1QVFP

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1qvfP00
1VQ6Q 1QVFP 1M90R 1S72Q 1VQPQ 3CCEQ 3CPWP 1KC8R 3G71Q 3I55Q 1YJWQ 1KD1R 3OW2P 1Q82R 1KQSP 1QVGP 1YIJQ 1JJ2P 1VQ9Q 1N8RR 2OTLQ 1VQMQ 1Q86R 3CD6Q 1YJ9Q 1VQKQ 3CCLQ 3CMAQ 1W2BP 3G4SQ 3CXCP 1Q81R 1VQ4Q 2QEXQ 1VQ5Q 3CC4Q 1VQ8Q 3CCRQ 1VQ7Q 3G6EQ 1YITQ 1M1KR 1VQLQ 1K8AR 1Q7YR 3CCVQ 3CCUQ 3CCQQ 1K9MR 1YI2Q 3CCJQ 3CCSQ 3I56Q 3CCMQ 2OTJQ 1VQOQ 3CC2Q 1VQNQ 1YHQQ 1YJNQ 1K73R 1NJIR 3CC7Q 3CMEQ 2QA4Q
chains in the Genus database with same CATH superfamily
1OU8A 3H0IA 5KCOA 3M0RA 2PVOB 1BU1A 1ZX6A 1JO8A 1SSHA 3EGXA 2RQVA 2RF0A 1RABB 1SHFA 2MWPA 3JCMJ 1Q7YC 5IHKA 2FVUA 1NEGA 4ZTFA 1OX9A 3E2UA 1VQ4T 4EMKB 2AT1B 2NLUA 4RUGA 2OAUA 4XQ3A 2IVWA 1TWBA 4GY5A 1QVPA 3OW2A 3OYKA 2KDSA 2EQMA 1T0HA 3GP8A 3M57A 3M9QA 1GBQA 5IH2A 5L8RE 4FW1A 2LNHB 1WFWA 2FZKB 2JVVA 2DL3A 7AT1B 5J26A 5FROA 2JJ9A 2E65A 4F7UE 3I56Q 1YHQQ 3QXEB 1SHGA 3LH5A 1AT1B 4HCKA 3R6OA 2YHTA 1K4US 2X35A 1I0CA 1VA7A 2DJQA 3CCLT 3M4GA 4LDUA 4JPBW 4M78D 2E70A 2F5TX 1AZEA 4N4IA 1OU9A 4GLMA 4RTXA 4YTLA 2QEXA 1NYGA 1VQNQ 3OBWA 2DAQA 1NYFA 3RR6A 2AHJB 2XDBA 2RJFA 2E10A 1MNDA 1M2VB 3OYDA 2O9VA 3VKIA 1MMAA 5CR2A 2RA2A 1KHCA 2J06A 1UG1A 3ZL7C 3JB9F 3M54A 3CCMQ 2P4RA 2F2WA 4E7IA 1M2OA 2QTVA 2ZZDA 4CC4B 3VS1A 3JB9I 4C92C 2FEIA 2CZ7B 4LDYA 4R55A 1ABQA 2EYYA 4ELZC 3CCLQ 2LT4A 2HSPA 2JMCA 2VC8A 4C8QF 3I9QA 4EMKA 1YIJA 4J6XA 4A53A 4C8QG 2DIQA 5GAOr 2AIRB 3CMAA 2IIMA 5FU6C 2V8KA 1WHHA 1NPRA 2KROA 1NLPC 2E5QA 4J9HA 4IUUA 4X34A 2L2PA 1SRLA 3CBPA 4J9FA 1ZBXA 5KE2A 1SPKA 3QBYA 1PCXA 1QVGS 2LZ6B 4C0DC 5GMKh 4C92D 3EG2A 4XTUA 2ATCB 3E1SA 4J6YA 3JCMW 1YBYA 3MP8A 3REBB 3M0QA 5CKFA 5LJ3g 4R0KA 2A36A 2CZ6B 3G71Q 2YLCA 2D6FA 4QT7A 5LJ5f 4M78F 4DBFA 1JXMA 4M78G 1MMGA 3CCRT 1NJIC 5J39A 1NZ9A 1Q81U 2I0NA 1RI0A 1K9MU 3MO8A 4M75E 3SHWA 1Y96A 3HHTB 3CCQA 4X9DA 4Z02A 1LOJA 1K0XA 2QK0A 2EKOA 1RADB 1JJ2P 4HKEA 2EW3A 3LWHA 1Y0MA 2DL8A 1Q81R 2EQJA 1PHTA 1JEGA 1YITT 2EYXA 1WHLA 1TUGB 3Q1JA 4ZTJA 1K9MR 3CD6A 1MV0B 4M77F 4M77G 4F04B 2CGHA 1BCMA 4KULA 1G3TA 4ATOA 3M5AA 1OYXA 2RI5A 4KGZB 4OMLA 3EHQA 1R8OB 2DA9A 2O9SA 4OMMA 8ATCB 4F17A 3CMEA 2O88A 3TVTA 4E7KA 4KH1B 2DRKA 4LD6A 3CCRQ 3OBYA 1PNJA 4A54A 3QWYA 3CCUT 3H8ZA 8AT1B 1OOTA 3G6EA 2DM1A 4F7UB 1T0JA 3LLRA 4Z8AA 5DLQE 3EG1A 3CPWP 4XTWA 2LTOA 3QHSA 4C5EA 1M8MA 3M0PA 3VS7A 1VQPA 2W10A 2KYBA 2QQ9A 4C92G 1ZQ1A 1WGSA 2RHIA 1YITQ 3M56A 2KNBB 2XDDA 1BB9A 2QI2A 4L6V5 5FU7B 3VUBA 3I5RA 1H641 3EG0A 1K73U 1Q81C 1JBMA 2BUDA 5GAMd 4BDZA 1ZA2B 4BUGA 1K9MC 1WXBA 3G1JA 2EJFA 3R6NA 3META 1AD5A 1WHGA 2HL5C 2X9HA 1T3LA 5GAMg 4NL3A 2K3BA 3C4SA 5I22A 2KE9A 2KXCA 2FZCB 2CKKA 1FX7A 2GQIA 5KYNA 2RJEA 2RPNA 1Y57A 3I56A 1OQKA 1YHQA 1MMNA 4OB2B 5GMKm 2Y4XA 2P0KA 4VUBA 1FMVA 3RNJA 5KYUA 2RN8A 2L89A 2A0FB 2DEUA 4XTVA 3L1AA 4AFZC 4M7DC 3MCAB 1N5ZA 4FT2A 4PK4A 2RK1A 2RHXA 1E6HA 2LMJA 4HVWA 3OQ5A 2YT6A 1Q86R 5LJ5h 2Z0WA 2QEXT 3H41A 1T3SA 1W2BS 4A4KA 4PFZA 4K11A 3ZEHA 2SEMA 2ZGWA 4PJNA 4XU1A 5HKCA 2NUTA 4JRPA 2BE9B 4M7DD 3CCMA 2WSFE 1XJWB 4E6RA 1IGQA 2M0OA 1LPLA 1XNIA 2P84A 2X4WA 4JRQA 1WPYA 4ZGJB 1VQKA 4A4FA 5GJWB 2DE0X 2EGEA 2IG0A 1XOVA 2P4TA 3MP1A 3MHXA 2OTJA 4M75B 2W0ZA 1YIJT 1QVFS 2DBMA 4OMPA 2D0NA 3CMAT 2QEXQ 3EG3A 2SRCA 2DRMA 3TEEA 1WHJA 5GAN7 2A7YA 3L42A 4MDXA 4PJOA 2L5QA 4QVDA 3RIRA 2CZ1B 3NFCA 1PSFA 5GANe 5HK3A 1Q86C 4RTVA 4J9EA 1B07A 2L3SA 3CEYA 3M53A 3FDRA 2VXEA 3S6WA 3NTKA 2HMAA 1N8RR 2YDLA 3KFVA 2YSQA 3G71A 4XU0A 2LVMA 3EFSA 4A4GA 3PVQA 2LQKA 3EG9B 2CYZB 2PZ1A 3MP6A 1AWOA 4AT1B 1M3BA 1GCQC 1QVGP 1YIJQ 2QASA 2MI6A 5GAMj 3CMAQ 1GXIE 5AYFA 1D0YA 1RAFB 3A8LB 4JZ3A 3CCQT 3SDZA 1YJNQ 4LE9A 5EC7A 3VS2A 2CUDA 2O4XA 3EGXB 1X75C 5KYYA 3GPLA 4BDYA 1A0NB 3M55A 3M59A 1QKXA 3JCMQ 3CD6T 3ASKA 1Q95G 4MZPA 4JLIA 2X4XA 3VRYA 1UJYA 1Z9QA 2XICA 2K3YA 3OYMA 3HKSA 1RAAB 2K6DA 2KT8A 5KH6A 4PL6A 1PWTA 2HDAA 1RLPC 3A8OB 3A8HB 3C95A 2KY9A 3CMET 1N8RC 1TS9A 1IO6A 4J5YA 3CCEQ 3SWNA 3THKA 1QLYA 4M75A 2BE7D 1UEBA 1HK9A 3QSUA 2RH2A 2DTHA 2R5AA 2E5KA 3H6ZA 5FW9A 1BKBA 1VOMA 3WVDB 4FYVB 3CCQQ 3VJPA 2BZYA 2DL4A 2RQRA 3UA6A 3E19A 4RTTA 5GAOl 1VQPT 1EZZB 1MUZA 1FXXA 3WVEB 3CXCA 1M5Q1 1OPKA 4AMCA 2OTLQ 1NG2A 4LNPA 1PG5B 3FC3A 2DETA 3INZA 1BCOA 2EQIA 4O5VA 2HQEA 2X4YA 3S3NA 1PD1A 4N0AA 4QKUA 2E4HA 4F7UF 3M4YA 2ED1A 2XI9A 3CMEQ 1KQSA 4HCZA 4F7UG 2LQWA 2F69A 2VB6A 2FRYA 4F16A 4GBQA 2LX7A 5GAN8 2AKKA 2XK0A 5LJ3e 2XDPA 4C8QC 3VS4A 2KRNA 2F2VA 2KK4A 4XU3A 3G6EQ 1C0MA 1CKBA 1X6BA 4RTZA 3I56T 2K57A 4M7DE 2JXBA 1YHQT 1C6VX 3JB9D 4RTWA 2RD1A 3VS5A 5GAN4 3V8JA 2O01E 1VQPQ 4JJDA 2C0OA 5GANd 2IPOB 1B34A 3AT1B 4M78A 1S72A 2QXFA 2C0TA 3NTHA 3QZ9B 2QDYB 4C0DB 5GANg 3X24B 2QQRA 4C8QD 3D7SB 1ACMB 2BZ8A 3L2QA 1VQNT 2I2LA 1YFNA 2BKDN 3C0CA 3VU3C 1WA7A 1FMKA 5CK9A 4M78C 2GBQA 5KCHA 3I5SA 2AK5A 1R0BG 3I55A 1WIEA 4ZGEB 3GNGA 2CP3A 1WZOA 2P0PA 3CCMT 4M77A 1VQ5A 2R58A 2FPFA 5C6SA 2QGGA 1AOJA 1PKSA 3JCMf 1E6GA 1M1GA 2BZXA 1UE9A 2COWA 1OZ2A 2EKHA 1VQKT 2LJ0A 4PLIA 1W2BP 3KUFA 3OYNA 4M77C 2BTTA 2ZPBB 1YJ9A 2OTJT 4OGEA 3HRSA 2M02A 5CQXA 2L0AA 1M9SA 2QTXA 2X3WD 4IUVA 2DVJA 4O6JA 1R77A 1Y96B 1UECA 4D8DA 1XQHA 1FYNA 3TU4K 4FCYA 3EGUA 2RQTA 5GAN3 1WHMA 4C5GA 4C92A 1DJ7B 2KRMA 2K3XA 4J7IA 4PJOE 3JAME 4B9XA 2MPXC 2CSIA 2KGTA 2VKNA 4EIKA 2EPDA 2EQUA 3JB9G 4M77D 4X1VA 2DD4A 5GAMe 3BFMA 1QVFP 3PNWC 2ZPIB 1JB0E 3G71T 1WQ7A 1D0XA 4FT4A 2D8JA 1KQSS 1BI1A 1K76A 1VQKQ 2CSQA 4HVUA 3OA6A 1D3BA 5KE3A 4J6WA 3OY9A 2X4JA 2ECZA 2OTJQ 2RQWA 4X9CA 1I1JA 2QGFB 1V29B 5DY9A 5KYXA 3DLLA 1AHJB 1P92A 1YJNA 5CKHA 4M7AF 1FMWA 1W4SA 2K5FA 3O5ZA 4M7AG 4WCIA 2KAFA 1WDXA 4ZN3A 5LJ3d 3IQLA 3P8HA 1M30A 2KSSA 1G8XA 1YCSB 2E3HA 1VQLA 1UUEA 5DLOA 4DOWA 1KFZA 3NPFA 5GANj 2JS0A 3JB9H 3OYYA 1JQQA 3OW2S 3OYFA 2O2OA 3CCEA 2QAZA 2A37A 4J7FA 1K0SA 2GQVA 1M3CA 1TSFA 2M1HA 3OYCA 3V7RA 2CP7A 3GF5A 2YUOA 4M7DB 1PC0A 4IUPA 2YRDA 2K5LA 2XU8A 2DXCA 2HEQA 4BI8B 2DK3A 2FHDA 5KYUB 4QQ6A 4Z89A 4OB1B 1K9AA 2OTLA 2HD0A 4XTZA 1SSFA 3RKYA 1SRMA 4WTOB 2E6NA 5HK0A 2VGMA 3CCVA 2VGNA 3NMZC 5CO7A 4DQ2A 3PE0A 3JCMh 3CBMA 4NS5A 2AZSA 3UDCA 4C8QE 1UJ0A 1X43A 3RBBB 1WI7A 3PFSA 1IHVA 2MOXA 2K2MA 2CP5A 1HSQA 3FEOA 2NWMA 4OB0B 3BY7A 3CC4A 1ZSZA 4FYWB 1I5LA 4XU2A 5HCKA 4KUDK 2NUTB 3GOXA 2QQAA 1EIFA 2LDMA 3S3MA 2VUBA 4DEXA 2OAWA 2DXBA 1BIAA 3H9NA 4J9IA 3M0UA 3NGPA 1PM3A 4AFUC 3QJ6A 2QG9B 2C06A 3SFMA 1ZSZC 1O75A 1KG1A 1QCFA 4PFOA 3H0HA 4ANJA 1S72T 1CSKA 1HD3A 2HKQB 4JUVA 3QO3A 3X26B 2CS7A 4M78E 2FL7A 2J6FA 1YP5A 2EBPA 4IURA 3SB2A 5FRNA 5A2QE 2VXFA 2EJ9A 1NLOC 1YJWA 4V2SA 1SG5A 4PJOB 1LCKA 4EMGA 1G83A 2ROLA 2RQUA 2K5IA 1K73R 5CAIA 1UGSB 2LQNA 4M7DA 4EDUA 5IT9E 3RKWA 3I55T 1PRMC 4F14A 1B3QA 2KR3A 1OV3A 3LGLA 1I5OB 2JNGA 3FLGA 2M9UA 2FPEA 2HAXA 1KQ1A 1VQ5T 1BI3A 2YWWA 1QKWA 4M77E 3HP9A 1GFDA 5LJ3j 2MK5A 2ZCFB 2V8JA 2XG8D 2VYTA 4MZTA 5IXBA 1R0CB 2V26A 3BW1A 2KXDA 3EGDA 4DBRA 5CKBA 1S72Q 1NM7A 1WLPB 4LDVA 4PFPA 1ABOA 2GTJA 1M1FA 3JV3A 1YJ9T 2NUZA 3OYEA 2EWNA 4L5GA 1U1TA 2BIVA 1ZLMA 1VQMA 4CRIA 1VQ4A 4QQDA 1SEMA 1TH7A 2EGAA 5GAN2 1UTIA 3VUZA 1JJ2A 2ZPHB 3MEWA 3C12A 5D6XA 2KQWA 2O4XB 4BI4A 5KYYB 1D1CA 1QMCA 4DBHA 3I55Q 4C92E 1ZUYA 1K1ZA 2V1QA 2V8IA 3JB9J 2CP0A 3RESA 3CQTA 3X25B 4L59A 1K73C 1VQ5Q 2COYA 1TG0A 2OX7A 4KGXB 2C0IA 1UGRB 1M1KU 2JTFA 3A8GB 1VQ8A 2DMOA 1IREB 1IRXA 2GF7A 3MKDA 3SWNB 1X01A 2JT4A 3TQ7P 1IXDA 1YJ9Q 2Y4YA 3PIOA 1D09B 3HPWA 3AHUA 4OF1A 1TXQA 1M3AA 2NUPA 3EFOA 4Q5WA 2GGRA 1YJNT 3FRNA 3OYIA 2DZ9A 4FW2A 2HL3A 3URGA 2M0YA 1MGQA 1I8FA 1KQSP 2VV5A 2E6ZA 1ZUUA 1VYVA 2LX9A 1GCQA 1N9RA 3RKXA 2DX1A 1HJDA 5L23A 2PVGB 1VQLT 1TU0B 1VQ9A 2ED0A 5FU7C 4JJCA 3QUIA 1VIFA 1JRIA 3QYGB 4E7SA 1X6GA 3PVLA 3UATA 2V1RA 3LX7A 3OMCA 4RTYA 2ZPEB 3CCET 1VQOA 3VYHB 2EYQA 4Y91A 2KYMA 1QCNA 3N5BB 1GFCA 3FJ5A 4MMKA 1UGPB 1RACB 2K9GA 2R5MA 4QVZA 1UDLA 2P0QA 3OS5A 1K8AU 3PMTA 4BE0A 2YLBA 5FLXE 2F1LA 2FZGB 2DPPB 2DO3A 3QIIA 2CT3A 3A5ZB 1B34B 3OW2P 1TUCA 4KBMB 2L3QA 2OTLT 4ZGDB 4HVVA 2ESWA 4M78B 2WSCE 4OMNA 1KD1U 2E64A 2K4YA 1E7OA 2XHCA 3JCMc 2ABLA 4ZNXA 3M0SA 1WJRA 1J3TA 3CCVT 1VQLQ 2PUKB 1K8AR 1ZBJA 1YCYA 3DKMA 1H92A 4RTUA 4ORZA 2D0QB 3QJYA 1KSWA 4D6WA 4BE1A 1G3SA 1IB8A 4HT9A 3HSBA 1UHCA 2A3LA 4M4ZA 3CC2A 1SF9A 4KH0B 3EFRA 4RG2A 1KC8U 4XTYA 1JJ2S 6AT1B 3CC4T 3OYAA 1VYUA 1U06A 2QQSA 3G6ET 1AWJA 2CZ0B 1ZHIA 5GAOq 3CCJQ 2PTKA 4M77B 1Q7YU 4BY6C 2DF6A 4J9DA 1IGUA 1VUBA 5GMKl 1KC8R 2L3PA 2EYWA 2KVQG 1V1CA 2MWOA 3P8DA 3OSVA 1YN8A 3UT1A 3VRZA 1X2QA 1WNLA 5A0DA 2MAMA 1KK7A 2DLPA 4C8QA 1RAEB 1U1SA 3BE3A 3CCVQ 1VYTA 4LD9K 2FPDA 1NBEB 3EH2A 5A0LA 4C5HA 2FRWA 2RHZA 4OMOA 2E1HA 1YJWT 1RL2A 3DB4A 4EMHA 1K8AC 4C92B 2JN0A 4M7AA 2G3RA 3F70A 4XTXA 3A1PA 3OYHA 3CC4Q 4IIOA 1D1AA 1Y71A 3VYGA 4QW2A 2JM9A 3O8VA 4JS5A 2DVEA 4N4HA 1PSEA 1PRLC 2K2VA 5LJ5e 4AFQC 4FM4B 5FU6B 2RI2A 1IZ6A 4BE2A 2J6KA 4M7AC 3PMIA 3RERA 1Q82U 4HCBA 4ELYC 1QWEA 1D3BB 1C1AA 4C0ZA 4JRIA 2GFUA 2DILA 2H3EB 4PJOF 4B9WA 1WXUA 1YI2Q 2DYBA 3NHNA 4KT0E 2LT1A 4ZN1A 2DTIA 2KRSA 3JCMP 2YUNA 4RCBA 1UHFA 5KYXB 1BYMA 5D6YA 2GNCA 1U8RA 1YJWQ 2LP5A 3BDLA 3RMSA 3CC7A 1Q82R 1RLQC 1CKAA 1VQMT 1VQ6A 5GANf 5FWBA 2DYIA 2E3IA 3V7SA 1MNEA 2HQHA 4QQGA 3UF4A 3J81E 4M7AD 2HBWA 3FIFA 5LL6S 4NL2A 1X27A 1H3ZA 1B7TA 3UWNA 4BB7A 2YRVA 1RAGB 3JCMd 1VQ7A 2DKGA 3OYLA 1I4K1 1D0ZA 3OS1A 3OYJA 4ESRA 3JCMg 2B86A 3DLMA 2Y90A 2DNUA 4AFSC 1VQ8T 1EFNA 3OB9A 4CC2A 3X28B 2HSEB 1F1BB 1BI0A 2CUBA 2LNVA 2LRQA 1Y7XA 1NE8A 2JMAA 4CI0C 1OI1A 4DBQA 1G2BA 1VQMQ 3JSCA 4J8OA 4CC3A 3QPHA 4D8KA 4LXCA 2CH4W 1VQ4Q 2CH4A 5CKDA 3HTRA 3OSSC 1GL5A 3CXCS 4E47A 3PTAA 2EAYA 4E7ZA 1Q82C 1TUDA 2XKOC 3V8KA 1GRIA 2RJCA 3CPFA 1H3HA 3E9GA 1HXDA 2M51A 4E7JA 1NJIU 4M75F 2PVDB 2WACA 1VQ9T 2D9TA 4M75G 4XK8E 2JS2A 4FYXB 2FO0A 2AZVA 2L8DA 3MEUA 4ME7A 1VQ8Q 3ZBDA 3TSWA 5CKEA 1VQOT 3G4SA 5GAOp 1LNXA 1ZSZB 3SD4A 1Y07A 1NJIR 2RO0A 1W6XA 2F2XA 4FU6A 2ZPFB 2EVRA 2J05A 3CCSA 3VS0A 1WJSA 1QP3A 5GJVB 3EHRA 2QA4A 5GMKj 4KGVB 1NPPA 2GCXA 4HT8A 5A0GA 2A08A 4DA4A 5I11A 1OEBA 3KXTA 3ER0A 4HCCA 3LW5E 3ZFJA 1AEYA 5C0MA 5LJ5d 2EGCA 1JU5C 3REAB 1VQ9Q 2XIDA 5IAYA 1ZA1B 4EMKC 3VS6A 4PJJA 1GCPA 3JRZA 5LJ5g 3MEAA 1U5SA 3CC2T 3G7ZA 1VQOQ 5LJ3f 3LYIA 2DL7A 4A4EA 3HRUA 2KI7A 1AWWA 2EYZA 2JM8A 4IIMA 3CCJA 2KMTA 1BBZA 3LWIA 2LJ1A 5KYWB 5GANh 1PD0A 2MIOA 2YUPA 4LN2A 4BD3A 1TOVA 2ENMA 2YRCA 1RUWA 2KBTA 2DJZA 3QWXX 3PT9A 3EGDB 5D7UA 3P8BB 1LVKA 2X51A 5GMKi 1YNZA 1W2BA 1G3YA 3QDFA 4JDSA 2CT4A 1M90U 3LGFA 1M2VA 1AVZC 2PQWA 2DTOA 1OULA 2GTOA 2MYSA 3S3OA 4BACA 2KT1A 5IHIA 2QDLA 2RHYA 2QYZA 3OYBA 5GAOn 3H0FA 1FWZA 3CC2Q 1TTHB 1YWPA 2YUQA 1LJOA 1M90R 4HXJA 1KJWA 5DM7R 2GFAA 3QKJA 4JS4A 2RI3A 3X20B 4M7AE 1AZGB 4FSXA 5CQYA 2MCNA 1QWFA 2QQBA 3PGGA 3WXMB 2J7IA 3EAEA 3E9FA 4CC7A 1QVFA 1KHIA 4N4GA 1AWXA 3L2RA 2ZAEA 1YI2A 2JOYA 2E12A 3HFNA 4JRKA 1BK2A 2J6OA 3PIPA 5AT1B 4C92F 1Z9ZA 4BI3A 1MHNA 1VIEA 2HQXA 1S1NA 2D8HA 2ROTA 4JZ4A 4JJNK 1WYXA 2CDTA 2NUPB 3EFOB 5GAN5 1QQJA 3CC7T 2L3RA 1VQ6T 3A8MB 4J9GA 4OVAA 1X6OA 3GIBA 1BI2A 2DEQA 4A63B 1EX4A 5HY6A 2DXUA 5GAMf 5KYWA 1VQ7T 2LCCA 4OP0A 3M58A 1M90C 3CCUQ 2WSEE 2VVKA 3JCMV 1HYOA 2DERA 1I81A 4E2FB 3GLXA 2VWFA 1ZSGA 3FB9A 2KEAA 4KUIA 3MEVA 5GAOm 5LJ5j 2OI3A 1IHWA 4OMFB 2R57A 4A4HA 5IN1A 2RB6A 1Q86U 2JZ2A 2EQKA 5M9OA 3TCJA 3L2ZA 3CC7Q 5LJ3h 2YXYA 3MJXA 4II1A 2MF2A 3M0TA 4C0GA 2E41A 5I2MA 1VQ6Q 4GLKA 1MV3A 2MMPA 3OS0A 1VQNA 1WXTA 3OS2A 3ULRB 2XD0A 2OJ2A 4HA8A 1N6AA 3V8LA 1RI9A 1VQ7Q 1UFFA 2DIGA 2CP2A 2FYKA 4WF2A 4FL6A 2D1XA 2H3JA 1M27C 2EIFA 2LCSA 4B6MA 1X2KA 4F7UA 4TVRA 2RK2A 4Z88A 4BY6B 9ATCB 5GMKe 1WHKA 3DB3A 5CIUA 4J83A 2DD5A 3JCMX 1OPLA 4J9CA 3U23A 3G4ST 4LDXA 3CXCP 3QZ5B 5IXFA 3L2VA 1QW1A 1M1KR 1WJQA 4AG2C 3J7AF 3CCST 3RDVA 3CCLA 4P5NA 1GBRA 3A98A 4DEYA 3CPWA 2HZYA 2QA4T 1V76A 1H8KA 3HL8A 1O9SA 1WQWA 4C5IA 5ECAA 2F5KA 3NTIA 1M8VA 1PKTA 1NEBA 3FJPA 3OYGA 5FWCA 1N8RU 5IHNA 4PNOA 4C8QB 1N27A 2X3XD 1UB4A 5I21A 1XTDA 2O31A 4LUDA 2EFIA 4MDWA 4AG1C 3JCMb 3UPUA 1W70A 1G3WA 2RM4A 4PKCC 2HKNA 4MZMA 4M7AB 3G4SQ 3GNFB 3VV0A 4UC4A 4MMLA 4PJOC 4DOVA 2HNIA 3JCMe 1JXOA 2CREA 3RUXA 2AKLA 3CCJT 3CCSQ 3T9NA 3C94A 2DL5A 4RMOA 4J9BA 3EH1A 2LC4A 1QP2A 1KIKA 2QA4Q 2K7AA 3KBGA 5CCAA 3I35A 1U3OA 1M1KC 3UA7A 3V7CA 5D6WA 2JTMA 5GAMh 4Y92A 2NYSA 3GBQA 2LCLA 4IUQA 4QVCA 2COZA 4PJOD 1UGQB 4PLLA 4M7DF 3HFOA 4M7DG 4OB3B 4IKFA 3MPUB 5I2SA 1KD1R 2LQ8A 1N9SA 4EPCA 4NOYA 1D1BA 4E7HA 2XMFA 1OX8A 2B8AA 2ZPGB 2A28A 2RNAA 2FB7A 4FSSA 4KRTA 2LJ3A 4XAXB 3SEMA 3VS3A 3CCRA 1BIBA 2PU9B 1M4ZA 5CVIA 4RKUE 3HRTA 1W1FA 4FIBA 3ME9A 3RMQA 2DFUA 4OMQA 5EG2A 2M16A 4RCCA 1WX6A 3J80E 1Q7YR 1YI2T 1G5VA 2RHUA 1MMDA 4RG8A 2G6FX 2EJGA 1YITA 3SWNC 2HCKA 4M75C 4Y28E 4E7LA 2DXTA 1RAHB 4OGCA 3QDRB 3CPWS 2DZCA 3CD6Q 2JW4A 1SKUB 4R56A 4LUEA 1ARKA 5GAN6 4JLGA 4FYYB 3TREA 3BDUA 2JUFA 2HBPA 3CBOA 3EG9A 2DBKA 1KD1C 2VASA 4PJMA 4PJLA 1RAIB 5FRMA 3TSZA 3QYHB 1ZUKA 2JTEA 4C0FA 1X69A 3QG1A 3CCUA 4M75D 5J3BA 1QCOA 1YWOA 2CP6A 2FG0A 4LDWA 3OMGA 3L2UA 4N0AC 2RMOA 1OZ3A 1KQ2A 1I07A 4IUTA 2PUOB 2PNIA 3LH0A 4JJBA 2H8HA 3L2WA 4PJOG 1KC8C 2RJDA 1UGVA 2K79A 1QVGA
chains in the Genus database with same CATH topology
1VQ6Q 1QVFP 1M90R 1S72Q 1VQPQ 3CCEQ 3CPWP 1KC8R 3G71Q 3I55Q 1YJWQ 1KD1R 3OW2P 1Q82R 1KQSP 1QVGP 1YIJQ 1JJ2P 1VQ9Q 1N8RR 2OTLQ 1VQMQ 1Q86R 3CD6Q 1YJ9Q 1VQKQ 3CCLQ 3CMAQ 1W2BP 3G4SQ 3CXCP 1Q81R 1VQ4Q 2QEXQ 1VQ5Q 3CC4Q 1VQ8Q 3CCRQ 1VQ7Q 3G6EQ 1YITQ 1M1KR 1VQLQ 1K8AR 1Q7YR 3CCVQ 3CCUQ 3CCQQ 1K9MR 1YI2Q 3CCJQ 3CCSQ 3I56Q 3CCMQ 2OTJQ 1VQOQ 3CC2Q 1VQNQ 1YHQQ 1YJNQ 1K73R 1NJIR 3CC7Q 3CMEQ 2QA4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 Q;  1QVF P;  1M90 R;  1S72 Q;  1VQP Q;  3CCE Q;  3CPW P;  1KC8 R;  3G71 Q;  3I55 Q;  1YJW Q;  1KD1 R;  3OW2 P;  1Q82 R;  1KQS P;  1QVG P;  1YIJ Q;  1JJ2 P;  1VQ9 Q;  1N8R R;  2OTL Q;  1VQM Q;  1Q86 R;  3CD6 Q;  1YJ9 Q;  1VQK Q;  3CCL Q;  3CMA Q;  1W2B P;  3G4S Q;  3CXC P;  1Q81 R;  1VQ4 Q;  2QEX Q;  1VQ5 Q;  3CC4 Q;  1VQ8 Q;  3CCR Q;  1VQ7 Q;  3G6E Q;  1YIT Q;  1M1K R;  1VQL Q;  1K8A R;  1Q7Y R;  3CCV Q;  3CCU Q;  3CCQ Q;  1K9M R;  1YI2 Q;  3CCJ Q;  3CCS Q;  3I56 Q;  3CCM Q;  2OTJ Q;  1VQO Q;  3CC2 Q;  1VQN Q;  1YHQ Q;  1YJN Q;  1K73 R;  1NJI R;  3CC7 Q;  3CME Q;  2QA4 Q; 
#chains in the Genus database with same CATH topology
 1OU8 A;  3H0I A;  5KCO A;  3M0R A;  2PVO B;  1BU1 A;  1ZX6 A;  1JO8 A;  1SSH A;  3EGX A;  2RQV A;  2RF0 A;  1RAB B;  1SHF A;  2MWP A;  3JCM J;  1Q7Y C;  5IHK A;  2FVU A;  1NEG A;  4ZTF A;  1OX9 A;  3E2U A;  1VQ4 T;  4EMK B;  2AT1 B;  2NLU A;  4RUG A;  2OAU A;  4XQ3 A;  2IVW A;  1TWB A;  4GY5 A;  1QVP A;  3OW2 A;  3OYK A;  2KDS A;  2EQM A;  1T0H A;  3GP8 A;  3M57 A;  3M9Q A;  1GBQ A;  5IH2 A;  5L8R E;  4FW1 A;  2LNH B;  1WFW A;  2FZK B;  2JVV A;  2DL3 A;  7AT1 B;  5J26 A;  5FRO A;  2JJ9 A;  2E65 A;  4F7U E;  3I56 Q;  1YHQ Q;  3QXE B;  1SHG A;  3LH5 A;  1AT1 B;  4HCK A;  3R6O A;  2YHT A;  1K4U S;  2X35 A;  1I0C A;  1VA7 A;  2DJQ A;  3CCL T;  3M4G A;  4LDU A;  4JPB W;  4M78 D;  2E70 A;  2F5T X;  1AZE A;  4N4I A;  1OU9 A;  4GLM A;  4RTX A;  4YTL A;  2QEX A;  1NYG A;  1VQN Q;  3OBW A;  2DAQ A;  1NYF A;  3RR6 A;  2AHJ B;  2XDB A;  2RJF A;  2E10 A;  1MND A;  1M2V B;  3OYD A;  2O9V A;  3VKI A;  1MMA A;  5CR2 A;  2RA2 A;  1KHC A;  2J06 A;  1UG1 A;  3ZL7 C;  3JB9 F;  3M54 A;  3CCM Q;  2P4R A;  2F2W A;  4E7I A;  1M2O A;  2QTV A;  2ZZD A;  4CC4 B;  3VS1 A;  3JB9 I;  4C92 C;  2FEI A;  2CZ7 B;  4LDY A;  4R55 A;  1ABQ A;  2EYY A;  4ELZ C;  3CCL Q;  2LT4 A;  2HSP A;  2JMC A;  2VC8 A;  4C8Q F;  3I9Q A;  4EMK A;  1YIJ A;  4J6X A;  4A53 A;  4C8Q G;  2DIQ A;  5GAO r;  2AIR B;  3CMA A;  2IIM A;  5FU6 C;  2V8K A;  1WHH A;  1NPR A;  2KRO A;  1NLP C;  2E5Q A;  4J9H A;  4IUU A;  4X34 A;  2L2P A;  1SRL A;  3CBP A;  4J9F A;  1ZBX A;  5KE2 A;  1SPK A;  3QBY A;  1PCX A;  1QVG S;  2LZ6 B;  4C0D C;  5GMK h;  4C92 D;  3EG2 A;  4XTU A;  2ATC B;  3E1S A;  4J6Y A;  3JCM W;  1YBY A;  3MP8 A;  3REB B;  3M0Q A;  5CKF A;  5LJ3 g;  4R0K A;  2A36 A;  2CZ6 B;  3G71 Q;  2YLC A;  2D6F A;  4QT7 A;  5LJ5 f;  4M78 F;  4DBF A;  1JXM A;  4M78 G;  1MMG A;  3CCR T;  1NJI C;  5J39 A;  1NZ9 A;  1Q81 U;  2I0N A;  1RI0 A;  1K9M U;  3MO8 A;  4M75 E;  3SHW A;  1Y96 A;  3HHT B;  3CCQ A;  4X9D A;  4Z02 A;  1LOJ A;  1K0X A;  2QK0 A;  2EKO A;  1RAD B;  1JJ2 P;  4HKE A;  2EW3 A;  3LWH A;  1Y0M A;  2DL8 A;  1Q81 R;  2EQJ A;  1PHT A;  1JEG A;  1YIT T;  2EYX A;  1WHL A;  1TUG B;  3Q1J A;  4ZTJ A;  1K9M R;  3CD6 A;  1MV0 B;  4M77 F;  4M77 G;  4F04 B;  2CGH A;  1BCM A;  4KUL A;  1G3T A;  4ATO A;  3M5A A;  1OYX A;  2RI5 A;  4KGZ B;  4OML A;  3EHQ A;  1R8O B;  2DA9 A;  2O9S A;  4OMM A;  8ATC B;  4F17 A;  3CME A;  2O88 A;  3TVT A;  4E7K A;  4KH1 B;  2DRK A;  4LD6 A;  3CCR Q;  3OBY A;  1PNJ A;  4A54 A;  3QWY A;  3CCU T;  3H8Z A;  8AT1 B;  1OOT A;  3G6E A;  2DM1 A;  4F7U B;  1T0J A;  3LLR A;  4Z8A A;  5DLQ E;  3EG1 A;  3CPW P;  4XTW A;  2LTO A;  3QHS A;  4C5E A;  1M8M A;  3M0P A;  3VS7 A;  1VQP A;  2W10 A;  2KYB A;  2QQ9 A;  4C92 G;  1ZQ1 A;  1WGS A;  2RHI A;  1YIT Q;  3M56 A;  2KNB B;  2XDD A;  1BB9 A;  2QI2 A;  4L6V 5;  5FU7 B;  3VUB A;  3I5R A;  1H64 1;  3EG0 A;  1K73 U;  1Q81 C;  1JBM A;  2BUD A;  5GAM d;  4BDZ A;  1ZA2 B;  4BUG A;  1K9M C;  1WXB A;  3G1J A;  2EJF A;  3R6N A;  3MET A;  1AD5 A;  1WHG A;  2HL5 C;  2X9H A;  1T3L A;  5GAM g;  4NL3 A;  2K3B A;  3C4S A;  5I22 A;  2KE9 A;  2KXC A;  2FZC B;  2CKK A;  1FX7 A;  2GQI A;  5KYN A;  2RJE A;  2RPN A;  1Y57 A;  3I56 A;  1OQK A;  1YHQ A;  1MMN A;  4OB2 B;  5GMK m;  2Y4X A;  2P0K A;  4VUB A;  1FMV A;  3RNJ A;  5KYU A;  2RN8 A;  2L89 A;  2A0F B;  2DEU A;  4XTV A;  3L1A A;  4AFZ C;  4M7D C;  3MCA B;  1N5Z A;  4FT2 A;  4PK4 A;  2RK1 A;  2RHX A;  1E6H A;  2LMJ A;  4HVW A;  3OQ5 A;  2YT6 A;  1Q86 R;  5LJ5 h;  2Z0W A;  2QEX T;  3H41 A;  1T3S A;  1W2B S;  4A4K A;  4PFZ A;  4K11 A;  3ZEH A;  2SEM A;  2ZGW A;  4PJN A;  4XU1 A;  5HKC A;  2NUT A;  4JRP A;  2BE9 B;  4M7D D;  3CCM A;  2WSF E;  1XJW B;  4E6R A;  1IGQ A;  2M0O A;  1LPL A;  1XNI A;  2P84 A;  2X4W A;  4JRQ A;  1WPY A;  4ZGJ B;  1VQK A;  4A4F A;  5GJW B;  2DE0 X;  2EGE A;  2IG0 A;  1XOV A;  2P4T A;  3MP1 A;  3MHX A;  2OTJ A;  4M75 B;  2W0Z A;  1YIJ T;  1QVF S;  2DBM A;  4OMP A;  2D0N A;  3CMA T;  2QEX Q;  3EG3 A;  2SRC A;  2DRM A;  3TEE A;  1WHJ A;  5GAN 7;  2A7Y A;  3L42 A;  4MDX A;  4PJO A;  2L5Q A;  4QVD A;  3RIR A;  2CZ1 B;  3NFC A;  1PSF A;  5GAN e;  5HK3 A;  1Q86 C;  4RTV A;  4J9E A;  1B07 A;  2L3S A;  3CEY A;  3M53 A;  3FDR A;  2VXE A;  3S6W A;  3NTK A;  2HMA A;  1N8R R;  2YDL A;  3KFV A;  2YSQ A;  3G71 A;  4XU0 A;  2LVM A;  3EFS A;  4A4G A;  3PVQ A;  2LQK A;  3EG9 B;  2CYZ B;  2PZ1 A;  3MP6 A;  1AWO A;  4AT1 B;  1M3B A;  1GCQ C;  1QVG P;  1YIJ Q;  2QAS A;  2MI6 A;  5GAM j;  3CMA Q;  1GXI E;  5AYF A;  1D0Y A;  1RAF B;  3A8L B;  4JZ3 A;  3CCQ T;  3SDZ A;  1YJN Q;  4LE9 A;  5EC7 A;  3VS2 A;  2CUD A;  2O4X A;  3EGX B;  1X75 C;  5KYY A;  3GPL A;  4BDY A;  1A0N B;  3M55 A;  3M59 A;  1QKX A;  3JCM Q;  3CD6 T;  3ASK A;  1Q95 G;  4MZP A;  4JLI A;  2X4X A;  3VRY A;  1UJY A;  1Z9Q A;  2XIC A;  2K3Y A;  3OYM A;  3HKS A;  1RAA B;  2K6D A;  2KT8 A;  5KH6 A;  4PL6 A;  1PWT A;  2HDA A;  1RLP C;  3A8O B;  3A8H B;  3C95 A;  2KY9 A;  3CME T;  1N8R C;  1TS9 A;  1IO6 A;  4J5Y A;  3CCE Q;  3SWN A;  3THK A;  1QLY A;  4M75 A;  2BE7 D;  1UEB A;  1HK9 A;  3QSU A;  2RH2 A;  2DTH A;  2R5A A;  2E5K A;  3H6Z A;  5FW9 A;  1BKB A;  1VOM A;  3WVD B;  4FYV B;  3CCQ Q;  3VJP A;  2BZY A;  2DL4 A;  2RQR A;  3UA6 A;  3E19 A;  4RTT A;  5GAO l;  1VQP T;  1EZZ B;  1MUZ A;  1FXX A;  3WVE B;  3CXC A;  1M5Q 1;  1OPK A;  4AMC A;  2OTL Q;  1NG2 A;  4LNP A;  1PG5 B;  3FC3 A;  2DET A;  3INZ A;  1BCO A;  2EQI A;  4O5V A;  2HQE A;  2X4Y A;  3S3N A;  1PD1 A;  4N0A A;  4QKU A;  2E4H A;  4F7U F;  3M4Y A;  2ED1 A;  2XI9 A;  3CME Q;  1KQS A;  4HCZ A;  4F7U G;  2LQW A;  2F69 A;  2VB6 A;  2FRY A;  4F16 A;  4GBQ A;  2LX7 A;  5GAN 8;  2AKK A;  2XK0 A;  5LJ3 e;  2XDP A;  4C8Q C;  3VS4 A;  2KRN A;  2F2V A;  2KK4 A;  4XU3 A;  3G6E Q;  1C0M A;  1CKB A;  1X6B A;  4RTZ A;  3I56 T;  2K57 A;  4M7D E;  2JXB A;  1YHQ T;  1C6V X;  3JB9 D;  4RTW A;  2RD1 A;  3VS5 A;  5GAN 4;  3V8J A;  2O01 E;  1VQP Q;  4JJD A;  2C0O A;  5GAN d;  2IPO B;  1B34 A;  3AT1 B;  4M78 A;  1S72 A;  2QXF A;  2C0T A;  3NTH A;  3QZ9 B;  2QDY B;  4C0D B;  5GAN g;  3X24 B;  2QQR A;  4C8Q D;  3D7S B;  1ACM B;  2BZ8 A;  3L2Q A;  1VQN T;  2I2L A;  1YFN A;  2BKD N;  3C0C A;  3VU3 C;  1WA7 A;  1FMK A;  5CK9 A;  4M78 C;  2GBQ A;  5KCH A;  3I5S A;  2AK5 A;  1R0B G;  3I55 A;  1WIE A;  4ZGE B;  3GNG A;  2CP3 A;  1WZO A;  2P0P A;  3CCM T;  4M77 A;  1VQ5 A;  2R58 A;  2FPF A;  5C6S A;  2QGG A;  1AOJ A;  1PKS A;  3JCM f;  1E6G A;  1M1G A;  2BZX A;  1UE9 A;  2COW A;  1OZ2 A;  2EKH A;  1VQK T;  2LJ0 A;  4PLI A;  1W2B P;  3KUF A;  3OYN A;  4M77 C;  2BTT A;  2ZPB B;  1YJ9 A;  2OTJ T;  4OGE A;  3HRS A;  2M02 A;  5CQX A;  2L0A A;  1M9S A;  2QTX A;  2X3W D;  4IUV A;  2DVJ A;  4O6J A;  1R77 A;  1Y96 B;  1UEC A;  4D8D A;  1XQH A;  1FYN A;  3TU4 K;  4FCY A;  3EGU A;  2RQT A;  5GAN 3;  1WHM A;  4C5G A;  4C92 A;  1DJ7 B;  2KRM A;  2K3X A;  4J7I A;  4PJO E;  3JAM E;  4B9X A;  2MPX C;  2CSI A;  2KGT A;  2VKN A;  4EIK A;  2EPD A;  2EQU A;  3JB9 G;  4M77 D;  4X1V A;  2DD4 A;  5GAM e;  3BFM A;  1QVF P;  3PNW C;  2ZPI B;  1JB0 E;  3G71 T;  1WQ7 A;  1D0X A;  4FT4 A;  2D8J A;  1KQS S;  1BI1 A;  1K76 A;  1VQK Q;  2CSQ A;  4HVU A;  3OA6 A;  1D3B A;  5KE3 A;  4J6W A;  3OY9 A;  2X4J A;  2ECZ A;  2OTJ Q;  2RQW A;  4X9C A;  1I1J A;  2QGF B;  1V29 B;  5DY9 A;  5KYX A;  3DLL A;  1AHJ B;  1P92 A;  1YJN A;  5CKH A;  4M7A F;  1FMW A;  1W4S A;  2K5F A;  3O5Z A;  4M7A G;  4WCI A;  2KAF A;  1WDX A;  4ZN3 A;  5LJ3 d;  3IQL A;  3P8H A;  1M30 A;  2KSS A;  1G8X A;  1YCS B;  2E3H A;  1VQL A;  1UUE A;  5DLO A;  4DOW A;  1KFZ A;  3NPF A;  5GAN j;  2JS0 A;  3JB9 H;  3OYY A;  1JQQ A;  3OW2 S;  3OYF A;  2O2O A;  3CCE A;  2QAZ A;  2A37 A;  4J7F A;  1K0S A;  2GQV A;  1M3C A;  1TSF A;  2M1H A;  3OYC A;  3V7R A;  2CP7 A;  3GF5 A;  2YUO A;  4M7D B;  1PC0 A;  4IUP A;  2YRD A;  2K5L A;  2XU8 A;  2DXC A;  2HEQ A;  4BI8 B;  2DK3 A;  2FHD A;  5KYU B;  4QQ6 A;  4Z89 A;  4OB1 B;  1K9A A;  2OTL A;  2HD0 A;  4XTZ A;  1SSF A;  3RKY A;  1SRM A;  4WTO B;  2E6N A;  5HK0 A;  2VGM A;  3CCV A;  2VGN A;  3NMZ C;  5CO7 A;  4DQ2 A;  3PE0 A;  3JCM h;  3CBM A;  4NS5 A;  2AZS A;  3UDC A;  4C8Q E;  1UJ0 A;  1X43 A;  3RBB B;  1WI7 A;  3PFS A;  1IHV A;  2MOX A;  2K2M A;  2CP5 A;  1HSQ A;  3FEO A;  2NWM A;  4OB0 B;  3BY7 A;  3CC4 A;  1ZSZ A;  4FYW B;  1I5L A;  4XU2 A;  5HCK A;  4KUD K;  2NUT B;  3GOX A;  2QQA A;  1EIF A;  2LDM A;  3S3M A;  2VUB A;  4DEX A;  2OAW A;  2DXB A;  1BIA A;  3H9N A;  4J9I A;  3M0U A;  3NGP A;  1PM3 A;  4AFU C;  3QJ6 A;  2QG9 B;  2C06 A;  3SFM A;  1ZSZ C;  1O75 A;  1KG1 A;  1QCF A;  4PFO A;  3H0H A;  4ANJ A;  1S72 T;  1CSK A;  1HD3 A;  2HKQ B;  4JUV A;  3QO3 A;  3X26 B;  2CS7 A;  4M78 E;  2FL7 A;  2J6F A;  1YP5 A;  2EBP A;  4IUR A;  3SB2 A;  5FRN A;  5A2Q E;  2VXF A;  2EJ9 A;  1NLO C;  1YJW A;  4V2S A;  1SG5 A;  4PJO B;  1LCK A;  4EMG A;  1G83 A;  2ROL A;  2RQU A;  2K5I A;  1K73 R;  5CAI A;  1UGS B;  2LQN A;  4M7D A;  4EDU A;  5IT9 E;  3RKW A;  3I55 T;  1PRM C;  4F14 A;  1B3Q A;  2KR3 A;  1OV3 A;  3LGL A;  1I5O B;  2JNG A;  3FLG A;  2M9U A;  2FPE A;  2HAX A;  1KQ1 A;  1VQ5 T;  1BI3 A;  2YWW A;  1QKW A;  4M77 E;  3HP9 A;  1GFD A;  5LJ3 j;  2MK5 A;  2ZCF B;  2V8J A;  2XG8 D;  2VYT A;  4MZT A;  5IXB A;  1R0C B;  2V26 A;  3BW1 A;  2KXD A;  3EGD A;  4DBR A;  5CKB A;  1S72 Q;  1NM7 A;  1WLP B;  4LDV A;  4PFP A;  1ABO A;  2GTJ A;  1M1F A;  3JV3 A;  1YJ9 T;  2NUZ A;  3OYE A;  2EWN A;  4L5G A;  1U1T A;  2BIV A;  1ZLM A;  1VQM A;  4CRI A;  1VQ4 A;  4QQD A;  1SEM A;  1TH7 A;  2EGA A;  5GAN 2;  1UTI A;  3VUZ A;  1JJ2 A;  2ZPH B;  3MEW A;  3C12 A;  5D6X A;  2KQW A;  2O4X B;  4BI4 A;  5KYY B;  1D1C A;  1QMC A;  4DBH A;  3I55 Q;  4C92 E;  1ZUY A;  1K1Z A;  2V1Q A;  2V8I A;  3JB9 J;  2CP0 A;  3RES A;  3CQT A;  3X25 B;  4L59 A;  1K73 C;  1VQ5 Q;  2COY A;  1TG0 A;  2OX7 A;  4KGX B;  2C0I A;  1UGR B;  1M1K U;  2JTF A;  3A8G B;  1VQ8 A;  2DMO A;  1IRE B;  1IRX A;  2GF7 A;  3MKD A;  3SWN B;  1X01 A;  2JT4 A;  3TQ7 P;  1IXD A;  1YJ9 Q;  2Y4Y A;  3PIO A;  1D09 B;  3HPW A;  3AHU A;  4OF1 A;  1TXQ A;  1M3A A;  2NUP A;  3EFO A;  4Q5W A;  2GGR A;  1YJN T;  3FRN A;  3OYI A;  2DZ9 A;  4FW2 A;  2HL3 A;  3URG A;  2M0Y A;  1MGQ A;  1I8F A;  1KQS P;  2VV5 A;  2E6Z A;  1ZUU A;  1VYV A;  2LX9 A;  1GCQ A;  1N9R A;  3RKX A;  2DX1 A;  1HJD A;  5L23 A;  2PVG B;  1VQL T;  1TU0 B;  1VQ9 A;  2ED0 A;  5FU7 C;  4JJC A;  3QUI A;  1VIF A;  1JRI A;  3QYG B;  4E7S A;  1X6G A;  3PVL A;  3UAT A;  2V1R A;  3LX7 A;  3OMC A;  4RTY A;  2ZPE B;  3CCE T;  1VQO A;  3VYH B;  2EYQ A;  4Y91 A;  2KYM A;  1QCN A;  3N5B B;  1GFC A;  3FJ5 A;  4MMK A;  1UGP B;  1RAC B;  2K9G A;  2R5M A;  4QVZ A;  1UDL A;  2P0Q A;  3OS5 A;  1K8A U;  3PMT A;  4BE0 A;  2YLB A;  5FLX E;  2F1L A;  2FZG B;  2DPP B;  2DO3 A;  3QII A;  2CT3 A;  3A5Z B;  1B34 B;  3OW2 P;  1TUC A;  4KBM B;  2L3Q A;  2OTL T;  4ZGD B;  4HVV A;  2ESW A;  4M78 B;  2WSC E;  4OMN A;  1KD1 U;  2E64 A;  2K4Y A;  1E7O A;  2XHC A;  3JCM c;  2ABL A;  4ZNX A;  3M0S A;  1WJR A;  1J3T A;  3CCV T;  1VQL Q;  2PUK B;  1K8A R;  1ZBJ A;  1YCY A;  3DKM A;  1H92 A;  4RTU A;  4ORZ A;  2D0Q B;  3QJY A;  1KSW A;  4D6W A;  4BE1 A;  1G3S A;  1IB8 A;  4HT9 A;  3HSB A;  1UHC A;  2A3L A;  4M4Z A;  3CC2 A;  1SF9 A;  4KH0 B;  3EFR A;  4RG2 A;  1KC8 U;  4XTY A;  1JJ2 S;  6AT1 B;  3CC4 T;  3OYA A;  1VYU A;  1U06 A;  2QQS A;  3G6E T;  1AWJ A;  2CZ0 B;  1ZHI A;  5GAO q;  3CCJ Q;  2PTK A;  4M77 B;  1Q7Y U;  4BY6 C;  2DF6 A;  4J9D A;  1IGU A;  1VUB A;  5GMK l;  1KC8 R;  2L3P A;  2EYW A;  2KVQ G;  1V1C A;  2MWO A;  3P8D A;  3OSV A;  1YN8 A;  3UT1 A;  3VRZ A;  1X2Q A;  1WNL A;  5A0D A;  2MAM A;  1KK7 A;  2DLP A;  4C8Q A;  1RAE B;  1U1S A;  3BE3 A;  3CCV Q;  1VYT A;  4LD9 K;  2FPD A;  1NBE B;  3EH2 A;  5A0L A;  4C5H A;  2FRW A;  2RHZ A;  4OMO A;  2E1H A;  1YJW T;  1RL2 A;  3DB4 A;  4EMH A;  1K8A C;  4C92 B;  2JN0 A;  4M7A A;  2G3R A;  3F70 A;  4XTX A;  3A1P A;  3OYH A;  3CC4 Q;  4IIO A;  1D1A A;  1Y71 A;  3VYG A;  4QW2 A;  2JM9 A;  3O8V A;  4JS5 A;  2DVE A;  4N4H A;  1PSE A;  1PRL C;  2K2V A;  5LJ5 e;  4AFQ C;  4FM4 B;  5FU6 B;  2RI2 A;  1IZ6 A;  4BE2 A;  2J6K A;  4M7A C;  3PMI A;  3RER A;  1Q82 U;  4HCB A;  4ELY C;  1QWE A;  1D3B B;  1C1A A;  4C0Z A;  4JRI A;  2GFU A;  2DIL A;  2H3E B;  4PJO F;  4B9W A;  1WXU A;  1YI2 Q;  2DYB A;  3NHN A;  4KT0 E;  2LT1 A;  4ZN1 A;  2DTI A;  2KRS A;  3JCM P;  2YUN A;  4RCB A;  1UHF A;  5KYX B;  1BYM A;  5D6Y A;  2GNC A;  1U8R A;  1YJW Q;  2LP5 A;  3BDL A;  3RMS A;  3CC7 A;  1Q82 R;  1RLQ C;  1CKA A;  1VQM T;  1VQ6 A;  5GAN f;  5FWB A;  2DYI A;  2E3I A;  3V7S A;  1MNE A;  2HQH A;  4QQG A;  3UF4 A;  3J81 E;  4M7A D;  2HBW A;  3FIF A;  5LL6 S;  4NL2 A;  1X27 A;  1H3Z A;  1B7T A;  3UWN A;  4BB7 A;  2YRV A;  1RAG B;  3JCM d;  1VQ7 A;  2DKG A;  3OYL A;  1I4K 1;  1D0Z A;  3OS1 A;  3OYJ A;  4ESR A;  3JCM g;  2B86 A;  3DLM A;  2Y90 A;  2DNU A;  4AFS C;  1VQ8 T;  1EFN A;  3OB9 A;  4CC2 A;  3X28 B;  2HSE B;  1F1B B;  1BI0 A;  2CUB A;  2LNV A;  2LRQ A;  1Y7X A;  1NE8 A;  2JMA A;  4CI0 C;  1OI1 A;  4DBQ A;  1G2B A;  1VQM Q;  3JSC A;  4J8O A;  4CC3 A;  3QPH A;  4D8K A;  4LXC A;  2CH4 W;  1VQ4 Q;  2CH4 A;  5CKD A;  3HTR A;  3OSS C;  1GL5 A;  3CXC S;  4E47 A;  3PTA A;  2EAY A;  4E7Z A;  1Q82 C;  1TUD A;  2XKO C;  3V8K A;  1GRI A;  2RJC A;  3CPF A;  1H3H A;  3E9G A;  1HXD A;  2M51 A;  4E7J A;  1NJI U;  4M75 F;  2PVD B;  2WAC A;  1VQ9 T;  2D9T A;  4M75 G;  4XK8 E;  2JS2 A;  4FYX B;  2FO0 A;  2AZV A;  2L8D A;  3MEU A;  4ME7 A;  1VQ8 Q;  3ZBD A;  3TSW A;  5CKE A;  1VQO T;  3G4S A;  5GAO p;  1LNX A;  1ZSZ B;  3SD4 A;  1Y07 A;  1NJI R;  2RO0 A;  1W6X A;  2F2X A;  4FU6 A;  2ZPF B;  2EVR A;  2J05 A;  3CCS A;  3VS0 A;  1WJS A;  1QP3 A;  5GJV B;  3EHR A;  2QA4 A;  5GMK j;  4KGV B;  1NPP A;  2GCX A;  4HT8 A;  5A0G A;  2A08 A;  4DA4 A;  5I11 A;  1OEB A;  3KXT A;  3ER0 A;  4HCC A;  3LW5 E;  3ZFJ A;  1AEY A;  5C0M A;  5LJ5 d;  2EGC A;  1JU5 C;  3REA B;  1VQ9 Q;  2XID A;  5IAY A;  1ZA1 B;  4EMK C;  3VS6 A;  4PJJ A;  1GCP A;  3JRZ A;  5LJ5 g;  3MEA A;  1U5S A;  3CC2 T;  3G7Z A;  1VQO Q;  5LJ3 f;  3LYI A;  2DL7 A;  4A4E A;  3HRU A;  2KI7 A;  1AWW A;  2EYZ A;  2JM8 A;  4IIM A;  3CCJ A;  2KMT A;  1BBZ A;  3LWI A;  2LJ1 A;  5KYW B;  5GAN h;  1PD0 A;  2MIO A;  2YUP A;  4LN2 A;  4BD3 A;  1TOV A;  2ENM A;  2YRC A;  1RUW A;  2KBT A;  2DJZ A;  3QWX X;  3PT9 A;  3EGD B;  5D7U A;  3P8B B;  1LVK A;  2X51 A;  5GMK i;  1YNZ A;  1W2B A;  1G3Y A;  3QDF A;  4JDS A;  2CT4 A;  1M90 U;  3LGF A;  1M2V A;  1AVZ C;  2PQW A;  2DTO A;  1OUL A;  2GTO A;  2MYS A;  3S3O A;  4BAC A;  2KT1 A;  5IHI A;  2QDL A;  2RHY A;  2QYZ A;  3OYB A;  5GAO n;  3H0F A;  1FWZ A;  3CC2 Q;  1TTH B;  1YWP A;  2YUQ A;  1LJO A;  1M90 R;  4HXJ A;  1KJW A;  5DM7 R;  2GFA A;  3QKJ A;  4JS4 A;  2RI3 A;  3X20 B;  4M7A E;  1AZG B;  4FSX A;  5CQY A;  2MCN A;  1QWF A;  2QQB A;  3PGG A;  3WXM B;  2J7I A;  3EAE A;  3E9F A;  4CC7 A;  1QVF A;  1KHI A;  4N4G A;  1AWX A;  3L2R A;  2ZAE A;  1YI2 A;  2JOY A;  2E12 A;  3HFN A;  4JRK A;  1BK2 A;  2J6O A;  3PIP A;  5AT1 B;  4C92 F;  1Z9Z A;  4BI3 A;  1MHN A;  1VIE A;  2HQX A;  1S1N A;  2D8H A;  2ROT A;  4JZ4 A;  4JJN K;  1WYX A;  2CDT A;  2NUP B;  3EFO B;  5GAN 5;  1QQJ A;  3CC7 T;  2L3R A;  1VQ6 T;  3A8M B;  4J9G A;  4OVA A;  1X6O A;  3GIB A;  1BI2 A;  2DEQ A;  4A63 B;  1EX4 A;  5HY6 A;  2DXU A;  5GAM f;  5KYW A;  1VQ7 T;  2LCC A;  4OP0 A;  3M58 A;  1M90 C;  3CCU Q;  2WSE E;  2VVK A;  3JCM V;  1HYO A;  2DER A;  1I81 A;  4E2F B;  3GLX A;  2VWF A;  1ZSG A;  3FB9 A;  2KEA A;  4KUI A;  3MEV A;  5GAO m;  5LJ5 j;  2OI3 A;  1IHW A;  4OMF B;  2R57 A;  4A4H A;  5IN1 A;  2RB6 A;  1Q86 U;  2JZ2 A;  2EQK A;  5M9O A;  3TCJ A;  3L2Z A;  3CC7 Q;  5LJ3 h;  2YXY A;  3MJX A;  4II1 A;  2MF2 A;  3M0T A;  4C0G A;  2E41 A;  5I2M A;  1VQ6 Q;  4GLK A;  1MV3 A;  2MMP A;  3OS0 A;  1VQN A;  1WXT A;  3OS2 A;  3ULR B;  2XD0 A;  2OJ2 A;  4HA8 A;  1N6A A;  3V8L A;  1RI9 A;  1VQ7 Q;  1UFF A;  2DIG A;  2CP2 A;  2FYK A;  4WF2 A;  4FL6 A;  2D1X A;  2H3J A;  1M27 C;  2EIF A;  2LCS A;  4B6M A;  1X2K A;  4F7U A;  4TVR A;  2RK2 A;  4Z88 A;  4BY6 B;  9ATC B;  5GMK e;  1WHK A;  3DB3 A;  5CIU A;  4J83 A;  2DD5 A;  3JCM X;  1OPL A;  4J9C A;  3U23 A;  3G4S T;  4LDX A;  3CXC P;  3QZ5 B;  5IXF A;  3L2V A;  1QW1 A;  1M1K R;  1WJQ A;  4AG2 C;  3J7A F;  3CCS T;  3RDV A;  3CCL A;  4P5N A;  1GBR A;  3A98 A;  4DEY A;  3CPW A;  2HZY A;  2QA4 T;  1V76 A;  1H8K A;  3HL8 A;  1O9S A;  1WQW A;  4C5I A;  5ECA A;  2F5K A;  3NTI A;  1M8V A;  1PKT A;  1NEB A;  3FJP A;  3OYG A;  5FWC A;  1N8R U;  5IHN A;  4PNO A;  4C8Q B;  1N27 A;  2X3X D;  1UB4 A;  5I21 A;  1XTD A;  2O31 A;  4LUD A;  2EFI A;  4MDW A;  4AG1 C;  3JCM b;  3UPU A;  1W70 A;  1G3W A;  2RM4 A;  4PKC C;  2HKN A;  4MZM A;  4M7A B;  3G4S Q;  3GNF B;  3VV0 A;  4UC4 A;  4MML A;  4PJO C;  4DOV A;  2HNI A;  3JCM e;  1JXO A;  2CRE A;  3RUX A;  2AKL A;  3CCJ T;  3CCS Q;  3T9N A;  3C94 A;  2DL5 A;  4RMO A;  4J9B A;  3EH1 A;  2LC4 A;  1QP2 A;  1KIK A;  2QA4 Q;  2K7A A;  3KBG A;  5CCA A;  3I35 A;  1U3O A;  1M1K C;  3UA7 A;  3V7C A;  5D6W A;  2JTM A;  5GAM h;  4Y92 A;  2NYS A;  3GBQ A;  2LCL A;  4IUQ A;  4QVC A;  2COZ A;  4PJO D;  1UGQ B;  4PLL A;  4M7D F;  3HFO A;  4M7D G;  4OB3 B;  4IKF A;  3MPU B;  5I2S A;  1KD1 R;  2LQ8 A;  1N9S A;  4EPC A;  4NOY A;  1D1B A;  4E7H A;  2XMF A;  1OX8 A;  2B8A A;  2ZPG B;  2A28 A;  2RNA A;  2FB7 A;  4FSS A;  4KRT A;  2LJ3 A;  4XAX B;  3SEM A;  3VS3 A;  3CCR A;  1BIB A;  2PU9 B;  1M4Z A;  5CVI A;  4RKU E;  3HRT A;  1W1F A;  4FIB A;  3ME9 A;  3RMQ A;  2DFU A;  4OMQ A;  5EG2 A;  2M16 A;  4RCC A;  1WX6 A;  3J80 E;  1Q7Y R;  1YI2 T;  1G5V A;  2RHU A;  1MMD A;  4RG8 A;  2G6F X;  2EJG A;  1YIT A;  3SWN C;  2HCK A;  4M75 C;  4Y28 E;  4E7L A;  2DXT A;  1RAH B;  4OGC A;  3QDR B;  3CPW S;  2DZC A;  3CD6 Q;  2JW4 A;  1SKU B;  4R56 A;  4LUE A;  1ARK A;  5GAN 6;  4JLG A;  4FYY B;  3TRE A;  3BDU A;  2JUF A;  2HBP A;  3CBO A;  3EG9 A;  2DBK A;  1KD1 C;  2VAS A;  4PJM A;  4PJL A;  1RAI B;  5FRM A;  3TSZ A;  3QYH B;  1ZUK A;  2JTE A;  4C0F A;  1X69 A;  3QG1 A;  3CCU A;  4M75 D;  5J3B A;  1QCO A;  1YWO A;  2CP6 A;  2FG0 A;  4LDW A;  3OMG A;  3L2U A;  4N0A C;  2RMO A;  1OZ3 A;  1KQ2 A;  1I07 A;  4IUT A;  2PUO B;  2PNI A;  3LH0 A;  4JJB A;  2H8H A;  3L2W A;  4PJO G;  1KC8 C;  2RJD A;  1UGV A;  2K79 A;  1QVG A; 
#chains in the Genus database with same CATH homology
 1VQ6 Q;  1QVF P;  1M90 R;  1S72 Q;  1VQP Q;  3CCE Q;  3CPW P;  1KC8 R;  3G71 Q;  3I55 Q;  1YJW Q;  1KD1 R;  3OW2 P;  1Q82 R;  1KQS P;  1QVG P;  1YIJ Q;  1JJ2 P;  1VQ9 Q;  1N8R R;  2OTL Q;  1VQM Q;  1Q86 R;  3CD6 Q;  1YJ9 Q;  1VQK Q;  3CCL Q;  3CMA Q;  1W2B P;  3G4S Q;  3CXC P;  1Q81 R;  1VQ4 Q;  2QEX Q;  1VQ5 Q;  3CC4 Q;  1VQ8 Q;  3CCR Q;  1VQ7 Q;  3G6E Q;  1YIT Q;  1M1K R;  1VQL Q;  1K8A R;  1Q7Y R;  3CCV Q;  3CCU Q;  3CCQ Q;  1K9M R;  1YI2 Q;  3CCJ Q;  3CCS Q;  3I56 Q;  3CCM Q;  2OTJ Q;  1VQO Q;  3CC2 Q;  1VQN Q;  1YHQ Q;  1YJN Q;  1K73 R;  1NJI R;  3CC7 Q;  3CME Q;  2QA4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...