1QVFP

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1qvfP00
3CPWP 1VQ4Q 1Q7YR 1Q82R 1VQ7Q 3CC2Q 1QVFP 3G4SQ 3I56Q 1K73R 1JJ2P 1K9MR 1VQPQ 1W2BP 1VQ6Q 1YIJQ 1VQMQ 1VQOQ 1YHQQ 1M90R 1QVGP 1VQ5Q 3CC4Q 3CCSQ 3CMEQ 2QEXQ 1VQ8Q 1YJ9Q 1YJNQ 3OW2P 1KC8R 3CCVQ 3I55Q 3CCMQ 1S72Q 1VQLQ 3CD6Q 1VQKQ 3CCQQ 1K8AR 1KD1R 1Q86R 1KQSP 1YITQ 2QA4Q 3CCUQ 1VQ9Q 3CCEQ 3CXCP 3CCJQ 1VQNQ 1YJWQ 3G6EQ 1Q81R 1M1KR 1NJIR 3CCLQ 1N8RR 3CMAQ 1YI2Q 3CCRQ 3G71Q 2OTLQ 3CC7Q 2OTJQ
chains in the Genus database with same CATH superfamily
1IHVA 2L0AA 4J6XA 4JZ4A 3A8LB 2EKOA 3RDVA 3QUIA 3V8LA 1YWOA 3JCMX 1RAFB 4MDWA 2DPPB 2E10A 3M59A 4M7AC 3EGDA 3CCMQ 3HL8A 2P0KA 3FRNA 1C1AA 4LE9A 2GCXA 2L3QA 3P8BB 4M77D 1AZEA 2DF6A 4MMLA 2RHIA 1OX8A 5KYNA 1SG5A 3RNJA 2XU8A 4IUTA 4XAXB 1IREB 2BIVA 1FMWA 1M5Q1 3LLRA 3MP8A 1D3BA 2EYXA 3DB3A 1K8AU 3HFOA 2PVOB 3M54A 5I11A 3PVQA 3NPFA 4GLKA 4M78F 1YP5A 3H9NA 1VQ4T 1G3WA 3EG9A 1K4US 1QCFA 4XTXA 2K7AA 2LTOA 2YUPA 3SWNB 1M2VB 1T3LA 1WHHA 1SF9A 1YIJQ 2L3RA 5J3BA 2LQKA 3HFNA 4VUBA 3JB9G 3EG2A 4X9CA 2LQ8A 1Q95G 3QHSA 5FU7C 2AIRB 2L5QA 5FROA 3CCUQ 3LGFA 3QZ5B 4QQGA 4M75C 5GANf 1YIJA 4A54A 1G3SA 3C4SA 2FZCB 1W6XA 4B9XA 5LJ3h 2FL7A 4QVZA 4CRIA 1YITT 2QA4T 3CCUA 2XG8D 2Z0WA 1M90R 1WGSA 2BE9B 2E12A 2ZPGB 2EJFA 4BDYA 4BD3A 1N9SA 2QQ9A 5GMKe 4J7FA 3X25B 4JUVA 3FC3A 2KYBA 1WIEA 2RMOA 3LWHA 1I4K1 2A3LA 3D7SB 2VXEA 2YUQA 3VKIA 3M56A 2QAZA 1PNJA 3X20B 1R0BG 2VB6A 2OTJA 3VS2A 1RLQC 2DFUA 4XU2A 1O9SA 2FHDA 4OB1B 3G6EQ 3CC4T 4PFOA 3JB9I 3RKXA 5ECAA 2M02A 2EJ9A 2C0IA 1OU9A 4NS5A 3CCVT 3JB9H 3PFSA 3G6EA 1ABOA 2RN8A 2RJEA 3VUZA 4M7AG 3OS1A 4KULA 2RK2A 2OTJT 3EGXB 2DVEA 4M7AA 2F2XA 1M8MA 4LN2A 1H92A 3VRZA 1ZA2B 4ZN1A 4Z89A 2DK3A 1QVFA 4M78B 2H8HA 3M4YA 2E6NA 2QTVA 5GAMh 3J80E 4KUDK 1WZOA 3KFVA 4PLLA 3RIRA 1YJWT 2LT4A 3VS5A 4XQ3A 4LD6A 1H641 1YJ9Q 3OW2P 2LCSA 2HKQB 5M9OA 3VYHB 1X43A 3V8KA 4EPCA 2O4XB 1IB8A 3A8MB 2DRMA 2EGEA 3BDUA 4AFUC 1YJ9A 2RA2A 4FCYA 1K73R 1K9MR 2HZYA 2K2VA 2DILA 5LJ3f 3GLXA 2MOXA 3L2RA 4RCCA 1M3BA 2RI2A 1EX4A 4M75G 3HSBA 3OQ5A 3A98A 3M9QA 1HJDA 1WXBA 4M75A 1KFZA 4M7AD 4ZNXA 3QPHA 9ATCB 5C0MA 1JJ2A 4A4EA 1TH7A 3SEMA 3ZL7C 1KHCA 1AWJA 2X9HA 1I5OB 4Q5WA 4JRKA 1KQ2A 1JEGA 2H3JA 1JRIA 2ZCFB 3FB9A 3UDCA 5HY6A 2HL3A 1R0CB 3VYGA 3EAEA 2A36A 1NZ9A 4DBRA 2XK0A 3HHTB 1NJIR 3BW1A 4PJOF 3R6NA 2FO0A 4AG2C 2KYMA 4E7HA 5D6YA 4C0GA 2YRDA 3F70A 1W2BP 1ZSZA 2EGAA 5D6WA 3P8DA 3OS5A 1YJNQ 2FVUA 1OZ2A 2QGFB 1G5VA 3REAB 2ZPEB 4IUQA 5GMKi 2FEIA 3EFOB 2A28A 2DM1A 5CAIA 2ENMA 1BYMA 1OZ3A 1X6BA 2JOYA 1RI9A 1UHFA 2EJGA 2Y4YA 3MEAA 1S72T 4J6WA 4M7DE 2JJ9A 4IIOA 1VQ6Q 4N4IA 4RTYA 5I2MA 3OW2A 2X51A 5GAMf 4A63B 2X4JA 3OYCA 2O2OA 1X01A 2PTKA 5KYWA 1VQKQ 5CQXA 3OW2S 1VQ6A 2VGMA 1N8RC 2VKNA 1Q81R 2QQSA 1HD3A 2QEXT 1VQKA 2OAUA 3CCJT 2DETA 4M7DC 2EQKA 1WXUA 3BFMA 2JTFA 2LX9A 3L2ZA 3GBQA 3HP9A 1OV3A 2IG0A 3H8ZA 1E6HA 3UA6A 1M3CA 1CKAA 5CKFA 2RO0A 3NTKA 2R58A 1QVPA 1Q82C 2COYA 2KXCA 3CD6T 5A0DA 3G4SQ 1VQ9T 5CQYA 1FWZA 5KYXB 1LCKA 2K5LA 1UGVA 2DBMA 4LDVA 3GOXA 3KBGA 3E9GA 4L59A 4A53A 1ZUKA 1UDLA 4A4FA 4WTOB 3JV3A 3G4SA 1MV0B 2KGTA 5GANe 2A08A 2GQIA 1M1KR 1RAGB 2M0OA 1UUEA 4PKCC 1VQ8T 2RF0A 1W2BA 3MP1A 1GBQA 5EG2A 1NE8A 2VXFA 1VQOQ 4PJOB 1KC8C 1NYGA 1AT1B 1VYTA 3M0SA 1XJWB 1W2BS 3INZA 3BE3A 1A0NB 3M0PA 3X28B 2EVRA 3J7AF 3MEVA 2QQRA 1VQOA 5CKBA 3ASKA 2RHYA 1GXIE 1WLPB 5GAOl 1Y71A 5KYYA 4ELZC 3I55T 2PVGB 1PCXA 4BACA 3CCET 2L3SA 3T9NA 3JCMg 1C0MA 2ECZA 3CCLT 2F1LA 4RKUE 1UE9A 3GNGA 1KK7A 4F7UG 1Q86C 2JT4A 3M5AA 4FW1A 2VC8A 4QQDA 2OI3A 4F7UA 1X75C 1PSFA 2VUBA 1TUGB 2EQJA 1KQ1A 4LUEA 2YRCA 1PSEA 2GQVA 2HDAA 5HK3A 4F16A 1XTDA 4C92C 4AT1B 1WNLA 1B07A 2F5KA 3QDFA 4DQ2A 2MI6A 5EC7A 5LL6S 1AWXA 1WQWA 3OYMA 1PD1A 4JRQA 1IHWA 4J9EA 1JO8A 3EH1A 3CC2A 3LGLA 3QXEB 4JJCA 3JCMf 1K9MU 1QWFA 2RB6A 1LPLA 3H41A 3MKDA 4XK8E 3JSCA 4M7DG 4L5GA 4FSXA 1MNEA 2H3EB 2E5QA 4M7DA 2E41A 1WHMA 2HQEA 1AOJA 1LNXA 1RACB 2KNBB 3CC2T 2LJ0A 3UWNA 2CZ7B 2J6FA 2K3XA 2CKKA 5DLQE 2XMFA 4EDUA 3JB9F 2LQNA 2YT6A 4DEYA 1WDXA 3FEOA 4DEXA 4A4HA 3I56Q 2XKOC 2GFAA 5FWCA 1SHGA 2JMCA 2PUOB 5LJ3e 4ANJA 2FPDA 4KGVB 4Y28E 1NJIU 4C8QE 3I56A 2FRWA 2DJZA 2DTHA 4HVVA 5I21A 1N5ZA 1W70A 2NWMA 2QDLA 3FJPA 3NGPA 4PJOD 1PC0A 4XTYA 1Q7YC 2FZKB 2EQUA 2AKKA 3PIOA 3S6WA 2LJ3A 5FW9A 1QW1A 5KYUB 4M7DD 2DL3A 3JCMW 2LCLA 4C8QC 1VQMT 1YFNA 1GCQC 5FU6C 2SEMA 2EYZA 3M53A 1HYOA 4AFQC 1NM7A 4AFZC 5LJ5j 3EGDB 2LZ6B 1D0ZA 1GRIA 4CI0C 3UPUA 2LDMA 1T0JA 3ULRB 2V8KA 2CP7A 1SEMA 1QMCA 4Y91A 1OI1A 4L6V5 4D6WA 3A8HB 2VV5A 4M7AF 3OYAA 2ROTA 4C92G 3G71Q 1D3BB 2B86A 4LNPA 4OMMA 5DY9A 1NEBA 2K5FA 4C92A 4PJMA 3PVLA 1X6OA 3A8OB 4MDXA 1BKBA 3H0HA 4IUVA 2M9UA 2IPOB 2HQXA 3I5RA 2MCNA 5GAMe 3I35A 1KD1U 1Y0MA 2K5IA 2YWWA 3G71A 4HCKA 1RAEB 1RUWA 1MUZA 4D8DA 1EFNA 2IIMA 1UTIA 3RERA 3OYKA 4F04B 1IXDA 5FLXE 3V7SA 2I0NA 3SWNC 1K0XA 3QWYA 2ED1A 3RESA 1PWTA 2MMPA 3UATA 4PL6A 2AKLA 4AMCA 1RADB 4PLIA 2V8IA 2DEQA 5FRNA 1NBEB 1I1JA 4CC3A 1ZUUA 1VOMA 3CPWA 2HMAA 2JS0A 3G1JA 4FU6A 3EFRA 4JJNK 4CC7A 3CC7Q 4OB3B 5L8RE 2CZ0B 4M75F 1ACMB 3CCMA 2E65A 2J6OA 3CBOA 1B34A 3CC7A 3HTRA 2DVJA 2KT1A 1KHIA 2WSFE 4M75E 2XDPA 2D6FA 2DJQA 4FW2A 2V8JA 4YTLA 3OYGA 1TTHB 4KRTA 3CCMT 1Y07A 2LNHB 3JCMd 1QVFP 2BKDN 1X69A 1D0YA 2DXTA 4PJNA 4NL2A 2C06A 2WSCE 5IN1A 2QI2A 2RPNA 4X9DA 5D6XA 1BK2A 3H0FA 1AD5A 3X26B 2D8JA 4C8QG 1KSWA 1SSFA 3EHRA 2A0FB 4C8QA 2RH2A 4OVAA 1GCQA 3BY7A 2DL5A 2V26A 4F17A 2KT8A 2MAMA 2DAQA 4KGXB 4HCBA 2F5TX 4M7AB 2LP5A 3HPWA 3OYHA 1I0CA 3VV0A 2M51A 2CP6A 2AHJB 1YIJT 1U1TA 3KUFA 3S3OA 1QCOA 2EAYA 2LC4A 1Z9QA 2WACA 4C0ZA 3LYIA 4M78C 1JJ2P 2DEUA 1RAIB 3CCUT 1M4ZA 1QCNA 2KROA 4BY6C 4RTXA 1V29B 5IHIA 3GPLA 5GAN4 7AT1B 2CGHA 4J5YA 1UHCA 2EBPA 3EG1A 2F69A 3E1SA 3M55A 3VS0A 4FIBA 2GFUA 4OP0A 8AT1B 2OTLQ 3JB9D 2E70A 3SWNA 3E2UA 5CK9A 3TVTA 4XTUA 5GMKj 2EGCA 5FU7B 3CMEQ 1AWOA 1GFCA 2OTLA 4GY5A 2K3BA 3CCQQ 3P8HA 3RUXA 4MZMA 2QTXA 2KRSA 1N8RR 3CMEA 1UGPB 4C5EA 4XU1A 1YCSB 3E19A 1GFDA 3CCQA 2KK4A 2JM8A 2CSQA 4C0DB 1UJ0A 2LMJA 3MJXA 3G6ET 2LQWA 1WHLA 1QVFS 3OYYA 1BB9A 4RG8A 2JTEA 2DX1A 1IGUA 4OF1A 4BE0A 2QK0A 3ZBDA 2KVQG 1LOJA 4XU0A 1HXDA 2DO3A 3FDRA 5LJ5g 1WJRA 1ZSZB 2ATCB 2NUTB 3ER0A 4FSSA 1Q82R 5CKDA 1OPKA 2JVVA 2RQTA 1GCPA 2P84A 2KRNA 4DBFA 3UA7A 4QVCA 3O5ZA 2LNVA 3OYNA 4BI8B 4JDSA 1BIBA 3SDZA 2KRMA 4ME7A 2HAXA 4JLGA 5D7UA 4F14A 2BUDA 5HK0A 2L8DA 3OMGA 3QZ9B 4F7UF 4OMLA 1YJ9T 4RG2A 4HA8A 4BUGA 4C5HA 3MP6A 3OYEA 1N27A 3LH0A 4IURA 2K57A 1JJ2S 1MNDA 1KC8R 2B8AA 2JM9A 4F7UE 4KH1B 2CUDA 2RI3A 2DE0X 4HKEA 2DD5A 4FL6A 3EGXA 1PKSA 3V7RA 2X3XD 2WSEE 4EMKB 3NTHA 4R56A 3TEEA 1WHGA 5CVIA 2MWOA 2E3IA 2CT3A 2HEQA 2E64A 4E6RA 4M7DF 3DLMA 2D9TA 2A7YA 1Q86R 5HKCA 1G83A 1VQNQ 2XICA 3LH5A 2YXYA 3WVEB 4OGEA 4GLMA 1RABB 4JJDA 1TS9A 4HVWA 1OYXA 2O4XA 3MHXA 3NHNA 3U23A 2FG0A 1YJNA 2P0PA 1QVGA 3RKWA 4M75D 1K9AA 2QASA 1VQNA 4Z02A 2M16A 4HCZA 5CIUA 5CR2A 2DZ9A 2QG9B 4N4HA 2VVKA 2F2WA 2RQRA 5I2SA 1JB0E 5CKHA 4AFSC 3J81E 2AT1B 3MEUA 1KIKA 1FMKA 3PIPA 1WJSA 2Y4XA 1YJNT 1VIEA 1QKXA 1SPKA 2ZPHB 3WVDB 3FIFA 2KMTA 4BB7A 2CH4A 1JXOA 3EGUA 4EMGA 1ABQA 3S3NA 4RUGA 1VQ6T 3JCMh 1UECA 2R57A 4E7SA 5DLOA 1HSQA 1YI2Q 4ZTJA 5FWBA 2FPFA 1SRMA 1M90U 1VQ7Q 1VQKT 2D0QB 4MZPA 1VYUA 4F7UB 5IT9E 1YI2A 3AHUA 3M4GA 2RQUA 5GAOr 1GBRA 1AVZC 1K1ZA 3ME9A 1VQ7A 4JJBA 1WJQA 1AWWA 2CH4W 4PFPA 3EFOA 1TG0A 3CMAQ 2KE9A 2RJFA 1JU5C 3RMQA 4ZGEB 4QVDA 2Y90A 2ZZDA 4OMNA 1Q7YR 2BE7D 3LW5E 4GBQA 1R8OB 1RLPC 1M2OA 2AZSA 3CMAA 5A0GA 1BI1A 5GAN7 2R5MA 1D1BA 1ZHIA 4ESRA 1VQLQ 2EW3A 2KY9A 3G4ST 1PRMC 4HT8A 2JXBA 3M58A 4B6MA 4C92E 2RJDA 2RHZA 5CKEA 4M7DB 1ZLMA 1K76A 1VQLA 1VIFA 4IUPA 5GANj 1YHQQ 3LWIA 1R77A 3PT9A 2A37A 1M1FA 3MPUB 5IHKA 5CO7A 1VQOT 2EQMA 2KAFA 1YHQA 3H0IA 4TVRA 1Y96B 3CQTA 1Z9ZA 2F2VA 2YDLA 2J06A 4RTUA 2DIGA 3OS0A 3IQLA 3CCSQ 1NEGA 4QKUA 3OBYA 2KEAA 4M77C 4NOYA 3M0QA 1WHJA 2L2PA 5LJ5d 3L2UA 1Q82U 1LJOA 3CCSA 2HCKA 2NUPA 2DBKA 1K73U 4EMHA 3MEWA 6AT1B 5J26A 3VS6A 4LDYA 2FYKA 1VQ5Q 1JQQA 3JCMb 3C12A 3QO3A 1FYNA 1ZA1B 3SFMA 3RBBB 3M0RA 3SD4A 3JCMQ 1TXQA 1VQ5A 2XDDA 5I22A 1D1CA 4C8QF 4JS4A 3PE0A 1KC8U 2YUNA 3V7CA 2DTOA 4JRIA 1E7OA 2JS2A 2EQIA 4J7IA 1KD1C 4BI3A 3EH2A 3TU4K 2HQHA 2YRVA 1PM3A 4RTWA 3NFCA 3CPFA 4WF2A 4OMPA 4KBMB 4BI4A 1FX7A 2D0NA 3CPWP 2RHXA 1B7TA 3CBPA 2CSIA 4J9DA 4UC4A 3META 1SHFA 3I56T 3CXCP 5LJ3j 4P5NA 2XDBA 3L1AA 2V1RA 2J7IA 3OB9A 3CCRQ 4K11A 1OX9A 4OMOA 2KR3A 2P0QA 1AHJB 2LT1A 3ZEHA 1WA7A 2X35A 1ZBJA 3CCRA 2HKNA 2W0ZA 2ZAEA 5AT1B 1K8AC 4E47A 4JPBW 1Q81U 1EZZB 3AT1B 2YSQA 2M1HA 3QBYA 1GL5A 1IGQA 1QWEA 3EFSA 1I07A 3OSSC 1B34B 2ZPIB 2QQAA 3PGGA 1D09B 1VQPQ 2CS7A 3A8GB 2RNAA 5GAN2 4M77G 4PJJA 1VYVA 3EG9B 2GBQA 1HK9A 2QXFA 3OMCA 3L2VA 4XTWA 4M77A 2FPEA 1VQPA 1M27C 3A5ZB 1X2QA 3EG0A 1MMGA 5DM7R 1CSKA 1UFFA 1NLOC 4V2SA 5FRMA 2DERA 3JAME 1G3YA 3M0UA 5GAOp 4BE1A 1YCYA 4LXCA 2G6FX 3G71T 1S1NA 1U06A 4XTVA 4OGCA 2OJ2A 4C8QB 4A4KA 3E9FA 1M1KU 1T3SA 1UEBA 2RK1A 3JCMJ 2JN0A 5KYUA 5GAMj 2HBPA 3A1PA 3ZFJA 3OS2A 1M8VA 2XD0A 1W1FA 2MYSA 1RAHB 1VUBA 1VQ4Q 2K9GA 5IXBA 2RD1A 2K4YA 3PMIA 5J39A 3CPWS 1O75A 2EWNA 3MCAB 4C92D 4HT9A 1UJYA 2HSEB 3OYBA 1PRLC 3CXCA 2DD4A 1VQ4A 1BI0A 2KSSA 2D8HA 1IZ6A 3VU3C 4LD9K 4E7JA 2CYZB 3CXCS 5GANg 4JS5A 1I81A 1U8RA 1WQ7A 1TUCA 2PVDB 3OYDA 2COZA 5GAN5 3CC7T 3GNFB 1YITQ 2QA4Q 1U3OA 2MF2A 2ESWA 1KG1A 2COWA 3HKSA 4EIKA 2QGGA 1N9RA 1I8FA 3HRSA 4M78E 1MV3A 2VASA 2EYYA 2O9SA 2SRCA 1YITA 2QA4A 3BDLA 2E5KA 2HSPA 4ELYC 2KBTA 2RI5A 2HD0A 1TSFA 1RAAB 4BE2A 5A0LA 3M57A 4J6YA 2LVMA 5GAN3 5GMKl 2CP0A 2NUZA 5KH6A 2DRKA 4XTZA 1OPLA 3O8VA 1OOTA 3CC4Q 4KUIA 5LJ5h 2K2MA 4C0DC 3CCVQ 2CREA 2ZPBB 4ZN3A 1QP2A 1KQSP 2JUFA 1AEYA 3CC4A 5IH2A 2PU9B 2DYBA 3TSWA 1G8XA 3QJYA 2DMOA 2VWFA 3CCVA 3GIBA 3OSVA 3JCMe 2OTJQ 1H3HA 3FLGA 1ZSZC 1ZX6A 5GJWB 1M2VA 3LX7A 4C8QD 3QWXX 4KGZB 2CZ6B 2V1QA 1QQJA 2AZVA 3JRZA 4NL3A 1BCMA 1NG2A 4M75B 2EIFA 2ZGWA 3HRTA 3SHWA 4E7ZA 2DL4A 2PZ1A 1X6GA 3OYIA 1YJWQ 3VS3A 4N0AC 2RHUA 4B9WA 2MPXC 1OQKA 1OU8A 4JRPA 5GJVB 2EPDA 4WCIA 4QT7A 4MZTA 1QLYA 1YJWA 3Q1JA 1QVGP 4HCCA 4OB0B 2C0TA 1WXTA 2OTLT 2BZ8A 2K79A 3RR6A 3GP8A 5LJ3g 3KXTA 1N6AA 1ZQ1A 1CKBA 1SSHA 2HBWA 1PKTA 5GAN8 3CMET 4E7KA 3OYJA 3OBWA 4O6JA 1UG1A 4BY6B 3CCQT 2FRYA 4C5GA 2O9VA 4FM4B 4EMKC 1V1CA 4OB2B 3VS7A 1TWBA 5L23A 2VYTA 2EKHA 1TU0B 3JB9J 4E7LA 3C95A 3QDRB 1BCOA 2MK5A 3CEYA 5GAOm 5KYWB 4PNOA 2LCCA 5C6SA 1H3ZA 2DZCA 1KQSA 1MMAA 4DOWA 3QYGB 2AK5A 5HCKA 2L89A 5LJ5f 5KE3A 3MO8A 2DA9A 1KQSS 1YN8A 3THKA 1WFWA 2K6DA 1PHTA 4M78G 3OYFA 4J9GA 1M90C 1H8KA 4M78A 4PFZA 4E7IA 2VGNA 4KT0E 5IAYA 4FT2A 1S72Q 2DYIA 2OX7A 2X4WA 5GAMg 2QYZA 3N5BB 1D1AA 2FZGB 1M3AA 4ZTFA 2YLCA 3M0TA 2PQWA 4RMOA 3H6ZA 1S72A 2ZPFB 2NUTA 2D1XA 2P4TA 3RMSA 2DXBA 2QEXQ 4PJOE 1KJWA 2OAWA 2RM4A 4CC4B 2XIDA 1QVGS 1K0SA 3CCJQ 1NYFA 3REBB 5GANd 1WHKA 4D8KA 2QEXA 2HNIA 4N0AA 1MGQA 3JCMV 3CCJA 1VQNT 5GAN6 3EG3A 3TSZA 2YHTA 2W10A 2E6ZA 1UGSB 4FYWB 4Z8AA 2J05A 2JNGA 2NLUA 4M78D 5GMKh 3QJ6A 4N4GA 2PNIA 3CD6Q 2EFIA 4PJOC 3X24B 4R0KA 1VQ9Q 1AZGB 2O01E 5KYYB 2GGRA 2JMAA 3CBMA 4JZ3A 3FJ5A 3CD6A 1ZUYA 4PK4A 1VQ9A 4J9FA 1U1SA 4ZGJB 1SRLA 1VQ8Q 4EMKA 1C6VX 4HVUA 2CP5A 3PTAA 1IRXA 2X3WD 3UF4A 2JW4A 4ZGDB 1KD1R 4LUDA 2I2LA 1W4SA 4A4GA 4QQ6A 4JLIA 1VQ8A 5IHNA 3PMTA 5A2QE 1K73C 3OYLA 1K9MC 1MMDA 3OA6A 4DOVA 8ATCB 4RTTA 2CDTA 4C92F 1YI2T 4QW2A 2K3YA 4ORZA 1NLPC 3I55Q 3JCMP 2KI7A 2DL8A 2NUPB 3C0CA 2JTMA 1VQ7T 3CCEQ 2LJ1A 2CT4A 4M77F 3CCLQ 3VRYA 5GAOn 3R6OA 2DIQA 2FB7A 3I55A 2G3RA 4LDWA 1B3QA 4DBHA 3CCEA 2QDYB 1OULA 1J3TA 4M77E 3CCLA 3CMAT 1M9SA 3GF5A 1F1BB 4OMFB 1FMVA 1I5LA 4AG1C 1K8AR 1N8RU 4II1A 4J9HA 1NJIC 3C94A 3TCJA 3WXMB 4Y92A 1V76A 3SB2A 4C0FA 4DBQA 1VQLT 2RQWA 4FYYB 4BDZA 3I9QA 2JZ2A 1VA7A 4J8OA 4FYVB 2R5AA 1UB4A 5LJ3d 1Y57A 1ZBXA 3QYHB 5AYFA 4LDUA 1Y7XA 5KE2A 5KYXA 4FT4A 3I5SA 2CP3A 2CZ1B 1YHQT 1XOVA 1T0HA 4IKFA 2HL5C 3VS1A 3CC2Q 2P4RA 1TOVA 2CP2A 4O5VA 1UGQB 4J9IA 1G2BA 3L2WA 1RI0A 3DLLA 1PD0A 4PJOG 3EHQA 4ATOA 2BTTA 1QKWA 5IXFA 3G7ZA 4PJOA 3PNWC 2KXDA 2IVWA 1Q81C 3VJPA 4RCBA 4Z88A 5GAOq 3CCST 1X27A 5KCHA 2XI9A 1YWPA 1JXMA 4OMQA 1DJ7B 1TUDA 4PJLA 2GNCA 2GTOA 1M1GA 2DXUA 1WI7A 4E2FB 1YBYA 2O31A 4J9BA 2PUKB 5CCAA 3NMZC 1RL2A 1ZSGA 3TQ7P 1M30A 4C92B 1VQ5T 1D0XA 4IIMA 4RTZA 2KQWA 1ARKA 3UT1A 2BZXA 3QSUA 4LDXA 3NTIA 3VS4A 3QG1A 1QP3A 4M77B 4DA4A 4FYXB 1VQMQ 3DB4A 1Y96A 3RKYA 4J9CA 1Q86U 5GAMd 3L2QA 2ROLA 2YUOA 2EYQA 1FXXA 1NPPA 5LJ5e 4HXJA 2MIOA 1BU1A 1WPYA 4IUUA 1M1KC 1VQMA 1LVKA 1BI3A 2DNUA 4X34A 2EYWA 1WX6A 1X2KA 2ED0A 5GMKm 2L3PA 4XU3A 2J6KA 1OEBA 2M0YA 2X4XA 1U5SA 2NYSA 4J83A 3OY9A 2O88A 1PG5B 1SKUB 2GTJA 2LX7A 3QIIA 2E3HA 2C0OA 2LRQA 2DLPA 1YNZA 3HRUA 2MWPA 1BIAA 4M4ZA 2DXCA 4MMKA 4CC2A 3L42A 1IO6A 1XNIA 2E4HA 2KDSA 1WYXA 1E6GA 2CUBA 2RQVA 3DKMA 1P92A 1EIFA 4C5IA 3CCRT 4R55A 2QQBA 1G3TA 5GANh 1JBMA 2BZYA 4RTVA 3QKJA 3URGA 3JCMc 2YLBA 3V8JA 2E1HA 2XHCA 3TREA 1MMNA 2DL7A 5KCOA 2RJCA 1XQHA 2DTIA 2DKGA 1NPRA 4M7AE 1UGRB 3VUBA 4KH0B 5FU6B 1VQPT 1MHNA 1BBZA 2ABLA 3S3MA 2GF7A 1Q7YU 2X4YA 1BI2A 4X1VA
chains in the Genus database with same CATH topology
3CPWP 1VQ4Q 1Q7YR 1Q82R 1VQ7Q 3CC2Q 1QVFP 3G4SQ 3I56Q 1K73R 1JJ2P 1K9MR 1VQPQ 1W2BP 1VQ6Q 1YIJQ 1VQMQ 1VQOQ 1YHQQ 1M90R 1QVGP 1VQ5Q 3CC4Q 3CCSQ 3CMEQ 2QEXQ 1VQ8Q 1YJ9Q 1YJNQ 3OW2P 1KC8R 3CCVQ 3I55Q 3CCMQ 1S72Q 1VQLQ 3CD6Q 1VQKQ 3CCQQ 1K8AR 1KD1R 1Q86R 1KQSP 1YITQ 2QA4Q 3CCUQ 1VQ9Q 3CCEQ 3CXCP 3CCJQ 1VQNQ 1YJWQ 3G6EQ 1Q81R 1M1KR 1NJIR 3CCLQ 1N8RR 3CMAQ 1YI2Q 3CCRQ 3G71Q 2OTLQ 3CC7Q 2OTJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW P;  1VQ4 Q;  1Q7Y R;  1Q82 R;  1VQ7 Q;  3CC2 Q;  1QVF P;  3G4S Q;  3I56 Q;  1K73 R;  1JJ2 P;  1K9M R;  1VQP Q;  1W2B P;  1VQ6 Q;  1YIJ Q;  1VQM Q;  1VQO Q;  1YHQ Q;  1M90 R;  1QVG P;  1VQ5 Q;  3CC4 Q;  3CCS Q;  3CME Q;  2QEX Q;  1VQ8 Q;  1YJ9 Q;  1YJN Q;  3OW2 P;  1KC8 R;  3CCV Q;  3I55 Q;  3CCM Q;  1S72 Q;  1VQL Q;  3CD6 Q;  1VQK Q;  3CCQ Q;  1K8A R;  1KD1 R;  1Q86 R;  1KQS P;  1YIT Q;  2QA4 Q;  3CCU Q;  1VQ9 Q;  3CCE Q;  3CXC P;  3CCJ Q;  1VQN Q;  1YJW Q;  3G6E Q;  1Q81 R;  1M1K R;  1NJI R;  3CCL Q;  1N8R R;  3CMA Q;  1YI2 Q;  3CCR Q;  3G71 Q;  2OTL Q;  3CC7 Q;  2OTJ Q; 
#chains in the Genus database with same CATH topology
 1IHV A;  2L0A A;  4J6X A;  4JZ4 A;  3A8L B;  2EKO A;  3RDV A;  3QUI A;  3V8L A;  1YWO A;  3JCM X;  1RAF B;  4MDW A;  2DPP B;  2E10 A;  3M59 A;  4M7A C;  3EGD A;  3CCM Q;  3HL8 A;  2P0K A;  3FRN A;  1C1A A;  4LE9 A;  2GCX A;  2L3Q A;  3P8B B;  4M77 D;  1AZE A;  2DF6 A;  4MML A;  2RHI A;  1OX8 A;  5KYN A;  1SG5 A;  3RNJ A;  2XU8 A;  4IUT A;  4XAX B;  1IRE B;  2BIV A;  1FMW A;  1M5Q 1;  3LLR A;  3MP8 A;  1D3B A;  2EYX A;  3DB3 A;  1K8A U;  3HFO A;  2PVO B;  3M54 A;  5I11 A;  3PVQ A;  3NPF A;  4GLK A;  4M78 F;  1YP5 A;  3H9N A;  1VQ4 T;  1G3W A;  3EG9 A;  1K4U S;  1QCF A;  4XTX A;  2K7A A;  2LTO A;  2YUP A;  3SWN B;  1M2V B;  1T3L A;  1WHH A;  1SF9 A;  1YIJ Q;  2L3R A;  5J3B A;  2LQK A;  3HFN A;  4VUB A;  3JB9 G;  3EG2 A;  4X9C A;  2LQ8 A;  1Q95 G;  3QHS A;  5FU7 C;  2AIR B;  2L5Q A;  5FRO A;  3CCU Q;  3LGF A;  3QZ5 B;  4QQG A;  4M75 C;  5GAN f;  1YIJ A;  4A54 A;  1G3S A;  3C4S A;  2FZC B;  1W6X A;  4B9X A;  5LJ3 h;  2FL7 A;  4QVZ A;  4CRI A;  1YIT T;  2QA4 T;  3CCU A;  2XG8 D;  2Z0W A;  1M90 R;  1WGS A;  2BE9 B;  2E12 A;  2ZPG B;  2EJF A;  4BDY A;  4BD3 A;  1N9S A;  2QQ9 A;  5GMK e;  4J7F A;  3X25 B;  4JUV A;  3FC3 A;  2KYB A;  1WIE A;  2RMO A;  3LWH A;  1I4K 1;  2A3L A;  3D7S B;  2VXE A;  2YUQ A;  3VKI A;  3M56 A;  2QAZ A;  1PNJ A;  3X20 B;  1R0B G;  2VB6 A;  2OTJ A;  3VS2 A;  1RLQ C;  2DFU A;  4XU2 A;  1O9S A;  2FHD A;  4OB1 B;  3G6E Q;  3CC4 T;  4PFO A;  3JB9 I;  3RKX A;  5ECA A;  2M02 A;  2EJ9 A;  2C0I A;  1OU9 A;  4NS5 A;  3CCV T;  3JB9 H;  3PFS A;  3G6E A;  1ABO A;  2RN8 A;  2RJE A;  3VUZ A;  4M7A G;  3OS1 A;  4KUL A;  2RK2 A;  2OTJ T;  3EGX B;  2DVE A;  4M7A A;  2F2X A;  1M8M A;  4LN2 A;  1H92 A;  3VRZ A;  1ZA2 B;  4ZN1 A;  4Z89 A;  2DK3 A;  1QVF A;  4M78 B;  2H8H A;  3M4Y A;  2E6N A;  2QTV A;  5GAM h;  3J80 E;  4KUD K;  1WZO A;  3KFV A;  4PLL A;  3RIR A;  1YJW T;  2LT4 A;  3VS5 A;  4XQ3 A;  4LD6 A;  1H64 1;  1YJ9 Q;  3OW2 P;  2LCS A;  2HKQ B;  5M9O A;  3VYH B;  1X43 A;  3V8K A;  4EPC A;  2O4X B;  1IB8 A;  3A8M B;  2DRM A;  2EGE A;  3BDU A;  4AFU C;  1YJ9 A;  2RA2 A;  4FCY A;  1K73 R;  1K9M R;  2HZY A;  2K2V A;  2DIL A;  5LJ3 f;  3GLX A;  2MOX A;  3L2R A;  4RCC A;  1M3B A;  2RI2 A;  1EX4 A;  4M75 G;  3HSB A;  3OQ5 A;  3A98 A;  3M9Q A;  1HJD A;  1WXB A;  4M75 A;  1KFZ A;  4M7A D;  4ZNX A;  3QPH A;  9ATC B;  5C0M A;  1JJ2 A;  4A4E A;  1TH7 A;  3SEM A;  3ZL7 C;  1KHC A;  1AWJ A;  2X9H A;  1I5O B;  4Q5W A;  4JRK A;  1KQ2 A;  1JEG A;  2H3J A;  1JRI A;  2ZCF B;  3FB9 A;  3UDC A;  5HY6 A;  2HL3 A;  1R0C B;  3VYG A;  3EAE A;  2A36 A;  1NZ9 A;  4DBR A;  2XK0 A;  3HHT B;  1NJI R;  3BW1 A;  4PJO F;  3R6N A;  2FO0 A;  4AG2 C;  2KYM A;  4E7H A;  5D6Y A;  4C0G A;  2YRD A;  3F70 A;  1W2B P;  1ZSZ A;  2EGA A;  5D6W A;  3P8D A;  3OS5 A;  1YJN Q;  2FVU A;  1OZ2 A;  2QGF B;  1G5V A;  3REA B;  2ZPE B;  4IUQ A;  5GMK i;  2FEI A;  3EFO B;  2A28 A;  2DM1 A;  5CAI A;  2ENM A;  1BYM A;  1OZ3 A;  1X6B A;  2JOY A;  1RI9 A;  1UHF A;  2EJG A;  2Y4Y A;  3MEA A;  1S72 T;  4J6W A;  4M7D E;  2JJ9 A;  4IIO A;  1VQ6 Q;  4N4I A;  4RTY A;  5I2M A;  3OW2 A;  2X51 A;  5GAM f;  4A63 B;  2X4J A;  3OYC A;  2O2O A;  1X01 A;  2PTK A;  5KYW A;  1VQK Q;  5CQX A;  3OW2 S;  1VQ6 A;  2VGM A;  1N8R C;  2VKN A;  1Q81 R;  2QQS A;  1HD3 A;  2QEX T;  1VQK A;  2OAU A;  3CCJ T;  2DET A;  4M7D C;  2EQK A;  1WXU A;  3BFM A;  2JTF A;  2LX9 A;  3L2Z A;  3GBQ A;  3HP9 A;  1OV3 A;  2IG0 A;  3H8Z A;  1E6H A;  3UA6 A;  1M3C A;  1CKA A;  5CKF A;  2RO0 A;  3NTK A;  2R58 A;  1QVP A;  1Q82 C;  2COY A;  2KXC A;  3CD6 T;  5A0D A;  3G4S Q;  1VQ9 T;  5CQY A;  1FWZ A;  5KYX B;  1LCK A;  2K5L A;  1UGV A;  2DBM A;  4LDV A;  3GOX A;  3KBG A;  3E9G A;  4L59 A;  4A53 A;  1ZUK A;  1UDL A;  4A4F A;  4WTO B;  3JV3 A;  3G4S A;  1MV0 B;  2KGT A;  5GAN e;  2A08 A;  2GQI A;  1M1K R;  1RAG B;  2M0O A;  1UUE A;  4PKC C;  1VQ8 T;  2RF0 A;  1W2B A;  3MP1 A;  1GBQ A;  5EG2 A;  1NE8 A;  2VXF A;  1VQO Q;  4PJO B;  1KC8 C;  1NYG A;  1AT1 B;  1VYT A;  3M0S A;  1XJW B;  1W2B S;  3INZ A;  3BE3 A;  1A0N B;  3M0P A;  3X28 B;  2EVR A;  3J7A F;  3MEV A;  2QQR A;  1VQO A;  5CKB A;  3ASK A;  2RHY A;  1GXI E;  1WLP B;  5GAO l;  1Y71 A;  5KYY A;  4ELZ C;  3I55 T;  2PVG B;  1PCX A;  4BAC A;  3CCE T;  2L3S A;  3T9N A;  3JCM g;  1C0M A;  2ECZ A;  3CCL T;  2F1L A;  4RKU E;  1UE9 A;  3GNG A;  1KK7 A;  4F7U G;  1Q86 C;  2JT4 A;  3M5A A;  4FW1 A;  2VC8 A;  4QQD A;  2OI3 A;  4F7U A;  1X75 C;  1PSF A;  2VUB A;  1TUG B;  2EQJ A;  1KQ1 A;  4LUE A;  2YRC A;  1PSE A;  2GQV A;  2HDA A;  5HK3 A;  4F16 A;  1XTD A;  4C92 C;  4AT1 B;  1WNL A;  1B07 A;  2F5K A;  3QDF A;  4DQ2 A;  2MI6 A;  5EC7 A;  5LL6 S;  1AWX A;  1WQW A;  3OYM A;  1PD1 A;  4JRQ A;  1IHW A;  4J9E A;  1JO8 A;  3EH1 A;  3CC2 A;  3LGL A;  3QXE B;  4JJC A;  3JCM f;  1K9M U;  1QWF A;  2RB6 A;  1LPL A;  3H41 A;  3MKD A;  4XK8 E;  3JSC A;  4M7D G;  4L5G A;  4FSX A;  1MNE A;  2H3E B;  2E5Q A;  4M7D A;  2E41 A;  1WHM A;  2HQE A;  1AOJ A;  1LNX A;  1RAC B;  2KNB B;  3CC2 T;  2LJ0 A;  3UWN A;  2CZ7 B;  2J6F A;  2K3X A;  2CKK A;  5DLQ E;  2XMF A;  4EDU A;  3JB9 F;  2LQN A;  2YT6 A;  4DEY A;  1WDX A;  3FEO A;  4DEX A;  4A4H A;  3I56 Q;  2XKO C;  2GFA A;  5FWC A;  1SHG A;  2JMC A;  2PUO B;  5LJ3 e;  4ANJ A;  2FPD A;  4KGV B;  4Y28 E;  1NJI U;  4C8Q E;  3I56 A;  2FRW A;  2DJZ A;  2DTH A;  4HVV A;  5I21 A;  1N5Z A;  1W70 A;  2NWM A;  2QDL A;  3FJP A;  3NGP A;  4PJO D;  1PC0 A;  4XTY A;  1Q7Y C;  2FZK B;  2EQU A;  2AKK A;  3PIO A;  3S6W A;  2LJ3 A;  5FW9 A;  1QW1 A;  5KYU B;  4M7D D;  2DL3 A;  3JCM W;  2LCL A;  4C8Q C;  1VQM T;  1YFN A;  1GCQ C;  5FU6 C;  2SEM A;  2EYZ A;  3M53 A;  1HYO A;  4AFQ C;  1NM7 A;  4AFZ C;  5LJ5 j;  3EGD B;  2LZ6 B;  1D0Z A;  1GRI A;  4CI0 C;  3UPU A;  2LDM A;  1T0J A;  3ULR B;  2V8K A;  2CP7 A;  1SEM A;  1QMC A;  4Y91 A;  1OI1 A;  4L6V 5;  4D6W A;  3A8H B;  2VV5 A;  4M7A F;  3OYA A;  2ROT A;  4C92 G;  3G71 Q;  1D3B B;  2B86 A;  4LNP A;  4OMM A;  5DY9 A;  1NEB A;  2K5F A;  4C92 A;  4PJM A;  3PVL A;  1X6O A;  3A8O B;  4MDX A;  1BKB A;  3H0H A;  4IUV A;  2M9U A;  2IPO B;  2HQX A;  3I5R A;  2MCN A;  5GAM e;  3I35 A;  1KD1 U;  1Y0M A;  2K5I A;  2YWW A;  3G71 A;  4HCK A;  1RAE B;  1RUW A;  1MUZ A;  4D8D A;  1EFN A;  2IIM A;  1UTI A;  3RER A;  3OYK A;  4F04 B;  1IXD A;  5FLX E;  3V7S A;  2I0N A;  3SWN C;  1K0X A;  3QWY A;  2ED1 A;  3RES A;  1PWT A;  2MMP A;  3UAT A;  4PL6 A;  2AKL A;  4AMC A;  1RAD B;  4PLI A;  2V8I A;  2DEQ A;  5FRN A;  1NBE B;  1I1J A;  4CC3 A;  1ZUU A;  1VOM A;  3CPW A;  2HMA A;  2JS0 A;  3G1J A;  4FU6 A;  3EFR A;  4JJN K;  4CC7 A;  3CC7 Q;  4OB3 B;  5L8R E;  2CZ0 B;  4M75 F;  1ACM B;  3CCM A;  2E65 A;  2J6O A;  3CBO A;  1B34 A;  3CC7 A;  3HTR A;  2DVJ A;  2KT1 A;  1KHI A;  2WSF E;  4M75 E;  2XDP A;  2D6F A;  2DJQ A;  4FW2 A;  2V8J A;  4YTL A;  3OYG A;  1TTH B;  4KRT A;  3CCM T;  1Y07 A;  2LNH B;  3JCM d;  1QVF P;  2BKD N;  1X69 A;  1D0Y A;  2DXT A;  4PJN A;  4NL2 A;  2C06 A;  2WSC E;  5IN1 A;  2QI2 A;  2RPN A;  4X9D A;  5D6X A;  1BK2 A;  3H0F A;  1AD5 A;  3X26 B;  2D8J A;  4C8Q G;  1KSW A;  1SSF A;  3EHR A;  2A0F B;  4C8Q A;  2RH2 A;  4OVA A;  1GCQ A;  3BY7 A;  2DL5 A;  2V26 A;  4F17 A;  2KT8 A;  2MAM A;  2DAQ A;  4KGX B;  4HCB A;  2F5T X;  4M7A B;  2LP5 A;  3HPW A;  3OYH A;  1I0C A;  3VV0 A;  2M51 A;  2CP6 A;  2AHJ B;  1YIJ T;  1U1T A;  3KUF A;  3S3O A;  1QCO A;  2EAY A;  2LC4 A;  1Z9Q A;  2WAC A;  4C0Z A;  3LYI A;  4M78 C;  1JJ2 P;  2DEU A;  1RAI B;  3CCU T;  1M4Z A;  1QCN A;  2KRO A;  4BY6 C;  4RTX A;  1V29 B;  5IHI A;  3GPL A;  5GAN 4;  7AT1 B;  2CGH A;  4J5Y A;  1UHC A;  2EBP A;  3EG1 A;  2F69 A;  3E1S A;  3M55 A;  3VS0 A;  4FIB A;  2GFU A;  4OP0 A;  8AT1 B;  2OTL Q;  3JB9 D;  2E70 A;  3SWN A;  3E2U A;  5CK9 A;  3TVT A;  4XTU A;  5GMK j;  2EGC A;  5FU7 B;  3CME Q;  1AWO A;  1GFC A;  2OTL A;  4GY5 A;  2K3B A;  3CCQ Q;  3P8H A;  3RUX A;  4MZM A;  2QTX A;  2KRS A;  1N8R R;  3CME A;  1UGP B;  4C5E A;  4XU1 A;  1YCS B;  3E19 A;  1GFD A;  3CCQ A;  2KK4 A;  2JM8 A;  2CSQ A;  4C0D B;  1UJ0 A;  2LMJ A;  3MJX A;  3G6E T;  2LQW A;  1WHL A;  1QVF S;  3OYY A;  1BB9 A;  4RG8 A;  2JTE A;  2DX1 A;  1IGU A;  4OF1 A;  4BE0 A;  2QK0 A;  3ZBD A;  2KVQ G;  1LOJ A;  4XU0 A;  1HXD A;  2DO3 A;  3FDR A;  5LJ5 g;  1WJR A;  1ZSZ B;  2ATC B;  2NUT B;  3ER0 A;  4FSS A;  1Q82 R;  5CKD A;  1OPK A;  2JVV A;  2RQT A;  1GCP A;  2P84 A;  2KRN A;  4DBF A;  3UA7 A;  4QVC A;  3O5Z A;  2LNV A;  3OYN A;  4BI8 B;  4JDS A;  1BIB A;  3SDZ A;  2KRM A;  4ME7 A;  2HAX A;  4JLG A;  5D7U A;  4F14 A;  2BUD A;  5HK0 A;  2L8D A;  3OMG A;  3QZ9 B;  4F7U F;  4OML A;  1YJ9 T;  4RG2 A;  4HA8 A;  4BUG A;  4C5H A;  3MP6 A;  3OYE A;  1N27 A;  3LH0 A;  4IUR A;  2K57 A;  1JJ2 S;  1MND A;  1KC8 R;  2B8A A;  2JM9 A;  4F7U E;  4KH1 B;  2CUD A;  2RI3 A;  2DE0 X;  4HKE A;  2DD5 A;  4FL6 A;  3EGX A;  1PKS A;  3V7R A;  2X3X D;  2WSE E;  4EMK B;  3NTH A;  4R56 A;  3TEE A;  1WHG A;  5CVI A;  2MWO A;  2E3I A;  2CT3 A;  2HEQ A;  2E64 A;  4E6R A;  4M7D F;  3DLM A;  2D9T A;  2A7Y A;  1Q86 R;  5HKC A;  1G83 A;  1VQN Q;  2XIC A;  3LH5 A;  2YXY A;  3WVE B;  4OGE A;  4GLM A;  1RAB B;  4JJD A;  1TS9 A;  4HVW A;  1OYX A;  2O4X A;  3MHX A;  3NHN A;  3U23 A;  2FG0 A;  1YJN A;  2P0P A;  1QVG A;  3RKW A;  4M75 D;  1K9A A;  2QAS A;  1VQN A;  4Z02 A;  2M16 A;  4HCZ A;  5CIU A;  5CR2 A;  2DZ9 A;  2QG9 B;  4N4H A;  2VVK A;  2F2W A;  2RQR A;  5I2S A;  1JB0 E;  5CKH A;  4AFS C;  3J81 E;  2AT1 B;  3MEU A;  1KIK A;  1FMK A;  3PIP A;  1WJS A;  2Y4X A;  1YJN T;  1VIE A;  1QKX A;  1SPK A;  2ZPH B;  3WVD B;  3FIF A;  2KMT A;  4BB7 A;  2CH4 A;  1JXO A;  3EGU A;  4EMG A;  1ABQ A;  3S3N A;  4RUG A;  1VQ6 T;  3JCM h;  1UEC A;  2R57 A;  4E7S A;  5DLO A;  1HSQ A;  1YI2 Q;  4ZTJ A;  5FWB A;  2FPF A;  1SRM A;  1M90 U;  1VQ7 Q;  1VQK T;  2D0Q B;  4MZP A;  1VYU A;  4F7U B;  5IT9 E;  1YI2 A;  3AHU A;  3M4G A;  2RQU A;  5GAO r;  1GBR A;  1AVZ C;  1K1Z A;  3ME9 A;  1VQ7 A;  4JJB A;  1WJQ A;  1AWW A;  2CH4 W;  4PFP A;  3EFO A;  1TG0 A;  3CMA Q;  2KE9 A;  2RJF A;  1JU5 C;  3RMQ A;  4ZGE B;  4QVD A;  2Y90 A;  2ZZD A;  4OMN A;  1Q7Y R;  2BE7 D;  3LW5 E;  4GBQ A;  1R8O B;  1RLP C;  1M2O A;  2AZS A;  3CMA A;  5A0G A;  1BI1 A;  5GAN 7;  2R5M A;  1D1B A;  1ZHI A;  4ESR A;  1VQL Q;  2EW3 A;  2KY9 A;  3G4S T;  1PRM C;  4HT8 A;  2JXB A;  3M58 A;  4B6M A;  4C92 E;  2RJD A;  2RHZ A;  5CKE A;  4M7D B;  1ZLM A;  1K76 A;  1VQL A;  1VIF A;  4IUP A;  5GAN j;  1YHQ Q;  3LWI A;  1R77 A;  3PT9 A;  2A37 A;  1M1F A;  3MPU B;  5IHK A;  5CO7 A;  1VQO T;  2EQM A;  2KAF A;  1YHQ A;  3H0I A;  4TVR A;  1Y96 B;  3CQT A;  1Z9Z A;  2F2V A;  2YDL A;  2J06 A;  4RTU A;  2DIG A;  3OS0 A;  3IQL A;  3CCS Q;  1NEG A;  4QKU A;  3OBY A;  2KEA A;  4M77 C;  4NOY A;  3M0Q A;  1WHJ A;  2L2P A;  5LJ5 d;  3L2U A;  1Q82 U;  1LJO A;  3CCS A;  2HCK A;  2NUP A;  2DBK A;  1K73 U;  4EMH A;  3MEW A;  6AT1 B;  5J26 A;  3VS6 A;  4LDY A;  2FYK A;  1VQ5 Q;  1JQQ A;  3JCM b;  3C12 A;  3QO3 A;  1FYN A;  1ZA1 B;  3SFM A;  3RBB B;  3M0R A;  3SD4 A;  3JCM Q;  1TXQ A;  1VQ5 A;  2XDD A;  5I22 A;  1D1C A;  4C8Q F;  4JS4 A;  3PE0 A;  1KC8 U;  2YUN A;  3V7C A;  2DTO A;  4JRI A;  1E7O A;  2JS2 A;  2EQI A;  4J7I A;  1KD1 C;  4BI3 A;  3EH2 A;  3TU4 K;  2HQH A;  2YRV A;  1PM3 A;  4RTW A;  3NFC A;  3CPF A;  4WF2 A;  4OMP A;  4KBM B;  4BI4 A;  1FX7 A;  2D0N A;  3CPW P;  2RHX A;  1B7T A;  3CBP A;  2CSI A;  4J9D A;  4UC4 A;  3MET A;  1SHF A;  3I56 T;  3CXC P;  5LJ3 j;  4P5N A;  2XDB A;  3L1A A;  2V1R A;  2J7I A;  3OB9 A;  3CCR Q;  4K11 A;  1OX9 A;  4OMO A;  2KR3 A;  2P0Q A;  1AHJ B;  2LT1 A;  3ZEH A;  1WA7 A;  2X35 A;  1ZBJ A;  3CCR A;  2HKN A;  2W0Z A;  2ZAE A;  5AT1 B;  1K8A C;  4E47 A;  4JPB W;  1Q81 U;  1EZZ B;  3AT1 B;  2YSQ A;  2M1H A;  3QBY A;  1GL5 A;  1IGQ A;  1QWE A;  3EFS A;  1I07 A;  3OSS C;  1B34 B;  2ZPI B;  2QQA A;  3PGG A;  1D09 B;  1VQP Q;  2CS7 A;  3A8G B;  2RNA A;  5GAN 2;  4M77 G;  4PJJ A;  1VYV A;  3EG9 B;  2GBQ A;  1HK9 A;  2QXF A;  3OMC A;  3L2V A;  4XTW A;  4M77 A;  2FPE A;  1VQP A;  1M27 C;  3A5Z B;  1X2Q A;  3EG0 A;  1MMG A;  5DM7 R;  1CSK A;  1UFF A;  1NLO C;  4V2S A;  5FRM A;  2DER A;  3JAM E;  1G3Y A;  3M0U A;  5GAO p;  4BE1 A;  1YCY A;  4LXC A;  2G6F X;  3G71 T;  1S1N A;  1U06 A;  4XTV A;  4OGC A;  2OJ2 A;  4C8Q B;  4A4K A;  3E9F A;  1M1K U;  1T3S A;  1UEB A;  2RK1 A;  3JCM J;  2JN0 A;  5KYU A;  5GAM j;  2HBP A;  3A1P A;  3ZFJ A;  3OS2 A;  1M8V A;  2XD0 A;  1W1F A;  2MYS A;  1RAH B;  1VUB A;  1VQ4 Q;  2K9G A;  5IXB A;  2RD1 A;  2K4Y A;  3PMI A;  5J39 A;  3CPW S;  1O75 A;  2EWN A;  3MCA B;  4C92 D;  4HT9 A;  1UJY A;  2HSE B;  3OYB A;  1PRL C;  3CXC A;  2DD4 A;  1VQ4 A;  1BI0 A;  2KSS A;  2D8H A;  1IZ6 A;  3VU3 C;  4LD9 K;  4E7J A;  2CYZ B;  3CXC S;  5GAN g;  4JS5 A;  1I81 A;  1U8R A;  1WQ7 A;  1TUC A;  2PVD B;  3OYD A;  2COZ A;  5GAN 5;  3CC7 T;  3GNF B;  1YIT Q;  2QA4 Q;  1U3O A;  2MF2 A;  2ESW A;  1KG1 A;  2COW A;  3HKS A;  4EIK A;  2QGG A;  1N9R A;  1I8F A;  3HRS A;  4M78 E;  1MV3 A;  2VAS A;  2EYY A;  2O9S A;  2SRC A;  1YIT A;  2QA4 A;  3BDL A;  2E5K A;  2HSP A;  4ELY C;  2KBT A;  2RI5 A;  2HD0 A;  1TSF A;  1RAA B;  4BE2 A;  5A0L A;  3M57 A;  4J6Y A;  2LVM A;  5GAN 3;  5GMK l;  2CP0 A;  2NUZ A;  5KH6 A;  2DRK A;  4XTZ A;  1OPL A;  3O8V A;  1OOT A;  3CC4 Q;  4KUI A;  5LJ5 h;  2K2M A;  4C0D C;  3CCV Q;  2CRE A;  2ZPB B;  4ZN3 A;  1QP2 A;  1KQS P;  2JUF A;  1AEY A;  3CC4 A;  5IH2 A;  2PU9 B;  2DYB A;  3TSW A;  1G8X A;  3QJY A;  2DMO A;  2VWF A;  3CCV A;  3GIB A;  3OSV A;  3JCM e;  2OTJ Q;  1H3H A;  3FLG A;  1ZSZ C;  1ZX6 A;  5GJW B;  1M2V A;  3LX7 A;  4C8Q D;  3QWX X;  4KGZ B;  2CZ6 B;  2V1Q A;  1QQJ A;  2AZV A;  3JRZ A;  4NL3 A;  1BCM A;  1NG2 A;  4M75 B;  2EIF A;  2ZGW A;  3HRT A;  3SHW A;  4E7Z A;  2DL4 A;  2PZ1 A;  1X6G A;  3OYI A;  1YJW Q;  3VS3 A;  4N0A C;  2RHU A;  4B9W A;  2MPX C;  1OQK A;  1OU8 A;  4JRP A;  5GJV B;  2EPD A;  4WCI A;  4QT7 A;  4MZT A;  1QLY A;  1YJW A;  3Q1J A;  1QVG P;  4HCC A;  4OB0 B;  2C0T A;  1WXT A;  2OTL T;  2BZ8 A;  2K79 A;  3RR6 A;  3GP8 A;  5LJ3 g;  3KXT A;  1N6A A;  1ZQ1 A;  1CKB A;  1SSH A;  2HBW A;  1PKT A;  5GAN 8;  3CME T;  4E7K A;  3OYJ A;  3OBW A;  4O6J A;  1UG1 A;  4BY6 B;  3CCQ T;  2FRY A;  4C5G A;  2O9V A;  4FM4 B;  4EMK C;  1V1C A;  4OB2 B;  3VS7 A;  1TWB A;  5L23 A;  2VYT A;  2EKH A;  1TU0 B;  3JB9 J;  4E7L A;  3C95 A;  3QDR B;  1BCO A;  2MK5 A;  3CEY A;  5GAO m;  5KYW B;  4PNO A;  2LCC A;  5C6S A;  1H3Z A;  2DZC A;  1KQS A;  1MMA A;  4DOW A;  3QYG B;  2AK5 A;  5HCK A;  2L89 A;  5LJ5 f;  5KE3 A;  3MO8 A;  2DA9 A;  1KQS S;  1YN8 A;  3THK A;  1WFW A;  2K6D A;  1PHT A;  4M78 G;  3OYF A;  4J9G A;  1M90 C;  1H8K A;  4M78 A;  4PFZ A;  4E7I A;  2VGN A;  4KT0 E;  5IAY A;  4FT2 A;  1S72 Q;  2DYI A;  2OX7 A;  2X4W A;  5GAM g;  2QYZ A;  3N5B B;  1D1A A;  2FZG B;  1M3A A;  4ZTF A;  2YLC A;  3M0T A;  2PQW A;  4RMO A;  3H6Z A;  1S72 A;  2ZPF B;  2NUT A;  2D1X A;  2P4T A;  3RMS A;  2DXB A;  2QEX Q;  4PJO E;  1KJW A;  2OAW A;  2RM4 A;  4CC4 B;  2XID A;  1QVG S;  1K0S A;  3CCJ Q;  1NYF A;  3REB B;  5GAN d;  1WHK A;  4D8K A;  2QEX A;  2HNI A;  4N0A A;  1MGQ A;  3JCM V;  3CCJ A;  1VQN T;  5GAN 6;  3EG3 A;  3TSZ A;  2YHT A;  2W10 A;  2E6Z A;  1UGS B;  4FYW B;  4Z8A A;  2J05 A;  2JNG A;  2NLU A;  4M78 D;  5GMK h;  3QJ6 A;  4N4G A;  2PNI A;  3CD6 Q;  2EFI A;  4PJO C;  3X24 B;  4R0K A;  1VQ9 Q;  1AZG B;  2O01 E;  5KYY B;  2GGR A;  2JMA A;  3CBM A;  4JZ3 A;  3FJ5 A;  3CD6 A;  1ZUY A;  4PK4 A;  1VQ9 A;  4J9F A;  1U1S A;  4ZGJ B;  1SRL A;  1VQ8 Q;  4EMK A;  1C6V X;  4HVU A;  2CP5 A;  3PTA A;  1IRX A;  2X3W D;  3UF4 A;  2JW4 A;  4ZGD B;  1KD1 R;  4LUD A;  2I2L A;  1W4S A;  4A4G A;  4QQ6 A;  4JLI A;  1VQ8 A;  5IHN A;  3PMT A;  5A2Q E;  1K73 C;  3OYL A;  1K9M C;  1MMD A;  3OA6 A;  4DOV A;  8ATC B;  4RTT A;  2CDT A;  4C92 F;  1YI2 T;  4QW2 A;  2K3Y A;  4ORZ A;  1NLP C;  3I55 Q;  3JCM P;  2KI7 A;  2DL8 A;  2NUP B;  3C0C A;  2JTM A;  1VQ7 T;  3CCE Q;  2LJ1 A;  2CT4 A;  4M77 F;  3CCL Q;  3VRY A;  5GAO n;  3R6O A;  2DIQ A;  2FB7 A;  3I55 A;  2G3R A;  4LDW A;  1B3Q A;  4DBH A;  3CCE A;  2QDY B;  1OUL A;  1J3T A;  4M77 E;  3CCL A;  3CMA T;  1M9S A;  3GF5 A;  1F1B B;  4OMF B;  1FMV A;  1I5L A;  4AG1 C;  1K8A R;  1N8R U;  4II1 A;  4J9H A;  1NJI C;  3C94 A;  3TCJ A;  3WXM B;  4Y92 A;  1V76 A;  3SB2 A;  4C0F A;  4DBQ A;  1VQL T;  2RQW A;  4FYY B;  4BDZ A;  3I9Q A;  2JZ2 A;  1VA7 A;  4J8O A;  4FYV B;  2R5A A;  1UB4 A;  5LJ3 d;  1Y57 A;  1ZBX A;  3QYH B;  5AYF A;  4LDU A;  1Y7X A;  5KE2 A;  5KYX A;  4FT4 A;  3I5S A;  2CP3 A;  2CZ1 B;  1YHQ T;  1XOV A;  1T0H A;  4IKF A;  2HL5 C;  3VS1 A;  3CC2 Q;  2P4R A;  1TOV A;  2CP2 A;  4O5V A;  1UGQ B;  4J9I A;  1G2B A;  3L2W A;  1RI0 A;  3DLL A;  1PD0 A;  4PJO G;  3EHQ A;  4ATO A;  2BTT A;  1QKW A;  5IXF A;  3G7Z A;  4PJO A;  3PNW C;  2KXD A;  2IVW A;  1Q81 C;  3VJP A;  4RCB A;  4Z88 A;  5GAO q;  3CCS T;  1X27 A;  5KCH A;  2XI9 A;  1YWP A;  1JXM A;  4OMQ A;  1DJ7 B;  1TUD A;  4PJL A;  2GNC A;  2GTO A;  1M1G A;  2DXU A;  1WI7 A;  4E2F B;  1YBY A;  2O31 A;  4J9B A;  2PUK B;  5CCA A;  3NMZ C;  1RL2 A;  1ZSG A;  3TQ7 P;  1M30 A;  4C92 B;  1VQ5 T;  1D0X A;  4IIM A;  4RTZ A;  2KQW A;  1ARK A;  3UT1 A;  2BZX A;  3QSU A;  4LDX A;  3NTI A;  3VS4 A;  3QG1 A;  1QP3 A;  4M77 B;  4DA4 A;  4FYX B;  1VQM Q;  3DB4 A;  1Y96 A;  3RKY A;  4J9C A;  1Q86 U;  5GAM d;  3L2Q A;  2ROL A;  2YUO A;  2EYQ A;  1FXX A;  1NPP A;  5LJ5 e;  4HXJ A;  2MIO A;  1BU1 A;  1WPY A;  4IUU A;  1M1K C;  1VQM A;  1LVK A;  1BI3 A;  2DNU A;  4X34 A;  2EYW A;  1WX6 A;  1X2K A;  2ED0 A;  5GMK m;  2L3P A;  4XU3 A;  2J6K A;  1OEB A;  2M0Y A;  2X4X A;  1U5S A;  2NYS A;  4J83 A;  3OY9 A;  2O88 A;  1PG5 B;  1SKU B;  2GTJ A;  2LX7 A;  3QII A;  2E3H A;  2C0O A;  2LRQ A;  2DLP A;  1YNZ A;  3HRU A;  2MWP A;  1BIA A;  4M4Z A;  2DXC A;  4MMK A;  4CC2 A;  3L42 A;  1IO6 A;  1XNI A;  2E4H A;  2KDS A;  1WYX A;  1E6G A;  2CUB A;  2RQV A;  3DKM A;  1P92 A;  1EIF A;  4C5I A;  3CCR T;  4R55 A;  2QQB A;  1G3T A;  5GAN h;  1JBM A;  2BZY A;  4RTV A;  3QKJ A;  3URG A;  3JCM c;  2YLB A;  3V8J A;  2E1H A;  2XHC A;  3TRE A;  1MMN A;  2DL7 A;  5KCO A;  2RJC A;  1XQH A;  2DTI A;  2DKG A;  1NPR A;  4M7A E;  1UGR B;  3VUB A;  4KH0 B;  5FU6 B;  1VQP T;  1MHN A;  1BBZ A;  2ABL A;  3S3M A;  2GF7 A;  1Q7Y U;  2X4Y A;  1BI2 A;  4X1V A; 
#chains in the Genus database with same CATH homology
 3CPW P;  1VQ4 Q;  1Q7Y R;  1Q82 R;  1VQ7 Q;  3CC2 Q;  1QVF P;  3G4S Q;  3I56 Q;  1K73 R;  1JJ2 P;  1K9M R;  1VQP Q;  1W2B P;  1VQ6 Q;  1YIJ Q;  1VQM Q;  1VQO Q;  1YHQ Q;  1M90 R;  1QVG P;  1VQ5 Q;  3CC4 Q;  3CCS Q;  3CME Q;  2QEX Q;  1VQ8 Q;  1YJ9 Q;  1YJN Q;  3OW2 P;  1KC8 R;  3CCV Q;  3I55 Q;  3CCM Q;  1S72 Q;  1VQL Q;  3CD6 Q;  1VQK Q;  3CCQ Q;  1K8A R;  1KD1 R;  1Q86 R;  1KQS P;  1YIT Q;  2QA4 Q;  3CCU Q;  1VQ9 Q;  3CCE Q;  3CXC P;  3CCJ Q;  1VQN Q;  1YJW Q;  3G6E Q;  1Q81 R;  1M1K R;  1NJI R;  3CCL Q;  1N8R R;  3CMA Q;  1YI2 Q;  3CCR Q;  3G71 Q;  2OTL Q;  3CC7 Q;  2OTJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...