1YJWQ

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yjwQ00
2QEXQ 3CCSQ 1K9MR 3CCUQ 3I56Q 1VQMQ 3CCQQ 1VQPQ 1M1KR 1VQ8Q 3CC7Q 1YJWQ 1VQ6Q 3CCRQ 1S72Q 3CCVQ 1VQ4Q 1VQNQ 3CMEQ 3I55Q 1Q7YR 1QVGP 1YJ9Q 1Q86R 3CCLQ 1VQOQ 3CPWP 1YHQQ 1W2BP 1KQSP 1JJ2P 3CXCP 3G6EQ 3G4SQ 2QA4Q 1M90R 3CD6Q 1N8RR 1Q82R 3CC4Q 3CC2Q 1VQKQ 1YITQ 1KD1R 1VQ5Q 3CCMQ 3CMAQ 1YJNQ 1K73R 3CCJQ 1VQ9Q 1QVFP 1NJIR 3OW2P 1VQ7Q 1VQLQ 2OTJQ 1Q81R 1YI2Q 1K8AR 2OTLQ 1KC8R 1YIJQ 3G71Q 3CCEQ
chains in the Genus database with same CATH superfamily
1S1NA 2DL3A 2ROTA 3KBGA 2YXYA 3OYEA 3OYHA 5CO7A 4F7UF 3VRZA 1VQ4Q 3QPHA 4XAXB 3ZEHA 2PZ1A 1H3ZA 4PK4A 2A7YA 4LDWA 1MMGA 4E7LA 2JJ9A 4ANJA 4C8QA 4LUDA 2EKHA 3PFSA 1VQMA 3LYIA 2K9GA 2CP3A 1BI2A 3QUIA 1UHCA 5GAMg 3X20B 3JCMP 5LL6S 4M78F 1E7OA 3H0IA 2AT1B 3SFMA 2A28A 3EG9A 4OMMA 2QA4Q 3CBOA 2HKQB 3OQ5A 4ATOA 4HVWA 4KULA 4BDYA 5J26A 5LJ3d 3J80E 3G6EA 3EG2A 4M7DC 1TTHB 2P4TA 1K1ZA 4J83A 4J9EA 1QVGP 1RAEB 3V7RA 1XOVA 5KCOA 3CBPA 4PJLA 2KK4A 4R0KA 3HHTB 1QP3A 5D6XA 3JB9I 2CP2A 3HRSA 1VUBA 1C6VX 2CYZB 3EFRA 2J06A 2K5LA 3CCRA 1K73C 1B3QA 2GQVA 3M53A 3L2QA 2ENMA 1LVKA 2KSSA 2LZ6B 3JCMf 2CUDA 3CD6Q 1MMNA 2EKOA 5M9OA 1KD1R 4LDYA 3ER0A 3MJXA 3HPWA 2L3PA 1SF9A 4FYWB 3SHWA 2FRWA 3META 3VRYA 3CC7Q 4M75A 4UC4A 2BE9B 3MKDA 2E10A 3JCMe 2O4XB 1VQNQ 5CCAA 2V1QA 4C0FA 4PJOA 2KR3A 1N5ZA 2VGNA 4FIBA 2DVJA 1BB9A 2EQJA 3Q1JA 1OPLA 3V7SA 4BACA 4AFZC 1KD1U 2M0YA 1JJ2A 2COWA 2BZ8A 2D1XA 2YUQA 1PWTA 4B6MA 2DMOA 4C5IA 2AZSA 2E6ZA 3LGFA 1NLOC 4JJBA 4OVAA 3CMET 1MHNA 4N0AA 1UB4A 3G71A 3FC3A 3OBYA 2ABLA 3JB9G 2EQMA 3REAB 3I5RA 1RLPC 1PRLC 2L3SA 2WACA 3I35A 2F2XA 3CEYA 1N9RA 4F04B 3BE3A 2DAQA 5I11A 3X25B 2HL3A 4F7UE 3CCUQ 1ZUUA 4JLGA 5GAOr 5GAOl 5FWCA 1Q86U 2C0TA 1BIBA 3C4SA 2CSQA 4KUDK 1K0SA 2JVVA 4E7ZA 3CCSA 1BU1A 1YN8A 2K3YA 4M4ZA 1GXIE 2C0OA 2R57A 3OMCA 5FRMA 2HKNA 4KGZB 4AT1B 1QVFP 1JB0E 2YUOA 3FB9A 5A0DA 5D7UA 1GCQA 5LJ5f 4EDUA 1M90U 2BE7D 3GIBA 3CCVA 2KRSA 3E19A 1WJSA 4JS5A 1QWEA 2EGEA 1G3TA 2CP5A 2L0AA 1SG5A 4PJOE 1JBMA 1T3LA 1ZUKA 3CCMQ 4LDUA 2FG0A 1K73R 4A54A 1C1AA 1QKXA 1NZ9A 3OYCA 1YI2Q 1UG1A 1UGPB 1WXTA 1HYOA 3HSBA 2YHTA 1YITT 3QJYA 4M77A 2MWPA 2A08A 2XIDA 2YLBA 2HCKA 1Y71A 4BI3A 2L2PA 4ZN1A 3LGLA 5CAIA 3M4YA 2NUZA 2FL7A 1I1JA 5FU7B 1VQMT 2FZKB 4N4IA 1OZ2A 4AFQC 4XTUA 1VQLQ 3JCMJ 4ESRA 3DB4A 4JDSA 4E7IA 3PMTA 4M7AC 2M1HA 1TU0B 1I4K1 1TXQA 5GAMj 5GMKi 1S72T 4KGXB 4BD3A 4J9DA 3G4SQ 1FMWA 2JN0A 1B34A 3PE0A 4M78D 2HAXA 4E47A 4Y28E 2QQAA 3JCMg 1NJIR 2KRMA 1KQSS 4Z88A 3E9FA 1R0CB 4M78C 4CC3A 2FYKA 3UWNA 2P0PA 1KHIA 2ZPBB 4C8QB 2K3BA 4WF2A 2RB6A 1VQ8Q 5HK3A 4WTOB 1TWBA 5I2MA 3HRUA 1EIFA 3I55Q 2VWFA 3MEVA 4M75G 3GPLA 2E12A 3CC4Q 3CC2Q 1M9SA 1TOVA 1ZUYA 2XKOC 1WFWA 2MI6A 1RL2A 4J8OA 3I56Q 3OYJA 1OI1A 4E7JA 4XTZA 4X9DA 3WXMB 1GL5A 1X01A 2RH2A 2LX7A 1RACB 4IKFA 1QLYA 2OTLA 2XHCA 4XTVA 1LNXA 3QYGB 3I56T 1WIEA 1WQWA 3FDRA 4JLIA 2BIVA 1UGSB 3JCMc 2CT3A 3CCMT 2DFUA 1JO8A 3X28B 2O31A 1AWXA 3CCLT 4LUEA 3OS2A 4JS4A 7AT1B 1WHJA 1M1GA 4DBFA 5L23A 1W6XA 2E3IA 2KDSA 1FWZA 3TREA 1I81A 2ZCFB 4MZMA 4ELZC 1UTIA 3VS7A 2DX1A 3EAEA 4KH1B 3A8OB 1D1CA 4RTZA 3CMEA 3WVDB 4PJOF 3JB9F 4HCKA 3LLRA 4C92B 2L3RA 3A5ZB 2Y4XA 1WJRA 4OP0A 3QJ6A 4RTTA 2QYZA 5LJ3f 4GY5A 2P84A 5GANh 2OX7A 2QASA 3P8HA 3EGUA 4DEXA 2RI5A 4X34A 1MV3A 1CKBA 2CS7A 4N0AC 2QQSA 2DRMA 2QXFA 1Q82U 2JS0A 4ORZA 5LJ5j 1AD5A 3BY7A 2JTEA 2RNAA 1YCYA 3SWNA 2RHXA 2VC8A 3QZ9B 3S3MA 2PU9B 1QMCA 2OI3A 4QVCA 1PD0A 3OYMA 1Q7YR 3EGDA 3NHNA 2ESWA 5FW9A 1X69A 1PD1A 5KYNA 1SHFA 5GAOm 5GANe 2DLPA 1H3HA 1M8VA 3F70A 3V8KA 1V76A 2KY9A 5FROA 2YUNA 2ZPIB 3ZL7C 5KYUB 1H92A 1AWJA 2YWWA 4OB1B 2E4HA 4ZGEB 2IVWA 3EHRA 3OYDA 3JCMQ 1UGQB 2KVQG 1E6GA 2VV5A 4M75B 2K57A 4PJJA 4M77D 3VJPA 2FPEA 3RR6A 5KYWB 2X35A 4M7DF 3QWYA 4A4FA 1VQ9Q 2E70A 2NWMA 3GOXA 1RAFB 3OBWA 4PKCC 3DB3A 3VUZA 1YIJA 2RQRA 3TSZA 1R0BG 2QK0A 2RA2A 1SRMA 4PL6A 1YFNA 3KUFA 3GF5A 2F2WA 2C06A 1M1FA 4RMOA 2QQ9A 3RIRA 4KBMB 3GNFB 5GAOp 1UHFA 2DJQA 1QP2A 2VKNA 3A98A 4O5VA 2ATCB 1Y07A 1VQOT 2CKKA 1M1KC 1KK7A 4RG8A 3LWIA 2QAZA 1WHKA 5CKFA 1AWWA 1W2BA 4J9BA 2A37A 3AHUA 1IZ6A 2QDYB 2CREA 1GFCA 1M27C 1NYGA 2DL7A 3L2WA 3CC4T 5GANf 2VUBA 2HMAA 2V26A 3UF4A 3M4GA 4M78A 3RBBB 3CCLQ 3TVTA 4XQ3A 2E3HA 3S6WA 2KNBB 4DBHA 2C0IA 3G1JA 2P0QA 2COZA 2RJDA 2R5MA 5CK9A 2H8HA 4M75D 1TUDA 5GJVB 1UECA 2FZCB 2K7AA 1CKAA 3C95A 1BK2A 2OAWA 5IXBA 3CMEQ 1NPRA 1VQ4T 2DTOA 1ZBXA 3HP9A 1AHJB 1KD1C 4C92G 3J7AF 2GF7A 1YI2T 1WHGA 1RAIB 2GCXA 4LNPA 2RM4A 4LN2A 2DD4A 5GAN2 1NJIU 1PSFA 3L2VA 3CCLA 2LQKA 4NL3A 2AK5A 2EJFA 5GANd 3JV3A 4XTYA 1YJNA 4II1A 3P8DA 2RQVA 2EFIA 5KYYA 4JPBW 1ZHIA 2EYQA 3OSSC 3QYHB 2LJ1A 4RKUE 2EQKA 5FRNA 1G5VA 5LJ3j 1GCQC 3L2RA 3CXCA 2X51A 3VYGA 2F2VA 2HEQA 1EFNA 3CPWS 2OJ2A 2RK1A 4DA4A 1JJ2S 1SRLA 5DLOA 3M59A 3CCJA 3GBQA 4WCIA 3JCMd 3I56A 2CT4A 4DQ2A 1D1AA 1PCXA 4FT4A 3CCUT 5KYYB 5CR2A 3M0TA 2DA9A 5FLXE 4PJNA 3JB9H 4J6YA 3NTHA 3VS2A 2X9HA 1OOTA 4J9HA 6AT1B 1PC0A 3EG3A 2LT1A 2K5IA 3NGPA 4RTXA 1M2VB 4KGVB 1NEBA 1ZX6A 3E9GA 4LDXA 1BCOA 4MDWA 1K76A 3BDUA 2DL4A 1EZZB 4X9CA 3G4SA 1MNEA 1H641 1D3BB 2EGAA 4QT7A 2RPNA 3CQTA 1G3YA 4L6V5 4L59A 1YNZA 4BY6B 2O4XA 4RUGA 5A0GA 1K9MU 5GAN4 1AWOA 4R56A 1YIJT 1EX4A 3LH0A 2QGGA 3OYLA 1KJWA 2CUBA 3TQ7P 2KAFA 4HT8A 2EJGA 4HKEA 2CZ1B 4M7DE 3QXEB 1FMKA 1GCPA 1BCMA 5J39A 2PVOB 3PMIA 4AFSC 1NE8A 1E6HA 1NYFA 2LQNA 1LJOA 2E64A 1R8OB 5CQYA 2BZXA 3R6OA 5GMKj 3ME9A 5A2QE 2MK5A 1YJNT 4XU0A 1W1FA 3VS6A 1M3BA 4HCZA 3OY9A 4LDVA 4V2SA 2DIQA 1MV0B 1YJ9Q 3R6NA 2DNUA 2DXCA 2BZYA 2L89A 4EIKA 1W2BP 1WZOA 2VASA 1Z9QA 4F7UB 1KHCA 2R58A 1Y7XA 1ZSZA 3CCJQ 4NS5A 3QO3A 4F16A 2DETA 3HRTA 3LH5A 2RN8A 3CCSQ 3PTAA 3RUXA 3QG1A 4DOWA 4ZTFA 1ZA2B 2DPPB 3CCUA 4EMGA 1P92A 2R5AA 2B86A 4JRPA 2GTJA 4OGEA 2LDMA 3QWXX 3SB2A 1HD3A 4MZTA 2KXDA 2LJ3A 2OTLQ 3FJPA 8ATCB 3G71Q 4FYVB 2FPDA 3V8JA 2MWOA 4JZ4A 4EMKB 2QA4T 2RK2A 2QTXA 1ARKA 2DK3A 2O88A 3NPFA 3KFVA 2YRVA 1YJ9A 4M78E 4RTWA 5GMKh 2BTTA 5D6WA 1G2BA 2GQIA 4GLKA 3CC2A 2F5KA 3QBYA 4HT9A 1AOJA 3I55A 1Q95G 4C92C 5KYUA 4A4GA 4BE1A 5KE3A 2DE0X 2FO0A 4PNOA 1JXMA 4F7UG 2XDDA 4RG2A 2J6KA 3QDRB 1AZEA 1IGUA 3HL8A 1SEMA 3I5SA 3HFOA 1OQKA 4PLIA 3SWNC 3OW2S 3FJ5A 1I5LA 3CD6A 2L3QA 2DL8A 2K2MA 2M0OA 2W10A 5KYXA 2K4YA 4DBQA 2EYZA 1ACMB 4ME7A 3G6ET 4BDZA 2O01E 3ZBDA 4A63B 1V29B 1M3CA 2A0FB 2LCSA 4XU1A 1D0ZA 2DEUA 3CC7T 3GNGA 1BYMA 1OU8A 3M55A 2D0QB 3I9QA 2RQWA 1KFZA 2EGCA 1RI0A 2JXBA 1RUWA 1XTDA 2ZPGB 1C0MA 1G83A 2EYXA 5CIUA 3H8ZA 2XI9A 2HBPA 1OPKA 1FX7A 4OMOA 4CI0C 2M02A 4PFPA 1TSFA 3L2ZA 4AFUC 4R55A 3CCST 2J7IA 2HL5C 3RESA 2ZPFB 4L5GA 2JTFA 4OB3B 3M0PA 5GAMf 2VVKA 2QTVA 4NOYA 1SSFA 3VV0A 3VS3A 1N6AA 2PVDB 2FPFA 4ZNXA 3MPUB 1VQ9A 3MCAB 1D0XA 4GLMA 3CCVQ 1M2OA 1YCSB 4JJDA 3E1SA 1UUEA 2ZAEA 1ZSGA 4FM4B 3D7SB 2XG8D 1XNIA 2KE9A 2EVRA 4D6WA 1VIFA 3H9NA 1M8MA 2H3EB 3EH1A 1QWFA 4CC4B 2XMFA 3H0HA 3WVEB 4KH0B 3OS0A 4JJCA 2XK0A 4M77E 4C0ZA 4GBQA 1X6OA 2Y4YA 3PT9A 1WGSA 3RMQA 3G71T 2LQ8A 3ASKA 3JCMb 1YJNQ 1T0HA 1A0NB 2FRYA 3OB9A 1KIKA 4DBRA 2BKDN 2MYSA 1T3SA 2RHYA 4Y92A 2E5KA 2RHIA 1M30A 4FCYA 2M51A 3A8LB 2XDBA 2EPDA 2DL5A 1NLPC 1WNLA 3TEEA 3OYBA 2PNIA 3EGDB 3E2UA 1W2BS 1IRXA 1WQ7A 2V1RA 2LJ0A 4HVUA 1HK9A 3ZFJA 2PUOB 2EQUA 1PG5B 1BI3A 1IB8A 4BUGA 3JAME 3REBB 2VB6A 2ED1A 3CC7A 5IHKA 2CSIA 2K3XA 2LP5A 1IXDA 2GTOA 2L8DA 1OZ3A 3HTRA 4K11A 4AMCA 2MAMA 1ABOA 4VUBA 2OTJT 1K8AR 2NUTB 3PVLA 5EC7A 1UE9A 1TUGB 2P0KA 2DJZA 3CCRQ 2RQUA 4C8QF 5FU7C 1UFFA 4E7KA 2KYBA 1FYNA 2DD5A 3SDZA 2OTLT 1OV3A 2W0ZA 2CGHA 4IUVA 4M7AB 1VQ5T 2RD1A 1X75C 1VQ9T 2VXEA 4JRQA 3A1PA 2E1HA 2RF0A 2LMJA 2IG0A 3OYFA 2RHZA 4Z89A 3CCEA 3DLMA 1RAAB 3G6EQ 2RQTA 3OA6A 5HCKA 1G3WA 4OB0B 2O2OA 1NPPA 1KC8R 1YIJQ 3HKSA 4FYYB 4IUTA 3VS4A 2JS2A 3RKXA 3JB9D 1TG0A 1YHQT 2YUPA 2KT1A 4A4EA 3JRZA 1AEYA 1VQOQ 3CPWP 4D8KA 2WSEE 1M1KU 2QEXT 1YP5A 3QIIA 2JOYA 2NYSA 4TVRA 1RABB 3O5ZA 3SEMA 4M7AD 1K8AU 2CP7A 1X6GA 4EPCA 1RADB 4MDXA 1Q81R 4JRIA 2CDTA 4F17A 1M5Q1 1K4US 1Y0MA 4MMLA 3X26B 3M0UA 1B34B 3OYKA 1D09B 1M4ZA 4J6WA 4YTLA 2CZ6B 2DTIA 4OMFB 2O9SA 3EG1A 4KRTA 4XU3A 3M54A 1UEBA 2E5QA 2GFAA 1CSKA 4J5YA 5I21A 1YI2A 3RERA 5IXFA 5J3BA 3CCMA 1VOMA 3S3OA 4ZN3A 3RKWA 3UA7A 1SPKA 2DKGA 3EFOB 4C92D 4RTUA 1YBYA 2AKLA 2DBMA 3TCJA 1YJWT 1SHGA 1QCFA 3HFNA 3GP8A 1WJQA 4A4HA 1XQHA 5I2SA 3M56A 5LJ3g 2B8AA 2LT4A 3JCMX 1VYUA 1XJWB 3TU4K 1KQ2A 2WSFE 2V8KA 3J81E 1NJIC 1YJ9T 2PUKB 1ZSZC 4E7SA 2DZCA 2YRDA 2YRCA 2DIGA 2PTKA 2DXBA 4FT2A 4C92A 3V7CA 3A8MB 3CMAQ 1Q81U 1VQKA 3UPUA 4OMLA 2RI2A 3UA6A 3EG0A 4FU6A 2KBTA 4IUPA 4C92F 3SWNB 4M77F 5GANg 4RCCA 1MGQA 5IN1A 3VU3C 2Z0WA 1WLPB 1I07A 1TS9A 2LCCA 1VYVA 1D0YA 2LQWA 2XD0A 1I0CA 4XK8E 1M2VA 2X3WD 4M77B 3VS5A 1Q82R 3OYNA 4J7FA 1KC8U 1VQ7Q 4P5NA 1K73U 1VQ7T 2RHUA 5GAN7 2P4RA 2ZPHB 2X3XD 2JW4A 2M16A 5GMKl 1X43A 1ZLMA 5HY6A 1VQ6Q 3OYYA 2LC4A 3CC4A 2AZVA 3JB9J 4IUUA 1VQPT 4E6RA 1WXUA 5GAMd 9ATCB 3CCQT 2X4XA 1N8RR 1VQNA 2F69A 3URGA 2CZ0B 4PJMA 1VQ8A 1LOJA 3H0FA 3FIFA 2KT8A 1MMAA 2KEAA 4PFOA 3L2UA 2X4WA 1F1BB 1OX8A 5IH2A 2NLUA 4EMHA 2F5TX 2LVMA 1X2QA 4N4HA 2LX9A 1IREB 1BKBA 2HQEA 2CP0A 4IURA 2LRQA 2EQIA 1UJYA 1U1TA 1K9MC 2RO0A 2D9TA 2NUPA 2RJCA 3T9NA 3C12A 3EFOA 1VQLA 3DKMA 5CKBA 3VS0A 2DYBA 4QQDA 3L1AA 1Y96B 2FZGB 3PVQA 1VQ6T 4IIMA 4AG1C 5A0LA 5GMKe 3EG9B 4HXJA 3OW2A 1W70A 4XU2A 3QHSA 1WPYA 2FEIA 1UJ0A 1M1KR 1K9AA 2HDAA 2M9UA 3A8HB 5C6SA 2YLCA 1ABQA 3M9QA 1S72Q 2QEXA 4QW2A 2G6FX 1LPLA 2O9VA 2IIMA 1D3BA 2DERA 1O75A 3JCMW 4N4GA 5HKCA 2KGTA 3U23A 4EMKA 5LJ5g 5I22A 4Z8AA 3P8BB 1BBZA 4QKUA 1YHQQ 2GBQA 2J05A 2MMPA 3OYGA 1VQ4A 1YWPA 1YITQ 3VUBA 4BI4A 3S3NA 5FU6C 3JCMV 3L42A 5GAN3 2E65A 4DEYA 3QKJA 2EW3A 2RMOA 2K6DA 4QQ6A 3CCQQ 4LXCA 4C8QC 5LJ3h 4PLLA 4BE0A 4JJNK 1VQNT 5KCHA 1JQQA 4Z02A 4A4KA 1RI9A 2AIRB 1JJ2P 4D8DA 2QQRA 2JUFA 3N5BB 2K5FA 2WSCE 1G3SA 2KYMA 5C0MA 2IPOB 3OW2P 1PHTA 4RTYA 3EFSA 2MCNA 2MIOA 2YT6A 1PRMC 1LCKA 4AG2C 3MEWA 2PVGB 3CD6T 4HCCA 4LD9K 5GMKm 2DF6A 2RI3A 1KG1A 1X6BA 3C0CA 1WDXA 1KQSP 1PM3A 4C5GA 3CXCP 3OS1A 1M90R 4OGCA 2VGMA 4LD6A 1K9MR 3ULRB 4CC7A 1YJWA 1W4SA 3PIOA 5CKDA 1BI0A 2G3RA 2DXUA 1Q86R 4ZTJA 4J9FA 4ELYC 1M3AA 2EIFA 1AZGB 4PJOB 4BI8B 2RJFA 2DTHA 5CVIA 2CH4W 1YITA 4C92E 2QGFB 3BDLA 2XDPA 2HD0A 1QVGA 4PJOC 2RJEA 1JU5C 4JZ3A 1YHQA 1Q86C 2FB7A 2E6NA 1RAHB 3G7ZA 3G4ST 3QSUA 4M75E 2SRCA 3OYIA 1VQPA 3KXTA 3M0QA 1QCOA 1WXBA 4JRKA 1DJ7B 1PNJA 2QDLA 3UDCA 1T0JA 2D8HA 2JZ2A 3THKA 1IHVA 3SD4A 1HXDA 3MEAA 2AKKA 4QVDA 4OB2B 4C0GA 4MMKA 5CKHA 1X2KA 4DOVA 4QQGA 4BE2A 3TSWA 5DLQE 1GFDA 2L5QA 3RKYA 1S72A 2HBWA 1OEBA 1NEGA 4M7DB 3C94A 3M57A 1VA7A 2JM8A 3RNJA 2J6FA 2QA4A 3OYAA 2OAUA 1HSQA 3QZ5B 2V8JA 2MOXA 3FRNA 3MO8A 1WYXA 2A36A 2VYTA 1O9SA 3M0RA 4F14A 3X24B 3VYHB 5LJ5e 2LTOA 4J9IA 3CBMA 3CC2T 5D6YA 1WI7A 1IHWA 4FW1A 2XU8A 1VQMQ 1VQPQ 1WX6A 2MPXC 2YSQA 5CQXA 1SKUB 5IHIA 2GGRA 1PKTA 1B7TA 4MZPA 5IT9E 1VQ8T 2EYYA 4M75C 3FEOA 2MF2A 1ZSZB 5DM7R 1VQ5Q 3CXCS 2DYIA 2GNCA 3IQLA 1JXOA 2QI2A 4Q5WA 3RDVA 1U3OA 2I2LA 1AVZC 3AT1B 1YJWQ 1MNDA 4O6JA 2KI7A 3V8LA 4C8QG 5GANj 4M7DD 5AYFA 1N8RC 2HQXA 2JNGA 1BIAA 5GAN5 1Y96A 1VQLT 1MMDA 4M77C 3M5AA 4EMKC 4RCBA 1KQ1A 2V8IA 2NUTA 3UATA 3MHXA 1H8KA 5L8RE 2OTJA 2LCLA 3VS1A 1VQ6A 3NTKA 2LNHB 2K79A 2HZYA 1Q7YC 1VQ7A 1NG2A 3NMZC 4KT0E 5GAN8 3VKIA 1FXXA 4B9WA 2GFUA 1QVPA 4LE9A 8AT1B 3QDFA 1K0XA 2HQHA 4JUVA 2ZGWA 3I55T 4IUQA 3FLGA 3CCQA 1SSHA 4ZGJB 4M7AE 4FL6A 3LWHA 2ZZDA 1OU9A 1MUZA 4J6XA 1TH7A 3LW5E 2DEQA 3CCET 2Y90A 4FSXA 4M75F 1U5SA 1QVGS 1U06A 2FHDA 2DRKA 2QG9B 4J9GA 5GAN6 4CRIA 5EG2A 2JM9A 4M77G 3UT1A 4OMPA 5DY9A 1OYXA 2CZ7B 1UGVA 2DILA 5KH6A 5KYXB 1M90C 1KC8C 4Y91A 1NBEB 3GLXA 2DXTA 2QQBA 2A3LA 2KXCA 4X1VA 1N9SA 2OTJQ 5LJ5h 1BI1A 2CP6A 3CMAT 3M58A 3PGGA 2QEXQ 5GJWB 1N8RU 2EJ9A 4ZGDB 4FW2A 2COYA 3JCMh 2LNVA 4FSSA 1WHHA 2JTMA 2VXFA 4OMNA 3MP8A 4XTXA 2H3JA 5GAMh 3RMSA 1X27A 1Q82C 4OF1A 1ZQ1A 1KQSA 5ECAA 4HVVA 1K8AC 5KE2A 2KQWA 1JRIA 2X4YA 1HJDA 1VQ5A 1Q7YU 5LJ3e 1GBQA 3INZA 3PNWC 3CCVT 4QVZA 1UGRB 4J7IA 4M7AA 3EGXB 2J6OA 4CC2A 1J3TA 2AHJB 2ZPEB 1VYTA 2D8JA 1WHLA 2BUDA 3CPWA 2EWNA 1GRIA 1KSWA 4A53A 5GAOq 1VQOA 2JT4A 5FU6B 5HK0A 2FVUA 5LJ5d 3OMGA 3DLLA 3OSVA 4B9XA 1FMVA 3EH2A 3H6ZA 1QQJA 3EHQA 4M7AG 2X4JA 1WHMA 1QKWA 4C0DB 2D6FA 2HSPA 5FWBA 1RAGB 2KROA 1JEGA 3CCEQ 4C0DC 1U8RA 4IIOA 1VQKT 1VIEA 2EYWA 2JMCA 1G8XA 2DVEA 5IHNA 5AT1B 4KUIA 3A8GB 4M78G 2DM1A 5KYWA 2ECZA 4OMQA 1B07A 4M7DA 1OULA 2PQWA 4BY6C 1YWOA 1IO6A 4NL2A 3MEUA 3CCJT 4F7UA 2K2VA 2YDLA 1I8FA 1I5OB 4E7HA 1Q81C 5GAOn 3CPFA 1RLQC 4M7AF 4BB7A 4PJOD 2HSEB 1UDLA 2CH4A 1ZA1B 3MP1A 2HNIA 4M78B 4HCBA 4C8QE 3CMAA 1VQKQ 1QVFA 1WA7A 1R77A 4C5EA 3BFMA 1QVFS 5CKEA 2ROLA 3EGXA 4PJOG 2KRNA 1NM7A 1N27A 2ED0A 4E2FB 4C5HA 2DZ9A 3H41A 1AT1B 2KMTA 3CCRT 3PIPA 2I0NA 2EBPA 5GAMe 3M0SA 1IGQA 4HA8A 1ZBJA 4FYXB 2DO3A 5IAYA 1QW1A 3BW1A 1OX9A 3NFCA 2NUPB 3JSCA 1U1SA 2EAYA 1PKSA 2SEMA 1GBRA 4PFZA 1Z9ZA 3NTIA 3OS5A 3MP6A 1Y57A 4C8QD 2DBKA 4M7DG 4J9CA 4RTVA 2JMAA 1TUCA 1PSEA 1D1BA 2XICA 4XTWA 1V1CA 3O8VA 2E41A 3LX7A 1QCNA 2D0NA 2F1LA
chains in the Genus database with same CATH topology
2QEXQ 3CCSQ 1K9MR 3CCUQ 3I56Q 1VQMQ 3CCQQ 1VQPQ 1M1KR 1VQ8Q 3CC7Q 1YJWQ 1VQ6Q 3CCRQ 1S72Q 3CCVQ 1VQ4Q 1VQNQ 3CMEQ 3I55Q 1Q7YR 1QVGP 1YJ9Q 1Q86R 3CCLQ 1VQOQ 3CPWP 1YHQQ 1W2BP 1KQSP 1JJ2P 3CXCP 3G6EQ 3G4SQ 2QA4Q 1M90R 3CD6Q 1N8RR 1Q82R 3CC4Q 3CC2Q 1VQKQ 1YITQ 1KD1R 1VQ5Q 3CCMQ 3CMAQ 1YJNQ 1K73R 3CCJQ 1VQ9Q 1QVFP 1NJIR 3OW2P 1VQ7Q 1VQLQ 2OTJQ 1Q81R 1YI2Q 1K8AR 2OTLQ 1KC8R 1YIJQ 3G71Q 3CCEQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX Q;  3CCS Q;  1K9M R;  3CCU Q;  3I56 Q;  1VQM Q;  3CCQ Q;  1VQP Q;  1M1K R;  1VQ8 Q;  3CC7 Q;  1YJW Q;  1VQ6 Q;  3CCR Q;  1S72 Q;  3CCV Q;  1VQ4 Q;  1VQN Q;  3CME Q;  3I55 Q;  1Q7Y R;  1QVG P;  1YJ9 Q;  1Q86 R;  3CCL Q;  1VQO Q;  3CPW P;  1YHQ Q;  1W2B P;  1KQS P;  1JJ2 P;  3CXC P;  3G6E Q;  3G4S Q;  2QA4 Q;  1M90 R;  3CD6 Q;  1N8R R;  1Q82 R;  3CC4 Q;  3CC2 Q;  1VQK Q;  1YIT Q;  1KD1 R;  1VQ5 Q;  3CCM Q;  3CMA Q;  1YJN Q;  1K73 R;  3CCJ Q;  1VQ9 Q;  1QVF P;  1NJI R;  3OW2 P;  1VQ7 Q;  1VQL Q;  2OTJ Q;  1Q81 R;  1YI2 Q;  1K8A R;  2OTL Q;  1KC8 R;  1YIJ Q;  3G71 Q;  3CCE Q; 
#chains in the Genus database with same CATH topology
 1S1N A;  2DL3 A;  2ROT A;  3KBG A;  2YXY A;  3OYE A;  3OYH A;  5CO7 A;  4F7U F;  3VRZ A;  1VQ4 Q;  3QPH A;  4XAX B;  3ZEH A;  2PZ1 A;  1H3Z A;  4PK4 A;  2A7Y A;  4LDW A;  1MMG A;  4E7L A;  2JJ9 A;  4ANJ A;  4C8Q A;  4LUD A;  2EKH A;  3PFS A;  1VQM A;  3LYI A;  2K9G A;  2CP3 A;  1BI2 A;  3QUI A;  1UHC A;  5GAM g;  3X20 B;  3JCM P;  5LL6 S;  4M78 F;  1E7O A;  3H0I A;  2AT1 B;  3SFM A;  2A28 A;  3EG9 A;  4OMM A;  2QA4 Q;  3CBO A;  2HKQ B;  3OQ5 A;  4ATO A;  4HVW A;  4KUL A;  4BDY A;  5J26 A;  5LJ3 d;  3J80 E;  3G6E A;  3EG2 A;  4M7D C;  1TTH B;  2P4T A;  1K1Z A;  4J83 A;  4J9E A;  1QVG P;  1RAE B;  3V7R A;  1XOV A;  5KCO A;  3CBP A;  4PJL A;  2KK4 A;  4R0K A;  3HHT B;  1QP3 A;  5D6X A;  3JB9 I;  2CP2 A;  3HRS A;  1VUB A;  1C6V X;  2CYZ B;  3EFR A;  2J06 A;  2K5L A;  3CCR A;  1K73 C;  1B3Q A;  2GQV A;  3M53 A;  3L2Q A;  2ENM A;  1LVK A;  2KSS A;  2LZ6 B;  3JCM f;  2CUD A;  3CD6 Q;  1MMN A;  2EKO A;  5M9O A;  1KD1 R;  4LDY A;  3ER0 A;  3MJX A;  3HPW A;  2L3P A;  1SF9 A;  4FYW B;  3SHW A;  2FRW A;  3MET A;  3VRY A;  3CC7 Q;  4M75 A;  4UC4 A;  2BE9 B;  3MKD A;  2E10 A;  3JCM e;  2O4X B;  1VQN Q;  5CCA A;  2V1Q A;  4C0F A;  4PJO A;  2KR3 A;  1N5Z A;  2VGN A;  4FIB A;  2DVJ A;  1BB9 A;  2EQJ A;  3Q1J A;  1OPL A;  3V7S A;  4BAC A;  4AFZ C;  1KD1 U;  2M0Y A;  1JJ2 A;  2COW A;  2BZ8 A;  2D1X A;  2YUQ A;  1PWT A;  4B6M A;  2DMO A;  4C5I A;  2AZS A;  2E6Z A;  3LGF A;  1NLO C;  4JJB A;  4OVA A;  3CME T;  1MHN A;  4N0A A;  1UB4 A;  3G71 A;  3FC3 A;  3OBY A;  2ABL A;  3JB9 G;  2EQM A;  3REA B;  3I5R A;  1RLP C;  1PRL C;  2L3S A;  2WAC A;  3I35 A;  2F2X A;  3CEY A;  1N9R A;  4F04 B;  3BE3 A;  2DAQ A;  5I11 A;  3X25 B;  2HL3 A;  4F7U E;  3CCU Q;  1ZUU A;  4JLG A;  5GAO r;  5GAO l;  5FWC A;  1Q86 U;  2C0T A;  1BIB A;  3C4S A;  2CSQ A;  4KUD K;  1K0S A;  2JVV A;  4E7Z A;  3CCS A;  1BU1 A;  1YN8 A;  2K3Y A;  4M4Z A;  1GXI E;  2C0O A;  2R57 A;  3OMC A;  5FRM A;  2HKN A;  4KGZ B;  4AT1 B;  1QVF P;  1JB0 E;  2YUO A;  3FB9 A;  5A0D A;  5D7U A;  1GCQ A;  5LJ5 f;  4EDU A;  1M90 U;  2BE7 D;  3GIB A;  3CCV A;  2KRS A;  3E19 A;  1WJS A;  4JS5 A;  1QWE A;  2EGE A;  1G3T A;  2CP5 A;  2L0A A;  1SG5 A;  4PJO E;  1JBM A;  1T3L A;  1ZUK A;  3CCM Q;  4LDU A;  2FG0 A;  1K73 R;  4A54 A;  1C1A A;  1QKX A;  1NZ9 A;  3OYC A;  1YI2 Q;  1UG1 A;  1UGP B;  1WXT A;  1HYO A;  3HSB A;  2YHT A;  1YIT T;  3QJY A;  4M77 A;  2MWP A;  2A08 A;  2XID A;  2YLB A;  2HCK A;  1Y71 A;  4BI3 A;  2L2P A;  4ZN1 A;  3LGL A;  5CAI A;  3M4Y A;  2NUZ A;  2FL7 A;  1I1J A;  5FU7 B;  1VQM T;  2FZK B;  4N4I A;  1OZ2 A;  4AFQ C;  4XTU A;  1VQL Q;  3JCM J;  4ESR A;  3DB4 A;  4JDS A;  4E7I A;  3PMT A;  4M7A C;  2M1H A;  1TU0 B;  1I4K 1;  1TXQ A;  5GAM j;  5GMK i;  1S72 T;  4KGX B;  4BD3 A;  4J9D A;  3G4S Q;  1FMW A;  2JN0 A;  1B34 A;  3PE0 A;  4M78 D;  2HAX A;  4E47 A;  4Y28 E;  2QQA A;  3JCM g;  1NJI R;  2KRM A;  1KQS S;  4Z88 A;  3E9F A;  1R0C B;  4M78 C;  4CC3 A;  2FYK A;  3UWN A;  2P0P A;  1KHI A;  2ZPB B;  4C8Q B;  2K3B A;  4WF2 A;  2RB6 A;  1VQ8 Q;  5HK3 A;  4WTO B;  1TWB A;  5I2M A;  3HRU A;  1EIF A;  3I55 Q;  2VWF A;  3MEV A;  4M75 G;  3GPL A;  2E12 A;  3CC4 Q;  3CC2 Q;  1M9S A;  1TOV A;  1ZUY A;  2XKO C;  1WFW A;  2MI6 A;  1RL2 A;  4J8O A;  3I56 Q;  3OYJ A;  1OI1 A;  4E7J A;  4XTZ A;  4X9D A;  3WXM B;  1GL5 A;  1X01 A;  2RH2 A;  2LX7 A;  1RAC B;  4IKF A;  1QLY A;  2OTL A;  2XHC A;  4XTV A;  1LNX A;  3QYG B;  3I56 T;  1WIE A;  1WQW A;  3FDR A;  4JLI A;  2BIV A;  1UGS B;  3JCM c;  2CT3 A;  3CCM T;  2DFU A;  1JO8 A;  3X28 B;  2O31 A;  1AWX A;  3CCL T;  4LUE A;  3OS2 A;  4JS4 A;  7AT1 B;  1WHJ A;  1M1G A;  4DBF A;  5L23 A;  1W6X A;  2E3I A;  2KDS A;  1FWZ A;  3TRE A;  1I81 A;  2ZCF B;  4MZM A;  4ELZ C;  1UTI A;  3VS7 A;  2DX1 A;  3EAE A;  4KH1 B;  3A8O B;  1D1C A;  4RTZ A;  3CME A;  3WVD B;  4PJO F;  3JB9 F;  4HCK A;  3LLR A;  4C92 B;  2L3R A;  3A5Z B;  2Y4X A;  1WJR A;  4OP0 A;  3QJ6 A;  4RTT A;  2QYZ A;  5LJ3 f;  4GY5 A;  2P84 A;  5GAN h;  2OX7 A;  2QAS A;  3P8H A;  3EGU A;  4DEX A;  2RI5 A;  4X34 A;  1MV3 A;  1CKB A;  2CS7 A;  4N0A C;  2QQS A;  2DRM A;  2QXF A;  1Q82 U;  2JS0 A;  4ORZ A;  5LJ5 j;  1AD5 A;  3BY7 A;  2JTE A;  2RNA A;  1YCY A;  3SWN A;  2RHX A;  2VC8 A;  3QZ9 B;  3S3M A;  2PU9 B;  1QMC A;  2OI3 A;  4QVC A;  1PD0 A;  3OYM A;  1Q7Y R;  3EGD A;  3NHN A;  2ESW A;  5FW9 A;  1X69 A;  1PD1 A;  5KYN A;  1SHF A;  5GAO m;  5GAN e;  2DLP A;  1H3H A;  1M8V A;  3F70 A;  3V8K A;  1V76 A;  2KY9 A;  5FRO A;  2YUN A;  2ZPI B;  3ZL7 C;  5KYU B;  1H92 A;  1AWJ A;  2YWW A;  4OB1 B;  2E4H A;  4ZGE B;  2IVW A;  3EHR A;  3OYD A;  3JCM Q;  1UGQ B;  2KVQ G;  1E6G A;  2VV5 A;  4M75 B;  2K57 A;  4PJJ A;  4M77 D;  3VJP A;  2FPE A;  3RR6 A;  5KYW B;  2X35 A;  4M7D F;  3QWY A;  4A4F A;  1VQ9 Q;  2E70 A;  2NWM A;  3GOX A;  1RAF B;  3OBW A;  4PKC C;  3DB3 A;  3VUZ A;  1YIJ A;  2RQR A;  3TSZ A;  1R0B G;  2QK0 A;  2RA2 A;  1SRM A;  4PL6 A;  1YFN A;  3KUF A;  3GF5 A;  2F2W A;  2C06 A;  1M1F A;  4RMO A;  2QQ9 A;  3RIR A;  4KBM B;  3GNF B;  5GAO p;  1UHF A;  2DJQ A;  1QP2 A;  2VKN A;  3A98 A;  4O5V A;  2ATC B;  1Y07 A;  1VQO T;  2CKK A;  1M1K C;  1KK7 A;  4RG8 A;  3LWI A;  2QAZ A;  1WHK A;  5CKF A;  1AWW A;  1W2B A;  4J9B A;  2A37 A;  3AHU A;  1IZ6 A;  2QDY B;  2CRE A;  1GFC A;  1M27 C;  1NYG A;  2DL7 A;  3L2W A;  3CC4 T;  5GAN f;  2VUB A;  2HMA A;  2V26 A;  3UF4 A;  3M4G A;  4M78 A;  3RBB B;  3CCL Q;  3TVT A;  4XQ3 A;  2E3H A;  3S6W A;  2KNB B;  4DBH A;  2C0I A;  3G1J A;  2P0Q A;  2COZ A;  2RJD A;  2R5M A;  5CK9 A;  2H8H A;  4M75 D;  1TUD A;  5GJV B;  1UEC A;  2FZC B;  2K7A A;  1CKA A;  3C95 A;  1BK2 A;  2OAW A;  5IXB A;  3CME Q;  1NPR A;  1VQ4 T;  2DTO A;  1ZBX A;  3HP9 A;  1AHJ B;  1KD1 C;  4C92 G;  3J7A F;  2GF7 A;  1YI2 T;  1WHG A;  1RAI B;  2GCX A;  4LNP A;  2RM4 A;  4LN2 A;  2DD4 A;  5GAN 2;  1NJI U;  1PSF A;  3L2V A;  3CCL A;  2LQK A;  4NL3 A;  2AK5 A;  2EJF A;  5GAN d;  3JV3 A;  4XTY A;  1YJN A;  4II1 A;  3P8D A;  2RQV A;  2EFI A;  5KYY A;  4JPB W;  1ZHI A;  2EYQ A;  3OSS C;  3QYH B;  2LJ1 A;  4RKU E;  2EQK A;  5FRN A;  1G5V A;  5LJ3 j;  1GCQ C;  3L2R A;  3CXC A;  2X51 A;  3VYG A;  2F2V A;  2HEQ A;  1EFN A;  3CPW S;  2OJ2 A;  2RK1 A;  4DA4 A;  1JJ2 S;  1SRL A;  5DLO A;  3M59 A;  3CCJ A;  3GBQ A;  4WCI A;  3JCM d;  3I56 A;  2CT4 A;  4DQ2 A;  1D1A A;  1PCX A;  4FT4 A;  3CCU T;  5KYY B;  5CR2 A;  3M0T A;  2DA9 A;  5FLX E;  4PJN A;  3JB9 H;  4J6Y A;  3NTH A;  3VS2 A;  2X9H A;  1OOT A;  4J9H A;  6AT1 B;  1PC0 A;  3EG3 A;  2LT1 A;  2K5I A;  3NGP A;  4RTX A;  1M2V B;  4KGV B;  1NEB A;  1ZX6 A;  3E9G A;  4LDX A;  1BCO A;  4MDW A;  1K76 A;  3BDU A;  2DL4 A;  1EZZ B;  4X9C A;  3G4S A;  1MNE A;  1H64 1;  1D3B B;  2EGA A;  4QT7 A;  2RPN A;  3CQT A;  1G3Y A;  4L6V 5;  4L59 A;  1YNZ A;  4BY6 B;  2O4X A;  4RUG A;  5A0G A;  1K9M U;  5GAN 4;  1AWO A;  4R56 A;  1YIJ T;  1EX4 A;  3LH0 A;  2QGG A;  3OYL A;  1KJW A;  2CUB A;  3TQ7 P;  2KAF A;  4HT8 A;  2EJG A;  4HKE A;  2CZ1 B;  4M7D E;  3QXE B;  1FMK A;  1GCP A;  1BCM A;  5J39 A;  2PVO B;  3PMI A;  4AFS C;  1NE8 A;  1E6H A;  1NYF A;  2LQN A;  1LJO A;  2E64 A;  1R8O B;  5CQY A;  2BZX A;  3R6O A;  5GMK j;  3ME9 A;  5A2Q E;  2MK5 A;  1YJN T;  4XU0 A;  1W1F A;  3VS6 A;  1M3B A;  4HCZ A;  3OY9 A;  4LDV A;  4V2S A;  2DIQ A;  1MV0 B;  1YJ9 Q;  3R6N A;  2DNU A;  2DXC A;  2BZY A;  2L89 A;  4EIK A;  1W2B P;  1WZO A;  2VAS A;  1Z9Q A;  4F7U B;  1KHC A;  2R58 A;  1Y7X A;  1ZSZ A;  3CCJ Q;  4NS5 A;  3QO3 A;  4F16 A;  2DET A;  3HRT A;  3LH5 A;  2RN8 A;  3CCS Q;  3PTA A;  3RUX A;  3QG1 A;  4DOW A;  4ZTF A;  1ZA2 B;  2DPP B;  3CCU A;  4EMG A;  1P92 A;  2R5A A;  2B86 A;  4JRP A;  2GTJ A;  4OGE A;  2LDM A;  3QWX X;  3SB2 A;  1HD3 A;  4MZT A;  2KXD A;  2LJ3 A;  2OTL Q;  3FJP A;  8ATC B;  3G71 Q;  4FYV B;  2FPD A;  3V8J A;  2MWO A;  4JZ4 A;  4EMK B;  2QA4 T;  2RK2 A;  2QTX A;  1ARK A;  2DK3 A;  2O88 A;  3NPF A;  3KFV A;  2YRV A;  1YJ9 A;  4M78 E;  4RTW A;  5GMK h;  2BTT A;  5D6W A;  1G2B A;  2GQI A;  4GLK A;  3CC2 A;  2F5K A;  3QBY A;  4HT9 A;  1AOJ A;  3I55 A;  1Q95 G;  4C92 C;  5KYU A;  4A4G A;  4BE1 A;  5KE3 A;  2DE0 X;  2FO0 A;  4PNO A;  1JXM A;  4F7U G;  2XDD A;  4RG2 A;  2J6K A;  3QDR B;  1AZE A;  1IGU A;  3HL8 A;  1SEM A;  3I5S A;  3HFO A;  1OQK A;  4PLI A;  3SWN C;  3OW2 S;  3FJ5 A;  1I5L A;  3CD6 A;  2L3Q A;  2DL8 A;  2K2M A;  2M0O A;  2W10 A;  5KYX A;  2K4Y A;  4DBQ A;  2EYZ A;  1ACM B;  4ME7 A;  3G6E T;  4BDZ A;  2O01 E;  3ZBD A;  4A63 B;  1V29 B;  1M3C A;  2A0F B;  2LCS A;  4XU1 A;  1D0Z A;  2DEU A;  3CC7 T;  3GNG A;  1BYM A;  1OU8 A;  3M55 A;  2D0Q B;  3I9Q A;  2RQW A;  1KFZ A;  2EGC A;  1RI0 A;  2JXB A;  1RUW A;  1XTD A;  2ZPG B;  1C0M A;  1G83 A;  2EYX A;  5CIU A;  3H8Z A;  2XI9 A;  2HBP A;  1OPK A;  1FX7 A;  4OMO A;  4CI0 C;  2M02 A;  4PFP A;  1TSF A;  3L2Z A;  4AFU C;  4R55 A;  3CCS T;  2J7I A;  2HL5 C;  3RES A;  2ZPF B;  4L5G A;  2JTF A;  4OB3 B;  3M0P A;  5GAM f;  2VVK A;  2QTV A;  4NOY A;  1SSF A;  3VV0 A;  3VS3 A;  1N6A A;  2PVD B;  2FPF A;  4ZNX A;  3MPU B;  1VQ9 A;  3MCA B;  1D0X A;  4GLM A;  3CCV Q;  1M2O A;  1YCS B;  4JJD A;  3E1S A;  1UUE A;  2ZAE A;  1ZSG A;  4FM4 B;  3D7S B;  2XG8 D;  1XNI A;  2KE9 A;  2EVR A;  4D6W A;  1VIF A;  3H9N A;  1M8M A;  2H3E B;  3EH1 A;  1QWF A;  4CC4 B;  2XMF A;  3H0H A;  3WVE B;  4KH0 B;  3OS0 A;  4JJC A;  2XK0 A;  4M77 E;  4C0Z A;  4GBQ A;  1X6O A;  2Y4Y A;  3PT9 A;  1WGS A;  3RMQ A;  3G71 T;  2LQ8 A;  3ASK A;  3JCM b;  1YJN Q;  1T0H A;  1A0N B;  2FRY A;  3OB9 A;  1KIK A;  4DBR A;  2BKD N;  2MYS A;  1T3S A;  2RHY A;  4Y92 A;  2E5K A;  2RHI A;  1M30 A;  4FCY A;  2M51 A;  3A8L B;  2XDB A;  2EPD A;  2DL5 A;  1NLP C;  1WNL A;  3TEE A;  3OYB A;  2PNI A;  3EGD B;  3E2U A;  1W2B S;  1IRX A;  1WQ7 A;  2V1R A;  2LJ0 A;  4HVU A;  1HK9 A;  3ZFJ A;  2PUO B;  2EQU A;  1PG5 B;  1BI3 A;  1IB8 A;  4BUG A;  3JAM E;  3REB B;  2VB6 A;  2ED1 A;  3CC7 A;  5IHK A;  2CSI A;  2K3X A;  2LP5 A;  1IXD A;  2GTO A;  2L8D A;  1OZ3 A;  3HTR A;  4K11 A;  4AMC A;  2MAM A;  1ABO A;  4VUB A;  2OTJ T;  1K8A R;  2NUT B;  3PVL A;  5EC7 A;  1UE9 A;  1TUG B;  2P0K A;  2DJZ A;  3CCR Q;  2RQU A;  4C8Q F;  5FU7 C;  1UFF A;  4E7K A;  2KYB A;  1FYN A;  2DD5 A;  3SDZ A;  2OTL T;  1OV3 A;  2W0Z A;  2CGH A;  4IUV A;  4M7A B;  1VQ5 T;  2RD1 A;  1X75 C;  1VQ9 T;  2VXE A;  4JRQ A;  3A1P A;  2E1H A;  2RF0 A;  2LMJ A;  2IG0 A;  3OYF A;  2RHZ A;  4Z89 A;  3CCE A;  3DLM A;  1RAA B;  3G6E Q;  2RQT A;  3OA6 A;  5HCK A;  1G3W A;  4OB0 B;  2O2O A;  1NPP A;  1KC8 R;  1YIJ Q;  3HKS A;  4FYY B;  4IUT A;  3VS4 A;  2JS2 A;  3RKX A;  3JB9 D;  1TG0 A;  1YHQ T;  2YUP A;  2KT1 A;  4A4E A;  3JRZ A;  1AEY A;  1VQO Q;  3CPW P;  4D8K A;  2WSE E;  1M1K U;  2QEX T;  1YP5 A;  3QII A;  2JOY A;  2NYS A;  4TVR A;  1RAB B;  3O5Z A;  3SEM A;  4M7A D;  1K8A U;  2CP7 A;  1X6G A;  4EPC A;  1RAD B;  4MDX A;  1Q81 R;  4JRI A;  2CDT A;  4F17 A;  1M5Q 1;  1K4U S;  1Y0M A;  4MML A;  3X26 B;  3M0U A;  1B34 B;  3OYK A;  1D09 B;  1M4Z A;  4J6W A;  4YTL A;  2CZ6 B;  2DTI A;  4OMF B;  2O9S A;  3EG1 A;  4KRT A;  4XU3 A;  3M54 A;  1UEB A;  2E5Q A;  2GFA A;  1CSK A;  4J5Y A;  5I21 A;  1YI2 A;  3RER A;  5IXF A;  5J3B A;  3CCM A;  1VOM A;  3S3O A;  4ZN3 A;  3RKW A;  3UA7 A;  1SPK A;  2DKG A;  3EFO B;  4C92 D;  4RTU A;  1YBY A;  2AKL A;  2DBM A;  3TCJ A;  1YJW T;  1SHG A;  1QCF A;  3HFN A;  3GP8 A;  1WJQ A;  4A4H A;  1XQH A;  5I2S A;  3M56 A;  5LJ3 g;  2B8A A;  2LT4 A;  3JCM X;  1VYU A;  1XJW B;  3TU4 K;  1KQ2 A;  2WSF E;  2V8K A;  3J81 E;  1NJI C;  1YJ9 T;  2PUK B;  1ZSZ C;  4E7S A;  2DZC A;  2YRD A;  2YRC A;  2DIG A;  2PTK A;  2DXB A;  4FT2 A;  4C92 A;  3V7C A;  3A8M B;  3CMA Q;  1Q81 U;  1VQK A;  3UPU A;  4OML A;  2RI2 A;  3UA6 A;  3EG0 A;  4FU6 A;  2KBT A;  4IUP A;  4C92 F;  3SWN B;  4M77 F;  5GAN g;  4RCC A;  1MGQ A;  5IN1 A;  3VU3 C;  2Z0W A;  1WLP B;  1I07 A;  1TS9 A;  2LCC A;  1VYV A;  1D0Y A;  2LQW A;  2XD0 A;  1I0C A;  4XK8 E;  1M2V A;  2X3W D;  4M77 B;  3VS5 A;  1Q82 R;  3OYN A;  4J7F A;  1KC8 U;  1VQ7 Q;  4P5N A;  1K73 U;  1VQ7 T;  2RHU A;  5GAN 7;  2P4R A;  2ZPH B;  2X3X D;  2JW4 A;  2M16 A;  5GMK l;  1X43 A;  1ZLM A;  5HY6 A;  1VQ6 Q;  3OYY A;  2LC4 A;  3CC4 A;  2AZV A;  3JB9 J;  4IUU A;  1VQP T;  4E6R A;  1WXU A;  5GAM d;  9ATC B;  3CCQ T;  2X4X A;  1N8R R;  1VQN A;  2F69 A;  3URG A;  2CZ0 B;  4PJM A;  1VQ8 A;  1LOJ A;  3H0F A;  3FIF A;  2KT8 A;  1MMA A;  2KEA A;  4PFO A;  3L2U A;  2X4W A;  1F1B B;  1OX8 A;  5IH2 A;  2NLU A;  4EMH A;  2F5T X;  2LVM A;  1X2Q A;  4N4H A;  2LX9 A;  1IRE B;  1BKB A;  2HQE A;  2CP0 A;  4IUR A;  2LRQ A;  2EQI A;  1UJY A;  1U1T A;  1K9M C;  2RO0 A;  2D9T A;  2NUP A;  2RJC A;  3T9N A;  3C12 A;  3EFO A;  1VQL A;  3DKM A;  5CKB A;  3VS0 A;  2DYB A;  4QQD A;  3L1A A;  1Y96 B;  2FZG B;  3PVQ A;  1VQ6 T;  4IIM A;  4AG1 C;  5A0L A;  5GMK e;  3EG9 B;  4HXJ A;  3OW2 A;  1W70 A;  4XU2 A;  3QHS A;  1WPY A;  2FEI A;  1UJ0 A;  1M1K R;  1K9A A;  2HDA A;  2M9U A;  3A8H B;  5C6S A;  2YLC A;  1ABQ A;  3M9Q A;  1S72 Q;  2QEX A;  4QW2 A;  2G6F X;  1LPL A;  2O9V A;  2IIM A;  1D3B A;  2DER A;  1O75 A;  3JCM W;  4N4G A;  5HKC A;  2KGT A;  3U23 A;  4EMK A;  5LJ5 g;  5I22 A;  4Z8A A;  3P8B B;  1BBZ A;  4QKU A;  1YHQ Q;  2GBQ A;  2J05 A;  2MMP A;  3OYG A;  1VQ4 A;  1YWP A;  1YIT Q;  3VUB A;  4BI4 A;  3S3N A;  5FU6 C;  3JCM V;  3L42 A;  5GAN 3;  2E65 A;  4DEY A;  3QKJ A;  2EW3 A;  2RMO A;  2K6D A;  4QQ6 A;  3CCQ Q;  4LXC A;  4C8Q C;  5LJ3 h;  4PLL A;  4BE0 A;  4JJN K;  1VQN T;  5KCH A;  1JQQ A;  4Z02 A;  4A4K A;  1RI9 A;  2AIR B;  1JJ2 P;  4D8D A;  2QQR A;  2JUF A;  3N5B B;  2K5F A;  2WSC E;  1G3S A;  2KYM A;  5C0M A;  2IPO B;  3OW2 P;  1PHT A;  4RTY A;  3EFS A;  2MCN A;  2MIO A;  2YT6 A;  1PRM C;  1LCK A;  4AG2 C;  3MEW A;  2PVG B;  3CD6 T;  4HCC A;  4LD9 K;  5GMK m;  2DF6 A;  2RI3 A;  1KG1 A;  1X6B A;  3C0C A;  1WDX A;  1KQS P;  1PM3 A;  4C5G A;  3CXC P;  3OS1 A;  1M90 R;  4OGC A;  2VGM A;  4LD6 A;  1K9M R;  3ULR B;  4CC7 A;  1YJW A;  1W4S A;  3PIO A;  5CKD A;  1BI0 A;  2G3R A;  2DXU A;  1Q86 R;  4ZTJ A;  4J9F A;  4ELY C;  1M3A A;  2EIF A;  1AZG B;  4PJO B;  4BI8 B;  2RJF A;  2DTH A;  5CVI A;  2CH4 W;  1YIT A;  4C92 E;  2QGF B;  3BDL A;  2XDP A;  2HD0 A;  1QVG A;  4PJO C;  2RJE A;  1JU5 C;  4JZ3 A;  1YHQ A;  1Q86 C;  2FB7 A;  2E6N A;  1RAH B;  3G7Z A;  3G4S T;  3QSU A;  4M75 E;  2SRC A;  3OYI A;  1VQP A;  3KXT A;  3M0Q A;  1QCO A;  1WXB A;  4JRK A;  1DJ7 B;  1PNJ A;  2QDL A;  3UDC A;  1T0J A;  2D8H A;  2JZ2 A;  3THK A;  1IHV A;  3SD4 A;  1HXD A;  3MEA A;  2AKK A;  4QVD A;  4OB2 B;  4C0G A;  4MMK A;  5CKH A;  1X2K A;  4DOV A;  4QQG A;  4BE2 A;  3TSW A;  5DLQ E;  1GFD A;  2L5Q A;  3RKY A;  1S72 A;  2HBW A;  1OEB A;  1NEG A;  4M7D B;  3C94 A;  3M57 A;  1VA7 A;  2JM8 A;  3RNJ A;  2J6F A;  2QA4 A;  3OYA A;  2OAU A;  1HSQ A;  3QZ5 B;  2V8J A;  2MOX A;  3FRN A;  3MO8 A;  1WYX A;  2A36 A;  2VYT A;  1O9S A;  3M0R A;  4F14 A;  3X24 B;  3VYH B;  5LJ5 e;  2LTO A;  4J9I A;  3CBM A;  3CC2 T;  5D6Y A;  1WI7 A;  1IHW A;  4FW1 A;  2XU8 A;  1VQM Q;  1VQP Q;  1WX6 A;  2MPX C;  2YSQ A;  5CQX A;  1SKU B;  5IHI A;  2GGR A;  1PKT A;  1B7T A;  4MZP A;  5IT9 E;  1VQ8 T;  2EYY A;  4M75 C;  3FEO A;  2MF2 A;  1ZSZ B;  5DM7 R;  1VQ5 Q;  3CXC S;  2DYI A;  2GNC A;  3IQL A;  1JXO A;  2QI2 A;  4Q5W A;  3RDV A;  1U3O A;  2I2L A;  1AVZ C;  3AT1 B;  1YJW Q;  1MND A;  4O6J A;  2KI7 A;  3V8L A;  4C8Q G;  5GAN j;  4M7D D;  5AYF A;  1N8R C;  2HQX A;  2JNG A;  1BIA A;  5GAN 5;  1Y96 A;  1VQL T;  1MMD A;  4M77 C;  3M5A A;  4EMK C;  4RCB A;  1KQ1 A;  2V8I A;  2NUT A;  3UAT A;  3MHX A;  1H8K A;  5L8R E;  2OTJ A;  2LCL A;  3VS1 A;  1VQ6 A;  3NTK A;  2LNH B;  2K79 A;  2HZY A;  1Q7Y C;  1VQ7 A;  1NG2 A;  3NMZ C;  4KT0 E;  5GAN 8;  3VKI A;  1FXX A;  4B9W A;  2GFU A;  1QVP A;  4LE9 A;  8AT1 B;  3QDF A;  1K0X A;  2HQH A;  4JUV A;  2ZGW A;  3I55 T;  4IUQ A;  3FLG A;  3CCQ A;  1SSH A;  4ZGJ B;  4M7A E;  4FL6 A;  3LWH A;  2ZZD A;  1OU9 A;  1MUZ A;  4J6X A;  1TH7 A;  3LW5 E;  2DEQ A;  3CCE T;  2Y90 A;  4FSX A;  4M75 F;  1U5S A;  1QVG S;  1U06 A;  2FHD A;  2DRK A;  2QG9 B;  4J9G A;  5GAN 6;  4CRI A;  5EG2 A;  2JM9 A;  4M77 G;  3UT1 A;  4OMP A;  5DY9 A;  1OYX A;  2CZ7 B;  1UGV A;  2DIL A;  5KH6 A;  5KYX B;  1M90 C;  1KC8 C;  4Y91 A;  1NBE B;  3GLX A;  2DXT A;  2QQB A;  2A3L A;  2KXC A;  4X1V A;  1N9S A;  2OTJ Q;  5LJ5 h;  1BI1 A;  2CP6 A;  3CMA T;  3M58 A;  3PGG A;  2QEX Q;  5GJW B;  1N8R U;  2EJ9 A;  4ZGD B;  4FW2 A;  2COY A;  3JCM h;  2LNV A;  4FSS A;  1WHH A;  2JTM A;  2VXF A;  4OMN A;  3MP8 A;  4XTX A;  2H3J A;  5GAM h;  3RMS A;  1X27 A;  1Q82 C;  4OF1 A;  1ZQ1 A;  1KQS A;  5ECA A;  4HVV A;  1K8A C;  5KE2 A;  2KQW A;  1JRI A;  2X4Y A;  1HJD A;  1VQ5 A;  1Q7Y U;  5LJ3 e;  1GBQ A;  3INZ A;  3PNW C;  3CCV T;  4QVZ A;  1UGR B;  4J7I A;  4M7A A;  3EGX B;  2J6O A;  4CC2 A;  1J3T A;  2AHJ B;  2ZPE B;  1VYT A;  2D8J A;  1WHL A;  2BUD A;  3CPW A;  2EWN A;  1GRI A;  1KSW A;  4A53 A;  5GAO q;  1VQO A;  2JT4 A;  5FU6 B;  5HK0 A;  2FVU A;  5LJ5 d;  3OMG A;  3DLL A;  3OSV A;  4B9X A;  1FMV A;  3EH2 A;  3H6Z A;  1QQJ A;  3EHQ A;  4M7A G;  2X4J A;  1WHM A;  1QKW A;  4C0D B;  2D6F A;  2HSP A;  5FWB A;  1RAG B;  2KRO A;  1JEG A;  3CCE Q;  4C0D C;  1U8R A;  4IIO A;  1VQK T;  1VIE A;  2EYW A;  2JMC A;  1G8X A;  2DVE A;  5IHN A;  5AT1 B;  4KUI A;  3A8G B;  4M78 G;  2DM1 A;  5KYW A;  2ECZ A;  4OMQ A;  1B07 A;  4M7D A;  1OUL A;  2PQW A;  4BY6 C;  1YWO A;  1IO6 A;  4NL2 A;  3MEU A;  3CCJ T;  4F7U A;  2K2V A;  2YDL A;  1I8F A;  1I5O B;  4E7H A;  1Q81 C;  5GAO n;  3CPF A;  1RLQ C;  4M7A F;  4BB7 A;  4PJO D;  2HSE B;  1UDL A;  2CH4 A;  1ZA1 B;  3MP1 A;  2HNI A;  4M78 B;  4HCB A;  4C8Q E;  3CMA A;  1VQK Q;  1QVF A;  1WA7 A;  1R77 A;  4C5E A;  3BFM A;  1QVF S;  5CKE A;  2ROL A;  3EGX A;  4PJO G;  2KRN A;  1NM7 A;  1N27 A;  2ED0 A;  4E2F B;  4C5H A;  2DZ9 A;  3H41 A;  1AT1 B;  2KMT A;  3CCR T;  3PIP A;  2I0N A;  2EBP A;  5GAM e;  3M0S A;  1IGQ A;  4HA8 A;  1ZBJ A;  4FYX B;  2DO3 A;  5IAY A;  1QW1 A;  3BW1 A;  1OX9 A;  3NFC A;  2NUP B;  3JSC A;  1U1S A;  2EAY A;  1PKS A;  2SEM A;  1GBR A;  4PFZ A;  1Z9Z A;  3NTI A;  3OS5 A;  3MP6 A;  1Y57 A;  4C8Q D;  2DBK A;  4M7D G;  4J9C A;  4RTV A;  2JMA A;  1TUC A;  1PSE A;  1D1B A;  2XIC A;  4XTW A;  1V1C A;  3O8V A;  2E41 A;  3LX7 A;  1QCN A;  2D0N A;  2F1L A; 
#chains in the Genus database with same CATH homology
 2QEX Q;  3CCS Q;  1K9M R;  3CCU Q;  3I56 Q;  1VQM Q;  3CCQ Q;  1VQP Q;  1M1K R;  1VQ8 Q;  3CC7 Q;  1YJW Q;  1VQ6 Q;  3CCR Q;  1S72 Q;  3CCV Q;  1VQ4 Q;  1VQN Q;  3CME Q;  3I55 Q;  1Q7Y R;  1QVG P;  1YJ9 Q;  1Q86 R;  3CCL Q;  1VQO Q;  3CPW P;  1YHQ Q;  1W2B P;  1KQS P;  1JJ2 P;  3CXC P;  3G6E Q;  3G4S Q;  2QA4 Q;  1M90 R;  3CD6 Q;  1N8R R;  1Q82 R;  3CC4 Q;  3CC2 Q;  1VQK Q;  1YIT Q;  1KD1 R;  1VQ5 Q;  3CCM Q;  3CMA Q;  1YJN Q;  1K73 R;  3CCJ Q;  1VQ9 Q;  1QVF P;  1NJI R;  3OW2 P;  1VQ7 Q;  1VQL Q;  2OTJ Q;  1Q81 R;  1YI2 Q;  1K8A R;  2OTL Q;  1KC8 R;  1YIJ Q;  3G71 Q;  3CCE Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...