5IHIA

Crystal structure of the alpha spectrin sh3 domain double mutant v46g-d48g
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
ELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEGNGRQGFVPAAYVKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the alpha spectrin SH3 domain double mutant V46G-D48G
rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, non-erythrocytic 1
total genus 12
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ihiA00
3QWXX 2FRYA 3EGUA 2FRWA 2DL5A 2JMAA 4M4ZA 2A36A 1NYGA 3VS6A 1B3QA 1IO6A 1I07A 3VS1A 1K4US 2DLPA 1Z9ZA 1ARKA 1ABQA 2K2MA 2H8HA 3PE0A 2EYWA 4LE9A 4E6RA 3PVLA 5IXBA 2J7IA 2ROLA 3H0IA 1CKBA 3M0SA 1AWXA 1ZUYA 2RF0A 1K0SA 5FW9A 2FPEA 1YNZA 1BK2A 2HEQA 1M3BA 1MV3A 1UDLA 1AOJA 1FMKA 1QWEA 5I22A 2EYZA 2KRNA 4JJBA 4K11A 1JQQA 1LCKA 1X27A 1BU1A 2L2PA 2K3BA 2EYYA 1SEMA 2QDLA 1TG0A 1JXOA 3VRZA 2VKNA 3SEMA 2JMCA 2LJ1A 2JT4A 2ESWA 2K6DA 5IXFA 1GCPA 1UUEA 2C0IA 2CH4W 1T0HA 2FEIA 2KNBB 1WX6A 2RQWA 3M0RA 4Z88A 1PHTA 3UF4A 4AG1C 2YUQA 4X1VA 5GJWB 1H8KA 2RQVA 1K0XA 1J3TA 3GBQA 1H3HA 1NEGA 2L3PA 2YSQA 3ZL7C 3EHRA 2BZYA 3NHNA 2L0AA 2FG0A 2YUPA 3UA7A 2BZ8A 1WFWA 1AEYA 3VS4A 2K9GA 4AFSC 2O9VA 1X2KA 2EKHA 1YCSB 3I5RA 1M8MA 3H0HA 4CC2A 1X2QA 2CDTA 2KT8A 2P4RA 1SHGA 3VS5A 4IIOA 2CH4A 2F2VA 1PNJA 2ED0A 2J06A 2LJ0A 1NYFA 1S1NA 1SRLA 4OMQA 1E6GA 2GQIA 2J6FA 3PVQA 2M0YA 1WI7A 2DILA 2DL3A 1ZUKA 2V1RA 3I5SA 2LQWA 2ED1A 2DRKA 2YT6A 2A28A 1UECA 4AG2C 3H0FA 2YDLA 2F2XA 1W6XA 3VRYA 3RNJA 1OPLA 2DF6A 2G6FX 4FSSA 2RPNA 2LCSA 1U06A 2K7AA 1UE9A 4GLMA 1QKWA 2L3SA 1RLQC 2DL4A 2B86A 2J6KA 1B07A 1OPKA 1YWOA 1WXTA 4LNPA 2E5KA 1QKXA 1WYXA 1Y0MA 3M0QA 4AFQC 1QLYA 2RN8A 4J9CA 1KJWA 1U3OA 2AZSA 2GTOA 5IH2A 1NG2A 4RTXA 1FYNA 2CREA 4ORZA 1JU5C 2KE9A 1GCQA 1X6BA 4CC3A 2DVJA 1ZBJA 1KFZA 1QWFA 3TVTA 3I9QA 1SPKA 2ABLA 3EG1A 2LX7A 1X43A 3U23A 2I0NA 2ECZA 2RQUA 3SHWA 3VS7A 2D0NA 1UHFA 3JV3A 1OOTA 1G83A 1NEBA 1NLOC 2D8JA 1PKSA 4CC4B 4JZ3A 1YN8A 2F2WA 3M0PA 3M0UA 4HCKA 2LJ3A 1SHFA 4RUGA 3VS2A 2EPDA 1X69A 2L3QA 2SRCA 2KR3A 4Z89A 1T0JA 2DM1A 2CSQA 1UG1A 2X3XD 3M0TA 2IIMA 4AFZC 1ZLMA 2LNHB 3VS3A 2O2OA 2BZXA 2ENMA 5FWBA 1W70A 1ZSGA 3KFVA 2GBQA 2KRSA 2GGRA 2PTKA 3RBBB 2DBKA 1M30A 4J9GA 4F14A 2D8HA 4RTYA 2DNUA 1BB9A 1YWPA 2CSIA 3EHQA 1CKAA 4OMNA 1U5SA 4RTZA 1UJYA 4EIKA 1M3CA 1PWTA 1ZX6A 1T3LA 1Z9QA 1Y57A 1AZEA 1AWOA 1MV0B 2ROTA 1UGVA 5IHKA 2JS2A 2EYXA 1WLPB 4LUDA 2KGTA 3I35A 1AZGB 4IIMA 1M3AA 2GTJA 2OI3A 4Z8AA 1T3SA 4OMLA 1AVZC 3UATA 1JEGA 2O88A 1AWWA 1V1CA 2KYBA 4CC7A 2J05A 1VYTA 2EBPA 2KRMA 4OMPA 2D1XA 4AFUC 2DJQA 2FO0A 1YP5A 2KYMA 1WXUA 4GBQA 4KRTA 1NLPC 2JXBA 4RTVA 4JPBW 1SRMA 2HDAA 1I1JA 1E6HA 2CUBA 1UTIA 1PRLC 2DL7A 2EVRA 2VWFA 4OMOA 3C0CA 4OMMA 2DL8A 2SEMA 1AD5A 2JTEA 1OEBA 2JM9A 4DEYA 2LMJA 3NGPA 3R6NA 2DA9A 2KBTA 2JW4A 2KEAA 2DRMA 1UHCA 1KSWA 2EGEA 1VA7A 1RUWA 1WDXA 1ABOA 2C0TA 2LP5A 2JM8A 4LUEA 1JO8A 3EG3A 2RNAA 2HCKA 4J9IA 3REBB 1WIEA 1TUCA 2C0OA 2GNCA 3CQTA 1G2BA 4J9HA 3O5ZA 3QWYA 1GBQA 1H92A 2RQRA 2EQIA 2VVKA 4Y92A 1W1FA 3FJ5A 2LQNA 2O31A 3EG2A 1UFFA 2KROA 2EW3A 2NWMA 2V1QA 1VYUA 2CT3A 2AKLA 2MIOA 1E7OA 1GCQC 1AWJA 1TUDA 2YUNA 1RLPC 2DX1A 2HBWA 3NPFA 3A98A 1GFDA 5IHIA 1BBZA 5FWCA 4D8KA 2W0ZA 4A63B 1I0CA 1X6GA 2DYBA 3H41A 4HXJA 4DEXA 2FPFA 4LN2A 1WXBA 2HSPA 2RQTA 2EGAA 3VS0A 2RMOA 2BTTA 1XOVA 1OV3A 5ECAA 4JJDA 2J6OA 4QT7A 1JXMA 1MUZA 1CSKA 1NM7A 1EFNA 2CUDA 1K1ZA 2JS0A 4D8DA 3LH5A 4HVUA 2FPDA 2LZ6B 5EC7A 4HVWA 2AKKA 5I11A 2DMOA 2O9SA 4F17A 3TSZA 4ZNXA 2AZVA 4J9DA 2X3WD 1WA7A 2A37A 2K79A 1KIKA 3UA6A 4RTWA 1GBRA 4RTUA 1K9AA 2DBMA 3EG0A 3REAB 2PZ1A 2KXDA 1QCFA 4R0KA 2A08A 5L23A 2KXCA 2OAWA 2PNIA 1M27C 2XMFA 1SSHA 2M51A 1N5ZA 3IQLA 4J9BA 1PKTA 1A0NB 1GL5A 1UJ0A 1PRMC 1K76A 4JZ4A 2EGCA 4WCIA 2MCNA 3TSWA 5HCKA 4F16A 2MOXA 1GRIA 3THKA 4JJCA 1GFCA 5IHNA 2DE0X 1HSQA 4HVVA 2YUOA 2AK5A 1HD3A 2W10A 2CT4A 4J9FA 2KT1A 2NUZA 3NMZC 1ZUUA 4ESRA 5GJVB 1RI9A 2OJ2A 4J9EA 4RTTA 3ULRB 1HJDA 1VYVA
chains in the Genus database with same CATH superfamily
4ZTFA 2FRWA 2JMAA 3FRNA 2A36A 4J7FA 1IO6A 3QIIA 1PG5B 2R5MA 3RDVA 3OYMA 5KCOA 2I2LA 5GMKe 2E5QA 2FZCB 3L1AA 3CCMT 3QUIA 5GAOq 2J7IA 2ROLA 3H0IA 1CKBA 3OYBA 1VQ5Q 2YHTA 1M1FA 4M78B 2DTHA 1YFNA 1RAHB 1BK2A 2HEQA 2M16A 2X51A 3DB3A 1YJNQ 1RL2A 1AOJA 1QWEA 4JJBA 4K11A 1JQQA 1X27A 2H3JA 5IN1A 1BU1A 2K3BA 4BUGA 4F7UG 1SEMA 4M7DE 2QDLA 1TG0A 2K4YA 3CXCP 1FMWA 1VQLA 1MGQA 3M58A 1YI2A 1HYOA 2YRCA 1GCPA 3CMEA 2CH4W 1T0HA 2E10A 1WX6A 2XU8A 4M7AA 4PJOB 3CCLQ 1PHTA 3UF4A 3CCJT 2QA4T 3S3NA 3GBQA 1H3HA 2YSQA 1IREB 1H3ZA 1D09B 3NHNA 1NJIU 3CC7Q 2BZ8A 2X4JA 3JB9F 3OYHA 3ASKA 3VV0A 4AFSC 1JBMA 1YJNA 3H0HA 4Z02A 2OTLA 5CKBA 2K5IA 1SHGA 1Q86C 2JN0A 4CI0C 2F2VA 2ED0A 3F70A 1S1NA 1SRLA 4D6WA 4OMQA 1TWBA 3SDZA 1QQJA 1C1AA 2DILA 3I5SA 5FLXE 2DJZA 2GQVA 2A28A 3VJPA 4AG2C 1VQPA 1IHVA 2PUOB 4IUUA 4J8OA 4F7UA 1BYMA 2MI6A 1I5LA 1UE9A 4GLMA 1QKWA 1FX7A 1M90R 2X9HA 2FVUA 2J6KA 2ZZDA 3RUXA 1B07A 2LC4A 1OPKA 1WXTA 1YIJA 1QMCA 1UGQB 1KJWA 3X28B 2GTOA 2KE9A 1GCQA 2DVJA 2CZ1B 3S3MA 1TXQA 3I9QA 5GAOp 5D6YA 1QVGA 2I0NA 2KY9A 4XTZA 2GCXA 2RQUA 3CCET 1OZ2A 5DY9A 1O75A 5GAN7 4RCBA 1WQ7A 2XI9A 2LDMA 2VGMA 5LJ3f 3DB4A 5FROA 4C8QG 1YHQA 4M77F 1SHFA 2EPDA 2V8JA 8AT1B 3CCQQ 2QQBA 4LDVA 1VQ6Q 1YCYA 5CAIA 2CSQA 2DZCA 3GLXA 1C0MA 1X6OA 3BE3A 4MZMA 1LNXA 3M55A 2E4HA 1YJ9Q 5GAOl 3T9NA 4M75D 2EYQA 2WSEE 3HKSA 1W70A 2R58A 2GBQA 2QK0A 2HAXA 5LJ5e 1VQKQ 5LJ3g 3RBBB 3BDUA 5KYYB 4AT1B 1YJ9A 4RTYA 2DNUA 1BB9A 4DBFA 1CKAA 2CYZB 1U5SA 4C8QC 3MP6A 1ZX6A 4HT8A 2QEXT 1Z9QA 4FT2A 1MV0B 1UGVA 1VQ7A 3JCMP 3DLLA 4KUDK 2KGTA 3BY7A 2GTJA 4XTYA 3CCUQ 1JEGA 4M7DB 5GANf 1TSFA 1V1CA 2GF7A 3S6WA 1SG5A 4C0FA 4A54A 4OMPA 1M1KR 2D1XA 3GPLA 3MO8A 1G8XA 2FO0A 1YP5A 1K9MC 4QVZA 1NLPC 3DKMA 4RTVA 4JPBW 2FZGB 2DAQA 2KMTA 1IGQA 5J39A 4C8QA 4DBRA 3GIBA 5CK9A 1LJOA 3UPUA 1N9SA 2EVRA 5FRMA 3OSVA 3QO3A 4OMOA 1Q82R 5I2SA 1O9SA 1I8FA 1QVFA 1OEBA 2JM9A 3R6NA 5HY6A 3JCMW 2EGEA 4ANJA 4LUEA 1EX4A 2HKNA 4QKUA 4A4HA 4FU6A 2CS7A 1JJ2A 4YTLA 1VQ4Q 4ZGEB 1OZ3A 2CZ6B 4EMKA 1K8AC 3M9QA 1XQHA 2EQKA 2LT1A 1WHLA 3O5ZA 1KD1R 3QWYA 2K3YA 1Q82C 2F69A 1Q7YC 2WSCE 2RHZA 1W1FA 2F5TX 4BI3A 2MYSA 4HT9A 1G3SA 1UFFA 4ME7A 1VYUA 2RJEA 2CT3A 2IPOB 2MIOA 4N4GA 1GCQC 4E7HA 2NUPA 2YUNA 2DX1A 4IURA 3CC7A 3JCMg 4X34A 1QP3A 3PTAA 4M7DC 4M7AF 2JNGA 4F7UE 1KD1C 5FWCA 1M5Q1 2FPFA 2DXCA 5LJ5f 1YHQT 2HQHA 3OMGA 4JJNK 2RMOA 1PD0A 2E64A 1HK9A 1XOVA 1OV3A 3CCST 5ECAA 1RAIB 5GMKh 2KAFA 4QT7A 1JXMA 3BDLA 1MUZA 2Y4YA 3QJYA 1OU8A 3L2VA 1QCOA 2JS0A 2K57A 4II1A 4HCCA 3HRTA 3GOXA 2COZA 2MPXC 5I11A 2YWWA 2M1HA 2LQKA 4PJOD 1XTDA 3OYKA 2X3WD 4C5IA 2QG9B 3UA6A 2XIDA 1QVPA 4AMCA 4E7JA 5C6SA 3EG0A 3OS2A 3EFRA 5LJ5d 3REAB 2E65A 1QCFA 4DA4A 5KYNA 1FXXA 2OAWA 3I55T 2F5KA 2PNIA 1M27C 1Y7XA 2BE9B 2HNIA 2O4XA 5GANh 4HKEA 1YI2Q 4C0DC 3QZ5B 3X25B 1KHIA 1UJ0A 1VQ4T 4EPCA 4JS4A 2FL7A 2QQAA 4C0DB 2EQUA 3FIFA 4HA8A 2XKOC 3VYGA 2MOXA 4JJCA 3OYAA 4L59A 1GFCA 5IHNA 4HVVA 3ZBDA 2V8IA 1W2BA 1HD3A 4A4KA 2ZGWA 3CBPA 2CT4A 4QVDA 4E7SA 2OAUA 1ZUUA 3H8ZA 1D1AA 2FB7A 4XU1A 1VQOQ 4RTTA 1BCOA 3QBYA 3EGUA 4M4ZA 5GAMd 3HL8A 1NYGA 3VS6A 1B3QA 2QGFB 1Y71A 2EJFA 5A2QE 2ZAEA 1VQOA 3CPWP 1K4US 2DLPA 1ARKA 3EGDA 3QPHA 1WNLA 5GMKi 3PE0A 5HKCA 4LD9K 5GAMf 1M2VB 1ZSZB 4J7IA 3M0SA 2DIGA 1AWXA 3OS1A 1FWZA 2RHXA 1RAFB 4FM4B 1YNZA 4HCZA 1M3BA 2RK2A 1UDLA 3LYIA 2EYZA 2KRNA 4JRPA 1LCKA 1YJ9T 1BI3A 2L2PA 2M9UA 3ME9A 3CCVQ 2EYYA 3AT1B 3EGDB 3GNGA 3JCMQ 2PVOB 2RHIA 2VKNA 3SEMA 2LRQA 3JRZA 1N6AA 1M2OA 3EG9A 2E1HA 2FEIA 2KNBB 3RKWA 3M0RA 4Z88A 3FC3A 5GJWB 3OY9A 1K0XA 4JRIA 2DEQA 2RJFA 1VQNQ 2BZYA 3VKIA 3CCJQ 2L0AA 2FG0A 2YUPA 1YI2T 1AEYA 2P0QA 4L6V5 1RABB 1YCSB 2D9TA 1M8MA 4CC2A 3A8HB 2CDTA 4A53A 1YIJT 2QGGA 2P4RA 3VS5A 4ZN3A 2EJGA 1PNJA 3CXCA 2GQIA 2Y90A 3CC4Q 2J6FA 4OMFB 3MEUA 1D3BA 3I56A 1ZUKA 2EAYA 1MMNA 4HCBA 1FMVA 5D6WA 5DLOA 1UECA 1ZQ1A 2NLUA 2F2XA 1R77A 1G3YA 3RNJA 3RKYA 5FU6B 2DF6A 1VQ8A 2G6FX 2RPNA 2LCSA 1VQLT 1U06A 4P5NA 1RAGB 2DL4A 2B86A 1IHWA 1YWOA 2HZYA 2A3LA 2L89A 4LNPA 1MMGA 1S72Q 1NPPA 2VV5A 4NS5A 1Y0MA 4AFQC 3CMAT 3L2WA 1G3WA 3HPWA 2CZ7B 2NUTA 3M53A 3CC2T 3QDFA 2DVEA 2GFAA 1VQPT 1K73U 4RTXA 4ORZA 1Q82U 3PNWC 4C92D 4QVCA 4CC3A 1KFZA 1NZ9A 4XU3A 1QW1A 3OYIA 1N8RU 2QXFA 4BE0A 4M7AC 2LX7A 3TREA 3V8LA 1WJRA 1BIAA 3PMTA 3U23A 3I56Q 3SB2A 2D0NA 2P4TA 1UHFA 4M77C 3JV3A 1OOTA 3N5BB 4C8QE 2KSSA 1PKSA 2MWPA 2OX7A 3CEYA 1YN8A 2F2WA 3I55Q 4Y91A 1KQSP 3M0UA 4HCKA 2LJ3A 1LPLA 3E9FA 4RUGA 2MAMA 4M75F 2L3QA 2SRCA 3JCMh 2LX9A 2WSFE 1UG1A 2X3XD 2OTJQ 1QP2A 1BI2A 2IIMA 1Q95G 3EGXB 3JSCA 3QYHB 3VS3A 2DETA 1VQNA 3MJXA 2C06A 2CP0A 5KE2A 1PC0A 2PTKA 4PLIA 4J9GA 2D8HA 1NJIR 2YXYA 4M78E 3EHQA 1U1SA 2CSIA 4XAXB 4RTZA 2OTLQ 4EIKA 1M3CA 1PWTA 1RACB 1WJQA 2H3EB 3A8LB 2ROTA 2EYXA 3EGXA 1M2VA 1WLPB 3HRSA 2RH2A 3X20B 4LUDA 3I35A 4PJOG 5CKEA 5CQYA 3CCJA 4M78G 3CCRT 1AVZC 5GAN6 3UATA 2O88A 2L8DA 5GAN3 3LX7A 1KQSA 5LJ5h 1VYTA 3NTHA 4BY6B 3ER0A 2HKQB 4BE2A 1JJ2P 4AFUC 2JUFA 4M77D 4F7UB 2RK1A 3EH2A 1SSFA 2DIQA 2JXBA 3GF5A 2V8KA 2DYIA 4JDSA 2A7YA 3GNFB 4DOWA 3UWNA 3CD6A 5GAN8 2HDAA 1KHCA 3L2ZA 1I1JA 5HK0A 1PRLC 4E7LA 1OX9A 1BKBA 2DL7A 2DXTA 4C5HA 3VUBA 4NL3A 3CC7T 2DL8A 3CMET 1AD5A 4KT0E 2JTEA 4LD6A 3PIOA 3Q1JA 4DEYA 3JCMX 3CPWS 4BACA 3NGPA 2KDSA 2JW4A 3V7SA 4B9WA 2DRMA 2QA4A 4R55A 2FYKA 3QXEB 1UHCA 1KSWA 1Q86U 1RUWA 1WDXA 2C0TA 2IG0A 5GANe 1JO8A 3EG3A 2DERA 1Y07A 4BI4A 2CKKA 4M7DG 1WIEA 4IUVA 1RI0A 1TUCA 4J6XA 1Q7YR 4UC4A 1TS9A 2XK0A 3CQTA 1TUGB 3JCMd 2OTJT 5A0LA 5KYWA 2RQRA 5A0DA 4ATOA 2VVKA 4Y92A 3CD6Q 1D1CA 3LWHA 3CBMA 3KXTA 4IUPA 2LQNA 2CP6A 2O31A 2AKLA 3SD4A 3OYYA 3S3OA 1Y96A 5I21A 1TUDA 1B7TA 1KQ2A 4KH0B 2HBWA 3M5AA 3NPFA 3A1PA 1D0XA 4KBMB 1VQLQ 1BBZA 1UB4A 5GAOr 1RAEB 2W0ZA 2LVMA 1SF9A 3H41A 2LCCA 4DEXA 1VQ5A 2LTOA 2RQTA 2JZ2A 4R56A 1ZHIA 5IT9E 5FU7C 3NFCA 3VS0A 3JCMf 2Z0WA 2LQ8A 1YITT 5FU6C 3CC2Q 4FL6A 3LGFA 3MEWA 3JCMV 4E7KA 1BI0A 2DXUA 1CSKA 1EFNA 4O5VA 3KBGA 1NJIC 3LH5A 4HVUA 2LZ6B 4PFPA 4E7ZA 2DMOA 3OYLA 4PLLA 3MCAB 3VUZA 4JLGA 1Q86R 3ZEHA 4M77E 3CCLA 1KIKA 2QEXA 3MP1A 2DBMA 1UGRB 4C92C 2A08A 2KXCA 5HK3A 1RADB 1PSFA 2M51A 4KULA 1N5ZA 3SWNC 3IQLA 4A4FA 1Q81C 1K8AU 3SWNB 4JRQA 4WCIA 4J6WA 1BI1A 5HCKA 3CCUA 3O8VA 1W2BP 1PM3A 2AK5A 5LJ3d 5GMKm 2Y4XA 4XQ3A 4O6JA 4EMKB 4J9FA 1NPRA 1OULA 4WTOB 2RD1A 2NUZA 3NMZC 4DQ2A 4ZGDB 4ESRA 3H9NA 2MK5A 1RI9A 8ATCB 2QAZA 1VYVA 2RHUA 3QWXX 5DLQE 2FRYA 1QVFS 2DL5A 3JCMc 2KQWA 1I07A 2DO3A 1YJWQ 2E12A 2K2MA 5LJ5g 3G6EQ 3M4GA 3CCRA 4E6RA 4ZTJA 4RG8A 2DKGA 5CCAA 3QSUA 3META 3L2UA 4C8QF 1ZUYA 2RF0A 1WZOA 1K0SA 1VQ6A 2DTIA 4QQ6A 5FW9A 2FPEA 3JCMJ 3TEEA 2RI5A 1MV3A 3OQ5A 2VB6A 1FMKA 1M1GA 4EMHA 3PFSA 2AIRB 3UDCA 3HHTB 1JXOA 3A8OB 4N4HA 1OI1A 1N9RA 4N0AA 3VRZA 3RERA 3CCEA 2LJ1A 2ESWA 5IXFA 1KC8C 1Q81R 1UUEA 3BW1A 2C0IA 3EFSA 4FIBA 4GLKA 4M75E 5KYUA 1UGSB 2QEXQ 2KVQG 1WHJA 2ZPBB 3P8HA 2FZKB 2RQVA 1J3TA 5GANg 2RJDA 3A8MB 4NOYA 2L3PA 3ZL7C 3EHRA 4C92B 1WFWA 3VS4A 3RR6A 5AYFA 2O9VA 1YBYA 3CCSQ 2QTVA 1K9MU 1X2QA 4BD3A 2KT8A 1OQKA 1VQMA 4IIOA 1WHHA 3MEAA 3CCQA 2CH4A 2LJ0A 4TVRA 1UEBA 1OU9A 1D0ZA 2QQ9A 1VQ7Q 4J83A 2E70A 2JJ9A 4LDXA 2V1RA 1ACMB 5GAN2 3OS0A 4BE1A 4M7AG 2ED1A 2DRKA 3OBYA 4MMKA 2MMPA 2VYTA 2CP7A 3H0FA 2YDLA 4ZGJB 3L2RA 2O01E 1W6XA 2P0KA 4C8QB 2VC8A 4FYYB 3VRYA 4M7AE 1PSEA 1OPLA 1P92A 4FSSA 1OX8A 2R5AA 2L3SA 1RLQC 2CZ0B 2B8AA 2HQEA 4XU2A 2E5KA 1WYXA 2LT4A 1WPYA 4RCCA 1QLYA 2CP2A 2RN8A 1U3OA 2AZSA 2KK4A 1NG2A 1FYNA 2CREA 4M78D 1D0YA 1JU5C 3CCEQ 1M9SA 3G71A 2QQRA 1QWFA 3V7RA 2E41A 1SPKA 4E2FB 2ABLA 1N27A 2KI7A 3MKDA 3CCUT 3WVDB 1S72T 1M1KU 3LW5E 1X43A 2ECZA 3M4YA 3OW2P 3M54A 4XU0A 1WGSA 2RI3A 4IUTA 1VQPQ 3V8KA 4M75C 1QVGS 1NEBA 1NLOC 3H6ZA 1N8RR 4CC4B 1YITA 3CMAA 4JZ3A 4EDUA 4PJOE 2M02A 3CCSA 2VXEA 3M0PA 4BB7A 1VQ5T 3MEVA 4LDUA 3VS2A 1IGUA 3VYHB 2KR3A 1T0JA 2ZPGB 2BUDA 2BKDN 2E6NA 2NUPB 2LNHB 1ZSZC 4M75B 5GAOm 3FDRA 4QQDA 2BZXA 5FWBA 1ZSGA 3OS5A 3UT1A 1B34A 2KRSA 2GGRA 3INZA 3RIRA 3DLMA 4LDYA 2DBKA 2XG8D 1QVGP 1M30A 4F14A 4M7AB 1YWPA 4LXCA 4OMNA 1UJYA 1PCXA 3OW2S 3X26B 5GAMj 4RMOA 2D0QB 2PVDB 1IZ6A 1VQ7T 1AWOA 3MP8A 4QQGA 2JS2A 4RG2A 1QVFP 5KYWB 4BI8B 1AZGB 4IIMA 5CIUA 2OI3A 4Z8AA 5KYYA 1T3SA 3HSBA 4OMLA 3PT9A 1LOJA 1H641 1JRIA 1HXDA 2ZPFB 2KYBA 2QQSA 2VGNA 3G6EA 3CCRQ 2J05A 2EBPA 3P8BB 2DD5A 2DJQA 4KGVB 1WXUA 3OYGA 5LJ5j 4PNOA 4KRTA 4C5GA 2YRDA 2PQWA 4EMKC 5CO7A 2BIVA 4PJJA 3I55A 1KD1U 5GAMe 2QTXA 1VQ9Q 1TU0B 4C8QD 1WHKA 1VQ6T 2LCLA 2VWFA 5IAYA 3X24B 2SEMA 3FJPA 4M77A 5LJ3h 3CC4T 4C0ZA 1I81A 3ZFJA 3TCJA 1ZSZA 2LMJA 3SFMA 3QZ9B 2KBTA 3A8GB 1YIJQ 3CMEQ 4KGZB 1VA7A 5GAMg 1ABOA 2CP5A 2DFUA 2VASA 4E7IA 3M57A 5CKHA 3EAEA 1VUBA 3TU4K 2RNAA 4J9IA 4PFOA 2CP3A 4KH1B 1YJNT 4J9HA 4XK8E 5LJ3j 4XTXA 1GBQA 2EQIA 3VU3C 1MHNA 1AHJB 2EQJA 3HFOA 3CPWA 1VQMQ 3PMIA 4OB3B 3OYEA 3OBWA 2KROA 2EW3A 2NWMA 1MNEA 2K2VA 4OF1A 3J80E 3CMAQ 3PGGA 2AT1B 3CXCS 1W4SA 5GAMh 1W2BS 3HP9A 4DOVA 5D6XA 3FLGA 1RLPC 3I56T 1M1KC 4B6MA 2RJCA 2DEUA 2R57A 1GFDA 1V76A 5I2MA 5IHIA 1VIEA 4FSXA 4D8KA 4A63B 1X6GA 2DYBA 3OMCA 3TQ7P 4HXJA 4LN2A 1WXBA 4V2SA 2EGAA 4KGXB 2BTTA 3JB9H 2J6OA 3JAME 1YITQ 1NM7A 2YLCA 1K1ZA 5DM7R 2RI2A 1V29B 2FPDA 5EC7A 4PJNA 4HVWA 2AKKA 2HD0A 4EMGA 1WHGA 3RMQA 3TSZA 2EJ9A 4M7DA 2HMAA 3WVEB 1MNDA 4C92F 4M78A 4J9DA 2QASA 1WA7A 1VQ4A 3BFMA 2K79A 1KQ1A 4FCYA 3L42A 1SKUB 3CPFA 4RTWA 1GBRA 4RTUA 1K9MR 4JS5A 2PZ1A 4R0KA 3G71Q 2ZCFB 5L23A 2L5QA 1SSHA 1R8OB 4OVAA 2DD4A 3JB9I 5KYXB 2PVGB 3WXMB 1N8RC 1TTHB 2ZPEB 1A0NB 2YRVA 4A4EA 1GL5A 1F1BB 3NTKA 2E3HA 4JZ4A 1Y96B 3E19A 4N0AC 3C95A 3M56A 2EGCA 1GXIE 2MCNA 1KK7A 4FYVB 3TSWA 5GANd 2YLBA 3OYFA 4XTVA 3G6ET 2XDDA 1GRIA 3THKA 2CGHA 1HSQA 2YUOA 3KUFA 1VQMT 2W10A 2NUTB 4C92G 4PFZA 4DBHA 3HRUA 3EFOB 5GJVB 4J9EA 1G3TA 2OJ2A 3ULRB 1HJDA 4ELZC 5C0MA 3J81E 3V7CA 2RHYA 3VS1A 2QDYB 1VQKT 1Z9ZA 1VQOT 1ABQA 4M7AD 2H8HA 2EYWA 4LE9A 3A5ZB 3PVLA 5IXBA 3MPUB 3E2UA 2ZPIB 3CCVA 1ZA2B 2JTMA 3LGLA 1OYXA 3C12A 1X01A 3OB9A 3PIPA 5LJ3e 1NBEB 2IVWA 5J26A 4PJOF 5I22A 1VQ9T 3HFNA 1TOVA 2NYSA 3E1SA 3CD6T 2DTOA 2RO0A 1ZBXA 4PJOC 4FT4A 1YHQQ 2JMCA 2JT4A 4RKUE 2VXFA 2K6DA 2QA4Q 5AT1B 2DXBA 1MMDA 4X9DA 2RQWA 2E6ZA 4OP0A 4AG1C 2YUQA 4X1VA 1H8KA 3OW2A 4M78F 3G71T 1NEGA 1M90C 1KG1A 3RESA 1Q81U 3UA7A 2K9GA 2EQMA 1X2KA 1X75C 5CKFA 2EKHA 3I5RA 3MHXA 3E9GA 2HL3A 5KH6A 4IKFA 2J06A 1NYFA 2XDPA 5KCHA 1E6GA 3PVQA 3OYCA 2M0YA 1WI7A 4ELYC 4FYXB 2X4WA 2DL3A 2LQWA 2YT6A 2P0PA 3OA6A 4X9CA 4Q5WA 3CC4A 4M75G 4DBQA 4PJLA 2K7AA 1IRXA 2XDBA 1B34B 1JJ2S 4PKCC 1M4ZA 2ATCB 1QKXA 2X4YA 3M0QA 5GAN4 4J9CA 1YJWA 4NL2A 3D7SB 3C94A 5IH2A 4OB1B 2EFIA 2FHDA 1R0CB 4PJOA 1X6BA 4M7DD 5L8RE 1ZBJA 2K3XA 3TVTA 4OGEA 5CKDA 2MF2A 5FRNA 3EG1A 3CCQT 3RKXA 4CRIA 1G5VA 1R0BG 3SHWA 3VS7A 4BDYA 2EKOA 5KYXA 1G83A 4PJMA 2D8JA 3R6OA 2DZ9A 1K8AR 2A0FB 1XNIA 3OYNA 4IUQA 4E47A 1VQ9A 4OGCA 2QI2A 1X69A 1M8VA 4Z89A 2DM1A 2X35A 3QYGB 3M0TA 1VQ8T 1U1TA 4AFZC 1ZLMA 3P8DA 2HL5C 1M90U 1BCMA 2HBPA 4Y28E 4JRKA 4BDZA 2HQXA 2O2OA 5KYUB 3EFOA 2ENMA 4MZTA 3NTIA 3KFVA 3EG9B 3RMSA 1ZA1B 2COWA 4F04B 1WHMA 4PL6A 1RAAB 1LVKA 2DPPB 1T3LA 4KUIA 1Y57A 4A4GA 1AZEA 3CBOA 3SWNA 5IHKA 1WQWA 2MWOA 4OB0B 1M3AA 2K5FA 3C4SA 5EG2A 2BE7D 7AT1B 4BY6C 3EH1A 4MZPA 1U8RA 1AWWA 1JB0E 3JB9D 1MMAA 2VUBA 3G7ZA 4CC7A 2KRMA 5CR2A 4OB2B 2D6FA 4ZN1A 2KYMA 2M0OA 3LWIA 4GBQA 1Q7YU 4J5YA 2X4XA 2HSEB 1EZZB 1SRMA 5LL6S 3JB9G 4FW2A 1E6HA 2CUBA 1UTIA 5CVIA 1DJ7B 3HTRA 1IB8A 1WJSA 5M9OA 2O4XB 5KE3A 3C0CA 4OMMA 4C5EA 1TH7A 3OSSC 2OTJA 2EWNA 2DA9A 1D1BA 2KEAA 1S72A 3G4SA 5GMKj 1I4K1 2LP5A 2AHJB 2GFUA 2JM8A 1D3BB 1BIBA 2HCKA 3OYDA 2OTLT 3V8JA 3REBB 3LLRA 4J6YA 2C0OA 2GNCA 4WF2A 2K5LA 2E3IA 1G2BA 2EIFA 1H92A 3QKJA 3JCMb 1YJWT 1AT1B 3QHSA 4QW2A 4C92E 3FJ5A 3EG2A 1KC8U 2RA2A 3AHUA 2V1QA 5FU7B 3G4ST 2PU9B 1E7OA 4M75A 4B9XA 6AT1B 1VQNT 4C0GA 1AWJA 4M78C 1XJWB 4LDWA 1PD1A 3A98A 2RM4A 3CCMA 5GANj 2XICA 3G1JA 3QDRB 4MMLA 1I0CA 4GY5A 1KC8R 2HSPA 2COYA 3FEOA 5D7UA 3CCMQ 4M7DF 1K73C 2ZPHB 4FW1A 3URGA 4JJDA 2JOYA 4FYWB 4L5GA 4XTWA 5GAOn 3CCVT 2XD0A 2CUDA 4D8DA 4MDWA 3M59A 2DK3A 1VIFA 2RB6A 1I5OB 2O9SA 1VOMA 4F17A 2XHCA 5A0GA 4ZNXA 2JVVA 5CQXA 2AZVA 4C92A 3OYJA 2LNVA 2A37A 1QCNA 2PUKB 1KQSS 3CCLT 1IXDA 1K9AA 2G3RA 1UGPB 4JLIA 2KXDA 4XTUA 9ATCB 4PK4A 2L3RA 4M77G 2XMFA 2JTFA 3FB9A 1VQ8Q 1NE8A 4M77B 3GP8A 1C6VX 5J3BA 4J9BA 1PKTA 3QG1A 3L2QA 4N4IA 2F1LA 2V26A 2WACA 1PRMC 1K76A 3QJ6A 4MDXA 4F7UF 5GAN5 4F16A 3LH0A 3JB9J 1K73R 2DE0X 1VQKA 4JUVA 1EIFA 5GMKl 2P84A 2KT1A 3JCMe 3G4SQ 3CC2A 2QYZA 3J7AF 4VUBA
chains in the Genus database with same CATH topology
3QWXX 2FRYA 3EGUA 2FRWA 2DL5A 2JMAA 4M4ZA 2A36A 1NYGA 3VS6A 1B3QA 1IO6A 1I07A 3VS1A 1K4US 2DLPA 1Z9ZA 1ARKA 1ABQA 2K2MA 2H8HA 3PE0A 2EYWA 4LE9A 4E6RA 3PVLA 5IXBA 2J7IA 2ROLA 3H0IA 1CKBA 3M0SA 1AWXA 1ZUYA 2RF0A 1K0SA 5FW9A 2FPEA 1YNZA 1BK2A 2HEQA 1M3BA 1MV3A 1UDLA 1AOJA 1FMKA 1QWEA 5I22A 2EYZA 2KRNA 4JJBA 4K11A 1JQQA 1LCKA 1X27A 1BU1A 2L2PA 2K3BA 2EYYA 1SEMA 2QDLA 1TG0A 1JXOA 3VRZA 2VKNA 3SEMA 2JMCA 2LJ1A 2JT4A 2ESWA 2K6DA 5IXFA 1GCPA 1UUEA 2C0IA 2CH4W 1T0HA 2FEIA 2KNBB 1WX6A 2RQWA 3M0RA 4Z88A 1PHTA 3UF4A 4AG1C 2YUQA 4X1VA 5GJWB 1H8KA 2RQVA 1K0XA 1J3TA 3GBQA 1H3HA 1NEGA 2L3PA 2YSQA 3ZL7C 3EHRA 2BZYA 3NHNA 2L0AA 2FG0A 2YUPA 3UA7A 2BZ8A 1WFWA 1AEYA 3VS4A 2K9GA 4AFSC 2O9VA 1X2KA 2EKHA 1YCSB 3I5RA 1M8MA 3H0HA 4CC2A 1X2QA 2CDTA 2KT8A 2P4RA 1SHGA 3VS5A 4IIOA 2CH4A 2F2VA 1PNJA 2ED0A 2J06A 2LJ0A 1NYFA 1S1NA 1SRLA 4OMQA 1E6GA 2GQIA 2J6FA 3PVQA 2M0YA 1WI7A 2DILA 2DL3A 1ZUKA 2V1RA 3I5SA 2LQWA 2ED1A 2DRKA 2YT6A 2A28A 1UECA 4AG2C 3H0FA 2YDLA 2F2XA 1W6XA 3VRYA 3RNJA 1OPLA 2DF6A 2G6FX 4FSSA 2RPNA 2LCSA 1U06A 2K7AA 1UE9A 4GLMA 1QKWA 2L3SA 1RLQC 2DL4A 2B86A 2J6KA 1B07A 1OPKA 1YWOA 1WXTA 4LNPA 2E5KA 1QKXA 1WYXA 1Y0MA 3M0QA 4AFQC 1QLYA 2RN8A 4J9CA 1KJWA 1U3OA 2AZSA 2GTOA 5IH2A 1NG2A 4RTXA 1FYNA 2CREA 4ORZA 1JU5C 2KE9A 1GCQA 1X6BA 4CC3A 2DVJA 1ZBJA 1KFZA 1QWFA 3TVTA 3I9QA 1SPKA 2ABLA 3EG1A 2LX7A 1X43A 3U23A 2I0NA 2ECZA 2RQUA 3SHWA 3VS7A 2D0NA 1UHFA 3JV3A 1OOTA 1G83A 1NEBA 1NLOC 2D8JA 1PKSA 4CC4B 4JZ3A 1YN8A 2F2WA 3M0PA 3M0UA 4HCKA 2LJ3A 1SHFA 4RUGA 3VS2A 2EPDA 1X69A 2L3QA 2SRCA 2KR3A 4Z89A 1T0JA 2DM1A 2CSQA 1UG1A 2X3XD 3M0TA 2IIMA 4AFZC 1ZLMA 2LNHB 3VS3A 2O2OA 2BZXA 2ENMA 5FWBA 1W70A 1ZSGA 3KFVA 2GBQA 2KRSA 2GGRA 2PTKA 3RBBB 2DBKA 1M30A 4J9GA 4F14A 2D8HA 4RTYA 2DNUA 1BB9A 1YWPA 2CSIA 3EHQA 1CKAA 4OMNA 1U5SA 4RTZA 1UJYA 4EIKA 1M3CA 1PWTA 1ZX6A 1T3LA 1Z9QA 1Y57A 1AZEA 1AWOA 1MV0B 2ROTA 1UGVA 5IHKA 2JS2A 2EYXA 1WLPB 4LUDA 2KGTA 3I35A 1AZGB 4IIMA 1M3AA 2GTJA 2OI3A 4Z8AA 1T3SA 4OMLA 1AVZC 3UATA 1JEGA 2O88A 1AWWA 1V1CA 2KYBA 4CC7A 2J05A 1VYTA 2EBPA 2KRMA 4OMPA 2D1XA 4AFUC 2DJQA 2FO0A 1YP5A 2KYMA 1WXUA 4GBQA 4KRTA 1NLPC 2JXBA 4RTVA 4JPBW 1SRMA 2HDAA 1I1JA 1E6HA 2CUBA 1UTIA 1PRLC 2DL7A 2EVRA 2VWFA 4OMOA 3C0CA 4OMMA 2DL8A 2SEMA 1AD5A 2JTEA 1OEBA 2JM9A 4DEYA 2LMJA 3NGPA 3R6NA 2DA9A 2KBTA 2JW4A 2KEAA 2DRMA 1UHCA 1KSWA 2EGEA 1VA7A 1RUWA 1WDXA 1ABOA 2C0TA 2LP5A 2JM8A 4LUEA 1JO8A 3EG3A 2RNAA 2HCKA 4J9IA 3REBB 1WIEA 1TUCA 2C0OA 2GNCA 3CQTA 1G2BA 4J9HA 3O5ZA 3QWYA 1GBQA 1H92A 2RQRA 2EQIA 2VVKA 4Y92A 1W1FA 3FJ5A 2LQNA 2O31A 3EG2A 1UFFA 2KROA 2EW3A 2NWMA 2V1QA 1VYUA 2CT3A 2AKLA 2MIOA 1E7OA 1GCQC 1AWJA 1TUDA 2YUNA 1RLPC 2DX1A 2HBWA 3NPFA 3A98A 1GFDA 5IHIA 1BBZA 5FWCA 4D8KA 2W0ZA 4A63B 1I0CA 1X6GA 2DYBA 3H41A 4HXJA 4DEXA 2FPFA 4LN2A 1WXBA 2HSPA 2RQTA 2EGAA 3VS0A 2RMOA 2BTTA 1XOVA 1OV3A 5ECAA 4JJDA 2J6OA 4QT7A 1JXMA 1MUZA 1CSKA 1NM7A 1EFNA 2CUDA 1K1ZA 2JS0A 4D8DA 3LH5A 4HVUA 2FPDA 2LZ6B 5EC7A 4HVWA 2AKKA 5I11A 2DMOA 2O9SA 4F17A 3TSZA 4ZNXA 2AZVA 4J9DA 2X3WD 1WA7A 2A37A 2K79A 1KIKA 3UA6A 4RTWA 1GBRA 4RTUA 1K9AA 2DBMA 3EG0A 3REAB 2PZ1A 2KXDA 1QCFA 4R0KA 2A08A 5L23A 2KXCA 2OAWA 2PNIA 1M27C 2XMFA 1SSHA 2M51A 1N5ZA 3IQLA 4J9BA 1PKTA 1A0NB 1GL5A 1UJ0A 1PRMC 1K76A 4JZ4A 2EGCA 4WCIA 2MCNA 3TSWA 5HCKA 4F16A 2MOXA 1GRIA 3THKA 4JJCA 1GFCA 5IHNA 2DE0X 1HSQA 4HVVA 2YUOA 2AK5A 1HD3A 2W10A 2CT4A 4J9FA 2KT1A 2NUZA 3NMZC 1ZUUA 4ESRA 5GJVB 1RI9A 2OJ2A 4J9EA 4RTTA 3ULRB 1HJDA 1VYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWX X;  2FRY A;  3EGU A;  2FRW A;  2DL5 A;  2JMA A;  4M4Z A;  2A36 A;  1NYG A;  3VS6 A;  1B3Q A;  1IO6 A;  1I07 A;  3VS1 A;  1K4U S;  2DLP A;  1Z9Z A;  1ARK A;  1ABQ A;  2K2M A;  2H8H A;  3PE0 A;  2EYW A;  4LE9 A;  4E6R A;  3PVL A;  5IXB A;  2J7I A;  2ROL A;  3H0I A;  1CKB A;  3M0S A;  1AWX A;  1ZUY A;  2RF0 A;  1K0S A;  5FW9 A;  2FPE A;  1YNZ A;  1BK2 A;  2HEQ A;  1M3B A;  1MV3 A;  1UDL A;  1AOJ A;  1FMK A;  1QWE A;  5I22 A;  2EYZ A;  2KRN A;  4JJB A;  4K11 A;  1JQQ A;  1LCK A;  1X27 A;  1BU1 A;  2L2P A;  2K3B A;  2EYY A;  1SEM A;  2QDL A;  1TG0 A;  1JXO A;  3VRZ A;  2VKN A;  3SEM A;  2JMC A;  2LJ1 A;  2JT4 A;  2ESW A;  2K6D A;  5IXF A;  1GCP A;  1UUE A;  2C0I A;  2CH4 W;  1T0H A;  2FEI A;  2KNB B;  1WX6 A;  2RQW A;  3M0R A;  4Z88 A;  1PHT A;  3UF4 A;  4AG1 C;  2YUQ A;  4X1V A;  5GJW B;  1H8K A;  2RQV A;  1K0X A;  1J3T A;  3GBQ A;  1H3H A;  1NEG A;  2L3P A;  2YSQ A;  3ZL7 C;  3EHR A;  2BZY A;  3NHN A;  2L0A A;  2FG0 A;  2YUP A;  3UA7 A;  2BZ8 A;  1WFW A;  1AEY A;  3VS4 A;  2K9G A;  4AFS C;  2O9V A;  1X2K A;  2EKH A;  1YCS B;  3I5R A;  1M8M A;  3H0H A;  4CC2 A;  1X2Q A;  2CDT A;  2KT8 A;  2P4R A;  1SHG A;  3VS5 A;  4IIO A;  2CH4 A;  2F2V A;  1PNJ A;  2ED0 A;  2J06 A;  2LJ0 A;  1NYF A;  1S1N A;  1SRL A;  4OMQ A;  1E6G A;  2GQI A;  2J6F A;  3PVQ A;  2M0Y A;  1WI7 A;  2DIL A;  2DL3 A;  1ZUK A;  2V1R A;  3I5S A;  2LQW A;  2ED1 A;  2DRK A;  2YT6 A;  2A28 A;  1UEC A;  4AG2 C;  3H0F A;  2YDL A;  2F2X A;  1W6X A;  3VRY A;  3RNJ A;  1OPL A;  2DF6 A;  2G6F X;  4FSS A;  2RPN A;  2LCS A;  1U06 A;  2K7A A;  1UE9 A;  4GLM A;  1QKW A;  2L3S A;  1RLQ C;  2DL4 A;  2B86 A;  2J6K A;  1B07 A;  1OPK A;  1YWO A;  1WXT A;  4LNP A;  2E5K A;  1QKX A;  1WYX A;  1Y0M A;  3M0Q A;  4AFQ C;  1QLY A;  2RN8 A;  4J9C A;  1KJW A;  1U3O A;  2AZS A;  2GTO A;  5IH2 A;  1NG2 A;  4RTX A;  1FYN A;  2CRE A;  4ORZ A;  1JU5 C;  2KE9 A;  1GCQ A;  1X6B A;  4CC3 A;  2DVJ A;  1ZBJ A;  1KFZ A;  1QWF A;  3TVT A;  3I9Q A;  1SPK A;  2ABL A;  3EG1 A;  2LX7 A;  1X43 A;  3U23 A;  2I0N A;  2ECZ A;  2RQU A;  3SHW A;  3VS7 A;  2D0N A;  1UHF A;  3JV3 A;  1OOT A;  1G83 A;  1NEB A;  1NLO C;  2D8J A;  1PKS A;  4CC4 B;  4JZ3 A;  1YN8 A;  2F2W A;  3M0P A;  3M0U A;  4HCK A;  2LJ3 A;  1SHF A;  4RUG A;  3VS2 A;  2EPD A;  1X69 A;  2L3Q A;  2SRC A;  2KR3 A;  4Z89 A;  1T0J A;  2DM1 A;  2CSQ A;  1UG1 A;  2X3X D;  3M0T A;  2IIM A;  4AFZ C;  1ZLM A;  2LNH B;  3VS3 A;  2O2O A;  2BZX A;  2ENM A;  5FWB A;  1W70 A;  1ZSG A;  3KFV A;  2GBQ A;  2KRS A;  2GGR A;  2PTK A;  3RBB B;  2DBK A;  1M30 A;  4J9G A;  4F14 A;  2D8H A;  4RTY A;  2DNU A;  1BB9 A;  1YWP A;  2CSI A;  3EHQ A;  1CKA A;  4OMN A;  1U5S A;  4RTZ A;  1UJY A;  4EIK A;  1M3C A;  1PWT A;  1ZX6 A;  1T3L A;  1Z9Q A;  1Y57 A;  1AZE A;  1AWO A;  1MV0 B;  2ROT A;  1UGV A;  5IHK A;  2JS2 A;  2EYX A;  1WLP B;  4LUD A;  2KGT A;  3I35 A;  1AZG B;  4IIM A;  1M3A A;  2GTJ A;  2OI3 A;  4Z8A A;  1T3S A;  4OML A;  1AVZ C;  3UAT A;  1JEG A;  2O88 A;  1AWW A;  1V1C A;  2KYB A;  4CC7 A;  2J05 A;  1VYT A;  2EBP A;  2KRM A;  4OMP A;  2D1X A;  4AFU C;  2DJQ A;  2FO0 A;  1YP5 A;  2KYM A;  1WXU A;  4GBQ A;  4KRT A;  1NLP C;  2JXB A;  4RTV A;  4JPB W;  1SRM A;  2HDA A;  1I1J A;  1E6H A;  2CUB A;  1UTI A;  1PRL C;  2DL7 A;  2EVR A;  2VWF A;  4OMO A;  3C0C A;  4OMM A;  2DL8 A;  2SEM A;  1AD5 A;  2JTE A;  1OEB A;  2JM9 A;  4DEY A;  2LMJ A;  3NGP A;  3R6N A;  2DA9 A;  2KBT A;  2JW4 A;  2KEA A;  2DRM A;  1UHC A;  1KSW A;  2EGE A;  1VA7 A;  1RUW A;  1WDX A;  1ABO A;  2C0T A;  2LP5 A;  2JM8 A;  4LUE A;  1JO8 A;  3EG3 A;  2RNA A;  2HCK A;  4J9I A;  3REB B;  1WIE A;  1TUC A;  2C0O A;  2GNC A;  3CQT A;  1G2B A;  4J9H A;  3O5Z A;  3QWY A;  1GBQ A;  1H92 A;  2RQR A;  2EQI A;  2VVK A;  4Y92 A;  1W1F A;  3FJ5 A;  2LQN A;  2O31 A;  3EG2 A;  1UFF A;  2KRO A;  2EW3 A;  2NWM A;  2V1Q A;  1VYU A;  2CT3 A;  2AKL A;  2MIO A;  1E7O A;  1GCQ C;  1AWJ A;  1TUD A;  2YUN A;  1RLP C;  2DX1 A;  2HBW A;  3NPF A;  3A98 A;  1GFD A;  5IHI A;  1BBZ A;  5FWC A;  4D8K A;  2W0Z A;  4A63 B;  1I0C A;  1X6G A;  2DYB A;  3H41 A;  4HXJ A;  4DEX A;  2FPF A;  4LN2 A;  1WXB A;  2HSP A;  2RQT A;  2EGA A;  3VS0 A;  2RMO A;  2BTT A;  1XOV A;  1OV3 A;  5ECA A;  4JJD A;  2J6O A;  4QT7 A;  1JXM A;  1MUZ A;  1CSK A;  1NM7 A;  1EFN A;  2CUD A;  1K1Z A;  2JS0 A;  4D8D A;  3LH5 A;  4HVU A;  2FPD A;  2LZ6 B;  5EC7 A;  4HVW A;  2AKK A;  5I11 A;  2DMO A;  2O9S A;  4F17 A;  3TSZ A;  4ZNX A;  2AZV A;  4J9D A;  2X3W D;  1WA7 A;  2A37 A;  2K79 A;  1KIK A;  3UA6 A;  4RTW A;  1GBR A;  4RTU A;  1K9A A;  2DBM A;  3EG0 A;  3REA B;  2PZ1 A;  2KXD A;  1QCF A;  4R0K A;  2A08 A;  5L23 A;  2KXC A;  2OAW A;  2PNI A;  1M27 C;  2XMF A;  1SSH A;  2M51 A;  1N5Z A;  3IQL A;  4J9B A;  1PKT A;  1A0N B;  1GL5 A;  1UJ0 A;  1PRM C;  1K76 A;  4JZ4 A;  2EGC A;  4WCI A;  2MCN A;  3TSW A;  5HCK A;  4F16 A;  2MOX A;  1GRI A;  3THK A;  4JJC A;  1GFC A;  5IHN A;  2DE0 X;  1HSQ A;  4HVV A;  2YUO A;  2AK5 A;  1HD3 A;  2W10 A;  2CT4 A;  4J9F A;  2KT1 A;  2NUZ A;  3NMZ C;  1ZUU A;  4ESR A;  5GJV B;  1RI9 A;  2OJ2 A;  4J9E A;  4RTT A;  3ULR B;  1HJD A;  1VYV A; 
#chains in the Genus database with same CATH topology
 4ZTF A;  2FRW A;  2JMA A;  3FRN A;  2A36 A;  4J7F A;  1IO6 A;  3QII A;  1PG5 B;  2R5M A;  3RDV A;  3OYM A;  5KCO A;  2I2L A;  5GMK e;  2E5Q A;  2FZC B;  3L1A A;  3CCM T;  3QUI A;  5GAO q;  2J7I A;  2ROL A;  3H0I A;  1CKB A;  3OYB A;  1VQ5 Q;  2YHT A;  1M1F A;  4M78 B;  2DTH A;  1YFN A;  1RAH B;  1BK2 A;  2HEQ A;  2M16 A;  2X51 A;  3DB3 A;  1YJN Q;  1RL2 A;  1AOJ A;  1QWE A;  4JJB A;  4K11 A;  1JQQ A;  1X27 A;  2H3J A;  5IN1 A;  1BU1 A;  2K3B A;  4BUG A;  4F7U G;  1SEM A;  4M7D E;  2QDL A;  1TG0 A;  2K4Y A;  3CXC P;  1FMW A;  1VQL A;  1MGQ A;  3M58 A;  1YI2 A;  1HYO A;  2YRC A;  1GCP A;  3CME A;  2CH4 W;  1T0H A;  2E10 A;  1WX6 A;  2XU8 A;  4M7A A;  4PJO B;  3CCL Q;  1PHT A;  3UF4 A;  3CCJ T;  2QA4 T;  3S3N A;  3GBQ A;  1H3H A;  2YSQ A;  1IRE B;  1H3Z A;  1D09 B;  3NHN A;  1NJI U;  3CC7 Q;  2BZ8 A;  2X4J A;  3JB9 F;  3OYH A;  3ASK A;  3VV0 A;  4AFS C;  1JBM A;  1YJN A;  3H0H A;  4Z02 A;  2OTL A;  5CKB A;  2K5I A;  1SHG A;  1Q86 C;  2JN0 A;  4CI0 C;  2F2V A;  2ED0 A;  3F70 A;  1S1N A;  1SRL A;  4D6W A;  4OMQ A;  1TWB A;  3SDZ A;  1QQJ A;  1C1A A;  2DIL A;  3I5S A;  5FLX E;  2DJZ A;  2GQV A;  2A28 A;  3VJP A;  4AG2 C;  1VQP A;  1IHV A;  2PUO B;  4IUU A;  4J8O A;  4F7U A;  1BYM A;  2MI6 A;  1I5L A;  1UE9 A;  4GLM A;  1QKW A;  1FX7 A;  1M90 R;  2X9H A;  2FVU A;  2J6K A;  2ZZD A;  3RUX A;  1B07 A;  2LC4 A;  1OPK A;  1WXT A;  1YIJ A;  1QMC A;  1UGQ B;  1KJW A;  3X28 B;  2GTO A;  2KE9 A;  1GCQ A;  2DVJ A;  2CZ1 B;  3S3M A;  1TXQ A;  3I9Q A;  5GAO p;  5D6Y A;  1QVG A;  2I0N A;  2KY9 A;  4XTZ A;  2GCX A;  2RQU A;  3CCE T;  1OZ2 A;  5DY9 A;  1O75 A;  5GAN 7;  4RCB A;  1WQ7 A;  2XI9 A;  2LDM A;  2VGM A;  5LJ3 f;  3DB4 A;  5FRO A;  4C8Q G;  1YHQ A;  4M77 F;  1SHF A;  2EPD A;  2V8J A;  8AT1 B;  3CCQ Q;  2QQB A;  4LDV A;  1VQ6 Q;  1YCY A;  5CAI A;  2CSQ A;  2DZC A;  3GLX A;  1C0M A;  1X6O A;  3BE3 A;  4MZM A;  1LNX A;  3M55 A;  2E4H A;  1YJ9 Q;  5GAO l;  3T9N A;  4M75 D;  2EYQ A;  2WSE E;  3HKS A;  1W70 A;  2R58 A;  2GBQ A;  2QK0 A;  2HAX A;  5LJ5 e;  1VQK Q;  5LJ3 g;  3RBB B;  3BDU A;  5KYY B;  4AT1 B;  1YJ9 A;  4RTY A;  2DNU A;  1BB9 A;  4DBF A;  1CKA A;  2CYZ B;  1U5S A;  4C8Q C;  3MP6 A;  1ZX6 A;  4HT8 A;  2QEX T;  1Z9Q A;  4FT2 A;  1MV0 B;  1UGV A;  1VQ7 A;  3JCM P;  3DLL A;  4KUD K;  2KGT A;  3BY7 A;  2GTJ A;  4XTY A;  3CCU Q;  1JEG A;  4M7D B;  5GAN f;  1TSF A;  1V1C A;  2GF7 A;  3S6W A;  1SG5 A;  4C0F A;  4A54 A;  4OMP A;  1M1K R;  2D1X A;  3GPL A;  3MO8 A;  1G8X A;  2FO0 A;  1YP5 A;  1K9M C;  4QVZ A;  1NLP C;  3DKM A;  4RTV A;  4JPB W;  2FZG B;  2DAQ A;  2KMT A;  1IGQ A;  5J39 A;  4C8Q A;  4DBR A;  3GIB A;  5CK9 A;  1LJO A;  3UPU A;  1N9S A;  2EVR A;  5FRM A;  3OSV A;  3QO3 A;  4OMO A;  1Q82 R;  5I2S A;  1O9S A;  1I8F A;  1QVF A;  1OEB A;  2JM9 A;  3R6N A;  5HY6 A;  3JCM W;  2EGE A;  4ANJ A;  4LUE A;  1EX4 A;  2HKN A;  4QKU A;  4A4H A;  4FU6 A;  2CS7 A;  1JJ2 A;  4YTL A;  1VQ4 Q;  4ZGE B;  1OZ3 A;  2CZ6 B;  4EMK A;  1K8A C;  3M9Q A;  1XQH A;  2EQK A;  2LT1 A;  1WHL A;  3O5Z A;  1KD1 R;  3QWY A;  2K3Y A;  1Q82 C;  2F69 A;  1Q7Y C;  2WSC E;  2RHZ A;  1W1F A;  2F5T X;  4BI3 A;  2MYS A;  4HT9 A;  1G3S A;  1UFF A;  4ME7 A;  1VYU A;  2RJE A;  2CT3 A;  2IPO B;  2MIO A;  4N4G A;  1GCQ C;  4E7H A;  2NUP A;  2YUN A;  2DX1 A;  4IUR A;  3CC7 A;  3JCM g;  4X34 A;  1QP3 A;  3PTA A;  4M7D C;  4M7A F;  2JNG A;  4F7U E;  1KD1 C;  5FWC A;  1M5Q 1;  2FPF A;  2DXC A;  5LJ5 f;  1YHQ T;  2HQH A;  3OMG A;  4JJN K;  2RMO A;  1PD0 A;  2E64 A;  1HK9 A;  1XOV A;  1OV3 A;  3CCS T;  5ECA A;  1RAI B;  5GMK h;  2KAF A;  4QT7 A;  1JXM A;  3BDL A;  1MUZ A;  2Y4Y A;  3QJY A;  1OU8 A;  3L2V A;  1QCO A;  2JS0 A;  2K57 A;  4II1 A;  4HCC A;  3HRT A;  3GOX A;  2COZ A;  2MPX C;  5I11 A;  2YWW A;  2M1H A;  2LQK A;  4PJO D;  1XTD A;  3OYK A;  2X3W D;  4C5I A;  2QG9 B;  3UA6 A;  2XID A;  1QVP A;  4AMC A;  4E7J A;  5C6S A;  3EG0 A;  3OS2 A;  3EFR A;  5LJ5 d;  3REA B;  2E65 A;  1QCF A;  4DA4 A;  5KYN A;  1FXX A;  2OAW A;  3I55 T;  2F5K A;  2PNI A;  1M27 C;  1Y7X A;  2BE9 B;  2HNI A;  2O4X A;  5GAN h;  4HKE A;  1YI2 Q;  4C0D C;  3QZ5 B;  3X25 B;  1KHI A;  1UJ0 A;  1VQ4 T;  4EPC A;  4JS4 A;  2FL7 A;  2QQA A;  4C0D B;  2EQU A;  3FIF A;  4HA8 A;  2XKO C;  3VYG A;  2MOX A;  4JJC A;  3OYA A;  4L59 A;  1GFC A;  5IHN A;  4HVV A;  3ZBD A;  2V8I A;  1W2B A;  1HD3 A;  4A4K A;  2ZGW A;  3CBP A;  2CT4 A;  4QVD A;  4E7S A;  2OAU A;  1ZUU A;  3H8Z A;  1D1A A;  2FB7 A;  4XU1 A;  1VQO Q;  4RTT A;  1BCO A;  3QBY A;  3EGU A;  4M4Z A;  5GAM d;  3HL8 A;  1NYG A;  3VS6 A;  1B3Q A;  2QGF B;  1Y71 A;  2EJF A;  5A2Q E;  2ZAE A;  1VQO A;  3CPW P;  1K4U S;  2DLP A;  1ARK A;  3EGD A;  3QPH A;  1WNL A;  5GMK i;  3PE0 A;  5HKC A;  4LD9 K;  5GAM f;  1M2V B;  1ZSZ B;  4J7I A;  3M0S A;  2DIG A;  1AWX A;  3OS1 A;  1FWZ A;  2RHX A;  1RAF B;  4FM4 B;  1YNZ A;  4HCZ A;  1M3B A;  2RK2 A;  1UDL A;  3LYI A;  2EYZ A;  2KRN A;  4JRP A;  1LCK A;  1YJ9 T;  1BI3 A;  2L2P A;  2M9U A;  3ME9 A;  3CCV Q;  2EYY A;  3AT1 B;  3EGD B;  3GNG A;  3JCM Q;  2PVO B;  2RHI A;  2VKN A;  3SEM A;  2LRQ A;  3JRZ A;  1N6A A;  1M2O A;  3EG9 A;  2E1H A;  2FEI A;  2KNB B;  3RKW A;  3M0R A;  4Z88 A;  3FC3 A;  5GJW B;  3OY9 A;  1K0X A;  4JRI A;  2DEQ A;  2RJF A;  1VQN Q;  2BZY A;  3VKI A;  3CCJ Q;  2L0A A;  2FG0 A;  2YUP A;  1YI2 T;  1AEY A;  2P0Q A;  4L6V 5;  1RAB B;  1YCS B;  2D9T A;  1M8M A;  4CC2 A;  3A8H B;  2CDT A;  4A53 A;  1YIJ T;  2QGG A;  2P4R A;  3VS5 A;  4ZN3 A;  2EJG A;  1PNJ A;  3CXC A;  2GQI A;  2Y90 A;  3CC4 Q;  2J6F A;  4OMF B;  3MEU A;  1D3B A;  3I56 A;  1ZUK A;  2EAY A;  1MMN A;  4HCB A;  1FMV A;  5D6W A;  5DLO A;  1UEC A;  1ZQ1 A;  2NLU A;  2F2X A;  1R77 A;  1G3Y A;  3RNJ A;  3RKY A;  5FU6 B;  2DF6 A;  1VQ8 A;  2G6F X;  2RPN A;  2LCS A;  1VQL T;  1U06 A;  4P5N A;  1RAG B;  2DL4 A;  2B86 A;  1IHW A;  1YWO A;  2HZY A;  2A3L A;  2L89 A;  4LNP A;  1MMG A;  1S72 Q;  1NPP A;  2VV5 A;  4NS5 A;  1Y0M A;  4AFQ C;  3CMA T;  3L2W A;  1G3W A;  3HPW A;  2CZ7 B;  2NUT A;  3M53 A;  3CC2 T;  3QDF A;  2DVE A;  2GFA A;  1VQP T;  1K73 U;  4RTX A;  4ORZ A;  1Q82 U;  3PNW C;  4C92 D;  4QVC A;  4CC3 A;  1KFZ A;  1NZ9 A;  4XU3 A;  1QW1 A;  3OYI A;  1N8R U;  2QXF A;  4BE0 A;  4M7A C;  2LX7 A;  3TRE A;  3V8L A;  1WJR A;  1BIA A;  3PMT A;  3U23 A;  3I56 Q;  3SB2 A;  2D0N A;  2P4T A;  1UHF A;  4M77 C;  3JV3 A;  1OOT A;  3N5B B;  4C8Q E;  2KSS A;  1PKS A;  2MWP A;  2OX7 A;  3CEY A;  1YN8 A;  2F2W A;  3I55 Q;  4Y91 A;  1KQS P;  3M0U A;  4HCK A;  2LJ3 A;  1LPL A;  3E9F A;  4RUG A;  2MAM A;  4M75 F;  2L3Q A;  2SRC A;  3JCM h;  2LX9 A;  2WSF E;  1UG1 A;  2X3X D;  2OTJ Q;  1QP2 A;  1BI2 A;  2IIM A;  1Q95 G;  3EGX B;  3JSC A;  3QYH B;  3VS3 A;  2DET A;  1VQN A;  3MJX A;  2C06 A;  2CP0 A;  5KE2 A;  1PC0 A;  2PTK A;  4PLI A;  4J9G A;  2D8H A;  1NJI R;  2YXY A;  4M78 E;  3EHQ A;  1U1S A;  2CSI A;  4XAX B;  4RTZ A;  2OTL Q;  4EIK A;  1M3C A;  1PWT A;  1RAC B;  1WJQ A;  2H3E B;  3A8L B;  2ROT A;  2EYX A;  3EGX A;  1M2V A;  1WLP B;  3HRS A;  2RH2 A;  3X20 B;  4LUD A;  3I35 A;  4PJO G;  5CKE A;  5CQY A;  3CCJ A;  4M78 G;  3CCR T;  1AVZ C;  5GAN 6;  3UAT A;  2O88 A;  2L8D A;  5GAN 3;  3LX7 A;  1KQS A;  5LJ5 h;  1VYT A;  3NTH A;  4BY6 B;  3ER0 A;  2HKQ B;  4BE2 A;  1JJ2 P;  4AFU C;  2JUF A;  4M77 D;  4F7U B;  2RK1 A;  3EH2 A;  1SSF A;  2DIQ A;  2JXB A;  3GF5 A;  2V8K A;  2DYI A;  4JDS A;  2A7Y A;  3GNF B;  4DOW A;  3UWN A;  3CD6 A;  5GAN 8;  2HDA A;  1KHC A;  3L2Z A;  1I1J A;  5HK0 A;  1PRL C;  4E7L A;  1OX9 A;  1BKB A;  2DL7 A;  2DXT A;  4C5H A;  3VUB A;  4NL3 A;  3CC7 T;  2DL8 A;  3CME T;  1AD5 A;  4KT0 E;  2JTE A;  4LD6 A;  3PIO A;  3Q1J A;  4DEY A;  3JCM X;  3CPW S;  4BAC A;  3NGP A;  2KDS A;  2JW4 A;  3V7S A;  4B9W A;  2DRM A;  2QA4 A;  4R55 A;  2FYK A;  3QXE B;  1UHC A;  1KSW A;  1Q86 U;  1RUW A;  1WDX A;  2C0T A;  2IG0 A;  5GAN e;  1JO8 A;  3EG3 A;  2DER A;  1Y07 A;  4BI4 A;  2CKK A;  4M7D G;  1WIE A;  4IUV A;  1RI0 A;  1TUC A;  4J6X A;  1Q7Y R;  4UC4 A;  1TS9 A;  2XK0 A;  3CQT A;  1TUG B;  3JCM d;  2OTJ T;  5A0L A;  5KYW A;  2RQR A;  5A0D A;  4ATO A;  2VVK A;  4Y92 A;  3CD6 Q;  1D1C A;  3LWH A;  3CBM A;  3KXT A;  4IUP A;  2LQN A;  2CP6 A;  2O31 A;  2AKL A;  3SD4 A;  3OYY A;  3S3O A;  1Y96 A;  5I21 A;  1TUD A;  1B7T A;  1KQ2 A;  4KH0 B;  2HBW A;  3M5A A;  3NPF A;  3A1P A;  1D0X A;  4KBM B;  1VQL Q;  1BBZ A;  1UB4 A;  5GAO r;  1RAE B;  2W0Z A;  2LVM A;  1SF9 A;  3H41 A;  2LCC A;  4DEX A;  1VQ5 A;  2LTO A;  2RQT A;  2JZ2 A;  4R56 A;  1ZHI A;  5IT9 E;  5FU7 C;  3NFC A;  3VS0 A;  3JCM f;  2Z0W A;  2LQ8 A;  1YIT T;  5FU6 C;  3CC2 Q;  4FL6 A;  3LGF A;  3MEW A;  3JCM V;  4E7K A;  1BI0 A;  2DXU A;  1CSK A;  1EFN A;  4O5V A;  3KBG A;  1NJI C;  3LH5 A;  4HVU A;  2LZ6 B;  4PFP A;  4E7Z A;  2DMO A;  3OYL A;  4PLL A;  3MCA B;  3VUZ A;  4JLG A;  1Q86 R;  3ZEH A;  4M77 E;  3CCL A;  1KIK A;  2QEX A;  3MP1 A;  2DBM A;  1UGR B;  4C92 C;  2A08 A;  2KXC A;  5HK3 A;  1RAD B;  1PSF A;  2M51 A;  4KUL A;  1N5Z A;  3SWN C;  3IQL A;  4A4F A;  1Q81 C;  1K8A U;  3SWN B;  4JRQ A;  4WCI A;  4J6W A;  1BI1 A;  5HCK A;  3CCU A;  3O8V A;  1W2B P;  1PM3 A;  2AK5 A;  5LJ3 d;  5GMK m;  2Y4X A;  4XQ3 A;  4O6J A;  4EMK B;  4J9F A;  1NPR A;  1OUL A;  4WTO B;  2RD1 A;  2NUZ A;  3NMZ C;  4DQ2 A;  4ZGD B;  4ESR A;  3H9N A;  2MK5 A;  1RI9 A;  8ATC B;  2QAZ A;  1VYV A;  2RHU A;  3QWX X;  5DLQ E;  2FRY A;  1QVF S;  2DL5 A;  3JCM c;  2KQW A;  1I07 A;  2DO3 A;  1YJW Q;  2E12 A;  2K2M A;  5LJ5 g;  3G6E Q;  3M4G A;  3CCR A;  4E6R A;  4ZTJ A;  4RG8 A;  2DKG A;  5CCA A;  3QSU A;  3MET A;  3L2U A;  4C8Q F;  1ZUY A;  2RF0 A;  1WZO A;  1K0S A;  1VQ6 A;  2DTI A;  4QQ6 A;  5FW9 A;  2FPE A;  3JCM J;  3TEE A;  2RI5 A;  1MV3 A;  3OQ5 A;  2VB6 A;  1FMK A;  1M1G A;  4EMH A;  3PFS A;  2AIR B;  3UDC A;  3HHT B;  1JXO A;  3A8O B;  4N4H A;  1OI1 A;  1N9R A;  4N0A A;  3VRZ A;  3RER A;  3CCE A;  2LJ1 A;  2ESW A;  5IXF A;  1KC8 C;  1Q81 R;  1UUE A;  3BW1 A;  2C0I A;  3EFS A;  4FIB A;  4GLK A;  4M75 E;  5KYU A;  1UGS B;  2QEX Q;  2KVQ G;  1WHJ A;  2ZPB B;  3P8H A;  2FZK B;  2RQV A;  1J3T A;  5GAN g;  2RJD A;  3A8M B;  4NOY A;  2L3P A;  3ZL7 C;  3EHR A;  4C92 B;  1WFW A;  3VS4 A;  3RR6 A;  5AYF A;  2O9V A;  1YBY A;  3CCS Q;  2QTV A;  1K9M U;  1X2Q A;  4BD3 A;  2KT8 A;  1OQK A;  1VQM A;  4IIO A;  1WHH A;  3MEA A;  3CCQ A;  2CH4 A;  2LJ0 A;  4TVR A;  1UEB A;  1OU9 A;  1D0Z A;  2QQ9 A;  1VQ7 Q;  4J83 A;  2E70 A;  2JJ9 A;  4LDX A;  2V1R A;  1ACM B;  5GAN 2;  3OS0 A;  4BE1 A;  4M7A G;  2ED1 A;  2DRK A;  3OBY A;  4MMK A;  2MMP A;  2VYT A;  2CP7 A;  3H0F A;  2YDL A;  4ZGJ B;  3L2R A;  2O01 E;  1W6X A;  2P0K A;  4C8Q B;  2VC8 A;  4FYY B;  3VRY A;  4M7A E;  1PSE A;  1OPL A;  1P92 A;  4FSS A;  1OX8 A;  2R5A A;  2L3S A;  1RLQ C;  2CZ0 B;  2B8A A;  2HQE A;  4XU2 A;  2E5K A;  1WYX A;  2LT4 A;  1WPY A;  4RCC A;  1QLY A;  2CP2 A;  2RN8 A;  1U3O A;  2AZS A;  2KK4 A;  1NG2 A;  1FYN A;  2CRE A;  4M78 D;  1D0Y A;  1JU5 C;  3CCE Q;  1M9S A;  3G71 A;  2QQR A;  1QWF A;  3V7R A;  2E41 A;  1SPK A;  4E2F B;  2ABL A;  1N27 A;  2KI7 A;  3MKD A;  3CCU T;  3WVD B;  1S72 T;  1M1K U;  3LW5 E;  1X43 A;  2ECZ A;  3M4Y A;  3OW2 P;  3M54 A;  4XU0 A;  1WGS A;  2RI3 A;  4IUT A;  1VQP Q;  3V8K A;  4M75 C;  1QVG S;  1NEB A;  1NLO C;  3H6Z A;  1N8R R;  4CC4 B;  1YIT A;  3CMA A;  4JZ3 A;  4EDU A;  4PJO E;  2M02 A;  3CCS A;  2VXE A;  3M0P A;  4BB7 A;  1VQ5 T;  3MEV A;  4LDU A;  3VS2 A;  1IGU A;  3VYH B;  2KR3 A;  1T0J A;  2ZPG B;  2BUD A;  2BKD N;  2E6N A;  2NUP B;  2LNH B;  1ZSZ C;  4M75 B;  5GAO m;  3FDR A;  4QQD A;  2BZX A;  5FWB A;  1ZSG A;  3OS5 A;  3UT1 A;  1B34 A;  2KRS A;  2GGR A;  3INZ A;  3RIR A;  3DLM A;  4LDY A;  2DBK A;  2XG8 D;  1QVG P;  1M30 A;  4F14 A;  4M7A B;  1YWP A;  4LXC A;  4OMN A;  1UJY A;  1PCX A;  3OW2 S;  3X26 B;  5GAM j;  4RMO A;  2D0Q B;  2PVD B;  1IZ6 A;  1VQ7 T;  1AWO A;  3MP8 A;  4QQG A;  2JS2 A;  4RG2 A;  1QVF P;  5KYW B;  4BI8 B;  1AZG B;  4IIM A;  5CIU A;  2OI3 A;  4Z8A A;  5KYY A;  1T3S A;  3HSB A;  4OML A;  3PT9 A;  1LOJ A;  1H64 1;  1JRI A;  1HXD A;  2ZPF B;  2KYB A;  2QQS A;  2VGN A;  3G6E A;  3CCR Q;  2J05 A;  2EBP A;  3P8B B;  2DD5 A;  2DJQ A;  4KGV B;  1WXU A;  3OYG A;  5LJ5 j;  4PNO A;  4KRT A;  4C5G A;  2YRD A;  2PQW A;  4EMK C;  5CO7 A;  2BIV A;  4PJJ A;  3I55 A;  1KD1 U;  5GAM e;  2QTX A;  1VQ9 Q;  1TU0 B;  4C8Q D;  1WHK A;  1VQ6 T;  2LCL A;  2VWF A;  5IAY A;  3X24 B;  2SEM A;  3FJP A;  4M77 A;  5LJ3 h;  3CC4 T;  4C0Z A;  1I81 A;  3ZFJ A;  3TCJ A;  1ZSZ A;  2LMJ A;  3SFM A;  3QZ9 B;  2KBT A;  3A8G B;  1YIJ Q;  3CME Q;  4KGZ B;  1VA7 A;  5GAM g;  1ABO A;  2CP5 A;  2DFU A;  2VAS A;  4E7I A;  3M57 A;  5CKH A;  3EAE A;  1VUB A;  3TU4 K;  2RNA A;  4J9I A;  4PFO A;  2CP3 A;  4KH1 B;  1YJN T;  4J9H A;  4XK8 E;  5LJ3 j;  4XTX A;  1GBQ A;  2EQI A;  3VU3 C;  1MHN A;  1AHJ B;  2EQJ A;  3HFO A;  3CPW A;  1VQM Q;  3PMI A;  4OB3 B;  3OYE A;  3OBW A;  2KRO A;  2EW3 A;  2NWM A;  1MNE A;  2K2V A;  4OF1 A;  3J80 E;  3CMA Q;  3PGG A;  2AT1 B;  3CXC S;  1W4S A;  5GAM h;  1W2B S;  3HP9 A;  4DOV A;  5D6X A;  3FLG A;  1RLP C;  3I56 T;  1M1K C;  4B6M A;  2RJC A;  2DEU A;  2R57 A;  1GFD A;  1V76 A;  5I2M A;  5IHI A;  1VIE A;  4FSX A;  4D8K A;  4A63 B;  1X6G A;  2DYB A;  3OMC A;  3TQ7 P;  4HXJ A;  4LN2 A;  1WXB A;  4V2S A;  2EGA A;  4KGX B;  2BTT A;  3JB9 H;  2J6O A;  3JAM E;  1YIT Q;  1NM7 A;  2YLC A;  1K1Z A;  5DM7 R;  2RI2 A;  1V29 B;  2FPD A;  5EC7 A;  4PJN A;  4HVW A;  2AKK A;  2HD0 A;  4EMG A;  1WHG A;  3RMQ A;  3TSZ A;  2EJ9 A;  4M7D A;  2HMA A;  3WVE B;  1MND A;  4C92 F;  4M78 A;  4J9D A;  2QAS A;  1WA7 A;  1VQ4 A;  3BFM A;  2K79 A;  1KQ1 A;  4FCY A;  3L42 A;  1SKU B;  3CPF A;  4RTW A;  1GBR A;  4RTU A;  1K9M R;  4JS5 A;  2PZ1 A;  4R0K A;  3G71 Q;  2ZCF B;  5L23 A;  2L5Q A;  1SSH A;  1R8O B;  4OVA A;  2DD4 A;  3JB9 I;  5KYX B;  2PVG B;  3WXM B;  1N8R C;  1TTH B;  2ZPE B;  1A0N B;  2YRV A;  4A4E A;  1GL5 A;  1F1B B;  3NTK A;  2E3H A;  4JZ4 A;  1Y96 B;  3E19 A;  4N0A C;  3C95 A;  3M56 A;  2EGC A;  1GXI E;  2MCN A;  1KK7 A;  4FYV B;  3TSW A;  5GAN d;  2YLB A;  3OYF A;  4XTV A;  3G6E T;  2XDD A;  1GRI A;  3THK A;  2CGH A;  1HSQ A;  2YUO A;  3KUF A;  1VQM T;  2W10 A;  2NUT B;  4C92 G;  4PFZ A;  4DBH A;  3HRU A;  3EFO B;  5GJV B;  4J9E A;  1G3T A;  2OJ2 A;  3ULR B;  1HJD A;  4ELZ C;  5C0M A;  3J81 E;  3V7C A;  2RHY A;  3VS1 A;  2QDY B;  1VQK T;  1Z9Z A;  1VQO T;  1ABQ A;  4M7A D;  2H8H A;  2EYW A;  4LE9 A;  3A5Z B;  3PVL A;  5IXB A;  3MPU B;  3E2U A;  2ZPI B;  3CCV A;  1ZA2 B;  2JTM A;  3LGL A;  1OYX A;  3C12 A;  1X01 A;  3OB9 A;  3PIP A;  5LJ3 e;  1NBE B;  2IVW A;  5J26 A;  4PJO F;  5I22 A;  1VQ9 T;  3HFN A;  1TOV A;  2NYS A;  3E1S A;  3CD6 T;  2DTO A;  2RO0 A;  1ZBX A;  4PJO C;  4FT4 A;  1YHQ Q;  2JMC A;  2JT4 A;  4RKU E;  2VXF A;  2K6D A;  2QA4 Q;  5AT1 B;  2DXB A;  1MMD A;  4X9D A;  2RQW A;  2E6Z A;  4OP0 A;  4AG1 C;  2YUQ A;  4X1V A;  1H8K A;  3OW2 A;  4M78 F;  3G71 T;  1NEG A;  1M90 C;  1KG1 A;  3RES A;  1Q81 U;  3UA7 A;  2K9G A;  2EQM A;  1X2K A;  1X75 C;  5CKF A;  2EKH A;  3I5R A;  3MHX A;  3E9G A;  2HL3 A;  5KH6 A;  4IKF A;  2J06 A;  1NYF A;  2XDP A;  5KCH A;  1E6G A;  3PVQ A;  3OYC A;  2M0Y A;  1WI7 A;  4ELY C;  4FYX B;  2X4W A;  2DL3 A;  2LQW A;  2YT6 A;  2P0P A;  3OA6 A;  4X9C A;  4Q5W A;  3CC4 A;  4M75 G;  4DBQ A;  4PJL A;  2K7A A;  1IRX A;  2XDB A;  1B34 B;  1JJ2 S;  4PKC C;  1M4Z A;  2ATC B;  1QKX A;  2X4Y A;  3M0Q A;  5GAN 4;  4J9C A;  1YJW A;  4NL2 A;  3D7S B;  3C94 A;  5IH2 A;  4OB1 B;  2EFI A;  2FHD A;  1R0C B;  4PJO A;  1X6B A;  4M7D D;  5L8R E;  1ZBJ A;  2K3X A;  3TVT A;  4OGE A;  5CKD A;  2MF2 A;  5FRN A;  3EG1 A;  3CCQ T;  3RKX A;  4CRI A;  1G5V A;  1R0B G;  3SHW A;  3VS7 A;  4BDY A;  2EKO A;  5KYX A;  1G83 A;  4PJM A;  2D8J A;  3R6O A;  2DZ9 A;  1K8A R;  2A0F B;  1XNI A;  3OYN A;  4IUQ A;  4E47 A;  1VQ9 A;  4OGC A;  2QI2 A;  1X69 A;  1M8V A;  4Z89 A;  2DM1 A;  2X35 A;  3QYG B;  3M0T A;  1VQ8 T;  1U1T A;  4AFZ C;  1ZLM A;  3P8D A;  2HL5 C;  1M90 U;  1BCM A;  2HBP A;  4Y28 E;  4JRK A;  4BDZ A;  2HQX A;  2O2O A;  5KYU B;  3EFO A;  2ENM A;  4MZT A;  3NTI A;  3KFV A;  3EG9 B;  3RMS A;  1ZA1 B;  2COW A;  4F04 B;  1WHM A;  4PL6 A;  1RAA B;  1LVK A;  2DPP B;  1T3L A;  4KUI A;  1Y57 A;  4A4G A;  1AZE A;  3CBO A;  3SWN A;  5IHK A;  1WQW A;  2MWO A;  4OB0 B;  1M3A A;  2K5F A;  3C4S A;  5EG2 A;  2BE7 D;  7AT1 B;  4BY6 C;  3EH1 A;  4MZP A;  1U8R A;  1AWW A;  1JB0 E;  3JB9 D;  1MMA A;  2VUB A;  3G7Z A;  4CC7 A;  2KRM A;  5CR2 A;  4OB2 B;  2D6F A;  4ZN1 A;  2KYM A;  2M0O A;  3LWI A;  4GBQ A;  1Q7Y U;  4J5Y A;  2X4X A;  2HSE B;  1EZZ B;  1SRM A;  5LL6 S;  3JB9 G;  4FW2 A;  1E6H A;  2CUB A;  1UTI A;  5CVI A;  1DJ7 B;  3HTR A;  1IB8 A;  1WJS A;  5M9O A;  2O4X B;  5KE3 A;  3C0C A;  4OMM A;  4C5E A;  1TH7 A;  3OSS C;  2OTJ A;  2EWN A;  2DA9 A;  1D1B A;  2KEA A;  1S72 A;  3G4S A;  5GMK j;  1I4K 1;  2LP5 A;  2AHJ B;  2GFU A;  2JM8 A;  1D3B B;  1BIB A;  2HCK A;  3OYD A;  2OTL T;  3V8J A;  3REB B;  3LLR A;  4J6Y A;  2C0O A;  2GNC A;  4WF2 A;  2K5L A;  2E3I A;  1G2B A;  2EIF A;  1H92 A;  3QKJ A;  3JCM b;  1YJW T;  1AT1 B;  3QHS A;  4QW2 A;  4C92 E;  3FJ5 A;  3EG2 A;  1KC8 U;  2RA2 A;  3AHU A;  2V1Q A;  5FU7 B;  3G4S T;  2PU9 B;  1E7O A;  4M75 A;  4B9X A;  6AT1 B;  1VQN T;  4C0G A;  1AWJ A;  4M78 C;  1XJW B;  4LDW A;  1PD1 A;  3A98 A;  2RM4 A;  3CCM A;  5GAN j;  2XIC A;  3G1J A;  3QDR B;  4MML A;  1I0C A;  4GY5 A;  1KC8 R;  2HSP A;  2COY A;  3FEO A;  5D7U A;  3CCM Q;  4M7D F;  1K73 C;  2ZPH B;  4FW1 A;  3URG A;  4JJD A;  2JOY A;  4FYW B;  4L5G A;  4XTW A;  5GAO n;  3CCV T;  2XD0 A;  2CUD A;  4D8D A;  4MDW A;  3M59 A;  2DK3 A;  1VIF A;  2RB6 A;  1I5O B;  2O9S A;  1VOM A;  4F17 A;  2XHC A;  5A0G A;  4ZNX A;  2JVV A;  5CQX A;  2AZV A;  4C92 A;  3OYJ A;  2LNV A;  2A37 A;  1QCN A;  2PUK B;  1KQS S;  3CCL T;  1IXD A;  1K9A A;  2G3R A;  1UGP B;  4JLI A;  2KXD A;  4XTU A;  9ATC B;  4PK4 A;  2L3R A;  4M77 G;  2XMF A;  2JTF A;  3FB9 A;  1VQ8 Q;  1NE8 A;  4M77 B;  3GP8 A;  1C6V X;  5J3B A;  4J9B A;  1PKT A;  3QG1 A;  3L2Q A;  4N4I A;  2F1L A;  2V26 A;  2WAC A;  1PRM C;  1K76 A;  3QJ6 A;  4MDX A;  4F7U F;  5GAN 5;  4F16 A;  3LH0 A;  3JB9 J;  1K73 R;  2DE0 X;  1VQK A;  4JUV A;  1EIF A;  5GMK l;  2P84 A;  2KT1 A;  3JCM e;  3G4S Q;  3CC2 A;  2QYZ A;  3J7A F;  4VUB A; 
#chains in the Genus database with same CATH homology
 3QWX X;  2FRY A;  3EGU A;  2FRW A;  2DL5 A;  2JMA A;  4M4Z A;  2A36 A;  1NYG A;  3VS6 A;  1B3Q A;  1IO6 A;  1I07 A;  3VS1 A;  1K4U S;  2DLP A;  1Z9Z A;  1ARK A;  1ABQ A;  2K2M A;  2H8H A;  3PE0 A;  2EYW A;  4LE9 A;  4E6R A;  3PVL A;  5IXB A;  2J7I A;  2ROL A;  3H0I A;  1CKB A;  3M0S A;  1AWX A;  1ZUY A;  2RF0 A;  1K0S A;  5FW9 A;  2FPE A;  1YNZ A;  1BK2 A;  2HEQ A;  1M3B A;  1MV3 A;  1UDL A;  1AOJ A;  1FMK A;  1QWE A;  5I22 A;  2EYZ A;  2KRN A;  4JJB A;  4K11 A;  1JQQ A;  1LCK A;  1X27 A;  1BU1 A;  2L2P A;  2K3B A;  2EYY A;  1SEM A;  2QDL A;  1TG0 A;  1JXO A;  3VRZ A;  2VKN A;  3SEM A;  2JMC A;  2LJ1 A;  2JT4 A;  2ESW A;  2K6D A;  5IXF A;  1GCP A;  1UUE A;  2C0I A;  2CH4 W;  1T0H A;  2FEI A;  2KNB B;  1WX6 A;  2RQW A;  3M0R A;  4Z88 A;  1PHT A;  3UF4 A;  4AG1 C;  2YUQ A;  4X1V A;  5GJW B;  1H8K A;  2RQV A;  1K0X A;  1J3T A;  3GBQ A;  1H3H A;  1NEG A;  2L3P A;  2YSQ A;  3ZL7 C;  3EHR A;  2BZY A;  3NHN A;  2L0A A;  2FG0 A;  2YUP A;  3UA7 A;  2BZ8 A;  1WFW A;  1AEY A;  3VS4 A;  2K9G A;  4AFS C;  2O9V A;  1X2K A;  2EKH A;  1YCS B;  3I5R A;  1M8M A;  3H0H A;  4CC2 A;  1X2Q A;  2CDT A;  2KT8 A;  2P4R A;  1SHG A;  3VS5 A;  4IIO A;  2CH4 A;  2F2V A;  1PNJ A;  2ED0 A;  2J06 A;  2LJ0 A;  1NYF A;  1S1N A;  1SRL A;  4OMQ A;  1E6G A;  2GQI A;  2J6F A;  3PVQ A;  2M0Y A;  1WI7 A;  2DIL A;  2DL3 A;  1ZUK A;  2V1R A;  3I5S A;  2LQW A;  2ED1 A;  2DRK A;  2YT6 A;  2A28 A;  1UEC A;  4AG2 C;  3H0F A;  2YDL A;  2F2X A;  1W6X A;  3VRY A;  3RNJ A;  1OPL A;  2DF6 A;  2G6F X;  4FSS A;  2RPN A;  2LCS A;  1U06 A;  2K7A A;  1UE9 A;  4GLM A;  1QKW A;  2L3S A;  1RLQ C;  2DL4 A;  2B86 A;  2J6K A;  1B07 A;  1OPK A;  1YWO A;  1WXT A;  4LNP A;  2E5K A;  1QKX A;  1WYX A;  1Y0M A;  3M0Q A;  4AFQ C;  1QLY A;  2RN8 A;  4J9C A;  1KJW A;  1U3O A;  2AZS A;  2GTO A;  5IH2 A;  1NG2 A;  4RTX A;  1FYN A;  2CRE A;  4ORZ A;  1JU5 C;  2KE9 A;  1GCQ A;  1X6B A;  4CC3 A;  2DVJ A;  1ZBJ A;  1KFZ A;  1QWF A;  3TVT A;  3I9Q A;  1SPK A;  2ABL A;  3EG1 A;  2LX7 A;  1X43 A;  3U23 A;  2I0N A;  2ECZ A;  2RQU A;  3SHW A;  3VS7 A;  2D0N A;  1UHF A;  3JV3 A;  1OOT A;  1G83 A;  1NEB A;  1NLO C;  2D8J A;  1PKS A;  4CC4 B;  4JZ3 A;  1YN8 A;  2F2W A;  3M0P A;  3M0U A;  4HCK A;  2LJ3 A;  1SHF A;  4RUG A;  3VS2 A;  2EPD A;  1X69 A;  2L3Q A;  2SRC A;  2KR3 A;  4Z89 A;  1T0J A;  2DM1 A;  2CSQ A;  1UG1 A;  2X3X D;  3M0T A;  2IIM A;  4AFZ C;  1ZLM A;  2LNH B;  3VS3 A;  2O2O A;  2BZX A;  2ENM A;  5FWB A;  1W70 A;  1ZSG A;  3KFV A;  2GBQ A;  2KRS A;  2GGR A;  2PTK A;  3RBB B;  2DBK A;  1M30 A;  4J9G A;  4F14 A;  2D8H A;  4RTY A;  2DNU A;  1BB9 A;  1YWP A;  2CSI A;  3EHQ A;  1CKA A;  4OMN A;  1U5S A;  4RTZ A;  1UJY A;  4EIK A;  1M3C A;  1PWT A;  1ZX6 A;  1T3L A;  1Z9Q A;  1Y57 A;  1AZE A;  1AWO A;  1MV0 B;  2ROT A;  1UGV A;  5IHK A;  2JS2 A;  2EYX A;  1WLP B;  4LUD A;  2KGT A;  3I35 A;  1AZG B;  4IIM A;  1M3A A;  2GTJ A;  2OI3 A;  4Z8A A;  1T3S A;  4OML A;  1AVZ C;  3UAT A;  1JEG A;  2O88 A;  1AWW A;  1V1C A;  2KYB A;  4CC7 A;  2J05 A;  1VYT A;  2EBP A;  2KRM A;  4OMP A;  2D1X A;  4AFU C;  2DJQ A;  2FO0 A;  1YP5 A;  2KYM A;  1WXU A;  4GBQ A;  4KRT A;  1NLP C;  2JXB A;  4RTV A;  4JPB W;  1SRM A;  2HDA A;  1I1J A;  1E6H A;  2CUB A;  1UTI A;  1PRL C;  2DL7 A;  2EVR A;  2VWF A;  4OMO A;  3C0C A;  4OMM A;  2DL8 A;  2SEM A;  1AD5 A;  2JTE A;  1OEB A;  2JM9 A;  4DEY A;  2LMJ A;  3NGP A;  3R6N A;  2DA9 A;  2KBT A;  2JW4 A;  2KEA A;  2DRM A;  1UHC A;  1KSW A;  2EGE A;  1VA7 A;  1RUW A;  1WDX A;  1ABO A;  2C0T A;  2LP5 A;  2JM8 A;  4LUE A;  1JO8 A;  3EG3 A;  2RNA A;  2HCK A;  4J9I A;  3REB B;  1WIE A;  1TUC A;  2C0O A;  2GNC A;  3CQT A;  1G2B A;  4J9H A;  3O5Z A;  3QWY A;  1GBQ A;  1H92 A;  2RQR A;  2EQI A;  2VVK A;  4Y92 A;  1W1F A;  3FJ5 A;  2LQN A;  2O31 A;  3EG2 A;  1UFF A;  2KRO A;  2EW3 A;  2NWM A;  2V1Q A;  1VYU A;  2CT3 A;  2AKL A;  2MIO A;  1E7O A;  1GCQ C;  1AWJ A;  1TUD A;  2YUN A;  1RLP C;  2DX1 A;  2HBW A;  3NPF A;  3A98 A;  1GFD A;  5IHI A;  1BBZ A;  5FWC A;  4D8K A;  2W0Z A;  4A63 B;  1I0C A;  1X6G A;  2DYB A;  3H41 A;  4HXJ A;  4DEX A;  2FPF A;  4LN2 A;  1WXB A;  2HSP A;  2RQT A;  2EGA A;  3VS0 A;  2RMO A;  2BTT A;  1XOV A;  1OV3 A;  5ECA A;  4JJD A;  2J6O A;  4QT7 A;  1JXM A;  1MUZ A;  1CSK A;  1NM7 A;  1EFN A;  2CUD A;  1K1Z A;  2JS0 A;  4D8D A;  3LH5 A;  4HVU A;  2FPD A;  2LZ6 B;  5EC7 A;  4HVW A;  2AKK A;  5I11 A;  2DMO A;  2O9S A;  4F17 A;  3TSZ A;  4ZNX A;  2AZV A;  4J9D A;  2X3W D;  1WA7 A;  2A37 A;  2K79 A;  1KIK A;  3UA6 A;  4RTW A;  1GBR A;  4RTU A;  1K9A A;  2DBM A;  3EG0 A;  3REA B;  2PZ1 A;  2KXD A;  1QCF A;  4R0K A;  2A08 A;  5L23 A;  2KXC A;  2OAW A;  2PNI A;  1M27 C;  2XMF A;  1SSH A;  2M51 A;  1N5Z A;  3IQL A;  4J9B A;  1PKT A;  1A0N B;  1GL5 A;  1UJ0 A;  1PRM C;  1K76 A;  4JZ4 A;  2EGC A;  4WCI A;  2MCN A;  3TSW A;  5HCK A;  4F16 A;  2MOX A;  1GRI A;  3THK A;  4JJC A;  1GFC A;  5IHN A;  2DE0 X;  1HSQ A;  4HVV A;  2YUO A;  2AK5 A;  1HD3 A;  2W10 A;  2CT4 A;  4J9F A;  2KT1 A;  2NUZ A;  3NMZ C;  1ZUU A;  4ESR A;  5GJV B;  1RI9 A;  2OJ2 A;  4J9E A;  4RTT A;  3ULR B;  1HJD A;  1VYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...