3SWNC

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
68
Chain Sequence
b'LDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRLTGAIRKLGLVVVRGTTLVLIAPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm7
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 10
structure length 68
sequence length 74
chains with identical sequence F, O, R
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnC00
4PJOG 4M78E 4M77E 4M78D 4X9CA 4MMKA 4M7AE 1TH7A 4QVCA 3JB9I 1B34B 3RKWA 3VU3C 3JCMg 4EMKC 4RCBA 4M7DB 4RCCA 4F7UF 3JB9J 2ZGWA 2DZ9A 4F7UE 1U1TA 2K57A 4M78C 4M77C 3SWNA 3V8KA 3RIRA 3HFOA 3HFNA 4M7AC 5GMKl 3JCMe 3BY7A 4PJOB 4N0AC 3JCMf 4J6XA 4M7DF 1D3BA 3BFMA 4M7DE 5LJ3d 4M7DD 5LJ3f 2CGHA 4OP0A 2EAYA 3V8JA 3JCMP 1Y96A 2VXFA 1N9SA 4C92G 4J6WA 4J6YA 5GAN4 4C8QC 3SWNB 4PJOF 4V2SA 4NOYA 4JRIA 4XU0A 5GAN7 3L2ZA 3SB2A 2EWNA 3QHSA 5LJ3j 5GAN2 4PJOE 5LJ3h 4PJOD 1LOJA 3PGGA 4EMKA 3RUXA 1Y96B 5GAOl 1KQ2A 3BDUA 5GMKe 1I5LA 3GIBA 4XTZA 5LJ5g 4C92B 4PNOA 5GANg 4X9DA 3HSBA 3V8LA 2YLCA 1MGQA 1WNLA 5LJ5e 4M75A 2YLBA 1M8VA 2DTOA 4HT8A 1BIBA 4C92F 4XTVA 2I2LA 2FB7A 4C8QA 5GANe 2DXTA 5GAMg 3JCMd 3FJPA 4C92E 5GANf 4C92D 2EJGA 1I81A 5GAN8 3JCMc 5GAN3 4MMLA 3JB9G 5DY9A 2FYKA 3V7SA 1I4K1 2VC8A 5GAMe 3JCMX 4M75B 3AHUA 3QO3A 3JCMh 4Y91A 1BIAA 3M4GA 4C92C 5CAIA 4XU3A 4JRKA 2RB6A 1D3BB 1LNXA 2EJFA 4M7DC 2HNIA 3INZA 3JCMJ 4XTYA 4M75F 2DTIA 4M77G 2E65A 4A53A 3RERA 1JRIA 3V7RA 4M7AG 3FB9A 4M77A 4M78A 4EMGA 4M7AA 1X01A 2EJ9A 4PJOC 1WQWA 5GAOr 4N0AA 4HT9A 2E64A 4M75G 4JUVA 4EMKB 3JB9F 1I8FA 3QUIA 2RD1A 4QVDA 2DTHA 4C8QG 5GMKj 4F7UA 5GMKh 5LJ5f 5LJ5d 3SWNC 3JCMQ 3QSUA 1YCYA 2YHTA 4M77B 5GANd 2E10A 4M7AB 2RA2A 2DKGA 2RM4A 4HA8A 1M5Q1 5GAOq 1LJOA 1B34A 3JB9H 5LJ5j 4M7DA 3RESA 4WF2A 4F7UB 5LJ5h 4NL3A 3RKXA 1HK9A 4NL2A 5GAMd 5GAMf 5GANj 5GANh 1WQ7A 4JLIA 2E1HA 4M77F 5GMKm 4M7AF 3JCMb 4C8QB 1JBMA 2Y90A 4M77D 3JCMV 4A54A 4PJOA 1WPYA 4M7AD 3V7CA 4XU2A 2VXEA 4XTUA 1H641 5GAMj 4XTWA 3EFRA 5GAMh 2DEQA 2E41A 4M78G 5GAN5 5GAN6 5I21A 4M75E 2DVEA 4M75D 4C8QF 3BW1A 4XU1A 5LJ3g 4C8QE 4XQ3A 4C8QD 5GAOn 3RKYA 3FIFA 4XTXA 4F7UG 5LJ3e 3L1AA 4J5YA 4DQ2A 5GAOm 3JB9D 4M75C 1KQ1A 2QTXA 4M78B 2JN0A 2DXUA 4EMHA 1HXDA 3EFSA 4C92A 3JCMW 4M7DG 1U1SA 1N9RA 5GAOp 5GMKi 2DZCA 4M78F 2DJZA
chains in the Genus database with same CATH superfamily
4RTZA 2L5QA 1RL2A 1TOVA 1B34B 2WACA 4EMKC 3VS7A 3EG3A 3EG9A 1NJIC 3UA7A 4J9BA 2QQRA 3G4SQ 2YXYA 2CZ0B 2BZYA 2XICA 5FU7C 3H41A 1TS9A 2JJ9A 1OULA 1OI1A 3EGDA 1E6GA 2EQIA 2EKHA 4E47A 1GBQA 2P0QA 1IRXA 2F69A 4PJOE 3OW2S 3LYIA 5A0GA 3G6ET 1Q86R 1Z9ZA 2HAXA 3REAB 2RH2A 1OU9A 2RO0A 1KQSS 3D7SB 1S72Q 3T9NA 3MCAB 4C8QA 3CBPA 1IZ6A 2AZVA 2Y4XA 2ZPFB 4C92E 1K1ZA 1WJSA 2DBKA 2NUTA 1QP3A 4N4HA 2JOYA 5CAIA 1UFFA 2OTLA 4M7DC 2HNIA 1VQ6Q 4E7JA 3CMAQ 2JM8A 2G6FX 2O2OA 2PZ1A 2RQRA 1QKWA 1T0HA 1VQLA 3J80E 4ZGEB 2HL5C 1X43A 3C95A 1QCNA 2VB6A 2RA2A 1M5Q1 8ATCB 4LUEA 3OA6A 2DL7A 2QA4T 2Y90A 3LH0A 4B9WA 1UG1A 1VQ7T 4DBQA 5GAMh 2E41A 3CCJA 3BE3A 5LJ3g 2IPOB 2RNAA 1O75A 1RAAB 4LD9K 3LH5A 1UB4A 5KYYA 5KCHA 4Q5WA 1NE8A 2ROLA 1M3CA 3CXCS 1GCQA 4PJLA 2AKLA 5GJWB 3LWIA 1ZA1B 2FPDA 4F7UF 3RDVA 4IKFA 4M78C 3DKMA 1VYTA 3HFOA 1N8RU 3MHXA 4PJOB 1YI2A 4J6XA 4F17A 4J83A 4OP0A 3OQ5A 1PWTA 1W2BS 3L2ZA 3CC7A 4QW2A 2HKNA 1HD3A 1PKTA 2PUKB 3N5BB 1K0SA 5C0MA 4C92B 2D8JA 1AT1B 4PFZA 1WNLA 3E2UA 1N27A 2DTOA 2QAZA 1F1BB 2X4JA 1VQOA 1ACMB 1VQ4Q 4M75B 3AHUA 2DRMA 3VS3A 2J7IA 2QXFA 2G3RA 4JJDA 4XTYA 1Q82U 4KGXB 3EG2A 4A53A 2GFUA 3CCJQ 4M77A 4OB0B 3URGA 2EGEA 1WQWA 2BTTA 2LJ1A 3CQTA 4OMOA 3PT9A 2V26A 3OYBA 3SWNC 1OPLA 5GANd 2DL8A 2CH4W 1QWFA 4RMOA 3CMEQ 1LJOA 1JJ2S 4BDYA 1HK9A 1WQ7A 4M77F 2A36A 2E1HA 2VGNA 2KRSA 3PVQA 1JBMA 4A54A 1WPYA 2C0TA 4IUTA 1UUEA 1M2VB 5GAMj 3X24B 2ED1A 5FW9A 5GAN6 6AT1B 2XDPA 4MZPA 2A3LA 2O4XA 4OMFB 4C8QD 1YI2Q 3UT1A 3L1AA 2DIGA 2RF0A 3M0PA 3I56T 2F2WA 5HK3A 2QG9B 1AWJA 3LLRA 3CC7Q 1PC0A 2RI2A 1NG2A 4ZN3A 3X20B 4X9CA 4QVCA 2FZGB 2GCXA 3H9NA 3X26B 2DA9A 2K57A 3OYIA 1PSFA 1N5ZA 3EGXA 3HRUA 3PVLA 4Z02A 2O01E 4M7DE 2V8JA 2CZ7B 2LX9A 4Z8AA 2ZCFB 2KYBA 1Z9QA 2D0NA 3A8HB 5CO7A 3P8HA 1GRIA 1MMAA 1YJNA 3QJYA 5GMKe 2LJ3A 2HL3A 2CZ6B 5KYXA 2HSPA 2YLBA 2LQWA 3CPWS 2DXTA 3JCMd 3G4ST 3EG0A 3CCVA 2FYKA 1OYXA 2VC8A 3M0SA 1BIAA 3M4GA 1X6OA 3H0FA 1GBRA 3KBGA 1FWZA 1D1BA 2E65A 3HRSA 3V7RA 1NJIU 2IG0A 2DFUA 2OTJA 4EMKB 1PRMC 5KYUB 4BDZA 4KRTA 1HSQA 1YJ9A 1UHFA 5CK9A 5KH6A 2KYMA 4J9DA 4E7IA 5FU7B 1NPPA 2FZKB 3CBOA 3ZEHA 1AWWA 2LQ8A 3MKDA 2GBQA 2OAUA 1MHNA 2DXBA 3TU4K 3NFCA 2DIQA 1J3TA 1ZSZA 2YUQA 4AFSC 2MCNA 2X4WA 3GNGA 2F1LA 4FL6A 4EDUA 3OYAA 2DEQA 3X25B 2BE9B 2CP6A 4II1A 3BW1A 3CMAT 4PJJA 2OI3A 1VQ8Q 1YITQ 2XDBA 2NLUA 3G71A 1T0JA 3M0UA 3QZ5B 4OMNA 1HXDA 1K0XA 2ENMA 5CKDA 1JB0E 4M78F 2CZ1B 2A37A 1D1CA 1VIFA 4M7AE 1T3LA 1YJNQ 3E19A 2ED0A 4FU6A 4E7KA 2COWA 4M7DB 2DZ9A 3JSCA 1U1TA 3OY9A 3HTRA 4IUQA 2RQUA 2O9VA 2ZPIB 3CCVQ 2EPDA 1ZBXA 2FRWA 4NOYA 3G6EQ 3KUFA 4EIKA 3NTIA 3VRYA 5GAOl 1ZUYA 3HPWA 4RKUE 2NWMA 4N4GA 3V8LA 1MGQA 2CH4A 2OTJQ 2ATCB 4R0KA 2KR3A 4JDSA 1KJWA 4BE1A 1I81A 4PJMA 2J6FA 2E3IA 4FT4A 1OOTA 4JJBA 3LX7A 4FSSA 4FSXA 3GP8A 3JCMJ 2DO3A 1M2OA 3G1JA 2OTLT 1PCXA 4M75G 3MP6A 1KSWA 2LMJA 1WHMA 3G71Q 2QQ9A 1YCYA 2ROTA 3WVEB 1SRMA 2RM4A 1YWOA 2E12A 2QK0A 5GANh 5C6SA 2KE9A 1IB8A 3CCJT 3VRZA 3CCSA 4BE2A 4J7IA 3PTAA 2NUPB 2RHUA 2DJQA 4F7UG 5LJ3e 2RQTA 1JQQA 1N8RC 3CCQA 1RADB 1N9RA 2DZCA 1BKBA 5KYWB 3JB9I 1B3QA 5I2MA 2CT3A 1WA7A 2ZGWA 3I9QA 1PRLC 1N8RR 4ELYC 3BFMA 2CREA 1SKUB 1BBZA 3V8JA 1YI2T 2VV5A 2VXFA 2Z0WA 5GAN4 2KRMA 3SWNB 1VQMA 1JXMA 1H3HA 3CC4Q 3OYJA 3CC7T 5LJ5g 1G5VA 3IQLA 1Q82C 3I55Q 2K3BA 3OW2P 1K9MU 4F04B 1WHKA 4MMLA 3OS2A 5DY9A 4OB3B 3V7SA 4CC4B 1WDXA 1PHTA 3JCMX 3EFOB 3JCMh 1RAGB 5CKFA 1VQOT 4RTTA 3QBYA 3JRZA 3R6NA 2COYA 3ZBDA 1KQSP 4LDYA 1G3TA 1EFNA 5IHNA 2DTIA 4M77G 2XD0A 3P8DA 4ELZC 1GCQC 1X01A 4RTVA 4JJNK 4N0AA 4QT7A 4ZGJB 2BKDN 3QUIA 1VQKA 5IXBA 4LN2A 2EBPA 3CCQQ 4HA8A 1QMCA 1B34A 4PFOA 1GXIE 5GANj 1QCFA 2HD0A 3RMSA 2AK5A 3VS2A 4M7AD 4F14A 4JRPA 3TEEA 1FYNA 2EKOA 1M8MA 5GAN5 2LRQA 3VYHB 1BI0A 1ZQ1A 1OQKA 2K5IA 3H6ZA 1XTDA 3JAME 1I0CA 1U06A 4RTUA 4CC2A 1VQMQ 5IAYA 2JT4A 3A8GB 3M53A 4FYYB 4BI4A 4D8DA 3G7ZA 1X6BA 4HVUA 1GCPA 2KNBB 1TH7A 3PIPA 1OX9A 3M55A 1VQ5A 4M77C 1A0NB 1WYXA 3EGUA 4LDVA 3BY7A 1E6HA 1VQ8T 5LJ3f 3PNWC 3CXCP 1QQJA 2PQWA 2X9HA 1YNZA 4J6WA 4Z88A 3OYGA 1NEBA 1M1GA 2VGMA 1PD0A 3OYLA 3M58A 3HHTB 3CPWA 3MP1A 2H3EB 3LGFA 3L42A 3L2RA 2GGRA 5J39A 1IGUA 3VS6A 1YJNT 3PE0A 4QQGA 1W2BP 3HRTA 1RI0A 3FEOA 5GAN8 2DE0X 4HKEA 5CVIA 3CCVT 1RLPC 2KRNA 1R77A 3J81E 5D7UA 2J05A 5IH2A 2OX7A 4DA4A 4XU3A 5KCOA 1D3BB 3GPLA 2DVJA 4PLLA 5D6YA 1NJIR 1O9SA 4IURA 3F70A 1K4US 4WCIA 3M4YA 1JXOA 2H3JA 2OTJT 1YJ9T 2F2VA 2XI9A 2ZPEB 4NL3A 1RUWA 2QDLA 4FW2A 4PJOA 1EX4A 2EYXA 1TTHB 5A0LA 4M78G 2IVWA 1D0YA 4M75E 1IHVA 3QXEB 4PL6A 4C8QF 1JJ2P 4DBFA 2W0ZA 5A0DA 1WXUA 1WJRA 3OYYA 3G71T 1B07A 2M0OA 4BUGA 4C92A 4X1VA 4L5GA 2F5KA 1KHCA 2XMFA 2E5QA 3FJ5A 4WTOB 3SD4A 2H8HA 4RCBA 4J9CA 4E2FB 4F7UE 3M5AA 1FMWA 3RIRA 3HFNA 1YBYA 5KE3A 1NPRA 2WSFE 1WLPB 5FRNA 1ABOA 3M57A 1C6VX 4J9HA 1Y96A 2LDMA 3EG9B 1YJWA 5IXFA 5GAN2 3RUXA 2GNCA 3FC3A 1ZSZC 2DMOA 1U5SA 4TVRA 1YIJA 3ZL7C 2LTOA 2EYQA 2X3WD 1NLOC 2DPPB 4XTVA 3VKIA 3JCMc 1M2VA 1SRLA 3VUBA 3FDRA 2R57A 2KXDA 3MEAA 2DXCA 2KQWA 3O8VA 2OTLQ 3CC4T 2CP7A 3CPWP 1MNEA 1OZ2A 2LP5A 4X34A 4EMGA 1VQLQ 3A98A 1JU5C 4O6JA 1WZOA 2PNIA 2RJCA 3I55T 3TQ7P 2E10A 3CCMA 1GFCA 4DBRA 2VVKA 1W6XA 2CP2A 2EQMA 4HCKA 4LDWA 1WHJA 2CP0A 2XKOC 1YN8A 3C4SA 3C94A 5FU6C 2YRCA 2P4TA 3OB9A 3PFSA 4J9FA 4QKUA 4IUPA 4CRIA 3C12A 3LGLA 2GQIA 3VS5A 3CCST 3L2UA 1UJYA 1KC8C 2D6FA 2JTMA 4BI3A 4EMHA 2CP3A 4C5IA 3JCMW 3C0CA 3I5SA 3CCQT 4F7UB 4RG2A 3OYEA 2JTFA 3QDRB 1YP5A 4RCCA 2I0NA 2LCSA 2EIFA 4RG8A 3UATA 2K79A 1H3ZA 3FLGA 1R0CB 2XK0A 1N9SA 4J6YA 1K9MC 3CC2A 3E9FA 3SB2A 2EWNA 4PJOD 2XIDA 2C06A 1VQMT 4EMKA 5KYUA 2QI2A 3THKA 1M3BA 1VIEA 1QVFA 2EQJA 3I35A 2P0KA 4PNOA 2DYBA 2FPFA 1UGPB 1OX8A 5LJ5e 4HT8A 1W70A 5GAMg 1DJ7B 2M51A 4BD3A 3UA6A 4C92D 1RI9A 1IXDA 2RHIA 3CCMQ 4FT2A 1UEBA 2RJDA 1VQOQ 2RQVA 3U23A 1Q7YU 1MMGA 3RNJA 1VQPA 3EH2A 4RTXA 4E6RA 1FXXA 3MP8A 2LCCA 2L3PA 2YUOA 1UECA 4KGVB 2HDAA 1VQ9A 2OAWA 2LZ6B 5CQXA 3JV3A 1IGQA 1WJQA 3VS4A 1GFDA 4M77B 2V1RA 1KD1U 1VQKT 5GAOq 2LC4A 5DM7R 4JS5A 4M7DA 2MPXC 4NL2A 2WSEE 4JRQA 3CCLA 3Q1JA 1X27A 4XTWA 4A63B 4ANJA 1AEYA 1YHQA 1HJDA 4XQ3A 4PK4A 5GAOn 4J7FA 2JMCA 4Y92A 4OB2B 1W1FA 4KH1B 4KGZB 2O4XB 2F2XA 4GBQA 4IIOA 1OZ3A 1JEGA 2DLPA 2YT6A 3TSZA 2DJZA 1Q86U 1UHCA 4M78E 1B7TA 2JVVA 2EYZA 3RKWA 2CSQA 5I22A 3M0QA 4RTWA 2LJ0A 3DLLA 3V8KA 4OMLA 4LDXA 5GMKl 2MYSA 3QWYA 4N0AC 2A08A 1ZUKA 5LJ3d 2DERA 2EAYA 3OMCA 2LX7A 2MWPA 2RPNA 1M1KC 2K6DA 1M9SA 1X2KA 4AG2C 1VQPQ 2Y4YA 1AVZC 1QVGA 1KQ2A 3OSSC 2L8DA 3QKJA 4XTZA 4DEYA 4E7HA 3TSWA 2FG0A 1U3OA 1VQ9Q 4JPBW 2FHDA 1OPKA 4ZN1A 2QEXA 2KK4A 4IUVA 3H8ZA 1WGSA 3NTKA 2LCLA 3QO3A 1VQ7A 4XAXB 1LNXA 2NUPA 2DRKA 3UPUA 2D0QB 4B6MA 2L0AA 3MO8A 4M7AA 1YHQQ 1QVFP 2SRCA 1I07A 1NYGA 4M4ZA 4D8KA 5CIUA 4C8QG 2LT4A 3OMGA 5GMKh 2K2VA 3CPFA 5LJ5f 1YJ9Q 1ZUUA 5CCAA 1QCOA 1G3WA 4M7AF 1OU8A 3CD6A 1SSHA 3CCEA 3V7CA 5I21A 1AZEA 5HY6A 1G83A 1AD5A 1VQLT 3M59A 1QP2A 1RAEB 5EG2A 2IIMA 1KQ1A 2RHZA 4M78B 2DD5A 2E5KA 1AWOA 4ESRA 2WSCE 3SDZA 1VYUA 5IT9E 2LQKA 3TVTA 4BACA 5KYNA 1W4SA 2B86A 2O9SA 2DL3A 1EIFA 1K73U 4PFPA 3EFOA 4ZNXA 1E7OA 1WHGA 2YUPA 1I5OB 4M7DD 2KBTA 4MDXA 4C8QC 2P4RA 2FL7A 3VS0A 2V8IA 1YJWT 2FPEA 3PGGA 3CEYA 4OVAA 2PU9B 1ARKA 3NMZC 4OGEA 3GIBA 5CKBA 4X9DA 4C5EA 5FU6B 1KC8U 1BIBA 2FB7A 4FYVB 5GANf 4OGCA 1V76A 4KULA 4LNPA 3LWHA 1I4K1 3CBMA 1MV0B 4C92C 1TWBA 2L2PA 4JRKA 1YCSB 3A5ZB 1G8XA 4NS5A 2M0YA 5AYFA 1QVGP 1KIKA 1Q81U 2BIVA 1UDLA 2HSEB 3HP9A 3JB9F 5GMKj 1VQNA 4FIBA 3S6WA 2X35A 4CI0C 2EGCA 4OMPA 3QZ9B 1QVFS 3OS0A 4KT0E 3RESA 1TU0B 3CCMT 4JLIA 2D9TA 1UGRB 3LW5E 8AT1B 1V29B 4JLGA 2LNVA 1Q82R 2DAQA 2DF6A 4HCZA 2HCKA 7AT1B 3CCSQ 3PMTA 4JZ4A 9ATCB 5GAOm 3EG1A 2JN0A 1U1SA 1UE9A 1NBEB 5GAOp 5CKHA 3ASKA 3QPHA 1RAHB 1C0MA 4MMKA 3S3MA 4ATOA 1XJWB 2K9GA 1I1JA 1VA7A 3META 1PSEA 2MWOA 1M27C 3JCMf 1D3BA 4FW1A 2HQHA 1VYVA 1ZBJA 2J6KA 4XU0A 2QQBA 5FRMA 5LJ3h 4EPCA 3TREA 1SEMA 3A8LB 1Q7YC 2KVQG 4QVZA 3RMQA 4LE9A 5GANg 1RABB 3GNFB 2YSQA 4E7SA 5I2SA 1S72A 2RQWA 5LL6S 1M8VA 2NUZA 2E6NA 1VOMA 2VKNA 5GAMe 1Y0MA 1MMNA 2AZSA 3PMIA 4Y91A 1KD1C 1Q7YR 2RB6A 1VQ6A 1NYFA 1BK2A 1VQPT 2YRVA 3RERA 1JRIA 2EYYA 2EJ9A 2FEIA 4HT9A 1WFWA 3E9GA 5IHKA 2CUDA 1M1KU 1VQKQ 2M9UA 1VQ9T 2DKGA 1QVGS 1K8AU 1TG0A 1UGQB 4AT1B 2A0FB 2ESWA 2R5AA 3JCMV 1ZLMA 2DBMA 2VYTA 4BE0A 4HCCA 2AHJB 3CCLT 1Q86C 3QG1A 2W10A 5FWBA 1BYMA 4C8QE 2DNUA 2EQUA 1YHQT 3VV0A 2GTOA 1U8RA 4LXCA 5FROA 3JB9D 4AFUC 3OS5A 1NM7A 4BI8B 1X69A 2K3XA 2M16A 2HBWA 3QJ6A 5GMKi 1CKBA 4E7ZA 2HMAA 1H8KA 3VJPA 2RJFA 1Y71A 2ZPGB 2CS7A 2E6ZA 2MI6A 5GJVB 2NYSA 2C0OA 3JCMg 1Y7XA 4D6WA 1M90U 3SEMA 3WVDB 1VQ5Q 2KI7A 1CSKA 3CCUA 3OYCA 1G2BA 4PJOF 1BCMA 5GAN7 3SFMA 5LJ3j 2DX1A 4DOWA 2R5MA 4A4HA 2XG8D 3SHWA 2XU8A 2DILA 3BDUA 3RBBB 5CKEA 1M30A 2YLCA 1KHIA 2QGGA 4ZTFA 4M75A 4C0GA 5KE2A 2JM9A 4C0ZA 4C92F 4FYXB 4OF1A 5FLXE 2QEXT 4C0DC 5IN1A 1X6GA 1VQ4A 2C0IA 4PJNA 1ZSGA 4BY6C 2EJFA 2QGFB 3EGDB 2P0PA 2LVMA 4M75F 2YUNA 4M7AG 2RI5A 1SPKA 3OYDA 1WX6A 2MOXA 3M9QA 2E64A 4C0FA 4HVVA 1UJ0A 1KG1A 4QVDA 1QWEA 5LJ5d 4F7UA 2BE7D 1BCOA 2RN8A 3CMEA 2E4HA 1QLYA 3QWXX 2EFIA 2X4XA 1NEGA 5GAMf 4KUDK 4C8QB 2HQEA 1UTIA 3J7AF 4RUGA 4QQ6A 4XTUA 1H641 2NUTB 3CD6T 3CCET 2X3XD 2K7AA 2A7YA 2DVEA 4XU1A 3CCRA 3NGPA 2XDDA 3RKYA 1BI3A 1BU1A 3FIFA 3KXTA 4F16A 1K73C 2RHXA 4A4GA 3CCUQ 2QASA 3EFSA 2JNGA 1PNJA 2O88A 1HYOA 1Q95G 2GFAA 1XOVA 4M77E 4FM4B 1WI7A 1PG5B 1X75C 2DL5A 1EZZB 1QW1A 5D6WA 1XQHA 1PKSA 2LT1A 2R58A 1K73R 4M7AC 4J9EA 2MMPA 4J8OA 2KT8A 3UWNA 1X2QA 2FZCB 2YRDA 1YJWQ 4ME7A 4JRIA 1Y96B 4OMMA 2OJ2A 2D8HA 5KYYB 1YIJQ 1YFNA 3OYMA 2EQKA 1TUGB 2KSSA 1KC8R 1Q81C 4LD6A 3M56A 2EJGA 3H0IA 2L3QA 3JB9G 3GF5A 5ECAA 1TSFA 4IIMA 3M0RA 2SEMA 4L6V5 4P5NA 2ZPBB 1GL5A 1FMVA 1JO8A 4L59A 2MF2A 3FB9A 3ME9A 3CCRQ 1Q81R 3HKSA 1PD1A 2P84A 3RR6A 2RD1A 2V8KA 3A8OB 4QQDA 2YHTA 2BZ8A 1VQNT 1K9MR 3DB4A 1QVPA 4HXJA 2XHCA 1PM3A 4J9GA 2V1QA 4PLIA 3M54A 5DLQE 2DM1A 3A8MB 4DOVA 3EFRA 3VYGA 3NHNA 1MNDA 4M75D 1VQ8A 2HKQB 1YITA 2PVDB 1MV3A 4A4KA 1SG5A 2EW3A 2FVUA 3QYHB 4ORZA 2QTXA 3S3OA 2DL4A 3VUZA 3MEWA 4AMCA 1R0BG 2QDYB 2E3HA 5CQYA 2FO0A 2X4YA 3OBWA 3EAEA 4IUUA 1IO6A 4OB1B 3AT1B 4M7DF 3A1PA 2PVOB 3WXMB 1M1FA 1S1NA 3CC2Q 2RK2A 3G6EA 3BDLA 1YWPA 4KUIA 5HCKA 3NPFA 1LOJA 2QYZA 1WXBA 3TCJA 1MUZA 3ULRB 1OEBA 2DD4A 2ZZDA 3DB3A 2KDSA 2DYIA 1AWXA 2AT1B 2ZPHB 5GANe 2I2LA 1AZGB 5A2QE 1RAFB 1S72T 1SSFA 1VQ5T 4MDWA 1N6AA 4KBMB 1K8AC 1TUDA 2COZA 2VASA 3EGXB 4GLMA 4ZTJA 1VQ6T 4UC4A 4M78A 2YDLA 2YWWA 4MZTA 2CP5A 2L3SA 1WHHA 1SHFA 2CT4A 4BB7A 1FMKA 3NTHA 4R55A 1G3YA 2RK1A 1TUCA 3O5ZA 1D1AA 1M1KR 2D1XA 1QKXA 2A28A 5KYXB 1K8AR 3MEUA 2JS2A 2QA4A 5LJ5h 5FWCA 4A4FA 3R6OA 3JCMb 4M77D 3OYKA 3CCLQ 3OYFA 2VXEA 2K2MA 2KAFA 2K5FA 4HCBA 3OW2A 3EHQA 2CKKA 1ZA2B 1M90C 4J5YA 5DLOA 2X51A 5I11A 5KYWA 1IREB 3X28B 3ER0A 4OMQA 1KQSA 2JTEA 3OYNA 2QQSA 4C0DB 2ZAEA 1BB9A 2HBPA 4PJOG 5J3BA 2M1HA 5CR2A 1K76A 1KFZA 4BY6B 2JUFA 2RI3A 1M90R 2ABLA 1ZSZB 3SWNA 3JCMe 4JJCA 3QDFA 1UGVA 4C92G 3MEVA 4V2SA 1LPLA 4K11A 3CC4A 2PVGB 3CCUT 2LQNA 4R56A 1M4ZA 2EYWA 2QTVA 2AKKA 2FRYA 4C5GA 1T3SA 1I5LA 2L3RA 3OYHA 3I55A 1D09B 2M02A 3L2WA 1IHWA 2AIRB 1RAIB 3EHRA 3OSVA 2QEXQ 2VWFA 2K4YA 1WXTA 2QA4Q 4AFZC 1BI1A 1M3AA 1UGSB 1VQ7Q 2MIOA 1VQ4T 3INZA 3ZFJA 3GOXA 2RHYA 5IHIA 4PJOC 4DBHA 1LVKA 1ZHIA 1BI2A 2JXBA 4Z89A 4JUVA 4PKCC 2EVRA 2DETA 3CXCA 4LDUA 1YIJT 2RJEA 3JCMQ 3QSUA 3QYGB 2HEQA 3I5RA 4M7AB 1MMDA 1ABQA 5LJ5j 5AT1B 4WF2A 3CMET 5GAMd 1FX7A 5GMKm 1XNIA 3DLMA 1VUBA 3CD6Q 3EH1A 4XU2A 1G3SA 3CCEQ 4GLKA 1W2BA 3QIIA 3REBB 2CYZB 2VUBA 2F5TX 3PIOA 1P92A 2LNHB 1NZ9A 3I56A 3CCRT 1OV3A 4DEXA 2DK3A 4DQ2A 2BUDA 2O31A 4M75C 5HKCA 2KEAA 4ZGDB 3P8BB 3OS1A 1ZX6A 4VUBA 2KY9A 4M78D 2BZXA 2KGTA 1AOJA 3VU3C 2CDTA 2MAMA 2MK5A 4KH0B 5J26A 1V1CA 3JB9J 1SF9A 4MZMA 3UDCA 5L8RE 2HQXA 4A4EA 2CSIA 3L2QA 2CGHA 3JCMP 2L89A 1RLQC 5M9OA 4FCYA 3QHSA 3S3NA 1K9AA 4O5VA 1TXQA 2EGAA 1JJ2A 2KT1A 1KK7A 1NLPC 5HK0A 1C1AA 3HSBA 2GQVA 1AHJB 1D0ZA 4C5HA 3M0TA 1R8OB 3G4SA 2K3YA 4N4IA 1D0XA 1WHLA 2GTJA 2JMAA 4FYWB 3FJPA 5GAN3 3MJXA 2KMTA 5L23A 5EC7A 3CC2T 1LCKA 3UF4A 1RACB 3GBQA 1Y07A 5GAOr 4YTLA 2K5LA 2QQAA 2KROA 4AFQC 1I8FA 3I56Q 2DTHA 3VS1A 1VQNQ 2JZ2A 2J6OA 2ECZA 4JZ3A 4XK8E 1CKAA 4J9IA 3JB9H 2KXCA 2HZYA 1Y57A 2RMOA 3RKXA 1WIEA 2J06A 2PTKA 4E7LA 3OBYA 2B8AA 1SHGA 3CMAA 3HL8A 3KFVA 2JS0A 4CC3A 2GF7A 2PUOB 3MPUB 4RTYA 4Y28E 1H92A 4XTXA 4CC7A 3L2VA 1YITT 3E1SA 2JW4A 2CUBA 4GY5A 4JS4A 2DXUA 4M7DG 3H0HA 4B9XA 1KD1R 5D6XA 2E70A 3GLXA 4AG1C 2DEUA 3FRNA 4HVWA 4LUDA
chains in the Genus database with same CATH topology
2GFAA 1Q86U 1XOVA 4M78E 2L5QA 4M77E 1RL2A 2JVVA 4FM4B 3JB9I 1B34B 1X75C 3RKWA 2WACA 5I2MA 4EMKC 2ZGWA 1QW1A 5D6WA 1NJIC 2QQRA 1XQHA 3DLLA 2LT1A 2R58A 3V8KA 2CZ0B 4M7AC 4LDXA 2XICA 5GMKl 2MMPA 5FU7C 4N0AC 4ELYC 3BFMA 4J8OA 1OI1A 3UWNA 5LJ3d 2EAYA 2MWPA 3OMCA 3V8JA 2VV5A 2VXFA 1YI2T 4E47A 5GAN4 1M1KC 3SWNB 1VQMA 2P0QA 4ME7A 4JRIA 1M9SA 2F69A 4PJOE 3OW2S 3LYIA 3OYJA 5A0GA 3G6ET 3CC7T 2Y4YA 1QVGA 1Y96B 1KQ2A 3OSSC 2L8DA 3QKJA 4XTZA 5LJ5g 2HAXA 1G5VA 4E7HA 2RH2A 1Q82C 2RO0A 1KQSS 3OYMA 2EQKA 2FHDA 4ZN1A 2KSSA 2QEXA 3T9NA 3MCAB 4C8QA 1Q81C 3CBPA 1IZ6A 2Y4XA 2ZPFB 3M56A 4LD6A 2EJGA 2KK4A 4IUVA 4C92E 1WJSA 1QP3A 4MMLA 3H8ZA 3GF5A 4N4HA 2JOYA 1WGSA 3NTKA 4OB3B 5DY9A 3V7SA 3JCMX 2LCLA 3QO3A 3JCMh 1VQ7A 5CKFA 4XAXB 1VQOT 5CAIA 4L6V5 3QBYA 3JRZA 3ZBDA 1LNXA 2OTLA 4M7DC 2HNIA 1G3TA 4LDYA 4P5NA 4E7JA 3UPUA 2ZPBB 2DTIA 4M77G 2XD0A 2D0QB 4L59A 3P8DA 2MF2A 3FB9A 4ELZC 3J80E 3MO8A 1VQLA 4ZGEB 1X01A 4M7AA 3ME9A 4JJNK 4N0AA 4ZGJB 3HKSA 2BKDN 3C95A 5CIUA 3QUIA 2RD1A 2V8KA 4C8QG 1VQKA 3A8OB 2LT4A 3OMGA 5GMKh 2K2VA 3CPFA 4QQDA 5LJ5f 2YHTA 5CCAA 2RA2A 4HA8A 1M5Q1 1VQNT 3DB4A 1B34A 1QVPA 1GXIE 3OA6A 5GANj 1G3WA 2HD0A 3RMSA 2XHCA 4M7AF 3CD6A 2QA4T 4PLIA 2Y90A 3LH0A 3CCEA 3M54A 4B9WA 5DLQE 3A8MB 3V7CA 4DOVA 4M7AD 4JRPA 1VQ7T 3TEEA 3EFRA 2EKOA 3VYGA 5GAMh 2E41A 3CCJA 5GAN5 5I21A 2LRQA 4M75D 3VYHB 1BI0A 5HY6A 5LJ3g 1ZQ1A 2K5IA 1VQ8A 3H6ZA 1YITA 2PVDB 1XTDA 3JAME 4A4KA 1VQLT 3M59A 1O75A 1QP2A 2FVUA 5EG2A 3QYHB 4LD9K 1KQ1A 2RHZA 1UB4A 2QTXA 2DD5A 4M78B 3S3OA 5IAYA 3VUZA 3A8GB 3M53A 5KCHA 2WSCE 3MEWA 4BI4A 4Q5WA 3SDZA 3G7ZA 1NE8A 2QDYB 5IT9E 5CQYA 3CXCS 2LQKA 2X4YA 1TH7A 4BACA 3OBWA 3LWIA 3PIPA 1W4SA 3EAEA 4F7UF 1EIFA 4IUUA 1K73U 4IKFA 3M55A 4M78C 4M77C 3DKMA 4OB1B 1VQ5A 3HFOA 4LDVA 1N8RU 3BY7A 3MHXA 4PJOB 1YI2A 4M7DF 4J6XA 4J83A 2PVOB 1VQ8T 4M7DD 5LJ3f 3PNWC 3WXMB 1M1FA 4OP0A 4MDXA 2PQWA 3OQ5A 4J6WA 4C8QC 3OYGA 1W2BS 2FL7A 1M1GA 2RK2A 2VGMA 3L2ZA 3G6EA 2V8IA 3BDLA 4QW2A 3CC7A 3OYLA 1YJWT 4KUIA 3M58A 1LOJA 3PGGA 3HHTB 3CEYA 3MP1A 4OVAA 3TCJA 3CPWA 2PU9B 3LGFA 4OGEA 3GIBA 2PUKB 3L42A 3N5BB 2DD4A 2ZZDA 3DB3A 4C92B 5C0MA 5CKBA 2KDSA 3L2RA 4X9DA 5J39A 1YJNT 4C5EA 1WNLA 4QQGA 5FU6B 2ZPHB 3HRTA 1KC8U 1N27A 1RI0A 2DTOA 3FEOA 1BIBA 5GANe 2I2LA 2FB7A 5A2QE 5GANf 5GAN8 1S72T 1SSFA 1VQ5T 4OGCA 4KULA 4HKEA 4MDWA 3LWHA 2X4JA 1N6AA 1I4K1 5CVIA 1VQOA 4M75B 4KBMB 3CCVT 3CBMA 3AHUA 1K8AC 3J81E 4C92C 4DA4A 2QXFA 4XU3A 4JRKA 5KCOA 1D3BB 3GPLA 3A5ZB 2G3RA 4NS5A 4XTYA 1Q82U 4ZTJA 4A53A 2GFUA 4UC4A 1VQ6T 5AYFA 4M78A 4M77A 4OB0B 4PLLA 3URGA 4MZTA 5D6YA 1O9SA 1WQWA 4IURA 1Q81U 4BB7A 2BIVA 3F70A 3HP9A 3NTHA 4R55A 3PT9A 3JB9F 1G3YA 3M4YA 3OYBA 5GMKj 1VQNA 2RK1A 2H3JA 4FIBA 3S6WA 2X35A 3SWNC 2OTJT 4CI0C 5GANd 4RMOA 1YJ9T 3QZ9B 1LJOA 2XI9A 3OS0A 4KT0E 1JJ2S 1QVFS 2ZPEB 3MEUA 2QA4A 3RESA 5LJ5h 4BDYA 4NL3A 1HK9A 3CCMT 1WQ7A 4JLIA 2E1HA 2VGNA 3R6OA 4M77F 4A4FA 3JCMb 1JBMA 1UGRB 2D9TA 3LW5E 4M77D 4A54A 1WPYA 3OYFA 3OYKA 4PJOA 2VXEA 4IUTA 1V29B 5GAMj 3X24B 4JLGA 2KAFA 5A0LA 2LNVA 2K5FA 4M78G 2IVWA 5GAN6 4HCBA 4M75E 3QXEB 2DAQA 4PL6A 4C8QF 2XDPA 3OW2A 4MZPA 2A3LA 2O4XA 4HCZA 4OMFB 2CKKA 4C8QD 1M90C 3PMTA 3UT1A 3L1AA 4J5YA 2DIGA 5DLOA 5GAOm 5A0DA 1WJRA 3I56T 3OYYA 2JN0A 3G71T 1IREB 2M0OA 4BUGA 3X28B 4C92A 5HK3A 3ER0A 4L5GA 1KQSA 1U1SA 2F5KA 3LLRA 3OYNA 2QQSA 4C0DB 2RI2A 5GAOp 4ZN3A 1KHCA 5CKHA 3ASKA 2HBPA 4PJOG 2E5QA 3QPHA 4X9CA 5J3BA 3X20B 2M1HA 3SD4A 5CR2A 4MMKA 4QVCA 3S3MA 4ATOA 2GCXA 4BY6B 2JUFA 4RCBA 2RI3A 3X26B 4F7UE 2K57A 3SWNA 3M5AA 3RIRA 3META 3HFNA 3JCMe 1PSEA 3OYIA 1PSFA 2MWOA 1YBYA 3JCMf 5KE3A 1D3BA 1NPRA 3HRUA 2WSFE 4Z02A 2O01E 5FRNA 4M7DE 2V8JA 3M57A 2CZ7B 2LX9A 2ZCFB 1Y96A 2LDMA 4C92G 1YJWA 3MEVA 4V2SA 4XU0A 3A8HB 5CO7A 2QQBA 5GAN2 3CC4A 2PVGB 3CCUT 5FRMA 3P8HA 5LJ3h 4EPCA 1M4ZA 4R56A 3TREA 3RUXA 3A8LB 3OS2A 1Q7YC 4C5GA 3FC3A 1YJNA 2KVQG 4QVZA 3QJYA 5GMKe 1I5LA 3RMQA 2L3RA 4TVRA 2CZ6B 5GANg 1YIJA 3OYHA 3I55A 3GNFB 3L2WA 2LTOA 5I2SA 1S72A 2YLBA 1M8VA 5LL6S 2EYQA 4XTVA 2DPPB 3OSVA 3CPWS 2DXTA 3JCMd 3G4ST 3VKIA 3CCVA 2K4YA 3JCMc 2E6NA 2FYKA 1OYXA 2VC8A 5GAMe 3VUBA 1BI1A 3FDRA 2R57A 3PMIA 4Y91A 1KD1C 1UGSB 1BIAA 3M4GA 2DXCA 1X6OA 2KQWA 3MEAA 1VQ4T 2RB6A 3O8VA 1VQ6A 3INZA 3ZFJA 3KBGA 1FWZA 3CC4T 3GOXA 2YRVA 1VQPT 2E65A 3RERA 1JRIA 2RHYA 3HRSA 3V7RA 1NJIU 1OZ2A 4EMGA 4X34A 2EJ9A 4PJOC 4HT9A 2IG0A 1ZHIA 1BI2A 1K9MU 3E9GA 2OTJA 4JUVA 4PKCC 4EMKB 4BDZA 3CXCA 4LDUA 4O6JA 1YJ9A 1YIJT 5CK9A 2RJCA 3I55T 2RJEA 3JCMQ 2M9UA 5KH6A 3QYGB 1M1KU 3QSUA 1VQ9T 2E10A 4M7AB 2DKGA 1QVGS 1K8AU 3CCMA 1UGQB 5FU7B 1NPPA 3CBOA 3ZEHA 4E7IA 2LQ8A 5LJ5j 4WF2A 3CMET 2OAUA 1MHNA 2DXBA 2EQMA 3NFCA 4LDWA 5GAMd 1FX7A 3TU4K 2DIQA 5GMKm 1XNIA 2R5AA 2XKOC 3DLMA 1VUBA 2X4WA 3GNGA 3JCMV 4BE0A 2VYTA 4HCCA 4XU2A 1G3SA 4FL6A 3C4SA 3C94A 4GLKA 4EDUA 2AHJB 3OYAA 2DEQA 5FU6C 3CCLT 2P4TA 3OB9A 3X25B 3QIIA 1W2BA 3PFSA 1Q86C 3QG1A 4II1A 3BW1A 2CYZB 2VUBA 2F5TX 4IUPA 3PIOA 3CMAT 1BYMA 4C8QE 1P92A 4CRIA 3C12A 2EQUA 1YHQT 2XDBA 1NZ9A 3VV0A 3I56A 3CCRT 2DK3A 3LGLA 2NLUA 2BUDA 4DQ2A 3G71A 3CCST 3L2UA 1U8RA 5FROA 3JB9D 4M75C 5HKCA 1KC8C 2D6FA 3QZ5B 2JTMA 4BI3A 3OS5A 4BI8B 4EMHA 1HXDA 4C5IA 3P8BB 4ZGDB 3JCMW 2K3XA 2M16A 3OS1A 3CCQT 5CKDA 3QJ6A 5GMKi 1JB0E 4M78F 4F7UB 2CZ1B 4RG2A 4VUBA 3OYEA 3JB9G 2KY9A 4M78D 2RJFA 3VJPA 1VIFA 1Y71A 2ZPGB 2CS7A 4M7AE 3E19A 2JTFA 2E6ZA 3QDRB 4FU6A 2MI6A 2MAMA 5J26A 3JCMg 3VU3C 1Y7XA 4D6WA 4E7KA 4RCCA 3JB9J 1M90U 4M7DB 2DZ9A 3JSCA 1U1TA 3OY9A 4MZMA 3WVDB 3UDCA 2EIFA 4RG8A 5L8RE 4IUQA 2HQXA 4A4EA 1H3ZA 3L2QA 3FLGA 2ZPIB 2CGHA 2XK0A 3CCUA 3JCMP 1N9SA 3OYCA 4J6YA 1ZBXA 1K9MC 3CC2A 4PJOF 2L89A 4NOYA 5M9OA 5GAN7 3E9FA 3SB2A 3SFMA 2EWNA 3QHSA 2XIDA 5LJ3j 3S3NA 4PJOD 3KUFA 4DOWA 2C06A 2R5MA 1VQMT 4EMKA 3NTIA 4A4HA 2QI2A 2XG8D 2XU8A 4O5VA 5GAOl 1VIEA 3BDUA 3HPWA 4RKUE 1JJ2A 2EQJA 1QVFA 5HK0A 2P0KA 4PNOA 4N4GA 5CKEA 3HSBA 2GQVA 1AHJB 2YLCA 3V8LA 1MGQA 1UGPB 1R8OB 4C5HA 1KHIA 3G4SA 2K3YA 4N4IA 4ZTFA 5LJ5e 4M75A 4C0GA 5KE2A 4C0ZA 4HT8A 4JDSA 4C92F 5GAMg 1DJ7B 3FJPA 4BD3A 4BE1A 4OF1A 4C92D 1I81A 5FLXE 5GAN3 4C0DC 2QEXT 2RHIA 5IN1A 4FT2A 1UEBA 4FT4A 2KMTA 2RJDA 1VQ4A 3LX7A 1Q7YU 1VQPA 4BY6C 2EJFA 4FSXA 3CC2T 2P0PA 3GP8A 3JCMJ 1FXXA 2LVMA 2LCCA 3MP8A 2DO3A 4M75F 4M7AG 2OTLT 2RI5A 3OYDA 1Y07A 5GAOr 3M9QA 2E64A 4YTLA 4C0FA 2K5LA 2QQAA 3MP6A 4M75G 1VQ9A 1I8FA 5CQXA 1KG1A 4QVDA 2DTHA 5LJ5d 4F7UA 2QQ9A 1WJQA 2JZ2A 1YCYA 4M77B 3WVEB 3CMEA 2RM4A 1KD1U 1VQKT 5GAOq 4XK8E 2LC4A 5DM7R 3JB9H 2E12A 4JS5A 4M7DA 2EFIA 2X4XA 3RKXA 4NL2A 2WSEE 5GAMf 5GANh 3OBYA 4JRQA 4E7LA 2B8AA 4KUDK 4C8QB 5C6SA 2HQEA 3CCLA 3J7AF 3Q1JA 4QQ6A 4XTUA 1H641 3CMAA 3HL8A 4XTWA 3CD6T 3CCET 2A7YA 2DVEA 2GF7A 2PUOB 1YHQA 4XU1A 3CCRA 2XDDA 3CCJT 4XQ3A 5GAOn 3CCSA 4J7FA 4J7IA 4Y28E 3RKYA 1BI3A 3PTAA 3FIFA 4BE2A 2RHUA 4XTXA 3KXTA 4F7UG 3L2VA 5LJ3e 1K73C 1YITT 4OB2B 2RHXA 1N8RC 3E1SA 4A4GA 3CCQA 4GY5A 4JS4A 2DXUA 2O4XB 3EFSA 4M7DG 2JNGA 4B9XA 5D6XA 2E70A 3GLXA 1OZ3A 1N9RA 3FRNA 2DZCA 1BKBA 2DJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO G;  4M78 E;  4M77 E;  4M78 D;  4X9C A;  4MMK A;  4M7A E;  1TH7 A;  4QVC A;  3JB9 I;  1B34 B;  3RKW A;  3VU3 C;  3JCM g;  4EMK C;  4RCB A;  4M7D B;  4RCC A;  4F7U F;  3JB9 J;  2ZGW A;  2DZ9 A;  4F7U E;  1U1T A;  2K57 A;  4M78 C;  4M77 C;  3SWN A;  3V8K A;  3RIR A;  3HFO A;  3HFN A;  4M7A C;  5GMK l;  3JCM e;  3BY7 A;  4PJO B;  4N0A C;  3JCM f;  4J6X A;  4M7D F;  1D3B A;  3BFM A;  4M7D E;  5LJ3 d;  4M7D D;  5LJ3 f;  2CGH A;  4OP0 A;  2EAY A;  3V8J A;  3JCM P;  1Y96 A;  2VXF A;  1N9S A;  4C92 G;  4J6W A;  4J6Y A;  5GAN 4;  4C8Q C;  3SWN B;  4PJO F;  4V2S A;  4NOY A;  4JRI A;  4XU0 A;  5GAN 7;  3L2Z A;  3SB2 A;  2EWN A;  3QHS A;  5LJ3 j;  5GAN 2;  4PJO E;  5LJ3 h;  4PJO D;  1LOJ A;  3PGG A;  4EMK A;  3RUX A;  1Y96 B;  5GAO l;  1KQ2 A;  3BDU A;  5GMK e;  1I5L A;  3GIB A;  4XTZ A;  5LJ5 g;  4C92 B;  4PNO A;  5GAN g;  4X9D A;  3HSB A;  3V8L A;  2YLC A;  1MGQ A;  1WNL A;  5LJ5 e;  4M75 A;  2YLB A;  1M8V A;  2DTO A;  4HT8 A;  1BIB A;  4C92 F;  4XTV A;  2I2L A;  2FB7 A;  4C8Q A;  5GAN e;  2DXT A;  5GAM g;  3JCM d;  3FJP A;  4C92 E;  5GAN f;  4C92 D;  2EJG A;  1I81 A;  5GAN 8;  3JCM c;  5GAN 3;  4MML A;  3JB9 G;  5DY9 A;  2FYK A;  3V7S A;  1I4K 1;  2VC8 A;  5GAM e;  3JCM X;  4M75 B;  3AHU A;  3QO3 A;  3JCM h;  4Y91 A;  1BIA A;  3M4G A;  4C92 C;  5CAI A;  4XU3 A;  4JRK A;  2RB6 A;  1D3B B;  1LNX A;  2EJF A;  4M7D C;  2HNI A;  3INZ A;  3JCM J;  4XTY A;  4M75 F;  2DTI A;  4M77 G;  2E65 A;  4A53 A;  3RER A;  1JRI A;  3V7R A;  4M7A G;  3FB9 A;  4M77 A;  4M78 A;  4EMG A;  4M7A A;  1X01 A;  2EJ9 A;  4PJO C;  1WQW A;  5GAO r;  4N0A A;  4HT9 A;  2E64 A;  4M75 G;  4JUV A;  4EMK B;  3JB9 F;  1I8F A;  3QUI A;  2RD1 A;  4QVD A;  2DTH A;  4C8Q G;  5GMK j;  4F7U A;  5GMK h;  5LJ5 f;  5LJ5 d;  3SWN C;  3JCM Q;  3QSU A;  1YCY A;  2YHT A;  4M77 B;  5GAN d;  2E10 A;  4M7A B;  2RA2 A;  2DKG A;  2RM4 A;  4HA8 A;  1M5Q 1;  5GAO q;  1LJO A;  1B34 A;  3JB9 H;  5LJ5 j;  4M7D A;  3RES A;  4WF2 A;  4F7U B;  5LJ5 h;  4NL3 A;  3RKX A;  1HK9 A;  4NL2 A;  5GAM d;  5GAM f;  5GAN j;  5GAN h;  1WQ7 A;  4JLI A;  2E1H A;  4M77 F;  5GMK m;  4M7A F;  3JCM b;  4C8Q B;  1JBM A;  2Y90 A;  4M77 D;  3JCM V;  4A54 A;  4PJO A;  1WPY A;  4M7A D;  3V7C A;  4XU2 A;  2VXE A;  4XTU A;  1H64 1;  5GAM j;  4XTW A;  3EFR A;  5GAM h;  2DEQ A;  2E41 A;  4M78 G;  5GAN 5;  5GAN 6;  5I21 A;  4M75 E;  2DVE A;  4M75 D;  4C8Q F;  3BW1 A;  4XU1 A;  5LJ3 g;  4C8Q E;  4XQ3 A;  4C8Q D;  5GAO n;  3RKY A;  3FIF A;  4XTX A;  4F7U G;  5LJ3 e;  3L1A A;  4J5Y A;  4DQ2 A;  5GAO m;  3JB9 D;  4M75 C;  1KQ1 A;  2QTX A;  4M78 B;  2JN0 A;  2DXU A;  4EMH A;  1HXD A;  3EFS A;  4C92 A;  3JCM W;  4M7D G;  1U1S A;  1N9R A;  5GAO p;  5GMK i;  2DZC A;  4M78 F;  2DJZ A; 
#chains in the Genus database with same CATH topology
 4RTZ A;  2L5Q A;  1RL2 A;  1TOV A;  1B34 B;  2WAC A;  4EMK C;  3VS7 A;  3EG3 A;  3EG9 A;  1NJI C;  3UA7 A;  4J9B A;  2QQR A;  3G4S Q;  2YXY A;  2CZ0 B;  2BZY A;  2XIC A;  5FU7 C;  3H41 A;  1TS9 A;  2JJ9 A;  1OUL A;  1OI1 A;  3EGD A;  1E6G A;  2EQI A;  2EKH A;  4E47 A;  1GBQ A;  2P0Q A;  1IRX A;  2F69 A;  4PJO E;  3OW2 S;  3LYI A;  5A0G A;  3G6E T;  1Q86 R;  1Z9Z A;  2HAX A;  3REA B;  2RH2 A;  1OU9 A;  2RO0 A;  1KQS S;  3D7S B;  1S72 Q;  3T9N A;  3MCA B;  4C8Q A;  3CBP A;  1IZ6 A;  2AZV A;  2Y4X A;  2ZPF B;  4C92 E;  1K1Z A;  1WJS A;  2DBK A;  2NUT A;  1QP3 A;  4N4H A;  2JOY A;  5CAI A;  1UFF A;  2OTL A;  4M7D C;  2HNI A;  1VQ6 Q;  4E7J A;  3CMA Q;  2JM8 A;  2G6F X;  2O2O A;  2PZ1 A;  2RQR A;  1QKW A;  1T0H A;  1VQL A;  3J80 E;  4ZGE B;  2HL5 C;  1X43 A;  3C95 A;  1QCN A;  2VB6 A;  2RA2 A;  1M5Q 1;  8ATC B;  4LUE A;  3OA6 A;  2DL7 A;  2QA4 T;  2Y90 A;  3LH0 A;  4B9W A;  1UG1 A;  1VQ7 T;  4DBQ A;  5GAM h;  2E41 A;  3CCJ A;  3BE3 A;  5LJ3 g;  2IPO B;  2RNA A;  1O75 A;  1RAA B;  4LD9 K;  3LH5 A;  1UB4 A;  5KYY A;  5KCH A;  4Q5W A;  1NE8 A;  2ROL A;  1M3C A;  3CXC S;  1GCQ A;  4PJL A;  2AKL A;  5GJW B;  3LWI A;  1ZA1 B;  2FPD A;  4F7U F;  3RDV A;  4IKF A;  4M78 C;  3DKM A;  1VYT A;  3HFO A;  1N8R U;  3MHX A;  4PJO B;  1YI2 A;  4J6X A;  4F17 A;  4J83 A;  4OP0 A;  3OQ5 A;  1PWT A;  1W2B S;  3L2Z A;  3CC7 A;  4QW2 A;  2HKN A;  1HD3 A;  1PKT A;  2PUK B;  3N5B B;  1K0S A;  5C0M A;  4C92 B;  2D8J A;  1AT1 B;  4PFZ A;  1WNL A;  3E2U A;  1N27 A;  2DTO A;  2QAZ A;  1F1B B;  2X4J A;  1VQO A;  1ACM B;  1VQ4 Q;  4M75 B;  3AHU A;  2DRM A;  3VS3 A;  2J7I A;  2QXF A;  2G3R A;  4JJD A;  4XTY A;  1Q82 U;  4KGX B;  3EG2 A;  4A53 A;  2GFU A;  3CCJ Q;  4M77 A;  4OB0 B;  3URG A;  2EGE A;  1WQW A;  2BTT A;  2LJ1 A;  3CQT A;  4OMO A;  3PT9 A;  2V26 A;  3OYB A;  3SWN C;  1OPL A;  5GAN d;  2DL8 A;  2CH4 W;  1QWF A;  4RMO A;  3CME Q;  1LJO A;  1JJ2 S;  4BDY A;  1HK9 A;  1WQ7 A;  4M77 F;  2A36 A;  2E1H A;  2VGN A;  2KRS A;  3PVQ A;  1JBM A;  4A54 A;  1WPY A;  2C0T A;  4IUT A;  1UUE A;  1M2V B;  5GAM j;  3X24 B;  2ED1 A;  5FW9 A;  5GAN 6;  6AT1 B;  2XDP A;  4MZP A;  2A3L A;  2O4X A;  4OMF B;  4C8Q D;  1YI2 Q;  3UT1 A;  3L1A A;  2DIG A;  2RF0 A;  3M0P A;  3I56 T;  2F2W A;  5HK3 A;  2QG9 B;  1AWJ A;  3LLR A;  3CC7 Q;  1PC0 A;  2RI2 A;  1NG2 A;  4ZN3 A;  3X20 B;  4X9C A;  4QVC A;  2FZG B;  2GCX A;  3H9N A;  3X26 B;  2DA9 A;  2K57 A;  3OYI A;  1PSF A;  1N5Z A;  3EGX A;  3HRU A;  3PVL A;  4Z02 A;  2O01 E;  4M7D E;  2V8J A;  2CZ7 B;  2LX9 A;  4Z8A A;  2ZCF B;  2KYB A;  1Z9Q A;  2D0N A;  3A8H B;  5CO7 A;  3P8H A;  1GRI A;  1MMA A;  1YJN A;  3QJY A;  5GMK e;  2LJ3 A;  2HL3 A;  2CZ6 B;  5KYX A;  2HSP A;  2YLB A;  2LQW A;  3CPW S;  2DXT A;  3JCM d;  3G4S T;  3EG0 A;  3CCV A;  2FYK A;  1OYX A;  2VC8 A;  3M0S A;  1BIA A;  3M4G A;  1X6O A;  3H0F A;  1GBR A;  3KBG A;  1FWZ A;  1D1B A;  2E65 A;  3HRS A;  3V7R A;  1NJI U;  2IG0 A;  2DFU A;  2OTJ A;  4EMK B;  1PRM C;  5KYU B;  4BDZ A;  4KRT A;  1HSQ A;  1YJ9 A;  1UHF A;  5CK9 A;  5KH6 A;  2KYM A;  4J9D A;  4E7I A;  5FU7 B;  1NPP A;  2FZK B;  3CBO A;  3ZEH A;  1AWW A;  2LQ8 A;  3MKD A;  2GBQ A;  2OAU A;  1MHN A;  2DXB A;  3TU4 K;  3NFC A;  2DIQ A;  1J3T A;  1ZSZ A;  2YUQ A;  4AFS C;  2MCN A;  2X4W A;  3GNG A;  2F1L A;  4FL6 A;  4EDU A;  3OYA A;  2DEQ A;  3X25 B;  2BE9 B;  2CP6 A;  4II1 A;  3BW1 A;  3CMA T;  4PJJ A;  2OI3 A;  1VQ8 Q;  1YIT Q;  2XDB A;  2NLU A;  3G71 A;  1T0J A;  3M0U A;  3QZ5 B;  4OMN A;  1HXD A;  1K0X A;  2ENM A;  5CKD A;  1JB0 E;  4M78 F;  2CZ1 B;  2A37 A;  1D1C A;  1VIF A;  4M7A E;  1T3L A;  1YJN Q;  3E19 A;  2ED0 A;  4FU6 A;  4E7K A;  2COW A;  4M7D B;  2DZ9 A;  3JSC A;  1U1T A;  3OY9 A;  3HTR A;  4IUQ A;  2RQU A;  2O9V A;  2ZPI B;  3CCV Q;  2EPD A;  1ZBX A;  2FRW A;  4NOY A;  3G6E Q;  3KUF A;  4EIK A;  3NTI A;  3VRY A;  5GAO l;  1ZUY A;  3HPW A;  4RKU E;  2NWM A;  4N4G A;  3V8L A;  1MGQ A;  2CH4 A;  2OTJ Q;  2ATC B;  4R0K A;  2KR3 A;  4JDS A;  1KJW A;  4BE1 A;  1I81 A;  4PJM A;  2J6F A;  2E3I A;  4FT4 A;  1OOT A;  4JJB A;  3LX7 A;  4FSS A;  4FSX A;  3GP8 A;  3JCM J;  2DO3 A;  1M2O A;  3G1J A;  2OTL T;  1PCX A;  4M75 G;  3MP6 A;  1KSW A;  2LMJ A;  1WHM A;  3G71 Q;  2QQ9 A;  1YCY A;  2ROT A;  3WVE B;  1SRM A;  2RM4 A;  1YWO A;  2E12 A;  2QK0 A;  5GAN h;  5C6S A;  2KE9 A;  1IB8 A;  3CCJ T;  3VRZ A;  3CCS A;  4BE2 A;  4J7I A;  3PTA A;  2NUP B;  2RHU A;  2DJQ A;  4F7U G;  5LJ3 e;  2RQT A;  1JQQ A;  1N8R C;  3CCQ A;  1RAD B;  1N9R A;  2DZC A;  1BKB A;  5KYW B;  3JB9 I;  1B3Q A;  5I2M A;  2CT3 A;  1WA7 A;  2ZGW A;  3I9Q A;  1PRL C;  1N8R R;  4ELY C;  3BFM A;  2CRE A;  1SKU B;  1BBZ A;  3V8J A;  1YI2 T;  2VV5 A;  2VXF A;  2Z0W A;  5GAN 4;  2KRM A;  3SWN B;  1VQM A;  1JXM A;  1H3H A;  3CC4 Q;  3OYJ A;  3CC7 T;  5LJ5 g;  1G5V A;  3IQL A;  1Q82 C;  3I55 Q;  2K3B A;  3OW2 P;  1K9M U;  4F04 B;  1WHK A;  4MML A;  3OS2 A;  5DY9 A;  4OB3 B;  3V7S A;  4CC4 B;  1WDX A;  1PHT A;  3JCM X;  3EFO B;  3JCM h;  1RAG B;  5CKF A;  1VQO T;  4RTT A;  3QBY A;  3JRZ A;  3R6N A;  2COY A;  3ZBD A;  1KQS P;  4LDY A;  1G3T A;  1EFN A;  5IHN A;  2DTI A;  4M77 G;  2XD0 A;  3P8D A;  4ELZ C;  1GCQ C;  1X01 A;  4RTV A;  4JJN K;  4N0A A;  4QT7 A;  4ZGJ B;  2BKD N;  3QUI A;  1VQK A;  5IXB A;  4LN2 A;  2EBP A;  3CCQ Q;  4HA8 A;  1QMC A;  1B34 A;  4PFO A;  1GXI E;  5GAN j;  1QCF A;  2HD0 A;  3RMS A;  2AK5 A;  3VS2 A;  4M7A D;  4F14 A;  4JRP A;  3TEE A;  1FYN A;  2EKO A;  1M8M A;  5GAN 5;  2LRQ A;  3VYH B;  1BI0 A;  1ZQ1 A;  1OQK A;  2K5I A;  3H6Z A;  1XTD A;  3JAM E;  1I0C A;  1U06 A;  4RTU A;  4CC2 A;  1VQM Q;  5IAY A;  2JT4 A;  3A8G B;  3M53 A;  4FYY B;  4BI4 A;  4D8D A;  3G7Z A;  1X6B A;  4HVU A;  1GCP A;  2KNB B;  1TH7 A;  3PIP A;  1OX9 A;  3M55 A;  1VQ5 A;  4M77 C;  1A0N B;  1WYX A;  3EGU A;  4LDV A;  3BY7 A;  1E6H A;  1VQ8 T;  5LJ3 f;  3PNW C;  3CXC P;  1QQJ A;  2PQW A;  2X9H A;  1YNZ A;  4J6W A;  4Z88 A;  3OYG A;  1NEB A;  1M1G A;  2VGM A;  1PD0 A;  3OYL A;  3M58 A;  3HHT B;  3CPW A;  3MP1 A;  2H3E B;  3LGF A;  3L42 A;  3L2R A;  2GGR A;  5J39 A;  1IGU A;  3VS6 A;  1YJN T;  3PE0 A;  4QQG A;  1W2B P;  3HRT A;  1RI0 A;  3FEO A;  5GAN 8;  2DE0 X;  4HKE A;  5CVI A;  3CCV T;  1RLP C;  2KRN A;  1R77 A;  3J81 E;  5D7U A;  2J05 A;  5IH2 A;  2OX7 A;  4DA4 A;  4XU3 A;  5KCO A;  1D3B B;  3GPL A;  2DVJ A;  4PLL A;  5D6Y A;  1NJI R;  1O9S A;  4IUR A;  3F70 A;  1K4U S;  4WCI A;  3M4Y A;  1JXO A;  2H3J A;  2OTJ T;  1YJ9 T;  2F2V A;  2XI9 A;  2ZPE B;  4NL3 A;  1RUW A;  2QDL A;  4FW2 A;  4PJO A;  1EX4 A;  2EYX A;  1TTH B;  5A0L A;  4M78 G;  2IVW A;  1D0Y A;  4M75 E;  1IHV A;  3QXE B;  4PL6 A;  4C8Q F;  1JJ2 P;  4DBF A;  2W0Z A;  5A0D A;  1WXU A;  1WJR A;  3OYY A;  3G71 T;  1B07 A;  2M0O A;  4BUG A;  4C92 A;  4X1V A;  4L5G A;  2F5K A;  1KHC A;  2XMF A;  2E5Q A;  3FJ5 A;  4WTO B;  3SD4 A;  2H8H A;  4RCB A;  4J9C A;  4E2F B;  4F7U E;  3M5A A;  1FMW A;  3RIR A;  3HFN A;  1YBY A;  5KE3 A;  1NPR A;  2WSF E;  1WLP B;  5FRN A;  1ABO A;  3M57 A;  1C6V X;  4J9H A;  1Y96 A;  2LDM A;  3EG9 B;  1YJW A;  5IXF A;  5GAN 2;  3RUX A;  2GNC A;  3FC3 A;  1ZSZ C;  2DMO A;  1U5S A;  4TVR A;  1YIJ A;  3ZL7 C;  2LTO A;  2EYQ A;  2X3W D;  1NLO C;  2DPP B;  4XTV A;  3VKI A;  3JCM c;  1M2V A;  1SRL A;  3VUB A;  3FDR A;  2R57 A;  2KXD A;  3MEA A;  2DXC A;  2KQW A;  3O8V A;  2OTL Q;  3CC4 T;  2CP7 A;  3CPW P;  1MNE A;  1OZ2 A;  2LP5 A;  4X34 A;  4EMG A;  1VQL Q;  3A98 A;  1JU5 C;  4O6J A;  1WZO A;  2PNI A;  2RJC A;  3I55 T;  3TQ7 P;  2E10 A;  3CCM A;  1GFC A;  4DBR A;  2VVK A;  1W6X A;  2CP2 A;  2EQM A;  4HCK A;  4LDW A;  1WHJ A;  2CP0 A;  2XKO C;  1YN8 A;  3C4S A;  3C94 A;  5FU6 C;  2YRC A;  2P4T A;  3OB9 A;  3PFS A;  4J9F A;  4QKU A;  4IUP A;  4CRI A;  3C12 A;  3LGL A;  2GQI A;  3VS5 A;  3CCS T;  3L2U A;  1UJY A;  1KC8 C;  2D6F A;  2JTM A;  4BI3 A;  4EMH A;  2CP3 A;  4C5I A;  3JCM W;  3C0C A;  3I5S A;  3CCQ T;  4F7U B;  4RG2 A;  3OYE A;  2JTF A;  3QDR B;  1YP5 A;  4RCC A;  2I0N A;  2LCS A;  2EIF A;  4RG8 A;  3UAT A;  2K79 A;  1H3Z A;  3FLG A;  1R0C B;  2XK0 A;  1N9S A;  4J6Y A;  1K9M C;  3CC2 A;  3E9F A;  3SB2 A;  2EWN A;  4PJO D;  2XID A;  2C06 A;  1VQM T;  4EMK A;  5KYU A;  2QI2 A;  3THK A;  1M3B A;  1VIE A;  1QVF A;  2EQJ A;  3I35 A;  2P0K A;  4PNO A;  2DYB A;  2FPF A;  1UGP B;  1OX8 A;  5LJ5 e;  4HT8 A;  1W70 A;  5GAM g;  1DJ7 B;  2M51 A;  4BD3 A;  3UA6 A;  4C92 D;  1RI9 A;  1IXD A;  2RHI A;  3CCM Q;  4FT2 A;  1UEB A;  2RJD A;  1VQO Q;  2RQV A;  3U23 A;  1Q7Y U;  1MMG A;  3RNJ A;  1VQP A;  3EH2 A;  4RTX A;  4E6R A;  1FXX A;  3MP8 A;  2LCC A;  2L3P A;  2YUO A;  1UEC A;  4KGV B;  2HDA A;  1VQ9 A;  2OAW A;  2LZ6 B;  5CQX A;  3JV3 A;  1IGQ A;  1WJQ A;  3VS4 A;  1GFD A;  4M77 B;  2V1R A;  1KD1 U;  1VQK T;  5GAO q;  2LC4 A;  5DM7 R;  4JS5 A;  4M7D A;  2MPX C;  4NL2 A;  2WSE E;  4JRQ A;  3CCL A;  3Q1J A;  1X27 A;  4XTW A;  4A63 B;  4ANJ A;  1AEY A;  1YHQ A;  1HJD A;  4XQ3 A;  4PK4 A;  5GAO n;  4J7F A;  2JMC A;  4Y92 A;  4OB2 B;  1W1F A;  4KH1 B;  4KGZ B;  2O4X B;  2F2X A;  4GBQ A;  4IIO A;  1OZ3 A;  1JEG A;  2DLP A;  2YT6 A;  3TSZ A;  2DJZ A;  1Q86 U;  1UHC A;  4M78 E;  1B7T A;  2JVV A;  2EYZ A;  3RKW A;  2CSQ A;  5I22 A;  3M0Q A;  4RTW A;  2LJ0 A;  3DLL A;  3V8K A;  4OML A;  4LDX A;  5GMK l;  2MYS A;  3QWY A;  4N0A C;  2A08 A;  1ZUK A;  5LJ3 d;  2DER A;  2EAY A;  3OMC A;  2LX7 A;  2MWP A;  2RPN A;  1M1K C;  2K6D A;  1M9S A;  1X2K A;  4AG2 C;  1VQP Q;  2Y4Y A;  1AVZ C;  1QVG A;  1KQ2 A;  3OSS C;  2L8D A;  3QKJ A;  4XTZ A;  4DEY A;  4E7H A;  3TSW A;  2FG0 A;  1U3O A;  1VQ9 Q;  4JPB W;  2FHD A;  1OPK A;  4ZN1 A;  2QEX A;  2KK4 A;  4IUV A;  3H8Z A;  1WGS A;  3NTK A;  2LCL A;  3QO3 A;  1VQ7 A;  4XAX B;  1LNX A;  2NUP A;  2DRK A;  3UPU A;  2D0Q B;  4B6M A;  2L0A A;  3MO8 A;  4M7A A;  1YHQ Q;  1QVF P;  2SRC A;  1I07 A;  1NYG A;  4M4Z A;  4D8K A;  5CIU A;  4C8Q G;  2LT4 A;  3OMG A;  5GMK h;  2K2V A;  3CPF A;  5LJ5 f;  1YJ9 Q;  1ZUU A;  5CCA A;  1QCO A;  1G3W A;  4M7A F;  1OU8 A;  3CD6 A;  1SSH A;  3CCE A;  3V7C A;  5I21 A;  1AZE A;  5HY6 A;  1G83 A;  1AD5 A;  1VQL T;  3M59 A;  1QP2 A;  1RAE B;  5EG2 A;  2IIM A;  1KQ1 A;  2RHZ A;  4M78 B;  2DD5 A;  2E5K A;  1AWO A;  4ESR A;  2WSC E;  3SDZ A;  1VYU A;  5IT9 E;  2LQK A;  3TVT A;  4BAC A;  5KYN A;  1W4S A;  2B86 A;  2O9S A;  2DL3 A;  1EIF A;  1K73 U;  4PFP A;  3EFO A;  4ZNX A;  1E7O A;  1WHG A;  2YUP A;  1I5O B;  4M7D D;  2KBT A;  4MDX A;  4C8Q C;  2P4R A;  2FL7 A;  3VS0 A;  2V8I A;  1YJW T;  2FPE A;  3PGG A;  3CEY A;  4OVA A;  2PU9 B;  1ARK A;  3NMZ C;  4OGE A;  3GIB A;  5CKB A;  4X9D A;  4C5E A;  5FU6 B;  1KC8 U;  1BIB A;  2FB7 A;  4FYV B;  5GAN f;  4OGC A;  1V76 A;  4KUL A;  4LNP A;  3LWH A;  1I4K 1;  3CBM A;  1MV0 B;  4C92 C;  1TWB A;  2L2P A;  4JRK A;  1YCS B;  3A5Z B;  1G8X A;  4NS5 A;  2M0Y A;  5AYF A;  1QVG P;  1KIK A;  1Q81 U;  2BIV A;  1UDL A;  2HSE B;  3HP9 A;  3JB9 F;  5GMK j;  1VQN A;  4FIB A;  3S6W A;  2X35 A;  4CI0 C;  2EGC A;  4OMP A;  3QZ9 B;  1QVF S;  3OS0 A;  4KT0 E;  3RES A;  1TU0 B;  3CCM T;  4JLI A;  2D9T A;  1UGR B;  3LW5 E;  8AT1 B;  1V29 B;  4JLG A;  2LNV A;  1Q82 R;  2DAQ A;  2DF6 A;  4HCZ A;  2HCK A;  7AT1 B;  3CCS Q;  3PMT A;  4JZ4 A;  9ATC B;  5GAO m;  3EG1 A;  2JN0 A;  1U1S A;  1UE9 A;  1NBE B;  5GAO p;  5CKH A;  3ASK A;  3QPH A;  1RAH B;  1C0M A;  4MMK A;  3S3M A;  4ATO A;  1XJW B;  2K9G A;  1I1J A;  1VA7 A;  3MET A;  1PSE A;  2MWO A;  1M27 C;  3JCM f;  1D3B A;  4FW1 A;  2HQH A;  1VYV A;  1ZBJ A;  2J6K A;  4XU0 A;  2QQB A;  5FRM A;  5LJ3 h;  4EPC A;  3TRE A;  1SEM A;  3A8L B;  1Q7Y C;  2KVQ G;  4QVZ A;  3RMQ A;  4LE9 A;  5GAN g;  1RAB B;  3GNF B;  2YSQ A;  4E7S A;  5I2S A;  1S72 A;  2RQW A;  5LL6 S;  1M8V A;  2NUZ A;  2E6N A;  1VOM A;  2VKN A;  5GAM e;  1Y0M A;  1MMN A;  2AZS A;  3PMI A;  4Y91 A;  1KD1 C;  1Q7Y R;  2RB6 A;  1VQ6 A;  1NYF A;  1BK2 A;  1VQP T;  2YRV A;  3RER A;  1JRI A;  2EYY A;  2EJ9 A;  2FEI A;  4HT9 A;  1WFW A;  3E9G A;  5IHK A;  2CUD A;  1M1K U;  1VQK Q;  2M9U A;  1VQ9 T;  2DKG A;  1QVG S;  1K8A U;  1TG0 A;  1UGQ B;  4AT1 B;  2A0F B;  2ESW A;  2R5A A;  3JCM V;  1ZLM A;  2DBM A;  2VYT A;  4BE0 A;  4HCC A;  2AHJ B;  3CCL T;  1Q86 C;  3QG1 A;  2W10 A;  5FWB A;  1BYM A;  4C8Q E;  2DNU A;  2EQU A;  1YHQ T;  3VV0 A;  2GTO A;  1U8R A;  4LXC A;  5FRO A;  3JB9 D;  4AFU C;  3OS5 A;  1NM7 A;  4BI8 B;  1X69 A;  2K3X A;  2M16 A;  2HBW A;  3QJ6 A;  5GMK i;  1CKB A;  4E7Z A;  2HMA A;  1H8K A;  3VJP A;  2RJF A;  1Y71 A;  2ZPG B;  2CS7 A;  2E6Z A;  2MI6 A;  5GJV B;  2NYS A;  2C0O A;  3JCM g;  1Y7X A;  4D6W A;  1M90 U;  3SEM A;  3WVD B;  1VQ5 Q;  2KI7 A;  1CSK A;  3CCU A;  3OYC A;  1G2B A;  4PJO F;  1BCM A;  5GAN 7;  3SFM A;  5LJ3 j;  2DX1 A;  4DOW A;  2R5M A;  4A4H A;  2XG8 D;  3SHW A;  2XU8 A;  2DIL A;  3BDU A;  3RBB B;  5CKE A;  1M30 A;  2YLC A;  1KHI A;  2QGG A;  4ZTF A;  4M75 A;  4C0G A;  5KE2 A;  2JM9 A;  4C0Z A;  4C92 F;  4FYX B;  4OF1 A;  5FLX E;  2QEX T;  4C0D C;  5IN1 A;  1X6G A;  1VQ4 A;  2C0I A;  4PJN A;  1ZSG A;  4BY6 C;  2EJF A;  2QGF B;  3EGD B;  2P0P A;  2LVM A;  4M75 F;  2YUN A;  4M7A G;  2RI5 A;  1SPK A;  3OYD A;  1WX6 A;  2MOX A;  3M9Q A;  2E64 A;  4C0F A;  4HVV A;  1UJ0 A;  1KG1 A;  4QVD A;  1QWE A;  5LJ5 d;  4F7U A;  2BE7 D;  1BCO A;  2RN8 A;  3CME A;  2E4H A;  1QLY A;  3QWX X;  2EFI A;  2X4X A;  1NEG A;  5GAM f;  4KUD K;  4C8Q B;  2HQE A;  1UTI A;  3J7A F;  4RUG A;  4QQ6 A;  4XTU A;  1H64 1;  2NUT B;  3CD6 T;  3CCE T;  2X3X D;  2K7A A;  2A7Y A;  2DVE A;  4XU1 A;  3CCR A;  3NGP A;  2XDD A;  3RKY A;  1BI3 A;  1BU1 A;  3FIF A;  3KXT A;  4F16 A;  1K73 C;  2RHX A;  4A4G A;  3CCU Q;  2QAS A;  3EFS A;  2JNG A;  1PNJ A;  2O88 A;  1HYO A;  1Q95 G;  2GFA A;  1XOV A;  4M77 E;  4FM4 B;  1WI7 A;  1PG5 B;  1X75 C;  2DL5 A;  1EZZ B;  1QW1 A;  5D6W A;  1XQH A;  1PKS A;  2LT1 A;  2R58 A;  1K73 R;  4M7A C;  4J9E A;  2MMP A;  4J8O A;  2KT8 A;  3UWN A;  1X2Q A;  2FZC B;  2YRD A;  1YJW Q;  4ME7 A;  4JRI A;  1Y96 B;  4OMM A;  2OJ2 A;  2D8H A;  5KYY B;  1YIJ Q;  1YFN A;  3OYM A;  2EQK A;  1TUG B;  2KSS A;  1KC8 R;  1Q81 C;  4LD6 A;  3M56 A;  2EJG A;  3H0I A;  2L3Q A;  3JB9 G;  3GF5 A;  5ECA A;  1TSF A;  4IIM A;  3M0R A;  2SEM A;  4L6V 5;  4P5N A;  2ZPB B;  1GL5 A;  1FMV A;  1JO8 A;  4L59 A;  2MF2 A;  3FB9 A;  3ME9 A;  3CCR Q;  1Q81 R;  3HKS A;  1PD1 A;  2P84 A;  3RR6 A;  2RD1 A;  2V8K A;  3A8O B;  4QQD A;  2YHT A;  2BZ8 A;  1VQN T;  1K9M R;  3DB4 A;  1QVP A;  4HXJ A;  2XHC A;  1PM3 A;  4J9G A;  2V1Q A;  4PLI A;  3M54 A;  5DLQ E;  2DM1 A;  3A8M B;  4DOV A;  3EFR A;  3VYG A;  3NHN A;  1MND A;  4M75 D;  1VQ8 A;  2HKQ B;  1YIT A;  2PVD B;  1MV3 A;  4A4K A;  1SG5 A;  2EW3 A;  2FVU A;  3QYH B;  4ORZ A;  2QTX A;  3S3O A;  2DL4 A;  3VUZ A;  3MEW A;  4AMC A;  1R0B G;  2QDY B;  2E3H A;  5CQY A;  2FO0 A;  2X4Y A;  3OBW A;  3EAE A;  4IUU A;  1IO6 A;  4OB1 B;  3AT1 B;  4M7D F;  3A1P A;  2PVO B;  3WXM B;  1M1F A;  1S1N A;  3CC2 Q;  2RK2 A;  3G6E A;  3BDL A;  1YWP A;  4KUI A;  5HCK A;  3NPF A;  1LOJ A;  2QYZ A;  1WXB A;  3TCJ A;  1MUZ A;  3ULR B;  1OEB A;  2DD4 A;  2ZZD A;  3DB3 A;  2KDS A;  2DYI A;  1AWX A;  2AT1 B;  2ZPH B;  5GAN e;  2I2L A;  1AZG B;  5A2Q E;  1RAF B;  1S72 T;  1SSF A;  1VQ5 T;  4MDW A;  1N6A A;  4KBM B;  1K8A C;  1TUD A;  2COZ A;  2VAS A;  3EGX B;  4GLM A;  4ZTJ A;  1VQ6 T;  4UC4 A;  4M78 A;  2YDL A;  2YWW A;  4MZT A;  2CP5 A;  2L3S A;  1WHH A;  1SHF A;  2CT4 A;  4BB7 A;  1FMK A;  3NTH A;  4R55 A;  1G3Y A;  2RK1 A;  1TUC A;  3O5Z A;  1D1A A;  1M1K R;  2D1X A;  1QKX A;  2A28 A;  5KYX B;  1K8A R;  3MEU A;  2JS2 A;  2QA4 A;  5LJ5 h;  5FWC A;  4A4F A;  3R6O A;  3JCM b;  4M77 D;  3OYK A;  3CCL Q;  3OYF A;  2VXE A;  2K2M A;  2KAF A;  2K5F A;  4HCB A;  3OW2 A;  3EHQ A;  2CKK A;  1ZA2 B;  1M90 C;  4J5Y A;  5DLO A;  2X51 A;  5I11 A;  5KYW A;  1IRE B;  3X28 B;  3ER0 A;  4OMQ A;  1KQS A;  2JTE A;  3OYN A;  2QQS A;  4C0D B;  2ZAE A;  1BB9 A;  2HBP A;  4PJO G;  5J3B A;  2M1H A;  5CR2 A;  1K76 A;  1KFZ A;  4BY6 B;  2JUF A;  2RI3 A;  1M90 R;  2ABL A;  1ZSZ B;  3SWN A;  3JCM e;  4JJC A;  3QDF A;  1UGV A;  4C92 G;  3MEV A;  4V2S A;  1LPL A;  4K11 A;  3CC4 A;  2PVG B;  3CCU T;  2LQN A;  4R56 A;  1M4Z A;  2EYW A;  2QTV A;  2AKK A;  2FRY A;  4C5G A;  1T3S A;  1I5L A;  2L3R A;  3OYH A;  3I55 A;  1D09 B;  2M02 A;  3L2W A;  1IHW A;  2AIR B;  1RAI B;  3EHR A;  3OSV A;  2QEX Q;  2VWF A;  2K4Y A;  1WXT A;  2QA4 Q;  4AFZ C;  1BI1 A;  1M3A A;  1UGS B;  1VQ7 Q;  2MIO A;  1VQ4 T;  3INZ A;  3ZFJ A;  3GOX A;  2RHY A;  5IHI A;  4PJO C;  4DBH A;  1LVK A;  1ZHI A;  1BI2 A;  2JXB A;  4Z89 A;  4JUV A;  4PKC C;  2EVR A;  2DET A;  3CXC A;  4LDU A;  1YIJ T;  2RJE A;  3JCM Q;  3QSU A;  3QYG B;  2HEQ A;  3I5R A;  4M7A B;  1MMD A;  1ABQ A;  5LJ5 j;  5AT1 B;  4WF2 A;  3CME T;  5GAM d;  1FX7 A;  5GMK m;  1XNI A;  3DLM A;  1VUB A;  3CD6 Q;  3EH1 A;  4XU2 A;  1G3S A;  3CCE Q;  4GLK A;  1W2B A;  3QII A;  3REB B;  2CYZ B;  2VUB A;  2F5T X;  3PIO A;  1P92 A;  2LNH B;  1NZ9 A;  3I56 A;  3CCR T;  1OV3 A;  4DEX A;  2DK3 A;  4DQ2 A;  2BUD A;  2O31 A;  4M75 C;  5HKC A;  2KEA A;  4ZGD B;  3P8B B;  3OS1 A;  1ZX6 A;  4VUB A;  2KY9 A;  4M78 D;  2BZX A;  2KGT A;  1AOJ A;  3VU3 C;  2CDT A;  2MAM A;  2MK5 A;  4KH0 B;  5J26 A;  1V1C A;  3JB9 J;  1SF9 A;  4MZM A;  3UDC A;  5L8R E;  2HQX A;  4A4E A;  2CSI A;  3L2Q A;  2CGH A;  3JCM P;  2L89 A;  1RLQ C;  5M9O A;  4FCY A;  3QHS A;  3S3N A;  1K9A A;  4O5V A;  1TXQ A;  2EGA A;  1JJ2 A;  2KT1 A;  1KK7 A;  1NLP C;  5HK0 A;  1C1A A;  3HSB A;  2GQV A;  1AHJ B;  1D0Z A;  4C5H A;  3M0T A;  1R8O B;  3G4S A;  2K3Y A;  4N4I A;  1D0X A;  1WHL A;  2GTJ A;  2JMA A;  4FYW B;  3FJP A;  5GAN 3;  3MJX A;  2KMT A;  5L23 A;  5EC7 A;  3CC2 T;  1LCK A;  3UF4 A;  1RAC B;  3GBQ A;  1Y07 A;  5GAO r;  4YTL A;  2K5L A;  2QQA A;  2KRO A;  4AFQ C;  1I8F A;  3I56 Q;  2DTH A;  3VS1 A;  1VQN Q;  2JZ2 A;  2J6O A;  2ECZ A;  4JZ3 A;  4XK8 E;  1CKA A;  4J9I A;  3JB9 H;  2KXC A;  2HZY A;  1Y57 A;  2RMO A;  3RKX A;  1WIE A;  2J06 A;  2PTK A;  4E7L A;  3OBY A;  2B8A A;  1SHG A;  3CMA A;  3HL8 A;  3KFV A;  2JS0 A;  4CC3 A;  2GF7 A;  2PUO B;  3MPU B;  4RTY A;  4Y28 E;  1H92 A;  4XTX A;  4CC7 A;  3L2V A;  1YIT T;  3E1S A;  2JW4 A;  2CUB A;  4GY5 A;  4JS4 A;  2DXU A;  4M7D G;  3H0H A;  4B9X A;  1KD1 R;  5D6X A;  2E70 A;  3GLX A;  4AG1 C;  2DEU A;  3FRN A;  4HVW A;  4LUD A; 
#chains in the Genus database with same CATH homology
 2GFA A;  1Q86 U;  1XOV A;  4M78 E;  2L5Q A;  4M77 E;  1RL2 A;  2JVV A;  4FM4 B;  3JB9 I;  1B34 B;  1X75 C;  3RKW A;  2WAC A;  5I2M A;  4EMK C;  2ZGW A;  1QW1 A;  5D6W A;  1NJI C;  2QQR A;  1XQH A;  3DLL A;  2LT1 A;  2R58 A;  3V8K A;  2CZ0 B;  4M7A C;  4LDX A;  2XIC A;  5GMK l;  2MMP A;  5FU7 C;  4N0A C;  4ELY C;  3BFM A;  4J8O A;  1OI1 A;  3UWN A;  5LJ3 d;  2EAY A;  2MWP A;  3OMC A;  3V8J A;  2VV5 A;  2VXF A;  1YI2 T;  4E47 A;  5GAN 4;  1M1K C;  3SWN B;  1VQM A;  2P0Q A;  4ME7 A;  4JRI A;  1M9S A;  2F69 A;  4PJO E;  3OW2 S;  3LYI A;  3OYJ A;  5A0G A;  3G6E T;  3CC7 T;  2Y4Y A;  1QVG A;  1Y96 B;  1KQ2 A;  3OSS C;  2L8D A;  3QKJ A;  4XTZ A;  5LJ5 g;  2HAX A;  1G5V A;  4E7H A;  2RH2 A;  1Q82 C;  2RO0 A;  1KQS S;  3OYM A;  2EQK A;  2FHD A;  4ZN1 A;  2KSS A;  2QEX A;  3T9N A;  3MCA B;  4C8Q A;  1Q81 C;  3CBP A;  1IZ6 A;  2Y4X A;  2ZPF B;  3M56 A;  4LD6 A;  2EJG A;  2KK4 A;  4IUV A;  4C92 E;  1WJS A;  1QP3 A;  4MML A;  3H8Z A;  3GF5 A;  4N4H A;  2JOY A;  1WGS A;  3NTK A;  4OB3 B;  5DY9 A;  3V7S A;  3JCM X;  2LCL A;  3QO3 A;  3JCM h;  1VQ7 A;  5CKF A;  4XAX B;  1VQO T;  5CAI A;  4L6V 5;  3QBY A;  3JRZ A;  3ZBD A;  1LNX A;  2OTL A;  4M7D C;  2HNI A;  1G3T A;  4LDY A;  4P5N A;  4E7J A;  3UPU A;  2ZPB B;  2DTI A;  4M77 G;  2XD0 A;  2D0Q B;  4L59 A;  3P8D A;  2MF2 A;  3FB9 A;  4ELZ C;  3J80 E;  3MO8 A;  1VQL A;  4ZGE B;  1X01 A;  4M7A A;  3ME9 A;  4JJN K;  4N0A A;  4ZGJ B;  3HKS A;  2BKD N;  3C95 A;  5CIU A;  3QUI A;  2RD1 A;  2V8K A;  4C8Q G;  1VQK A;  3A8O B;  2LT4 A;  3OMG A;  5GMK h;  2K2V A;  3CPF A;  4QQD A;  5LJ5 f;  2YHT A;  5CCA A;  2RA2 A;  4HA8 A;  1M5Q 1;  1VQN T;  3DB4 A;  1B34 A;  1QVP A;  1GXI E;  3OA6 A;  5GAN j;  1G3W A;  2HD0 A;  3RMS A;  2XHC A;  4M7A F;  3CD6 A;  2QA4 T;  4PLI A;  2Y90 A;  3LH0 A;  3CCE A;  3M54 A;  4B9W A;  5DLQ E;  3A8M B;  3V7C A;  4DOV A;  4M7A D;  4JRP A;  1VQ7 T;  3TEE A;  3EFR A;  2EKO A;  3VYG A;  5GAM h;  2E41 A;  3CCJ A;  5GAN 5;  5I21 A;  2LRQ A;  4M75 D;  3VYH B;  1BI0 A;  5HY6 A;  5LJ3 g;  1ZQ1 A;  2K5I A;  1VQ8 A;  3H6Z A;  1YIT A;  2PVD B;  1XTD A;  3JAM E;  4A4K A;  1VQL T;  3M59 A;  1O75 A;  1QP2 A;  2FVU A;  5EG2 A;  3QYH B;  4LD9 K;  1KQ1 A;  2RHZ A;  1UB4 A;  2QTX A;  2DD5 A;  4M78 B;  3S3O A;  5IAY A;  3VUZ A;  3A8G B;  3M53 A;  5KCH A;  2WSC E;  3MEW A;  4BI4 A;  4Q5W A;  3SDZ A;  3G7Z A;  1NE8 A;  2QDY B;  5IT9 E;  5CQY A;  3CXC S;  2LQK A;  2X4Y A;  1TH7 A;  4BAC A;  3OBW A;  3LWI A;  3PIP A;  1W4S A;  3EAE A;  4F7U F;  1EIF A;  4IUU A;  1K73 U;  4IKF A;  3M55 A;  4M78 C;  4M77 C;  3DKM A;  4OB1 B;  1VQ5 A;  3HFO A;  4LDV A;  1N8R U;  3BY7 A;  3MHX A;  4PJO B;  1YI2 A;  4M7D F;  4J6X A;  4J83 A;  2PVO B;  1VQ8 T;  4M7D D;  5LJ3 f;  3PNW C;  3WXM B;  1M1F A;  4OP0 A;  4MDX A;  2PQW A;  3OQ5 A;  4J6W A;  4C8Q C;  3OYG A;  1W2B S;  2FL7 A;  1M1G A;  2RK2 A;  2VGM A;  3L2Z A;  3G6E A;  2V8I A;  3BDL A;  4QW2 A;  3CC7 A;  3OYL A;  1YJW T;  4KUI A;  3M58 A;  1LOJ A;  3PGG A;  3HHT B;  3CEY A;  3MP1 A;  4OVA A;  3TCJ A;  3CPW A;  2PU9 B;  3LGF A;  4OGE A;  3GIB A;  2PUK B;  3L42 A;  3N5B B;  2DD4 A;  2ZZD A;  3DB3 A;  4C92 B;  5C0M A;  5CKB A;  2KDS A;  3L2R A;  4X9D A;  5J39 A;  1YJN T;  4C5E A;  1WNL A;  4QQG A;  5FU6 B;  2ZPH B;  3HRT A;  1KC8 U;  1N27 A;  1RI0 A;  2DTO A;  3FEO A;  1BIB A;  5GAN e;  2I2L A;  2FB7 A;  5A2Q E;  5GAN f;  5GAN 8;  1S72 T;  1SSF A;  1VQ5 T;  4OGC A;  4KUL A;  4HKE A;  4MDW A;  3LWH A;  2X4J A;  1N6A A;  1I4K 1;  5CVI A;  1VQO A;  4M75 B;  4KBM B;  3CCV T;  3CBM A;  3AHU A;  1K8A C;  3J81 E;  4C92 C;  4DA4 A;  2QXF A;  4XU3 A;  4JRK A;  5KCO A;  1D3B B;  3GPL A;  3A5Z B;  2G3R A;  4NS5 A;  4XTY A;  1Q82 U;  4ZTJ A;  4A53 A;  2GFU A;  4UC4 A;  1VQ6 T;  5AYF A;  4M78 A;  4M77 A;  4OB0 B;  4PLL A;  3URG A;  4MZT A;  5D6Y A;  1O9S A;  1WQW A;  4IUR A;  1Q81 U;  4BB7 A;  2BIV A;  3F70 A;  3HP9 A;  3NTH A;  4R55 A;  3PT9 A;  3JB9 F;  1G3Y A;  3M4Y A;  3OYB A;  5GMK j;  1VQN A;  2RK1 A;  2H3J A;  4FIB A;  3S6W A;  2X35 A;  3SWN C;  2OTJ T;  4CI0 C;  5GAN d;  4RMO A;  1YJ9 T;  3QZ9 B;  1LJO A;  2XI9 A;  3OS0 A;  4KT0 E;  1JJ2 S;  1QVF S;  2ZPE B;  3MEU A;  2QA4 A;  3RES A;  5LJ5 h;  4BDY A;  4NL3 A;  1HK9 A;  3CCM T;  1WQ7 A;  4JLI A;  2E1H A;  2VGN A;  3R6O A;  4M77 F;  4A4F A;  3JCM b;  1JBM A;  1UGR B;  2D9T A;  3LW5 E;  4M77 D;  4A54 A;  1WPY A;  3OYF A;  3OYK A;  4PJO A;  2VXE A;  4IUT A;  1V29 B;  5GAM j;  3X24 B;  4JLG A;  2KAF A;  5A0L A;  2LNV A;  2K5F A;  4M78 G;  2IVW A;  5GAN 6;  4HCB A;  4M75 E;  3QXE B;  2DAQ A;  4PL6 A;  4C8Q F;  2XDP A;  3OW2 A;  4MZP A;  2A3L A;  2O4X A;  4HCZ A;  4OMF B;  2CKK A;  4C8Q D;  1M90 C;  3PMT A;  3UT1 A;  3L1A A;  4J5Y A;  2DIG A;  5DLO A;  5GAO m;  5A0D A;  1WJR A;  3I56 T;  3OYY A;  2JN0 A;  3G71 T;  1IRE B;  2M0O A;  4BUG A;  3X28 B;  4C92 A;  5HK3 A;  3ER0 A;  4L5G A;  1KQS A;  1U1S A;  2F5K A;  3LLR A;  3OYN A;  2QQS A;  4C0D B;  2RI2 A;  5GAO p;  4ZN3 A;  1KHC A;  5CKH A;  3ASK A;  2HBP A;  4PJO G;  2E5Q A;  3QPH A;  4X9C A;  5J3B A;  3X20 B;  2M1H A;  3SD4 A;  5CR2 A;  4MMK A;  4QVC A;  3S3M A;  4ATO A;  2GCX A;  4BY6 B;  2JUF A;  4RCB A;  2RI3 A;  3X26 B;  4F7U E;  2K57 A;  3SWN A;  3M5A A;  3RIR A;  3MET A;  3HFN A;  3JCM e;  1PSE A;  3OYI A;  1PSF A;  2MWO A;  1YBY A;  3JCM f;  5KE3 A;  1D3B A;  1NPR A;  3HRU A;  2WSF E;  4Z02 A;  2O01 E;  5FRN A;  4M7D E;  2V8J A;  3M57 A;  2CZ7 B;  2LX9 A;  2ZCF B;  1Y96 A;  2LDM A;  4C92 G;  1YJW A;  3MEV A;  4V2S A;  4XU0 A;  3A8H B;  5CO7 A;  2QQB A;  5GAN 2;  3CC4 A;  2PVG B;  3CCU T;  5FRM A;  3P8H A;  5LJ3 h;  4EPC A;  1M4Z A;  4R56 A;  3TRE A;  3RUX A;  3A8L B;  3OS2 A;  1Q7Y C;  4C5G A;  3FC3 A;  1YJN A;  2KVQ G;  4QVZ A;  3QJY A;  5GMK e;  1I5L A;  3RMQ A;  2L3R A;  4TVR A;  2CZ6 B;  5GAN g;  1YIJ A;  3OYH A;  3I55 A;  3GNF B;  3L2W A;  2LTO A;  5I2S A;  1S72 A;  2YLB A;  1M8V A;  5LL6 S;  2EYQ A;  4XTV A;  2DPP B;  3OSV A;  3CPW S;  2DXT A;  3JCM d;  3G4S T;  3VKI A;  3CCV A;  2K4Y A;  3JCM c;  2E6N A;  2FYK A;  1OYX A;  2VC8 A;  5GAM e;  3VUB A;  1BI1 A;  3FDR A;  2R57 A;  3PMI A;  4Y91 A;  1KD1 C;  1UGS B;  1BIA A;  3M4G A;  2DXC A;  1X6O A;  2KQW A;  3MEA A;  1VQ4 T;  2RB6 A;  3O8V A;  1VQ6 A;  3INZ A;  3ZFJ A;  3KBG A;  1FWZ A;  3CC4 T;  3GOX A;  2YRV A;  1VQP T;  2E65 A;  3RER A;  1JRI A;  2RHY A;  3HRS A;  3V7R A;  1NJI U;  1OZ2 A;  4EMG A;  4X34 A;  2EJ9 A;  4PJO C;  4HT9 A;  2IG0 A;  1ZHI A;  1BI2 A;  1K9M U;  3E9G A;  2OTJ A;  4JUV A;  4PKC C;  4EMK B;  4BDZ A;  3CXC A;  4LDU A;  4O6J A;  1YJ9 A;  1YIJ T;  5CK9 A;  2RJC A;  3I55 T;  2RJE A;  3JCM Q;  2M9U A;  5KH6 A;  3QYG B;  1M1K U;  3QSU A;  1VQ9 T;  2E10 A;  4M7A B;  2DKG A;  1QVG S;  1K8A U;  3CCM A;  1UGQ B;  5FU7 B;  1NPP A;  3CBO A;  3ZEH A;  4E7I A;  2LQ8 A;  5LJ5 j;  4WF2 A;  3CME T;  2OAU A;  1MHN A;  2DXB A;  2EQM A;  3NFC A;  4LDW A;  5GAM d;  1FX7 A;  3TU4 K;  2DIQ A;  5GMK m;  1XNI A;  2R5A A;  2XKO C;  3DLM A;  1VUB A;  2X4W A;  3GNG A;  3JCM V;  4BE0 A;  2VYT A;  4HCC A;  4XU2 A;  1G3S A;  4FL6 A;  3C4S A;  3C94 A;  4GLK A;  4EDU A;  2AHJ B;  3OYA A;  2DEQ A;  5FU6 C;  3CCL T;  2P4T A;  3OB9 A;  3X25 B;  3QII A;  1W2B A;  3PFS A;  1Q86 C;  3QG1 A;  4II1 A;  3BW1 A;  2CYZ B;  2VUB A;  2F5T X;  4IUP A;  3PIO A;  3CMA T;  1BYM A;  4C8Q E;  1P92 A;  4CRI A;  3C12 A;  2EQU A;  1YHQ T;  2XDB A;  1NZ9 A;  3VV0 A;  3I56 A;  3CCR T;  2DK3 A;  3LGL A;  2NLU A;  2BUD A;  4DQ2 A;  3G71 A;  3CCS T;  3L2U A;  1U8R A;  5FRO A;  3JB9 D;  4M75 C;  5HKC A;  1KC8 C;  2D6F A;  3QZ5 B;  2JTM A;  4BI3 A;  3OS5 A;  4BI8 B;  4EMH A;  1HXD A;  4C5I A;  3P8B B;  4ZGD B;  3JCM W;  2K3X A;  2M16 A;  3OS1 A;  3CCQ T;  5CKD A;  3QJ6 A;  5GMK i;  1JB0 E;  4M78 F;  4F7U B;  2CZ1 B;  4RG2 A;  4VUB A;  3OYE A;  3JB9 G;  2KY9 A;  4M78 D;  2RJF A;  3VJP A;  1VIF A;  1Y71 A;  2ZPG B;  2CS7 A;  4M7A E;  3E19 A;  2JTF A;  2E6Z A;  3QDR B;  4FU6 A;  2MI6 A;  2MAM A;  5J26 A;  3JCM g;  3VU3 C;  1Y7X A;  4D6W A;  4E7K A;  4RCC A;  3JB9 J;  1M90 U;  4M7D B;  2DZ9 A;  3JSC A;  1U1T A;  3OY9 A;  4MZM A;  3WVD B;  3UDC A;  2EIF A;  4RG8 A;  5L8R E;  4IUQ A;  2HQX A;  4A4E A;  1H3Z A;  3L2Q A;  3FLG A;  2ZPI B;  2CGH A;  2XK0 A;  3CCU A;  3JCM P;  1N9S A;  3OYC A;  4J6Y A;  1ZBX A;  1K9M C;  3CC2 A;  4PJO F;  2L89 A;  4NOY A;  5M9O A;  5GAN 7;  3E9F A;  3SB2 A;  3SFM A;  2EWN A;  3QHS A;  2XID A;  5LJ3 j;  3S3N A;  4PJO D;  3KUF A;  4DOW A;  2C06 A;  2R5M A;  1VQM T;  4EMK A;  3NTI A;  4A4H A;  2QI2 A;  2XG8 D;  2XU8 A;  4O5V A;  5GAO l;  1VIE A;  3BDU A;  3HPW A;  4RKU E;  1JJ2 A;  2EQJ A;  1QVF A;  5HK0 A;  2P0K A;  4PNO A;  4N4G A;  5CKE A;  3HSB A;  2GQV A;  1AHJ B;  2YLC A;  3V8L A;  1MGQ A;  1UGP B;  1R8O B;  4C5H A;  1KHI A;  3G4S A;  2K3Y A;  4N4I A;  4ZTF A;  5LJ5 e;  4M75 A;  4C0G A;  5KE2 A;  4C0Z A;  4HT8 A;  4JDS A;  4C92 F;  5GAM g;  1DJ7 B;  3FJP A;  4BD3 A;  4BE1 A;  4OF1 A;  4C92 D;  1I81 A;  5FLX E;  5GAN 3;  4C0D C;  2QEX T;  2RHI A;  5IN1 A;  4FT2 A;  1UEB A;  4FT4 A;  2KMT A;  2RJD A;  1VQ4 A;  3LX7 A;  1Q7Y U;  1VQP A;  4BY6 C;  2EJF A;  4FSX A;  3CC2 T;  2P0P A;  3GP8 A;  3JCM J;  1FXX A;  2LVM A;  2LCC A;  3MP8 A;  2DO3 A;  4M75 F;  4M7A G;  2OTL T;  2RI5 A;  3OYD A;  1Y07 A;  5GAO r;  3M9Q A;  2E64 A;  4YTL A;  4C0F A;  2K5L A;  2QQA A;  3MP6 A;  4M75 G;  1VQ9 A;  1I8F A;  5CQX A;  1KG1 A;  4QVD A;  2DTH A;  5LJ5 d;  4F7U A;  2QQ9 A;  1WJQ A;  2JZ2 A;  1YCY A;  4M77 B;  3WVE B;  3CME A;  2RM4 A;  1KD1 U;  1VQK T;  5GAO q;  4XK8 E;  2LC4 A;  5DM7 R;  3JB9 H;  2E12 A;  4JS5 A;  4M7D A;  2EFI A;  2X4X A;  3RKX A;  4NL2 A;  2WSE E;  5GAM f;  5GAN h;  3OBY A;  4JRQ A;  4E7L A;  2B8A A;  4KUD K;  4C8Q B;  5C6S A;  2HQE A;  3CCL A;  3J7A F;  3Q1J A;  4QQ6 A;  4XTU A;  1H64 1;  3CMA A;  3HL8 A;  4XTW A;  3CD6 T;  3CCE T;  2A7Y A;  2DVE A;  2GF7 A;  2PUO B;  1YHQ A;  4XU1 A;  3CCR A;  2XDD A;  3CCJ T;  4XQ3 A;  5GAO n;  3CCS A;  4J7F A;  4J7I A;  4Y28 E;  3RKY A;  1BI3 A;  3PTA A;  3FIF A;  4BE2 A;  2RHU A;  4XTX A;  3KXT A;  4F7U G;  3L2V A;  5LJ3 e;  1K73 C;  1YIT T;  4OB2 B;  2RHX A;  1N8R C;  3E1S A;  4A4G A;  3CCQ A;  4GY5 A;  4JS4 A;  2DXU A;  2O4X B;  3EFS A;  4M7D G;  2JNG A;  4B9X A;  5D6X A;  2E70 A;  3GLX A;  1OZ3 A;  1N9R A;  3FRN A;  2DZC A;  1BKB A;  2DJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...