1H92A

Sh3 domain of human lck tyrosine kinase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
63
structure length
63
Chain Sequence
b'GSPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
molecule tags Transferase
source organism Homo sapiens
publication title Structural Investigation of the Binding of a Herpesviral Protein to the SH3 Domain of Tyrosine Kinase Lck
pubmed doi rcsb
total genus 7
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1h92A00
2YUOA 4CC3A 4CC7A 4ESRA 2HEQA 3GBQA 3VS3A 4QT7A 1HD3A 2DBMA 4FSSA 2EGAA 1N5ZA 4RTUA 1T3SA 4J9CA 5I11A 4ORZA 2XMFA 2YUQA 2DYBA 1YWOA 1TG0A 2D0NA 4DEYA 3PE0A 2LNHB 1ZUYA 1WXTA 5HCKA 1M3CA 4OMOA 2BZXA 2EW3A 2D8HA 2E5KA 1I0CA 1T3LA 1B07A 5L23A 2YUPA 1KFZA 1XOVA 2GBQA 1AEYA 4RUGA 2PZ1A 1JQQA 2LJ1A 1X69A 1U06A 2J6KA 4RTTA 1VYTA 3QWXX 4J9DA 2BTTA 1OV3A 2CH4A 3VS2A 1GBRA 2C0OA 1GBQA 2EYXA 1KSWA 2AZVA 3VS0A 1PWTA 1B3QA 2F2VA 1UJ0A 1TUDA 1VA7A 2RPNA 2D1XA 5IXBA 3I9QA 2H8HA 4LUDA 2RMOA 1M3AA 2RQUA 2KRSA 1MV0B 2YSQA 4Z8AA 4HVUA 4J9HA 2FPEA 2FPFA 1WI7A 2DF6A 1SEMA 1YN8A 4AFZC 1PNJA 1JXOA 2V1QA 2JMAA 4IIOA 3RBBB 1T0JA 2FPDA 2RNAA 3JV3A 2OI3A 2JXBA 2DRKA 1PKTA 3TVTA 2J06A 3LH5A 1UHCA 1Z9QA 3VS5A 1W6XA 2CSQA 5IH2A 2YDLA 1H3HA 3I5RA 4E6RA 2J6FA 3M0RA 1LCKA 2I0NA 2DJQA 5ECAA 1K9AA 2DE0X 5EC7A 4LN2A 1GFDA 1SRLA 1H8KA 1EFNA 1OPLA 2A36A 4EIKA 1T0HA 1QWFA 1ZSGA 1SHFA 2EGCA 4LNPA 1JEGA 1K0XA 2EGEA 1RLPC 2KE9A 2RQWA 1WXUA 4WCIA 2HCKA 1Y57A 1V1CA 2EYZA 2O9SA 1YNZA 1GFCA 2NWMA 2FRYA 2O31A 3ULRB 4AG1C 2D8JA 2K79A 2VWFA 5FWCA 2ABLA 1NEGA 4Y92A 2RQTA 1ZX6A 1WYXA 1SHGA 5IHNA 1NYFA 1QKWA 2O9VA 1UE9A 1X6BA 1NLPC 3EG0A 2KGTA 2X3XD 1X6GA 2MCNA 1UJYA 1ABOA 1YWPA 3REBB 3EHQA 5FWBA 2FG0A 1AWOA 2F2XA 2F2WA 1CKBA 4JJBA 2KT8A 1K1ZA 2FEIA 2ESWA 4GLMA 3UATA 4OMLA 2MIOA 3VRZA 4D8DA 1AVZC 4ZNXA 2OAWA 2RF0A 1SRMA 4OMQA 2BZYA 1OEBA 3ZL7C 3UF4A 2KXCA 1ARKA 3RNJA 1AWJA 3PVLA 1TUCA 3NGPA 2YT6A 1AWWA 1WX6A 2DA9A 1X27A 2CH4W 2LZ6B 4J9EA 2HSPA 1NLOC 4LUEA 1U3OA 1VYVA 2AKKA 2GQIA 2P4RA 2QDLA 1BU1A 2JS0A 3H0FA 3M0UA 1JU5C 3M0QA 2O88A 1IO6A 2A37A 2PTKA 2JM9A 1OOTA 5I22A 1AOJA 3EGUA 2L2PA 2LP5A 2M51A 3TSZA 1OPKA 2ED0A 3U23A 3EHRA 2DL5A 2RN8A 3H41A 2LJ3A 3NHNA 2G6FX 1QCFA 2BZ8A 3KFVA 2SEMA 1H92A 1JXMA 2KXDA 2EYYA 2KRMA 1MV3A 2DL3A 4JPBW 4AFQC 1M27C 1UHFA 4J9GA 1GL5A 2DLPA 2K9GA 2IIMA 2K3BA 2M0YA 4CC4B 5IXFA 2KR3A 2AK5A 4HVWA 2K2MA 3IQLA 4RTWA 4D8KA 4DEXA 2V1RA 1FMKA 1U5SA 2RQVA 1RLQC 2CUBA 3M0TA 2O2OA 3M0SA 4F16A 2A08A 1AD5A 2KT1A 3M0PA 3SEMA 1X2QA 1BK2A 1PKSA 2DX1A 2SRCA 3TSWA 1FYNA 1WDXA 2ED1A 1QWEA 4JJDA 1PHTA 3O5ZA 2K6DA 4KRTA 4CC2A 1M8MA 1W1FA 2DNUA 3QWYA 1AWXA 3PVQA 2ENMA 5IHIA 4A63B 3UA7A 1X43A 1UECA 2VKNA 2CUDA 1I1JA 2HBWA 1NG2A 2LQNA 2W10A 5FW9A 1K0SA 1YP5A 1UDLA 2CSIA 1Z9ZA 1QLYA 1J3TA 1NYGA 2CT4A 4JJCA 2DL4A 2DRMA 4J9IA 3H0HA 1JO8A 2PNIA 3CQTA 2L0AA 4JZ4A 1SSHA 1ZUUA 2CREA 1YCSB 2JMCA 1KJWA 2KBTA 2L3SA 1BBZA 2JTEA 2J6OA 2JS2A 4K11A 2EKHA 2DILA 1ZLMA 1SPKA 2EBPA 2FO0A 2EPDA 2GTOA 2B86A 2JM8A 4Z89A 2KEAA 4X1VA 2ECZA 1PRLC 2GTJA 1KIKA 3EG3A 1NM7A 3EG1A 3VS6A 1GCQC 5IHKA 1M30A 2NUZA 2AKLA 2AZSA 2CT3A 2LMJA 4IIMA 2X3WD 2LCSA 2FRWA 4HVVA 2DBKA 2L3PA 4F14A 1HSQA 1ZUKA 4OMPA 4AFSC 1K4US 1PRMC 1WIEA 5GJWB 4AG2C 1UG1A 4LE9A 1WA7A 1UFFA 2HDAA 1ABQA 1E6HA 5GJVB 2EQIA 1CSKA 4GBQA 1E6GA 2EVRA 1WXBA 4RTVA 1AZGB 1WLPB 2CDTA 3C0CA 2KYBA 2J7IA 2ROLA 1ZBJA 2J05A 1GCPA 3NPFA 2K7AA 1NEBA 1X2KA 2DL7A 3I35A 2LQWA 3VRYA 1AZEA 2A28A 2KRNA 2JW4A 2DMOA 2OJ2A 2DM1A 1K76A 4J9BA 3A98A 4OMNA 1QKXA 3REAB 1G2BA 3SHWA 1I07A 4M4ZA 2GNCA 3VS1A 4Z88A 1HJDA 1WFWA 1BB9A 3NMZC 3VS7A 3UA6A 3VS4A 4J9FA 4R0KA 2VVKA 1S1NA 4OMMA 1A0NB 1G83A 1VYUA 2DL8A 4RTXA 2L3QA 2ROTA 4RTYA 2RQRA 2KROA 3H0IA 1Y0MA 1GRIA 2YUNA 1UTIA 2C0IA 3THKA 2DVJA 2C0TA 1UUEA 2W0ZA 2MOXA 1CKAA 2EYWA 2KNBB 4JZ3A 3FJ5A 4AFUC 1W70A 2GGRA 4F17A 4HXJA 2LJ0A 1GCQA 1RUWA 2LX7A 4HCKA 4RTZA 2KYMA 2JT4A 3I5SA 1UGVA 3R6NA 3EG2A 1RI9A 1MUZA 1M3BA 1E7OA
chains in the Genus database with same CATH superfamily
2PQWA 2PU9B 2YUOA 4CC3A 4E7ZA 4ZGEB 3O8VA 3CD6T 2Z0WA 4DQ2A 1Q81R 1TOVA 2HQEA 1KQ1A 2DXCA 4C92G 1T3SA 3L42A 2E1HA 2CP3A 4BI3A 2K57A 3M57A 4ELYC 2LNHB 2IG0A 2R5AA 5HCKA 4OMOA 1HXDA 2CZ0B 2BZXA 4BE2A 2K3XA 5GAOr 1T3LA 4EDUA 1Q7YU 5HKCA 3FEOA 3JCMe 3CCQT 5J3BA 3LGFA 3QIIA 1XOVA 5EG2A 4PJOF 2HQHA 2LJ1A 2J6KA 4RTTA 3P8DA 1C0MA 1W2BS 3VS2A 2HMAA 1D0XA 3LGLA 4E7SA 5GANe 1MNEA 1VA7A 5IXBA 2D1XA 4M78A 4M7DD 3HHTB 1VQ6T 5I2SA 3HFOA 4F7UB 4LUDA 1MV0B 2YSQA 4HVUA 5CO7A 2FPEA 1WI7A 4KUIA 2DERA 2HSEB 3I56A 3OYJA 4AFZC 4OGEA 4M7DA 3CCRQ 4C0DB 3RBBB 4M7AB 2QQAA 2JXBA 1PKTA 2J06A 3QYGB 1H3HA 4E6RA 4OMFB 2I0NA 5KYYA 3WVDB 5ECAA 4M75G 2QEXT 2CP5A 4F7UF 4LN2A 2VGNA 1GFDA 2A36A 4FT2A 1YI2A 5FU7C 3JCMb 2DK3A 4B9WA 1KC8C 1WXUA 2BKDN 1I8FA 2WSEE 2AIRB 5GAOl 5I21A 4WCIA 3CC4Q 3CCLA 2O9SA 1YNZA 3PFSA 2E6ZA 1VIEA 2M1HA 2ZPBB 1Q81U 2QAZA 3EGXA 2K79A 2VWFA 5FWCA 4C92B 3OY9A 2ABLA 1QCNA 2RQTA 3L2QA 1BCOA 3CEYA 1TS9A 2PUKB 5IHNA 1NYFA 2O01E 1NLPC 3N5BB 1VQLT 3CCRA 3JCMJ 3DKMA 2X51A 1IREB 5CKHA 2E12A 3EHQA 2VUBA 1YITA 1MNDA 2RI2A 3RKYA 3JAME 2CYZB 2JZ2A 4XTYA 3X26B 4QVZA 5GAMf 1AWOA 1X75C 2F2WA 2DO3A 2Y4YA 1V76A 4JJBA 4BE1A 2L8DA 3MKDA 2MIOA 1WHKA 5GANh 3VRZA 4E7IA 1VQ8T 2OAWA 4XQ3A 2RF0A 2QTXA 3UDCA 2BZYA 2KVQG 3JCMh 5AT1B 3L2VA 5KYUB 3RNJA 1AWJA 1QMCA 3DLMA 4M77F 1Q81C 2YT6A 1R0BG 4Y28E 1PD1A 2QG9B 4A4GA 4M7AG 2EQMA 1XTDA 2Y90A 3HRSA 2HSPA 3OYFA 3QYHB 2GQIA 4PJOE 4LDUA 4MMLA 3H0FA 4BE0A 3JB9G 3JCMV 1YITT 4R55A 2MWOA 2L2PA 3VU3C 1YIJA 2E3IA 3EFSA 2RN8A 3H41A 4BUGA 2RHIA 3BW1A 1RABB 2G6FX 2BZ8A 4IUPA 2DD4A 5KCHA 4Z02A 4M78E 1JXMA 2KXDA 5CK9A 1MV3A 1D3BB 2K5FA 3TQ7P 1M27C 5KE2A 3CCUA 5J26A 3ZBDA 4M75D 2F5TX 1X6OA 4J9GA 3CMEA 1Q82R 3ASKA 2GF7A 2RHZA 4CC4B 2KR3A 2FZKB 4J8OA 3OMCA 3CCVQ 1YJ9T 3CCLT 2ZPFB 3QXEB 3TREA 2E70A 2BIVA 2COZA 2DZ9A 4DA4A 5FRMA 1U5SA 1RLQC 1BKBA 2O2OA 1AD5A 3SEMA 1FMWA 4YTLA 3PIPA 4M77E 1PKSA 2DX1A 2SRCA 3C95A 2CP6A 3LWHA 2ED1A 5A2QE 1QWEA 4JJDA 3V8JA 3JSCA 2EQJA 4BD3A 2XDDA 3CCET 4HA8A 3RKXA 4AT1B 4C8QB 5IN1A 2LQ8A 1D3BA 2OTJT 3PVQA 3A8OB 1RADB 5IHIA 1WQWA 1VIFA 3FB9A 4M78G 1YJ9Q 3G1JA 5KYXB 1VUBA 3G6EA 2CUDA 1I1JA 2JVVA 2W10A 1YP5A 3OYIA 1UDLA 1Y07A 2KI7A 2ZGWA 1QLYA 3PIOA 1NZ9A 3KUFA 5KYWB 5HY6A 3JB9I 1OZ3A 5GAN4 1ZUUA 1BIAA 2VC8A 1YCSB 2JMCA 1VQNQ 1BI2A 5FLXE 1MMNA 1BBZA 4KULA 1VQ4A 3MP8A 5M9OA 2EBPA 1N6AA 2EPDA 5C6SA 4C8QE 4ATOA 4Z89A 3M4GA 5FROA 3R6OA 1M1GA 1KIKA 4GLKA 4XAXB 5GMKj 3M9QA 3VS6A 3EAEA 1M30A 4II1A 2NUZA 3SDZA 2AKLA 2CT3A 4IIMA 2X3WD 2M9UA 1TSFA 2ZPGB 3OYNA 2D9TA 5CAIA 2WACA 1OX8A 4F14A 2QEXQ 3MEUA 4OMPA 4AFSC 1N8RR 1XJWB 4AG2C 5KYWA 1UG1A 4JLGA 1UFFA 1PSFA 1WJQA 5GJVB 2GFUA 1UB4A 2EVRA 1WXBA 4J83A 1AZGB 1OQKA 3C0CA 2KYBA 2K7AA 1AZEA 3VRYA 2A28A 1ZSZB 2DMOA 1S72T 3S6WA 1WJRA 3HRUA 1K76A 1MMGA 2YHTA 1BI0A 3EG9A 3E9GA 1PG5B 4XTZA 3MEWA 3HKSA 3SHWA 2X9HA 2GNCA 4PLIA 3RMSA 3V7CA 2FZCB 3GIBA 1JBMA 4C8QG 1TU0B 3UA6A 1RAGB 3CBMA 4R0KA 3LWIA 1LJOA 1VYUA 4QQ6A 3E2UA 4RTYA 2KROA 3H0IA 1WHHA 1Y0MA 2EWNA 1KQ2A 3S3MA 1TWBA 2C0IA 1WQ7A 1SG5A 3EGDB 1ZSZA 3FJ5A 3FLGA 1M2VB 3CCJT 4HXJA 1UGRB 3EG9B 1BCMA 1PM3A 3INZA 3GNFB 4OB3B 3UWNA 2KYMA 3X25B 4J6WA 1E7OA 2RK1A 3H9NA 1QVFA 1M5Q1 2EGAA 1N5ZA 3RIRA 1QCOA 4XTWA 5I11A 4V2SA 1ZBXA 2LC4A 2XDPA 1TG0A 4ELZC 2FVUA 1U1SA 4PLLA 1ZUYA 1WXTA 1M3CA 2QQ9A 2EW3A 4LXCA 3EGDA 1I0CA 4EMKA 3M53A 3L2ZA 5L23A 1M90C 1NJIC 1VQ5T 1UGPB 4RUGA 5FU6C 1VQ7A 1X69A 1U06A 1G5VA 1VYTA 3OS0A 4J9DA 3OYBA 1RL2A 4M7DG 3EFRA 2XG8D 4CRIA 1GBQA 2NUTA 1BI1A 2AZVA 4OGCA 1PWTA 1UJ0A 5D6XA 1TUDA 5A0GA 2E10A 2RPNA 3A8HB 2VYTA 3I9QA 1M3AA 1QW1A 3X24B 2OTLQ 2VV5A 3P8HA 1VQ7T 2DF6A 1SEMA 3CCRT 3CXCA 4EPCA 4EMKB 3VYHB 1B34A 1PNJA 4JUVA 4XU1A 4PL6A 1T0JA 2RNAA 3CPWA 2LTOA 1R77A 1LNXA 2DYIA 4NOYA 1UGSB 1UHCA 4HCCA 1I81A 3OYKA 2E3HA 3L1AA 2QASA 4A54A 1N8RC 2MYSA 1N9SA 5CKEA 3I5RA 2J6FA 1VQ9Q 1NBEB 3M0RA 1U1TA 2DJQA 3M5AA 3MHXA 3HL8A 4A4HA 2DE0X 3SWNC 3CCMA 1H8KA 1EFNA 1OPLA 4EIKA 4WF2A 1T0HA 3HPWA 5LJ5d 1TUGB 1SHFA 3CXCP 4ZN3A 2EGEA 2RQWA 4C8QA 2QDYB 3ER0A 2EQKA 5LJ5f 3OYEA 4C5IA 1YI2Q 2QQSA 4BY6C 1Y57A 1V1CA 3S3NA 4M7AD 1RAFB 2FRYA 2O31A 1Q86U 4AG1C 2QTVA 1W2BA 1WZOA 1NEGA 4M78D 4Y92A 5FU7B 1RAHB 2JUFA 1YIJT 3HP9A 3CD6Q 2QI2A 2O9VA 2RHUA 1X6BA 3BY7A 1EX4A 1TXQA 4WTOB 3M56A 3SFMA 3AT1B 3NTIA 3M55A 2CZ6B 3RUXA 2K4YA 1YWPA 3MEVA 3OYCA 3LX7A 4C92F 5DM7R 3REBB 1QVGA 4BY6B 7AT1B 1KHCA 2D6FA 1M90U 3J7AF 4X9CA 1YI2T 2F2XA 1VQ7Q 2KT8A 5I2MA 1Y7XA 2R58A 2FEIA 2MWPA 4XTUA 3UATA 2RI5A 1VQKA 4JRPA 3PTAA 1AVZC 2P84A 3GLXA 3SWNB 2MK5A 4JDSA 3M4YA 3QBYA 3JCMg 1QP2A 3UF4A 2DVEA 3CMAA 3G71Q 1AWWA 1WX6A 4Y91A 1X27A 1X01A 4LUEA 1U3OA 1VYVA 3VUBA 1M1KR 3C94A 4PFOA 4LD9K 2QDLA 1BU1A 2FB7A 3M0QA 4IUUA 4IUQA 2ZPHB 2JM9A 1SF9A 4F04B 1OOTA 2YLCA 5I22A 3CD6A 1FWZA 1NPRA 1RAIB 3TSZA 2KSSA 3U23A 1OX9A 4RKUE 2DL5A 2DFUA 3L2UA 3SWNA 3OYYA 4O5VA 2GFAA 2HL5C 2K5IA 2XKOC 4ZTJA 2EYYA 2KRMA 4ZTFA 3CCMQ 1OU8A 4FW2A 1RAAB 1GL5A 1G3SA 5GMKe 2K3BA 3C12A 4EMKC 5LJ5j 1VQ4Q 2K2MA 4RTWA 2FYKA 1JJ2P 5FU6B 4EMGA 4DEXA 1K9MR 2V1RA 5LJ3h 2XDBA 8ATCB 3CCLQ 3CC4A 4FYWB 2RQVA 1VQ6Q 1ACMB 3DLLA 4F16A 3M0PA 1X2QA 3JCMQ 1BK2A 4M75C 3J81E 1FYNA 2MAMA 1YJWQ 1PHTA 5GMKl 4JRIA 3O5ZA 2IPOB 4UC4A 5LJ5g 2DNUA 4MDXA 5GAN7 1M8VA 2DXTA 1QVFS 3UA7A 2V8IA 2P0KA 3OYHA 2QYZA 2VKNA 2HBWA 1NG2A 3QG1A 3MEAA 5GAOq 2ZPIB 2EQUA 2RH2A 1Z9ZA 4N4GA 1FX7A 3G6EQ 2DL4A 1VQLQ 4J6XA 2QGFB 4JLIA 5CCAA 2NLUA 2CREA 4C5GA 1R0CB 2L3SA 1VQPT 1QVFP 2EKHA 4A4FA 2E41A 2X4JA 1SKUB 2FO0A 2RM4A 3CCST 1H3ZA 4B9XA 2JM8A 2X4XA 2KEAA 4X1VA 1VQ5Q 4M75A 5LJ3d 4M75E 1IXDA 3EG3A 3OSVA 3I55A 3V8KA 2ZZDA 2MPXC 4HVVA 5CKDA 2DBKA 3G4SQ 5HK3A 3CCQA 2P0PA 1OZ2A 2RJDA 1K4US 1D1AA 1WIEA 5GJWB 4FCYA 4LE9A 1W4SA 1JJ2S 4J6YA 1ABQA 1B34B 3OW2S 5D6WA 3T9NA 1IZ6A 4M78F 1CSKA 5GMKh 2RJEA 1I4K1 4PJOD 4M7AF 3BDUA 3HFNA 4M77D 2DL7A 3I35A 4M7DE 2LQWA 2JW4A 2RB6A 5GMKi 1K9MU 3META 1S72Q 4IKFA 3A98A 4OMNA 4M78C 2WSCE 1QKXA 3DB3A 5GAN6 3HSBA 1G2BA 4A53A 4LD6A 5KE3A 2L89A 4Z88A 5AYFA 1HJDA 1KQSS 4BDZA 1BI3A 3VS7A 1EZZB 1KQSA 4OMMA 1VQKT 4RTXA 2L3QA 2OX7A 2ROTA 5FRNA 4M78B 3CC2T 2CKKA 4LDWA 2BE7D 4F7UA 1UTIA 3QDRB 3THKA 1M2OA 5CQXA 2E4HA 4PJOB 4L59A 2MOXA 3RDVA 3G4SA 2KNBB 4JZ3A 3NTKA 3CCQQ 5CKBA 4J7IA 2GGRA 3ZEHA 4F17A 3L2RA 4HT9A 3A5ZB 2E65A 1QVGS 4LDYA 5GAN2 2JT4A 1RI9A 1M3BA 1IHWA 1K73C 4ESRA 4J7FA 2YRCA 3CBOA 3VS3A 1YIJQ 4QT7A 4A4KA 4FSSA 1YJNQ 1WJSA 2LCLA 4RTUA 2PVGB 2KY9A 4LDXA 2XMFA 1D1CA 5LJ3e 1VQ5A 3OA6A 2D8HA 2EIFA 2K5LA 1RI0A 2R5MA 3E19A 3DB4A 3HTRA 1KFZA 5GAMg 1JQQA 2M16A 2QK0A 2E5QA 4C8QC 4QQDA 4KH0B 1OV3A 1GBRA 1D1BA 2C0OA 1UEBA 2XU8A 4Q5WA 4IURA 3CXCS 1KSWA 4N0AC 3C4SA 3VS0A 2WSFE 2MF2A 5KH6A 4NL3A 1YJNT 2JTMA 3AHUA 2V8KA 5LJ3g 1LOJA 2H8HA 3TCJA 2RMOA 4Z8AA 3TEEA 2RD1A 2NUTB 4OB1B 4PJJA 1VQ4T 2F69A 3OW2P 1JXOA 2V1QA 1WHJA 2JMAA 3I55Q 2FPDA 3JV3A 4FIBA 4N4IA 2OI3A 4MDWA 4C92E 3FC3A 2YXYA 3EFOA 2CGHA 4L6V5 5GAMj 5IH2A 3CBPA 2G3RA 1XNIA 4PJOG 1LCKA 2LX9A 1IB8A 3P8BB 1Q7YC 2C06A 1VQKQ 4XTVA 3OS2A 1TTHB 2AT1B 5EC7A 1SRLA 1ZSGA 3OYLA 4FSXA 2LT1A 3V7SA 2KMTA 2P0QA 2ZCFB 3QJ6A 3QJYA 1RLPC 3TU4K 4E7HA 2V8JA 1YJWA 2HCKA 2EYZA 1GFCA 1WHLA 3J80E 6AT1B 2EKOA 4N4HA 3CCUT 2DTHA 1SHGA 1HK9A 1QKWA 4XU3A 1BYMA 4KT0E 2V26A 5DLQE 2KGTA 2X3XD 1X6GA 4C92C 1UJYA 5GAN8 2LNVA 2F1LA 3H6ZA 4ZN1A 1KD1R 1Q82C 1M4ZA 2JOYA 2FG0A 1YBYA 2A7YA 4M7DB 2LQKA 4FM4B 5GAMe 3VV0A 1VQNA 4GLMA 1K8AR 4OMLA 4KGVB 4E2FB 3CC7A 1VQMA 4MZTA 3CC2Q 4D8DA 3UPUA 4ZNXA 1ZSZC 1KHIA 1JJ2A 4NS5A 1SRMA 3CC7Q 1MMDA 2JJ9A 3CPWS 1M9SA 4PK4A 4JRQA 5DLOA 1MGQA 2KXCA 3JCMP 3VJPA 1ARKA 2PVOB 1P92A 3NGPA 1JRIA 5GANj 2EJGA 2DA9A 3QZ5B 2FL7A 5CR2A 2CH4W 4J9EA 5KYXA 3G71A 5KYNA 3QUIA 4PFZA 4MZPA 2QEXA 5DY9A 2P4RA 4QVDA 2L5QA 3ZFJA 2JS0A 3M0UA 1JU5C 3OBWA 1IO6A 4M7DF 3EH2A 3EGUA 3OYAA 2M51A 1VQPQ 3EHRA 5GANg 4CI0C 1ZQ1A 3EGXB 1VQNT 2LJ3A 2VASA 5J39A 3NHNA 2A0FB 4JRKA 2HBPA 5GAN5 1K8AC 2DL3A 3G6ET 1LVKA 1UHFA 5GAMh 1IGUA 2K9GA 5IXFA 1KD1C 4FYVB 3GNGA 1FXXA 1MMAA 3IQLA 1YHQT 3A1PA 4D8KA 3EH1A 2FZGB 3X28B 3KBGA 1VQOQ 2CUBA 3M0SA 2A08A 1H641 1YJWT 1WGSA 3MCAB 3PMIA 4XK8E 1WDXA 2OTJA 4ZGDB 2RHYA 4KRTA 1PCXA 5KYUA 3OS1A 2RHXA 1YHQA 4C5HA 1W1FA 3QWYA 1O9SA 3CMEQ 4R56A 4A63B 1I5OB 1XQHA 2L3RA 1UECA 4JS5A 1K0SA 4XU2A 2JNGA 2HZYA 2CT4A 1FMVA 2DRMA 2H3EB 3LH0A 4J9IA 3A8LB 1VQPA 1JO8A 4XU0A 2VGMA 2PNIA 3CQTA 1U8RA 4QQGA 2L0AA 1SSHA 4PNOA 3M58A 3E1SA 1KJWA 2KDSA 1V29B 2LCCA 3CCSA 2J6OA 3CMAQ 2YWWA 1KD1U 4K11A 2NUPB 2LDMA 1ZLMA 4C0ZA 2RJFA 5GANd 5L8RE 2DTOA 2GTOA 3QSUA 1VQOT 1JB0E 1PC0A 1PRLC 3HRTA 4DBHA 2GTJA 4B6MA 4C5EA 1GCQC 1M2VA 2RK2A 4L5GA 3CCVT 1OI1A 5LJ3f 2B8AA 2NYSA 1BIBA 4C8QD 2FRWA 3A8GB 4HKEA 1WPYA 2HKQB 2BE9B 1ZUKA 1I5LA 1D0YA 2QQBA 3CC2A 2CP2A 1KC8U 5GAOn 5LJ3j 3E9FA 1HYOA 4LDVA 2EQIA 4PFPA 4GBQA 2DTIA 1WLPB 4GY5A 3BDLA 2CDTA 4FYXB 4M75F 5CKFA 1ZBJA 2J05A 3NPFA 4RCBA 1NEBA 1R8OB 2OJ2A 3LLRA 3BFMA 3ME9A 3PGGA 1Y96A 1WHMA 1K9MC 4DBQA 1S72A 5IAYA 4M4ZA 2DIGA 3VS1A 4KUDK 2ZAEA 3QPHA 3CCSQ 2DJZA 3NMZC 2AHJB 4J9FA 2XI9A 1A0NB 1NE8A 3L2WA 3RERA 1UGQB 1D09B 1M90R 2HD0A 1GRIA 3G4ST 2IVWA 2O4XA 2DVJA 2C0TA 1UUEA 1QQJA 2W0ZA 2EYWA 4FYYB 2CS7A 3MO8A 2P4TA 2ZPEB 2QA4T 1Y96B 2A3LA 3GOXA 2LJ0A 1G3WA 2X4YA 2DXUA 2LX7A 2XIDA 5LJ5h 4RTZA 3I5SA 1M1KC 3QDFA 4PJOA 4D6WA 3R6NA 5CQYA 3EG2A 3VUZA 2LT4A 1MUZA 1NJIU 4TVRA 4BI8B 2OTJQ 4QW2A 4CC7A 2HEQA 3GBQA 1HD3A 1OYXA 4JS4A 1YFNA 2DBMA 2HAXA 3JCMf 1MHNA 4J9CA 4ORZA 3H8ZA 4MMKA 2YUQA 2DYBA 1YWOA 3WXMB 2D0NA 4DEYA 3PE0A 4C0GA 2R57A 3I55T 1VOMA 5A0LA 2E5KA 3LW5E 1B07A 8AT1B 1VQ6A 2HKNA 2DIQA 2YUPA 3JB9J 2GBQA 1AEYA 1SSFA 2PZ1A 4M7AC 2M0OA 4F7UE 1RAEB 2HQXA 1KC8R 3QWXX 2E6NA 2EFIA 4OF1A 2BTTA 2CH4A 3OS5A 2EYXA 3MPUB 1VQ9A 1Q82U 1NPPA 3QHSA 4J5YA 1B3QA 2DEQA 2F2VA 4KBMB 2EJFA 2VXEA 4DBRA 3OMGA 1GXIE 3GPLA 2EYQA 1Q86C 2H3JA 2RQUA 2KRSA 2X4WA 3VYGA 3WVEB 4J9HA 2FPFA 4BDYA 4X9DA 4E47A 1YITQ 3F70A 1YN8A 3FDRA 2Y4XA 4IIOA 3OBYA 4ME7A 3MP6A 1YJ9A 2DRKA 3TVTA 3LH5A 1Z9QA 3VS5A 2VB6A 4M7DC 1W6XA 2CSQA 3FRNA 3QKJA 2YDLA 3G7ZA 1VQLA 2XICA 2DXBA 4RMOA 2XHCA 3CPFA 3V8LA 3X20B 1N8RU 3JCMd 1K9AA 2JTFA 2FHDA 3JCMX 2DZCA 3EFOB 1QWFA 5IT9E 5GAOm 4M77C 4OB0B 1JEGA 2EGCA 4LNPA 1K0XA 4PJLA 4QKUA 2KE9A 4DBFA 5LJ5e 3PMTA 3MJXA 3QO3A 5LL6S 3G71T 2QXFA 2CZ1B 2ATCB 4C0FA 3OSSC 2NWMA 3ULRB 2D8JA 4HT8A 4PJMA 3JB9F 1ZX6A 1WYXA 1VQ8Q 1UE9A 3CCUQ 1VQ8A 3EG0A 3I56T 4FU6A 2MCNA 4E7KA 1G3TA 3JRZA 1ABOA 2HNIA 1K73R 3CCJA 4M77A 5GAMd 3CC4T 3FIFA 2HL3A 2KK4A 1RACB 5FWBA 3PNWC 4QVCA 1CKBA 1NJIR 4OB2B 1K1ZA 5D6YA 3S3OA 2DPPB 2ESWA 4RG8A 1QVGP 4ZGJB 2OAUA 3A8MB 1ZA1B 1QP3A 2XK0A 1G3YA 1IGQA 3CMAT 4OMQA 1OEBA 3CC7T 2RJCA 1QVPA 4BI4A 4DOWA 3ZL7C 3PVLA 1VQ9T 1TUCA 3MP1A 2QGGA 2QA4A 3GP8A 3M59A 2LZ6B 1KK7A 1NLOC 1EIFA 2AKKA 5HK0A 2O88A 1KQSP 2A37A 2PTKA 1LPLA 2PUOB 1AOJA 4MZMA 2RI3A 1YCYA 2LP5A 3I56Q 3OYDA 1OPKA 2ED0A 2DAQA 2GCXA 1YJNA 1N9RA 2MMPA 1DJ7B 3KFVA 1QCFA 3RKWA 2SEMA 1H92A 3CCEQ 4E7LA 3JCMc 4JPBW 4AFQC 4M7AA 4OP0A 3OYMA 2DLPA 3CCEA 2IIMA 2M0YA 4EMHA 3CCJQ 2AK5A 4HVWA 3NFCA 1PSEA 9ATCB 2K2VA 3CMET 3CPWP 3SB2A 4C8QF 1FMKA 2E64A 2CP0A 5KYYB 2O4XB 3M0TA 4FW1A 2KT1A 5GAOp 3V7RA 1OULA 3NTHA 3TSWA 3CCMT 4NL2A 5KCOA 2GQVA 2VXFA 3RESA 4PJOC 2K6DA 3JCMW 4C0DC 2KAFA 4CC2A 1M8MA 2XD0A 1AWXA 2CZ7B 5CIUA 1Y71A 4DOVA 4OVAA 2ENMA 4C92D 3JB9H 1X43A 1YHQQ 1F1BB 4C92A 2OTLA 2I2LA 4JJNK 2LQNA 2QQRA 5FW9A 2LRQA 2CSIA 5A0DA 1ZA2B 2MI6A 1KG1A 1J3TA 1NYGA 3FJPA 1AT1B 2DEUA 4JJCA 4RG2A 1TH7A 3H0HA 2COYA 2RO0A 3SD4A 5C0MA 4JZ4A 3UT1A 1PD0A 1B7TA 2YRVA 2KBTA 2YLBA 2JTEA 1D0ZA 1O75A 5GAN3 2LVMA 4M77G 4O6JA 4KGXB 2JS2A 3OQ5A 3RR6A 3URGA 2DILA 1AHJB 1SPKA 1IHVA 2QA4Q 2EAYA 2B86A 1C6VX 2ECZA 4FL6A 4IUVA 1NM7A 3EG1A 3Q1JA 5IHKA 1M1FA 1IRXA 1Q86R 2AZSA 2LMJA 4FT4A 1VQMT 2D0QB 4E7JA 3LYIA 4KGZB 1Q7YR 2LCSA 3OB9A 2NUPA 2L3PA 3PT9A 3RMQA 1HSQA 2JN0A 3VKIA 1PRMC 4X34A 1WA7A 2COWA 2HDAA 4KH1B 1E6HA 1Q95G 3JB9D 1E6GA 4RTVA 2CP7A 2J7IA 2ROLA 2DKGA 1GCPA 1N27A 2RA2A 1X2KA 2KRNA 2DM1A 4J9BA 4F7UG 4PJNA 2K3YA 2PVDB 1VQMQ 4ANJA 3QZ9B 3M54A 1OU9A 3REAB 1K73U 4XTXA 4IUTA 1I07A 4N0AA 3OYGA 3CCVA 2OTLT 5D7UA 1W2BP 1WFWA 1BB9A 2F5KA 3D7SB 3VS4A 2X35A 4RCCA 2VVKA 1S1NA 1G83A 1K8AU 4HCZA 1G8XA 2DL8A 4M7AE 2RQRA 3GF5A 2BUDA 1M1KU 2YUNA 2DD5A 4AMCA 1WNLA 2M02A 3KXTA 1C1AA 5GANf 1CKAA 4BACA 4M75B 4AFUC 3BE3A 5CVIA 1W70A 4HCBA 4A4EA 1VQOA 2DETA 2YRDA 4PKCC 4BB7A 1ZHIA 2EJ9A 5GMKm 1GCQA 1RUWA 4HCKA 2KQWA 4P5NA 3OW2A 1WHGA 4VUBA 1UGVA 4M77B
chains in the Genus database with same CATH topology
2YUOA 4CC3A 4CC7A 4ESRA 2HEQA 3GBQA 3VS3A 4QT7A 1HD3A 2DBMA 4FSSA 2EGAA 1N5ZA 4RTUA 1T3SA 4J9CA 5I11A 4ORZA 2XMFA 2YUQA 2DYBA 1YWOA 1TG0A 2D0NA 4DEYA 3PE0A 2LNHB 1ZUYA 1WXTA 5HCKA 1M3CA 4OMOA 2BZXA 2EW3A 2D8HA 2E5KA 1I0CA 1T3LA 1B07A 5L23A 2YUPA 1KFZA 1XOVA 2GBQA 1AEYA 4RUGA 2PZ1A 1JQQA 2LJ1A 1X69A 1U06A 2J6KA 4RTTA 1VYTA 3QWXX 4J9DA 2BTTA 1OV3A 2CH4A 3VS2A 1GBRA 2C0OA 1GBQA 2EYXA 1KSWA 2AZVA 3VS0A 1PWTA 1B3QA 2F2VA 1UJ0A 1TUDA 1VA7A 2RPNA 2D1XA 5IXBA 3I9QA 2H8HA 4LUDA 2RMOA 1M3AA 2RQUA 2KRSA 1MV0B 2YSQA 4Z8AA 4HVUA 4J9HA 2FPEA 2FPFA 1WI7A 2DF6A 1SEMA 1YN8A 4AFZC 1PNJA 1JXOA 2V1QA 2JMAA 4IIOA 3RBBB 1T0JA 2FPDA 2RNAA 3JV3A 2OI3A 2JXBA 2DRKA 1PKTA 3TVTA 2J06A 3LH5A 1UHCA 1Z9QA 3VS5A 1W6XA 2CSQA 5IH2A 2YDLA 1H3HA 3I5RA 4E6RA 2J6FA 3M0RA 1LCKA 2I0NA 2DJQA 5ECAA 1K9AA 2DE0X 5EC7A 4LN2A 1GFDA 1SRLA 1H8KA 1EFNA 1OPLA 2A36A 4EIKA 1T0HA 1QWFA 1ZSGA 1SHFA 2EGCA 4LNPA 1JEGA 1K0XA 2EGEA 1RLPC 2KE9A 2RQWA 1WXUA 4WCIA 2HCKA 1Y57A 1V1CA 2EYZA 2O9SA 1YNZA 1GFCA 2NWMA 2FRYA 2O31A 3ULRB 4AG1C 2D8JA 2K79A 2VWFA 5FWCA 2ABLA 1NEGA 4Y92A 2RQTA 1ZX6A 1WYXA 1SHGA 5IHNA 1NYFA 1QKWA 2O9VA 1UE9A 1X6BA 1NLPC 3EG0A 2KGTA 2X3XD 1X6GA 2MCNA 1UJYA 1ABOA 1YWPA 3REBB 3EHQA 5FWBA 2FG0A 1AWOA 2F2XA 2F2WA 1CKBA 4JJBA 2KT8A 1K1ZA 2FEIA 2ESWA 4GLMA 3UATA 4OMLA 2MIOA 3VRZA 4D8DA 1AVZC 4ZNXA 2OAWA 2RF0A 1SRMA 4OMQA 2BZYA 1OEBA 3ZL7C 3UF4A 2KXCA 1ARKA 3RNJA 1AWJA 3PVLA 1TUCA 3NGPA 2YT6A 1AWWA 1WX6A 2DA9A 1X27A 2CH4W 2LZ6B 4J9EA 2HSPA 1NLOC 4LUEA 1U3OA 1VYVA 2AKKA 2GQIA 2P4RA 2QDLA 1BU1A 2JS0A 3H0FA 3M0UA 1JU5C 3M0QA 2O88A 1IO6A 2A37A 2PTKA 2JM9A 1OOTA 5I22A 1AOJA 3EGUA 2L2PA 2LP5A 2M51A 3TSZA 1OPKA 2ED0A 3U23A 3EHRA 2DL5A 2RN8A 3H41A 2LJ3A 3NHNA 2G6FX 1QCFA 2BZ8A 3KFVA 2SEMA 1H92A 1JXMA 2KXDA 2EYYA 2KRMA 1MV3A 2DL3A 4JPBW 4AFQC 1M27C 1UHFA 4J9GA 1GL5A 2DLPA 2K9GA 2IIMA 2K3BA 2M0YA 4CC4B 5IXFA 2KR3A 2AK5A 4HVWA 2K2MA 3IQLA 4RTWA 4D8KA 4DEXA 2V1RA 1FMKA 1U5SA 2RQVA 1RLQC 2CUBA 3M0TA 2O2OA 3M0SA 4F16A 2A08A 1AD5A 2KT1A 3M0PA 3SEMA 1X2QA 1BK2A 1PKSA 2DX1A 2SRCA 3TSWA 1FYNA 1WDXA 2ED1A 1QWEA 4JJDA 1PHTA 3O5ZA 2K6DA 4KRTA 4CC2A 1M8MA 1W1FA 2DNUA 3QWYA 1AWXA 3PVQA 2ENMA 5IHIA 4A63B 3UA7A 1X43A 1UECA 2VKNA 2CUDA 1I1JA 2HBWA 1NG2A 2LQNA 2W10A 5FW9A 1K0SA 1YP5A 1UDLA 2CSIA 1Z9ZA 1QLYA 1J3TA 1NYGA 2CT4A 4JJCA 2DL4A 2DRMA 4J9IA 3H0HA 1JO8A 2PNIA 3CQTA 2L0AA 4JZ4A 1SSHA 1ZUUA 2CREA 1YCSB 2JMCA 1KJWA 2KBTA 2L3SA 1BBZA 2JTEA 2J6OA 2JS2A 4K11A 2EKHA 2DILA 1ZLMA 1SPKA 2EBPA 2FO0A 2EPDA 2GTOA 2B86A 2JM8A 4Z89A 2KEAA 4X1VA 2ECZA 1PRLC 2GTJA 1KIKA 3EG3A 1NM7A 3EG1A 3VS6A 1GCQC 5IHKA 1M30A 2NUZA 2AKLA 2AZSA 2CT3A 2LMJA 4IIMA 2X3WD 2LCSA 2FRWA 4HVVA 2DBKA 2L3PA 4F14A 1HSQA 1ZUKA 4OMPA 4AFSC 1K4US 1PRMC 1WIEA 5GJWB 4AG2C 1UG1A 4LE9A 1WA7A 1UFFA 2HDAA 1ABQA 1E6HA 5GJVB 2EQIA 1CSKA 4GBQA 1E6GA 2EVRA 1WXBA 4RTVA 1AZGB 1WLPB 2CDTA 3C0CA 2KYBA 2J7IA 2ROLA 1ZBJA 2J05A 1GCPA 3NPFA 2K7AA 1NEBA 1X2KA 2DL7A 3I35A 2LQWA 3VRYA 1AZEA 2A28A 2KRNA 2JW4A 2DMOA 2OJ2A 2DM1A 1K76A 4J9BA 3A98A 4OMNA 1QKXA 3REAB 1G2BA 3SHWA 1I07A 4M4ZA 2GNCA 3VS1A 4Z88A 1HJDA 1WFWA 1BB9A 3NMZC 3VS7A 3UA6A 3VS4A 4J9FA 4R0KA 2VVKA 1S1NA 4OMMA 1A0NB 1G83A 1VYUA 2DL8A 4RTXA 2L3QA 2ROTA 4RTYA 2RQRA 2KROA 3H0IA 1Y0MA 1GRIA 2YUNA 1UTIA 2C0IA 3THKA 2DVJA 2C0TA 1UUEA 2W0ZA 2MOXA 1CKAA 2EYWA 2KNBB 4JZ3A 3FJ5A 4AFUC 1W70A 2GGRA 4F17A 4HXJA 2LJ0A 1GCQA 1RUWA 2LX7A 4HCKA 4RTZA 2KYMA 2JT4A 3I5SA 1UGVA 3R6NA 3EG2A 1RI9A 1MUZA 1M3BA 1E7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUO A;  4CC3 A;  4CC7 A;  4ESR A;  2HEQ A;  3GBQ A;  3VS3 A;  4QT7 A;  1HD3 A;  2DBM A;  4FSS A;  2EGA A;  1N5Z A;  4RTU A;  1T3S A;  4J9C A;  5I11 A;  4ORZ A;  2XMF A;  2YUQ A;  2DYB A;  1YWO A;  1TG0 A;  2D0N A;  4DEY A;  3PE0 A;  2LNH B;  1ZUY A;  1WXT A;  5HCK A;  1M3C A;  4OMO A;  2BZX A;  2EW3 A;  2D8H A;  2E5K A;  1I0C A;  1T3L A;  1B07 A;  5L23 A;  2YUP A;  1KFZ A;  1XOV A;  2GBQ A;  1AEY A;  4RUG A;  2PZ1 A;  1JQQ A;  2LJ1 A;  1X69 A;  1U06 A;  2J6K A;  4RTT A;  1VYT A;  3QWX X;  4J9D A;  2BTT A;  1OV3 A;  2CH4 A;  3VS2 A;  1GBR A;  2C0O A;  1GBQ A;  2EYX A;  1KSW A;  2AZV A;  3VS0 A;  1PWT A;  1B3Q A;  2F2V A;  1UJ0 A;  1TUD A;  1VA7 A;  2RPN A;  2D1X A;  5IXB A;  3I9Q A;  2H8H A;  4LUD A;  2RMO A;  1M3A A;  2RQU A;  2KRS A;  1MV0 B;  2YSQ A;  4Z8A A;  4HVU A;  4J9H A;  2FPE A;  2FPF A;  1WI7 A;  2DF6 A;  1SEM A;  1YN8 A;  4AFZ C;  1PNJ A;  1JXO A;  2V1Q A;  2JMA A;  4IIO A;  3RBB B;  1T0J A;  2FPD A;  2RNA A;  3JV3 A;  2OI3 A;  2JXB A;  2DRK A;  1PKT A;  3TVT A;  2J06 A;  3LH5 A;  1UHC A;  1Z9Q A;  3VS5 A;  1W6X A;  2CSQ A;  5IH2 A;  2YDL A;  1H3H A;  3I5R A;  4E6R A;  2J6F A;  3M0R A;  1LCK A;  2I0N A;  2DJQ A;  5ECA A;  1K9A A;  2DE0 X;  5EC7 A;  4LN2 A;  1GFD A;  1SRL A;  1H8K A;  1EFN A;  1OPL A;  2A36 A;  4EIK A;  1T0H A;  1QWF A;  1ZSG A;  1SHF A;  2EGC A;  4LNP A;  1JEG A;  1K0X A;  2EGE A;  1RLP C;  2KE9 A;  2RQW A;  1WXU A;  4WCI A;  2HCK A;  1Y57 A;  1V1C A;  2EYZ A;  2O9S A;  1YNZ A;  1GFC A;  2NWM A;  2FRY A;  2O31 A;  3ULR B;  4AG1 C;  2D8J A;  2K79 A;  2VWF A;  5FWC A;  2ABL A;  1NEG A;  4Y92 A;  2RQT A;  1ZX6 A;  1WYX A;  1SHG A;  5IHN A;  1NYF A;  1QKW A;  2O9V A;  1UE9 A;  1X6B A;  1NLP C;  3EG0 A;  2KGT A;  2X3X D;  1X6G A;  2MCN A;  1UJY A;  1ABO A;  1YWP A;  3REB B;  3EHQ A;  5FWB A;  2FG0 A;  1AWO A;  2F2X A;  2F2W A;  1CKB A;  4JJB A;  2KT8 A;  1K1Z A;  2FEI A;  2ESW A;  4GLM A;  3UAT A;  4OML A;  2MIO A;  3VRZ A;  4D8D A;  1AVZ C;  4ZNX A;  2OAW A;  2RF0 A;  1SRM A;  4OMQ A;  2BZY A;  1OEB A;  3ZL7 C;  3UF4 A;  2KXC A;  1ARK A;  3RNJ A;  1AWJ A;  3PVL A;  1TUC A;  3NGP A;  2YT6 A;  1AWW A;  1WX6 A;  2DA9 A;  1X27 A;  2CH4 W;  2LZ6 B;  4J9E A;  2HSP A;  1NLO C;  4LUE A;  1U3O A;  1VYV A;  2AKK A;  2GQI A;  2P4R A;  2QDL A;  1BU1 A;  2JS0 A;  3H0F A;  3M0U A;  1JU5 C;  3M0Q A;  2O88 A;  1IO6 A;  2A37 A;  2PTK A;  2JM9 A;  1OOT A;  5I22 A;  1AOJ A;  3EGU A;  2L2P A;  2LP5 A;  2M51 A;  3TSZ A;  1OPK A;  2ED0 A;  3U23 A;  3EHR A;  2DL5 A;  2RN8 A;  3H41 A;  2LJ3 A;  3NHN A;  2G6F X;  1QCF A;  2BZ8 A;  3KFV A;  2SEM A;  1H92 A;  1JXM A;  2KXD A;  2EYY A;  2KRM A;  1MV3 A;  2DL3 A;  4JPB W;  4AFQ C;  1M27 C;  1UHF A;  4J9G A;  1GL5 A;  2DLP A;  2K9G A;  2IIM A;  2K3B A;  2M0Y A;  4CC4 B;  5IXF A;  2KR3 A;  2AK5 A;  4HVW A;  2K2M A;  3IQL A;  4RTW A;  4D8K A;  4DEX A;  2V1R A;  1FMK A;  1U5S A;  2RQV A;  1RLQ C;  2CUB A;  3M0T A;  2O2O A;  3M0S A;  4F16 A;  2A08 A;  1AD5 A;  2KT1 A;  3M0P A;  3SEM A;  1X2Q A;  1BK2 A;  1PKS A;  2DX1 A;  2SRC A;  3TSW A;  1FYN A;  1WDX A;  2ED1 A;  1QWE A;  4JJD A;  1PHT A;  3O5Z A;  2K6D A;  4KRT A;  4CC2 A;  1M8M A;  1W1F A;  2DNU A;  3QWY A;  1AWX A;  3PVQ A;  2ENM A;  5IHI A;  4A63 B;  3UA7 A;  1X43 A;  1UEC A;  2VKN A;  2CUD A;  1I1J A;  2HBW A;  1NG2 A;  2LQN A;  2W10 A;  5FW9 A;  1K0S A;  1YP5 A;  1UDL A;  2CSI A;  1Z9Z A;  1QLY A;  1J3T A;  1NYG A;  2CT4 A;  4JJC A;  2DL4 A;  2DRM A;  4J9I A;  3H0H A;  1JO8 A;  2PNI A;  3CQT A;  2L0A A;  4JZ4 A;  1SSH A;  1ZUU A;  2CRE A;  1YCS B;  2JMC A;  1KJW A;  2KBT A;  2L3S A;  1BBZ A;  2JTE A;  2J6O A;  2JS2 A;  4K11 A;  2EKH A;  2DIL A;  1ZLM A;  1SPK A;  2EBP A;  2FO0 A;  2EPD A;  2GTO A;  2B86 A;  2JM8 A;  4Z89 A;  2KEA A;  4X1V A;  2ECZ A;  1PRL C;  2GTJ A;  1KIK A;  3EG3 A;  1NM7 A;  3EG1 A;  3VS6 A;  1GCQ C;  5IHK A;  1M30 A;  2NUZ A;  2AKL A;  2AZS A;  2CT3 A;  2LMJ A;  4IIM A;  2X3W D;  2LCS A;  2FRW A;  4HVV A;  2DBK A;  2L3P A;  4F14 A;  1HSQ A;  1ZUK A;  4OMP A;  4AFS C;  1K4U S;  1PRM C;  1WIE A;  5GJW B;  4AG2 C;  1UG1 A;  4LE9 A;  1WA7 A;  1UFF A;  2HDA A;  1ABQ A;  1E6H A;  5GJV B;  2EQI A;  1CSK A;  4GBQ A;  1E6G A;  2EVR A;  1WXB A;  4RTV A;  1AZG B;  1WLP B;  2CDT A;  3C0C A;  2KYB A;  2J7I A;  2ROL A;  1ZBJ A;  2J05 A;  1GCP A;  3NPF A;  2K7A A;  1NEB A;  1X2K A;  2DL7 A;  3I35 A;  2LQW A;  3VRY A;  1AZE A;  2A28 A;  2KRN A;  2JW4 A;  2DMO A;  2OJ2 A;  2DM1 A;  1K76 A;  4J9B A;  3A98 A;  4OMN A;  1QKX A;  3REA B;  1G2B A;  3SHW A;  1I07 A;  4M4Z A;  2GNC A;  3VS1 A;  4Z88 A;  1HJD A;  1WFW A;  1BB9 A;  3NMZ C;  3VS7 A;  3UA6 A;  3VS4 A;  4J9F A;  4R0K A;  2VVK A;  1S1N A;  4OMM A;  1A0N B;  1G83 A;  1VYU A;  2DL8 A;  4RTX A;  2L3Q A;  2ROT A;  4RTY A;  2RQR A;  2KRO A;  3H0I A;  1Y0M A;  1GRI A;  2YUN A;  1UTI A;  2C0I A;  3THK A;  2DVJ A;  2C0T A;  1UUE A;  2W0Z A;  2MOX A;  1CKA A;  2EYW A;  2KNB B;  4JZ3 A;  3FJ5 A;  4AFU C;  1W70 A;  2GGR A;  4F17 A;  4HXJ A;  2LJ0 A;  1GCQ A;  1RUW A;  2LX7 A;  4HCK A;  4RTZ A;  2KYM A;  2JT4 A;  3I5S A;  1UGV A;  3R6N A;  3EG2 A;  1RI9 A;  1MUZ A;  1M3B A;  1E7O A; 
#chains in the Genus database with same CATH topology
 2PQW A;  2PU9 B;  2YUO A;  4CC3 A;  4E7Z A;  4ZGE B;  3O8V A;  3CD6 T;  2Z0W A;  4DQ2 A;  1Q81 R;  1TOV A;  2HQE A;  1KQ1 A;  2DXC A;  4C92 G;  1T3S A;  3L42 A;  2E1H A;  2CP3 A;  4BI3 A;  2K57 A;  3M57 A;  4ELY C;  2LNH B;  2IG0 A;  2R5A A;  5HCK A;  4OMO A;  1HXD A;  2CZ0 B;  2BZX A;  4BE2 A;  2K3X A;  5GAO r;  1T3L A;  4EDU A;  1Q7Y U;  5HKC A;  3FEO A;  3JCM e;  3CCQ T;  5J3B A;  3LGF A;  3QII A;  1XOV A;  5EG2 A;  4PJO F;  2HQH A;  2LJ1 A;  2J6K A;  4RTT A;  3P8D A;  1C0M A;  1W2B S;  3VS2 A;  2HMA A;  1D0X A;  3LGL A;  4E7S A;  5GAN e;  1MNE A;  1VA7 A;  5IXB A;  2D1X A;  4M78 A;  4M7D D;  3HHT B;  1VQ6 T;  5I2S A;  3HFO A;  4F7U B;  4LUD A;  1MV0 B;  2YSQ A;  4HVU A;  5CO7 A;  2FPE A;  1WI7 A;  4KUI A;  2DER A;  2HSE B;  3I56 A;  3OYJ A;  4AFZ C;  4OGE A;  4M7D A;  3CCR Q;  4C0D B;  3RBB B;  4M7A B;  2QQA A;  2JXB A;  1PKT A;  2J06 A;  3QYG B;  1H3H A;  4E6R A;  4OMF B;  2I0N A;  5KYY A;  3WVD B;  5ECA A;  4M75 G;  2QEX T;  2CP5 A;  4F7U F;  4LN2 A;  2VGN A;  1GFD A;  2A36 A;  4FT2 A;  1YI2 A;  5FU7 C;  3JCM b;  2DK3 A;  4B9W A;  1KC8 C;  1WXU A;  2BKD N;  1I8F A;  2WSE E;  2AIR B;  5GAO l;  5I21 A;  4WCI A;  3CC4 Q;  3CCL A;  2O9S A;  1YNZ A;  3PFS A;  2E6Z A;  1VIE A;  2M1H A;  2ZPB B;  1Q81 U;  2QAZ A;  3EGX A;  2K79 A;  2VWF A;  5FWC A;  4C92 B;  3OY9 A;  2ABL A;  1QCN A;  2RQT A;  3L2Q A;  1BCO A;  3CEY A;  1TS9 A;  2PUK B;  5IHN A;  1NYF A;  2O01 E;  1NLP C;  3N5B B;  1VQL T;  3CCR A;  3JCM J;  3DKM A;  2X51 A;  1IRE B;  5CKH A;  2E12 A;  3EHQ A;  2VUB A;  1YIT A;  1MND A;  2RI2 A;  3RKY A;  3JAM E;  2CYZ B;  2JZ2 A;  4XTY A;  3X26 B;  4QVZ A;  5GAM f;  1AWO A;  1X75 C;  2F2W A;  2DO3 A;  2Y4Y A;  1V76 A;  4JJB A;  4BE1 A;  2L8D A;  3MKD A;  2MIO A;  1WHK A;  5GAN h;  3VRZ A;  4E7I A;  1VQ8 T;  2OAW A;  4XQ3 A;  2RF0 A;  2QTX A;  3UDC A;  2BZY A;  2KVQ G;  3JCM h;  5AT1 B;  3L2V A;  5KYU B;  3RNJ A;  1AWJ A;  1QMC A;  3DLM A;  4M77 F;  1Q81 C;  2YT6 A;  1R0B G;  4Y28 E;  1PD1 A;  2QG9 B;  4A4G A;  4M7A G;  2EQM A;  1XTD A;  2Y90 A;  3HRS A;  2HSP A;  3OYF A;  3QYH B;  2GQI A;  4PJO E;  4LDU A;  4MML A;  3H0F A;  4BE0 A;  3JB9 G;  3JCM V;  1YIT T;  4R55 A;  2MWO A;  2L2P A;  3VU3 C;  1YIJ A;  2E3I A;  3EFS A;  2RN8 A;  3H41 A;  4BUG A;  2RHI A;  3BW1 A;  1RAB B;  2G6F X;  2BZ8 A;  4IUP A;  2DD4 A;  5KCH A;  4Z02 A;  4M78 E;  1JXM A;  2KXD A;  5CK9 A;  1MV3 A;  1D3B B;  2K5F A;  3TQ7 P;  1M27 C;  5KE2 A;  3CCU A;  5J26 A;  3ZBD A;  4M75 D;  2F5T X;  1X6O A;  4J9G A;  3CME A;  1Q82 R;  3ASK A;  2GF7 A;  2RHZ A;  4CC4 B;  2KR3 A;  2FZK B;  4J8O A;  3OMC A;  3CCV Q;  1YJ9 T;  3CCL T;  2ZPF B;  3QXE B;  3TRE A;  2E70 A;  2BIV A;  2COZ A;  2DZ9 A;  4DA4 A;  5FRM A;  1U5S A;  1RLQ C;  1BKB A;  2O2O A;  1AD5 A;  3SEM A;  1FMW A;  4YTL A;  3PIP A;  4M77 E;  1PKS A;  2DX1 A;  2SRC A;  3C95 A;  2CP6 A;  3LWH A;  2ED1 A;  5A2Q E;  1QWE A;  4JJD A;  3V8J A;  3JSC A;  2EQJ A;  4BD3 A;  2XDD A;  3CCE T;  4HA8 A;  3RKX A;  4AT1 B;  4C8Q B;  5IN1 A;  2LQ8 A;  1D3B A;  2OTJ T;  3PVQ A;  3A8O B;  1RAD B;  5IHI A;  1WQW A;  1VIF A;  3FB9 A;  4M78 G;  1YJ9 Q;  3G1J A;  5KYX B;  1VUB A;  3G6E A;  2CUD A;  1I1J A;  2JVV A;  2W10 A;  1YP5 A;  3OYI A;  1UDL A;  1Y07 A;  2KI7 A;  2ZGW A;  1QLY A;  3PIO A;  1NZ9 A;  3KUF A;  5KYW B;  5HY6 A;  3JB9 I;  1OZ3 A;  5GAN 4;  1ZUU A;  1BIA A;  2VC8 A;  1YCS B;  2JMC A;  1VQN Q;  1BI2 A;  5FLX E;  1MMN A;  1BBZ A;  4KUL A;  1VQ4 A;  3MP8 A;  5M9O A;  2EBP A;  1N6A A;  2EPD A;  5C6S A;  4C8Q E;  4ATO A;  4Z89 A;  3M4G A;  5FRO A;  3R6O A;  1M1G A;  1KIK A;  4GLK A;  4XAX B;  5GMK j;  3M9Q A;  3VS6 A;  3EAE A;  1M30 A;  4II1 A;  2NUZ A;  3SDZ A;  2AKL A;  2CT3 A;  4IIM A;  2X3W D;  2M9U A;  1TSF A;  2ZPG B;  3OYN A;  2D9T A;  5CAI A;  2WAC A;  1OX8 A;  4F14 A;  2QEX Q;  3MEU A;  4OMP A;  4AFS C;  1N8R R;  1XJW B;  4AG2 C;  5KYW A;  1UG1 A;  4JLG A;  1UFF A;  1PSF A;  1WJQ A;  5GJV B;  2GFU A;  1UB4 A;  2EVR A;  1WXB A;  4J83 A;  1AZG B;  1OQK A;  3C0C A;  2KYB A;  2K7A A;  1AZE A;  3VRY A;  2A28 A;  1ZSZ B;  2DMO A;  1S72 T;  3S6W A;  1WJR A;  3HRU A;  1K76 A;  1MMG A;  2YHT A;  1BI0 A;  3EG9 A;  3E9G A;  1PG5 B;  4XTZ A;  3MEW A;  3HKS A;  3SHW A;  2X9H A;  2GNC A;  4PLI A;  3RMS A;  3V7C A;  2FZC B;  3GIB A;  1JBM A;  4C8Q G;  1TU0 B;  3UA6 A;  1RAG B;  3CBM A;  4R0K A;  3LWI A;  1LJO A;  1VYU A;  4QQ6 A;  3E2U A;  4RTY A;  2KRO A;  3H0I A;  1WHH A;  1Y0M A;  2EWN A;  1KQ2 A;  3S3M A;  1TWB A;  2C0I A;  1WQ7 A;  1SG5 A;  3EGD B;  1ZSZ A;  3FJ5 A;  3FLG A;  1M2V B;  3CCJ T;  4HXJ A;  1UGR B;  3EG9 B;  1BCM A;  1PM3 A;  3INZ A;  3GNF B;  4OB3 B;  3UWN A;  2KYM A;  3X25 B;  4J6W A;  1E7O A;  2RK1 A;  3H9N A;  1QVF A;  1M5Q 1;  2EGA A;  1N5Z A;  3RIR A;  1QCO A;  4XTW A;  5I11 A;  4V2S A;  1ZBX A;  2LC4 A;  2XDP A;  1TG0 A;  4ELZ C;  2FVU A;  1U1S A;  4PLL A;  1ZUY A;  1WXT A;  1M3C A;  2QQ9 A;  2EW3 A;  4LXC A;  3EGD A;  1I0C A;  4EMK A;  3M53 A;  3L2Z A;  5L23 A;  1M90 C;  1NJI C;  1VQ5 T;  1UGP B;  4RUG A;  5FU6 C;  1VQ7 A;  1X69 A;  1U06 A;  1G5V A;  1VYT A;  3OS0 A;  4J9D A;  3OYB A;  1RL2 A;  4M7D G;  3EFR A;  2XG8 D;  4CRI A;  1GBQ A;  2NUT A;  1BI1 A;  2AZV A;  4OGC A;  1PWT A;  1UJ0 A;  5D6X A;  1TUD A;  5A0G A;  2E10 A;  2RPN A;  3A8H B;  2VYT A;  3I9Q A;  1M3A A;  1QW1 A;  3X24 B;  2OTL Q;  2VV5 A;  3P8H A;  1VQ7 T;  2DF6 A;  1SEM A;  3CCR T;  3CXC A;  4EPC A;  4EMK B;  3VYH B;  1B34 A;  1PNJ A;  4JUV A;  4XU1 A;  4PL6 A;  1T0J A;  2RNA A;  3CPW A;  2LTO A;  1R77 A;  1LNX A;  2DYI A;  4NOY A;  1UGS B;  1UHC A;  4HCC A;  1I81 A;  3OYK A;  2E3H A;  3L1A A;  2QAS A;  4A54 A;  1N8R C;  2MYS A;  1N9S A;  5CKE A;  3I5R A;  2J6F A;  1VQ9 Q;  1NBE B;  3M0R A;  1U1T A;  2DJQ A;  3M5A A;  3MHX A;  3HL8 A;  4A4H A;  2DE0 X;  3SWN C;  3CCM A;  1H8K A;  1EFN A;  1OPL A;  4EIK A;  4WF2 A;  1T0H A;  3HPW A;  5LJ5 d;  1TUG B;  1SHF A;  3CXC P;  4ZN3 A;  2EGE A;  2RQW A;  4C8Q A;  2QDY B;  3ER0 A;  2EQK A;  5LJ5 f;  3OYE A;  4C5I A;  1YI2 Q;  2QQS A;  4BY6 C;  1Y57 A;  1V1C A;  3S3N A;  4M7A D;  1RAF B;  2FRY A;  2O31 A;  1Q86 U;  4AG1 C;  2QTV A;  1W2B A;  1WZO A;  1NEG A;  4M78 D;  4Y92 A;  5FU7 B;  1RAH B;  2JUF A;  1YIJ T;  3HP9 A;  3CD6 Q;  2QI2 A;  2O9V A;  2RHU A;  1X6B A;  3BY7 A;  1EX4 A;  1TXQ A;  4WTO B;  3M56 A;  3SFM A;  3AT1 B;  3NTI A;  3M55 A;  2CZ6 B;  3RUX A;  2K4Y A;  1YWP A;  3MEV A;  3OYC A;  3LX7 A;  4C92 F;  5DM7 R;  3REB B;  1QVG A;  4BY6 B;  7AT1 B;  1KHC A;  2D6F A;  1M90 U;  3J7A F;  4X9C A;  1YI2 T;  2F2X A;  1VQ7 Q;  2KT8 A;  5I2M A;  1Y7X A;  2R58 A;  2FEI A;  2MWP A;  4XTU A;  3UAT A;  2RI5 A;  1VQK A;  4JRP A;  3PTA A;  1AVZ C;  2P84 A;  3GLX A;  3SWN B;  2MK5 A;  4JDS A;  3M4Y A;  3QBY A;  3JCM g;  1QP2 A;  3UF4 A;  2DVE A;  3CMA A;  3G71 Q;  1AWW A;  1WX6 A;  4Y91 A;  1X27 A;  1X01 A;  4LUE A;  1U3O A;  1VYV A;  3VUB A;  1M1K R;  3C94 A;  4PFO A;  4LD9 K;  2QDL A;  1BU1 A;  2FB7 A;  3M0Q A;  4IUU A;  4IUQ A;  2ZPH B;  2JM9 A;  1SF9 A;  4F04 B;  1OOT A;  2YLC A;  5I22 A;  3CD6 A;  1FWZ A;  1NPR A;  1RAI B;  3TSZ A;  2KSS A;  3U23 A;  1OX9 A;  4RKU E;  2DL5 A;  2DFU A;  3L2U A;  3SWN A;  3OYY A;  4O5V A;  2GFA A;  2HL5 C;  2K5I A;  2XKO C;  4ZTJ A;  2EYY A;  2KRM A;  4ZTF A;  3CCM Q;  1OU8 A;  4FW2 A;  1RAA B;  1GL5 A;  1G3S A;  5GMK e;  2K3B A;  3C12 A;  4EMK C;  5LJ5 j;  1VQ4 Q;  2K2M A;  4RTW A;  2FYK A;  1JJ2 P;  5FU6 B;  4EMG A;  4DEX A;  1K9M R;  2V1R A;  5LJ3 h;  2XDB A;  8ATC B;  3CCL Q;  3CC4 A;  4FYW B;  2RQV A;  1VQ6 Q;  1ACM B;  3DLL A;  4F16 A;  3M0P A;  1X2Q A;  3JCM Q;  1BK2 A;  4M75 C;  3J81 E;  1FYN A;  2MAM A;  1YJW Q;  1PHT A;  5GMK l;  4JRI A;  3O5Z A;  2IPO B;  4UC4 A;  5LJ5 g;  2DNU A;  4MDX A;  5GAN 7;  1M8V A;  2DXT A;  1QVF S;  3UA7 A;  2V8I A;  2P0K A;  3OYH A;  2QYZ A;  2VKN A;  2HBW A;  1NG2 A;  3QG1 A;  3MEA A;  5GAO q;  2ZPI B;  2EQU A;  2RH2 A;  1Z9Z A;  4N4G A;  1FX7 A;  3G6E Q;  2DL4 A;  1VQL Q;  4J6X A;  2QGF B;  4JLI A;  5CCA A;  2NLU A;  2CRE A;  4C5G A;  1R0C B;  2L3S A;  1VQP T;  1QVF P;  2EKH A;  4A4F A;  2E41 A;  2X4J A;  1SKU B;  2FO0 A;  2RM4 A;  3CCS T;  1H3Z A;  4B9X A;  2JM8 A;  2X4X A;  2KEA A;  4X1V A;  1VQ5 Q;  4M75 A;  5LJ3 d;  4M75 E;  1IXD A;  3EG3 A;  3OSV A;  3I55 A;  3V8K A;  2ZZD A;  2MPX C;  4HVV A;  5CKD A;  2DBK A;  3G4S Q;  5HK3 A;  3CCQ A;  2P0P A;  1OZ2 A;  2RJD A;  1K4U S;  1D1A A;  1WIE A;  5GJW B;  4FCY A;  4LE9 A;  1W4S A;  1JJ2 S;  4J6Y A;  1ABQ A;  1B34 B;  3OW2 S;  5D6W A;  3T9N A;  1IZ6 A;  4M78 F;  1CSK A;  5GMK h;  2RJE A;  1I4K 1;  4PJO D;  4M7A F;  3BDU A;  3HFN A;  4M77 D;  2DL7 A;  3I35 A;  4M7D E;  2LQW A;  2JW4 A;  2RB6 A;  5GMK i;  1K9M U;  3MET A;  1S72 Q;  4IKF A;  3A98 A;  4OMN A;  4M78 C;  2WSC E;  1QKX A;  3DB3 A;  5GAN 6;  3HSB A;  1G2B A;  4A53 A;  4LD6 A;  5KE3 A;  2L89 A;  4Z88 A;  5AYF A;  1HJD A;  1KQS S;  4BDZ A;  1BI3 A;  3VS7 A;  1EZZ B;  1KQS A;  4OMM A;  1VQK T;  4RTX A;  2L3Q A;  2OX7 A;  2ROT A;  5FRN A;  4M78 B;  3CC2 T;  2CKK A;  4LDW A;  2BE7 D;  4F7U A;  1UTI A;  3QDR B;  3THK A;  1M2O A;  5CQX A;  2E4H A;  4PJO B;  4L59 A;  2MOX A;  3RDV A;  3G4S A;  2KNB B;  4JZ3 A;  3NTK A;  3CCQ Q;  5CKB A;  4J7I A;  2GGR A;  3ZEH A;  4F17 A;  3L2R A;  4HT9 A;  3A5Z B;  2E65 A;  1QVG S;  4LDY A;  5GAN 2;  2JT4 A;  1RI9 A;  1M3B A;  1IHW A;  1K73 C;  4ESR A;  4J7F A;  2YRC A;  3CBO A;  3VS3 A;  1YIJ Q;  4QT7 A;  4A4K A;  4FSS A;  1YJN Q;  1WJS A;  2LCL A;  4RTU A;  2PVG B;  2KY9 A;  4LDX A;  2XMF A;  1D1C A;  5LJ3 e;  1VQ5 A;  3OA6 A;  2D8H A;  2EIF A;  2K5L A;  1RI0 A;  2R5M A;  3E19 A;  3DB4 A;  3HTR A;  1KFZ A;  5GAM g;  1JQQ A;  2M16 A;  2QK0 A;  2E5Q A;  4C8Q C;  4QQD A;  4KH0 B;  1OV3 A;  1GBR A;  1D1B A;  2C0O A;  1UEB A;  2XU8 A;  4Q5W A;  4IUR A;  3CXC S;  1KSW A;  4N0A C;  3C4S A;  3VS0 A;  2WSF E;  2MF2 A;  5KH6 A;  4NL3 A;  1YJN T;  2JTM A;  3AHU A;  2V8K A;  5LJ3 g;  1LOJ A;  2H8H A;  3TCJ A;  2RMO A;  4Z8A A;  3TEE A;  2RD1 A;  2NUT B;  4OB1 B;  4PJJ A;  1VQ4 T;  2F69 A;  3OW2 P;  1JXO A;  2V1Q A;  1WHJ A;  2JMA A;  3I55 Q;  2FPD A;  3JV3 A;  4FIB A;  4N4I A;  2OI3 A;  4MDW A;  4C92 E;  3FC3 A;  2YXY A;  3EFO A;  2CGH A;  4L6V 5;  5GAM j;  5IH2 A;  3CBP A;  2G3R A;  1XNI A;  4PJO G;  1LCK A;  2LX9 A;  1IB8 A;  3P8B B;  1Q7Y C;  2C06 A;  1VQK Q;  4XTV A;  3OS2 A;  1TTH B;  2AT1 B;  5EC7 A;  1SRL A;  1ZSG A;  3OYL A;  4FSX A;  2LT1 A;  3V7S A;  2KMT A;  2P0Q A;  2ZCF B;  3QJ6 A;  3QJY A;  1RLP C;  3TU4 K;  4E7H A;  2V8J A;  1YJW A;  2HCK A;  2EYZ A;  1GFC A;  1WHL A;  3J80 E;  6AT1 B;  2EKO A;  4N4H A;  3CCU T;  2DTH A;  1SHG A;  1HK9 A;  1QKW A;  4XU3 A;  1BYM A;  4KT0 E;  2V26 A;  5DLQ E;  2KGT A;  2X3X D;  1X6G A;  4C92 C;  1UJY A;  5GAN 8;  2LNV A;  2F1L A;  3H6Z A;  4ZN1 A;  1KD1 R;  1Q82 C;  1M4Z A;  2JOY A;  2FG0 A;  1YBY A;  2A7Y A;  4M7D B;  2LQK A;  4FM4 B;  5GAM e;  3VV0 A;  1VQN A;  4GLM A;  1K8A R;  4OML A;  4KGV B;  4E2F B;  3CC7 A;  1VQM A;  4MZT A;  3CC2 Q;  4D8D A;  3UPU A;  4ZNX A;  1ZSZ C;  1KHI A;  1JJ2 A;  4NS5 A;  1SRM A;  3CC7 Q;  1MMD A;  2JJ9 A;  3CPW S;  1M9S A;  4PK4 A;  4JRQ A;  5DLO A;  1MGQ A;  2KXC A;  3JCM P;  3VJP A;  1ARK A;  2PVO B;  1P92 A;  3NGP A;  1JRI A;  5GAN j;  2EJG A;  2DA9 A;  3QZ5 B;  2FL7 A;  5CR2 A;  2CH4 W;  4J9E A;  5KYX A;  3G71 A;  5KYN A;  3QUI A;  4PFZ A;  4MZP A;  2QEX A;  5DY9 A;  2P4R A;  4QVD A;  2L5Q A;  3ZFJ A;  2JS0 A;  3M0U A;  1JU5 C;  3OBW A;  1IO6 A;  4M7D F;  3EH2 A;  3EGU A;  3OYA A;  2M51 A;  1VQP Q;  3EHR A;  5GAN g;  4CI0 C;  1ZQ1 A;  3EGX B;  1VQN T;  2LJ3 A;  2VAS A;  5J39 A;  3NHN A;  2A0F B;  4JRK A;  2HBP A;  5GAN 5;  1K8A C;  2DL3 A;  3G6E T;  1LVK A;  1UHF A;  5GAM h;  1IGU A;  2K9G A;  5IXF A;  1KD1 C;  4FYV B;  3GNG A;  1FXX A;  1MMA A;  3IQL A;  1YHQ T;  3A1P A;  4D8K A;  3EH1 A;  2FZG B;  3X28 B;  3KBG A;  1VQO Q;  2CUB A;  3M0S A;  2A08 A;  1H64 1;  1YJW T;  1WGS A;  3MCA B;  3PMI A;  4XK8 E;  1WDX A;  2OTJ A;  4ZGD B;  2RHY A;  4KRT A;  1PCX A;  5KYU A;  3OS1 A;  2RHX A;  1YHQ A;  4C5H A;  1W1F A;  3QWY A;  1O9S A;  3CME Q;  4R56 A;  4A63 B;  1I5O B;  1XQH A;  2L3R A;  1UEC A;  4JS5 A;  1K0S A;  4XU2 A;  2JNG A;  2HZY A;  2CT4 A;  1FMV A;  2DRM A;  2H3E B;  3LH0 A;  4J9I A;  3A8L B;  1VQP A;  1JO8 A;  4XU0 A;  2VGM A;  2PNI A;  3CQT A;  1U8R A;  4QQG A;  2L0A A;  1SSH A;  4PNO A;  3M58 A;  3E1S A;  1KJW A;  2KDS A;  1V29 B;  2LCC A;  3CCS A;  2J6O A;  3CMA Q;  2YWW A;  1KD1 U;  4K11 A;  2NUP B;  2LDM A;  1ZLM A;  4C0Z A;  2RJF A;  5GAN d;  5L8R E;  2DTO A;  2GTO A;  3QSU A;  1VQO T;  1JB0 E;  1PC0 A;  1PRL C;  3HRT A;  4DBH A;  2GTJ A;  4B6M A;  4C5E A;  1GCQ C;  1M2V A;  2RK2 A;  4L5G A;  3CCV T;  1OI1 A;  5LJ3 f;  2B8A A;  2NYS A;  1BIB A;  4C8Q D;  2FRW A;  3A8G B;  4HKE A;  1WPY A;  2HKQ B;  2BE9 B;  1ZUK A;  1I5L A;  1D0Y A;  2QQB A;  3CC2 A;  2CP2 A;  1KC8 U;  5GAO n;  5LJ3 j;  3E9F A;  1HYO A;  4LDV A;  2EQI A;  4PFP A;  4GBQ A;  2DTI A;  1WLP B;  4GY5 A;  3BDL A;  2CDT A;  4FYX B;  4M75 F;  5CKF A;  1ZBJ A;  2J05 A;  3NPF A;  4RCB A;  1NEB A;  1R8O B;  2OJ2 A;  3LLR A;  3BFM A;  3ME9 A;  3PGG A;  1Y96 A;  1WHM A;  1K9M C;  4DBQ A;  1S72 A;  5IAY A;  4M4Z A;  2DIG A;  3VS1 A;  4KUD K;  2ZAE A;  3QPH A;  3CCS Q;  2DJZ A;  3NMZ C;  2AHJ B;  4J9F A;  2XI9 A;  1A0N B;  1NE8 A;  3L2W A;  3RER A;  1UGQ B;  1D09 B;  1M90 R;  2HD0 A;  1GRI A;  3G4S T;  2IVW A;  2O4X A;  2DVJ A;  2C0T A;  1UUE A;  1QQJ A;  2W0Z A;  2EYW A;  4FYY B;  2CS7 A;  3MO8 A;  2P4T A;  2ZPE B;  2QA4 T;  1Y96 B;  2A3L A;  3GOX A;  2LJ0 A;  1G3W A;  2X4Y A;  2DXU A;  2LX7 A;  2XID A;  5LJ5 h;  4RTZ A;  3I5S A;  1M1K C;  3QDF A;  4PJO A;  4D6W A;  3R6N A;  5CQY A;  3EG2 A;  3VUZ A;  2LT4 A;  1MUZ A;  1NJI U;  4TVR A;  4BI8 B;  2OTJ Q;  4QW2 A;  4CC7 A;  2HEQ A;  3GBQ A;  1HD3 A;  1OYX A;  4JS4 A;  1YFN A;  2DBM A;  2HAX A;  3JCM f;  1MHN A;  4J9C A;  4ORZ A;  3H8Z A;  4MMK A;  2YUQ A;  2DYB A;  1YWO A;  3WXM B;  2D0N A;  4DEY A;  3PE0 A;  4C0G A;  2R57 A;  3I55 T;  1VOM A;  5A0L A;  2E5K A;  3LW5 E;  1B07 A;  8AT1 B;  1VQ6 A;  2HKN A;  2DIQ A;  2YUP A;  3JB9 J;  2GBQ A;  1AEY A;  1SSF A;  2PZ1 A;  4M7A C;  2M0O A;  4F7U E;  1RAE B;  2HQX A;  1KC8 R;  3QWX X;  2E6N A;  2EFI A;  4OF1 A;  2BTT A;  2CH4 A;  3OS5 A;  2EYX A;  3MPU B;  1VQ9 A;  1Q82 U;  1NPP A;  3QHS A;  4J5Y A;  1B3Q A;  2DEQ A;  2F2V A;  4KBM B;  2EJF A;  2VXE A;  4DBR A;  3OMG A;  1GXI E;  3GPL A;  2EYQ A;  1Q86 C;  2H3J A;  2RQU A;  2KRS A;  2X4W A;  3VYG A;  3WVE B;  4J9H A;  2FPF A;  4BDY A;  4X9D A;  4E47 A;  1YIT Q;  3F70 A;  1YN8 A;  3FDR A;  2Y4X A;  4IIO A;  3OBY A;  4ME7 A;  3MP6 A;  1YJ9 A;  2DRK A;  3TVT A;  3LH5 A;  1Z9Q A;  3VS5 A;  2VB6 A;  4M7D C;  1W6X A;  2CSQ A;  3FRN A;  3QKJ A;  2YDL A;  3G7Z A;  1VQL A;  2XIC A;  2DXB A;  4RMO A;  2XHC A;  3CPF A;  3V8L A;  3X20 B;  1N8R U;  3JCM d;  1K9A A;  2JTF A;  2FHD A;  3JCM X;  2DZC A;  3EFO B;  1QWF A;  5IT9 E;  5GAO m;  4M77 C;  4OB0 B;  1JEG A;  2EGC A;  4LNP A;  1K0X A;  4PJL A;  4QKU A;  2KE9 A;  4DBF A;  5LJ5 e;  3PMT A;  3MJX A;  3QO3 A;  5LL6 S;  3G71 T;  2QXF A;  2CZ1 B;  2ATC B;  4C0F A;  3OSS C;  2NWM A;  3ULR B;  2D8J A;  4HT8 A;  4PJM A;  3JB9 F;  1ZX6 A;  1WYX A;  1VQ8 Q;  1UE9 A;  3CCU Q;  1VQ8 A;  3EG0 A;  3I56 T;  4FU6 A;  2MCN A;  4E7K A;  1G3T A;  3JRZ A;  1ABO A;  2HNI A;  1K73 R;  3CCJ A;  4M77 A;  5GAM d;  3CC4 T;  3FIF A;  2HL3 A;  2KK4 A;  1RAC B;  5FWB A;  3PNW C;  4QVC A;  1CKB A;  1NJI R;  4OB2 B;  1K1Z A;  5D6Y A;  3S3O A;  2DPP B;  2ESW A;  4RG8 A;  1QVG P;  4ZGJ B;  2OAU A;  3A8M B;  1ZA1 B;  1QP3 A;  2XK0 A;  1G3Y A;  1IGQ A;  3CMA T;  4OMQ A;  1OEB A;  3CC7 T;  2RJC A;  1QVP A;  4BI4 A;  4DOW A;  3ZL7 C;  3PVL A;  1VQ9 T;  1TUC A;  3MP1 A;  2QGG A;  2QA4 A;  3GP8 A;  3M59 A;  2LZ6 B;  1KK7 A;  1NLO C;  1EIF A;  2AKK A;  5HK0 A;  2O88 A;  1KQS P;  2A37 A;  2PTK A;  1LPL A;  2PUO B;  1AOJ A;  4MZM A;  2RI3 A;  1YCY A;  2LP5 A;  3I56 Q;  3OYD A;  1OPK A;  2ED0 A;  2DAQ A;  2GCX A;  1YJN A;  1N9R A;  2MMP A;  1DJ7 B;  3KFV A;  1QCF A;  3RKW A;  2SEM A;  1H92 A;  3CCE Q;  4E7L A;  3JCM c;  4JPB W;  4AFQ C;  4M7A A;  4OP0 A;  3OYM A;  2DLP A;  3CCE A;  2IIM A;  2M0Y A;  4EMH A;  3CCJ Q;  2AK5 A;  4HVW A;  3NFC A;  1PSE A;  9ATC B;  2K2V A;  3CME T;  3CPW P;  3SB2 A;  4C8Q F;  1FMK A;  2E64 A;  2CP0 A;  5KYY B;  2O4X B;  3M0T A;  4FW1 A;  2KT1 A;  5GAO p;  3V7R A;  1OUL A;  3NTH A;  3TSW A;  3CCM T;  4NL2 A;  5KCO A;  2GQV A;  2VXF A;  3RES A;  4PJO C;  2K6D A;  3JCM W;  4C0D C;  2KAF A;  4CC2 A;  1M8M A;  2XD0 A;  1AWX A;  2CZ7 B;  5CIU A;  1Y71 A;  4DOV A;  4OVA A;  2ENM A;  4C92 D;  3JB9 H;  1X43 A;  1YHQ Q;  1F1B B;  4C92 A;  2OTL A;  2I2L A;  4JJN K;  2LQN A;  2QQR A;  5FW9 A;  2LRQ A;  2CSI A;  5A0D A;  1ZA2 B;  2MI6 A;  1KG1 A;  1J3T A;  1NYG A;  3FJP A;  1AT1 B;  2DEU A;  4JJC A;  4RG2 A;  1TH7 A;  3H0H A;  2COY A;  2RO0 A;  3SD4 A;  5C0M A;  4JZ4 A;  3UT1 A;  1PD0 A;  1B7T A;  2YRV A;  2KBT A;  2YLB A;  2JTE A;  1D0Z A;  1O75 A;  5GAN 3;  2LVM A;  4M77 G;  4O6J A;  4KGX B;  2JS2 A;  3OQ5 A;  3RR6 A;  3URG A;  2DIL A;  1AHJ B;  1SPK A;  1IHV A;  2QA4 Q;  2EAY A;  2B86 A;  1C6V X;  2ECZ A;  4FL6 A;  4IUV A;  1NM7 A;  3EG1 A;  3Q1J A;  5IHK A;  1M1F A;  1IRX A;  1Q86 R;  2AZS A;  2LMJ A;  4FT4 A;  1VQM T;  2D0Q B;  4E7J A;  3LYI A;  4KGZ B;  1Q7Y R;  2LCS A;  3OB9 A;  2NUP A;  2L3P A;  3PT9 A;  3RMQ A;  1HSQ A;  2JN0 A;  3VKI A;  1PRM C;  4X34 A;  1WA7 A;  2COW A;  2HDA A;  4KH1 B;  1E6H A;  1Q95 G;  3JB9 D;  1E6G A;  4RTV A;  2CP7 A;  2J7I A;  2ROL A;  2DKG A;  1GCP A;  1N27 A;  2RA2 A;  1X2K A;  2KRN A;  2DM1 A;  4J9B A;  4F7U G;  4PJN A;  2K3Y A;  2PVD B;  1VQM Q;  4ANJ A;  3QZ9 B;  3M54 A;  1OU9 A;  3REA B;  1K73 U;  4XTX A;  4IUT A;  1I07 A;  4N0A A;  3OYG A;  3CCV A;  2OTL T;  5D7U A;  1W2B P;  1WFW A;  1BB9 A;  2F5K A;  3D7S B;  3VS4 A;  2X35 A;  4RCC A;  2VVK A;  1S1N A;  1G83 A;  1K8A U;  4HCZ A;  1G8X A;  2DL8 A;  4M7A E;  2RQR A;  3GF5 A;  2BUD A;  1M1K U;  2YUN A;  2DD5 A;  4AMC A;  1WNL A;  2M02 A;  3KXT A;  1C1A A;  5GAN f;  1CKA A;  4BAC A;  4M75 B;  4AFU C;  3BE3 A;  5CVI A;  1W70 A;  4HCB A;  4A4E A;  1VQO A;  2DET A;  2YRD A;  4PKC C;  4BB7 A;  1ZHI A;  2EJ9 A;  5GMK m;  1GCQ A;  1RUW A;  4HCK A;  2KQW A;  4P5N A;  3OW2 A;  1WHG A;  4VUB A;  1UGV A;  4M77 B; 
#chains in the Genus database with same CATH homology
 2YUO A;  4CC3 A;  4CC7 A;  4ESR A;  2HEQ A;  3GBQ A;  3VS3 A;  4QT7 A;  1HD3 A;  2DBM A;  4FSS A;  2EGA A;  1N5Z A;  4RTU A;  1T3S A;  4J9C A;  5I11 A;  4ORZ A;  2XMF A;  2YUQ A;  2DYB A;  1YWO A;  1TG0 A;  2D0N A;  4DEY A;  3PE0 A;  2LNH B;  1ZUY A;  1WXT A;  5HCK A;  1M3C A;  4OMO A;  2BZX A;  2EW3 A;  2D8H A;  2E5K A;  1I0C A;  1T3L A;  1B07 A;  5L23 A;  2YUP A;  1KFZ A;  1XOV A;  2GBQ A;  1AEY A;  4RUG A;  2PZ1 A;  1JQQ A;  2LJ1 A;  1X69 A;  1U06 A;  2J6K A;  4RTT A;  1VYT A;  3QWX X;  4J9D A;  2BTT A;  1OV3 A;  2CH4 A;  3VS2 A;  1GBR A;  2C0O A;  1GBQ A;  2EYX A;  1KSW A;  2AZV A;  3VS0 A;  1PWT A;  1B3Q A;  2F2V A;  1UJ0 A;  1TUD A;  1VA7 A;  2RPN A;  2D1X A;  5IXB A;  3I9Q A;  2H8H A;  4LUD A;  2RMO A;  1M3A A;  2RQU A;  2KRS A;  1MV0 B;  2YSQ A;  4Z8A A;  4HVU A;  4J9H A;  2FPE A;  2FPF A;  1WI7 A;  2DF6 A;  1SEM A;  1YN8 A;  4AFZ C;  1PNJ A;  1JXO A;  2V1Q A;  2JMA A;  4IIO A;  3RBB B;  1T0J A;  2FPD A;  2RNA A;  3JV3 A;  2OI3 A;  2JXB A;  2DRK A;  1PKT A;  3TVT A;  2J06 A;  3LH5 A;  1UHC A;  1Z9Q A;  3VS5 A;  1W6X A;  2CSQ A;  5IH2 A;  2YDL A;  1H3H A;  3I5R A;  4E6R A;  2J6F A;  3M0R A;  1LCK A;  2I0N A;  2DJQ A;  5ECA A;  1K9A A;  2DE0 X;  5EC7 A;  4LN2 A;  1GFD A;  1SRL A;  1H8K A;  1EFN A;  1OPL A;  2A36 A;  4EIK A;  1T0H A;  1QWF A;  1ZSG A;  1SHF A;  2EGC A;  4LNP A;  1JEG A;  1K0X A;  2EGE A;  1RLP C;  2KE9 A;  2RQW A;  1WXU A;  4WCI A;  2HCK A;  1Y57 A;  1V1C A;  2EYZ A;  2O9S A;  1YNZ A;  1GFC A;  2NWM A;  2FRY A;  2O31 A;  3ULR B;  4AG1 C;  2D8J A;  2K79 A;  2VWF A;  5FWC A;  2ABL A;  1NEG A;  4Y92 A;  2RQT A;  1ZX6 A;  1WYX A;  1SHG A;  5IHN A;  1NYF A;  1QKW A;  2O9V A;  1UE9 A;  1X6B A;  1NLP C;  3EG0 A;  2KGT A;  2X3X D;  1X6G A;  2MCN A;  1UJY A;  1ABO A;  1YWP A;  3REB B;  3EHQ A;  5FWB A;  2FG0 A;  1AWO A;  2F2X A;  2F2W A;  1CKB A;  4JJB A;  2KT8 A;  1K1Z A;  2FEI A;  2ESW A;  4GLM A;  3UAT A;  4OML A;  2MIO A;  3VRZ A;  4D8D A;  1AVZ C;  4ZNX A;  2OAW A;  2RF0 A;  1SRM A;  4OMQ A;  2BZY A;  1OEB A;  3ZL7 C;  3UF4 A;  2KXC A;  1ARK A;  3RNJ A;  1AWJ A;  3PVL A;  1TUC A;  3NGP A;  2YT6 A;  1AWW A;  1WX6 A;  2DA9 A;  1X27 A;  2CH4 W;  2LZ6 B;  4J9E A;  2HSP A;  1NLO C;  4LUE A;  1U3O A;  1VYV A;  2AKK A;  2GQI A;  2P4R A;  2QDL A;  1BU1 A;  2JS0 A;  3H0F A;  3M0U A;  1JU5 C;  3M0Q A;  2O88 A;  1IO6 A;  2A37 A;  2PTK A;  2JM9 A;  1OOT A;  5I22 A;  1AOJ A;  3EGU A;  2L2P A;  2LP5 A;  2M51 A;  3TSZ A;  1OPK A;  2ED0 A;  3U23 A;  3EHR A;  2DL5 A;  2RN8 A;  3H41 A;  2LJ3 A;  3NHN A;  2G6F X;  1QCF A;  2BZ8 A;  3KFV A;  2SEM A;  1H92 A;  1JXM A;  2KXD A;  2EYY A;  2KRM A;  1MV3 A;  2DL3 A;  4JPB W;  4AFQ C;  1M27 C;  1UHF A;  4J9G A;  1GL5 A;  2DLP A;  2K9G A;  2IIM A;  2K3B A;  2M0Y A;  4CC4 B;  5IXF A;  2KR3 A;  2AK5 A;  4HVW A;  2K2M A;  3IQL A;  4RTW A;  4D8K A;  4DEX A;  2V1R A;  1FMK A;  1U5S A;  2RQV A;  1RLQ C;  2CUB A;  3M0T A;  2O2O A;  3M0S A;  4F16 A;  2A08 A;  1AD5 A;  2KT1 A;  3M0P A;  3SEM A;  1X2Q A;  1BK2 A;  1PKS A;  2DX1 A;  2SRC A;  3TSW A;  1FYN A;  1WDX A;  2ED1 A;  1QWE A;  4JJD A;  1PHT A;  3O5Z A;  2K6D A;  4KRT A;  4CC2 A;  1M8M A;  1W1F A;  2DNU A;  3QWY A;  1AWX A;  3PVQ A;  2ENM A;  5IHI A;  4A63 B;  3UA7 A;  1X43 A;  1UEC A;  2VKN A;  2CUD A;  1I1J A;  2HBW A;  1NG2 A;  2LQN A;  2W10 A;  5FW9 A;  1K0S A;  1YP5 A;  1UDL A;  2CSI A;  1Z9Z A;  1QLY A;  1J3T A;  1NYG A;  2CT4 A;  4JJC A;  2DL4 A;  2DRM A;  4J9I A;  3H0H A;  1JO8 A;  2PNI A;  3CQT A;  2L0A A;  4JZ4 A;  1SSH A;  1ZUU A;  2CRE A;  1YCS B;  2JMC A;  1KJW A;  2KBT A;  2L3S A;  1BBZ A;  2JTE A;  2J6O A;  2JS2 A;  4K11 A;  2EKH A;  2DIL A;  1ZLM A;  1SPK A;  2EBP A;  2FO0 A;  2EPD A;  2GTO A;  2B86 A;  2JM8 A;  4Z89 A;  2KEA A;  4X1V A;  2ECZ A;  1PRL C;  2GTJ A;  1KIK A;  3EG3 A;  1NM7 A;  3EG1 A;  3VS6 A;  1GCQ C;  5IHK A;  1M30 A;  2NUZ A;  2AKL A;  2AZS A;  2CT3 A;  2LMJ A;  4IIM A;  2X3W D;  2LCS A;  2FRW A;  4HVV A;  2DBK A;  2L3P A;  4F14 A;  1HSQ A;  1ZUK A;  4OMP A;  4AFS C;  1K4U S;  1PRM C;  1WIE A;  5GJW B;  4AG2 C;  1UG1 A;  4LE9 A;  1WA7 A;  1UFF A;  2HDA A;  1ABQ A;  1E6H A;  5GJV B;  2EQI A;  1CSK A;  4GBQ A;  1E6G A;  2EVR A;  1WXB A;  4RTV A;  1AZG B;  1WLP B;  2CDT A;  3C0C A;  2KYB A;  2J7I A;  2ROL A;  1ZBJ A;  2J05 A;  1GCP A;  3NPF A;  2K7A A;  1NEB A;  1X2K A;  2DL7 A;  3I35 A;  2LQW A;  3VRY A;  1AZE A;  2A28 A;  2KRN A;  2JW4 A;  2DMO A;  2OJ2 A;  2DM1 A;  1K76 A;  4J9B A;  3A98 A;  4OMN A;  1QKX A;  3REA B;  1G2B A;  3SHW A;  1I07 A;  4M4Z A;  2GNC A;  3VS1 A;  4Z88 A;  1HJD A;  1WFW A;  1BB9 A;  3NMZ C;  3VS7 A;  3UA6 A;  3VS4 A;  4J9F A;  4R0K A;  2VVK A;  1S1N A;  4OMM A;  1A0N B;  1G83 A;  1VYU A;  2DL8 A;  4RTX A;  2L3Q A;  2ROT A;  4RTY A;  2RQR A;  2KRO A;  3H0I A;  1Y0M A;  1GRI A;  2YUN A;  1UTI A;  2C0I A;  3THK A;  2DVJ A;  2C0T A;  1UUE A;  2W0Z A;  2MOX A;  1CKA A;  2EYW A;  2KNB B;  4JZ3 A;  3FJ5 A;  4AFU C;  1W70 A;  2GGR A;  4F17 A;  4HXJ A;  2LJ0 A;  1GCQ A;  1RUW A;  2LX7 A;  4HCK A;  4RTZ A;  2KYM A;  2JT4 A;  3I5S A;  1UGV A;  3R6N A;  3EG2 A;  1RI9 A;  1MUZ A;  1M3B A;  1E7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...