1YJWQ

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome/antibiotic
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yjwQ00
1VQNQ 1VQLQ 3CPWP 3CCVQ 1YHQQ 1VQMQ 1VQKQ 1YI2Q 3CC2Q 3I56Q 3CCQQ 1QVGP 1KD1R 3G6EQ 3OW2P 1VQ5Q 3CCSQ 1W2BP 1Q81R 3CC7Q 3CMAQ 2QEXQ 3CCUQ 3CCEQ 1M1KR 3G4SQ 1YITQ 1KC8R 1YJWQ 1S72Q 1KQSP 2OTJQ 1VQOQ 1Q7YR 1JJ2P 1VQ4Q 3CCLQ 3CC4Q 1VQ7Q 3CD6Q 3CCRQ 1K9MR 3CMEQ 3CXCP 1M90R 3CCMQ 1VQPQ 3G71Q 1K8AR 2OTLQ 1N8RR 1NJIR 1K73R 1YJ9Q 1QVFP 1VQ8Q 1Q82R 1Q86R 3CCJQ 2QA4Q 1YJNQ 1VQ6Q 1VQ9Q 1YIJQ 3I55Q
chains in the Genus database with same CATH superfamily
2EWNA 2YUQA 3A8HB 3FDRA 1I4K1 4LD6A 3OBWA 1AD5A 2LQ8A 1AOJA 1ZA2B 4PJNA 3V8KA 3SEMA 1KHIA 2MF2A 1N8RC 1E7OA 2M02A 2DXUA 3E19A 3CPWA 1OPLA 3JAME 1S72A 4D6WA 3CXCS 4M7AE 1UDLA 4N4GA 2P84A 4ATOA 3G6EA 2L3QA 1GFDA 1NYFA 3VU3C 3EG0A 1WXTA 3P8BB 1KC8C 1RABB 3HKSA 4KULA 2IVWA 1G3SA 4PJLA 4IIOA 4K11A 3G7ZA 2YRVA 4Y91A 1H3ZA 3EGXA 3JB9J 1VQ8T 2FG0A 4C8QF 3TQ7P 4PJMA 2JS2A 3I55T 3A8MB 1V29B 3CPWS 3RKXA 3ASKA 1VQLQ 1YJNT 2YLBA 2QG9B 2H3JA 2SRCA 3CCLA 1NYGA 3SHWA 2ESWA 4HT8A 2JMCA 1OU8A 2L5QA 1VQOT 1HD3A 4OMLA 1RAHB 4HA8A 1YJNQ 1ZQ1A 2JNGA 2L8DA 1VQNQ 1OI1A 1VQ9T 1M2OA 2P0QA 3C0CA 3OSVA 1X27A 3VS5A 2DVJA 2ABLA 2DXBA 2X4XA 3CC4Q 3PVQA 3QDRB 1YWPA 2RK1A 3EGDB 2DL7A 2DL3A 3TREA 2FYKA 2CUBA 1NPPA 4C0FA 1Y57A 1OX9A 1VQ9Q 2YUPA 3ZBDA 3CC7T 5EG2A 4AFQC 1QQJA 2ZPBB 4WTOB 2QQAA 4C0GA 5IHKA 4M77D 4JPBW 2OTLQ 2EKOA 1BIBA 3MPUB 5ECAA 2DE0X 2GQIA 2HBPA 5CKHA 5KYXB 4JUVA 4IKFA 1X6OA 4QT7A 4PK4A 3G6ET 5IN1A 2JVVA 1QVPA 5EC7A 3BY7A 2EAYA 4LDUA 3QYGB 1RADB 4A4KA 3HP9A 1D3BB 1WQWA 2P4RA 4BDZA 5GMKh 4IUQA 2PVGB 2RQRA 1Q86R 4XU0A 1RLPC 3SB2A 1AWWA 2HNIA 1QKXA 5KCHA 1JJ2S 3CMAT 4OB1B 4AG2C 5GMKl 1NBEB 1KQ1A 2JMAA 4JS5A 4LDVA 2GQVA 1SEMA 2KXDA 1T0JA 3A8OB 5GANd 4LN2A 1W2BA 4J9BA 2DL8A 4R56A 1JQQA 4ZN3A 5KYXA 3UDCA 4HVWA 2FZCB 2DMOA 3VS3A 1M90R 1M3BA 3R6NA 3PVLA 1WHGA 2E12A 2AIRB 4C5IA 1YJ9Q 3FIFA 3RMSA 4J9FA 2D0QB 4M7DA 2V8IA 1OZ3A 4FU6A 4LXCA 4Z88A 2VGNA 1ZSZC 3CC4A 1WHKA 2JXBA 5CK9A 1PSEA 4CRIA 3QKJA 1SHGA 4IUTA 1XJWB 1R77A 2K5IA 3H9NA 2MMPA 2FRWA 1AWOA 3H8ZA 3CMEA 2J7IA 1E6HA 2LT1A 3EGDA 1Q82R 5A0GA 2L89A 4MDWA 2JM9A 4WF2A 5GAMj 4GLMA 5GAOp 5GAMd 2X3WD 5GAOq 2NUPA 4XTVA 1YI2T 2RQTA 2AT1B 2VWFA 5GMKm 4AFUC 5D6XA 1RI9A 2RI5A 3Q1JA 1QKWA 3G1JA 2PUOB 4F17A 1VQLA 2JUFA 4C8QB 2K9GA 3VS0A 2FZGB 3FJPA 4CC2A 2KY9A 5CKDA 5GAMh 3CPWP 2CUDA 1QP2A 1IREB 2FPEA 2QQSA 2QQRA 4OVAA 4BI3A 1SF9A 1Y07A 3CCEA 2DZ9A 2DETA 1VQOQ 3JCMc 2JN0A 1ZUYA 2LNHB 2J06A 2DKGA 4E7SA 4XTWA 1VQPT 4HVUA 2QA4Q 4M78A 2KRSA 1G8XA 3INZA 2CKKA 2G6FX 4M75G 2KT8A 1FXXA 5GAN8 2NUTA 4PL6A 3OYLA 3VS1A 1TSFA 2FO0A 1VQ4Q 5IXBA 1KIKA 4MZTA 1DJ7B 2KQWA 4JDSA 3MEUA 1D1BA 4OMNA 5D6WA 5LJ3h 5LJ5h 3VKIA 3I55Q 1WLPB 4N4HA 1TXQA 3VS2A 3M9QA 4E7JA 2C0TA 4XU2A 2MCNA 4RUGA 1QWFA 3CD6Q 2KR3A 1K1ZA 3HFOA 5LJ3d 5LJ5d 3WXMB 2KNBB 1OU9A 3L2VA 1M1KC 4J9GA 2DA9A 3HPWA 4ELYC 1VQ5T 2C0OA 4RTYA 2CT3A 2G3RA 4QKUA 2K3YA 1KD1C 1X6BA 1EIFA 4A4GA 2XK0A 1M8VA 5CKEA 4JRIA 3NFCA 1PM3A 3OYHA 3M0PA 4PJOG 1IXDA 5GAOr 2RJEA 3JB9D 1N9RA 2FHDA 1PCXA 1ZUKA 3OYJA 3FB9A 2XD0A 3MHXA 4J9CA 1KK7A 2L3PA 4E7IA 2OAWA 1WI7A 2JW4A 1Y7XA 4LDYA 1Z9ZA 1K8AR 4B6MA 2DILA 1I07A 4FYXB 4F14A 1OOTA 1RLQC 3LWIA 1G3TA 1JBMA 2EJ9A 2R5MA 2KGTA 3QG1A 3CCUQ 1YITA 4LE9A 1Q81C 3R6OA 1HYOA 1ZBXA 1B07A 2K2MA 1QVGA 4A4EA 4B9XA 2HDAA 4FIBA 3M0SA 1H641 4C92D 4KH0B 1U5SA 2RHUA 2BIVA 1Q7YR 4C8QE 3HRUA 2RK2A 1SSHA 2QQ9A 4PJOB 3L1AA 3T9NA 4R55A 1M1KR 1WNLA 1KC8U 2O4XB 2O9VA 4BACA 5C0MA 2LVMA 5KYYA 2DERA 5I22A 1M90C 4F7UF 4V2SA 2PVDB 1JXOA 3I56T 2OTJQ 2DTOA 1B34B 5HK3A 4C8QC 1KJWA 3J7AF 3CMAQ 3M0QA 3QIIA 3RBBB 1MV3A 4XTZA 1C6VX 1YJWQ 2FRYA 4A54A 3OS0A 1GFCA 4PJJA 3G71Q 4XTUA 4F7UA 3VRZA 3LH0A 4OGCA 2OTLT 3GP8A 3TU4K 3OYNA 1UE9A 2JS0A 2XG8D 1JO8A 4XTXA 4RG8A 2CS7A 1TTHB 1YJWA 3OYEA 5A0DA 1VQ8A 2LTOA 1QVFA 3EH2A 2J6OA 4KUDK 2Y4YA 3CCMQ 2EQUA 1QVFP 2LC4A 5L8RE 2CZ1B 4CI0C 1QVFS 2F69A 1YIJQ 3GIBA 2DRKA 3OW2A 4M7AD 2LCSA 3GLXA 2RQVA 1N8RU 2EYZA 3C4SA 2ZPFB 4FCYA 2FL7A 1SSFA 3FEOA 2ZPHB 1QW1A 2EJGA 2BTTA 4C0DC 1I81A 1VQMQ 3LGFA 2E70A 2L3RA 3X20B 5DY9A 3DLLA 3HL8A 2QA4A 1BI3A 3CCUA 1NEBA 1YITQ 1IO6A 2A3LA 1OPKA 2RA2A 4M7DB 1PKSA 3NTKA 4HKEA 4ZGJB 4E6RA 4O5VA 2M9UA 1MV0B 1QCNA 1HK9A 4JLIA 4ESRA 2LX9A 1Q7YC 3UWNA 2QEXT 2HQXA 9ATCB 2KRNA 5FW9A 2VASA 1VIEA 3UT1A 1OULA 4A4HA 4NL3A 1ZSZB 2CZ7B 2IIMA 1IB8A 4RG2A 3BFMA 4M77B 1KQSS 2EGCA 4IIMA 3NPFA 2LDMA 5GAN6 2MOXA 2WACA 2DL4A 4AG1C 2KDSA 1GRIA 5A2QE 2KROA 1X43A 2COZA 2BZ8A 2P0KA 2H3EB 1P92A 3LX7A 3MO8A 2LZ6B 3SWNA 1K76A 1C0MA 4OF1A 5LJ3e 5LJ5e 5GAN4 4M75A 3M0RA 4E7LA 3AT1B 5CO7A 1MMGA 2A08A 4FYVB 1NLPC 2DFUA 5GAN2 2X35A 2XU8A 1WDXA 1AVZC 4M78F 2E6ZA 5A0LA 5I2MA 5AYFA 4JJNK 2JT4A 1KD1R 4DOVA 1M3CA 2AHJB 2KK4A 4C92A 1VQ7T 4AT1B 2E4HA 2I2LA 4M75E 3CMET 1BYMA 4Z89A 3M4YA 2XDBA 1K9MC 1YCYA 4Y92A 3NTIA 2XHCA 3QUIA 5GAOn 4RCCA 5CQYA 2LP5A 2VV5A 1N5ZA 3V8LA 1OYXA 4J9HA 3V8JA 3HHTB 2X4JA 2O2OA 1NJIU 3EFSA 2V8KA 4ZNXA 3TSWA 2EW3A 2R5AA 2K5FA 3OY9A 1N27A 2COWA 1Y96B 1K4US 4X9CA 3E1SA 5J3BA 3ME9A 2ENMA 1RL2A 4E7ZA 2KE9A 4A53A 2PTKA 3BDLA 2OI3A 3OB9A 3CCQQ 2X3XD 2A0FB 3I9QA 3QZ9B 3GNGA 3CCEQ 1W1FA 1WHJA 4M78E 4MZPA 2OTLA 1YITT 4EMKA 4OGEA 5GANe 3I35A 1M90U 3L2ZA 5HKCA 4N0AA 4X9DA 4CC7A 4KT0E 2YSQA 2IPOB 3QYHB 2BZXA 3REAB 2P0PA 1M1KU 2KMTA 3A98A 1M27C 2WSCE 2DLPA 1KSWA 1UGQB 2PUKB 4PJOE 4J7IA 3OYCA 5I2SA 8AT1B 2VYTA 3I5SA 3CCMT 5IHNA 5FRNA 4A63B 2XIDA 3HRSA 5J39A 3OQ5A 2RHIA 1OZ2A 1AEYA 3EGXB 2EYXA 3CCVT 2PZ1A 4NL2A 2E5QA 2K4YA 2EYYA 2DBMA 1QVGP 4UC4A 2DPPB 3A5ZB 3C12A 2F1LA 1LJOA 1W70A 4X1VA 1AZGB 2C06A 3RNJA 4FT2A 4EMGA 5FU6B 2W0ZA 2EQKA 1UB4A 1BKBA 3JCMQ 1ZA1B 4JZ4A 1WXBA 3THKA 2JTFA 1NG2A 3QO3A 1VQMT 2RB6A 1EFNA 2D9TA 2WSFE 3DLMA 4RTZA 1FMKA 3QHSA 2E5KA 2K3XA 1D0YA 2LQNA 2E41A 3FRNA 4HCBA 3OYKA 3P8HA 2RI2A 5D7UA 1WHMA 3PIPA 3RERA 5I21A 2HSEB 2D1XA 4GLKA 3RKWA 2MYSA 2DIQA 2DD5A 2VGMA 3H41A 5FROA 4M7DG 2F2VA 3E9GA 2OJ2A 1BU1A 1M8MA 1WX6A 4C92C 3L2RA 4J6XA 1TU0B 3G6EQ 5IXFA 2NUZA 2YUOA 4F04B 3MKDA 1QWEA 5DM7R 4XTYA 2QXFA 1JU5C 3GPLA 4E7KA 1GBRA 2XI9A 3HTRA 3U23A 4JZ3A 2JOYA 2B8AA 2DXCA 3EG9B 2Z0WA 1UG1A 4OMMA 3A8GB 4PFOA 1QCOA 1AZEA 3CCQA 3CCJA 2DEUA 1KG1A 2EPDA 4XK8E 1MHNA 1PG5B 2LCCA 2LJ3A 5L23A 1M2VA 3HRTA 3ZEHA 2KSSA 2O9SA 2CP5A 3M0TA 2BE7D 1UHFA 2E3HA 1IGUA 2K3BA 4LUDA 4J6WA 1NLOC 4KH1B 1MNDA 1R8OB 2YRCA 4AFZC 4M7DD 4PJOF 3VS4A 2ZPEB 1OEBA 4EMKB 3L2QA 2ZPIB 4EPCA 4QQGA 4DQ2A 3M53A 2DBKA 2MI6A 4X34A 1VQ9A 2DTIA 4QVDA 3OYIA 3TEEA 5GAMg 4RCBA 1UEBA 3REBB 3VYHB 5LJ5g 5LJ3g 3PGGA 3M58A 3UPUA 2FEIA 3LGLA 3RUXA 3OMGA 4LD9K 2LX7A 2E64A 1WJSA 2YLCA 4EMKC 1K8AU 3QWXX 1MNEA 2HAXA 1RUWA 1H3HA 4L5GA 2BE9B 2FB7A 1XTDA 1KHCA 2JZ2A 5GJVB 1JEGA 3QPHA 2QDYB 3TCJA 5KE2A 2OTJT 3V7SA 4XU3A 4ORZA 1OX8A 1NZ9A 2XKOC 2M0YA 2XDDA 4C8QG 4C92B 1YJWT 1T3LA 1Q7YU 2RI3A 5M9OA 3OBYA 3VRYA 4MZMA 2VUBA 4N0AC 3I5RA 4C5GA 2E3IA 4OMFB 1EZZB 1VQKA 3ZFJA 4M7AB 3JCMP 3ZL7C 2RF0A 3UATA 2X9HA 1MUZA 1Q82C 4FYWB 3FJ5A 3M0UA 2M16A 1VQPQ 1OQKA 3OS2A 1PSFA 1VIFA 5FU7B 1WHHA 1TS9A 3FLGA 4JRQA 2CP2A 4XAXB 6AT1B 2CREA 1GL5A 5KYWA 3DB3A 1VQMA 2C0IA 1VQ4T 4D8KA 4M77A 2DNUA 4C92F 1KC8R 3RDVA 2LMJA 4KGZB 3J81E 2HKQB 3CD6T 1WYXA 2HSPA 3M55A 4RTWA 3GOXA 4FT4A 3SDZA 5KH6A 3UF4A 2FPFA 1VQ8Q 4C0DB 4M7DF 4FM4B 2KYMA 1LOJA 1BK2A 4HVVA 3JB9H 2Y4XA 3EAEA 1VQKT 3A1PA 3EHQA 4M77C 3KUFA 5GAN3 1YIJA 3D7SB 1CKBA 2EQMA 3G71A 4GBQA 4ZN1A 1YI2A 2RM4A 3CXCA 2YDLA 1O75A 2QQBA 3O5ZA 4JJDA 4P5NA 1IHWA 1WZOA 4PFZA 5GMKe 5GANf 2KEAA 1ZLMA 7AT1B 1D1AA 3CC2A 2NLUA 4J5YA 5KYUA 1VQ5Q 2L3SA 3QDFA 1U06A 1X75C 2GNCA 4A4FA 3BE3A 5AT1B 2EYQA 1KQSP 1RI0A 3QWYA 2QI2A 4KGXB 2QGFB 1UGPB 2ZCFB 2O31A 4C92E 1BIAA 2MPXC 2K57A 1K0XA 2JTEA 3JRZA 1FX7A 1UJ0A 1WGSA 1LCKA 3CMAA 1MMAA 4J7FA 2OTJA 2DZCA 2KYBA 1AWXA 3EG1A 2ATCB 1K9AA 2KRMA 1VQ5A 2DF6A 2YWWA 1Z9QA 1VQ7A 2XMFA 3J80E 1WJRA 2EQJA 2VVKA 5GMKj 3CCSA 2JJ9A 1QVGS 2VXEA 1YHQA 3QBYA 4HXJA 1VQOA 4KBMB 2CH4W 5KYUB 3JCMX 1H92A 1E6GA 4J9DA 1X2KA 2LRQA 4JRKA 4M7AF 2PU9B 2K6DA 4WCIA 1Q81U 4HCKA 1VQ6Q 1M9SA 2QA4T 4BY6B 4II1A 8ATCB 2X4YA 3NGPA 2LQWA 1S72T 2CSQA 3OYBA 3MCAB 4N4IA 4PLLA 2K7AA 3JCMh 2D6FA 5GJWB 1TUDA 2P4TA 4LUEA 4PJOA 2RNAA 3G4SA 4M7DE 1UGRB 2ROLA 4MDXA 1LNXA 3BW1A 2EQIA 5LJ3j 5LJ5j 2A28A 4C5HA 3TSZA 3L42A 1U1SA 1KD1U 1YHQT 2RJCA 2DJQA 2QASA 1V76A 4QVCA 1SG5A 4M78C 1WQ7A 1KFZA 3BDUA 3RR6A 1BCMA 2MAMA 1RAEB 1Q86C 1M30A 1GCQC 2HQEA 3M4GA 1C1AA 3V7RA 4QQDA 1JJ2A 2DD4A 2HKNA 4CC4B 2A36A 3URGA 1UECA 4EMHA 3O8VA 2VXFA 1ZHIA 3MP6A 4QVZA 4E2FB 3UA6A 3ER0A 3CCRT 3ULRB 1VQ4A 1RACB 3VUZA 3DKMA 1RAGB 4L59A 1I8FA 4BUGA 4ELZC 1WHLA 1KQ2A 2GFAA 3JCMe 3OW2P 3VS6A 1GCPA 1GCQA 2RPNA 2YHTA 4FW2A 3TVTA 2F2WA 1QCFA 1R0CB 3PTAA 3EFOB 3CCVA 2DTHA 2KT1A 2M0OA 2SEMA 2PNIA 3KXTA 2M51A 5GAN7 1UUEA 3OYGA 4RKUE 5DLOA 4J83A 4QQ6A 1SRMA 4M78D 4J9IA 3JSCA 1PRMC 3DB4A 4JS4A 1ZUUA 3VYGA 1K9MU 2QEXQ 2COYA 4LNPA 1U8RA 2DX1A 4MMKA 5GAMf 1U1TA 1SPKA 2DK3A 3OA6A 1RAIB 4KGVB 3CBPA 1YNZA 3JV3A 1YN8A 2K2VA 1K73U 2L2PA 2RHZA 3OYDA 1SKUB 2DIGA 2RHXA 4FSXA 1Q81R 2DL5A 5HCKA 5CR2A 1TH7A 2HL5C 1KQSA 1PRLC 4RTVA 2KVQG 1K73C 1UTIA 4BE1A 1UGSB 2NUTB 2V1RA 2ZGWA 2NWMA 1G3YA 1R0BG 3JCMb 3EFRA 2W10A 4M75D 3X25B 4BD3A 1TG0A 1BI1A 1PKTA 1YP5A 4FW1A 4PKCC 1YJ9A 4M77G 4KUIA 3KBGA 2RJDA 3JCMg 2DO3A 2BUDA 3CMEQ 1TWBA 3PFSA 1IHVA 4BY6C 1NPRA 1TOVA 4DEYA 2GTOA 5FU6C 3CC2T 2EJFA 1X01A 1N6AA 4R0KA 3E2UA 2QAZA 1X69A 1D09B 4B9WA 2CZ0B 4Q5WA 3KFVA 3OMCA 3VS7A 1BBZA 4C8QA 5GMKi 3F70A 1FMVA 3OW2S 4M7AG 2O01E 1W2BS 2LNVA 3EH1A 1EX4A 3HSBA 3CCLQ 1LVKA 1VUBA 1JRIA 2NUPB 4NOYA 5DLQE 1SHFA 4FL6A 1VYVA 1Q82U 1V1CA 1I5LA 4OMPA 1BI0A 2DJZA 2KAFA 1X6GA 1Y96A 2LCLA 2AZVA 1VYUA 2EGAA 4E47A 2ED1A 2PVOB 3CCLT 1M1FA 3NTHA 3JCMd 3I56A 3OSSC 4KRTA 2VB6A 5HK0A 1M3AA 4XU1A 2MIOA 3M57A 1N8RR 1CKAA 1XQHA 2ZAEA 1XOVA 4C5EA 3EFOA 1BCOA 5C6SA 3NHNA 3MEAA 2HBWA 2AK5A 3AHUA 2R57A 5D6YA 2EFIA 2XDPA 4M4ZA 2V26A 4J9EA 4O6JA 4BI8B 3L2UA 4C8QD 1M4ZA 4TVRA 3JB9G 3RIRA 5CAIA 5FWBA 1D1CA 2LT4A 1K9MR 3PT9A 1UFFA 2QYZA 1NJIR 3MP1A 4JJBA 3H0HA 1MMDA 1O9SA 3CBOA 4DEXA 5CQXA 1G5VA 1GBQA 2YRDA 3X26B 1PC0A 1YCSB 2D8HA 1FYNA 3EG3A 2EVRA 1D0XA 2YUNA 3CCUT 3CPFA 4M75B 2NYSA 3CQTA 1UGVA 1U3OA 1Y71A 3SWNB 4F7UE 3WVEB 3NMZC 1VQ6T 3S3MA 1Q86U 2CP3A 2BKDN 2DYBA 4ZGEB 2EKHA 3X28B 3I56Q 4PJOD 1YIJT 1D3BA 2XICA 1YJNA 1QLYA 1G2BA 1WPYA 1A0NB 4M7AC 1ZSZA 4VUBA 4AMCA 1AT1B 1NE8A 2WSEE 4NS5A 3META 5FWCA 3A8LB 4IUUA 4RTXA 5CIUA 1W6XA 2QTXA 1K0SA 2OX7A 1VQNA 5LJ3f 5LJ5f 3JB9F 3PMTA 2HD0A 1RAAB 2DM1A 1OV3A 3E9FA 4LDWA 1D0ZA 1Y0MA 2EBPA 3HFNA 4FYYB 5GANj 5IH2A 4AFSC 3L2WA 4F16A 2D0NA 2CZ6B 1QP3A 4XQ3A 5IAYA 1G3WA 1SRLA 1M1GA 3JCMW 4M75F 3PMIA 4Z02A 4LDXA 4GY5A 3C95A 3G4SQ 2VC8A 3N5BB 2E10A 1S72Q 1XNIA 1RAFB 5KYNA 4BI4A 2CDTA 2CSIA 1I5OB 2RJFA 3LH5A 5GAOm 2RO0A 3CBMA 4M77F 2CGHA 1J3TA 3MEVA 5IT9E 3CEYA 3QSUA 2DRMA 2FPDA 4OB3B 2FZKB 1YBYA 4BDYA 2MWPA 1VQ6A 4C0ZA 1AWJA 2D8JA 2OAUA 4JLGA 2AKKA 2FVUA 4DBFA 5IHIA 2HEQA 2O88A 3JCMf 1LPLA 4ZGDB 5J26A 4OP0A 1VOMA 2LJ1A 2GFUA 3OYMA 2IG0A 1VA7A 3H0FA 1HJDA 2E65A 3OS1A 4M78G 2YXYA 3VJPA 3C94A 1GXIE 4MMLA 1I0CA 4BE2A 5KCOA 2K5LA 1YHQQ 1PWTA 3CCMA 4BE0A 2DEQA 3CCSQ 3FC3A 2K79A 2JM8A 2QEXA 4ZTFA 1VQ7Q 3EGUA 2CP0A 2CT4A 4RTTA 2KXCA 2QGGA 1B3QA 2E6NA 1IRXA 2HMAA 3OYAA 1B34A 1VQLT 5GAN5 1WJQA 2GCXA 5GANg 2ECZA 3CCVQ 3CCST 2CYZB 3S3NA 4D8DA 4FSSA 5KYYB 2HL3A 4M7DC 2V8JA 1I1JA 2KBTA 1UJYA 2O4XA 3CXCP 2RD1A 1NEGA 3OYFA 2HZYA 2CP6A 2A7YA 2RHYA 3OS5A 2LJ0A 4J6YA 3S3OA 2ED0A 3WVDB 1QMCA 2E1HA 2HQHA 3CC2Q 3SD4A 2ZZDA 2GBQA 4HCZA 4OB0B 5HY6A 1H8KA 4OMQA 3CC4T 5KYWB 4C92G 2X51A 2CH4A 3JCMJ 1B7TA 2J05A 2QDLA 3QXEB 3JB9I 1ARKA 2AKLA 2J6FA 1WXUA 3CC7A 2H8HA 3QZ5B 2QK0A 3M59A 4QW2A 3VUBA 4EDUA 5GANh 3X24B 1S1NA 1PD0A 3RESA 3PIOA 2RQUA 2AZSA 4M7AA 2F2XA 4JJCA 1JJ2P 1JXMA 2RQWA 4J8OA 4DBHA 3G71T 3GBQA 1TUGB 2ZPGB 5FU7C 1YJ9T 1MMNA 1K73R 2LQKA 4F7UB 3CCJT 1ZX6A 1UHCA 4PJOC 1ZBJA 2VKNA 2I0NA 2YT6A 1BB9A 1HXDA 4ANJA 5CVIA 1X2QA 4RTUA 1TUCA 3S6WA 1K8AC 4IUPA 4PFPA 1NJIC 1T3SA 3SWNC 3CCRQ 4Y28E 4DBQA 5FLXE 1WFWA 3LLRA 3CCRA 4DA4A 5LL6S 3QJ6A 1FMWA 1ABQA 1PHTA 1VQNT 1AHJB 3UA7A 3CCQT 3M54A 1VQKQ 4IUVA 2EIFA 3LW5E 3CCET 3CC7Q 2A37A 3PE0A 3MEWA 2KI7A 3EG2A 2MWOA 3M56A 3G4ST 2RMOA 2F5KA 1Q95G 1NM7A 2R58A 1PNJA 1VQPA 1MGQA 3JCMV 2EYWA 3LYIA 1HSQA 3GF5A 4M77E 1ZSGA 4ME7A 3RMQA 3M5AA 2MK5A 3GNFB 2DAQA 5CKFA 4PNOA 2DXTA 3IQLA 5KE3A 1F1BB 4HCCA 3PNWC 5I11A 3P8DA 1W4SA 2GF7A 2V1QA 3SFMA 2M1HA 5FRMA 4M75C 5GAOl 3MJXA 1N9SA 4DBRA 4OB2B 4Z8AA 2GGRA 1M2VB 2QTVA 4EIKA 4M78B 1IGQA 2Y90A 4YTLA 2CP7A 3OYYA 1FWZA 5GAMe 3VV0A 1WIEA 4L6V5 2JTMA 4E7HA 3LWHA 1ABOA 2DVEA 4OMOA 3MP8A 4BB7A 2HCKA 1T0HA 3EG9A 1PD1A 2J6KA 1IZ6A 1CSKA 3H0IA 2PQWA 4F7UG 1JB0E 1G83A 2B86A 3QJYA 1YI2Q 2RH2A 1W2BP 3CD6A 4DOWA 4ZTJA 1VYTA 2GTJA 4IURA 1WA7A 1YFNA 4HT9A 2X4WA 2F5TX 4PLIA 1YWOA 4RMOA 2DYIA 1ACMB 1M5Q1 3H6ZA 3V7CA 2ROTA 4CC3A 1BI2A 3EHRA 4JRPA 3I55A 2RN8A 3RKYA 5CKBA 5CCAA 2BZYA 3CCJQ 2L0AA 2EGEA
chains in the Genus database with same CATH topology
1VQNQ 1VQLQ 3CPWP 3CCVQ 1YHQQ 1VQMQ 1VQKQ 1YI2Q 3CC2Q 3I56Q 3CCQQ 1QVGP 1KD1R 3G6EQ 3OW2P 1VQ5Q 3CCSQ 1W2BP 1Q81R 3CC7Q 3CMAQ 2QEXQ 3CCUQ 3CCEQ 1M1KR 3G4SQ 1YITQ 1KC8R 1YJWQ 1S72Q 1KQSP 2OTJQ 1VQOQ 1Q7YR 1JJ2P 1VQ4Q 3CCLQ 3CC4Q 1VQ7Q 3CD6Q 3CCRQ 1K9MR 3CMEQ 3CXCP 1M90R 3CCMQ 1VQPQ 3G71Q 1K8AR 2OTLQ 1N8RR 1NJIR 1K73R 1YJ9Q 1QVFP 1VQ8Q 1Q82R 1Q86R 3CCJQ 2QA4Q 1YJNQ 1VQ6Q 1VQ9Q 1YIJQ 3I55Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN Q;  1VQL Q;  3CPW P;  3CCV Q;  1YHQ Q;  1VQM Q;  1VQK Q;  1YI2 Q;  3CC2 Q;  3I56 Q;  3CCQ Q;  1QVG P;  1KD1 R;  3G6E Q;  3OW2 P;  1VQ5 Q;  3CCS Q;  1W2B P;  1Q81 R;  3CC7 Q;  3CMA Q;  2QEX Q;  3CCU Q;  3CCE Q;  1M1K R;  3G4S Q;  1YIT Q;  1KC8 R;  1YJW Q;  1S72 Q;  1KQS P;  2OTJ Q;  1VQO Q;  1Q7Y R;  1JJ2 P;  1VQ4 Q;  3CCL Q;  3CC4 Q;  1VQ7 Q;  3CD6 Q;  3CCR Q;  1K9M R;  3CME Q;  3CXC P;  1M90 R;  3CCM Q;  1VQP Q;  3G71 Q;  1K8A R;  2OTL Q;  1N8R R;  1NJI R;  1K73 R;  1YJ9 Q;  1QVF P;  1VQ8 Q;  1Q82 R;  1Q86 R;  3CCJ Q;  2QA4 Q;  1YJN Q;  1VQ6 Q;  1VQ9 Q;  1YIJ Q;  3I55 Q; 
#chains in the Genus database with same CATH topology
 2EWN A;  2YUQ A;  3A8H B;  3FDR A;  1I4K 1;  4LD6 A;  3OBW A;  1AD5 A;  2LQ8 A;  1AOJ A;  1ZA2 B;  4PJN A;  3V8K A;  3SEM A;  1KHI A;  2MF2 A;  1N8R C;  1E7O A;  2M02 A;  2DXU A;  3E19 A;  3CPW A;  1OPL A;  3JAM E;  1S72 A;  4D6W A;  3CXC S;  4M7A E;  1UDL A;  4N4G A;  2P84 A;  4ATO A;  3G6E A;  2L3Q A;  1GFD A;  1NYF A;  3VU3 C;  3EG0 A;  1WXT A;  3P8B B;  1KC8 C;  1RAB B;  3HKS A;  4KUL A;  2IVW A;  1G3S A;  4PJL A;  4IIO A;  4K11 A;  3G7Z A;  2YRV A;  4Y91 A;  1H3Z A;  3EGX A;  3JB9 J;  1VQ8 T;  2FG0 A;  4C8Q F;  3TQ7 P;  4PJM A;  2JS2 A;  3I55 T;  3A8M B;  1V29 B;  3CPW S;  3RKX A;  3ASK A;  1VQL Q;  1YJN T;  2YLB A;  2QG9 B;  2H3J A;  2SRC A;  3CCL A;  1NYG A;  3SHW A;  2ESW A;  4HT8 A;  2JMC A;  1OU8 A;  2L5Q A;  1VQO T;  1HD3 A;  4OML A;  1RAH B;  4HA8 A;  1YJN Q;  1ZQ1 A;  2JNG A;  2L8D A;  1VQN Q;  1OI1 A;  1VQ9 T;  1M2O A;  2P0Q A;  3C0C A;  3OSV A;  1X27 A;  3VS5 A;  2DVJ A;  2ABL A;  2DXB A;  2X4X A;  3CC4 Q;  3PVQ A;  3QDR B;  1YWP A;  2RK1 A;  3EGD B;  2DL7 A;  2DL3 A;  3TRE A;  2FYK A;  2CUB A;  1NPP A;  4C0F A;  1Y57 A;  1OX9 A;  1VQ9 Q;  2YUP A;  3ZBD A;  3CC7 T;  5EG2 A;  4AFQ C;  1QQJ A;  2ZPB B;  4WTO B;  2QQA A;  4C0G A;  5IHK A;  4M77 D;  4JPB W;  2OTL Q;  2EKO A;  1BIB A;  3MPU B;  5ECA A;  2DE0 X;  2GQI A;  2HBP A;  5CKH A;  5KYX B;  4JUV A;  4IKF A;  1X6O A;  4QT7 A;  4PK4 A;  3G6E T;  5IN1 A;  2JVV A;  1QVP A;  5EC7 A;  3BY7 A;  2EAY A;  4LDU A;  3QYG B;  1RAD B;  4A4K A;  3HP9 A;  1D3B B;  1WQW A;  2P4R A;  4BDZ A;  5GMK h;  4IUQ A;  2PVG B;  2RQR A;  1Q86 R;  4XU0 A;  1RLP C;  3SB2 A;  1AWW A;  2HNI A;  1QKX A;  5KCH A;  1JJ2 S;  3CMA T;  4OB1 B;  4AG2 C;  5GMK l;  1NBE B;  1KQ1 A;  2JMA A;  4JS5 A;  4LDV A;  2GQV A;  1SEM A;  2KXD A;  1T0J A;  3A8O B;  5GAN d;  4LN2 A;  1W2B A;  4J9B A;  2DL8 A;  4R56 A;  1JQQ A;  4ZN3 A;  5KYX A;  3UDC A;  4HVW A;  2FZC B;  2DMO A;  3VS3 A;  1M90 R;  1M3B A;  3R6N A;  3PVL A;  1WHG A;  2E12 A;  2AIR B;  4C5I A;  1YJ9 Q;  3FIF A;  3RMS A;  4J9F A;  2D0Q B;  4M7D A;  2V8I A;  1OZ3 A;  4FU6 A;  4LXC A;  4Z88 A;  2VGN A;  1ZSZ C;  3CC4 A;  1WHK A;  2JXB A;  5CK9 A;  1PSE A;  4CRI A;  3QKJ A;  1SHG A;  4IUT A;  1XJW B;  1R77 A;  2K5I A;  3H9N A;  2MMP A;  2FRW A;  1AWO A;  3H8Z A;  3CME A;  2J7I A;  1E6H A;  2LT1 A;  3EGD A;  1Q82 R;  5A0G A;  2L89 A;  4MDW A;  2JM9 A;  4WF2 A;  5GAM j;  4GLM A;  5GAO p;  5GAM d;  2X3W D;  5GAO q;  2NUP A;  4XTV A;  1YI2 T;  2RQT A;  2AT1 B;  2VWF A;  5GMK m;  4AFU C;  5D6X A;  1RI9 A;  2RI5 A;  3Q1J A;  1QKW A;  3G1J A;  2PUO B;  4F17 A;  1VQL A;  2JUF A;  4C8Q B;  2K9G A;  3VS0 A;  2FZG B;  3FJP A;  4CC2 A;  2KY9 A;  5CKD A;  5GAM h;  3CPW P;  2CUD A;  1QP2 A;  1IRE B;  2FPE A;  2QQS A;  2QQR A;  4OVA A;  4BI3 A;  1SF9 A;  1Y07 A;  3CCE A;  2DZ9 A;  2DET A;  1VQO Q;  3JCM c;  2JN0 A;  1ZUY A;  2LNH B;  2J06 A;  2DKG A;  4E7S A;  4XTW A;  1VQP T;  4HVU A;  2QA4 Q;  4M78 A;  2KRS A;  1G8X A;  3INZ A;  2CKK A;  2G6F X;  4M75 G;  2KT8 A;  1FXX A;  5GAN 8;  2NUT A;  4PL6 A;  3OYL A;  3VS1 A;  1TSF A;  2FO0 A;  1VQ4 Q;  5IXB A;  1KIK A;  4MZT A;  1DJ7 B;  2KQW A;  4JDS A;  3MEU A;  1D1B A;  4OMN A;  5D6W A;  5LJ3 h;  5LJ5 h;  3VKI A;  3I55 Q;  1WLP B;  4N4H A;  1TXQ A;  3VS2 A;  3M9Q A;  4E7J A;  2C0T A;  4XU2 A;  2MCN A;  4RUG A;  1QWF A;  3CD6 Q;  2KR3 A;  1K1Z A;  3HFO A;  5LJ3 d;  5LJ5 d;  3WXM B;  2KNB B;  1OU9 A;  3L2V A;  1M1K C;  4J9G A;  2DA9 A;  3HPW A;  4ELY C;  1VQ5 T;  2C0O A;  4RTY A;  2CT3 A;  2G3R A;  4QKU A;  2K3Y A;  1KD1 C;  1X6B A;  1EIF A;  4A4G A;  2XK0 A;  1M8V A;  5CKE A;  4JRI A;  3NFC A;  1PM3 A;  3OYH A;  3M0P A;  4PJO G;  1IXD A;  5GAO r;  2RJE A;  3JB9 D;  1N9R A;  2FHD A;  1PCX A;  1ZUK A;  3OYJ A;  3FB9 A;  2XD0 A;  3MHX A;  4J9C A;  1KK7 A;  2L3P A;  4E7I A;  2OAW A;  1WI7 A;  2JW4 A;  1Y7X A;  4LDY A;  1Z9Z A;  1K8A R;  4B6M A;  2DIL A;  1I07 A;  4FYX B;  4F14 A;  1OOT A;  1RLQ C;  3LWI A;  1G3T A;  1JBM A;  2EJ9 A;  2R5M A;  2KGT A;  3QG1 A;  3CCU Q;  1YIT A;  4LE9 A;  1Q81 C;  3R6O A;  1HYO A;  1ZBX A;  1B07 A;  2K2M A;  1QVG A;  4A4E A;  4B9X A;  2HDA A;  4FIB A;  3M0S A;  1H64 1;  4C92 D;  4KH0 B;  1U5S A;  2RHU A;  2BIV A;  1Q7Y R;  4C8Q E;  3HRU A;  2RK2 A;  1SSH A;  2QQ9 A;  4PJO B;  3L1A A;  3T9N A;  4R55 A;  1M1K R;  1WNL A;  1KC8 U;  2O4X B;  2O9V A;  4BAC A;  5C0M A;  2LVM A;  5KYY A;  2DER A;  5I22 A;  1M90 C;  4F7U F;  4V2S A;  2PVD B;  1JXO A;  3I56 T;  2OTJ Q;  2DTO A;  1B34 B;  5HK3 A;  4C8Q C;  1KJW A;  3J7A F;  3CMA Q;  3M0Q A;  3QII A;  3RBB B;  1MV3 A;  4XTZ A;  1C6V X;  1YJW Q;  2FRY A;  4A54 A;  3OS0 A;  1GFC A;  4PJJ A;  3G71 Q;  4XTU A;  4F7U A;  3VRZ A;  3LH0 A;  4OGC A;  2OTL T;  3GP8 A;  3TU4 K;  3OYN A;  1UE9 A;  2JS0 A;  2XG8 D;  1JO8 A;  4XTX A;  4RG8 A;  2CS7 A;  1TTH B;  1YJW A;  3OYE A;  5A0D A;  1VQ8 A;  2LTO A;  1QVF A;  3EH2 A;  2J6O A;  4KUD K;  2Y4Y A;  3CCM Q;  2EQU A;  1QVF P;  2LC4 A;  5L8R E;  2CZ1 B;  4CI0 C;  1QVF S;  2F69 A;  1YIJ Q;  3GIB A;  2DRK A;  3OW2 A;  4M7A D;  2LCS A;  3GLX A;  2RQV A;  1N8R U;  2EYZ A;  3C4S A;  2ZPF B;  4FCY A;  2FL7 A;  1SSF A;  3FEO A;  2ZPH B;  1QW1 A;  2EJG A;  2BTT A;  4C0D C;  1I81 A;  1VQM Q;  3LGF A;  2E70 A;  2L3R A;  3X20 B;  5DY9 A;  3DLL A;  3HL8 A;  2QA4 A;  1BI3 A;  3CCU A;  1NEB A;  1YIT Q;  1IO6 A;  2A3L A;  1OPK A;  2RA2 A;  4M7D B;  1PKS A;  3NTK A;  4HKE A;  4ZGJ B;  4E6R A;  4O5V A;  2M9U A;  1MV0 B;  1QCN A;  1HK9 A;  4JLI A;  4ESR A;  2LX9 A;  1Q7Y C;  3UWN A;  2QEX T;  2HQX A;  9ATC B;  2KRN A;  5FW9 A;  2VAS A;  1VIE A;  3UT1 A;  1OUL A;  4A4H A;  4NL3 A;  1ZSZ B;  2CZ7 B;  2IIM A;  1IB8 A;  4RG2 A;  3BFM A;  4M77 B;  1KQS S;  2EGC A;  4IIM A;  3NPF A;  2LDM A;  5GAN 6;  2MOX A;  2WAC A;  2DL4 A;  4AG1 C;  2KDS A;  1GRI A;  5A2Q E;  2KRO A;  1X43 A;  2COZ A;  2BZ8 A;  2P0K A;  2H3E B;  1P92 A;  3LX7 A;  3MO8 A;  2LZ6 B;  3SWN A;  1K76 A;  1C0M A;  4OF1 A;  5LJ3 e;  5LJ5 e;  5GAN 4;  4M75 A;  3M0R A;  4E7L A;  3AT1 B;  5CO7 A;  1MMG A;  2A08 A;  4FYV B;  1NLP C;  2DFU A;  5GAN 2;  2X35 A;  2XU8 A;  1WDX A;  1AVZ C;  4M78 F;  2E6Z A;  5A0L A;  5I2M A;  5AYF A;  4JJN K;  2JT4 A;  1KD1 R;  4DOV A;  1M3C A;  2AHJ B;  2KK4 A;  4C92 A;  1VQ7 T;  4AT1 B;  2E4H A;  2I2L A;  4M75 E;  3CME T;  1BYM A;  4Z89 A;  3M4Y A;  2XDB A;  1K9M C;  1YCY A;  4Y92 A;  3NTI A;  2XHC A;  3QUI A;  5GAO n;  4RCC A;  5CQY A;  2LP5 A;  2VV5 A;  1N5Z A;  3V8L A;  1OYX A;  4J9H A;  3V8J A;  3HHT B;  2X4J A;  2O2O A;  1NJI U;  3EFS A;  2V8K A;  4ZNX A;  3TSW A;  2EW3 A;  2R5A A;  2K5F A;  3OY9 A;  1N27 A;  2COW A;  1Y96 B;  1K4U S;  4X9C A;  3E1S A;  5J3B A;  3ME9 A;  2ENM A;  1RL2 A;  4E7Z A;  2KE9 A;  4A53 A;  2PTK A;  3BDL A;  2OI3 A;  3OB9 A;  3CCQ Q;  2X3X D;  2A0F B;  3I9Q A;  3QZ9 B;  3GNG A;  3CCE Q;  1W1F A;  1WHJ A;  4M78 E;  4MZP A;  2OTL A;  1YIT T;  4EMK A;  4OGE A;  5GAN e;  3I35 A;  1M90 U;  3L2Z A;  5HKC A;  4N0A A;  4X9D A;  4CC7 A;  4KT0 E;  2YSQ A;  2IPO B;  3QYH B;  2BZX A;  3REA B;  2P0P A;  1M1K U;  2KMT A;  3A98 A;  1M27 C;  2WSC E;  2DLP A;  1KSW A;  1UGQ B;  2PUK B;  4PJO E;  4J7I A;  3OYC A;  5I2S A;  8AT1 B;  2VYT A;  3I5S A;  3CCM T;  5IHN A;  5FRN A;  4A63 B;  2XID A;  3HRS A;  5J39 A;  3OQ5 A;  2RHI A;  1OZ2 A;  1AEY A;  3EGX B;  2EYX A;  3CCV T;  2PZ1 A;  4NL2 A;  2E5Q A;  2K4Y A;  2EYY A;  2DBM A;  1QVG P;  4UC4 A;  2DPP B;  3A5Z B;  3C12 A;  2F1L A;  1LJO A;  1W70 A;  4X1V A;  1AZG B;  2C06 A;  3RNJ A;  4FT2 A;  4EMG A;  5FU6 B;  2W0Z A;  2EQK A;  1UB4 A;  1BKB A;  3JCM Q;  1ZA1 B;  4JZ4 A;  1WXB A;  3THK A;  2JTF A;  1NG2 A;  3QO3 A;  1VQM T;  2RB6 A;  1EFN A;  2D9T A;  2WSF E;  3DLM A;  4RTZ A;  1FMK A;  3QHS A;  2E5K A;  2K3X A;  1D0Y A;  2LQN A;  2E41 A;  3FRN A;  4HCB A;  3OYK A;  3P8H A;  2RI2 A;  5D7U A;  1WHM A;  3PIP A;  3RER A;  5I21 A;  2HSE B;  2D1X A;  4GLK A;  3RKW A;  2MYS A;  2DIQ A;  2DD5 A;  2VGM A;  3H41 A;  5FRO A;  4M7D G;  2F2V A;  3E9G A;  2OJ2 A;  1BU1 A;  1M8M A;  1WX6 A;  4C92 C;  3L2R A;  4J6X A;  1TU0 B;  3G6E Q;  5IXF A;  2NUZ A;  2YUO A;  4F04 B;  3MKD A;  1QWE A;  5DM7 R;  4XTY A;  2QXF A;  1JU5 C;  3GPL A;  4E7K A;  1GBR A;  2XI9 A;  3HTR A;  3U23 A;  4JZ3 A;  2JOY A;  2B8A A;  2DXC A;  3EG9 B;  2Z0W A;  1UG1 A;  4OMM A;  3A8G B;  4PFO A;  1QCO A;  1AZE A;  3CCQ A;  3CCJ A;  2DEU A;  1KG1 A;  2EPD A;  4XK8 E;  1MHN A;  1PG5 B;  2LCC A;  2LJ3 A;  5L23 A;  1M2V A;  3HRT A;  3ZEH A;  2KSS A;  2O9S A;  2CP5 A;  3M0T A;  2BE7 D;  1UHF A;  2E3H A;  1IGU A;  2K3B A;  4LUD A;  4J6W A;  1NLO C;  4KH1 B;  1MND A;  1R8O B;  2YRC A;  4AFZ C;  4M7D D;  4PJO F;  3VS4 A;  2ZPE B;  1OEB A;  4EMK B;  3L2Q A;  2ZPI B;  4EPC A;  4QQG A;  4DQ2 A;  3M53 A;  2DBK A;  2MI6 A;  4X34 A;  1VQ9 A;  2DTI A;  4QVD A;  3OYI A;  3TEE A;  5GAM g;  4RCB A;  1UEB A;  3REB B;  3VYH B;  5LJ5 g;  5LJ3 g;  3PGG A;  3M58 A;  3UPU A;  2FEI A;  3LGL A;  3RUX A;  3OMG A;  4LD9 K;  2LX7 A;  2E64 A;  1WJS A;  2YLC A;  4EMK C;  1K8A U;  3QWX X;  1MNE A;  2HAX A;  1RUW A;  1H3H A;  4L5G A;  2BE9 B;  2FB7 A;  1XTD A;  1KHC A;  2JZ2 A;  5GJV B;  1JEG A;  3QPH A;  2QDY B;  3TCJ A;  5KE2 A;  2OTJ T;  3V7S A;  4XU3 A;  4ORZ A;  1OX8 A;  1NZ9 A;  2XKO C;  2M0Y A;  2XDD A;  4C8Q G;  4C92 B;  1YJW T;  1T3L A;  1Q7Y U;  2RI3 A;  5M9O A;  3OBY A;  3VRY A;  4MZM A;  2VUB A;  4N0A C;  3I5R A;  4C5G A;  2E3I A;  4OMF B;  1EZZ B;  1VQK A;  3ZFJ A;  4M7A B;  3JCM P;  3ZL7 C;  2RF0 A;  3UAT A;  2X9H A;  1MUZ A;  1Q82 C;  4FYW B;  3FJ5 A;  3M0U A;  2M16 A;  1VQP Q;  1OQK A;  3OS2 A;  1PSF A;  1VIF A;  5FU7 B;  1WHH A;  1TS9 A;  3FLG A;  4JRQ A;  2CP2 A;  4XAX B;  6AT1 B;  2CRE A;  1GL5 A;  5KYW A;  3DB3 A;  1VQM A;  2C0I A;  1VQ4 T;  4D8K A;  4M77 A;  2DNU A;  4C92 F;  1KC8 R;  3RDV A;  2LMJ A;  4KGZ B;  3J81 E;  2HKQ B;  3CD6 T;  1WYX A;  2HSP A;  3M55 A;  4RTW A;  3GOX A;  4FT4 A;  3SDZ A;  5KH6 A;  3UF4 A;  2FPF A;  1VQ8 Q;  4C0D B;  4M7D F;  4FM4 B;  2KYM A;  1LOJ A;  1BK2 A;  4HVV A;  3JB9 H;  2Y4X A;  3EAE A;  1VQK T;  3A1P A;  3EHQ A;  4M77 C;  3KUF A;  5GAN 3;  1YIJ A;  3D7S B;  1CKB A;  2EQM A;  3G71 A;  4GBQ A;  4ZN1 A;  1YI2 A;  2RM4 A;  3CXC A;  2YDL A;  1O75 A;  2QQB A;  3O5Z A;  4JJD A;  4P5N A;  1IHW A;  1WZO A;  4PFZ A;  5GMK e;  5GAN f;  2KEA A;  1ZLM A;  7AT1 B;  1D1A A;  3CC2 A;  2NLU A;  4J5Y A;  5KYU A;  1VQ5 Q;  2L3S A;  3QDF A;  1U06 A;  1X75 C;  2GNC A;  4A4F A;  3BE3 A;  5AT1 B;  2EYQ A;  1KQS P;  1RI0 A;  3QWY A;  2QI2 A;  4KGX B;  2QGF B;  1UGP B;  2ZCF B;  2O31 A;  4C92 E;  1BIA A;  2MPX C;  2K57 A;  1K0X A;  2JTE A;  3JRZ A;  1FX7 A;  1UJ0 A;  1WGS A;  1LCK A;  3CMA A;  1MMA A;  4J7F A;  2OTJ A;  2DZC A;  2KYB A;  1AWX A;  3EG1 A;  2ATC B;  1K9A A;  2KRM A;  1VQ5 A;  2DF6 A;  2YWW A;  1Z9Q A;  1VQ7 A;  2XMF A;  3J80 E;  1WJR A;  2EQJ A;  2VVK A;  5GMK j;  3CCS A;  2JJ9 A;  1QVG S;  2VXE A;  1YHQ A;  3QBY A;  4HXJ A;  1VQO A;  4KBM B;  2CH4 W;  5KYU B;  3JCM X;  1H92 A;  1E6G A;  4J9D A;  1X2K A;  2LRQ A;  4JRK A;  4M7A F;  2PU9 B;  2K6D A;  4WCI A;  1Q81 U;  4HCK A;  1VQ6 Q;  1M9S A;  2QA4 T;  4BY6 B;  4II1 A;  8ATC B;  2X4Y A;  3NGP A;  2LQW A;  1S72 T;  2CSQ A;  3OYB A;  3MCA B;  4N4I A;  4PLL A;  2K7A A;  3JCM h;  2D6F A;  5GJW B;  1TUD A;  2P4T A;  4LUE A;  4PJO A;  2RNA A;  3G4S A;  4M7D E;  1UGR B;  2ROL A;  4MDX A;  1LNX A;  3BW1 A;  2EQI A;  5LJ3 j;  5LJ5 j;  2A28 A;  4C5H A;  3TSZ A;  3L42 A;  1U1S A;  1KD1 U;  1YHQ T;  2RJC A;  2DJQ A;  2QAS A;  1V76 A;  4QVC A;  1SG5 A;  4M78 C;  1WQ7 A;  1KFZ A;  3BDU A;  3RR6 A;  1BCM A;  2MAM A;  1RAE B;  1Q86 C;  1M30 A;  1GCQ C;  2HQE A;  3M4G A;  1C1A A;  3V7R A;  4QQD A;  1JJ2 A;  2DD4 A;  2HKN A;  4CC4 B;  2A36 A;  3URG A;  1UEC A;  4EMH A;  3O8V A;  2VXF A;  1ZHI A;  3MP6 A;  4QVZ A;  4E2F B;  3UA6 A;  3ER0 A;  3CCR T;  3ULR B;  1VQ4 A;  1RAC B;  3VUZ A;  3DKM A;  1RAG B;  4L59 A;  1I8F A;  4BUG A;  4ELZ C;  1WHL A;  1KQ2 A;  2GFA A;  3JCM e;  3OW2 P;  3VS6 A;  1GCP A;  1GCQ A;  2RPN A;  2YHT A;  4FW2 A;  3TVT A;  2F2W A;  1QCF A;  1R0C B;  3PTA A;  3EFO B;  3CCV A;  2DTH A;  2KT1 A;  2M0O A;  2SEM A;  2PNI A;  3KXT A;  2M51 A;  5GAN 7;  1UUE A;  3OYG A;  4RKU E;  5DLO A;  4J83 A;  4QQ6 A;  1SRM A;  4M78 D;  4J9I A;  3JSC A;  1PRM C;  3DB4 A;  4JS4 A;  1ZUU A;  3VYG A;  1K9M U;  2QEX Q;  2COY A;  4LNP A;  1U8R A;  2DX1 A;  4MMK A;  5GAM f;  1U1T A;  1SPK A;  2DK3 A;  3OA6 A;  1RAI B;  4KGV B;  3CBP A;  1YNZ A;  3JV3 A;  1YN8 A;  2K2V A;  1K73 U;  2L2P A;  2RHZ A;  3OYD A;  1SKU B;  2DIG A;  2RHX A;  4FSX A;  1Q81 R;  2DL5 A;  5HCK A;  5CR2 A;  1TH7 A;  2HL5 C;  1KQS A;  1PRL C;  4RTV A;  2KVQ G;  1K73 C;  1UTI A;  4BE1 A;  1UGS B;  2NUT B;  2V1R A;  2ZGW A;  2NWM A;  1G3Y A;  1R0B G;  3JCM b;  3EFR A;  2W10 A;  4M75 D;  3X25 B;  4BD3 A;  1TG0 A;  1BI1 A;  1PKT A;  1YP5 A;  4FW1 A;  4PKC C;  1YJ9 A;  4M77 G;  4KUI A;  3KBG A;  2RJD A;  3JCM g;  2DO3 A;  2BUD A;  3CME Q;  1TWB A;  3PFS A;  1IHV A;  4BY6 C;  1NPR A;  1TOV A;  4DEY A;  2GTO A;  5FU6 C;  3CC2 T;  2EJF A;  1X01 A;  1N6A A;  4R0K A;  3E2U A;  2QAZ A;  1X69 A;  1D09 B;  4B9W A;  2CZ0 B;  4Q5W A;  3KFV A;  3OMC A;  3VS7 A;  1BBZ A;  4C8Q A;  5GMK i;  3F70 A;  1FMV A;  3OW2 S;  4M7A G;  2O01 E;  1W2B S;  2LNV A;  3EH1 A;  1EX4 A;  3HSB A;  3CCL Q;  1LVK A;  1VUB A;  1JRI A;  2NUP B;  4NOY A;  5DLQ E;  1SHF A;  4FL6 A;  1VYV A;  1Q82 U;  1V1C A;  1I5L A;  4OMP A;  1BI0 A;  2DJZ A;  2KAF A;  1X6G A;  1Y96 A;  2LCL A;  2AZV A;  1VYU A;  2EGA A;  4E47 A;  2ED1 A;  2PVO B;  3CCL T;  1M1F A;  3NTH A;  3JCM d;  3I56 A;  3OSS C;  4KRT A;  2VB6 A;  5HK0 A;  1M3A A;  4XU1 A;  2MIO A;  3M57 A;  1N8R R;  1CKA A;  1XQH A;  2ZAE A;  1XOV A;  4C5E A;  3EFO A;  1BCO A;  5C6S A;  3NHN A;  3MEA A;  2HBW A;  2AK5 A;  3AHU A;  2R57 A;  5D6Y A;  2EFI A;  2XDP A;  4M4Z A;  2V26 A;  4J9E A;  4O6J A;  4BI8 B;  3L2U A;  4C8Q D;  1M4Z A;  4TVR A;  3JB9 G;  3RIR A;  5CAI A;  5FWB A;  1D1C A;  2LT4 A;  1K9M R;  3PT9 A;  1UFF A;  2QYZ A;  1NJI R;  3MP1 A;  4JJB A;  3H0H A;  1MMD A;  1O9S A;  3CBO A;  4DEX A;  5CQX A;  1G5V A;  1GBQ A;  2YRD A;  3X26 B;  1PC0 A;  1YCS B;  2D8H A;  1FYN A;  3EG3 A;  2EVR A;  1D0X A;  2YUN A;  3CCU T;  3CPF A;  4M75 B;  2NYS A;  3CQT A;  1UGV A;  1U3O A;  1Y71 A;  3SWN B;  4F7U E;  3WVE B;  3NMZ C;  1VQ6 T;  3S3M A;  1Q86 U;  2CP3 A;  2BKD N;  2DYB A;  4ZGE B;  2EKH A;  3X28 B;  3I56 Q;  4PJO D;  1YIJ T;  1D3B A;  2XIC A;  1YJN A;  1QLY A;  1G2B A;  1WPY A;  1A0N B;  4M7A C;  1ZSZ A;  4VUB A;  4AMC A;  1AT1 B;  1NE8 A;  2WSE E;  4NS5 A;  3MET A;  5FWC A;  3A8L B;  4IUU A;  4RTX A;  5CIU A;  1W6X A;  2QTX A;  1K0S A;  2OX7 A;  1VQN A;  5LJ3 f;  5LJ5 f;  3JB9 F;  3PMT A;  2HD0 A;  1RAA B;  2DM1 A;  1OV3 A;  3E9F A;  4LDW A;  1D0Z A;  1Y0M A;  2EBP A;  3HFN A;  4FYY B;  5GAN j;  5IH2 A;  4AFS C;  3L2W A;  4F16 A;  2D0N A;  2CZ6 B;  1QP3 A;  4XQ3 A;  5IAY A;  1G3W A;  1SRL A;  1M1G A;  3JCM W;  4M75 F;  3PMI A;  4Z02 A;  4LDX A;  4GY5 A;  3C95 A;  3G4S Q;  2VC8 A;  3N5B B;  2E10 A;  1S72 Q;  1XNI A;  1RAF B;  5KYN A;  4BI4 A;  2CDT A;  2CSI A;  1I5O B;  2RJF A;  3LH5 A;  5GAO m;  2RO0 A;  3CBM A;  4M77 F;  2CGH A;  1J3T A;  3MEV A;  5IT9 E;  3CEY A;  3QSU A;  2DRM A;  2FPD A;  4OB3 B;  2FZK B;  1YBY A;  4BDY A;  2MWP A;  1VQ6 A;  4C0Z A;  1AWJ A;  2D8J A;  2OAU A;  4JLG A;  2AKK A;  2FVU A;  4DBF A;  5IHI A;  2HEQ A;  2O88 A;  3JCM f;  1LPL A;  4ZGD B;  5J26 A;  4OP0 A;  1VOM A;  2LJ1 A;  2GFU A;  3OYM A;  2IG0 A;  1VA7 A;  3H0F A;  1HJD A;  2E65 A;  3OS1 A;  4M78 G;  2YXY A;  3VJP A;  3C94 A;  1GXI E;  4MML A;  1I0C A;  4BE2 A;  5KCO A;  2K5L A;  1YHQ Q;  1PWT A;  3CCM A;  4BE0 A;  2DEQ A;  3CCS Q;  3FC3 A;  2K79 A;  2JM8 A;  2QEX A;  4ZTF A;  1VQ7 Q;  3EGU A;  2CP0 A;  2CT4 A;  4RTT A;  2KXC A;  2QGG A;  1B3Q A;  2E6N A;  1IRX A;  2HMA A;  3OYA A;  1B34 A;  1VQL T;  5GAN 5;  1WJQ A;  2GCX A;  5GAN g;  2ECZ A;  3CCV Q;  3CCS T;  2CYZ B;  3S3N A;  4D8D A;  4FSS A;  5KYY B;  2HL3 A;  4M7D C;  2V8J A;  1I1J A;  2KBT A;  1UJY A;  2O4X A;  3CXC P;  2RD1 A;  1NEG A;  3OYF A;  2HZY A;  2CP6 A;  2A7Y A;  2RHY A;  3OS5 A;  2LJ0 A;  4J6Y A;  3S3O A;  2ED0 A;  3WVD B;  1QMC A;  2E1H A;  2HQH A;  3CC2 Q;  3SD4 A;  2ZZD A;  2GBQ A;  4HCZ A;  4OB0 B;  5HY6 A;  1H8K A;  4OMQ A;  3CC4 T;  5KYW B;  4C92 G;  2X51 A;  2CH4 A;  3JCM J;  1B7T A;  2J05 A;  2QDL A;  3QXE B;  3JB9 I;  1ARK A;  2AKL A;  2J6F A;  1WXU A;  3CC7 A;  2H8H A;  3QZ5 B;  2QK0 A;  3M59 A;  4QW2 A;  3VUB A;  4EDU A;  5GAN h;  3X24 B;  1S1N A;  1PD0 A;  3RES A;  3PIO A;  2RQU A;  2AZS A;  4M7A A;  2F2X A;  4JJC A;  1JJ2 P;  1JXM A;  2RQW A;  4J8O A;  4DBH A;  3G71 T;  3GBQ A;  1TUG B;  2ZPG B;  5FU7 C;  1YJ9 T;  1MMN A;  1K73 R;  2LQK A;  4F7U B;  3CCJ T;  1ZX6 A;  1UHC A;  4PJO C;  1ZBJ A;  2VKN A;  2I0N A;  2YT6 A;  1BB9 A;  1HXD A;  4ANJ A;  5CVI A;  1X2Q A;  4RTU A;  1TUC A;  3S6W A;  1K8A C;  4IUP A;  4PFP A;  1NJI C;  1T3S A;  3SWN C;  3CCR Q;  4Y28 E;  4DBQ A;  5FLX E;  1WFW A;  3LLR A;  3CCR A;  4DA4 A;  5LL6 S;  3QJ6 A;  1FMW A;  1ABQ A;  1PHT A;  1VQN T;  1AHJ B;  3UA7 A;  3CCQ T;  3M54 A;  1VQK Q;  4IUV A;  2EIF A;  3LW5 E;  3CCE T;  3CC7 Q;  2A37 A;  3PE0 A;  3MEW A;  2KI7 A;  3EG2 A;  2MWO A;  3M56 A;  3G4S T;  2RMO A;  2F5K A;  1Q95 G;  1NM7 A;  2R58 A;  1PNJ A;  1VQP A;  1MGQ A;  3JCM V;  2EYW A;  3LYI A;  1HSQ A;  3GF5 A;  4M77 E;  1ZSG A;  4ME7 A;  3RMQ A;  3M5A A;  2MK5 A;  3GNF B;  2DAQ A;  5CKF A;  4PNO A;  2DXT A;  3IQL A;  5KE3 A;  1F1B B;  4HCC A;  3PNW C;  5I11 A;  3P8D A;  1W4S A;  2GF7 A;  2V1Q A;  3SFM A;  2M1H A;  5FRM A;  4M75 C;  5GAO l;  3MJX A;  1N9S A;  4DBR A;  4OB2 B;  4Z8A A;  2GGR A;  1M2V B;  2QTV A;  4EIK A;  4M78 B;  1IGQ A;  2Y90 A;  4YTL A;  2CP7 A;  3OYY A;  1FWZ A;  5GAM e;  3VV0 A;  1WIE A;  4L6V 5;  2JTM A;  4E7H A;  3LWH A;  1ABO A;  2DVE A;  4OMO A;  3MP8 A;  4BB7 A;  2HCK A;  1T0H A;  3EG9 A;  1PD1 A;  2J6K A;  1IZ6 A;  1CSK A;  3H0I A;  2PQW A;  4F7U G;  1JB0 E;  1G83 A;  2B86 A;  3QJY A;  1YI2 Q;  2RH2 A;  1W2B P;  3CD6 A;  4DOW A;  4ZTJ A;  1VYT A;  2GTJ A;  4IUR A;  1WA7 A;  1YFN A;  4HT9 A;  2X4W A;  2F5T X;  4PLI A;  1YWO A;  4RMO A;  2DYI A;  1ACM B;  1M5Q 1;  3H6Z A;  3V7C A;  2ROT A;  4CC3 A;  1BI2 A;  3EHR A;  4JRP A;  3I55 A;  2RN8 A;  3RKY A;  5CKB A;  5CCA A;  2BZY A;  3CCJ Q;  2L0A A;  2EGE A; 
#chains in the Genus database with same CATH homology
 1VQN Q;  1VQL Q;  3CPW P;  3CCV Q;  1YHQ Q;  1VQM Q;  1VQK Q;  1YI2 Q;  3CC2 Q;  3I56 Q;  3CCQ Q;  1QVG P;  1KD1 R;  3G6E Q;  3OW2 P;  1VQ5 Q;  3CCS Q;  1W2B P;  1Q81 R;  3CC7 Q;  3CMA Q;  2QEX Q;  3CCU Q;  3CCE Q;  1M1K R;  3G4S Q;  1YIT Q;  1KC8 R;  1YJW Q;  1S72 Q;  1KQS P;  2OTJ Q;  1VQO Q;  1Q7Y R;  1JJ2 P;  1VQ4 Q;  3CCL Q;  3CC4 Q;  1VQ7 Q;  3CD6 Q;  3CCR Q;  1K9M R;  3CME Q;  3CXC P;  1M90 R;  3CCM Q;  1VQP Q;  3G71 Q;  1K8A R;  2OTL Q;  1N8R R;  1NJI R;  1K73 R;  1YJ9 Q;  1QVF P;  1VQ8 Q;  1Q82 R;  1Q86 R;  3CCJ Q;  2QA4 Q;  1YJN Q;  1VQ6 Q;  1VQ9 Q;  1YIJ Q;  3I55 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...