5IHIA

Crystal structure of the alpha spectrin sh3 domain double mutant v46g-d48g
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
ELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEGNGRQGFVPAAYVKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Spectrin alpha chain, non-erythrocytic 1
publication title Crystal Structure of the alpha spectrin SH3 domain double mutant V46G-D48G
rcsb
source organism Gallus gallus
total genus 12
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ihiA00
2EGAA 1OOTA 1X27A 1JU5C 4JJCA 1HJDA 3EHRA 3A98A 1BK2A 4M4ZA 4D8DA 1I1JA 2DLPA 2FEIA 5ECAA 3TSZA 1HSQA 3VS7A 2BZYA 2JXBA 3H41A 4J9EA 1AWXA 1OPLA 2A37A 3ZL7C 4GBQA 3VS2A 5IHNA 3SHWA 2RQRA 1JEGA 1QCFA 2ESWA 2PZ1A 2SEMA 1PWTA 3H0FA 2EYWA 1M3BA 3EGUA 4IIOA 3REAB 3TVTA 2VKNA 1NLOC 1VYVA 1S1NA 2ED1A 2CDTA 2LX7A 2I0NA 1K76A 1T3LA 1I07A 1Z9QA 2FRYA 4JPBW 1K4US 4IIMA 2E5KA 1AWWA 2RPNA 2RMOA 1UECA 2FPFA 1B3QA 1MV3A 1M8MA 2IIMA 5IH2A 2K6DA 4J9FA 5FWCA 5IXFA 1WIEA 5IHKA 3EHQA 1G2BA 4F16A 3TSWA 2DBKA 2EYZA 1KSWA 3UA7A 4K11A 2ROLA 3PVQA 2GNCA 1N5ZA 4J9IA 1M27C 2L3QA 2HEQA 3LH5A 2ECZA 5GJVB 1M3CA 3C0CA 1AZEA 1WDXA 1BBZA 2YUPA 2VWFA 1ZX6A 2XMFA 1UJYA 2HCKA 4J9BA 1WXBA 4HXJA 2JS2A 2B86A 2A08A 1TG0A 2W0ZA 3I9QA 1FMKA 1ABQA 1ZUUA 3VS6A 1PRLC 1AZGB 4JJDA 1GL5A 2JM9A 1RUWA 2EQIA 2KT1A 4CC4B 2C0OA 2K2MA 1X6BA 2JS0A 2L3SA 2DF6A 4J9HA 4QT7A 2LJ0A 1NLPC 2L0AA 2EW3A 1YWPA 4ESRA 1E6HA 4AFSC 2LJ1A 1K9AA 2DVJA 2KRSA 3EG1A 2DRMA 4LUDA 1HD3A 2DM1A 1OV3A 2EYYA 2KR3A 1KIKA 1ZUKA 2JM8A 1GBRA 4J9DA 2J7IA 4J9GA 2GTOA 2YUOA 3VRZA 1QKWA 2CH4A 1CKBA 2J6KA 1OPKA 2FPDA 1X2QA 2JW4A 3R6NA 2HDAA 2FRWA 2CT3A 2CUBA 1H8KA 1M30A 1SHFA 1UHCA 2AKLA 1JXMA 1WXTA 2O9VA 1Z9ZA 1AWJA 2GGRA 4Z89A 1ARKA 2X3XD 3QWXX 1X6GA 1U5SA 1GRIA 1W6XA 4DEXA 1GCQA 3ULRB 2G6FX 4RTZA 1B07A 1UHFA 2RQVA 5I22A 2KXDA 2P4RA 2KROA 4LN2A 5FWBA 2BZ8A 1PKTA 1WXUA 3PE0A 2A36A 4Z88A 2DE0X 2LNHB 2DJQA 2EBPA 2EKHA 2F2VA 4GLMA 1MUZA 2KXCA 3SEMA 2O9SA 1UDLA 3I35A 4KRTA 4RTTA 2OAWA 1JO8A 1A0NB 2D8JA 2JT4A 4Y92A 2YUNA 2AKKA 2YDLA 1UG1A 3VS3A 2DYBA 4FSSA 2KT8A 2A28A 1UJ0A 2C0IA 4AFZC 3EG0A 2KRMA 1CKAA 1K0XA 3CQTA 1TUDA 4AFUC 1NG2A 5EC7A 2D0NA 3VS4A 4J9CA 2KGTA 4OMNA 1UE9A 1T3SA 2M51A 5GJWB 1PNJA 1XOVA 4OMMA 4RTUA 1JQQA 2AZSA 1AOJA 2L2PA 2VVKA 3U23A 4AG2C 2J05A 2X3WD 2CSIA 2EPDA 1OEBA 1AEYA 2JMAA 3M0PA 1ZSGA 3FJ5A 1SRLA 2MIOA 1MV0B 2ROTA 3NHNA 1BB9A 1GFDA 2LZ6B 3VS1A 3RBBB 1AD5A 4X1VA 2KYMA 3M0QA 4F14A 3QWYA 4OMPA 2CH4W 1SRMA 3THKA 2W10A 3GBQA 4JJBA 3IQLA 1NEBA 3I5SA 5HCKA 5I11A 1E7OA 4CC3A 2PNIA 2DX1A 4HVVA 2GQIA 1QKXA 2J06A 2L3PA 4D8KA 2ED0A 2LMJA 1GFCA 1UGVA 2M0YA 4OMLA 2YUQA 2O31A 5IXBA 1YWOA 3M0TA 4AFQC 3M0UA 2DRKA 3PVLA 1K0SA 1LCKA 2F2XA 3RNJA 2YT6A 2O88A 1BU1A 2LQNA 4LNPA 1EFNA 1UUEA 1T0JA 2KBTA 1SHGA 2C0TA 3H0HA 1NEGA 2CUDA 1QWFA 2J6FA 2O2OA 1YP5A 1WA7A 1ZBJA 3JV3A 2BZXA 2GTJA 2EGEA 1YN8A 2YSQA 4JZ3A 1KJWA 2DNUA 2KYBA 3EG3A 1NYFA 3UATA 2KE9A 1X69A 2RF0A 3NMZC 1PRMC 2FPEA 4F17A 2DL3A 1Y57A 2D8HA 2F2WA 4RUGA 4DEYA 4E6RA 1CSKA 1M3AA 1WLPB 1IO6A 1H92A 2DL8A 2RQWA 2LJ3A 4CC7A 1YCSB 4JZ4A 4WCIA 1RLQC 4R0KA 3H0IA 2FG0A 1PHTA 5FW9A 2RNAA 2PTKA 1GCPA 2EVRA 1E6GA 1ZLMA 1VYUA 3UA6A 3O5ZA 3VS0A 1VA7A 4LE9A 1ABOA 1WX6A 2LQWA 3NPFA 4ORZA 3EG2A 2AK5A 2DL7A 1PKSA 1W1FA 2DA9A 4AG1C 4A63B 1Y0MA 4OMOA 2DMOA 2NWMA 2KRNA 5IHIA 2LP5A 1U3OA 4RTVA 3UF4A 1WI7A 2D1XA 2DL4A 4HVWA 1GCQC 2ENMA 2CSQA 2HBWA 2DILA 1UTIA 1QWEA 4RTXA 1VYTA 2QDLA 3I5RA 4Z8AA 2MOXA 1SSHA 2EYXA 1TUCA 2MCNA 3NGPA 2NUZA 1SPKA 2KNBB 1JXOA 1FYNA 1QLYA 1SEMA 1H3HA 1I0CA 3KFVA 4ZNXA 1WFWA 4LUEA 1GBQA 2H8HA 1RLPC 2BTTA 2DL5A 3VS5A 1UFFA 1KFZA 1G83A 2DBMA 5L23A 2K9GA 1X2KA 2K7AA 1W70A 3M0SA 4EIKA 2JTEA 2K3BA 1WYXA 4HCKA 2V1QA 2KEAA 1J3TA 4CC2A 2K79A 2J6OA 2OI3A 2SRCA 2RQTA 1NYGA 2ABLA 2HSPA 2RN8A 4OMQA 4RTYA 1T0HA 2JMCA 1RI9A 3VRYA 1NM7A 1AWOA 1V1CA 1X43A 1U06A 2OJ2A 4HVUA 2V1RA 1AVZC 2FO0A 1K1ZA 2EGCA 2RQUA 4RTWA 3REBB 3M0RA 2LCSA 1YNZA 2AZVA 1ZUYA 2CREA 2CT4A 2GBQA
chains in the Genus database with same CATH superfamily
1OOTA 1X27A 4PJLA 4D6WA 4JRKA 1JU5C 1RACB 4BACA 4M4ZA 1Q86C 2DERA 1HSQA 2JXBA 3H41A 3LYIA 3SWNC 2A37A 1Q7YC 3ZL7C 5KE2A 4GBQA 3VS2A 5IHNA 3CCSQ 1JEGA 1Y71A 2ESWA 3TVTA 1VYVA 5CIUA 1S1NA 1QVFA 3FJPA 3OYDA 3G4ST 1PC0A 3VV0A 1K76A 1Z9QA 4EMKC 1D1AA 4IIMA 1M90C 4AMCA 3BY7A 1B3QA 2H3EB 5I2SA 1KQSP 2IIMA 1XTDA 5IH2A 4KBMB 2O01E 3EHQA 3R6OA 2RHIA 1N8RC 2DBKA 2K57A 1XQHA 4C92E 3JCMJ 3S3OA 5I2MA 1NE8A 3PVQA 4K11A 1VQNA 4BE2A 4P5NA 3HP9A 1QVPA 1M3CA 3HTRA 2K5FA 1WDXA 2E3HA 4FSXA 2YUPA 2CP2A 4J9BA 5GANd 2WSEE 4HXJA 2KAFA 1UEBA 4BDZA 3VS6A 1Y96A 3V8JA 2X4JA 1H3ZA 5A0DA 3EFOB 1AZGB 2JM9A 5GAN7 2EQIA 5HKCA 4CC4B 3OSVA 2C0OA 1VQPA 4FYXB 2K2MA 1X6BA 4UC4A 4QT7A 4J6XA 2O4XB 4OB3B 3RKYA 1KC8C 2XD0A 1K9AA 1WHKA 4J6YA 1LOJA 3V8LA 1YITT 1HD3A 1RAAB 3JCMW 1OV3A 3QJ6A 2WSCE 2EWNA 1SF9A 1ZUKA 2JM8A 2KI7A 5GANj 2CH4A 3HRTA 1VQOQ 1VQLT 1CKBA 4E7HA 4M75G 1OPKA 5KYWB 2DKGA 3PFSA 2JW4A 2ATCB 1H8KA 1M30A 1MGQA 2E64A 5I21A 4M77G 1KD1C 3LX7A 1JXMA 2O9VA 5GAN6 4X34A 2G3RA 1Z9ZA 2DXUA 1AWJA 3CCJQ 2DD4A 3RKXA 1X6GA 1GRIA 4DEXA 3ULRB 1B07A 1UHFA 1ZSZA 2VUBA 4FYVB 3CEYA 3OW2S 2KXDA 2D0QB 3CBMA 4ME7A 5FWBA 2FZGB 1NJIR 1MHNA 2LCLA 2DE0X 1Q82C 2DJQA 5CKHA 1MMAA 2KXCA 3I55Q 4BE1A 1UDLA 5CR2A 4EMGA 5KCOA 3PIPA 2CS7A 1B7TA 1KQ2A 2DYBA 5GANf 1BI3A 4PK4A 3SDZA 3JB9F 3JAME 2NUPA 3EG0A 1CKAA 3LLRA 3PT9A 3CQTA 1TUDA 4PFOA 3GNFB 2VC8A 3VS4A 4J9CA 1UE9A 5GJWB 3GNGA 1XOVA 4OMMA 2QA4A 1VQ6T 3U23A 5LJ5g 3MJXA 2CSIA 4KH0B 4E7SA 5CCAA 2RJDA 1WJSA 4KH1B 4M78B 1YITA 2GFAA 1MV0B 1EIFA 2ROTA 4M7AG 1VQ8T 3VS1A 3V7SA 4N0AC 5GMKh 3M0QA 1YI2Q 5GMKm 1K9MR 1HK9A 2COZA 3F70A 4OB0B 4ELZC 3J81E 4RG8A 3QYHB 5D6WA 7AT1B 2NLUA 2ZGWA 4MDXA 5A2QE 2GQIA 1QKXA 2QQBA 1WHGA 4M78D 4Y91A 2LMJA 4AT1B 4OGCA 3JCMh 2HMAA 5DLOA 2ZPBB 3CCST 3JCMe 4AFQC 1WHHA 3PVLA 1M2VB 1K0SA 4PJOG 2M16A 1K9MU 4KGVB 2RH2A 3MP8A 2YT6A 3CMAA 2FZKB 2LQNA 2NUTB 4A4FA 2AT1B 5DY9A 3JB9J 2O2OA 1VQKQ 4FYYB 5FROA 4DBRA 3CD6A 3C95A 2CP7A 4M7DG 2JJ9A 3JCMg 3CCVQ 1VQ6A 1X69A 1KG1A 5GAOp 2D8HA 5GAOl 2BE7D 4E6RA 3M56A 4PLLA 3KUFA 3SB2A 1ZHIA 3D7SB 1Y96B 3OYNA 4JS5A 2LRQA 2XKOC 4JZ4A 2M9UA 1VQ8A 3OW2P 4F7UA 1C0MA 4HT9A 2HL5C 3UA6A 3O5ZA 1YJWQ 1D1CA 3PIOA 1TS9A 3EG2A 3CCRQ 3HHTB 1K8AR 4WTOB 2AIRB 1QP2A 3QYGB 2X4WA 4M7DB 2Z0WA 3FEOA 4AG1C 3MO8A 4OMOA 2DMOA 3CMEQ 2OAUA 1VQOT 1UB4A 2MK5A 1VQ4T 1W4SA 2QDYB 1U3OA 2PUKB 4RTVA 5L8RE 4J7FA 2GCXA 1WI7A 1FMVA 3GIBA 3CPWA 2K4YA 3MHXA 2DTOA 4KUDK 2KY9A 1QWEA 5AT1B 3A8OB 1TOVA 3EGDA 3CCJT 1TUCA 1ZA2B 1FYNA 1QLYA 1I0CA 3KFVA 1Q95G 2YXYA 2DXCA 2VGNA 3WVEB 4C0ZA 1KK7A 1GBQA 1I5LA 3CC4Q 2PVDB 2BTTA 2DL5A 1WZOA 3URGA 1KFZA 2K9GA 2RJFA 3I55T 1X2KA 2P0QA 2EJFA 1M90U 4EIKA 1TU0B 3G71Q 1BIAA 1WYXA 2KEAA 4CC2A 5KH6A 2K79A 4JS4A 2EKOA 1NYGA 2ABLA 2RQTA 2RN8A 1V1CA 2OJ2A 2DEQA 4HVUA 1AVZC 3CC2Q 2E3IA 5LJ3h 3REBB 2LCSA 1X6OA 1G5VA 3BFMA 5GAOq 1N9RA 5LJ3e 2O4XA 3CBPA 2GBQA 2EGAA 2HD0A 4LDUA 5CKBA 3EFSA 1QQJA 4N4IA 4IUPA 1BK2A 1I1JA 2DLPA 5CQYA 5ECAA 1M5Q1 1W2BS 4L5GA 1VQ7Q 2LC4A 4J9EA 4N4HA 2ZPGB 3M57A 4QVCA 3CPFA 5KYWA 1NPPA 2MF2A 1YI2T 1PWTA 3H0FA 4IIOA 3VUZA 3REAB 3M58A 1IGUA 2BUDA 1VQ4A 2MYSA 4O6JA 2CDTA 2LQKA 1T3LA 1I07A 4E7KA 3MPUB 1JJ2A 3OYGA 1K9MC 2FRYA 1VUBA 2P84A 3Q1JA 4E7JA 1AWWA 1D0YA 1UECA 2FPFA 2EJ9A 4C5HA 1MV3A 2OTLQ 1M8VA 5IXFA 5LJ5d 4A53A 4BI3A 2P4TA 3CCJA 4OP0A 2GNCA 1M27C 2PVOB 3LH5A 5C6SA 3RMSA 3PTAA 3C0CA 4C8QG 2XMFA 3KBGA 1UJYA 5D7UA 2B86A 3I55A 3HSBA 2DO3A 3DB3A 1VQKT 4BY6B 2KSSA 4JJDA 2RHUA 3CCMQ 3MEWA 2OTJQ 2KT1A 2L3RA 4C0DC 2X35A 2EAYA 2LJ0A 5GAMh 3MCAB 3X26B 2EW3A 3GF5A 5KE3A 1OX9A 2KRSA 4C8QB 2DRMA 2P0KA 5CKFA 4LUDA 5GAMe 3G7ZA 4FT2A 1KIKA 4C92G 1GBRA 3WXMB 1IXDA 4XU0A 1RAGB 2BE9B 3CCUQ 1YJ9Q 2PU9B 1IHWA 2PUOB 3CCQQ 4F7UB 2QASA 2FHDA 1YJWT 4FIBA 2RJEA 3CCRT 2K3XA 1QVFS 2GGRA 1DJ7B 1W6XA 1GCQA 2DXTA 3JRZA 1K8AC 4RTZA 3UDCA 3OSSC 5I22A 4PFPA 3EG9A 4C92B 5LJ5f 2BZ8A 1Q81U 1PKTA 2D9TA 4M7AA 3PE0A 2DAQA 1M2VA 2A36A 4Z88A 2LNHB 5GMKj 1KHIA 3FB9A 1N27A 2O9SA 4JUVA 2NUTA 2JNGA 2RK1A 1A0NB 2JT4A 4Y92A 2YDLA 3CCLA 3VS3A 1D1BA 3E9GA 2KT8A 3EGDB 4HCBA 2GF7A 1W2BP 4OB1B 2RM4A 4N4GA 1RABB 4Y28E 1VQ9A 2K5IA 2QGGA 2LDMA 3HFNA 2D0NA 3M9QA 2M02A 3QDFA 1PNJA 3V7RA 5C0MA 1K73R 5CAIA 1JQQA 2AZSA 3FRNA 1AOJA 1M4ZA 2K3YA 4RKUE 4PJMA 5CKEA 1MMDA 4XTZA 2DTHA 4TVRA 3NTKA 1BB9A 3RBBB 3BW1A 4NL2A 3G1JA 2NYSA 4OMPA 2EQUA 3THKA 3QDRB 2W10A 3GBQA 4JJBA 1M1KR 1NEBA 1ZSZC 2Y4XA 3I5SA 4MZMA 3CC7Q 6AT1B 1K73U 3I56Q 2C06A 3M53A 2CGHA 2VASA 4E7LA 2PNIA 1YJWA 2J06A 4D8KA 2KDSA 3H9NA 3DKMA 4M7DA 1ZA1B 3CCRA 1RAIB 3T9NA 4NL3A 1VQ7T 2O31A 2H3JA 4OB2B 2RI5A 1IZ6A 2GQVA 1QW1A 1YWOA 2JZ2A 4C0FA 3M0TA 3HKSA 3J80E 3QZ5B 3L42A 2MAMA 2DRKA 4JJNK 2ZAEA 1QMCA 3OS0A 3G4SA 2J6FA 5LL6S 4FL6A 3A8HB 1VQ5Q 4LD9K 4CRIA 2CYZB 1OI1A 3QHSA 4PNOA 2V8KA 4A4EA 4ZTFA 2BZXA 4A4HA 1YN8A 2YRDA 3JB9G 2KK4A 1FX7A 3MKDA 4MZTA 1KJWA 3CXCA 3CBOA 3EG3A 1NYFA 4M75B 2KMTA 1BI2A 5GAN2 1G3SA 1IHVA 2PQWA 3QJYA 2L89A 3LH0A 4RUGA 4M77B 1QVFP 1IREB 1AHJB 5GAOr 3CCMT 2RQWA 2OTJT 1YCSB 2HZYA 3E19A 1B34A 5FW9A 2RNAA 2PTKA 3QBYA 1GCPA 4HT8A 1ZLMA 2EFIA 4M75D 3VS0A 2WACA 1NJIU 4LE9A 1TXQA 1W1FA 4FM4B 4M77D 5FU6C 4BDYA 2CZ6B 5FU7C 1Y0MA 5FLXE 2E4HA 2HL3A 5IHIA 1OQKA 2Y4YA 2LNVA 2QEXT 3CCUT 4M78F 1YJ9T 1WNLA 3CCET 4BE0A 1Q81C 1VQLA 2D1XA 5LJ3j 4HVWA 1BI1A 3TCJA 2A7YA 2CSQA 1G3YA 3AT1B 3SFMA 1YJNQ 4KGZB 4RTXA 3M5AA 2Y90A 4Z8AA 4L6V5 1YIJQ 4J5YA 3H6ZA 2L8DA 2KNBB 1JXOA 1H3HA 2XI9A 4ZNXA 1EZZB 1WFWA 3EG9B 2H8HA 4EPCA 4M7AB 3OBYA 1R0BG 2JVVA 1UFFA 2M1HA 3EAEA 4M78E 5CQXA 1WJRA 2K7AA 5GMKl 3M0SA 2K3BA 2HKQB 1JB0E 4NOYA 2V1QA 4E7ZA 1AT1B 2SRCA 1NBEB 2HSPA 1P92A 4RTYA 1T0HA 3VRYA 5KYXA 3OYJA 1C1AA 1VIEA 1X43A 1V76A 5GAN4 4QW2A 2FO0A 1K1ZA 4RG2A 3M0RA 2QYZA 5CVIA 3X24B 2RI3A 4LDYA 2ZPEB 4M7AD 2OTJA 1ZUYA 2CP0A 2CREA 1ACMB 3C4SA 9ATCB 5GAN8 1YFNA 4JJCA 4IUTA 1HJDA 4C8QA 2LX9A 4IUVA 1UGRB 4PJOB 1K73C 2FEIA 2QGFB 2X4XA 4BI8B 3VS7A 1TTHB 2P0PA 4X9CA 2JTMA 1IB8A 2COYA 1QCFA 2SEMA 2EYWA 1M3BA 3EGUA 5D6XA 2VKNA 1NLOC 2XDPA 2LQ8A 1X01A 2HQXA 2QEXA 2ED1A 2LX7A 3CCEA 3CC7T 3SWNB 2CKKA 4JPBW 1TWBA 1K4US 3I56T 2E5KA 2E10A 2RPNA 4PJOD 3CPWS 5GAMj 3OYHA 1M8MA 2EQKA 5GANe 2K6DA 5FWCA 5IHKA 1G2BA 3TEEA 2DYIA 4F16A 1VQPQ 3TSWA 2EYZA 1N5ZA 2HQEA 2MMPA 4C92A 2QTXA 2DIQA 5KYNA 2L3QA 1JRIA 3OS1A 2HEQA 4EMKB 4M7DF 1D0XA 4KT0E 2VWFA 1SG5A 3CCSA 3QKJA 1O75A 1OU9A 1LPLA 1Q7YR 1WXBA 2RHZA 5J39A 1I81A 2A08A 5IN1A 1ABQA 1MMGA 4QQGA 1K8AU 1VQ5T 1PRLC 4XTUA 4M7DD 3M4YA 1OZ2A 3OYEA 1GL5A 1PCXA 1R0CB 4IKFA 1RUWA 1SSFA 3PMTA 4B9WA 3M59A 1NPRA 1UGPB 3OYFA 3P8BB 1HXDA 1NLPC 1N8RR 2RB6A 4PJNA 1PD1A 2FYKA 4AFSC 4EDUA 2LJ1A 3VKIA 2DVJA 1NJIC 2QG9B 2EYYA 2KVQG 1M9SA 2KR3A 2YRVA 4IURA 4J9DA 1YCYA 2DIGA 2J7IA 4B9XA 4ZN3A 5GMKi 2YUOA 2EIFA 1QKWA 2K5LA 1QVGA 1VOMA 2J6KA 1RAFB 2FPDA 1WJQA 3R6NA 2HDAA 2FRWA 4RCBA 2EQMA 1B34B 1N6AA 3QG1A 1UHCA 3GOXA 1WXTA 2E1HA 2I2LA 3JB9H 3V8KA 3CC7A 3X25B 2DZ9A 5GAOn 3NTHA 2E12A 3I56A 1JJ2S 3OYYA 2LT1A 2DFUA 1PG5B 2RQVA 4XTXA 2P4RA 2QA4Q 4LN2A 2DD5A 2ZPIB 3RUXA 4C8QE 4CI0C 3E9FA 1BIBA 2XK0A 2F2VA 4XTVA 1VQOA 2DTIA 1MUZA 1RAEB 4EMHA 3OQ5A 5GAN3 3A8GB 1M1FA 4KRTA 1RADB 2OAWA 4ZGEB 1YJNT 1JO8A 3QPHA 2D8JA 2YUNA 2AKKA 1UG1A 3BDLA 1BCMA 4FSSA 3OS2A 1YIJT 5LJ3g 1UJ0A 2MWOA 3LWHA 1ZBXA 5DLQE 3E2UA 1M2OA 4PKCC 1K0XA 4F04B 3L2VA 2YRCA 4AFUC 3ZBDA 2QXFA 5EC7A 4M78C 2KGTA 5HK0A 4OMNA 1WGSA 2M51A 1T3SA 1KQSA 1MNDA 4JLGA 5KCHA 3VUBA 3OYKA 4M75A 1S72Q 2L2PA 3SD4A 4AG2C 2X3WD 1OEBA 2VXFA 1AEYA 3M0PA 4M77A 1ZSGA 3CPWP 4ANJA 3INZA 3L2ZA 2MIOA 1Q82R 1U1TA 2RD1A 3PMIA 4DA4A 5KYXB 3OYLA 1AD5A 3CMAQ 2KYMA 2DZCA 4F14A 4QVDA 3QWYA 2CH4W 1SRMA 3RERA 4A54A 3RMQA 3G6EQ 4JRIA 2DX1A 4HVVA 2L3PA 4LDXA 3CCVT 1WPYA 1GFCA 3CD6Q 1FWZA 2M0YA 4C8QF 4JDSA 1QP3A 4NS5A 4QQDA 4J7IA 1VQ6Q 1LCKA 1UGQB 4PJJA 3E1SA 2IVWA 4RMOA 2O88A 1YI2A 2CZ0B 1UUEA 3UPUA 1WHMA 1SHGA 2KBTA 2C0TA 3H0HA 1NEGA 4C8QD 1OYXA 3WVDB 2F5KA 4F7UF 1YJNA 5A0LA 1VQ8Q 1YP5A 1VQPT 1BCOA 2E65A 3HL8A 3OS5A 3JCMd 3JV3A 1YIJA 1EX4A 1BKBA 2XDBA 1BI0A 1PD0A 2GTJA 2EGEA 5GAMg 2YSQA 3CMET 3OYBA 2CP3A 5CO7A 1YBYA 4JZ3A 1PSFA 2E6ZA 3EGXB 3QO3A 4C92F 1SKUB 2V8JA 3TU4K 3OYIA 3QSUA 1D0ZA 2RF0A 3NMZC 1D3BA 2FPEA 4F17A 1Y57A 1F1BB 4FU6A 3AHUA 1WLPB 1IO6A 1JJ2P 4F7UE 2A3LA 2LTOA 4C92D 3NFCA 3PGGA 1H641 1VQKA 1PM3A 4R0KA 4M7DC 2FG0A 2AHJB 2L5QA 1OULA 2QQRA 2EVRA 1VYUA 3CC4T 1VA7A 1ABOA 1WX6A 2LQWA 1VQMQ 4ELYC 4ORZA 4PJOA 2DL7A 3MP6A 1PKSA 2KQWA 3LWIA 4R55A 3G71T 2X4YA 4ZN1A 4A63B 1IRXA 3CCVA 2JTFA 3HRUA 4FW2A 1YHQQ 2KRNA 3O8VA 3OYAA 3CC2T 4GY5A 3OY9A 1QCOA 2DL4A 2ZCFB 2M0OA 3KXTA 3M54A 3SWNA 2HBWA 2DILA 1UTIA 4OF1A 3L2UA 1RL2A 4MMKA 4DBFA 3BE3A 2MOXA 1SSHA 2EYXA 2VYTA 1RAHB 2NUZA 4C5IA 1SPKA 1SEMA 4GLKA 2QA4T 4QVZA 2D6FA 4EMKA 4MDWA 1R77A 4LUEA 1RLPC 3JCMf 3MEUA 3CMEA 1G83A 2DBMA 5L23A 3DLLA 1JBMA 3ER0A 1M1KU 2JTEA 3M55A 2GFUA 3CXCS 3QZ9B 2E70A 2HSEB 8AT1B 4HCKA 1J3TA 1O9SA 2JUFA 2JOYA 2OI3A 2CP6A 1GXIE 3A8MB 1WQWA 4HA8A 4DOVA 2OTLT 1G8XA 1UGSB 4J8OA 4BB7A 1NM7A 3S3MA 1U06A 1VQ4Q 3L1AA 2RQUA 2EGCA 2RA2A 4B6MA 5IT9E 2DXBA 3LW5E 4KULA 1S72T 2CZ7B 4LD6A 3M4GA 4FYWB 3ASKA 3EHRA 3A98A 3CC4A 4XU2A 4FCYA 4D8DA 2XU8A 3ZFJA 5LJ5h 3TSZA 2F69A 3JCMV 1OX8A 4M75F 2BZYA 3G71A 4XU3A 1AWXA 1OPLA 5LJ5e 3SHWA 2RQRA 3CMAT 1ZQ1A 2PZ1A 2RHXA 5LJ3d 2RHYA 4M77F 4XU1A 3CC2A 4BD3A 3H8ZA 5HK3A 2I0NA 2DVEA 2BKDN 4M78G 3RKWA 3G6ET 4JRPA 2COWA 5DM7R 2RMOA 4ZTJA 5KYYB 4OMFB 5AYFA 1I4K1 2A0FB 3OW2A 4J9FA 1WIEA 2VV5A 2VGMA 3CD6T 1KSWA 3JSCA 3UA7A 2ROLA 4J9IA 1PSEA 1XNIA 4LDVA 3META 2RO0A 2QK0A 2FVUA 5KYUA 3HPWA 4M75E 2ECZA 2YLCA 3P8DA 5GJVB 1VQ7A 1G3TA 1AZEA 2DPPB 4BY6C 1BBZA 1ZX6A 3C94A 3CCQT 2HCKA 4M77E 3JB9D 1U8RA 2ZZDA 2JN0A 1G3WA 2JS2A 3LGFA 1TG0A 2W0ZA 3I9QA 1FMKA 4ZGJB 1ZUUA 3MEVA 2CP5A 1TSFA 4XK8E 5HY6A 3QIIA 4BI4A 4C8QC 2OTLA 5GMKe 2JS0A 3VU3C 4C0GA 4O5VA 2LCCA 3X28B 1KQ1A 2L3SA 4J83A 2DF6A 2VB6A 4J9HA 5D6YA 2L0AA 2IPOB 4E7IA 1YWPA 4ESRA 1E6HA 2F1LA 3EG1A 5CKDA 3C12A 2DM1A 1S72A 4M7AF 2B8AA 4C0DB 1D3BB 1D09B 2DK3A 2RJCA 4J9GA 2GTOA 2QAZA 4KUIA 3VRZA 1X2QA 5FRNA 1XJWB 2CT3A 2CUBA 3GPLA 2MPXC 1I8FA 3CCMA 1SHFA 5GAOm 2BIVA 4Z02A 3CCLQ 5GAMd 2EJGA 4QQ6A 2AKLA 5LJ3f 1RI0A 4C92C 2XICA 3RR6A 1VQMT 4MZPA 3A1PA 1MNEA 4N0AA 2QTVA 2HBPA 2XDDA 4Z89A 1ARKA 3G6EA 4MMLA 2X3XD 3QWXX 3CXCP 1VQ9Q 1VQNQ 1U5SA 4XAXB 2G6FX 3S3NA 2EYQA 4M7AE 4E2FB 4PJOF 2KROA 1YHQT 1WXUA 3OBWA 2EBPA 2EKHA 5GAN5 4GLMA 3SEMA 3CCUA 1YJ9A 3A5ZB 3I35A 4RTTA 4XTWA 5GANh 3VJPA 3CCQA 4DBQA 2QQ9A 3DLMA 1M1KC 5J3BA 3VYGA 2YLBA 2A28A 1FXXA 2C0IA 3RIRA 4AFZC 3L2QA 4HCCA 2KRMA 2YHTA 4DQ2A 2QQSA 2DEUA 5FRMA 4J6WA 3BDUA 1NG2A 3OYCA 4OGEA 2R5MA 1Y07A 4C5GA 4PJOE 3EGXA 4RTUA 1VIFA 1Q86R 2OX7A 2VVKA 1IGQA 2J05A 2WSFE 2EPDA 2JMAA 1LVKA 4PLIA 4WF2A 2R57A 3FJ5A 3QUIA 1SRLA 3OMCA 3NHNA 3EFRA 3FIFA 1GFDA 2LZ6B 2ZPHB 3EH2A 5A0GA 4X1VA 4KGXB 4QKUA 2FB7A 4JRQA 4HKEA 2MWPA 5GANg 1M90R 3IQLA 3G4SQ 1QVGS 2V8IA 2MI6A 5HCKA 1C6VX 1R8OB 4FT4A 5I11A 1Q86U 1E7OA 4M7DE 2E6NA 4CC3A 4C5EA 5GAMf 4Q5WA 4ATOA 2ED0A 1VQMA 1Q7YU 2VXEA 1UGVA 4OMLA 1ZSZB 2YUQA 3DB4A 3V7CA 5IXBA 4LXCA 3TQ7P 2XHCA 1QCNA 4R56A 2FL7A 3M0UA 2X51A 1YHQA 3A8LB 2RK2A 2F2XA 3RNJA 1BU1A 1TH7A 2RI2A 4LNPA 1EFNA 1V29B 1WQ7A 1T0JA 2FZCB 1N8RU 2CUDA 1QWFA 2HQHA 3ZEHA 2HAXA 4JLIA 3OMGA 4V2SA 3JB9I 1OZ3A 3EFOA 3RDVA 8ATCB 1LJOA 4M75C 3JCMP 1WA7A 1ZBJA 2NUPB 3MP1A 3JCMb 4X9DA 3FLGA 2F5TX 1KC8R 4L59A 3OA6A 5KYUB 4M77C 2LT4A 3S6WA 2DNUA 2KYBA 3FDRA 4DOWA 2DETA 4IUUA 3UATA 1BYMA 5IAYA 2KE9A 4XTYA 3TREA 1KQSS 1YITQ 2PVGB 2XG8D 1PRMC 1X75C 2DL3A 2F2WA 4DEYA 1CSKA 1M3AA 1H92A 3L2WA 2IG0A 1LNXA 1VQLQ 1M1GA 2X9HA 2DL8A 2LJ3A 2CZ1B 3HRSA 4CC7A 1VQ5A 4IUQA 1I5OB 4WCIA 4FW1A 1RLQC 3H0IA 4VUBA 1PHTA 1KD1R 1KC8U 4PFZA 1HYOA 2YWWA 2ZPFB 1E6GA 4HCZA 1WHJA 2E5QA 1W2BA 4E47A 3NPFA 2AK5A 1OU8A 2E41A 5CK9A 2DA9A 3PNWC 2V26A 2NWMA 3L2RA 2HKNA 5M9OA 3X20B 2LP5A 3UF4A 3EH1A 2EQJA 3GP8A 5FU6B 3JCMX 3UWNA 1KD1U 1GCQC 2ENMA 4YTLA 2QQAA 2LVMA 5FU7B 3CCLT 3NTIA 3JCMc 2R5AA 4DBHA 1N9SA 4RCCA 5KYYA 2HNIA 1VYTA 2QDLA 4II1A 3I5RA 4M7AC 4ZGDB 4BUGA 1VQ9T 1VQNT 2MCNA 3FC3A 3NGPA 2K2VA 3P8HA 2XIDA 3HFOA 3UT1A 4F7UG 5LJ5j 1U1SA 1TUGB 4A4KA 1Q82U 3JCMQ 3N5BB 1Y7XA 1KHCA 4PL6A 5J26A 1WHLA 3VS5A 3LGLA 1QVGP 4LDWA 1W70A 1FMWA 1MMNA 2DJZA 4M78A 3MEAA 3OB9A 3GLXA 2J6OA 4XQ3A 1NZ9A 5EG2A 4OMQA 4A4GA 3OYMA 3VYHB 2JMCA 1Q81R 1RI9A 3J7AF 1AWOA 3ME9A 3RESA 2V1RA 4OVAA 2QEXQ 4PJOC 4RTWA 3CCEQ 2QI2A 1YNZA 2AZVA 2R58A 2CT4A 3QXEB
chains in the Genus database with same CATH topology
2EGAA 1OOTA 1X27A 1JU5C 4JJCA 1HJDA 3EHRA 3A98A 1BK2A 4M4ZA 4D8DA 1I1JA 2DLPA 2FEIA 5ECAA 3TSZA 1HSQA 3VS7A 2BZYA 2JXBA 3H41A 4J9EA 1AWXA 1OPLA 2A37A 3ZL7C 4GBQA 3VS2A 5IHNA 3SHWA 2RQRA 1JEGA 1QCFA 2ESWA 2PZ1A 2SEMA 1PWTA 3H0FA 2EYWA 1M3BA 3EGUA 4IIOA 3REAB 3TVTA 2VKNA 1NLOC 1VYVA 1S1NA 2ED1A 2CDTA 2LX7A 2I0NA 1K76A 1T3LA 1I07A 1Z9QA 2FRYA 4JPBW 1K4US 4IIMA 2E5KA 1AWWA 2RPNA 2RMOA 1UECA 2FPFA 1B3QA 1MV3A 1M8MA 2IIMA 5IH2A 2K6DA 4J9FA 5FWCA 5IXFA 1WIEA 5IHKA 3EHQA 1G2BA 4F16A 3TSWA 2DBKA 2EYZA 1KSWA 3UA7A 4K11A 2ROLA 3PVQA 2GNCA 1N5ZA 4J9IA 1M27C 2L3QA 2HEQA 3LH5A 2ECZA 5GJVB 1M3CA 3C0CA 1AZEA 1WDXA 1BBZA 2YUPA 2VWFA 1ZX6A 2XMFA 1UJYA 2HCKA 4J9BA 1WXBA 4HXJA 2JS2A 2B86A 2A08A 1TG0A 2W0ZA 3I9QA 1FMKA 1ABQA 1ZUUA 3VS6A 1PRLC 1AZGB 4JJDA 1GL5A 2JM9A 1RUWA 2EQIA 2KT1A 4CC4B 2C0OA 2K2MA 1X6BA 2JS0A 2L3SA 2DF6A 4J9HA 4QT7A 2LJ0A 1NLPC 2L0AA 2EW3A 1YWPA 4ESRA 1E6HA 4AFSC 2LJ1A 1K9AA 2DVJA 2KRSA 3EG1A 2DRMA 4LUDA 1HD3A 2DM1A 1OV3A 2EYYA 2KR3A 1KIKA 1ZUKA 2JM8A 1GBRA 4J9DA 2J7IA 4J9GA 2GTOA 2YUOA 3VRZA 1QKWA 2CH4A 1CKBA 2J6KA 1OPKA 2FPDA 1X2QA 2JW4A 3R6NA 2HDAA 2FRWA 2CT3A 2CUBA 1H8KA 1M30A 1SHFA 1UHCA 2AKLA 1JXMA 1WXTA 2O9VA 1Z9ZA 1AWJA 2GGRA 4Z89A 1ARKA 2X3XD 3QWXX 1X6GA 1U5SA 1GRIA 1W6XA 4DEXA 1GCQA 3ULRB 2G6FX 4RTZA 1B07A 1UHFA 2RQVA 5I22A 2KXDA 2P4RA 2KROA 4LN2A 5FWBA 2BZ8A 1PKTA 1WXUA 3PE0A 2A36A 4Z88A 2DE0X 2LNHB 2DJQA 2EBPA 2EKHA 2F2VA 4GLMA 1MUZA 2KXCA 3SEMA 2O9SA 1UDLA 3I35A 4KRTA 4RTTA 2OAWA 1JO8A 1A0NB 2D8JA 2JT4A 4Y92A 2YUNA 2AKKA 2YDLA 1UG1A 3VS3A 2DYBA 4FSSA 2KT8A 2A28A 1UJ0A 2C0IA 4AFZC 3EG0A 2KRMA 1CKAA 1K0XA 3CQTA 1TUDA 4AFUC 1NG2A 5EC7A 2D0NA 3VS4A 4J9CA 2KGTA 4OMNA 1UE9A 1T3SA 2M51A 5GJWB 1PNJA 1XOVA 4OMMA 4RTUA 1JQQA 2AZSA 1AOJA 2L2PA 2VVKA 3U23A 4AG2C 2J05A 2X3WD 2CSIA 2EPDA 1OEBA 1AEYA 2JMAA 3M0PA 1ZSGA 3FJ5A 1SRLA 2MIOA 1MV0B 2ROTA 3NHNA 1BB9A 1GFDA 2LZ6B 3VS1A 3RBBB 1AD5A 4X1VA 2KYMA 3M0QA 4F14A 3QWYA 4OMPA 2CH4W 1SRMA 3THKA 2W10A 3GBQA 4JJBA 3IQLA 1NEBA 3I5SA 5HCKA 5I11A 1E7OA 4CC3A 2PNIA 2DX1A 4HVVA 2GQIA 1QKXA 2J06A 2L3PA 4D8KA 2ED0A 2LMJA 1GFCA 1UGVA 2M0YA 4OMLA 2YUQA 2O31A 5IXBA 1YWOA 3M0TA 4AFQC 3M0UA 2DRKA 3PVLA 1K0SA 1LCKA 2F2XA 3RNJA 2YT6A 2O88A 1BU1A 2LQNA 4LNPA 1EFNA 1UUEA 1T0JA 2KBTA 1SHGA 2C0TA 3H0HA 1NEGA 2CUDA 1QWFA 2J6FA 2O2OA 1YP5A 1WA7A 1ZBJA 3JV3A 2BZXA 2GTJA 2EGEA 1YN8A 2YSQA 4JZ3A 1KJWA 2DNUA 2KYBA 3EG3A 1NYFA 3UATA 2KE9A 1X69A 2RF0A 3NMZC 1PRMC 2FPEA 4F17A 2DL3A 1Y57A 2D8HA 2F2WA 4RUGA 4DEYA 4E6RA 1CSKA 1M3AA 1WLPB 1IO6A 1H92A 2DL8A 2RQWA 2LJ3A 4CC7A 1YCSB 4JZ4A 4WCIA 1RLQC 4R0KA 3H0IA 2FG0A 1PHTA 5FW9A 2RNAA 2PTKA 1GCPA 2EVRA 1E6GA 1ZLMA 1VYUA 3UA6A 3O5ZA 3VS0A 1VA7A 4LE9A 1ABOA 1WX6A 2LQWA 3NPFA 4ORZA 3EG2A 2AK5A 2DL7A 1PKSA 1W1FA 2DA9A 4AG1C 4A63B 1Y0MA 4OMOA 2DMOA 2NWMA 2KRNA 5IHIA 2LP5A 1U3OA 4RTVA 3UF4A 1WI7A 2D1XA 2DL4A 4HVWA 1GCQC 2ENMA 2CSQA 2HBWA 2DILA 1UTIA 1QWEA 4RTXA 1VYTA 2QDLA 3I5RA 4Z8AA 2MOXA 1SSHA 2EYXA 1TUCA 2MCNA 3NGPA 2NUZA 1SPKA 2KNBB 1JXOA 1FYNA 1QLYA 1SEMA 1H3HA 1I0CA 3KFVA 4ZNXA 1WFWA 4LUEA 1GBQA 2H8HA 1RLPC 2BTTA 2DL5A 3VS5A 1UFFA 1KFZA 1G83A 2DBMA 5L23A 2K9GA 1X2KA 2K7AA 1W70A 3M0SA 4EIKA 2JTEA 2K3BA 1WYXA 4HCKA 2V1QA 2KEAA 1J3TA 4CC2A 2K79A 2J6OA 2OI3A 2SRCA 2RQTA 1NYGA 2ABLA 2HSPA 2RN8A 4OMQA 4RTYA 1T0HA 2JMCA 1RI9A 3VRYA 1NM7A 1AWOA 1V1CA 1X43A 1U06A 2OJ2A 4HVUA 2V1RA 1AVZC 2FO0A 1K1ZA 2EGCA 2RQUA 4RTWA 3REBB 3M0RA 2LCSA 1YNZA 2AZVA 1ZUYA 2CREA 2CT4A 2GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGA A;  1OOT A;  1X27 A;  1JU5 C;  4JJC A;  1HJD A;  3EHR A;  3A98 A;  1BK2 A;  4M4Z A;  4D8D A;  1I1J A;  2DLP A;  2FEI A;  5ECA A;  3TSZ A;  1HSQ A;  3VS7 A;  2BZY A;  2JXB A;  3H41 A;  4J9E A;  1AWX A;  1OPL A;  2A37 A;  3ZL7 C;  4GBQ A;  3VS2 A;  5IHN A;  3SHW A;  2RQR A;  1JEG A;  1QCF A;  2ESW A;  2PZ1 A;  2SEM A;  1PWT A;  3H0F A;  2EYW A;  1M3B A;  3EGU A;  4IIO A;  3REA B;  3TVT A;  2VKN A;  1NLO C;  1VYV A;  1S1N A;  2ED1 A;  2CDT A;  2LX7 A;  2I0N A;  1K76 A;  1T3L A;  1I07 A;  1Z9Q A;  2FRY A;  4JPB W;  1K4U S;  4IIM A;  2E5K A;  1AWW A;  2RPN A;  2RMO A;  1UEC A;  2FPF A;  1B3Q A;  1MV3 A;  1M8M A;  2IIM A;  5IH2 A;  2K6D A;  4J9F A;  5FWC A;  5IXF A;  1WIE A;  5IHK A;  3EHQ A;  1G2B A;  4F16 A;  3TSW A;  2DBK A;  2EYZ A;  1KSW A;  3UA7 A;  4K11 A;  2ROL A;  3PVQ A;  2GNC A;  1N5Z A;  4J9I A;  1M27 C;  2L3Q A;  2HEQ A;  3LH5 A;  2ECZ A;  5GJV B;  1M3C A;  3C0C A;  1AZE A;  1WDX A;  1BBZ A;  2YUP A;  2VWF A;  1ZX6 A;  2XMF A;  1UJY A;  2HCK A;  4J9B A;  1WXB A;  4HXJ A;  2JS2 A;  2B86 A;  2A08 A;  1TG0 A;  2W0Z A;  3I9Q A;  1FMK A;  1ABQ A;  1ZUU A;  3VS6 A;  1PRL C;  1AZG B;  4JJD A;  1GL5 A;  2JM9 A;  1RUW A;  2EQI A;  2KT1 A;  4CC4 B;  2C0O A;  2K2M A;  1X6B A;  2JS0 A;  2L3S A;  2DF6 A;  4J9H A;  4QT7 A;  2LJ0 A;  1NLP C;  2L0A A;  2EW3 A;  1YWP A;  4ESR A;  1E6H A;  4AFS C;  2LJ1 A;  1K9A A;  2DVJ A;  2KRS A;  3EG1 A;  2DRM A;  4LUD A;  1HD3 A;  2DM1 A;  1OV3 A;  2EYY A;  2KR3 A;  1KIK A;  1ZUK A;  2JM8 A;  1GBR A;  4J9D A;  2J7I A;  4J9G A;  2GTO A;  2YUO A;  3VRZ A;  1QKW A;  2CH4 A;  1CKB A;  2J6K A;  1OPK A;  2FPD A;  1X2Q A;  2JW4 A;  3R6N A;  2HDA A;  2FRW A;  2CT3 A;  2CUB A;  1H8K A;  1M30 A;  1SHF A;  1UHC A;  2AKL A;  1JXM A;  1WXT A;  2O9V A;  1Z9Z A;  1AWJ A;  2GGR A;  4Z89 A;  1ARK A;  2X3X D;  3QWX X;  1X6G A;  1U5S A;  1GRI A;  1W6X A;  4DEX A;  1GCQ A;  3ULR B;  2G6F X;  4RTZ A;  1B07 A;  1UHF A;  2RQV A;  5I22 A;  2KXD A;  2P4R A;  2KRO A;  4LN2 A;  5FWB A;  2BZ8 A;  1PKT A;  1WXU A;  3PE0 A;  2A36 A;  4Z88 A;  2DE0 X;  2LNH B;  2DJQ A;  2EBP A;  2EKH A;  2F2V A;  4GLM A;  1MUZ A;  2KXC A;  3SEM A;  2O9S A;  1UDL A;  3I35 A;  4KRT A;  4RTT A;  2OAW A;  1JO8 A;  1A0N B;  2D8J A;  2JT4 A;  4Y92 A;  2YUN A;  2AKK A;  2YDL A;  1UG1 A;  3VS3 A;  2DYB A;  4FSS A;  2KT8 A;  2A28 A;  1UJ0 A;  2C0I A;  4AFZ C;  3EG0 A;  2KRM A;  1CKA A;  1K0X A;  3CQT A;  1TUD A;  4AFU C;  1NG2 A;  5EC7 A;  2D0N A;  3VS4 A;  4J9C A;  2KGT A;  4OMN A;  1UE9 A;  1T3S A;  2M51 A;  5GJW B;  1PNJ A;  1XOV A;  4OMM A;  4RTU A;  1JQQ A;  2AZS A;  1AOJ A;  2L2P A;  2VVK A;  3U23 A;  4AG2 C;  2J05 A;  2X3W D;  2CSI A;  2EPD A;  1OEB A;  1AEY A;  2JMA A;  3M0P A;  1ZSG A;  3FJ5 A;  1SRL A;  2MIO A;  1MV0 B;  2ROT A;  3NHN A;  1BB9 A;  1GFD A;  2LZ6 B;  3VS1 A;  3RBB B;  1AD5 A;  4X1V A;  2KYM A;  3M0Q A;  4F14 A;  3QWY A;  4OMP A;  2CH4 W;  1SRM A;  3THK A;  2W10 A;  3GBQ A;  4JJB A;  3IQL A;  1NEB A;  3I5S A;  5HCK A;  5I11 A;  1E7O A;  4CC3 A;  2PNI A;  2DX1 A;  4HVV A;  2GQI A;  1QKX A;  2J06 A;  2L3P A;  4D8K A;  2ED0 A;  2LMJ A;  1GFC A;  1UGV A;  2M0Y A;  4OML A;  2YUQ A;  2O31 A;  5IXB A;  1YWO A;  3M0T A;  4AFQ C;  3M0U A;  2DRK A;  3PVL A;  1K0S A;  1LCK A;  2F2X A;  3RNJ A;  2YT6 A;  2O88 A;  1BU1 A;  2LQN A;  4LNP A;  1EFN A;  1UUE A;  1T0J A;  2KBT A;  1SHG A;  2C0T A;  3H0H A;  1NEG A;  2CUD A;  1QWF A;  2J6F A;  2O2O A;  1YP5 A;  1WA7 A;  1ZBJ A;  3JV3 A;  2BZX A;  2GTJ A;  2EGE A;  1YN8 A;  2YSQ A;  4JZ3 A;  1KJW A;  2DNU A;  2KYB A;  3EG3 A;  1NYF A;  3UAT A;  2KE9 A;  1X69 A;  2RF0 A;  3NMZ C;  1PRM C;  2FPE A;  4F17 A;  2DL3 A;  1Y57 A;  2D8H A;  2F2W A;  4RUG A;  4DEY A;  4E6R A;  1CSK A;  1M3A A;  1WLP B;  1IO6 A;  1H92 A;  2DL8 A;  2RQW A;  2LJ3 A;  4CC7 A;  1YCS B;  4JZ4 A;  4WCI A;  1RLQ C;  4R0K A;  3H0I A;  2FG0 A;  1PHT A;  5FW9 A;  2RNA A;  2PTK A;  1GCP A;  2EVR A;  1E6G A;  1ZLM A;  1VYU A;  3UA6 A;  3O5Z A;  3VS0 A;  1VA7 A;  4LE9 A;  1ABO A;  1WX6 A;  2LQW A;  3NPF A;  4ORZ A;  3EG2 A;  2AK5 A;  2DL7 A;  1PKS A;  1W1F A;  2DA9 A;  4AG1 C;  4A63 B;  1Y0M A;  4OMO A;  2DMO A;  2NWM A;  2KRN A;  5IHI A;  2LP5 A;  1U3O A;  4RTV A;  3UF4 A;  1WI7 A;  2D1X A;  2DL4 A;  4HVW A;  1GCQ C;  2ENM A;  2CSQ A;  2HBW A;  2DIL A;  1UTI A;  1QWE A;  4RTX A;  1VYT A;  2QDL A;  3I5R A;  4Z8A A;  2MOX A;  1SSH A;  2EYX A;  1TUC A;  2MCN A;  3NGP A;  2NUZ A;  1SPK A;  2KNB B;  1JXO A;  1FYN A;  1QLY A;  1SEM A;  1H3H A;  1I0C A;  3KFV A;  4ZNX A;  1WFW A;  4LUE A;  1GBQ A;  2H8H A;  1RLP C;  2BTT A;  2DL5 A;  3VS5 A;  1UFF A;  1KFZ A;  1G83 A;  2DBM A;  5L23 A;  2K9G A;  1X2K A;  2K7A A;  1W70 A;  3M0S A;  4EIK A;  2JTE A;  2K3B A;  1WYX A;  4HCK A;  2V1Q A;  2KEA A;  1J3T A;  4CC2 A;  2K79 A;  2J6O A;  2OI3 A;  2SRC A;  2RQT A;  1NYG A;  2ABL A;  2HSP A;  2RN8 A;  4OMQ A;  4RTY A;  1T0H A;  2JMC A;  1RI9 A;  3VRY A;  1NM7 A;  1AWO A;  1V1C A;  1X43 A;  1U06 A;  2OJ2 A;  4HVU A;  2V1R A;  1AVZ C;  2FO0 A;  1K1Z A;  2EGC A;  2RQU A;  4RTW A;  3REB B;  3M0R A;  2LCS A;  1YNZ A;  2AZV A;  1ZUY A;  2CRE A;  2CT4 A;  2GBQ A; 
#chains in the Genus database with same CATH topology
 1OOT A;  1X27 A;  4PJL A;  4D6W A;  4JRK A;  1JU5 C;  1RAC B;  4BAC A;  4M4Z A;  1Q86 C;  2DER A;  1HSQ A;  2JXB A;  3H41 A;  3LYI A;  3SWN C;  2A37 A;  1Q7Y C;  3ZL7 C;  5KE2 A;  4GBQ A;  3VS2 A;  5IHN A;  3CCS Q;  1JEG A;  1Y71 A;  2ESW A;  3TVT A;  1VYV A;  5CIU A;  1S1N A;  1QVF A;  3FJP A;  3OYD A;  3G4S T;  1PC0 A;  3VV0 A;  1K76 A;  1Z9Q A;  4EMK C;  1D1A A;  4IIM A;  1M90 C;  4AMC A;  3BY7 A;  1B3Q A;  2H3E B;  5I2S A;  1KQS P;  2IIM A;  1XTD A;  5IH2 A;  4KBM B;  2O01 E;  3EHQ A;  3R6O A;  2RHI A;  1N8R C;  2DBK A;  2K57 A;  1XQH A;  4C92 E;  3JCM J;  3S3O A;  5I2M A;  1NE8 A;  3PVQ A;  4K11 A;  1VQN A;  4BE2 A;  4P5N A;  3HP9 A;  1QVP A;  1M3C A;  3HTR A;  2K5F A;  1WDX A;  2E3H A;  4FSX A;  2YUP A;  2CP2 A;  4J9B A;  5GAN d;  2WSE E;  4HXJ A;  2KAF A;  1UEB A;  4BDZ A;  3VS6 A;  1Y96 A;  3V8J A;  2X4J A;  1H3Z A;  5A0D A;  3EFO B;  1AZG B;  2JM9 A;  5GAN 7;  2EQI A;  5HKC A;  4CC4 B;  3OSV A;  2C0O A;  1VQP A;  4FYX B;  2K2M A;  1X6B A;  4UC4 A;  4QT7 A;  4J6X A;  2O4X B;  4OB3 B;  3RKY A;  1KC8 C;  2XD0 A;  1K9A A;  1WHK A;  4J6Y A;  1LOJ A;  3V8L A;  1YIT T;  1HD3 A;  1RAA B;  3JCM W;  1OV3 A;  3QJ6 A;  2WSC E;  2EWN A;  1SF9 A;  1ZUK A;  2JM8 A;  2KI7 A;  5GAN j;  2CH4 A;  3HRT A;  1VQO Q;  1VQL T;  1CKB A;  4E7H A;  4M75 G;  1OPK A;  5KYW B;  2DKG A;  3PFS A;  2JW4 A;  2ATC B;  1H8K A;  1M30 A;  1MGQ A;  2E64 A;  5I21 A;  4M77 G;  1KD1 C;  3LX7 A;  1JXM A;  2O9V A;  5GAN 6;  4X34 A;  2G3R A;  1Z9Z A;  2DXU A;  1AWJ A;  3CCJ Q;  2DD4 A;  3RKX A;  1X6G A;  1GRI A;  4DEX A;  3ULR B;  1B07 A;  1UHF A;  1ZSZ A;  2VUB A;  4FYV B;  3CEY A;  3OW2 S;  2KXD A;  2D0Q B;  3CBM A;  4ME7 A;  5FWB A;  2FZG B;  1NJI R;  1MHN A;  2LCL A;  2DE0 X;  1Q82 C;  2DJQ A;  5CKH A;  1MMA A;  2KXC A;  3I55 Q;  4BE1 A;  1UDL A;  5CR2 A;  4EMG A;  5KCO A;  3PIP A;  2CS7 A;  1B7T A;  1KQ2 A;  2DYB A;  5GAN f;  1BI3 A;  4PK4 A;  3SDZ A;  3JB9 F;  3JAM E;  2NUP A;  3EG0 A;  1CKA A;  3LLR A;  3PT9 A;  3CQT A;  1TUD A;  4PFO A;  3GNF B;  2VC8 A;  3VS4 A;  4J9C A;  1UE9 A;  5GJW B;  3GNG A;  1XOV A;  4OMM A;  2QA4 A;  1VQ6 T;  3U23 A;  5LJ5 g;  3MJX A;  2CSI A;  4KH0 B;  4E7S A;  5CCA A;  2RJD A;  1WJS A;  4KH1 B;  4M78 B;  1YIT A;  2GFA A;  1MV0 B;  1EIF A;  2ROT A;  4M7A G;  1VQ8 T;  3VS1 A;  3V7S A;  4N0A C;  5GMK h;  3M0Q A;  1YI2 Q;  5GMK m;  1K9M R;  1HK9 A;  2COZ A;  3F70 A;  4OB0 B;  4ELZ C;  3J81 E;  4RG8 A;  3QYH B;  5D6W A;  7AT1 B;  2NLU A;  2ZGW A;  4MDX A;  5A2Q E;  2GQI A;  1QKX A;  2QQB A;  1WHG A;  4M78 D;  4Y91 A;  2LMJ A;  4AT1 B;  4OGC A;  3JCM h;  2HMA A;  5DLO A;  2ZPB B;  3CCS T;  3JCM e;  4AFQ C;  1WHH A;  3PVL A;  1M2V B;  1K0S A;  4PJO G;  2M16 A;  1K9M U;  4KGV B;  2RH2 A;  3MP8 A;  2YT6 A;  3CMA A;  2FZK B;  2LQN A;  2NUT B;  4A4F A;  2AT1 B;  5DY9 A;  3JB9 J;  2O2O A;  1VQK Q;  4FYY B;  5FRO A;  4DBR A;  3CD6 A;  3C95 A;  2CP7 A;  4M7D G;  2JJ9 A;  3JCM g;  3CCV Q;  1VQ6 A;  1X69 A;  1KG1 A;  5GAO p;  2D8H A;  5GAO l;  2BE7 D;  4E6R A;  3M56 A;  4PLL A;  3KUF A;  3SB2 A;  1ZHI A;  3D7S B;  1Y96 B;  3OYN A;  4JS5 A;  2LRQ A;  2XKO C;  4JZ4 A;  2M9U A;  1VQ8 A;  3OW2 P;  4F7U A;  1C0M A;  4HT9 A;  2HL5 C;  3UA6 A;  3O5Z A;  1YJW Q;  1D1C A;  3PIO A;  1TS9 A;  3EG2 A;  3CCR Q;  3HHT B;  1K8A R;  4WTO B;  2AIR B;  1QP2 A;  3QYG B;  2X4W A;  4M7D B;  2Z0W A;  3FEO A;  4AG1 C;  3MO8 A;  4OMO A;  2DMO A;  3CME Q;  2OAU A;  1VQO T;  1UB4 A;  2MK5 A;  1VQ4 T;  1W4S A;  2QDY B;  1U3O A;  2PUK B;  4RTV A;  5L8R E;  4J7F A;  2GCX A;  1WI7 A;  1FMV A;  3GIB A;  3CPW A;  2K4Y A;  3MHX A;  2DTO A;  4KUD K;  2KY9 A;  1QWE A;  5AT1 B;  3A8O B;  1TOV A;  3EGD A;  3CCJ T;  1TUC A;  1ZA2 B;  1FYN A;  1QLY A;  1I0C A;  3KFV A;  1Q95 G;  2YXY A;  2DXC A;  2VGN A;  3WVE B;  4C0Z A;  1KK7 A;  1GBQ A;  1I5L A;  3CC4 Q;  2PVD B;  2BTT A;  2DL5 A;  1WZO A;  3URG A;  1KFZ A;  2K9G A;  2RJF A;  3I55 T;  1X2K A;  2P0Q A;  2EJF A;  1M90 U;  4EIK A;  1TU0 B;  3G71 Q;  1BIA A;  1WYX A;  2KEA A;  4CC2 A;  5KH6 A;  2K79 A;  4JS4 A;  2EKO A;  1NYG A;  2ABL A;  2RQT A;  2RN8 A;  1V1C A;  2OJ2 A;  2DEQ A;  4HVU A;  1AVZ C;  3CC2 Q;  2E3I A;  5LJ3 h;  3REB B;  2LCS A;  1X6O A;  1G5V A;  3BFM A;  5GAO q;  1N9R A;  5LJ3 e;  2O4X A;  3CBP A;  2GBQ A;  2EGA A;  2HD0 A;  4LDU A;  5CKB A;  3EFS A;  1QQJ A;  4N4I A;  4IUP A;  1BK2 A;  1I1J A;  2DLP A;  5CQY A;  5ECA A;  1M5Q 1;  1W2B S;  4L5G A;  1VQ7 Q;  2LC4 A;  4J9E A;  4N4H A;  2ZPG B;  3M57 A;  4QVC A;  3CPF A;  5KYW A;  1NPP A;  2MF2 A;  1YI2 T;  1PWT A;  3H0F A;  4IIO A;  3VUZ A;  3REA B;  3M58 A;  1IGU A;  2BUD A;  1VQ4 A;  2MYS A;  4O6J A;  2CDT A;  2LQK A;  1T3L A;  1I07 A;  4E7K A;  3MPU B;  1JJ2 A;  3OYG A;  1K9M C;  2FRY A;  1VUB A;  2P84 A;  3Q1J A;  4E7J A;  1AWW A;  1D0Y A;  1UEC A;  2FPF A;  2EJ9 A;  4C5H A;  1MV3 A;  2OTL Q;  1M8V A;  5IXF A;  5LJ5 d;  4A53 A;  4BI3 A;  2P4T A;  3CCJ A;  4OP0 A;  2GNC A;  1M27 C;  2PVO B;  3LH5 A;  5C6S A;  3RMS A;  3PTA A;  3C0C A;  4C8Q G;  2XMF A;  3KBG A;  1UJY A;  5D7U A;  2B86 A;  3I55 A;  3HSB A;  2DO3 A;  3DB3 A;  1VQK T;  4BY6 B;  2KSS A;  4JJD A;  2RHU A;  3CCM Q;  3MEW A;  2OTJ Q;  2KT1 A;  2L3R A;  4C0D C;  2X35 A;  2EAY A;  2LJ0 A;  5GAM h;  3MCA B;  3X26 B;  2EW3 A;  3GF5 A;  5KE3 A;  1OX9 A;  2KRS A;  4C8Q B;  2DRM A;  2P0K A;  5CKF A;  4LUD A;  5GAM e;  3G7Z A;  4FT2 A;  1KIK A;  4C92 G;  1GBR A;  3WXM B;  1IXD A;  4XU0 A;  1RAG B;  2BE9 B;  3CCU Q;  1YJ9 Q;  2PU9 B;  1IHW A;  2PUO B;  3CCQ Q;  4F7U B;  2QAS A;  2FHD A;  1YJW T;  4FIB A;  2RJE A;  3CCR T;  2K3X A;  1QVF S;  2GGR A;  1DJ7 B;  1W6X A;  1GCQ A;  2DXT A;  3JRZ A;  1K8A C;  4RTZ A;  3UDC A;  3OSS C;  5I22 A;  4PFP A;  3EG9 A;  4C92 B;  5LJ5 f;  2BZ8 A;  1Q81 U;  1PKT A;  2D9T A;  4M7A A;  3PE0 A;  2DAQ A;  1M2V A;  2A36 A;  4Z88 A;  2LNH B;  5GMK j;  1KHI A;  3FB9 A;  1N27 A;  2O9S A;  4JUV A;  2NUT A;  2JNG A;  2RK1 A;  1A0N B;  2JT4 A;  4Y92 A;  2YDL A;  3CCL A;  3VS3 A;  1D1B A;  3E9G A;  2KT8 A;  3EGD B;  4HCB A;  2GF7 A;  1W2B P;  4OB1 B;  2RM4 A;  4N4G A;  1RAB B;  4Y28 E;  1VQ9 A;  2K5I A;  2QGG A;  2LDM A;  3HFN A;  2D0N A;  3M9Q A;  2M02 A;  3QDF A;  1PNJ A;  3V7R A;  5C0M A;  1K73 R;  5CAI A;  1JQQ A;  2AZS A;  3FRN A;  1AOJ A;  1M4Z A;  2K3Y A;  4RKU E;  4PJM A;  5CKE A;  1MMD A;  4XTZ A;  2DTH A;  4TVR A;  3NTK A;  1BB9 A;  3RBB B;  3BW1 A;  4NL2 A;  3G1J A;  2NYS A;  4OMP A;  2EQU A;  3THK A;  3QDR B;  2W10 A;  3GBQ A;  4JJB A;  1M1K R;  1NEB A;  1ZSZ C;  2Y4X A;  3I5S A;  4MZM A;  3CC7 Q;  6AT1 B;  1K73 U;  3I56 Q;  2C06 A;  3M53 A;  2CGH A;  2VAS A;  4E7L A;  2PNI A;  1YJW A;  2J06 A;  4D8K A;  2KDS A;  3H9N A;  3DKM A;  4M7D A;  1ZA1 B;  3CCR A;  1RAI B;  3T9N A;  4NL3 A;  1VQ7 T;  2O31 A;  2H3J A;  4OB2 B;  2RI5 A;  1IZ6 A;  2GQV A;  1QW1 A;  1YWO A;  2JZ2 A;  4C0F A;  3M0T A;  3HKS A;  3J80 E;  3QZ5 B;  3L42 A;  2MAM A;  2DRK A;  4JJN K;  2ZAE A;  1QMC A;  3OS0 A;  3G4S A;  2J6F A;  5LL6 S;  4FL6 A;  3A8H B;  1VQ5 Q;  4LD9 K;  4CRI A;  2CYZ B;  1OI1 A;  3QHS A;  4PNO A;  2V8K A;  4A4E A;  4ZTF A;  2BZX A;  4A4H A;  1YN8 A;  2YRD A;  3JB9 G;  2KK4 A;  1FX7 A;  3MKD A;  4MZT A;  1KJW A;  3CXC A;  3CBO A;  3EG3 A;  1NYF A;  4M75 B;  2KMT A;  1BI2 A;  5GAN 2;  1G3S A;  1IHV A;  2PQW A;  3QJY A;  2L89 A;  3LH0 A;  4RUG A;  4M77 B;  1QVF P;  1IRE B;  1AHJ B;  5GAO r;  3CCM T;  2RQW A;  2OTJ T;  1YCS B;  2HZY A;  3E19 A;  1B34 A;  5FW9 A;  2RNA A;  2PTK A;  3QBY A;  1GCP A;  4HT8 A;  1ZLM A;  2EFI A;  4M75 D;  3VS0 A;  2WAC A;  1NJI U;  4LE9 A;  1TXQ A;  1W1F A;  4FM4 B;  4M77 D;  5FU6 C;  4BDY A;  2CZ6 B;  5FU7 C;  1Y0M A;  5FLX E;  2E4H A;  2HL3 A;  5IHI A;  1OQK A;  2Y4Y A;  2LNV A;  2QEX T;  3CCU T;  4M78 F;  1YJ9 T;  1WNL A;  3CCE T;  4BE0 A;  1Q81 C;  1VQL A;  2D1X A;  5LJ3 j;  4HVW A;  1BI1 A;  3TCJ A;  2A7Y A;  2CSQ A;  1G3Y A;  3AT1 B;  3SFM A;  1YJN Q;  4KGZ B;  4RTX A;  3M5A A;  2Y90 A;  4Z8A A;  4L6V 5;  1YIJ Q;  4J5Y A;  3H6Z A;  2L8D A;  2KNB B;  1JXO A;  1H3H A;  2XI9 A;  4ZNX A;  1EZZ B;  1WFW A;  3EG9 B;  2H8H A;  4EPC A;  4M7A B;  3OBY A;  1R0B G;  2JVV A;  1UFF A;  2M1H A;  3EAE A;  4M78 E;  5CQX A;  1WJR A;  2K7A A;  5GMK l;  3M0S A;  2K3B A;  2HKQ B;  1JB0 E;  4NOY A;  2V1Q A;  4E7Z A;  1AT1 B;  2SRC A;  1NBE B;  2HSP A;  1P92 A;  4RTY A;  1T0H A;  3VRY A;  5KYX A;  3OYJ A;  1C1A A;  1VIE A;  1X43 A;  1V76 A;  5GAN 4;  4QW2 A;  2FO0 A;  1K1Z A;  4RG2 A;  3M0R A;  2QYZ A;  5CVI A;  3X24 B;  2RI3 A;  4LDY A;  2ZPE B;  4M7A D;  2OTJ A;  1ZUY A;  2CP0 A;  2CRE A;  1ACM B;  3C4S A;  9ATC B;  5GAN 8;  1YFN A;  4JJC A;  4IUT A;  1HJD A;  4C8Q A;  2LX9 A;  4IUV A;  1UGR B;  4PJO B;  1K73 C;  2FEI A;  2QGF B;  2X4X A;  4BI8 B;  3VS7 A;  1TTH B;  2P0P A;  4X9C A;  2JTM A;  1IB8 A;  2COY A;  1QCF A;  2SEM A;  2EYW A;  1M3B A;  3EGU A;  5D6X A;  2VKN A;  1NLO C;  2XDP A;  2LQ8 A;  1X01 A;  2HQX A;  2QEX A;  2ED1 A;  2LX7 A;  3CCE A;  3CC7 T;  3SWN B;  2CKK A;  4JPB W;  1TWB A;  1K4U S;  3I56 T;  2E5K A;  2E10 A;  2RPN A;  4PJO D;  3CPW S;  5GAM j;  3OYH A;  1M8M A;  2EQK A;  5GAN e;  2K6D A;  5FWC A;  5IHK A;  1G2B A;  3TEE A;  2DYI A;  4F16 A;  1VQP Q;  3TSW A;  2EYZ A;  1N5Z A;  2HQE A;  2MMP A;  4C92 A;  2QTX A;  2DIQ A;  5KYN A;  2L3Q A;  1JRI A;  3OS1 A;  2HEQ A;  4EMK B;  4M7D F;  1D0X A;  4KT0 E;  2VWF A;  1SG5 A;  3CCS A;  3QKJ A;  1O75 A;  1OU9 A;  1LPL A;  1Q7Y R;  1WXB A;  2RHZ A;  5J39 A;  1I81 A;  2A08 A;  5IN1 A;  1ABQ A;  1MMG A;  4QQG A;  1K8A U;  1VQ5 T;  1PRL C;  4XTU A;  4M7D D;  3M4Y A;  1OZ2 A;  3OYE A;  1GL5 A;  1PCX A;  1R0C B;  4IKF A;  1RUW A;  1SSF A;  3PMT A;  4B9W A;  3M59 A;  1NPR A;  1UGP B;  3OYF A;  3P8B B;  1HXD A;  1NLP C;  1N8R R;  2RB6 A;  4PJN A;  1PD1 A;  2FYK A;  4AFS C;  4EDU A;  2LJ1 A;  3VKI A;  2DVJ A;  1NJI C;  2QG9 B;  2EYY A;  2KVQ G;  1M9S A;  2KR3 A;  2YRV A;  4IUR A;  4J9D A;  1YCY A;  2DIG A;  2J7I A;  4B9X A;  4ZN3 A;  5GMK i;  2YUO A;  2EIF A;  1QKW A;  2K5L A;  1QVG A;  1VOM A;  2J6K A;  1RAF B;  2FPD A;  1WJQ A;  3R6N A;  2HDA A;  2FRW A;  4RCB A;  2EQM A;  1B34 B;  1N6A A;  3QG1 A;  1UHC A;  3GOX A;  1WXT A;  2E1H A;  2I2L A;  3JB9 H;  3V8K A;  3CC7 A;  3X25 B;  2DZ9 A;  5GAO n;  3NTH A;  2E12 A;  3I56 A;  1JJ2 S;  3OYY A;  2LT1 A;  2DFU A;  1PG5 B;  2RQV A;  4XTX A;  2P4R A;  2QA4 Q;  4LN2 A;  2DD5 A;  2ZPI B;  3RUX A;  4C8Q E;  4CI0 C;  3E9F A;  1BIB A;  2XK0 A;  2F2V A;  4XTV A;  1VQO A;  2DTI A;  1MUZ A;  1RAE B;  4EMH A;  3OQ5 A;  5GAN 3;  3A8G B;  1M1F A;  4KRT A;  1RAD B;  2OAW A;  4ZGE B;  1YJN T;  1JO8 A;  3QPH A;  2D8J A;  2YUN A;  2AKK A;  1UG1 A;  3BDL A;  1BCM A;  4FSS A;  3OS2 A;  1YIJ T;  5LJ3 g;  1UJ0 A;  2MWO A;  3LWH A;  1ZBX A;  5DLQ E;  3E2U A;  1M2O A;  4PKC C;  1K0X A;  4F04 B;  3L2V A;  2YRC A;  4AFU C;  3ZBD A;  2QXF A;  5EC7 A;  4M78 C;  2KGT A;  5HK0 A;  4OMN A;  1WGS A;  2M51 A;  1T3S A;  1KQS A;  1MND A;  4JLG A;  5KCH A;  3VUB A;  3OYK A;  4M75 A;  1S72 Q;  2L2P A;  3SD4 A;  4AG2 C;  2X3W D;  1OEB A;  2VXF A;  1AEY A;  3M0P A;  4M77 A;  1ZSG A;  3CPW P;  4ANJ A;  3INZ A;  3L2Z A;  2MIO A;  1Q82 R;  1U1T A;  2RD1 A;  3PMI A;  4DA4 A;  5KYX B;  3OYL A;  1AD5 A;  3CMA Q;  2KYM A;  2DZC A;  4F14 A;  4QVD A;  3QWY A;  2CH4 W;  1SRM A;  3RER A;  4A54 A;  3RMQ A;  3G6E Q;  4JRI A;  2DX1 A;  4HVV A;  2L3P A;  4LDX A;  3CCV T;  1WPY A;  1GFC A;  3CD6 Q;  1FWZ A;  2M0Y A;  4C8Q F;  4JDS A;  1QP3 A;  4NS5 A;  4QQD A;  4J7I A;  1VQ6 Q;  1LCK A;  1UGQ B;  4PJJ A;  3E1S A;  2IVW A;  4RMO A;  2O88 A;  1YI2 A;  2CZ0 B;  1UUE A;  3UPU A;  1WHM A;  1SHG A;  2KBT A;  2C0T A;  3H0H A;  1NEG A;  4C8Q D;  1OYX A;  3WVD B;  2F5K A;  4F7U F;  1YJN A;  5A0L A;  1VQ8 Q;  1YP5 A;  1VQP T;  1BCO A;  2E65 A;  3HL8 A;  3OS5 A;  3JCM d;  3JV3 A;  1YIJ A;  1EX4 A;  1BKB A;  2XDB A;  1BI0 A;  1PD0 A;  2GTJ A;  2EGE A;  5GAM g;  2YSQ A;  3CME T;  3OYB A;  2CP3 A;  5CO7 A;  1YBY A;  4JZ3 A;  1PSF A;  2E6Z A;  3EGX B;  3QO3 A;  4C92 F;  1SKU B;  2V8J A;  3TU4 K;  3OYI A;  3QSU A;  1D0Z A;  2RF0 A;  3NMZ C;  1D3B A;  2FPE A;  4F17 A;  1Y57 A;  1F1B B;  4FU6 A;  3AHU A;  1WLP B;  1IO6 A;  1JJ2 P;  4F7U E;  2A3L A;  2LTO A;  4C92 D;  3NFC A;  3PGG A;  1H64 1;  1VQK A;  1PM3 A;  4R0K A;  4M7D C;  2FG0 A;  2AHJ B;  2L5Q A;  1OUL A;  2QQR A;  2EVR A;  1VYU A;  3CC4 T;  1VA7 A;  1ABO A;  1WX6 A;  2LQW A;  1VQM Q;  4ELY C;  4ORZ A;  4PJO A;  2DL7 A;  3MP6 A;  1PKS A;  2KQW A;  3LWI A;  4R55 A;  3G71 T;  2X4Y A;  4ZN1 A;  4A63 B;  1IRX A;  3CCV A;  2JTF A;  3HRU A;  4FW2 A;  1YHQ Q;  2KRN A;  3O8V A;  3OYA A;  3CC2 T;  4GY5 A;  3OY9 A;  1QCO A;  2DL4 A;  2ZCF B;  2M0O A;  3KXT A;  3M54 A;  3SWN A;  2HBW A;  2DIL A;  1UTI A;  4OF1 A;  3L2U A;  1RL2 A;  4MMK A;  4DBF A;  3BE3 A;  2MOX A;  1SSH A;  2EYX A;  2VYT A;  1RAH B;  2NUZ A;  4C5I A;  1SPK A;  1SEM A;  4GLK A;  2QA4 T;  4QVZ A;  2D6F A;  4EMK A;  4MDW A;  1R77 A;  4LUE A;  1RLP C;  3JCM f;  3MEU A;  3CME A;  1G83 A;  2DBM A;  5L23 A;  3DLL A;  1JBM A;  3ER0 A;  1M1K U;  2JTE A;  3M55 A;  2GFU A;  3CXC S;  3QZ9 B;  2E70 A;  2HSE B;  8AT1 B;  4HCK A;  1J3T A;  1O9S A;  2JUF A;  2JOY A;  2OI3 A;  2CP6 A;  1GXI E;  3A8M B;  1WQW A;  4HA8 A;  4DOV A;  2OTL T;  1G8X A;  1UGS B;  4J8O A;  4BB7 A;  1NM7 A;  3S3M A;  1U06 A;  1VQ4 Q;  3L1A A;  2RQU A;  2EGC A;  2RA2 A;  4B6M A;  5IT9 E;  2DXB A;  3LW5 E;  4KUL A;  1S72 T;  2CZ7 B;  4LD6 A;  3M4G A;  4FYW B;  3ASK A;  3EHR A;  3A98 A;  3CC4 A;  4XU2 A;  4FCY A;  4D8D A;  2XU8 A;  3ZFJ A;  5LJ5 h;  3TSZ A;  2F69 A;  3JCM V;  1OX8 A;  4M75 F;  2BZY A;  3G71 A;  4XU3 A;  1AWX A;  1OPL A;  5LJ5 e;  3SHW A;  2RQR A;  3CMA T;  1ZQ1 A;  2PZ1 A;  2RHX A;  5LJ3 d;  2RHY A;  4M77 F;  4XU1 A;  3CC2 A;  4BD3 A;  3H8Z A;  5HK3 A;  2I0N A;  2DVE A;  2BKD N;  4M78 G;  3RKW A;  3G6E T;  4JRP A;  2COW A;  5DM7 R;  2RMO A;  4ZTJ A;  5KYY B;  4OMF B;  5AYF A;  1I4K 1;  2A0F B;  3OW2 A;  4J9F A;  1WIE A;  2VV5 A;  2VGM A;  3CD6 T;  1KSW A;  3JSC A;  3UA7 A;  2ROL A;  4J9I A;  1PSE A;  1XNI A;  4LDV A;  3MET A;  2RO0 A;  2QK0 A;  2FVU A;  5KYU A;  3HPW A;  4M75 E;  2ECZ A;  2YLC A;  3P8D A;  5GJV B;  1VQ7 A;  1G3T A;  1AZE A;  2DPP B;  4BY6 C;  1BBZ A;  1ZX6 A;  3C94 A;  3CCQ T;  2HCK A;  4M77 E;  3JB9 D;  1U8R A;  2ZZD A;  2JN0 A;  1G3W A;  2JS2 A;  3LGF A;  1TG0 A;  2W0Z A;  3I9Q A;  1FMK A;  4ZGJ B;  1ZUU A;  3MEV A;  2CP5 A;  1TSF A;  4XK8 E;  5HY6 A;  3QII A;  4BI4 A;  4C8Q C;  2OTL A;  5GMK e;  2JS0 A;  3VU3 C;  4C0G A;  4O5V A;  2LCC A;  3X28 B;  1KQ1 A;  2L3S A;  4J83 A;  2DF6 A;  2VB6 A;  4J9H A;  5D6Y A;  2L0A A;  2IPO B;  4E7I A;  1YWP A;  4ESR A;  1E6H A;  2F1L A;  3EG1 A;  5CKD A;  3C12 A;  2DM1 A;  1S72 A;  4M7A F;  2B8A A;  4C0D B;  1D3B B;  1D09 B;  2DK3 A;  2RJC A;  4J9G A;  2GTO A;  2QAZ A;  4KUI A;  3VRZ A;  1X2Q A;  5FRN A;  1XJW B;  2CT3 A;  2CUB A;  3GPL A;  2MPX C;  1I8F A;  3CCM A;  1SHF A;  5GAO m;  2BIV A;  4Z02 A;  3CCL Q;  5GAM d;  2EJG A;  4QQ6 A;  2AKL A;  5LJ3 f;  1RI0 A;  4C92 C;  2XIC A;  3RR6 A;  1VQM T;  4MZP A;  3A1P A;  1MNE A;  4N0A A;  2QTV A;  2HBP A;  2XDD A;  4Z89 A;  1ARK A;  3G6E A;  4MML A;  2X3X D;  3QWX X;  3CXC P;  1VQ9 Q;  1VQN Q;  1U5S A;  4XAX B;  2G6F X;  3S3N A;  2EYQ A;  4M7A E;  4E2F B;  4PJO F;  2KRO A;  1YHQ T;  1WXU A;  3OBW A;  2EBP A;  2EKH A;  5GAN 5;  4GLM A;  3SEM A;  3CCU A;  1YJ9 A;  3A5Z B;  3I35 A;  4RTT A;  4XTW A;  5GAN h;  3VJP A;  3CCQ A;  4DBQ A;  2QQ9 A;  3DLM A;  1M1K C;  5J3B A;  3VYG A;  2YLB A;  2A28 A;  1FXX A;  2C0I A;  3RIR A;  4AFZ C;  3L2Q A;  4HCC A;  2KRM A;  2YHT A;  4DQ2 A;  2QQS A;  2DEU A;  5FRM A;  4J6W A;  3BDU A;  1NG2 A;  3OYC A;  4OGE A;  2R5M A;  1Y07 A;  4C5G A;  4PJO E;  3EGX A;  4RTU A;  1VIF A;  1Q86 R;  2OX7 A;  2VVK A;  1IGQ A;  2J05 A;  2WSF E;  2EPD A;  2JMA A;  1LVK A;  4PLI A;  4WF2 A;  2R57 A;  3FJ5 A;  3QUI A;  1SRL A;  3OMC A;  3NHN A;  3EFR A;  3FIF A;  1GFD A;  2LZ6 B;  2ZPH B;  3EH2 A;  5A0G A;  4X1V A;  4KGX B;  4QKU A;  2FB7 A;  4JRQ A;  4HKE A;  2MWP A;  5GAN g;  1M90 R;  3IQL A;  3G4S Q;  1QVG S;  2V8I A;  2MI6 A;  5HCK A;  1C6V X;  1R8O B;  4FT4 A;  5I11 A;  1Q86 U;  1E7O A;  4M7D E;  2E6N A;  4CC3 A;  4C5E A;  5GAM f;  4Q5W A;  4ATO A;  2ED0 A;  1VQM A;  1Q7Y U;  2VXE A;  1UGV A;  4OML A;  1ZSZ B;  2YUQ A;  3DB4 A;  3V7C A;  5IXB A;  4LXC A;  3TQ7 P;  2XHC A;  1QCN A;  4R56 A;  2FL7 A;  3M0U A;  2X51 A;  1YHQ A;  3A8L B;  2RK2 A;  2F2X A;  3RNJ A;  1BU1 A;  1TH7 A;  2RI2 A;  4LNP A;  1EFN A;  1V29 B;  1WQ7 A;  1T0J A;  2FZC B;  1N8R U;  2CUD A;  1QWF A;  2HQH A;  3ZEH A;  2HAX A;  4JLI A;  3OMG A;  4V2S A;  3JB9 I;  1OZ3 A;  3EFO A;  3RDV A;  8ATC B;  1LJO A;  4M75 C;  3JCM P;  1WA7 A;  1ZBJ A;  2NUP B;  3MP1 A;  3JCM b;  4X9D A;  3FLG A;  2F5T X;  1KC8 R;  4L59 A;  3OA6 A;  5KYU B;  4M77 C;  2LT4 A;  3S6W A;  2DNU A;  2KYB A;  3FDR A;  4DOW A;  2DET A;  4IUU A;  3UAT A;  1BYM A;  5IAY A;  2KE9 A;  4XTY A;  3TRE A;  1KQS S;  1YIT Q;  2PVG B;  2XG8 D;  1PRM C;  1X75 C;  2DL3 A;  2F2W A;  4DEY A;  1CSK A;  1M3A A;  1H92 A;  3L2W A;  2IG0 A;  1LNX A;  1VQL Q;  1M1G A;  2X9H A;  2DL8 A;  2LJ3 A;  2CZ1 B;  3HRS A;  4CC7 A;  1VQ5 A;  4IUQ A;  1I5O B;  4WCI A;  4FW1 A;  1RLQ C;  3H0I A;  4VUB A;  1PHT A;  1KD1 R;  1KC8 U;  4PFZ A;  1HYO A;  2YWW A;  2ZPF B;  1E6G A;  4HCZ A;  1WHJ A;  2E5Q A;  1W2B A;  4E47 A;  3NPF A;  2AK5 A;  1OU8 A;  2E41 A;  5CK9 A;  2DA9 A;  3PNW C;  2V26 A;  2NWM A;  3L2R A;  2HKN A;  5M9O A;  3X20 B;  2LP5 A;  3UF4 A;  3EH1 A;  2EQJ A;  3GP8 A;  5FU6 B;  3JCM X;  3UWN A;  1KD1 U;  1GCQ C;  2ENM A;  4YTL A;  2QQA A;  2LVM A;  5FU7 B;  3CCL T;  3NTI A;  3JCM c;  2R5A A;  4DBH A;  1N9S A;  4RCC A;  5KYY A;  2HNI A;  1VYT A;  2QDL A;  4II1 A;  3I5R A;  4M7A C;  4ZGD B;  4BUG A;  1VQ9 T;  1VQN T;  2MCN A;  3FC3 A;  3NGP A;  2K2V A;  3P8H A;  2XID A;  3HFO A;  3UT1 A;  4F7U G;  5LJ5 j;  1U1S A;  1TUG B;  4A4K A;  1Q82 U;  3JCM Q;  3N5B B;  1Y7X A;  1KHC A;  4PL6 A;  5J26 A;  1WHL A;  3VS5 A;  3LGL A;  1QVG P;  4LDW A;  1W70 A;  1FMW A;  1MMN A;  2DJZ A;  4M78 A;  3MEA A;  3OB9 A;  3GLX A;  2J6O A;  4XQ3 A;  1NZ9 A;  5EG2 A;  4OMQ A;  4A4G A;  3OYM A;  3VYH B;  2JMC A;  1Q81 R;  1RI9 A;  3J7A F;  1AWO A;  3ME9 A;  3RES A;  2V1R A;  4OVA A;  2QEX Q;  4PJO C;  4RTW A;  3CCE Q;  2QI2 A;  1YNZ A;  2AZV A;  2R58 A;  2CT4 A;  3QXE B; 
#chains in the Genus database with same CATH homology
 2EGA A;  1OOT A;  1X27 A;  1JU5 C;  4JJC A;  1HJD A;  3EHR A;  3A98 A;  1BK2 A;  4M4Z A;  4D8D A;  1I1J A;  2DLP A;  2FEI A;  5ECA A;  3TSZ A;  1HSQ A;  3VS7 A;  2BZY A;  2JXB A;  3H41 A;  4J9E A;  1AWX A;  1OPL A;  2A37 A;  3ZL7 C;  4GBQ A;  3VS2 A;  5IHN A;  3SHW A;  2RQR A;  1JEG A;  1QCF A;  2ESW A;  2PZ1 A;  2SEM A;  1PWT A;  3H0F A;  2EYW A;  1M3B A;  3EGU A;  4IIO A;  3REA B;  3TVT A;  2VKN A;  1NLO C;  1VYV A;  1S1N A;  2ED1 A;  2CDT A;  2LX7 A;  2I0N A;  1K76 A;  1T3L A;  1I07 A;  1Z9Q A;  2FRY A;  4JPB W;  1K4U S;  4IIM A;  2E5K A;  1AWW A;  2RPN A;  2RMO A;  1UEC A;  2FPF A;  1B3Q A;  1MV3 A;  1M8M A;  2IIM A;  5IH2 A;  2K6D A;  4J9F A;  5FWC A;  5IXF A;  1WIE A;  5IHK A;  3EHQ A;  1G2B A;  4F16 A;  3TSW A;  2DBK A;  2EYZ A;  1KSW A;  3UA7 A;  4K11 A;  2ROL A;  3PVQ A;  2GNC A;  1N5Z A;  4J9I A;  1M27 C;  2L3Q A;  2HEQ A;  3LH5 A;  2ECZ A;  5GJV B;  1M3C A;  3C0C A;  1AZE A;  1WDX A;  1BBZ A;  2YUP A;  2VWF A;  1ZX6 A;  2XMF A;  1UJY A;  2HCK A;  4J9B A;  1WXB A;  4HXJ A;  2JS2 A;  2B86 A;  2A08 A;  1TG0 A;  2W0Z A;  3I9Q A;  1FMK A;  1ABQ A;  1ZUU A;  3VS6 A;  1PRL C;  1AZG B;  4JJD A;  1GL5 A;  2JM9 A;  1RUW A;  2EQI A;  2KT1 A;  4CC4 B;  2C0O A;  2K2M A;  1X6B A;  2JS0 A;  2L3S A;  2DF6 A;  4J9H A;  4QT7 A;  2LJ0 A;  1NLP C;  2L0A A;  2EW3 A;  1YWP A;  4ESR A;  1E6H A;  4AFS C;  2LJ1 A;  1K9A A;  2DVJ A;  2KRS A;  3EG1 A;  2DRM A;  4LUD A;  1HD3 A;  2DM1 A;  1OV3 A;  2EYY A;  2KR3 A;  1KIK A;  1ZUK A;  2JM8 A;  1GBR A;  4J9D A;  2J7I A;  4J9G A;  2GTO A;  2YUO A;  3VRZ A;  1QKW A;  2CH4 A;  1CKB A;  2J6K A;  1OPK A;  2FPD A;  1X2Q A;  2JW4 A;  3R6N A;  2HDA A;  2FRW A;  2CT3 A;  2CUB A;  1H8K A;  1M30 A;  1SHF A;  1UHC A;  2AKL A;  1JXM A;  1WXT A;  2O9V A;  1Z9Z A;  1AWJ A;  2GGR A;  4Z89 A;  1ARK A;  2X3X D;  3QWX X;  1X6G A;  1U5S A;  1GRI A;  1W6X A;  4DEX A;  1GCQ A;  3ULR B;  2G6F X;  4RTZ A;  1B07 A;  1UHF A;  2RQV A;  5I22 A;  2KXD A;  2P4R A;  2KRO A;  4LN2 A;  5FWB A;  2BZ8 A;  1PKT A;  1WXU A;  3PE0 A;  2A36 A;  4Z88 A;  2DE0 X;  2LNH B;  2DJQ A;  2EBP A;  2EKH A;  2F2V A;  4GLM A;  1MUZ A;  2KXC A;  3SEM A;  2O9S A;  1UDL A;  3I35 A;  4KRT A;  4RTT A;  2OAW A;  1JO8 A;  1A0N B;  2D8J A;  2JT4 A;  4Y92 A;  2YUN A;  2AKK A;  2YDL A;  1UG1 A;  3VS3 A;  2DYB A;  4FSS A;  2KT8 A;  2A28 A;  1UJ0 A;  2C0I A;  4AFZ C;  3EG0 A;  2KRM A;  1CKA A;  1K0X A;  3CQT A;  1TUD A;  4AFU C;  1NG2 A;  5EC7 A;  2D0N A;  3VS4 A;  4J9C A;  2KGT A;  4OMN A;  1UE9 A;  1T3S A;  2M51 A;  5GJW B;  1PNJ A;  1XOV A;  4OMM A;  4RTU A;  1JQQ A;  2AZS A;  1AOJ A;  2L2P A;  2VVK A;  3U23 A;  4AG2 C;  2J05 A;  2X3W D;  2CSI A;  2EPD A;  1OEB A;  1AEY A;  2JMA A;  3M0P A;  1ZSG A;  3FJ5 A;  1SRL A;  2MIO A;  1MV0 B;  2ROT A;  3NHN A;  1BB9 A;  1GFD A;  2LZ6 B;  3VS1 A;  3RBB B;  1AD5 A;  4X1V A;  2KYM A;  3M0Q A;  4F14 A;  3QWY A;  4OMP A;  2CH4 W;  1SRM A;  3THK A;  2W10 A;  3GBQ A;  4JJB A;  3IQL A;  1NEB A;  3I5S A;  5HCK A;  5I11 A;  1E7O A;  4CC3 A;  2PNI A;  2DX1 A;  4HVV A;  2GQI A;  1QKX A;  2J06 A;  2L3P A;  4D8K A;  2ED0 A;  2LMJ A;  1GFC A;  1UGV A;  2M0Y A;  4OML A;  2YUQ A;  2O31 A;  5IXB A;  1YWO A;  3M0T A;  4AFQ C;  3M0U A;  2DRK A;  3PVL A;  1K0S A;  1LCK A;  2F2X A;  3RNJ A;  2YT6 A;  2O88 A;  1BU1 A;  2LQN A;  4LNP A;  1EFN A;  1UUE A;  1T0J A;  2KBT A;  1SHG A;  2C0T A;  3H0H A;  1NEG A;  2CUD A;  1QWF A;  2J6F A;  2O2O A;  1YP5 A;  1WA7 A;  1ZBJ A;  3JV3 A;  2BZX A;  2GTJ A;  2EGE A;  1YN8 A;  2YSQ A;  4JZ3 A;  1KJW A;  2DNU A;  2KYB A;  3EG3 A;  1NYF A;  3UAT A;  2KE9 A;  1X69 A;  2RF0 A;  3NMZ C;  1PRM C;  2FPE A;  4F17 A;  2DL3 A;  1Y57 A;  2D8H A;  2F2W A;  4RUG A;  4DEY A;  4E6R A;  1CSK A;  1M3A A;  1WLP B;  1IO6 A;  1H92 A;  2DL8 A;  2RQW A;  2LJ3 A;  4CC7 A;  1YCS B;  4JZ4 A;  4WCI A;  1RLQ C;  4R0K A;  3H0I A;  2FG0 A;  1PHT A;  5FW9 A;  2RNA A;  2PTK A;  1GCP A;  2EVR A;  1E6G A;  1ZLM A;  1VYU A;  3UA6 A;  3O5Z A;  3VS0 A;  1VA7 A;  4LE9 A;  1ABO A;  1WX6 A;  2LQW A;  3NPF A;  4ORZ A;  3EG2 A;  2AK5 A;  2DL7 A;  1PKS A;  1W1F A;  2DA9 A;  4AG1 C;  4A63 B;  1Y0M A;  4OMO A;  2DMO A;  2NWM A;  2KRN A;  5IHI A;  2LP5 A;  1U3O A;  4RTV A;  3UF4 A;  1WI7 A;  2D1X A;  2DL4 A;  4HVW A;  1GCQ C;  2ENM A;  2CSQ A;  2HBW A;  2DIL A;  1UTI A;  1QWE A;  4RTX A;  1VYT A;  2QDL A;  3I5R A;  4Z8A A;  2MOX A;  1SSH A;  2EYX A;  1TUC A;  2MCN A;  3NGP A;  2NUZ A;  1SPK A;  2KNB B;  1JXO A;  1FYN A;  1QLY A;  1SEM A;  1H3H A;  1I0C A;  3KFV A;  4ZNX A;  1WFW A;  4LUE A;  1GBQ A;  2H8H A;  1RLP C;  2BTT A;  2DL5 A;  3VS5 A;  1UFF A;  1KFZ A;  1G83 A;  2DBM A;  5L23 A;  2K9G A;  1X2K A;  2K7A A;  1W70 A;  3M0S A;  4EIK A;  2JTE A;  2K3B A;  1WYX A;  4HCK A;  2V1Q A;  2KEA A;  1J3T A;  4CC2 A;  2K79 A;  2J6O A;  2OI3 A;  2SRC A;  2RQT A;  1NYG A;  2ABL A;  2HSP A;  2RN8 A;  4OMQ A;  4RTY A;  1T0H A;  2JMC A;  1RI9 A;  3VRY A;  1NM7 A;  1AWO A;  1V1C A;  1X43 A;  1U06 A;  2OJ2 A;  4HVU A;  2V1R A;  1AVZ C;  2FO0 A;  1K1Z A;  2EGC A;  2RQU A;  4RTW A;  3REB B;  3M0R A;  2LCS A;  1YNZ A;  2AZV A;  1ZUY A;  2CRE A;  2CT4 A;  2GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...