3SWNC

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
68
Chain Sequence
LDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRLTGAIRKLGLVVVRGTTLVLIAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm7
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 10
structure length 68
sequence length 74
chains with identical sequence F, O, R
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnC00
3RKYA 3BDUA 1BIBA 4NL3A 5GAOq 4M75D 5GAMh 4M75B 3EFRA 3SWNC 3FJPA 1Y96B 3INZA 4XQ3A 3SWNA 4F7UF 4NL2A 4F7UA 5GAMj 2RB6A 2YHTA 4M7AA 4M7DG 4F7UE 4XTXA 4XTYA 1HK9A 4EMKB 3JB9I 4J6YA 3GIBA 5LJ3f 3RIRA 1U1SA 5GAN2 4C8QA 4NOYA 4M78C 3RKXA 3L1AA 4M75G 3V7RA 4QVDA 3BW1A 4RCCA 4M78E 2EJFA 2QTXA 2JN0A 4M77D 5GAMe 4M77B 3JCMP 3HFOA 5LJ3g 4JRKA 1H641 3HFNA 3RESA 3SB2A 4M7DD 3V8JA 1M8VA 1WPYA 3JB9F 5GMKi 4M7AD 4M7AB 5GAN4 5GAOl 2EJ9A 4HT8A 3JCMQ 2E10A 2YLCA 1N9RA 4XTZA 3V7CA 5GAN6 2DVEA 1I81A 3JCMb 5GAOn 3V8LA 4M77G 4C8QD 4C8QB 3JCMh 2RM4A 5GAMf 3QHSA 1U1TA 1X01A 5DY9A 4C92F 4XTWA 4C92C 4F7UG 2FB7A 4C92A 4M7AG 3FIFA 4J6XA 1KQ1A 1MGQA 4PJOF 4PJOC 5GAN8 4C92E 4DQ2A 4X9DA 4PJOA 5LJ5d 2VC8A 4M78F 3AHUA 4XTUA 1M5Q1 5GAMg 5LJ5e 4M78A 4HT9A 3QUIA 2DJZA 4XTVA 4PJOE 4C8QG 1YCYA 3RERA 5GAOp 4MMLA 1HXDA 3JB9H 1LJOA 1I5LA 3JCMd 4N0AC 3JCMe 1WNLA 4M7DC 2DXUA 3SWNB 4F7UB 4RCBA 5LJ5h 5GANh 2I2LA 4EMHA 5GMKe 4OP0A 1WQWA 5LJ5j 5GANj 4HA8A 2Y90A 3JCMV 4MMKA 2RA2A 1WQ7A 2HNIA 2EAYA 3RUXA 2DTHA 3JB9G 1KQ2A 2RD1A 4M75F 4M75C 1LOJA 5GMKm 3QSUA 4XU0A 1JBMA 2E41A 5GAN3 1TH7A 3JB9J 4M78D 4M78B 4EMGA 4M75E 1BIAA 2YLBA 3JCMf 5GMKh 3EFSA 4PNOA 4EMKC 2EJGA 5GMKj 1LNXA 4EMKA 4XU3A 5GANd 2CGHA 3V8KA 2E1HA 5GANe 4V2SA 2ZGWA 4PJOG 2FYKA 3JCMg 5I21A 3JB9D 4J6WA 4Y91A 3HSBA 4M78G 4XU1A 3BY7A 4M77F 4M77C 2DKGA 3FB9A 4XU2A 3V7SA 3VU3C 4WF2A 4QVCA 4N0AA 4M7DF 1D3BA 5CAIA 4M77E 3RKWA 2EWNA 3JCMW 1B34A 4M7DA 3L2ZA 4M7AF 4M7AC 4M7DE 2E64A 5LJ5f 4C92D 5GANf 4C92B 3QO3A 4M7AE 4A54A 5LJ3h 4PJOD 4PJOB 4M75A 5GAOm 1I8FA 4C8QF 1Y96A 4C8QC 2DZCA 5LJ3j 2K57A 2DTIA 3M4GA 2DZ9A 2DTOA 4A53A 1JRIA 4JUVA 5LJ5g 5GANg 1I4K1 4C8QE 2DEQA 2VXEA 5GAMd 4C92G 3JCMJ 5GAN5 1D3BB 3BFMA 4J5YA 2VXFA 4JRIA 3JCMX 4M7DB 1B34B 3PGGA 4X9CA 4JLIA 2E65A 5LJ3d 3JCMc 5GMKl 5GAOr 5LJ3e 2DXTA 5GAN7 4M77A 1N9SA
chains in the Genus database with same CATH superfamily
2DE0X 1ABOA 1RUWA 1K8AC 2YHTA 4X34A 1LPLA 5CKFA 2XHCA 1HK9A 2ZPFB 4ZN3A 3C12A 1MHNA 1UHCA 3CCMT 3OYBA 1VQ5T 2CZ6B 2EJFA 1TUGB 4M77B 4BD3A 3MJXA 1OYXA 3J7AF 1W2BS 4CC4B 3KXTA 2K5IA 2H3EB 8ATCB 1SRMA 2J6OA 2LZ6B 2RM4A 1VQ6A 2K4YA 5FW9A 2KT1A 2COYA 1YJWA 3CXCP 4HT9A 3RERA 1TWBA 2KR3A 1BI2A 1KQSA 1RL2A 1QVFP 1V1CA 4LD6A 3OYLA 2HKNA 1JXOA 1WX6A 4QVZA 3OMCA 1YN8A 2EYWA 1LNXA 4HCCA 2LX9A 3ULRB 4KGZB 1OZ3A 4L5GA 1WXUA 3V8KA 1I0CA 3D7SB 5GANe 1HSQA 6AT1B 2ZPIB 1RABB 2DA9A 2NYSA 3MP1A 4BE0A 1YJNT 5FWBA 4M77C 1Q86C 2ATCB 4FW1A 1Q81R 2EYXA 4PKCC 1GBQA 1M27C 3C0CA 3I56T 3OSSC 2LP5A 1NJIC 2ZPEB 1G2BA 3I55T 3PT9A 5IH2A 2CH4W 3M0PA 1OV3A 1EZZB 5GAN5 3DB3A 1RLQC 2YXYA 1IGUA 1R8OB 3PGGA 1JO8A 2FHDA 1TU0B 4FU6A 3NPFA 2FG0A 1VQ6Q 3QDFA 2J06A 3EGXA 2EBPA 3CXCA 1N8RC 1M1GA 1O9SA 3CCVQ 3OYEA 3FDRA 1YCSB 2RQRA 4AFSC 1QVFA 1RACB 4QW2A 2GFAA 5KE3A 2D9TA 3HFOA 3FJ5A 1KC8C 1GXIE 4HXJA 3V8JA 1M8VA 2BUDA 2YRDA 4QQ6A 1Q82U 1VQ8T 3L42A 4ORZA 2MI6A 2DEUA 1ZA1B 1VYVA 2YUOA 2DBMA 1QCNA 4M77G 2DRMA 2GCXA 1X01A 4PJJA 2QEXQ 2RJCA 4CI0C 4QKUA 1M3CA 4M78A 2LCSA 5CKBA 3CBPA 5CQXA 3EFOB 2L3RA 3R6NA 4CC2A 4J7IA 1VQLA 3JCMd 3EH2A 1JEGA 1H3ZA 4LE9A 2E3HA 5KYWA 5GANh 2I2LA 3U23A 3RUXA 5ECAA 2J6FA 1QCFA 1G83A 1TH7A 2K2MA 2M9UA 2R5MA 3A98A 3E1SA 2GQVA 4ATOA 1NM7A 4OB3B 3NHNA 4IUVA 1RAHB 4RKUE 2CZ0B 1VQ9Q 2L2PA 1FWZA 1X43A 1WI7A 4WF2A 2JOYA 1YWOA 4ZNXA 2ZAEA 3MEUA 3CCUQ 4J9FA 4C92D 1JJ2S 2RQUA 4ZTJA 4M75A 1SF9A 2DVJA 4LN2A 5CIUA 1NPPA 1WHHA 4HVUA 1G3SA 4OMMA 2RI2A 4RG8A 2VXEA 2DRKA 3CCJA 1GFCA 3M0UA 2EQJA 4BB7A 1TUCA 3BFMA 1LCKA 3S3OA 2ABLA 1YITA 3HP9A 2QASA 1WFWA 5AYFA 5GAOq 2K2VA 1G8XA 2XK0A 4E6RA 3CCLT 3CCSA 1NYGA 4IIOA 5CKHA 4M7AA 2QGFB 1MMDA 4XTYA 1YNZA 3X24B 1UG1A 4M4ZA 1M1KR 4AFZC 3L2QA 3H9NA 3TQ7P 1M30A 3VKIA 5GAMe 2O01E 1OQKA 2YLCA 1I81A 5I11A 1OU8A 4C92F 2X4JA 2FB7A 4IIMA 1KQ1A 1N27A 4ZGJB 2P0QA 2CSQA 2CP5A 2DJZA 4N4HA 3WVEB 5GAOp 3RNJA 2LRQA 1I5LA 1SPKA 3JCMe 2DERA 5LJ5j 4HA8A 2FPFA 4AFQC 1ZSZA 2DYBA 2K79A 2O88A 1VYUA 2FRYA 2JXBA 5KYNA 2X4XA 1ZUUA 3CCJQ 3QKJA 2KRNA 3CD6A 1YJWT 1BI3A 5GJWB 1D09B 1QCOA 1M3BA 4BI8B 1OEBA 2FYKA 5I21A 2F5KA 5DLOA 2OTJQ 1RI9A 4OB0B 4N0AA 3H0HA 1Y0MA 3VJPA 1M4ZA 4M7DE 1PKSA 4C92B 4C5IA 1Q86R 3A8MB 1M2VB 4BACA 4PLLA 2K7AA 5LJ3j 3VS7A 1GFDA 2FVUA 2DL5A 3C95A 4L59A 2IIMA 4JRIA 4J9CA 1WHLA 3NFCA 1WYXA 1M8MA 2XDDA 4J8OA 5GAMh 4F7UF 1YI2Q 2HSEB 2LMJA 3QWYA 5FRNA 1TUDA 3CC4Q 3X25B 3EH1A 2HDAA 2E6ZA 4JJNK 2D8HA 1H641 3HFNA 4E47A 2XKOC 2SRCA 1VA7A 1VQMA 2ECZA 1WIEA 3LW5E 3PNWC 2EKHA 5J39A 3JCMh 4XTWA 4C92C 3G6EA 2ESWA 3OYIA 1VQOQ 1T3SA 1WGSA 4LNPA 4JRPA 1YCYA 2L3PA 1IO6A 4GLMA 4LXCA 4F7UB 1KD1R 4C0FA 1K8AU 4OP0A 4CC7A 4JPBW 2D0NA 2D8JA 3T9NA 2ZZDA 2YLBA 2QA4Q 3PTAA 3CCEQ 2LDMA 1GRIA 2C0IA 3X26B 1QWFA 4OVAA 1OI1A 4PJOG 2QTVA 1OX9A 4F17A 1VQLT 4OB1B 1H8KA 3KFVA 4J9GA 4C5GA 1W1FA 3VUBA 2A7YA 2E64A 3A8HB 2AT1B 1QVGP 2DM1A 4C92G 1X27A 3TCJA 1Q81C 3CPWS 1HD3A 2D6FA 2ZCFB 4FSSA 5D6XA 4Y92A 4RTXA 3QJ6A 5M9OA 3G6EQ 3S3NA 1WJRA 3RDVA 3OYKA 2HEQA 2DILA 3GIBA 1AZGB 3V7RA 4J9HA 4A4EA 2NUPB 4JS5A 1OX8A 1X75C 3G71A 1Q86U 2E12A 3CMAA 1YITT 2CUBA 4E2FB 1JJ2A 1YIJA 2E10A 1N9RA 4KGXB 3OS1A 3CCST 4ELYC 1VQNA 2QQSA 1I07A 2EYYA 3N5BB 1NJIU 4C5EA 3CC7A 3CC2A 3SDZA 4BE1A 4J6XA 2QG9B 2QGGA 4ME7A 1UFFA 2JJ9A 3ZL7C 2G6FX 4MMLA 1LJOA 4K11A 1MMGA 2EFIA 4Y28E 3SWNB 3CCQA 1QVGA 2EYQA 4FM4B 1N8RU 1A0NB 4DOVA 4M78D 5FROA 3L2VA 4DOWA 2KNBB 4E7JA 1WDXA 1BKBA 2L89A 2CGHA 1KC8U 4V2SA 3CBOA 3OSVA 1M2OA 8AT1B 1KK7A 3HSBA 5D7UA 4D8DA 2LNVA 1M90U 4R0KA 3JCMW 4M77E 1T3LA 2KDSA 4M7DA 4Z02A 2H3JA 2CYZB 1MUZA 2LJ1A 3QXEB 5KYXA 1EX4A 3OS5A 2EGCA 3CD6T 3G71Q 4GY5A 3VS2A 1IZ6A 2PQWA 1PWTA 4OMPA 3OBWA 2LJ3A 2QI2A 1K9AA 2PUKB 3H8ZA 2R57A 3I5RA 3S3MA 3RKYA 3CC7Q 5IHIA 2HQHA 4M75D 3SWNC 3J80E 2E70A 3HPWA 2D1XA 2GGRA 2V8KA 3M58A 4J6YA 4C8QA 1S72Q 3RKXA 2CKKA 2YUQA 4RCCA 2Y4YA 4PK4A 1Q7YR 3SB2A 4LDWA 2DAQA 4M7AD 1J3TA 2CSIA 2KAFA 1YHQQ 1M1KC 3X20B 3QYHB 5KE2A 3RMQA 1QP2A 2NLUA 5GAN8 2HSPA 4FYXB 2JMCA 1VIEA 3CBMA 1C6VX 3JB9H 3EHRA 1ZUKA 4OMLA 1VQKQ 4ANJA 1VQMT 4RCBA 2PUOB 5GANj 1E7OA 1EIFA 2PTKA 1D1AA 3JB9G 1M9SA 2QK0A 4M75F 2AZVA 4M78B 3G6ET 5GMKh 4ELZC 4EMKA 1X6OA 2QXFA 1X2QA 5KYWB 3CCVA 4XU1A 3NMZC 5HY6A 3OYAA 1NYFA 4C0DB 2LCLA 3V7SA 4QVCA 4M7AF 2OJ2A 3LWIA 1XQHA 2Y4XA 2VGNA 1AWXA 5LJ5g 3GPLA 3EG9A 2QEXA 1S1NA 1TSFA 2RHXA 4N4GA 4J9DA 5I22A 4NL3A 1BIBA 3VUZA 4M75B 3SEMA 3FJPA 3VS3A 3L2WA 4N4IA 2KBTA 1RAGB 2X3WD 4LDVA 3H6ZA 5CCAA 4BUGA 3MEAA 3PIOA 1TS9A 3MP8A 2F5TX 4EIKA 2OAUA 2RQTA 1K0XA 4M78C 2ZPGB 5IXBA 2NUTB 1K9MR 1D0ZA 1JQQA 4BDYA 4HCBA 5LJ3g 3PMTA 1B07A 5LL6S 1Y71A 4JJCA 4M7AB 4C0DC 1QKXA 1AWWA 1ZSGA 2DVEA 1LVKA 3V8LA 1VQ9A 3HRUA 2X3XD 2KSSA 3CCUA 1C1AA 1WJQA 4IUTA 2O2OA 3QUIA 1WHKA 1X69A 3OYNA 3CMAT 2P0PA 2DL7A 2WSEE 3FC3A 2EQMA 2CP0A 2GTOA 2F2VA 1RAFB 2M51A 1YIJT 4EMHA 2GF7A 3OS0A 1VQNT 2EAYA 3EAEA 5KYUA 1DJ7B 2RD1A 4M75C 1LOJA 3QSUA 3CC2T 5CR2A 1MNEA 3VRYA 2COWA 5CO7A 3AT1B 4JLGA 1NEBA 1KD1C 2PVGB 4M78G 2RJDA 2DD4A 3URGA 1ZSZB 2A3LA 3CCQT 3VU3C 1VQPQ 1D3BA 5CAIA 3R6OA 1ARKA 3L2ZA 4M7AC 4QQGA 2VB6A 5C0MA 2DMOA 2NUZA 4PJOD 1UHFA 1I8FA 1Y96A 1WA7A 3LGLA 2EIFA 2JS0A 4A53A 3JCMJ 1SSHA 2BKDN 1WHGA 3M0QA 3G4SQ 4A63B 4LD9K 5KCHA 3M59A 1GL5A 2CS7A 3HKSA 2AZSA 2FPEA 1B7TA 2RPNA 1UGQB 3INZA 4NL2A 5GAMj 2PVOB 4EPCA 3KBGA 2K5FA 4NS5A 2GBQA 3RMSA 2HMAA 3FRNA 1AWJA 5IAYA 2K6DA 3KUFA 1PRMC 2QQ9A 4M75G 1BYMA 2CZ7B 4RTVA 2V1QA 1RAEB 2JVVA 2GNCA 3VS4A 2JUFA 3RESA 3QDRB 3UATA 3ZFJA 3JAME 1AZEA 1ZSZC 3V7CA 1W6XA 3JCMb 2OTJA 2LNHB 4JZ4A 1WHMA 1W2BP 1C0MA 1JB0E 1D1BA 4M7AG 1MGQA 4PJOF 4E7SA 4C92E 5LJ5d 1Q81U 2L8DA 3NTHA 2R58A 4E7IA 4Z88A 2MCNA 4N0AC 3GLXA 5IHNA 4FL6A 2A37A 3SD4A 3JCMV 3M53A 1OPLA 2L0AA 1E6HA 1KHIA 4XU0A 4KT0E 1YI2A 2KQWA 4OMQA 2EYZA 4XU3A 1VQ7Q 1AHJB 5CVIA 3LLRA 2O4XA 4MZPA 4AG1C 2RNAA 2DX1A 2F2WA 3OW2S 3CC4A 2EWNA 2O9SA 2KEAA 2KK4A 3ME9A 3QO3A 1SG5A 1PC0A 2XU8A 5KH6A 2DL4A 2KE9A 4A4HA 1VQ6T 4PJOB 2MIOA 3NTKA 3M4GA 1U3OA 1IRXA 2JW4A 1I4K1 2BZXA 3UT1A 1BBZA 3CCVT 1VQOA 2P0KA 5J26A 1QW1A 3JCMX 3JCMc 1W2BA 2E65A 5GMKl 4PLIA 1K73C 2MWOA 1FMVA 4ZTFA 3EG2A 4F7UE 1H3HA 1NG2A 2PU9B 1AVZC 3RIRA 2LC4A 1KFZA 1MMNA 2QEXT 2QDYB 2FL7A 4DBRA 3GNGA 2JN0A 2QA4A 1ZUYA 3CCEA 1P92A 4KH0B 4LUDA 2CT3A 2BTTA 3FLGA 3GBQA 3CCRQ 1VQ4Q 3M0SA 3JCMQ 5GAN6 1X6GA 2KYMA 3EG1A 3UDCA 3QYGB 2DJQA 4C8QD 1FXXA 1HYOA 5DY9A 2NWMA 2RQWA 3FIFA 1UGVA 1Q7YC 3CMEQ 2EGEA 4BI3A 4PJOC 1GCQA 1T0JA 2HKQB 5LJ5e 4XTVA 4FT2A 3EGUA 3GP8A 4HVWA 1G3YA 3FEOA 5KYYA 1D0YA 2JMAA 2FZGB 2LQ8A 1VQ9T 4MMKA 5FU7B 2DTHA 1R0CB 1KHCA 3E19A 3CCUT 3EFSA 3PFSA 1R0BG 2F2XA 2XI9A 2R5AA 2E1HA 2LQKA 1YFNA 3JB9D 4Y91A 3UA7A 3O8VA 1YJ9Q 4QQDA 4KBMB 1V29B 1WHJA 3FB9A 1KQSS 2FPDA 1X2KA 1M1KU 4RMOA 2E4HA 2F69A 1XNIA 1ZQ1A 3H0FA 5LJ5f 3CQTA 4OMFB 2I0NA 2LT4A 4C8QF 4BE2A 3JV3A 2DTIA 4PJMA 1JJ2P 1D0XA 4DBFA 5GANg 4PL6A 2MK5A 5FWCA 1YWPA 5I2SA 1CSKA 1MV0B 4M7DB 2D0QB 2EQKA 2LVMA 2CDTA 1BK2A 2CH4A 1ZX6A 3OMGA 1H92A 2DXTA 2EQIA 5KYXB 2OTLQ 3EFRA 3ZEHA 4RTWA 2DBKA 4FSXA 2CP3A 5FU7C 2WSFE 2FZCB 1QVPA 5LJ3f 1U1SA 5EC7A 1OOTA 2M1HA 2RMOA 2WACA 2YUPA 1N5ZA 4FIBA 3JB9F 4IURA 1I1JA 5GAOl 4PJLA 4J7FA 2KT8A 3TVTA 1IREB 3EGDA 4C8QB 3MCAB 3CCMQ 1U1TA 1UE9A 1VQ5Q 1YBYA 3CXCS 1IHWA 4C92A 4KH1B 3MP6A 1K9MC 3META 2EPDA 4DQ2A 2V1RA 4XTUA 3TEEA 3CCJT 3VRZA 1QVFS 2OX7A 2KRMA 3J81E 3C4SA 2DK3A 2LX7A 1X6BA 3JRZA 4M7DC 2PZ1A 2KGTA 1WQWA 2OTJT 1BI0A 2W10A 1HJDA 1UUEA 1VOMA 5CKDA 1Q95G 4PNOA 2SEMA 2B86A 2KROA 2XMFA 4LUEA 4B6MA 5GMKj 3PVLA 3L2UA 3OBYA 3ZBDA 3M57A 1S72A 5AT1B 4ZN1A 2IVWA 4XU2A 1VYTA 1FX7A 2JNGA 2V26A 3P8DA 4DBHA 4PFPA 4A54A 4LDUA 4C8QC 1YI2T 1YHQA 1YJNQ 2HD0A 3EG0A 1B3QA 2COZA 4X1VA 3L2RA 3O5ZA 3CC4T 1RLPC 2DF6A 3I56Q 4F7UA 2YUNA 1VQKA 5L23A 1K73R 4M7DG 3I55Q 2E6NA 2EGAA 3EG9B 2CREA 1UECA 2CP6A 4NOYA 1KD1U 4FYVB 3M55A 2C0TA 3HRSA 4M78E 4CRIA 1AWOA 1VQOT 4HKEA 4Q5WA 1TTHB 2M0YA 5GMKi 3BE3A 4HT8A 1UEBA 2YRVA 4XTZA 3EG3A 1UJ0A 2XDBA 3M4YA 3QHSA 1Z9QA 2X4WA 1KG1A 3M5AA 2J6KA 4M78F 3HL8A 1M5Q1 2KRSA 5GAMg 2DPPB 4C8QG 2QA4T 1VQ8Q 3PMIA 4TVRA 3CCET 2ZPBB 1MV3A 3JSCA 1RI0A 2P84A 1ZBJA 2KMTA 3DLLA 3EGXB 3LH0A 3DB4A 2ROLA 3VV0A 3CCLA 5A0GA 3HTRA 5GMKm 1IXDA 1K1ZA 4IUQA 3H41A 1BU1A 2BE9B 4M75E 1BIAA 2QDLA 2P4TA 4RTTA 1Q82R 2EJGA 4R56A 1R77A 3QJYA 3JCMg 2AIRB 2PNIA 4OGCA 3M54A 2VV5A 5D6YA 5KYUB 3OYYA 2OAWA 2FRWA 1Y57A 4M7AE 1UB4A 2X9HA 5EG2A 1G3TA 3A8OB 4A4FA 1QP3A 2GTJA 4AG2C 1K0SA 4AMCA 1D3BB 4E7LA 1XTDA 1FMWA 3OS2A 3CPWP 1UTIA 1GCPA 1N9SA 2DIGA 1Y96B 3SWNA 2X51A 3LX7A 5DLQE 1IHVA 5HKCA 3PE0A 2DO3A 2MOXA 2DNUA 4FCYA 3I9QA 4YTLA 4IUPA 1Y07A 1QKWA 2MWPA 4HCKA 4JDSA 2E5QA 3M0TA 4WTOB 2B8AA 4JJDA 2DXCA 3RBBB 3CCLQ 1PD0A 4XK8E 1QMCA 2GFUA 5GAOn 1PD1A 2A36A 3C94A 3SFMA 2K9GA 1VQPA 1AD5A 4RTUA 3ER0A 2PVDB 2DIQA 3X28B 4LDYA 2LQNA 3A8LB 1ZHIA 1ACMB 3IQLA 1K73U 1ABQA 3I35A 3OYMA 5J3BA 2JT4A 4JJBA 4GLKA 3G4SA 3P8BB 4IKFA 2RA2A 4D6WA 2CUDA 2E41A 4PFOA 2V8JA 2VVKA 1KJWA 3CPFA 2E5KA 5C6SA 1XOVA 3CPWA 4F04B 3G71T 3E9GA 1W70A 1UGSB 2IG0A 3BY7A 3OB9A 4DBQA 2RQVA 1W4SA 1B34A 1KSWA 2A28A 4JS4A 3VS1A 5GANf 1YJWQ 1Q7YU 1XJWB 3CC7T 5GAOm 2K57A 3REBB 1OULA 3MEWA 2O4XB 3DLMA 2KY9A 5GAMd 4E7HA 3REAB 2J05A 1S72T 1OPKA 2RK2A 4F14A 3DKMA 1PSEA 4M77A 1RAIB 1CKBA 1M90C 3EHQA 3LGFA 2L3QA 2XIDA 1UJYA 1BB9A 2KXCA 3WXMB 4BY6B 2RHZA 4DA4A 1UGPB 1YHQT 2P4RA 2DETA 1NLPC 3BDLA 2YSQA 3L1AA 3BW1A 1PKTA 2XG8D 3M0RA 3WVDB 2RJFA 4FW2A 4RUGA 5IT9E 2MYSA 3JCMP 4JRKA 5L8RE 4J83A 2RK1A 5GAN4 1VQ7A 2EJ9A 2RO0A 2L3SA 7AT1B 4B9WA 2RHIA 1WXBA 1VQKT 2KYBA 4FYWB 4HCZA 3MO8A 2FEIA 3NGPA 4MDWA 4PJOE 4PJNA 4XAXB 3M56A 1ZLMA 2W0ZA 3RR6A 5IN1A 3VS5A 1IGQA 2DXUA 1MNDA 3MHXA 5FU6B 1KQ2A 1WQ7A 3E2UA 4QT7A 1JBMA 1OZ2A 3H0IA 3S6WA 3OYFA 1T0HA 4BY6C 2LT1A 4EMGA 2K3XA 1RADB 2AK5A 2RI3A 4UC4A 2XDPA 2ED0A 2ZGWA 1I5OB 5KYYB 4J6WA 4RTYA 1O75A 2DL3A 2NUTA 1GBRA 4E7KA 4KUDK 1Z9ZA 1QVGS 2JM9A 3CCRA 1VQ4A 2V8IA 4FYYB 1K9MU 1K8AR 4II1A 1VQLQ 4JUVA 3UF4A 5HK3A 2DEQA 4OF1A 2DL8A 1U06A 3VYHB 3OYHA 2KXDA 2VKNA 2BE7D 5FLXE 5A0LA 3CMEA 1AOJA 2QAZA 5LJ3d 4O6JA 5GAOr 2EQUA 4LDXA 2QYZA 5GAN7 1QLYA 9ATCB 4J9EA 5FU6C 2HAXA 4JZ3A 2JTEA 2O31A 1NPRA 1KIKA 1SHFA 1GCQC 5GAN2 2WSCE 4O5VA 4QVDA 2FO0A 1K76A 1JXMA 2MF2A 2LJ0A 4M7DD 2EW3A 1WPYA 3EFOA 2F1LA 3OYCA 5HK0A 2YDLA 3A8GB 4VUBA 1PSFA 1YJ9A 3SHWA 4RTZA 1D1CA 5GAMf 4AT1B 4IUUA 3PVQA 1TOVA 3OA6A 4OMNA 2VC8A 4P5NA 1U5SA 2RF0A 3QBYA 1YITQ 2C06A 3HRTA 1HXDA 1PHTA 2CT4A 1QWEA 1PG5B 3CCSQ 2EKOA 2G3RA 3EGDB 2QQBA 3HHTB 2DD5A 2HL5C 5A0DA 4Z89A 4OMOA 2JTFA 3QZ5B 3TREA 1VQPT 5GAN3 1AEYA 2Z0WA 1SHGA 2OTLA 3JCMf 1CKAA 4DEYA 5IHKA 3QWXX 1NJIR 1VUBA 1YP5A 5A2QE 4MZMA 1G5VA 2DKGA 4DEXA 2JM8A 4M7DF 1PM3A 4C0GA 3G4ST 3TSWA 1Q82C 2IPOB 3QZ9B 4MZTA 5CKEA 3OYDA 3Q1JA 5DM7R 4D8KA 2DZCA 4PFZA 2DZ9A 2QQRA 2DTOA 3MPUB 1JRIA 2ED1A 4C8QE 1VIFA 2KI7A 3CCMA 1N8RR 1VQ5A 2M0OA 4ZGDB 2MMPA 2LTOA 2AHJB 1PNJA 3VS6A 2DLPA 1IB8A 5LJ3e 3CEYA 3BDUA 1KC8R 3QIIA 4RG2A 1F1BB 3CD6Q 1WXTA 2RB6A 1FYNA 1QQJA 4OB2B 2XICA 1M90R 3ASKA 3OYJA 4E7ZA 2J7IA 2X35A 3M9QA 4C5HA 2QTXA 2AKKA 4B9XA 2EVRA 1Y7XA 3QPHA 1G3WA 4JRQA 1BCMA 3P8HA 3UWNA 4WCIA 2A08A 2K3YA 4KUIA 2LCCA 2KVQG 1M3AA 2JTMA 2ENMA 2YRCA 4X9DA 2RJEA 1SKUB 5HCKA 3UPUA 4A4KA 4PJOA 3TU4K 4CC3A 2GQIA 1YJNA 2JS2A 3G7ZA 1VQ7T 5LJ5h 2VUBA 4Z8AA 2HNIA 2E3IA 2XD0A 2ROTA 3I5SA 3I56A 1U8RA 4GBQA 1NEGA 2O9VA 2YWWA 3MKDA 1M2VA 4ZGEB 2M02A 3I55A 3NTIA 5GJVB 2AKLA 2RN8A 1VQMQ 1PRLC 1UDLA 2K3BA 2RH2A 3GNFB 5CK9A 2OI3A 3VYGA 2FZKB 1E6GA 3OW2P 4HVVA 5LJ3h 1NZ9A 4C0ZA 4J9IA 4KRTA 2A0FB 5CQYA 5IXFA 2MPXC 1RAAB 2HQEA 4EDUA 1TXQA 3LYIA 3GOXA 2VXFA 1SEMA 1K4US 2BIVA 3F70A 2HBPA 1VQ8A 4R55A 4XQ3A 2MAMA 4BI4A 3CCRT 1VQ4T 1TG0A 2HQXA 2VWFA 2YT6A 4XTXA 2M16A 2K5LA 4KULA 4EMKB 2BZYA 3JB9I 3A5ZB 3G1JA 1PCXA 3OY9A 3TSZA 2CZ1B 3CMET 4M77D 4BDZA 1JU5C 3THKA 4J9BA 1SSFA 2LQWA 1NLOC 3LWHA 3GF5A 2VASA 1FMKA 1WZOA 2C0OA 4A4GA 1EFNA 1M1FA 3OQ5A 4F7UG 3LH5A 1NE8A 1ZBXA 3AHUA 4L6V5 4ESRA 4AFUC 3PIPA 1AT1B 2H8HA 2VYTA 3E9FA 3OW2A 2DYIA 2RHYA 1ZA2B 1BI1A 1WNLA 5GMKe 1NBEB 2BZ8A 1N6AA 3MEVA 3QG1A 2Y90A 1YJ9T 1MMAA 4KGVB 4F16A 3A1PA 2HCKA 3JB9J 2HZYA 1WLPB 5FRMA 3CMAQ 2VGMA 4EMKC 3UA6A 5GANd 1BCOA 4FT4A 1YIJQ 2RHUA 2JZ2A 2HBWA 2X4YA 1VQNQ 4M77F 4OGEA 3CC2Q 3RKWA 5KCOA 2ZPHB 1KQSP 1UGRB 1SRLA 1WJSA 2OTLT 3OYGA 2DXBA 2CP7A 4MDXA 5I2MA 5D6WA 2L5QA 2CP2A 3CCQQ 1V76A 3VS0A 2DFUA 4J5YA 1B34B 4X9CA 2NUPA 2RI5A 4JLIA 2HL3A 1OU9A 2QQAA
chains in the Genus database with same CATH topology
3QJ6A 1M90C 3LGFA 2XIDA 5M9OA 4ZTFA 1K8AC 3S3NA 3WXMB 2YHTA 1WJRA 4BY6B 4X34A 4F7UE 3OYKA 5CKFA 2XHCA 2RHZA 4DA4A 1HK9A 1UGPB 2PU9B 2ZPFB 4ZN3A 1YHQT 3GIBA 3C12A 3RIRA 1MHNA 3BDLA 3V7RA 2LC4A 3L1AA 3CCMT 3OYBA 3BW1A 4A4EA 2QEXT 1VQ5T 2QDYB 2CZ6B 4JS5A 2XG8D 2FL7A 1X75C 3WVDB 2EJFA 2RJFA 3GNGA 3G71A 5IT9E 1Q86U 2JN0A 2E12A 2QA4A 4M77B 3CMAA 4BD3A 3JCMP 3CCEA 4JRKA 1P92A 5L8RE 1YITT 1OYXA 3FLGA 4J83A 3J7AF 2RK1A 5GAN4 1W2BS 1VQ7A 2EJ9A 2RO0A 3KXTA 3JCMQ 1YIJA 2E10A 2K5IA 1N9RA 5GAN6 3UDCA 4B9WA 3QYGB 3OS1A 3CCST 2RHIA 4ELYC 1VQKT 1VQNA 2QQSA 1FXXA 3N5BB 4C8QD 2RM4A 1NJIU 4C5EA 5DY9A 3CC7A 1VQ6A 3CC2A 3SDZA 4BE1A 3FIFA 4HCZA 2K4YA 4J6XA 3MO8A 4ME7A 4BI3A 1Q7YC 1JJ2A 4PJOC 1YJWA 5LJ5e 4MDWA 4XTVA 4HT9A 4PJOE 3RERA 4XAXB 3M56A 4FT2A 4MMLA 1LJOA 3GP8A 1BI2A 1KQSA 5IN1A 1G3YA 2EFIA 2DXUA 4Y28E 3SWNB 1RL2A 3MHXA 3CCQA 1QVGA 3FEOA 2EYQA 5FU6B 4FM4B 2LQ8A 1VQ9T 4LD6A 4MMKA 1N8RU 1WQ7A 5FU7B 3OYLA 1KQ2A 2DTHA 1KHCA 1JBMA 1OZ2A 4QVZA 3S6WA 3OYFA 4DOVA 3E19A 4M78D 4BY6C 3OMCA 2LT1A 5FROA 4EMGA 3CCUT 2K3XA 3L2VA 3EFSA 4DOWA 3PFSA 4E7JA 2RI3A 1LNXA 4UC4A 1BKBA 2L89A 2LX9A 2XDPA 2XI9A 4HCCA 2CGHA 1OZ3A 4L5GA 2R5AA 2E1HA 3V8KA 2LQKA 5GANe 1KC8U 4V2SA 3CBOA 2ZGWA 3OSVA 2ZPIB 3JB9D 4J6WA 4Y91A 3MP1A 4BE0A 1YJNT 1O75A 3O8VA 4QQDA 3HSBA 4KBMB 1V29B 4M77C 1Q86C 4E7KA 3FB9A 2LNVA 1KQSS 1M90U 1M1KU 4RMOA 4KUDK 3JCMW 2F69A 4M77E 2KDSA 4M7DA 1XNIA 4PKCC 4Z02A 1ZQ1A 1QVGS 2H3JA 2CYZB 5LJ5f 3CCRA 3QXEB 1VQ4A 2V8IA 3I56T 1K9MU 4OMFB 3OS5A 2LT4A 4C8QF 4BE2A 3OSSC 2DTIA 1NJIC 3CD6T 2ZPEB 4GY5A 4II1A 4JUVA 5GANg 3I55T 1IZ6A 5HK3A 4PL6A 3PT9A 2DEQA 4OF1A 3VYHB 3OYHA 2PQWA 5GAN5 3DB3A 5FLXE 5A0LA 5I2SA 3CMEA 3OBWA 1R8OB 4M7DB 2D0QB 2EQKA 2LVMA 3PGGA 2QI2A 5LJ3d 3OMGA 4O6JA 2FHDA 5GAOr 2EQUA 2PUKB 2DXTA 3H8ZA 4LDXA 5GAN7 2R57A 4FU6A 3RKYA 3S3MA 4M75D 3SWNC 3EFRA 3ZEHA 5FU6C 3J80E 2HAXA 2E70A 3HPWA 1NPRA 4FSXA 3CXCA 5FU7C 1N8RC 2WSFE 2V8KA 1M1GA 3M58A 4J6YA 1O9SA 1QVPA 5LJ3f 1U1SA 5GAN2 4C8QA 3RKXA 2CKKA 2WSCE 3FDRA 4O5VA 4QVDA 3OYEA 2M1HA 1QVFA 4QW2A 4RCCA 2Y4YA 2GFAA 5KE3A 2D9TA 3HFOA 1KC8C 2WACA 2MF2A 3SB2A 4LDWA 4M7DD 1GXIE 3V8JA 1M8VA 2BUDA 1WPYA 3JB9F 4FIBA 2DAQA 4IURA 4QQ6A 3OYCA 5HK0A 1Q82U 5GAOl 1VQ8T 4M7AD 3L42A 2KAFA 2MI6A 3A8GB 4VUBA 1PSFA 4J7FA 1YJ9A 1M1KC 1IREB 4M77G 3X20B 2GCXA 4C8QB 5GAMf 3MCAB 1U1TA 1X01A 4IUUA 3QYHB 1YBYA 3CXCS 4C92A 5KE2A 1K9MC 3MP6A 3META 3RMQA 1QP2A 2RJCA 2NLUA 4DQ2A 5GAN8 4CI0C 3OA6A 2VC8A 4P5NA 4XTUA 3QBYA 3TEEA 1VIEA 4M78A 3CCJT 2C06A 3CBMA 5CKBA 3CBPA 3HRTA 5CQXA 2L3RA 1QVFS 3JB9H 1HXDA 4J7IA 1VQLA 3J81E 3C4SA 3JCMd 2DK3A 2EKOA 2G3RA 1H3ZA 1VQMT 3JRZA 2QQBA 3HHTB 4M7DC 2DD5A 4RCBA 5A0DA 5GANh 2I2LA 1WQWA 2OTJT 2PUOB 5GANj 1EIFA 1BI0A 3RUXA 3JB9G 2JTFA 3QZ5B 1M9SA 4M75F 3TREA 1VQPT 5GAN3 1TH7A 4M78B 3G6ET 5CKDA 2OTLA 3JCMf 2M9UA 2R5MA 5GMKh 4PNOA 3E1SA 2GQVA 4ATOA 4ELZC 4OB3B 5GMKj 4IUVA 4EMKA 1X6OA 3L2UA 3OBYA 3ZBDA 1VUBA 2QXFA 3M57A 5A2QE 4MZMA 4RKUE 1S72A 4ZN1A 3CCVA 2IVWA 4XU1A 5HY6A 2CZ0B 1FWZA 1G5VA 3OYAA 2DKGA 2LCLA 4XU2A 3V7SA 4C0DB 4WF2A 4QVCA 4M7DF 3G4ST 2JOYA 4C0GA 4M7AF 3MEUA 1FX7A 1Q82C 2JNGA 3QZ9B 4C92D 1JJ2S 3P8DA 4MZTA 5CKEA 1XQHA 3LWIA 4A54A 4LDUA 4ZTJA 3OYDA 3Q1JA 5DM7R 2Y4XA 4M75A 4C8QC 1YI2T 2DZCA 2VGNA 1YHQA 2DZ9A 1NPPA 2QQRA 5CIUA 2DTOA 1JRIA 5LJ5g 3GPLA 1G3SA 4C8QE 2RI2A 4RG8A 2VXEA 1VIFA 3CCMA 3CCJA 2QEXA 1VQ5A 2HD0A 2M0OA 4IKFA 2EQJA 4BB7A 4ZGDB 2MMPA 3BFMA 3L2RA 2LTOA 2AHJB 3S3OA 3CC4T 1YITA 2RHXA 3HP9A 4N4GA 5LJ3e 3CEYA 5AYFA 3BDUA 1BIBA 4NL3A 3VUZA 5GAOq 2K2VA 3QIIA 2XK0A 4M75B 3FJPA 4RG2A 4F7UA 3CCLT 3CCSA 1VQKA 2RB6A 5CKHA 3L2WA 4M7AA 4N4IA 4M7DG 2E6NA 4LDVA 3H6ZA 5CCAA 4OB2B 4BUGA 3MEAA 3PIOA 4XTYA 2XICA 3X24B 3MP8A 2F5TX 3ASKA 2OAUA 3OYJA 4NOYA 4M78C 3L2QA 2ZPGB 1KD1U 3M55A 2X35A 3M9QA 3HRSA 4M78E 4C5HA 4CRIA 2QTXA 3VKIA 4HKEA 5GAMe 4Q5WA 4BDYA 1VQOT 4B9XA 3PMTA 5LJ3g 4HCBA 1Y7XA 5LL6S 3QPHA 1G3WA 1Y71A 5GMKi 4JRQA 4M7AB 2O01E 4HT8A 3P8HA 1UEBA 2YLCA 2YRVA 4XTZA 3UWNA 4C0DC 2DVEA 1I81A 3V8LA 1VQ9A 2XDBA 3HRUA 3M4YA 3QHSA 4C92F 2K3YA 2X4WA 4KUIA 2LCCA 2FB7A 2X4JA 1KG1A 2KSSA 2KVQG 3CCUA 2JTMA 1WJQA 1KQ1A 1N27A 3M5AA 4IUTA 4ZGJB 4X9DA 2RJEA 4PJOA 3UPUA 4A4KA 4M78F 2P0QA 1M5Q1 3HL8A 5GAMg 2DPPB 3QUIA 2DJZA 4N4HA 3WVEB 4C8QG 2QA4T 3PMIA 4TVRA 5GAOp 3OYNA 3TU4K 3CCET 2LRQA 2P0PA 3CMAT 2ZPBB 2WSEE 3FC3A 1I5LA 1YJNA 2EQMA 3JSCA 3G7ZA 3JCMe 1RI0A 1VQ7T 2KMTA 5LJ5h 3DLLA 1YIJT 4EMHA 2GF7A 3LH0A 3OS0A 2VUBA 3DB4A 4HA8A 3VV0A 5LJ5j 1VQNT 3CCLA 5A0GA 2HNIA 2EAYA 3EAEA 1DJ7B 2RD1A 4M75C 1LOJA 5GMKm 2XD0A 3QSUA 2X4XA 3I56A 3CC2T 4IUQA 1U8RA 4M75E 1BIAA 2P4TA 3QKJA 3CD6A 1YJWT 1BI3A 5CR2A 4ZGEB 2EJGA 3I55A 3NTIA 4R56A 5CO7A 3QJYA 4JLGA 1KD1C 4BI8B 2FYKA 3JCMg 5I21A 2F5KA 2PVGB 5DLOA 2RH2A 4M78G 2RJDA 3GNFB 5CK9A 2DD4A 3URGA 4OGCA 2A3LA 3M54A 2VV5A 5D6YA 4OB0B 3VU3C 3CCQT 3OYYA 4N0AA 1D3BA 3VJPA 1M4ZA 5CAIA 3R6OA 3L2ZA 3VYGA 4M7AC 4M7DE 4QQGA 5C0MA 4C92B 4C5IA 3A8MB 4M7AE 5LJ3h 4BACA 4PJOD 1NZ9A 4PLLA 4C0ZA 1I8FA 1UB4A 1Y96A 3LGLA 5EG2A 5LJ3j 1G3TA 3A8OB 2EIFA 4A4FA 1QP3A 4A53A 2FVUA 5CQYA 3JCMJ 3C95A 2HQEA 2BKDN 4L59A 4EDUA 1D3BB 3LYIA 3GOXA 4E7LA 4LD9K 5KCHA 2VXFA 4JRIA 3NFCA 1XTDA 3M59A 2CS7A 3OS2A 3HKSA 2BIVA 2XDDA 3F70A 2HBPA 1VQ8A 2DIGA 1N9SA 4J8OA 4R55A 5GAMh 4F7UF 1UGQB 1Y96B 3INZA 4XQ3A 3SWNA 2MAMA 3LX7A 4NL2A 5DLQE 2PVOB 4BI4A 4EPCA 5HKCA 5GAMj 3CCRT 3KBGA 2HQXA 2DO3A 2K5FA 1VQ4T 4NS5A 5FRNA 3RMSA 3FRNA 4XTXA 2M16A 2K5LA 4KULA 4EMKB 3JB9I 4YTLA 5IAYA 3KUFA 3A5ZB 4IUPA 1Y07A 2QQ9A 2MWPA 4JDSA 4M75G 1BYMA 2CZ7B 3OY9A 2JVVA 2E5QA 3X25B 2E6ZA 2JUFA 2CZ1B 3CMET 2B8AA 4M77D 4BDZA 4JJNK 1H641 3HFNA 3RESA 2DXCA 4E47A 1SSFA 2XKOC 3QDRB 3ZFJA 1VQMA 3JAME 3PNWC 3LW5E 4XK8E 3LWHA 3V7CA 3GF5A 3JCMb 2GFUA 5GAOn 2OTJA 3SFMA 5J39A 3C94A 4A4GA 3JCMh 1VQPA 1M1FA 3OQ5A 1JB0E 4XTWA 4C92C 4F7UG 3ER0A 4M7AG 2PVDB 3G6EA 1NE8A 2DIQA 3X28B 1MGQA 4PJOF 3OYIA 4C92E 1ZBXA 1WGSA 4LDYA 5LJ5d 1Q81U 3AHUA 2L8DA 3A8LB 3NTHA 4JRPA 1ZHIA 2R58A 4L6V5 4E7IA 1YCYA 1K73U 3PIPA 2VYTA 3E9FA 3OYMA 3OW2A 2RHYA 4N0AC 1BI1A 5J3BA 1WNLA 4F7UB 3GLXA 4GLKA 4C0FA 1K8AU 3G4SA 5GMKe 3P8BB 4FL6A 4OP0A 1N6AA 3MEVA 3QG1A 2Y90A 3SD4A 3JCMV 1YJ9T 2RA2A 3M53A 4D6WA 1KHIA 2E41A 4XU0A 3T9NA 4KT0E 2V8JA 3JB9J 3CPFA 2ZZDA 2YLBA 1YI2A 5FRMA 2KQWA 2VGMA 3PTAA 5C6SA 4EMKC 1XOVA 2LDMA 4XU3A 5GANd 3CPWA 3X26B 4FT4A 4OVAA 1AHJB 1OI1A 5CVIA 4PJOG 3LLRA 3G71T 1VQLT 2O4XA 2JZ2A 2RHUA 3E9GA 1UGSB 4MZPA 2IG0A 2X4YA 3BY7A 4OB1B 4M77F 3OB9A 3OW2S 4OGEA 3CC4A 4C5GA 3RKWA 1W4SA 2EWNA 5KCOA 1B34A 3VUBA 2A7YA 4JS4A 2E64A 2KK4A 3ME9A 5GANf 3A8HB 2ZPHB 3QO3A 2XU8A 1UGRB 5KH6A 1Q7YU 3CC7T 4A4HA 4PJOB 1WJSA 5GAOm 2OTLT 1VQ6T 3OYGA 3NTKA 2DXBA 2K57A 3M4GA 3MEWA 2O4XB 3DLMA 4MDXA 1I4K1 2KY9A 5I2MA 5D6WA 5GAMd 2L5QA 4C92G 4E7HA 3TCJA 3UT1A 1Q81C 3CPWS 1S72T 3CCVT 1VQOA 2P0KA 2D6FA 2ZCFB 4J5YA 2RK2A 1QW1A 5J26A 3JCMX 1B34B 3JCMc 4X9CA 4JLIA 2E65A 2RI5A 4PLIA 5D6XA 2MWOA 5GMKl 3DKMA 1W2BA 1K73C 2QQAA 1PSEA 4M77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKY A;  3BDU A;  1BIB A;  4NL3 A;  5GAO q;  4M75 D;  5GAM h;  4M75 B;  3EFR A;  3SWN C;  3FJP A;  1Y96 B;  3INZ A;  4XQ3 A;  3SWN A;  4F7U F;  4NL2 A;  4F7U A;  5GAM j;  2RB6 A;  2YHT A;  4M7A A;  4M7D G;  4F7U E;  4XTX A;  4XTY A;  1HK9 A;  4EMK B;  3JB9 I;  4J6Y A;  3GIB A;  5LJ3 f;  3RIR A;  1U1S A;  5GAN 2;  4C8Q A;  4NOY A;  4M78 C;  3RKX A;  3L1A A;  4M75 G;  3V7R A;  4QVD A;  3BW1 A;  4RCC A;  4M78 E;  2EJF A;  2QTX A;  2JN0 A;  4M77 D;  5GAM e;  4M77 B;  3JCM P;  3HFO A;  5LJ3 g;  4JRK A;  1H64 1;  3HFN A;  3RES A;  3SB2 A;  4M7D D;  3V8J A;  1M8V A;  1WPY A;  3JB9 F;  5GMK i;  4M7A D;  4M7A B;  5GAN 4;  5GAO l;  2EJ9 A;  4HT8 A;  3JCM Q;  2E10 A;  2YLC A;  1N9R A;  4XTZ A;  3V7C A;  5GAN 6;  2DVE A;  1I81 A;  3JCM b;  5GAO n;  3V8L A;  4M77 G;  4C8Q D;  4C8Q B;  3JCM h;  2RM4 A;  5GAM f;  3QHS A;  1U1T A;  1X01 A;  5DY9 A;  4C92 F;  4XTW A;  4C92 C;  4F7U G;  2FB7 A;  4C92 A;  4M7A G;  3FIF A;  4J6X A;  1KQ1 A;  1MGQ A;  4PJO F;  4PJO C;  5GAN 8;  4C92 E;  4DQ2 A;  4X9D A;  4PJO A;  5LJ5 d;  2VC8 A;  4M78 F;  3AHU A;  4XTU A;  1M5Q 1;  5GAM g;  5LJ5 e;  4M78 A;  4HT9 A;  3QUI A;  2DJZ A;  4XTV A;  4PJO E;  4C8Q G;  1YCY A;  3RER A;  5GAO p;  4MML A;  1HXD A;  3JB9 H;  1LJO A;  1I5L A;  3JCM d;  4N0A C;  3JCM e;  1WNL A;  4M7D C;  2DXU A;  3SWN B;  4F7U B;  4RCB A;  5LJ5 h;  5GAN h;  2I2L A;  4EMH A;  5GMK e;  4OP0 A;  1WQW A;  5LJ5 j;  5GAN j;  4HA8 A;  2Y90 A;  3JCM V;  4MMK A;  2RA2 A;  1WQ7 A;  2HNI A;  2EAY A;  3RUX A;  2DTH A;  3JB9 G;  1KQ2 A;  2RD1 A;  4M75 F;  4M75 C;  1LOJ A;  5GMK m;  3QSU A;  4XU0 A;  1JBM A;  2E41 A;  5GAN 3;  1TH7 A;  3JB9 J;  4M78 D;  4M78 B;  4EMG A;  4M75 E;  1BIA A;  2YLB A;  3JCM f;  5GMK h;  3EFS A;  4PNO A;  4EMK C;  2EJG A;  5GMK j;  1LNX A;  4EMK A;  4XU3 A;  5GAN d;  2CGH A;  3V8K A;  2E1H A;  5GAN e;  4V2S A;  2ZGW A;  4PJO G;  2FYK A;  3JCM g;  5I21 A;  3JB9 D;  4J6W A;  4Y91 A;  3HSB A;  4M78 G;  4XU1 A;  3BY7 A;  4M77 F;  4M77 C;  2DKG A;  3FB9 A;  4XU2 A;  3V7S A;  3VU3 C;  4WF2 A;  4QVC A;  4N0A A;  4M7D F;  1D3B A;  5CAI A;  4M77 E;  3RKW A;  2EWN A;  3JCM W;  1B34 A;  4M7D A;  3L2Z A;  4M7A F;  4M7A C;  4M7D E;  2E64 A;  5LJ5 f;  4C92 D;  5GAN f;  4C92 B;  3QO3 A;  4M7A E;  4A54 A;  5LJ3 h;  4PJO D;  4PJO B;  4M75 A;  5GAO m;  1I8F A;  4C8Q F;  1Y96 A;  4C8Q C;  2DZC A;  5LJ3 j;  2K57 A;  2DTI A;  3M4G A;  2DZ9 A;  2DTO A;  4A53 A;  1JRI A;  4JUV A;  5LJ5 g;  5GAN g;  1I4K 1;  4C8Q E;  2DEQ A;  2VXE A;  5GAM d;  4C92 G;  3JCM J;  5GAN 5;  1D3B B;  3BFM A;  4J5Y A;  2VXF A;  4JRI A;  3JCM X;  4M7D B;  1B34 B;  3PGG A;  4X9C A;  4JLI A;  2E65 A;  5LJ3 d;  3JCM c;  5GMK l;  5GAO r;  5LJ3 e;  2DXT A;  5GAN 7;  4M77 A;  1N9S A; 
#chains in the Genus database with same CATH topology
 2DE0 X;  1ABO A;  1RUW A;  1K8A C;  2YHT A;  4X34 A;  1LPL A;  5CKF A;  2XHC A;  1HK9 A;  2ZPF B;  4ZN3 A;  3C12 A;  1MHN A;  1UHC A;  3CCM T;  3OYB A;  1VQ5 T;  2CZ6 B;  2EJF A;  1TUG B;  4M77 B;  4BD3 A;  3MJX A;  1OYX A;  3J7A F;  1W2B S;  4CC4 B;  3KXT A;  2K5I A;  2H3E B;  8ATC B;  1SRM A;  2J6O A;  2LZ6 B;  2RM4 A;  1VQ6 A;  2K4Y A;  5FW9 A;  2KT1 A;  2COY A;  1YJW A;  3CXC P;  4HT9 A;  3RER A;  1TWB A;  2KR3 A;  1BI2 A;  1KQS A;  1RL2 A;  1QVF P;  1V1C A;  4LD6 A;  3OYL A;  2HKN A;  1JXO A;  1WX6 A;  4QVZ A;  3OMC A;  1YN8 A;  2EYW A;  1LNX A;  4HCC A;  2LX9 A;  3ULR B;  4KGZ B;  1OZ3 A;  4L5G A;  1WXU A;  3V8K A;  1I0C A;  3D7S B;  5GAN e;  1HSQ A;  6AT1 B;  2ZPI B;  1RAB B;  2DA9 A;  2NYS A;  3MP1 A;  4BE0 A;  1YJN T;  5FWB A;  4M77 C;  1Q86 C;  2ATC B;  4FW1 A;  1Q81 R;  2EYX A;  4PKC C;  1GBQ A;  1M27 C;  3C0C A;  3I56 T;  3OSS C;  2LP5 A;  1NJI C;  2ZPE B;  1G2B A;  3I55 T;  3PT9 A;  5IH2 A;  2CH4 W;  3M0P A;  1OV3 A;  1EZZ B;  5GAN 5;  3DB3 A;  1RLQ C;  2YXY A;  1IGU A;  1R8O B;  3PGG A;  1JO8 A;  2FHD A;  1TU0 B;  4FU6 A;  3NPF A;  2FG0 A;  1VQ6 Q;  3QDF A;  2J06 A;  3EGX A;  2EBP A;  3CXC A;  1N8R C;  1M1G A;  1O9S A;  3CCV Q;  3OYE A;  3FDR A;  1YCS B;  2RQR A;  4AFS C;  1QVF A;  1RAC B;  4QW2 A;  2GFA A;  5KE3 A;  2D9T A;  3HFO A;  3FJ5 A;  1KC8 C;  1GXI E;  4HXJ A;  3V8J A;  1M8V A;  2BUD A;  2YRD A;  4QQ6 A;  1Q82 U;  1VQ8 T;  3L42 A;  4ORZ A;  2MI6 A;  2DEU A;  1ZA1 B;  1VYV A;  2YUO A;  2DBM A;  1QCN A;  4M77 G;  2DRM A;  2GCX A;  1X01 A;  4PJJ A;  2QEX Q;  2RJC A;  4CI0 C;  4QKU A;  1M3C A;  4M78 A;  2LCS A;  5CKB A;  3CBP A;  5CQX A;  3EFO B;  2L3R A;  3R6N A;  4CC2 A;  4J7I A;  1VQL A;  3JCM d;  3EH2 A;  1JEG A;  1H3Z A;  4LE9 A;  2E3H A;  5KYW A;  5GAN h;  2I2L A;  3U23 A;  3RUX A;  5ECA A;  2J6F A;  1QCF A;  1G83 A;  1TH7 A;  2K2M A;  2M9U A;  2R5M A;  3A98 A;  3E1S A;  2GQV A;  4ATO A;  1NM7 A;  4OB3 B;  3NHN A;  4IUV A;  1RAH B;  4RKU E;  2CZ0 B;  1VQ9 Q;  2L2P A;  1FWZ A;  1X43 A;  1WI7 A;  4WF2 A;  2JOY A;  1YWO A;  4ZNX A;  2ZAE A;  3MEU A;  3CCU Q;  4J9F A;  4C92 D;  1JJ2 S;  2RQU A;  4ZTJ A;  4M75 A;  1SF9 A;  2DVJ A;  4LN2 A;  5CIU A;  1NPP A;  1WHH A;  4HVU A;  1G3S A;  4OMM A;  2RI2 A;  4RG8 A;  2VXE A;  2DRK A;  3CCJ A;  1GFC A;  3M0U A;  2EQJ A;  4BB7 A;  1TUC A;  3BFM A;  1LCK A;  3S3O A;  2ABL A;  1YIT A;  3HP9 A;  2QAS A;  1WFW A;  5AYF A;  5GAO q;  2K2V A;  1G8X A;  2XK0 A;  4E6R A;  3CCL T;  3CCS A;  1NYG A;  4IIO A;  5CKH A;  4M7A A;  2QGF B;  1MMD A;  4XTY A;  1YNZ A;  3X24 B;  1UG1 A;  4M4Z A;  1M1K R;  4AFZ C;  3L2Q A;  3H9N A;  3TQ7 P;  1M30 A;  3VKI A;  5GAM e;  2O01 E;  1OQK A;  2YLC A;  1I81 A;  5I11 A;  1OU8 A;  4C92 F;  2X4J A;  2FB7 A;  4IIM A;  1KQ1 A;  1N27 A;  4ZGJ B;  2P0Q A;  2CSQ A;  2CP5 A;  2DJZ A;  4N4H A;  3WVE B;  5GAO p;  3RNJ A;  2LRQ A;  1I5L A;  1SPK A;  3JCM e;  2DER A;  5LJ5 j;  4HA8 A;  2FPF A;  4AFQ C;  1ZSZ A;  2DYB A;  2K79 A;  2O88 A;  1VYU A;  2FRY A;  2JXB A;  5KYN A;  2X4X A;  1ZUU A;  3CCJ Q;  3QKJ A;  2KRN A;  3CD6 A;  1YJW T;  1BI3 A;  5GJW B;  1D09 B;  1QCO A;  1M3B A;  4BI8 B;  1OEB A;  2FYK A;  5I21 A;  2F5K A;  5DLO A;  2OTJ Q;  1RI9 A;  4OB0 B;  4N0A A;  3H0H A;  1Y0M A;  3VJP A;  1M4Z A;  4M7D E;  1PKS A;  4C92 B;  4C5I A;  1Q86 R;  3A8M B;  1M2V B;  4BAC A;  4PLL A;  2K7A A;  5LJ3 j;  3VS7 A;  1GFD A;  2FVU A;  2DL5 A;  3C95 A;  4L59 A;  2IIM A;  4JRI A;  4J9C A;  1WHL A;  3NFC A;  1WYX A;  1M8M A;  2XDD A;  4J8O A;  5GAM h;  4F7U F;  1YI2 Q;  2HSE B;  2LMJ A;  3QWY A;  5FRN A;  1TUD A;  3CC4 Q;  3X25 B;  3EH1 A;  2HDA A;  2E6Z A;  4JJN K;  2D8H A;  1H64 1;  3HFN A;  4E47 A;  2XKO C;  2SRC A;  1VA7 A;  1VQM A;  2ECZ A;  1WIE A;  3LW5 E;  3PNW C;  2EKH A;  5J39 A;  3JCM h;  4XTW A;  4C92 C;  3G6E A;  2ESW A;  3OYI A;  1VQO Q;  1T3S A;  1WGS A;  4LNP A;  4JRP A;  1YCY A;  2L3P A;  1IO6 A;  4GLM A;  4LXC A;  4F7U B;  1KD1 R;  4C0F A;  1K8A U;  4OP0 A;  4CC7 A;  4JPB W;  2D0N A;  2D8J A;  3T9N A;  2ZZD A;  2YLB A;  2QA4 Q;  3PTA A;  3CCE Q;  2LDM A;  1GRI A;  2C0I A;  3X26 B;  1QWF A;  4OVA A;  1OI1 A;  4PJO G;  2QTV A;  1OX9 A;  4F17 A;  1VQL T;  4OB1 B;  1H8K A;  3KFV A;  4J9G A;  4C5G A;  1W1F A;  3VUB A;  2A7Y A;  2E64 A;  3A8H B;  2AT1 B;  1QVG P;  2DM1 A;  4C92 G;  1X27 A;  3TCJ A;  1Q81 C;  3CPW S;  1HD3 A;  2D6F A;  2ZCF B;  4FSS A;  5D6X A;  4Y92 A;  4RTX A;  3QJ6 A;  5M9O A;  3G6E Q;  3S3N A;  1WJR A;  3RDV A;  3OYK A;  2HEQ A;  2DIL A;  3GIB A;  1AZG B;  3V7R A;  4J9H A;  4A4E A;  2NUP B;  4JS5 A;  1OX8 A;  1X75 C;  3G71 A;  1Q86 U;  2E12 A;  3CMA A;  1YIT T;  2CUB A;  4E2F B;  1JJ2 A;  1YIJ A;  2E10 A;  1N9R A;  4KGX B;  3OS1 A;  3CCS T;  4ELY C;  1VQN A;  2QQS A;  1I07 A;  2EYY A;  3N5B B;  1NJI U;  4C5E A;  3CC7 A;  3CC2 A;  3SDZ A;  4BE1 A;  4J6X A;  2QG9 B;  2QGG A;  4ME7 A;  1UFF A;  2JJ9 A;  3ZL7 C;  2G6F X;  4MML A;  1LJO A;  4K11 A;  1MMG A;  2EFI A;  4Y28 E;  3SWN B;  3CCQ A;  1QVG A;  2EYQ A;  4FM4 B;  1N8R U;  1A0N B;  4DOV A;  4M78 D;  5FRO A;  3L2V A;  4DOW A;  2KNB B;  4E7J A;  1WDX A;  1BKB A;  2L89 A;  2CGH A;  1KC8 U;  4V2S A;  3CBO A;  3OSV A;  1M2O A;  8AT1 B;  1KK7 A;  3HSB A;  5D7U A;  4D8D A;  2LNV A;  1M90 U;  4R0K A;  3JCM W;  4M77 E;  1T3L A;  2KDS A;  4M7D A;  4Z02 A;  2H3J A;  2CYZ B;  1MUZ A;  2LJ1 A;  3QXE B;  5KYX A;  1EX4 A;  3OS5 A;  2EGC A;  3CD6 T;  3G71 Q;  4GY5 A;  3VS2 A;  1IZ6 A;  2PQW A;  1PWT A;  4OMP A;  3OBW A;  2LJ3 A;  2QI2 A;  1K9A A;  2PUK B;  3H8Z A;  2R57 A;  3I5R A;  3S3M A;  3RKY A;  3CC7 Q;  5IHI A;  2HQH A;  4M75 D;  3SWN C;  3J80 E;  2E70 A;  3HPW A;  2D1X A;  2GGR A;  2V8K A;  3M58 A;  4J6Y A;  4C8Q A;  1S72 Q;  3RKX A;  2CKK A;  2YUQ A;  4RCC A;  2Y4Y A;  4PK4 A;  1Q7Y R;  3SB2 A;  4LDW A;  2DAQ A;  4M7A D;  1J3T A;  2CSI A;  2KAF A;  1YHQ Q;  1M1K C;  3X20 B;  3QYH B;  5KE2 A;  3RMQ A;  1QP2 A;  2NLU A;  5GAN 8;  2HSP A;  4FYX B;  2JMC A;  1VIE A;  3CBM A;  1C6V X;  3JB9 H;  3EHR A;  1ZUK A;  4OML A;  1VQK Q;  4ANJ A;  1VQM T;  4RCB A;  2PUO B;  5GAN j;  1E7O A;  1EIF A;  2PTK A;  1D1A A;  3JB9 G;  1M9S A;  2QK0 A;  4M75 F;  2AZV A;  4M78 B;  3G6E T;  5GMK h;  4ELZ C;  4EMK A;  1X6O A;  2QXF A;  1X2Q A;  5KYW B;  3CCV A;  4XU1 A;  3NMZ C;  5HY6 A;  3OYA A;  1NYF A;  4C0D B;  2LCL A;  3V7S A;  4QVC A;  4M7A F;  2OJ2 A;  3LWI A;  1XQH A;  2Y4X A;  2VGN A;  1AWX A;  5LJ5 g;  3GPL A;  3EG9 A;  2QEX A;  1S1N A;  1TSF A;  2RHX A;  4N4G A;  4J9D A;  5I22 A;  4NL3 A;  1BIB A;  3VUZ A;  4M75 B;  3SEM A;  3FJP A;  3VS3 A;  3L2W A;  4N4I A;  2KBT A;  1RAG B;  2X3W D;  4LDV A;  3H6Z A;  5CCA A;  4BUG A;  3MEA A;  3PIO A;  1TS9 A;  3MP8 A;  2F5T X;  4EIK A;  2OAU A;  2RQT A;  1K0X A;  4M78 C;  2ZPG B;  5IXB A;  2NUT B;  1K9M R;  1D0Z A;  1JQQ A;  4BDY A;  4HCB A;  5LJ3 g;  3PMT A;  1B07 A;  5LL6 S;  1Y71 A;  4JJC A;  4M7A B;  4C0D C;  1QKX A;  1AWW A;  1ZSG A;  2DVE A;  1LVK A;  3V8L A;  1VQ9 A;  3HRU A;  2X3X D;  2KSS A;  3CCU A;  1C1A A;  1WJQ A;  4IUT A;  2O2O A;  3QUI A;  1WHK A;  1X69 A;  3OYN A;  3CMA T;  2P0P A;  2DL7 A;  2WSE E;  3FC3 A;  2EQM A;  2CP0 A;  2GTO A;  2F2V A;  1RAF B;  2M51 A;  1YIJ T;  4EMH A;  2GF7 A;  3OS0 A;  1VQN T;  2EAY A;  3EAE A;  5KYU A;  1DJ7 B;  2RD1 A;  4M75 C;  1LOJ A;  3QSU A;  3CC2 T;  5CR2 A;  1MNE A;  3VRY A;  2COW A;  5CO7 A;  3AT1 B;  4JLG A;  1NEB A;  1KD1 C;  2PVG B;  4M78 G;  2RJD A;  2DD4 A;  3URG A;  1ZSZ B;  2A3L A;  3CCQ T;  3VU3 C;  1VQP Q;  1D3B A;  5CAI A;  3R6O A;  1ARK A;  3L2Z A;  4M7A C;  4QQG A;  2VB6 A;  5C0M A;  2DMO A;  2NUZ A;  4PJO D;  1UHF A;  1I8F A;  1Y96 A;  1WA7 A;  3LGL A;  2EIF A;  2JS0 A;  4A53 A;  3JCM J;  1SSH A;  2BKD N;  1WHG A;  3M0Q A;  3G4S Q;  4A63 B;  4LD9 K;  5KCH A;  3M59 A;  1GL5 A;  2CS7 A;  3HKS A;  2AZS A;  2FPE A;  1B7T A;  2RPN A;  1UGQ B;  3INZ A;  4NL2 A;  5GAM j;  2PVO B;  4EPC A;  3KBG A;  2K5F A;  4NS5 A;  2GBQ A;  3RMS A;  2HMA A;  3FRN A;  1AWJ A;  5IAY A;  2K6D A;  3KUF A;  1PRM C;  2QQ9 A;  4M75 G;  1BYM A;  2CZ7 B;  4RTV A;  2V1Q A;  1RAE B;  2JVV A;  2GNC A;  3VS4 A;  2JUF A;  3RES A;  3QDR B;  3UAT A;  3ZFJ A;  3JAM E;  1AZE A;  1ZSZ C;  3V7C A;  1W6X A;  3JCM b;  2OTJ A;  2LNH B;  4JZ4 A;  1WHM A;  1W2B P;  1C0M A;  1JB0 E;  1D1B A;  4M7A G;  1MGQ A;  4PJO F;  4E7S A;  4C92 E;  5LJ5 d;  1Q81 U;  2L8D A;  3NTH A;  2R58 A;  4E7I A;  4Z88 A;  2MCN A;  4N0A C;  3GLX A;  5IHN A;  4FL6 A;  2A37 A;  3SD4 A;  3JCM V;  3M53 A;  1OPL A;  2L0A A;  1E6H A;  1KHI A;  4XU0 A;  4KT0 E;  1YI2 A;  2KQW A;  4OMQ A;  2EYZ A;  4XU3 A;  1VQ7 Q;  1AHJ B;  5CVI A;  3LLR A;  2O4X A;  4MZP A;  4AG1 C;  2RNA A;  2DX1 A;  2F2W A;  3OW2 S;  3CC4 A;  2EWN A;  2O9S A;  2KEA A;  2KK4 A;  3ME9 A;  3QO3 A;  1SG5 A;  1PC0 A;  2XU8 A;  5KH6 A;  2DL4 A;  2KE9 A;  4A4H A;  1VQ6 T;  4PJO B;  2MIO A;  3NTK A;  3M4G A;  1U3O A;  1IRX A;  2JW4 A;  1I4K 1;  2BZX A;  3UT1 A;  1BBZ A;  3CCV T;  1VQO A;  2P0K A;  5J26 A;  1QW1 A;  3JCM X;  3JCM c;  1W2B A;  2E65 A;  5GMK l;  4PLI A;  1K73 C;  2MWO A;  1FMV A;  4ZTF A;  3EG2 A;  4F7U E;  1H3H A;  1NG2 A;  2PU9 B;  1AVZ C;  3RIR A;  2LC4 A;  1KFZ A;  1MMN A;  2QEX T;  2QDY B;  2FL7 A;  4DBR A;  3GNG A;  2JN0 A;  2QA4 A;  1ZUY A;  3CCE A;  1P92 A;  4KH0 B;  4LUD A;  2CT3 A;  2BTT A;  3FLG A;  3GBQ A;  3CCR Q;  1VQ4 Q;  3M0S A;  3JCM Q;  5GAN 6;  1X6G A;  2KYM A;  3EG1 A;  3UDC A;  3QYG B;  2DJQ A;  4C8Q D;  1FXX A;  1HYO A;  5DY9 A;  2NWM A;  2RQW A;  3FIF A;  1UGV A;  1Q7Y C;  3CME Q;  2EGE A;  4BI3 A;  4PJO C;  1GCQ A;  1T0J A;  2HKQ B;  5LJ5 e;  4XTV A;  4FT2 A;  3EGU A;  3GP8 A;  4HVW A;  1G3Y A;  3FEO A;  5KYY A;  1D0Y A;  2JMA A;  2FZG B;  2LQ8 A;  1VQ9 T;  4MMK A;  5FU7 B;  2DTH A;  1R0C B;  1KHC A;  3E19 A;  3CCU T;  3EFS A;  3PFS A;  1R0B G;  2F2X A;  2XI9 A;  2R5A A;  2E1H A;  2LQK A;  1YFN A;  3JB9 D;  4Y91 A;  3UA7 A;  3O8V A;  1YJ9 Q;  4QQD A;  4KBM B;  1V29 B;  1WHJ A;  3FB9 A;  1KQS S;  2FPD A;  1X2K A;  1M1K U;  4RMO A;  2E4H A;  2F69 A;  1XNI A;  1ZQ1 A;  3H0F A;  5LJ5 f;  3CQT A;  4OMF B;  2I0N A;  2LT4 A;  4C8Q F;  4BE2 A;  3JV3 A;  2DTI A;  4PJM A;  1JJ2 P;  1D0X A;  4DBF A;  5GAN g;  4PL6 A;  2MK5 A;  5FWC A;  1YWP A;  5I2S A;  1CSK A;  1MV0 B;  4M7D B;  2D0Q B;  2EQK A;  2LVM A;  2CDT A;  1BK2 A;  2CH4 A;  1ZX6 A;  3OMG A;  1H92 A;  2DXT A;  2EQI A;  5KYX B;  2OTL Q;  3EFR A;  3ZEH A;  4RTW A;  2DBK A;  4FSX A;  2CP3 A;  5FU7 C;  2WSF E;  2FZC B;  1QVP A;  5LJ3 f;  1U1S A;  5EC7 A;  1OOT A;  2M1H A;  2RMO A;  2WAC A;  2YUP A;  1N5Z A;  4FIB A;  3JB9 F;  4IUR A;  1I1J A;  5GAO l;  4PJL A;  4J7F A;  2KT8 A;  3TVT A;  1IRE B;  3EGD A;  4C8Q B;  3MCA B;  3CCM Q;  1U1T A;  1UE9 A;  1VQ5 Q;  1YBY A;  3CXC S;  1IHW A;  4C92 A;  4KH1 B;  3MP6 A;  1K9M C;  3MET A;  2EPD A;  4DQ2 A;  2V1R A;  4XTU A;  3TEE A;  3CCJ T;  3VRZ A;  1QVF S;  2OX7 A;  2KRM A;  3J81 E;  3C4S A;  2DK3 A;  2LX7 A;  1X6B A;  3JRZ A;  4M7D C;  2PZ1 A;  2KGT A;  1WQW A;  2OTJ T;  1BI0 A;  2W10 A;  1HJD A;  1UUE A;  1VOM A;  5CKD A;  1Q95 G;  4PNO A;  2SEM A;  2B86 A;  2KRO A;  2XMF A;  4LUE A;  4B6M A;  5GMK j;  3PVL A;  3L2U A;  3OBY A;  3ZBD A;  3M57 A;  1S72 A;  5AT1 B;  4ZN1 A;  2IVW A;  4XU2 A;  1VYT A;  1FX7 A;  2JNG A;  2V26 A;  3P8D A;  4DBH A;  4PFP A;  4A54 A;  4LDU A;  4C8Q C;  1YI2 T;  1YHQ A;  1YJN Q;  2HD0 A;  3EG0 A;  1B3Q A;  2COZ A;  4X1V A;  3L2R A;  3O5Z A;  3CC4 T;  1RLP C;  2DF6 A;  3I56 Q;  4F7U A;  2YUN A;  1VQK A;  5L23 A;  1K73 R;  4M7D G;  3I55 Q;  2E6N A;  2EGA A;  3EG9 B;  2CRE A;  1UEC A;  2CP6 A;  4NOY A;  1KD1 U;  4FYV B;  3M55 A;  2C0T A;  3HRS A;  4M78 E;  4CRI A;  1AWO A;  1VQO T;  4HKE A;  4Q5W A;  1TTH B;  2M0Y A;  5GMK i;  3BE3 A;  4HT8 A;  1UEB A;  2YRV A;  4XTZ A;  3EG3 A;  1UJ0 A;  2XDB A;  3M4Y A;  3QHS A;  1Z9Q A;  2X4W A;  1KG1 A;  3M5A A;  2J6K A;  4M78 F;  3HL8 A;  1M5Q 1;  2KRS A;  5GAM g;  2DPP B;  4C8Q G;  2QA4 T;  1VQ8 Q;  3PMI A;  4TVR A;  3CCE T;  2ZPB B;  1MV3 A;  3JSC A;  1RI0 A;  2P84 A;  1ZBJ A;  2KMT A;  3DLL A;  3EGX B;  3LH0 A;  3DB4 A;  2ROL A;  3VV0 A;  3CCL A;  5A0G A;  3HTR A;  5GMK m;  1IXD A;  1K1Z A;  4IUQ A;  3H41 A;  1BU1 A;  2BE9 B;  4M75 E;  1BIA A;  2QDL A;  2P4T A;  4RTT A;  1Q82 R;  2EJG A;  4R56 A;  1R77 A;  3QJY A;  3JCM g;  2AIR B;  2PNI A;  4OGC A;  3M54 A;  2VV5 A;  5D6Y A;  5KYU B;  3OYY A;  2OAW A;  2FRW A;  1Y57 A;  4M7A E;  1UB4 A;  2X9H A;  5EG2 A;  1G3T A;  3A8O B;  4A4F A;  1QP3 A;  2GTJ A;  4AG2 C;  1K0S A;  4AMC A;  1D3B B;  4E7L A;  1XTD A;  1FMW A;  3OS2 A;  3CPW P;  1UTI A;  1GCP A;  1N9S A;  2DIG A;  1Y96 B;  3SWN A;  2X51 A;  3LX7 A;  5DLQ E;  1IHV A;  5HKC A;  3PE0 A;  2DO3 A;  2MOX A;  2DNU A;  4FCY A;  3I9Q A;  4YTL A;  4IUP A;  1Y07 A;  1QKW A;  2MWP A;  4HCK A;  4JDS A;  2E5Q A;  3M0T A;  4WTO B;  2B8A A;  4JJD A;  2DXC A;  3RBB B;  3CCL Q;  1PD0 A;  4XK8 E;  1QMC A;  2GFU A;  5GAO n;  1PD1 A;  2A36 A;  3C94 A;  3SFM A;  2K9G A;  1VQP A;  1AD5 A;  4RTU A;  3ER0 A;  2PVD B;  2DIQ A;  3X28 B;  4LDY A;  2LQN A;  3A8L B;  1ZHI A;  1ACM B;  3IQL A;  1K73 U;  1ABQ A;  3I35 A;  3OYM A;  5J3B A;  2JT4 A;  4JJB A;  4GLK A;  3G4S A;  3P8B B;  4IKF A;  2RA2 A;  4D6W A;  2CUD A;  2E41 A;  4PFO A;  2V8J A;  2VVK A;  1KJW A;  3CPF A;  2E5K A;  5C6S A;  1XOV A;  3CPW A;  4F04 B;  3G71 T;  3E9G A;  1W70 A;  1UGS B;  2IG0 A;  3BY7 A;  3OB9 A;  4DBQ A;  2RQV A;  1W4S A;  1B34 A;  1KSW A;  2A28 A;  4JS4 A;  3VS1 A;  5GAN f;  1YJW Q;  1Q7Y U;  1XJW B;  3CC7 T;  5GAO m;  2K57 A;  3REB B;  1OUL A;  3MEW A;  2O4X B;  3DLM A;  2KY9 A;  5GAM d;  4E7H A;  3REA B;  2J05 A;  1S72 T;  1OPK A;  2RK2 A;  4F14 A;  3DKM A;  1PSE A;  4M77 A;  1RAI B;  1CKB A;  1M90 C;  3EHQ A;  3LGF A;  2L3Q A;  2XID A;  1UJY A;  1BB9 A;  2KXC A;  3WXM B;  4BY6 B;  2RHZ A;  4DA4 A;  1UGP B;  1YHQ T;  2P4R A;  2DET A;  1NLP C;  3BDL A;  2YSQ A;  3L1A A;  3BW1 A;  1PKT A;  2XG8 D;  3M0R A;  3WVD B;  2RJF A;  4FW2 A;  4RUG A;  5IT9 E;  2MYS A;  3JCM P;  4JRK A;  5L8R E;  4J83 A;  2RK1 A;  5GAN 4;  1VQ7 A;  2EJ9 A;  2RO0 A;  2L3S A;  7AT1 B;  4B9W A;  2RHI A;  1WXB A;  1VQK T;  2KYB A;  4FYW B;  4HCZ A;  3MO8 A;  2FEI A;  3NGP A;  4MDW A;  4PJO E;  4PJN A;  4XAX B;  3M56 A;  1ZLM A;  2W0Z A;  3RR6 A;  5IN1 A;  3VS5 A;  1IGQ A;  2DXU A;  1MND A;  3MHX A;  5FU6 B;  1KQ2 A;  1WQ7 A;  3E2U A;  4QT7 A;  1JBM A;  1OZ2 A;  3H0I A;  3S6W A;  3OYF A;  1T0H A;  4BY6 C;  2LT1 A;  4EMG A;  2K3X A;  1RAD B;  2AK5 A;  2RI3 A;  4UC4 A;  2XDP A;  2ED0 A;  2ZGW A;  1I5O B;  5KYY B;  4J6W A;  4RTY A;  1O75 A;  2DL3 A;  2NUT A;  1GBR A;  4E7K A;  4KUD K;  1Z9Z A;  1QVG S;  2JM9 A;  3CCR A;  1VQ4 A;  2V8I A;  4FYY B;  1K9M U;  1K8A R;  4II1 A;  1VQL Q;  4JUV A;  3UF4 A;  5HK3 A;  2DEQ A;  4OF1 A;  2DL8 A;  1U06 A;  3VYH B;  3OYH A;  2KXD A;  2VKN A;  2BE7 D;  5FLX E;  5A0L A;  3CME A;  1AOJ A;  2QAZ A;  5LJ3 d;  4O6J A;  5GAO r;  2EQU A;  4LDX A;  2QYZ A;  5GAN 7;  1QLY A;  9ATC B;  4J9E A;  5FU6 C;  2HAX A;  4JZ3 A;  2JTE A;  2O31 A;  1NPR A;  1KIK A;  1SHF A;  1GCQ C;  5GAN 2;  2WSC E;  4O5V A;  4QVD A;  2FO0 A;  1K76 A;  1JXM A;  2MF2 A;  2LJ0 A;  4M7D D;  2EW3 A;  1WPY A;  3EFO A;  2F1L A;  3OYC A;  5HK0 A;  2YDL A;  3A8G B;  4VUB A;  1PSF A;  1YJ9 A;  3SHW A;  4RTZ A;  1D1C A;  5GAM f;  4AT1 B;  4IUU A;  3PVQ A;  1TOV A;  3OA6 A;  4OMN A;  2VC8 A;  4P5N A;  1U5S A;  2RF0 A;  3QBY A;  1YIT Q;  2C06 A;  3HRT A;  1HXD A;  1PHT A;  2CT4 A;  1QWE A;  1PG5 B;  3CCS Q;  2EKO A;  2G3R A;  3EGD B;  2QQB A;  3HHT B;  2DD5 A;  2HL5 C;  5A0D A;  4Z89 A;  4OMO A;  2JTF A;  3QZ5 B;  3TRE A;  1VQP T;  5GAN 3;  1AEY A;  2Z0W A;  1SHG A;  2OTL A;  3JCM f;  1CKA A;  4DEY A;  5IHK A;  3QWX X;  1NJI R;  1VUB A;  1YP5 A;  5A2Q E;  4MZM A;  1G5V A;  2DKG A;  4DEX A;  2JM8 A;  4M7D F;  1PM3 A;  4C0G A;  3G4S T;  3TSW A;  1Q82 C;  2IPO B;  3QZ9 B;  4MZT A;  5CKE A;  3OYD A;  3Q1J A;  5DM7 R;  4D8K A;  2DZC A;  4PFZ A;  2DZ9 A;  2QQR A;  2DTO A;  3MPU B;  1JRI A;  2ED1 A;  4C8Q E;  1VIF A;  2KI7 A;  3CCM A;  1N8R R;  1VQ5 A;  2M0O A;  4ZGD B;  2MMP A;  2LTO A;  2AHJ B;  1PNJ A;  3VS6 A;  2DLP A;  1IB8 A;  5LJ3 e;  3CEY A;  3BDU A;  1KC8 R;  3QII A;  4RG2 A;  1F1B B;  3CD6 Q;  1WXT A;  2RB6 A;  1FYN A;  1QQJ A;  4OB2 B;  2XIC A;  1M90 R;  3ASK A;  3OYJ A;  4E7Z A;  2J7I A;  2X35 A;  3M9Q A;  4C5H A;  2QTX A;  2AKK A;  4B9X A;  2EVR A;  1Y7X A;  3QPH A;  1G3W A;  4JRQ A;  1BCM A;  3P8H A;  3UWN A;  4WCI A;  2A08 A;  2K3Y A;  4KUI A;  2LCC A;  2KVQ G;  1M3A A;  2JTM A;  2ENM A;  2YRC A;  4X9D A;  2RJE A;  1SKU B;  5HCK A;  3UPU A;  4A4K A;  4PJO A;  3TU4 K;  4CC3 A;  2GQI A;  1YJN A;  2JS2 A;  3G7Z A;  1VQ7 T;  5LJ5 h;  2VUB A;  4Z8A A;  2HNI A;  2E3I A;  2XD0 A;  2ROT A;  3I5S A;  3I56 A;  1U8R A;  4GBQ A;  1NEG A;  2O9V A;  2YWW A;  3MKD A;  1M2V A;  4ZGE B;  2M02 A;  3I55 A;  3NTI A;  5GJV B;  2AKL A;  2RN8 A;  1VQM Q;  1PRL C;  1UDL A;  2K3B A;  2RH2 A;  3GNF B;  5CK9 A;  2OI3 A;  3VYG A;  2FZK B;  1E6G A;  3OW2 P;  4HVV A;  5LJ3 h;  1NZ9 A;  4C0Z A;  4J9I A;  4KRT A;  2A0F B;  5CQY A;  5IXF A;  2MPX C;  1RAA B;  2HQE A;  4EDU A;  1TXQ A;  3LYI A;  3GOX A;  2VXF A;  1SEM A;  1K4U S;  2BIV A;  3F70 A;  2HBP A;  1VQ8 A;  4R55 A;  4XQ3 A;  2MAM A;  4BI4 A;  3CCR T;  1VQ4 T;  1TG0 A;  2HQX A;  2VWF A;  2YT6 A;  4XTX A;  2M16 A;  2K5L A;  4KUL A;  4EMK B;  2BZY A;  3JB9 I;  3A5Z B;  3G1J A;  1PCX A;  3OY9 A;  3TSZ A;  2CZ1 B;  3CME T;  4M77 D;  4BDZ A;  1JU5 C;  3THK A;  4J9B A;  1SSF A;  2LQW A;  1NLO C;  3LWH A;  3GF5 A;  2VAS A;  1FMK A;  1WZO A;  2C0O A;  4A4G A;  1EFN A;  1M1F A;  3OQ5 A;  4F7U G;  3LH5 A;  1NE8 A;  1ZBX A;  3AHU A;  4L6V 5;  4ESR A;  4AFU C;  3PIP A;  1AT1 B;  2H8H A;  2VYT A;  3E9F A;  3OW2 A;  2DYI A;  2RHY A;  1ZA2 B;  1BI1 A;  1WNL A;  5GMK e;  1NBE B;  2BZ8 A;  1N6A A;  3MEV A;  3QG1 A;  2Y90 A;  1YJ9 T;  1MMA A;  4KGV B;  4F16 A;  3A1P A;  2HCK A;  3JB9 J;  2HZY A;  1WLP B;  5FRM A;  3CMA Q;  2VGM A;  4EMK C;  3UA6 A;  5GAN d;  1BCO A;  4FT4 A;  1YIJ Q;  2RHU A;  2JZ2 A;  2HBW A;  2X4Y A;  1VQN Q;  4M77 F;  4OGE A;  3CC2 Q;  3RKW A;  5KCO A;  2ZPH B;  1KQS P;  1UGR B;  1SRL A;  1WJS A;  2OTL T;  3OYG A;  2DXB A;  2CP7 A;  4MDX A;  5I2M A;  5D6W A;  2L5Q A;  2CP2 A;  3CCQ Q;  1V76 A;  3VS0 A;  2DFU A;  4J5Y A;  1B34 B;  4X9C A;  2NUP A;  2RI5 A;  4JLI A;  2HL3 A;  1OU9 A;  2QQA A; 
#chains in the Genus database with same CATH homology
 3QJ6 A;  1M90 C;  3LGF A;  2XID A;  5M9O A;  4ZTF A;  1K8A C;  3S3N A;  3WXM B;  2YHT A;  1WJR A;  4BY6 B;  4X34 A;  4F7U E;  3OYK A;  5CKF A;  2XHC A;  2RHZ A;  4DA4 A;  1HK9 A;  1UGP B;  2PU9 B;  2ZPF B;  4ZN3 A;  1YHQ T;  3GIB A;  3C12 A;  3RIR A;  1MHN A;  3BDL A;  3V7R A;  2LC4 A;  3L1A A;  3CCM T;  3OYB A;  3BW1 A;  4A4E A;  2QEX T;  1VQ5 T;  2QDY B;  2CZ6 B;  4JS5 A;  2XG8 D;  2FL7 A;  1X75 C;  3WVD B;  2EJF A;  2RJF A;  3GNG A;  3G71 A;  5IT9 E;  1Q86 U;  2JN0 A;  2E12 A;  2QA4 A;  4M77 B;  3CMA A;  4BD3 A;  3JCM P;  3CCE A;  4JRK A;  1P92 A;  5L8R E;  1YIT T;  1OYX A;  3FLG A;  4J83 A;  3J7A F;  2RK1 A;  5GAN 4;  1W2B S;  1VQ7 A;  2EJ9 A;  2RO0 A;  3KXT A;  3JCM Q;  1YIJ A;  2E10 A;  2K5I A;  1N9R A;  5GAN 6;  3UDC A;  4B9W A;  3QYG B;  3OS1 A;  3CCS T;  2RHI A;  4ELY C;  1VQK T;  1VQN A;  2QQS A;  1FXX A;  3N5B B;  4C8Q D;  2RM4 A;  1NJI U;  4C5E A;  5DY9 A;  3CC7 A;  1VQ6 A;  3CC2 A;  3SDZ A;  4BE1 A;  3FIF A;  4HCZ A;  2K4Y A;  4J6X A;  3MO8 A;  4ME7 A;  4BI3 A;  1Q7Y C;  1JJ2 A;  4PJO C;  1YJW A;  5LJ5 e;  4MDW A;  4XTV A;  4HT9 A;  4PJO E;  3RER A;  4XAX B;  3M56 A;  4FT2 A;  4MML A;  1LJO A;  3GP8 A;  1BI2 A;  1KQS A;  5IN1 A;  1G3Y A;  2EFI A;  2DXU A;  4Y28 E;  3SWN B;  1RL2 A;  3MHX A;  3CCQ A;  1QVG A;  3FEO A;  2EYQ A;  5FU6 B;  4FM4 B;  2LQ8 A;  1VQ9 T;  4LD6 A;  4MMK A;  1N8R U;  1WQ7 A;  5FU7 B;  3OYL A;  1KQ2 A;  2DTH A;  1KHC A;  1JBM A;  1OZ2 A;  4QVZ A;  3S6W A;  3OYF A;  4DOV A;  3E19 A;  4M78 D;  4BY6 C;  3OMC A;  2LT1 A;  5FRO A;  4EMG A;  3CCU T;  2K3X A;  3L2V A;  3EFS A;  4DOW A;  3PFS A;  4E7J A;  2RI3 A;  1LNX A;  4UC4 A;  1BKB A;  2L89 A;  2LX9 A;  2XDP A;  2XI9 A;  4HCC A;  2CGH A;  1OZ3 A;  4L5G A;  2R5A A;  2E1H A;  3V8K A;  2LQK A;  5GAN e;  1KC8 U;  4V2S A;  3CBO A;  2ZGW A;  3OSV A;  2ZPI B;  3JB9 D;  4J6W A;  4Y91 A;  3MP1 A;  4BE0 A;  1YJN T;  1O75 A;  3O8V A;  4QQD A;  3HSB A;  4KBM B;  1V29 B;  4M77 C;  1Q86 C;  4E7K A;  3FB9 A;  2LNV A;  1KQS S;  1M90 U;  1M1K U;  4RMO A;  4KUD K;  3JCM W;  2F69 A;  4M77 E;  2KDS A;  4M7D A;  1XNI A;  4PKC C;  4Z02 A;  1ZQ1 A;  1QVG S;  2H3J A;  2CYZ B;  5LJ5 f;  3CCR A;  3QXE B;  1VQ4 A;  2V8I A;  3I56 T;  1K9M U;  4OMF B;  3OS5 A;  2LT4 A;  4C8Q F;  4BE2 A;  3OSS C;  2DTI A;  1NJI C;  3CD6 T;  2ZPE B;  4GY5 A;  4II1 A;  4JUV A;  5GAN g;  3I55 T;  1IZ6 A;  5HK3 A;  4PL6 A;  3PT9 A;  2DEQ A;  4OF1 A;  3VYH B;  3OYH A;  2PQW A;  5GAN 5;  3DB3 A;  5FLX E;  5A0L A;  5I2S A;  3CME A;  3OBW A;  1R8O B;  4M7D B;  2D0Q B;  2EQK A;  2LVM A;  3PGG A;  2QI2 A;  5LJ3 d;  3OMG A;  4O6J A;  2FHD A;  5GAO r;  2EQU A;  2PUK B;  2DXT A;  3H8Z A;  4LDX A;  5GAN 7;  2R57 A;  4FU6 A;  3RKY A;  3S3M A;  4M75 D;  3SWN C;  3EFR A;  3ZEH A;  5FU6 C;  3J80 E;  2HAX A;  2E70 A;  3HPW A;  1NPR A;  4FSX A;  3CXC A;  5FU7 C;  1N8R C;  2WSF E;  2V8K A;  1M1G A;  3M58 A;  4J6Y A;  1O9S A;  1QVP A;  5LJ3 f;  1U1S A;  5GAN 2;  4C8Q A;  3RKX A;  2CKK A;  2WSC E;  3FDR A;  4O5V A;  4QVD A;  3OYE A;  2M1H A;  1QVF A;  4QW2 A;  4RCC A;  2Y4Y A;  2GFA A;  5KE3 A;  2D9T A;  3HFO A;  1KC8 C;  2WAC A;  2MF2 A;  3SB2 A;  4LDW A;  4M7D D;  1GXI E;  3V8J A;  1M8V A;  2BUD A;  1WPY A;  3JB9 F;  4FIB A;  2DAQ A;  4IUR A;  4QQ6 A;  3OYC A;  5HK0 A;  1Q82 U;  5GAO l;  1VQ8 T;  4M7A D;  3L42 A;  2KAF A;  2MI6 A;  3A8G B;  4VUB A;  1PSF A;  4J7F A;  1YJ9 A;  1M1K C;  1IRE B;  4M77 G;  3X20 B;  2GCX A;  4C8Q B;  5GAM f;  3MCA B;  1U1T A;  1X01 A;  4IUU A;  3QYH B;  1YBY A;  3CXC S;  4C92 A;  5KE2 A;  1K9M C;  3MP6 A;  3MET A;  3RMQ A;  1QP2 A;  2RJC A;  2NLU A;  4DQ2 A;  5GAN 8;  4CI0 C;  3OA6 A;  2VC8 A;  4P5N A;  4XTU A;  3QBY A;  3TEE A;  1VIE A;  4M78 A;  3CCJ T;  2C06 A;  3CBM A;  5CKB A;  3CBP A;  3HRT A;  5CQX A;  2L3R A;  1QVF S;  3JB9 H;  1HXD A;  4J7I A;  1VQL A;  3J81 E;  3C4S A;  3JCM d;  2DK3 A;  2EKO A;  2G3R A;  1H3Z A;  1VQM T;  3JRZ A;  2QQB A;  3HHT B;  4M7D C;  2DD5 A;  4RCB A;  5A0D A;  5GAN h;  2I2L A;  1WQW A;  2OTJ T;  2PUO B;  5GAN j;  1EIF A;  1BI0 A;  3RUX A;  3JB9 G;  2JTF A;  3QZ5 B;  1M9S A;  4M75 F;  3TRE A;  1VQP T;  5GAN 3;  1TH7 A;  4M78 B;  3G6E T;  5CKD A;  2OTL A;  3JCM f;  2M9U A;  2R5M A;  5GMK h;  4PNO A;  3E1S A;  2GQV A;  4ATO A;  4ELZ C;  4OB3 B;  5GMK j;  4IUV A;  4EMK A;  1X6O A;  3L2U A;  3OBY A;  3ZBD A;  1VUB A;  2QXF A;  3M57 A;  5A2Q E;  4MZM A;  4RKU E;  1S72 A;  4ZN1 A;  3CCV A;  2IVW A;  4XU1 A;  5HY6 A;  2CZ0 B;  1FWZ A;  1G5V A;  3OYA A;  2DKG A;  2LCL A;  4XU2 A;  3V7S A;  4C0D B;  4WF2 A;  4QVC A;  4M7D F;  3G4S T;  2JOY A;  4C0G A;  4M7A F;  3MEU A;  1FX7 A;  1Q82 C;  2JNG A;  3QZ9 B;  4C92 D;  1JJ2 S;  3P8D A;  4MZT A;  5CKE A;  1XQH A;  3LWI A;  4A54 A;  4LDU A;  4ZTJ A;  3OYD A;  3Q1J A;  5DM7 R;  2Y4X A;  4M75 A;  4C8Q C;  1YI2 T;  2DZC A;  2VGN A;  1YHQ A;  2DZ9 A;  1NPP A;  2QQR A;  5CIU A;  2DTO A;  1JRI A;  5LJ5 g;  3GPL A;  1G3S A;  4C8Q E;  2RI2 A;  4RG8 A;  2VXE A;  1VIF A;  3CCM A;  3CCJ A;  2QEX A;  1VQ5 A;  2HD0 A;  2M0O A;  4IKF A;  2EQJ A;  4BB7 A;  4ZGD B;  2MMP A;  3BFM A;  3L2R A;  2LTO A;  2AHJ B;  3S3O A;  3CC4 T;  1YIT A;  2RHX A;  3HP9 A;  4N4G A;  5LJ3 e;  3CEY A;  5AYF A;  3BDU A;  1BIB A;  4NL3 A;  3VUZ A;  5GAO q;  2K2V A;  3QII A;  2XK0 A;  4M75 B;  3FJP A;  4RG2 A;  4F7U A;  3CCL T;  3CCS A;  1VQK A;  2RB6 A;  5CKH A;  3L2W A;  4M7A A;  4N4I A;  4M7D G;  2E6N A;  4LDV A;  3H6Z A;  5CCA A;  4OB2 B;  4BUG A;  3MEA A;  3PIO A;  4XTY A;  2XIC A;  3X24 B;  3MP8 A;  2F5T X;  3ASK A;  2OAU A;  3OYJ A;  4NOY A;  4M78 C;  3L2Q A;  2ZPG B;  1KD1 U;  3M55 A;  2X35 A;  3M9Q A;  3HRS A;  4M78 E;  4C5H A;  4CRI A;  2QTX A;  3VKI A;  4HKE A;  5GAM e;  4Q5W A;  4BDY A;  1VQO T;  4B9X A;  3PMT A;  5LJ3 g;  4HCB A;  1Y7X A;  5LL6 S;  3QPH A;  1G3W A;  1Y71 A;  5GMK i;  4JRQ A;  4M7A B;  2O01 E;  4HT8 A;  3P8H A;  1UEB A;  2YLC A;  2YRV A;  4XTZ A;  3UWN A;  4C0D C;  2DVE A;  1I81 A;  3V8L A;  1VQ9 A;  2XDB A;  3HRU A;  3M4Y A;  3QHS A;  4C92 F;  2K3Y A;  2X4W A;  4KUI A;  2LCC A;  2FB7 A;  2X4J A;  1KG1 A;  2KSS A;  2KVQ G;  3CCU A;  2JTM A;  1WJQ A;  1KQ1 A;  1N27 A;  3M5A A;  4IUT A;  4ZGJ B;  4X9D A;  2RJE A;  4PJO A;  3UPU A;  4A4K A;  4M78 F;  2P0Q A;  1M5Q 1;  3HL8 A;  5GAM g;  2DPP B;  3QUI A;  2DJZ A;  4N4H A;  3WVE B;  4C8Q G;  2QA4 T;  3PMI A;  4TVR A;  5GAO p;  3OYN A;  3TU4 K;  3CCE T;  2LRQ A;  2P0P A;  3CMA T;  2ZPB B;  2WSE E;  3FC3 A;  1I5L A;  1YJN A;  2EQM A;  3JSC A;  3G7Z A;  3JCM e;  1RI0 A;  1VQ7 T;  2KMT A;  5LJ5 h;  3DLL A;  1YIJ T;  4EMH A;  2GF7 A;  3LH0 A;  3OS0 A;  2VUB A;  3DB4 A;  4HA8 A;  3VV0 A;  5LJ5 j;  1VQN T;  3CCL A;  5A0G A;  2HNI A;  2EAY A;  3EAE A;  1DJ7 B;  2RD1 A;  4M75 C;  1LOJ A;  5GMK m;  2XD0 A;  3QSU A;  2X4X A;  3I56 A;  3CC2 T;  4IUQ A;  1U8R A;  4M75 E;  1BIA A;  2P4T A;  3QKJ A;  3CD6 A;  1YJW T;  1BI3 A;  5CR2 A;  4ZGE B;  2EJG A;  3I55 A;  3NTI A;  4R56 A;  5CO7 A;  3QJY A;  4JLG A;  1KD1 C;  4BI8 B;  2FYK A;  3JCM g;  5I21 A;  2F5K A;  2PVG B;  5DLO A;  2RH2 A;  4M78 G;  2RJD A;  3GNF B;  5CK9 A;  2DD4 A;  3URG A;  4OGC A;  2A3L A;  3M54 A;  2VV5 A;  5D6Y A;  4OB0 B;  3VU3 C;  3CCQ T;  3OYY A;  4N0A A;  1D3B A;  3VJP A;  1M4Z A;  5CAI A;  3R6O A;  3L2Z A;  3VYG A;  4M7A C;  4M7D E;  4QQG A;  5C0M A;  4C92 B;  4C5I A;  3A8M B;  4M7A E;  5LJ3 h;  4BAC A;  4PJO D;  1NZ9 A;  4PLL A;  4C0Z A;  1I8F A;  1UB4 A;  1Y96 A;  3LGL A;  5EG2 A;  5LJ3 j;  1G3T A;  3A8O B;  2EIF A;  4A4F A;  1QP3 A;  4A53 A;  2FVU A;  5CQY A;  3JCM J;  3C95 A;  2HQE A;  2BKD N;  4L59 A;  4EDU A;  1D3B B;  3LYI A;  3GOX A;  4E7L A;  4LD9 K;  5KCH A;  2VXF A;  4JRI A;  3NFC A;  1XTD A;  3M59 A;  2CS7 A;  3OS2 A;  3HKS A;  2BIV A;  2XDD A;  3F70 A;  2HBP A;  1VQ8 A;  2DIG A;  1N9S A;  4J8O A;  4R55 A;  5GAM h;  4F7U F;  1UGQ B;  1Y96 B;  3INZ A;  4XQ3 A;  3SWN A;  2MAM A;  3LX7 A;  4NL2 A;  5DLQ E;  2PVO B;  4BI4 A;  4EPC A;  5HKC A;  5GAM j;  3CCR T;  3KBG A;  2HQX A;  2DO3 A;  2K5F A;  1VQ4 T;  4NS5 A;  5FRN A;  3RMS A;  3FRN A;  4XTX A;  2M16 A;  2K5L A;  4KUL A;  4EMK B;  3JB9 I;  4YTL A;  5IAY A;  3KUF A;  3A5Z B;  4IUP A;  1Y07 A;  2QQ9 A;  2MWP A;  4JDS A;  4M75 G;  1BYM A;  2CZ7 B;  3OY9 A;  2JVV A;  2E5Q A;  3X25 B;  2E6Z A;  2JUF A;  2CZ1 B;  3CME T;  2B8A A;  4M77 D;  4BDZ A;  4JJN K;  1H64 1;  3HFN A;  3RES A;  2DXC A;  4E47 A;  1SSF A;  2XKO C;  3QDR B;  3ZFJ A;  1VQM A;  3JAM E;  3PNW C;  3LW5 E;  4XK8 E;  3LWH A;  3V7C A;  3GF5 A;  3JCM b;  2GFU A;  5GAO n;  2OTJ A;  3SFM A;  5J39 A;  3C94 A;  4A4G A;  3JCM h;  1VQP A;  1M1F A;  3OQ5 A;  1JB0 E;  4XTW A;  4C92 C;  4F7U G;  3ER0 A;  4M7A G;  2PVD B;  3G6E A;  1NE8 A;  2DIQ A;  3X28 B;  1MGQ A;  4PJO F;  3OYI A;  4C92 E;  1ZBX A;  1WGS A;  4LDY A;  5LJ5 d;  1Q81 U;  3AHU A;  2L8D A;  3A8L B;  3NTH A;  4JRP A;  1ZHI A;  2R58 A;  4L6V 5;  4E7I A;  1YCY A;  1K73 U;  3PIP A;  2VYT A;  3E9F A;  3OYM A;  3OW2 A;  2RHY A;  4N0A C;  1BI1 A;  5J3B A;  1WNL A;  4F7U B;  3GLX A;  4GLK A;  4C0F A;  1K8A U;  3G4S A;  5GMK e;  3P8B B;  4FL6 A;  4OP0 A;  1N6A A;  3MEV A;  3QG1 A;  2Y90 A;  3SD4 A;  3JCM V;  1YJ9 T;  2RA2 A;  3M53 A;  4D6W A;  1KHI A;  2E41 A;  4XU0 A;  3T9N A;  4KT0 E;  2V8J A;  3JB9 J;  3CPF A;  2ZZD A;  2YLB A;  1YI2 A;  5FRM A;  2KQW A;  2VGM A;  3PTA A;  5C6S A;  4EMK C;  1XOV A;  2LDM A;  4XU3 A;  5GAN d;  3CPW A;  3X26 B;  4FT4 A;  4OVA A;  1AHJ B;  1OI1 A;  5CVI A;  4PJO G;  3LLR A;  3G71 T;  1VQL T;  2O4X A;  2JZ2 A;  2RHU A;  3E9G A;  1UGS B;  4MZP A;  2IG0 A;  2X4Y A;  3BY7 A;  4OB1 B;  4M77 F;  3OB9 A;  3OW2 S;  4OGE A;  3CC4 A;  4C5G A;  3RKW A;  1W4S A;  2EWN A;  5KCO A;  1B34 A;  3VUB A;  2A7Y A;  4JS4 A;  2E64 A;  2KK4 A;  3ME9 A;  5GAN f;  3A8H B;  2ZPH B;  3QO3 A;  2XU8 A;  1UGR B;  5KH6 A;  1Q7Y U;  3CC7 T;  4A4H A;  4PJO B;  1WJS A;  5GAO m;  2OTL T;  1VQ6 T;  3OYG A;  3NTK A;  2DXB A;  2K57 A;  3M4G A;  3MEW A;  2O4X B;  3DLM A;  4MDX A;  1I4K 1;  2KY9 A;  5I2M A;  5D6W A;  5GAM d;  2L5Q A;  4C92 G;  4E7H A;  3TCJ A;  3UT1 A;  1Q81 C;  3CPW S;  1S72 T;  3CCV T;  1VQO A;  2P0K A;  2D6F A;  2ZCF B;  4J5Y A;  2RK2 A;  1QW1 A;  5J26 A;  3JCM X;  1B34 B;  3JCM c;  4X9C A;  4JLI A;  2E65 A;  2RI5 A;  4PLI A;  5D6X A;  2MWO A;  5GMK l;  3DKM A;  1W2B A;  1K73 C;  2QQA A;  1PSE A;  4M77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...