1S72Q

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1s72Q00
3CMEQ 1KD1R 1W2BP 1VQKQ 1N8RR 3CMAQ 1VQ6Q 1VQOQ 3CC4Q 1VQLQ 1K9MR 3OW2P 1VQNQ 3CD6Q 1QVFP 3CCUQ 3G71Q 1Q81R 1Q82R 3CC2Q 1YITQ 1KC8R 3CCSQ 3CCVQ 2OTLQ 1YJNQ 2OTJQ 1JJ2P 1QVGP 3G4SQ 3I55Q 2QA4Q 1VQ7Q 1VQMQ 1NJIR 1YHQQ 3CCLQ 3CCEQ 3I56Q 1M1KR 1VQ4Q 1Q7YR 3CCJQ 3G6EQ 3CCQQ 1YIJQ 3CXCP 3CCRQ 1YJ9Q 1Q86R 1K8AR 1VQ5Q 1VQ8Q 3CC7Q 1VQPQ 1YJWQ 3CCMQ 1KQSP 2QEXQ 1K73R 1S72Q 1YI2Q 1VQ9Q 1M90R 3CPWP
chains in the Genus database with same CATH superfamily
1FMWA 2MCNA 1ZUYA 3CPFA 4Z89A 1G83A 1X2QA 2KGTA 2QQBA 3A8MB 4M77D 1M4ZA 2J7IA 4FCYA 1NE8A 4EMKB 3TEEA 5D6WA 1YWPA 2EQJA 5EG2A 2J6FA 2XG8D 3T9NA 5GAMe 3OMCA 3CCVA 3PGGA 3CCMQ 4DEXA 1PNJA 3CCET 2KRSA 2FB7A 5I22A 3VS0A 3OSSC 4RTTA 2AT1B 2O4XB 2QK0A 1AT1B 1VQ8A 2EW3A 1Y7XA 3J7AF 1HK9A 3VV0A 4DQ2A 1EZZB 2QQ9A 1HSQA 5LJ5j 3VS7A 1K8AR 1KC8C 2KDSA 2OI3A 4M75G 3QIIA 2B8AA 1OU8A 2AHJB 4AFZC 3REBB 1AWWA 4B6MA 5GAMg 3OYEA 2DXUA 2F5TX 4J9FA 2AK5A 1WDXA 1LPLA 3OBWA 4M77G 3H41A 3JB9D 1YJNT 1OU9A 1WNLA 1QCOA 4CC3A 1RAHB 4II1A 4C92D 1WHGA 3REAB 2RHUA 3BDLA 2H8HA 4ZN3A 1GBRA 1MUZA 4E2FB 2PNIA 3EAEA 2VWFA 1B07A 3GNFB 4C8QD 1AOJA 3OW2S 1VQPA 3J80E 1Y57A 1O75A 1MNDA 4XTWA 3MEAA 2KQWA 2KNBB 2CP6A 3GBQA 2C0TA 5FU7C 4Q5WA 1SKUB 1PWTA 3CMEQ 1VIFA 2DNUA 3EGDB 1ZSGA 5KE3A 4RCCA 5GMKj 1VQ4A 3VRZA 1S72T 2M9UA 4LDVA 4NL3A 3FJ5A 1Y07A 2A0FB 1TOVA 2BZYA 4RTZA 3GOXA 3LLRA 2E41A 4KUIA 2FZKB 3PT9A 3MEWA 3L2UA 1NEBA 4HVVA 2EGEA 2DL8A 2RA2A 4WCIA 2HSPA 5KYXB 5GAOr 2VYTA 2RB6A 4EDUA 3OYMA 3FEOA 1AEYA 4GBQA 4C92G 4E7IA 3EG1A 3V7RA 1WI7A 4OGCA 2JOYA 3P8DA 5HK3A 4C8QG 4RTVA 2BZXA 2YUQA 3HP9A 1M1KR 2QGFB 3CCJQ 2QA4T 4M78E 1BI0A 3INZA 1QVFA 1WLPB 2DEUA 1N8RU 2ZPIB 4BI8B 2PVDB 3CD6Q 4ZNXA 4PFZA 2HDAA 1WQ7A 5GAN5 3OS5A 4M7AF 2CREA 4WF2A 1JJ2S 3NHNA 4B9XA 4BUGA 4LD6A 1Z9QA 1PRLC 4V2SA 5LJ3e 2RHZA 1JU5C 2EGCA 2F2VA 4E6RA 2RJDA 4M75C 1RAEB 5IN1A 2DFUA 4DBFA 3OYLA 2CUBA 2MI6A 2AKLA 2DERA 3MP8A 2JNGA 1EX4A 1M1FA 4ZTFA 1K73C 2RO0A 3HKSA 4RTWA 4E7LA 2XHCA 2QQAA 4M77C 3UA7A 2EFIA 2QQRA 3MP1A 2RH2A 1ZHIA 4D8DA 1AZEA 2FRWA 1YIJT 1ZUUA 4PJOD 2LQ8A 2OAUA 1QP2A 3L2QA 1Q82R 5CK9A 4OB3B 2YUNA 3OYCA 4ZGJB 3S3MA 3QXEB 2LCCA 1KQSA 1M3AA 2O01E 2D8HA 2EYYA 2X35A 2EAYA 1U06A 4J6YA 2OTJA 2HQXA 2LCLA 1M90U 4JDSA 3I55A 2VVKA 3CPWS 4C0DB 3CMET 4HCKA 3LWIA 1TG0A 2VB6A 1N9SA 1VQLT 2QEXA 2COYA 2VV5A 1BI1A 2DTHA 3M0RA 4JJBA 3M55A 3OW2A 3DB3A 4C5HA 1QVPA 4E7JA 2LQNA 2F2WA 2FO0A 4PJOG 3TSWA 4BY6C 3LWHA 1UB4A 4C92C 2XU8A 1PD1A 5LJ5h 1VQOA 3HFNA 4C8QC 1W1FA 4A54A 2LNVA 2MK5A 3DB4A 1LCKA 4LDWA 2K5IA 1XTDA 1QKXA 1CKAA 1SHFA 1U8RA 1TSFA 4E7ZA 1QVGP 3I55Q 2KR3A 1YJWA 2K57A 4KULA 1FMVA 2FPDA 3I5RA 3OSVA 3JCMQ 3SWNB 3X20B 1QWEA 1RAIB 4ELZC 1BU1A 1BIAA 1LOJA 4FM4B 3JCMd 1FYNA 2HZYA 5HY6A 1I0CA 4F7UB 3JB9J 1NLOC 4FW2A 5KH6A 4XU2A 1JBMA 2E5QA 4PL6A 4E7SA 5A0LA 1GCQC 4N4GA 3V8LA 3EFRA 3VJPA 4XQ3A 3JB9I 4RTUA 4C5GA 3KUFA 5GMKh 1JJ2A 1IRXA 5KCHA 2EYXA 2P0PA 2RMOA 4OMLA 1KC8U 2ATCB 1UTIA 1XQHA 9ATCB 3L2WA 1UGPB 4AMCA 2QGGA 2WSEE 2L8DA 5IHKA 1OQKA 2OJ2A 5KYYA 1PCXA 2P0KA 3BY7A 1UE9A 1SF9A 4XU1A 5LL6S 3OMGA 1KK7A 3H9NA 2E10A 2F69A 4OMMA 5L8RE 3VKIA 5GAN4 1WXTA 2LTOA 2QXFA 1I07A 4FYWB 3UWNA 4IUPA 1M2VA 1YWOA 2BUDA 2D9TA 1WA7A 5GAN2 2LNHB 1Y96A 2HNIA 1M3CA 1W2BP 3RMSA 5KYUA 2DRMA 2DBKA 4J9HA 3G71Q 4M75A 1AWOA 1VQ5A 2RJFA 5IXFA 4LNPA 2G3RA 2CP2A 4PJOC 1R0CB 3VUZA 3SEMA 1PKTA 2VC8A 5C6SA 1N8RC 2LQWA 3G6EQ 1Q7YU 3CPWA 3CCQQ 1FX7A 4M7AE 2M02A 1D3BA 4R55A 2GNCA 4M77A 1YJ9T 2KY9A 4M7DF 3GF5A 2V1QA 4M78G 1QKWA 5CKDA 3VS6A 2LT4A 1MV3A 3P8HA 1K4US 7AT1B 4QVCA 2XK0A 1S1NA 4Y91A 2AIRB 4J6XA 3RR6A 2CP0A 1YJNA 3BE3A 4F7UF 2RI5A 4HT9A 2ZAEA 1EIFA 1JO8A 2DEQA 2K5FA 5GANh 2M0OA 3OYHA 2RHXA 2VXEA 4N4HA 2ENMA 3QZ5B 1UFFA 4NS5A 3X25B 3I56Q 1VQ6A 4PJLA 1NEGA 1VQ5Q 3HL8A 3HRTA 4BB7A 2ED0A 1G2BA 3OQ5A 4J9DA 3SD4A 2GGRA 3EH2A 2VXFA 1QP3A 1M3BA 1IHVA 4EPCA 1H8KA 1VQ9T 1PHTA 1S72A 5FRNA 1YI2A 2DA9A 1KJWA 4C92A 4BDYA 2WACA 1M90C 1IZ6A 2ECZA 4CC4B 4BE1A 3CCRQ 2B86A 1YNZA 2P4RA 2DLPA 5GMKm 4C8QA 3RDVA 5KYYB 1K73U 4JUVA 4YTLA 5FWCA 2NUTB 2E70A 3TREA 3VYHB 2SEMA 4RKUE 4PNOA 3TVTA 4AT1B 3MO8A 4KH0B 1AWXA 2K3YA 5GAMf 3MEVA 5FWBA 2DVJA 3M59A 1VQNT 3CCLQ 3AT1B 1JEGA 3H0IA 2A3LA 1MMNA 4JS5A 1NLPC 6AT1B 4KUDK 2DKGA 1ZSZC 2QA4A 1RAFB 1EFNA 1Y96B 2DIQA 5KYUB 3GIBA 2DD5A 2DTIA 2H3EB 3CC7A 2EKOA 3EHQA 1QVFS 3VYGA 2HSEB 3G71T 4M75B 4MDXA 3EFOA 4KH1B 1WFWA 2HD0A 3OYIA 4LDXA 3CC4A 1BIBA 1H641 4KRTA 2PVOB 2NLUA 1UDLA 5J39A 4M75D 1VQMT 3PVLA 3ZBDA 1GCQA 3NFCA 1YI2Q 1K1ZA 3G1JA 3CCQT 1D3BB 4RG8A 4IUQA 2YDLA 2CP7A 4M77B 5CKEA 3OYGA 2K7AA 2MIOA 3OBYA 1G3YA 2YRCA 4IIMA 1PC0A 4M78C 2W0ZA 2R57A 3V7SA 1M30A 5CAIA 4LE9A 3JB9H 1KFZA 3VS4A 1X6OA 3E1SA 4BD3A 4IUTA 2XKOC 5GMKi 3H6ZA 2X4JA 1G3WA 2MPXC 2EYWA 1YIJA 2EJGA 4HVWA 4IUVA 3A98A 3TSZA 3CC2T 2DO3A 1QWFA 4A4GA 5LJ5e 1UEBA 1K9MC 3V8KA 3HPWA 5GAMj 1WPYA 5AT1B 3HHTB 2DETA 1OZ2A 1KQSS 3H0HA 3O5ZA 1BCMA 5FROA 5A0GA 3SB2A 1WGSA 2CT4A 3NTHA 2YWWA 3VS5A 4PJOA 3QO3A 4O6JA 5GAOm 4C92B 3CXCP 3G4ST 1VQ7T 3QYHB 3X28B 4AFUC 4C8QB 1G3TA 2KVQG 2ABLA 3OA6A 4QQDA 2HL5C 3CCVQ 1LJOA 2Y4XA 2R5AA 2E3IA 2CS7A 1KSWA 5DLQE 1XJWB 1PD0A 4JPBW 4MDWA 3CCUT 1NJIU 4JS4A 2X3WD 2OTLT 2I2LA 2JS0A 4NL2A 4CC7A 3ZEHA 1VQ8Q 2Y4YA 1UGRB 2IVWA 2X4XA 2YSQA 3CCLT 5GAMd 3A8LB 2O88A 1TH7A 3DLLA 4JJCA 2JMAA 5GMKe 3E2UA 2DL5A 2L2PA 1PSEA 1Q7YC 2GCXA 5HCKA 3QBYA 2LCSA 1WJQA 3RERA 4M7DE 4QQGA 1QVGS 1TXQA 2FEIA 3EFOB 2K3BA 4A63B 1YHQT 5GAOq 2PUKB 1GCPA 4QQ6A 3O8VA 1BI2A 3M0PA 4M7AG 2CSIA 1KC8R 4J83A 3R6NA 4F7UE 1AD5A 3URGA 5HK0A 3E19A 4NOYA 1RI0A 5CO7A 1VQKA 1KHIA 2RF0A 2HAXA 1LNXA 2FPFA 3M58A 2OAWA 3EH1A 2DK3A 2ZGWA 1VQPQ 3UA6A 1ZA2B 1IB8A 1WHLA 2BZ8A 1PG5B 3VS2A 1BBZA 3M53A 5A0DA 1XNIA 2DXTA 2JXBA 3CCMT 4PJJA 3VUBA 3I9QA 1TU0B 2DXCA 3UDCA 3ASKA 1MMAA 1W70A 1VQ4Q 1PRMC 1H3ZA 3M5AA 3JCMf 4JLGA 2DTOA 1UGSB 2KT1A 2XMFA 2RK1A 3JB9F 5CR2A 3A1PA 1KD1U 1QMCA 1ZSZA 3M0SA 2HBPA 2COWA 2A36A 3PMTA 2QG9B 2FYKA 2YUOA 1M8VA 3TU4K 3CEYA 2MOXA 1SG5A 1Q7YR 1Y0MA 5HKCA 1OPLA 4PJOB 2D8JA 4FL6A 1VQKQ 2DRKA 2DYIA 1C6VX 2HCKA 1MV0B 4J5YA 5GANe 2EQMA 1W2BS 2J6KA 2E64A 1UJYA 4R56A 3C94A 5LJ3g 1HJDA 5I21A 3M56A 4DBHA 2L3SA 4M78A 1N9RA 4F17A 3LX7A 4KGVB 5KYWA 1D1BA 1ZQ1A 1NBEB 3PTAA 1D0ZA 4JRQA 2K3XA 3OS1A 1SHGA 4HCZA 3GLXA 4EMKC 1B3QA 4CC2A 2DMOA 2PU9B 1WHJA 4RTXA 3RESA 4J9EA 4LUDA 1OPKA 3ZL7C 4DOWA 3HSBA 5GANg 8AT1B 2QASA 2MWOA 2RJCA 1YITA 3BFMA 3QJYA 3LW5E 3OY9A 4C5EA 4BE2A 1SEMA 4Z88A 2XD0A 1E7OA 2GFUA 1B34A 4AG2C 2KYMA 3NPFA 2COZA 1ACMB 1OYXA 3JSCA 1WIEA 3E9GA 4M7AC 3C4SA 3L2ZA 4PLLA 3CMAA 3JCMP 2EJ9A 2DL4A 1K0XA 2LX7A 1D0XA 1OZ3A 4QT7A 1K73R 3CCJT 2EYZA 4XTXA 4C0ZA 1QVGA 3OB9A 3NTIA 2RNAA 1QLYA 2OTJQ 2DXBA 1UUEA 1VQ9A 3M0UA 3CD6T 3QDFA 4B9WA 4WTOB 2C0IA 3JCMW 1AHJB 4UC4A 2DF6A 4A4EA 2QEXQ 2WSCE 2KSSA 2EQIA 2K9GA 1D0YA 1ZSZB 2EWNA 2DPPB 5DY9A 1C1AA 3EFSA 1GFCA 1V76A 5J26A 2A08A 3RMQA 1WQWA 2CSQA 2JTEA 1D1AA 2RK2A 2ROTA 4CI0C 1LVKA 1VQNA 5DLOA 1X75C 3H0FA 4M7DD 4XTVA 3CCSA 1X01A 2LJ0A 1UJ0A 1Y71A 2HKNA 1VQOQ 2L5QA 2KMTA 4J9CA 1NJIC 1K9MU 2BE9B 5M9OA 1R77A 3QHSA 2D0QB 2M16A 2KYBA 2HQHA 2P4TA 2JM8A 2YRVA 2GBQA 4EMHA 3L1AA 2LX9A 4J7IA 1Q86U 2RQRA 1A0NB 4M78B 1YJWQ 2JTFA 4JZ4A 5KYWB 3GNGA 4M77E 1UHFA 1VQMA 4O5VA 1ARKA 2GF7A 1M5Q1 4M78D 3CBPA 2HMAA 5EC7A 1GL5A 4J6WA 2JW4A 3FRNA 1WJSA 2RPNA 2CGHA 2PZ1A 2CH4W 4OB2B 3M9QA 1W2BA 5GAN3 8ATCB 2LVMA 3FDRA 4J9BA 2J05A 4HCCA 2EPDA 4M7DG 2F5KA 2D6FA 3CCEA 5IHNA 2WSFE 5CCAA 1QQJA 2KROA 4PKCC 2ZPEB 2DILA 2RQUA 1B34B 2DAQA 4DA4A 3H8ZA 4HVUA 5A2QE 2C06A 2QTXA 5GAOn 3MPUB 2FVUA 4F7UG 3CC2A 5ECAA 4JJDA 2EKHA 1FMKA 2X9HA 2X4WA 2O31A 1IREB 3ZFJA 4LD9K 4KBMB 4JRPA 2V8JA 1IO6A 4PFPA 1V29B 5IXBA 2RQWA 2FG0A 2J06A 2L3QA 1ZUKA 1BKBA 4ZGEB 2A28A 3RNJA 1CSKA 1JRIA 1NJIR 3THKA 1I4K1 4VUBA 1KD1C 3JCMV 4EIKA 3AHUA 3I55T 2EYQA 3OS2A 3EG2A 3CXCS 3G4SA 1VQ7A 1O9SA 1U1SA 2J6OA 5FLXE 1SRLA 2KK4A 1HXDA 5FU7B 1ZA1B 1RLQC 1WHKA 3KFVA 2JT4A 2ESWA 3SFMA 5GAOl 1X27A 4EMKA 2CZ6B 1W6XA 4RTYA 3S6WA 3CCEQ 3QKJA 4QVZA 3X24B 3M0TA 1VOMA 2IG0A 3CCUA 4N0AC 2ZPHB 1QW1A 4FT4A 2FHDA 4C0DC 1BB9A 4OVAA 4JJNK 2KXCA 2CKKA 2KEAA 5KYNA 4DBQA 2JN0A 3CQTA 2EJFA 4M7AA 5J3BA 3RKWA 3JCMX 3VRYA 4Z02A 3TQ7P 1WJRA 1MNEA 2VGMA 3JCMc 4ZN1A 1N8RR 1TUCA 3JCMh 4PLIA 3RUXA 1YHQA 2YT6A 2ZPBB 1UHCA 2EBPA 1YJNQ 1G3SA 2A7YA 1U3OA 3MKDA 2XICA 1RAGB 1RAAB 4JRKA 5CIUA 5I2MA 4XTYA 1HYOA 1PKSA 3RKXA 2DVEA 2L3RA 2GTOA 2M1HA 2K6DA 1M2VB 3A8GB 1GBQA 1OOTA 2O9SA 4OB1B 1VQ6Q 3PFSA 4N4IA 3OS0A 4J9GA 1M9SA 4M7DC 4K11A 2E4HA 3FB9A 3FC3A 3HRUA 4L59A 1PM3A 1E6HA 3RIRA 3SWNC 4XU0A 2XDPA 3L2VA 1QCFA 4D6WA 1RADB 2R58A 2CZ7B 3NTKA 3EGDA 1I81A 2AZSA 2E6NA 4DOVA 2CUDA 1S72Q 1K0SA 4IURA 5GJVB 3G6ET 4BI4A 3PNWC 2NYSA 4XTUA 1GXIE 1OV3A 2L3PA 4QW2A 3OYFA 3LH5A 4RMOA 3PMIA 1I8FA 3M4GA 4FW1A 1NPRA 2FRYA 1UECA 1M90R 1WZOA 3N5BB 3DLMA 1GRIA 4GY5A 5CQXA 5GAN8 2E12A 4PK4A 2P84A 5FU6C 2QA4Q 3FJPA 2K5LA 4L6V5 3QSUA 4OMNA 4DEYA 3R6OA 3Q1JA 3CC7Q 2EIFA 2LQKA 1KG1A 3QG1A 4BDZA 3I56T 3LH0A 5C0MA 4LDUA 1I1JA 3CC4Q 1VQ5T 3CBOA 4AFQC 2SRCA 4F16A 4FSSA 2RN8A 1YCSB 4Y28E 4FYXB 1ABQA 4PJNA 2V1RA 1Q86C 3WXMB 3QWYA 5L23A 2DZ9A 3CXCA 3CMEA 4HCBA 3FIFA 4XK8E 2VASA 5IAYA 1VQLA 2RM4A 4BY6B 4M7AB 4FYYB 4AG1C 1U1TA 1U5SA 1KQ1A 3MCAB 2JM9A 3CCRT 2D1XA 2X4YA 2LJ3A 4E47A 4M7AD 2F1LA 1ZLMA 5LJ5g 1M1KC 5FRMA 4JRIA 3META 4IKFA 2X3XD 1D1CA 2E6ZA 2HQEA 2GTJA 1YIJQ 3EG9A 3S3NA 2LC4A 2LT1A 1BCOA 4M75F 2MF2A 3CCJA 1VQ6T 1RL2A 1M8MA 5LJ3f 2VGNA 2K2VA 2ZZDA 1YCYA 4BI3A 3JCMJ 2EQUA 2E1HA 1G8XA 1JXOA 4M77F 3CD6A 5LJ5d 2RHIA 2DZCA 5IH2A 2E5KA 4N0AA 2V8KA 5GAN7 4P5NA 1VQLQ 1K9MR 1DJ7B 3NGPA 1YI2T 3MEUA 2ZCFB 2FZGB 3NMZC 3UT1A 4Z8AA 3SHWA 1VYTA 3F70A 2JMCA 5GANf 2HL3A 2LP5A 3VS3A 1Q86R 4ESRA 3JB9G 1SRMA 1Q82C 1M2OA 2DL7A 2JS2A 1ZBXA 4X9DA 2NUZA 2C0OA 3OYKA 3GP8A 2X51A 3EG3A 1I5LA 3VU3C 1MMDA 4FYVB 2YXYA 2PUOB 4L5GA 1X6GA 4OMOA 3OYBA 2PQWA 3A8OB 1V1CA 3FLGA 1BK2A 1X6BA 1M27C 2M0YA 3QYGB 1NYGA 2G6FX 2ZPGB 3HFOA 4X9CA 2P0QA 3S3OA 1OI1A 2CZ1B 3CC7T 1MGQA 1QVFP 2JZ2A 4D8KA 4C92F 2QDYB 1H3HA 4F04B 3CC4T 4M7DA 4C0FA 2K4YA 3KBGA 4ANJA 3PVQA 4C8QF 3SWNA 2L0AA 3V7CA 1SPKA 3EHRA 2QI2A 5LJ3j 1JXMA 4A4HA 2RQTA 4F7UA 4RUGA 4XU3A 1Q81U 1D09B 4OMFB 2XIDA 1I5OB 5KE2A 3ER0A 4OB0B 4FU6A 2ROLA 4M4ZA 4QKUA 1IHWA 3CCVT 2YRDA 4QVDA 3UATA 5GAOp 2DIGA 1WXBA 3RKYA 3EG9B 4HKEA 4OMPA 1X43A 1VUBA 1VQ8T 5GANj 2QYZA 2KBTA 4MMLA 1G5VA 4IUUA 1TUDA 5I11A 1X69A 1YJ9A 2MYSA 3UPUA 2KI7A 4OGEA 1IGQA 1RLPC 2RI3A 5IHIA 1MMGA 1YBYA 2V8IA 4GLKA 3EGXA 2QTVA 1KQSP 3PE0A 1X2KA 5LJ3d 3JRZA 3M54A 2MWPA 3JCMe 1RUWA 4X34A 3ULRB 4A4FA 3UF4A 4RG2A 5D7UA 1KIKA 3M4YA 2YUPA 5GAMh 1UGVA 1K8AU 1T3SA 3OYYA 3KXTA 1XOVA 4BACA 4C5IA 4MZTA 1VIEA 3OW2P 1VQPT 2HBWA 3DKMA 2D0NA 5GANd 1WYXA 1OX8A 2DYBA 2JVVA 2NWMA 1SSHA 1J3TA 5IT9E 4XAXB 3JCMg 1TTHB 1BI3A 1YJ9Q 1ZBJA 4KT0E 3PIPA 1UG1A 1KQ2A 1RABB 3EGUA 2KRNA 1ABOA 1VQ4T 2KE9A 4X1VA 2K2MA 3MJXA 1B7TA 3X26B 4A4KA 1YITQ 2GFAA 3OYDA 2RI2A 2DM1A 1W4SA 4PJOF 5CQYA 4ZTJA 3JV3A 2E65A 4LUEA 5GMKl 4M7DB 2RJEA 4CRIA 4Y92A 1M1GA 2RHYA 1VA7A 2BIVA 4ORZA 1N27A 2FPEA 2K79A 2PTKA 4E7KA 2DX1A 4J9IA 1NPPA 3QUIA 3CMAQ 1Z9ZA 2DJQA 4ATOA 2MMPA 5D6YA 3C95A 3CBMA 2F2XA 2AKKA 2CH4A 2RQVA 4GLMA 1VQKT 1FXXA 4M75E 1AVZC 4KGZB 1TWBA 2JUFA 2AZVA 3G71A 2BE7D 1VQ9Q 2VKNA 2CYZB 3C12A 3JCMb 3G6EA 5DM7R 1TS9A 3CCQA 3GPLA 2YLCA 3RBBB 1FWZA 1JJ2P 2XI9A 2NUPA 1CKBA 3C0CA 4R0KA 4FSXA 1M1KU 4LN2A 5FU6B 3OYNA 1K9AA 2NUTA 3QWXX 3J81E 1AZGB 4LXCA 4EMGA 4MZPA 4F14A 2PVGB 4IIOA 3EGXB 2LJ1A 4HT8A 2RD1A 1NYFA 1VQNQ 1C0MA 3SDZA 4JZ3A 4FT2A 3I5SA 3CCSQ 4XTZA 3M0QA 1ZX6A 4MMKA 2OX7A 1WHMA 1T3LA 2CDTA 4J7FA 3QJ6A 4RCBA 2KAFA 5CKFA 1YN8A 3G7ZA 2H3JA 4LDYA 3E9FA 1KHCA 2O2OA 3I35A 3WVDB 3JAME 1TUGB 5I2SA 2KRMA 2R5MA 2XDDA 2EVRA 1IGUA 3I56A 3LGFA 4E7HA 5CKBA 4DBRA 1VYUA 1YFNA 1NG2A 1JB0E 5CVIA 1VQMQ 1WX6A 4C92E 1T0JA 5KCOA 2OTJT 3P8BB 4PJMA 1F1BB 2E3HA 5D6XA 5LJ3h 3HRSA 3L42A 4MZMA 4C8QE 3CPWP 1N6AA 3D7SB 1RACB 3ME9A 3L2RA 1E6GA 2EQKA 4HA8A 2DE0X 1OX9A 1K76A 3QZ9B 2QEXT 1Q82U 3CCRA 1WHHA 4TVRA 3PIOA 1QCNA 5AYFA 2QAZA 4BE0A 2CT3A 1YITT 2CZ0B 1RI9A 3TCJA 1MHNA 2V26A 2IIMA 1YP5A 1Q81C 5GAN6 3QPHA 2OTLA 2XDBA 2O4XA 4JLIA 3CCLA 2IPOB 4OMQA 3CC2Q 2JJ9A 1OULA 3CMAT 2EGAA 3M57A 2FL7A 1VQOT 4M78F 3U23A 1HD3A 2LDMA 3VS1A 3A8HB 2ED1A 4PFOA 2GQIA 2CP5A 2Y90A 2L89A 1GFDA 2I0NA 1WXUA 4J8OA 2M51A 2GQVA 4OP0A 1UGQB 1YJWT 2JTMA 2CP3A 1P92A 2BTTA 3G4SQ 1VQ7Q 2QDLA 1R0BG 4C0GA 5GJWB 3MHXA 2NUPB 2MAMA 1H92A 2DBMA 3LYIA 2HKQB 2VUBA 3OYAA 1KD1R 2LRQA 2DJZA 2O9VA 3QDRB 3CCUQ 3A5ZB 5LJ5f 5CKHA 3BDUA 1NM7A 2DL3A 2OTLQ 1VYVA 1K8AC 2YHTA 2HEQA 3CCMA 3IQLA 4KGXB 3LGLA 3CCST 1SSFA 3MP6A 1N5ZA 2YLBA 2ZPFB 1JQQA 4AFSC 3V8JA 1NZ9A 2FZCB 5FW9A 4HXJA 3OYJA 2LMJA 2DD4A 3HTRA 1Q81R 4FIBA 2QQSA 3BW1A 2LZ6B 1Q95G 2W10A 1BYMA 3WVEB 1YHQQ 5KYXA 1IXDA 2A37A 1R8OB 3EG0A 1PSFA 1T0HA 4ZGDB 4PJOE 1AWJA 4OF1A 4ELYC 2Z0WA 4A53A 2KXDA 2KT8A 4ME7A 2BKDN 1OEBA
chains in the Genus database with same CATH topology
3CMEQ 1KD1R 1W2BP 1VQKQ 1N8RR 3CMAQ 1VQ6Q 1VQOQ 3CC4Q 1VQLQ 1K9MR 3OW2P 1VQNQ 3CD6Q 1QVFP 3CCUQ 3G71Q 1Q81R 1Q82R 3CC2Q 1YITQ 1KC8R 3CCSQ 3CCVQ 2OTLQ 1YJNQ 2OTJQ 1JJ2P 1QVGP 3G4SQ 3I55Q 2QA4Q 1VQ7Q 1VQMQ 1NJIR 1YHQQ 3CCLQ 3CCEQ 3I56Q 1M1KR 1VQ4Q 1Q7YR 3CCJQ 3G6EQ 3CCQQ 1YIJQ 3CXCP 3CCRQ 1YJ9Q 1Q86R 1K8AR 1VQ5Q 1VQ8Q 3CC7Q 1VQPQ 1YJWQ 3CCMQ 1KQSP 2QEXQ 1K73R 1S72Q 1YI2Q 1VQ9Q 1M90R 3CPWP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME Q;  1KD1 R;  1W2B P;  1VQK Q;  1N8R R;  3CMA Q;  1VQ6 Q;  1VQO Q;  3CC4 Q;  1VQL Q;  1K9M R;  3OW2 P;  1VQN Q;  3CD6 Q;  1QVF P;  3CCU Q;  3G71 Q;  1Q81 R;  1Q82 R;  3CC2 Q;  1YIT Q;  1KC8 R;  3CCS Q;  3CCV Q;  2OTL Q;  1YJN Q;  2OTJ Q;  1JJ2 P;  1QVG P;  3G4S Q;  3I55 Q;  2QA4 Q;  1VQ7 Q;  1VQM Q;  1NJI R;  1YHQ Q;  3CCL Q;  3CCE Q;  3I56 Q;  1M1K R;  1VQ4 Q;  1Q7Y R;  3CCJ Q;  3G6E Q;  3CCQ Q;  1YIJ Q;  3CXC P;  3CCR Q;  1YJ9 Q;  1Q86 R;  1K8A R;  1VQ5 Q;  1VQ8 Q;  3CC7 Q;  1VQP Q;  1YJW Q;  3CCM Q;  1KQS P;  2QEX Q;  1K73 R;  1S72 Q;  1YI2 Q;  1VQ9 Q;  1M90 R;  3CPW P; 
#chains in the Genus database with same CATH topology
 1FMW A;  2MCN A;  1ZUY A;  3CPF A;  4Z89 A;  1G83 A;  1X2Q A;  2KGT A;  2QQB A;  3A8M B;  4M77 D;  1M4Z A;  2J7I A;  4FCY A;  1NE8 A;  4EMK B;  3TEE A;  5D6W A;  1YWP A;  2EQJ A;  5EG2 A;  2J6F A;  2XG8 D;  3T9N A;  5GAM e;  3OMC A;  3CCV A;  3PGG A;  3CCM Q;  4DEX A;  1PNJ A;  3CCE T;  2KRS A;  2FB7 A;  5I22 A;  3VS0 A;  3OSS C;  4RTT A;  2AT1 B;  2O4X B;  2QK0 A;  1AT1 B;  1VQ8 A;  2EW3 A;  1Y7X A;  3J7A F;  1HK9 A;  3VV0 A;  4DQ2 A;  1EZZ B;  2QQ9 A;  1HSQ A;  5LJ5 j;  3VS7 A;  1K8A R;  1KC8 C;  2KDS A;  2OI3 A;  4M75 G;  3QII A;  2B8A A;  1OU8 A;  2AHJ B;  4AFZ C;  3REB B;  1AWW A;  4B6M A;  5GAM g;  3OYE A;  2DXU A;  2F5T X;  4J9F A;  2AK5 A;  1WDX A;  1LPL A;  3OBW A;  4M77 G;  3H41 A;  3JB9 D;  1YJN T;  1OU9 A;  1WNL A;  1QCO A;  4CC3 A;  1RAH B;  4II1 A;  4C92 D;  1WHG A;  3REA B;  2RHU A;  3BDL A;  2H8H A;  4ZN3 A;  1GBR A;  1MUZ A;  4E2F B;  2PNI A;  3EAE A;  2VWF A;  1B07 A;  3GNF B;  4C8Q D;  1AOJ A;  3OW2 S;  1VQP A;  3J80 E;  1Y57 A;  1O75 A;  1MND A;  4XTW A;  3MEA A;  2KQW A;  2KNB B;  2CP6 A;  3GBQ A;  2C0T A;  5FU7 C;  4Q5W A;  1SKU B;  1PWT A;  3CME Q;  1VIF A;  2DNU A;  3EGD B;  1ZSG A;  5KE3 A;  4RCC A;  5GMK j;  1VQ4 A;  3VRZ A;  1S72 T;  2M9U A;  4LDV A;  4NL3 A;  3FJ5 A;  1Y07 A;  2A0F B;  1TOV A;  2BZY A;  4RTZ A;  3GOX A;  3LLR A;  2E41 A;  4KUI A;  2FZK B;  3PT9 A;  3MEW A;  3L2U A;  1NEB A;  4HVV A;  2EGE A;  2DL8 A;  2RA2 A;  4WCI A;  2HSP A;  5KYX B;  5GAO r;  2VYT A;  2RB6 A;  4EDU A;  3OYM A;  3FEO A;  1AEY A;  4GBQ A;  4C92 G;  4E7I A;  3EG1 A;  3V7R A;  1WI7 A;  4OGC A;  2JOY A;  3P8D A;  5HK3 A;  4C8Q G;  4RTV A;  2BZX A;  2YUQ A;  3HP9 A;  1M1K R;  2QGF B;  3CCJ Q;  2QA4 T;  4M78 E;  1BI0 A;  3INZ A;  1QVF A;  1WLP B;  2DEU A;  1N8R U;  2ZPI B;  4BI8 B;  2PVD B;  3CD6 Q;  4ZNX A;  4PFZ A;  2HDA A;  1WQ7 A;  5GAN 5;  3OS5 A;  4M7A F;  2CRE A;  4WF2 A;  1JJ2 S;  3NHN A;  4B9X A;  4BUG A;  4LD6 A;  1Z9Q A;  1PRL C;  4V2S A;  5LJ3 e;  2RHZ A;  1JU5 C;  2EGC A;  2F2V A;  4E6R A;  2RJD A;  4M75 C;  1RAE B;  5IN1 A;  2DFU A;  4DBF A;  3OYL A;  2CUB A;  2MI6 A;  2AKL A;  2DER A;  3MP8 A;  2JNG A;  1EX4 A;  1M1F A;  4ZTF A;  1K73 C;  2RO0 A;  3HKS A;  4RTW A;  4E7L A;  2XHC A;  2QQA A;  4M77 C;  3UA7 A;  2EFI A;  2QQR A;  3MP1 A;  2RH2 A;  1ZHI A;  4D8D A;  1AZE A;  2FRW A;  1YIJ T;  1ZUU A;  4PJO D;  2LQ8 A;  2OAU A;  1QP2 A;  3L2Q A;  1Q82 R;  5CK9 A;  4OB3 B;  2YUN A;  3OYC A;  4ZGJ B;  3S3M A;  3QXE B;  2LCC A;  1KQS A;  1M3A A;  2O01 E;  2D8H A;  2EYY A;  2X35 A;  2EAY A;  1U06 A;  4J6Y A;  2OTJ A;  2HQX A;  2LCL A;  1M90 U;  4JDS A;  3I55 A;  2VVK A;  3CPW S;  4C0D B;  3CME T;  4HCK A;  3LWI A;  1TG0 A;  2VB6 A;  1N9S A;  1VQL T;  2QEX A;  2COY A;  2VV5 A;  1BI1 A;  2DTH A;  3M0R A;  4JJB A;  3M55 A;  3OW2 A;  3DB3 A;  4C5H A;  1QVP A;  4E7J A;  2LQN A;  2F2W A;  2FO0 A;  4PJO G;  3TSW A;  4BY6 C;  3LWH A;  1UB4 A;  4C92 C;  2XU8 A;  1PD1 A;  5LJ5 h;  1VQO A;  3HFN A;  4C8Q C;  1W1F A;  4A54 A;  2LNV A;  2MK5 A;  3DB4 A;  1LCK A;  4LDW A;  2K5I A;  1XTD A;  1QKX A;  1CKA A;  1SHF A;  1U8R A;  1TSF A;  4E7Z A;  1QVG P;  3I55 Q;  2KR3 A;  1YJW A;  2K57 A;  4KUL A;  1FMV A;  2FPD A;  3I5R A;  3OSV A;  3JCM Q;  3SWN B;  3X20 B;  1QWE A;  1RAI B;  4ELZ C;  1BU1 A;  1BIA A;  1LOJ A;  4FM4 B;  3JCM d;  1FYN A;  2HZY A;  5HY6 A;  1I0C A;  4F7U B;  3JB9 J;  1NLO C;  4FW2 A;  5KH6 A;  4XU2 A;  1JBM A;  2E5Q A;  4PL6 A;  4E7S A;  5A0L A;  1GCQ C;  4N4G A;  3V8L A;  3EFR A;  3VJP A;  4XQ3 A;  3JB9 I;  4RTU A;  4C5G A;  3KUF A;  5GMK h;  1JJ2 A;  1IRX A;  5KCH A;  2EYX A;  2P0P A;  2RMO A;  4OML A;  1KC8 U;  2ATC B;  1UTI A;  1XQH A;  9ATC B;  3L2W A;  1UGP B;  4AMC A;  2QGG A;  2WSE E;  2L8D A;  5IHK A;  1OQK A;  2OJ2 A;  5KYY A;  1PCX A;  2P0K A;  3BY7 A;  1UE9 A;  1SF9 A;  4XU1 A;  5LL6 S;  3OMG A;  1KK7 A;  3H9N A;  2E10 A;  2F69 A;  4OMM A;  5L8R E;  3VKI A;  5GAN 4;  1WXT A;  2LTO A;  2QXF A;  1I07 A;  4FYW B;  3UWN A;  4IUP A;  1M2V A;  1YWO A;  2BUD A;  2D9T A;  1WA7 A;  5GAN 2;  2LNH B;  1Y96 A;  2HNI A;  1M3C A;  1W2B P;  3RMS A;  5KYU A;  2DRM A;  2DBK A;  4J9H A;  3G71 Q;  4M75 A;  1AWO A;  1VQ5 A;  2RJF A;  5IXF A;  4LNP A;  2G3R A;  2CP2 A;  4PJO C;  1R0C B;  3VUZ A;  3SEM A;  1PKT A;  2VC8 A;  5C6S A;  1N8R C;  2LQW A;  3G6E Q;  1Q7Y U;  3CPW A;  3CCQ Q;  1FX7 A;  4M7A E;  2M02 A;  1D3B A;  4R55 A;  2GNC A;  4M77 A;  1YJ9 T;  2KY9 A;  4M7D F;  3GF5 A;  2V1Q A;  4M78 G;  1QKW A;  5CKD A;  3VS6 A;  2LT4 A;  1MV3 A;  3P8H A;  1K4U S;  7AT1 B;  4QVC A;  2XK0 A;  1S1N A;  4Y91 A;  2AIR B;  4J6X A;  3RR6 A;  2CP0 A;  1YJN A;  3BE3 A;  4F7U F;  2RI5 A;  4HT9 A;  2ZAE A;  1EIF A;  1JO8 A;  2DEQ A;  2K5F A;  5GAN h;  2M0O A;  3OYH A;  2RHX A;  2VXE A;  4N4H A;  2ENM A;  3QZ5 B;  1UFF A;  4NS5 A;  3X25 B;  3I56 Q;  1VQ6 A;  4PJL A;  1NEG A;  1VQ5 Q;  3HL8 A;  3HRT A;  4BB7 A;  2ED0 A;  1G2B A;  3OQ5 A;  4J9D A;  3SD4 A;  2GGR A;  3EH2 A;  2VXF A;  1QP3 A;  1M3B A;  1IHV A;  4EPC A;  1H8K A;  1VQ9 T;  1PHT A;  1S72 A;  5FRN A;  1YI2 A;  2DA9 A;  1KJW A;  4C92 A;  4BDY A;  2WAC A;  1M90 C;  1IZ6 A;  2ECZ A;  4CC4 B;  4BE1 A;  3CCR Q;  2B86 A;  1YNZ A;  2P4R A;  2DLP A;  5GMK m;  4C8Q A;  3RDV A;  5KYY B;  1K73 U;  4JUV A;  4YTL A;  5FWC A;  2NUT B;  2E70 A;  3TRE A;  3VYH B;  2SEM A;  4RKU E;  4PNO A;  3TVT A;  4AT1 B;  3MO8 A;  4KH0 B;  1AWX A;  2K3Y A;  5GAM f;  3MEV A;  5FWB A;  2DVJ A;  3M59 A;  1VQN T;  3CCL Q;  3AT1 B;  1JEG A;  3H0I A;  2A3L A;  1MMN A;  4JS5 A;  1NLP C;  6AT1 B;  4KUD K;  2DKG A;  1ZSZ C;  2QA4 A;  1RAF B;  1EFN A;  1Y96 B;  2DIQ A;  5KYU B;  3GIB A;  2DD5 A;  2DTI A;  2H3E B;  3CC7 A;  2EKO A;  3EHQ A;  1QVF S;  3VYG A;  2HSE B;  3G71 T;  4M75 B;  4MDX A;  3EFO A;  4KH1 B;  1WFW A;  2HD0 A;  3OYI A;  4LDX A;  3CC4 A;  1BIB A;  1H64 1;  4KRT A;  2PVO B;  2NLU A;  1UDL A;  5J39 A;  4M75 D;  1VQM T;  3PVL A;  3ZBD A;  1GCQ A;  3NFC A;  1YI2 Q;  1K1Z A;  3G1J A;  3CCQ T;  1D3B B;  4RG8 A;  4IUQ A;  2YDL A;  2CP7 A;  4M77 B;  5CKE A;  3OYG A;  2K7A A;  2MIO A;  3OBY A;  1G3Y A;  2YRC A;  4IIM A;  1PC0 A;  4M78 C;  2W0Z A;  2R57 A;  3V7S A;  1M30 A;  5CAI A;  4LE9 A;  3JB9 H;  1KFZ A;  3VS4 A;  1X6O A;  3E1S A;  4BD3 A;  4IUT A;  2XKO C;  5GMK i;  3H6Z A;  2X4J A;  1G3W A;  2MPX C;  2EYW A;  1YIJ A;  2EJG A;  4HVW A;  4IUV A;  3A98 A;  3TSZ A;  3CC2 T;  2DO3 A;  1QWF A;  4A4G A;  5LJ5 e;  1UEB A;  1K9M C;  3V8K A;  3HPW A;  5GAM j;  1WPY A;  5AT1 B;  3HHT B;  2DET A;  1OZ2 A;  1KQS S;  3H0H A;  3O5Z A;  1BCM A;  5FRO A;  5A0G A;  3SB2 A;  1WGS A;  2CT4 A;  3NTH A;  2YWW A;  3VS5 A;  4PJO A;  3QO3 A;  4O6J A;  5GAO m;  4C92 B;  3CXC P;  3G4S T;  1VQ7 T;  3QYH B;  3X28 B;  4AFU C;  4C8Q B;  1G3T A;  2KVQ G;  2ABL A;  3OA6 A;  4QQD A;  2HL5 C;  3CCV Q;  1LJO A;  2Y4X A;  2R5A A;  2E3I A;  2CS7 A;  1KSW A;  5DLQ E;  1XJW B;  1PD0 A;  4JPB W;  4MDW A;  3CCU T;  1NJI U;  4JS4 A;  2X3W D;  2OTL T;  2I2L A;  2JS0 A;  4NL2 A;  4CC7 A;  3ZEH A;  1VQ8 Q;  2Y4Y A;  1UGR B;  2IVW A;  2X4X A;  2YSQ A;  3CCL T;  5GAM d;  3A8L B;  2O88 A;  1TH7 A;  3DLL A;  4JJC A;  2JMA A;  5GMK e;  3E2U A;  2DL5 A;  2L2P A;  1PSE A;  1Q7Y C;  2GCX A;  5HCK A;  3QBY A;  2LCS A;  1WJQ A;  3RER A;  4M7D E;  4QQG A;  1QVG S;  1TXQ A;  2FEI A;  3EFO B;  2K3B A;  4A63 B;  1YHQ T;  5GAO q;  2PUK B;  1GCP A;  4QQ6 A;  3O8V A;  1BI2 A;  3M0P A;  4M7A G;  2CSI A;  1KC8 R;  4J83 A;  3R6N A;  4F7U E;  1AD5 A;  3URG A;  5HK0 A;  3E19 A;  4NOY A;  1RI0 A;  5CO7 A;  1VQK A;  1KHI A;  2RF0 A;  2HAX A;  1LNX A;  2FPF A;  3M58 A;  2OAW A;  3EH1 A;  2DK3 A;  2ZGW A;  1VQP Q;  3UA6 A;  1ZA2 B;  1IB8 A;  1WHL A;  2BZ8 A;  1PG5 B;  3VS2 A;  1BBZ A;  3M53 A;  5A0D A;  1XNI A;  2DXT A;  2JXB A;  3CCM T;  4PJJ A;  3VUB A;  3I9Q A;  1TU0 B;  2DXC A;  3UDC A;  3ASK A;  1MMA A;  1W70 A;  1VQ4 Q;  1PRM C;  1H3Z A;  3M5A A;  3JCM f;  4JLG A;  2DTO A;  1UGS B;  2KT1 A;  2XMF A;  2RK1 A;  3JB9 F;  5CR2 A;  3A1P A;  1KD1 U;  1QMC A;  1ZSZ A;  3M0S A;  2HBP A;  2COW A;  2A36 A;  3PMT A;  2QG9 B;  2FYK A;  2YUO A;  1M8V A;  3TU4 K;  3CEY A;  2MOX A;  1SG5 A;  1Q7Y R;  1Y0M A;  5HKC A;  1OPL A;  4PJO B;  2D8J A;  4FL6 A;  1VQK Q;  2DRK A;  2DYI A;  1C6V X;  2HCK A;  1MV0 B;  4J5Y A;  5GAN e;  2EQM A;  1W2B S;  2J6K A;  2E64 A;  1UJY A;  4R56 A;  3C94 A;  5LJ3 g;  1HJD A;  5I21 A;  3M56 A;  4DBH A;  2L3S A;  4M78 A;  1N9R A;  4F17 A;  3LX7 A;  4KGV B;  5KYW A;  1D1B A;  1ZQ1 A;  1NBE B;  3PTA A;  1D0Z A;  4JRQ A;  2K3X A;  3OS1 A;  1SHG A;  4HCZ A;  3GLX A;  4EMK C;  1B3Q A;  4CC2 A;  2DMO A;  2PU9 B;  1WHJ A;  4RTX A;  3RES A;  4J9E A;  4LUD A;  1OPK A;  3ZL7 C;  4DOW A;  3HSB A;  5GAN g;  8AT1 B;  2QAS A;  2MWO A;  2RJC A;  1YIT A;  3BFM A;  3QJY A;  3LW5 E;  3OY9 A;  4C5E A;  4BE2 A;  1SEM A;  4Z88 A;  2XD0 A;  1E7O A;  2GFU A;  1B34 A;  4AG2 C;  2KYM A;  3NPF A;  2COZ A;  1ACM B;  1OYX A;  3JSC A;  1WIE A;  3E9G A;  4M7A C;  3C4S A;  3L2Z A;  4PLL A;  3CMA A;  3JCM P;  2EJ9 A;  2DL4 A;  1K0X A;  2LX7 A;  1D0X A;  1OZ3 A;  4QT7 A;  1K73 R;  3CCJ T;  2EYZ A;  4XTX A;  4C0Z A;  1QVG A;  3OB9 A;  3NTI A;  2RNA A;  1QLY A;  2OTJ Q;  2DXB A;  1UUE A;  1VQ9 A;  3M0U A;  3CD6 T;  3QDF A;  4B9W A;  4WTO B;  2C0I A;  3JCM W;  1AHJ B;  4UC4 A;  2DF6 A;  4A4E A;  2QEX Q;  2WSC E;  2KSS A;  2EQI A;  2K9G A;  1D0Y A;  1ZSZ B;  2EWN A;  2DPP B;  5DY9 A;  1C1A A;  3EFS A;  1GFC A;  1V76 A;  5J26 A;  2A08 A;  3RMQ A;  1WQW A;  2CSQ A;  2JTE A;  1D1A A;  2RK2 A;  2ROT A;  4CI0 C;  1LVK A;  1VQN A;  5DLO A;  1X75 C;  3H0F A;  4M7D D;  4XTV A;  3CCS A;  1X01 A;  2LJ0 A;  1UJ0 A;  1Y71 A;  2HKN A;  1VQO Q;  2L5Q A;  2KMT A;  4J9C A;  1NJI C;  1K9M U;  2BE9 B;  5M9O A;  1R77 A;  3QHS A;  2D0Q B;  2M16 A;  2KYB A;  2HQH A;  2P4T A;  2JM8 A;  2YRV A;  2GBQ A;  4EMH A;  3L1A A;  2LX9 A;  4J7I A;  1Q86 U;  2RQR A;  1A0N B;  4M78 B;  1YJW Q;  2JTF A;  4JZ4 A;  5KYW B;  3GNG A;  4M77 E;  1UHF A;  1VQM A;  4O5V A;  1ARK A;  2GF7 A;  1M5Q 1;  4M78 D;  3CBP A;  2HMA A;  5EC7 A;  1GL5 A;  4J6W A;  2JW4 A;  3FRN A;  1WJS A;  2RPN A;  2CGH A;  2PZ1 A;  2CH4 W;  4OB2 B;  3M9Q A;  1W2B A;  5GAN 3;  8ATC B;  2LVM A;  3FDR A;  4J9B A;  2J05 A;  4HCC A;  2EPD A;  4M7D G;  2F5K A;  2D6F A;  3CCE A;  5IHN A;  2WSF E;  5CCA A;  1QQJ A;  2KRO A;  4PKC C;  2ZPE B;  2DIL A;  2RQU A;  1B34 B;  2DAQ A;  4DA4 A;  3H8Z A;  4HVU A;  5A2Q E;  2C06 A;  2QTX A;  5GAO n;  3MPU B;  2FVU A;  4F7U G;  3CC2 A;  5ECA A;  4JJD A;  2EKH A;  1FMK A;  2X9H A;  2X4W A;  2O31 A;  1IRE B;  3ZFJ A;  4LD9 K;  4KBM B;  4JRP A;  2V8J A;  1IO6 A;  4PFP A;  1V29 B;  5IXB A;  2RQW A;  2FG0 A;  2J06 A;  2L3Q A;  1ZUK A;  1BKB A;  4ZGE B;  2A28 A;  3RNJ A;  1CSK A;  1JRI A;  1NJI R;  3THK A;  1I4K 1;  4VUB A;  1KD1 C;  3JCM V;  4EIK A;  3AHU A;  3I55 T;  2EYQ A;  3OS2 A;  3EG2 A;  3CXC S;  3G4S A;  1VQ7 A;  1O9S A;  1U1S A;  2J6O A;  5FLX E;  1SRL A;  2KK4 A;  1HXD A;  5FU7 B;  1ZA1 B;  1RLQ C;  1WHK A;  3KFV A;  2JT4 A;  2ESW A;  3SFM A;  5GAO l;  1X27 A;  4EMK A;  2CZ6 B;  1W6X A;  4RTY A;  3S6W A;  3CCE Q;  3QKJ A;  4QVZ A;  3X24 B;  3M0T A;  1VOM A;  2IG0 A;  3CCU A;  4N0A C;  2ZPH B;  1QW1 A;  4FT4 A;  2FHD A;  4C0D C;  1BB9 A;  4OVA A;  4JJN K;  2KXC A;  2CKK A;  2KEA A;  5KYN A;  4DBQ A;  2JN0 A;  3CQT A;  2EJF A;  4M7A A;  5J3B A;  3RKW A;  3JCM X;  3VRY A;  4Z02 A;  3TQ7 P;  1WJR A;  1MNE A;  2VGM A;  3JCM c;  4ZN1 A;  1N8R R;  1TUC A;  3JCM h;  4PLI A;  3RUX A;  1YHQ A;  2YT6 A;  2ZPB B;  1UHC A;  2EBP A;  1YJN Q;  1G3S A;  2A7Y A;  1U3O A;  3MKD A;  2XIC A;  1RAG B;  1RAA B;  4JRK A;  5CIU A;  5I2M A;  4XTY A;  1HYO A;  1PKS A;  3RKX A;  2DVE A;  2L3R A;  2GTO A;  2M1H A;  2K6D A;  1M2V B;  3A8G B;  1GBQ A;  1OOT A;  2O9S A;  4OB1 B;  1VQ6 Q;  3PFS A;  4N4I A;  3OS0 A;  4J9G A;  1M9S A;  4M7D C;  4K11 A;  2E4H A;  3FB9 A;  3FC3 A;  3HRU A;  4L59 A;  1PM3 A;  1E6H A;  3RIR A;  3SWN C;  4XU0 A;  2XDP A;  3L2V A;  1QCF A;  4D6W A;  1RAD B;  2R58 A;  2CZ7 B;  3NTK A;  3EGD A;  1I81 A;  2AZS A;  2E6N A;  4DOV A;  2CUD A;  1S72 Q;  1K0S A;  4IUR A;  5GJV B;  3G6E T;  4BI4 A;  3PNW C;  2NYS A;  4XTU A;  1GXI E;  1OV3 A;  2L3P A;  4QW2 A;  3OYF A;  3LH5 A;  4RMO A;  3PMI A;  1I8F A;  3M4G A;  4FW1 A;  1NPR A;  2FRY A;  1UEC A;  1M90 R;  1WZO A;  3N5B B;  3DLM A;  1GRI A;  4GY5 A;  5CQX A;  5GAN 8;  2E12 A;  4PK4 A;  2P84 A;  5FU6 C;  2QA4 Q;  3FJP A;  2K5L A;  4L6V 5;  3QSU A;  4OMN A;  4DEY A;  3R6O A;  3Q1J A;  3CC7 Q;  2EIF A;  2LQK A;  1KG1 A;  3QG1 A;  4BDZ A;  3I56 T;  3LH0 A;  5C0M A;  4LDU A;  1I1J A;  3CC4 Q;  1VQ5 T;  3CBO A;  4AFQ C;  2SRC A;  4F16 A;  4FSS A;  2RN8 A;  1YCS B;  4Y28 E;  4FYX B;  1ABQ A;  4PJN A;  2V1R A;  1Q86 C;  3WXM B;  3QWY A;  5L23 A;  2DZ9 A;  3CXC A;  3CME A;  4HCB A;  3FIF A;  4XK8 E;  2VAS A;  5IAY A;  1VQL A;  2RM4 A;  4BY6 B;  4M7A B;  4FYY B;  4AG1 C;  1U1T A;  1U5S A;  1KQ1 A;  3MCA B;  2JM9 A;  3CCR T;  2D1X A;  2X4Y A;  2LJ3 A;  4E47 A;  4M7A D;  2F1L A;  1ZLM A;  5LJ5 g;  1M1K C;  5FRM A;  4JRI A;  3MET A;  4IKF A;  2X3X D;  1D1C A;  2E6Z A;  2HQE A;  2GTJ A;  1YIJ Q;  3EG9 A;  3S3N A;  2LC4 A;  2LT1 A;  1BCO A;  4M75 F;  2MF2 A;  3CCJ A;  1VQ6 T;  1RL2 A;  1M8M A;  5LJ3 f;  2VGN A;  2K2V A;  2ZZD A;  1YCY A;  4BI3 A;  3JCM J;  2EQU A;  2E1H A;  1G8X A;  1JXO A;  4M77 F;  3CD6 A;  5LJ5 d;  2RHI A;  2DZC A;  5IH2 A;  2E5K A;  4N0A A;  2V8K A;  5GAN 7;  4P5N A;  1VQL Q;  1K9M R;  1DJ7 B;  3NGP A;  1YI2 T;  3MEU A;  2ZCF B;  2FZG B;  3NMZ C;  3UT1 A;  4Z8A A;  3SHW A;  1VYT A;  3F70 A;  2JMC A;  5GAN f;  2HL3 A;  2LP5 A;  3VS3 A;  1Q86 R;  4ESR A;  3JB9 G;  1SRM A;  1Q82 C;  1M2O A;  2DL7 A;  2JS2 A;  1ZBX A;  4X9D A;  2NUZ A;  2C0O A;  3OYK A;  3GP8 A;  2X51 A;  3EG3 A;  1I5L A;  3VU3 C;  1MMD A;  4FYV B;  2YXY A;  2PUO B;  4L5G A;  1X6G A;  4OMO A;  3OYB A;  2PQW A;  3A8O B;  1V1C A;  3FLG A;  1BK2 A;  1X6B A;  1M27 C;  2M0Y A;  3QYG B;  1NYG A;  2G6F X;  2ZPG B;  3HFO A;  4X9C A;  2P0Q A;  3S3O A;  1OI1 A;  2CZ1 B;  3CC7 T;  1MGQ A;  1QVF P;  2JZ2 A;  4D8K A;  4C92 F;  2QDY B;  1H3H A;  4F04 B;  3CC4 T;  4M7D A;  4C0F A;  2K4Y A;  3KBG A;  4ANJ A;  3PVQ A;  4C8Q F;  3SWN A;  2L0A A;  3V7C A;  1SPK A;  3EHR A;  2QI2 A;  5LJ3 j;  1JXM A;  4A4H A;  2RQT A;  4F7U A;  4RUG A;  4XU3 A;  1Q81 U;  1D09 B;  4OMF B;  2XID A;  1I5O B;  5KE2 A;  3ER0 A;  4OB0 B;  4FU6 A;  2ROL A;  4M4Z A;  4QKU A;  1IHW A;  3CCV T;  2YRD A;  4QVD A;  3UAT A;  5GAO p;  2DIG A;  1WXB A;  3RKY A;  3EG9 B;  4HKE A;  4OMP A;  1X43 A;  1VUB A;  1VQ8 T;  5GAN j;  2QYZ A;  2KBT A;  4MML A;  1G5V A;  4IUU A;  1TUD A;  5I11 A;  1X69 A;  1YJ9 A;  2MYS A;  3UPU A;  2KI7 A;  4OGE A;  1IGQ A;  1RLP C;  2RI3 A;  5IHI A;  1MMG A;  1YBY A;  2V8I A;  4GLK A;  3EGX A;  2QTV A;  1KQS P;  3PE0 A;  1X2K A;  5LJ3 d;  3JRZ A;  3M54 A;  2MWP A;  3JCM e;  1RUW A;  4X34 A;  3ULR B;  4A4F A;  3UF4 A;  4RG2 A;  5D7U A;  1KIK A;  3M4Y A;  2YUP A;  5GAM h;  1UGV A;  1K8A U;  1T3S A;  3OYY A;  3KXT A;  1XOV A;  4BAC A;  4C5I A;  4MZT A;  1VIE A;  3OW2 P;  1VQP T;  2HBW A;  3DKM A;  2D0N A;  5GAN d;  1WYX A;  1OX8 A;  2DYB A;  2JVV A;  2NWM A;  1SSH A;  1J3T A;  5IT9 E;  4XAX B;  3JCM g;  1TTH B;  1BI3 A;  1YJ9 Q;  1ZBJ A;  4KT0 E;  3PIP A;  1UG1 A;  1KQ2 A;  1RAB B;  3EGU A;  2KRN A;  1ABO A;  1VQ4 T;  2KE9 A;  4X1V A;  2K2M A;  3MJX A;  1B7T A;  3X26 B;  4A4K A;  1YIT Q;  2GFA A;  3OYD A;  2RI2 A;  2DM1 A;  1W4S A;  4PJO F;  5CQY A;  4ZTJ A;  3JV3 A;  2E65 A;  4LUE A;  5GMK l;  4M7D B;  2RJE A;  4CRI A;  4Y92 A;  1M1G A;  2RHY A;  1VA7 A;  2BIV A;  4ORZ A;  1N27 A;  2FPE A;  2K79 A;  2PTK A;  4E7K A;  2DX1 A;  4J9I A;  1NPP A;  3QUI A;  3CMA Q;  1Z9Z A;  2DJQ A;  4ATO A;  2MMP A;  5D6Y A;  3C95 A;  3CBM A;  2F2X A;  2AKK A;  2CH4 A;  2RQV A;  4GLM A;  1VQK T;  1FXX A;  4M75 E;  1AVZ C;  4KGZ B;  1TWB A;  2JUF A;  2AZV A;  3G71 A;  2BE7 D;  1VQ9 Q;  2VKN A;  2CYZ B;  3C12 A;  3JCM b;  3G6E A;  5DM7 R;  1TS9 A;  3CCQ A;  3GPL A;  2YLC A;  3RBB B;  1FWZ A;  1JJ2 P;  2XI9 A;  2NUP A;  1CKB A;  3C0C A;  4R0K A;  4FSX A;  1M1K U;  4LN2 A;  5FU6 B;  3OYN A;  1K9A A;  2NUT A;  3QWX X;  3J81 E;  1AZG B;  4LXC A;  4EMG A;  4MZP A;  4F14 A;  2PVG B;  4IIO A;  3EGX B;  2LJ1 A;  4HT8 A;  2RD1 A;  1NYF A;  1VQN Q;  1C0M A;  3SDZ A;  4JZ3 A;  4FT2 A;  3I5S A;  3CCS Q;  4XTZ A;  3M0Q A;  1ZX6 A;  4MMK A;  2OX7 A;  1WHM A;  1T3L A;  2CDT A;  4J7F A;  3QJ6 A;  4RCB A;  2KAF A;  5CKF A;  1YN8 A;  3G7Z A;  2H3J A;  4LDY A;  3E9F A;  1KHC A;  2O2O A;  3I35 A;  3WVD B;  3JAM E;  1TUG B;  5I2S A;  2KRM A;  2R5M A;  2XDD A;  2EVR A;  1IGU A;  3I56 A;  3LGF A;  4E7H A;  5CKB A;  4DBR A;  1VYU A;  1YFN A;  1NG2 A;  1JB0 E;  5CVI A;  1VQM Q;  1WX6 A;  4C92 E;  1T0J A;  5KCO A;  2OTJ T;  3P8B B;  4PJM A;  1F1B B;  2E3H A;  5D6X A;  5LJ3 h;  3HRS A;  3L42 A;  4MZM A;  4C8Q E;  3CPW P;  1N6A A;  3D7S B;  1RAC B;  3ME9 A;  3L2R A;  1E6G A;  2EQK A;  4HA8 A;  2DE0 X;  1OX9 A;  1K76 A;  3QZ9 B;  2QEX T;  1Q82 U;  3CCR A;  1WHH A;  4TVR A;  3PIO A;  1QCN A;  5AYF A;  2QAZ A;  4BE0 A;  2CT3 A;  1YIT T;  2CZ0 B;  1RI9 A;  3TCJ A;  1MHN A;  2V26 A;  2IIM A;  1YP5 A;  1Q81 C;  5GAN 6;  3QPH A;  2OTL A;  2XDB A;  2O4X A;  4JLI A;  3CCL A;  2IPO B;  4OMQ A;  3CC2 Q;  2JJ9 A;  1OUL A;  3CMA T;  2EGA A;  3M57 A;  2FL7 A;  1VQO T;  4M78 F;  3U23 A;  1HD3 A;  2LDM A;  3VS1 A;  3A8H B;  2ED1 A;  4PFO A;  2GQI A;  2CP5 A;  2Y90 A;  2L89 A;  1GFD A;  2I0N A;  1WXU A;  4J8O A;  2M51 A;  2GQV A;  4OP0 A;  1UGQ B;  1YJW T;  2JTM A;  2CP3 A;  1P92 A;  2BTT A;  3G4S Q;  1VQ7 Q;  2QDL A;  1R0B G;  4C0G A;  5GJW B;  3MHX A;  2NUP B;  2MAM A;  1H92 A;  2DBM A;  3LYI A;  2HKQ B;  2VUB A;  3OYA A;  1KD1 R;  2LRQ A;  2DJZ A;  2O9V A;  3QDR B;  3CCU Q;  3A5Z B;  5LJ5 f;  5CKH A;  3BDU A;  1NM7 A;  2DL3 A;  2OTL Q;  1VYV A;  1K8A C;  2YHT A;  2HEQ A;  3CCM A;  3IQL A;  4KGX B;  3LGL A;  3CCS T;  1SSF A;  3MP6 A;  1N5Z A;  2YLB A;  2ZPF B;  1JQQ A;  4AFS C;  3V8J A;  1NZ9 A;  2FZC B;  5FW9 A;  4HXJ A;  3OYJ A;  2LMJ A;  2DD4 A;  3HTR A;  1Q81 R;  4FIB A;  2QQS A;  3BW1 A;  2LZ6 B;  1Q95 G;  2W10 A;  1BYM A;  3WVE B;  1YHQ Q;  5KYX A;  1IXD A;  2A37 A;  1R8O B;  3EG0 A;  1PSF A;  1T0H A;  4ZGD B;  4PJO E;  1AWJ A;  4OF1 A;  4ELY C;  2Z0W A;  4A53 A;  2KXD A;  2KT8 A;  4ME7 A;  2BKD N;  1OEB A; 
#chains in the Genus database with same CATH homology
 3CME Q;  1KD1 R;  1W2B P;  1VQK Q;  1N8R R;  3CMA Q;  1VQ6 Q;  1VQO Q;  3CC4 Q;  1VQL Q;  1K9M R;  3OW2 P;  1VQN Q;  3CD6 Q;  1QVF P;  3CCU Q;  3G71 Q;  1Q81 R;  1Q82 R;  3CC2 Q;  1YIT Q;  1KC8 R;  3CCS Q;  3CCV Q;  2OTL Q;  1YJN Q;  2OTJ Q;  1JJ2 P;  1QVG P;  3G4S Q;  3I55 Q;  2QA4 Q;  1VQ7 Q;  1VQM Q;  1NJI R;  1YHQ Q;  3CCL Q;  3CCE Q;  3I56 Q;  1M1K R;  1VQ4 Q;  1Q7Y R;  3CCJ Q;  3G6E Q;  3CCQ Q;  1YIJ Q;  3CXC P;  3CCR Q;  1YJ9 Q;  1Q86 R;  1K8A R;  1VQ5 Q;  1VQ8 Q;  3CC7 Q;  1VQP Q;  1YJW Q;  3CCM Q;  1KQS P;  2QEX Q;  1K73 R;  1S72 Q;  1YI2 Q;  1VQ9 Q;  1M90 R;  3CPW P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...