1H92A

Sh3 domain of human lck tyrosine kinase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
63
structure length
63
Chain Sequence
GSPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
publication title Structural Investigation of the Binding of a Herpesviral Protein to the SH3 Domain of Tyrosine Kinase Lck
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1h92A00
4WCIA 2AZVA 2YDLA 2DILA 1I0CA 3EGUA 2HEQA 2KRNA 4JZ4A 1K9AA 1AEYA 4LNPA 5FWBA 3EG0A 4J9BA 2AK5A 2PNIA 1WXTA 2A37A 2ABLA 2LJ3A 4J9CA 1SEMA 1Z9ZA 2KE9A 3R6NA 2RMOA 1U3OA 4M4ZA 1AWWA 3I5SA 3QWYA 3M0SA 1QCFA 4RTZA 1ABQA 1KJWA 5ECAA 5IXBA 2GTOA 4IIOA 1UE9A 1PKSA 3I9QA 1X69A 1M27C 2LX7A 4J9IA 2O9VA 4F16A 3U23A 4Y92A 4HVUA 2SRCA 1MV3A 1ZUKA 4Z88A 1LCKA 4DEYA 4KRTA 1SHFA 1GCQA 1M3AA 3VS3A 3EHQA 2EYZA 2V1RA 2EQIA 1PWTA 4AFUC 3THKA 1ZX6A 3M0UA 1SPKA 1SHGA 4RTYA 2EYYA 4F14A 1M3CA 2C0TA 1JXMA 4OMPA 1N5ZA 1M3BA 1SRLA 2FRWA 2RPNA 2HDAA 2DRKA 2FG0A 3VS7A 1TG0A 2DMOA 1AWJA 1WLPB 2RNAA 1HD3A 2JMAA 2LP5A 4R0KA 2ENMA 1UHCA 2M0YA 1GFCA 1CKBA 1M30A 4EIKA 2RQRA 1AVZC 1WDXA 2EBPA 2X3XD 4LUDA 1BB9A 2X3WD 2DNUA 4J9FA 4OMLA 3I5RA 3IQLA 4ESRA 3A98A 2ED0A 2RQVA 2KXDA 4J9EA 2KNBB 4J9DA 2GGRA 1EFNA 2O2OA 1M8MA 1NLPC 4RTVA 1KSWA 1Y0MA 3TSWA 1X2KA 1ZBJA 2K79A 2D0NA 2DL7A 5EC7A 1WFWA 2DBMA 2CH4W 2NUZA 1T0HA 3I35A 3UATA 2OJ2A 2D8JA 5HCKA 1MUZA 4RTTA 1RI9A 3PVQA 3O5ZA 2AKLA 2RQWA 1B3QA 1X6GA 2JM8A 2DF6A 5FWCA 3NMZC 1ARKA 1WXUA 2CT4A 5GJVB 4OMMA 2LZ6B 2LJ1A 4AFQC 2AKKA 2CH4A 1FMKA 2C0IA 1GCQC 3M0TA 4LN2A 3VS6A 1I07A 2A36A 2B86A 4OMQA 1KFZA 1GBRA 4OMNA 3GBQA 2SEMA 2DX1A 2FO0A 3TVTA 2RN8A 4F17A 5I22A 3H0FA 1CKAA 4JPBW 2ED1A 2DM1A 2G6FX 1WI7A 1Y57A 1VA7A 2KEAA 1AWOA 2L0AA 1X2QA 1ZUUA 4Z89A 1A0NB 2JM9A 2DA9A 3NPFA 2DRMA 2O88A 2DL5A 1YCSB 1QLYA 4CC2A 1CSKA 1NG2A 1GBQA 1U06A 1GCPA 2DL4A 1UJYA 2EKHA 5IXFA 3C0CA 2KRMA 3VS0A 3VS5A 4E6RA 1ABOA 2A08A 3SEMA 1WXBA 1SRMA 3QWXX 3RNJA 1K4US 3UF4A 1UUEA 1TUCA 4AFSC 4OMOA 4GLMA 1JU5C 4D8DA 3EHRA 1BK2A 1YNZA 4ZNXA 2GQIA 1WA7A 1YWOA 4LUEA 2YSQA 1E6HA 2FPFA 2JTEA 3RBBB 2MOXA 2NWMA 2L2PA 4HVVA 5GJWB 2ESWA 4DEXA 2LCSA 1QWFA 1J3TA 1XOVA 1OPKA 4K11A 4RTWA 2KT1A 1W6XA 2YUQA 2LNHB 1JO8A 2E5KA 1RLQC 1YN8A 1NYGA 1OOTA 2DBKA 2J7IA 3KFVA 2VVKA 1RUWA 3EG2A 1GL5A 1PRMC 1W70A 3H0HA 2VWFA 2P4RA 3TSZA 5IH2A 1FYNA 1NEGA 2DJQA 4D8KA 3CQTA 1OEBA 1RLPC 1WYXA 2JMCA 1BU1A 2ECZA 2EPDA 2I0NA 2MIOA 2O9SA 2RF0A 2ROTA 1KIKA 2JXBA 1PRLC 1MV0B 2EW3A 4JJBA 4JZ3A 2EGCA 4HVWA 2CT3A 3JV3A 2F2XA 1WIEA 2RQUA 1AZEA 2DL8A 3VRYA 4AG2C 1B07A 3EG3A 3H0IA 1NYFA 2DVJA 2KT8A 2PZ1A 2K9GA 2JS2A 2KGTA 2LQWA 1UFFA 1NM7A 4J9HA 4X1VA 2CSIA 3ULRB 2J6FA 2CREA 2GNCA 2YUPA 2DLPA 1VYUA 1JQQA 1X6BA 1G83A 4RUGA 1IO6A 4GBQA 2LJ0A 2KYMA 2D1XA 3H41A 3VRZA 1E7OA 4RTUA 3REBB 3PVLA 3NHNA 2KR3A 3ZL7C 5IHIA 4IIMA 2YUNA 2QDLA 2ROLA 2EGAA 4LE9A 3SHWA 2J6KA 2OI3A 3VS1A 1NEBA 5FW9A 3FJ5A 2CSQA 1T0JA 1W1FA 2BTTA 1TUDA 4Z8AA 1AOJA 2KRSA 1NLOC 4JJDA 2F2VA 5IHKA 1VYVA 1G2BA 2CUDA 2FPDA 1YP5A 1AWXA 2YUOA 4HXJA 4FSSA 2FPEA 1JEGA 2LQNA 3UA6A 1K0SA 2DYBA 2CDTA 1UECA 2HCKA 2PTKA 1YWPA 3M0RA 4J9GA 2K3BA 2JS0A 4A63B 1T3SA 4CC3A 2DL3A 1OPLA 1UDLA 2L3QA 3NGPA 2BZYA 1V1CA 1HJDA 1PHTA 2OAWA 2J05A 2JW4A 1UG1A 3M0PA 2H8HA 2D8HA 2O31A 5IHNA 2J06A 2J6OA 1AD5A 4JJCA 2BZ8A 3PE0A 4AFZC 2CUBA 1GRIA 1WX6A 2JT4A 2EYWA 2V1QA 1PKTA 2HBWA 2KXCA 2LMJA 4QT7A 1BBZA 4RTXA 1ZUYA 4ORZA 1U5SA 2KROA 1Z9QA 2FRYA 3UA7A 2A28A 1K76A 1X43A 2DE0X 4CC7A 2FEIA 5L23A 2EGEA 1QKXA 1JXOA 1QWEA 2AZSA 3M0QA 1UJ0A 3VS2A 1E6GA 1H3HA 1I1JA 2C0OA 1K1ZA 2K6DA 2EVRA 2GTJA 1ZSGA 4CC4B 1SSHA 2M51A 3LH5A 1H8KA 1UTIA 2W10A 3EG1A 1GFDA 2HSPA 1S1NA 2VKNA 3VS4A 1AZGB 2BZXA 2EYXA 2XMFA 1HSQA 5I11A 1K0XA 2L3PA 1T3LA 1X27A 2GBQA 1PNJA 1H92A 2RQTA 2W0ZA 2YT6A 3REAB 2K7AA 1UHFA 2IIMA 1VYTA 2KBTA 4AG1C 4HCKA 1UGVA 1ZLMA 2F2WA 2L3SA 2MCNA 1OV3A 2KYBA 2K2MA 1QKWA
chains in the Genus database with same CATH superfamily
4MZPA 1B34B 5GAN3 4QQDA 4M7DE 5LL6S 3EGUA 2KRNA 1VQMA 1VQKQ 5FROA 2DEQA 2CYZB 2ABLA 5HK3A 1IGUA 3OQ5A 4FT4A 4J9CA 1KG1A 1JJ2A 2DXBA 1QVFA 5GAOq 2XHCA 3R6NA 1D09B 1U3OA 3QWYA 3MHXA 2HZYA 5KYYB 1JB0E 1M9SA 3QDFA 1ABQA 2CKKA 2Z0WA 5HK0A 2RJFA 5LJ3f 1Y71A 8ATCB 2DD5A 1X69A 3J80E 2JJ9A 4J9IA 4FT2A 3FEOA 3U23A 5FRMA 4LDXA 3GOXA 2PVGB 1SHFA 4ZGJB 2RI2A 2F69A 3G1JA 5GAN2 4ZGDB 3OSVA 3HP9A 1ZX6A 3M0UA 2LCCA 1SHGA 3CCMA 2EYYA 1VQLA 4F14A 2RI3A 4OMPA 1Q82U 2QXFA 4OGCA 1SRLA 4A54A 2DRKA 3VS7A 2BUDA 1TG0A 1YHQA 1WLPB 1YIJQ 2RNAA 2LP5A 4E2FB 2ENMA 5GANe 1GFCA 3N5BB 2RQRA 3CCQQ 2X4JA 3QYHB 1WDXA 4PJOG 1BB9A 1VQ7A 2X3WD 2QG9B 2KQWA 3OB9A 3I5RA 3IQLA 4CI0C 5D6XA 4ESRA 2NLUA 2HNIA 2EQJA 2KNBB 2MI6A 2O2OA 1K8AU 3PIPA 3OYGA 3TSWA 1X2KA 2K79A 3MP1A 2DL7A 1D1CA 2MK5A 4XAXB 3JCMW 4X9DA 3RIRA 1SKUB 4DOWA 5GAMj 3PVQA 3O5ZA 3CCLA 2RQWA 1B3QA 3CPWA 6AT1B 1VQ5Q 1BCOA 3OYYA 3AT1B 3NFCA 4C8QG 2LZ6B 2CZ6B 2GCXA 1TSFA 2XICA 1OZ2A 1BI0A 3OW2A 3M0TA 3Q1JA 2LVMA 1I07A 1M2VA 2A36A 2CP6A 3H6ZA 4J6YA 4DBQA 5LJ3e 4OMQA 2QEXQ 4OMNA 2SEMA 2DX1A 2FO0A 1U1TA 4FCYA 3MO8A 3JB9J 2G6FX 1W2BA 3X26B 4FYXB 1ZUUA 4HT8A 4BACA 2RD1A 3NPFA 4MDXA 4C5GA 2DL5A 5GMKh 2OTJT 4FYVB 5FU7C 3CC7A 1NG2A 1VQ8T 5GMKi 3C0CA 3J7AF 1ABOA 4M77D 1SRMA 5LJ5j 1MNDA 3QWXX 1PCXA 4KBMB 3UF4A 1VQPQ 3CPWS 4N4IA 1C1AA 1N9RA 3CCJA 3QHSA 2QYZA 4KGVB 2HL5C 2LCLA 3E2UA 1VQOA 3HPWA 3CD6T 1YCYA 2RK1A 3CMAQ 2NYSA 1RI0A 2ZPBB 4DEXA 4L59A 4LD6A 3SWNA 1QWFA 1J3TA 4Y28E 1W6XA 2YUQA 2COYA 4YTLA 4NL2A 4EMKC 2OAUA 1YJNQ 2DBKA 1OULA 2VVKA 3EG2A 3LH0A 2E70A 3H0HA 2RB6A 1KHCA 2P4RA 5C0MA 3TSZA 2X4XA 2DJQA 4N4GA 4D8KA 3I55A 4XU2A 3JB9I 2O4XA 5I21A 2EYQA 2QAZA 2EPDA 4HCZA 2YRVA 4BD3A 2RK2A 1MV0B 2M1HA 1OU9A 2WACA 2GFAA 4GLKA 1M1FA 4D6WA 2K3XA 2RQUA 1AZEA 2V8KA 4BDYA 1M90C 1WHGA 3EFOB 4JRQA 4RKUE 1NYFA 2PZ1A 3L2VA 4M75C 2LQWA 1UFFA 3KBGA 5GAOm 1JRIA 2QGFB 2VGMA 4QKUA 4JS5A 2DTOA 2HSEB 3LX7A 1W4SA 1IO6A 3MEAA 2YLCA 3CCSQ 2LJ0A 3ZEHA 2D1XA 3H41A 3ZBDA 3QBYA 1SF9A 2BE9B 1JJ2P 1QVFP 3PVLA 2KR3A 3ZL7C 5LJ5g 1WPYA 2YUNA 2WSFE 2AIRB 1QQJA 4IUQA 3LWHA 1VQMT 1YJ9Q 3EFOA 3VS1A 3OMCA 5FW9A 4ME7A 4C92D 3JCMb 2JTMA 1TUDA 5CKBA 2HKNA 2KRSA 1VYVA 1BIAA 1TWBA 1G2BA 3GIBA 1AWXA 2RHXA 5KYWB 4C0DC 4BI8B 4KGZB 1RABB 3FJPA 3UA6A 3A8LB 3LGFA 3OA6A 2QQBA 2FHDA 2K3BA 1U8RA 2E41A 3TCJA 3DLLA 4M7DB 2DL3A 3JRZA 3LLRA 5GAN8 3RERA 2E3IA 5HKCA 2MPXC 4PFPA 1VQ4Q 5D7UA 1G3YA 5KYXB 4M7AC 2D8HA 3GNFB 2J06A 2J6OA 4C0DB 2JZ2A 5A2QE 3CCMT 1VQLT 5KYWA 2JT4A 2HBWA 4ORZA 1YHQT 3OYKA 1KQSA 1BI2A 1WHLA 2DXCA 1X43A 4CC7A 2FEIA 1QKXA 5EG2A 3PTAA 2AZSA 4M78D 1VQ7T 3FIFA 1E6GA 3G71A 1H3HA 4OB1B 2K2VA 4FM4B 1MHNA 2FZCB 1H8KA 5CKFA 2W10A 5KYXA 3GPLA 5AT1B 4DQ2A 1RAEB 3OW2P 2LDMA 1IGQA 4X9CA 1HSQA 1FMVA 4FSXA 5I11A 3JSCA 1H92A 1PNJA 2EAYA 2W0ZA 3CCLT 3REAB 3EGXB 4MDWA 4AMCA 1UHFA 4MZTA 2IIMA 3OYEA 1BYMA 3A8MB 2ZPEB 3JCMg 2L3SA 1W2BP 3TREA 2KYBA 2NUTB 3E1SA 1MMDA 2OTLQ 4AT1B 4N0AA 5IAYA 2HBPA 5GMKj 4WCIA 2AZVA 4E7LA 1U1SA 2RHIA 1OZ3A 2HEQA 1K9AA 2QA4A 5GAMf 5FWBA 3CCEQ 4M75F 2AK5A 2RJCA 2A37A 4OGEA 1KQSS 5GANd 4J6WA 4QVDA 4HA8A 1G3TA 3OYCA 1OYXA 2L5QA 4PJOC 4L5GA 2RMOA 4XTYA 3E9GA 3FLGA 4DBHA 1AWWA 3I5SA 4PFOA 3S6WA 3M0SA 2M02A 1ACMB 3OYJA 5ECAA 2GTOA 3UWNA 3D7SB 3I9QA 4M75G 3CC7T 3CBPA 1NPRA 4F16A 3GP8A 5CK9A 4M7DF 4HVUA 1OU8A 4KRTA 1GCQA 3V8JA 1KD1U 3BDUA 1YFNA 4WF2A 2XK0A 2EQIA 4AFUC 4PJOB 3QZ9B 5I2MA 2DEUA 1SPKA 4C8QC 2PUKB 1TOVA 4LDUA 3CCJT 2C0TA 1M3BA 3RESA 3MEUA 1VQOT 2F5KA 2RPNA 2FRWA 3M57A 2IG0A 2DMOA 1Y96A 1AWJA 2ATCB 1HD3A 5KYUB 1VQMQ 1UHCA 5LJ3d 4LUDA 4J9FA 4A4GA 4J6XA 3JB9G 3QJ6A 3I56A 2MF2A 2VYTA 2HAXA 1VQ6Q 4VUBA 2WSCE 3V8LA 1M90U 1NLPC 1KSWA 2KI7A 3I55T 2HQHA 5EC7A 3F70A 4XTXA 3UATA 4M75E 4XU1A 5GAMe 2D8JA 2HQEA 5HCKA 5GAN6 3CCUA 5KYUA 1LNXA 3C94A 2JM8A 2DF6A 5FWCA 3NMZC 1KQ2A 3A8HB 1ARKA 4M7AG 2CT4A 1LOJA 3EGDB 4IUPA 1VQ9Q 3QDRB 3VYGA 2LJ1A 2QQAA 3OYNA 2AKKA 1IRXA 4UC4A 1Q86U 1Q81R 1R0CB 3VS6A 1KFZA 1EIFA 2YHTA 4P5NA 2RN8A 4KH1B 3H0FA 1QCOA 5CKEA 1CKAA 4MZMA 4JPBW 2ED1A 3M55A 2DM1A 2EJFA 1UGRB 4JUVA 1WI7A 2L0AA 1LVKA 1VQ7Q 4DA4A 4JLIA 3EGDA 1IREB 2DRMA 2O88A 1I4K1 4HCCA 5DLOA 4CC2A 2CZ1B 1PM3A 2FZGB 1U06A 5LJ3h 2DL4A 3G6EA 1B34A 1C6VX 3SDZA 5IXFA 4X34A 3CC2A 4LD9K 2Y90A 3VS5A 2A08A 3PGGA 3JCMh 3SD4A 3ER0A 1VIEA 3QUIA 1YI2A 1K4US 4M7AE 4AFSC 2RHUA 4PJOF 2EFIA 3C12A 1YNZA 4PNOA 2YXYA 4EPCA 1XQHA 2KAFA 2GQIA 4PJNA 2JTEA 2NWMA 2OX7A 5KYYA 2LNVA 1TU0B 5GJWB 1TH7A 3QYGB 1XOVA 2MMPA 3CCRQ 2XIDA 3C95A 1P92A 1JO8A 1G8XA 1RLQC 1YN8A 1OOTA 3A5ZB 3SFMA 3X20B 4IUTA 2CZ7B 1RUWA 3QJYA 3MP6A 3HKSA 2VWFA 4B9XA 1RAGB 1AHJB 1D0ZA 4C8QF 3M4YA 2E5QA 4KULA 1I5LA 3CQTA 1RLPC 2YLBA 3HL8A 1WYXA 2MYSA 2JMCA 1N8RC 1K9MU 1N8RR 3CC7Q 1PRLC 3G71T 3FRNA 4ZN1A 2F2XA 2V26A 1LJOA 2VV5A 1QP2A 2DYIA 4R56A 1B07A 4DBFA 4C0GA 2PQWA 3H0IA 2DVJA 1R77A 2KT8A 2K9GA 3CCJQ 2HL3A 4RMOA 1D3BB 1PC0A 1UGQB 3RR6A 1IXDA 3QO3A 4R55A 3JB9H 2YUPA 1JQQA 3DB4A 4QQ6A 1ZA1B 3H9NA 4PJOE 4A4KA 3LYIA 3VRZA 2C06A 3CBOA 4EDUA 3SWNC 2F5TX 2IVWA 3RKYA 1YIJA 2QDLA 2ROLA 2YRCA 3CCQA 4LE9A 2QA4T 2OI3A 2JOYA 1NEBA 4M77C 2DIQA 4PLLA 1IZ6A 1Y07A 1D3BA 2FZKB 2BTTA 4E7HA 2I2LA 1QMCA 1BI3A 2F2VA 3A1PA 1MMNA 1WQWA 2CUDA 4J83A 3CCVQ 2V8JA 4HKEA 2DETA 4NS5A 3ASKA 4C8QE 2FPEA 3EFSA 2EWNA 3MJXA 3S3NA 2DYBA 2CDTA 4FYYB 2HCKA 3BFMA 2PTKA 1YWPA 4ANJA 4A63B 2RJEA 3GNGA 1VQ5A 5FU7B 2JN0A 3HSBA 2VXEA 2XDBA 2RHYA 3V7RA 1GXIE 2ZPFB 2A7YA 3H8ZA 1NJIC 3OYAA 3QKJA 5CAIA 1NJIR 2H8HA 3VV0A 2BZ8A 4AFZC 5DM7R 3PT9A 1GRIA 3V8KA 2V1QA 1YBYA 5GMKl 4QT7A 4RTXA 1ZUYA 1U5SA 1JBMA 2KROA 3UA7A 2MWOA 1QVGS 1SG5A 5L23A 2DE0X 1JXOA 1ZHIA 3OS5A 1QWEA 3MEWA 1UJ0A 3VS2A 3WXMB 3G4SA 3NTIA 4RCCA 4C0FA 1K1ZA 2K6DA 2GTJA 5J26A 3RKXA 4EMKB 4XQ3A 3I56T 3DKMA 2R58A 1IB8A 1VQNA 3EG9B 2CP7A 2CGHA 1GFDA 1NZ9A 3VS4A 1RAIB 2H3EB 1K0XA 2L3PA 3PNWC 2GBQA 2B8AA 2AHJB 3MKDA 1VQPA 1TUGB 3CCUT 2FL7A 1Q7YC 2DIGA 1Q7YR 4JJNK 1OV3A 1YJWA 2ZPIB 4KT0E 2K2MA 1M1KC 3CXCS 3V7SA 1UGPB 3VYHB 1M1KR 4EMKA 2YDLA 4WTOB 2DILA 1S72A 3VUZA 4C92C 4JZ4A 5A0DA 3MP8A 4LNPA 4J9BA 1WHMA 3LGLA 2PNIA 1YJNA 4E7ZA 1VIFA 1HYOA 4M75B 2EJGA 2GF7A 2P0QA 5FRNA 1ZA2B 4FIBA 5KE2A 4JDSA 1Z9ZA 3PFSA 4O6JA 1PD1A 1M4ZA 3G71Q 2XD0A 5I2SA 1QCFA 3JCMc 3BY7A 1KJWA 5IXBA 3MPUB 4IIOA 4J5YA 1PKSA 1IHVA 2K4YA 1FX7A 5KCHA 3G6ET 5CQYA 1YITA 3CC2T 4TVRA 2SRCA 4M7DD 1MV3A 2CP2A 4Z88A 4DEYA 1LCKA 5GAMd 4M75A 1YI2T 5GANg 3VS3A 1RAFB 2F1LA 3OYDA 2V1RA 2DXTA 4ELZC 2AT1B 4FYWB 1PWTA 2P4TA 3THKA 4RCBA 1RACB 1M3CA 1PSEA 1JXMA 1N5ZA 2DTIA 4OB2B 1N6AA 2HDAA 2FG0A 4M77G 1WZOA 1M5Q1 4PJJA 4M78C 2JMAA 4R0KA 2VXFA 2QA4Q 3CCSA 2OTJQ 1CKBA 2LX9A 3BE3A 1AVZC 1B7TA 3HHTB 3M59A 4ZTFA 4M7DA 4JRKA 1VQ8Q 2DNUA 5GAOn 4OMLA 3QZ5B 4LDVA 3A98A 2ED0A 2KXDA 3M54A 3KUFA 3L2QA 3CPWP 4J9DA 1OI1A 3CPFA 1Q82C 1YJ9A 4M7AB 1M8MA 4PJMA 1Q82R 1Y0MA 1ZBJA 3G7ZA 1XJWB 4JS4A 2LQKA 1WFWA 2DBMA 2CH4W 2NUZA 3EFRA 3I35A 3JCMP 5FU6C 4CRIA 2OJ2A 2DK3A 5J3BA 3OYIA 5L8RE 1MUZA 3HFOA 2RHZA 3CD6Q 2E6ZA 5CCAA 5GAOp 5LJ3g 2XU8A 3VJPA 2EKOA 2HMAA 2QQRA 1WXUA 1ZSZC 4OMMA 2DZCA 4BDZA 1K8AC 2CH4A 1K8AR 1G5VA 5CO7A 2LTOA 3X28B 2C0IA 1GCQC 3META 3OYFA 3PMTA 3M5AA 4B9WA 5M9OA 4M77E 4HT9A 3GBQA 3TVTA 2P0PA 1O9SA 4F17A 1VQ4A 1WQ7A 2QK0A 4IKFA 1D0XA 3CMEA 2VASA 1Y57A 2DERA 1VA7A 3HRUA 1DJ7B 3X25B 1X2QA 3EGXA 2RO0A 1A0NB 1YIJT 1YCSB 1QLYA 2JVVA 2NUTA 3CCQT 5GAOr 2RM4A 2IPOB 4C92F 1NPPA 2CP5A 1UJYA 3JCMJ 1D1AA 1LPLA 1KK7A 3AHUA 2X4YA 4PK4A 1UUEA 4OMOA 4GLMA 4ZGEB 4PJOD 2RH2A 2PVOB 4C92G 3JB9F 1YWOA 2K5IA 4LUEA 2G3RA 2QDYB 2CP3A 3OY9A 2L2PA 1VQ5T 1OPKA 4K11A 2RA2A 4RTWA 2KT1A 2LNHB 2E5KA 1VOMA 2OTLA 3HRTA 5LJ5f 1NYGA 3JCMV 2J7IA 1R8OB 3KFVA 4RG8A 1W70A 1UGSB 4M7AF 3CCEA 5IH2A 1FYNA 2DFUA 4Y91A 4GY5A 4PJOA 4C8QB 7AT1B 1BU1A 2ECZA 2RF0A 2MIOA 2ROTA 2M0OA 1G3SA 2K3YA 2VC8A 5CKDA 3G6EQ 8AT1B 2LQ8A 5GANh 2PVDB 4PJLA 9ATCB 2EGCA 3G4ST 2CT3A 3JV3A 4OVAA 2M16A 1MGQA 1WIEA 5CVIA 1VQNT 3VRYA 4XTWA 3EG3A 1OX9A 1Q81C 4C92E 2JS2A 4F7UF 4M78G 1HXDA 2FB7A 1RL2A 3CCMQ 4ZN3A 3ZFJA 1VQLQ 4C8QA 1NM7A 3M9QA 2CSIA 1VQPT 5GAOl 2GNCA 3L2UA 1YHQQ 2KY9A 2L3RA 2DD4A 4PFZA 4FL6A 4RTUA 4EMGA 5HY6A 2VGNA 3RDVA 2CP0A 1QCNA 1YJWT 3CMAT 2DXUA 3L2RA 3NHNA 3P8BB 2X4WA 4F7UG 4IIMA 3OBWA 1SSFA 5IT9E 1S72T 3L42A 2EGAA 4ELYC 3SHWA 2J6KA 2RI5A 5KCOA 4IUUA 3EH2A 3FJ5A 3URGA 2A0FB 1YJNT 1T0JA 5GAN5 1NBEB 4Z8AA 1AOJA 1VQ6A 5LJ5e 1YP5A 2YUOA 1K73C 3CCLQ 4KUIA 1K73R 2GFUA 2WSEE 5J39A 2H3JA 1G3WA 1N9SA 2HKQB 2BKDN 1UECA 3M0RA 4OB0B 1PSFA 4M78E 2QASA 3JCMQ 1H3ZA 2DJZA 3JCMf 1YITT 1Y7XA 1BI1A 2L3QA 3NGPA 3CC4A 1VQ9A 2BZYA 1KQSP 1V1CA 1PHTA 3OYMA 3M56A 3M0PA 5KH6A 3INZA 5IHNA 3VU3C 1AD5A 4JJCA 1BKBA 3PE0A 2CUBA 4F7UE 1VQKA 4V2SA 2LMJA 3A8GB 1BBZA 2COZA 5GAN4 2FRYA 2A28A 2LRQA 4RG2A 3OS0A 1K76A 3CCST 2EGEA 3QG1A 4KGXB 5D6WA 1TTHB 3M0QA 1KHIA 1UB4A 2EQKA 4B6MA 3ME9A 1X01A 4F04B 2DZ9A 1MMGA 2LT1A 1JJ2S 2EVRA 1ZSGA 2K5FA 1QVFS 1SSHA 3LH5A 1M2VB 1YJ9T 3J81E 4QVZA 1AT1B 2HSPA 1AZGB 3WVDB 2BZXA 2EYXA 3BDLA 3EH1A 1VQOQ 2RQTA 2YT6A 1QVPA 2FVUA 2V8IA 4Z02A 4AG1C 4HCKA 2MCNA 3MCAB 1I81A 3TEEA 2DO3A 3UDCA 2FYKA 3UT1A 4BE0A 2D6FA 1RAAB 2D9TA 1I0CA 3CCRA 1PG5B 1AEYA 3EG0A 3PMIA 1QVGA 4C0ZA 1V76A 1M2OA 3I55Q 4BI4A 1WXTA 1VQ4T 3JCMe 4C5IA 3HRSA 1BCMA 3OS2A 4OF1A 2EIFA 2LJ3A 4E47A 2E1HA 3CMET 2KVQG 2X35A 2ZCFB 1SEMA 4NOYA 2KE9A 1WHJA 1WJQA 1X75C 4M4ZA 3G4SQ 1QP3A 2KK4A 2XG8D 4RTZA 4A4FA 3GLXA 2DKGA 4II1A 3SWNB 4E7JA 1VQNQ 4MMKA 1UE9A 4Q5WA 1M27C 2LX7A 1XNIA 3OMGA 2O9VA 4LDYA 1KC8C 3HTRA 3MEVA 4Y92A 1KC8R 5CIUA 3OYLA 1ZUKA 4M77B 1M3AA 2P0KA 3VKIA 3EHQA 4BB7A 4BE2A 2EYZA 2X51A 1OX8A 2O4XB 3CXCA 5GAN7 4RTYA 5AYFA 2EQMA 2A3LA 1FWZA 1YJWQ 2E3HA 3OW2S 2QEXA 4A53A 1WJSA 4BY6C 4L6V5 1S72Q 4XK8E 2GQVA 2M0YA 5GANj 3QIIA 1M30A 4EIKA 1KD1C 4XU0A 2EBPA 2X3XD 1KD1R 3UPUA 2OTLT 1M1GA 5GAMg 3SB2A 4M77A 3L2ZA 3O8VA 1W2BS 2RQVA 3BW1A 2QTXA 4J9EA 2CZ0B 3RUXA 3FB9A 2GGRA 5CR2A 4HCBA 1EFNA 3CCET 3C4SA 4RTVA 3RKWA 4A4EA 2D0NA 1Q81U 4A4HA 3OBYA 1T0HA 2LT4A 4O5VA 2K57A 4BY6B 2NUPB 4RTTA 1RI9A 3CCVA 2AKLA 1YITQ 1TS9A 3S3MA 1X6GA 2ZZDA 4OMFB 2PU9B 5GJVB 4AFQC 1F1BB 5DY9A 1FMKA 1M90R 3CMAA 5GMKe 4LN2A 1ZBXA 5LJ3j 2P84A 2B86A 3LW5E 3EG9A 1GBRA 2VB6A 3TQ7P 5CQXA 5I22A 3KXTA 2NUPA 4C5HA 5KYNA 4M75D 3QXEB 4PKCC 2KEAA 1AWOA 1I8FA 3E9FA 5A0LA 2K5LA 1K73U 4Z89A 1Q86C 2JM9A 2DA9A 3JCMX 1Q86R 2DAQA 1C0MA 2YRDA 2MAMA 1CSKA 1V29B 4M7DC 4ATOA 1GBQA 1GCPA 4IUVA 2EKHA 4C92B 3M4GA 2KRMA 3VS0A 2XDDA 4M77F 2M9UA 4E6RA 2EQUA 3SEMA 4J7IA 1WXBA 1WJRA 1VQ6T 3TU4K 3RNJA 4XTUA 5KE3A 1TUCA 3GF5A 1JU5C 4D8DA 3EHRA 1EZZB 1BK2A 2KDSA 3A8OB 2DTHA 3S3OA 4XU3A 4ZNXA 4ZTJA 5CKHA 1WA7A 3RMSA 2YSQA 1E6HA 2QI2A 2FPFA 2ZGWA 3JB9D 3RBBB 2MOXA 4E7KA 4HVVA 2COWA 2ESWA 2HD0A 3CEYA 2YWWA 3CBMA 2LCSA 5DLQE 1N8RU 3CC4T 1VQ9T 4LXCA 4C92A 4BE1A 4IURA 4N0AC 3V7CA 2E64A 4QVCA 4EMHA 1PD0A 1GL5A 3CMEQ 1PRMC 3FDRA 3M58A 3P8HA 4MMLA 2MWPA 1WHHA 1HK9A 1FMWA 3DB3A 1NEGA 4M7AD 1VQKT 1OEBA 2LC4A 4XTZA 2QQSA 4PLIA 2E6NA 1EX4A 2O9SA 2I0NA 2L89A 1MNEA 1OQKA 4KUDK 2VUBA 3RMQA 1KIKA 1Q95G 2JXBA 2KSSA 4M78B 2HQXA 3OYHA 2EW3A 4JJBA 2EJ9A 4JZ3A 4HVWA 1RADB 1M8VA 3WVEB 2O01E 4NL3A 5LJ5d 2DL8A 4AG2C 1TXQA 2CS7A 4M7AA 1K9MC 2JNGA 2KGTA 1N27A 4JRPA 4F7UB 3EAEA 4J9HA 4JRIA 4X1VA 1K9MR 1QVGP 3OS1A 3ULRB 4KH0B 1KQ1A 2J6FA 2RJDA 5FU6B 2CREA 5GAMh 2DLPA 1VYUA 4J7FA 3X24B 1VUBA 1X6BA 3JAME 1G83A 1H641 5A0GA 4M78A 4PL6A 4OB3B 4RUGA 4GBQA 4BI3A 1D1BA 2XDPA 2KYMA 2XI9A 1E7OA 3T9NA 3REBB 3L1AA 2QGGA 1ZSZB 4QQGA 1WHKA 5IHIA 5D6YA 1X6OA 2R5AA 2OTJA 2R5MA 3CCRT 2DVEA 3I56Q 3QSUA 2ZPHB 2E12A 1IHWA 1KC8U 3OSSC 1VQ8A 1UEBA 2CSQA 2Y4XA 3P8DA 1W1FA 1WGSA 4F7UA 2D0QB 4JJDA 1NLOC 5IHKA 1I5OB 2E10A 2R57A 2FPDA 3CCUQ 4JLGA 2JTFA 1NJIU 4HXJA 4FSSA 1Y96B 3CXCP 1JEGA 3PIOA 2LQNA 1K0SA 4J8OA 3CD6A 4FW1A 1ZSZA 3R6OA 4BUGA 1QW1A 4J9GA 2KMTA 2JS0A 4N4HA 1T3SA 4C5EA 3FC3A 4CC3A 3NTKA 3QPHA 1OPLA 4E7IA 1UDLA 2JUFA 1HJDA 3E19A 5C6SA 2OAWA 2J05A 2JW4A 4LDWA 5IN1A 5LJ5h 1UG1A 1MMAA 2O31A 1WNLA 3DLMA 4OP0A 1WX6A 4M7DG 2QEXT 5GMKm 2EYWA 1PKTA 2KXCA 4C8QD 1Z9QA 2XKOC 4FW2A 4M78F 2L8DA 1O75A 3JCMd 1ZQ1A 2BIVA 2ZPGB 3LWIA 1NE8A 3CC2Q 1I1JA 2C0OA 4DOVA 1Q7YU 2QQ9A 4CC4B 4XTVA 2M51A 1UTIA 1YI2Q 1M1KU 3EG1A 1S1NA 2VKNA 1R0BG 2XMFA 3M53A 3NTHA 1D0YA 5GANf 1T3LA 1X27A 1FXXA 2DPPB 1BIBA 3CCVT 4E7SA 3HFNA 4QW2A 2E4HA 2K7AA 2X9HA 4DBRA 3L2WA 1VYTA 2KBTA 1RAHB 2Y4YA 4FU6A 3CC4Q 1XTDA 1UGVA 1ZLMA 2BE7D 2E65A 2QTVA 3VUBA 2F2WA 2ZAEA 3OYBA 2PUOB 5FLXE 1QKWA
chains in the Genus database with same CATH topology
4WCIA 2AZVA 2YDLA 2DILA 1I0CA 3EGUA 2HEQA 2KRNA 4JZ4A 1K9AA 1AEYA 4LNPA 5FWBA 3EG0A 4J9BA 2AK5A 2PNIA 1WXTA 2A37A 2ABLA 2LJ3A 4J9CA 1SEMA 1Z9ZA 2KE9A 3R6NA 2RMOA 1U3OA 4M4ZA 1AWWA 3I5SA 3QWYA 3M0SA 1QCFA 4RTZA 1ABQA 1KJWA 5ECAA 5IXBA 2GTOA 4IIOA 1UE9A 1PKSA 3I9QA 1X69A 1M27C 2LX7A 4J9IA 2O9VA 4F16A 3U23A 4Y92A 4HVUA 2SRCA 1MV3A 1ZUKA 4Z88A 1LCKA 4DEYA 4KRTA 1SHFA 1GCQA 1M3AA 3VS3A 3EHQA 2EYZA 2V1RA 2EQIA 1PWTA 4AFUC 3THKA 1ZX6A 3M0UA 1SPKA 1SHGA 4RTYA 2EYYA 4F14A 1M3CA 2C0TA 1JXMA 4OMPA 1N5ZA 1M3BA 1SRLA 2FRWA 2RPNA 2HDAA 2DRKA 2FG0A 3VS7A 1TG0A 2DMOA 1AWJA 1WLPB 2RNAA 1HD3A 2JMAA 2LP5A 4R0KA 2ENMA 1UHCA 2M0YA 1GFCA 1CKBA 1M30A 4EIKA 2RQRA 1AVZC 1WDXA 2EBPA 2X3XD 4LUDA 1BB9A 2X3WD 2DNUA 4J9FA 4OMLA 3I5RA 3IQLA 4ESRA 3A98A 2ED0A 2RQVA 2KXDA 4J9EA 2KNBB 4J9DA 2GGRA 1EFNA 2O2OA 1M8MA 1NLPC 4RTVA 1KSWA 1Y0MA 3TSWA 1X2KA 1ZBJA 2K79A 2D0NA 2DL7A 5EC7A 1WFWA 2DBMA 2CH4W 2NUZA 1T0HA 3I35A 3UATA 2OJ2A 2D8JA 5HCKA 1MUZA 4RTTA 1RI9A 3PVQA 3O5ZA 2AKLA 2RQWA 1B3QA 1X6GA 2JM8A 2DF6A 5FWCA 3NMZC 1ARKA 1WXUA 2CT4A 5GJVB 4OMMA 2LZ6B 2LJ1A 4AFQC 2AKKA 2CH4A 1FMKA 2C0IA 1GCQC 3M0TA 4LN2A 3VS6A 1I07A 2A36A 2B86A 4OMQA 1KFZA 1GBRA 4OMNA 3GBQA 2SEMA 2DX1A 2FO0A 3TVTA 2RN8A 4F17A 5I22A 3H0FA 1CKAA 4JPBW 2ED1A 2DM1A 2G6FX 1WI7A 1Y57A 1VA7A 2KEAA 1AWOA 2L0AA 1X2QA 1ZUUA 4Z89A 1A0NB 2JM9A 2DA9A 3NPFA 2DRMA 2O88A 2DL5A 1YCSB 1QLYA 4CC2A 1CSKA 1NG2A 1GBQA 1U06A 1GCPA 2DL4A 1UJYA 2EKHA 5IXFA 3C0CA 2KRMA 3VS0A 3VS5A 4E6RA 1ABOA 2A08A 3SEMA 1WXBA 1SRMA 3QWXX 3RNJA 1K4US 3UF4A 1UUEA 1TUCA 4AFSC 4OMOA 4GLMA 1JU5C 4D8DA 3EHRA 1BK2A 1YNZA 4ZNXA 2GQIA 1WA7A 1YWOA 4LUEA 2YSQA 1E6HA 2FPFA 2JTEA 3RBBB 2MOXA 2NWMA 2L2PA 4HVVA 5GJWB 2ESWA 4DEXA 2LCSA 1QWFA 1J3TA 1XOVA 1OPKA 4K11A 4RTWA 2KT1A 1W6XA 2YUQA 2LNHB 1JO8A 2E5KA 1RLQC 1YN8A 1NYGA 1OOTA 2DBKA 2J7IA 3KFVA 2VVKA 1RUWA 3EG2A 1GL5A 1PRMC 1W70A 3H0HA 2VWFA 2P4RA 3TSZA 5IH2A 1FYNA 1NEGA 2DJQA 4D8KA 3CQTA 1OEBA 1RLPC 1WYXA 2JMCA 1BU1A 2ECZA 2EPDA 2I0NA 2MIOA 2O9SA 2RF0A 2ROTA 1KIKA 2JXBA 1PRLC 1MV0B 2EW3A 4JJBA 4JZ3A 2EGCA 4HVWA 2CT3A 3JV3A 2F2XA 1WIEA 2RQUA 1AZEA 2DL8A 3VRYA 4AG2C 1B07A 3EG3A 3H0IA 1NYFA 2DVJA 2KT8A 2PZ1A 2K9GA 2JS2A 2KGTA 2LQWA 1UFFA 1NM7A 4J9HA 4X1VA 2CSIA 3ULRB 2J6FA 2CREA 2GNCA 2YUPA 2DLPA 1VYUA 1JQQA 1X6BA 1G83A 4RUGA 1IO6A 4GBQA 2LJ0A 2KYMA 2D1XA 3H41A 3VRZA 1E7OA 4RTUA 3REBB 3PVLA 3NHNA 2KR3A 3ZL7C 5IHIA 4IIMA 2YUNA 2QDLA 2ROLA 2EGAA 4LE9A 3SHWA 2J6KA 2OI3A 3VS1A 1NEBA 5FW9A 3FJ5A 2CSQA 1T0JA 1W1FA 2BTTA 1TUDA 4Z8AA 1AOJA 2KRSA 1NLOC 4JJDA 2F2VA 5IHKA 1VYVA 1G2BA 2CUDA 2FPDA 1YP5A 1AWXA 2YUOA 4HXJA 4FSSA 2FPEA 1JEGA 2LQNA 3UA6A 1K0SA 2DYBA 2CDTA 1UECA 2HCKA 2PTKA 1YWPA 3M0RA 4J9GA 2K3BA 2JS0A 4A63B 1T3SA 4CC3A 2DL3A 1OPLA 1UDLA 2L3QA 3NGPA 2BZYA 1V1CA 1HJDA 1PHTA 2OAWA 2J05A 2JW4A 1UG1A 3M0PA 2H8HA 2D8HA 2O31A 5IHNA 2J06A 2J6OA 1AD5A 4JJCA 2BZ8A 3PE0A 4AFZC 2CUBA 1GRIA 1WX6A 2JT4A 2EYWA 2V1QA 1PKTA 2HBWA 2KXCA 2LMJA 4QT7A 1BBZA 4RTXA 1ZUYA 4ORZA 1U5SA 2KROA 1Z9QA 2FRYA 3UA7A 2A28A 1K76A 1X43A 2DE0X 4CC7A 2FEIA 5L23A 2EGEA 1QKXA 1JXOA 1QWEA 2AZSA 3M0QA 1UJ0A 3VS2A 1E6GA 1H3HA 1I1JA 2C0OA 1K1ZA 2K6DA 2EVRA 2GTJA 1ZSGA 4CC4B 1SSHA 2M51A 3LH5A 1H8KA 1UTIA 2W10A 3EG1A 1GFDA 2HSPA 1S1NA 2VKNA 3VS4A 1AZGB 2BZXA 2EYXA 2XMFA 1HSQA 5I11A 1K0XA 2L3PA 1T3LA 1X27A 2GBQA 1PNJA 1H92A 2RQTA 2W0ZA 2YT6A 3REAB 2K7AA 1UHFA 2IIMA 1VYTA 2KBTA 4AG1C 4HCKA 1UGVA 1ZLMA 2F2WA 2L3SA 2MCNA 1OV3A 2KYBA 2K2MA 1QKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCI A;  2AZV A;  2YDL A;  2DIL A;  1I0C A;  3EGU A;  2HEQ A;  2KRN A;  4JZ4 A;  1K9A A;  1AEY A;  4LNP A;  5FWB A;  3EG0 A;  4J9B A;  2AK5 A;  2PNI A;  1WXT A;  2A37 A;  2ABL A;  2LJ3 A;  4J9C A;  1SEM A;  1Z9Z A;  2KE9 A;  3R6N A;  2RMO A;  1U3O A;  4M4Z A;  1AWW A;  3I5S A;  3QWY A;  3M0S A;  1QCF A;  4RTZ A;  1ABQ A;  1KJW A;  5ECA A;  5IXB A;  2GTO A;  4IIO A;  1UE9 A;  1PKS A;  3I9Q A;  1X69 A;  1M27 C;  2LX7 A;  4J9I A;  2O9V A;  4F16 A;  3U23 A;  4Y92 A;  4HVU A;  2SRC A;  1MV3 A;  1ZUK A;  4Z88 A;  1LCK A;  4DEY A;  4KRT A;  1SHF A;  1GCQ A;  1M3A A;  3VS3 A;  3EHQ A;  2EYZ A;  2V1R A;  2EQI A;  1PWT A;  4AFU C;  3THK A;  1ZX6 A;  3M0U A;  1SPK A;  1SHG A;  4RTY A;  2EYY A;  4F14 A;  1M3C A;  2C0T A;  1JXM A;  4OMP A;  1N5Z A;  1M3B A;  1SRL A;  2FRW A;  2RPN A;  2HDA A;  2DRK A;  2FG0 A;  3VS7 A;  1TG0 A;  2DMO A;  1AWJ A;  1WLP B;  2RNA A;  1HD3 A;  2JMA A;  2LP5 A;  4R0K A;  2ENM A;  1UHC A;  2M0Y A;  1GFC A;  1CKB A;  1M30 A;  4EIK A;  2RQR A;  1AVZ C;  1WDX A;  2EBP A;  2X3X D;  4LUD A;  1BB9 A;  2X3W D;  2DNU A;  4J9F A;  4OML A;  3I5R A;  3IQL A;  4ESR A;  3A98 A;  2ED0 A;  2RQV A;  2KXD A;  4J9E A;  2KNB B;  4J9D A;  2GGR A;  1EFN A;  2O2O A;  1M8M A;  1NLP C;  4RTV A;  1KSW A;  1Y0M A;  3TSW A;  1X2K A;  1ZBJ A;  2K79 A;  2D0N A;  2DL7 A;  5EC7 A;  1WFW A;  2DBM A;  2CH4 W;  2NUZ A;  1T0H A;  3I35 A;  3UAT A;  2OJ2 A;  2D8J A;  5HCK A;  1MUZ A;  4RTT A;  1RI9 A;  3PVQ A;  3O5Z A;  2AKL A;  2RQW A;  1B3Q A;  1X6G A;  2JM8 A;  2DF6 A;  5FWC A;  3NMZ C;  1ARK A;  1WXU A;  2CT4 A;  5GJV B;  4OMM A;  2LZ6 B;  2LJ1 A;  4AFQ C;  2AKK A;  2CH4 A;  1FMK A;  2C0I A;  1GCQ C;  3M0T A;  4LN2 A;  3VS6 A;  1I07 A;  2A36 A;  2B86 A;  4OMQ A;  1KFZ A;  1GBR A;  4OMN A;  3GBQ A;  2SEM A;  2DX1 A;  2FO0 A;  3TVT A;  2RN8 A;  4F17 A;  5I22 A;  3H0F A;  1CKA A;  4JPB W;  2ED1 A;  2DM1 A;  2G6F X;  1WI7 A;  1Y57 A;  1VA7 A;  2KEA A;  1AWO A;  2L0A A;  1X2Q A;  1ZUU A;  4Z89 A;  1A0N B;  2JM9 A;  2DA9 A;  3NPF A;  2DRM A;  2O88 A;  2DL5 A;  1YCS B;  1QLY A;  4CC2 A;  1CSK A;  1NG2 A;  1GBQ A;  1U06 A;  1GCP A;  2DL4 A;  1UJY A;  2EKH A;  5IXF A;  3C0C A;  2KRM A;  3VS0 A;  3VS5 A;  4E6R A;  1ABO A;  2A08 A;  3SEM A;  1WXB A;  1SRM A;  3QWX X;  3RNJ A;  1K4U S;  3UF4 A;  1UUE A;  1TUC A;  4AFS C;  4OMO A;  4GLM A;  1JU5 C;  4D8D A;  3EHR A;  1BK2 A;  1YNZ A;  4ZNX A;  2GQI A;  1WA7 A;  1YWO A;  4LUE A;  2YSQ A;  1E6H A;  2FPF A;  2JTE A;  3RBB B;  2MOX A;  2NWM A;  2L2P A;  4HVV A;  5GJW B;  2ESW A;  4DEX A;  2LCS A;  1QWF A;  1J3T A;  1XOV A;  1OPK A;  4K11 A;  4RTW A;  2KT1 A;  1W6X A;  2YUQ A;  2LNH B;  1JO8 A;  2E5K A;  1RLQ C;  1YN8 A;  1NYG A;  1OOT A;  2DBK A;  2J7I A;  3KFV A;  2VVK A;  1RUW A;  3EG2 A;  1GL5 A;  1PRM C;  1W70 A;  3H0H A;  2VWF A;  2P4R A;  3TSZ A;  5IH2 A;  1FYN A;  1NEG A;  2DJQ A;  4D8K A;  3CQT A;  1OEB A;  1RLP C;  1WYX A;  2JMC A;  1BU1 A;  2ECZ A;  2EPD A;  2I0N A;  2MIO A;  2O9S A;  2RF0 A;  2ROT A;  1KIK A;  2JXB A;  1PRL C;  1MV0 B;  2EW3 A;  4JJB A;  4JZ3 A;  2EGC A;  4HVW A;  2CT3 A;  3JV3 A;  2F2X A;  1WIE A;  2RQU A;  1AZE A;  2DL8 A;  3VRY A;  4AG2 C;  1B07 A;  3EG3 A;  3H0I A;  1NYF A;  2DVJ A;  2KT8 A;  2PZ1 A;  2K9G A;  2JS2 A;  2KGT A;  2LQW A;  1UFF A;  1NM7 A;  4J9H A;  4X1V A;  2CSI A;  3ULR B;  2J6F A;  2CRE A;  2GNC A;  2YUP A;  2DLP A;  1VYU A;  1JQQ A;  1X6B A;  1G83 A;  4RUG A;  1IO6 A;  4GBQ A;  2LJ0 A;  2KYM A;  2D1X A;  3H41 A;  3VRZ A;  1E7O A;  4RTU A;  3REB B;  3PVL A;  3NHN A;  2KR3 A;  3ZL7 C;  5IHI A;  4IIM A;  2YUN A;  2QDL A;  2ROL A;  2EGA A;  4LE9 A;  3SHW A;  2J6K A;  2OI3 A;  3VS1 A;  1NEB A;  5FW9 A;  3FJ5 A;  2CSQ A;  1T0J A;  1W1F A;  2BTT A;  1TUD A;  4Z8A A;  1AOJ A;  2KRS A;  1NLO C;  4JJD A;  2F2V A;  5IHK A;  1VYV A;  1G2B A;  2CUD A;  2FPD A;  1YP5 A;  1AWX A;  2YUO A;  4HXJ A;  4FSS A;  2FPE A;  1JEG A;  2LQN A;  3UA6 A;  1K0S A;  2DYB A;  2CDT A;  1UEC A;  2HCK A;  2PTK A;  1YWP A;  3M0R A;  4J9G A;  2K3B A;  2JS0 A;  4A63 B;  1T3S A;  4CC3 A;  2DL3 A;  1OPL A;  1UDL A;  2L3Q A;  3NGP A;  2BZY A;  1V1C A;  1HJD A;  1PHT A;  2OAW A;  2J05 A;  2JW4 A;  1UG1 A;  3M0P A;  2H8H A;  2D8H A;  2O31 A;  5IHN A;  2J06 A;  2J6O A;  1AD5 A;  4JJC A;  2BZ8 A;  3PE0 A;  4AFZ C;  2CUB A;  1GRI A;  1WX6 A;  2JT4 A;  2EYW A;  2V1Q A;  1PKT A;  2HBW A;  2KXC A;  2LMJ A;  4QT7 A;  1BBZ A;  4RTX A;  1ZUY A;  4ORZ A;  1U5S A;  2KRO A;  1Z9Q A;  2FRY A;  3UA7 A;  2A28 A;  1K76 A;  1X43 A;  2DE0 X;  4CC7 A;  2FEI A;  5L23 A;  2EGE A;  1QKX A;  1JXO A;  1QWE A;  2AZS A;  3M0Q A;  1UJ0 A;  3VS2 A;  1E6G A;  1H3H A;  1I1J A;  2C0O A;  1K1Z A;  2K6D A;  2EVR A;  2GTJ A;  1ZSG A;  4CC4 B;  1SSH A;  2M51 A;  3LH5 A;  1H8K A;  1UTI A;  2W10 A;  3EG1 A;  1GFD A;  2HSP A;  1S1N A;  2VKN A;  3VS4 A;  1AZG B;  2BZX A;  2EYX A;  2XMF A;  1HSQ A;  5I11 A;  1K0X A;  2L3P A;  1T3L A;  1X27 A;  2GBQ A;  1PNJ A;  1H92 A;  2RQT A;  2W0Z A;  2YT6 A;  3REA B;  2K7A A;  1UHF A;  2IIM A;  1VYT A;  2KBT A;  4AG1 C;  4HCK A;  1UGV A;  1ZLM A;  2F2W A;  2L3S A;  2MCN A;  1OV3 A;  2KYB A;  2K2M A;  1QKW A; 
#chains in the Genus database with same CATH topology
 4MZP A;  1B34 B;  5GAN 3;  4QQD A;  4M7D E;  5LL6 S;  3EGU A;  2KRN A;  1VQM A;  1VQK Q;  5FRO A;  2DEQ A;  2CYZ B;  2ABL A;  5HK3 A;  1IGU A;  3OQ5 A;  4FT4 A;  4J9C A;  1KG1 A;  1JJ2 A;  2DXB A;  1QVF A;  5GAO q;  2XHC A;  3R6N A;  1D09 B;  1U3O A;  3QWY A;  3MHX A;  2HZY A;  5KYY B;  1JB0 E;  1M9S A;  3QDF A;  1ABQ A;  2CKK A;  2Z0W A;  5HK0 A;  2RJF A;  5LJ3 f;  1Y71 A;  8ATC B;  2DD5 A;  1X69 A;  3J80 E;  2JJ9 A;  4J9I A;  4FT2 A;  3FEO A;  3U23 A;  5FRM A;  4LDX A;  3GOX A;  2PVG B;  1SHF A;  4ZGJ B;  2RI2 A;  2F69 A;  3G1J A;  5GAN 2;  4ZGD B;  3OSV A;  3HP9 A;  1ZX6 A;  3M0U A;  2LCC A;  1SHG A;  3CCM A;  2EYY A;  1VQL A;  4F14 A;  2RI3 A;  4OMP A;  1Q82 U;  2QXF A;  4OGC A;  1SRL A;  4A54 A;  2DRK A;  3VS7 A;  2BUD A;  1TG0 A;  1YHQ A;  1WLP B;  1YIJ Q;  2RNA A;  2LP5 A;  4E2F B;  2ENM A;  5GAN e;  1GFC A;  3N5B B;  2RQR A;  3CCQ Q;  2X4J A;  3QYH B;  1WDX A;  4PJO G;  1BB9 A;  1VQ7 A;  2X3W D;  2QG9 B;  2KQW A;  3OB9 A;  3I5R A;  3IQL A;  4CI0 C;  5D6X A;  4ESR A;  2NLU A;  2HNI A;  2EQJ A;  2KNB B;  2MI6 A;  2O2O A;  1K8A U;  3PIP A;  3OYG A;  3TSW A;  1X2K A;  2K79 A;  3MP1 A;  2DL7 A;  1D1C A;  2MK5 A;  4XAX B;  3JCM W;  4X9D A;  3RIR A;  1SKU B;  4DOW A;  5GAM j;  3PVQ A;  3O5Z A;  3CCL A;  2RQW A;  1B3Q A;  3CPW A;  6AT1 B;  1VQ5 Q;  1BCO A;  3OYY A;  3AT1 B;  3NFC A;  4C8Q G;  2LZ6 B;  2CZ6 B;  2GCX A;  1TSF A;  2XIC A;  1OZ2 A;  1BI0 A;  3OW2 A;  3M0T A;  3Q1J A;  2LVM A;  1I07 A;  1M2V A;  2A36 A;  2CP6 A;  3H6Z A;  4J6Y A;  4DBQ A;  5LJ3 e;  4OMQ A;  2QEX Q;  4OMN A;  2SEM A;  2DX1 A;  2FO0 A;  1U1T A;  4FCY A;  3MO8 A;  3JB9 J;  2G6F X;  1W2B A;  3X26 B;  4FYX B;  1ZUU A;  4HT8 A;  4BAC A;  2RD1 A;  3NPF A;  4MDX A;  4C5G A;  2DL5 A;  5GMK h;  2OTJ T;  4FYV B;  5FU7 C;  3CC7 A;  1NG2 A;  1VQ8 T;  5GMK i;  3C0C A;  3J7A F;  1ABO A;  4M77 D;  1SRM A;  5LJ5 j;  1MND A;  3QWX X;  1PCX A;  4KBM B;  3UF4 A;  1VQP Q;  3CPW S;  4N4I A;  1C1A A;  1N9R A;  3CCJ A;  3QHS A;  2QYZ A;  4KGV B;  2HL5 C;  2LCL A;  3E2U A;  1VQO A;  3HPW A;  3CD6 T;  1YCY A;  2RK1 A;  3CMA Q;  2NYS A;  1RI0 A;  2ZPB B;  4DEX A;  4L59 A;  4LD6 A;  3SWN A;  1QWF A;  1J3T A;  4Y28 E;  1W6X A;  2YUQ A;  2COY A;  4YTL A;  4NL2 A;  4EMK C;  2OAU A;  1YJN Q;  2DBK A;  1OUL A;  2VVK A;  3EG2 A;  3LH0 A;  2E70 A;  3H0H A;  2RB6 A;  1KHC A;  2P4R A;  5C0M A;  3TSZ A;  2X4X A;  2DJQ A;  4N4G A;  4D8K A;  3I55 A;  4XU2 A;  3JB9 I;  2O4X A;  5I21 A;  2EYQ A;  2QAZ A;  2EPD A;  4HCZ A;  2YRV A;  4BD3 A;  2RK2 A;  1MV0 B;  2M1H A;  1OU9 A;  2WAC A;  2GFA A;  4GLK A;  1M1F A;  4D6W A;  2K3X A;  2RQU A;  1AZE A;  2V8K A;  4BDY A;  1M90 C;  1WHG A;  3EFO B;  4JRQ A;  4RKU E;  1NYF A;  2PZ1 A;  3L2V A;  4M75 C;  2LQW A;  1UFF A;  3KBG A;  5GAO m;  1JRI A;  2QGF B;  2VGM A;  4QKU A;  4JS5 A;  2DTO A;  2HSE B;  3LX7 A;  1W4S A;  1IO6 A;  3MEA A;  2YLC A;  3CCS Q;  2LJ0 A;  3ZEH A;  2D1X A;  3H41 A;  3ZBD A;  3QBY A;  1SF9 A;  2BE9 B;  1JJ2 P;  1QVF P;  3PVL A;  2KR3 A;  3ZL7 C;  5LJ5 g;  1WPY A;  2YUN A;  2WSF E;  2AIR B;  1QQJ A;  4IUQ A;  3LWH A;  1VQM T;  1YJ9 Q;  3EFO A;  3VS1 A;  3OMC A;  5FW9 A;  4ME7 A;  4C92 D;  3JCM b;  2JTM A;  1TUD A;  5CKB A;  2HKN A;  2KRS A;  1VYV A;  1BIA A;  1TWB A;  1G2B A;  3GIB A;  1AWX A;  2RHX A;  5KYW B;  4C0D C;  4BI8 B;  4KGZ B;  1RAB B;  3FJP A;  3UA6 A;  3A8L B;  3LGF A;  3OA6 A;  2QQB A;  2FHD A;  2K3B A;  1U8R A;  2E41 A;  3TCJ A;  3DLL A;  4M7D B;  2DL3 A;  3JRZ A;  3LLR A;  5GAN 8;  3RER A;  2E3I A;  5HKC A;  2MPX C;  4PFP A;  1VQ4 Q;  5D7U A;  1G3Y A;  5KYX B;  4M7A C;  2D8H A;  3GNF B;  2J06 A;  2J6O A;  4C0D B;  2JZ2 A;  5A2Q E;  3CCM T;  1VQL T;  5KYW A;  2JT4 A;  2HBW A;  4ORZ A;  1YHQ T;  3OYK A;  1KQS A;  1BI2 A;  1WHL A;  2DXC A;  1X43 A;  4CC7 A;  2FEI A;  1QKX A;  5EG2 A;  3PTA A;  2AZS A;  4M78 D;  1VQ7 T;  3FIF A;  1E6G A;  3G71 A;  1H3H A;  4OB1 B;  2K2V A;  4FM4 B;  1MHN A;  2FZC B;  1H8K A;  5CKF A;  2W10 A;  5KYX A;  3GPL A;  5AT1 B;  4DQ2 A;  1RAE B;  3OW2 P;  2LDM A;  1IGQ A;  4X9C A;  1HSQ A;  1FMV A;  4FSX A;  5I11 A;  3JSC A;  1H92 A;  1PNJ A;  2EAY A;  2W0Z A;  3CCL T;  3REA B;  3EGX B;  4MDW A;  4AMC A;  1UHF A;  4MZT A;  2IIM A;  3OYE A;  1BYM A;  3A8M B;  2ZPE B;  3JCM g;  2L3S A;  1W2B P;  3TRE A;  2KYB A;  2NUT B;  3E1S A;  1MMD A;  2OTL Q;  4AT1 B;  4N0A A;  5IAY A;  2HBP A;  5GMK j;  4WCI A;  2AZV A;  4E7L A;  1U1S A;  2RHI A;  1OZ3 A;  2HEQ A;  1K9A A;  2QA4 A;  5GAM f;  5FWB A;  3CCE Q;  4M75 F;  2AK5 A;  2RJC A;  2A37 A;  4OGE A;  1KQS S;  5GAN d;  4J6W A;  4QVD A;  4HA8 A;  1G3T A;  3OYC A;  1OYX A;  2L5Q A;  4PJO C;  4L5G A;  2RMO A;  4XTY A;  3E9G A;  3FLG A;  4DBH A;  1AWW A;  3I5S A;  4PFO A;  3S6W A;  3M0S A;  2M02 A;  1ACM B;  3OYJ A;  5ECA A;  2GTO A;  3UWN A;  3D7S B;  3I9Q A;  4M75 G;  3CC7 T;  3CBP A;  1NPR A;  4F16 A;  3GP8 A;  5CK9 A;  4M7D F;  4HVU A;  1OU8 A;  4KRT A;  1GCQ A;  3V8J A;  1KD1 U;  3BDU A;  1YFN A;  4WF2 A;  2XK0 A;  2EQI A;  4AFU C;  4PJO B;  3QZ9 B;  5I2M A;  2DEU A;  1SPK A;  4C8Q C;  2PUK B;  1TOV A;  4LDU A;  3CCJ T;  2C0T A;  1M3B A;  3RES A;  3MEU A;  1VQO T;  2F5K A;  2RPN A;  2FRW A;  3M57 A;  2IG0 A;  2DMO A;  1Y96 A;  1AWJ A;  2ATC B;  1HD3 A;  5KYU B;  1VQM Q;  1UHC A;  5LJ3 d;  4LUD A;  4J9F A;  4A4G A;  4J6X A;  3JB9 G;  3QJ6 A;  3I56 A;  2MF2 A;  2VYT A;  2HAX A;  1VQ6 Q;  4VUB A;  2WSC E;  3V8L A;  1M90 U;  1NLP C;  1KSW A;  2KI7 A;  3I55 T;  2HQH A;  5EC7 A;  3F70 A;  4XTX A;  3UAT A;  4M75 E;  4XU1 A;  5GAM e;  2D8J A;  2HQE A;  5HCK A;  5GAN 6;  3CCU A;  5KYU A;  1LNX A;  3C94 A;  2JM8 A;  2DF6 A;  5FWC A;  3NMZ C;  1KQ2 A;  3A8H B;  1ARK A;  4M7A G;  2CT4 A;  1LOJ A;  3EGD B;  4IUP A;  1VQ9 Q;  3QDR B;  3VYG A;  2LJ1 A;  2QQA A;  3OYN A;  2AKK A;  1IRX A;  4UC4 A;  1Q86 U;  1Q81 R;  1R0C B;  3VS6 A;  1KFZ A;  1EIF A;  2YHT A;  4P5N A;  2RN8 A;  4KH1 B;  3H0F A;  1QCO A;  5CKE A;  1CKA A;  4MZM A;  4JPB W;  2ED1 A;  3M55 A;  2DM1 A;  2EJF A;  1UGR B;  4JUV A;  1WI7 A;  2L0A A;  1LVK A;  1VQ7 Q;  4DA4 A;  4JLI A;  3EGD A;  1IRE B;  2DRM A;  2O88 A;  1I4K 1;  4HCC A;  5DLO A;  4CC2 A;  2CZ1 B;  1PM3 A;  2FZG B;  1U06 A;  5LJ3 h;  2DL4 A;  3G6E A;  1B34 A;  1C6V X;  3SDZ A;  5IXF A;  4X34 A;  3CC2 A;  4LD9 K;  2Y90 A;  3VS5 A;  2A08 A;  3PGG A;  3JCM h;  3SD4 A;  3ER0 A;  1VIE A;  3QUI A;  1YI2 A;  1K4U S;  4M7A E;  4AFS C;  2RHU A;  4PJO F;  2EFI A;  3C12 A;  1YNZ A;  4PNO A;  2YXY A;  4EPC A;  1XQH A;  2KAF A;  2GQI A;  4PJN A;  2JTE A;  2NWM A;  2OX7 A;  5KYY A;  2LNV A;  1TU0 B;  5GJW B;  1TH7 A;  3QYG B;  1XOV A;  2MMP A;  3CCR Q;  2XID A;  3C95 A;  1P92 A;  1JO8 A;  1G8X A;  1RLQ C;  1YN8 A;  1OOT A;  3A5Z B;  3SFM A;  3X20 B;  4IUT A;  2CZ7 B;  1RUW A;  3QJY A;  3MP6 A;  3HKS A;  2VWF A;  4B9X A;  1RAG B;  1AHJ B;  1D0Z A;  4C8Q F;  3M4Y A;  2E5Q A;  4KUL A;  1I5L A;  3CQT A;  1RLP C;  2YLB A;  3HL8 A;  1WYX A;  2MYS A;  2JMC A;  1N8R C;  1K9M U;  1N8R R;  3CC7 Q;  1PRL C;  3G71 T;  3FRN A;  4ZN1 A;  2F2X A;  2V26 A;  1LJO A;  2VV5 A;  1QP2 A;  2DYI A;  4R56 A;  1B07 A;  4DBF A;  4C0G A;  2PQW A;  3H0I A;  2DVJ A;  1R77 A;  2KT8 A;  2K9G A;  3CCJ Q;  2HL3 A;  4RMO A;  1D3B B;  1PC0 A;  1UGQ B;  3RR6 A;  1IXD A;  3QO3 A;  4R55 A;  3JB9 H;  2YUP A;  1JQQ A;  3DB4 A;  4QQ6 A;  1ZA1 B;  3H9N A;  4PJO E;  4A4K A;  3LYI A;  3VRZ A;  2C06 A;  3CBO A;  4EDU A;  3SWN C;  2F5T X;  2IVW A;  3RKY A;  1YIJ A;  2QDL A;  2ROL A;  2YRC A;  3CCQ A;  4LE9 A;  2QA4 T;  2OI3 A;  2JOY A;  1NEB A;  4M77 C;  2DIQ A;  4PLL A;  1IZ6 A;  1Y07 A;  1D3B A;  2FZK B;  2BTT A;  4E7H A;  2I2L A;  1QMC A;  1BI3 A;  2F2V A;  3A1P A;  1MMN A;  1WQW A;  2CUD A;  4J83 A;  3CCV Q;  2V8J A;  4HKE A;  2DET A;  4NS5 A;  3ASK A;  4C8Q E;  2FPE A;  3EFS A;  2EWN A;  3MJX A;  3S3N A;  2DYB A;  2CDT A;  4FYY B;  2HCK A;  3BFM A;  2PTK A;  1YWP A;  4ANJ A;  4A63 B;  2RJE A;  3GNG A;  1VQ5 A;  5FU7 B;  2JN0 A;  3HSB A;  2VXE A;  2XDB A;  2RHY A;  3V7R A;  1GXI E;  2ZPF B;  2A7Y A;  3H8Z A;  1NJI C;  3OYA A;  3QKJ A;  5CAI A;  1NJI R;  2H8H A;  3VV0 A;  2BZ8 A;  4AFZ C;  5DM7 R;  3PT9 A;  1GRI A;  3V8K A;  2V1Q A;  1YBY A;  5GMK l;  4QT7 A;  4RTX A;  1ZUY A;  1U5S A;  1JBM A;  2KRO A;  3UA7 A;  2MWO A;  1QVG S;  1SG5 A;  5L23 A;  2DE0 X;  1JXO A;  1ZHI A;  3OS5 A;  1QWE A;  3MEW A;  1UJ0 A;  3VS2 A;  3WXM B;  3G4S A;  3NTI A;  4RCC A;  4C0F A;  1K1Z A;  2K6D A;  2GTJ A;  5J26 A;  3RKX A;  4EMK B;  4XQ3 A;  3I56 T;  3DKM A;  2R58 A;  1IB8 A;  1VQN A;  3EG9 B;  2CP7 A;  2CGH A;  1GFD A;  1NZ9 A;  3VS4 A;  1RAI B;  2H3E B;  1K0X A;  2L3P A;  3PNW C;  2GBQ A;  2B8A A;  2AHJ B;  3MKD A;  1VQP A;  1TUG B;  3CCU T;  2FL7 A;  1Q7Y C;  2DIG A;  1Q7Y R;  4JJN K;  1OV3 A;  1YJW A;  2ZPI B;  4KT0 E;  2K2M A;  1M1K C;  3CXC S;  3V7S A;  1UGP B;  3VYH B;  1M1K R;  4EMK A;  2YDL A;  4WTO B;  2DIL A;  1S72 A;  3VUZ A;  4C92 C;  4JZ4 A;  5A0D A;  3MP8 A;  4LNP A;  4J9B A;  1WHM A;  3LGL A;  2PNI A;  1YJN A;  4E7Z A;  1VIF A;  1HYO A;  4M75 B;  2EJG A;  2GF7 A;  2P0Q A;  5FRN A;  1ZA2 B;  4FIB A;  5KE2 A;  4JDS A;  1Z9Z A;  3PFS A;  4O6J A;  1PD1 A;  1M4Z A;  3G71 Q;  2XD0 A;  5I2S A;  1QCF A;  3JCM c;  3BY7 A;  1KJW A;  5IXB A;  3MPU B;  4IIO A;  4J5Y A;  1PKS A;  1IHV A;  2K4Y A;  1FX7 A;  5KCH A;  3G6E T;  5CQY A;  1YIT A;  3CC2 T;  4TVR A;  2SRC A;  4M7D D;  1MV3 A;  2CP2 A;  4Z88 A;  4DEY A;  1LCK A;  5GAM d;  4M75 A;  1YI2 T;  5GAN g;  3VS3 A;  1RAF B;  2F1L A;  3OYD A;  2V1R A;  2DXT A;  4ELZ C;  2AT1 B;  4FYW B;  1PWT A;  2P4T A;  3THK A;  4RCB A;  1RAC B;  1M3C A;  1PSE A;  1JXM A;  1N5Z A;  2DTI A;  4OB2 B;  1N6A A;  2HDA A;  2FG0 A;  4M77 G;  1WZO A;  1M5Q 1;  4PJJ A;  4M78 C;  2JMA A;  4R0K A;  2VXF A;  2QA4 Q;  3CCS A;  2OTJ Q;  1CKB A;  2LX9 A;  3BE3 A;  1AVZ C;  1B7T A;  3HHT B;  3M59 A;  4ZTF A;  4M7D A;  4JRK A;  1VQ8 Q;  2DNU A;  5GAO n;  4OML A;  3QZ5 B;  4LDV A;  3A98 A;  2ED0 A;  2KXD A;  3M54 A;  3KUF A;  3L2Q A;  3CPW P;  4J9D A;  1OI1 A;  3CPF A;  1Q82 C;  1YJ9 A;  4M7A B;  1M8M A;  4PJM A;  1Q82 R;  1Y0M A;  1ZBJ A;  3G7Z A;  1XJW B;  4JS4 A;  2LQK A;  1WFW A;  2DBM A;  2CH4 W;  2NUZ A;  3EFR A;  3I35 A;  3JCM P;  5FU6 C;  4CRI A;  2OJ2 A;  2DK3 A;  5J3B A;  3OYI A;  5L8R E;  1MUZ A;  3HFO A;  2RHZ A;  3CD6 Q;  2E6Z A;  5CCA A;  5GAO p;  5LJ3 g;  2XU8 A;  3VJP A;  2EKO A;  2HMA A;  2QQR A;  1WXU A;  1ZSZ C;  4OMM A;  2DZC A;  4BDZ A;  1K8A C;  2CH4 A;  1K8A R;  1G5V A;  5CO7 A;  2LTO A;  3X28 B;  2C0I A;  1GCQ C;  3MET A;  3OYF A;  3PMT A;  3M5A A;  4B9W A;  5M9O A;  4M77 E;  4HT9 A;  3GBQ A;  3TVT A;  2P0P A;  1O9S A;  4F17 A;  1VQ4 A;  1WQ7 A;  2QK0 A;  4IKF A;  1D0X A;  3CME A;  2VAS A;  1Y57 A;  2DER A;  1VA7 A;  3HRU A;  1DJ7 B;  3X25 B;  1X2Q A;  3EGX A;  2RO0 A;  1A0N B;  1YIJ T;  1YCS B;  1QLY A;  2JVV A;  2NUT A;  3CCQ T;  5GAO r;  2RM4 A;  2IPO B;  4C92 F;  1NPP A;  2CP5 A;  1UJY A;  3JCM J;  1D1A A;  1LPL A;  1KK7 A;  3AHU A;  2X4Y A;  4PK4 A;  1UUE A;  4OMO A;  4GLM A;  4ZGE B;  4PJO D;  2RH2 A;  2PVO B;  4C92 G;  3JB9 F;  1YWO A;  2K5I A;  4LUE A;  2G3R A;  2QDY B;  2CP3 A;  3OY9 A;  2L2P A;  1VQ5 T;  1OPK A;  4K11 A;  2RA2 A;  4RTW A;  2KT1 A;  2LNH B;  2E5K A;  1VOM A;  2OTL A;  3HRT A;  5LJ5 f;  1NYG A;  3JCM V;  2J7I A;  1R8O B;  3KFV A;  4RG8 A;  1W70 A;  1UGS B;  4M7A F;  3CCE A;  5IH2 A;  1FYN A;  2DFU A;  4Y91 A;  4GY5 A;  4PJO A;  4C8Q B;  7AT1 B;  1BU1 A;  2ECZ A;  2RF0 A;  2MIO A;  2ROT A;  2M0O A;  1G3S A;  2K3Y A;  2VC8 A;  5CKD A;  3G6E Q;  8AT1 B;  2LQ8 A;  5GAN h;  2PVD B;  4PJL A;  9ATC B;  2EGC A;  3G4S T;  2CT3 A;  3JV3 A;  4OVA A;  2M16 A;  1MGQ A;  1WIE A;  5CVI A;  1VQN T;  3VRY A;  4XTW A;  3EG3 A;  1OX9 A;  1Q81 C;  4C92 E;  2JS2 A;  4F7U F;  4M78 G;  1HXD A;  2FB7 A;  1RL2 A;  3CCM Q;  4ZN3 A;  3ZFJ A;  1VQL Q;  4C8Q A;  1NM7 A;  3M9Q A;  2CSI A;  1VQP T;  5GAO l;  2GNC A;  3L2U A;  1YHQ Q;  2KY9 A;  2L3R A;  2DD4 A;  4PFZ A;  4FL6 A;  4RTU A;  4EMG A;  5HY6 A;  2VGN A;  3RDV A;  2CP0 A;  1QCN A;  1YJW T;  3CMA T;  2DXU A;  3L2R A;  3NHN A;  3P8B B;  2X4W A;  4F7U G;  4IIM A;  3OBW A;  1SSF A;  5IT9 E;  1S72 T;  3L42 A;  2EGA A;  4ELY C;  3SHW A;  2J6K A;  2RI5 A;  5KCO A;  4IUU A;  3EH2 A;  3FJ5 A;  3URG A;  2A0F B;  1YJN T;  1T0J A;  5GAN 5;  1NBE B;  4Z8A A;  1AOJ A;  1VQ6 A;  5LJ5 e;  1YP5 A;  2YUO A;  1K73 C;  3CCL Q;  4KUI A;  1K73 R;  2GFU A;  2WSE E;  5J39 A;  2H3J A;  1G3W A;  1N9S A;  2HKQ B;  2BKD N;  1UEC A;  3M0R A;  4OB0 B;  1PSF A;  4M78 E;  2QAS A;  3JCM Q;  1H3Z A;  2DJZ A;  3JCM f;  1YIT T;  1Y7X A;  1BI1 A;  2L3Q A;  3NGP A;  3CC4 A;  1VQ9 A;  2BZY A;  1KQS P;  1V1C A;  1PHT A;  3OYM A;  3M56 A;  3M0P A;  5KH6 A;  3INZ A;  5IHN A;  3VU3 C;  1AD5 A;  4JJC A;  1BKB A;  3PE0 A;  2CUB A;  4F7U E;  1VQK A;  4V2S A;  2LMJ A;  3A8G B;  1BBZ A;  2COZ A;  5GAN 4;  2FRY A;  2A28 A;  2LRQ A;  4RG2 A;  3OS0 A;  1K76 A;  3CCS T;  2EGE A;  3QG1 A;  4KGX B;  5D6W A;  1TTH B;  3M0Q A;  1KHI A;  1UB4 A;  2EQK A;  4B6M A;  3ME9 A;  1X01 A;  4F04 B;  2DZ9 A;  1MMG A;  2LT1 A;  1JJ2 S;  2EVR A;  1ZSG A;  2K5F A;  1QVF S;  1SSH A;  3LH5 A;  1M2V B;  1YJ9 T;  3J81 E;  4QVZ A;  1AT1 B;  2HSP A;  1AZG B;  3WVD B;  2BZX A;  2EYX A;  3BDL A;  3EH1 A;  1VQO Q;  2RQT A;  2YT6 A;  1QVP A;  2FVU A;  2V8I A;  4Z02 A;  4AG1 C;  4HCK A;  2MCN A;  3MCA B;  1I81 A;  3TEE A;  2DO3 A;  3UDC A;  2FYK A;  3UT1 A;  4BE0 A;  2D6F A;  1RAA B;  2D9T A;  1I0C A;  3CCR A;  1PG5 B;  1AEY A;  3EG0 A;  3PMI A;  1QVG A;  4C0Z A;  1V76 A;  1M2O A;  3I55 Q;  4BI4 A;  1WXT A;  1VQ4 T;  3JCM e;  4C5I A;  3HRS A;  1BCM A;  3OS2 A;  4OF1 A;  2EIF A;  2LJ3 A;  4E47 A;  2E1H A;  3CME T;  2KVQ G;  2X35 A;  2ZCF B;  1SEM A;  4NOY A;  2KE9 A;  1WHJ A;  1WJQ A;  1X75 C;  4M4Z A;  3G4S Q;  1QP3 A;  2KK4 A;  2XG8 D;  4RTZ A;  4A4F A;  3GLX A;  2DKG A;  4II1 A;  3SWN B;  4E7J A;  1VQN Q;  4MMK A;  1UE9 A;  4Q5W A;  1M27 C;  2LX7 A;  1XNI A;  3OMG A;  2O9V A;  4LDY A;  1KC8 C;  3HTR A;  3MEV A;  4Y92 A;  1KC8 R;  5CIU A;  3OYL A;  1ZUK A;  4M77 B;  1M3A A;  2P0K A;  3VKI A;  3EHQ A;  4BB7 A;  4BE2 A;  2EYZ A;  2X51 A;  1OX8 A;  2O4X B;  3CXC A;  5GAN 7;  4RTY A;  5AYF A;  2EQM A;  2A3L A;  1FWZ A;  1YJW Q;  2E3H A;  3OW2 S;  2QEX A;  4A53 A;  1WJS A;  4BY6 C;  4L6V 5;  1S72 Q;  4XK8 E;  2GQV A;  2M0Y A;  5GAN j;  3QII A;  1M30 A;  4EIK A;  1KD1 C;  4XU0 A;  2EBP A;  2X3X D;  1KD1 R;  3UPU A;  2OTL T;  1M1G A;  5GAM g;  3SB2 A;  4M77 A;  3L2Z A;  3O8V A;  1W2B S;  2RQV A;  3BW1 A;  2QTX A;  4J9E A;  2CZ0 B;  3RUX A;  3FB9 A;  2GGR A;  5CR2 A;  4HCB A;  1EFN A;  3CCE T;  3C4S A;  4RTV A;  3RKW A;  4A4E A;  2D0N A;  1Q81 U;  4A4H A;  3OBY A;  1T0H A;  2LT4 A;  4O5V A;  2K57 A;  4BY6 B;  2NUP B;  4RTT A;  1RI9 A;  3CCV A;  2AKL A;  1YIT Q;  1TS9 A;  3S3M A;  1X6G A;  2ZZD A;  4OMF B;  2PU9 B;  5GJV B;  4AFQ C;  1F1B B;  5DY9 A;  1FMK A;  1M90 R;  3CMA A;  5GMK e;  4LN2 A;  1ZBX A;  5LJ3 j;  2P84 A;  2B86 A;  3LW5 E;  3EG9 A;  1GBR A;  2VB6 A;  3TQ7 P;  5CQX A;  5I22 A;  3KXT A;  2NUP A;  4C5H A;  5KYN A;  4M75 D;  3QXE B;  4PKC C;  2KEA A;  1AWO A;  1I8F A;  3E9F A;  5A0L A;  2K5L A;  1K73 U;  4Z89 A;  1Q86 C;  2JM9 A;  2DA9 A;  3JCM X;  1Q86 R;  2DAQ A;  1C0M A;  2YRD A;  2MAM A;  1CSK A;  1V29 B;  4M7D C;  4ATO A;  1GBQ A;  1GCP A;  4IUV A;  2EKH A;  4C92 B;  3M4G A;  2KRM A;  3VS0 A;  2XDD A;  4M77 F;  2M9U A;  4E6R A;  2EQU A;  3SEM A;  4J7I A;  1WXB A;  1WJR A;  1VQ6 T;  3TU4 K;  3RNJ A;  4XTU A;  5KE3 A;  1TUC A;  3GF5 A;  1JU5 C;  4D8D A;  3EHR A;  1EZZ B;  1BK2 A;  2KDS A;  3A8O B;  2DTH A;  3S3O A;  4XU3 A;  4ZNX A;  4ZTJ A;  5CKH A;  1WA7 A;  3RMS A;  2YSQ A;  1E6H A;  2QI2 A;  2FPF A;  2ZGW A;  3JB9 D;  3RBB B;  2MOX A;  4E7K A;  4HVV A;  2COW A;  2ESW A;  2HD0 A;  3CEY A;  2YWW A;  3CBM A;  2LCS A;  5DLQ E;  1N8R U;  3CC4 T;  1VQ9 T;  4LXC A;  4C92 A;  4BE1 A;  4IUR A;  4N0A C;  3V7C A;  2E64 A;  4QVC A;  4EMH A;  1PD0 A;  1GL5 A;  3CME Q;  1PRM C;  3FDR A;  3M58 A;  3P8H A;  4MML A;  2MWP A;  1WHH A;  1HK9 A;  1FMW A;  3DB3 A;  1NEG A;  4M7A D;  1VQK T;  1OEB A;  2LC4 A;  4XTZ A;  2QQS A;  4PLI A;  2E6N A;  1EX4 A;  2O9S A;  2I0N A;  2L89 A;  1MNE A;  1OQK A;  4KUD K;  2VUB A;  3RMQ A;  1KIK A;  1Q95 G;  2JXB A;  2KSS A;  4M78 B;  2HQX A;  3OYH A;  2EW3 A;  4JJB A;  2EJ9 A;  4JZ3 A;  4HVW A;  1RAD B;  1M8V A;  3WVE B;  2O01 E;  4NL3 A;  5LJ5 d;  2DL8 A;  4AG2 C;  1TXQ A;  2CS7 A;  4M7A A;  1K9M C;  2JNG A;  2KGT A;  1N27 A;  4JRP A;  4F7U B;  3EAE A;  4J9H A;  4JRI A;  4X1V A;  1K9M R;  1QVG P;  3OS1 A;  3ULR B;  4KH0 B;  1KQ1 A;  2J6F A;  2RJD A;  5FU6 B;  2CRE A;  5GAM h;  2DLP A;  1VYU A;  4J7F A;  3X24 B;  1VUB A;  1X6B A;  3JAM E;  1G83 A;  1H64 1;  5A0G A;  4M78 A;  4PL6 A;  4OB3 B;  4RUG A;  4GBQ A;  4BI3 A;  1D1B A;  2XDP A;  2KYM A;  2XI9 A;  1E7O A;  3T9N A;  3REB B;  3L1A A;  2QGG A;  1ZSZ B;  4QQG A;  1WHK A;  5IHI A;  5D6Y A;  1X6O A;  2R5A A;  2OTJ A;  2R5M A;  3CCR T;  2DVE A;  3I56 Q;  3QSU A;  2ZPH B;  2E12 A;  1IHW A;  1KC8 U;  3OSS C;  1VQ8 A;  1UEB A;  2CSQ A;  2Y4X A;  3P8D A;  1W1F A;  1WGS A;  4F7U A;  2D0Q B;  4JJD A;  1NLO C;  5IHK A;  1I5O B;  2E10 A;  2R57 A;  2FPD A;  3CCU Q;  4JLG A;  2JTF A;  1NJI U;  4HXJ A;  4FSS A;  1Y96 B;  3CXC P;  1JEG A;  3PIO A;  2LQN A;  1K0S A;  4J8O A;  3CD6 A;  4FW1 A;  1ZSZ A;  3R6O A;  4BUG A;  1QW1 A;  4J9G A;  2KMT A;  2JS0 A;  4N4H A;  1T3S A;  4C5E A;  3FC3 A;  4CC3 A;  3NTK A;  3QPH A;  1OPL A;  4E7I A;  1UDL A;  2JUF A;  1HJD A;  3E19 A;  5C6S A;  2OAW A;  2J05 A;  2JW4 A;  4LDW A;  5IN1 A;  5LJ5 h;  1UG1 A;  1MMA A;  2O31 A;  1WNL A;  3DLM A;  4OP0 A;  1WX6 A;  4M7D G;  2QEX T;  5GMK m;  2EYW A;  1PKT A;  2KXC A;  4C8Q D;  1Z9Q A;  2XKO C;  4FW2 A;  4M78 F;  2L8D A;  1O75 A;  3JCM d;  1ZQ1 A;  2BIV A;  2ZPG B;  3LWI A;  1NE8 A;  3CC2 Q;  1I1J A;  2C0O A;  4DOV A;  1Q7Y U;  2QQ9 A;  4CC4 B;  4XTV A;  2M51 A;  1UTI A;  1YI2 Q;  1M1K U;  3EG1 A;  1S1N A;  2VKN A;  1R0B G;  2XMF A;  3M53 A;  3NTH A;  1D0Y A;  5GAN f;  1T3L A;  1X27 A;  1FXX A;  2DPP B;  1BIB A;  3CCV T;  4E7S A;  3HFN A;  4QW2 A;  2E4H A;  2K7A A;  2X9H A;  4DBR A;  3L2W A;  1VYT A;  2KBT A;  1RAH B;  2Y4Y A;  4FU6 A;  3CC4 Q;  1XTD A;  1UGV A;  1ZLM A;  2BE7 D;  2E65 A;  2QTV A;  3VUB A;  2F2W A;  2ZAE A;  3OYB A;  2PUO B;  5FLX E;  1QKW A; 
#chains in the Genus database with same CATH homology
 4WCI A;  2AZV A;  2YDL A;  2DIL A;  1I0C A;  3EGU A;  2HEQ A;  2KRN A;  4JZ4 A;  1K9A A;  1AEY A;  4LNP A;  5FWB A;  3EG0 A;  4J9B A;  2AK5 A;  2PNI A;  1WXT A;  2A37 A;  2ABL A;  2LJ3 A;  4J9C A;  1SEM A;  1Z9Z A;  2KE9 A;  3R6N A;  2RMO A;  1U3O A;  4M4Z A;  1AWW A;  3I5S A;  3QWY A;  3M0S A;  1QCF A;  4RTZ A;  1ABQ A;  1KJW A;  5ECA A;  5IXB A;  2GTO A;  4IIO A;  1UE9 A;  1PKS A;  3I9Q A;  1X69 A;  1M27 C;  2LX7 A;  4J9I A;  2O9V A;  4F16 A;  3U23 A;  4Y92 A;  4HVU A;  2SRC A;  1MV3 A;  1ZUK A;  4Z88 A;  1LCK A;  4DEY A;  4KRT A;  1SHF A;  1GCQ A;  1M3A A;  3VS3 A;  3EHQ A;  2EYZ A;  2V1R A;  2EQI A;  1PWT A;  4AFU C;  3THK A;  1ZX6 A;  3M0U A;  1SPK A;  1SHG A;  4RTY A;  2EYY A;  4F14 A;  1M3C A;  2C0T A;  1JXM A;  4OMP A;  1N5Z A;  1M3B A;  1SRL A;  2FRW A;  2RPN A;  2HDA A;  2DRK A;  2FG0 A;  3VS7 A;  1TG0 A;  2DMO A;  1AWJ A;  1WLP B;  2RNA A;  1HD3 A;  2JMA A;  2LP5 A;  4R0K A;  2ENM A;  1UHC A;  2M0Y A;  1GFC A;  1CKB A;  1M30 A;  4EIK A;  2RQR A;  1AVZ C;  1WDX A;  2EBP A;  2X3X D;  4LUD A;  1BB9 A;  2X3W D;  2DNU A;  4J9F A;  4OML A;  3I5R A;  3IQL A;  4ESR A;  3A98 A;  2ED0 A;  2RQV A;  2KXD A;  4J9E A;  2KNB B;  4J9D A;  2GGR A;  1EFN A;  2O2O A;  1M8M A;  1NLP C;  4RTV A;  1KSW A;  1Y0M A;  3TSW A;  1X2K A;  1ZBJ A;  2K79 A;  2D0N A;  2DL7 A;  5EC7 A;  1WFW A;  2DBM A;  2CH4 W;  2NUZ A;  1T0H A;  3I35 A;  3UAT A;  2OJ2 A;  2D8J A;  5HCK A;  1MUZ A;  4RTT A;  1RI9 A;  3PVQ A;  3O5Z A;  2AKL A;  2RQW A;  1B3Q A;  1X6G A;  2JM8 A;  2DF6 A;  5FWC A;  3NMZ C;  1ARK A;  1WXU A;  2CT4 A;  5GJV B;  4OMM A;  2LZ6 B;  2LJ1 A;  4AFQ C;  2AKK A;  2CH4 A;  1FMK A;  2C0I A;  1GCQ C;  3M0T A;  4LN2 A;  3VS6 A;  1I07 A;  2A36 A;  2B86 A;  4OMQ A;  1KFZ A;  1GBR A;  4OMN A;  3GBQ A;  2SEM A;  2DX1 A;  2FO0 A;  3TVT A;  2RN8 A;  4F17 A;  5I22 A;  3H0F A;  1CKA A;  4JPB W;  2ED1 A;  2DM1 A;  2G6F X;  1WI7 A;  1Y57 A;  1VA7 A;  2KEA A;  1AWO A;  2L0A A;  1X2Q A;  1ZUU A;  4Z89 A;  1A0N B;  2JM9 A;  2DA9 A;  3NPF A;  2DRM A;  2O88 A;  2DL5 A;  1YCS B;  1QLY A;  4CC2 A;  1CSK A;  1NG2 A;  1GBQ A;  1U06 A;  1GCP A;  2DL4 A;  1UJY A;  2EKH A;  5IXF A;  3C0C A;  2KRM A;  3VS0 A;  3VS5 A;  4E6R A;  1ABO A;  2A08 A;  3SEM A;  1WXB A;  1SRM A;  3QWX X;  3RNJ A;  1K4U S;  3UF4 A;  1UUE A;  1TUC A;  4AFS C;  4OMO A;  4GLM A;  1JU5 C;  4D8D A;  3EHR A;  1BK2 A;  1YNZ A;  4ZNX A;  2GQI A;  1WA7 A;  1YWO A;  4LUE A;  2YSQ A;  1E6H A;  2FPF A;  2JTE A;  3RBB B;  2MOX A;  2NWM A;  2L2P A;  4HVV A;  5GJW B;  2ESW A;  4DEX A;  2LCS A;  1QWF A;  1J3T A;  1XOV A;  1OPK A;  4K11 A;  4RTW A;  2KT1 A;  1W6X A;  2YUQ A;  2LNH B;  1JO8 A;  2E5K A;  1RLQ C;  1YN8 A;  1NYG A;  1OOT A;  2DBK A;  2J7I A;  3KFV A;  2VVK A;  1RUW A;  3EG2 A;  1GL5 A;  1PRM C;  1W70 A;  3H0H A;  2VWF A;  2P4R A;  3TSZ A;  5IH2 A;  1FYN A;  1NEG A;  2DJQ A;  4D8K A;  3CQT A;  1OEB A;  1RLP C;  1WYX A;  2JMC A;  1BU1 A;  2ECZ A;  2EPD A;  2I0N A;  2MIO A;  2O9S A;  2RF0 A;  2ROT A;  1KIK A;  2JXB A;  1PRL C;  1MV0 B;  2EW3 A;  4JJB A;  4JZ3 A;  2EGC A;  4HVW A;  2CT3 A;  3JV3 A;  2F2X A;  1WIE A;  2RQU A;  1AZE A;  2DL8 A;  3VRY A;  4AG2 C;  1B07 A;  3EG3 A;  3H0I A;  1NYF A;  2DVJ A;  2KT8 A;  2PZ1 A;  2K9G A;  2JS2 A;  2KGT A;  2LQW A;  1UFF A;  1NM7 A;  4J9H A;  4X1V A;  2CSI A;  3ULR B;  2J6F A;  2CRE A;  2GNC A;  2YUP A;  2DLP A;  1VYU A;  1JQQ A;  1X6B A;  1G83 A;  4RUG A;  1IO6 A;  4GBQ A;  2LJ0 A;  2KYM A;  2D1X A;  3H41 A;  3VRZ A;  1E7O A;  4RTU A;  3REB B;  3PVL A;  3NHN A;  2KR3 A;  3ZL7 C;  5IHI A;  4IIM A;  2YUN A;  2QDL A;  2ROL A;  2EGA A;  4LE9 A;  3SHW A;  2J6K A;  2OI3 A;  3VS1 A;  1NEB A;  5FW9 A;  3FJ5 A;  2CSQ A;  1T0J A;  1W1F A;  2BTT A;  1TUD A;  4Z8A A;  1AOJ A;  2KRS A;  1NLO C;  4JJD A;  2F2V A;  5IHK A;  1VYV A;  1G2B A;  2CUD A;  2FPD A;  1YP5 A;  1AWX A;  2YUO A;  4HXJ A;  4FSS A;  2FPE A;  1JEG A;  2LQN A;  3UA6 A;  1K0S A;  2DYB A;  2CDT A;  1UEC A;  2HCK A;  2PTK A;  1YWP A;  3M0R A;  4J9G A;  2K3B A;  2JS0 A;  4A63 B;  1T3S A;  4CC3 A;  2DL3 A;  1OPL A;  1UDL A;  2L3Q A;  3NGP A;  2BZY A;  1V1C A;  1HJD A;  1PHT A;  2OAW A;  2J05 A;  2JW4 A;  1UG1 A;  3M0P A;  2H8H A;  2D8H A;  2O31 A;  5IHN A;  2J06 A;  2J6O A;  1AD5 A;  4JJC A;  2BZ8 A;  3PE0 A;  4AFZ C;  2CUB A;  1GRI A;  1WX6 A;  2JT4 A;  2EYW A;  2V1Q A;  1PKT A;  2HBW A;  2KXC A;  2LMJ A;  4QT7 A;  1BBZ A;  4RTX A;  1ZUY A;  4ORZ A;  1U5S A;  2KRO A;  1Z9Q A;  2FRY A;  3UA7 A;  2A28 A;  1K76 A;  1X43 A;  2DE0 X;  4CC7 A;  2FEI A;  5L23 A;  2EGE A;  1QKX A;  1JXO A;  1QWE A;  2AZS A;  3M0Q A;  1UJ0 A;  3VS2 A;  1E6G A;  1H3H A;  1I1J A;  2C0O A;  1K1Z A;  2K6D A;  2EVR A;  2GTJ A;  1ZSG A;  4CC4 B;  1SSH A;  2M51 A;  3LH5 A;  1H8K A;  1UTI A;  2W10 A;  3EG1 A;  1GFD A;  2HSP A;  1S1N A;  2VKN A;  3VS4 A;  1AZG B;  2BZX A;  2EYX A;  2XMF A;  1HSQ A;  5I11 A;  1K0X A;  2L3P A;  1T3L A;  1X27 A;  2GBQ A;  1PNJ A;  1H92 A;  2RQT A;  2W0Z A;  2YT6 A;  3REA B;  2K7A A;  1UHF A;  2IIM A;  1VYT A;  2KBT A;  4AG1 C;  4HCK A;  1UGV A;  1ZLM A;  2F2W A;  2L3S A;  2MCN A;  1OV3 A;  2KYB A;  2K2M A;  1QKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...