1S72Q

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1s72Q00
1VQOQ 2QEXQ 1YITQ 1K8AR 1VQ8Q 1Q86R 1KQSP 1QVFP 1K73R 1VQ9Q 3CCSQ 1Q7YR 3CCVQ 1M1KR 1VQLQ 1N8RR 1YI2Q 1KC8R 1VQ7Q 1YJ9Q 1NJIR 1JJ2P 1YJWQ 3G71Q 1QVGP 3CCEQ 1VQMQ 3I56Q 3CCUQ 1YJNQ 3CCJQ 1KD1R 1YHQQ 1VQ4Q 3CD6Q 3CCLQ 1VQ6Q 3G6EQ 3CPWP 1YIJQ 1K9MR 1VQKQ 1VQNQ 3CC4Q 3OW2P 2QA4Q 3CC2Q 1VQPQ 2OTLQ 1Q81R 2OTJQ 3CXCP 3CCMQ 3CCQQ 1Q82R 3CC7Q 3CCRQ 3CMAQ 1S72Q 1M90R 1W2BP 3I55Q 3G4SQ 1VQ5Q 3CMEQ
chains in the Genus database with same CATH superfamily
1M90U 1AWOA 1UJYA 1BI3A 4M77E 2CP0A 1KK7A 2E4HA 2V8JA 4IUQA 5LJ3e 2KYMA 1OU8A 2FHDA 4M7AF 3OYDA 2OTJQ 5D6XA 3MEVA 3CCQQ 4FYYB 1Y71A 3CCUT 4JJBA 2C06A 4M75A 4Q5WA 5GANh 1KC8R 2DVJA 3A1PA 2H8HA 2JTMA 4OB1B 1M1GA 4C5HA 1Q86C 3VS5A 4PJOD 3PNWC 3ZEHA 3NTHA 1QCNA 5I22A 3P8BB 1YITT 5A0DA 2A37A 1BKBA 5KYUA 1H8KA 2FPDA 5EG2A 2W0ZA 2L2PA 3META 2PNIA 4NS5A 1X75C 2CP3A 2HKQB 1HJDA 3MP6A 3NTIA 1VUBA 2LNVA 1W70A 4CC2A 1QVGP 4RTYA 1GFDA 1WA7A 2LT1A 4J6YA 2QA4A 4J9FA 3SDZA 3S3NA 3VS0A 3M4YA 1M30A 5GAOm 2GF7A 2E5KA 2X3XD 3EG3A 2KR3A 3OYIA 4R56A 1QWFA 4JLGA 3JB9G 1K76A 2L3QA 4M75E 5GAOq 4DBFA 3QWXX 2EGEA 3G71A 4RTXA 3CCVQ 2XDBA 3UDCA 1IZ6A 1BI2A 1AT1B 1QVGA 3HKSA 3X25B 4A4KA 2QDLA 3LH5A 4OMQA 5J26A 3OYLA 1T0HA 2QEXT 3QYHB 3NMZC 1M2OA 2HD0A 2QTVA 1MMAA 3EHQA 3JCMQ 5I2MA 1B34B 2ZCFB 1WLPB 1X01A 1IGUA 1TH7A 3BDUA 2D6FA 2HNIA 4KT0E 2KXDA 1YJWA 4XTVA 4ZN1A 1KG1A 2DJQA 1AWWA 5A0GA 4XTXA 2K2MA 2A7YA 4Z02A 1K73U 2EQKA 4M75G 1UHCA 5KYXB 1Q7YU 1MUZA 4ZN3A 1YIJA 6AT1B 5A2QE 1ZHIA 3LGLA 2BUDA 1NEGA 2DNUA 5LJ5j 2H3JA 4M7DD 3DB3A 5FU6C 2OJ2A 3HRUA 4IURA 4N0AC 1UB4A 2CZ1B 2PUOB 2JT4A 4PL6A 1VQ9Q 4C8QB 4CC7A 3EFSA 3NPFA 4PJJA 1D3BA 4ANJA 2QASA 1BBZA 2BKDN 5KYWB 2H3EB 4M7AC 1GCQC 1PD0A 2DMOA 2V1QA 2XG8D 4UC4A 1ZBXA 2KYBA 4C0DC 5HCKA 1VIEA 3G1JA 4PJOF 1M3BA 4HCZA 2HQXA 3FB9A 5IH2A 1VQ4T 3S3MA 4JRQA 4PJNA 1WZOA 1TTHB 1U3OA 2F5TX 4HT8A 1G5VA 3OYKA 4MDXA 5IN1A 2CDTA 1RAAB 2F1LA 2K7AA 2E3HA 5KH6A 3I9QA 2WSEE 2KMTA 4BE1A 1VQ5T 1I8FA 5ECAA 3G4ST 2KVQG 3M58A 4M77D 4XTUA 2PU9B 2DJZA 4OMPA 1VQLT 2DTIA 2QQ9A 5GAMj 1U1TA 4R0KA 2W10A 4ME7A 5KCOA 4M4ZA 4IUPA 1SRLA 4XAXB 5CQYA 2EYXA 4A4HA 4AG2C 1YN8A 3CCJA 3VUZA 3X28B 2F5KA 3ME9A 1X43A 4YTLA 3JCMg 3CPWS 4RG2A 1QKXA 1WHMA 2BE7D 1VQOT 1G3YA 2F2VA 2JW4A 1ZSZA 2YUNA 2DYIA 1N8RC 2RN8A 2FO0A 3I35A 2DKGA 1M2VA 1YJ9A 4QW2A 2K5IA 3VV0A 2LCLA 4BE2A 5GMKi 1FMWA 1U06A 2NUPB 2COWA 1PKTA 3C0CA 5GANf 2J05A 5FRMA 3IQLA 2AKLA 4Z89A 1JJ2P 3NFCA 4BY6B 3OQ5A 2JNGA 3MPUB 4LN2A 2X51A 4AT1B 5GAN8 2XDPA 2FRWA 3JAME 3VS6A 2QEXA 1QMCA 4M7DF 4M75D 3C94A 1QVGS 4C92A 2FPFA 4JRKA 3M55A 2RJDA 1Q81C 3PVLA 4X1VA 1JJ2A 2HQEA 4PLIA 1LOJA 2VGMA 1M1KU 2A28A 1SSHA 4J9DA 9ATCB 1K8AC 1SSFA 4IUTA 3MEWA 1O9SA 3A8LB 3BY7A 2JS0A 4Z8AA 4J6XA 1NJIC 1WGSA 3JB9J 2V8IA 1PRLC 2CH4W 3QJ6A 1SEMA 4FIBA 3CMAQ 2RJEA 1AZEA 4IIOA 1X6BA 5DLQE 2M16A 2MPXC 3L2RA 2VVKA 2YSQA 1PM3A 3OYJA 2L89A 4PJOC 2OTLT 1N8RU 1M3AA 3ZFJA 3C4SA 1GBQA 2RHYA 3MP8A 4M75B 1IGQA 5FWCA 4M77F 4K11A 3BW1A 3H9NA 3QKJA 1U1SA 1M8MA 1WHHA 2CZ0B 4C92E 3AT1B 4J8OA 1RAEB 4J9EA 2VB6A 1Q86R 2ROTA 2CZ6B 1ZUYA 1OOTA 4BI8B 3DLMA 1NM7A 4Y28E 2VYTA 3G6EA 1SF9A 5KYUB 1QCFA 5GAN3 3CEYA 5GAOn 1UGRB 1RADB 3VYGA 5LL6S 3VS1A 1D0XA 1XJWB 1KHCA 1VQ5A 2KRMA 1WJRA 3RUXA 3QSUA 4ATOA 2YUOA 4CI0C 3EG2A 2D9TA 2QYZA 4A54A 1E6GA 4O6JA 4C92G 3G71Q 2QGFB 3E2UA 4PFZA 2HCKA 3LWIA 3SWNC 3J81E 1HYOA 4HCKA 3OBYA 2RQVA 1KC8C 1D1BA 2BTTA 5CK9A 2M02A 4JUVA 1ZX6A 2JOYA 4LD6A 4F7UA 1RABB 2EW3A 2I0NA 3VS4A 4D8DA 1IHVA 4M75F 3HL8A 2KRNA 2RQRA 4BDZA 2EBPA 1YIJQ 2HDAA 2HL5C 5CKFA 2IPOB 1V76A 3UA7A 4E7JA 3I56T 2K5LA 2XICA 1JU5C 3CMEQ 1VQ6T 2DBMA 1YI2Q 3JCMc 3CBMA 1D1AA 5GANe 2RI3A 1AEYA 1MGQA 4JS4A 2ZPFB 2OAUA 3C95A 4NL2A 3OW2P 3PMIA 2A08A 1OZ2A 1QLYA 3EFOA 4BE0A 4F7UE 3J7AF 1ZQ1A 2C0IA 1E7OA 2HSEB 1BI0A 1PD1A 3PFSA 1RL2A 1JO8A 3OB9A 3CCUQ 1KC8U 4FU6A 2PZ1A 3E9GA 3CCST 2RI5A 1RLQC 1FMKA 3M0UA 1ABQA 1YJNT 4AFZC 4C5IA 3QXEB 4LUDA 1YITQ 2LZ6B 3V7CA 5GMKm 2RK2A 5IT9E 4F7UG 3PIOA 1I4K1 1MMNA 2QI2A 3OBWA 2AZVA 1MHNA 3OYEA 3GPLA 2AHJB 2RJCA 3L1AA 2RHIA 2EJFA 4B9XA 2E70A 4BI3A 4DEYA 3CCET 4C0FA 1AVZC 3BFMA 1UECA 4C92D 2CT4A 3MO8A 4KGXB 4WCIA 5GMKj 1ZSZB 2O4XA 4MDWA 2LRQA 3I5SA 4RCBA 5DY9A 2YRVA 3JB9I 2DXTA 3OYMA 1KIKA 3L2UA 1M2VB 4MZPA 3SWNA 3EG1A 1FX7A 1G3WA 3MCAB 2E3IA 4FL6A 2QEXQ 4LDXA 2E1HA 3ZBDA 1A0NB 2DTOA 4M78D 2JTEA 5IHKA 3WVEB 5AT1B 4F04B 1YHQQ 1K9MR 4C92B 4EPCA 2WACA 1Q81R 2EAYA 4HT9A 3OMGA 1KHIA 1X27A 4QVCA 1K8AR 4EMKA 1MV3A 2DXCA 2L3PA 3I56A 2K6DA 4MZTA 3JCMX 2G6FX 1NJIR 1T3LA 1ABOA 2O9VA 1I0CA 2EVRA 5GAN6 4JJCA 4MZMA 2PVOB 5C6SA 4C5GA 2O01E 5CO7A 2ED0A 3CXCP 2EPDA 1B07A 1VQMT 2L8DA 1M27C 2J6KA 3V8LA 8AT1B 4L6V5 2R5AA 2M51A 4FYVB 2WSFE 1R8OB 4XK8E 1Y07A 3EG9A 1N27A 2YDLA 1VQ4Q 4C0DB 1BB9A 5CQXA 1SHFA 4PFOA 1W6XA 2M1HA 2RQWA 3D7SB 2ECZA 2P0KA 2QXFA 4ZGEB 3CCSA 3OYGA 5CKDA 5FLXE 3G4SQ 3JCMe 2LJ1A 3HP9A 1KQSP 3SEMA 4OMOA 1VQLQ 1YJNA 4C92F 2J6FA 1TOVA 3M0QA 4QQ6A 2KT8A 1T3SA 4Y91A 2E65A 2ED1A 4AG1C 1AZGB 2K9GA 1MNEA 1PG5B 2YLBA 4C0ZA 3L42A 4LDVA 4R55A 4LDYA 1GL5A 4KGZB 2FZCB 2YHTA 1VQOQ 3H8ZA 1NPRA 2DO3A 4PJMA 3QDRB 3EGDA 3CCEA 4FM4B 2E6ZA 2V8KA 4CC4B 1K0XA 4OGCA 2RQTA 4M78F 2HZYA 2ABLA 2P84A 4C0GA 1G8XA 3VKIA 2B86A 4F7UB 3M56A 3V7SA 3L2VA 1OX8A 1S72Q 5FWBA 2P0QA 3EH2A 4BD3A 5IXFA 3CCLT 3CCJT 5GAN5 1QP2A 1UGSB 4PFPA 3JCMW 3M0SA 4DOVA 1N9RA 2X4JA 1ZSGA 5C0MA 3M0RA 5DLOA 2ESWA 1AD5A 5GAMd 1M1FA 1YJ9T 2MWPA 1H3HA 2XU8A 1X6GA 2CH4A 4DOWA 2QTXA 1UGVA 1TXQA 4PJLA 4EMGA 3PGGA 4C8QD 1X2KA 3EFOB 4C5EA 5FW9A 2ATCB 4JZ3A 3M0PA 1AOJA 3TQ7P 1BCOA 3PIPA 5KE3A 1IB8A 4LXCA 2ENMA 2OTLQ 1Q82R 4J9BA 4FW2A 2CREA 3DKMA 3HHTB 3J80E 1VQMA 3H0IA 3CC2T 4F7UF 5J3BA 1G83A 1Q86U 3CCRT 1GBRA 3QO3A 2PVDB 4HKEA 4J9IA 1VQ8T 3PVQA 3RKWA 4JS5A 1RAIB 2LQKA 2A0FB 2DVEA 1VQPQ 2EYQA 1I5LA 3I55Q 1YNZA 5HKCA 3FJ5A 3UT1A 4RCCA 1C6VX 3NHNA 3RKXA 2RHZA 3QYGB 5CVIA 1SRMA 2XMFA 1AHJB 3P8DA 1IXDA 5LJ3j 2KDSA 1ZUUA 1G2BA 1WXTA 4QT7A 2LP5A 1RI0A 1E6HA 2L3RA 5KE2A 1KFZA 2JMCA 1HXDA 2GBQA 1O75A 4M78C 1QCOA 2EQJA 2EQUA 3A8GB 2O4XB 1TSFA 3G6ET 3CBOA 2VXEA 2DRMA 5CAIA 2K79A 4KBMB 3SWNB 4DQ2A 4ESRA 3FLGA 3QHSA 2RHXA 4XU2A 1P92A 3NTKA 7AT1B 2L3SA 2MF2A 3HPWA 1DJ7B 2PTKA 4QKUA 3CC7Q 3LH0A 2EYZA 3MJXA 1MV0B 1D1CA 3M53A 1T0JA 2JS2A 3CCLA 2A3LA 2DL3A 1VQ6Q 4RTUA 2DD4A 2LT4A 3JB9D 2XK0A 4OP0A 2NUTA 4C8QF 3SD4A 4EMKB 3KFVA 2HBPA 1M9SA 5GAN2 3JCMh 1KSWA 1FXXA 1K0SA 2BZ8A 2JM8A 2PQWA 4J6WA 2DZ9A 4LD9K 4D8KA 5LJ5g 4L59A 4BUGA 3P8HA 3QZ5B 3CCMT 4FW1A 5L23A 3LGFA 4E7KA 2CUBA 2EKHA 2J6OA 2GNCA 2YXYA 1TWBA 3MEUA 3V7RA 4AFUC 1PRMC 2GFUA 4HCBA 2CP6A 4Z88A 2K3XA 5IXBA 3EG9B 1K9MC 2DX1A 3CCSQ 2RHUA 2LQNA 2E41A 2M0YA 2VC8A 3CC2A 2BZYA 3CCRA 3LLRA 2FG0A 2GFAA 1VQ7T 2YRCA 1VQ8A 4OF1A 1BIBA 1RAFB 2GGRA 1NLOC 2HEQA 3A8OB 1WHJA 3JV3A 4N0AA 1VQNT 2PUKB 1WQWA 2KEAA 5GAMg 3GP8A 3CCEQ 2XI9A 1YWOA 4RG8A 4M7AA 1OPLA 1MMGA 3CCVT 1S1NA 1GCQA 1Z9QA 3EGDB 3TU4K 1WHLA 1NLPC 3QJYA 2DFUA 4P5NA 1ARKA 1BIAA 1WFWA 3TSWA 3CBPA 1OI1A 3SB2A 1N5ZA 1MMDA 1CKBA 2CT3A 1FWZA 1PKSA 1CKAA 1UEBA 2QA4Q 2GQIA 4KUDK 1K9MU 5L8RE 3JB9F 4E2FB 2GTJA 2MYSA 4IIMA 2V26A 2DAQA 1Q81U 3S3OA 5GAN4 5D7UA 1R77A 3RR6A 1K8AU 2NYSA 4M7AE 2D1XA 4RUGA 2WSCE 2GQVA 1KD1R 1NJIU 3ZL7C 1VQ9T 2BE9B 1VYTA 2DK3A 2F2XA 2HSPA 1QWEA 3MHXA 1LPLA 4PLLA 4J9GA 1QVFP 3TEEA 4J9CA 5I2SA 2CSQA 1NEBA 1YJWQ 1K4US 4JPBW 4FT2A 4X9CA 2LNHB 2OTJA 4M7DC 2CZ7B 2HKNA 2VWFA 3CCQA 4FSSA 3CCMA 4J7FA 2DRKA 4M7AG 4PKCC 2JJ9A 1NPPA 2Y4XA 2ROLA 3OYHA 2R57A 3DLLA 2E6NA 2ZZDA 3VYHB 2NWMA 2VV5A 2DXBA 2XIDA 1Y7XA 1J3TA 2X4YA 3TVTA 5GAOl 1N9SA 2DETA 2VKNA 3WXMB 4OMFB 2FEIA 3JCMf 1MNDA 1VQ7A 2HQHA 3RIRA 1JJ2S 4FYXB 3SHWA 4FSXA 2QQSA 2BIVA 1ACMB 2KY9A 1Q82C 2LCCA 4M77C 1VQNA 1U5SA 2XDDA 3EGUA 4BY6C 3JCMP 4PJOA 3H6ZA 2COZA 3FEOA 3OW2A 4GY5A 2KAFA 5IHIA 1WDXA 2LJ0A 2KROA 3RNJA 2RQUA 3CCVA 3TREA 1HSQA 1OEBA 4Y92A 2COYA 4CC3A 4BB7A 3UWNA 2KBTA 2VGNA 2LMJA 1G3SA 1SHGA 2MMPA 3CCJQ 4XU1A 1GFCA 4X9DA 4A4GA 1H92A 3ULRB 2HMAA 4E47A 1I07A 1H641 1YCYA 1BI1A 3QZ9B 1YJ9Q 2JMAA 3UPUA 2ZPEB 3SFMA 2NUTB 3LW5E 1SG5A 3OYNA 4PJOE 2LX7A 2K4YA 2LJ3A 3MKDA 2RB6A 1LVKA 4IUUA 3O8VA 2AIRB 1N6AA 1WNLA 2YT6A 3U23A 1VQ9A 4M75C 3T9NA 4A4EA 1C0MA 5FU7C 3CD6T 4VUBA 1FYNA 4ZTJA 2C0OA 1Q82U 4EMHA 1RLPC 4QQDA 3A8HB 5GJVB 1WJSA 3M4GA 3QPHA 4MMLA 3PE0A 4JLIA 3L2WA 1QQJA 4ZGJB 4FYWB 3CC2Q 4X34A 4PJOG 5CIUA 2DTHA 2ZPHB 1UHFA 2X4XA 3L2QA 2QGGA 1VQ8Q 2QQBA 2DILA 4KH1B 4B6MA 3I5RA 5GANj 1M90C 3OS1A 1RAGB 5D6YA 4J83A 2MAMA 3OS2A 1BYMA 1KQ1A 3BDLA 5FU6B 3VS2A 2QK0A 2X35A 1V29B 3OS5A 3ER0A 4XU0A 1UE9A 3JSCA 1TUDA 2EIFA 4F14A 4M7AB 1AWJA 2RI2A 4E6RA 3HRTA 4A4FA 1IREB 3A5ZB 5GJWB 2DZCA 4M7DE 3G6EQ 4JRIA 2AK5A 3H41A 3OS0A 4RMOA 3CXCA 1IHWA 1Y96A 1VQ5Q 1QW1A 4HA8A 1YCSB 2X3WD 3DB4A 2EJGA 3EGXA 2ZPBB 4WF2A 3CMET 3CPFA 1WHGA 3OW2S 4N4IA 2ZPIB 1YI2T 5LJ5d 1I81A 1YFNA 5LJ5e 4II1A 3URGA 4M7DG 4A53A 1KQSA 4HCCA 1XQHA 3R6OA 4WTOB 3TSZA 3KXTA 2DEUA 4DBHA 3R6NA 1BK2A 5LJ3d 3GNFB 4FT4A 3CPWP 2DYBA 3CMAA 5GANg 2E64A 3GBQA 1OQKA 2IIMA 3CCMQ 1NYGA 1OYXA 2EFIA 2LVMA 3RDVA 1VIFA 2QQAA 1QKWA 2KGTA 4DBQA 4E7HA 3CD6A 4OMNA 2FZGB 2I2LA 8ATCB 1K73C 1Q7YC 3CPWA 2RPNA 2ZPGB 1K9AA 3AHUA 2DD5A 1B7TA 2RM4A 4M77G 2CGHA 1Y0MA 1WI7A 5HK3A 2LTOA 5GAMe 1KD1C 4RTTA 2KE9A 3QG1A 3CC4T 1VQ7Q 3VU3C 1ZUKA 2P4TA 5KYYA 3VRYA 1ZSZC 4ZGDB 4BACA 1EFNA 2K5FA 2P4RA 1VQNQ 3THKA 2MI6A 4J5YA 4KRTA 1HD3A 5DM7R 1Y57A 4ELZC 3VUBA 2FB7A 1YBYA 1VQKT 2FVUA 3REBB 4PJOB 2E10A 2YWWA 4ELYC 3M5AA 2ZAEA 1PCXA 1SPKA 3OYAA 2OX7A 2FPEA 1W1FA 4KH0B 4PNOA 4C92C 2EWNA 3OY9A 2SEMA 1YHQT 2DXUA 2EGCA 1JEGA 2RH2A 4DEXA 3GLXA 2K3YA 4GLKA 2KNBB 2D0QB 1V1CA 2YUQA 2E12A 4RTVA 5A0LA 2DBKA 1UJ0A 2X9HA 2KI7A 3JCMJ 1WXBA 3HSBA 3CXCS 1WJQA 1KD1U 1C1AA 3LX7A 3CMEA 1TS9A 2YUPA 4JDSA 2CSIA 2P0PA 4LDUA 1W2BP 1YI2A 2AZSA 4E7SA 2XD0A 3FIFA 1K1ZA 4O5VA 4ZTFA 1JBMA 1QVPA 5GAOr 3M54A 3X20B 2KQWA 2FYKA 4A63B 5CR2A 2KT1A 2CYZB 3L2ZA 3LYIA 2CP2A 1KQSS 4OB0B 1W2BA 2JVVA 4KULA 2O9SA 3S6WA 2LX9A 3M57A 2CS7A 3CCUA 2RO0A 5GMKl 4RTWA 3BE3A 5CKBA 3X24B 4BDYA 2HAXA 3C12A 4B9WA 2LCSA 2DPPB 4F16A 4M7DB 1UGQB 3I56Q 1M1KC 1JXOA 1RI9A 1ZA2B 2VASA 1YITA 1WPYA 3OSVA 1M90R 2XKOC 2VUBA 1WIEA 5KCHA 2D8HA 1LJOA 1OZ3A 2DL7A 3LWHA 1M3CA 2KSSA 4E7ZA 4LDWA 4LUEA 1HK9A 2OTJT 3CCQT 1UFFA 1W4SA 1I1JA 3CC4A 1VYUA 3E9FA 3VJPA 4J9HA 5D6WA 4N4HA 5J39A 2QAZA 2F69A 5LJ5h 2DERA 3VS7A 1UDLA 3UF4A 1WXUA 5LJ3g 2RNAA 2R5MA 1KQ2A 3FC3A 4M77B 2M0OA 4AFSC 5IHNA 2ZGWA 4ORZA 1S72T 5LJ3h 1VQKA 1D09B 1YJNQ 3QIIA 1Y96B 1F1BB 2JZ2A 4EDUA 5CKHA 5FRNA 2YRDA 4DA4A 2VXFA 2RF0A 1WX6A 3EGXB 3OYYA 1WQ7A 2DEQA 4QQGA 2K57A 1M8VA 1EIFA 1YHQA 1YWPA 2KXCA 2FZKB 3PT9A 3QUIA 4OGEA 2DLPA 3OYCA 4GBQA 1EX4A 5GAMh 1RUWA 1OV3A 1GCPA 2Y90A 2KK4A 2HL3A 1KJWA 3EFRA 4JZ4A 2PVGB 2CKKA 1ZA1B 2YLCA 1VYVA 2EYWA 4XTZA 1M4ZA 4M78A 3HFOA 1JQQA 2O31A 3JB9H 4FCYA 3RERA 2F2WA 2DA9A 3CD6Q 1NE8A 3H0HA 3E19A 4OB2B 5IAYA 2NUZA 1D0ZA 2QG9B 1PSFA 2EYYA 2J06A 5FROA 1ZBJA 1EZZB 3VRZA 1Z9ZA 1SKUB 5FU7B 3TCJA 2RJFA 2XHCA 4HVVA 3JCMV 1K73R 1Q7YR 5AYFA 1I5OB 1U8RA 1VQ4A 2DF6A 1VQPT 4C8QC 1TUCA 5GAOp 4AFQC 2DIQA 4EIKA 3I55T 3HTRA 1D0YA 4RTZA 4E7IA 4PK4A 1NBEB 2CP7A 2K3BA 2DIGA 4V2SA 4QVDA 1W2BS 3G4SA 5CCAA 1WHKA 3PMTA 3PTAA 4E7LA 2MIOA 1VQLA 2AT1B 4M78E 3REAB 2EJ9A 2MOXA 5KYYB 1R0CB 2L0AA 3UATA 4OMLA 1TG0A 5HK0A 2C0TA 3EHRA 1GXIE 1YP5A 5GMKe 1TUGB 3F70A 1RAHB 2HBWA 4ZNXA 1VQMQ 2RMOA 3ASKA 4N4GA 1XNIA 3RKYA 2O88A 3KUFA 1IO6A 1VQOA 2LQ8A 2G3RA 2Z0WA 3MP1A 2RK1A 1OPKA 4HXJA 2KRSA 1QVFA 4IUVA 3QBYA 4XTYA 3CC7T 4M78G 3MEAA 3CQTA 4XU3A 2OAWA 3G7ZA 1S72A 2JN0A 3NGPA 1OULA 3HRSA 4RKUE 1G3TA 4EMKC 2NLUA 3OMCA 2RA2A 1X2QA 4LNPA 2A36A 5GANd 1XTDA 3INZA 3VS3A 1PHTA 3RMQA 4IKFA 5M9OA 2GTOA 3EG0A 2EQMA 3JRZA 4J7IA 5KYNA 3A98A 1JXMA 3FRNA 3GNGA 1D3BB 5LJ5f 3RMSA 4KGVB 5GAN7 2GCXA 4D6WA 1B3QA 3M0TA 4OMMA 1B34A 3GOXA 2D8JA 4DBRA 3FJPA 1FMVA 1WYXA 2MK5A 4MMKA 4CRIA 1OX9A 1Q95G 5LJ3f 2K2VA 3CCLQ 1RACB 2L5QA 4KUIA 2OTLA 1LCKA 1X6OA 5HY6A 3JCMb 5KYXA 2IG0A 4BI4A 3EAEA 3M59A 4OVAA 1M5Q1 3N5BB 2OI3A 3OSSC 1M1KR 3RBBB 2JTFA 1PSEA 5CKEA 3CMAT 1LNXA 4C8QA 3WVDB 5EC7A 1VQPA 5KYWA 4HVUA 3CC4Q 3EH1A 3I55A 2SRCA 4XQ3A 1JB0E 5GAMf 2D0NA 4NOYA 1UG1A 3FDRA 2O2OA 3O5ZA 1N8RR 2LDMA 4XTWA 2LQWA 2E5QA 1CSKA 5I11A 4M7AD 3E1SA 2V1RA 1NZ9A 1VQKQ 1R0BG 3RESA 4M7DA 1TU0B 1JRIA 4F17A 2DE0X 3CCRQ 2M9UA 1UGPB 2DL4A 3A8MB 2EQIA 3UA6A 1PNJA 4HVWA 3X26B 2QA4T 4C8QE 1UUEA 4OB3B 2CUDA 1BU1A 4GLMA 2RD1A 2BZXA 1IRXA 4TVRA 3CC7A 4JRPA 2LC4A 1XOVA 3G71T 2R58A 1QVFS 1AWXA 3OYBA 5I21A 4AMCA 3H0FA 2JXBA 3OYFA 2X4WA 1VQ6A 3V8JA 2DL5A 2EKOA 2DL8A 2NUPA 3QDFA 1VA7A 2B8AA 2J7IA 1QP3A 4M77A 1PC0A 2MWOA 1PWTA 1VOMA 4C8QG 2AKKA 2Y4YA 1YJWT 3GF5A 1BCMA 4M78B 3GIBA 4JJDA 3V8KA 3QWYA 4QVZA 2MCNA 1NYFA 1YIJT 1GRIA 2DM1A 5GMKh 3HFNA 2EGAA 2IVWA 2FL7A 2QDYB 1H3ZA 3OA6A 2JM9A 4JJNK 2FRYA 1OU9A 4L5GA 3Q1JA 4NL3A 3KBGA 1NG2A 1X69A 4LE9A 2QQRA 2JUFA 1UTIA 2CP5A 3JCMd 1ZLMA 3M9QA
chains in the Genus database with same CATH topology
1VQOQ 2QEXQ 1YITQ 1K8AR 1VQ8Q 1Q86R 1KQSP 1QVFP 1K73R 1VQ9Q 3CCSQ 1Q7YR 3CCVQ 1M1KR 1VQLQ 1N8RR 1YI2Q 1KC8R 1VQ7Q 1YJ9Q 1NJIR 1JJ2P 1YJWQ 3G71Q 1QVGP 3CCEQ 1VQMQ 3I56Q 3CCUQ 1YJNQ 3CCJQ 1KD1R 1YHQQ 1VQ4Q 3CD6Q 3CCLQ 1VQ6Q 3G6EQ 3CPWP 1YIJQ 1K9MR 1VQKQ 1VQNQ 3CC4Q 3OW2P 2QA4Q 3CC2Q 1VQPQ 2OTLQ 1Q81R 2OTJQ 3CXCP 3CCMQ 3CCQQ 1Q82R 3CC7Q 3CCRQ 3CMAQ 1S72Q 1M90R 1W2BP 3I55Q 3G4SQ 1VQ5Q 3CMEQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO Q;  2QEX Q;  1YIT Q;  1K8A R;  1VQ8 Q;  1Q86 R;  1KQS P;  1QVF P;  1K73 R;  1VQ9 Q;  3CCS Q;  1Q7Y R;  3CCV Q;  1M1K R;  1VQL Q;  1N8R R;  1YI2 Q;  1KC8 R;  1VQ7 Q;  1YJ9 Q;  1NJI R;  1JJ2 P;  1YJW Q;  3G71 Q;  1QVG P;  3CCE Q;  1VQM Q;  3I56 Q;  3CCU Q;  1YJN Q;  3CCJ Q;  1KD1 R;  1YHQ Q;  1VQ4 Q;  3CD6 Q;  3CCL Q;  1VQ6 Q;  3G6E Q;  3CPW P;  1YIJ Q;  1K9M R;  1VQK Q;  1VQN Q;  3CC4 Q;  3OW2 P;  2QA4 Q;  3CC2 Q;  1VQP Q;  2OTL Q;  1Q81 R;  2OTJ Q;  3CXC P;  3CCM Q;  3CCQ Q;  1Q82 R;  3CC7 Q;  3CCR Q;  3CMA Q;  1S72 Q;  1M90 R;  1W2B P;  3I55 Q;  3G4S Q;  1VQ5 Q;  3CME Q; 
#chains in the Genus database with same CATH topology
 1M90 U;  1AWO A;  1UJY A;  1BI3 A;  4M77 E;  2CP0 A;  1KK7 A;  2E4H A;  2V8J A;  4IUQ A;  5LJ3 e;  2KYM A;  1OU8 A;  2FHD A;  4M7A F;  3OYD A;  2OTJ Q;  5D6X A;  3MEV A;  3CCQ Q;  4FYY B;  1Y71 A;  3CCU T;  4JJB A;  2C06 A;  4M75 A;  4Q5W A;  5GAN h;  1KC8 R;  2DVJ A;  3A1P A;  2H8H A;  2JTM A;  4OB1 B;  1M1G A;  4C5H A;  1Q86 C;  3VS5 A;  4PJO D;  3PNW C;  3ZEH A;  3NTH A;  1QCN A;  5I22 A;  3P8B B;  1YIT T;  5A0D A;  2A37 A;  1BKB A;  5KYU A;  1H8K A;  2FPD A;  5EG2 A;  2W0Z A;  2L2P A;  3MET A;  2PNI A;  4NS5 A;  1X75 C;  2CP3 A;  2HKQ B;  1HJD A;  3MP6 A;  3NTI A;  1VUB A;  2LNV A;  1W70 A;  4CC2 A;  1QVG P;  4RTY A;  1GFD A;  1WA7 A;  2LT1 A;  4J6Y A;  2QA4 A;  4J9F A;  3SDZ A;  3S3N A;  3VS0 A;  3M4Y A;  1M30 A;  5GAO m;  2GF7 A;  2E5K A;  2X3X D;  3EG3 A;  2KR3 A;  3OYI A;  4R56 A;  1QWF A;  4JLG A;  3JB9 G;  1K76 A;  2L3Q A;  4M75 E;  5GAO q;  4DBF A;  3QWX X;  2EGE A;  3G71 A;  4RTX A;  3CCV Q;  2XDB A;  3UDC A;  1IZ6 A;  1BI2 A;  1AT1 B;  1QVG A;  3HKS A;  3X25 B;  4A4K A;  2QDL A;  3LH5 A;  4OMQ A;  5J26 A;  3OYL A;  1T0H A;  2QEX T;  3QYH B;  3NMZ C;  1M2O A;  2HD0 A;  2QTV A;  1MMA A;  3EHQ A;  3JCM Q;  5I2M A;  1B34 B;  2ZCF B;  1WLP B;  1X01 A;  1IGU A;  1TH7 A;  3BDU A;  2D6F A;  2HNI A;  4KT0 E;  2KXD A;  1YJW A;  4XTV A;  4ZN1 A;  1KG1 A;  2DJQ A;  1AWW A;  5A0G A;  4XTX A;  2K2M A;  2A7Y A;  4Z02 A;  1K73 U;  2EQK A;  4M75 G;  1UHC A;  5KYX B;  1Q7Y U;  1MUZ A;  4ZN3 A;  1YIJ A;  6AT1 B;  5A2Q E;  1ZHI A;  3LGL A;  2BUD A;  1NEG A;  2DNU A;  5LJ5 j;  2H3J A;  4M7D D;  3DB3 A;  5FU6 C;  2OJ2 A;  3HRU A;  4IUR A;  4N0A C;  1UB4 A;  2CZ1 B;  2PUO B;  2JT4 A;  4PL6 A;  1VQ9 Q;  4C8Q B;  4CC7 A;  3EFS A;  3NPF A;  4PJJ A;  1D3B A;  4ANJ A;  2QAS A;  1BBZ A;  2BKD N;  5KYW B;  2H3E B;  4M7A C;  1GCQ C;  1PD0 A;  2DMO A;  2V1Q A;  2XG8 D;  4UC4 A;  1ZBX A;  2KYB A;  4C0D C;  5HCK A;  1VIE A;  3G1J A;  4PJO F;  1M3B A;  4HCZ A;  2HQX A;  3FB9 A;  5IH2 A;  1VQ4 T;  3S3M A;  4JRQ A;  4PJN A;  1WZO A;  1TTH B;  1U3O A;  2F5T X;  4HT8 A;  1G5V A;  3OYK A;  4MDX A;  5IN1 A;  2CDT A;  1RAA B;  2F1L A;  2K7A A;  2E3H A;  5KH6 A;  3I9Q A;  2WSE E;  2KMT A;  4BE1 A;  1VQ5 T;  1I8F A;  5ECA A;  3G4S T;  2KVQ G;  3M58 A;  4M77 D;  4XTU A;  2PU9 B;  2DJZ A;  4OMP A;  1VQL T;  2DTI A;  2QQ9 A;  5GAM j;  1U1T A;  4R0K A;  2W10 A;  4ME7 A;  5KCO A;  4M4Z A;  4IUP A;  1SRL A;  4XAX B;  5CQY A;  2EYX A;  4A4H A;  4AG2 C;  1YN8 A;  3CCJ A;  3VUZ A;  3X28 B;  2F5K A;  3ME9 A;  1X43 A;  4YTL A;  3JCM g;  3CPW S;  4RG2 A;  1QKX A;  1WHM A;  2BE7 D;  1VQO T;  1G3Y A;  2F2V A;  2JW4 A;  1ZSZ A;  2YUN A;  2DYI A;  1N8R C;  2RN8 A;  2FO0 A;  3I35 A;  2DKG A;  1M2V A;  1YJ9 A;  4QW2 A;  2K5I A;  3VV0 A;  2LCL A;  4BE2 A;  5GMK i;  1FMW A;  1U06 A;  2NUP B;  2COW A;  1PKT A;  3C0C A;  5GAN f;  2J05 A;  5FRM A;  3IQL A;  2AKL A;  4Z89 A;  1JJ2 P;  3NFC A;  4BY6 B;  3OQ5 A;  2JNG A;  3MPU B;  4LN2 A;  2X51 A;  4AT1 B;  5GAN 8;  2XDP A;  2FRW A;  3JAM E;  3VS6 A;  2QEX A;  1QMC A;  4M7D F;  4M75 D;  3C94 A;  1QVG S;  4C92 A;  2FPF A;  4JRK A;  3M55 A;  2RJD A;  1Q81 C;  3PVL A;  4X1V A;  1JJ2 A;  2HQE A;  4PLI A;  1LOJ A;  2VGM A;  1M1K U;  2A28 A;  1SSH A;  4J9D A;  9ATC B;  1K8A C;  1SSF A;  4IUT A;  3MEW A;  1O9S A;  3A8L B;  3BY7 A;  2JS0 A;  4Z8A A;  4J6X A;  1NJI C;  1WGS A;  3JB9 J;  2V8I A;  1PRL C;  2CH4 W;  3QJ6 A;  1SEM A;  4FIB A;  3CMA Q;  2RJE A;  1AZE A;  4IIO A;  1X6B A;  5DLQ E;  2M16 A;  2MPX C;  3L2R A;  2VVK A;  2YSQ A;  1PM3 A;  3OYJ A;  2L89 A;  4PJO C;  2OTL T;  1N8R U;  1M3A A;  3ZFJ A;  3C4S A;  1GBQ A;  2RHY A;  3MP8 A;  4M75 B;  1IGQ A;  5FWC A;  4M77 F;  4K11 A;  3BW1 A;  3H9N A;  3QKJ A;  1U1S A;  1M8M A;  1WHH A;  2CZ0 B;  4C92 E;  3AT1 B;  4J8O A;  1RAE B;  4J9E A;  2VB6 A;  1Q86 R;  2ROT A;  2CZ6 B;  1ZUY A;  1OOT A;  4BI8 B;  3DLM A;  1NM7 A;  4Y28 E;  2VYT A;  3G6E A;  1SF9 A;  5KYU B;  1QCF A;  5GAN 3;  3CEY A;  5GAO n;  1UGR B;  1RAD B;  3VYG A;  5LL6 S;  3VS1 A;  1D0X A;  1XJW B;  1KHC A;  1VQ5 A;  2KRM A;  1WJR A;  3RUX A;  3QSU A;  4ATO A;  2YUO A;  4CI0 C;  3EG2 A;  2D9T A;  2QYZ A;  4A54 A;  1E6G A;  4O6J A;  4C92 G;  3G71 Q;  2QGF B;  3E2U A;  4PFZ A;  2HCK A;  3LWI A;  3SWN C;  3J81 E;  1HYO A;  4HCK A;  3OBY A;  2RQV A;  1KC8 C;  1D1B A;  2BTT A;  5CK9 A;  2M02 A;  4JUV A;  1ZX6 A;  2JOY A;  4LD6 A;  4F7U A;  1RAB B;  2EW3 A;  2I0N A;  3VS4 A;  4D8D A;  1IHV A;  4M75 F;  3HL8 A;  2KRN A;  2RQR A;  4BDZ A;  2EBP A;  1YIJ Q;  2HDA A;  2HL5 C;  5CKF A;  2IPO B;  1V76 A;  3UA7 A;  4E7J A;  3I56 T;  2K5L A;  2XIC A;  1JU5 C;  3CME Q;  1VQ6 T;  2DBM A;  1YI2 Q;  3JCM c;  3CBM A;  1D1A A;  5GAN e;  2RI3 A;  1AEY A;  1MGQ A;  4JS4 A;  2ZPF B;  2OAU A;  3C95 A;  4NL2 A;  3OW2 P;  3PMI A;  2A08 A;  1OZ2 A;  1QLY A;  3EFO A;  4BE0 A;  4F7U E;  3J7A F;  1ZQ1 A;  2C0I A;  1E7O A;  2HSE B;  1BI0 A;  1PD1 A;  3PFS A;  1RL2 A;  1JO8 A;  3OB9 A;  3CCU Q;  1KC8 U;  4FU6 A;  2PZ1 A;  3E9G A;  3CCS T;  2RI5 A;  1RLQ C;  1FMK A;  3M0U A;  1ABQ A;  1YJN T;  4AFZ C;  4C5I A;  3QXE B;  4LUD A;  1YIT Q;  2LZ6 B;  3V7C A;  5GMK m;  2RK2 A;  5IT9 E;  4F7U G;  3PIO A;  1I4K 1;  1MMN A;  2QI2 A;  3OBW A;  2AZV A;  1MHN A;  3OYE A;  3GPL A;  2AHJ B;  2RJC A;  3L1A A;  2RHI A;  2EJF A;  4B9X A;  2E70 A;  4BI3 A;  4DEY A;  3CCE T;  4C0F A;  1AVZ C;  3BFM A;  1UEC A;  4C92 D;  2CT4 A;  3MO8 A;  4KGX B;  4WCI A;  5GMK j;  1ZSZ B;  2O4X A;  4MDW A;  2LRQ A;  3I5S A;  4RCB A;  5DY9 A;  2YRV A;  3JB9 I;  2DXT A;  3OYM A;  1KIK A;  3L2U A;  1M2V B;  4MZP A;  3SWN A;  3EG1 A;  1FX7 A;  1G3W A;  3MCA B;  2E3I A;  4FL6 A;  2QEX Q;  4LDX A;  2E1H A;  3ZBD A;  1A0N B;  2DTO A;  4M78 D;  2JTE A;  5IHK A;  3WVE B;  5AT1 B;  4F04 B;  1YHQ Q;  1K9M R;  4C92 B;  4EPC A;  2WAC A;  1Q81 R;  2EAY A;  4HT9 A;  3OMG A;  1KHI A;  1X27 A;  4QVC A;  1K8A R;  4EMK A;  1MV3 A;  2DXC A;  2L3P A;  3I56 A;  2K6D A;  4MZT A;  3JCM X;  2G6F X;  1NJI R;  1T3L A;  1ABO A;  2O9V A;  1I0C A;  2EVR A;  5GAN 6;  4JJC A;  4MZM A;  2PVO B;  5C6S A;  4C5G A;  2O01 E;  5CO7 A;  2ED0 A;  3CXC P;  2EPD A;  1B07 A;  1VQM T;  2L8D A;  1M27 C;  2J6K A;  3V8L A;  8AT1 B;  4L6V 5;  2R5A A;  2M51 A;  4FYV B;  2WSF E;  1R8O B;  4XK8 E;  1Y07 A;  3EG9 A;  1N27 A;  2YDL A;  1VQ4 Q;  4C0D B;  1BB9 A;  5CQX A;  1SHF A;  4PFO A;  1W6X A;  2M1H A;  2RQW A;  3D7S B;  2ECZ A;  2P0K A;  2QXF A;  4ZGE B;  3CCS A;  3OYG A;  5CKD A;  5FLX E;  3G4S Q;  3JCM e;  2LJ1 A;  3HP9 A;  1KQS P;  3SEM A;  4OMO A;  1VQL Q;  1YJN A;  4C92 F;  2J6F A;  1TOV A;  3M0Q A;  4QQ6 A;  2KT8 A;  1T3S A;  4Y91 A;  2E65 A;  2ED1 A;  4AG1 C;  1AZG B;  2K9G A;  1MNE A;  1PG5 B;  2YLB A;  4C0Z A;  3L42 A;  4LDV A;  4R55 A;  4LDY A;  1GL5 A;  4KGZ B;  2FZC B;  2YHT A;  1VQO Q;  3H8Z A;  1NPR A;  2DO3 A;  4PJM A;  3QDR B;  3EGD A;  3CCE A;  4FM4 B;  2E6Z A;  2V8K A;  4CC4 B;  1K0X A;  4OGC A;  2RQT A;  4M78 F;  2HZY A;  2ABL A;  2P84 A;  4C0G A;  1G8X A;  3VKI A;  2B86 A;  4F7U B;  3M56 A;  3V7S A;  3L2V A;  1OX8 A;  1S72 Q;  5FWB A;  2P0Q A;  3EH2 A;  4BD3 A;  5IXF A;  3CCL T;  3CCJ T;  5GAN 5;  1QP2 A;  1UGS B;  4PFP A;  3JCM W;  3M0S A;  4DOV A;  1N9R A;  2X4J A;  1ZSG A;  5C0M A;  3M0R A;  5DLO A;  2ESW A;  1AD5 A;  5GAM d;  1M1F A;  1YJ9 T;  2MWP A;  1H3H A;  2XU8 A;  1X6G A;  2CH4 A;  4DOW A;  2QTX A;  1UGV A;  1TXQ A;  4PJL A;  4EMG A;  3PGG A;  4C8Q D;  1X2K A;  3EFO B;  4C5E A;  5FW9 A;  2ATC B;  4JZ3 A;  3M0P A;  1AOJ A;  3TQ7 P;  1BCO A;  3PIP A;  5KE3 A;  1IB8 A;  4LXC A;  2ENM A;  2OTL Q;  1Q82 R;  4J9B A;  4FW2 A;  2CRE A;  3DKM A;  3HHT B;  3J80 E;  1VQM A;  3H0I A;  3CC2 T;  4F7U F;  5J3B A;  1G83 A;  1Q86 U;  3CCR T;  1GBR A;  3QO3 A;  2PVD B;  4HKE A;  4J9I A;  1VQ8 T;  3PVQ A;  3RKW A;  4JS5 A;  1RAI B;  2LQK A;  2A0F B;  2DVE A;  1VQP Q;  2EYQ A;  1I5L A;  3I55 Q;  1YNZ A;  5HKC A;  3FJ5 A;  3UT1 A;  4RCC A;  1C6V X;  3NHN A;  3RKX A;  2RHZ A;  3QYG B;  5CVI A;  1SRM A;  2XMF A;  1AHJ B;  3P8D A;  1IXD A;  5LJ3 j;  2KDS A;  1ZUU A;  1G2B A;  1WXT A;  4QT7 A;  2LP5 A;  1RI0 A;  1E6H A;  2L3R A;  5KE2 A;  1KFZ A;  2JMC A;  1HXD A;  2GBQ A;  1O75 A;  4M78 C;  1QCO A;  2EQJ A;  2EQU A;  3A8G B;  2O4X B;  1TSF A;  3G6E T;  3CBO A;  2VXE A;  2DRM A;  5CAI A;  2K79 A;  4KBM B;  3SWN B;  4DQ2 A;  4ESR A;  3FLG A;  3QHS A;  2RHX A;  4XU2 A;  1P92 A;  3NTK A;  7AT1 B;  2L3S A;  2MF2 A;  3HPW A;  1DJ7 B;  2PTK A;  4QKU A;  3CC7 Q;  3LH0 A;  2EYZ A;  3MJX A;  1MV0 B;  1D1C A;  3M53 A;  1T0J A;  2JS2 A;  3CCL A;  2A3L A;  2DL3 A;  1VQ6 Q;  4RTU A;  2DD4 A;  2LT4 A;  3JB9 D;  2XK0 A;  4OP0 A;  2NUT A;  4C8Q F;  3SD4 A;  4EMK B;  3KFV A;  2HBP A;  1M9S A;  5GAN 2;  3JCM h;  1KSW A;  1FXX A;  1K0S A;  2BZ8 A;  2JM8 A;  2PQW A;  4J6W A;  2DZ9 A;  4LD9 K;  4D8K A;  5LJ5 g;  4L59 A;  4BUG A;  3P8H A;  3QZ5 B;  3CCM T;  4FW1 A;  5L23 A;  3LGF A;  4E7K A;  2CUB A;  2EKH A;  2J6O A;  2GNC A;  2YXY A;  1TWB A;  3MEU A;  3V7R A;  4AFU C;  1PRM C;  2GFU A;  4HCB A;  2CP6 A;  4Z88 A;  2K3X A;  5IXB A;  3EG9 B;  1K9M C;  2DX1 A;  3CCS Q;  2RHU A;  2LQN A;  2E41 A;  2M0Y A;  2VC8 A;  3CC2 A;  2BZY A;  3CCR A;  3LLR A;  2FG0 A;  2GFA A;  1VQ7 T;  2YRC A;  1VQ8 A;  4OF1 A;  1BIB A;  1RAF B;  2GGR A;  1NLO C;  2HEQ A;  3A8O B;  1WHJ A;  3JV3 A;  4N0A A;  1VQN T;  2PUK B;  1WQW A;  2KEA A;  5GAM g;  3GP8 A;  3CCE Q;  2XI9 A;  1YWO A;  4RG8 A;  4M7A A;  1OPL A;  1MMG A;  3CCV T;  1S1N A;  1GCQ A;  1Z9Q A;  3EGD B;  3TU4 K;  1WHL A;  1NLP C;  3QJY A;  2DFU A;  4P5N A;  1ARK A;  1BIA A;  1WFW A;  3TSW A;  3CBP A;  1OI1 A;  3SB2 A;  1N5Z A;  1MMD A;  1CKB A;  2CT3 A;  1FWZ A;  1PKS A;  1CKA A;  1UEB A;  2QA4 Q;  2GQI A;  4KUD K;  1K9M U;  5L8R E;  3JB9 F;  4E2F B;  2GTJ A;  2MYS A;  4IIM A;  2V26 A;  2DAQ A;  1Q81 U;  3S3O A;  5GAN 4;  5D7U A;  1R77 A;  3RR6 A;  1K8A U;  2NYS A;  4M7A E;  2D1X A;  4RUG A;  2WSC E;  2GQV A;  1KD1 R;  1NJI U;  3ZL7 C;  1VQ9 T;  2BE9 B;  1VYT A;  2DK3 A;  2F2X A;  2HSP A;  1QWE A;  3MHX A;  1LPL A;  4PLL A;  4J9G A;  1QVF P;  3TEE A;  4J9C A;  5I2S A;  2CSQ A;  1NEB A;  1YJW Q;  1K4U S;  4JPB W;  4FT2 A;  4X9C A;  2LNH B;  2OTJ A;  4M7D C;  2CZ7 B;  2HKN A;  2VWF A;  3CCQ A;  4FSS A;  3CCM A;  4J7F A;  2DRK A;  4M7A G;  4PKC C;  2JJ9 A;  1NPP A;  2Y4X A;  2ROL A;  3OYH A;  2R57 A;  3DLL A;  2E6N A;  2ZZD A;  3VYH B;  2NWM A;  2VV5 A;  2DXB A;  2XID A;  1Y7X A;  1J3T A;  2X4Y A;  3TVT A;  5GAO l;  1N9S A;  2DET A;  2VKN A;  3WXM B;  4OMF B;  2FEI A;  3JCM f;  1MND A;  1VQ7 A;  2HQH A;  3RIR A;  1JJ2 S;  4FYX B;  3SHW A;  4FSX A;  2QQS A;  2BIV A;  1ACM B;  2KY9 A;  1Q82 C;  2LCC A;  4M77 C;  1VQN A;  1U5S A;  2XDD A;  3EGU A;  4BY6 C;  3JCM P;  4PJO A;  3H6Z A;  2COZ A;  3FEO A;  3OW2 A;  4GY5 A;  2KAF A;  5IHI A;  1WDX A;  2LJ0 A;  2KRO A;  3RNJ A;  2RQU A;  3CCV A;  3TRE A;  1HSQ A;  1OEB A;  4Y92 A;  2COY A;  4CC3 A;  4BB7 A;  3UWN A;  2KBT A;  2VGN A;  2LMJ A;  1G3S A;  1SHG A;  2MMP A;  3CCJ Q;  4XU1 A;  1GFC A;  4X9D A;  4A4G A;  1H92 A;  3ULR B;  2HMA A;  4E47 A;  1I07 A;  1H64 1;  1YCY A;  1BI1 A;  3QZ9 B;  1YJ9 Q;  2JMA A;  3UPU A;  2ZPE B;  3SFM A;  2NUT B;  3LW5 E;  1SG5 A;  3OYN A;  4PJO E;  2LX7 A;  2K4Y A;  2LJ3 A;  3MKD A;  2RB6 A;  1LVK A;  4IUU A;  3O8V A;  2AIR B;  1N6A A;  1WNL A;  2YT6 A;  3U23 A;  1VQ9 A;  4M75 C;  3T9N A;  4A4E A;  1C0M A;  5FU7 C;  3CD6 T;  4VUB A;  1FYN A;  4ZTJ A;  2C0O A;  1Q82 U;  4EMH A;  1RLP C;  4QQD A;  3A8H B;  5GJV B;  1WJS A;  3M4G A;  3QPH A;  4MML A;  3PE0 A;  4JLI A;  3L2W A;  1QQJ A;  4ZGJ B;  4FYW B;  3CC2 Q;  4X34 A;  4PJO G;  5CIU A;  2DTH A;  2ZPH B;  1UHF A;  2X4X A;  3L2Q A;  2QGG A;  1VQ8 Q;  2QQB A;  2DIL A;  4KH1 B;  4B6M A;  3I5R A;  5GAN j;  1M90 C;  3OS1 A;  1RAG B;  5D6Y A;  4J83 A;  2MAM A;  3OS2 A;  1BYM A;  1KQ1 A;  3BDL A;  5FU6 B;  3VS2 A;  2QK0 A;  2X35 A;  1V29 B;  3OS5 A;  3ER0 A;  4XU0 A;  1UE9 A;  3JSC A;  1TUD A;  2EIF A;  4F14 A;  4M7A B;  1AWJ A;  2RI2 A;  4E6R A;  3HRT A;  4A4F A;  1IRE B;  3A5Z B;  5GJW B;  2DZC A;  4M7D E;  3G6E Q;  4JRI A;  2AK5 A;  3H41 A;  3OS0 A;  4RMO A;  3CXC A;  1IHW A;  1Y96 A;  1VQ5 Q;  1QW1 A;  4HA8 A;  1YCS B;  2X3W D;  3DB4 A;  2EJG A;  3EGX A;  2ZPB B;  4WF2 A;  3CME T;  3CPF A;  1WHG A;  3OW2 S;  4N4I A;  2ZPI B;  1YI2 T;  5LJ5 d;  1I81 A;  1YFN A;  5LJ5 e;  4II1 A;  3URG A;  4M7D G;  4A53 A;  1KQS A;  4HCC A;  1XQH A;  3R6O A;  4WTO B;  3TSZ A;  3KXT A;  2DEU A;  4DBH A;  3R6N A;  1BK2 A;  5LJ3 d;  3GNF B;  4FT4 A;  3CPW P;  2DYB A;  3CMA A;  5GAN g;  2E64 A;  3GBQ A;  1OQK A;  2IIM A;  3CCM Q;  1NYG A;  1OYX A;  2EFI A;  2LVM A;  3RDV A;  1VIF A;  2QQA A;  1QKW A;  2KGT A;  4DBQ A;  4E7H A;  3CD6 A;  4OMN A;  2FZG B;  2I2L A;  8ATC B;  1K73 C;  1Q7Y C;  3CPW A;  2RPN A;  2ZPG B;  1K9A A;  3AHU A;  2DD5 A;  1B7T A;  2RM4 A;  4M77 G;  2CGH A;  1Y0M A;  1WI7 A;  5HK3 A;  2LTO A;  5GAM e;  1KD1 C;  4RTT A;  2KE9 A;  3QG1 A;  3CC4 T;  1VQ7 Q;  3VU3 C;  1ZUK A;  2P4T A;  5KYY A;  3VRY A;  1ZSZ C;  4ZGD B;  4BAC A;  1EFN A;  2K5F A;  2P4R A;  1VQN Q;  3THK A;  2MI6 A;  4J5Y A;  4KRT A;  1HD3 A;  5DM7 R;  1Y57 A;  4ELZ C;  3VUB A;  2FB7 A;  1YBY A;  1VQK T;  2FVU A;  3REB B;  4PJO B;  2E10 A;  2YWW A;  4ELY C;  3M5A A;  2ZAE A;  1PCX A;  1SPK A;  3OYA A;  2OX7 A;  2FPE A;  1W1F A;  4KH0 B;  4PNO A;  4C92 C;  2EWN A;  3OY9 A;  2SEM A;  1YHQ T;  2DXU A;  2EGC A;  1JEG A;  2RH2 A;  4DEX A;  3GLX A;  2K3Y A;  4GLK A;  2KNB B;  2D0Q B;  1V1C A;  2YUQ A;  2E12 A;  4RTV A;  5A0L A;  2DBK A;  1UJ0 A;  2X9H A;  2KI7 A;  3JCM J;  1WXB A;  3HSB A;  3CXC S;  1WJQ A;  1KD1 U;  1C1A A;  3LX7 A;  3CME A;  1TS9 A;  2YUP A;  4JDS A;  2CSI A;  2P0P A;  4LDU A;  1W2B P;  1YI2 A;  2AZS A;  4E7S A;  2XD0 A;  3FIF A;  1K1Z A;  4O5V A;  4ZTF A;  1JBM A;  1QVP A;  5GAO r;  3M54 A;  3X20 B;  2KQW A;  2FYK A;  4A63 B;  5CR2 A;  2KT1 A;  2CYZ B;  3L2Z A;  3LYI A;  2CP2 A;  1KQS S;  4OB0 B;  1W2B A;  2JVV A;  4KUL A;  2O9S A;  3S6W A;  2LX9 A;  3M57 A;  2CS7 A;  3CCU A;  2RO0 A;  5GMK l;  4RTW A;  3BE3 A;  5CKB A;  3X24 B;  4BDY A;  2HAX A;  3C12 A;  4B9W A;  2LCS A;  2DPP B;  4F16 A;  4M7D B;  1UGQ B;  3I56 Q;  1M1K C;  1JXO A;  1RI9 A;  1ZA2 B;  2VAS A;  1YIT A;  1WPY A;  3OSV A;  1M90 R;  2XKO C;  2VUB A;  1WIE A;  5KCH A;  2D8H A;  1LJO A;  1OZ3 A;  2DL7 A;  3LWH A;  1M3C A;  2KSS A;  4E7Z A;  4LDW A;  4LUE A;  1HK9 A;  2OTJ T;  3CCQ T;  1UFF A;  1W4S A;  1I1J A;  3CC4 A;  1VYU A;  3E9F A;  3VJP A;  4J9H A;  5D6W A;  4N4H A;  5J39 A;  2QAZ A;  2F69 A;  5LJ5 h;  2DER A;  3VS7 A;  1UDL A;  3UF4 A;  1WXU A;  5LJ3 g;  2RNA A;  2R5M A;  1KQ2 A;  3FC3 A;  4M77 B;  2M0O A;  4AFS C;  5IHN A;  2ZGW A;  4ORZ A;  1S72 T;  5LJ3 h;  1VQK A;  1D09 B;  1YJN Q;  3QII A;  1Y96 B;  1F1B B;  2JZ2 A;  4EDU A;  5CKH A;  5FRN A;  2YRD A;  4DA4 A;  2VXF A;  2RF0 A;  1WX6 A;  3EGX B;  3OYY A;  1WQ7 A;  2DEQ A;  4QQG A;  2K57 A;  1M8V A;  1EIF A;  1YHQ A;  1YWP A;  2KXC A;  2FZK B;  3PT9 A;  3QUI A;  4OGE A;  2DLP A;  3OYC A;  4GBQ A;  1EX4 A;  5GAM h;  1RUW A;  1OV3 A;  1GCP A;  2Y90 A;  2KK4 A;  2HL3 A;  1KJW A;  3EFR A;  4JZ4 A;  2PVG B;  2CKK A;  1ZA1 B;  2YLC A;  1VYV A;  2EYW A;  4XTZ A;  1M4Z A;  4M78 A;  3HFO A;  1JQQ A;  2O31 A;  3JB9 H;  4FCY A;  3RER A;  2F2W A;  2DA9 A;  3CD6 Q;  1NE8 A;  3H0H A;  3E19 A;  4OB2 B;  5IAY A;  2NUZ A;  1D0Z A;  2QG9 B;  1PSF A;  2EYY A;  2J06 A;  5FRO A;  1ZBJ A;  1EZZ B;  3VRZ A;  1Z9Z A;  1SKU B;  5FU7 B;  3TCJ A;  2RJF A;  2XHC A;  4HVV A;  3JCM V;  1K73 R;  1Q7Y R;  5AYF A;  1I5O B;  1U8R A;  1VQ4 A;  2DF6 A;  1VQP T;  4C8Q C;  1TUC A;  5GAO p;  4AFQ C;  2DIQ A;  4EIK A;  3I55 T;  3HTR A;  1D0Y A;  4RTZ A;  4E7I A;  4PK4 A;  1NBE B;  2CP7 A;  2K3B A;  2DIG A;  4V2S A;  4QVD A;  1W2B S;  3G4S A;  5CCA A;  1WHK A;  3PMT A;  3PTA A;  4E7L A;  2MIO A;  1VQL A;  2AT1 B;  4M78 E;  3REA B;  2EJ9 A;  2MOX A;  5KYY B;  1R0C B;  2L0A A;  3UAT A;  4OML A;  1TG0 A;  5HK0 A;  2C0T A;  3EHR A;  1GXI E;  1YP5 A;  5GMK e;  1TUG B;  3F70 A;  1RAH B;  2HBW A;  4ZNX A;  1VQM Q;  2RMO A;  3ASK A;  4N4G A;  1XNI A;  3RKY A;  2O88 A;  3KUF A;  1IO6 A;  1VQO A;  2LQ8 A;  2G3R A;  2Z0W A;  3MP1 A;  2RK1 A;  1OPK A;  4HXJ A;  2KRS A;  1QVF A;  4IUV A;  3QBY A;  4XTY A;  3CC7 T;  4M78 G;  3MEA A;  3CQT A;  4XU3 A;  2OAW A;  3G7Z A;  1S72 A;  2JN0 A;  3NGP A;  1OUL A;  3HRS A;  4RKU E;  1G3T A;  4EMK C;  2NLU A;  3OMC A;  2RA2 A;  1X2Q A;  4LNP A;  2A36 A;  5GAN d;  1XTD A;  3INZ A;  3VS3 A;  1PHT A;  3RMQ A;  4IKF A;  5M9O A;  2GTO A;  3EG0 A;  2EQM A;  3JRZ A;  4J7I A;  5KYN A;  3A98 A;  1JXM A;  3FRN A;  3GNG A;  1D3B B;  5LJ5 f;  3RMS A;  4KGV B;  5GAN 7;  2GCX A;  4D6W A;  1B3Q A;  3M0T A;  4OMM A;  1B34 A;  3GOX A;  2D8J A;  4DBR A;  3FJP A;  1FMV A;  1WYX A;  2MK5 A;  4MMK A;  4CRI A;  1OX9 A;  1Q95 G;  5LJ3 f;  2K2V A;  3CCL Q;  1RAC B;  2L5Q A;  4KUI A;  2OTL A;  1LCK A;  1X6O A;  5HY6 A;  3JCM b;  5KYX A;  2IG0 A;  4BI4 A;  3EAE A;  3M59 A;  4OVA A;  1M5Q 1;  3N5B B;  2OI3 A;  3OSS C;  1M1K R;  3RBB B;  2JTF A;  1PSE A;  5CKE A;  3CMA T;  1LNX A;  4C8Q A;  3WVD B;  5EC7 A;  1VQP A;  5KYW A;  4HVU A;  3CC4 Q;  3EH1 A;  3I55 A;  2SRC A;  4XQ3 A;  1JB0 E;  5GAM f;  2D0N A;  4NOY A;  1UG1 A;  3FDR A;  2O2O A;  3O5Z A;  1N8R R;  2LDM A;  4XTW A;  2LQW A;  2E5Q A;  1CSK A;  5I11 A;  4M7A D;  3E1S A;  2V1R A;  1NZ9 A;  1VQK Q;  1R0B G;  3RES A;  4M7D A;  1TU0 B;  1JRI A;  4F17 A;  2DE0 X;  3CCR Q;  2M9U A;  1UGP B;  2DL4 A;  3A8M B;  2EQI A;  3UA6 A;  1PNJ A;  4HVW A;  3X26 B;  2QA4 T;  4C8Q E;  1UUE A;  4OB3 B;  2CUD A;  1BU1 A;  4GLM A;  2RD1 A;  2BZX A;  1IRX A;  4TVR A;  3CC7 A;  4JRP A;  2LC4 A;  1XOV A;  3G71 T;  2R58 A;  1QVF S;  1AWX A;  3OYB A;  5I21 A;  4AMC A;  3H0F A;  2JXB A;  3OYF A;  2X4W A;  1VQ6 A;  3V8J A;  2DL5 A;  2EKO A;  2DL8 A;  2NUP A;  3QDF A;  1VA7 A;  2B8A A;  2J7I A;  1QP3 A;  4M77 A;  1PC0 A;  2MWO A;  1PWT A;  1VOM A;  4C8Q G;  2AKK A;  2Y4Y A;  1YJW T;  3GF5 A;  1BCM A;  4M78 B;  3GIB A;  4JJD A;  3V8K A;  3QWY A;  4QVZ A;  2MCN A;  1NYF A;  1YIJ T;  1GRI A;  2DM1 A;  5GMK h;  3HFN A;  2EGA A;  2IVW A;  2FL7 A;  2QDY B;  1H3Z A;  3OA6 A;  2JM9 A;  4JJN K;  2FRY A;  1OU9 A;  4L5G A;  3Q1J A;  4NL3 A;  3KBG A;  1NG2 A;  1X69 A;  4LE9 A;  2QQR A;  2JUF A;  1UTI A;  2CP5 A;  3JCM d;  1ZLM A;  3M9Q A; 
#chains in the Genus database with same CATH homology
 1VQO Q;  2QEX Q;  1YIT Q;  1K8A R;  1VQ8 Q;  1Q86 R;  1KQS P;  1QVF P;  1K73 R;  1VQ9 Q;  3CCS Q;  1Q7Y R;  3CCV Q;  1M1K R;  1VQL Q;  1N8R R;  1YI2 Q;  1KC8 R;  1VQ7 Q;  1YJ9 Q;  1NJI R;  1JJ2 P;  1YJW Q;  3G71 Q;  1QVG P;  3CCE Q;  1VQM Q;  3I56 Q;  3CCU Q;  1YJN Q;  3CCJ Q;  1KD1 R;  1YHQ Q;  1VQ4 Q;  3CD6 Q;  3CCL Q;  1VQ6 Q;  3G6E Q;  3CPW P;  1YIJ Q;  1K9M R;  1VQK Q;  1VQN Q;  3CC4 Q;  3OW2 P;  2QA4 Q;  3CC2 Q;  1VQP Q;  2OTL Q;  1Q81 R;  2OTJ Q;  3CXC P;  3CCM Q;  3CCQ Q;  1Q82 R;  3CC7 Q;  3CCR Q;  3CMA Q;  1S72 Q;  1M90 R;  1W2B P;  3I55 Q;  3G4S Q;  1VQ5 Q;  3CME Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...