5IHIA

Crystal structure of the alpha spectrin sh3 domain double mutant v46g-d48g
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
ELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEGNGRQGFVPAAYVKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the alpha spectrin SH3 domain double mutant V46G-D48G
rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, non-erythrocytic 1
total genus 12
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ihiA00
2J6FA 1SRMA 2K9GA 1H92A 3TVTA 1WXBA 4AFQC 4J9BA 1K0XA 1AD5A 1PWTA 2BZ8A 1RUWA 2J7IA 2DRKA 1NEGA 4LNPA 3EG3A 1EFNA 2EYWA 1GFDA 1AWOA 4HVVA 1M8MA 2LQWA 4OMQA 1AOJA 4HVUA 2LJ0A 2FRWA 1WXTA 2DBMA 2V1QA 2K3BA 1SRLA 3PE0A 1NLOC 4RTXA 3I5SA 2D8JA 1AWXA 1IO6A 2L3PA 1ZUYA 1UECA 2GBQA 1UJYA 3GBQA 2J6OA 5IHIA 1K4US 3EG2A 5HCKA 2CUBA 4FSSA 1I1JA 3EHQA 4Y92A 1W1FA 3PVQA 2DF6A 2AZSA 2DLPA 4K11A 2DL3A 2JMCA 1T0HA 4F16A 2DILA 3SEMA 2KRNA 1WDXA 2A08A 1GCQC 3IQLA 1CKBA 4R0KA 4LN2A 1VYUA 5IHNA 2LCSA 2JT4A 2HBWA 2RQVA 4RTWA 1OPLA 4JZ3A 5IXFA 3VS4A 2DVJA 3M0PA 2MOXA 3H0HA 4RTVA 2DA9A 3EHRA 1RLPC 5IHKA 2EYXA 3CQTA 4AFZC 2D8HA 4RTUA 2LNHB 1YN8A 2DL8A 4J9EA 2DBKA 2DL7A 4DEYA 2AKLA 1UE9A 2DX1A 3VS2A 1K0SA 1VA7A 2DYBA 2A28A 2FO0A 2LX7A 1JXOA 4AFSC 2PNIA 1X6BA 4CC7A 5L23A 2VWFA 1UHFA 5GJWB 2RN8A 2JW4A 4LE9A 1AEYA 2CUDA 2KT8A 4J9FA 1AZGB 1CSKA 3NMZC 1NYGA 4JPBW 3REAB 2RPNA 2X3WD 2B86A 1OPKA 2KROA 3VS6A 4A63B 2OAWA 2AK5A 4CC4B 1SHFA 3SHWA 4GBQA 1YWPA 1M3CA 1ZSGA 3KFVA 2LJ3A 2PZ1A 2GTJA 1X27A 2W10A 2YUOA 2PTKA 1GL5A 2GNCA 2JS0A 1BU1A 4AFUC 1U5SA 3M0UA 4F14A 5ECAA 1WA7A 1KIKA 1ABOA 2JM8A 1JO8A 2MCNA 2CSQA 4DEXA 1YNZA 2YT6A 1TUCA 2HCKA 4AG1C 4JZ4A 3UA6A 2SEMA 3O5ZA 1M3BA 2OJ2A 1M27C 2CH4A 1KFZA 2FEIA 1K76A 1NEBA 3I5RA 2ESWA 2FRYA 2FPEA 1AVZC 2O9SA 1B07A 2J05A 1T3LA 2JM9A 1VYTA 2W0ZA 1KJWA 2SRCA 3RNJA 1NG2A 1ABQA 1UUEA 1H3HA 2GQIA 2M51A 2K7AA 4EIKA 3I35A 4HVWA 2G6FX 4OMOA 4RTZA 1ZUKA 2LJ1A 3EG0A 2AKKA 1SEMA 2ENMA 3VRYA 2C0IA 2F2XA 4OMPA 1GCQA 2EVRA 2O2OA 4KRTA 2O31A 1I07A 1WI7A 3EGUA 5I11A 3H41A 1K9AA 1QWEA 1V1CA 3JV3A 2DNUA 2BZYA 2K6DA 3QWXX 1M3AA 2FPDA 1T3SA 2RF0A 2LQNA 4IIOA 3VS1A 4QT7A 1J3TA 1KSWA 4JJCA 1Y57A 1FYNA 2IIMA 2RQWA 4JJDA 1QKWA 1JEGA 2KRSA 2KE9A 2JS2A 3EG1A 1AZEA 2HSPA 1WX6A 2LMJA 1PRMC 3R6NA 2NUZA 2KBTA 2HDAA 1NM7A 2LZ6B 3LH5A 1SHGA 3QWYA 4OMMA 4Z89A 2J06A 3H0IA 1X2QA 1E6GA 1SSHA 2RNAA 4M4ZA 3RBBB 1QKXA 1LCKA 1AWJA 1GBQA 4JJBA 4Z88A 2YSQA 1T0JA 4OMNA 1Z9ZA 1OEBA 2EQIA 2K79A 4WCIA 1UJ0A 2EPDA 3ZL7C 4CC3A 1A0NB 1UFFA 2KT1A 2YUQA 5FW9A 1ZUUA 1JU5C 2LP5A 1UGVA 1YWOA 1W6XA 4LUDA 1GBRA 1NLPC 4RTTA 5IH2A 1QWFA 2CDTA 3REBB 2XMFA 2RQRA 2J6KA 2FG0A 4RUGA 4ZNXA 1G83A 1GRIA 2BTTA 2AZVA 2BZXA 2YUNA 2M0YA 1BK2A 3NPFA 3VS0A 2KYBA 2EW3A 2CT3A 2ED1A 4J9DA 1X43A 1JQQA 1MUZA 2X3XD 1PRLC 2DRMA 2D1XA 1ZX6A 2GGRA 1UTIA 3FJ5A 1GCPA 1OOTA 2FPFA 2EYYA 2QDLA 4J9HA 2EYZA 4J9GA 1RLQC 2KNBB 4CC2A 3M0TA 1B3QA 2ROTA 4Z8AA 1MV3A 1BBZA 2O9VA 2NWMA 2A36A 2HEQA 1TUDA 1UG1A 3NGPA 2CH4W 3VS5A 2DE0X 2I0NA 1N5ZA 1GFCA 1S1NA 1RI9A 2EKHA 1U3OA 5IXBA 1X2KA 1JXMA 1H8KA 2L2PA 4HCKA 4AG2C 3UATA 2EGEA 3UF4A 1ZBJA 4IIMA 1WXUA 1W70A 2CSIA 2K2MA 2EBPA 2CREA 1MV0B 1WIEA 2F2VA 5EC7A 1YCSB 2ED0A 2L0AA 1Z9QA 2CT4A 1HD3A 2VKNA 4F17A 1OV3A 1AWWA 2RQTA 4J9IA 3UA7A 1VYVA 2O88A 1PHTA 5FWCA 1SPKA 1BB9A 2E5KA 3NHNA 2A37A 2DM1A 2JMAA 2OI3A 4E6RA 1QCFA 4OMLA 4J9CA 3VS3A 1UHCA 3VS7A 4ESRA 3M0RA 3TSWA 5FWBA 1WLPB 2C0OA 3TSZA 1I0CA 2KYMA 1X6GA 2RQUA 2JTEA 1NYFA 2YDLA 2L3SA 2DL5A 2DJQA 2KXCA 1CKAA 4ORZA 4D8KA 3I9QA 2V1RA 2RMOA 2EGAA 3U23A 4GLMA 4X1VA 3ULRB 4LUEA 1X69A 1YP5A 4D8DA 1ARKA 3M0SA 1G2BA 1K1ZA 1XOVA 2MIOA 5GJVB 3H0FA 3THKA 2GTOA 2EGCA 2L3QA 2ROLA 2JXBA 1ZLMA 3C0CA 4HXJA 1PKTA 1PKSA 2ABLA 2DL4A 2KXDA 3A98A 1QLYA 1Y0MA 1E6HA 2H8HA 1TG0A 2KEAA 1HSQA 2P4RA 2F2WA 1WYXA 1PNJA 1UDLA 2VVKA 2ECZA 1E7OA 2KRMA 2D0NA 1FMKA 1M30A 2DMOA 5I22A 1U06A 1HJDA 3VRZA 1WFWA 3PVLA 4RTYA 2C0TA 2KR3A 2KGTA 2YUPA 3M0QA
chains in the Genus database with same CATH superfamily
2E64A 2K9GA 3TVTA 4J9BA 3GIBA 3OYYA 5GAN8 2X51A 1AD5A 5D7UA 1RUWA 4N0AA 4ZN1A 3EG3A 2ZPBB 4LD6A 5GAOl 2K57A 2CP6A 2JTFA 4HVVA 1OX9A 5GAOm 8ATCB 1M8MA 3G71Q 3RMSA 1YITT 2YRVA 2DBMA 2CZ6B 2K3BA 5D6YA 3UWNA 1NLOC 1AWXA 1IO6A 4HT8A 2L3PA 5DLQE 3GBQA 3OS5A 1G3WA 1K4US 3TQ7P 5HCKA 4FSSA 1I1JA 3H9NA 1WNLA 4N4HA 3CD6T 5KYWB 1W1FA 3PVQA 3JCMe 3CC7A 2DF6A 4MDXA 2DLPA 4K11A 3L2VA 2X35A 4F16A 5KYNA 2DILA 3SEMA 6AT1B 2KRNA 2PU9B 5A0GA 3IQLA 2DTHA 3CMAQ 3HRTA 5IHNA 3CCST 3FIFA 2EAYA 1X6OA 2HBWA 3VS4A 3QJ6A 3MEAA 3RKYA 4M7AB 2HL3A 4FU6A 2RH2A 1QVFP 1PD0A 2FB7A 3CQTA 2PVDB 4AFZC 5LJ3e 2QQ9A 4RTUA 3OW2A 5AYFA 4KUIA 1BCMA 4DEYA 1UE9A 4C92E 2CP5A 3HP9A 4PFOA 4C8QF 1JXOA 2PNIA 1X6BA 4EDUA 5GMKh 3OS2A 5L23A 4LDXA 3V7RA 5GJWB 2RN8A 2JW4A 4J7IA 3HFOA 3QXEB 3T9NA 1WHLA 4J9FA 3L2UA 4C8QB 1AZGB 3JCMQ 2CP2A 2X3WD 2KROA 5C0MA 4A63B 3CCSQ 4CC4B 3JSCA 4GBQA 1ZSGA 3GOXA 2LJ3A 2ZGWA 1VQ7A 2QI2A 4JDSA 1QMCA 2JS0A 3OBWA 5CKBA 1U5SA 3TEEA 3S3NA 3M0UA 4F14A 5ECAA 1ABOA 4M7DB 2JN0A 2JM8A 1JO8A 2MCNA 4DEXA 1TUCA 4GLKA 2QGFB 1VQPQ 4M7AA 3ER0A 1BI3A 5FRNA 3CCSA 2NUTB 3CMAT 3G6ET 2CH4A 1D3BA 1NEBA 1LPLA 2FVUA 3I5RA 5KYXA 1UGSB 2H3JA 1IGUA 1UGRB 2O9SA 4C0DC 4M77A 1U8RA 3RNJA 2RJCA 1NG2A 4M77F 1H3HA 2M51A 3R6OA 3CCRQ 2CGHA 4E2FB 1PD1A 2DVEA 2G6FX 1ZUKA 3L2ZA 3EG0A 3VRYA 3M55A 2CZ7B 4OMPA 4KH0B 4FT4A 5GAN7 2ZPHB 1WI7A 2MI6A 3E9GA 4C0FA 4N4GA 1H641 3H41A 1QWEA 1I4K1 4FW1A 4F7UF 2DNUA 4E7KA 1VQ6T 5KCOA 2NUPA 1M3AA 1G3YA 1EIFA 3LGLA 2LQNA 4E7JA 4IIOA 3VS1A 4QT7A 4F7UG 3KXTA 3CCRA 1Q82R 1FYNA 2IIMA 4EMKC 2KE9A 4FCYA 2HSPA 1PRMC 4C5GA 2Y90A 3CC2A 1JRIA 3PMTA 5KCHA 3CMEA 3QWYA 1IRXA 1HXDA 1YI2A 4E7HA 4IUUA 3LGFA 5FROA 2NYSA 4YTLA 3OYJA 4JJBA 3C4SA 3P8DA 1B34A 1PG5B 1T0JA 1X01A 4FYXB 4MMKA 4A4FA 3EFRA 1VQKQ 3PMIA 2YRCA 2H3EB 1LNXA 4WCIA 5GAOp 2CZ1B 5J3BA 3CBOA 2LVMA 1D0ZA 3FB9A 3M53A 2YUQA 1KC8C 4KUDK 1JU5C 4EMHA 2K5IA 2EJGA 1W6XA 1NJIU 1NLPC 3CCEQ 2P0QA 3OYHA 2DZCA 1NZ9A 4RUGA 5KYWA 2AT1B 1G83A 1GRIA 1JJ2P 3CMEQ 3JB9G 1VQLT 5DM7R 3CEYA 2YUNA 3M54A 3KUFA 2XU8A 3GNGA 3QBYA 3VS0A 2KYBA 4C8QC 2ED1A 3JB9F 5GMKj 1VIFA 3OYCA 1YFNA 2D1XA 1ZSZC 2RJDA 3E9FA 3OYEA 1UTIA 4O5VA 5GAN2 3QSUA 2KNBB 1JJ2A 4CC2A 3M0TA 5CAIA 2VYTA 1C1AA 4Z8AA 1MV3A 5CO7A 1VQOT 4NL2A 4IUVA 2B8AA 3VUZA 1G3SA 2CP0A 3NGPA 4Z02A 4A4KA 4X34A 3CC4Q 5LJ5f 5I2MA 4M77E 5HK3A 2FZGB 1U3OA 2ZCFB 5IXBA 1M2OA 1H8KA 4HCKA 4FT2A 4IIMA 2K2MA 1LVKA 3H6ZA 5EC7A 4F7UA 1YCSB 4M75G 1OYXA 2BE7D 4XK8E 3CCJA 3JB9D 2VKNA 5CKDA 2RO0A 4F17A 9ATCB 1YJ9T 1M1FA 5FU7C 3UA7A 3OY9A 1VYVA 5FWCA 2WACA 3NHNA 2QG9B 4FW2A 4J9CA 3G4SQ 2AIRB 2MWPA 3TSWA 4ZGDB 5GAMd 1K8AR 4JRKA 2DERA 1WLPB 2C0OA 3RDVA 1I0CA 4XU2A 5CQYA 1Y07A 2RQUA 3A8OB 4ELZC 1BYMA 2KXCA 4OP0A 4ORZA 3JB9J 2V1RA 4C8QA 1Q82C 4D8DA 1ARKA 2X4JA 3M0SA 2LCLA 1G2BA 1KHIA 1XOVA 4UC4A 1WQWA 3H0FA 3URGA 1VQ8Q 3CC4A 4M7AC 2JXBA 3QDRB 3CC2Q 2RHZA 1YJWA 2IPOB 3CCMT 2BE9B 3EGDA 2DL4A 3BE3A 1QLYA 1Q7YC 1VQPT 3QHSA 1MMDA 2F2WA 3E19A 2OTLQ 1Y7XA 5LJ3d 1E7OA 2DZ9A 3CCJQ 2P0KA 4PJLA 2DMOA 4E7LA 3HRSA 2K2VA 2JUFA 1TSFA 2QTXA 1BCOA 3CCMA 5D6WA 2MWOA 1ZSZA 1VQNQ 5GAMj 1K0XA 1ZA2B 3META 1QVGS 3M56A 2F5TX 3RIRA 4MZPA 2EQKA 4LNPA 3LX7A 2DXUA 2LT1A 3M58A 3CBPA 4DOVA 2RHIA 1BI2A 4PFZA 2LQWA 4OMQA 1AOJA 4HVUA 2LJ0A 1RACB 1ZSZB 1D3BB 3DKMA 3SB2A 2V1QA 1C6VX 3MP8A 3GP8A 4R55A 1OQKA 4RTXA 4LDYA 2D8JA 1FMWA 2RJEA 1ZUYA 1UECA 1NPRA 3MKDA 3G1JA 5IHIA 4BACA 3I55A 3CCUA 2QASA 1UGPB 5LJ3j 2JVVA 1V76A 4OVAA 1KC8U 1YJWT 1PC0A 1T0HA 3JCMd 1QVFA 2V8KA 2K4YA 3CCLA 2A08A 3OB9A 3PIPA 2HQEA 3P8BB 1VQ5A 5GANd 1VQNT 2KVQG 1RAFB 4LN2A 3BY7A 1EZZB 1VYUA 3H8ZA 4M75D 2LCSA 5GAN4 3CC4T 4XTYA 4PJOD 2E6NA 1WJQA 2DVJA 3M57A 2MOXA 3H0HA 1BKBA 3L2WA 3EHRA 4II1A 5GMKe 1RLPC 3M59A 4D6WA 2L3RA 2DBKA 2AKLA 2DX1A 2K3YA 1K0SA 1VA7A 2DYBA 1M5Q1 2A28A 2FO0A 2R58A 5IAYA 4JLIA 4CC7A 3SWNB 5KYUB 4PJMA 2PVGB 2Y4XA 2KT8A 4C5IA 1QCNA 3HRUA 2GFUA 3EFOB 3NMZC 4HA8A 4OB0B 3REAB 1OX8A 2YXYA 4OB3B 1YJNQ 4JUVA 2ZPFB 4F7UE 5HKCA 2RHUA 1K9MC 3VS6A 2OAWA 1NJIR 1KD1C 3JB9I 5DLOA 2QEXT 4QVDA 3OYLA 2YUOA 1WPYA 1GL5A 4RG2A 4A4GA 4LXCA 2R5AA 1BU1A 1D09B 4J6YA 1PCXA 1RL2A 4L59A 4AFUC 4IUQA 2HKNA 5GAN6 2QA4A 2VGMA 4N4IA 1K8AU 5L8RE 2CSQA 1YNZA 5DY9A 1RI0A 2ZPGB 3UA6A 3MHXA 4QVCA 3CCET 1VIEA 3GNFB 3V8JA 2OJ2A 4ANJA 1K76A 4XTXA 2XHCA 2DEQA 4ZGJB 4MMLA 1AVZC 1N9SA 1B07A 2M1HA 3QYHB 3L2RA 4C92A 1M2VB 1VYTA 1KJWA 2KI7A 2WSCE 2D6FA 2DJZA 4PK4A 4PFPA 3CC7Q 4J7FA 1VQMA 5CCAA 4EIKA 1G8XA 4XTWA 5CKHA 3SD4A 2K5FA 2QQRA 3GF5A 3G4SA 4KRTA 1LJOA 2GF7A 1P92A 1WHKA 1K9AA 1V1CA 2LQ8A 1B7TA 2F69A 1XJWB 3A8GB 1T3SA 2RF0A 3FLGA 3JCMJ 1K73U 3NFCA 3V7CA 1BI0A 2A0FB 1KSWA 1Y57A 2L89A 2RQWA 4JJDA 1QKWA 2OAUA 1IB8A 3A8LB 4C0ZA 3EG1A 3L2QA 1N8RU 1D1AA 4P5NA 1WX6A 4ZTJA 2NUZA 1QVGA 1M1KC 2KBTA 2HDAA 5CQXA 3VUBA 2QA4T 5A2QE 1SHGA 4OMMA 3CXCS 4Z89A 1WJRA 4PKCC 4KBMB 1N6AA 1R0BG 2NUPB 3H0IA 3HFNA 1OZ3A 3CD6A 5GANf 3M5AA 4M78D 1LCKA 1AWJA 3AT1B 1ZQ1A 4C5EA 1Z9ZA 4PJOA 5CVIA 3QZ9B 1YIJA 4BD3A 2EPDA 3FEOA 4RCBA 1A0NB 2GCXA 5FW9A 1UGVA 2EKOA 4M7DF 1QP3A 3QPHA 1VQ8A 3PIOA 3REBB 3JCMW 2RQRA 2EQJA 2YHTA 4TVRA 1MMAA 2AZVA 2E70A 2EQMA 2DEUA 1U1TA 3MP1A 4ELYC 3VJPA 2M0YA 3JB9H 3NPFA 2HSEB 2CT3A 4J83A 3CCLQ 5A0DA 1X43A 1JQQA 1MNDA 1SSFA 1PRLC 4DOWA 1KK7A 3JCMc 2R5MA 2RI5A 1SKUB 1GCPA 3OYAA 2F1LA 4J9GA 1RLQC 4PJOG 2CS7A 1QVPA 2O9VA 2NWMA 3I56A 5CIUA 1TUDA 4XQ3A 3VS5A 3JCMf 2X4XA 2O4XA 3TREA 2CZ0B 3OW2P 2I0NA 1GFCA 3DB3A 1UB4A 2R57A 2DD4A 2EKHA 2L2PA 3UATA 1ZBJA 1FWZA 2VUBA 2XDPA 4PLLA 2EBPA 2CREA 4B9WA 5I2SA 5GAMg 2NLUA 2ED0A 4E7ZA 2DFUA 1Z9QA 4KH1B 5GAOq 2RQTA 4M7AE 4Y91A 4EMKB 4M78G 3A8MB 1C0MA 4OB1B 1QVGP 1BB9A 1HYOA 2LDMA 2MPXC 3VYGA 2DM1A 4E6RA 4E47A 2E6ZA 5J26A 2P84A 3JCMX 3OW2S 2OTLA 2KYMA 1N8RC 2RI3A 3JRZA 4IURA 1VQ5T 2QEXA 1NYFA 4OB2B 5GAN3 2EYQA 1RAIB 3D7SB 1QP2A 2DKGA 3OSSC 4PL6A 2KSSA 3CCVA 2RMOA 2EGAA 4PJJA 1VQ9Q 5CR2A 1X69A 3RMQA 3OYMA 3QYGB 2FZCB 1OU9A 5GJVB 2ZAEA 4O6JA 4PJOF 3THKA 2GTOA 3CCEA 4HXJA 1PKTA 1ZHIA 2A7YA 1ZA1B 4BI3A 2KXDA 2H8HA 5KYYB 1UDLA 7AT1B 2ECZA 2JNGA 1UGQB 4ZN3A 3CCVQ 1M30A 1D1BA 3KBGA 5I22A 4FIBA 1U06A 1WFWA 1M1KR 4IKFA 2QYZA 1MNEA 4A4EA 2YUPA 3M0QA 2EJ9A 2J6FA 4M75A 1H92A 1WXBA 5A0LA 1KC8R 1XQHA 4BB7A 1KQ1A 4BDZA 2YLBA 1VQ4A 4C0GA 4CI0C 3CXCA 2O01E 2MK5A 2DRKA 2KQWA 2ZPIB 3EH1A 2KAFA 1S72A 1GFDA 4C92F 5FU6C 3MP6A 4HT9A 2ZPEB 2P0PA 5LJ5h 4C8QE 2FRWA 1WXTA 2JTMA 1M1GA 2FL7A 3BW1A 4BE1A 3N5BB 1RAEB 2GBQA 2VB6A 3I55T 3EG2A 3QO3A 2VC8A 2VASA 4X9DA 2O4XB 3MO8A 2QXFA 3FRNA 3CPWA 2VGNA 5FU6B 2PUKB 3CCQQ 4XTUA 2X4WA 3PGGA 1WHMA 4JJNK 1KQSS 2M02A 4M7AG 3BDLA 5GMKi 4QVZA 2JT4A 4FL6A 2RQVA 3HPWA 1OPLA 1GXIE 5IXFA 2XICA 3A5ZB 4HCCA 3M0PA 4RTVA 4BDYA 4OGCA 3OYIA 4M7DG 4DBRA 1YHQT 1TU0B 2Y4YA 2LNHB 1YN8A 1KQSP 2DL8A 1D0YA 4LD9K 3MEVA 1AHJB 3WVEB 2QQBA 3HL8A 3VS2A 3I56T 1M2VA 1K73R 2PVOB 2IVWA 2QK0A 1M1KU 1AEYA 1UHFA 4LE9A 1YITA 2CUDA 4F7UB 1PM3A 1Y96A 1CSKA 3LWHA 4JRPA 4QQGA 1NYGA 4JPBW 2RPNA 2MYSA 1OPKA 2NUTA 2AK5A 1JJ2S 4PJOC 4JLGA 1SHFA 3SHWA 1YWPA 4M75C 2V8JA 2VV5A 1VQ7Q 1M3CA 3E1SA 3EGXA 3KFVA 3NTIA 2HAXA 2DIQA 1KD1R 2GTJA 2VXEA 3LYIA 5HY6A 1WHHA 2W10A 2PTKA 4ZGEB 5KYUA 2GNCA 1YHQQ 2XG8D 1DJ7B 2COYA 2DETA 3QZ5B 2EJFA 1PSFA 1WA7A 5D6XA 1KIKA 2YT6A 3EFOA 2PQWA 2OTLT 2LNVA 4LDWA 3S3MA 2HCKA 1VQLQ 4C92C 2RK2A 5C6SA 1Q81C 4KGXB 4JS4A 3JCMP 4EMGA 1KFZA 3PFSA 3CPWS 4OF1A 2ZZDA 2FPEA 2K5LA 1K9MU 4F04B 2AHJB 1T3LA 2W0ZA 2SRCA 3J80E 1ABQA 2DXTA 5HK0A 1YHQA 1N27A 1FX7A 2K7AA 1Q86C 3I35A 5IN1A 4FYVB 2E3IA 4L6V5 1Q7YU 4M77C 3AHUA 1R77A 2AKKA 1SEMA 2ENMA 2F2XA 1VQPA 2EVRA 3EG9A 2O2OA 4QQDA 3A8HB 3OYKA 2XD0A 5I11A 1TTHB 4N0AC 3UPUA 2E1HA 2RHXA 1RAHB 2D9TA 3OSVA 2KY9A 2E65A 1OU8A 4J6WA 3QWXX 4PJOE 4J8OA 2MAMA 2DK3A 3OMCA 4BE0A 3M9QA 4JJCA 3X25B 1W2BA 1NBEB 3EH2A 3QIIA 2KRSA 2JS2A 2LC4A 1ZBXA 1VQ6A 2LMJA 2CP7A 3R6NA 1RAAB 2E12A 1Q95G 4IUPA 1NM7A 2LZ6B 3LH5A 1YJ9A 4JRIA 3QKJA 1QVFS 1WHGA 3HSBA 4M77B 1SSHA 3OS1A 3RBBB 4M4ZA 1Q7YR 2OTJT 3FDRA 2YSQA 2DTIA 2DTOA 4JRQA 2OTJQ 2DXCA 4RKUE 5GAOr 1OEBA 4BI4A 2K79A 1UJ0A 2BUDA 1VQOQ 3ZL7C 1ACMB 4V2SA 1UFFA 5GANe 2QQSA 1W2BS 2QAZA 2HQXA 1W4SA 3EGDB 1YWOA 2RM4A 3SWNA 2MF2A 4RTTA 5CKEA 5IH2A 1RABB 3VU3C 2XMFA 4C92G 2J6KA 1G5VA 4FYYB 4DBQA 4ZNXA 2BTTA 5KH6A 2DO3A 4M7DE 2BZXA 4WTOB 3X26B 1BIAA 1D0XA 4L5GA 1BK2A 1IZ6A 2X4YA 1VQOA 3OYBA 3EG9B 4QW2A 5GAOn 1LOJA 3FJ5A 4J9HA 2QDLA 1I8FA 4HCZA 3JAME 3WVDB 5GAN5 1B3QA 4M78E 2V8IA 5LJ5g 1M90U 2ROTA 1VQ4Q 2HEQA 2HKQB 2D0QB 4EMKA 2CP3A 2CH4W 2CYZB 2BKDN 1S72Q 1IXDA 3A1PA 1RI9A 3G71A 4M7AF 3RKWA 1JXMA 1F1BB 2EGEA 4C92B 3UF4A 2XDBA 1WXUA 2DD5A 1MV0B 2F2VA 5I21A 1KD1U 1K73C 4M7DC 2L0AA 1R0CB 1YI2T 4LDVA 2RB6A 1AWWA 2COZA 3HHTB 4PJNA 1M8VA 4XAXB 2O88A 1PHTA 3RR6A 2HMAA 4MDWA 1WGSA 4DQ2A 5GANj 2A37A 2JMAA 2OI3A 4OMLA 3INZA 1QW1A 3VS7A 1Q81R 3M0RA 8AT1B 1YCYA 5FWBA 3WXMB 5LJ5d 2QEXQ 3TSZA 2RHYA 1XNIA 3GPLA 4C8QD 2YDLA 2L3SA 4XU0A 1QQJA 4J5YA 1CKAA 3CCVT 4D8KA 2RK1A 2LRQA 4M77G 4M75F 3CBMA 1YIJT 4GLMA 3ULRB 1WJSA 4LUEA 1YP5A 3CCUT 4VUBA 1PSEA 1K1ZA 2MIOA 3OMGA 1VQMT 5CKFA 2VXFA 1VQNA 4XTZA 4M75E 2L3QA 2DYIA 2HZYA 2ROLA 4E7IA 3I56Q 1ZLMA 4M7AD 3L42A 2OX7A 2QTVA 3G6EQ 5LJ3h 1HK9A 1WHJA 3ME9A 1NE8A 3CCQT 1Y0MA 1E6HA 4B6MA 2KEAA 2P4RA 4KGZB 1PNJA 2VVKA 3RESA 2KMTA 2E41A 4ZTFA 1HJDA 4M78A 5AT1B 2PUOB 1M9SA 3L1AA 2KR3A 3PT9A 1KHCA 3M4GA 3PNWC 1SRMA 4M7DD 5J39A 4AFQC 3ZFJA 3PTAA 3RUXA 1PWTA 2BZ8A 2FHDA 2GQVA 2XDDA 4NL3A 3CCUQ 2J7IA 1NEGA 2YWWA 4M77D 5GAMe 1EFNA 3CCJT 2EYWA 3CD6Q 1AWOA 4PNOA 3CMET 4A4HA 2QGGA 3RERA 1B34B 2L5QA 2V26A 5LJ3g 3OBYA 4M78B 4BY6B 3G7ZA 1IGQA 2RJFA 3CCMQ 1SRLA 3PE0A 2HNIA 1KQ2A 3I5SA 4M75B 2Z0WA 3P8HA 3OYGA 1I81A 1UJYA 1Y71A 2HL5C 1WQ7A 2J6OA 4BUGA 3E2UA 4XTVA 2XK0A 2DPPB 3CCLT 1RADB 1YJWQ 4OGEA 2CUBA 3C12A 3EHQA 3LW5E 4Y92A 4RCCA 2LTOA 1VQ9T 4PLIA 5KYYA 3UT1A 3CC7T 5KE2A 1KQSA 2AZSA 3DLLA 2YLCA 4B9XA 3C95A 2DL3A 2JMCA 1VQ6Q 1VQ5Q 5GMKl 1WDXA 2F5KA 1O75A 2JJ9A 1GCQC 1CKBA 4R0KA 4LDUA 5KE3A 4MZTA 1JBMA 4J6XA 3CPFA 2KDSA 3EAEA 4WF2A 4R56A 1BIBA 4RTWA 1M90R 4JZ3A 3OYDA 1M4ZA 5CK9A 5FRMA 2DA9A 4DBHA 5IHKA 2EYXA 2EFIA 2D8HA 1SG5A 4J9EA 4XU3A 1U1SA 2DL7A 3RKXA 2QA4Q 4Q5WA 4FYWB 2LX7A 4AFSC 1N9RA 2VWFA 1FXXA 1OZ2A 2KK4A 5GANh 3X24B 1IHVA 1YJNT 3F70A 3TCJA 3G71T 5IT9E 3BFMA 1YBYA 1SF9A 3JCMh 2IG0A 2M16A 4M78F 2DXBA 3M4YA 2B86A 4A53A 3LWIA 2PZ1A 2BIVA 1Q86U 1X27A 1X75C 1VQ7T 5FU7B 3SDZA 3VKIA 4BY6C 2FZKB 2JZ2A 3MJXA 1TS9A 2ATCB 3VYHB 4ME7A 2WSEE 1G3TA 4AG1C 4JZ4A 2I2LA 4FSXA 3J7AF 1VQ9A 2SEMA 3O5ZA 2HBPA 1M3BA 3EGXB 1M27C 1TUGB 1VQKA 4OMFB 1VQ8T 2FEIA 1R8OB 2ESWA 2FRYA 1WZOA 1VOMA 2COWA 2J05A 2JM9A 2WSFE 1EX4A 1UUEA 2GQIA 1YIJQ 2GFAA 2RI2A 4C92D 1M90C 3QUIA 3QG1A 4HVWA 3DLMA 4OMOA 4RTZA 2LJ1A 2C0IA 2LQKA 1YI2Q 3BDUA 3S6WA 2EIFA 1GCQA 3OYNA 2O31A 1YJNA 1I07A 1W2BP 5KYXB 4JS5A 4XU1A 3EGUA 4RG8A 3S3OA 2HD0A 1N8RR 3JV3A 1OI1A 2BZYA 4AMCA 2K6DA 2FPDA 3V7SA 1AT1B 1MMNA 1S72T 3FJPA 4E7SA 1J3TA 3EFSA 4EPCA 4RMOA 3CCRT 1K9MR 3FC3A 4PJOB 4M78C 1VQ4T 1JEGA 2XKOC 3C94A 3ASKA 3LH0A 3OA6A 1AZEA 4Y28E 2EWNA 1FMVA 4AT1B 4BE2A 4C5HA 1H3ZA 3CC2T 2J06A 1TWBA 2FYKA 2DIGA 4DA4A 1X2QA 1E6GA 3HTRA 1D1CA 3SWNC 3MEWA 2RNAA 2OTJA 1QKXA 2XIDA 5GAMh 1GBQA 4Z88A 5LL6S 4IUTA 4OMNA 5FLXE 3MEUA 2EQIA 4CRIA 4BI8B 4CC3A 3JCMV 3V8LA 2KT1A 5GANg 2RA2A 1JB0E 1ZUUA 2LP5A 1TH7A 4LUDA 1GBRA 1MHNA 1NPPA 4GY5A 4QQ6A 1QWFA 2CDTA 3SFMA 3ZBDA 2FG0A 2G3RA 3MPUB 1YITQ 2LX9A 2LCCA 2P4TA 2E5QA 5EG2A 3MCAB 4C8QG 2HQHA 1VQLA 1O9SA 2MMPA 3JCMb 1TOVA 2EW3A 4J9DA 1K8AC 1MUZA 2X3XD 2DRMA 1KG1A 5M9OA 1ZX6A 2GGRA 3NTHA 3X28B 1OOTA 2FPFA 2EYYA 1TXQA 2EYZA 3QDFA 3G4ST 3OQ5A 5LJ5e 1BBZA 2A36A 2XI9A 1UG1A 1I5OB 4MZMA 2JOYA 1YJ9Q 1MGQA 2DE0X 3VV0A 5GAMf 1N5ZA 1S1NA 3Q1JA 4KULA 3X20B 1X2KA 4AG2C 1W70A 2CSIA 3JCMg 4A54A 2QQAA 1XTDA 1WIEA 1V29B 1IHWA 4NOYA 2LT4A 4DBFA 1Y96B 4NS5A 2CT4A 1HD3A 1OV3A 2M9UA 1UEBA 2L8DA 3ZEHA 3HKSA 4J9IA 2C06A 4KT0E 1Q86R 4ATOA 1SPKA 2E5KA 4M7DA 3G6EA 3UDCA 1QCFA 3CPWP 4HCBA 4HKEA 3VS3A 2E3HA 1UHCA 4ESRA 1OULA 5GMKm 2A3LA 2E10A 1Q81U 3V8KA 1X6GA 2JTEA 5LJ3f 2DL5A 2M0OA 3TU4K 3CMAA 5LJ5j 2DJQA 2YRDA 3I9QA 1QCOA 1VQKT 2DAQA 2E4HA 3LLRA 3U23A 2K3XA 4X9CA 3OYFA 1VUBA 4X1VA 3I55Q 4KGVB 1BI1A 1I5LA 1NJIC 4FM4B 2EGCA 3DB4A 3C0CA 1PKSA 1VQMQ 3CCQA 2ABLA 3QJYA 2QDYB 3CXCP 3A98A 1IREB 1TG0A 1HSQA 2EQUA 1WYXA 1RAGB 1MMGA 2CKKA 2RD1A 2X9HA 2KRMA 2D0NA 1FMKA 3OS0A 3NTKA 3VRZA 3GLXA 3PVLA 4RTYA 2C0TA 3O8VA 2KGTA 4QKUA 3J81E 4C0DB 1Q82U
chains in the Genus database with same CATH topology
2J6FA 1SRMA 2K9GA 1H92A 3TVTA 1WXBA 4AFQC 4J9BA 1K0XA 1AD5A 1PWTA 2BZ8A 1RUWA 2J7IA 2DRKA 1NEGA 4LNPA 3EG3A 1EFNA 2EYWA 1GFDA 1AWOA 4HVVA 1M8MA 2LQWA 4OMQA 1AOJA 4HVUA 2LJ0A 2FRWA 1WXTA 2DBMA 2V1QA 2K3BA 1SRLA 3PE0A 1NLOC 4RTXA 3I5SA 2D8JA 1AWXA 1IO6A 2L3PA 1ZUYA 1UECA 2GBQA 1UJYA 3GBQA 2J6OA 5IHIA 1K4US 3EG2A 5HCKA 2CUBA 4FSSA 1I1JA 3EHQA 4Y92A 1W1FA 3PVQA 2DF6A 2AZSA 2DLPA 4K11A 2DL3A 2JMCA 1T0HA 4F16A 2DILA 3SEMA 2KRNA 1WDXA 2A08A 1GCQC 3IQLA 1CKBA 4R0KA 4LN2A 1VYUA 5IHNA 2LCSA 2JT4A 2HBWA 2RQVA 4RTWA 1OPLA 4JZ3A 5IXFA 3VS4A 2DVJA 3M0PA 2MOXA 3H0HA 4RTVA 2DA9A 3EHRA 1RLPC 5IHKA 2EYXA 3CQTA 4AFZC 2D8HA 4RTUA 2LNHB 1YN8A 2DL8A 4J9EA 2DBKA 2DL7A 4DEYA 2AKLA 1UE9A 2DX1A 3VS2A 1K0SA 1VA7A 2DYBA 2A28A 2FO0A 2LX7A 1JXOA 4AFSC 2PNIA 1X6BA 4CC7A 5L23A 2VWFA 1UHFA 5GJWB 2RN8A 2JW4A 4LE9A 1AEYA 2CUDA 2KT8A 4J9FA 1AZGB 1CSKA 3NMZC 1NYGA 4JPBW 3REAB 2RPNA 2X3WD 2B86A 1OPKA 2KROA 3VS6A 4A63B 2OAWA 2AK5A 4CC4B 1SHFA 3SHWA 4GBQA 1YWPA 1M3CA 1ZSGA 3KFVA 2LJ3A 2PZ1A 2GTJA 1X27A 2W10A 2YUOA 2PTKA 1GL5A 2GNCA 2JS0A 1BU1A 4AFUC 1U5SA 3M0UA 4F14A 5ECAA 1WA7A 1KIKA 1ABOA 2JM8A 1JO8A 2MCNA 2CSQA 4DEXA 1YNZA 2YT6A 1TUCA 2HCKA 4AG1C 4JZ4A 3UA6A 2SEMA 3O5ZA 1M3BA 2OJ2A 1M27C 2CH4A 1KFZA 2FEIA 1K76A 1NEBA 3I5RA 2ESWA 2FRYA 2FPEA 1AVZC 2O9SA 1B07A 2J05A 1T3LA 2JM9A 1VYTA 2W0ZA 1KJWA 2SRCA 3RNJA 1NG2A 1ABQA 1UUEA 1H3HA 2GQIA 2M51A 2K7AA 4EIKA 3I35A 4HVWA 2G6FX 4OMOA 4RTZA 1ZUKA 2LJ1A 3EG0A 2AKKA 1SEMA 2ENMA 3VRYA 2C0IA 2F2XA 4OMPA 1GCQA 2EVRA 2O2OA 4KRTA 2O31A 1I07A 1WI7A 3EGUA 5I11A 3H41A 1K9AA 1QWEA 1V1CA 3JV3A 2DNUA 2BZYA 2K6DA 3QWXX 1M3AA 2FPDA 1T3SA 2RF0A 2LQNA 4IIOA 3VS1A 4QT7A 1J3TA 1KSWA 4JJCA 1Y57A 1FYNA 2IIMA 2RQWA 4JJDA 1QKWA 1JEGA 2KRSA 2KE9A 2JS2A 3EG1A 1AZEA 2HSPA 1WX6A 2LMJA 1PRMC 3R6NA 2NUZA 2KBTA 2HDAA 1NM7A 2LZ6B 3LH5A 1SHGA 3QWYA 4OMMA 4Z89A 2J06A 3H0IA 1X2QA 1E6GA 1SSHA 2RNAA 4M4ZA 3RBBB 1QKXA 1LCKA 1AWJA 1GBQA 4JJBA 4Z88A 2YSQA 1T0JA 4OMNA 1Z9ZA 1OEBA 2EQIA 2K79A 4WCIA 1UJ0A 2EPDA 3ZL7C 4CC3A 1A0NB 1UFFA 2KT1A 2YUQA 5FW9A 1ZUUA 1JU5C 2LP5A 1UGVA 1YWOA 1W6XA 4LUDA 1GBRA 1NLPC 4RTTA 5IH2A 1QWFA 2CDTA 3REBB 2XMFA 2RQRA 2J6KA 2FG0A 4RUGA 4ZNXA 1G83A 1GRIA 2BTTA 2AZVA 2BZXA 2YUNA 2M0YA 1BK2A 3NPFA 3VS0A 2KYBA 2EW3A 2CT3A 2ED1A 4J9DA 1X43A 1JQQA 1MUZA 2X3XD 1PRLC 2DRMA 2D1XA 1ZX6A 2GGRA 1UTIA 3FJ5A 1GCPA 1OOTA 2FPFA 2EYYA 2QDLA 4J9HA 2EYZA 4J9GA 1RLQC 2KNBB 4CC2A 3M0TA 1B3QA 2ROTA 4Z8AA 1MV3A 1BBZA 2O9VA 2NWMA 2A36A 2HEQA 1TUDA 1UG1A 3NGPA 2CH4W 3VS5A 2DE0X 2I0NA 1N5ZA 1GFCA 1S1NA 1RI9A 2EKHA 1U3OA 5IXBA 1X2KA 1JXMA 1H8KA 2L2PA 4HCKA 4AG2C 3UATA 2EGEA 3UF4A 1ZBJA 4IIMA 1WXUA 1W70A 2CSIA 2K2MA 2EBPA 2CREA 1MV0B 1WIEA 2F2VA 5EC7A 1YCSB 2ED0A 2L0AA 1Z9QA 2CT4A 1HD3A 2VKNA 4F17A 1OV3A 1AWWA 2RQTA 4J9IA 3UA7A 1VYVA 2O88A 1PHTA 5FWCA 1SPKA 1BB9A 2E5KA 3NHNA 2A37A 2DM1A 2JMAA 2OI3A 4E6RA 1QCFA 4OMLA 4J9CA 3VS3A 1UHCA 3VS7A 4ESRA 3M0RA 3TSWA 5FWBA 1WLPB 2C0OA 3TSZA 1I0CA 2KYMA 1X6GA 2RQUA 2JTEA 1NYFA 2YDLA 2L3SA 2DL5A 2DJQA 2KXCA 1CKAA 4ORZA 4D8KA 3I9QA 2V1RA 2RMOA 2EGAA 3U23A 4GLMA 4X1VA 3ULRB 4LUEA 1X69A 1YP5A 4D8DA 1ARKA 3M0SA 1G2BA 1K1ZA 1XOVA 2MIOA 5GJVB 3H0FA 3THKA 2GTOA 2EGCA 2L3QA 2ROLA 2JXBA 1ZLMA 3C0CA 4HXJA 1PKTA 1PKSA 2ABLA 2DL4A 2KXDA 3A98A 1QLYA 1Y0MA 1E6HA 2H8HA 1TG0A 2KEAA 1HSQA 2P4RA 2F2WA 1WYXA 1PNJA 1UDLA 2VVKA 2ECZA 1E7OA 2KRMA 2D0NA 1FMKA 1M30A 2DMOA 5I22A 1U06A 1HJDA 3VRZA 1WFWA 3PVLA 4RTYA 2C0TA 2KR3A 2KGTA 2YUPA 3M0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J6F A;  1SRM A;  2K9G A;  1H92 A;  3TVT A;  1WXB A;  4AFQ C;  4J9B A;  1K0X A;  1AD5 A;  1PWT A;  2BZ8 A;  1RUW A;  2J7I A;  2DRK A;  1NEG A;  4LNP A;  3EG3 A;  1EFN A;  2EYW A;  1GFD A;  1AWO A;  4HVV A;  1M8M A;  2LQW A;  4OMQ A;  1AOJ A;  4HVU A;  2LJ0 A;  2FRW A;  1WXT A;  2DBM A;  2V1Q A;  2K3B A;  1SRL A;  3PE0 A;  1NLO C;  4RTX A;  3I5S A;  2D8J A;  1AWX A;  1IO6 A;  2L3P A;  1ZUY A;  1UEC A;  2GBQ A;  1UJY A;  3GBQ A;  2J6O A;  5IHI A;  1K4U S;  3EG2 A;  5HCK A;  2CUB A;  4FSS A;  1I1J A;  3EHQ A;  4Y92 A;  1W1F A;  3PVQ A;  2DF6 A;  2AZS A;  2DLP A;  4K11 A;  2DL3 A;  2JMC A;  1T0H A;  4F16 A;  2DIL A;  3SEM A;  2KRN A;  1WDX A;  2A08 A;  1GCQ C;  3IQL A;  1CKB A;  4R0K A;  4LN2 A;  1VYU A;  5IHN A;  2LCS A;  2JT4 A;  2HBW A;  2RQV A;  4RTW A;  1OPL A;  4JZ3 A;  5IXF A;  3VS4 A;  2DVJ A;  3M0P A;  2MOX A;  3H0H A;  4RTV A;  2DA9 A;  3EHR A;  1RLP C;  5IHK A;  2EYX A;  3CQT A;  4AFZ C;  2D8H A;  4RTU A;  2LNH B;  1YN8 A;  2DL8 A;  4J9E A;  2DBK A;  2DL7 A;  4DEY A;  2AKL A;  1UE9 A;  2DX1 A;  3VS2 A;  1K0S A;  1VA7 A;  2DYB A;  2A28 A;  2FO0 A;  2LX7 A;  1JXO A;  4AFS C;  2PNI A;  1X6B A;  4CC7 A;  5L23 A;  2VWF A;  1UHF A;  5GJW B;  2RN8 A;  2JW4 A;  4LE9 A;  1AEY A;  2CUD A;  2KT8 A;  4J9F A;  1AZG B;  1CSK A;  3NMZ C;  1NYG A;  4JPB W;  3REA B;  2RPN A;  2X3W D;  2B86 A;  1OPK A;  2KRO A;  3VS6 A;  4A63 B;  2OAW A;  2AK5 A;  4CC4 B;  1SHF A;  3SHW A;  4GBQ A;  1YWP A;  1M3C A;  1ZSG A;  3KFV A;  2LJ3 A;  2PZ1 A;  2GTJ A;  1X27 A;  2W10 A;  2YUO A;  2PTK A;  1GL5 A;  2GNC A;  2JS0 A;  1BU1 A;  4AFU C;  1U5S A;  3M0U A;  4F14 A;  5ECA A;  1WA7 A;  1KIK A;  1ABO A;  2JM8 A;  1JO8 A;  2MCN A;  2CSQ A;  4DEX A;  1YNZ A;  2YT6 A;  1TUC A;  2HCK A;  4AG1 C;  4JZ4 A;  3UA6 A;  2SEM A;  3O5Z A;  1M3B A;  2OJ2 A;  1M27 C;  2CH4 A;  1KFZ A;  2FEI A;  1K76 A;  1NEB A;  3I5R A;  2ESW A;  2FRY A;  2FPE A;  1AVZ C;  2O9S A;  1B07 A;  2J05 A;  1T3L A;  2JM9 A;  1VYT A;  2W0Z A;  1KJW A;  2SRC A;  3RNJ A;  1NG2 A;  1ABQ A;  1UUE A;  1H3H A;  2GQI A;  2M51 A;  2K7A A;  4EIK A;  3I35 A;  4HVW A;  2G6F X;  4OMO A;  4RTZ A;  1ZUK A;  2LJ1 A;  3EG0 A;  2AKK A;  1SEM A;  2ENM A;  3VRY A;  2C0I A;  2F2X A;  4OMP A;  1GCQ A;  2EVR A;  2O2O A;  4KRT A;  2O31 A;  1I07 A;  1WI7 A;  3EGU A;  5I11 A;  3H41 A;  1K9A A;  1QWE A;  1V1C A;  3JV3 A;  2DNU A;  2BZY A;  2K6D A;  3QWX X;  1M3A A;  2FPD A;  1T3S A;  2RF0 A;  2LQN A;  4IIO A;  3VS1 A;  4QT7 A;  1J3T A;  1KSW A;  4JJC A;  1Y57 A;  1FYN A;  2IIM A;  2RQW A;  4JJD A;  1QKW A;  1JEG A;  2KRS A;  2KE9 A;  2JS2 A;  3EG1 A;  1AZE A;  2HSP A;  1WX6 A;  2LMJ A;  1PRM C;  3R6N A;  2NUZ A;  2KBT A;  2HDA A;  1NM7 A;  2LZ6 B;  3LH5 A;  1SHG A;  3QWY A;  4OMM A;  4Z89 A;  2J06 A;  3H0I A;  1X2Q A;  1E6G A;  1SSH A;  2RNA A;  4M4Z A;  3RBB B;  1QKX A;  1LCK A;  1AWJ A;  1GBQ A;  4JJB A;  4Z88 A;  2YSQ A;  1T0J A;  4OMN A;  1Z9Z A;  1OEB A;  2EQI A;  2K79 A;  4WCI A;  1UJ0 A;  2EPD A;  3ZL7 C;  4CC3 A;  1A0N B;  1UFF A;  2KT1 A;  2YUQ A;  5FW9 A;  1ZUU A;  1JU5 C;  2LP5 A;  1UGV A;  1YWO A;  1W6X A;  4LUD A;  1GBR A;  1NLP C;  4RTT A;  5IH2 A;  1QWF A;  2CDT A;  3REB B;  2XMF A;  2RQR A;  2J6K A;  2FG0 A;  4RUG A;  4ZNX A;  1G83 A;  1GRI A;  2BTT A;  2AZV A;  2BZX A;  2YUN A;  2M0Y A;  1BK2 A;  3NPF A;  3VS0 A;  2KYB A;  2EW3 A;  2CT3 A;  2ED1 A;  4J9D A;  1X43 A;  1JQQ A;  1MUZ A;  2X3X D;  1PRL C;  2DRM A;  2D1X A;  1ZX6 A;  2GGR A;  1UTI A;  3FJ5 A;  1GCP A;  1OOT A;  2FPF A;  2EYY A;  2QDL A;  4J9H A;  2EYZ A;  4J9G A;  1RLQ C;  2KNB B;  4CC2 A;  3M0T A;  1B3Q A;  2ROT A;  4Z8A A;  1MV3 A;  1BBZ A;  2O9V A;  2NWM A;  2A36 A;  2HEQ A;  1TUD A;  1UG1 A;  3NGP A;  2CH4 W;  3VS5 A;  2DE0 X;  2I0N A;  1N5Z A;  1GFC A;  1S1N A;  1RI9 A;  2EKH A;  1U3O A;  5IXB A;  1X2K A;  1JXM A;  1H8K A;  2L2P A;  4HCK A;  4AG2 C;  3UAT A;  2EGE A;  3UF4 A;  1ZBJ A;  4IIM A;  1WXU A;  1W70 A;  2CSI A;  2K2M A;  2EBP A;  2CRE A;  1MV0 B;  1WIE A;  2F2V A;  5EC7 A;  1YCS B;  2ED0 A;  2L0A A;  1Z9Q A;  2CT4 A;  1HD3 A;  2VKN A;  4F17 A;  1OV3 A;  1AWW A;  2RQT A;  4J9I A;  3UA7 A;  1VYV A;  2O88 A;  1PHT A;  5FWC A;  1SPK A;  1BB9 A;  2E5K A;  3NHN A;  2A37 A;  2DM1 A;  2JMA A;  2OI3 A;  4E6R A;  1QCF A;  4OML A;  4J9C A;  3VS3 A;  1UHC A;  3VS7 A;  4ESR A;  3M0R A;  3TSW A;  5FWB A;  1WLP B;  2C0O A;  3TSZ A;  1I0C A;  2KYM A;  1X6G A;  2RQU A;  2JTE A;  1NYF A;  2YDL A;  2L3S A;  2DL5 A;  2DJQ A;  2KXC A;  1CKA A;  4ORZ A;  4D8K A;  3I9Q A;  2V1R A;  2RMO A;  2EGA A;  3U23 A;  4GLM A;  4X1V A;  3ULR B;  4LUE A;  1X69 A;  1YP5 A;  4D8D A;  1ARK A;  3M0S A;  1G2B A;  1K1Z A;  1XOV A;  2MIO A;  5GJV B;  3H0F A;  3THK A;  2GTO A;  2EGC A;  2L3Q A;  2ROL A;  2JXB A;  1ZLM A;  3C0C A;  4HXJ A;  1PKT A;  1PKS A;  2ABL A;  2DL4 A;  2KXD A;  3A98 A;  1QLY A;  1Y0M A;  1E6H A;  2H8H A;  1TG0 A;  2KEA A;  1HSQ A;  2P4R A;  2F2W A;  1WYX A;  1PNJ A;  1UDL A;  2VVK A;  2ECZ A;  1E7O A;  2KRM A;  2D0N A;  1FMK A;  1M30 A;  2DMO A;  5I22 A;  1U06 A;  1HJD A;  3VRZ A;  1WFW A;  3PVL A;  4RTY A;  2C0T A;  2KR3 A;  2KGT A;  2YUP A;  3M0Q A; 
#chains in the Genus database with same CATH topology
 2E64 A;  2K9G A;  3TVT A;  4J9B A;  3GIB A;  3OYY A;  5GAN 8;  2X51 A;  1AD5 A;  5D7U A;  1RUW A;  4N0A A;  4ZN1 A;  3EG3 A;  2ZPB B;  4LD6 A;  5GAO l;  2K57 A;  2CP6 A;  2JTF A;  4HVV A;  1OX9 A;  5GAO m;  8ATC B;  1M8M A;  3G71 Q;  3RMS A;  1YIT T;  2YRV A;  2DBM A;  2CZ6 B;  2K3B A;  5D6Y A;  3UWN A;  1NLO C;  1AWX A;  1IO6 A;  4HT8 A;  2L3P A;  5DLQ E;  3GBQ A;  3OS5 A;  1G3W A;  1K4U S;  3TQ7 P;  5HCK A;  4FSS A;  1I1J A;  3H9N A;  1WNL A;  4N4H A;  3CD6 T;  5KYW B;  1W1F A;  3PVQ A;  3JCM e;  3CC7 A;  2DF6 A;  4MDX A;  2DLP A;  4K11 A;  3L2V A;  2X35 A;  4F16 A;  5KYN A;  2DIL A;  3SEM A;  6AT1 B;  2KRN A;  2PU9 B;  5A0G A;  3IQL A;  2DTH A;  3CMA Q;  3HRT A;  5IHN A;  3CCS T;  3FIF A;  2EAY A;  1X6O A;  2HBW A;  3VS4 A;  3QJ6 A;  3MEA A;  3RKY A;  4M7A B;  2HL3 A;  4FU6 A;  2RH2 A;  1QVF P;  1PD0 A;  2FB7 A;  3CQT A;  2PVD B;  4AFZ C;  5LJ3 e;  2QQ9 A;  4RTU A;  3OW2 A;  5AYF A;  4KUI A;  1BCM A;  4DEY A;  1UE9 A;  4C92 E;  2CP5 A;  3HP9 A;  4PFO A;  4C8Q F;  1JXO A;  2PNI A;  1X6B A;  4EDU A;  5GMK h;  3OS2 A;  5L23 A;  4LDX A;  3V7R A;  5GJW B;  2RN8 A;  2JW4 A;  4J7I A;  3HFO A;  3QXE B;  3T9N A;  1WHL A;  4J9F A;  3L2U A;  4C8Q B;  1AZG B;  3JCM Q;  2CP2 A;  2X3W D;  2KRO A;  5C0M A;  4A63 B;  3CCS Q;  4CC4 B;  3JSC A;  4GBQ A;  1ZSG A;  3GOX A;  2LJ3 A;  2ZGW A;  1VQ7 A;  2QI2 A;  4JDS A;  1QMC A;  2JS0 A;  3OBW A;  5CKB A;  1U5S A;  3TEE A;  3S3N A;  3M0U A;  4F14 A;  5ECA A;  1ABO A;  4M7D B;  2JN0 A;  2JM8 A;  1JO8 A;  2MCN A;  4DEX A;  1TUC A;  4GLK A;  2QGF B;  1VQP Q;  4M7A A;  3ER0 A;  1BI3 A;  5FRN A;  3CCS A;  2NUT B;  3CMA T;  3G6E T;  2CH4 A;  1D3B A;  1NEB A;  1LPL A;  2FVU A;  3I5R A;  5KYX A;  1UGS B;  2H3J A;  1IGU A;  1UGR B;  2O9S A;  4C0D C;  4M77 A;  1U8R A;  3RNJ A;  2RJC A;  1NG2 A;  4M77 F;  1H3H A;  2M51 A;  3R6O A;  3CCR Q;  2CGH A;  4E2F B;  1PD1 A;  2DVE A;  2G6F X;  1ZUK A;  3L2Z A;  3EG0 A;  3VRY A;  3M55 A;  2CZ7 B;  4OMP A;  4KH0 B;  4FT4 A;  5GAN 7;  2ZPH B;  1WI7 A;  2MI6 A;  3E9G A;  4C0F A;  4N4G A;  1H64 1;  3H41 A;  1QWE A;  1I4K 1;  4FW1 A;  4F7U F;  2DNU A;  4E7K A;  1VQ6 T;  5KCO A;  2NUP A;  1M3A A;  1G3Y A;  1EIF A;  3LGL A;  2LQN A;  4E7J A;  4IIO A;  3VS1 A;  4QT7 A;  4F7U G;  3KXT A;  3CCR A;  1Q82 R;  1FYN A;  2IIM A;  4EMK C;  2KE9 A;  4FCY A;  2HSP A;  1PRM C;  4C5G A;  2Y90 A;  3CC2 A;  1JRI A;  3PMT A;  5KCH A;  3CME A;  3QWY A;  1IRX A;  1HXD A;  1YI2 A;  4E7H A;  4IUU A;  3LGF A;  5FRO A;  2NYS A;  4YTL A;  3OYJ A;  4JJB A;  3C4S A;  3P8D A;  1B34 A;  1PG5 B;  1T0J A;  1X01 A;  4FYX B;  4MMK A;  4A4F A;  3EFR A;  1VQK Q;  3PMI A;  2YRC A;  2H3E B;  1LNX A;  4WCI A;  5GAO p;  2CZ1 B;  5J3B A;  3CBO A;  2LVM A;  1D0Z A;  3FB9 A;  3M53 A;  2YUQ A;  1KC8 C;  4KUD K;  1JU5 C;  4EMH A;  2K5I A;  2EJG A;  1W6X A;  1NJI U;  1NLP C;  3CCE Q;  2P0Q A;  3OYH A;  2DZC A;  1NZ9 A;  4RUG A;  5KYW A;  2AT1 B;  1G83 A;  1GRI A;  1JJ2 P;  3CME Q;  3JB9 G;  1VQL T;  5DM7 R;  3CEY A;  2YUN A;  3M54 A;  3KUF A;  2XU8 A;  3GNG A;  3QBY A;  3VS0 A;  2KYB A;  4C8Q C;  2ED1 A;  3JB9 F;  5GMK j;  1VIF A;  3OYC A;  1YFN A;  2D1X A;  1ZSZ C;  2RJD A;  3E9F A;  3OYE A;  1UTI A;  4O5V A;  5GAN 2;  3QSU A;  2KNB B;  1JJ2 A;  4CC2 A;  3M0T A;  5CAI A;  2VYT A;  1C1A A;  4Z8A A;  1MV3 A;  5CO7 A;  1VQO T;  4NL2 A;  4IUV A;  2B8A A;  3VUZ A;  1G3S A;  2CP0 A;  3NGP A;  4Z02 A;  4A4K A;  4X34 A;  3CC4 Q;  5LJ5 f;  5I2M A;  4M77 E;  5HK3 A;  2FZG B;  1U3O A;  2ZCF B;  5IXB A;  1M2O A;  1H8K A;  4HCK A;  4FT2 A;  4IIM A;  2K2M A;  1LVK A;  3H6Z A;  5EC7 A;  4F7U A;  1YCS B;  4M75 G;  1OYX A;  2BE7 D;  4XK8 E;  3CCJ A;  3JB9 D;  2VKN A;  5CKD A;  2RO0 A;  4F17 A;  9ATC B;  1YJ9 T;  1M1F A;  5FU7 C;  3UA7 A;  3OY9 A;  1VYV A;  5FWC A;  2WAC A;  3NHN A;  2QG9 B;  4FW2 A;  4J9C A;  3G4S Q;  2AIR B;  2MWP A;  3TSW A;  4ZGD B;  5GAM d;  1K8A R;  4JRK A;  2DER A;  1WLP B;  2C0O A;  3RDV A;  1I0C A;  4XU2 A;  5CQY A;  1Y07 A;  2RQU A;  3A8O B;  4ELZ C;  1BYM A;  2KXC A;  4OP0 A;  4ORZ A;  3JB9 J;  2V1R A;  4C8Q A;  1Q82 C;  4D8D A;  1ARK A;  2X4J A;  3M0S A;  2LCL A;  1G2B A;  1KHI A;  1XOV A;  4UC4 A;  1WQW A;  3H0F A;  3URG A;  1VQ8 Q;  3CC4 A;  4M7A C;  2JXB A;  3QDR B;  3CC2 Q;  2RHZ A;  1YJW A;  2IPO B;  3CCM T;  2BE9 B;  3EGD A;  2DL4 A;  3BE3 A;  1QLY A;  1Q7Y C;  1VQP T;  3QHS A;  1MMD A;  2F2W A;  3E19 A;  2OTL Q;  1Y7X A;  5LJ3 d;  1E7O A;  2DZ9 A;  3CCJ Q;  2P0K A;  4PJL A;  2DMO A;  4E7L A;  3HRS A;  2K2V A;  2JUF A;  1TSF A;  2QTX A;  1BCO A;  3CCM A;  5D6W A;  2MWO A;  1ZSZ A;  1VQN Q;  5GAM j;  1K0X A;  1ZA2 B;  3MET A;  1QVG S;  3M56 A;  2F5T X;  3RIR A;  4MZP A;  2EQK A;  4LNP A;  3LX7 A;  2DXU A;  2LT1 A;  3M58 A;  3CBP A;  4DOV A;  2RHI A;  1BI2 A;  4PFZ A;  2LQW A;  4OMQ A;  1AOJ A;  4HVU A;  2LJ0 A;  1RAC B;  1ZSZ B;  1D3B B;  3DKM A;  3SB2 A;  2V1Q A;  1C6V X;  3MP8 A;  3GP8 A;  4R55 A;  1OQK A;  4RTX A;  4LDY A;  2D8J A;  1FMW A;  2RJE A;  1ZUY A;  1UEC A;  1NPR A;  3MKD A;  3G1J A;  5IHI A;  4BAC A;  3I55 A;  3CCU A;  2QAS A;  1UGP B;  5LJ3 j;  2JVV A;  1V76 A;  4OVA A;  1KC8 U;  1YJW T;  1PC0 A;  1T0H A;  3JCM d;  1QVF A;  2V8K A;  2K4Y A;  3CCL A;  2A08 A;  3OB9 A;  3PIP A;  2HQE A;  3P8B B;  1VQ5 A;  5GAN d;  1VQN T;  2KVQ G;  1RAF B;  4LN2 A;  3BY7 A;  1EZZ B;  1VYU A;  3H8Z A;  4M75 D;  2LCS A;  5GAN 4;  3CC4 T;  4XTY A;  4PJO D;  2E6N A;  1WJQ A;  2DVJ A;  3M57 A;  2MOX A;  3H0H A;  1BKB A;  3L2W A;  3EHR A;  4II1 A;  5GMK e;  1RLP C;  3M59 A;  4D6W A;  2L3R A;  2DBK A;  2AKL A;  2DX1 A;  2K3Y A;  1K0S A;  1VA7 A;  2DYB A;  1M5Q 1;  2A28 A;  2FO0 A;  2R58 A;  5IAY A;  4JLI A;  4CC7 A;  3SWN B;  5KYU B;  4PJM A;  2PVG B;  2Y4X A;  2KT8 A;  4C5I A;  1QCN A;  3HRU A;  2GFU A;  3EFO B;  3NMZ C;  4HA8 A;  4OB0 B;  3REA B;  1OX8 A;  2YXY A;  4OB3 B;  1YJN Q;  4JUV A;  2ZPF B;  4F7U E;  5HKC A;  2RHU A;  1K9M C;  3VS6 A;  2OAW A;  1NJI R;  1KD1 C;  3JB9 I;  5DLO A;  2QEX T;  4QVD A;  3OYL A;  2YUO A;  1WPY A;  1GL5 A;  4RG2 A;  4A4G A;  4LXC A;  2R5A A;  1BU1 A;  1D09 B;  4J6Y A;  1PCX A;  1RL2 A;  4L59 A;  4AFU C;  4IUQ A;  2HKN A;  5GAN 6;  2QA4 A;  2VGM A;  4N4I A;  1K8A U;  5L8R E;  2CSQ A;  1YNZ A;  5DY9 A;  1RI0 A;  2ZPG B;  3UA6 A;  3MHX A;  4QVC A;  3CCE T;  1VIE A;  3GNF B;  3V8J A;  2OJ2 A;  4ANJ A;  1K76 A;  4XTX A;  2XHC A;  2DEQ A;  4ZGJ B;  4MML A;  1AVZ C;  1N9S A;  1B07 A;  2M1H A;  3QYH B;  3L2R A;  4C92 A;  1M2V B;  1VYT A;  1KJW A;  2KI7 A;  2WSC E;  2D6F A;  2DJZ A;  4PK4 A;  4PFP A;  3CC7 Q;  4J7F A;  1VQM A;  5CCA A;  4EIK A;  1G8X A;  4XTW A;  5CKH A;  3SD4 A;  2K5F A;  2QQR A;  3GF5 A;  3G4S A;  4KRT A;  1LJO A;  2GF7 A;  1P92 A;  1WHK A;  1K9A A;  1V1C A;  2LQ8 A;  1B7T A;  2F69 A;  1XJW B;  3A8G B;  1T3S A;  2RF0 A;  3FLG A;  3JCM J;  1K73 U;  3NFC A;  3V7C A;  1BI0 A;  2A0F B;  1KSW A;  1Y57 A;  2L89 A;  2RQW A;  4JJD A;  1QKW A;  2OAU A;  1IB8 A;  3A8L B;  4C0Z A;  3EG1 A;  3L2Q A;  1N8R U;  1D1A A;  4P5N A;  1WX6 A;  4ZTJ A;  2NUZ A;  1QVG A;  1M1K C;  2KBT A;  2HDA A;  5CQX A;  3VUB A;  2QA4 T;  5A2Q E;  1SHG A;  4OMM A;  3CXC S;  4Z89 A;  1WJR A;  4PKC C;  4KBM B;  1N6A A;  1R0B G;  2NUP B;  3H0I A;  3HFN A;  1OZ3 A;  3CD6 A;  5GAN f;  3M5A A;  4M78 D;  1LCK A;  1AWJ A;  3AT1 B;  1ZQ1 A;  4C5E A;  1Z9Z A;  4PJO A;  5CVI A;  3QZ9 B;  1YIJ A;  4BD3 A;  2EPD A;  3FEO A;  4RCB A;  1A0N B;  2GCX A;  5FW9 A;  1UGV A;  2EKO A;  4M7D F;  1QP3 A;  3QPH A;  1VQ8 A;  3PIO A;  3REB B;  3JCM W;  2RQR A;  2EQJ A;  2YHT A;  4TVR A;  1MMA A;  2AZV A;  2E70 A;  2EQM A;  2DEU A;  1U1T A;  3MP1 A;  4ELY C;  3VJP A;  2M0Y A;  3JB9 H;  3NPF A;  2HSE B;  2CT3 A;  4J83 A;  3CCL Q;  5A0D A;  1X43 A;  1JQQ A;  1MND A;  1SSF A;  1PRL C;  4DOW A;  1KK7 A;  3JCM c;  2R5M A;  2RI5 A;  1SKU B;  1GCP A;  3OYA A;  2F1L A;  4J9G A;  1RLQ C;  4PJO G;  2CS7 A;  1QVP A;  2O9V A;  2NWM A;  3I56 A;  5CIU A;  1TUD A;  4XQ3 A;  3VS5 A;  3JCM f;  2X4X A;  2O4X A;  3TRE A;  2CZ0 B;  3OW2 P;  2I0N A;  1GFC A;  3DB3 A;  1UB4 A;  2R57 A;  2DD4 A;  2EKH A;  2L2P A;  3UAT A;  1ZBJ A;  1FWZ A;  2VUB A;  2XDP A;  4PLL A;  2EBP A;  2CRE A;  4B9W A;  5I2S A;  5GAM g;  2NLU A;  2ED0 A;  4E7Z A;  2DFU A;  1Z9Q A;  4KH1 B;  5GAO q;  2RQT A;  4M7A E;  4Y91 A;  4EMK B;  4M78 G;  3A8M B;  1C0M A;  4OB1 B;  1QVG P;  1BB9 A;  1HYO A;  2LDM A;  2MPX C;  3VYG A;  2DM1 A;  4E6R A;  4E47 A;  2E6Z A;  5J26 A;  2P84 A;  3JCM X;  3OW2 S;  2OTL A;  2KYM A;  1N8R C;  2RI3 A;  3JRZ A;  4IUR A;  1VQ5 T;  2QEX A;  1NYF A;  4OB2 B;  5GAN 3;  2EYQ A;  1RAI B;  3D7S B;  1QP2 A;  2DKG A;  3OSS C;  4PL6 A;  2KSS A;  3CCV A;  2RMO A;  2EGA A;  4PJJ A;  1VQ9 Q;  5CR2 A;  1X69 A;  3RMQ A;  3OYM A;  3QYG B;  2FZC B;  1OU9 A;  5GJV B;  2ZAE A;  4O6J A;  4PJO F;  3THK A;  2GTO A;  3CCE A;  4HXJ A;  1PKT A;  1ZHI A;  2A7Y A;  1ZA1 B;  4BI3 A;  2KXD A;  2H8H A;  5KYY B;  1UDL A;  7AT1 B;  2ECZ A;  2JNG A;  1UGQ B;  4ZN3 A;  3CCV Q;  1M30 A;  1D1B A;  3KBG A;  5I22 A;  4FIB A;  1U06 A;  1WFW A;  1M1K R;  4IKF A;  2QYZ A;  1MNE A;  4A4E A;  2YUP A;  3M0Q A;  2EJ9 A;  2J6F A;  4M75 A;  1H92 A;  1WXB A;  5A0L A;  1KC8 R;  1XQH A;  4BB7 A;  1KQ1 A;  4BDZ A;  2YLB A;  1VQ4 A;  4C0G A;  4CI0 C;  3CXC A;  2O01 E;  2MK5 A;  2DRK A;  2KQW A;  2ZPI B;  3EH1 A;  2KAF A;  1S72 A;  1GFD A;  4C92 F;  5FU6 C;  3MP6 A;  4HT9 A;  2ZPE B;  2P0P A;  5LJ5 h;  4C8Q E;  2FRW A;  1WXT A;  2JTM A;  1M1G A;  2FL7 A;  3BW1 A;  4BE1 A;  3N5B B;  1RAE B;  2GBQ A;  2VB6 A;  3I55 T;  3EG2 A;  3QO3 A;  2VC8 A;  2VAS A;  4X9D A;  2O4X B;  3MO8 A;  2QXF A;  3FRN A;  3CPW A;  2VGN A;  5FU6 B;  2PUK B;  3CCQ Q;  4XTU A;  2X4W A;  3PGG A;  1WHM A;  4JJN K;  1KQS S;  2M02 A;  4M7A G;  3BDL A;  5GMK i;  4QVZ A;  2JT4 A;  4FL6 A;  2RQV A;  3HPW A;  1OPL A;  1GXI E;  5IXF A;  2XIC A;  3A5Z B;  4HCC A;  3M0P A;  4RTV A;  4BDY A;  4OGC A;  3OYI A;  4M7D G;  4DBR A;  1YHQ T;  1TU0 B;  2Y4Y A;  2LNH B;  1YN8 A;  1KQS P;  2DL8 A;  1D0Y A;  4LD9 K;  3MEV A;  1AHJ B;  3WVE B;  2QQB A;  3HL8 A;  3VS2 A;  3I56 T;  1M2V A;  1K73 R;  2PVO B;  2IVW A;  2QK0 A;  1M1K U;  1AEY A;  1UHF A;  4LE9 A;  1YIT A;  2CUD A;  4F7U B;  1PM3 A;  1Y96 A;  1CSK A;  3LWH A;  4JRP A;  4QQG A;  1NYG A;  4JPB W;  2RPN A;  2MYS A;  1OPK A;  2NUT A;  2AK5 A;  1JJ2 S;  4PJO C;  4JLG A;  1SHF A;  3SHW A;  1YWP A;  4M75 C;  2V8J A;  2VV5 A;  1VQ7 Q;  1M3C A;  3E1S A;  3EGX A;  3KFV A;  3NTI A;  2HAX A;  2DIQ A;  1KD1 R;  2GTJ A;  2VXE A;  3LYI A;  5HY6 A;  1WHH A;  2W10 A;  2PTK A;  4ZGE B;  5KYU A;  2GNC A;  1YHQ Q;  2XG8 D;  1DJ7 B;  2COY A;  2DET A;  3QZ5 B;  2EJF A;  1PSF A;  1WA7 A;  5D6X A;  1KIK A;  2YT6 A;  3EFO A;  2PQW A;  2OTL T;  2LNV A;  4LDW A;  3S3M A;  2HCK A;  1VQL Q;  4C92 C;  2RK2 A;  5C6S A;  1Q81 C;  4KGX B;  4JS4 A;  3JCM P;  4EMG A;  1KFZ A;  3PFS A;  3CPW S;  4OF1 A;  2ZZD A;  2FPE A;  2K5L A;  1K9M U;  4F04 B;  2AHJ B;  1T3L A;  2W0Z A;  2SRC A;  3J80 E;  1ABQ A;  2DXT A;  5HK0 A;  1YHQ A;  1N27 A;  1FX7 A;  2K7A A;  1Q86 C;  3I35 A;  5IN1 A;  4FYV B;  2E3I A;  4L6V 5;  1Q7Y U;  4M77 C;  3AHU A;  1R77 A;  2AKK A;  1SEM A;  2ENM A;  2F2X A;  1VQP A;  2EVR A;  3EG9 A;  2O2O A;  4QQD A;  3A8H B;  3OYK A;  2XD0 A;  5I11 A;  1TTH B;  4N0A C;  3UPU A;  2E1H A;  2RHX A;  1RAH B;  2D9T A;  3OSV A;  2KY9 A;  2E65 A;  1OU8 A;  4J6W A;  3QWX X;  4PJO E;  4J8O A;  2MAM A;  2DK3 A;  3OMC A;  4BE0 A;  3M9Q A;  4JJC A;  3X25 B;  1W2B A;  1NBE B;  3EH2 A;  3QII A;  2KRS A;  2JS2 A;  2LC4 A;  1ZBX A;  1VQ6 A;  2LMJ A;  2CP7 A;  3R6N A;  1RAA B;  2E12 A;  1Q95 G;  4IUP A;  1NM7 A;  2LZ6 B;  3LH5 A;  1YJ9 A;  4JRI A;  3QKJ A;  1QVF S;  1WHG A;  3HSB A;  4M77 B;  1SSH A;  3OS1 A;  3RBB B;  4M4Z A;  1Q7Y R;  2OTJ T;  3FDR A;  2YSQ A;  2DTI A;  2DTO A;  4JRQ A;  2OTJ Q;  2DXC A;  4RKU E;  5GAO r;  1OEB A;  4BI4 A;  2K79 A;  1UJ0 A;  2BUD A;  1VQO Q;  3ZL7 C;  1ACM B;  4V2S A;  1UFF A;  5GAN e;  2QQS A;  1W2B S;  2QAZ A;  2HQX A;  1W4S A;  3EGD B;  1YWO A;  2RM4 A;  3SWN A;  2MF2 A;  4RTT A;  5CKE A;  5IH2 A;  1RAB B;  3VU3 C;  2XMF A;  4C92 G;  2J6K A;  1G5V A;  4FYY B;  4DBQ A;  4ZNX A;  2BTT A;  5KH6 A;  2DO3 A;  4M7D E;  2BZX A;  4WTO B;  3X26 B;  1BIA A;  1D0X A;  4L5G A;  1BK2 A;  1IZ6 A;  2X4Y A;  1VQO A;  3OYB A;  3EG9 B;  4QW2 A;  5GAO n;  1LOJ A;  3FJ5 A;  4J9H A;  2QDL A;  1I8F A;  4HCZ A;  3JAM E;  3WVD B;  5GAN 5;  1B3Q A;  4M78 E;  2V8I A;  5LJ5 g;  1M90 U;  2ROT A;  1VQ4 Q;  2HEQ A;  2HKQ B;  2D0Q B;  4EMK A;  2CP3 A;  2CH4 W;  2CYZ B;  2BKD N;  1S72 Q;  1IXD A;  3A1P A;  1RI9 A;  3G71 A;  4M7A F;  3RKW A;  1JXM A;  1F1B B;  2EGE A;  4C92 B;  3UF4 A;  2XDB A;  1WXU A;  2DD5 A;  1MV0 B;  2F2V A;  5I21 A;  1KD1 U;  1K73 C;  4M7D C;  2L0A A;  1R0C B;  1YI2 T;  4LDV A;  2RB6 A;  1AWW A;  2COZ A;  3HHT B;  4PJN A;  1M8V A;  4XAX B;  2O88 A;  1PHT A;  3RR6 A;  2HMA A;  4MDW A;  1WGS A;  4DQ2 A;  5GAN j;  2A37 A;  2JMA A;  2OI3 A;  4OML A;  3INZ A;  1QW1 A;  3VS7 A;  1Q81 R;  3M0R A;  8AT1 B;  1YCY A;  5FWB A;  3WXM B;  5LJ5 d;  2QEX Q;  3TSZ A;  2RHY A;  1XNI A;  3GPL A;  4C8Q D;  2YDL A;  2L3S A;  4XU0 A;  1QQJ A;  4J5Y A;  1CKA A;  3CCV T;  4D8K A;  2RK1 A;  2LRQ A;  4M77 G;  4M75 F;  3CBM A;  1YIJ T;  4GLM A;  3ULR B;  1WJS A;  4LUE A;  1YP5 A;  3CCU T;  4VUB A;  1PSE A;  1K1Z A;  2MIO A;  3OMG A;  1VQM T;  5CKF A;  2VXF A;  1VQN A;  4XTZ A;  4M75 E;  2L3Q A;  2DYI A;  2HZY A;  2ROL A;  4E7I A;  3I56 Q;  1ZLM A;  4M7A D;  3L42 A;  2OX7 A;  2QTV A;  3G6E Q;  5LJ3 h;  1HK9 A;  1WHJ A;  3ME9 A;  1NE8 A;  3CCQ T;  1Y0M A;  1E6H A;  4B6M A;  2KEA A;  2P4R A;  4KGZ B;  1PNJ A;  2VVK A;  3RES A;  2KMT A;  2E41 A;  4ZTF A;  1HJD A;  4M78 A;  5AT1 B;  2PUO B;  1M9S A;  3L1A A;  2KR3 A;  3PT9 A;  1KHC A;  3M4G A;  3PNW C;  1SRM A;  4M7D D;  5J39 A;  4AFQ C;  3ZFJ A;  3PTA A;  3RUX A;  1PWT A;  2BZ8 A;  2FHD A;  2GQV A;  2XDD A;  4NL3 A;  3CCU Q;  2J7I A;  1NEG A;  2YWW A;  4M77 D;  5GAM e;  1EFN A;  3CCJ T;  2EYW A;  3CD6 Q;  1AWO A;  4PNO A;  3CME T;  4A4H A;  2QGG A;  3RER A;  1B34 B;  2L5Q A;  2V26 A;  5LJ3 g;  3OBY A;  4M78 B;  4BY6 B;  3G7Z A;  1IGQ A;  2RJF A;  3CCM Q;  1SRL A;  3PE0 A;  2HNI A;  1KQ2 A;  3I5S A;  4M75 B;  2Z0W A;  3P8H A;  3OYG A;  1I81 A;  1UJY A;  1Y71 A;  2HL5 C;  1WQ7 A;  2J6O A;  4BUG A;  3E2U A;  4XTV A;  2XK0 A;  2DPP B;  3CCL T;  1RAD B;  1YJW Q;  4OGE A;  2CUB A;  3C12 A;  3EHQ A;  3LW5 E;  4Y92 A;  4RCC A;  2LTO A;  1VQ9 T;  4PLI A;  5KYY A;  3UT1 A;  3CC7 T;  5KE2 A;  1KQS A;  2AZS A;  3DLL A;  2YLC A;  4B9X A;  3C95 A;  2DL3 A;  2JMC A;  1VQ6 Q;  1VQ5 Q;  5GMK l;  1WDX A;  2F5K A;  1O75 A;  2JJ9 A;  1GCQ C;  1CKB A;  4R0K A;  4LDU A;  5KE3 A;  4MZT A;  1JBM A;  4J6X A;  3CPF A;  2KDS A;  3EAE A;  4WF2 A;  4R56 A;  1BIB A;  4RTW A;  1M90 R;  4JZ3 A;  3OYD A;  1M4Z A;  5CK9 A;  5FRM A;  2DA9 A;  4DBH A;  5IHK A;  2EYX A;  2EFI A;  2D8H A;  1SG5 A;  4J9E A;  4XU3 A;  1U1S A;  2DL7 A;  3RKX A;  2QA4 Q;  4Q5W A;  4FYW B;  2LX7 A;  4AFS C;  1N9R A;  2VWF A;  1FXX A;  1OZ2 A;  2KK4 A;  5GAN h;  3X24 B;  1IHV A;  1YJN T;  3F70 A;  3TCJ A;  3G71 T;  5IT9 E;  3BFM A;  1YBY A;  1SF9 A;  3JCM h;  2IG0 A;  2M16 A;  4M78 F;  2DXB A;  3M4Y A;  2B86 A;  4A53 A;  3LWI A;  2PZ1 A;  2BIV A;  1Q86 U;  1X27 A;  1X75 C;  1VQ7 T;  5FU7 B;  3SDZ A;  3VKI A;  4BY6 C;  2FZK B;  2JZ2 A;  3MJX A;  1TS9 A;  2ATC B;  3VYH B;  4ME7 A;  2WSE E;  1G3T A;  4AG1 C;  4JZ4 A;  2I2L A;  4FSX A;  3J7A F;  1VQ9 A;  2SEM A;  3O5Z A;  2HBP A;  1M3B A;  3EGX B;  1M27 C;  1TUG B;  1VQK A;  4OMF B;  1VQ8 T;  2FEI A;  1R8O B;  2ESW A;  2FRY A;  1WZO A;  1VOM A;  2COW A;  2J05 A;  2JM9 A;  2WSF E;  1EX4 A;  1UUE A;  2GQI A;  1YIJ Q;  2GFA A;  2RI2 A;  4C92 D;  1M90 C;  3QUI A;  3QG1 A;  4HVW A;  3DLM A;  4OMO A;  4RTZ A;  2LJ1 A;  2C0I A;  2LQK A;  1YI2 Q;  3BDU A;  3S6W A;  2EIF A;  1GCQ A;  3OYN A;  2O31 A;  1YJN A;  1I07 A;  1W2B P;  5KYX B;  4JS5 A;  4XU1 A;  3EGU A;  4RG8 A;  3S3O A;  2HD0 A;  1N8R R;  3JV3 A;  1OI1 A;  2BZY A;  4AMC A;  2K6D A;  2FPD A;  3V7S A;  1AT1 B;  1MMN A;  1S72 T;  3FJP A;  4E7S A;  1J3T A;  3EFS A;  4EPC A;  4RMO A;  3CCR T;  1K9M R;  3FC3 A;  4PJO B;  4M78 C;  1VQ4 T;  1JEG A;  2XKO C;  3C94 A;  3ASK A;  3LH0 A;  3OA6 A;  1AZE A;  4Y28 E;  2EWN A;  1FMV A;  4AT1 B;  4BE2 A;  4C5H A;  1H3Z A;  3CC2 T;  2J06 A;  1TWB A;  2FYK A;  2DIG A;  4DA4 A;  1X2Q A;  1E6G A;  3HTR A;  1D1C A;  3SWN C;  3MEW A;  2RNA A;  2OTJ A;  1QKX A;  2XID A;  5GAM h;  1GBQ A;  4Z88 A;  5LL6 S;  4IUT A;  4OMN A;  5FLX E;  3MEU A;  2EQI A;  4CRI A;  4BI8 B;  4CC3 A;  3JCM V;  3V8L A;  2KT1 A;  5GAN g;  2RA2 A;  1JB0 E;  1ZUU A;  2LP5 A;  1TH7 A;  4LUD A;  1GBR A;  1MHN A;  1NPP A;  4GY5 A;  4QQ6 A;  1QWF A;  2CDT A;  3SFM A;  3ZBD A;  2FG0 A;  2G3R A;  3MPU B;  1YIT Q;  2LX9 A;  2LCC A;  2P4T A;  2E5Q A;  5EG2 A;  3MCA B;  4C8Q G;  2HQH A;  1VQL A;  1O9S A;  2MMP A;  3JCM b;  1TOV A;  2EW3 A;  4J9D A;  1K8A C;  1MUZ A;  2X3X D;  2DRM A;  1KG1 A;  5M9O A;  1ZX6 A;  2GGR A;  3NTH A;  3X28 B;  1OOT A;  2FPF A;  2EYY A;  1TXQ A;  2EYZ A;  3QDF A;  3G4S T;  3OQ5 A;  5LJ5 e;  1BBZ A;  2A36 A;  2XI9 A;  1UG1 A;  1I5O B;  4MZM A;  2JOY A;  1YJ9 Q;  1MGQ A;  2DE0 X;  3VV0 A;  5GAM f;  1N5Z A;  1S1N A;  3Q1J A;  4KUL A;  3X20 B;  1X2K A;  4AG2 C;  1W70 A;  2CSI A;  3JCM g;  4A54 A;  2QQA A;  1XTD A;  1WIE A;  1V29 B;  1IHW A;  4NOY A;  2LT4 A;  4DBF A;  1Y96 B;  4NS5 A;  2CT4 A;  1HD3 A;  1OV3 A;  2M9U A;  1UEB A;  2L8D A;  3ZEH A;  3HKS A;  4J9I A;  2C06 A;  4KT0 E;  1Q86 R;  4ATO A;  1SPK A;  2E5K A;  4M7D A;  3G6E A;  3UDC A;  1QCF A;  3CPW P;  4HCB A;  4HKE A;  3VS3 A;  2E3H A;  1UHC A;  4ESR A;  1OUL A;  5GMK m;  2A3L A;  2E10 A;  1Q81 U;  3V8K A;  1X6G A;  2JTE A;  5LJ3 f;  2DL5 A;  2M0O A;  3TU4 K;  3CMA A;  5LJ5 j;  2DJQ A;  2YRD A;  3I9Q A;  1QCO A;  1VQK T;  2DAQ A;  2E4H A;  3LLR A;  3U23 A;  2K3X A;  4X9C A;  3OYF A;  1VUB A;  4X1V A;  3I55 Q;  4KGV B;  1BI1 A;  1I5L A;  1NJI C;  4FM4 B;  2EGC A;  3DB4 A;  3C0C A;  1PKS A;  1VQM Q;  3CCQ A;  2ABL A;  3QJY A;  2QDY B;  3CXC P;  3A98 A;  1IRE B;  1TG0 A;  1HSQ A;  2EQU A;  1WYX A;  1RAG B;  1MMG A;  2CKK A;  2RD1 A;  2X9H A;  2KRM A;  2D0N A;  1FMK A;  3OS0 A;  3NTK A;  3VRZ A;  3GLX A;  3PVL A;  4RTY A;  2C0T A;  3O8V A;  2KGT A;  4QKU A;  3J81 E;  4C0D B;  1Q82 U; 
#chains in the Genus database with same CATH homology
 2J6F A;  1SRM A;  2K9G A;  1H92 A;  3TVT A;  1WXB A;  4AFQ C;  4J9B A;  1K0X A;  1AD5 A;  1PWT A;  2BZ8 A;  1RUW A;  2J7I A;  2DRK A;  1NEG A;  4LNP A;  3EG3 A;  1EFN A;  2EYW A;  1GFD A;  1AWO A;  4HVV A;  1M8M A;  2LQW A;  4OMQ A;  1AOJ A;  4HVU A;  2LJ0 A;  2FRW A;  1WXT A;  2DBM A;  2V1Q A;  2K3B A;  1SRL A;  3PE0 A;  1NLO C;  4RTX A;  3I5S A;  2D8J A;  1AWX A;  1IO6 A;  2L3P A;  1ZUY A;  1UEC A;  2GBQ A;  1UJY A;  3GBQ A;  2J6O A;  5IHI A;  1K4U S;  3EG2 A;  5HCK A;  2CUB A;  4FSS A;  1I1J A;  3EHQ A;  4Y92 A;  1W1F A;  3PVQ A;  2DF6 A;  2AZS A;  2DLP A;  4K11 A;  2DL3 A;  2JMC A;  1T0H A;  4F16 A;  2DIL A;  3SEM A;  2KRN A;  1WDX A;  2A08 A;  1GCQ C;  3IQL A;  1CKB A;  4R0K A;  4LN2 A;  1VYU A;  5IHN A;  2LCS A;  2JT4 A;  2HBW A;  2RQV A;  4RTW A;  1OPL A;  4JZ3 A;  5IXF A;  3VS4 A;  2DVJ A;  3M0P A;  2MOX A;  3H0H A;  4RTV A;  2DA9 A;  3EHR A;  1RLP C;  5IHK A;  2EYX A;  3CQT A;  4AFZ C;  2D8H A;  4RTU A;  2LNH B;  1YN8 A;  2DL8 A;  4J9E A;  2DBK A;  2DL7 A;  4DEY A;  2AKL A;  1UE9 A;  2DX1 A;  3VS2 A;  1K0S A;  1VA7 A;  2DYB A;  2A28 A;  2FO0 A;  2LX7 A;  1JXO A;  4AFS C;  2PNI A;  1X6B A;  4CC7 A;  5L23 A;  2VWF A;  1UHF A;  5GJW B;  2RN8 A;  2JW4 A;  4LE9 A;  1AEY A;  2CUD A;  2KT8 A;  4J9F A;  1AZG B;  1CSK A;  3NMZ C;  1NYG A;  4JPB W;  3REA B;  2RPN A;  2X3W D;  2B86 A;  1OPK A;  2KRO A;  3VS6 A;  4A63 B;  2OAW A;  2AK5 A;  4CC4 B;  1SHF A;  3SHW A;  4GBQ A;  1YWP A;  1M3C A;  1ZSG A;  3KFV A;  2LJ3 A;  2PZ1 A;  2GTJ A;  1X27 A;  2W10 A;  2YUO A;  2PTK A;  1GL5 A;  2GNC A;  2JS0 A;  1BU1 A;  4AFU C;  1U5S A;  3M0U A;  4F14 A;  5ECA A;  1WA7 A;  1KIK A;  1ABO A;  2JM8 A;  1JO8 A;  2MCN A;  2CSQ A;  4DEX A;  1YNZ A;  2YT6 A;  1TUC A;  2HCK A;  4AG1 C;  4JZ4 A;  3UA6 A;  2SEM A;  3O5Z A;  1M3B A;  2OJ2 A;  1M27 C;  2CH4 A;  1KFZ A;  2FEI A;  1K76 A;  1NEB A;  3I5R A;  2ESW A;  2FRY A;  2FPE A;  1AVZ C;  2O9S A;  1B07 A;  2J05 A;  1T3L A;  2JM9 A;  1VYT A;  2W0Z A;  1KJW A;  2SRC A;  3RNJ A;  1NG2 A;  1ABQ A;  1UUE A;  1H3H A;  2GQI A;  2M51 A;  2K7A A;  4EIK A;  3I35 A;  4HVW A;  2G6F X;  4OMO A;  4RTZ A;  1ZUK A;  2LJ1 A;  3EG0 A;  2AKK A;  1SEM A;  2ENM A;  3VRY A;  2C0I A;  2F2X A;  4OMP A;  1GCQ A;  2EVR A;  2O2O A;  4KRT A;  2O31 A;  1I07 A;  1WI7 A;  3EGU A;  5I11 A;  3H41 A;  1K9A A;  1QWE A;  1V1C A;  3JV3 A;  2DNU A;  2BZY A;  2K6D A;  3QWX X;  1M3A A;  2FPD A;  1T3S A;  2RF0 A;  2LQN A;  4IIO A;  3VS1 A;  4QT7 A;  1J3T A;  1KSW A;  4JJC A;  1Y57 A;  1FYN A;  2IIM A;  2RQW A;  4JJD A;  1QKW A;  1JEG A;  2KRS A;  2KE9 A;  2JS2 A;  3EG1 A;  1AZE A;  2HSP A;  1WX6 A;  2LMJ A;  1PRM C;  3R6N A;  2NUZ A;  2KBT A;  2HDA A;  1NM7 A;  2LZ6 B;  3LH5 A;  1SHG A;  3QWY A;  4OMM A;  4Z89 A;  2J06 A;  3H0I A;  1X2Q A;  1E6G A;  1SSH A;  2RNA A;  4M4Z A;  3RBB B;  1QKX A;  1LCK A;  1AWJ A;  1GBQ A;  4JJB A;  4Z88 A;  2YSQ A;  1T0J A;  4OMN A;  1Z9Z A;  1OEB A;  2EQI A;  2K79 A;  4WCI A;  1UJ0 A;  2EPD A;  3ZL7 C;  4CC3 A;  1A0N B;  1UFF A;  2KT1 A;  2YUQ A;  5FW9 A;  1ZUU A;  1JU5 C;  2LP5 A;  1UGV A;  1YWO A;  1W6X A;  4LUD A;  1GBR A;  1NLP C;  4RTT A;  5IH2 A;  1QWF A;  2CDT A;  3REB B;  2XMF A;  2RQR A;  2J6K A;  2FG0 A;  4RUG A;  4ZNX A;  1G83 A;  1GRI A;  2BTT A;  2AZV A;  2BZX A;  2YUN A;  2M0Y A;  1BK2 A;  3NPF A;  3VS0 A;  2KYB A;  2EW3 A;  2CT3 A;  2ED1 A;  4J9D A;  1X43 A;  1JQQ A;  1MUZ A;  2X3X D;  1PRL C;  2DRM A;  2D1X A;  1ZX6 A;  2GGR A;  1UTI A;  3FJ5 A;  1GCP A;  1OOT A;  2FPF A;  2EYY A;  2QDL A;  4J9H A;  2EYZ A;  4J9G A;  1RLQ C;  2KNB B;  4CC2 A;  3M0T A;  1B3Q A;  2ROT A;  4Z8A A;  1MV3 A;  1BBZ A;  2O9V A;  2NWM A;  2A36 A;  2HEQ A;  1TUD A;  1UG1 A;  3NGP A;  2CH4 W;  3VS5 A;  2DE0 X;  2I0N A;  1N5Z A;  1GFC A;  1S1N A;  1RI9 A;  2EKH A;  1U3O A;  5IXB A;  1X2K A;  1JXM A;  1H8K A;  2L2P A;  4HCK A;  4AG2 C;  3UAT A;  2EGE A;  3UF4 A;  1ZBJ A;  4IIM A;  1WXU A;  1W70 A;  2CSI A;  2K2M A;  2EBP A;  2CRE A;  1MV0 B;  1WIE A;  2F2V A;  5EC7 A;  1YCS B;  2ED0 A;  2L0A A;  1Z9Q A;  2CT4 A;  1HD3 A;  2VKN A;  4F17 A;  1OV3 A;  1AWW A;  2RQT A;  4J9I A;  3UA7 A;  1VYV A;  2O88 A;  1PHT A;  5FWC A;  1SPK A;  1BB9 A;  2E5K A;  3NHN A;  2A37 A;  2DM1 A;  2JMA A;  2OI3 A;  4E6R A;  1QCF A;  4OML A;  4J9C A;  3VS3 A;  1UHC A;  3VS7 A;  4ESR A;  3M0R A;  3TSW A;  5FWB A;  1WLP B;  2C0O A;  3TSZ A;  1I0C A;  2KYM A;  1X6G A;  2RQU A;  2JTE A;  1NYF A;  2YDL A;  2L3S A;  2DL5 A;  2DJQ A;  2KXC A;  1CKA A;  4ORZ A;  4D8K A;  3I9Q A;  2V1R A;  2RMO A;  2EGA A;  3U23 A;  4GLM A;  4X1V A;  3ULR B;  4LUE A;  1X69 A;  1YP5 A;  4D8D A;  1ARK A;  3M0S A;  1G2B A;  1K1Z A;  1XOV A;  2MIO A;  5GJV B;  3H0F A;  3THK A;  2GTO A;  2EGC A;  2L3Q A;  2ROL A;  2JXB A;  1ZLM A;  3C0C A;  4HXJ A;  1PKT A;  1PKS A;  2ABL A;  2DL4 A;  2KXD A;  3A98 A;  1QLY A;  1Y0M A;  1E6H A;  2H8H A;  1TG0 A;  2KEA A;  1HSQ A;  2P4R A;  2F2W A;  1WYX A;  1PNJ A;  1UDL A;  2VVK A;  2ECZ A;  1E7O A;  2KRM A;  2D0N A;  1FMK A;  1M30 A;  2DMO A;  5I22 A;  1U06 A;  1HJD A;  3VRZ A;  1WFW A;  3PVL A;  4RTY A;  2C0T A;  2KR3 A;  2KGT A;  2YUP A;  3M0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...