1YJWQ

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yjwQ00
3CCVQ 2QA4Q 1Q82R 3CCQQ 2OTJQ 1VQ5Q 1QVGP 1VQNQ 1YJWQ 3G4SQ 3CMEQ 1N8RR 3CD6Q 3CCLQ 1YI2Q 1Q86R 1KC8R 3G6EQ 1VQ9Q 1VQOQ 1S72Q 1M90R 2OTLQ 3CCMQ 1K9MR 1VQ6Q 1K8AR 3I56Q 3CMAQ 1YHQQ 1M1KR 3CCJQ 1YJ9Q 1VQ7Q 1QVFP 1YITQ 1Q7YR 1VQMQ 1VQ8Q 1KQSP 1JJ2P 3CC2Q 1YIJQ 1VQ4Q 1KD1R 1YJNQ 2QEXQ 3CCRQ 1NJIR 3OW2P 1Q81R 3CCEQ 3CCSQ 1VQLQ 3CPWP 3I55Q 1VQPQ 3G71Q 3CXCP 3CCUQ 1VQKQ 3CC7Q 1K73R 3CC4Q 1W2BP
chains in the Genus database with same CATH superfamily
2M1HA 1TUCA 2YLCA 4OP0A 4A53A 4QQDA 1M90R 3MP1A 3VJPA 4RUGA 3HP9A 5D7UA 1D1CA 2J7IA 3HRTA 4EPCA 2DX1A 1PSEA 8AT1B 4OMQA 1GRIA 2E70A 3VYGA 2YUQA 4II1A 1ABQA 2QEXA 2FO0A 2D8JA 1XTDA 2HL3A 4V2SA 3M9QA 2YSQA 2JZ2A 1Q86U 2C0IA 2KQWA 1B34A 1OQKA 2QA4Q 1W2BA 5IXBA 3JB9D 2KYMA 5KYWB 1YCYA 2R5MA 1CSKA 3EHRA 3VUBA 2AT1B 3E9FA 3X26B 1PD1A 1VQ9T 3A8OB 3ER0A 4DBQA 1KD1R 2EYZA 3GNFB 1KQ1A 2RQUA 2KXCA 4PJOA 2A3LA 2A36A 3J7AF 1QQJA 3QJ6A 2X51A 1YIJT 2YHTA 3FJPA 5LJ5e 4L5GA 2CP0A 1N5ZA 2FZKB 1OU9A 3EH1A 3E1SA 4F14A 1IB8A 1SF9A 1UTIA 3MEVA 2FHDA 1NJIU 1OZ3A 3SB2A 5FU7C 3MJXA 1Y0MA 1NE8A 2IPOB 4C5EA 5IN1A 2GQIA 3OS1A 1FX7A 2OTJQ 3TSZA 2NUTA 2LMJA 2HD0A 4XTVA 4ANJA 2LZ6B 1VIFA 3NTKA 4OB1B 2BZ8A 1OV3A 2Y90A 2RQRA 1I07A 3PIOA 3PVLA 1VQ4A 5GAOn 2K5IA 2RQTA 3CCSQ 1UGPB 1IXDA 2LC4A 1IREB 1VQ5Q 3M57A 2XI9A 3O8VA 2JTFA 5CKEA 4N4IA 2ESWA 1G2BA 3JCMb 1O75A 1RAIB 3QYGB 2RHIA 2FRWA 4BE1A 1PD0A 3SWNC 1Q82U 2DMOA 4M77F 4FW2A 2E6NA 2G3RA 2YDLA 2MMPA 2RQWA 3RMSA 1PWTA 3CPWP 1VQMT 4HXJA 3C95A 2GFAA 3FLGA 1NJIC 1BK2A 4OB3B 2BE7D 3PMIA 2DZCA 2XHCA 2JMAA 4LD9K 5CCAA 1YITA 4DBHA 3HFNA 1Q81R 1YN8A 4M78F 1GXIE 3LX7A 3G71Q 4DEXA 2BTTA 3UA7A 3EAEA 1B34B 2RO0A 3CD6Q 1VQLT 2O88A 3OS0A 2XD0A 2CYZB 2P4TA 2KT1A 2SEMA 1K4US 5A0DA 4ZGDB 2GBQA 4B9WA 3CPWS 1YHQT 4LUEA 3JSCA 2HQXA 4A63B 2QQ9A 4PJOB 2JN0A 4J9BA 5GMKh 5CQYA 4E7ZA 2ZZDA 5LJ3e 1S72A 2EBPA 2V8IA 1OX9A 2MPXC 1YJ9A 4AFSC 1HD3A 2XIDA 2X3WD 2CP6A 1ARKA 2AZVA 3OW2P 1PSFA 4AFUC 5HCKA 3L1AA 1C0MA 5IHIA 3CPWA 1ZA2B 2COWA 3VS5A 4WTOB 1BIBA 2HZYA 3CMEA 1Q95G 4Z02A 3R6OA 4JRIA 2NUTB 4GLMA 1RAAB 2J6FA 3ASKA 4J9HA 1HSQA 3RERA 5FW9A 5CO7A 1TUGB 2CH4A 4FM4B 3I9QA 4ZNXA 2RQVA 1K8AC 1PM3A 2MF2A 2CP5A 3I56T 4JPBW 4BDYA 4KGVB 1YJNT 2HCKA 1WJQA 4AMCA 3MPUB 3KXTA 4KUIA 4Y28E 4ZTJA 1X6OA 3L2WA 3OW2S 5CIUA 2E12A 1WIEA 2DD4A 3M56A 4QKUA 4E7IA 5L23A 1VQ7T 2QQBA 1AWWA 2DL5A 2GNCA 3TVTA 1TOVA 3CCVA 1EFNA 2QA4A 3G4SQ 4RG8A 1I5OB 3MCAB 2L89A 1AZEA 1BYMA 3O5ZA 3OS5A 3QDFA 3C4SA 3V8KA 1IRXA 2QDLA 4JRPA 1N9RA 1QKWA 1CKAA 3OW2A 4R55A 1OU8A 2KDSA 1PRLC 4OMOA 3OYBA 3CCET 1D0YA 2M0OA 2GTJA 3L2VA 2KRMA 5GAN4 2DTHA 1K9MR 4KRTA 3CMAQ 2GGRA 1WX6A 3QUIA 4X1VA 1OYXA 5FWBA 3CCQT 1PCXA 2ZCFB 1WHHA 4C0DB 2O4XA 1WFWA 2K5FA 1TTHB 2MIOA 1G3SA 3HRUA 2RD1A 4E7JA 2OTJA 4RMOA 3H8ZA 2DRKA 5AT1B 3D7SB 1I81A 1NZ9A 1TUDA 3VS4A 2A7YA 5D6YA 3VKIA 5AYFA 4J8OA 2F2WA 1ZX6A 3M53A 1U1SA 4A54A 4ZN3A 3CCSA 2WSCE 1ZBXA 3OYMA 2DRMA 1NYGA 3L42A 2DBKA 1VQ5A 1VQOQ 4RTTA 1JRIA 1X2KA 1LPLA 2ZPBB 2V8JA 2XKOC 5L8RE 2KEAA 3WVEB 1N8RU 2YUNA 3MEWA 4Q5WA 2DZ9A 4ELZC 3CBOA 4BB7A 1GCQC 3SFMA 4ZN1A 1KD1C 2FZGB 1AT1B 4IUUA 3SHWA 1MGQA 4N0AC 5LL6S 2MAMA 1C1AA 1M1KR 1BCMA 3OYYA 5HK0A 4HA8A 2KXDA 5KYXA 1KIKA 5GANf 1K0XA 3BE3A 2IG0A 1F1BB 2ATCB 2LJ3A 4E47A 5KE3A 1UJ0A 2D1XA 2RNAA 3G71A 3CC4A 1NPRA 2CZ6B 3DB3A 1FMVA 1VYVA 1M2VB 1M1GA 2RHZA 3H41A 3EGUA 4OB2B 3CD6A 4BI3A 3EG2A 1A0NB 1FMKA 4NL2A 2M16A 4HVWA 5HKCA 2YXYA 3LH5A 4TVRA 2HQEA 3EFRA 4C5HA 3N5BB 2XDDA 2HKQB 3OYIA 4QVDA 5GMKl 3PE0A 2WACA 2QEXT 2J06A 1QCFA 3HPWA 2QG9B 3OYFA 1WA7A 4DQ2A 3H6ZA 2E3HA 2CP3A 5GAN7 4M7AA 1D0XA 2KSSA 4M4ZA 3S3NA 2O4XB 2RK1A 2LTOA 2X35A 3META 3OYHA 1KC8U 2CZ7B 3M0TA 4BI8B 1MMAA 1RI0A 1AWJA 4PJOF 3CC7T 3UWNA 2NUZA 2MWPA 1QVFP 4BE2A 2XU8A 3SEMA 4D8KA 1JEGA 1V29B 4RTWA 4DA4A 2GFUA 3REAB 2YUOA 2NUPA 2VASA 3VS3A 4LN2A 1XNIA 2QGFB 4IIOA 1WGSA 4J6WA 2PVOB 2W10A 3CCRT 1T3LA 1Q81C 2LX9A 3M0SA 1YI2A 2KYBA 1NEBA 2LQWA 3QWXX 1TU0B 3FIFA 3R6NA 2K6DA 3CC2Q 2VB6A 1SEMA 4QQGA 3REBB 2LDMA 3OYAA 4JRKA 3I55Q 3V8LA 1VQ4T 3OYLA 3M54A 5GJWB 4L6V5 1QVFS 3G4SA 2WSFE 1YFNA 5CVIA 3OBWA 2FZCB 2CKKA 3QPHA 1UHFA 5FRMA 2K3XA 1Y7XA 3OY9A 1SHFA 4PJOC 2I0NA 3KUFA 1JXOA 4JDSA 3MHXA 1M27C 4M7DF 2P0QA 3GF5A 3RDVA 1WJSA 3VUZA 5GANd 3G6EA 2DBMA 4PJNA 5CKFA 4EMGA 4M75G 2M02A 1ZBJA 4R56A 1QVFA 1G3WA 1UG1A 1Y07A 1Y71A 2LQNA 3NFCA 2H3JA 1YIJQ 3MEUA 3JAME 5A0LA 3C12A 3GIBA 4XAXB 3G1JA 1N27A 1NM7A 1YITT 4ZGEB 3M5AA 3VS6A 4M75E 1TSFA 2E5KA 2K2MA 2DETA 3JCMh 1IGUA 5J39A 2F1LA 4E6RA 2KAFA 2HSPA 3HHTB 2ZPHB 7AT1B 4PFPA 3M0PA 1GBRA 4J9CA 1QKXA 4C92C 1I4K1 1M9SA 3CCVQ 1M2OA 4PJLA 4J7FA 3E19A 3MKDA 1B07A 3A98A 3RR6A 4JLIA 1VQOA 1RUWA 3HL8A 1K76A 3AHUA 3EFOA 2P0KA 2EYWA 6AT1B 4M7DC 2QK0A 1D3BB 1I1JA 2FYKA 1S72T 3G7ZA 3A8MB 2OTLT 4AFQC 1IZ6A 4J9GA 1YJ9T 2NUPB 3RMQA 4ZGJB 2EIFA 1VQPQ 1XOVA 5GAN2 2PUOB 1XJWB 4BY6B 1AEYA 3EGXA 2E41A 1VQMQ 4C8QG 5I21A 1TG0A 1LVKA 4EMKA 3TU4K 2X4YA 4OMFB 1VQ6T 1WHJA 5GAMf 4C0ZA 2CUDA 4WCIA 1VQKA 1K73R 2DILA 2K3YA 2RJFA 4ME7A 2JTEA 4C8QE 3ULRB 4B6MA 3HSBA 2FVUA 2PZ1A 3CCMQ 1NPPA 2EQJA 3CCUT 1HJDA 2X9HA 1NLPC 4C0DC 4PKCC 3EG1A 4RCBA 5FRNA 2ED1A 3L2RA 5CQXA 1VQLQ 4J9IA 4NOYA 2QQRA 4XTUA 4HKEA 2IVWA 4Y92A 1Q7YU 3IQLA 1YJWA 4ESRA 1H3ZA 2QAZA 4QQ6A 1P92A 4M7AG 2CP2A 4WF2A 2YWWA 2RH2A 2Y4XA 4PJOD 2LVMA 5GMKi 3M0QA 3A8GB 3OQ5A 2K2VA 4CC7A 4XU1A 1PG5B 2EGEA 1VQ8T 4IUTA 4M7AE 5CKHA 2KNBB 2QQAA 1OI1A 3VS1A 2COYA 3EHQA 2LCLA 1ZUKA 1SPKA 4MDXA 4E7SA 2RPNA 1X27A 1M1KC 3FEOA 3DKMA 1UJYA 3L2ZA 2EWNA 3OA6A 2PVDB 3CC4Q 1K8AU 2GTOA 2O9VA 2OI3A 2KROA 3V8JA 3J81E 2MWOA 3EGDA 1AD5A 2OAWA 3I56Q 3M0RA 1M8MA 2OTJT 3GP8A 5M9OA 4LDYA 1GBQA 4E7LA 3CC2A 5KYUA 4QT7A 4F04B 4C92D 1RABB 4Z89A 1Q7YC 3ZBDA 1E7OA 2COZA 1PKTA 4XU0A 3I55A 3RIRA 5IT9E 2DTOA 5A2QE 4HVVA 3CCST 2CS7A 4M77C 4M7DD 5GANh 2DL7A 5C6SA 3EGXB 3JCMf 1GFDA 2EFIA 5GMKm 3QSUA 1QP3A 4X9CA 3LWHA 4EMKB 2HBWA 3JB9G 1ZHIA 3UA6A 5GJVB 2H3EB 5GAN5 3S3MA 4RG2A 3P8BB 2MI6A 1QVGP 4J9EA 2V8KA 4RCCA 1VQ9A 2RJDA 9ATCB 4M78C 1R8OB 4MZTA 5GAMd 5KCHA 1M5Q1 3RUXA 1YIJA 2EVRA 2BE9B 3GLXA 2RJEA 4Z88A 3CCQQ 2D0QB 2VXEA 1YI2Q 3UDCA 5GAN8 4L59A 2Z0WA 3PGGA 4FYWB 3G71T 1NLOC 1WQ7A 2DL4A 2X4JA 4HCBA 3CD6T 2DXCA 1BI3A 2AKKA 4FW1A 3LLRA 2KY9A 3PTAA 1RLQC 2HEQA 4BD3A 2Y4YA 1QVGS 2DJZA 1M90U 2DVJA 4RTXA 2DA9A 1D1BA 3HTRA 5GMKj 4F16A 5GANj 1CKBA 2ABLA 4C5IA 5CAIA 2YUPA 1BIAA 3URGA 4BUGA 3JCMJ 5FU6C 5IAYA 4LXCA 1FWZA 2F69A 3P8DA 1VQPA 1LNXA 2A08A 1UFFA 4XU3A 1QVGA 1E6GA 2RHXA 1V1CA 3G6EQ 1KD1U 4FT4A 4EDUA 2L8DA 1S1NA 3EGDB 1ZUUA 5LJ5h 4KGXB 4E7KA 4K11A 1VQMA 1RL2A 2JTMA 3OYDA 5FU7B 5KYUB 3QIIA 4M75A 1UHCA 2EYQA 5DY9A 5CK9A 2R5AA 1WZOA 2X4WA 3CCLQ 4N4GA 3CCMA 2DJQA 5KE2A 1R0BG 2ZPFB 2KBTA 1W70A 1M90C 2O9SA 5EC7A 2HL5C 3DLLA 2E64A 1VQLA 2BKDN 1IHWA 2QTXA 4HVUA 4JUVA 2E4HA 4M77D 3JCMd 2QQSA 4MDWA 2PNIA 1Q86R 3KFVA 3A5ZB 2E3IA 5J26A 1X2QA 2AIRB 3QG1A 4C92G 3QJYA 1ZA1B 3G4ST 2KE9A 1RAGB 1SSHA 3OSVA 1KJWA 2CGHA 2CP7A 4XTYA 5GAOl 1KK7A 1LOJA 4J6YA 2EPDA 1MUZA 2M51A 1W6XA 4LDVA 4ORZA 4OGCA 4C92E 1MMNA 2DIQA 3EG9A 3ME9A 4M78D 3M4YA 3Q1JA 4JZ3A 2L3PA 1YWPA 1TXQA 3CQTA 1G3YA 4OMMA 3GPLA 4A4KA 3NMZC 1SG5A 2XICA 4PL6A 4F7UG 4LE9A 3I35A 2F2VA 3V7CA 4GY5A 3P8HA 4M7DE 3OYKA 2GQVA 1NJIR 2DKGA 2K57A 3CMAT 2W0ZA 3GOXA 2DYBA 2QDYB 3CCJT 2DVEA 4C8QA 1VQKQ 1ZSGA 2AK5A 4OMPA 4BY6C 1HK9A 4F7UE 3OB9A 1ACMB 3TCJA 2LQ8A 1BU1A 1QMCA 2PU9B 1H8KA 1K73C 1MV3A 2DAQA 1DJ7B 2M9UA 3I56A 1Q81U 1U5SA 3QZ9B 4JRQA 1JXMA 2DK3A 4J5YA 2IIMA 2P0PA 2LRQA 2DL8A 2JOYA 1YP5A 1UB4A 3BY7A 2O01E 2RI5A 1X6GA 2F2XA 2OX7A 4LNPA 2K5LA 1AWOA 1VYTA 1M8VA 1GCPA 3JCMX 1VQNQ 3OBYA 1YJWQ 2CT4A 1VOMA 3VV0A 2BUDA 4J7IA 4KT0E 2DIGA 1VQ7A 5IXFA 2RF0A 5GAMh 2C0OA 5LJ3h 3JCMW 2VKNA 3QHSA 2HQHA 1VYUA 1BI0A 1X69A 2F5KA 1JQQA 4M75B 1I8FA 1Q82R 4RKUE 2EQKA 5I2SA 4F17A 4FYXB 2HMAA 4EMHA 4KGZB 5IH2A 1EIFA 4R0KA 3QZ5B 1M4ZA 4FCYA 4XTWA 1GFCA 5D6XA 5I11A 4FIBA 4IURA 1M3BA 2YRCA 4AG2C 2F5TX 1GCQA 2JS0A 1MMGA 3CXCP 4C5GA 2DNUA 2EGAA 3CCQA 2FEIA 4N0AA 2ROTA 4RTZA 2LT1A 1U3OA 2HBPA 1JJ2P 2EJFA 2JS2A 2KVQG 4E2FB 1M1FA 5LJ5f 4BE0A 1RLPC 3NPFA 2ED0A 2JM9A 2C0TA 1AOJA 2QYZA 1I0CA 2DE0X 1R0CB 5GAMj 2HAXA 1WDXA 3L2QA 5I2MA 3OSSC 3FB9A 2KR3A 3EG3A 5KYXB 1UGQB 2ENMA 4M77G 3CXCS 2VGMA 3KBGA 4J9FA 3THKA 4HT9A 3PVQA 5GMKe 1WQWA 3X28B 3ZL7C 4C8QB 4IUQA 4VUBA 2B86A 4Z8AA 1VQ9Q 3S3OA 3ZFJA 4A4GA 1JJ2S 1RAHB 2KI7A 4M77E 2YRVA 1X75C 1ZLMA 1G5VA 1WNLA 1UUEA 1KQSP 4IUPA 1OULA 3RKWA 3LYIA 1MV0B 1JU5C 4PFZA 2SRCA 4M78G 2L3QA 1K9MU 3CXCA 5A0GA 3FDRA 2D0NA 3NGPA 2KMTA 4C0GA 3UATA 3CCLA 2DD5A 1WXUA 4DEYA 4M78E 4D8DA 3NTHA 1QLYA 4ZTFA 1JJ2A 2QXFA 2OJ2A 2QASA 1WHGA 1NG2A 5GAOq 2X3XD 2PQWA 2A28A 1WJRA 4XQ3A 2DLPA 3HRSA 4M7AB 3CCUQ 3CBMA 4D6WA 2KT8A 1X6BA 1E6HA 2AZSA 2X4XA 2EAYA 1D1AA 3I55T 1KQSS 2JMCA 2YRDA 2LX7A 1KFZA 1H641 5KYNA 4PLLA 3MO8A 3QDRB 2XMFA 3UPUA 4J83A 2HDAA 2VWFA 1UECA 1YBYA 2JT4A 4JS4A 2E10A 3TSWA 3GNGA 1OPLA 1W4SA 2PUKB 4O5VA 1ZSZA 5GAOp 3CPFA 3OMCA 1VQ8Q 3CMET 5D6WA 5DLOA 1KQSA 2CT3A 1K9MC 1VA7A 4PLIA 5EG2A 3FJ5A 5LJ3f 2FB7A 3MP6A 3CC7A 4RTYA 3OS2A 1M1KU 4XTZA 4KBMB 3QWYA 3H0IA 3BFMA 8ATCB 5LJ5d 2LCCA 4X9DA 1UGVA 2EJGA 4X34A 4BI4A 2MYSA 3EG0A 1YCSB 3CCRA 4UC4A 3UF4A 4LUDA 3SDZA 1OX8A 1U06A 1XQHA 2VVKA 1UGSB 2JW4A 1QCOA 1AHJB 1O9SA 4B9XA 1FMWA 1VQNA 5FROA 3PFSA 1YHQQ 3LW5E 3CCVT 4FYVB 2QA4T 2ZPIB 1Q86C 1TH7A 1KHCA 1EZZB 4QVZA 3RKXA 2J6OA 2YT6A 3JCMg 2A0FB 1TWBA 4C92A 1WHLA 1KSWA 3HFOA 2JJ9A 1N8RR 2EQMA 2RB6A 3X20B 4GBQA 5IHKA 4AT1B 1NEGA 4JJDA 1VQPT 1FXXA 5KYYA 5GAOm 4M7DA 2DF6A 2A37A 4EIKA 2RM4A 3A8LB 1RADB 4Y91A 3S6WA 1T3SA 1T0HA 4RTUA 3JCMQ 4FSSA 3QXEB 4F7UA 1FYNA 3FRNA 2RK2A 2P4RA 5I22A 2FRYA 3RBBB 1KG1A 2J6KA 3E9GA 4JJCA 2YLBA 4OB0B 4QW2A 2EGCA 4M75F 1JO8A 3JB9I 4MZMA 2E6ZA 2BZYA 3I5SA 5CKDA 1YJNQ 3EFOB 3CCMT 2NLUA 4QVCA 4RTVA 1LCKA 2RHYA 2ZPEB 5CR2A 2FPFA 3QKJA 4JS5A 2LNHB 1G3TA 4CC4B 1AZGB 1SHGA 2L2PA 4HCZA 5GAN6 1VQ7Q 3OYEA 4FSXA 1VQ5T 2DEQA 4AFZC 1ZSZB 2V1RA 1OZ2A 3H9NA 1SKUB 2RMOA 4KULA 1QP2A 2LCSA 1RI9A 2R58A 1K0SA 2L3SA 2KK4A 2CREA 2L0AA 5GAMe 1WI7A 1KC8R 3X24B 4DOVA 2OTLA 2CUBA 1M30A 2LP5A 1Q82C 3PNWC 3VS2A 1Y96A 2E1HA 5LJ3d 2V26A 2AKLA 4MMKA 4P5NA 4MMLA 1QCNA 3SWNA 1OPKA 3EFSA 3CCEQ 4BACA 3JV3A 4M75C 4DBRA 5HY6A 3SD4A 3EH2A 2EQIA 1UGRB 3GBQA 1YWOA 3VS0A 2MCNA 3F70A 2NWMA 4MZPA 1W1FA 2HSEB 2LJ0A 1VQ6A 1OEBA 2VGNA 2DL3A 3CC4T 2J05A 3RESA 4ELYC 3HKSA 4C8QF 1BB9A 3MP8A 1YNZA 4JLGA 2JM8A 3C0CA 2K4YA 3BW1A 1VUBA 1IHVA 4C92B 3CCUA 3OYNA 4OMNA 4FT2A 1U8RA 2D8HA 3TQ7P 2RA2A 2C06A 3RKYA 4A4FA 5KYYB 2R57A 4M7DB 1Y57A 4IKFA 1H92A 4CC2A 1BCOA 3H0FA 4BDZA 2E5QA 1M2VA 3CBPA 4F7UB 2VV5A 4HT8A 5FLXE 1NYFA 4M77A 4PJMA 3VYHB 3BDLA 4PJOG 2KRNA 2DXUA 2I2LA 4M7AF 2CH4W 2DO3A 2L5QA 2EW3A 4FYYB 3UT1A 4JJBA 1VQ8A 3V7SA 4DBFA 3J80E 1G83A 1WXTA 3TEEA 3JCMP 2BZXA 5GANg 4PJOE 4C8QC 3M59A 3M55A 4IUVA 3DB4A 3LGLA 2LQKA 1IGQA 2K9GA 4J9DA 4M78A 2PVGB 3CCJQ 5J3BA 1AWXA 2LJ1A 4OGEA 2FPEA 2RN8A 3U23A 1YI2T 2K3BA 5FWCA 1VIEA 3VRYA 1K73U 1RACB 1WLPB 2EKOA 2RI3A 4IIMA 1QW1A 3JCMe 3I5RA 3LGFA 2P84A 1V76A 1D09B 3LWIA 1HYOA 2LNVA 2GCXA 2O31A 2DPPB 4LDWA 2G6FX 1UE9A 1YHQA 3QO3A 2CZ1B 1Y96B 4N4HA 1KHIA 3TREA 2QEXQ 2KRSA 4E7HA 2XG8D 2RI2A 4M7AC 2E65A 1N9SA 3SWNB 1MNEA 2FG0A 2VYTA 1IO6A 2HKNA 2VC8A 3OMGA 1X01A 5KCOA 4M7DG 1GL5A 3A1PA 3VU3C 2LT4A 2PTKA 5LJ5j 2CSIA 4CI0C 3PIPA 1M3CA 3QBYA 1RAEB 1MNDA 4AG1C 3G6ET 2RJCA 3MEAA 4M75D 5C0MA 3JB9H 4LD6A 3L2UA 1WHMA 4GLKA 3JB9F 1B7TA 2CDTA 2CZ0B 4NS5A 3CC7Q 4A4HA 3C94A 3RNJA 1H3HA 1N6AA 3JRZA 2EYXA 3NTIA 3PT9A 2B8AA 1D0ZA 2K7AA 1SRMA 2MK5A 4XK8E 3CCLT 3CCRQ 2JVVA 1YJNA 1RAFB 2ZPGB 1K1ZA 2BIVA 4PNOA 3INZA 3X25B 4KUDK 2MOXA 2DXTA 5LJ5g 1BBZA 2ZAEA 3AT1B 2WSEE 3M4GA 5ECAA 1UEBA 2QTVA 5DM7R 1KQ2A 5DLQE 4M77B 1PKSA 4PJJA 4OVAA 3V7RA 3PMTA 1Q7YR 2L3RA 2DYIA 1ABOA 1PRMC 1Z9QA 1VQ4Q 2DERA 1C6VX 3CEYA 1VQOT 1BI2A 4KH0B 1MMDA 2FPDA 4KH1B 1UDLA 5GAOr 3JB9J 3FC3A 4XTXA 1Z9ZA 2ECZA 1WHKA 1WYXA 2HNIA 1K9AA 1N8RC 4LDUA 1QWEA 4M78B 1TS9A 4ATOA 2JUFA 2KGTA 4J6XA 1M3AA 4NL3A 4JZ4A 2ROLA 4C8QD 3CCEA 2XDBA 2K79A 1OOTA 4JJNK 5KYWA 4HCKA 3WXMB 3OYGA 2NYSA 1VQKT 2GF7A 1K8AR 1D3BA 4OMLA 1MHNA 4DOWA 4O6JA 1YITQ 1U1TA 1PNJA 2XK0A 3M58A 2VXFA 4PK4A 1BI1A 1EX4A 1QVPA 2QI2A 4LDXA 1PC0A 1T0JA 3BDUA 3OYCA 3VRZA 3OYJA 1ZQ1A 1X43A 3A8HB 2AHJB 1BKBA 3DLMA 4CC3A 1I5LA 3NHNA 3E2UA 5KH6A 2DM1A 3EG9B 2DTIA 5IHNA 3JCMc 1VQNT 2V1QA 5LJ3j 1YJWT 1WXBA 4M7AD 4A4EA 2EQUA 2OAUA 1SRLA 1JBMA 5FU6B 4C0FA 2D6FA 2DFUA 5GANe 1W2BP 3JCMV 2VUBA 2DEUA 2DXBA 1SSFA 2D9TA 2H8HA 1LJOA 2EJ9A 3LH0A 1S72Q 2OTLQ 2XDPA 4YTLA 4CRIA 4C92F 1YJ9Q 1ZSZC 1PHTA 4FL6A 4FU6A 4HCCA 1KC8C 2M0YA 4EMKC 2FL7A 5CKBA 1J3TA 3VS7A 2RHUA 1AVZC 5GAN3 1JB0E 1B3QA 1ZUYA 5GAMg 2JNGA 5LJ3g 3CMEQ 3H0HA 4PFOA 2EYYA 2CSQA 2O2OA 1VQ6Q 4OF1A 3CMAA 3ZEHA 3WVDB 3CCJA 3QYHB 4F7UF 2JXBA 2EKHA 3M0UA 1G8XA 1NBEB 5HK3A 1HXDA 3T9NA 1WPYA 1QWFA 2ZGWA 1W2BS 1R77A 2QGGA 3CC2T 4XU2A
chains in the Genus database with same CATH topology
3CCVQ 2QA4Q 1Q82R 3CCQQ 2OTJQ 1VQ5Q 1QVGP 1VQNQ 1YJWQ 3G4SQ 3CMEQ 1N8RR 3CD6Q 3CCLQ 1YI2Q 1Q86R 1KC8R 3G6EQ 1VQ9Q 1VQOQ 1S72Q 1M90R 2OTLQ 3CCMQ 1K9MR 1VQ6Q 1K8AR 3I56Q 3CMAQ 1YHQQ 1M1KR 3CCJQ 1YJ9Q 1VQ7Q 1QVFP 1YITQ 1Q7YR 1VQMQ 1VQ8Q 1KQSP 1JJ2P 3CC2Q 1YIJQ 1VQ4Q 1KD1R 1YJNQ 2QEXQ 3CCRQ 1NJIR 3OW2P 1Q81R 3CCEQ 3CCSQ 1VQLQ 3CPWP 3I55Q 1VQPQ 3G71Q 3CXCP 3CCUQ 1VQKQ 3CC7Q 1K73R 3CC4Q 1W2BP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV Q;  2QA4 Q;  1Q82 R;  3CCQ Q;  2OTJ Q;  1VQ5 Q;  1QVG P;  1VQN Q;  1YJW Q;  3G4S Q;  3CME Q;  1N8R R;  3CD6 Q;  3CCL Q;  1YI2 Q;  1Q86 R;  1KC8 R;  3G6E Q;  1VQ9 Q;  1VQO Q;  1S72 Q;  1M90 R;  2OTL Q;  3CCM Q;  1K9M R;  1VQ6 Q;  1K8A R;  3I56 Q;  3CMA Q;  1YHQ Q;  1M1K R;  3CCJ Q;  1YJ9 Q;  1VQ7 Q;  1QVF P;  1YIT Q;  1Q7Y R;  1VQM Q;  1VQ8 Q;  1KQS P;  1JJ2 P;  3CC2 Q;  1YIJ Q;  1VQ4 Q;  1KD1 R;  1YJN Q;  2QEX Q;  3CCR Q;  1NJI R;  3OW2 P;  1Q81 R;  3CCE Q;  3CCS Q;  1VQL Q;  3CPW P;  3I55 Q;  1VQP Q;  3G71 Q;  3CXC P;  3CCU Q;  1VQK Q;  3CC7 Q;  1K73 R;  3CC4 Q;  1W2B P; 
#chains in the Genus database with same CATH topology
 2M1H A;  1TUC A;  2YLC A;  4OP0 A;  4A53 A;  4QQD A;  1M90 R;  3MP1 A;  3VJP A;  4RUG A;  3HP9 A;  5D7U A;  1D1C A;  2J7I A;  3HRT A;  4EPC A;  2DX1 A;  1PSE A;  8AT1 B;  4OMQ A;  1GRI A;  2E70 A;  3VYG A;  2YUQ A;  4II1 A;  1ABQ A;  2QEX A;  2FO0 A;  2D8J A;  1XTD A;  2HL3 A;  4V2S A;  3M9Q A;  2YSQ A;  2JZ2 A;  1Q86 U;  2C0I A;  2KQW A;  1B34 A;  1OQK A;  2QA4 Q;  1W2B A;  5IXB A;  3JB9 D;  2KYM A;  5KYW B;  1YCY A;  2R5M A;  1CSK A;  3EHR A;  3VUB A;  2AT1 B;  3E9F A;  3X26 B;  1PD1 A;  1VQ9 T;  3A8O B;  3ER0 A;  4DBQ A;  1KD1 R;  2EYZ A;  3GNF B;  1KQ1 A;  2RQU A;  2KXC A;  4PJO A;  2A3L A;  2A36 A;  3J7A F;  1QQJ A;  3QJ6 A;  2X51 A;  1YIJ T;  2YHT A;  3FJP A;  5LJ5 e;  4L5G A;  2CP0 A;  1N5Z A;  2FZK B;  1OU9 A;  3EH1 A;  3E1S A;  4F14 A;  1IB8 A;  1SF9 A;  1UTI A;  3MEV A;  2FHD A;  1NJI U;  1OZ3 A;  3SB2 A;  5FU7 C;  3MJX A;  1Y0M A;  1NE8 A;  2IPO B;  4C5E A;  5IN1 A;  2GQI A;  3OS1 A;  1FX7 A;  2OTJ Q;  3TSZ A;  2NUT A;  2LMJ A;  2HD0 A;  4XTV A;  4ANJ A;  2LZ6 B;  1VIF A;  3NTK A;  4OB1 B;  2BZ8 A;  1OV3 A;  2Y90 A;  2RQR A;  1I07 A;  3PIO A;  3PVL A;  1VQ4 A;  5GAO n;  2K5I A;  2RQT A;  3CCS Q;  1UGP B;  1IXD A;  2LC4 A;  1IRE B;  1VQ5 Q;  3M57 A;  2XI9 A;  3O8V A;  2JTF A;  5CKE A;  4N4I A;  2ESW A;  1G2B A;  3JCM b;  1O75 A;  1RAI B;  3QYG B;  2RHI A;  2FRW A;  4BE1 A;  1PD0 A;  3SWN C;  1Q82 U;  2DMO A;  4M77 F;  4FW2 A;  2E6N A;  2G3R A;  2YDL A;  2MMP A;  2RQW A;  3RMS A;  1PWT A;  3CPW P;  1VQM T;  4HXJ A;  3C95 A;  2GFA A;  3FLG A;  1NJI C;  1BK2 A;  4OB3 B;  2BE7 D;  3PMI A;  2DZC A;  2XHC A;  2JMA A;  4LD9 K;  5CCA A;  1YIT A;  4DBH A;  3HFN A;  1Q81 R;  1YN8 A;  4M78 F;  1GXI E;  3LX7 A;  3G71 Q;  4DEX A;  2BTT A;  3UA7 A;  3EAE A;  1B34 B;  2RO0 A;  3CD6 Q;  1VQL T;  2O88 A;  3OS0 A;  2XD0 A;  2CYZ B;  2P4T A;  2KT1 A;  2SEM A;  1K4U S;  5A0D A;  4ZGD B;  2GBQ A;  4B9W A;  3CPW S;  1YHQ T;  4LUE A;  3JSC A;  2HQX A;  4A63 B;  2QQ9 A;  4PJO B;  2JN0 A;  4J9B A;  5GMK h;  5CQY A;  4E7Z A;  2ZZD A;  5LJ3 e;  1S72 A;  2EBP A;  2V8I A;  1OX9 A;  2MPX C;  1YJ9 A;  4AFS C;  1HD3 A;  2XID A;  2X3W D;  2CP6 A;  1ARK A;  2AZV A;  3OW2 P;  1PSF A;  4AFU C;  5HCK A;  3L1A A;  1C0M A;  5IHI A;  3CPW A;  1ZA2 B;  2COW A;  3VS5 A;  4WTO B;  1BIB A;  2HZY A;  3CME A;  1Q95 G;  4Z02 A;  3R6O A;  4JRI A;  2NUT B;  4GLM A;  1RAA B;  2J6F A;  3ASK A;  4J9H A;  1HSQ A;  3RER A;  5FW9 A;  5CO7 A;  1TUG B;  2CH4 A;  4FM4 B;  3I9Q A;  4ZNX A;  2RQV A;  1K8A C;  1PM3 A;  2MF2 A;  2CP5 A;  3I56 T;  4JPB W;  4BDY A;  4KGV B;  1YJN T;  2HCK A;  1WJQ A;  4AMC A;  3MPU B;  3KXT A;  4KUI A;  4Y28 E;  4ZTJ A;  1X6O A;  3L2W A;  3OW2 S;  5CIU A;  2E12 A;  1WIE A;  2DD4 A;  3M56 A;  4QKU A;  4E7I A;  5L23 A;  1VQ7 T;  2QQB A;  1AWW A;  2DL5 A;  2GNC A;  3TVT A;  1TOV A;  3CCV A;  1EFN A;  2QA4 A;  3G4S Q;  4RG8 A;  1I5O B;  3MCA B;  2L89 A;  1AZE A;  1BYM A;  3O5Z A;  3OS5 A;  3QDF A;  3C4S A;  3V8K A;  1IRX A;  2QDL A;  4JRP A;  1N9R A;  1QKW A;  1CKA A;  3OW2 A;  4R55 A;  1OU8 A;  2KDS A;  1PRL C;  4OMO A;  3OYB A;  3CCE T;  1D0Y A;  2M0O A;  2GTJ A;  3L2V A;  2KRM A;  5GAN 4;  2DTH A;  1K9M R;  4KRT A;  3CMA Q;  2GGR A;  1WX6 A;  3QUI A;  4X1V A;  1OYX A;  5FWB A;  3CCQ T;  1PCX A;  2ZCF B;  1WHH A;  4C0D B;  2O4X A;  1WFW A;  2K5F A;  1TTH B;  2MIO A;  1G3S A;  3HRU A;  2RD1 A;  4E7J A;  2OTJ A;  4RMO A;  3H8Z A;  2DRK A;  5AT1 B;  3D7S B;  1I81 A;  1NZ9 A;  1TUD A;  3VS4 A;  2A7Y A;  5D6Y A;  3VKI A;  5AYF A;  4J8O A;  2F2W A;  1ZX6 A;  3M53 A;  1U1S A;  4A54 A;  4ZN3 A;  3CCS A;  2WSC E;  1ZBX A;  3OYM A;  2DRM A;  1NYG A;  3L42 A;  2DBK A;  1VQ5 A;  1VQO Q;  4RTT A;  1JRI A;  1X2K A;  1LPL A;  2ZPB B;  2V8J A;  2XKO C;  5L8R E;  2KEA A;  3WVE B;  1N8R U;  2YUN A;  3MEW A;  4Q5W A;  2DZ9 A;  4ELZ C;  3CBO A;  4BB7 A;  1GCQ C;  3SFM A;  4ZN1 A;  1KD1 C;  2FZG B;  1AT1 B;  4IUU A;  3SHW A;  1MGQ A;  4N0A C;  5LL6 S;  2MAM A;  1C1A A;  1M1K R;  1BCM A;  3OYY A;  5HK0 A;  4HA8 A;  2KXD A;  5KYX A;  1KIK A;  5GAN f;  1K0X A;  3BE3 A;  2IG0 A;  1F1B B;  2ATC B;  2LJ3 A;  4E47 A;  5KE3 A;  1UJ0 A;  2D1X A;  2RNA A;  3G71 A;  3CC4 A;  1NPR A;  2CZ6 B;  3DB3 A;  1FMV A;  1VYV A;  1M2V B;  1M1G A;  2RHZ A;  3H41 A;  3EGU A;  4OB2 B;  3CD6 A;  4BI3 A;  3EG2 A;  1A0N B;  1FMK A;  4NL2 A;  2M16 A;  4HVW A;  5HKC A;  2YXY A;  3LH5 A;  4TVR A;  2HQE A;  3EFR A;  4C5H A;  3N5B B;  2XDD A;  2HKQ B;  3OYI A;  4QVD A;  5GMK l;  3PE0 A;  2WAC A;  2QEX T;  2J06 A;  1QCF A;  3HPW A;  2QG9 B;  3OYF A;  1WA7 A;  4DQ2 A;  3H6Z A;  2E3H A;  2CP3 A;  5GAN 7;  4M7A A;  1D0X A;  2KSS A;  4M4Z A;  3S3N A;  2O4X B;  2RK1 A;  2LTO A;  2X35 A;  3MET A;  3OYH A;  1KC8 U;  2CZ7 B;  3M0T A;  4BI8 B;  1MMA A;  1RI0 A;  1AWJ A;  4PJO F;  3CC7 T;  3UWN A;  2NUZ A;  2MWP A;  1QVF P;  4BE2 A;  2XU8 A;  3SEM A;  4D8K A;  1JEG A;  1V29 B;  4RTW A;  4DA4 A;  2GFU A;  3REA B;  2YUO A;  2NUP A;  2VAS A;  3VS3 A;  4LN2 A;  1XNI A;  2QGF B;  4IIO A;  1WGS A;  4J6W A;  2PVO B;  2W10 A;  3CCR T;  1T3L A;  1Q81 C;  2LX9 A;  3M0S A;  1YI2 A;  2KYB A;  1NEB A;  2LQW A;  3QWX X;  1TU0 B;  3FIF A;  3R6N A;  2K6D A;  3CC2 Q;  2VB6 A;  1SEM A;  4QQG A;  3REB B;  2LDM A;  3OYA A;  4JRK A;  3I55 Q;  3V8L A;  1VQ4 T;  3OYL A;  3M54 A;  5GJW B;  4L6V 5;  1QVF S;  3G4S A;  2WSF E;  1YFN A;  5CVI A;  3OBW A;  2FZC B;  2CKK A;  3QPH A;  1UHF A;  5FRM A;  2K3X A;  1Y7X A;  3OY9 A;  1SHF A;  4PJO C;  2I0N A;  3KUF A;  1JXO A;  4JDS A;  3MHX A;  1M27 C;  4M7D F;  2P0Q A;  3GF5 A;  3RDV A;  1WJS A;  3VUZ A;  5GAN d;  3G6E A;  2DBM A;  4PJN A;  5CKF A;  4EMG A;  4M75 G;  2M02 A;  1ZBJ A;  4R56 A;  1QVF A;  1G3W A;  1UG1 A;  1Y07 A;  1Y71 A;  2LQN A;  3NFC A;  2H3J A;  1YIJ Q;  3MEU A;  3JAM E;  5A0L A;  3C12 A;  3GIB A;  4XAX B;  3G1J A;  1N27 A;  1NM7 A;  1YIT T;  4ZGE B;  3M5A A;  3VS6 A;  4M75 E;  1TSF A;  2E5K A;  2K2M A;  2DET A;  3JCM h;  1IGU A;  5J39 A;  2F1L A;  4E6R A;  2KAF A;  2HSP A;  3HHT B;  2ZPH B;  7AT1 B;  4PFP A;  3M0P A;  1GBR A;  4J9C A;  1QKX A;  4C92 C;  1I4K 1;  1M9S A;  3CCV Q;  1M2O A;  4PJL A;  4J7F A;  3E19 A;  3MKD A;  1B07 A;  3A98 A;  3RR6 A;  4JLI A;  1VQO A;  1RUW A;  3HL8 A;  1K76 A;  3AHU A;  3EFO A;  2P0K A;  2EYW A;  6AT1 B;  4M7D C;  2QK0 A;  1D3B B;  1I1J A;  2FYK A;  1S72 T;  3G7Z A;  3A8M B;  2OTL T;  4AFQ C;  1IZ6 A;  4J9G A;  1YJ9 T;  2NUP B;  3RMQ A;  4ZGJ B;  2EIF A;  1VQP Q;  1XOV A;  5GAN 2;  2PUO B;  1XJW B;  4BY6 B;  1AEY A;  3EGX A;  2E41 A;  1VQM Q;  4C8Q G;  5I21 A;  1TG0 A;  1LVK A;  4EMK A;  3TU4 K;  2X4Y A;  4OMF B;  1VQ6 T;  1WHJ A;  5GAM f;  4C0Z A;  2CUD A;  4WCI A;  1VQK A;  1K73 R;  2DIL A;  2K3Y A;  2RJF A;  4ME7 A;  2JTE A;  4C8Q E;  3ULR B;  4B6M A;  3HSB A;  2FVU A;  2PZ1 A;  3CCM Q;  1NPP A;  2EQJ A;  3CCU T;  1HJD A;  2X9H A;  1NLP C;  4C0D C;  4PKC C;  3EG1 A;  4RCB A;  5FRN A;  2ED1 A;  3L2R A;  5CQX A;  1VQL Q;  4J9I A;  4NOY A;  2QQR A;  4XTU A;  4HKE A;  2IVW A;  4Y92 A;  1Q7Y U;  3IQL A;  1YJW A;  4ESR A;  1H3Z A;  2QAZ A;  4QQ6 A;  1P92 A;  4M7A G;  2CP2 A;  4WF2 A;  2YWW A;  2RH2 A;  2Y4X A;  4PJO D;  2LVM A;  5GMK i;  3M0Q A;  3A8G B;  3OQ5 A;  2K2V A;  4CC7 A;  4XU1 A;  1PG5 B;  2EGE A;  1VQ8 T;  4IUT A;  4M7A E;  5CKH A;  2KNB B;  2QQA A;  1OI1 A;  3VS1 A;  2COY A;  3EHQ A;  2LCL A;  1ZUK A;  1SPK A;  4MDX A;  4E7S A;  2RPN A;  1X27 A;  1M1K C;  3FEO A;  3DKM A;  1UJY A;  3L2Z A;  2EWN A;  3OA6 A;  2PVD B;  3CC4 Q;  1K8A U;  2GTO A;  2O9V A;  2OI3 A;  2KRO A;  3V8J A;  3J81 E;  2MWO A;  3EGD A;  1AD5 A;  2OAW A;  3I56 Q;  3M0R A;  1M8M A;  2OTJ T;  3GP8 A;  5M9O A;  4LDY A;  1GBQ A;  4E7L A;  3CC2 A;  5KYU A;  4QT7 A;  4F04 B;  4C92 D;  1RAB B;  4Z89 A;  1Q7Y C;  3ZBD A;  1E7O A;  2COZ A;  1PKT A;  4XU0 A;  3I55 A;  3RIR A;  5IT9 E;  2DTO A;  5A2Q E;  4HVV A;  3CCS T;  2CS7 A;  4M77 C;  4M7D D;  5GAN h;  2DL7 A;  5C6S A;  3EGX B;  3JCM f;  1GFD A;  2EFI A;  5GMK m;  3QSU A;  1QP3 A;  4X9C A;  3LWH A;  4EMK B;  2HBW A;  3JB9 G;  1ZHI A;  3UA6 A;  5GJV B;  2H3E B;  5GAN 5;  3S3M A;  4RG2 A;  3P8B B;  2MI6 A;  1QVG P;  4J9E A;  2V8K A;  4RCC A;  1VQ9 A;  2RJD A;  9ATC B;  4M78 C;  1R8O B;  4MZT A;  5GAM d;  5KCH A;  1M5Q 1;  3RUX A;  1YIJ A;  2EVR A;  2BE9 B;  3GLX A;  2RJE A;  4Z88 A;  3CCQ Q;  2D0Q B;  2VXE A;  1YI2 Q;  3UDC A;  5GAN 8;  4L59 A;  2Z0W A;  3PGG A;  4FYW B;  3G71 T;  1NLO C;  1WQ7 A;  2DL4 A;  2X4J A;  4HCB A;  3CD6 T;  2DXC A;  1BI3 A;  2AKK A;  4FW1 A;  3LLR A;  2KY9 A;  3PTA A;  1RLQ C;  2HEQ A;  4BD3 A;  2Y4Y A;  1QVG S;  2DJZ A;  1M90 U;  2DVJ A;  4RTX A;  2DA9 A;  1D1B A;  3HTR A;  5GMK j;  4F16 A;  5GAN j;  1CKB A;  2ABL A;  4C5I A;  5CAI A;  2YUP A;  1BIA A;  3URG A;  4BUG A;  3JCM J;  5FU6 C;  5IAY A;  4LXC A;  1FWZ A;  2F69 A;  3P8D A;  1VQP A;  1LNX A;  2A08 A;  1UFF A;  4XU3 A;  1QVG A;  1E6G A;  2RHX A;  1V1C A;  3G6E Q;  1KD1 U;  4FT4 A;  4EDU A;  2L8D A;  1S1N A;  3EGD B;  1ZUU A;  5LJ5 h;  4KGX B;  4E7K A;  4K11 A;  1VQM A;  1RL2 A;  2JTM A;  3OYD A;  5FU7 B;  5KYU B;  3QII A;  4M75 A;  1UHC A;  2EYQ A;  5DY9 A;  5CK9 A;  2R5A A;  1WZO A;  2X4W A;  3CCL Q;  4N4G A;  3CCM A;  2DJQ A;  5KE2 A;  1R0B G;  2ZPF B;  2KBT A;  1W70 A;  1M90 C;  2O9S A;  5EC7 A;  2HL5 C;  3DLL A;  2E64 A;  1VQL A;  2BKD N;  1IHW A;  2QTX A;  4HVU A;  4JUV A;  2E4H A;  4M77 D;  3JCM d;  2QQS A;  4MDW A;  2PNI A;  1Q86 R;  3KFV A;  3A5Z B;  2E3I A;  5J26 A;  1X2Q A;  2AIR B;  3QG1 A;  4C92 G;  3QJY A;  1ZA1 B;  3G4S T;  2KE9 A;  1RAG B;  1SSH A;  3OSV A;  1KJW A;  2CGH A;  2CP7 A;  4XTY A;  5GAO l;  1KK7 A;  1LOJ A;  4J6Y A;  2EPD A;  1MUZ A;  2M51 A;  1W6X A;  4LDV A;  4ORZ A;  4OGC A;  4C92 E;  1MMN A;  2DIQ A;  3EG9 A;  3ME9 A;  4M78 D;  3M4Y A;  3Q1J A;  4JZ3 A;  2L3P A;  1YWP A;  1TXQ A;  3CQT A;  1G3Y A;  4OMM A;  3GPL A;  4A4K A;  3NMZ C;  1SG5 A;  2XIC A;  4PL6 A;  4F7U G;  4LE9 A;  3I35 A;  2F2V A;  3V7C A;  4GY5 A;  3P8H A;  4M7D E;  3OYK A;  2GQV A;  1NJI R;  2DKG A;  2K57 A;  3CMA T;  2W0Z A;  3GOX A;  2DYB A;  2QDY B;  3CCJ T;  2DVE A;  4C8Q A;  1VQK Q;  1ZSG A;  2AK5 A;  4OMP A;  4BY6 C;  1HK9 A;  4F7U E;  3OB9 A;  1ACM B;  3TCJ A;  2LQ8 A;  1BU1 A;  1QMC A;  2PU9 B;  1H8K A;  1K73 C;  1MV3 A;  2DAQ A;  1DJ7 B;  2M9U A;  3I56 A;  1Q81 U;  1U5S A;  3QZ9 B;  4JRQ A;  1JXM A;  2DK3 A;  4J5Y A;  2IIM A;  2P0P A;  2LRQ A;  2DL8 A;  2JOY A;  1YP5 A;  1UB4 A;  3BY7 A;  2O01 E;  2RI5 A;  1X6G A;  2F2X A;  2OX7 A;  4LNP A;  2K5L A;  1AWO A;  1VYT A;  1M8V A;  1GCP A;  3JCM X;  1VQN Q;  3OBY A;  1YJW Q;  2CT4 A;  1VOM A;  3VV0 A;  2BUD A;  4J7I A;  4KT0 E;  2DIG A;  1VQ7 A;  5IXF A;  2RF0 A;  5GAM h;  2C0O A;  5LJ3 h;  3JCM W;  2VKN A;  3QHS A;  2HQH A;  1VYU A;  1BI0 A;  1X69 A;  2F5K A;  1JQQ A;  4M75 B;  1I8F A;  1Q82 R;  4RKU E;  2EQK A;  5I2S A;  4F17 A;  4FYX B;  2HMA A;  4EMH A;  4KGZ B;  5IH2 A;  1EIF A;  4R0K A;  3QZ5 B;  1M4Z A;  4FCY A;  4XTW A;  1GFC A;  5D6X A;  5I11 A;  4FIB A;  4IUR A;  1M3B A;  2YRC A;  4AG2 C;  2F5T X;  1GCQ A;  2JS0 A;  1MMG A;  3CXC P;  4C5G A;  2DNU A;  2EGA A;  3CCQ A;  2FEI A;  4N0A A;  2ROT A;  4RTZ A;  2LT1 A;  1U3O A;  2HBP A;  1JJ2 P;  2EJF A;  2JS2 A;  2KVQ G;  4E2F B;  1M1F A;  5LJ5 f;  4BE0 A;  1RLP C;  3NPF A;  2ED0 A;  2JM9 A;  2C0T A;  1AOJ A;  2QYZ A;  1I0C A;  2DE0 X;  1R0C B;  5GAM j;  2HAX A;  1WDX A;  3L2Q A;  5I2M A;  3OSS C;  3FB9 A;  2KR3 A;  3EG3 A;  5KYX B;  1UGQ B;  2ENM A;  4M77 G;  3CXC S;  2VGM A;  3KBG A;  4J9F A;  3THK A;  4HT9 A;  3PVQ A;  5GMK e;  1WQW A;  3X28 B;  3ZL7 C;  4C8Q B;  4IUQ A;  4VUB A;  2B86 A;  4Z8A A;  1VQ9 Q;  3S3O A;  3ZFJ A;  4A4G A;  1JJ2 S;  1RAH B;  2KI7 A;  4M77 E;  2YRV A;  1X75 C;  1ZLM A;  1G5V A;  1WNL A;  1UUE A;  1KQS P;  4IUP A;  1OUL A;  3RKW A;  3LYI A;  1MV0 B;  1JU5 C;  4PFZ A;  2SRC A;  4M78 G;  2L3Q A;  1K9M U;  3CXC A;  5A0G A;  3FDR A;  2D0N A;  3NGP A;  2KMT A;  4C0G A;  3UAT A;  3CCL A;  2DD5 A;  1WXU A;  4DEY A;  4M78 E;  4D8D A;  3NTH A;  1QLY A;  4ZTF A;  1JJ2 A;  2QXF A;  2OJ2 A;  2QAS A;  1WHG A;  1NG2 A;  5GAO q;  2X3X D;  2PQW A;  2A28 A;  1WJR A;  4XQ3 A;  2DLP A;  3HRS A;  4M7A B;  3CCU Q;  3CBM A;  4D6W A;  2KT8 A;  1X6B A;  1E6H A;  2AZS A;  2X4X A;  2EAY A;  1D1A A;  3I55 T;  1KQS S;  2JMC A;  2YRD A;  2LX7 A;  1KFZ A;  1H64 1;  5KYN A;  4PLL A;  3MO8 A;  3QDR B;  2XMF A;  3UPU A;  4J83 A;  2HDA A;  2VWF A;  1UEC A;  1YBY A;  2JT4 A;  4JS4 A;  2E10 A;  3TSW A;  3GNG A;  1OPL A;  1W4S A;  2PUK B;  4O5V A;  1ZSZ A;  5GAO p;  3CPF A;  3OMC A;  1VQ8 Q;  3CME T;  5D6W A;  5DLO A;  1KQS A;  2CT3 A;  1K9M C;  1VA7 A;  4PLI A;  5EG2 A;  3FJ5 A;  5LJ3 f;  2FB7 A;  3MP6 A;  3CC7 A;  4RTY A;  3OS2 A;  1M1K U;  4XTZ A;  4KBM B;  3QWY A;  3H0I A;  3BFM A;  8ATC B;  5LJ5 d;  2LCC A;  4X9D A;  1UGV A;  2EJG A;  4X34 A;  4BI4 A;  2MYS A;  3EG0 A;  1YCS B;  3CCR A;  4UC4 A;  3UF4 A;  4LUD A;  3SDZ A;  1OX8 A;  1U06 A;  1XQH A;  2VVK A;  1UGS B;  2JW4 A;  1QCO A;  1AHJ B;  1O9S A;  4B9X A;  1FMW A;  1VQN A;  5FRO A;  3PFS A;  1YHQ Q;  3LW5 E;  3CCV T;  4FYV B;  2QA4 T;  2ZPI B;  1Q86 C;  1TH7 A;  1KHC A;  1EZZ B;  4QVZ A;  3RKX A;  2J6O A;  2YT6 A;  3JCM g;  2A0F B;  1TWB A;  4C92 A;  1WHL A;  1KSW A;  3HFO A;  2JJ9 A;  1N8R R;  2EQM A;  2RB6 A;  3X20 B;  4GBQ A;  5IHK A;  4AT1 B;  1NEG A;  4JJD A;  1VQP T;  1FXX A;  5KYY A;  5GAO m;  4M7D A;  2DF6 A;  2A37 A;  4EIK A;  2RM4 A;  3A8L B;  1RAD B;  4Y91 A;  3S6W A;  1T3S A;  1T0H A;  4RTU A;  3JCM Q;  4FSS A;  3QXE B;  4F7U A;  1FYN A;  3FRN A;  2RK2 A;  2P4R A;  5I22 A;  2FRY A;  3RBB B;  1KG1 A;  2J6K A;  3E9G A;  4JJC A;  2YLB A;  4OB0 B;  4QW2 A;  2EGC A;  4M75 F;  1JO8 A;  3JB9 I;  4MZM A;  2E6Z A;  2BZY A;  3I5S A;  5CKD A;  1YJN Q;  3EFO B;  3CCM T;  2NLU A;  4QVC A;  4RTV A;  1LCK A;  2RHY A;  2ZPE B;  5CR2 A;  2FPF A;  3QKJ A;  4JS5 A;  2LNH B;  1G3T A;  4CC4 B;  1AZG B;  1SHG A;  2L2P A;  4HCZ A;  5GAN 6;  1VQ7 Q;  3OYE A;  4FSX A;  1VQ5 T;  2DEQ A;  4AFZ C;  1ZSZ B;  2V1R A;  1OZ2 A;  3H9N A;  1SKU B;  2RMO A;  4KUL A;  1QP2 A;  2LCS A;  1RI9 A;  2R58 A;  1K0S A;  2L3S A;  2KK4 A;  2CRE A;  2L0A A;  5GAM e;  1WI7 A;  1KC8 R;  3X24 B;  4DOV A;  2OTL A;  2CUB A;  1M30 A;  2LP5 A;  1Q82 C;  3PNW C;  3VS2 A;  1Y96 A;  2E1H A;  5LJ3 d;  2V26 A;  2AKL A;  4MMK A;  4P5N A;  4MML A;  1QCN A;  3SWN A;  1OPK A;  3EFS A;  3CCE Q;  4BAC A;  3JV3 A;  4M75 C;  4DBR A;  5HY6 A;  3SD4 A;  3EH2 A;  2EQI A;  1UGR B;  3GBQ A;  1YWO A;  3VS0 A;  2MCN A;  3F70 A;  2NWM A;  4MZP A;  1W1F A;  2HSE B;  2LJ0 A;  1VQ6 A;  1OEB A;  2VGN A;  2DL3 A;  3CC4 T;  2J05 A;  3RES A;  4ELY C;  3HKS A;  4C8Q F;  1BB9 A;  3MP8 A;  1YNZ A;  4JLG A;  2JM8 A;  3C0C A;  2K4Y A;  3BW1 A;  1VUB A;  1IHV A;  4C92 B;  3CCU A;  3OYN A;  4OMN A;  4FT2 A;  1U8R A;  2D8H A;  3TQ7 P;  2RA2 A;  2C06 A;  3RKY A;  4A4F A;  5KYY B;  2R57 A;  4M7D B;  1Y57 A;  4IKF A;  1H92 A;  4CC2 A;  1BCO A;  3H0F A;  4BDZ A;  2E5Q A;  1M2V A;  3CBP A;  4F7U B;  2VV5 A;  4HT8 A;  5FLX E;  1NYF A;  4M77 A;  4PJM A;  3VYH B;  3BDL A;  4PJO G;  2KRN A;  2DXU A;  2I2L A;  4M7A F;  2CH4 W;  2DO3 A;  2L5Q A;  2EW3 A;  4FYY B;  3UT1 A;  4JJB A;  1VQ8 A;  3V7S A;  4DBF A;  3J80 E;  1G83 A;  1WXT A;  3TEE A;  3JCM P;  2BZX A;  5GAN g;  4PJO E;  4C8Q C;  3M59 A;  3M55 A;  4IUV A;  3DB4 A;  3LGL A;  2LQK A;  1IGQ A;  2K9G A;  4J9D A;  4M78 A;  2PVG B;  3CCJ Q;  5J3B A;  1AWX A;  2LJ1 A;  4OGE A;  2FPE A;  2RN8 A;  3U23 A;  1YI2 T;  2K3B A;  5FWC A;  1VIE A;  3VRY A;  1K73 U;  1RAC B;  1WLP B;  2EKO A;  2RI3 A;  4IIM A;  1QW1 A;  3JCM e;  3I5R A;  3LGF A;  2P84 A;  1V76 A;  1D09 B;  3LWI A;  1HYO A;  2LNV A;  2GCX A;  2O31 A;  2DPP B;  4LDW A;  2G6F X;  1UE9 A;  1YHQ A;  3QO3 A;  2CZ1 B;  1Y96 B;  4N4H A;  1KHI A;  3TRE A;  2QEX Q;  2KRS A;  4E7H A;  2XG8 D;  2RI2 A;  4M7A C;  2E65 A;  1N9S A;  3SWN B;  1MNE A;  2FG0 A;  2VYT A;  1IO6 A;  2HKN A;  2VC8 A;  3OMG A;  1X01 A;  5KCO A;  4M7D G;  1GL5 A;  3A1P A;  3VU3 C;  2LT4 A;  2PTK A;  5LJ5 j;  2CSI A;  4CI0 C;  3PIP A;  1M3C A;  3QBY A;  1RAE B;  1MND A;  4AG1 C;  3G6E T;  2RJC A;  3MEA A;  4M75 D;  5C0M A;  3JB9 H;  4LD6 A;  3L2U A;  1WHM A;  4GLK A;  3JB9 F;  1B7T A;  2CDT A;  2CZ0 B;  4NS5 A;  3CC7 Q;  4A4H A;  3C94 A;  3RNJ A;  1H3H A;  1N6A A;  3JRZ A;  2EYX A;  3NTI A;  3PT9 A;  2B8A A;  1D0Z A;  2K7A A;  1SRM A;  2MK5 A;  4XK8 E;  3CCL T;  3CCR Q;  2JVV A;  1YJN A;  1RAF B;  2ZPG B;  1K1Z A;  2BIV A;  4PNO A;  3INZ A;  3X25 B;  4KUD K;  2MOX A;  2DXT A;  5LJ5 g;  1BBZ A;  2ZAE A;  3AT1 B;  2WSE E;  3M4G A;  5ECA A;  1UEB A;  2QTV A;  5DM7 R;  1KQ2 A;  5DLQ E;  4M77 B;  1PKS A;  4PJJ A;  4OVA A;  3V7R A;  3PMT A;  1Q7Y R;  2L3R A;  2DYI A;  1ABO A;  1PRM C;  1Z9Q A;  1VQ4 Q;  2DER A;  1C6V X;  3CEY A;  1VQO T;  1BI2 A;  4KH0 B;  1MMD A;  2FPD A;  4KH1 B;  1UDL A;  5GAO r;  3JB9 J;  3FC3 A;  4XTX A;  1Z9Z A;  2ECZ A;  1WHK A;  1WYX A;  2HNI A;  1K9A A;  1N8R C;  4LDU A;  1QWE A;  4M78 B;  1TS9 A;  4ATO A;  2JUF A;  2KGT A;  4J6X A;  1M3A A;  4NL3 A;  4JZ4 A;  2ROL A;  4C8Q D;  3CCE A;  2XDB A;  2K79 A;  1OOT A;  4JJN K;  5KYW A;  4HCK A;  3WXM B;  3OYG A;  2NYS A;  1VQK T;  2GF7 A;  1K8A R;  1D3B A;  4OML A;  1MHN A;  4DOW A;  4O6J A;  1YIT Q;  1U1T A;  1PNJ A;  2XK0 A;  3M58 A;  2VXF A;  4PK4 A;  1BI1 A;  1EX4 A;  1QVP A;  2QI2 A;  4LDX A;  1PC0 A;  1T0J A;  3BDU A;  3OYC A;  3VRZ A;  3OYJ A;  1ZQ1 A;  1X43 A;  3A8H B;  2AHJ B;  1BKB A;  3DLM A;  4CC3 A;  1I5L A;  3NHN A;  3E2U A;  5KH6 A;  2DM1 A;  3EG9 B;  2DTI A;  5IHN A;  3JCM c;  1VQN T;  2V1Q A;  5LJ3 j;  1YJW T;  1WXB A;  4M7A D;  4A4E A;  2EQU A;  2OAU A;  1SRL A;  1JBM A;  5FU6 B;  4C0F A;  2D6F A;  2DFU A;  5GAN e;  1W2B P;  3JCM V;  2VUB A;  2DEU A;  2DXB A;  1SSF A;  2D9T A;  2H8H A;  1LJO A;  2EJ9 A;  3LH0 A;  1S72 Q;  2OTL Q;  2XDP A;  4YTL A;  4CRI A;  4C92 F;  1YJ9 Q;  1ZSZ C;  1PHT A;  4FL6 A;  4FU6 A;  4HCC A;  1KC8 C;  2M0Y A;  4EMK C;  2FL7 A;  5CKB A;  1J3T A;  3VS7 A;  2RHU A;  1AVZ C;  5GAN 3;  1JB0 E;  1B3Q A;  1ZUY A;  5GAM g;  2JNG A;  5LJ3 g;  3CME Q;  3H0H A;  4PFO A;  2EYY A;  2CSQ A;  2O2O A;  1VQ6 Q;  4OF1 A;  3CMA A;  3ZEH A;  3WVD B;  3CCJ A;  3QYH B;  4F7U F;  2JXB A;  2EKH A;  3M0U A;  1G8X A;  1NBE B;  5HK3 A;  1HXD A;  3T9N A;  1WPY A;  1QWF A;  2ZGW A;  1W2B S;  1R77 A;  2QGG A;  3CC2 T;  4XU2 A; 
#chains in the Genus database with same CATH homology
 3CCV Q;  2QA4 Q;  1Q82 R;  3CCQ Q;  2OTJ Q;  1VQ5 Q;  1QVG P;  1VQN Q;  1YJW Q;  3G4S Q;  3CME Q;  1N8R R;  3CD6 Q;  3CCL Q;  1YI2 Q;  1Q86 R;  1KC8 R;  3G6E Q;  1VQ9 Q;  1VQO Q;  1S72 Q;  1M90 R;  2OTL Q;  3CCM Q;  1K9M R;  1VQ6 Q;  1K8A R;  3I56 Q;  3CMA Q;  1YHQ Q;  1M1K R;  3CCJ Q;  1YJ9 Q;  1VQ7 Q;  1QVF P;  1YIT Q;  1Q7Y R;  1VQM Q;  1VQ8 Q;  1KQS P;  1JJ2 P;  3CC2 Q;  1YIJ Q;  1VQ4 Q;  1KD1 R;  1YJN Q;  2QEX Q;  3CCR Q;  1NJI R;  3OW2 P;  1Q81 R;  3CCE Q;  3CCS Q;  1VQL Q;  3CPW P;  3I55 Q;  1VQP Q;  3G71 Q;  3CXC P;  3CCU Q;  1VQK Q;  3CC7 Q;  1K73 R;  3CC4 Q;  1W2B P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...