMA 4J9EA 1RI9A 3PFSA 4F7UB 2AIRB 4RMOA 3R6OA 2DXTA 4OMOA 2M51A 1EX4A 4FM4B 2CGHA 1RAGB 1YCSB 4GLMA 3FJPA 4F16A 1SHGA 4KUIA 2FL7A 2LCLA 2HBWA 3CCSA 2VWFA 3CD6A 2BE9B 2H3EB 5LJ5d 5FU7C 4M78G 4M7AA 1QW1A 4E7ZA 1UGRB 1VQPA 3CCUA 1ZUKA 1E6HA 2XG8D 3A8OB 5C6SA 2KYMA 4QVCA 1KC8U 3M55A 3J80E 4ANJA 1KK7A 4C92B 1WXUA 5GAN2 4CC3A 1YI2T 4PJOE 2E12A 3S3OA 3E9GA 4M78D 2VXFA 3SDZA 2ZPGB 3O8VA 2GFAA 4A4KA 3CCST 3QG1A 3PIOA 2DJZA 3CD6T 4HT8A 4O5VA 5A0LA 1M90R 2CP0A 1VQ8A 4OB2B 2J6FA 4C0DB 2XKOC 1VYTA 3JCMg 1PC0A 1RI0A 1VQPT 3CCUT 3QXEB 2FEIA 3OY9A 3A8MB 4LXCA 1X01A 4E2FB 5CAIA 3CD6Q 1N6AA 1GBRA 1BI0A 1RL2A 2CSIA 4XTUA 3CCUQ 3KUFA 4LUEA 3G4SA 2PU9B 3MO8A 2FRWA 3FLGA 4RTUA 4E7IA 2ED1A 1K9AA 2GQIA 4HCZA 1ZSZA 2XU8A 2NUTA 3MCAB 2CZ6B 3CEYA 1VQ8T 3A5ZB 4PLIA 2K2MA 3NTIA 5I21A 1VQ6A 2KNBB 4M75E 3I5SA 2X51A 5J3BA 3CC2Q 3JCMe 1K9MC 5GANf 2MPXC 3V8JA 5LJ3f 3Q1JA 4M78E 2CDTA 3PMIA 1TUDA 2SEMA 3BFMA 1V1CA 4YTLA 3G4ST 3RUXA 2L3QA 1G3YA 3JV3A 5KYUB 2KI7A 2LCSA 1D1BA 3ZFJA 1IXDA 1BKBA 3FDRA 4KGXB 4X9DA 5FU6C 5GAN6 5FROA 4J5YA 2JS2A 4PJJA 1GXIE 4M7DE 3BDUA 2DZ9A 1GFCA 1VQ6T 5IHKA 4OMFB 1LPLA 3ER0A 5AYFA 1PG5B 3SWNB 4FYXB 2GGRA 1PSEA 1VUBA 3CXCA 2KXDA 2B8AA 5FWBA 4BI8B 2EQKA 1KD1U 3HTRA 2RQUA 3G71A 4Z89A 3ULRB 3M59A 2DIGA 1K73R 1KSWA 2CP3A 1OEBA 2EKHA 2Y90A 4A4HA 4CC7A 2LRQA 1WXTA 4J83A 5HY6A 4OMQA 1AVZC 3V7CA 3EH1A 1PRMC 1KJWA 3CXCS 4II1A 2Y4YA 2RM4A 1G3WA 2R57A 2J6OA 3CBMA 2QDYB 3J7AF 1OULA 3MEUA 4ZNXA 4B9WA 2HSEB 2CP6A 3RKWA 3PIPA 2GFUA 5M9OA 3OS1A 2RHZA 1EZZB 5CKDA 2DK3A 1TG0A 1NEGA 1RABB 2VKNA 3EGXA 4A4GA 1BK2A 3G71T 3NFCA 5GAOr 1JJ2S 3OS2A 4LDVA 1XNIA 1VQOA 2LJ0A 2LNHB 1ZHIA 2DNUA 2JM8A 3JCMW 1BBZA 4KRTA 1BB9A 5FW9A 1PKTA 1Q95G 2FB7A 4IUTA 1KC8R 2JOYA 2KEAA 1I8FA 1OQKA 3D7SB 1XQHA 1AWOA 1VQ9Q 3GNGA 4JJNK 2HNIA 4C5IA 1NE8A 4XTWA 3CCEA 2OAUA 5GAMf 2FRYA 4E47A 1QVFP 1VQOT 3OS0A 2LJ3A 3FB9A 2MI6A 4ZGDB 3CPWP 2BTTA 2LQWA 3FEOA 1YCYA 1JB0E 1WHLA 2J7IA 2KYBA 2A37A 2L3RA 3A1PA 1VQOQ 3OS5A 1U5SA 2OTJA 2COZA 5CR2A 4OB0B 4TVRA 1K76A 2BE7D 4RCCA 3DB3A 2E41A 5GMKh 1QP3A 2H3JA 2A36A 4M7AB 3CCET 3OYEA 5DLOA 2HCKA 2F5KA 3RR6A 2EBPA 4C8QE 2OX7A 4F14A 1X2KA 2PNIA 3QJYA 3CCQA 2DVEA 2KMTA 2FYKA 4PJNA 1O75A 1U1SA 3C94A 3EGDA 1JU5C 3RDVA 1KFZA 4IURA 1AHJB 4PJOA 1BYMA 1ZUUA 1LCKA 1M90C 2D8JA 2RQVA 5HCKA 2FPEA 2O9SA 2I2LA 2NUZA 2LQ8A 3OSSC 1CKBA 2RA2A 1OOTA 4BUGA 3VYGA 2OTJT 3FJ5A 3I9QA 1RLQC 2NUPA 4D8KA 9ATCB 2YXYA 3J81E 1N5ZA 3HKSA 2JNGA 1KQ2A 3M9QA 2QTVA 3VRZA 2E5KA 1OZ3A 2OTJQ 2IG0A 1WX6A 4JS4A 4GBQA 3CCQT 3EFSA 1MHNA 2RQTA 2PUOB 2CSQA 4LDYA 2X4YA 5IHNA 3CC4Q 2C0IA 4JLGA 2K57A 2RI3A 2OTLA 4BE0A 4J7IA 3EFOB 1H3ZA 3CCQQ 1FMKA 4M77F 4BD3A 3R6NA 2V8JA 1KD1R 5GAOm 1ZSZB 1CKAA 1WIEA 5KYYB 2JT4A 5GANh 4JJCA 2HQEA 1RAHB 1TH7A 3OYGA 5LJ3h 4M77C 1EFNA 4QW2A 4OMNA 2DRMA 3S6WA 2YHTA 3SB2A 3PE0A 4M78A 1WGSA 4J9DA 1KQSP 3UDCA 2JM9A 1UJ0A 1YBYA 2EYZA 3JCMd 1VQ7T 4LN2A 3I56T 2OTLT 4CI0C 3DLLA 4ATOA 3ME9A 4ELZC 3LH5A 4CRIA 2JVVA 4JRIA 2OJ2A 3X20B 4XK8E 1MUZA 2XICA 2JTEA 2MIOA 4M7DA 1YN8A 1G83A 3NGPA 3VS1A 1DJ7B 2O9VA 3VS7A 2PUKB 3OYAA 2EVRA 2DRKA 1OV3A 3QO3A 1K73C 4XTVA 3MHXA 2P0PA 2K3BA 3OYJA 2RN8A 3CCJA 2HL5C 1OPLA 2VGMA 1LOJA 4LDUA 3GLXA 3GNFB 2JZ2A 2JTMA 3HFNA 2AHJB 1VQ5Q 1GL5A 2VXEA 2EFIA 3TVTA 3JCMP 3G7ZA 3META 2SRCA 3UT1A 2YT6A 3HRTA 1VQNQ 4PL6A 4M77G 1SRMA 3JRZA 4HVVA 4IUQA 4NS5A 3TEEA 3L2ZA 5ECAA 4L6V5 1HSQA 2A28A 5I11A 2LQNA 3OBWA 3UPUA 2COYA 3CCJT 4BDYA 2LDMA 3GF5A 2HEQA 4E7KA 3BY7A 4M77D 2ZPIB 1QVGP 2P0KA 1KC8C 4J9GA 2F2XA 5HK0A 3MP8A 2DYBA 4DA4A 2QDLA 2ZPFB 2XD0A 2DA9A 3UF4A 4LUDA 1NPPA 5D6YA 5GJWB 2DERA 3LWIA 4PJLA 2L0AA 2GTJA 5A0DA 1KHCA 3S3MA 1TUCA 1TWBA 1YITA 1K1ZA 1NBEB 3H6ZA 1TSFA 3H0HA 4OB3B 4AG1C 5GAMh 1XOVA 2DL5A 1XTDA 3SEMA 3MEWA 3H0FA 2L2PA 2EWNA 2JMCA 2D8HA 2M16A 1B07A 4BY6B 4DBFA 3KBGA 2XMFA 3OYIA 2V1QA 3HSBA 4C5GA 1SRLA 3TQ7P 1M2OA 4BI4A 3VKIA 3CQTA 4EIKA 3NMZC 1I81A 1JXOA 1KHIA 1TOVA 4F17A 2QK0A 3QDFA 1ZA2B 1JXMA 1YJNQ 1YITT 4QKUA 2FPDA 4OGEA 1KQ1A 1WHJA 1QWEA 4M77E 1VYUA 2WSCE 1YHQA 1PSFA 1VIFA 4J6YA 1D3BA 5GAOq 1VQ4Q 1B34A 4F7UG 1YITQ 2CKKA 1FMVA 1QCOA 4MMKA 3L2QA 3M4YA 1E6GA 2KT1A 2OAWA 1I5LA 3WVEB 1YJ9A 5LJ5j 3EGDB 3L2RA 1M3AA 1X27A 3C0CA 1Q81U 2NYSA 4LD9K 4PJOB 2RJFA 2MMPA 1A0NB 2F1LA 1YI2A 3VUBA 3NTKA 4Y92A 2XDDA 4KBMB 3CBOA 1YHQT 2MF2A 1WPYA 2XHCA 1KG1A 3X24B 2ZCFB 4L5GA 3OYMA 4C92G 2MCNA 5DM7R 1AWXA 2OI3A 3CCVA 1YHQQ 2RF0A 3OYFA 2YWWA 2YUOA 1AOJA 1YJ9T 3OYYA 1KD1C 4A53A 2CP5A 2PZ1A 5KYXB 1Y07A 2EYQA 3A8GB 1YFNA 1Y96B 4A63B 5IXFA 2CYZB 5EG2A 2RH2A 2K5IA 5L8RE 4C92D 2MWOA 2JTFA 5D6WA 3ZEHA 3JCMh 2M02A 3SWNC 1S72A 3TREA 4XTYA 2DILA 4EMGA 4M75B 4DOVA 3RNJA 2QEXA 4RTWA 3JCMb 1YI2Q 1H3HA 3CCVT 1KIKA 1FYNA 3M0RA 4QQGA 3JB9J 2EGEA 2QQAA 3CCSQ 5EC7A 1MV0B 2DL8A 2V1RA 4KUDK 2E6ZA 3M0PA 4DEXA 1GRIA 2DJQA 2RI2A 3OMGA 3RKXA 1VQPQ 1QVFA 3JAME 2CH4W 5CQYA 1U8RA 3E19A 1FMWA 1OX8A 1W2BP 4GLKA 3CPWA 3HFOA 2YUNA 4M7DB 1S72T 2F2VA 3M5AA 2KRNA 5FLXE 1HYOA 1PNJA 1VQLA 4FYVB 5GAN8 1UE9A 2QEXT 2H8HA 4KGZB 5GAN4 1QVFS 4QQDA 4MZTA 3VYHB 2CS7A 2EYWA 4EPCA 5L23A 1VQ8Q 2LT4A 2I0NA 2K79A 1MV3A 2K3YA 2RJCA 3THKA 2RK2A 3MP1A 5GANd 5FRNA 3EG2A 5LJ3d 1NLOC 2CH4A 3PNWC 3A98A 4X34A 1SSHA 1VQLT 1M8VA 2YRDA 3G4SQ 1QKWA 4EMKB 3VS4A 4C0ZA 1QWFA 2Z0WA 1HJDA 4ZTFA 2IPOB 2KDSA 1V76A 4Y28E 2RHXA 1YIJA 1K8AU 2J06A 3ASKA 2L3PA 2D0NA 1VQ6Q 3JB9F 1BCOA 2EQUA 3EAEA 2EJGA 3PT9A 2HKNA 6AT1B 3CMAA 4RTVA 1GCPA 1C6VX 1X6BA 1IRXA 4N4HA 4QQ6A 5A0GA 2X4JA 1Q81R 1NM7A 1BI1A 1QCFA 2DTIA 2DXUA 4DBHA 1X75C 4B6MA 2E4HA 1YIJT 4RG2A 3NPFA 4IUUA 2FPFA 1M3CA 2E10A 1LJOA 2ATCB 1XJWB 3RBBB 4XU1A 5D7UA 2CUDA 1VQMA 1KQSA 4O6JA 2K2VA 1W1FA 3CMAT 3EGUA 3QPHA 4IIMA 3V7RA 5CKBA 1PD0A 3G71Q 2KY9A 2PQWA 5GAOp 2ROTA 4M77A 3UA7A 1Y57A 1TUGB 1Y0MA 3M0UA 3GOXA 2DF6A 1WHKA 2DFUA 2KE9A 3OYHA 3V8KA 4RCBA 1KQSS 1D3BB 4OF1A 3L2VA 3I5RA 1GCQC 2KK4A 4C8QB 5J39A 5KH6A 3L1AA 1AZGB 4AFQC 3HRSA 3VS3A 2BZXA 3U23A 4VUBA 2K9GA 1VQMT 4AFSC 4FSSA 1BCMA 2PVGB 3HRUA 3JB9G 2DXCA 4ZTJA 3INZA 1JO8A 2C0OA 5FU6B 4HVWA 1ZSZC 5GAMd 3MEAA 4M7AG 5KYNA 2ZPHB 4LD6A 3QJ6A 5CVIA 4J7FA 2VASA 2BIVA 2KT8A 3VJPA 3E2UA 4WF2A 1W4SA 4P5NA 4N0AC 1BI2A 4JPBW 2YLCA 1WZOA 2B86A 3JB9D 3CPFA 2M0YA 4IIOA 1IZ6A 1JEGA 3AT1B 1WJSA 4M7AD 1WI7A 2YLBA 1M2VA 4UC4A 5LJ5g 4BB7A 1R0CB 2CP2A 2NWMA 3JB9H 1RUWA 2QQBA 3CCRA 4RUGA 1AD5A 1T0HA 4E7SA 3CCEQ 2HDAA 4KH0B 3E1SA 1QVGA 3LH0A 4IKFA 1S1NA 2F69A 1T0JA 2HKQB 1NJIU 3OW2P 4RG8A 2E70A 1I0CA 1PM3A 2AT1B 3GPLA 2O4XA 2DZCA 2K5LA 2AKLA 2KAFA 3JCMQ 1PKSA 3PMTA 4OVAA 1TTHB 1X69A 4X9CA 1ZLMA 3CCRT 1O9SA 3EFRA 2QI2A 4J9HA 1M9SA 5I2SA 1K8AR 1VQ7A 3I56A 2BZ8A 3TSWA 3O5ZA 2RK1A 3OYKA 2AK5A 2E3HA 2QASA 3P8HA 1TS9A 3CCRQ 4JRKA 3JCMc 1WXBA 3M54A 1ABOA 2LT1A 2RNAA 2NUTB 1U1TA 3QBYA 1FX7A 3QKJA 2MOXA 3RMQA 4LDXA 2RI5A 5KE3A 2JN0A 3REBB 2EQIA 2DL7A 1VQKT 4RTTA 1JJ2P 1UGVA 1ZX6A 3HP9A 1D0YA 2E6NA 2DLPA 1C0MA 2RB6A 4JZ3A 1QQJA 5GMKm 4HXJA 4BE1A 4JRPA 1U06A 1M1KU 1JQQA 2LX7A 1ZBJA 3OYCA 1IB8A 2GCXA 4D6WA 8AT1B 3TU4K 1D1AA 2HAXA 1UDLA 2RJEA 1VQ7Q 2OTLQ 3I56Q 1H92A 1PWTA 3IQLA 5CKFA 1NZ9A 3LYIA 4BY6C 1M30A 2EQJA 1OZ2A 2M0OA 4DQ2A 4OMMA 2HBPA 5GAOn 2HSPA 2ZAEA 3C4SA 4J8OA 3CCLA 2HD0A 2MAMA 3OYBA 1GBQA 4PLLA 4CC2A 2GF7A 1QMCA 1HD3A 2RHUA 1Q7YC 2RMOA 2ROLA 3SFMA 1Q81C 2A0FB 4E7HA 2YUQA 4JJBA 1VYVA 1WYXA 2KROA 4RTZA 4F04B 2DBKA 5KYWA 2QA4T 2EGAA 3MKDA 1VIEA 3JSCA 4KH1B 3GBQA 4F7UF 1CSKA 3GIBA 4PNOA 5KYUA 4A4FA 3SD4A 3JCMV 3CCLT
chains in the Genus database with same CATH topology
3G71A 3M53A 3M59A 1WQWA 2DIGA 2ZZDA 1YJ9T 4A54A 2DO3A 3OYYA 5I2MA 4F7UA 1QVGS 1KD1C 2Y90A 4A4HA 4A53A 1VQKA 2LRQA 1Y07A 2EYQA 3A8GB 2CZ1B 3QZ5B 3QZ9B 4J83A 5HY6A 4FIBA 3S3NA 1Y96B 2PVOB 3X25B 3V7CA 2Y4XA 2EAYA 3WXMB 2CYZB 2WSEE 2BKDN 3OMCA 2ZGWA 2RH2A 5EG2A 2K5IA 4II1A 5L8RE 4C0FA 2Y4YA 3L42A 3SWNA 2MWOA 2JTFA 1G3WA 2R57A 2RM4A 3CBMA 2QDYB 2L89A 4HKEA 5D6WA 3ZEHA 3JCMh 3MEUA 5KE2A 3J7AF 3CC4T 3SWNC 1S72A 2D9TA 3TREA 4B9WA 2PVDB 4XTYA 3RKWA 1ZQ1A 3PIPA 1Q82U 1W2BA 4ME7A 2E5QA 2GQVA 4OGCA 2E1HA 2GFUA 4M75B 4EMGA 2RHZA 4DOVA 5M9OA 3OS1A 2K5FA 3HPWA 4Y91A 5CKDA 2QEXA 2DK3A 3JCMb 2LX9A 4M7AE 4C92F 3CCVT 5GAN5 3VU3C 2K3XA 4QQGA 3JB9J 3OSVA 4FL6A 4MZMA 1QVPA 4A4GA 3V7SA 3MEVA 3G71T 3NFCA 2QQAA 5GMKe 4KUDK 5GAOr 1JJ2S 3OS2A 1FXXA 1Y96A 2CZ0B 1XNIA 4LDVA 4C92A 5GMKi 2E6ZA 1VQOA 4E7LA 2IVWA 2RO0A 2D0QB 3CXCS 1ZHIA 2QQRA 5GAN3 1UEBA 2E64A 1W2BS 2QQSA 1BIAA 4M75F 4C92C 2RI2A 3OMGA 4B9XA 3RKXA 1QVFA 4ZGEB 3JCMW 3JAME 5CQYA 2G3RA 1U8RA 3E19A 5D6XA 1WJQA 2VC8A 4GLKA 3CPWA 5IN1A 2XI9A 3HFOA 2FB7A 3LW5E 4IUTA 4M7DB 2XDBA 1UGQB 2DTOA 4M75A 2JOYA 1S72T 3M5AA 1I8FA 5FLXE 2YRVA 3JCMf 3X26B 4M75C 4HA8A 4BACA 4MDXA 1VQLA 1XQHA 2VV5A 5GAN8 4R56A 5IT9E 3GNGA 4C0DC 2QEXT 4JJNK 2RHIA 1VQ5A 1Y71A 2HNIA 2X35A 3ZBDA 4C5IA 3LGFA 5GANg 3RKYA 5GAN4 2EKOA 3CCMA 2QA4A 1QVFS 1G3SA 4QQDA 4J6XA 3CBPA 4MZTA 1P92A 1NE8A 3QHSA 4XTWA 5CCAA 5LJ3g 2OAUA 3CCEA 5GAMf 4PJOG 5FRMA 3DLMA 1VQNA 4E47A 3PTAA 3VYHB 2CS7A 4EPCA 1VQOT 3OS0A 2LCCA 2LT4A 4Z02A 4XQ3A 3JCMX 3FB9A 2MI6A 4ZGDB 2R5MA 2KSSA 3FEOA 4C5EA 1YCYA 1JB0E 2K3YA 2RJCA 2WACA 2K4YA 2RD1A 2RK2A 3M4GA 3MP1A 1Q7YU 5GANd 2DD5A 2L3RA 3N5BB 5GAOl 3LLRA 1N9RA 5FRNA 3OS5A 5LJ3d 4IUVA 2XIDA 4OP0A 5DY9A 1JRIA 3PNWC 4X34A 4XTXA 2OTJA 5CR2A 4OB0B 1MGQA 2VYTA 4PJOD 1VQLT 4TVRA 3JB9I 1M8VA 1M5Q1 2VUBA 4EMKB 4RCCA 1VQ5T 3DB3A 3TCJA 4DOWA 2E41A 4C0ZA 2EIFA 1QP3A 5GMKh 4C5HA 1N8RU 2QQ9A 2X4XA 3VV0A 4ZTFA 2FVUA 3OQ5A 4ZN1A 3CCMT 2H3JA 4MZPA 2O4XB 4M7AB 2KDSA 2QXFA 1N8RC 4Y28E 3OYEA 2RHXA 5DLOA 1YIJA 1K8AU 3CCET 1VQNT 5CQXA 2F5KA 4C8QE 5GANe 5GMKj 4PJOF 3P8DA 1K8AC 5GMKl 2O01E 3QJYA 3QDRB 2DVEA 2KMTA 2RHYA 5LJ3e 3ASKA 5A2QE 3CCQA 4XU3A 2FYKA 4V2SA 2LC4A 4BI3A 1O75A 2DEQA 1U1SA 3A8HB 3C94A 3JB9F 4N4IA 1M90U 4XU2A 1QP2A 4IURA 3OYDA 1AHJB 5LJ5f 2EQUA 3EAEA 4PJOA 1BYMA 3L2WA 1M90C 3DB4A 2EJGA 3PT9A 4XTZA 4HCCA 3F70A 2I2LA 4M75G 2LQ8A 3LGLA 4PJOC 1UGSB 3OSSC 2RA2A 3CMAA 4QVZA 1HK9A 2HQXA 3VYGA 4BUGA 4EMKA 3PGGA 3HHTB 2OTJT 2P4TA 3C95A 5C0MA 4EMKC 2CZ7B 2FHDA 1BIBA 3BW1A 4N4HA 4GY5A 4QQ6A 4C0GA 5A0GA 2X4JA 4QVDA 3FC3A 1BI1A 2DTIA 1G3TA 2DXUA 3J81E 2F5TX 3HKSA 4KULA 2JNGA 1X75C 2NLUA 3M9QA 3I55A 1Q86U 1KQ2A 1YIJT 1OZ3A 4M77B 2IG0A 2DXBA 2L5QA 4RG2A 4JS4A 1WJRA 4FT2A 4IUUA 1Q86C 4FU6A 2E10A 1YJWA 4ZGJB 3CCQT 1LJOA 2DTHA 3EFSA 1MHNA 1YJNA 4M75D 4HT9A 2PUOB 4LDYA 2X4YA 4JLIA 4XU1A 4M7DG 4JLGA 4M78B 2K57A 2RI3A 1V29B 2OTLA 4BE0A 4F7UE 3OB9A 1JBMA 4J7IA 1VQMA 4HCBA 1H3ZA 2ZPEB 5J26A 1KQSA 2LQKA 1X6OA 4O6JA 2K2VA 2KQWA 2M9UA 4M77F 1UB4A 3CC2A 4BD3A 3CMAT 1VQ4A 2R5AA 5CIUA 5HK3A 3QPHA 2V8JA 4IUPA 3V7RA 5GAOm 1H641 5CKBA 2KY9A 2PQWA 5GAOp 4M77A 5GANh 5KCOA 4M78F 2HQEA 3LX7A 4XAXB 1TH7A 3VUZA 3OYGA 3E9FA 4M77C 5LJ3h 3GOXA 3I55T 4M7DD 3OYHA 3QSUA 4QW2A 2EJFA 5GANj 5CKEA 2RJDA 3S6WA 3V8KA 4RCBA 1SSFA 5GAN7 1D3BB 5LJ5e 4OF1A 1KQSS 4FT4A 5GAMg 2YHTA 3SB2A 3L2VA 1YJWT 4M78A 5LJ3j 2KK4A 4C8QB 1WGSA 5J39A 3OYNA 3FRNA 1YJNT 5KH6A 1WQ7A 3L1AA 3UDCA 4M78C 2XDPA 4A4EA 3HRSA 1YBYA 3JCMd 5CK9A 1VQ7T 2OTLT 3I56T 3CPWS 4VUBA 4CI0C 3OA6A 4M7DF 4LDWA 4EDUA 3DLLA 1VQMT 4OB1B 4ATOA 4KT0E 1M1GA 3ME9A 3X28B 4C92E 2PVGB 3RIRA 3HRUA 4CRIA 4ELZC 1HXDA 2DXCA 2JVVA 4JRIA 3INZA 1R8OB 3X20B 3JB9G 5DLQE 4XK8E 3QUIA 4ZTJA 3CC2T 1VQ4T 5FU6B 2XICA 5GAMd 2DPPB 3MEAA 4M7DA 4C8QF 3WVDB 4M7AG 1BI3A 5CKHA 2ZPHB 4LD6A 3AHUA 4M7DC 3QJ6A 5CVIA 4J7FA 1DJ7B 2BUDA 2BIVA 4N0AA 4XU0A 4BE2A 3VJPA 4WF2A 1W4SA 2XK0A 1IREB 1UGPB 1K73U 2PUKB 3OYAA 4C8QA 4P5NA 3OBYA 4N0AC 1BI2A 2YLCA 4NL2A 3QO3A 1K73C 4XTVA 3MHXA 2P0PA 4C8QC 4Q5WA 1WNLA 3CMEA 2KVQG 5FU7B 3OW2A 3JB9D 3CPFA 4EMHA 2XD0A 1ZBXA 1IZ6A 3V8LA 3OYJA 5HKCA 3DKMA 3CCJA 5GAMe 4ZN3A 2ZPBB 3M56A 2VGMA 3NTHA 1LOJA 4LDUA 1WJSA 3GLXA 4M7AD 3GNFB 2YLBA 2JZ2A 2JTMA 2QTXA 3HFNA 3PFSA 4UC4A 5LJ5g 2AHJB 3RESA 4BB7A 2L8DA 4F7UB 4RMOA 3JB9H 2VXEA 3R6OA 2DXTA 2QQBA 2EFIA 3RMSA 4ELYC 3CCRA 1Q82C 4BDZA 3RERA 3JCMP 3G7ZA 3META 4FM4B 3UT1A 3HRTA 2CGHA 3H8ZA 3E1SA 4PL6A 1QVGA 4M77G 3OW2S 4M7AF 3LH0A 3FJPA 4MMLA 4IKFA 4KUIA 2FL7A 2F69A 2LCLA 3JRZA 3CCSA 1NJIU 4RG8A 3CD6A 2E65A 2E70A 4IUQA 4NS5A 4FSXA 3KXTA 5LJ5d 3TEEA 3L2ZA 3GPLA 1NJIC 5FU7C 2O4XA 4NL3A 4L6V5 4M78G 2LTOA 1Y7XA 4C92D 1QW1A 3CMET 1UGRB 4M7AA 2DZCA 1VQPA 3CCUA 2K5LA 4M7AC 3OYLA 2KAFA 3OBWA 3JCMQ 3PMTA 3UPUA 3CCJT 4OVAA 2XG8D 4MDWA 4BDYA 2LDMA 3GF5A 3A8OB 3G6EA 4X9CA 5C6SA 2C06A 4QVCA 1KC8U 4E7KA 3BY7A 4M77D 2DAQA 2ZPIB 3M55A 3J80E 3FIFA 4C92B 3CCRT 2P0KA 2A3LA 1OI1A 1KC8C 1O9SA 3EFRA 5GAN2 2P0QA 1VQ9A 2QI2A 3T9NA 5HK0A 3MP8A 4DA4A 2ZPFB 1M9SA 1N9SA 5I2SA 1YI2T 2E12A 3S3OA 1VQ7A 3I56A 1JJ2A 4PJOE 2LVMA 3E9GA 1NPPA 3HL8A 5D6YA 4M78D 2VXFA 2EQMA 3SDZA 2ZPGB 3O8VA 3LWIA 2GFAA 5A0DA 2RK1A 3OYKA 3URGA 2DIQA 4A4KA 1KHCA 3GP8A 3CCST 3P8HA 3S3MA 3QG1A 4C8QG 1YITA 1EIFA 3PIOA 2DJZA 4JRKA 3H6ZA 3JCMc 4O5VA 5A0LA 4HT8A 3CD6T 1VQ8A 4OB2B 3M54A 4OB3B 4C0DB 5KCHA 2LT1A 2XKOC 5GAMh 3CCLA 2A7YA 3M58A 1XOVA 3JCMg 5IAYA 1U1TA 3QBYA 1XTDA 1RI0A 4E7JA 3MEWA 1FX7A 3QKJA 1VQPT 3A8LB 3RMQA 3QXEB 2RI5A 3OY9A 3CCUT 4LDXA 2EWNA 3A8MB 5KE3A 1X01A 2M16A 5CAIA 5GAMj 3QYGB 2JN0A 4BY6B 3KBGA 1N6AA 3G6ET 1VQKT 2V8IA 3P8BB 1BI0A 1B34B 3OYIA 3HSBA 1RL2A 3HP9A 4C5GA 4XTUA 3KUFA 3G4SA 1VQ9T 2E6NA 2RB6A 4N4GA 4C8QD 2PU9B 3MO8A 4BI4A 3VKIA 3FLGA 3L2UA 3OYFA 4BE1A 5GMKm 4E7IA 1LNXA 4JRPA 1I81A 1KHIA 1OYXA 1M1KU 4HCZA 1M1FA 3OYCA 2XU8A 1M1KC 1G5VA 2V8KA 1YITT 2X4WA 2GCXA 2DKGA 4D6WA 2JUFA 3MCAB 2LNVA 2CZ6B 3CEYA 3TU4K 4OGEA 1VQ8T 1KQ1A 3A5ZB 3C12A 2HAXA 2DD4A 2RJEA 4PLIA 3NTIA 5I21A 2M1HA 4M77E 4PKCC 5CKFA 1VQ6A 4L59A 2WSCE 1YHQA 1PSFA 1VIFA 1NZ9A 4M75E 4J6YA 2MWPA 3LYIA 1K9MU 5J3BA 1D3BA 4BY6C 5LL6S 5GAOq 1B34A 1I4K1 4F7UG 2CKKA 3BDLA 2EQJA 1OZ2A 3JCMe 5GANf 1K9MC 4MMKA 2WSFE 3UWNA 2M0OA 4DQ2A 3V8JA 4JRQA 2HBPA 5LJ3f 2VGNA 3Q1JA 4RKUE 4M78E 5LJ5h 5GAOn 3L2QA 3QIIA 3PMIA 1M4ZA 3C4SA 3CC7A 3MP6A 1N27A 4J8OA 3BFMA 2HD0A 2MAMA 4YTLA 3QYHB 3M4YA 3G4ST 3M57A 4JUVA 3RUXA 1I5LA 1G3YA 3WVEB 1YJ9A 3OYBA 5LJ5j 4PLLA 2EJ9A 2GF7A 2R58A 3L2RA 1Q81U 2RHUA 1Q7YC 3ZFJA 4R55A 1BKBA 3FDRA 4LD9K 4PJOB 2RJFA 3SFMA 4X9DA 1Q81C 2MMPA 4E7HA 5FU6C 1NPRA 5GAN6 5FROA 4J5YA 1GXIE 4M7DE 3BDUA 4JS5A 1YI2A 3VUBA 3NTKA 2DZ9A 2XDDA 4KBMB 1VQ6T 2QA4T 3CBOA 1YHQT 4OMFB 3CC4A 2MF2A 3ER0A 5AYFA 1WPYA 3SWNB 2XHCA 1KG1A 3X24B 2ZCFB 4L5GA 1VIEA 1PSEA 1FWZA 4NOYA 4C92G 3OYMA 1VUBA 3JSCA 5DM7R 3CXCA 3LWHA 4JDSA 4F7UF 2B8AA 2D6FA 3CCVA 4BI8B 5CO7A 3JCMJ 3GIBA 4PNOA 2EQKA 4A4FA 3SD4A 3JCMV 3CC7T 4J6WA 3CCLT 1KD1U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJZ A;  4JRK A;  1MGQ A;  3JCM c;  3JCM d;  1WQW A;  4HT8 A;  4PJO D;  1M8V A;  4A54 A;  3JB9 I;  1M5Q 1;  4F7U A;  4EMK B;  4M7D F;  4RCC A;  5GAM h;  2Y90 A;  4A53 A;  4C92 E;  2E41 A;  3RIR A;  3JCM g;  5GMK h;  1U1T A;  1HXD A;  4JRI A;  3JB9 G;  3INZ A;  3QUI A;  2EWN A;  1Y96 B;  4M7A B;  3V7C A;  1X01 A;  2EAY A;  5CAI A;  5GAM j;  5GAM d;  2JN0 A;  2ZGW A;  4M7D A;  4C8Q F;  4C8Q E;  5GAN e;  5GMK j;  4M7A G;  3SWN A;  4C92 D;  5LJ5 e;  2RM4 A;  4PJO F;  5GMK l;  3JCM h;  5LJ3 e;  2DVE A;  3AHU A;  4M7D C;  1B34 B;  4XU3 A;  3SWN C;  2FYK A;  3HSB A;  4V2S A;  4XTY A;  2DEQ A;  4N0A A;  4XU0 A;  1U1S A;  3RKW A;  3JB9 F;  4WF2 A;  4XTU A;  4XU2 A;  2RB6 A;  4C8Q A;  4C8Q D;  4N0A C;  2E1H A;  4M75 B;  4EMG A;  5LJ5 f;  2YLC A;  4NL2 A;  4PJO A;  4Y91 A;  3QO3 A;  2EJG A;  5GMK m;  4XTZ A;  1LNX A;  4XTV A;  3JCM b;  1I81 A;  4C8Q C;  4M7A E;  1WNL A;  4C92 F;  2I2L A;  4M75 G;  5GAN 5;  3VU3 C;  4PJO C;  3JB9 J;  3JB9 D;  2RA2 A;  4EMH A;  4EMK A;  1HK9 A;  3V7S A;  3V8L A;  3PGG A;  5GAM e;  2DKG A;  5GMK e;  4EMK C;  1LOJ A;  1KQ1 A;  5GAO r;  1BIB A;  1Y96 A;  3BW1 A;  4M7A D;  4QVD A;  4C92 A;  5GMK i;  2YLB A;  5I21 A;  3HFN A;  2QTX A;  4M77 E;  5LJ5 g;  2DTI A;  3RES A;  2DXU A;  5GAN 3;  2E64 A;  4F7U B;  3JB9 H;  4C92 C;  1BIA A;  2VXE A;  2DXT A;  4J6Y A;  4M75 E;  4M75 F;  3RKX A;  1D3B A;  1KQ2 A;  5GAO q;  3JCM W;  4M77 B;  1B34 A;  1I4K 1;  4F7U G;  3JCM e;  3JCM P;  3RER A;  5GAN f;  2CGH A;  2VC8 A;  4MMK A;  4DQ2 A;  2E10 A;  3V8J A;  4M77 G;  3HFO A;  1LJO A;  2DTH A;  3EFS A;  5LJ3 f;  5LJ5 h;  2FB7 A;  4M78 E;  5GAO n;  4M7A F;  4M7D B;  3FJP A;  2DTO A;  4M75 D;  4M75 A;  4MML A;  4HT9 A;  1I8F A;  4JLI A;  3BFM A;  4XU1 A;  4M7D G;  3JCM f;  4M75 C;  4JUV A;  2E65 A;  4M78 B;  2K57 A;  4HA8 A;  3RUX A;  1I5L A;  5LJ5 j;  5GAN 8;  5LJ5 d;  3L2Z A;  2EJ9 A;  4F7U E;  1JBM A;  4NL3 A;  4M78 G;  4M7A A;  2HNI A;  2DZC A;  5GAN g;  4PJO B;  4M77 F;  3RKY A;  4X9D A;  5GAN 4;  4J6X A;  4M7A C;  3QHS A;  4XTW A;  5GAN 6;  5LJ3 g;  3JCM Q;  5GAM f;  4PJO G;  4J5Y A;  3V7R A;  5GAO m;  1H64 1;  4M7D E;  3BDU A;  4X9C A;  5GAO p;  4QVC A;  4XQ3 A;  3JCM X;  3BY7 A;  2DZ9 A;  3FB9 A;  4M77 D;  4M77 A;  5GAN h;  4M78 F;  1WPY A;  3FIF A;  1TH7 A;  3SWN B;  4C92 B;  5LJ3 h;  4M77 C;  3EFR A;  1YCY A;  5GAN 2;  4M7D D;  2RD1 A;  3M4G A;  4NOY A;  2EJF A;  4C92 G;  1N9S A;  5GAN j;  3V8K A;  5GAN 7;  5GAN d;  4PJO E;  4RCB A;  1D3B B;  5GAO l;  4F7U F;  5GAM g;  1N9R A;  2YHT A;  3SB2 A;  4M78 D;  2VXF A;  4M78 A;  5LJ3 d;  4C8Q B;  5LJ3 j;  3JCM J;  3GIB A;  4PNO A;  4OP0 A;  1WQ7 A;  1JRI A;  5DY9 A;  3L1A A;  3JCM V;  3QSU A;  4XTX A;  4J6W A;  4M78 C;  4C8Q G; 
#chains in the Genus database with same CATH topology
 3M53 A;  1WQW A;  4A54 A;  3EGX B;  2DO3 A;  3VS0 A;  1TU0 B;  1J3T A;  1YWO A;  3QZ9 B;  1UG1 A;  3S3N A;  2KRM A;  2PVO B;  3X25 B;  2Y4X A;  2EAY A;  3WXM B;  3CCL Q;  2BKD N;  3OMC A;  3CCJ Q;  2LP5 A;  3EH2 A;  3SWN A;  4C0F A;  3M0S A;  4HKE A;  5HKC A;  1I07 A;  3M0Q A;  1Q82 U;  1W2B A;  1BU1 A;  4OGC A;  2EYY A;  2K5F A;  4D8D A;  2LX9 A;  4C92 F;  3VU3 C;  2K3X A;  4FL6 A;  4MZM A;  4WCI A;  3V7S A;  1WHH A;  1NJI R;  3EG0 A;  3ZL7 C;  4E7L A;  2RO0 A;  2D0Q B;  3VRY A;  3EG9 A;  3PVQ A;  1UEB A;  2E64 A;  1W2B S;  2QQS A;  1BIA A;  3H41 A;  4M75 F;  4C92 C;  2DBM A;  1SG5 A;  4ZGE B;  1K4U S;  1QLY A;  1NYF A;  1LVK A;  1WJQ A;  4JZ4 A;  3EHQ A;  1M3B A;  2BZY A;  2XDB A;  2X3X D;  2DTO A;  2K6D A;  2YRV A;  3X26 B;  4M75 C;  1QKX A;  4HA8 A;  4BAC A;  1M27 C;  4R56 A;  4C0D C;  2RHI A;  3ZBD A;  1NLP C;  3RKY A;  3CCM A;  1G3S A;  4J6X A;  3QHS A;  1I1J A;  4PJO G;  2ECZ A;  3PTA A;  4Z8A A;  2LCC A;  4Z02 A;  4XQ3 A;  3JCM X;  4DBQ A;  2R5M A;  2KSS A;  1M2V B;  2WAC A;  2LMJ A;  3EG1 A;  1T3L A;  3EG3 A;  1Q7Y U;  2HL3 A;  2DD5 A;  1UUE A;  3LLR A;  1JRI A;  2FZC B;  2CT4 A;  3KFV A;  1MGQ A;  1D0X A;  2VYT A;  4PJO D;  1U3O A;  2EYX A;  4HVU A;  3JB9 I;  1WDX A;  1GFD A;  2EIF A;  1N8R U;  2X4X A;  1M1K R;  3MPU B;  4ZN1 A;  3CCM T;  4PJM A;  4MZP A;  2GNC A;  2O4X B;  4PFP A;  2QXF A;  2NUP B;  5CQX A;  5GMK j;  4FW2 A;  1K8A C;  2O01 E;  2O2O A;  1D0Z A;  4XU3 A;  1W70 A;  2LC4 A;  3VS2 A;  4BI3 A;  1ZUY A;  5IXB A;  3CCM Q;  4N4I A;  1QP2 A;  3OYD A;  5LJ5 f;  1ZSG A;  2EGC A;  2F2W A;  2FZK B;  3DB4 A;  4HCC A;  3F70 A;  3SHW A;  4M75 G;  1UGS B;  1HK9 A;  2PTK A;  3PGG A;  2QGF B;  1VA7 A;  2P4T A;  3C95 A;  4EMK C;  2CZ7 B;  2K7A A;  1YJ9 Q;  4C0G A;  3FC3 A;  2P4R A;  4KUL A;  2NLU A;  1RAD B;  1Q86 U;  1SF9 A;  2L5Q A;  2P84 A;  1WJR A;  4FT2 A;  4KGV B;  4FU6 A;  1Z9Z A;  1YJW A;  2ESW A;  2AKK A;  4M75 D;  1UHF A;  2GTO A;  4M7D G;  4M78 B;  2CT3 A;  1V29 B;  3I35 A;  1WHM A;  5I22 A;  4F7U E;  3OB9 A;  3H0I A;  4HCB A;  5J26 A;  2LQK A;  1X6O A;  2KQW A;  2M9U A;  3CC2 A;  1K0S A;  3CCV Q;  2R5A A;  1MMA A;  1WFW A;  1G8X A;  2LZ6 B;  2YRC A;  3EHR A;  2ABL A;  5IHI A;  3LX7 A;  4XAX B;  3VUZ A;  3E9F A;  1RAI B;  1UFF A;  3MJX A;  4M7D D;  1GCQ A;  2EJF A;  5GAN j;  1SSF A;  4FT4 A;  1YJW T;  1F1B B;  4PFO A;  5LJ3 j;  1G2B A;  3FRN A;  2W10 A;  3EFO A;  1S72 Q;  2XDP A;  1Q82 R;  2YUP A;  5CK9 A;  3CPW S;  3OA6 A;  4LDW A;  3REA B;  4OB1 B;  3X28 B;  1M1G A;  2DMO A;  4C92 E;  2VB6 A;  3RIR A;  2QEX Q;  1YJW Q;  1HXD A;  2QG9 B;  2DVJ A;  3CC2 T;  5KYY A;  4AMC A;  2QGG A;  2JXB A;  2DPP B;  2AZS A;  4C8Q F;  3QWX X;  1BI3 A;  3AHU A;  4N0A A;  4BE2 A;  2XK0 A;  4RTX A;  1UGP B;  2G6F X;  1MMD A;  5KYW B;  2RQR A;  2FG0 A;  4C8Q C;  4Q5W A;  1WNL A;  3CME A;  5FU7 B;  3OW2 A;  3V8L A;  4ZN3 A;  2ZPB B;  3M56 A;  3NTH A;  4DEY A;  1VQL Q;  1I5O B;  2AZV A;  2QTX A;  3RES A;  2L8D A;  3VS5 A;  4ELY C;  1TXQ A;  3RMS A;  4BDZ A;  2LJ1 A;  3RER A;  1M8M A;  7AT1 B;  2O31 A;  3H8Z A;  3OW2 S;  2QYZ A;  4M7A F;  4MML A;  1PCX A;  4ORZ A;  2E65 A;  4FSX A;  3KXT A;  1NJI C;  1Q7Y R;  4NL3 A;  2LTO A;  1Y7X A;  3CME T;  2KGT A;  2DL3 A;  4M7A C;  3OYL A;  1VOM A;  4MDW A;  3G6E A;  1Z9Q A;  2C06 A;  2DAQ A;  3CME Q;  1N8R R;  3FIF A;  2A3L A;  1OI1 A;  4J9B A;  2P0Q A;  1VQ9 A;  1RAC B;  1B3Q A;  3EG9 B;  3T9N A;  1N9S A;  2HQH A;  1YIJ Q;  5AT1 B;  1JJ2 A;  2LVM A;  1YWP A;  1IGU A;  3HL8 A;  3H9N A;  2EQM A;  2DET A;  4OML A;  3URG A;  2DIQ A;  3GP8 A;  3QSU A;  4C8Q G;  1RAE B;  1EIF A;  1MMN A;  4HCK A;  1MND A;  5KCH A;  1SHF A;  2A7Y A;  3M58 A;  5IAY A;  4E7J A;  3A8L B;  3CMA Q;  5GAM j;  3QYG B;  4PFZ A;  3G6E T;  2JS0 A;  2V8I A;  3P8B B;  2HZY A;  1B34 B;  2YSQ A;  3NHN A;  1IHV A;  1UJY A;  2W0Z A;  1VQ9 T;  4N4G A;  4C8Q D;  1Q86 R;  3L2U A;  2FO0 A;  1X6G A;  3G6E Q;  1LNX A;  1OYX A;  5GJV B;  1M1F A;  2L3S A;  1M1K C;  1G5V A;  4FYY B;  2V8K A;  2X4W A;  2DKG A;  2JUF A;  2LNV A;  3C12 A;  2DD4 A;  1AWW A;  2M1H A;  4PKC C;  1VQM Q;  4L59 A;  2DEU A;  2DX1 A;  4PK4 A;  1K9M U;  2MWP A;  5LL6 S;  5IH2 A;  1I4K 1;  3BDL A;  3UWN A;  1IGQ A;  2WSF E;  4JRQ A;  3BE3 A;  2VGN A;  2E3I A;  4RKU E;  1ACM B;  5LJ5 h;  3QII A;  1M4Z A;  3CC7 A;  3MP6 A;  1N27 A;  3QYH B;  3M57 A;  4JUV A;  2CP7 A;  2EJ9 A;  2CUB A;  2R58 A;  1SPK A;  4R55 A;  1WLP B;  1NPR A;  3TSZ A;  4JS5 A;  4DBR A;  3CC4 A;  2DM1 A;  2RPN A;  4J9F A;  1PD1 A;  4JJD A;  2KBT A;  2ED0 A;  1FWZ A;  4NOY A;  3UA6 A;  3LWH A;  4JDS A;  2D6F A;  5CO7 A;  3JCM J;  3CC7 T;  4J6W A;  2KR3 A;  3UAT A;  2ZZD A;  4M4Z A;  2KXC A;  1NEB A;  4F7U A;  5I2M A;  1QVG S;  1ZA1 B;  1VQK A;  2CZ1 B;  3QZ5 B;  4FIB A;  4J9C A;  3CC7 Q;  1PHT A;  2WSE E;  1ABQ A;  2ZGW A;  5LJ5 e;  3L42 A;  2L89 A;  2EPD A;  5KE2 A;  1MMG A;  3CXC P;  3CC4 T;  2D9T A;  2PVD B;  1D09 B;  1ZQ1 A;  4ME7 A;  2E5Q A;  2GQV A;  1Q82 C;  2E1H A;  4Z88 A;  3HPW A;  4Y91 A;  2GBQ A;  4M7A E;  5GAN 5;  1OPK A;  3OSV A;  1QVP A;  2V26 A;  3MEV A;  4E6R A;  5KYX A;  2CRE A;  5GMK e;  1H8K A;  1FXX A;  1Y96 A;  2CZ0 B;  5GMK i;  4C92 A;  2IVW A;  4LNP A;  2QQR A;  5GAN 3;  4FCY A;  1OX9 A;  4B9X A;  4K11 A;  1WA7 A;  2G3R A;  5D6X A;  2VC8 A;  4ESR A;  5IN1 A;  2XI9 A;  2A08 A;  1AWJ A;  2EW3 A;  3LW5 E;  1VQK Q;  1UGQ B;  4M75 A;  1IO6 A;  4FYW B;  2DL4 A;  3JCM f;  2JJ9 A;  4MDX A;  2VV5 A;  5IT9 E;  2J05 A;  1VQ5 A;  1Y71 A;  2X35 A;  5GAN g;  3G1J A;  3LGF A;  2QA4 A;  2EKO A;  1UEC A;  3CBP A;  1P92 A;  5CCA A;  5FRM A;  5LJ3 g;  1VQN A;  3DLM A;  4FW1 A;  1NYG A;  1W6X A;  1AEY A;  1QCN A;  2ENM A;  1X2Q A;  4AG2 C;  2DE0 X;  4C5E A;  3PVL A;  2K4Y A;  2RD1 A;  3M4G A;  3N5B B;  5GAO l;  1SEM A;  1N9R A;  1UHC A;  4IUV A;  1RLP C;  2XID A;  4OMP A;  4OP0 A;  5DY9 A;  4XTX A;  3QWY A;  2YDL A;  1OU8 A;  1WHG A;  4J9I A;  1OU9 A;  1PRL C;  1M5Q 1;  2VUB A;  1AZE A;  1VQ5 T;  8ATC B;  3TCJ A;  4DOW A;  4C5H A;  2QQ9 A;  3VV0 A;  2COW A;  2DYI A;  2FVU A;  3OQ5 A;  2D1X A;  1NG2 A;  1N8R C;  1VQN T;  5GAN e;  4X1V A;  1B7T A;  4PJO F;  3P8D A;  5GMK l;  3QDR B;  5LJ3 e;  2RHY A;  5A2Q E;  1ARK A;  4V2S A;  2DEQ A;  1YP5 A;  3A8H B;  1C1A A;  2QA4 Q;  3VS6 A;  4XU2 A;  1K9M R;  1M90 U;  1YNZ A;  3L2W A;  4XTZ A;  2RQW A;  4PJO C;  3LGL A;  4QVZ A;  2HQX A;  4EMK A;  3HHT B;  5C0M A;  1MNE A;  2FHD A;  1BIB A;  3BW1 A;  4GY5 A;  4QVD A;  1G3T A;  1K0X A;  2QAZ A;  2F5T X;  4LE9 A;  3I55 A;  4M77 B;  2JMA A;  4CC4 B;  2DXB A;  1Q86 C;  3M0T A;  4ZGJ B;  2DTH A;  1YJN A;  4HT9 A;  4R0K A;  4JLI A;  1SKU B;  1JBM A;  2FZG B;  2VVK A;  2ZPE B;  1E7O A;  4RTY A;  1UB4 A;  1VQ4 A;  5CIU A;  2MYS A;  2MK5 A;  5FWC A;  5HK3 A;  2O88 A;  4IUP A;  1H64 1;  4AFU C;  5KCO A;  4M78 F;  1IHW A;  1RAA B;  1RAF B;  3I55 T;  2J6K A;  4QT7 A;  1UTI A;  2RJD A;  5CKE A;  5GAN 7;  5GAM g;  4WTO B;  2JW4 A;  1YJN T;  3OYN A;  1WQ7 A;  4M78 C;  4A4E A;  3I55 Q;  1R0B G;  1R77 A;  4M7D F;  4EDU A;  4KT0 E;  1X43 A;  1D1C A;  1AT1 B;  1R8O B;  5DLQ E;  3QUI A;  1VQ4 T;  1T3S A;  3WVD B;  2KRS A;  5CKH A;  4M7D C;  2BUD A;  4XU0 A;  1IRE B;  2X9H A;  1K73 U;  4AFZ C;  4C8Q A;  3OBY A;  4AT1 B;  4NL2 A;  2HMA A;  2KVQ G;  2X3W D;  4EMH A;  1ZBX A;  3DKM A;  5GAM e;  2C0T A;  2IIM A;  4J9E A;  1RI9 A;  3PFS A;  4F7U B;  2AIR B;  4RMO A;  3R6O A;  2DXT A;  4OMO A;  2M51 A;  1EX4 A;  4FM4 B;  2CGH A;  1RAG B;  1YCS B;  4GLM A;  3FJP A;  4F16 A;  1SHG A;  4KUI A;  2FL7 A;  2LCL A;  2HBW A;  3CCS A;  2VWF A;  3CD6 A;  2BE9 B;  2H3E B;  5LJ5 d;  5FU7 C;  4M78 G;  4M7A A;  1QW1 A;  4E7Z A;  1UGR B;  1VQP A;  3CCU A;  1ZUK A;  1E6H A;  2XG8 D;  3A8O B;  5C6S A;  2KYM A;  4QVC A;  1KC8 U;  3M55 A;  3J80 E;  4ANJ A;  1KK7 A;  4C92 B;  1WXU A;  5GAN 2;  4CC3 A;  1YI2 T;  4PJO E;  2E12 A;  3S3O A;  3E9G A;  4M78 D;  2VXF A;  3SDZ A;  2ZPG B;  3O8V A;  2GFA A;  4A4K A;  3CCS T;  3QG1 A;  3PIO A;  2DJZ A;  3CD6 T;  4HT8 A;  4O5V A;  5A0L A;  1M90 R;  2CP0 A;  1VQ8 A;  4OB2 B;  2J6F A;  4C0D B;  2XKO C;  1VYT A;  3JCM g;  1PC0 A;  1RI0 A;  1VQP T;  3CCU T;  3QXE B;  2FEI A;  3OY9 A;  3A8M B;  4LXC A;  1X01 A;  4E2F B;  5CAI A;  3CD6 Q;  1N6A A;  1GBR A;  1BI0 A;  1RL2 A;  2CSI A;  4XTU A;  3CCU Q;  3KUF A;  4LUE A;  3G4S A;  2PU9 B;  3MO8 A;  2FRW A;  3FLG A;  4RTU A;  4E7I A;  2ED1 A;  1K9A A;  2GQI A;  4HCZ A;  1ZSZ A;  2XU8 A;  2NUT A;  3MCA B;  2CZ6 B;  3CEY A;  1VQ8 T;  3A5Z B;  4PLI A;  2K2M A;  3NTI A;  5I21 A;  1VQ6 A;  2KNB B;  4M75 E;  3I5S A;  2X51 A;  5J3B A;  3CC2 Q;  3JCM e;  1K9M C;  5GAN f;  2MPX C;  3V8J A;  5LJ3 f;  3Q1J A;  4M78 E;  2CDT A;  3PMI A;  1TUD A;  2SEM A;  3BFM A;  1V1C A;  4YTL A;  3G4S T;  3RUX A;  2L3Q A;  1G3Y A;  3JV3 A;  5KYU B;  2KI7 A;  2LCS A;  1D1B A;  3ZFJ A;  1IXD A;  1BKB A;  3FDR A;  4KGX B;  4X9D A;  5FU6 C;  5GAN 6;  5FRO A;  4J5Y A;  2JS2 A;  4PJJ A;  1GXI E;  4M7D E;  3BDU A;  2DZ9 A;  1GFC A;  1VQ6 T;  5IHK A;  4OMF B;  1LPL A;  3ER0 A;  5AYF A;  1PG5 B;  3SWN B;  4FYX B;  2GGR A;  1PSE A;  1VUB A;  3CXC A;  2KXD A;  2B8A A;  5FWB A;  4BI8 B;  2EQK A;  1KD1 U;  3HTR A;  2RQU A;  3G71 A;  4Z89 A;  3ULR B;  3M59 A;  2DIG A;  1K73 R;  1KSW A;  2CP3 A;  1OEB A;  2EKH A;  2Y90 A;  4A4H A;  4CC7 A;  2LRQ A;  1WXT A;  4J83 A;  5HY6 A;  4OMQ A;  1AVZ C;  3V7C A;  3EH1 A;  1PRM C;  1KJW A;  3CXC S;  4II1 A;  2Y4Y A;  2RM4 A;  1G3W A;  2R57 A;  2J6O A;  3CBM A;  2QDY B;  3J7A F;  1OUL A;  3MEU A;  4ZNX A;  4B9W A;  2HSE B;  2CP6 A;  3RKW A;  3PIP A;  2GFU A;  5M9O A;  3OS1 A;  2RHZ A;  1EZZ B;  5CKD A;  2DK3 A;  1TG0 A;  1NEG A;  1RAB B;  2VKN A;  3EGX A;  4A4G A;  1BK2 A;  3G71 T;  3NFC A;  5GAO r;  1JJ2 S;  3OS2 A;  4LDV A;  1XNI A;  1VQO A;  2LJ0 A;  2LNH B;  1ZHI A;  2DNU A;  2JM8 A;  3JCM W;  1BBZ A;  4KRT A;  1BB9 A;  5FW9 A;  1PKT A;  1Q95 G;  2FB7 A;  4IUT A;  1KC8 R;  2JOY A;  2KEA A;  1I8F A;  1OQK A;  3D7S B;  1XQH A;  1AWO A;  1VQ9 Q;  3GNG A;  4JJN K;  2HNI A;  4C5I A;  1NE8 A;  4XTW A;  3CCE A;  2OAU A;  5GAM f;  2FRY A;  4E47 A;  1QVF P;  1VQO T;  3OS0 A;  2LJ3 A;  3FB9 A;  2MI6 A;  4ZGD B;  3CPW P;  2BTT A;  2LQW A;  3FEO A;  1YCY A;  1JB0 E;  1WHL A;  2J7I A;  2KYB A;  2A37 A;  2L3R A;  3A1P A;  1VQO Q;  3OS5 A;  1U5S A;  2OTJ A;  2COZ A;  5CR2 A;  4OB0 B;  4TVR A;  1K76 A;  2BE7 D;  4RCC A;  3DB3 A;  2E41 A;  5GMK h;  1QP3 A;  2H3J A;  2A36 A;  4M7A B;  3CCE T;  3OYE A;  5DLO A;  2HCK A;  2F5K A;  3RR6 A;  2EBP A;  4C8Q E;  2OX7 A;  4F14 A;  1X2K A;  2PNI A;  3QJY A;  3CCQ A;  2DVE A;  2KMT A;  2FYK A;  4PJN A;  1O75 A;  1U1S A;  3C94 A;  3EGD A;  1JU5 C;  3RDV A;  1KFZ A;  4IUR A;  1AHJ B;  4PJO A;  1BYM A;  1ZUU A;  1LCK A;  1M90 C;  2D8J A;  2RQV A;  5HCK A;  2FPE A;  2O9S A;  2I2L A;  2NUZ A;  2LQ8 A;  3OSS C;  1CKB A;  2RA2 A;  1OOT A;  4BUG A;  3VYG A;  2OTJ T;  3FJ5 A;  3I9Q A;  1RLQ C;  2NUP A;  4D8K A;  9ATC B;  2YXY A;  3J81 E;  1N5Z A;  3HKS A;  2JNG A;  1KQ2 A;  3M9Q A;  2QTV A;  3VRZ A;  2E5K A;  1OZ3 A;  2OTJ Q;  2IG0 A;  1WX6 A;  4JS4 A;  4GBQ A;  3CCQ T;  3EFS A;  1MHN A;  2RQT A;  2PUO B;  2CSQ A;  4LDY A;  2X4Y A;  5IHN A;  3CC4 Q;  2C0I A;  4JLG A;  2K57 A;  2RI3 A;  2OTL A;  4BE0 A;  4J7I A;  3EFO B;  1H3Z A;  3CCQ Q;  1FMK A;  4M77 F;  4BD3 A;  3R6N A;  2V8J A;  1KD1 R;  5GAO m;  1ZSZ B;  1CKA A;  1WIE A;  5KYY B;  2JT4 A;  5GAN h;  4JJC A;  2HQE A;  1RAH B;  1TH7 A;  3OYG A;  5LJ3 h;  4M77 C;  1EFN A;  4QW2 A;  4OMN A;  2DRM A;  3S6W A;  2YHT A;  3SB2 A;  3PE0 A;  4M78 A;  1WGS A;  4J9D A;  1KQS P;  3UDC A;  2JM9 A;  1UJ0 A;  1YBY A;  2EYZ A;  3JCM d;  1VQ7 T;  4LN2 A;  3I56 T;  2OTL T;  4CI0 C;  3DLL A;  4ATO A;  3ME9 A;  4ELZ C;  3LH5 A;  4CRI A;  2JVV A;  4JRI A;  2OJ2 A;  3X20 B;  4XK8 E;  1MUZ A;  2XIC A;  2JTE A;  2MIO A;  4M7D A;  1YN8 A;  1G83 A;  3NGP A;  3VS1 A;  1DJ7 B;  2O9V A;  3VS7 A;  2PUK B;  3OYA A;  2EVR A;  2DRK A;  1OV3 A;  3QO3 A;  1K73 C;  4XTV A;  3MHX A;  2P0P A;  2K3B A;  3OYJ A;  2RN8 A;  3CCJ A;  2HL5 C;  1OPL A;  2VGM A;  1LOJ A;  4LDU A;  3GLX A;  3GNF B;  2JZ2 A;  2JTM A;  3HFN A;  2AHJ B;  1VQ5 Q;  1GL5 A;  2VXE A;  2EFI A;  3TVT A;  3JCM P;  3G7Z A;  3MET A;  2SRC A;  3UT1 A;  2YT6 A;  3HRT A;  1VQN Q;  4PL6 A;  4M77 G;  1SRM A;  3JRZ A;  4HVV A;  4IUQ A;  4NS5 A;  3TEE A;  3L2Z A;  5ECA A;  4L6V 5;  1HSQ A;  2A28 A;  5I11 A;  2LQN A;  3OBW A;  3UPU A;  2COY A;  3CCJ T;  4BDY A;  2LDM A;  3GF5 A;  2HEQ A;  4E7K A;  3BY7 A;  4M77 D;  2ZPI B;  1QVG P;  2P0K A;  1KC8 C;  4J9G A;  2F2X A;  5HK0 A;  3MP8 A;  2DYB A;  4DA4 A;  2QDL A;  2ZPF B;  2XD0 A;  2DA9 A;  3UF4 A;  4LUD A;  1NPP A;  5D6Y A;  5GJW B;  2DER A;  3LWI A;  4PJL A;  2L0A A;  2GTJ A;  5A0D A;  1KHC A;  3S3M A;  1TUC A;  1TWB A;  1YIT A;  1K1Z A;  1NBE B;  3H6Z A;  1TSF A;  3H0H A;  4OB3 B;  4AG1 C;  5GAM h;  1XOV A;  2DL5 A;  1XTD A;  3SEM A;  3MEW A;  3H0F A;  2L2P A;  2EWN A;  2JMC A;  2D8H A;  2M16 A;  1B07 A;  4BY6 B;  4DBF A;  3KBG A;  2XMF A;  3OYI A;  2V1Q A;  3HSB A;  4C5G A;  1SRL A;  3TQ7 P;  1M2O A;  4BI4 A;  3VKI A;  3CQT A;  4EIK A;  3NMZ C;  1I81 A;  1JXO A;  1KHI A;  1TOV A;  4F17 A;  2QK0 A;  3QDF A;  1ZA2 B;  1JXM A;  1YJN Q;  1YIT T;  4QKU A;  2FPD A;  4OGE A;  1KQ1 A;  1WHJ A;  1QWE A;  4M77 E;  1VYU A;  2WSC E;  1YHQ A;  1PSF A;  1VIF A;  4J6Y A;  1D3B A;  5GAO q;  1VQ4 Q;  1B34 A;  4F7U G;  1YIT Q;  2CKK A;  1FMV A;  1QCO A;  4MMK A;  3L2Q A;  3M4Y A;  1E6G A;  2KT1 A;  2OAW A;  1I5L A;  3WVE B;  1YJ9 A;  5LJ5 j;  3EGD B;  3L2R A;  1M3A A;  1X27 A;  3C0C A;  1Q81 U;  2NYS A;  4LD9 K;  4PJO B;  2RJF A;  2MMP A;  1A0N B;  2F1L A;  1YI2 A;  3VUB A;  3NTK A;  4Y92 A;  2XDD A;  4KBM B;  3CBO A;  1YHQ T;  2MF2 A;  1WPY A;  2XHC A;  1KG1 A;  3X24 B;  2ZCF B;  4L5G A;  3OYM A;  4C92 G;  2MCN A;  5DM7 R;  1AWX A;  2OI3 A;  3CCV A;  1YHQ Q;  2RF0 A;  3OYF A;  2YWW A;  2YUO A;  1AOJ A;  1YJ9 T;  3OYY A;  1KD1 C;  4A53 A;  2CP5 A;  2PZ1 A;  5KYX B;  1Y07 A;  2EYQ A;  3A8G B;  1YFN A;  1Y96 B;  4A63 B;  5IXF A;  2CYZ B;  5EG2 A;  2RH2 A;  2K5I A;  5L8R E;  4C92 D;  2MWO A;  2JTF A;  5D6W A;  3ZEH A;  3JCM h;  2M02 A;  3SWN C;  1S72 A;  3TRE A;  4XTY A;  2DIL A;  4EMG A;  4M75 B;  4DOV A;  3RNJ A;  2QEX A;  4RTW A;  3JCM b;  1YI2 Q;  1H3H A;  3CCV T;  1KIK A;  1FYN A;  3M0R A;  4QQG A;  3JB9 J;  2EGE A;  2QQA A;  3CCS Q;  5EC7 A;  1MV0 B;  2DL8 A;  2V1R A;  4KUD K;  2E6Z A;  3M0P A;  4DEX A;  1GRI A;  2DJQ A;  2RI2 A;  3OMG A;  3RKX A;  1VQP Q;  1QVF A;  3JAM E;  2CH4 W;  5CQY A;  1U8R A;  3E19 A;  1FMW A;  1OX8 A;  1W2B P;  4GLK A;  3CPW A;  3HFO A;  2YUN A;  4M7D B;  1S72 T;  2F2V A;  3M5A A;  2KRN A;  5FLX E;  1HYO A;  1PNJ A;  1VQL A;  4FYV B;  5GAN 8;  1UE9 A;  2QEX T;  2H8H A;  4KGZ B;  5GAN 4;  1QVF S;  4QQD A;  4MZT A;  3VYH B;  2CS7 A;  2EYW A;  4EPC A;  5L23 A;  1VQ8 Q;  2LT4 A;  2I0N A;  2K79 A;  1MV3 A;  2K3Y A;  2RJC A;  3THK A;  2RK2 A;  3MP1 A;  5GAN d;  5FRN A;  3EG2 A;  5LJ3 d;  1NLO C;  2CH4 A;  3PNW C;  3A98 A;  4X34 A;  1SSH A;  1VQL T;  1M8V A;  2YRD A;  3G4S Q;  1QKW A;  4EMK B;  3VS4 A;  4C0Z A;  1QWF A;  2Z0W A;  1HJD A;  4ZTF A;  2IPO B;  2KDS A;  1V76 A;  4Y28 E;  2RHX A;  1YIJ A;  1K8A U;  2J06 A;  3ASK A;  2L3P A;  2D0N A;  1VQ6 Q;  3JB9 F;  1BCO A;  2EQU A;  3EAE A;  2EJG A;  3PT9 A;  2HKN A;  6AT1 B;  3CMA A;  4RTV A;  1GCP A;  1C6V X;  1X6B A;  1IRX A;  4N4H A;  4QQ6 A;  5A0G A;  2X4J A;  1Q81 R;  1NM7 A;  1BI1 A;  1QCF A;  2DTI A;  2DXU A;  4DBH A;  1X75 C;  4B6M A;  2E4H A;  1YIJ T;  4RG2 A;  3NPF A;  4IUU A;  2FPF A;  1M3C A;  2E10 A;  1LJO A;  2ATC B;  1XJW B;  3RBB B;  4XU1 A;  5D7U A;  2CUD A;  1VQM A;  1KQS A;  4O6J A;  2K2V A;  1W1F A;  3CMA T;  3EGU A;  3QPH A;  4IIM A;  3V7R A;  5CKB A;  1PD0 A;  3G71 Q;  2KY9 A;  2PQW A;  5GAO p;  2ROT A;  4M77 A;  3UA7 A;  1Y57 A;  1TUG B;  1Y0M A;  3M0U A;  3GOX A;  2DF6 A;  1WHK A;  2DFU A;  2KE9 A;  3OYH A;  3V8K A;  4RCB A;  1KQS S;  1D3B B;  4OF1 A;  3L2V A;  3I5R A;  1GCQ C;  2KK4 A;  4C8Q B;  5J39 A;  5KH6 A;  3L1A A;  1AZG B;  4AFQ C;  3HRS A;  3VS3 A;  2BZX A;  3U23 A;  4VUB A;  2K9G A;  1VQM T;  4AFS C;  4FSS A;  1BCM A;  2PVG B;  3HRU A;  3JB9 G;  2DXC A;  4ZTJ A;  3INZ A;  1JO8 A;  2C0O A;  5FU6 B;  4HVW A;  1ZSZ C;  5GAM d;  3MEA A;  4M7A G;  5KYN A;  2ZPH B;  4LD6 A;  3QJ6 A;  5CVI A;  4J7F A;  2VAS A;  2BIV A;  2KT8 A;  3VJP A;  3E2U A;  4WF2 A;  1W4S A;  4P5N A;  4N0A C;  1BI2 A;  4JPB W;  2YLC A;  1WZO A;  2B86 A;  3JB9 D;  3CPF A;  2M0Y A;  4IIO A;  1IZ6 A;  1JEG A;  3AT1 B;  1WJS A;  4M7A D;  1WI7 A;  2YLB A;  1M2V A;  4UC4 A;  5LJ5 g;  4BB7 A;  1R0C B;  2CP2 A;  2NWM A;  3JB9 H;  1RUW A;  2QQB A;  3CCR A;  4RUG A;  1AD5 A;  1T0H A;  4E7S A;  3CCE Q;  2HDA A;  4KH0 B;  3E1S A;  1QVG A;  3LH0 A;  4IKF A;  1S1N A;  2F69 A;  1T0J A;  2HKQ B;  1NJI U;  3OW2 P;  4RG8 A;  2E70 A;  1I0C A;  1PM3 A;  2AT1 B;  3GPL A;  2O4X A;  2DZC A;  2K5L A;  2AKL A;  2KAF A;  3JCM Q;  1PKS A;  3PMT A;  4OVA A;  1TTH B;  1X69 A;  4X9C A;  1ZLM A;  3CCR T;  1O9S A;  3EFR A;  2QI2 A;  4J9H A;  1M9S A;  5I2S A;  1K8A R;  1VQ7 A;  3I56 A;  2BZ8 A;  3TSW A;  3O5Z A;  2RK1 A;  3OYK A;  2AK5 A;  2E3H A;  2QAS A;  3P8H A;  1TS9 A;  3CCR Q;  4JRK A;  3JCM c;  1WXB A;  3M54 A;  1ABO A;  2LT1 A;  2RNA A;  2NUT B;  1U1T A;  3QBY A;  1FX7 A;  3QKJ A;  2MOX A;  3RMQ A;  4LDX A;  2RI5 A;  5KE3 A;  2JN0 A;  3REB B;  2EQI A;  2DL7 A;  1VQK T;  4RTT A;  1JJ2 P;  1UGV A;  1ZX6 A;  3HP9 A;  1D0Y A;  2E6N A;  2DLP A;  1C0M A;  2RB6 A;  4JZ3 A;  1QQJ A;  5GMK m;  4HXJ A;  4BE1 A;  4JRP A;  1U06 A;  1M1K U;  1JQQ A;  2LX7 A;  1ZBJ A;  3OYC A;  1IB8 A;  2GCX A;  4D6W A;  8AT1 B;  3TU4 K;  1D1A A;  2HAX A;  1UDL A;  2RJE A;  1VQ7 Q;  2OTL Q;  3I56 Q;  1H92 A;  1PWT A;  3IQL A;  5CKF A;  1NZ9 A;  3LYI A;  4BY6 C;  1M30 A;  2EQJ A;  1OZ2 A;  2M0O A;  4DQ2 A;  4OMM A;  2HBP A;  5GAO n;  2HSP A;  2ZAE A;  3C4S A;  4J8O A;  3CCL A;  2HD0 A;  2MAM A;  3OYB A;  1GBQ A;  4PLL A;  4CC2 A;  2GF7 A;  1QMC A;  1HD3 A;  2RHU A;  1Q7Y C;  2RMO A;  2ROL A;  3SFM A;  1Q81 C;  2A0F B;  4E7H A;  2YUQ A;  4JJB A;  1VYV A;  1WYX A;  2KRO A;  4RTZ A;  4F04 B;  2DBK A;  5KYW A;  2QA4 T;  2EGA A;  3MKD A;  1VIE A;  3JSC A;  4KH1 B;  3GBQ A;  4F7U F;  1CSK A;  3GIB A;  4PNO A;  5KYU A;  4A4F A;  3SD4 A;  3JCM V;  3CCL T; 
#chains in the Genus database with same CATH homology
 3G71 A;  3M53 A;  3M59 A;  1WQW A;  2DIG A;  2ZZD A;  1YJ9 T;  4A54 A;  2DO3 A;  3OYY A;  5I2M A;  4F7U A;  1QVG S;  1KD1 C;  2Y90 A;  4A4H A;  4A53 A;  1VQK A;  2LRQ A;  1Y07 A;  2EYQ A;  3A8G B;  2CZ1 B;  3QZ5 B;  3QZ9 B;  4J83 A;  5HY6 A;  4FIB A;  3S3N A;  1Y96 B;  2PVO B;  3X25 B;  3V7C A;  2Y4X A;  2EAY A;  3WXM B;  2CYZ B;  2WSE E;  2BKD N;  3OMC A;  2ZGW A;  2RH2 A;  5EG2 A;  2K5I A;  4II1 A;  5L8R E;  4C0F A;  2Y4Y A;  3L42 A;  3SWN A;  2MWO A;  2JTF A;  1G3W A;  2R57 A;  2RM4 A;  3CBM A;  2QDY B;  2L89 A;  4HKE A;  5D6W A;  3ZEH A;  3JCM h;  3MEU A;  5KE2 A;  3J7A F;  3CC4 T;  3SWN C;  1S72 A;  2D9T A;  3TRE A;  4B9W A;  2PVD B;  4XTY A;  3RKW A;  1ZQ1 A;  3PIP A;  1Q82 U;  1W2B A;  4ME7 A;  2E5Q A;  2GQV A;  4OGC A;  2E1H A;  2GFU A;  4M75 B;  4EMG A;  2RHZ A;  4DOV A;  5M9O A;  3OS1 A;  2K5F A;  3HPW A;  4Y91 A;  5CKD A;  2QEX A;  2DK3 A;  3JCM b;  2LX9 A;  4M7A E;  4C92 F;  3CCV T;  5GAN 5;  3VU3 C;  2K3X A;  4QQG A;  3JB9 J;  3OSV A;  4FL6 A;  4MZM A;  1QVP A;  4A4G A;  3V7S A;  3MEV A;  3G71 T;  3NFC A;  2QQA A;  5GMK e;  4KUD K;  5GAO r;  1JJ2 S;  3OS2 A;  1FXX A;  1Y96 A;  2CZ0 B;  1XNI A;  4LDV A;  4C92 A;  5GMK i;  2E6Z A;  1VQO A;  4E7L A;  2IVW A;  2RO0 A;  2D0Q B;  3CXC S;  1ZHI A;  2QQR A;  5GAN 3;  1UEB A;  2E64 A;  1W2B S;  2QQS A;  1BIA A;  4M75 F;  4C92 C;  2RI2 A;  3OMG A;  4B9X A;  3RKX A;  1QVF A;  4ZGE B;  3JCM W;  3JAM E;  5CQY A;  2G3R A;  1U8R A;  3E19 A;  5D6X A;  1WJQ A;  2VC8 A;  4GLK A;  3CPW A;  5IN1 A;  2XI9 A;  3HFO A;  2FB7 A;  3LW5 E;  4IUT A;  4M7D B;  2XDB A;  1UGQ B;  2DTO A;  4M75 A;  2JOY A;  1S72 T;  3M5A A;  1I8F A;  5FLX E;  2YRV A;  3JCM f;  3X26 B;  4M75 C;  4HA8 A;  4BAC A;  4MDX A;  1VQL A;  1XQH A;  2VV5 A;  5GAN 8;  4R56 A;  5IT9 E;  3GNG A;  4C0D C;  2QEX T;  4JJN K;  2RHI A;  1VQ5 A;  1Y71 A;  2HNI A;  2X35 A;  3ZBD A;  4C5I A;  3LGF A;  5GAN g;  3RKY A;  5GAN 4;  2EKO A;  3CCM A;  2QA4 A;  1QVF S;  1G3S A;  4QQD A;  4J6X A;  3CBP A;  4MZT A;  1P92 A;  1NE8 A;  3QHS A;  4XTW A;  5CCA A;  5LJ3 g;  2OAU A;  3CCE A;  5GAM f;  4PJO G;  5FRM A;  3DLM A;  1VQN A;  4E47 A;  3PTA A;  3VYH B;  2CS7 A;  4EPC A;  1VQO T;  3OS0 A;  2LCC A;  2LT4 A;  4Z02 A;  4XQ3 A;  3JCM X;  3FB9 A;  2MI6 A;  4ZGD B;  2R5M A;  2KSS A;  3FEO A;  4C5E A;  1YCY A;  1JB0 E;  2K3Y A;  2RJC A;  2WAC A;  2K4Y A;  2RD1 A;  2RK2 A;  3M4G A;  3MP1 A;  1Q7Y U;  5GAN d;  2DD5 A;  2L3R A;  3N5B B;  5GAO l;  3LLR A;  1N9R A;  5FRN A;  3OS5 A;  5LJ3 d;  4IUV A;  2XID A;  4OP0 A;  5DY9 A;  1JRI A;  3PNW C;  4X34 A;  4XTX A;  2OTJ A;  5CR2 A;  4OB0 B;  1MGQ A;  2VYT A;  4PJO D;  1VQL T;  4TVR A;  3JB9 I;  1M8V A;  1M5Q 1;  2VUB A;  4EMK B;  4RCC A;  1VQ5 T;  3DB3 A;  3TCJ A;  4DOW A;  2E41 A;  4C0Z A;  2EIF A;  1QP3 A;  5GMK h;  4C5H A;  1N8R U;  2QQ9 A;  2X4X A;  3VV0 A;  4ZTF A;  2FVU A;  3OQ5 A;  4ZN1 A;  3CCM T;  2H3J A;  4MZP A;  2O4X B;  4M7A B;  2KDS A;  2QXF A;  1N8R C;  4Y28 E;  3OYE A;  2RHX A;  5DLO A;  1YIJ A;  1K8A U;  3CCE T;  1VQN T;  5CQX A;  2F5K A;  4C8Q E;  5GAN e;  5GMK j;  4PJO F;  3P8D A;  1K8A C;  5GMK l;  2O01 E;  3QJY A;  3QDR B;  2DVE A;  2KMT A;  2RHY A;  5LJ3 e;  3ASK A;  5A2Q E;  3CCQ A;  4XU3 A;  2FYK A;  4V2S A;  2LC4 A;  4BI3 A;  1O75 A;  2DEQ A;  1U1S A;  3A8H B;  3C94 A;  3JB9 F;  4N4I A;  1M90 U;  4XU2 A;  1QP2 A;  4IUR A;  3OYD A;  1AHJ B;  5LJ5 f;  2EQU A;  3EAE A;  4PJO A;  1BYM A;  3L2W A;  1M90 C;  3DB4 A;  2EJG A;  3PT9 A;  4XTZ A;  4HCC A;  3F70 A;  2I2L A;  4M75 G;  2LQ8 A;  3LGL A;  4PJO C;  1UGS B;  3OSS C;  2RA2 A;  3CMA A;  4QVZ A;  1HK9 A;  2HQX A;  3VYG A;  4BUG A;  4EMK A;  3PGG A;  3HHT B;  2OTJ T;  2P4T A;  3C95 A;  5C0M A;  4EMK C;  2CZ7 B;  2FHD A;  1BIB A;  3BW1 A;  4N4H A;  4GY5 A;  4QQ6 A;  4C0G A;  5A0G A;  2X4J A;  4QVD A;  3FC3 A;  1BI1 A;  2DTI A;  1G3T A;  2DXU A;  3J81 E;  2F5T X;  3HKS A;  4KUL A;  2JNG A;  1X75 C;  2NLU A;  3M9Q A;  3I55 A;  1Q86 U;  1KQ2 A;  1YIJ T;  1OZ3 A;  4M77 B;  2IG0 A;  2DXB A;  2L5Q A;  4RG2 A;  4JS4 A;  1WJR A;  4FT2 A;  4IUU A;  1Q86 C;  4FU6 A;  2E10 A;  1YJW A;  4ZGJ B;  3CCQ T;  1LJO A;  2DTH A;  3EFS A;  1MHN A;  1YJN A;  4M75 D;  4HT9 A;  2PUO B;  4LDY A;  2X4Y A;  4JLI A;  4XU1 A;  4M7D G;  4JLG A;  4M78 B;  2K57 A;  2RI3 A;  1V29 B;  2OTL A;  4BE0 A;  4F7U E;  3OB9 A;  1JBM A;  4J7I A;  1VQM A;  4HCB A;  1H3Z A;  2ZPE B;  5J26 A;  1KQS A;  2LQK A;  1X6O A;  4O6J A;  2K2V A;  2KQW A;  2M9U A;  4M77 F;  1UB4 A;  3CC2 A;  4BD3 A;  3CMA T;  1VQ4 A;  2R5A A;  5CIU A;  5HK3 A;  3QPH A;  2V8J A;  4IUP A;  3V7R A;  5GAO m;  1H64 1;  5CKB A;  2KY9 A;  2PQW A;  5GAO p;  4M77 A;  5GAN h;  5KCO A;  4M78 F;  2HQE A;  3LX7 A;  4XAX B;  1TH7 A;  3VUZ A;  3OYG A;  3E9F A;  4M77 C;  5LJ3 h;  3GOX A;  3I55 T;  4M7D D;  3OYH A;  3QSU A;  4QW2 A;  2EJF A;  5GAN j;  5CKE A;  2RJD A;  3S6W A;  3V8K A;  4RCB A;  1SSF A;  5GAN 7;  1D3B B;  5LJ5 e;  4OF1 A;  1KQS S;  4FT4 A;  5GAM g;  2YHT A;  3SB2 A;  3L2V A;  1YJW T;  4M78 A;  5LJ3 j;  2KK4 A;  4C8Q B;  1WGS A;  5J39 A;  3OYN A;  3FRN A;  1YJN T;  5KH6 A;  1WQ7 A;  3L1A A;  3UDC A;  4M78 C;  2XDP A;  4A4E A;  3HRS A;  1YBY A;  3JCM d;  5CK9 A;  1VQ7 T;  2OTL T;  3I56 T;  3CPW S;  4VUB A;  4CI0 C;  3OA6 A;  4M7D F;  4LDW A;  4EDU A;  3DLL A;  1VQM T;  4OB1 B;  4ATO A;  4KT0 E;  1M1G A;  3ME9 A;  3X28 B;  4C92 E;  2PVG B;  3RIR A;  3HRU A;  4CRI A;  4ELZ C;  1HXD A;  2DXC A;  2JVV A;  4JRI A;  3INZ A;  1R8O B;  3X20 B;  3JB9 G;  5DLQ E;  4XK8 E;  3QUI A;  4ZTJ A;  3CC2 T;  1VQ4 T;  5FU6 B;  2XIC A;  5GAM d;  2DPP B;  3MEA A;  4M7D A;  4C8Q F;  3WVD B;  4M7A G;  1BI3 A;  5CKH A;  2ZPH B;  4LD6 A;  3AHU A;  4M7D C;  3QJ6 A;  5CVI A;  4J7F A;  1DJ7 B;  2BUD A;  2BIV A;  4N0A A;  4XU0 A;  4BE2 A;  3VJP A;  4WF2 A;  1W4S A;  2XK0 A;  1IRE B;  1UGP B;  1K73 U;  2PUK B;  3OYA A;  4C8Q A;  4P5N A;  3OBY A;  4N0A C;  1BI2 A;  2YLC A;  4NL2 A;  3QO3 A;  1K73 C;  4XTV A;  3MHX A;  2P0P A;  4C8Q C;  4Q5W A;  1WNL A;  3CME A;  2KVQ G;  5FU7 B;  3OW2 A;  3JB9 D;  3CPF A;  4EMH A;  2XD0 A;  1ZBX A;  1IZ6 A;  3V8L A;  3OYJ A;  5HKC A;  3DKM A;  3CCJ A;  5GAM e;  4ZN3 A;  2ZPB B;  3M56 A;  2VGM A;  3NTH A;  1LOJ A;  4LDU A;  1WJS A;  3GLX A;  4M7A D;  3GNF B;  2YLB A;  2JZ2 A;  2JTM A;  2QTX A;  3HFN A;  3PFS A;  4UC4 A;  5LJ5 g;  2AHJ B;  3RES A;  4BB7 A;  2L8D A;  4F7U B;  4RMO A;  3JB9 H;  2VXE A;  3R6O A;  2DXT A;  2QQB A;  2EFI A;  3RMS A;  4ELY C;  3CCR A;  1Q82 C;  4BDZ A;  3RER A;  3JCM P;  3G7Z A;  3MET A;  4FM4 B;  3UT1 A;  3HRT A;  2CGH A;  3H8Z A;  3E1S A;  4PL6 A;  1QVG A;  4M77 G;  3OW2 S;  4M7A F;  3LH0 A;  3FJP A;  4MML A;  4IKF A;  4KUI A;  2FL7 A;  2F69 A;  2LCL A;  3JRZ A;  3CCS A;  1NJI U;  4RG8 A;  3CD6 A;  2E65 A;  2E70 A;  4IUQ A;  4NS5 A;  4FSX A;  3KXT A;  5LJ5 d;  3TEE A;  3L2Z A;  3GPL A;  1NJI C;  5FU7 C;  2O4X A;  4NL3 A;  4L6V 5;  4M78 G;  2LTO A;  1Y7X A;  4C92 D;  1QW1 A;  3CME T;  1UGR B;  4M7A A;  2DZC A;  1VQP A;  3CCU A;  2K5L A;  4M7A C;  3OYL A;  2KAF A;  3OBW A;  3JCM Q;  3PMT A;  3UPU A;  3CCJ T;  4OVA A;  2XG8 D;  4MDW A;  4BDY A;  2LDM A;  3GF5 A;  3A8O B;  3G6E A;  4X9C A;  5C6S A;  2C06 A;  4QVC A;  1KC8 U;  4E7K A;  3BY7 A;  4M77 D;  2DAQ A;  2ZPI B;  3M55 A;  3J80 E;  3FIF A;  4C92 B;  3CCR T;  2P0K A;  2A3L A;  1OI1 A;  1KC8 C;  1O9S A;  3EFR A;  5GAN 2;  2P0Q A;  1VQ9 A;  2QI2 A;  3T9N A;  5HK0 A;  3MP8 A;  4DA4 A;  2ZPF B;  1M9S A;  1N9S A;  5I2S A;  1YI2 T;  2E12 A;  3S3O A;  1VQ7 A;  3I56 A;  1JJ2 A;  4PJO E;  2LVM A;  3E9G A;  1NPP A;  3HL8 A;  5D6Y A;  4M78 D;  2VXF A;  2EQM A;  3SDZ A;  2ZPG B;  3O8V A;  3LWI A;  2GFA A;  5A0D A;  2RK1 A;  3OYK A;  3URG A;  2DIQ A;  4A4K A;  1KHC A;  3GP8 A;  3CCS T;  3P8H A;  3S3M A;  3QG1 A;  4C8Q G;  1YIT A;  1EIF A;  3PIO A;  2DJZ A;  4JRK A;  3H6Z A;  3JCM c;  4O5V A;  5A0L A;  4HT8 A;  3CD6 T;  1VQ8 A;  4OB2 B;  3M54 A;  4OB3 B;  4C0D B;  5KCH A;  2LT1 A;  2XKO C;  5GAM h;  3CCL A;  2A7Y A;  3M58 A;  1XOV A;  3JCM g;  5IAY A;  1U1T A;  3QBY A;  1XTD A;  1RI0 A;  4E7J A;  3MEW A;  1FX7 A;  3QKJ A;  1VQP T;  3A8L B;  3RMQ A;  3QXE B;  2RI5 A;  3OY9 A;  3CCU T;  4LDX A;  2EWN A;  3A8M B;  5KE3 A;  1X01 A;  2M16 A;  5CAI A;  5GAM j;  3QYG B;  2JN0 A;  4BY6 B;  3KBG A;  1N6A A;  3G6E T;  1VQK T;  2V8I A;  3P8B B;  1BI0 A;  1B34 B;  3OYI A;  3HSB A;  1RL2 A;  3HP9 A;  4C5G A;  4XTU A;  3KUF A;  3G4S A;  1VQ9 T;  2E6N A;  2RB6 A;  4N4G A;  4C8Q D;  2PU9 B;  3MO8 A;  4BI4 A;  3VKI A;  3FLG A;  3L2U A;  3OYF A;  4BE1 A;  5GMK m;  4E7I A;  1LNX A;  4JRP A;  1I81 A;  1KHI A;  1OYX A;  1M1K U;  4HCZ A;  1M1F A;  3OYC A;  2XU8 A;  1M1K C;  1G5V A;  2V8K A;  1YIT T;  2X4W A;  2GCX A;  2DKG A;  4D6W A;  2JUF A;  3MCA B;  2LNV A;  2CZ6 B;  3CEY A;  3TU4 K;  4OGE A;  1VQ8 T;  1KQ1 A;  3A5Z B;  3C12 A;  2HAX A;  2DD4 A;  2RJE A;  4PLI A;  3NTI A;  5I21 A;  2M1H A;  4M77 E;  4PKC C;  5CKF A;  1VQ6 A;  4L59 A;  2WSC E;  1YHQ A;  1PSF A;  1VIF A;  1NZ9 A;  4M75 E;  4J6Y A;  2MWP A;  3LYI A;  1K9M U;  5J3B A;  1D3B A;  4BY6 C;  5LL6 S;  5GAO q;  1B34 A;  1I4K 1;  4F7U G;  2CKK A;  3BDL A;  2EQJ A;  1OZ2 A;  3JCM e;  5GAN f;  1K9M C;  4MMK A;  2WSF E;  3UWN A;  2M0O A;  4DQ2 A;  3V8J A;  4JRQ A;  2HBP A;  5LJ3 f;  2VGN A;  3Q1J A;  4RKU E;  4M78 E;  5LJ5 h;  5GAO n;  3L2Q A;  3QII A;  3PMI A;  1M4Z A;  3C4S A;  3CC7 A;  3MP6 A;  1N27 A;  4J8O A;  3BFM A;  2HD0 A;  2MAM A;  4YTL A;  3QYH B;  3M4Y A;  3G4S T;  3M57 A;  4JUV A;  3RUX A;  1I5L A;  1G3Y A;  3WVE B;  1YJ9 A;  3OYB A;  5LJ5 j;  4PLL A;  2EJ9 A;  2GF7 A;  2R58 A;  3L2R A;  1Q81 U;  2RHU A;  1Q7Y C;  3ZFJ A;  4R55 A;  1BKB A;  3FDR A;  4LD9 K;  4PJO B;  2RJF A;  3SFM A;  4X9D A;  1Q81 C;  2MMP A;  4E7H A;  5FU6 C;  1NPR A;  5GAN 6;  5FRO A;  4J5Y A;  1GXI E;  4M7D E;  3BDU A;  4JS5 A;  1YI2 A;  3VUB A;  3NTK A;  2DZ9 A;  2XDD A;  4KBM B;  1VQ6 T;  2QA4 T;  3CBO A;  1YHQ T;  4OMF B;  3CC4 A;  2MF2 A;  3ER0 A;  5AYF A;  1WPY A;  3SWN B;  2XHC A;  1KG1 A;  3X24 B;  2ZCF B;  4L5G A;  1VIE A;  1PSE A;  1FWZ A;  4NOY A;  4C92 G;  3OYM A;  1VUB A;  3JSC A;  5DM7 R;  3CXC A;  3LWH A;  4JDS A;  4F7U F;  2B8A A;  2D6F A;  3CCV A;  4BI8 B;  5CO7 A;  3JCM J;  3GIB A;  4PNO A;  2EQK A;  4A4F A;  3SD4 A;  3JCM V;  3CC7 T;  4J6W A;  3CCL T;  1KD1 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...