5IHIA

Crystal structure of the alpha spectrin sh3 domain double mutant v46g-d48g
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
ELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEGNGRQGFVPAAYVKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, non-erythrocytic 1
publication title Crystal Structure of the alpha spectrin SH3 domain double mutant V46G-D48G
rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 12
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ihiA00
1SPKA 3I9QA 5FWBA 3VRZA 1NYGA 2K3BA 1SEMA 2HDAA 2GTOA 4OMMA 2A28A 3FJ5A 4GLMA 3EG3A 5GJWB 1TUCA 3VS2A 1JXMA 3VS1A 2KBTA 2ED0A 2SEMA 2K7AA 5FW9A 1JEGA 1AZGB 1BU1A 4GBQA 2JM8A 5IXFA 1AWXA 1VYUA 2KRMA 2VKNA 4JPBW 4ZNXA 1GFDA 2RF0A 2V1RA 1PKSA 4J9BA 2DVJA 1WXBA 1A0NB 2A08A 2F2VA 2MOXA 1WLPB 3NGPA 4WCIA 2E5KA 1AOJA 1WXUA 4JZ4A 3UA7A 1AD5A 1ZLMA 2RMOA 2K6DA 4FSSA 1J3TA 5IXBA 1JXOA 3GBQA 5IHIA 2B86A 1K1ZA 2PTKA 2EBPA 4J9EA 2YUOA 1VYTA 3CQTA 2JW4A 1X69A 3PVQA 2JXBA 4Y92A 4OMOA 2DLPA 1UJ0A 1I1JA 3H0HA 2D8HA 1QCFA 1T0HA 1CKAA 1PNJA 1M8MA 2F2WA 1G2BA 2BZYA 2O88A 1WA7A 1OEBA 3REBB 1SHGA 4LUDA 1RI9A 2J6FA 2RNAA 4HVWA 3THKA 1YN8A 1Y0MA 2V1QA 2W0ZA 1PWTA 2KYBA 2KNBB 1UGVA 2HEQA 2EGAA 4D8DA 1KJWA 2YDLA 2AZSA 1CKBA 1GCQC 1Z9QA 2LJ1A 2G6FX 2YUQA 4IIMA 2DJQA 1UFFA 1NG2A 1PRLC 4LN2A 4F16A 2K9GA 5IH2A 1B3QA 2EYZA 2OJ2A 2GTJA 2EVRA 4HVUA 1T3SA 4RTTA 1WIEA 1B07A 2LQNA 1GCPA 4DEXA 4RTZA 2CSIA 1T3LA 2ROLA 1NYFA 2L3QA 2EGCA 1HD3A 2KT8A 1BK2A 1QWEA 2JS0A 1UECA 3VS7A 1N5ZA 3EG2A 2NWMA 1I0CA 3VS6A 2YT6A 1RUWA 5L23A 2L0AA 2CT3A 3H0IA 5FWCA 1H3HA 2KXDA 1X6GA 1HSQA 2J7IA 3SEMA 3M0RA 4J9FA 1JU5C 4JJCA 4X1VA 1AWOA 1YP5A 2DF6A 3NMZC 2CREA 2LQWA 4RTYA 2D0NA 2EGEA 3VS0A 3NPFA 4Z88A 1ZUYA 4CC4B 1GRIA 3EHRA 2O9SA 2DMOA 2OAWA 4ESRA 1E6GA 1E6HA 2PZ1A 1K4US 3I5SA 2DRKA 1NEBA 2RPNA 3PVLA 2AKLA 1ARKA 1WYXA 1SHFA 4KRTA 1K0SA 2LP5A 2X3XD 2DL7A 1RLPC 2LX7A 4OMLA 2CUBA 1UE9A 1WI7A 3LH5A 4CC7A 2DILA 1HJDA 2DM1A 2SRCA 2KGTA 3O5ZA 2KR3A 2GNCA 1M3BA 3NHNA 1Z9ZA 2J6OA 3VS3A 2L3PA 3VRYA 1AEYA 2RQTA 4QT7A 2LZ6B 2J05A 4RUGA 2J6KA 1X2KA 1UHCA 1M3AA 4M4ZA 1AWWA 1VYVA 4DEYA 4AFZC 2ROTA 3A98A 2DBKA 3UF4A 1ZX6A 4A63B 1GCQA 2J06A 1K76A 1SRMA 2F2XA 2DNUA 2D1XA 2BTTA 1EFNA 3TSWA 1E7OA 1XOVA 4Z8AA 1V1CA 2GBQA 1RLQC 4F14A 1ZUUA 2DL5A 4EIKA 4OMPA 2JMCA 2KYMA 2L3SA 5IHNA 2FRYA 2GGRA 2RN8A 1JO8A 1UTIA 1KFZA 2FEIA 2RQUA 1U3OA 2EPDA 5EC7A 2KE9A 1BB9A 5GJVB 2DX1A 1X27A 2PNIA 4LNPA 1MV0B 2ABLA 5I11A 3M0QA 2LJ0A 3QWYA 2FPEA 2P4RA 2C0OA 3M0TA 4J9IA 1ZUKA 2KRSA 5IHKA 1GL5A 2DL3A 3RNJA 1WXTA 2O9VA 2CDTA 3C0CA 1BBZA 1PKTA 4JZ3A 3PE0A 1X2QA 1YNZA 1NEGA 3I5RA 1TG0A 4HCKA 1YWOA 2EW3A 2ECZA 2L2PA 2XMFA 2YUPA 4JJBA 1GFCA 1PRMC 2MIOA 3ZL7C 2AZVA 2CSQA 2LMJA 1QKXA 3VS4A 4J9CA 5I22A 3M0SA 2KEAA 3IQLA 1JQQA 2RQWA 1WFWA 1CSKA 3UATA 2GQIA 1S1NA 2D8JA 1UDLA 2JT4A 3I35A 1NLOC 1QWFA 5ECAA 2KROA 1K0XA 1FYNA 3M0UA 3M0PA 2EYXA 4RTXA 4K11A 1TUDA 1ZBJA 2YSQA 3R6NA 4RTUA 2W10A 1T0JA 2M51A 2KXCA 2MCNA 1QKWA 3SHWA 3TSZA 2VVKA 4E6RA 1X6BA 2RQVA 4Z89A 4IIOA 2O2OA 3RBBB 1LCKA 1UJYA 1OOTA 1I07A 4AFQC 1IO6A 2EYWA 1M3CA 4ORZA 1U06A 4LE9A 2DL4A 2BZXA 1OPLA 1QLYA 3VS5A 4AG1C 1AVZC 4R0KA 1H8KA 1SSHA 3TVTA 5HCKA 1AWJA 1FMKA 1YWPA 1PHTA 1ABOA 2LJ3A 4RTWA 2ED1A 2EQIA 2DYBA 1M30A 2NUZA 1K9AA 1H92A 1M27C 3JV3A 4OMNA 1MUZA 2A36A 2M0YA 3REAB 2OI3A 2DL8A 1U5SA 2C0TA 1UHFA 2H8HA 3EG0A 1MV3A 2K79A 2AK5A 2FPDA 4RTVA 1VA7A 2DRMA 2ENMA 1UG1A 4AG2C 2I0NA 4OMQA 1OPKA 4F17A 2ESWA 2QDLA 2FPFA 1GBRA 1W6XA 2JMAA 2VWFA 1NM7A 1KSWA 4LUEA 1YCSB 2YUNA 4AFUC 4JJDA 2KT1A 2FRWA 2JS2A 2JM9A 2HSPA 2K2MA 1GBQA 4AFSC 2HCKA 1G83A 2CH4A 4D8KA 2C0IA 1ZSGA 2A37A 4CC3A 3EHQA 2LNHB 2BZ8A 2CT4A 1W70A 3ULRB 4HXJA 2EYYA 2LCSA 2DA9A 3EGUA 3QWXX 2FO0A 2CH4W 1SRLA 2HBWA 1UUEA 4CC2A 2O31A 4J9DA 2FG0A 1X43A 4HVVA 1Y57A 1W1FA 4J9GA 2X3WD 1OV3A 2RQRA 2CUDA 2AKKA 3H41A 3U23A 1NLPC 3UA6A 1WDXA 1WX6A 4J9HA 2DE0X 1AZEA 3KFVA 2JTEA 1ABQA 2DBMA 3H0FA 2KRNA 2IIMA 3EG1A 1KIKA 2EKHA
chains in the Genus database with same CATH superfamily
4KGZB 2MF2A 1NYGA 1SEMA 2EJFA 2VGNA 1M1KR 4GLMA 3CCMA 4IUVA 1YJ9Q 1R0CB 1WJQA 3CCQA 4HCCA 2ED0A 4XTXA 4QKUA 1I8FA 4EMKA 2COZA 5FU6B 2K7AA 1VQLQ 4GBQA 2JM8A 4PFPA 2VKNA 2Y4XA 5CO7A 2QQBA 4A4KA 1YJWQ 2JVVA 3VYHB 2DVJA 3CCUA 2MOXA 3NGPA 3NTHA 2E5KA 1AOJA 3HKSA 2V8IA 1ZLMA 2RMOA 2K6DA 4C8QA 2A0FB 2EJGA 1JXOA 2EQUA 2BKDN 2PTKA 2YUOA 1VYTA 4FL6A 4C0DC 2DIGA 2JW4A 1PM3A 4OMOA 3QZ9B 1I1JA 2VV5A 1D3BB 4PJMA 2D8HA 1QCFA 3BE3A 1BI1A 5GANj 1HYOA 2O88A 4M75C 1W4SA 1OEBA 1YI2Q 2CZ0B 1RI9A 4OGEA 1PSEA 1GXIE 1Y0MA 2W0ZA 1IHVA 2KNBB 1YJ9A 4PJLA 1LNXA 2K3YA 2AZSA 1CKBA 2CP2A 5CQYA 1FX7A 2JTMA 1Q82U 1QP2A 1VQLA 4LN2A 4QW2A 2K9GA 5CK9A 1B3QA 2EYZA 3RMSA 5LJ3h 2KSSA 4Q5WA 1G3SA 2X35A 3BW1A 3G71A 3GNFB 4KT0E 1M5Q1 4FW2A 4M78D 4BD3A 3CCMT 3G4SQ 3OW2P 2K5FA 4J8OA 2CYZB 4F7UA 4C92G 3LWIA 1VQOA 2KT8A 2CP3A 3GPLA 1SSFA 3OYBA 1VQ8Q 2NWMA 1K73U 1RUWA 3JCMJ 1VQKQ 2E5QA 3H0IA 1Q82R 2KXDA 1X6GA 1HSQA 4J9FA 2HD0A 4JJCA 5C6SA 2DVEA 1NJIR 3NMZC 1QVPA 1KHIA 1W2BP 9ATCB 1V76A 2IG0A 2EGEA 5LJ5d 3X26B 3CCUT 4Z88A 4CC4B 1FXXA 1GRIA 3EHRA 4C0GA 2O9SA 4ESRA 1E6GA 2PZ1A 5GAMh 3OYAA 1Y07A 2BE7D 1QVFS 3PVLA 1WYXA 4KRTA 5I2SA 2CUBA 2K3XA 4CC7A 3JSCA 1HJDA 3CCJQ 1QVFA 1RAIB 3VS3A 4KGVB 2RQTA 1KC8U 4C0ZA 1YBYA 1VQ8A 3RESA 3OYCA 1VQLT 1ZSZA 1VQKA 4FYYB 2ROTA 4HA8A 2H3JA 1GCQA 3G6EQ 5CVIA 1YITT 3E9GA 1YJWT 1Y7XA 5KYXA 2VASA 3PTAA 3RR6A 3JCMP 4RG8A 4E7IA 1EFNA 5FU7C 3ZBDA 1XOVA 2DETA 3PNWC 5LJ5j 1ZSZC 1V1CA 4Z8AA 3JCMc 1NPPA 3I55Q 3OS0A 4R55A 1YJNQ 2DL5A 1I5LA 4M7DG 4EIKA 1C0MA 2JMCA 1ZQ1A 2F5TX 4Y91A 1ZA1B 5IHNA 4HT9A 3MEAA 1WNLA 1YI2T 3TQ7P 1KFZA 1BCMA 1WJRA 4EPCA 2EPDA 1F1BB 1BB9A 5GMKh 2X4YA 5GJVB 2DX1A 4C0FA 2HBPA 4NL3A 3QWYA 3L2ZA 2R5MA 2C0OA 3HRUA 3CBPA 4B6MA 2JNGA 5IHKA 3OYIA 3C0CA 3S3MA 1MGQA 3PE0A 1X2QA 5J26A 3GLXA 1YNZA 3I5RA 4O6JA 1QQJA 1UB4A 2EW3A 3FRNA 3DLLA 4JJBA 3G4ST 1TUGB 1LJOA 1EX4A 4FT4A 2CSQA 4BY6B 8ATCB 1VQ8T 2COYA 2CP5A 3M0SA 2KEAA 3IQLA 3I55A 3CC7T 2JZ2A 1S1NA 1YJNA 5CKDA 2D8JA 1DJ7B 4B9XA 4DBFA 5ECAA 1FYNA 5DY9A 1K9MR 3M9QA 1ZBJA 1XJWB 1D0ZA 2W10A 1T0JA 4E6RA 2KXCA 3OYGA 5GMKm 2OTLQ 1M2VA 3M55A 1QCOA 1X6BA 4Z89A 4MMKA 4XU0A 1G3WA 1LCKA 1RAGB 4BDYA 1Q86C 1Y96B 1UJYA 3OYKA 1OOTA 1RADB 2NUTA 1IXDA 1M3CA 2DL4A 3VS5A 2DD5A 2CKKA 4AG1C 1AVZC 1VQ5A 3EGDB 3CPFA 1QVFP 1H8KA 2HSEB 1IREB 1SSHA 1BIAA 3TVTA 3CC4T 3WVEB 3CCJT 2LJ3A 3OBYA 2ED1A 1RI0A 1Q81U 1K9AA 2ZZDA 1H92A 2XDDA 1MUZA 1TWBA 2M0YA 3REAB 3OBWA 3MP8A 3LW5E 2L89A 3J81E 2C0TA 1VQ6Q 4AT1B 3EG0A 1SG5A 4M78A 2RHZA 3G6ET 2ENMA 1UG1A 3MJXA 4XU1A 4FYXB 1BI0A 3JCMf 4F17A 2ESWA 2QDLA 2YRVA 2VWFA 3QYHB 3URGA 4LUEA 1YCSB 3OSSC 1N9RA 1Q81R 4AFUC 2KT1A 3P8DA 3ZEHA 4GLKA 5D7UA 3I55T 1PCXA 3QXEB 1KD1C 2HSPA 3OYJA 1GBQA 1YJNT 1M2VB 4D8KA 3OYMA 1RAFB 4E7ZA 1KK7A 3QO3A 4C92F 2LNHB 3WVDB 2CT4A 3SDZA 4EDUA 1IGQA 3ULRB 1TS9A 2QYZA 2NUPB 3QYGB 2DA9A 3QWXX 4ELZC 5GAOr 1SRLA 4LDXA 3D7SB 3KXTA 4L6V5 4PLLA 2HZYA 2FG0A 1X43A 1Y57A 5LJ3g 2D6FA 1O9SA 2X3WD 3KUFA 2E4HA 2RQRA 4FT2A 3H41A 2LNVA 3U23A 1WDXA 1WX6A 1AZEA 1MNEA 2QTVA 4Z02A 1KQSS 3CCLQ 2KRNA 2PVOB 3EG1A 5CKFA 4A4GA 2YXYA 2M9UA 1SPKA 5GMKl 2K3BA 3V7RA 1TTHB 2MWOA 2EYQA 3LH0A 2A28A 4OMMA 3SD4A 5GANh 3GIBA 4OB0B 2LX9A 4M78B 2RA2A 4IUTA 2KBTA 3EGXB 2MPXC 3H6ZA 4C92E 3S3OA 5DLOA 1KQSA 4A54A 3CBOA 3VYGA 1TXQA 2SEMA 5FW9A 1JEGA 3BDUA 1BU1A 4M77B 5GAMg 2KRMA 1VQ9Q 5IAYA 1BCOA 3V8JA 1GFDA 2RF0A 2OTLT 3L2RA 3L2WA 1PKSA 4J9BA 4PFOA 1WXBA 1ZA2B 1UGPB 1WLPB 3QDRB 4N0AA 3META 4V2SA 4LD9K 2GF7A 1S72Q 3V8KA 2E6ZA 1J3TA 2R58A 4JDSA 5IXBA 3OMCA 5IHIA 2B86A 4J9EA 1K1ZA 1OU8A 2XD0A 4M7DD 3CQTA 4ZTFA 3M54A 3T9NA 1UJ0A 3EH2A 5CR2A 3H0HA 2LT4A 1CKAA 3TEEA 1KHCA 1M8MA 2BZYA 3JCMW 2VYTA 1SHGA 1XQHA 4M7DF 4LUDA 5LJ3e 2J6FA 2K5LA 3THKA 1YN8A 3X25B 1I81A 5GAMf 2GQVA 5M9OA 2EGAA 2OAUA 3JAME 4M7AG 1JRIA 1Q7YR 1VQ6T 2VC8A 1NG2A 1PRLC 3OMGA 1N8RR 2AT1B 2L3RA 3EAEA 5HY6A 2OJ2A 2EVRA 5IN1A 5L8RE 2DXBA 5LL6S 4RTTA 5GAOp 4DA4A 4IUUA 4DEXA 5FRMA 2YRCA 1M1KU 3OQ5A 2XU8A 1D1BA 1FMVA 1NYFA 2P0PA 4LDVA 4P5NA 1S72A 2O4XA 4PJOG 4IKFA 3MEWA 4MZTA 1I0CA 3CD6Q 4DOWA 2YT6A 3PGGA 1R8OB 2XHCA 1AT1B 2J7IA 4M7DE 1JU5C 4QQDA 2CREA 2M02A 3RKYA 1YCYA 3DLMA 2XIDA 3A8LB 1ZUYA 2WSEE 3FLGA 2DEQA 3JCMV 2DTHA 1E6HA 4KUIA 3AT1B 2AKLA 1ARKA 1SHFA 4C5EA 3R6OA 3GOXA 5LJ5h 3UPUA 3CCLT 5KE2A 1OI1A 3CEYA 4RCCA 4RCBA 2QASA 3OB9A 1OX8A 2DILA 2SRCA 5J39A 1YITQ 1KQSP 4XAXB 1TU0B 1Z9ZA 2J6OA 4M75A 3RUXA 1WHMA 2LZ6B 2J05A 5I2MA 2VUBA 1TOVA 3EFOA 3HL8A 1VQ9T 3RERA 4AFZC 2LQ8A 3UF4A 1ZX6A 4A63B 8AT1B 2J06A 1K76A 2QAZA 3UWNA 4BI4A 4FM4B 5GAN4 2O4XB 4GY5A 1MMGA 5KE3A 2QEXQ 4MZPA 3M57A 3V7CA 2GFUA 2BTTA 2K57A 3TSWA 2QQSA 1E7OA 3PMIA 1S72T 3BY7A 1OYXA 5KYWA 1K8AU 4A4HA 4A53A 5GAN3 1M1KC 1H3ZA 1LOJA 2CZ1B 4NS5A 3X20B 2ZPFB 3OSVA 5GMKe 2RK1A 2M16A 3L42A 4KBMB 4C92C 2K5IA 3C94A 3FB9A 4OMPA 1NBEB 5AYFA 3L1AA 1NJIU 1WHHA 2GGRA 2RN8A 2LCCA 1JO8A 5FROA 2RQUA 1B34A 2BE9B 1YITA 4EMKB 2KE9A 4D6WA 1YJWA 2LCLA 1X75C 2PNIA 4LNPA 1MV0B 2X4WA 4YTLA 4VUBA 5I11A 2MK5A 2DO3A 3M0QA 2XDPA 4XTWA 5CQXA 1K8AR 2FPEA 4E2FB 3CCEQ 4J9IA 2KRSA 3S6WA 2DXUA 2DL3A 1WXTA 2O9VA 1G8XA 3CC7Q 1BBZA 1V29B 4C8QG 4M75B 2RJFA 3LX7A 3MP1A 5FLXE 1AHJB 1NEGA 1TG0A 3A8HB 1VQ7Q 2QEXA 1WHLA 4C8QB 6AT1B 1YI2A 3EFOB 3QPHA 1GFCA 3GNGA 2MIOA 3JCMd 4J9CA 3CD6T 3UATA 2JTFA 2KY9A 2PVDB 1VQPQ 1NLOC 5KYWB 4QQ6A 4JLIA 4K11A 1KG1A 1OZ2A 3R6NA 2MCNA 3CC4Q 2CP6A 4A4EA 2ZPGB 2FYKA 1RAEB 2RQVA 1WJSA 2O2OA 1Q95G 3FIFA 3G4SA 2EFIA 2KQWA 2DZCA 1IO6A 4ORZA 5I21A 4FW1A 4XU2A 2EQMA 4LE9A 3M56A 4BDZA 1B34B 5GANg 1PSFA 3Q1JA 4OP0A 3HHTB 1RABB 3JCMb 3CC7A 2CP0A 2EJ9A 3J80E 2K2VA 3TCJA 4F7UB 1P92A 3CPWS 1Q82C 4M7DC 1PHTA 4RTWA 2I2LA 4OMNA 3E2UA 2MMPA 3X24B 4PJJA 2KK4A 2L5QA 3CPWA 1U5SA 3M53A 1UHFA 1VUBA 2LDMA 1OU9A 2ZPBB 2HQXA 1VQPA 2DXCA 2RHIA 2QGGA 4RTVA 1K73C 1VOMA 4AG2C 2DIQA 2QEXT 4M7AF 2KAFA 2X4JA 1OPKA 4MZMA 2FPFA 3CC4A 2DPPB 5KYUA 1KSWA 1MMNA 1LPLA 3CCJA 3OYDA 1IRXA 2X9HA 4FYVB 2JS2A 4PK4A 4BY6C 4WTOB 2MWPA 4AFSC 2HCKA 4QQGA 2HAXA 2CH4A 2QA4Q 1BIBA 2BZ8A 1ZBXA 2FL7A 4PJOF 4HXJA 2EYYA 2YLBA 1K9MU 1VQMT 3G6EA 3FJPA 4OVAA 2FZGB 1FMWA 1UUEA 2HBWA 4CC2A 1YHQQ 1PD0A 1H641 5FU7B 1ZSZB 2K4YA 2EQJA 2Y4YA 4N4GA 5GANe 3CMEQ 3CCET 2CUDA 3E9FA 4XQ3A 5KYXB 4M7AE 1QVGS 3HRTA 2IPOB 3EFSA 3KFVA 1KC8C 2JTEA 1MNDA 4AMCA 3LYIA 2LVMA 3MEVA 1VQ7T 1KIKA 1B7TA 3I9QA 5FWBA 3VRZA 2HDAA 4EMGA 3FJ5A 1U8RA 4Y28E 1TUCA 1QVGA 3QJYA 1JXMA 3VS2A 1WQWA 3INZA 4JJNK 3BDLA 1O75A 4PJOE 3JB9G 5KYUB 1AZGB 2EKOA 1RAAB 3RKXA 1VQPT 5IXFA 1VYUA 5GAN7 4ZNXA 5GAN5 3MEUA 1U1TA 2V1RA 4FCYA 5LJ5g 3SB2A 1YHQA 1I4K1 1N6AA 1A0NB 2QK0A 5A0GA 1AD5A 2PU9B 2RM4A 2ATCB 1VQ4Q 1RAHB 1M8VA 5CCAA 3OYHA 1X69A 3PVQA 2JXBA 4Y92A 4ZN1A 3NFCA 4OB2B 3A8GB 5CIUA 3S3NA 1T0HA 3OS1A 3VV0A 4KH1B 2FHDA 1NE8A 3REBB 2F1LA 4IUPA 3JCMX 3CCST 4KULA 4BE1A 4PKCC 4BE0A 2RNAA 2OTLA 1PWTA 3MKDA 4J5YA 2HEQA 4C92D 3OYFA 1SKUB 2YDLA 1Z9QA 2G6FX 4ZN3A 2YUQA 3QDFA 2DJQA 3M4GA 3VU3C 4F16A 2VGMA 2A3LA 4HVUA 2RJEA 2RI3A 3WXMB 2NUTB 1WIEA 4RTZA 1LVKA 3CMAQ 4C8QF 1M90U 2L3QA 1HD3A 1QWEA 2JS0A 3SWNC 1UECA 2HQEA 3VS6A 3SFMA 1G3TA 1VQ4A 2QA4T 2CT3A 2DKGA 5FWCA 2X4XA 4A4FA 4M77C 3M0RA 1VQ6A 4X1VA 2V8JA 3M4YA 1AWOA 1YP5A 3C12A 3UT1A 2LT1A 5LJ5e 2ZPIB 4QVZA 1PC0A 1YHQT 4RTYA 2D0NA 5CAIA 3NPFA 4M78G 5FRNA 1XTDA 5A0DA 4XTZA 1TH7A 2WSCE 4BE2A 2DMOA 4RMOA 1K4US 3CMET 1M90R 5GAN2 1Q81C 2JOYA 1D1AA 1NEBA 4M77G 4N4IA 4WF2A 2DL7A 1RLPC 2CZ6B 2LX7A 1IGUA 4CI0C 3ER0A 3DKMA 1WI7A 4C8QE 3LH5A 5LJ3f 1QVGP 3QZ5B 1KQ2A 1BI3A 4F7UF 3I56Q 2QGFB 4DQ2A 3O5ZA 3EH1A 5GAOn 1M3BA 3NHNA 4KH0B 2QQAA 3CCRQ 3VRYA 3L2QA 5CKBA 2E64A 4ZTJA 2J6KA 4KUDK 1X2KA 1Q7YU 1YIJQ 1VYVA 2PUKB 4DEYA 2RHXA 2DBKA 1N8RU 1QCNA 4M7AC 1WGSA 1UEBA 1SRMA 3CCLA 4PLIA 4J6YA 3RIRA 1M4ZA 2JUFA 3HP9A 3CC2Q 1WPYA 3GP8A 2OTJQ 1OX9A 4C5GA 4L59A 2RHUA 1VQ4T 4F14A 1M1GA 4E47A 1R0BG 5C0MA 1VQNQ 4PJOC 3CXCS 3A5ZB 3O8VA 3OW2S 2KYMA 2AIRB 1VQ9A 4XTVA 2FEIA 3V8LA 5KCHA 3I56A 2EQKA 5EC7A 2FB7A 1I5OB 3CCQQ 1X27A 2ABLA 3CXCA 2LJ0A 3OW2A 2P4RA 1HK9A 3M0TA 4R56A 5FU6C 3TU4K 3A8OB 3HFNA 4E7SA 1PKTA 3QBYA 4HCKA 2L2PA 3CMAT 2YUPA 1D3BA 2R5AA 1PRMC 3CC2A 1M9SA 2R57A 1Y71A 2E10A 3JCMQ 2LMJA 3VS4A 5DM7R 2JN0A 3FDRA 3HRSA 5I22A 3JB9D 1CSKA 2GQIA 4E7JA 2CS7A 1UDLA 3BFMA 2FVUA 3I35A 1QWFA 2KROA 1MMDA 3JCMh 3M0PA 1TUDA 3P8HA 1N8RC 2GFAA 2P0QA 2YSQA 3JB9F 4ANJA 2DXTA 4RTUA 3SHWA 1QKWA 2BUDA 4JRQA 2VVKA 2C06A 2HL5C 4LDUA 2ZCFB 1C1AA 4NOYA 4AFQC 5CKHA 2RHYA 2E12A 2DAQA 3HSBA 4PFZA 1QLYA 1IHWA 3GF5A 4QVCA 3CD6A 2DERA 3DB3A 1QP3A 1U1SA 4DBHA 3G71Q 5HCKA 5DLQE 4C92A 1YWPA 3I56T 2QXFA 5CKEA 1ABOA 1D09B 5KH6A 1M30A 2NUZA 4EMKC 2H3EB 3CCRT 4J83A 1VQOQ 3JV3A 1PD1A 5KCOA 1C6VX 2DD4A 2M0OA 5GAN6 3QSUA 4HCZA 3UDCA 2OI3A 2Y90A 3HFOA 2D9TA 3PIPA 1M2OA 2E3HA 1YIJT 2DK3A 2E65A 3PFSA 4FU6A 1MV3A 3QIIA 2K79A 2KDSA 2FPDA 2MYSA 1VA7A 2YLCA 4FYWB 2I0NA 2FZKB 4OMQA 1GBRA 2JMAA 2JJ9A 4C8QC 1WZOA 1VQMQ 3CC2T 2YUNA 4LXCA 2OTJT 4JJDA 2LQKA 2LC4A 3MHXA 2CP7A 2L8DA 2JM9A 2K2MA 3ME9A 4N4HA 5D6YA 1G83A 4OB3B 4C0DB 2RB6A 2C0IA 4M75G 1ZSGA 1VQNT 3EHQA 2ZAEA 3LGLA 1W70A 3L2UA 2LCSA 2QQ9A 1VIFA 4OB1B 2FO0A 2CH4W 3M58A 2E70A 2RJDA 1M1FA 3CXCP 1HXDA 1VIEA 4HVVA 3CCQT 1W1FA 3OYEA 1FWZA 2HMAA 4M77D 5KYYA 4C92B 2AKKA 2DYIA 4M78F 1NLPC 4JRIA 1R77A 2DE0X 4J9HA 2XDBA 4PJNA 2VXFA 5GAOq 1ABQA 3H0FA 2IIMA 3P8BB 4M77F 2XK0A 2RI5A 3OYYA 2LTOA 1ACMB 2GTOA 3HTRA 4ZGDB 1VQMA 4MDWA 2RH2A 4HKEA 3EG3A 5GJWB 3RDVA 3VS1A 2QG9B 4M7DA 3G7ZA 3OS2A 3RMQA 2PVGB 1K73R 1UGQB 2F5KA 3E19A 2RO0A 2O01E 3CCEA 1K8AC 3HPWA 1AWXA 4F7UG 4LDYA 4RG2A 1QW1A 4JRPA 4JPBW 5A2QE 4KGXB 1IZ6A 1VQ7A 1NJIC 1YJ9T 4M78E 3OY9A 2MI6A 2A08A 2F2VA 2X51A 3CCSQ 4WCIA 1WXUA 4JZ4A 4CRIA 3UA7A 2DFUA 1YFNA 4FSSA 1N9SA 2CZ7B 3GBQA 1SF9A 2EBPA 4M7AD 4J6WA 1JBMA 3LLRA 4M77E 4EMHA 3MO8A 3MP6A 1MHNA 2DLPA 3PIOA 3G71T 4XTYA 2NLUA 1PNJA 3EG9A 2F2WA 1G2BA 1QMCA 1WA7A 2E3IA 3A1PA 5KYYB 1Q86U 2VXEA 2LRQA 4HVWA 1VQOT 3MCAB 4BI8B 2V1QA 2KYBA 2V26A 5LJ3d 5GANf 1UGVA 4D8DA 1KJWA 1ZHIA 1KC8R 4PJOD 3F70A 4BACA 2LJ1A 1GCQC 3C4SA 3E1SA 2QTXA 1Y96A 4IIMA 1UFFA 2KVQG 4II1A 5IH2A 4M7DB 2GTJA 1T3SA 4C5IA 1B07A 2LQNA 1Q86R 1GCPA 2YRDA 4J6XA 3EGDA 2CSIA 4L5GA 1T3LA 3CCSA 3M59A 2ROLA 5HK0A 1NZ9A 2EGCA 4XU3A 1G5VA 1BK2A 3VS7A 2PUOB 1N5ZA 3EG2A 2WSFE 1VQ5Q 4ME7A 2XI9A 5L23A 2L0AA 4MDXA 1H3HA 5HK3A 4E7HA 3SEMA 3H8ZA 4NL2A 5GAMd 2RD1A 2YWWA 2DF6A 3PMTA 2LQWA 2HKNA 1NPRA 5A0LA 3VS0A 1WQ7A 1KD1U 1JJ2S 3JRZA 1BYMA 2OAWA 3EG9B 3C95A 3I5SA 2DRKA 1VQKT 1UGRB 4OMFB 2RPNA 3V7SA 3A8MB 5LJ3j 1K0SA 2LP5A 2NYSA 2X3XD 2HL3A 4OMLA 4UC4A 3KBGA 2F69A 2QA4A 3LGFA 4DOVA 4X34A 1JJ2A 1UE9A 2E1HA 4RKUE 2DM1A 2D0QB 1G3YA 2GCXA 3OA6A 2KGTA 2KR3A 2WACA 2GNCA 2XKOC 1KD1R 3DB4A 3JCMg 3JB9J 2L3PA 4OGCA 1AEYA 2NUPA 3G1JA 1PG5B 4QT7A 3CCVQ 4RUGA 3FEOA 5HKCA 3ASKA 1OZ3A 2M1HA 3CMEA 2HQHA 1UHCA 1M3AA 4BI3A 1D1CA 4M4ZA 1AWWA 1RACB 5GAOm 2DTOA 3A98A 2EAYA 4IURA 2F2XA 1X01A 2DNUA 3OS5A 4XTUA 1MMAA 5GAMj 1TSFA 2D1XA 1K9MC 2ZPHB 3CPWP 3VJPA 1BI2A 4ZGJB 2EIFA 2GBQA 4JLGA 4E7KA 1RLQC 4M75D 1RL2A 1ZUUA 3VUZA 3EGXA 5KYNA 4O5VA 5LJ5f 3FC3A 3J7AF 3SWNA 4C8QD 2L3SA 2FRYA 3AHUA 1UTIA 3VKIA 1IB8A 4M75F 4JS5A 1U3OA 4M77A 2QI2A 5D6XA 4ZGEB 3CCVA 4M78C 1WHKA 3JB9H 1ZUKA 2KI7A 1GL5A 3RNJA 2CDTA 4PNOA 3LWHA 3QUIA 2YHTA 4JZ3A 4BUGA 1YWOA 2ECZA 2XMFA 3JCMe 2CGHA 3MPUB 3ZL7C 3VUBA 2AZVA 3ZFJA 1QKXA 4JRKA 2DZ9A 4LD6A 2IVWA 1VQ5T 1JQQA 2XG8D 2RQWA 1WFWA 2V8KA 4PL6A 2HKQB 4J7IA 3H9NA 3OYLA 2P0KA 4M75E 2JT4A 2E6NA 3OYNA 1OULA 1K0XA 2VB6A 3M0UA 2AHJB 4RTXA 2EYXA 5GMKj 1JB0E 2DJZA 4HT8A 4IUQA 4HCBA 2M51A 1X6OA 3TSZA 1EZZB 4XK8E 4X9CA 5EG2A 4IIOA 3RBBB 4M7AA 4E7LA 4ATOA 3SWNB 3CMAA 4JUVA 4JS4A 1I07A 2EYWA 1U06A 1JJ2P 2BZXA 1BKBA 1OPLA 2G3RA 3NTIA 2P84A 5GAOl 1WHJA 4R0KA 4LDWA 1AWJA 1XNIA 3PT9A 1FMKA 3L2VA 1KQ1A 4PJOA 2KMTA 2EQIA 2DYBA 2DTIA 3CBMA 3NTKA 1M27C 2MAMA 2FZCB 3CCVT 2QDYB 5J3BA 2A36A 2PQWA 2BIVA 2DL8A 1D0XA 1M90C 2H8HA 4DBRA 4OF1A 3EFRA 2AK5A 4J7FA 4F7UE 2A7YA 2DRMA 4N0AC 4MMLA 4F04B 1D0YA 2RK2A 3X28B 1W6XA 1NM7A 4TVRA 2RJCA 3QKJA 2RI2A 3CCMQ 3QG1A 2B8AA 5IT9E 2E41A 2FRWA 3CCRA 4FIBA 4X9DA 3RKWA 4QVDA 5D6WA 1EIFA 2A37A 1W2BS 2DEUA 1UGSB 4CC3A 4M7AB 2COWA 1YIJA 4BB7A 2ZPEB 4B9WA 3M5AA 3EGUA 1WHGA 4C5HA 1OQKA 4DBQA 2O31A 4J9DA 2XICA 2Z0WA 3QJ6A 2P4TA 3CCUQ 5GMKi 4J9GA 5GAN8 1W2BA 2OX7A 1N27A 3TREA 4FSXA 1OV3A 2EWNA 2OTJA 5GAMe 2ZGWA 2QQRA 3JB9I 5GANd 4PJOB 3UA6A 2HNIA 3N5BB 4ELYC 3QHSA 2DBMA 7AT1B 1VQNA 5AT1B 1Q7YC 2EKHA
chains in the Genus database with same CATH topology
1SPKA 3I9QA 5FWBA 3VRZA 1NYGA 2K3BA 1SEMA 2HDAA 2GTOA 4OMMA 2A28A 3FJ5A 4GLMA 3EG3A 5GJWB 1TUCA 3VS2A 1JXMA 3VS1A 2KBTA 2ED0A 2SEMA 2K7AA 5FW9A 1JEGA 1AZGB 1BU1A 4GBQA 2JM8A 5IXFA 1AWXA 1VYUA 2KRMA 2VKNA 4JPBW 4ZNXA 1GFDA 2RF0A 2V1RA 1PKSA 4J9BA 2DVJA 1WXBA 1A0NB 2A08A 2F2VA 2MOXA 1WLPB 3NGPA 4WCIA 2E5KA 1AOJA 1WXUA 4JZ4A 3UA7A 1AD5A 1ZLMA 2RMOA 2K6DA 4FSSA 1J3TA 5IXBA 1JXOA 3GBQA 5IHIA 2B86A 1K1ZA 2PTKA 2EBPA 4J9EA 2YUOA 1VYTA 3CQTA 2JW4A 1X69A 3PVQA 2JXBA 4Y92A 4OMOA 2DLPA 1UJ0A 1I1JA 3H0HA 2D8HA 1QCFA 1T0HA 1CKAA 1PNJA 1M8MA 2F2WA 1G2BA 2BZYA 2O88A 1WA7A 1OEBA 3REBB 1SHGA 4LUDA 1RI9A 2J6FA 2RNAA 4HVWA 3THKA 1YN8A 1Y0MA 2V1QA 2W0ZA 1PWTA 2KYBA 2KNBB 1UGVA 2HEQA 2EGAA 4D8DA 1KJWA 2YDLA 2AZSA 1CKBA 1GCQC 1Z9QA 2LJ1A 2G6FX 2YUQA 4IIMA 2DJQA 1UFFA 1NG2A 1PRLC 4LN2A 4F16A 2K9GA 5IH2A 1B3QA 2EYZA 2OJ2A 2GTJA 2EVRA 4HVUA 1T3SA 4RTTA 1WIEA 1B07A 2LQNA 1GCPA 4DEXA 4RTZA 2CSIA 1T3LA 2ROLA 1NYFA 2L3QA 2EGCA 1HD3A 2KT8A 1BK2A 1QWEA 2JS0A 1UECA 3VS7A 1N5ZA 3EG2A 2NWMA 1I0CA 3VS6A 2YT6A 1RUWA 5L23A 2L0AA 2CT3A 3H0IA 5FWCA 1H3HA 2KXDA 1X6GA 1HSQA 2J7IA 3SEMA 3M0RA 4J9FA 1JU5C 4JJCA 4X1VA 1AWOA 1YP5A 2DF6A 3NMZC 2CREA 2LQWA 4RTYA 2D0NA 2EGEA 3VS0A 3NPFA 4Z88A 1ZUYA 4CC4B 1GRIA 3EHRA 2O9SA 2DMOA 2OAWA 4ESRA 1E6GA 1E6HA 2PZ1A 1K4US 3I5SA 2DRKA 1NEBA 2RPNA 3PVLA 2AKLA 1ARKA 1WYXA 1SHFA 4KRTA 1K0SA 2LP5A 2X3XD 2DL7A 1RLPC 2LX7A 4OMLA 2CUBA 1UE9A 1WI7A 3LH5A 4CC7A 2DILA 1HJDA 2DM1A 2SRCA 2KGTA 3O5ZA 2KR3A 2GNCA 1M3BA 3NHNA 1Z9ZA 2J6OA 3VS3A 2L3PA 3VRYA 1AEYA 2RQTA 4QT7A 2LZ6B 2J05A 4RUGA 2J6KA 1X2KA 1UHCA 1M3AA 4M4ZA 1AWWA 1VYVA 4DEYA 4AFZC 2ROTA 3A98A 2DBKA 3UF4A 1ZX6A 4A63B 1GCQA 2J06A 1K76A 1SRMA 2F2XA 2DNUA 2D1XA 2BTTA 1EFNA 3TSWA 1E7OA 1XOVA 4Z8AA 1V1CA 2GBQA 1RLQC 4F14A 1ZUUA 2DL5A 4EIKA 4OMPA 2JMCA 2KYMA 2L3SA 5IHNA 2FRYA 2GGRA 2RN8A 1JO8A 1UTIA 1KFZA 2FEIA 2RQUA 1U3OA 2EPDA 5EC7A 2KE9A 1BB9A 5GJVB 2DX1A 1X27A 2PNIA 4LNPA 1MV0B 2ABLA 5I11A 3M0QA 2LJ0A 3QWYA 2FPEA 2P4RA 2C0OA 3M0TA 4J9IA 1ZUKA 2KRSA 5IHKA 1GL5A 2DL3A 3RNJA 1WXTA 2O9VA 2CDTA 3C0CA 1BBZA 1PKTA 4JZ3A 3PE0A 1X2QA 1YNZA 1NEGA 3I5RA 1TG0A 4HCKA 1YWOA 2EW3A 2ECZA 2L2PA 2XMFA 2YUPA 4JJBA 1GFCA 1PRMC 2MIOA 3ZL7C 2AZVA 2CSQA 2LMJA 1QKXA 3VS4A 4J9CA 5I22A 3M0SA 2KEAA 3IQLA 1JQQA 2RQWA 1WFWA 1CSKA 3UATA 2GQIA 1S1NA 2D8JA 1UDLA 2JT4A 3I35A 1NLOC 1QWFA 5ECAA 2KROA 1K0XA 1FYNA 3M0UA 3M0PA 2EYXA 4RTXA 4K11A 1TUDA 1ZBJA 2YSQA 3R6NA 4RTUA 2W10A 1T0JA 2M51A 2KXCA 2MCNA 1QKWA 3SHWA 3TSZA 2VVKA 4E6RA 1X6BA 2RQVA 4Z89A 4IIOA 2O2OA 3RBBB 1LCKA 1UJYA 1OOTA 1I07A 4AFQC 1IO6A 2EYWA 1M3CA 4ORZA 1U06A 4LE9A 2DL4A 2BZXA 1OPLA 1QLYA 3VS5A 4AG1C 1AVZC 4R0KA 1H8KA 1SSHA 3TVTA 5HCKA 1AWJA 1FMKA 1YWPA 1PHTA 1ABOA 2LJ3A 4RTWA 2ED1A 2EQIA 2DYBA 1M30A 2NUZA 1K9AA 1H92A 1M27C 3JV3A 4OMNA 1MUZA 2A36A 2M0YA 3REAB 2OI3A 2DL8A 1U5SA 2C0TA 1UHFA 2H8HA 3EG0A 1MV3A 2K79A 2AK5A 2FPDA 4RTVA 1VA7A 2DRMA 2ENMA 1UG1A 4AG2C 2I0NA 4OMQA 1OPKA 4F17A 2ESWA 2QDLA 2FPFA 1GBRA 1W6XA 2JMAA 2VWFA 1NM7A 1KSWA 4LUEA 1YCSB 2YUNA 4AFUC 4JJDA 2KT1A 2FRWA 2JS2A 2JM9A 2HSPA 2K2MA 1GBQA 4AFSC 2HCKA 1G83A 2CH4A 4D8KA 2C0IA 1ZSGA 2A37A 4CC3A 3EHQA 2LNHB 2BZ8A 2CT4A 1W70A 3ULRB 4HXJA 2EYYA 2LCSA 2DA9A 3EGUA 3QWXX 2FO0A 2CH4W 1SRLA 2HBWA 1UUEA 4CC2A 2O31A 4J9DA 2FG0A 1X43A 4HVVA 1Y57A 1W1FA 4J9GA 2X3WD 1OV3A 2RQRA 2CUDA 2AKKA 3H41A 3U23A 1NLPC 3UA6A 1WDXA 1WX6A 4J9HA 2DE0X 1AZEA 3KFVA 2JTEA 1ABQA 2DBMA 3H0FA 2KRNA 2IIMA 3EG1A 1KIKA 2EKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPK A;  3I9Q A;  5FWB A;  3VRZ A;  1NYG A;  2K3B A;  1SEM A;  2HDA A;  2GTO A;  4OMM A;  2A28 A;  3FJ5 A;  4GLM A;  3EG3 A;  5GJW B;  1TUC A;  3VS2 A;  1JXM A;  3VS1 A;  2KBT A;  2ED0 A;  2SEM A;  2K7A A;  5FW9 A;  1JEG A;  1AZG B;  1BU1 A;  4GBQ A;  2JM8 A;  5IXF A;  1AWX A;  1VYU A;  2KRM A;  2VKN A;  4JPB W;  4ZNX A;  1GFD A;  2RF0 A;  2V1R A;  1PKS A;  4J9B A;  2DVJ A;  1WXB A;  1A0N B;  2A08 A;  2F2V A;  2MOX A;  1WLP B;  3NGP A;  4WCI A;  2E5K A;  1AOJ A;  1WXU A;  4JZ4 A;  3UA7 A;  1AD5 A;  1ZLM A;  2RMO A;  2K6D A;  4FSS A;  1J3T A;  5IXB A;  1JXO A;  3GBQ A;  5IHI A;  2B86 A;  1K1Z A;  2PTK A;  2EBP A;  4J9E A;  2YUO A;  1VYT A;  3CQT A;  2JW4 A;  1X69 A;  3PVQ A;  2JXB A;  4Y92 A;  4OMO A;  2DLP A;  1UJ0 A;  1I1J A;  3H0H A;  2D8H A;  1QCF A;  1T0H A;  1CKA A;  1PNJ A;  1M8M A;  2F2W A;  1G2B A;  2BZY A;  2O88 A;  1WA7 A;  1OEB A;  3REB B;  1SHG A;  4LUD A;  1RI9 A;  2J6F A;  2RNA A;  4HVW A;  3THK A;  1YN8 A;  1Y0M A;  2V1Q A;  2W0Z A;  1PWT A;  2KYB A;  2KNB B;  1UGV A;  2HEQ A;  2EGA A;  4D8D A;  1KJW A;  2YDL A;  2AZS A;  1CKB A;  1GCQ C;  1Z9Q A;  2LJ1 A;  2G6F X;  2YUQ A;  4IIM A;  2DJQ A;  1UFF A;  1NG2 A;  1PRL C;  4LN2 A;  4F16 A;  2K9G A;  5IH2 A;  1B3Q A;  2EYZ A;  2OJ2 A;  2GTJ A;  2EVR A;  4HVU A;  1T3S A;  4RTT A;  1WIE A;  1B07 A;  2LQN A;  1GCP A;  4DEX A;  4RTZ A;  2CSI A;  1T3L A;  2ROL A;  1NYF A;  2L3Q A;  2EGC A;  1HD3 A;  2KT8 A;  1BK2 A;  1QWE A;  2JS0 A;  1UEC A;  3VS7 A;  1N5Z A;  3EG2 A;  2NWM A;  1I0C A;  3VS6 A;  2YT6 A;  1RUW A;  5L23 A;  2L0A A;  2CT3 A;  3H0I A;  5FWC A;  1H3H A;  2KXD A;  1X6G A;  1HSQ A;  2J7I A;  3SEM A;  3M0R A;  4J9F A;  1JU5 C;  4JJC A;  4X1V A;  1AWO A;  1YP5 A;  2DF6 A;  3NMZ C;  2CRE A;  2LQW A;  4RTY A;  2D0N A;  2EGE A;  3VS0 A;  3NPF A;  4Z88 A;  1ZUY A;  4CC4 B;  1GRI A;  3EHR A;  2O9S A;  2DMO A;  2OAW A;  4ESR A;  1E6G A;  1E6H A;  2PZ1 A;  1K4U S;  3I5S A;  2DRK A;  1NEB A;  2RPN A;  3PVL A;  2AKL A;  1ARK A;  1WYX A;  1SHF A;  4KRT A;  1K0S A;  2LP5 A;  2X3X D;  2DL7 A;  1RLP C;  2LX7 A;  4OML A;  2CUB A;  1UE9 A;  1WI7 A;  3LH5 A;  4CC7 A;  2DIL A;  1HJD A;  2DM1 A;  2SRC A;  2KGT A;  3O5Z A;  2KR3 A;  2GNC A;  1M3B A;  3NHN A;  1Z9Z A;  2J6O A;  3VS3 A;  2L3P A;  3VRY A;  1AEY A;  2RQT A;  4QT7 A;  2LZ6 B;  2J05 A;  4RUG A;  2J6K A;  1X2K A;  1UHC A;  1M3A A;  4M4Z A;  1AWW A;  1VYV A;  4DEY A;  4AFZ C;  2ROT A;  3A98 A;  2DBK A;  3UF4 A;  1ZX6 A;  4A63 B;  1GCQ A;  2J06 A;  1K76 A;  1SRM A;  2F2X A;  2DNU A;  2D1X A;  2BTT A;  1EFN A;  3TSW A;  1E7O A;  1XOV A;  4Z8A A;  1V1C A;  2GBQ A;  1RLQ C;  4F14 A;  1ZUU A;  2DL5 A;  4EIK A;  4OMP A;  2JMC A;  2KYM A;  2L3S A;  5IHN A;  2FRY A;  2GGR A;  2RN8 A;  1JO8 A;  1UTI A;  1KFZ A;  2FEI A;  2RQU A;  1U3O A;  2EPD A;  5EC7 A;  2KE9 A;  1BB9 A;  5GJV B;  2DX1 A;  1X27 A;  2PNI A;  4LNP A;  1MV0 B;  2ABL A;  5I11 A;  3M0Q A;  2LJ0 A;  3QWY A;  2FPE A;  2P4R A;  2C0O A;  3M0T A;  4J9I A;  1ZUK A;  2KRS A;  5IHK A;  1GL5 A;  2DL3 A;  3RNJ A;  1WXT A;  2O9V A;  2CDT A;  3C0C A;  1BBZ A;  1PKT A;  4JZ3 A;  3PE0 A;  1X2Q A;  1YNZ A;  1NEG A;  3I5R A;  1TG0 A;  4HCK A;  1YWO A;  2EW3 A;  2ECZ A;  2L2P A;  2XMF A;  2YUP A;  4JJB A;  1GFC A;  1PRM C;  2MIO A;  3ZL7 C;  2AZV A;  2CSQ A;  2LMJ A;  1QKX A;  3VS4 A;  4J9C A;  5I22 A;  3M0S A;  2KEA A;  3IQL A;  1JQQ A;  2RQW A;  1WFW A;  1CSK A;  3UAT A;  2GQI A;  1S1N A;  2D8J A;  1UDL A;  2JT4 A;  3I35 A;  1NLO C;  1QWF A;  5ECA A;  2KRO A;  1K0X A;  1FYN A;  3M0U A;  3M0P A;  2EYX A;  4RTX A;  4K11 A;  1TUD A;  1ZBJ A;  2YSQ A;  3R6N A;  4RTU A;  2W10 A;  1T0J A;  2M51 A;  2KXC A;  2MCN A;  1QKW A;  3SHW A;  3TSZ A;  2VVK A;  4E6R A;  1X6B A;  2RQV A;  4Z89 A;  4IIO A;  2O2O A;  3RBB B;  1LCK A;  1UJY A;  1OOT A;  1I07 A;  4AFQ C;  1IO6 A;  2EYW A;  1M3C A;  4ORZ A;  1U06 A;  4LE9 A;  2DL4 A;  2BZX A;  1OPL A;  1QLY A;  3VS5 A;  4AG1 C;  1AVZ C;  4R0K A;  1H8K A;  1SSH A;  3TVT A;  5HCK A;  1AWJ A;  1FMK A;  1YWP A;  1PHT A;  1ABO A;  2LJ3 A;  4RTW A;  2ED1 A;  2EQI A;  2DYB A;  1M30 A;  2NUZ A;  1K9A A;  1H92 A;  1M27 C;  3JV3 A;  4OMN A;  1MUZ A;  2A36 A;  2M0Y A;  3REA B;  2OI3 A;  2DL8 A;  1U5S A;  2C0T A;  1UHF A;  2H8H A;  3EG0 A;  1MV3 A;  2K79 A;  2AK5 A;  2FPD A;  4RTV A;  1VA7 A;  2DRM A;  2ENM A;  1UG1 A;  4AG2 C;  2I0N A;  4OMQ A;  1OPK A;  4F17 A;  2ESW A;  2QDL A;  2FPF A;  1GBR A;  1W6X A;  2JMA A;  2VWF A;  1NM7 A;  1KSW A;  4LUE A;  1YCS B;  2YUN A;  4AFU C;  4JJD A;  2KT1 A;  2FRW A;  2JS2 A;  2JM9 A;  2HSP A;  2K2M A;  1GBQ A;  4AFS C;  2HCK A;  1G83 A;  2CH4 A;  4D8K A;  2C0I A;  1ZSG A;  2A37 A;  4CC3 A;  3EHQ A;  2LNH B;  2BZ8 A;  2CT4 A;  1W70 A;  3ULR B;  4HXJ A;  2EYY A;  2LCS A;  2DA9 A;  3EGU A;  3QWX X;  2FO0 A;  2CH4 W;  1SRL A;  2HBW A;  1UUE A;  4CC2 A;  2O31 A;  4J9D A;  2FG0 A;  1X43 A;  4HVV A;  1Y57 A;  1W1F A;  4J9G A;  2X3W D;  1OV3 A;  2RQR A;  2CUD A;  2AKK A;  3H41 A;  3U23 A;  1NLP C;  3UA6 A;  1WDX A;  1WX6 A;  4J9H A;  2DE0 X;  1AZE A;  3KFV A;  2JTE A;  1ABQ A;  2DBM A;  3H0F A;  2KRN A;  2IIM A;  3EG1 A;  1KIK A;  2EKH A; 
#chains in the Genus database with same CATH topology
 4KGZ B;  2MF2 A;  1NYG A;  1SEM A;  2EJF A;  2VGN A;  1M1K R;  4GLM A;  3CCM A;  4IUV A;  1YJ9 Q;  1R0C B;  1WJQ A;  3CCQ A;  4HCC A;  2ED0 A;  4XTX A;  4QKU A;  1I8F A;  4EMK A;  2COZ A;  5FU6 B;  2K7A A;  1VQL Q;  4GBQ A;  2JM8 A;  4PFP A;  2VKN A;  2Y4X A;  5CO7 A;  2QQB A;  4A4K A;  1YJW Q;  2JVV A;  3VYH B;  2DVJ A;  3CCU A;  2MOX A;  3NGP A;  3NTH A;  2E5K A;  1AOJ A;  3HKS A;  2V8I A;  1ZLM A;  2RMO A;  2K6D A;  4C8Q A;  2A0F B;  2EJG A;  1JXO A;  2EQU A;  2BKD N;  2PTK A;  2YUO A;  1VYT A;  4FL6 A;  4C0D C;  2DIG A;  2JW4 A;  1PM3 A;  4OMO A;  3QZ9 B;  1I1J A;  2VV5 A;  1D3B B;  4PJM A;  2D8H A;  1QCF A;  3BE3 A;  1BI1 A;  5GAN j;  1HYO A;  2O88 A;  4M75 C;  1W4S A;  1OEB A;  1YI2 Q;  2CZ0 B;  1RI9 A;  4OGE A;  1PSE A;  1GXI E;  1Y0M A;  2W0Z A;  1IHV A;  2KNB B;  1YJ9 A;  4PJL A;  1LNX A;  2K3Y A;  2AZS A;  1CKB A;  2CP2 A;  5CQY A;  1FX7 A;  2JTM A;  1Q82 U;  1QP2 A;  1VQL A;  4LN2 A;  4QW2 A;  2K9G A;  5CK9 A;  1B3Q A;  2EYZ A;  3RMS A;  5LJ3 h;  2KSS A;  4Q5W A;  1G3S A;  2X35 A;  3BW1 A;  3G71 A;  3GNF B;  4KT0 E;  1M5Q 1;  4FW2 A;  4M78 D;  4BD3 A;  3CCM T;  3G4S Q;  3OW2 P;  2K5F A;  4J8O A;  2CYZ B;  4F7U A;  4C92 G;  3LWI A;  1VQO A;  2KT8 A;  2CP3 A;  3GPL A;  1SSF A;  3OYB A;  1VQ8 Q;  2NWM A;  1K73 U;  1RUW A;  3JCM J;  1VQK Q;  2E5Q A;  3H0I A;  1Q82 R;  2KXD A;  1X6G A;  1HSQ A;  4J9F A;  2HD0 A;  4JJC A;  5C6S A;  2DVE A;  1NJI R;  3NMZ C;  1QVP A;  1KHI A;  1W2B P;  9ATC B;  1V76 A;  2IG0 A;  2EGE A;  5LJ5 d;  3X26 B;  3CCU T;  4Z88 A;  4CC4 B;  1FXX A;  1GRI A;  3EHR A;  4C0G A;  2O9S A;  4ESR A;  1E6G A;  2PZ1 A;  5GAM h;  3OYA A;  1Y07 A;  2BE7 D;  1QVF S;  3PVL A;  1WYX A;  4KRT A;  5I2S A;  2CUB A;  2K3X A;  4CC7 A;  3JSC A;  1HJD A;  3CCJ Q;  1QVF A;  1RAI B;  3VS3 A;  4KGV B;  2RQT A;  1KC8 U;  4C0Z A;  1YBY A;  1VQ8 A;  3RES A;  3OYC A;  1VQL T;  1ZSZ A;  1VQK A;  4FYY B;  2ROT A;  4HA8 A;  2H3J A;  1GCQ A;  3G6E Q;  5CVI A;  1YIT T;  3E9G A;  1YJW T;  1Y7X A;  5KYX A;  2VAS A;  3PTA A;  3RR6 A;  3JCM P;  4RG8 A;  4E7I A;  1EFN A;  5FU7 C;  3ZBD A;  1XOV A;  2DET A;  3PNW C;  5LJ5 j;  1ZSZ C;  1V1C A;  4Z8A A;  3JCM c;  1NPP A;  3I55 Q;  3OS0 A;  4R55 A;  1YJN Q;  2DL5 A;  1I5L A;  4M7D G;  4EIK A;  1C0M A;  2JMC A;  1ZQ1 A;  2F5T X;  4Y91 A;  1ZA1 B;  5IHN A;  4HT9 A;  3MEA A;  1WNL A;  1YI2 T;  3TQ7 P;  1KFZ A;  1BCM A;  1WJR A;  4EPC A;  2EPD A;  1F1B B;  1BB9 A;  5GMK h;  2X4Y A;  5GJV B;  2DX1 A;  4C0F A;  2HBP A;  4NL3 A;  3QWY A;  3L2Z A;  2R5M A;  2C0O A;  3HRU A;  3CBP A;  4B6M A;  2JNG A;  5IHK A;  3OYI A;  3C0C A;  3S3M A;  1MGQ A;  3PE0 A;  1X2Q A;  5J26 A;  3GLX A;  1YNZ A;  3I5R A;  4O6J A;  1QQJ A;  1UB4 A;  2EW3 A;  3FRN A;  3DLL A;  4JJB A;  3G4S T;  1TUG B;  1LJO A;  1EX4 A;  4FT4 A;  2CSQ A;  4BY6 B;  8ATC B;  1VQ8 T;  2COY A;  2CP5 A;  3M0S A;  2KEA A;  3IQL A;  3I55 A;  3CC7 T;  2JZ2 A;  1S1N A;  1YJN A;  5CKD A;  2D8J A;  1DJ7 B;  4B9X A;  4DBF A;  5ECA A;  1FYN A;  5DY9 A;  1K9M R;  3M9Q A;  1ZBJ A;  1XJW B;  1D0Z A;  2W10 A;  1T0J A;  4E6R A;  2KXC A;  3OYG A;  5GMK m;  2OTL Q;  1M2V A;  3M55 A;  1QCO A;  1X6B A;  4Z89 A;  4MMK A;  4XU0 A;  1G3W A;  1LCK A;  1RAG B;  4BDY A;  1Q86 C;  1Y96 B;  1UJY A;  3OYK A;  1OOT A;  1RAD B;  2NUT A;  1IXD A;  1M3C A;  2DL4 A;  3VS5 A;  2DD5 A;  2CKK A;  4AG1 C;  1AVZ C;  1VQ5 A;  3EGD B;  3CPF A;  1QVF P;  1H8K A;  2HSE B;  1IRE B;  1SSH A;  1BIA A;  3TVT A;  3CC4 T;  3WVE B;  3CCJ T;  2LJ3 A;  3OBY A;  2ED1 A;  1RI0 A;  1Q81 U;  1K9A A;  2ZZD A;  1H92 A;  2XDD A;  1MUZ A;  1TWB A;  2M0Y A;  3REA B;  3OBW A;  3MP8 A;  3LW5 E;  2L89 A;  3J81 E;  2C0T A;  1VQ6 Q;  4AT1 B;  3EG0 A;  1SG5 A;  4M78 A;  2RHZ A;  3G6E T;  2ENM A;  1UG1 A;  3MJX A;  4XU1 A;  4FYX B;  1BI0 A;  3JCM f;  4F17 A;  2ESW A;  2QDL A;  2YRV A;  2VWF A;  3QYH B;  3URG A;  4LUE A;  1YCS B;  3OSS C;  1N9R A;  1Q81 R;  4AFU C;  2KT1 A;  3P8D A;  3ZEH A;  4GLK A;  5D7U A;  3I55 T;  1PCX A;  3QXE B;  1KD1 C;  2HSP A;  3OYJ A;  1GBQ A;  1YJN T;  1M2V B;  4D8K A;  3OYM A;  1RAF B;  4E7Z A;  1KK7 A;  3QO3 A;  4C92 F;  2LNH B;  3WVD B;  2CT4 A;  3SDZ A;  4EDU A;  1IGQ A;  3ULR B;  1TS9 A;  2QYZ A;  2NUP B;  3QYG B;  2DA9 A;  3QWX X;  4ELZ C;  5GAO r;  1SRL A;  4LDX A;  3D7S B;  3KXT A;  4L6V 5;  4PLL A;  2HZY A;  2FG0 A;  1X43 A;  1Y57 A;  5LJ3 g;  2D6F A;  1O9S A;  2X3W D;  3KUF A;  2E4H A;  2RQR A;  4FT2 A;  3H41 A;  2LNV A;  3U23 A;  1WDX A;  1WX6 A;  1AZE A;  1MNE A;  2QTV A;  4Z02 A;  1KQS S;  3CCL Q;  2KRN A;  2PVO B;  3EG1 A;  5CKF A;  4A4G A;  2YXY A;  2M9U A;  1SPK A;  5GMK l;  2K3B A;  3V7R A;  1TTH B;  2MWO A;  2EYQ A;  3LH0 A;  2A28 A;  4OMM A;  3SD4 A;  5GAN h;  3GIB A;  4OB0 B;  2LX9 A;  4M78 B;  2RA2 A;  4IUT A;  2KBT A;  3EGX B;  2MPX C;  3H6Z A;  4C92 E;  3S3O A;  5DLO A;  1KQS A;  4A54 A;  3CBO A;  3VYG A;  1TXQ A;  2SEM A;  5FW9 A;  1JEG A;  3BDU A;  1BU1 A;  4M77 B;  5GAM g;  2KRM A;  1VQ9 Q;  5IAY A;  1BCO A;  3V8J A;  1GFD A;  2RF0 A;  2OTL T;  3L2R A;  3L2W A;  1PKS A;  4J9B A;  4PFO A;  1WXB A;  1ZA2 B;  1UGP B;  1WLP B;  3QDR B;  4N0A A;  3MET A;  4V2S A;  4LD9 K;  2GF7 A;  1S72 Q;  3V8K A;  2E6Z A;  1J3T A;  2R58 A;  4JDS A;  5IXB A;  3OMC A;  5IHI A;  2B86 A;  4J9E A;  1K1Z A;  1OU8 A;  2XD0 A;  4M7D D;  3CQT A;  4ZTF A;  3M54 A;  3T9N A;  1UJ0 A;  3EH2 A;  5CR2 A;  3H0H A;  2LT4 A;  1CKA A;  3TEE A;  1KHC A;  1M8M A;  2BZY A;  3JCM W;  2VYT A;  1SHG A;  1XQH A;  4M7D F;  4LUD A;  5LJ3 e;  2J6F A;  2K5L A;  3THK A;  1YN8 A;  3X25 B;  1I81 A;  5GAM f;  2GQV A;  5M9O A;  2EGA A;  2OAU A;  3JAM E;  4M7A G;  1JRI A;  1Q7Y R;  1VQ6 T;  2VC8 A;  1NG2 A;  1PRL C;  3OMG A;  1N8R R;  2AT1 B;  2L3R A;  3EAE A;  5HY6 A;  2OJ2 A;  2EVR A;  5IN1 A;  5L8R E;  2DXB A;  5LL6 S;  4RTT A;  5GAO p;  4DA4 A;  4IUU A;  4DEX A;  5FRM A;  2YRC A;  1M1K U;  3OQ5 A;  2XU8 A;  1D1B A;  1FMV A;  1NYF A;  2P0P A;  4LDV A;  4P5N A;  1S72 A;  2O4X A;  4PJO G;  4IKF A;  3MEW A;  4MZT A;  1I0C A;  3CD6 Q;  4DOW A;  2YT6 A;  3PGG A;  1R8O B;  2XHC A;  1AT1 B;  2J7I A;  4M7D E;  1JU5 C;  4QQD A;  2CRE A;  2M02 A;  3RKY A;  1YCY A;  3DLM A;  2XID A;  3A8L B;  1ZUY A;  2WSE E;  3FLG A;  2DEQ A;  3JCM V;  2DTH A;  1E6H A;  4KUI A;  3AT1 B;  2AKL A;  1ARK A;  1SHF A;  4C5E A;  3R6O A;  3GOX A;  5LJ5 h;  3UPU A;  3CCL T;  5KE2 A;  1OI1 A;  3CEY A;  4RCC A;  4RCB A;  2QAS A;  3OB9 A;  1OX8 A;  2DIL A;  2SRC A;  5J39 A;  1YIT Q;  1KQS P;  4XAX B;  1TU0 B;  1Z9Z A;  2J6O A;  4M75 A;  3RUX A;  1WHM A;  2LZ6 B;  2J05 A;  5I2M A;  2VUB A;  1TOV A;  3EFO A;  3HL8 A;  1VQ9 T;  3RER A;  4AFZ C;  2LQ8 A;  3UF4 A;  1ZX6 A;  4A63 B;  8AT1 B;  2J06 A;  1K76 A;  2QAZ A;  3UWN A;  4BI4 A;  4FM4 B;  5GAN 4;  2O4X B;  4GY5 A;  1MMG A;  5KE3 A;  2QEX Q;  4MZP A;  3M57 A;  3V7C A;  2GFU A;  2BTT A;  2K57 A;  3TSW A;  2QQS A;  1E7O A;  3PMI A;  1S72 T;  3BY7 A;  1OYX A;  5KYW A;  1K8A U;  4A4H A;  4A53 A;  5GAN 3;  1M1K C;  1H3Z A;  1LOJ A;  2CZ1 B;  4NS5 A;  3X20 B;  2ZPF B;  3OSV A;  5GMK e;  2RK1 A;  2M16 A;  3L42 A;  4KBM B;  4C92 C;  2K5I A;  3C94 A;  3FB9 A;  4OMP A;  1NBE B;  5AYF A;  3L1A A;  1NJI U;  1WHH A;  2GGR A;  2RN8 A;  2LCC A;  1JO8 A;  5FRO A;  2RQU A;  1B34 A;  2BE9 B;  1YIT A;  4EMK B;  2KE9 A;  4D6W A;  1YJW A;  2LCL A;  1X75 C;  2PNI A;  4LNP A;  1MV0 B;  2X4W A;  4YTL A;  4VUB A;  5I11 A;  2MK5 A;  2DO3 A;  3M0Q A;  2XDP A;  4XTW A;  5CQX A;  1K8A R;  2FPE A;  4E2F B;  3CCE Q;  4J9I A;  2KRS A;  3S6W A;  2DXU A;  2DL3 A;  1WXT A;  2O9V A;  1G8X A;  3CC7 Q;  1BBZ A;  1V29 B;  4C8Q G;  4M75 B;  2RJF A;  3LX7 A;  3MP1 A;  5FLX E;  1AHJ B;  1NEG A;  1TG0 A;  3A8H B;  1VQ7 Q;  2QEX A;  1WHL A;  4C8Q B;  6AT1 B;  1YI2 A;  3EFO B;  3QPH A;  1GFC A;  3GNG A;  2MIO A;  3JCM d;  4J9C A;  3CD6 T;  3UAT A;  2JTF A;  2KY9 A;  2PVD B;  1VQP Q;  1NLO C;  5KYW B;  4QQ6 A;  4JLI A;  4K11 A;  1KG1 A;  1OZ2 A;  3R6N A;  2MCN A;  3CC4 Q;  2CP6 A;  4A4E A;  2ZPG B;  2FYK A;  1RAE B;  2RQV A;  1WJS A;  2O2O A;  1Q95 G;  3FIF A;  3G4S A;  2EFI A;  2KQW A;  2DZC A;  1IO6 A;  4ORZ A;  5I21 A;  4FW1 A;  4XU2 A;  2EQM A;  4LE9 A;  3M56 A;  4BDZ A;  1B34 B;  5GAN g;  1PSF A;  3Q1J A;  4OP0 A;  3HHT B;  1RAB B;  3JCM b;  3CC7 A;  2CP0 A;  2EJ9 A;  3J80 E;  2K2V A;  3TCJ A;  4F7U B;  1P92 A;  3CPW S;  1Q82 C;  4M7D C;  1PHT A;  4RTW A;  2I2L A;  4OMN A;  3E2U A;  2MMP A;  3X24 B;  4PJJ A;  2KK4 A;  2L5Q A;  3CPW A;  1U5S A;  3M53 A;  1UHF A;  1VUB A;  2LDM A;  1OU9 A;  2ZPB B;  2HQX A;  1VQP A;  2DXC A;  2RHI A;  2QGG A;  4RTV A;  1K73 C;  1VOM A;  4AG2 C;  2DIQ A;  2QEX T;  4M7A F;  2KAF A;  2X4J A;  1OPK A;  4MZM A;  2FPF A;  3CC4 A;  2DPP B;  5KYU A;  1KSW A;  1MMN A;  1LPL A;  3CCJ A;  3OYD A;  1IRX A;  2X9H A;  4FYV B;  2JS2 A;  4PK4 A;  4BY6 C;  4WTO B;  2MWP A;  4AFS C;  2HCK A;  4QQG A;  2HAX A;  2CH4 A;  2QA4 Q;  1BIB A;  2BZ8 A;  1ZBX A;  2FL7 A;  4PJO F;  4HXJ A;  2EYY A;  2YLB A;  1K9M U;  1VQM T;  3G6E A;  3FJP A;  4OVA A;  2FZG B;  1FMW A;  1UUE A;  2HBW A;  4CC2 A;  1YHQ Q;  1PD0 A;  1H64 1;  5FU7 B;  1ZSZ B;  2K4Y A;  2EQJ A;  2Y4Y A;  4N4G A;  5GAN e;  3CME Q;  3CCE T;  2CUD A;  3E9F A;  4XQ3 A;  5KYX B;  4M7A E;  1QVG S;  3HRT A;  2IPO B;  3EFS A;  3KFV A;  1KC8 C;  2JTE A;  1MND A;  4AMC A;  3LYI A;  2LVM A;  3MEV A;  1VQ7 T;  1KIK A;  1B7T A;  3I9Q A;  5FWB A;  3VRZ A;  2HDA A;  4EMG A;  3FJ5 A;  1U8R A;  4Y28 E;  1TUC A;  1QVG A;  3QJY A;  1JXM A;  3VS2 A;  1WQW A;  3INZ A;  4JJN K;  3BDL A;  1O75 A;  4PJO E;  3JB9 G;  5KYU B;  1AZG B;  2EKO A;  1RAA B;  3RKX A;  1VQP T;  5IXF A;  1VYU A;  5GAN 7;  4ZNX A;  5GAN 5;  3MEU A;  1U1T A;  2V1R A;  4FCY A;  5LJ5 g;  3SB2 A;  1YHQ A;  1I4K 1;  1N6A A;  1A0N B;  2QK0 A;  5A0G A;  1AD5 A;  2PU9 B;  2RM4 A;  2ATC B;  1VQ4 Q;  1RAH B;  1M8V A;  5CCA A;  3OYH A;  1X69 A;  3PVQ A;  2JXB A;  4Y92 A;  4ZN1 A;  3NFC A;  4OB2 B;  3A8G B;  5CIU A;  3S3N A;  1T0H A;  3OS1 A;  3VV0 A;  4KH1 B;  2FHD A;  1NE8 A;  3REB B;  2F1L A;  4IUP A;  3JCM X;  3CCS T;  4KUL A;  4BE1 A;  4PKC C;  4BE0 A;  2RNA A;  2OTL A;  1PWT A;  3MKD A;  4J5Y A;  2HEQ A;  4C92 D;  3OYF A;  1SKU B;  2YDL A;  1Z9Q A;  2G6F X;  4ZN3 A;  2YUQ A;  3QDF A;  2DJQ A;  3M4G A;  3VU3 C;  4F16 A;  2VGM A;  2A3L A;  4HVU A;  2RJE A;  2RI3 A;  3WXM B;  2NUT B;  1WIE A;  4RTZ A;  1LVK A;  3CMA Q;  4C8Q F;  1M90 U;  2L3Q A;  1HD3 A;  1QWE A;  2JS0 A;  3SWN C;  1UEC A;  2HQE A;  3VS6 A;  3SFM A;  1G3T A;  1VQ4 A;  2QA4 T;  2CT3 A;  2DKG A;  5FWC A;  2X4X A;  4A4F A;  4M77 C;  3M0R A;  1VQ6 A;  4X1V A;  2V8J A;  3M4Y A;  1AWO A;  1YP5 A;  3C12 A;  3UT1 A;  2LT1 A;  5LJ5 e;  2ZPI B;  4QVZ A;  1PC0 A;  1YHQ T;  4RTY A;  2D0N A;  5CAI A;  3NPF A;  4M78 G;  5FRN A;  1XTD A;  5A0D A;  4XTZ A;  1TH7 A;  2WSC E;  4BE2 A;  2DMO A;  4RMO A;  1K4U S;  3CME T;  1M90 R;  5GAN 2;  1Q81 C;  2JOY A;  1D1A A;  1NEB A;  4M77 G;  4N4I A;  4WF2 A;  2DL7 A;  1RLP C;  2CZ6 B;  2LX7 A;  1IGU A;  4CI0 C;  3ER0 A;  3DKM A;  1WI7 A;  4C8Q E;  3LH5 A;  5LJ3 f;  1QVG P;  3QZ5 B;  1KQ2 A;  1BI3 A;  4F7U F;  3I56 Q;  2QGF B;  4DQ2 A;  3O5Z A;  3EH1 A;  5GAO n;  1M3B A;  3NHN A;  4KH0 B;  2QQA A;  3CCR Q;  3VRY A;  3L2Q A;  5CKB A;  2E64 A;  4ZTJ A;  2J6K A;  4KUD K;  1X2K A;  1Q7Y U;  1YIJ Q;  1VYV A;  2PUK B;  4DEY A;  2RHX A;  2DBK A;  1N8R U;  1QCN A;  4M7A C;  1WGS A;  1UEB A;  1SRM A;  3CCL A;  4PLI A;  4J6Y A;  3RIR A;  1M4Z A;  2JUF A;  3HP9 A;  3CC2 Q;  1WPY A;  3GP8 A;  2OTJ Q;  1OX9 A;  4C5G A;  4L59 A;  2RHU A;  1VQ4 T;  4F14 A;  1M1G A;  4E47 A;  1R0B G;  5C0M A;  1VQN Q;  4PJO C;  3CXC S;  3A5Z B;  3O8V A;  3OW2 S;  2KYM A;  2AIR B;  1VQ9 A;  4XTV A;  2FEI A;  3V8L A;  5KCH A;  3I56 A;  2EQK A;  5EC7 A;  2FB7 A;  1I5O B;  3CCQ Q;  1X27 A;  2ABL A;  3CXC A;  2LJ0 A;  3OW2 A;  2P4R A;  1HK9 A;  3M0T A;  4R56 A;  5FU6 C;  3TU4 K;  3A8O B;  3HFN A;  4E7S A;  1PKT A;  3QBY A;  4HCK A;  2L2P A;  3CMA T;  2YUP A;  1D3B A;  2R5A A;  1PRM C;  3CC2 A;  1M9S A;  2R57 A;  1Y71 A;  2E10 A;  3JCM Q;  2LMJ A;  3VS4 A;  5DM7 R;  2JN0 A;  3FDR A;  3HRS A;  5I22 A;  3JB9 D;  1CSK A;  2GQI A;  4E7J A;  2CS7 A;  1UDL A;  3BFM A;  2FVU A;  3I35 A;  1QWF A;  2KRO A;  1MMD A;  3JCM h;  3M0P A;  1TUD A;  3P8H A;  1N8R C;  2GFA A;  2P0Q A;  2YSQ A;  3JB9 F;  4ANJ A;  2DXT A;  4RTU A;  3SHW A;  1QKW A;  2BUD A;  4JRQ A;  2VVK A;  2C06 A;  2HL5 C;  4LDU A;  2ZCF B;  1C1A A;  4NOY A;  4AFQ C;  5CKH A;  2RHY A;  2E12 A;  2DAQ A;  3HSB A;  4PFZ A;  1QLY A;  1IHW A;  3GF5 A;  4QVC A;  3CD6 A;  2DER A;  3DB3 A;  1QP3 A;  1U1S A;  4DBH A;  3G71 Q;  5HCK A;  5DLQ E;  4C92 A;  1YWP A;  3I56 T;  2QXF A;  5CKE A;  1ABO A;  1D09 B;  5KH6 A;  1M30 A;  2NUZ A;  4EMK C;  2H3E B;  3CCR T;  4J83 A;  1VQO Q;  3JV3 A;  1PD1 A;  5KCO A;  1C6V X;  2DD4 A;  2M0O A;  5GAN 6;  3QSU A;  4HCZ A;  3UDC A;  2OI3 A;  2Y90 A;  3HFO A;  2D9T A;  3PIP A;  1M2O A;  2E3H A;  1YIJ T;  2DK3 A;  2E65 A;  3PFS A;  4FU6 A;  1MV3 A;  3QII A;  2K79 A;  2KDS A;  2FPD A;  2MYS A;  1VA7 A;  2YLC A;  4FYW B;  2I0N A;  2FZK B;  4OMQ A;  1GBR A;  2JMA A;  2JJ9 A;  4C8Q C;  1WZO A;  1VQM Q;  3CC2 T;  2YUN A;  4LXC A;  2OTJ T;  4JJD A;  2LQK A;  2LC4 A;  3MHX A;  2CP7 A;  2L8D A;  2JM9 A;  2K2M A;  3ME9 A;  4N4H A;  5D6Y A;  1G83 A;  4OB3 B;  4C0D B;  2RB6 A;  2C0I A;  4M75 G;  1ZSG A;  1VQN T;  3EHQ A;  2ZAE A;  3LGL A;  1W70 A;  3L2U A;  2LCS A;  2QQ9 A;  1VIF A;  4OB1 B;  2FO0 A;  2CH4 W;  3M58 A;  2E70 A;  2RJD A;  1M1F A;  3CXC P;  1HXD A;  1VIE A;  4HVV A;  3CCQ T;  1W1F A;  3OYE A;  1FWZ A;  2HMA A;  4M77 D;  5KYY A;  4C92 B;  2AKK A;  2DYI A;  4M78 F;  1NLP C;  4JRI A;  1R77 A;  2DE0 X;  4J9H A;  2XDB A;  4PJN A;  2VXF A;  5GAO q;  1ABQ A;  3H0F A;  2IIM A;  3P8B B;  4M77 F;  2XK0 A;  2RI5 A;  3OYY A;  2LTO A;  1ACM B;  2GTO A;  3HTR A;  4ZGD B;  1VQM A;  4MDW A;  2RH2 A;  4HKE A;  3EG3 A;  5GJW B;  3RDV A;  3VS1 A;  2QG9 B;  4M7D A;  3G7Z A;  3OS2 A;  3RMQ A;  2PVG B;  1K73 R;  1UGQ B;  2F5K A;  3E19 A;  2RO0 A;  2O01 E;  3CCE A;  1K8A C;  3HPW A;  1AWX A;  4F7U G;  4LDY A;  4RG2 A;  1QW1 A;  4JRP A;  4JPB W;  5A2Q E;  4KGX B;  1IZ6 A;  1VQ7 A;  1NJI C;  1YJ9 T;  4M78 E;  3OY9 A;  2MI6 A;  2A08 A;  2F2V A;  2X51 A;  3CCS Q;  4WCI A;  1WXU A;  4JZ4 A;  4CRI A;  3UA7 A;  2DFU A;  1YFN A;  4FSS A;  1N9S A;  2CZ7 B;  3GBQ A;  1SF9 A;  2EBP A;  4M7A D;  4J6W A;  1JBM A;  3LLR A;  4M77 E;  4EMH A;  3MO8 A;  3MP6 A;  1MHN A;  2DLP A;  3PIO A;  3G71 T;  4XTY A;  2NLU A;  1PNJ A;  3EG9 A;  2F2W A;  1G2B A;  1QMC A;  1WA7 A;  2E3I A;  3A1P A;  5KYY B;  1Q86 U;  2VXE A;  2LRQ A;  4HVW A;  1VQO T;  3MCA B;  4BI8 B;  2V1Q A;  2KYB A;  2V26 A;  5LJ3 d;  5GAN f;  1UGV A;  4D8D A;  1KJW A;  1ZHI A;  1KC8 R;  4PJO D;  3F70 A;  4BAC A;  2LJ1 A;  1GCQ C;  3C4S A;  3E1S A;  2QTX A;  1Y96 A;  4IIM A;  1UFF A;  2KVQ G;  4II1 A;  5IH2 A;  4M7D B;  2GTJ A;  1T3S A;  4C5I A;  1B07 A;  2LQN A;  1Q86 R;  1GCP A;  2YRD A;  4J6X A;  3EGD A;  2CSI A;  4L5G A;  1T3L A;  3CCS A;  3M59 A;  2ROL A;  5HK0 A;  1NZ9 A;  2EGC A;  4XU3 A;  1G5V A;  1BK2 A;  3VS7 A;  2PUO B;  1N5Z A;  3EG2 A;  2WSF E;  1VQ5 Q;  4ME7 A;  2XI9 A;  5L23 A;  2L0A A;  4MDX A;  1H3H A;  5HK3 A;  4E7H A;  3SEM A;  3H8Z A;  4NL2 A;  5GAM d;  2RD1 A;  2YWW A;  2DF6 A;  3PMT A;  2LQW A;  2HKN A;  1NPR A;  5A0L A;  3VS0 A;  1WQ7 A;  1KD1 U;  1JJ2 S;  3JRZ A;  1BYM A;  2OAW A;  3EG9 B;  3C95 A;  3I5S A;  2DRK A;  1VQK T;  1UGR B;  4OMF B;  2RPN A;  3V7S A;  3A8M B;  5LJ3 j;  1K0S A;  2LP5 A;  2NYS A;  2X3X D;  2HL3 A;  4OML A;  4UC4 A;  3KBG A;  2F69 A;  2QA4 A;  3LGF A;  4DOV A;  4X34 A;  1JJ2 A;  1UE9 A;  2E1H A;  4RKU E;  2DM1 A;  2D0Q B;  1G3Y A;  2GCX A;  3OA6 A;  2KGT A;  2KR3 A;  2WAC A;  2GNC A;  2XKO C;  1KD1 R;  3DB4 A;  3JCM g;  3JB9 J;  2L3P A;  4OGC A;  1AEY A;  2NUP A;  3G1J A;  1PG5 B;  4QT7 A;  3CCV Q;  4RUG A;  3FEO A;  5HKC A;  3ASK A;  1OZ3 A;  2M1H A;  3CME A;  2HQH A;  1UHC A;  1M3A A;  4BI3 A;  1D1C A;  4M4Z A;  1AWW A;  1RAC B;  5GAO m;  2DTO A;  3A98 A;  2EAY A;  4IUR A;  2F2X A;  1X01 A;  2DNU A;  3OS5 A;  4XTU A;  1MMA A;  5GAM j;  1TSF A;  2D1X A;  1K9M C;  2ZPH B;  3CPW P;  3VJP A;  1BI2 A;  4ZGJ B;  2EIF A;  2GBQ A;  4JLG A;  4E7K A;  1RLQ C;  4M75 D;  1RL2 A;  1ZUU A;  3VUZ A;  3EGX A;  5KYN A;  4O5V A;  5LJ5 f;  3FC3 A;  3J7A F;  3SWN A;  4C8Q D;  2L3S A;  2FRY A;  3AHU A;  1UTI A;  3VKI A;  1IB8 A;  4M75 F;  4JS5 A;  1U3O A;  4M77 A;  2QI2 A;  5D6X A;  4ZGE B;  3CCV A;  4M78 C;  1WHK A;  3JB9 H;  1ZUK A;  2KI7 A;  1GL5 A;  3RNJ A;  2CDT A;  4PNO A;  3LWH A;  3QUI A;  2YHT A;  4JZ3 A;  4BUG A;  1YWO A;  2ECZ A;  2XMF A;  3JCM e;  2CGH A;  3MPU B;  3ZL7 C;  3VUB A;  2AZV A;  3ZFJ A;  1QKX A;  4JRK A;  2DZ9 A;  4LD6 A;  2IVW A;  1VQ5 T;  1JQQ A;  2XG8 D;  2RQW A;  1WFW A;  2V8K A;  4PL6 A;  2HKQ B;  4J7I A;  3H9N A;  3OYL A;  2P0K A;  4M75 E;  2JT4 A;  2E6N A;  3OYN A;  1OUL A;  1K0X A;  2VB6 A;  3M0U A;  2AHJ B;  4RTX A;  2EYX A;  5GMK j;  1JB0 E;  2DJZ A;  4HT8 A;  4IUQ A;  4HCB A;  2M51 A;  1X6O A;  3TSZ A;  1EZZ B;  4XK8 E;  4X9C A;  5EG2 A;  4IIO A;  3RBB B;  4M7A A;  4E7L A;  4ATO A;  3SWN B;  3CMA A;  4JUV A;  4JS4 A;  1I07 A;  2EYW A;  1U06 A;  1JJ2 P;  2BZX A;  1BKB A;  1OPL A;  2G3R A;  3NTI A;  2P84 A;  5GAO l;  1WHJ A;  4R0K A;  4LDW A;  1AWJ A;  1XNI A;  3PT9 A;  1FMK A;  3L2V A;  1KQ1 A;  4PJO A;  2KMT A;  2EQI A;  2DYB A;  2DTI A;  3CBM A;  3NTK A;  1M27 C;  2MAM A;  2FZC B;  3CCV T;  2QDY B;  5J3B A;  2A36 A;  2PQW A;  2BIV A;  2DL8 A;  1D0X A;  1M90 C;  2H8H A;  4DBR A;  4OF1 A;  3EFR A;  2AK5 A;  4J7F A;  4F7U E;  2A7Y A;  2DRM A;  4N0A C;  4MML A;  4F04 B;  1D0Y A;  2RK2 A;  3X28 B;  1W6X A;  1NM7 A;  4TVR A;  2RJC A;  3QKJ A;  2RI2 A;  3CCM Q;  3QG1 A;  2B8A A;  5IT9 E;  2E41 A;  2FRW A;  3CCR A;  4FIB A;  4X9D A;  3RKW A;  4QVD A;  5D6W A;  1EIF A;  2A37 A;  1W2B S;  2DEU A;  1UGS B;  4CC3 A;  4M7A B;  2COW A;  1YIJ A;  4BB7 A;  2ZPE B;  4B9W A;  3M5A A;  3EGU A;  1WHG A;  4C5H A;  1OQK A;  4DBQ A;  2O31 A;  4J9D A;  2XIC A;  2Z0W A;  3QJ6 A;  2P4T A;  3CCU Q;  5GMK i;  4J9G A;  5GAN 8;  1W2B A;  2OX7 A;  1N27 A;  3TRE A;  4FSX A;  1OV3 A;  2EWN A;  2OTJ A;  5GAM e;  2ZGW A;  2QQR A;  3JB9 I;  5GAN d;  4PJO B;  3UA6 A;  2HNI A;  3N5B B;  4ELY C;  3QHS A;  2DBM A;  7AT1 B;  1VQN A;  5AT1 B;  1Q7Y C;  2EKH A; 
#chains in the Genus database with same CATH homology
 1SPK A;  3I9Q A;  5FWB A;  3VRZ A;  1NYG A;  2K3B A;  1SEM A;  2HDA A;  2GTO A;  4OMM A;  2A28 A;  3FJ5 A;  4GLM A;  3EG3 A;  5GJW B;  1TUC A;  3VS2 A;  1JXM A;  3VS1 A;  2KBT A;  2ED0 A;  2SEM A;  2K7A A;  5FW9 A;  1JEG A;  1AZG B;  1BU1 A;  4GBQ A;  2JM8 A;  5IXF A;  1AWX A;  1VYU A;  2KRM A;  2VKN A;  4JPB W;  4ZNX A;  1GFD A;  2RF0 A;  2V1R A;  1PKS A;  4J9B A;  2DVJ A;  1WXB A;  1A0N B;  2A08 A;  2F2V A;  2MOX A;  1WLP B;  3NGP A;  4WCI A;  2E5K A;  1AOJ A;  1WXU A;  4JZ4 A;  3UA7 A;  1AD5 A;  1ZLM A;  2RMO A;  2K6D A;  4FSS A;  1J3T A;  5IXB A;  1JXO A;  3GBQ A;  5IHI A;  2B86 A;  1K1Z A;  2PTK A;  2EBP A;  4J9E A;  2YUO A;  1VYT A;  3CQT A;  2JW4 A;  1X69 A;  3PVQ A;  2JXB A;  4Y92 A;  4OMO A;  2DLP A;  1UJ0 A;  1I1J A;  3H0H A;  2D8H A;  1QCF A;  1T0H A;  1CKA A;  1PNJ A;  1M8M A;  2F2W A;  1G2B A;  2BZY A;  2O88 A;  1WA7 A;  1OEB A;  3REB B;  1SHG A;  4LUD A;  1RI9 A;  2J6F A;  2RNA A;  4HVW A;  3THK A;  1YN8 A;  1Y0M A;  2V1Q A;  2W0Z A;  1PWT A;  2KYB A;  2KNB B;  1UGV A;  2HEQ A;  2EGA A;  4D8D A;  1KJW A;  2YDL A;  2AZS A;  1CKB A;  1GCQ C;  1Z9Q A;  2LJ1 A;  2G6F X;  2YUQ A;  4IIM A;  2DJQ A;  1UFF A;  1NG2 A;  1PRL C;  4LN2 A;  4F16 A;  2K9G A;  5IH2 A;  1B3Q A;  2EYZ A;  2OJ2 A;  2GTJ A;  2EVR A;  4HVU A;  1T3S A;  4RTT A;  1WIE A;  1B07 A;  2LQN A;  1GCP A;  4DEX A;  4RTZ A;  2CSI A;  1T3L A;  2ROL A;  1NYF A;  2L3Q A;  2EGC A;  1HD3 A;  2KT8 A;  1BK2 A;  1QWE A;  2JS0 A;  1UEC A;  3VS7 A;  1N5Z A;  3EG2 A;  2NWM A;  1I0C A;  3VS6 A;  2YT6 A;  1RUW A;  5L23 A;  2L0A A;  2CT3 A;  3H0I A;  5FWC A;  1H3H A;  2KXD A;  1X6G A;  1HSQ A;  2J7I A;  3SEM A;  3M0R A;  4J9F A;  1JU5 C;  4JJC A;  4X1V A;  1AWO A;  1YP5 A;  2DF6 A;  3NMZ C;  2CRE A;  2LQW A;  4RTY A;  2D0N A;  2EGE A;  3VS0 A;  3NPF A;  4Z88 A;  1ZUY A;  4CC4 B;  1GRI A;  3EHR A;  2O9S A;  2DMO A;  2OAW A;  4ESR A;  1E6G A;  1E6H A;  2PZ1 A;  1K4U S;  3I5S A;  2DRK A;  1NEB A;  2RPN A;  3PVL A;  2AKL A;  1ARK A;  1WYX A;  1SHF A;  4KRT A;  1K0S A;  2LP5 A;  2X3X D;  2DL7 A;  1RLP C;  2LX7 A;  4OML A;  2CUB A;  1UE9 A;  1WI7 A;  3LH5 A;  4CC7 A;  2DIL A;  1HJD A;  2DM1 A;  2SRC A;  2KGT A;  3O5Z A;  2KR3 A;  2GNC A;  1M3B A;  3NHN A;  1Z9Z A;  2J6O A;  3VS3 A;  2L3P A;  3VRY A;  1AEY A;  2RQT A;  4QT7 A;  2LZ6 B;  2J05 A;  4RUG A;  2J6K A;  1X2K A;  1UHC A;  1M3A A;  4M4Z A;  1AWW A;  1VYV A;  4DEY A;  4AFZ C;  2ROT A;  3A98 A;  2DBK A;  3UF4 A;  1ZX6 A;  4A63 B;  1GCQ A;  2J06 A;  1K76 A;  1SRM A;  2F2X A;  2DNU A;  2D1X A;  2BTT A;  1EFN A;  3TSW A;  1E7O A;  1XOV A;  4Z8A A;  1V1C A;  2GBQ A;  1RLQ C;  4F14 A;  1ZUU A;  2DL5 A;  4EIK A;  4OMP A;  2JMC A;  2KYM A;  2L3S A;  5IHN A;  2FRY A;  2GGR A;  2RN8 A;  1JO8 A;  1UTI A;  1KFZ A;  2FEI A;  2RQU A;  1U3O A;  2EPD A;  5EC7 A;  2KE9 A;  1BB9 A;  5GJV B;  2DX1 A;  1X27 A;  2PNI A;  4LNP A;  1MV0 B;  2ABL A;  5I11 A;  3M0Q A;  2LJ0 A;  3QWY A;  2FPE A;  2P4R A;  2C0O A;  3M0T A;  4J9I A;  1ZUK A;  2KRS A;  5IHK A;  1GL5 A;  2DL3 A;  3RNJ A;  1WXT A;  2O9V A;  2CDT A;  3C0C A;  1BBZ A;  1PKT A;  4JZ3 A;  3PE0 A;  1X2Q A;  1YNZ A;  1NEG A;  3I5R A;  1TG0 A;  4HCK A;  1YWO A;  2EW3 A;  2ECZ A;  2L2P A;  2XMF A;  2YUP A;  4JJB A;  1GFC A;  1PRM C;  2MIO A;  3ZL7 C;  2AZV A;  2CSQ A;  2LMJ A;  1QKX A;  3VS4 A;  4J9C A;  5I22 A;  3M0S A;  2KEA A;  3IQL A;  1JQQ A;  2RQW A;  1WFW A;  1CSK A;  3UAT A;  2GQI A;  1S1N A;  2D8J A;  1UDL A;  2JT4 A;  3I35 A;  1NLO C;  1QWF A;  5ECA A;  2KRO A;  1K0X A;  1FYN A;  3M0U A;  3M0P A;  2EYX A;  4RTX A;  4K11 A;  1TUD A;  1ZBJ A;  2YSQ A;  3R6N A;  4RTU A;  2W10 A;  1T0J A;  2M51 A;  2KXC A;  2MCN A;  1QKW A;  3SHW A;  3TSZ A;  2VVK A;  4E6R A;  1X6B A;  2RQV A;  4Z89 A;  4IIO A;  2O2O A;  3RBB B;  1LCK A;  1UJY A;  1OOT A;  1I07 A;  4AFQ C;  1IO6 A;  2EYW A;  1M3C A;  4ORZ A;  1U06 A;  4LE9 A;  2DL4 A;  2BZX A;  1OPL A;  1QLY A;  3VS5 A;  4AG1 C;  1AVZ C;  4R0K A;  1H8K A;  1SSH A;  3TVT A;  5HCK A;  1AWJ A;  1FMK A;  1YWP A;  1PHT A;  1ABO A;  2LJ3 A;  4RTW A;  2ED1 A;  2EQI A;  2DYB A;  1M30 A;  2NUZ A;  1K9A A;  1H92 A;  1M27 C;  3JV3 A;  4OMN A;  1MUZ A;  2A36 A;  2M0Y A;  3REA B;  2OI3 A;  2DL8 A;  1U5S A;  2C0T A;  1UHF A;  2H8H A;  3EG0 A;  1MV3 A;  2K79 A;  2AK5 A;  2FPD A;  4RTV A;  1VA7 A;  2DRM A;  2ENM A;  1UG1 A;  4AG2 C;  2I0N A;  4OMQ A;  1OPK A;  4F17 A;  2ESW A;  2QDL A;  2FPF A;  1GBR A;  1W6X A;  2JMA A;  2VWF A;  1NM7 A;  1KSW A;  4LUE A;  1YCS B;  2YUN A;  4AFU C;  4JJD A;  2KT1 A;  2FRW A;  2JS2 A;  2JM9 A;  2HSP A;  2K2M A;  1GBQ A;  4AFS C;  2HCK A;  1G83 A;  2CH4 A;  4D8K A;  2C0I A;  1ZSG A;  2A37 A;  4CC3 A;  3EHQ A;  2LNH B;  2BZ8 A;  2CT4 A;  1W70 A;  3ULR B;  4HXJ A;  2EYY A;  2LCS A;  2DA9 A;  3EGU A;  3QWX X;  2FO0 A;  2CH4 W;  1SRL A;  2HBW A;  1UUE A;  4CC2 A;  2O31 A;  4J9D A;  2FG0 A;  1X43 A;  4HVV A;  1Y57 A;  1W1F A;  4J9G A;  2X3W D;  1OV3 A;  2RQR A;  2CUD A;  2AKK A;  3H41 A;  3U23 A;  1NLP C;  3UA6 A;  1WDX A;  1WX6 A;  4J9H A;  2DE0 X;  1AZE A;  3KFV A;  2JTE A;  1ABQ A;  2DBM A;  3H0F A;  2KRN A;  2IIM A;  3EG1 A;  1KIK A;  2EKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...