1YJWQ

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yjwQ00
1W2BP 3CCQQ 1YIJQ 1VQOQ 3CC7Q 1VQMQ 1YHQQ 3CPWP 3CCRQ 1Q7YR 3CCLQ 2QEXQ 1VQLQ 3CMAQ 1VQNQ 3I56Q 1KQSP 3G6EQ 1Q81R 1K8AR 1YJWQ 1QVGP 3CMEQ 1Q82R 1Q86R 3CXCP 1YJ9Q 2QA4Q 1K9MR 3CC4Q 1VQKQ 3CCJQ 1S72Q 2OTJQ 1KC8R 1VQPQ 2OTLQ 3OW2P 1QVFP 1N8RR 3CD6Q 1YITQ 1VQ5Q 3CCSQ 1YI2Q 1K73R 1VQ8Q 3CC2Q 3I55Q 1YJNQ 1NJIR 1KD1R 1VQ9Q 1M1KR 1M90R 3CCEQ 3G71Q 1VQ4Q 3CCVQ 3CCUQ 1VQ6Q 1JJ2P 1VQ7Q 3CCMQ 3G4SQ
chains in the Genus database with same CATH superfamily
2DXCA 1UJYA 1VQ7A 1GCQC 2YSQA 5D7UA 5GAN6 2GNCA 5I2MA 2KNBB 3LH5A 1X2QA 3E2UA 1ZA2B 5IXFA 3CCJQ 2OTJQ 5KYUA 2L0AA 1NJIR 1NLOC 2RQUA 1BCMA 3PE0A 1VQ5A 5CAIA 3QIIA 1YJNA 4MZMA 4PFZA 4DBHA 1AD5A 1GRIA 3OSVA 3D7SB 3BDUA 4ZNXA 4QW2A 2X4YA 2MWOA 4E7SA 1K73U 3HP9A 4IIOA 4M7DC 2ZPGB 4FW1A 2W10A 1K73C 5CQXA 1TU0B 1G3SA 1UHFA 1WYXA 2K5IA 1VQ7Q 1JEGA 1N9RA 3OMCA 5LJ3e 1OV3A 5CR2A 3OYKA 4J9IA 4M78G 1SSHA 5GAMe 4DA4A 4M7AA 3OS2A 4HCCA 4MZTA 3MKDA 3VS0A 4A54A 3U23A 4C92C 4XTUA 2SRCA 4EMKB 1VQ5Q 1U1TA 1YJNQ 3CD6A 4KGZB 2E64A 2DKGA 2A3LA 2M9UA 1FXXA 1Y96A 4ELZC 2JTMA 1ZQ1A 1YHQT 2L3QA 5GJWB 1YIJA 2YUPA 2RQWA 4BUGA 2BTTA 4XU3A 3TQ7P 2E41A 2HMAA 4DBFA 2RMOA 5IT9E 1UHCA 2LX9A 2X4JA 3UA7A 3C4SA 3AHUA 4PL6A 2R5AA 4N4HA 4DBRA 1FYNA 4C0DB 1QCNA 1WHGA 4LDYA 4JRQA 1NG2A 3META 2L3PA 3PT9A 4PJOD 3VS3A 2DLPA 3CD6Q 4FW2A 4ZN3A 1KHCA 3CCVT 3SB2A 1NE8A 2LCCA 4XU1A 2XD0A 2PUKB 4F7UA 4OB0B 3FDRA 3X25B 3DLLA 2LTOA 3RNJA 2LNVA 1PRMC 1YBYA 1N8RU 3RDVA 7AT1B 1IZ6A 4J9CA 4ATOA 5KE3A 5KCHA 2HBWA 4MMKA 3REBB 2EQIA 3KBGA 1N8RC 4CC3A 5LL6S 1QQJA 1MUZA 3QKJA 4M7DE 2EYYA 2KAFA 3AT1B 2F1LA 4DOWA 4BDYA 2XK0A 2AK5A 2FVUA 3INZA 4E6RA 4PJOC 1K9MU 2HDAA 1YHQA 4IKFA 2V8IA 3OYLA 2A0FB 2KXCA 2LQNA 1VQKT 2O4XA 3A8GB 2DIGA 2X3WD 5GMKh 1K9MC 3I55T 3M55A 4JS4A 4RCBA 4C5GA 4C92E 4A53A 3OW2S 2ZGWA 4EPCA 3VUZA 3JCMh 2CT3A 4F17A 1YCYA 2ROTA 1AT1B 2YXYA 1WFWA 1NPRA 1XNIA 2QQSA 3JCMg 5I22A 1S72T 1Y0MA 4MMLA 1ZUYA 1KJWA 5J26A 3VU3C 3T9NA 3CBPA 2NUTB 2VKNA 2EKOA 4A4GA 2BKDN 4JRIA 3REAB 1N6AA 1Q82U 4RKUE 3CCVA 2DXUA 2DYIA 3OYGA 2KYBA 1YHQQ 2QQBA 4FYWB 2DERA 2AZVA 4LDWA 2VGNA 1Q82C 2KEAA 2VB6A 4ELYC 1ZSZC 1YITT 1IREB 2DZ9A 2H3EB 4C8QA 2K3XA 5GAN5 3FJ5A 1VYVA 1ZX6A 5HCKA 5GAN8 4EMKC 3QWYA 1JXOA 3RUXA 3H8ZA 4QVCA 2JVVA 2DL7A 3SD4A 1TWBA 8ATCB 3HHTB 2KE9A 1WJQA 1VQPT 1SF9A 3QXEB 2R58A 2JUFA 4M77E 4FYVB 1B3QA 4AFQC 4XK8E 2RHXA 3CCVQ 2RF0A 5IAYA 2MAMA 1PWTA 3QYHB 3CCLT 4B9WA 4C0DC 2K4YA 1Q81C 2ED1A 5CO7A 2ROLA 2ZPFB 3OYDA 4PJOE 3NTHA 1BIAA 3CCET 2SEMA 1LCKA 1VQ9A 4KRTA 3OB9A 2DFUA 4DEYA 1NYGA 3JCMc 4FSXA 4JS5A 2VC8A 2LJ0A 4M7AB 5GAMf 2C0TA 3M58A 1KHIA 3JRZA 5KE2A 4QQ6A 1U1SA 3EG9A 3CC2T 3V7SA 1G3WA 2COYA 2NWMA 2DBKA 3L2RA 2DETA 3OW2A 1TH7A 4M75A 1K8AU 1Q86U 3E19A 3S3MA 2FB7A 3MCAB 3A1PA 2PQWA 1K8AC 2GFAA 1Q86C 1QKXA 2K6DA 4J9BA 4F04B 5I11A 3LLRA 2HEQA 3BE3A 2HL5C 1NBEB 3HTRA 5FLXE 1I5OB 2HKNA 3OBWA 2A7YA 2HQEA 2MK5A 2RI3A 3RKXA 2KYMA 3OA6A 1M3BA 1I8FA 2LCLA 1TG0A 2RNAA 4RG2A 1Q82R 3EG3A 3LGFA 1QWEA 4MDXA 5LJ5e 4LNPA 3R6NA 3HL8A 2PVGB 1BBZA 1JBMA 3MJXA 3TSZA 1XOVA 4PKCC 3SHWA 3SWNB 4LD9K 2KVQG 1K0XA 3VS2A 1E6HA 2L5QA 4JZ4A 1V1CA 1D3BA 1DJ7B 2QGFB 2LT4A 4X1VA 5GMKm 4HVWA 4M78A 2K3BA 4PLIA 1C0MA 2BUDA 2DA9A 2VV5A 2DTOA 1NPPA 2KRMA 4N0AC 2RI5A 3LW5E 3TREA 1SEMA 1GL5A 1W4SA 3SFMA 2ZPEB 1KC8U 1M2VA 3UT1A 5M9OA 2KROA 4LN2A 1IO6A 5IH2A 5DLQE 2RH2A 3M0RA 2L8DA 1Z9ZA 1IRXA 4M7DF 3DKMA 2CP3A 4C0GA 4OGEA 1WXBA 3MO8A 5CQYA 4ZN1A 1OOTA 3QUIA 3OYCA 2M0YA 1QP2A 1E6GA 2R57A 3I56T 1K9AA 4BB7A 1KFZA 2H8HA 1I0CA 1NJIU 3H9NA 3ER0A 1YJWA 5CCAA 4X9CA 4ME7A 1BI0A 2AIRB 4R56A 1GFCA 4XU2A 1NJIC 2EVRA 4QQDA 3JB9J 3O8VA 2GGRA 4C92F 3ULRB 4KT0E 3PIOA 1SSFA 2DK3A 2E5KA 3MEAA 4M7AC 3JCMJ 3ME9A 1G5VA 3HRSA 1HD3A 3WVEB 1TUCA 2C06A 1M1GA 2O2OA 3CQTA 3WVDB 2M0OA 2J6KA 5A0GA 2JJ9A 4J9HA 2X3XD 4ZTJA 3UA6A 2NYSA 1TXQA 1VQOT 3QG1A 2JM8A 1T0JA 5CKEA 2A28A 5KYWA 4OMOA 5ECAA 1OPLA 1W70A 1AHJB 2E6ZA 1X6GA 3M0QA 1YJWQ 1VQLA 3EFSA 5GAOp 1ZUKA 4YTLA 3TCJA 3QYGB 1XTDA 3PMIA 4E7HA 2DL5A 5KYXA 1SHGA 4E47A 1CKBA 1JXMA 2XDDA 2OJ2A 3RKYA 1UECA 3MHXA 4QVZA 3UDCA 1D1AA 2EGCA 1KSWA 2IG0A 2EW3A 3EFOB 5GMKj 3I56A 3GNGA 2JS2A 3L2ZA 2FHDA 2P0KA 1PG5B 5FWBA 3P8DA 2FO0A 2LJ3A 3A5ZB 1OX8A 4XTYA 3CCJA 2OTJA 2KK4A 2J7IA 4M77F 2GBQA 1M4ZA 2KRNA 4Y28E 5FRMA 3WXMB 1UJ0A 1G2BA 4J6YA 3SWNC 1WNLA 1RI0A 4M77B 3EG9B 4OB1B 1BKBA 1KC8R 5KCOA 1QKWA 4PJOF 3QDFA 3RKWA 1EZZB 1PKSA 4XTZA 1UGPB 1KK7A 3VS1A 1N9SA 2D0QB 2YUNA 1QLYA 1X6BA 4GLKA 2LC4A 2PNIA 3UWNA 3I56Q 4FM4B 3L2UA 5A0LA 3FC3A 1QMCA 3JAME 4Z88A 3EH1A 4M7AE 1WXTA 1ABOA 1AZGB 2QYZA 5GAMh 4C92D 2VGMA 5GAMg 2QGGA 3FLGA 3G6ET 2XDBA 2QDYB 3A98A 5LJ5f 1GBQA 1I4K1 1RADB 3CC4T 1MHNA 4Y92A 1D0YA 1OU9A 2ZAEA 2CT4A 1TS9A 1WZOA 1WHMA 2EYWA 3VS6A 3NHNA 1OI1A 4AMCA 1VQ4T 2X9HA 3VS7A 1K76A 2RO0A 4ESRA 3FB9A 2ENMA 1RI9A 2VASA 1UB4A 2EGAA 2QG9B 2K5LA 3C12A 2MPXC 1ZSZB 2YWWA 2M1HA 4M78B 4C8QC 5D6XA 2LQKA 4RTXA 3M56A 4KUIA 4LDUA 2EJ9A 3CCSA 2GQIA 1NM7A 3QZ9B 2K2VA 1BU1A 1I81A 1YP5A 2QXFA 4FSSA 4IUUA 4FIBA 4LDVA 4F7UE 1AOJA 2VXFA 3GOXA 4DEXA 4Q5WA 1LPLA 2D8HA 3MEWA 5J39A 1O9SA 2D9TA 2HZYA 3H0FA 1M5Q1 5GANd 4LUEA 4C0ZA 2VWFA 3GF5A 1B34B 2CKKA 4M77D 3CCMT 4NL3A 2J05A 2F2XA 3FJPA 3M57A 1D09B 1BI3A 2PUOB 2L3SA 2JZ2A 2WSFE 3VYGA 3G6EA 3BW1A 2V26A 3A8MB 1EX4A 2X4WA 4XQ3A 3BY7A 3CCSQ 3HRTA 3JCMd 2CSQA 3VYHB 2DF6A 4PJOB 2DX1A 1VQ4A 5EC7A 3MPUB 4JRKA 4OMLA 3HSBA 1MMAA 2CH4W 2E5QA 2BZ8A 1GXIE 1OZ3A 2A37A 1UGRB 4M77C 2CZ6B 1C1AA 4E2FB 3EAEA 4LXCA 2QQAA 1H8KA 2E3HA 2OI3A 3DLMA 1I07A 4E7IA 4RTYA 1M90R 4M75C 4JUVA 2CREA 3OYNA 3L2WA 3PFSA 3G6EQ 1JB0E 1YJ9T 4MDWA 2DL8A 5KYXB 1ZA1B 3CC4Q 2RM4A 5CKBA 4XTWA 2KRSA 3NTIA 4K11A 4KGVB 1MV3A 4EMGA 1BB9A 1MMDA 4CC2A 1VQ4Q 5C6SA 1WQWA 2HSPA 1JJ2P 4C8QE 1MV0B 1GCQA 3CCRT 3ZBDA 1JU5C 2JMAA 5HKCA 3TEEA 3EG0A 4WCIA 1FMWA 2P84A 2W0ZA 3EH2A 4E7KA 4C0FA 2O9VA 2P4TA 1WX6A 3LGLA 1VYTA 4OGCA 1TUGB 2A36A 3EHRA 1TTHB 1TSFA 1AWWA 5L23A 4V2SA 1PCXA 3A8LB 3GPLA 4CRIA 4JJBA 4M7DA 4Z89A 1Y57A 4BE0A 4D8KA 5GANe 3CXCS 3KUFA 3L2VA 1PM3A 1YI2T 2PVOB 2RJDA 4M78C 3IQLA 1KD1R 2NUPB 4CC7A 3G4ST 1MMNA 3CC7T 2F2VA 1VQMT 1X2KA 2DJQA 1G3TA 2EYQA 1KG1A 2QQ9A 4WF2A 1Y7XA 2JXBA 3QBYA 1AVZC 3QDRB 2QA4T 4P5NA 4RUGA 5CKFA 1UG1A 3PMTA 1XQHA 4QT7A 5KYUB 1QVPA 5HK0A 2D8JA 3MP1A 2EAYA 1VQKA 5DLOA 2AHJB 4J83A 3I55A 2EQUA 3SDZA 4OMPA 4BY6B 1NYFA 3CMAT 1T3LA 4OP0A 4ANJA 4EMHA 4IURA 4M75E 4PK4A 5CVIA 3CXCP 2EJGA 1IHVA 2KMTA 3MEVA 5L8RE 1S72A 1D1CA 3UF4A 8AT1B 2XICA 4M7AF 1WJSA 2EGEA 1W2BP 1KQ1A 4IIMA 5LJ3f 2QEXT 5GAOm 1S1NA 1WHLA 3VS5A 3UATA 2LT1A 2QI2A 1D1BA 4OMNA 1YJ9Q 1OPKA 1ZUUA 1VQKQ 3VJPA 1M3AA 1WHHA 3JB9H 3RMQA 3I55Q 1NLPC 2E12A 1RUWA 3H6ZA 4J6XA 1YITA 1Y96B 5J3BA 1YI2A 3RERA 1BYMA 5LJ5h 4NS5A 1ARKA 3G4SA 2O01E 2FPFA 5CK9A 5LJ5g 2BIVA 1R0CB 3LX7A 2MOXA 2ATCB 2LQWA 2AKLA 3O5ZA 4HCKA 1K4US 2K3YA 2CP6A 2CZ7B 5HK3A 4ZGDB 4DOVA 1S72Q 2P4RA 1LJOA 1PKTA 3OSSC 1VQPA 2PZ1A 1RAAB 2CDTA 1QVFS 3M4GA 3OY9A 5IHNA 9ATCB 2VXEA 4M78E 4PJOA 2RHZA 2ZPIB 1H641 4B6MA 2CP2A 5EG2A 3CCLA 2FG0A 3CMAA 3LWIA 5GAOn 1D0XA 2FPEA 1FMVA 2LRQA 1ABQA 3CXCA 6AT1B 4JZ3A 1YITQ 1YI2Q 1X27A 2DO3A 5GAMj 1RAFB 1G83A 3FRNA 4F7UB 4J6WA 2KR3A 3QSUA 3CCEA 3G4SQ 5D6YA 2FYKA 2F5TX 2ZCFB 2FZCB 2DZCA 1UUEA 2QTXA 3MEUA 3LYIA 2QA4Q 1NEBA 1UGVA 4N4GA 1H3HA 4PJLA 5CKHA 4FU6A 1VQPQ 1QVFP 5FU6B 1YN8A 2HSEB 1VQ6T 3L2QA 4J9GA 3G71T 4A4EA 3CC2A 4BI3A 3LH0A 2YT6A 2X35A 3M0TA 3CCLQ 3CMAQ 2M51A 2O4XB 2CUDA 3NFCA 1PSEA 2GFUA 3EHQA 3HFNA 2GQVA 2OTLT 4HT8A 5C0MA 2QTVA 1KC8C 2HNIA 5IXBA 4JJNK 4M7AD 3CCUT 2HQXA 3CCEQ 2E10A 2CP5A 1F1BB 1ZHIA 2AZSA 2R5MA 1VOMA 4HCBA 2QEXQ 4BY6C 3HKSA 3RESA 3CMET 1OU8A 3ASKA 4GLMA 2K2MA 2DJZA 3PNWC 3NGPA 4PNOA 2ZPBB 2JOYA 4II1A 3CC2Q 2D1XA 2OAWA 2LX7A 4XTVA 2DTHA 4ZGEB 3J80E 4M7DG 2ECZA 4C8QF 4R55A 2JNGA 3JCMX 2ZPHB 2IVWA 3V7CA 5HY6A 3ZEHA 1Y07A 5GANf 2J6OA 2JTFA 2MYSA 4C8QB 2HAXA 2RI2A 4JRPA 3PVQA 2CP0A 2P0PA 2XKOC 2JN0A 1U5SA 1QVFA 1M9SA 2J6FA 2VYTA 4C92G 1R77A 2DD4A 3DB3A 4A4FA 4A63B 2RHUA 3X26B 3EGDA 1I1JA 4TVRA 2WSCE 4A4KA 4B9XA 3EGXA 2K5FA 3OMGA 1VQ7T 4RTTA 4KUDK 4C5EA 2F2WA 2CSIA 3THKA 1Z9QA 3SEMA 3CCUA 1KQ2A 2RB6A 4PJMA 3ZL7C 2KY9A 5IN1A 5GJVB 2CZ0B 4RG8A 2B86A 1ZLMA 4Z8AA 1D0ZA 5GAMd 1VQ5T 3QJ6A 4IUPA 3JB9F 1AWOA 4OMFB 2G3RA 4J9DA 1VUBA 2LQ8A 2XIDA 2QDLA 3G71Q 3M4YA 4PFOA 1EFNA 2PTKA 5GAOq 3QZ5B 1ZBJA 5GMKi 2DEQA 2D6FA 4M75F 4BE1A 1WJRA 5I2SA 2OTLQ 2DAQA 1VQ8T 3G7ZA 1M1FA 3L1AA 4HVVA 4IUTA 3TSWA 2NUTA 5FU6C 4M75B 3CCUQ 4N4IA 1X01A 1EIFA 1WXUA 2YRCA 2Z0WA 1G3YA 5DM7R 4M77G 3CBOA 4CI0C 2DRKA 2FZKB 2BZYA 1R0BG 3I5RA 1VQOA 2KT8A 2ESWA 4UC4A 1OULA 3CMEQ 4IUVA 4OMQA 1AWXA 3CD6T 4JLGA 4AG2C 3PVLA 3R6OA 3JCMb 1M90U 3S3OA 5LJ3h 4PJOG 3I9QA 3RBBB 5LJ3g 3M53A 4N0AA 1YIJT 1HK9A 1M90C 4D6WA 3M5AA 4C8QD 1YNZA 5GAOl 3E9FA 1UGQB 5KYNA 4AT1B 4MZPA 1QP3A 4FL6A 3M0PA 1ZSGA 2HCKA 1IGQA 2EKHA 3M0UA 1AZEA 2M02A 1SG5A 2E65A 2EIFA 1HJDA 4VUBA 1Q7YU 1PC0A 3QWXX 2L89A 1VQOQ 2GTJA 1Q7YC 1UFFA 4AG1C 1QVGS 2YLCA 4M78F 2QK0A 2O9SA 4EIKA 1D3BB 2YRDA 2ABLA 1UE9A 1FMKA 2K7AA 3OYHA 1B7TA 1PRLC 1VA7A 2NUZA 3QO3A 3PTAA 2YUQA 3LWHA 2JW4A 1VQ8A 1UGSB 2COZA 3GBQA 2QQRA 4JPBW 2BZXA 1M2VB 2LZ6B 1MGQA 1YFNA 2DYBA 2L2PA 1WA7A 1CKAA 3OBYA 1MNDA 3OYBA 3NPFA 2Y4XA 1KD1U 4HVUA 1X75C 1LNXA 3VUBA 3JB9D 1WGSA 2CUBA 1YWOA 1KD1C 3E1SA 2K79A 5LJ5j 1QVGP 2QASA 2M16A 1HXDA 4O6JA 1UTIA 2FRWA 3OS0A 4X9DA 4FT4A 1E7OA 1M8VA 1WDXA 1TOVA 4M75D 1M1KU 1V76A 3VRYA 2RJEA 2HKQB 4HCZA 5GMKl 5GAOr 4AFZC 2AKKA 3EFRA 1RAIB 1VQ8Q 3CC4A 1M1KC 5IHKA 4JJDA 1LOJA 2EYXA 3CCQT 1WLPB 1JO8A 1JJ2S 4Z02A 3X20B 4XU0A 3I5SA 3JV3A 1BIBA 1AWJA 4KH0B 2D0NA 1YCSB 4R0KA 4BI4A 2EJFA 2CH4A 1U8RA 3ZFJA 2RQVA 2E70A 3GLXA 3X24B 2EWNA 2OAUA 2RQTA 5KYWB 2KQWA 1YIJQ 1WHJA 1U06A 3H41A 2JS0A 1SKUB 1M3CA 3SWNA 2DM1A 3EGDB 4HA8A 1T3SA 2O88A 3EGXB 2RPNA 2LVMA 1CSKA 2YRVA 2P0QA 1X6OA 2FZGB 4OMMA 2L3RA 2KBTA 3DB4A 1NEGA 4J8OA 1W1FA 2NLUA 5GAN7 2CGHA 1C6VX 1WQ7A 2Y90A 5GANh 4J7IA 4RTUA 3S3NA 4M78D 3CCMA 2DL3A 1VQNT 1Q7YR 2RK2A 1QVGA 5GAN2 2GTOA 5GANg 2A08A 3KFVA 5GAN3 1X43A 2COWA 1W6XA 2RA2A 1BK2A 3VRZA 4KULA 1UEBA 4JJCA 3CPFA 1K73R 4BE2A 4M4ZA 4ORZA 3QJYA 1MMGA 1AEYA 2V8KA 4HXJA 3CCQA 4LE9A 1RABB 1JRIA 1O75A 1Q95G 2ED0A 3V8JA 2MCNA 1WHKA 4QQGA 1N5ZA 3M59A 2DEUA 3C0CA 3CBMA 1M8MA 2RHIA 2KXDA 2E3IA 1VQ9T 4NOYA 2KGTA 2HD0A 2DXTA 2XMFA 3V8KA 2C0IA 2LMJA 1HYOA 3OYYA 1RL2A 4HKEA 5GMKe 3CCMQ 4OB3B 1SRMA 2YHTA 2KT1A 5D6WA 3OYJA 3GP8A 1W2BS 3N5BB 3JCMP 1IXDA 2DE0X 2GCXA 4C92A 2HBPA 2WSEE 5LJ5d 3OW2P 1YJ9A 1HSQA 3JCMe 1RAEB 4BACA 1M1KR 4ZTFA 5A0DA 3RIRA 1RAHB 3CCQQ 1ZBXA 3GIBA 1H92A 1OQKA 1JJ2A 3CCRA 3CPWS 4EDUA 5CIUA 1VQNA 4LUDA 1TUDA 3M0SA 2K9GA 3OYEA 3TU4K 1NZ9A 2X4XA 2V8JA 4JDSA 1X69A 2V1RA 3J7AF 4PLLA 2IPOB 1H3ZA 2E6NA 2HQHA 3OYFA 2K57A 4Y91A 1Q81U 1PSFA 5IHIA 3OYAA 4AFUC 2X51A 5KH6A 4FYYB 1VYUA 5KYYA 2B8AA 2MWPA 3EG1A 3UPUA 4PJJA 1V29B 2JM9A 3EFOA 2MF2A 4KGXB 2CS7A 2FL7A 1N8RR 4GBQA 2EYZA 2EQJA 2FRYA 2I0NA 2YUOA 3A8HB 4OB2B 2XI9A 2YLBA 3C94A 4M7AG 3MP8A 2XU8A 4BD3A 3JCMV 5FROA 2RK1A 3BDLA 3CPWP 1JQQA 3NMZC 3CCRQ 3JCMW 1VQNQ 1SHFA 1XJWB 3CC7A 1BI2A 3OS5A 1VQMA 4D8DA 4BI8B 4M77A 3HFOA 2DILA 4F14A 4O5VA 1K9MR 3E9GA 2DIQA 2YDLA 4JLIA 2QA4A 1SPKA 3FEOA 3QPHA 1P92A 2F5KA 3PIPA 3RMSA 2PU9B 3OYMA 5DY9A 3V7RA 4F7UF 2JMCA 2CP7A 1WI7A 2ZZDA 1KQSS 1PNJA 5LJ3j 4RCCA 4C5IA 1IGUA 1RLQC 1U3OA 2BE7D 1VQ9Q 1K0SA 1QW1A 3V8LA 2DVJA 5FU7B 4E7JA 3P8BB 1OZ2A 1K1ZA 2DD5A 2J06A 1A0NB 3CC7Q 1VQMQ 5CKDA 4KH1B 1YJWT 1OYXA 1M27C 1QCOA 1W2BA 4XTXA 4XAXB 2QEXA 3JCMQ 4F7UG 4X34A 3EG2A 4BDZA 5I21A 1PHTA 4L6V5 2PVDB 1MNEA 3HRUA 4RTWA 2RJFA 2IIMA 2FPDA 2LJ1A 2MMPA 3F70A 2DPPB 1UDLA 2EBPA 2KSSA 1KQSP 1KIKA 3CPWA 4L59A 1J3TA 4QVDA 1ZSZA 4GY5A 2Y4YA 1B07A 1M30A 2XG8D 2DMOA 3VS4A 4EMKA 2QAZA 4FYXB 2AT1B 1WPYA 5GAN4 3PGGA 2E1HA 2XHCA 1VQLT 1N27A 4A4HA 2DL4A 4L5GA 1Q81R 5FRNA 1WIEA 2RN8A 1FWZA 3EGUA 3G1JA 4QKUA 2HL3A 2RJCA 2VUBA 4CC4B 3HPWA 4DQ2A 3P8HA 3M54A 2RHYA 3M9QA 3L42A 2F69A 5AYFA 1M2OA 4LDXA 2WACA 1RLPC 4ZGJB 1B34A 3JSCA 4E7ZA 3KXTA 3C95A 2FEIA 1GBRA 4J9EA 4IUQA 2G6FX 3S6WA 4M7DB 5FWCA 4C5HA 2EFIA 3H0HA 1QWFA 1VIFA 3CCJT 3URGA 2OTJT 4FT2A 3NTKA 1G8XA 1YWPA 2CZ1B 2LP5A 1VQ6A 3G71A 4FCYA 2CYZB 4RMOA 4C8QG 2DTIA 1K8AR 3QHSA 1Q86R 4C92B 4RTVA 4OF1A 1KQSA 3JCMf 3OYIA 3Q1JA 2OTLA 2KI7A 4J9FA 3RR6A 1IHWA 4AFSC 3VV0A 4NL2A 2DBMA 3J81E 2VVKA 2DVEA 3VKIA 2EQKA 2JTEA 5LJ3d 4E7LA 3TVTA 2DNUA 2JT4A 2RD1A 2EQMA 2E4HA 2LCSA 2BE9B 3MP6A 1GCPA 3CMEA 1YJNT 2RQRA 5A2QE 2GF7A 1VQ6Q 4J5YA 1R8OB 2I2LA 5GANj 2C0OA 5KYYB 4RTZA 4F16A 5FU7C 2KDSA 3I35A 4LD6A 1ACMB 3CEYA 3X28B 4DBQA 2OX7A 2LDMA 3BFMA 1PD0A 4WTOB 4J7FA 2DXBA 2DRMA 5AT1B 4PJNA 1FX7A 3OS1A 1SRLA 3JB9G 1VIEA 2MIOA 2H3JA 1BCOA 2MI6A 3GNFB 1RAGB 3JB9I 1GFDA 1PD1A 1VQLQ 3OQ5A 2O31A 3H0IA 1QCFA 3FIFA 1Y71A 1RACB 4PFPA 1IB8A 1I5LA 3CCST 4M75G 1T0HA 2XDPA 5FW9A 4HT9A 1BI1A 2EPDA 2LNHB 4KBMB 4M7DD 1OEBA 2V1QA 1OX9A 1LVKA 2NUPA 3A8OB 4OVAA
chains in the Genus database with same CATH topology
1W2BP 3CCQQ 1YIJQ 1VQOQ 3CC7Q 1VQMQ 1YHQQ 3CPWP 3CCRQ 1Q7YR 3CCLQ 2QEXQ 1VQLQ 3CMAQ 1VQNQ 3I56Q 1KQSP 3G6EQ 1Q81R 1K8AR 1YJWQ 1QVGP 3CMEQ 1Q82R 1Q86R 3CXCP 1YJ9Q 2QA4Q 1K9MR 3CC4Q 1VQKQ 3CCJQ 1S72Q 2OTJQ 1KC8R 1VQPQ 2OTLQ 3OW2P 1QVFP 1N8RR 3CD6Q 1YITQ 1VQ5Q 3CCSQ 1YI2Q 1K73R 1VQ8Q 3CC2Q 3I55Q 1YJNQ 1NJIR 1KD1R 1VQ9Q 1M1KR 1M90R 3CCEQ 3G71Q 1VQ4Q 3CCVQ 3CCUQ 1VQ6Q 1JJ2P 1VQ7Q 3CCMQ 3G4SQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B P;  3CCQ Q;  1YIJ Q;  1VQO Q;  3CC7 Q;  1VQM Q;  1YHQ Q;  3CPW P;  3CCR Q;  1Q7Y R;  3CCL Q;  2QEX Q;  1VQL Q;  3CMA Q;  1VQN Q;  3I56 Q;  1KQS P;  3G6E Q;  1Q81 R;  1K8A R;  1YJW Q;  1QVG P;  3CME Q;  1Q82 R;  1Q86 R;  3CXC P;  1YJ9 Q;  2QA4 Q;  1K9M R;  3CC4 Q;  1VQK Q;  3CCJ Q;  1S72 Q;  2OTJ Q;  1KC8 R;  1VQP Q;  2OTL Q;  3OW2 P;  1QVF P;  1N8R R;  3CD6 Q;  1YIT Q;  1VQ5 Q;  3CCS Q;  1YI2 Q;  1K73 R;  1VQ8 Q;  3CC2 Q;  3I55 Q;  1YJN Q;  1NJI R;  1KD1 R;  1VQ9 Q;  1M1K R;  1M90 R;  3CCE Q;  3G71 Q;  1VQ4 Q;  3CCV Q;  3CCU Q;  1VQ6 Q;  1JJ2 P;  1VQ7 Q;  3CCM Q;  3G4S Q; 
#chains in the Genus database with same CATH topology
 2DXC A;  1UJY A;  1VQ7 A;  1GCQ C;  2YSQ A;  5D7U A;  5GAN 6;  2GNC A;  5I2M A;  2KNB B;  3LH5 A;  1X2Q A;  3E2U A;  1ZA2 B;  5IXF A;  3CCJ Q;  2OTJ Q;  5KYU A;  2L0A A;  1NJI R;  1NLO C;  2RQU A;  1BCM A;  3PE0 A;  1VQ5 A;  5CAI A;  3QII A;  1YJN A;  4MZM A;  4PFZ A;  4DBH A;  1AD5 A;  1GRI A;  3OSV A;  3D7S B;  3BDU A;  4ZNX A;  4QW2 A;  2X4Y A;  2MWO A;  4E7S A;  1K73 U;  3HP9 A;  4IIO A;  4M7D C;  2ZPG B;  4FW1 A;  2W10 A;  1K73 C;  5CQX A;  1TU0 B;  1G3S A;  1UHF A;  1WYX A;  2K5I A;  1VQ7 Q;  1JEG A;  1N9R A;  3OMC A;  5LJ3 e;  1OV3 A;  5CR2 A;  3OYK A;  4J9I A;  4M78 G;  1SSH A;  5GAM e;  4DA4 A;  4M7A A;  3OS2 A;  4HCC A;  4MZT A;  3MKD A;  3VS0 A;  4A54 A;  3U23 A;  4C92 C;  4XTU A;  2SRC A;  4EMK B;  1VQ5 Q;  1U1T A;  1YJN Q;  3CD6 A;  4KGZ B;  2E64 A;  2DKG A;  2A3L A;  2M9U A;  1FXX A;  1Y96 A;  4ELZ C;  2JTM A;  1ZQ1 A;  1YHQ T;  2L3Q A;  5GJW B;  1YIJ A;  2YUP A;  2RQW A;  4BUG A;  2BTT A;  4XU3 A;  3TQ7 P;  2E41 A;  2HMA A;  4DBF A;  2RMO A;  5IT9 E;  1UHC A;  2LX9 A;  2X4J A;  3UA7 A;  3C4S A;  3AHU A;  4PL6 A;  2R5A A;  4N4H A;  4DBR A;  1FYN A;  4C0D B;  1QCN A;  1WHG A;  4LDY A;  4JRQ A;  1NG2 A;  3MET A;  2L3P A;  3PT9 A;  4PJO D;  3VS3 A;  2DLP A;  3CD6 Q;  4FW2 A;  4ZN3 A;  1KHC A;  3CCV T;  3SB2 A;  1NE8 A;  2LCC A;  4XU1 A;  2XD0 A;  2PUK B;  4F7U A;  4OB0 B;  3FDR A;  3X25 B;  3DLL A;  2LTO A;  3RNJ A;  2LNV A;  1PRM C;  1YBY A;  1N8R U;  3RDV A;  7AT1 B;  1IZ6 A;  4J9C A;  4ATO A;  5KE3 A;  5KCH A;  2HBW A;  4MMK A;  3REB B;  2EQI A;  3KBG A;  1N8R C;  4CC3 A;  5LL6 S;  1QQJ A;  1MUZ A;  3QKJ A;  4M7D E;  2EYY A;  2KAF A;  3AT1 B;  2F1L A;  4DOW A;  4BDY A;  2XK0 A;  2AK5 A;  2FVU A;  3INZ A;  4E6R A;  4PJO C;  1K9M U;  2HDA A;  1YHQ A;  4IKF A;  2V8I A;  3OYL A;  2A0F B;  2KXC A;  2LQN A;  1VQK T;  2O4X A;  3A8G B;  2DIG A;  2X3W D;  5GMK h;  1K9M C;  3I55 T;  3M55 A;  4JS4 A;  4RCB A;  4C5G A;  4C92 E;  4A53 A;  3OW2 S;  2ZGW A;  4EPC A;  3VUZ A;  3JCM h;  2CT3 A;  4F17 A;  1YCY A;  2ROT A;  1AT1 B;  2YXY A;  1WFW A;  1NPR A;  1XNI A;  2QQS A;  3JCM g;  5I22 A;  1S72 T;  1Y0M A;  4MML A;  1ZUY A;  1KJW A;  5J26 A;  3VU3 C;  3T9N A;  3CBP A;  2NUT B;  2VKN A;  2EKO A;  4A4G A;  2BKD N;  4JRI A;  3REA B;  1N6A A;  1Q82 U;  4RKU E;  3CCV A;  2DXU A;  2DYI A;  3OYG A;  2KYB A;  1YHQ Q;  2QQB A;  4FYW B;  2DER A;  2AZV A;  4LDW A;  2VGN A;  1Q82 C;  2KEA A;  2VB6 A;  4ELY C;  1ZSZ C;  1YIT T;  1IRE B;  2DZ9 A;  2H3E B;  4C8Q A;  2K3X A;  5GAN 5;  3FJ5 A;  1VYV A;  1ZX6 A;  5HCK A;  5GAN 8;  4EMK C;  3QWY A;  1JXO A;  3RUX A;  3H8Z A;  4QVC A;  2JVV A;  2DL7 A;  3SD4 A;  1TWB A;  8ATC B;  3HHT B;  2KE9 A;  1WJQ A;  1VQP T;  1SF9 A;  3QXE B;  2R58 A;  2JUF A;  4M77 E;  4FYV B;  1B3Q A;  4AFQ C;  4XK8 E;  2RHX A;  3CCV Q;  2RF0 A;  5IAY A;  2MAM A;  1PWT A;  3QYH B;  3CCL T;  4B9W A;  4C0D C;  2K4Y A;  1Q81 C;  2ED1 A;  5CO7 A;  2ROL A;  2ZPF B;  3OYD A;  4PJO E;  3NTH A;  1BIA A;  3CCE T;  2SEM A;  1LCK A;  1VQ9 A;  4KRT A;  3OB9 A;  2DFU A;  4DEY A;  1NYG A;  3JCM c;  4FSX A;  4JS5 A;  2VC8 A;  2LJ0 A;  4M7A B;  5GAM f;  2C0T A;  3M58 A;  1KHI A;  3JRZ A;  5KE2 A;  4QQ6 A;  1U1S A;  3EG9 A;  3CC2 T;  3V7S A;  1G3W A;  2COY A;  2NWM A;  2DBK A;  3L2R A;  2DET A;  3OW2 A;  1TH7 A;  4M75 A;  1K8A U;  1Q86 U;  3E19 A;  3S3M A;  2FB7 A;  3MCA B;  3A1P A;  2PQW A;  1K8A C;  2GFA A;  1Q86 C;  1QKX A;  2K6D A;  4J9B A;  4F04 B;  5I11 A;  3LLR A;  2HEQ A;  3BE3 A;  2HL5 C;  1NBE B;  3HTR A;  5FLX E;  1I5O B;  2HKN A;  3OBW A;  2A7Y A;  2HQE A;  2MK5 A;  2RI3 A;  3RKX A;  2KYM A;  3OA6 A;  1M3B A;  1I8F A;  2LCL A;  1TG0 A;  2RNA A;  4RG2 A;  1Q82 R;  3EG3 A;  3LGF A;  1QWE A;  4MDX A;  5LJ5 e;  4LNP A;  3R6N A;  3HL8 A;  2PVG B;  1BBZ A;  1JBM A;  3MJX A;  3TSZ A;  1XOV A;  4PKC C;  3SHW A;  3SWN B;  4LD9 K;  2KVQ G;  1K0X A;  3VS2 A;  1E6H A;  2L5Q A;  4JZ4 A;  1V1C A;  1D3B A;  1DJ7 B;  2QGF B;  2LT4 A;  4X1V A;  5GMK m;  4HVW A;  4M78 A;  2K3B A;  4PLI A;  1C0M A;  2BUD A;  2DA9 A;  2VV5 A;  2DTO A;  1NPP A;  2KRM A;  4N0A C;  2RI5 A;  3LW5 E;  3TRE A;  1SEM A;  1GL5 A;  1W4S A;  3SFM A;  2ZPE B;  1KC8 U;  1M2V A;  3UT1 A;  5M9O A;  2KRO A;  4LN2 A;  1IO6 A;  5IH2 A;  5DLQ E;  2RH2 A;  3M0R A;  2L8D A;  1Z9Z A;  1IRX A;  4M7D F;  3DKM A;  2CP3 A;  4C0G A;  4OGE A;  1WXB A;  3MO8 A;  5CQY A;  4ZN1 A;  1OOT A;  3QUI A;  3OYC A;  2M0Y A;  1QP2 A;  1E6G A;  2R57 A;  3I56 T;  1K9A A;  4BB7 A;  1KFZ A;  2H8H A;  1I0C A;  1NJI U;  3H9N A;  3ER0 A;  1YJW A;  5CCA A;  4X9C A;  4ME7 A;  1BI0 A;  2AIR B;  4R56 A;  1GFC A;  4XU2 A;  1NJI C;  2EVR A;  4QQD A;  3JB9 J;  3O8V A;  2GGR A;  4C92 F;  3ULR B;  4KT0 E;  3PIO A;  1SSF A;  2DK3 A;  2E5K A;  3MEA A;  4M7A C;  3JCM J;  3ME9 A;  1G5V A;  3HRS A;  1HD3 A;  3WVE B;  1TUC A;  2C06 A;  1M1G A;  2O2O A;  3CQT A;  3WVD B;  2M0O A;  2J6K A;  5A0G A;  2JJ9 A;  4J9H A;  2X3X D;  4ZTJ A;  3UA6 A;  2NYS A;  1TXQ A;  1VQO T;  3QG1 A;  2JM8 A;  1T0J A;  5CKE A;  2A28 A;  5KYW A;  4OMO A;  5ECA A;  1OPL A;  1W70 A;  1AHJ B;  2E6Z A;  1X6G A;  3M0Q A;  1YJW Q;  1VQL A;  3EFS A;  5GAO p;  1ZUK A;  4YTL A;  3TCJ A;  3QYG B;  1XTD A;  3PMI A;  4E7H A;  2DL5 A;  5KYX A;  1SHG A;  4E47 A;  1CKB A;  1JXM A;  2XDD A;  2OJ2 A;  3RKY A;  1UEC A;  3MHX A;  4QVZ A;  3UDC A;  1D1A A;  2EGC A;  1KSW A;  2IG0 A;  2EW3 A;  3EFO B;  5GMK j;  3I56 A;  3GNG A;  2JS2 A;  3L2Z A;  2FHD A;  2P0K A;  1PG5 B;  5FWB A;  3P8D A;  2FO0 A;  2LJ3 A;  3A5Z B;  1OX8 A;  4XTY A;  3CCJ A;  2OTJ A;  2KK4 A;  2J7I A;  4M77 F;  2GBQ A;  1M4Z A;  2KRN A;  4Y28 E;  5FRM A;  3WXM B;  1UJ0 A;  1G2B A;  4J6Y A;  3SWN C;  1WNL A;  1RI0 A;  4M77 B;  3EG9 B;  4OB1 B;  1BKB A;  1KC8 R;  5KCO A;  1QKW A;  4PJO F;  3QDF A;  3RKW A;  1EZZ B;  1PKS A;  4XTZ A;  1UGP B;  1KK7 A;  3VS1 A;  1N9S A;  2D0Q B;  2YUN A;  1QLY A;  1X6B A;  4GLK A;  2LC4 A;  2PNI A;  3UWN A;  3I56 Q;  4FM4 B;  3L2U A;  5A0L A;  3FC3 A;  1QMC A;  3JAM E;  4Z88 A;  3EH1 A;  4M7A E;  1WXT A;  1ABO A;  1AZG B;  2QYZ A;  5GAM h;  4C92 D;  2VGM A;  5GAM g;  2QGG A;  3FLG A;  3G6E T;  2XDB A;  2QDY B;  3A98 A;  5LJ5 f;  1GBQ A;  1I4K 1;  1RAD B;  3CC4 T;  1MHN A;  4Y92 A;  1D0Y A;  1OU9 A;  2ZAE A;  2CT4 A;  1TS9 A;  1WZO A;  1WHM A;  2EYW A;  3VS6 A;  3NHN A;  1OI1 A;  4AMC A;  1VQ4 T;  2X9H A;  3VS7 A;  1K76 A;  2RO0 A;  4ESR A;  3FB9 A;  2ENM A;  1RI9 A;  2VAS A;  1UB4 A;  2EGA A;  2QG9 B;  2K5L A;  3C12 A;  2MPX C;  1ZSZ B;  2YWW A;  2M1H A;  4M78 B;  4C8Q C;  5D6X A;  2LQK A;  4RTX A;  3M56 A;  4KUI A;  4LDU A;  2EJ9 A;  3CCS A;  2GQI A;  1NM7 A;  3QZ9 B;  2K2V A;  1BU1 A;  1I81 A;  1YP5 A;  2QXF A;  4FSS A;  4IUU A;  4FIB A;  4LDV A;  4F7U E;  1AOJ A;  2VXF A;  3GOX A;  4DEX A;  4Q5W A;  1LPL A;  2D8H A;  3MEW A;  5J39 A;  1O9S A;  2D9T A;  2HZY A;  3H0F A;  1M5Q 1;  5GAN d;  4LUE A;  4C0Z A;  2VWF A;  3GF5 A;  1B34 B;  2CKK A;  4M77 D;  3CCM T;  4NL3 A;  2J05 A;  2F2X A;  3FJP A;  3M57 A;  1D09 B;  1BI3 A;  2PUO B;  2L3S A;  2JZ2 A;  2WSF E;  3VYG A;  3G6E A;  3BW1 A;  2V26 A;  3A8M B;  1EX4 A;  2X4W A;  4XQ3 A;  3BY7 A;  3CCS Q;  3HRT A;  3JCM d;  2CSQ A;  3VYH B;  2DF6 A;  4PJO B;  2DX1 A;  1VQ4 A;  5EC7 A;  3MPU B;  4JRK A;  4OML A;  3HSB A;  1MMA A;  2CH4 W;  2E5Q A;  2BZ8 A;  1GXI E;  1OZ3 A;  2A37 A;  1UGR B;  4M77 C;  2CZ6 B;  1C1A A;  4E2F B;  3EAE A;  4LXC A;  2QQA A;  1H8K A;  2E3H A;  2OI3 A;  3DLM A;  1I07 A;  4E7I A;  4RTY A;  1M90 R;  4M75 C;  4JUV A;  2CRE A;  3OYN A;  3L2W A;  3PFS A;  3G6E Q;  1JB0 E;  1YJ9 T;  4MDW A;  2DL8 A;  5KYX B;  1ZA1 B;  3CC4 Q;  2RM4 A;  5CKB A;  4XTW A;  2KRS A;  3NTI A;  4K11 A;  4KGV B;  1MV3 A;  4EMG A;  1BB9 A;  1MMD A;  4CC2 A;  1VQ4 Q;  5C6S A;  1WQW A;  2HSP A;  1JJ2 P;  4C8Q E;  1MV0 B;  1GCQ A;  3CCR T;  3ZBD A;  1JU5 C;  2JMA A;  5HKC A;  3TEE A;  3EG0 A;  4WCI A;  1FMW A;  2P84 A;  2W0Z A;  3EH2 A;  4E7K A;  4C0F A;  2O9V A;  2P4T A;  1WX6 A;  3LGL A;  1VYT A;  4OGC A;  1TUG B;  2A36 A;  3EHR A;  1TTH B;  1TSF A;  1AWW A;  5L23 A;  4V2S A;  1PCX A;  3A8L B;  3GPL A;  4CRI A;  4JJB A;  4M7D A;  4Z89 A;  1Y57 A;  4BE0 A;  4D8K A;  5GAN e;  3CXC S;  3KUF A;  3L2V A;  1PM3 A;  1YI2 T;  2PVO B;  2RJD A;  4M78 C;  3IQL A;  1KD1 R;  2NUP B;  4CC7 A;  3G4S T;  1MMN A;  3CC7 T;  2F2V A;  1VQM T;  1X2K A;  2DJQ A;  1G3T A;  2EYQ A;  1KG1 A;  2QQ9 A;  4WF2 A;  1Y7X A;  2JXB A;  3QBY A;  1AVZ C;  3QDR B;  2QA4 T;  4P5N A;  4RUG A;  5CKF A;  1UG1 A;  3PMT A;  1XQH A;  4QT7 A;  5KYU B;  1QVP A;  5HK0 A;  2D8J A;  3MP1 A;  2EAY A;  1VQK A;  5DLO A;  2AHJ B;  4J83 A;  3I55 A;  2EQU A;  3SDZ A;  4OMP A;  4BY6 B;  1NYF A;  3CMA T;  1T3L A;  4OP0 A;  4ANJ A;  4EMH A;  4IUR A;  4M75 E;  4PK4 A;  5CVI A;  3CXC P;  2EJG A;  1IHV A;  2KMT A;  3MEV A;  5L8R E;  1S72 A;  1D1C A;  3UF4 A;  8AT1 B;  2XIC A;  4M7A F;  1WJS A;  2EGE A;  1W2B P;  1KQ1 A;  4IIM A;  5LJ3 f;  2QEX T;  5GAO m;  1S1N A;  1WHL A;  3VS5 A;  3UAT A;  2LT1 A;  2QI2 A;  1D1B A;  4OMN A;  1YJ9 Q;  1OPK A;  1ZUU A;  1VQK Q;  3VJP A;  1M3A A;  1WHH A;  3JB9 H;  3RMQ A;  3I55 Q;  1NLP C;  2E12 A;  1RUW A;  3H6Z A;  4J6X A;  1YIT A;  1Y96 B;  5J3B A;  1YI2 A;  3RER A;  1BYM A;  5LJ5 h;  4NS5 A;  1ARK A;  3G4S A;  2O01 E;  2FPF A;  5CK9 A;  5LJ5 g;  2BIV A;  1R0C B;  3LX7 A;  2MOX A;  2ATC B;  2LQW A;  2AKL A;  3O5Z A;  4HCK A;  1K4U S;  2K3Y A;  2CP6 A;  2CZ7 B;  5HK3 A;  4ZGD B;  4DOV A;  1S72 Q;  2P4R A;  1LJO A;  1PKT A;  3OSS C;  1VQP A;  2PZ1 A;  1RAA B;  2CDT A;  1QVF S;  3M4G A;  3OY9 A;  5IHN A;  9ATC B;  2VXE A;  4M78 E;  4PJO A;  2RHZ A;  2ZPI B;  1H64 1;  4B6M A;  2CP2 A;  5EG2 A;  3CCL A;  2FG0 A;  3CMA A;  3LWI A;  5GAO n;  1D0X A;  2FPE A;  1FMV A;  2LRQ A;  1ABQ A;  3CXC A;  6AT1 B;  4JZ3 A;  1YIT Q;  1YI2 Q;  1X27 A;  2DO3 A;  5GAM j;  1RAF B;  1G83 A;  3FRN A;  4F7U B;  4J6W A;  2KR3 A;  3QSU A;  3CCE A;  3G4S Q;  5D6Y A;  2FYK A;  2F5T X;  2ZCF B;  2FZC B;  2DZC A;  1UUE A;  2QTX A;  3MEU A;  3LYI A;  2QA4 Q;  1NEB A;  1UGV A;  4N4G A;  1H3H A;  4PJL A;  5CKH A;  4FU6 A;  1VQP Q;  1QVF P;  5FU6 B;  1YN8 A;  2HSE B;  1VQ6 T;  3L2Q A;  4J9G A;  3G71 T;  4A4E A;  3CC2 A;  4BI3 A;  3LH0 A;  2YT6 A;  2X35 A;  3M0T A;  3CCL Q;  3CMA Q;  2M51 A;  2O4X B;  2CUD A;  3NFC A;  1PSE A;  2GFU A;  3EHQ A;  3HFN A;  2GQV A;  2OTL T;  4HT8 A;  5C0M A;  2QTV A;  1KC8 C;  2HNI A;  5IXB A;  4JJN K;  4M7A D;  3CCU T;  2HQX A;  3CCE Q;  2E10 A;  2CP5 A;  1F1B B;  1ZHI A;  2AZS A;  2R5M A;  1VOM A;  4HCB A;  2QEX Q;  4BY6 C;  3HKS A;  3RES A;  3CME T;  1OU8 A;  3ASK A;  4GLM A;  2K2M A;  2DJZ A;  3PNW C;  3NGP A;  4PNO A;  2ZPB B;  2JOY A;  4II1 A;  3CC2 Q;  2D1X A;  2OAW A;  2LX7 A;  4XTV A;  2DTH A;  4ZGE B;  3J80 E;  4M7D G;  2ECZ A;  4C8Q F;  4R55 A;  2JNG A;  3JCM X;  2ZPH B;  2IVW A;  3V7C A;  5HY6 A;  3ZEH A;  1Y07 A;  5GAN f;  2J6O A;  2JTF A;  2MYS A;  4C8Q B;  2HAX A;  2RI2 A;  4JRP A;  3PVQ A;  2CP0 A;  2P0P A;  2XKO C;  2JN0 A;  1U5S A;  1QVF A;  1M9S A;  2J6F A;  2VYT A;  4C92 G;  1R77 A;  2DD4 A;  3DB3 A;  4A4F A;  4A63 B;  2RHU A;  3X26 B;  3EGD A;  1I1J A;  4TVR A;  2WSC E;  4A4K A;  4B9X A;  3EGX A;  2K5F A;  3OMG A;  1VQ7 T;  4RTT A;  4KUD K;  4C5E A;  2F2W A;  2CSI A;  3THK A;  1Z9Q A;  3SEM A;  3CCU A;  1KQ2 A;  2RB6 A;  4PJM A;  3ZL7 C;  2KY9 A;  5IN1 A;  5GJV B;  2CZ0 B;  4RG8 A;  2B86 A;  1ZLM A;  4Z8A A;  1D0Z A;  5GAM d;  1VQ5 T;  3QJ6 A;  4IUP A;  3JB9 F;  1AWO A;  4OMF B;  2G3R A;  4J9D A;  1VUB A;  2LQ8 A;  2XID A;  2QDL A;  3G71 Q;  3M4Y A;  4PFO A;  1EFN A;  2PTK A;  5GAO q;  3QZ5 B;  1ZBJ A;  5GMK i;  2DEQ A;  2D6F A;  4M75 F;  4BE1 A;  1WJR A;  5I2S A;  2OTL Q;  2DAQ A;  1VQ8 T;  3G7Z A;  1M1F A;  3L1A A;  4HVV A;  4IUT A;  3TSW A;  2NUT A;  5FU6 C;  4M75 B;  3CCU Q;  4N4I A;  1X01 A;  1EIF A;  1WXU A;  2YRC A;  2Z0W A;  1G3Y A;  5DM7 R;  4M77 G;  3CBO A;  4CI0 C;  2DRK A;  2FZK B;  2BZY A;  1R0B G;  3I5R A;  1VQO A;  2KT8 A;  2ESW A;  4UC4 A;  1OUL A;  3CME Q;  4IUV A;  4OMQ A;  1AWX A;  3CD6 T;  4JLG A;  4AG2 C;  3PVL A;  3R6O A;  3JCM b;  1M90 U;  3S3O A;  5LJ3 h;  4PJO G;  3I9Q A;  3RBB B;  5LJ3 g;  3M53 A;  4N0A A;  1YIJ T;  1HK9 A;  1M90 C;  4D6W A;  3M5A A;  4C8Q D;  1YNZ A;  5GAO l;  3E9F A;  1UGQ B;  5KYN A;  4AT1 B;  4MZP A;  1QP3 A;  4FL6 A;  3M0P A;  1ZSG A;  2HCK A;  1IGQ A;  2EKH A;  3M0U A;  1AZE A;  2M02 A;  1SG5 A;  2E65 A;  2EIF A;  1HJD A;  4VUB A;  1Q7Y U;  1PC0 A;  3QWX X;  2L89 A;  1VQO Q;  2GTJ A;  1Q7Y C;  1UFF A;  4AG1 C;  1QVG S;  2YLC A;  4M78 F;  2QK0 A;  2O9S A;  4EIK A;  1D3B B;  2YRD A;  2ABL A;  1UE9 A;  1FMK A;  2K7A A;  3OYH A;  1B7T A;  1PRL C;  1VA7 A;  2NUZ A;  3QO3 A;  3PTA A;  2YUQ A;  3LWH A;  2JW4 A;  1VQ8 A;  1UGS B;  2COZ A;  3GBQ A;  2QQR A;  4JPB W;  2BZX A;  1M2V B;  2LZ6 B;  1MGQ A;  1YFN A;  2DYB A;  2L2P A;  1WA7 A;  1CKA A;  3OBY A;  1MND A;  3OYB A;  3NPF A;  2Y4X A;  1KD1 U;  4HVU A;  1X75 C;  1LNX A;  3VUB A;  3JB9 D;  1WGS A;  2CUB A;  1YWO A;  1KD1 C;  3E1S A;  2K79 A;  5LJ5 j;  1QVG P;  2QAS A;  2M16 A;  1HXD A;  4O6J A;  1UTI A;  2FRW A;  3OS0 A;  4X9D A;  4FT4 A;  1E7O A;  1M8V A;  1WDX A;  1TOV A;  4M75 D;  1M1K U;  1V76 A;  3VRY A;  2RJE A;  2HKQ B;  4HCZ A;  5GMK l;  5GAO r;  4AFZ C;  2AKK A;  3EFR A;  1RAI B;  1VQ8 Q;  3CC4 A;  1M1K C;  5IHK A;  4JJD A;  1LOJ A;  2EYX A;  3CCQ T;  1WLP B;  1JO8 A;  1JJ2 S;  4Z02 A;  3X20 B;  4XU0 A;  3I5S A;  3JV3 A;  1BIB A;  1AWJ A;  4KH0 B;  2D0N A;  1YCS B;  4R0K A;  4BI4 A;  2EJF A;  2CH4 A;  1U8R A;  3ZFJ A;  2RQV A;  2E70 A;  3GLX A;  3X24 B;  2EWN A;  2OAU A;  2RQT A;  5KYW B;  2KQW A;  1YIJ Q;  1WHJ A;  1U06 A;  3H41 A;  2JS0 A;  1SKU B;  1M3C A;  3SWN A;  2DM1 A;  3EGD B;  4HA8 A;  1T3S A;  2O88 A;  3EGX B;  2RPN A;  2LVM A;  1CSK A;  2YRV A;  2P0Q A;  1X6O A;  2FZG B;  4OMM A;  2L3R A;  2KBT A;  3DB4 A;  1NEG A;  4J8O A;  1W1F A;  2NLU A;  5GAN 7;  2CGH A;  1C6V X;  1WQ7 A;  2Y90 A;  5GAN h;  4J7I A;  4RTU A;  3S3N A;  4M78 D;  3CCM A;  2DL3 A;  1VQN T;  1Q7Y R;  2RK2 A;  1QVG A;  5GAN 2;  2GTO A;  5GAN g;  2A08 A;  3KFV A;  5GAN 3;  1X43 A;  2COW A;  1W6X A;  2RA2 A;  1BK2 A;  3VRZ A;  4KUL A;  1UEB A;  4JJC A;  3CPF A;  1K73 R;  4BE2 A;  4M4Z A;  4ORZ A;  3QJY A;  1MMG A;  1AEY A;  2V8K A;  4HXJ A;  3CCQ A;  4LE9 A;  1RAB B;  1JRI A;  1O75 A;  1Q95 G;  2ED0 A;  3V8J A;  2MCN A;  1WHK A;  4QQG A;  1N5Z A;  3M59 A;  2DEU A;  3C0C A;  3CBM A;  1M8M A;  2RHI A;  2KXD A;  2E3I A;  1VQ9 T;  4NOY A;  2KGT A;  2HD0 A;  2DXT A;  2XMF A;  3V8K A;  2C0I A;  2LMJ A;  1HYO A;  3OYY A;  1RL2 A;  4HKE A;  5GMK e;  3CCM Q;  4OB3 B;  1SRM A;  2YHT A;  2KT1 A;  5D6W A;  3OYJ A;  3GP8 A;  1W2B S;  3N5B B;  3JCM P;  1IXD A;  2DE0 X;  2GCX A;  4C92 A;  2HBP A;  2WSE E;  5LJ5 d;  3OW2 P;  1YJ9 A;  1HSQ A;  3JCM e;  1RAE B;  4BAC A;  1M1K R;  4ZTF A;  5A0D A;  3RIR A;  1RAH B;  3CCQ Q;  1ZBX A;  3GIB A;  1H92 A;  1OQK A;  1JJ2 A;  3CCR A;  3CPW S;  4EDU A;  5CIU A;  1VQN A;  4LUD A;  1TUD A;  3M0S A;  2K9G A;  3OYE A;  3TU4 K;  1NZ9 A;  2X4X A;  2V8J A;  4JDS A;  1X69 A;  2V1R A;  3J7A F;  4PLL A;  2IPO B;  1H3Z A;  2E6N A;  2HQH A;  3OYF A;  2K57 A;  4Y91 A;  1Q81 U;  1PSF A;  5IHI A;  3OYA A;  4AFU C;  2X51 A;  5KH6 A;  4FYY B;  1VYU A;  5KYY A;  2B8A A;  2MWP A;  3EG1 A;  3UPU A;  4PJJ A;  1V29 B;  2JM9 A;  3EFO A;  2MF2 A;  4KGX B;  2CS7 A;  2FL7 A;  1N8R R;  4GBQ A;  2EYZ A;  2EQJ A;  2FRY A;  2I0N A;  2YUO A;  3A8H B;  4OB2 B;  2XI9 A;  2YLB A;  3C94 A;  4M7A G;  3MP8 A;  2XU8 A;  4BD3 A;  3JCM V;  5FRO A;  2RK1 A;  3BDL A;  3CPW P;  1JQQ A;  3NMZ C;  3CCR Q;  3JCM W;  1VQN Q;  1SHF A;  1XJW B;  3CC7 A;  1BI2 A;  3OS5 A;  1VQM A;  4D8D A;  4BI8 B;  4M77 A;  3HFO A;  2DIL A;  4F14 A;  4O5V A;  1K9M R;  3E9G A;  2DIQ A;  2YDL A;  4JLI A;  2QA4 A;  1SPK A;  3FEO A;  3QPH A;  1P92 A;  2F5K A;  3PIP A;  3RMS A;  2PU9 B;  3OYM A;  5DY9 A;  3V7R A;  4F7U F;  2JMC A;  2CP7 A;  1WI7 A;  2ZZD A;  1KQS S;  1PNJ A;  5LJ3 j;  4RCC A;  4C5I A;  1IGU A;  1RLQ C;  1U3O A;  2BE7 D;  1VQ9 Q;  1K0S A;  1QW1 A;  3V8L A;  2DVJ A;  5FU7 B;  4E7J A;  3P8B B;  1OZ2 A;  1K1Z A;  2DD5 A;  2J06 A;  1A0N B;  3CC7 Q;  1VQM Q;  5CKD A;  4KH1 B;  1YJW T;  1OYX A;  1M27 C;  1QCO A;  1W2B A;  4XTX A;  4XAX B;  2QEX A;  3JCM Q;  4F7U G;  4X34 A;  3EG2 A;  4BDZ A;  5I21 A;  1PHT A;  4L6V 5;  2PVD B;  1MNE A;  3HRU A;  4RTW A;  2RJF A;  2IIM A;  2FPD A;  2LJ1 A;  2MMP A;  3F70 A;  2DPP B;  1UDL A;  2EBP A;  2KSS A;  1KQS P;  1KIK A;  3CPW A;  4L59 A;  1J3T A;  4QVD A;  1ZSZ A;  4GY5 A;  2Y4Y A;  1B07 A;  1M30 A;  2XG8 D;  2DMO A;  3VS4 A;  4EMK A;  2QAZ A;  4FYX B;  2AT1 B;  1WPY A;  5GAN 4;  3PGG A;  2E1H A;  2XHC A;  1VQL T;  1N27 A;  4A4H A;  2DL4 A;  4L5G A;  1Q81 R;  5FRN A;  1WIE A;  2RN8 A;  1FWZ A;  3EGU A;  3G1J A;  4QKU A;  2HL3 A;  2RJC A;  2VUB A;  4CC4 B;  3HPW A;  4DQ2 A;  3P8H A;  3M54 A;  2RHY A;  3M9Q A;  3L42 A;  2F69 A;  5AYF A;  1M2O A;  4LDX A;  2WAC A;  1RLP C;  4ZGJ B;  1B34 A;  3JSC A;  4E7Z A;  3KXT A;  3C95 A;  2FEI A;  1GBR A;  4J9E A;  4IUQ A;  2G6F X;  3S6W A;  4M7D B;  5FWC A;  4C5H A;  2EFI A;  3H0H A;  1QWF A;  1VIF A;  3CCJ T;  3URG A;  2OTJ T;  4FT2 A;  3NTK A;  1G8X A;  1YWP A;  2CZ1 B;  2LP5 A;  1VQ6 A;  3G71 A;  4FCY A;  2CYZ B;  4RMO A;  4C8Q G;  2DTI A;  1K8A R;  3QHS A;  1Q86 R;  4C92 B;  4RTV A;  4OF1 A;  1KQS A;  3JCM f;  3OYI A;  3Q1J A;  2OTL A;  2KI7 A;  4J9F A;  3RR6 A;  1IHW A;  4AFS C;  3VV0 A;  4NL2 A;  2DBM A;  3J81 E;  2VVK A;  2DVE A;  3VKI A;  2EQK A;  2JTE A;  5LJ3 d;  4E7L A;  3TVT A;  2DNU A;  2JT4 A;  2RD1 A;  2EQM A;  2E4H A;  2LCS A;  2BE9 B;  3MP6 A;  1GCP A;  3CME A;  1YJN T;  2RQR A;  5A2Q E;  2GF7 A;  1VQ6 Q;  4J5Y A;  1R8O B;  2I2L A;  5GAN j;  2C0O A;  5KYY B;  4RTZ A;  4F16 A;  5FU7 C;  2KDS A;  3I35 A;  4LD6 A;  1ACM B;  3CEY A;  3X28 B;  4DBQ A;  2OX7 A;  2LDM A;  3BFM A;  1PD0 A;  4WTO B;  4J7F A;  2DXB A;  2DRM A;  5AT1 B;  4PJN A;  1FX7 A;  3OS1 A;  1SRL A;  3JB9 G;  1VIE A;  2MIO A;  2H3J A;  1BCO A;  2MI6 A;  3GNF B;  1RAG B;  3JB9 I;  1GFD A;  1PD1 A;  1VQL Q;  3OQ5 A;  2O31 A;  3H0I A;  1QCF A;  3FIF A;  1Y71 A;  1RAC B;  4PFP A;  1IB8 A;  1I5L A;  3CCS T;  4M75 G;  1T0H A;  2XDP A;  5FW9 A;  4HT9 A;  1BI1 A;  2EPD A;  2LNH B;  4KBM B;  4M7D D;  1OEB A;  2V1Q A;  1OX9 A;  1LVK A;  2NUP A;  3A8O B;  4OVA A; 
#chains in the Genus database with same CATH homology
 1W2B P;  3CCQ Q;  1YIJ Q;  1VQO Q;  3CC7 Q;  1VQM Q;  1YHQ Q;  3CPW P;  3CCR Q;  1Q7Y R;  3CCL Q;  2QEX Q;  1VQL Q;  3CMA Q;  1VQN Q;  3I56 Q;  1KQS P;  3G6E Q;  1Q81 R;  1K8A R;  1YJW Q;  1QVG P;  3CME Q;  1Q82 R;  1Q86 R;  3CXC P;  1YJ9 Q;  2QA4 Q;  1K9M R;  3CC4 Q;  1VQK Q;  3CCJ Q;  1S72 Q;  2OTJ Q;  1KC8 R;  1VQP Q;  2OTL Q;  3OW2 P;  1QVF P;  1N8R R;  3CD6 Q;  1YIT Q;  1VQ5 Q;  3CCS Q;  1YI2 Q;  1K73 R;  1VQ8 Q;  3CC2 Q;  3I55 Q;  1YJN Q;  1NJI R;  1KD1 R;  1VQ9 Q;  1M1K R;  1M90 R;  3CCE Q;  3G71 Q;  1VQ4 Q;  3CCV Q;  3CCU Q;  1VQ6 Q;  1JJ2 P;  1VQ7 Q;  3CCM Q;  3G4S Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...