1H92A

Sh3 domain of human lck tyrosine kinase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
63
structure length
63
Chain Sequence
GSPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
publication title Structural Investigation of the Binding of a Herpesviral Protein to the SH3 Domain of Tyrosine Kinase Lck
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1h92A00
2CDTA 1M27C 1U06A 3H0IA 2EGEA 3EHRA 1K0SA 2J06A 4HVUA 2X3WD 2DL5A 1NM7A 2KT1A 1TG0A 1A0NB 2KRSA 1VYTA 2KXDA 2L3SA 2BTTA 2KE9A 2O2OA 1PKTA 3M0PA 2IIMA 1RUWA 1WX6A 4K11A 2GQIA 4JJDA 2CUDA 3SHWA 1B07A 1MUZA 4AFSC 2VWFA 2X3XD 2FPFA 1T0HA 5HCKA 1WXTA 2D8JA 1UE9A 2JS0A 1AZGB 2ROTA 3VS1A 2O9VA 2CH4W 3H41A 2LX7A 1JXOA 2SRCA 2VVKA 1GL5A 5FW9A 3REBB 2O9SA 3M0UA 1FYNA 4KRTA 1GBRA 4RTXA 1VA7A 1RI9A 2J05A 4J9HA 3GBQA 1MV0B 2C0OA 1QLYA 1XOVA 3PVQA 2PTKA 2LZ6B 2EYWA 1K0XA 2W0ZA 1UDLA 1Z9QA 2DRKA 1KFZA 2E5KA 2EYZA 4HVWA 1UHCA 3O5ZA 2FO0A 3VRZA 4OMNA 1QKWA 1X2KA 5EC7A 4E6RA 3EG3A 3TSZA 2YT6A 1UECA 2K7AA 1WIEA 1U3OA 2ABLA 2J7IA 2ROLA 3NMZC 2AZSA 3I35A 2CSQA 1QWFA 2K3BA 2DJQA 3RBBB 1WYXA 1ZSGA 4LUEA 1I07A 1GFDA 4HXJA 2L3PA 3NHNA 5IHKA 2A08A 1HSQA 2DNUA 1PRMC 1X43A 4RTYA 1W1FA 4J9BA 1UJ0A 3UA7A 1OEBA 2LMJA 1W70A 1J3TA 1WFWA 2LCSA 1BK2A 1JEGA 1AWOA 2KNBB 1T3SA 1GCQA 1AOJA 4HVVA 5IXFA 3VS3A 1M8MA 2YUOA 1UG1A 2FPDA 2RN8A 2L0AA 2KGTA 2O31A 2RQRA 4RTUA 2M51A 4RTTA 4LN2A 3RNJA 1AEYA 3VS6A 4JJCA 5I11A 1NEBA 2KBTA 1AVZC 2RF0A 2K2MA 2M0YA 4J9FA 2DL3A 1OPLA 4J9CA 4ESRA 2K9GA 2A36A 2EGAA 2YUNA 1GFCA 2BZ8A 5ECAA 2DE0X 2ESWA 1NLPC 1OPKA 4J9DA 2F2XA 2CREA 1AWXA 1X6GA 2DBMA 2DL7A 2HSPA 3VRYA 2C0TA 2RMOA 2ECZA 3NGPA 1K1ZA 1ZLMA 1LCKA 3KFVA 4LE9A 5GJVB 4GBQA 2RQUA 5FWCA 1BB9A 4M4ZA 2CUBA 1K9AA 1SRMA 2AKKA 4IIMA 1UHFA 2D0NA 2HDAA 2SEMA 2BZYA 2H8HA 2W10A 3EG0A 1PHTA 2KT8A 2DLPA 2C0IA 2NWMA 2OI3A 3PVLA 4Z88A 1YWPA 1E6GA 3UA6A 2KYMA 5IHNA 2V1RA 4QT7A 2KR3A 1NYFA 1ARKA 2XMFA 2GTOA 4OMOA 4IIOA 1M3CA 1CSKA 1TUDA 4CC3A 1K4US 1NLOC 2JW4A 1KJWA 1YCSB 2CT4A 1WXBA 2PNIA 1M3AA 5I22A 1ZX6A 2DA9A 2RQTA 4ZNXA 2AZVA 2D1XA 2A37A 1X27A 1GBQA 2CH4A 1EFNA 2YSQA 2O88A 2MCNA 1UUEA 5L23A 2KRMA 3REAB 1SHFA 2G6FX 2CSIA 3U23A 2FRYA 1YNZA 1X6BA 1AD5A 4RUGA 2EPDA 1I1JA 2JM8A 4CC7A 4AG1C 1PKSA 2EW3A 1QWEA 4A63B 1U5SA 4EIKA 1B3QA 1E6HA 2I0NA 3NPFA 2GNCA 2L2PA 2EVRA 3H0FA 1ABOA 1TUCA 4LUDA 4D8DA 4WCIA 2EGCA 2ENMA 2LJ1A 2K79A 2YDLA 1FMKA 2RQVA 2P4RA 4DEYA 4F16A 3UF4A 2EBPA 1RLPC 3QWYA 2DL4A 1ABQA 1SSHA 3H0HA 4JPBW 1X2QA 2DF6A 1E7OA 1M30A 2A28A 3I9QA 3CQTA 4J9IA 2DBKA 2DYBA 2K6DA 4Y92A 3A98A 1AZEA 1Z9ZA 2JM9A 1UFFA 1WDXA 1WI7A 2LNHB 1ZUUA 1M3BA 2JMCA 3UATA 1OV3A 1UGVA 1V1CA 1AWWA 4CC4B 3VS7A 1G83A 1ZUYA 4J9EA 3ZL7C 1SRLA 1MV3A 2OJ2A 4DEXA 2NUZA 2MIOA 3M0TA 2JXBA 2DX1A 2YUQA 2GTJA 1Y57A 1G2BA 4AG2C 2J6FA 1H92A 1RLQC 1Y0MA 5IXBA 2KRNA 1OOTA 2V1QA 1PWTA 1JQQA 1WXUA 1T3LA 1PRLC 5GJWB 2ED0A 1H3HA 3VS4A 2LQNA 1JXMA 4ORZA 1UJYA 2F2VA 2DVJA 1WLPB 2CT3A 2HBWA 1YN8A 2RPNA 4JJBA 3EGUA 1W6XA 1UTIA 3M0QA 2LP5A 1QKXA 3ULRB 1NG2A 2LQWA 1NEGA 2DRMA 1IO6A 2EYYA 2OAWA 2L3QA 5IHIA 3IQLA 2GGRA 2HEQA 3R6NA 2DILA 2D8HA 4OMMA 3VS2A 2J6KA 2KXCA 1GCPA 2JT4A 3FJ5A 1QCFA 2KEAA 3SEMA 1BU1A 2EKHA 3M0RA 4OMQA 4GLMA 3VS5A 2KYBA 1X69A 1T0JA 1I0CA 4Z8AA 1KIKA 4JZ4A 1BBZA 2DMOA 4RTWA 3QWXX 3M0SA 1YWOA 2FG0A 4HCKA 1SEMA 1CKBA 1CKAA 2ED1A 3TVTA 2DM1A 1H8KA 2FRWA 4F14A 2B86A 3PE0A 4F17A 3EHQA 2F2WA 3JV3A 4OMPA 3EG1A 3EG2A 1YP5A 2JMAA 2HCKA 1WA7A 3C0CA 1VYUA 2EQIA 4RTZA 1ZUKA 2AKLA 1JO8A 4FSSA 1ZBJA 2YUPA 2FEIA 3I5SA 3TSWA 4X1VA 1GCQC 4LNPA 5FWBA 1S1NA 4Z89A 2LJ3A 4R0KA 2J6OA 2PZ1A 1VYVA 4AFQC 1NYGA 4RTVA 2FPEA 1JU5C 1SPKA 3I5RA 2RQWA 1K76A 1HD3A 4J9GA 2BZXA 4AFUC 2LJ0A 1SHGA 4JZ3A 2VKNA 2GBQA 1GRIA 2JS2A 1N5ZA 4AFZC 2DL8A 2KROA 1KSWA 3VS0A 4CC2A 2MOXA 3THKA 2QDLA 2RNAA 1PNJA 4OMLA 1AWJA 2JTEA 3LH5A 2EYXA 5IH2A 2AK5A 1HJDA 4D8KA
chains in the Genus database with same CATH superfamily
3G4SQ 3E2UA 6AT1B 3EHRA 1I5LA 3KXTA 4HVUA 4OB3B 1TG0A 2E3HA 3J80E 2QASA 1VYTA 3OYEA 1Q7YU 4A54A 4BDZA 2QQRA 2KQWA 1YHQQ 4FT4A 4K11A 2GQIA 5GMKj 1IGUA 2XKOC 1VQOQ 2HQXA 3V8LA 4AFSC 2X3XD 1C0MA 5HCKA 2D8JA 3MEUA 4RG2A 2CP5A 2QK0A 3MEAA 2CH4W 2NLUA 1U1TA 4PJOE 1JXOA 2VVKA 3FB9A 3M4YA 3CCQA 1U1SA 4JDSA 3CEYA 2CP7A 2J05A 3L1AA 2C0OA 3CPWA 5CQXA 2C06A 3CXCS 3DLMA 3M4GA 1BYMA 4BI3A 4L6V5 1K0XA 4M7AE 2W0ZA 3OYDA 1YBYA 2DRKA 5GMKh 3CCUA 2FZGB 2EYQA 2AIRB 5D6WA 4FT2A 3H8ZA 1UHCA 1YI2Q 2FO0A 1Y96B 3OSVA 2BE9B 3JB9D 4F04B 1QVFS 1WHMA 4E6RA 5HK3A 3ER0A 4PJJA 4E7HA 2YT6A 1K8AC 2K7AA 2ZPIB 5A2QE 1K9MR 8AT1B 2WSFE 2AZSA 4E7SA 4E47A 3ZEHA 2DJQA 1YITQ 2LTOA 2QTVA 4A4KA 3EG9B 5IHKA 2DERA 3INZA 3HP9A 3E9GA 4RTYA 1W1FA 4CI0C 2AT1B 1W70A 3CC2A 3QIIA 1J3TA 3OQ5A 1I5OB 4M7AC 1BK2A 4HCZA 2OAUA 1PM3A 2K5LA 2YLCA 4HT9A 1MMAA 3OYCA 4XK8E 3CCVA 3A8MB 2L0AA 3HHTB 4QQ6A 4M77B 3EFOB 3QPHA 4RTTA 2DTOA 3RNJA 3WVEB 3MCAB 1NPRA 4RCBA 3TU4K 2RF0A 4J9FA 2DL3A 4C92D 5FU6B 1WJQA 5LJ5j 4M75D 4C8QB 2X4YA 1VQ6T 2K9GA 2R57A 4M77G 3QKJA 2BZ8A 3CCRQ 5M9OA 1ZSZB 2CREA 1AWXA 2DL7A 2D9TA 1WHLA 4MDXA 2KK4A 3URGA 2RMOA 4J6WA 1D3BA 5GAMe 1ZLMA 5AYFA 2VV5A 4GBQA 5GJVB 2RQUA 3VV0A 4C8QG 1VQ9A 4M4ZA 1Y07A 5KYYA 2L89A 1YIJQ 5GANf 3VJPA 2D0NA 3L2QA 3JB9J 2W10A 3EG0A 3I55T 2KT8A 4PFZA 3OW2P 3PVLA 4ZTFA 3QBYA 4BE2A 4IUUA 5LJ5h 1E6GA 1AT1B 2DXCA 3JCMV 4LDVA 2XIDA 4ZN3A 2KR3A 1VQ7Q 4OMOA 3KBGA 3ZBDA 4XAXB 4M7DE 4ZTJA 2DIGA 3S3MA 3JCMe 2JW4A 3OBYA 1YCSB 1K9MU 1WXBA 2PNIA 2PUKB 2X9HA 5A0LA 3DB4A 2AZVA 3HL8A 1GBQA 2CH4A 4VUBA 1EFNA 2M0OA 2XU8A 4B9XA 1VQ4T 4EPCA 4BB7A 4D6WA 2EKOA 2CKKA 2MCNA 1KQ2A 5L23A 2CSIA 3U23A 1BI3A 4QVDA 3MP8A 5LJ3e 1AD5A 1I1JA 4BY6B 3JB9F 4CC7A 1PD0A 1PKSA 1YJWA 1N27A 3CCSA 3ZFJA 2QEXT 4EIKA 1WJRA 5I21A 1B3QA 5CCAA 1E6HA 2I0NA 1EIFA 5CAIA 4BI4A 3UDCA 2L2PA 3H0FA 4M7DC 4LUDA 5CR2A 2LC4A 3L42A 1UGRB 1VQKT 1KD1C 2KSSA 4XTVA 2YDLA 2DVEA 1V76A 2CZ7B 1M2OA 2ZGWA 2EBPA 2CZ0B 2EQUA 4WF2A 1M8VA 2HKNA 3CCEQ 1VQLT 4DOVA 4OB1B 1YJ9T 4J9IA 2DBKA 2DYBA 3VUBA 3A98A 1Z9ZA 1WDXA 3CD6T 2YWWA 2MI6A 2JMCA 3QYGB 3GOXA 3HPWA 1OV3A 2RH2A 4CC4B 1KK7A 1SRLA 1RADB 2X51A 3A8OB 3MP6A 4DEXA 2MIOA 2DD4A 4JS5A 3M0TA 1RI0A 4M75F 2K5IA 9ATCB 4AG2C 1Q95G 1ZA2B 3Q1JA 1IHWA 4YTLA 3GPLA 3UWNA 1FWZA 1YFNA 1T3LA 1PRLC 4E7KA 3OS0A 3QXEB 2ED0A 4KGZB 1H3HA 3VS4A 4HKEA 4BD3A 2DVJA 2RHXA 2QA4Q 1M1FA 2H3JA 4JJBA 2HZYA 1Q82R 2OAWA 1JJ2A 5IHIA 3EGXB 4A4HA 1M1GA 4PL6A 3VS2A 3LWHA 5D7UA 1VQNQ 3LGLA 1TWBA 1GCPA 2Y90A 2ZCFB 1ZA1B 5FRMA 2EKHA 1RAIB 1N8RR 2GFAA 4GLMA 3EAEA 1Q86R 1X69A 2VC8A 1VQ6A 2AHJB 2BIVA 1PG5B 2O4XB 1GXIE 5C6SA 4JS4A 4RTWA 3OMCA 3M0SA 4C8QD 1YWOA 3CMEQ 3EFOA 1CKBA 1CKAA 3TVTA 2GF7A 2DM1A 2FRWA 3EHQA 4PLLA 2XHCA 3FRNA 3JSCA 3FEOA 5L8RE 5CQYA 2YRVA 3LX7A 1LVKA 2COZA 3JAME 2LCLA 4JUVA 2IVWA 3I55A 4FSSA 2JNGA 2MPXC 5IT9E 3TSWA 1OI1A 2Z0WA 2V8KA 3OBWA 2WACA 3OYMA 1S1NA 2BUDA 2RB6A 4Z89A 4PJOA 5CKBA 1M90C 5A0GA 2JJ9A 4F7UF 2J6OA 2CP2A 4AFQC 1R77A 2FPEA 5GAN7 2A7YA 4C5GA 4LXCA 2L8DA 5GAOr 2DTIA 3CCUQ 2LJ0A 1SHGA 2VKNA 2E3IA 1VQ4A 2PU9B 1N5ZA 4AFZC 2DL8A 2RJFA 1VQPT 1Q82U 3THKA 2P0PA 2DJZA 2QDLA 2DTHA 4JRQA 1S72T 4OMLA 2JZ2A 3LH5A 2EYXA 3RESA 3CC4T 3JCMQ 2HKQB 2QEXA 3FDRA 5GAMf 1RAAB 1UEBA 5I2MA 4D8KA 3S6WA 4B9WA 1KC8U 1K0SA 3BE3A 2XD0A 4J83A 2KRSA 2KXDA 2L3SA 2JOYA 2YRCA 3VYGA 2BTTA 2KE9A 1N8RU 1VQKA 4O6JA 2IIMA 4TVRA 3JB9G 1RUWA 1Q86U 5EG2A 3CCVQ 1VQLA 1B7TA 5GANe 5LJ5d 1BIAA 5IN1A 4EMGA 3M56A 3SWNA 2FPFA 1RACB 1QVFP 2LVMA 1QCNA 3WVDB 1QVGA 2E6NA 2ROTA 1NJIC 3CD6A 2K2VA 2DZCA 2O9VA 3RMSA 3H41A 1ACMB 1MNEA 1KHCA 2O9SA 4KRTA 2RHZA 2DZ9A 1KQSA 3CCMQ 3GIBA 4C92B 2LQ8A 3RDVA 3CBPA 4LDWA 2DEUA 4M75B 3PVQA 2PTKA 1ZQ1A 3DB3A 3G1JA 1QQJA 3M58A 5GAN6 3G6ET 1VQ9Q 4HVWA 2H3EB 3CMAQ 5CKHA 2DYIA 2HSEB 2ZAEA 3LW5E 4C92G 2OTJA 4WTOB 1W4SA 4M75G 1UECA 3JRZA 1TOVA 2ABLA 4BE1A 3S3OA 1WHJA 3HRSA 3RIRA 1LOJA 2CSQA 1QWFA 2K3BA 3RBBB 4OGEA 1WYXA 2PUOB 1ZSGA 3A8GB 2VASA 1I07A 1NJIR 4QKUA 4OP0A 3NHNA 3LGFA 1HSQA 2DNUA 3QZ5B 3P8DA 3PMIA 3OS2A 3UA7A 3CBOA 5LJ5g 1V29B 2DPPB 1SG5A 4OVAA 2LCSA 3CPWS 2RD1A 2KNBB 1AOJA 2HBPA 5IXFA 3VS3A 1M8MA 4FIBA 3RUXA 2KDSA 2YUOA 1PD1A 2GQVA 2FPDA 2KGTA 3QYHB 1TH7A 2M51A 2CS7A 3A8HB 4JJCA 5I11A 2YRDA 1AVZC 1YJWQ 4IUTA 2CZ6B 3CCSQ 3AHUA 1M1KC 2BE7D 1OPLA 4OB2B 2DIQA 4ESRA 4ZGEB 2R5MA 4M78D 2EJFA 5ECAA 2DE0X 3L2RA 4V2SA 1VQ8T 4M77E 3HFOA 1NLPC 1OPKA 4J9DA 3OA6A 1VUBA 2HSPA 2C0TA 2ECZA 2ZPBB 3KFVA 4L59A 4LE9A 4MDWA 1BI0A 4N4HA 3A5ZB 2CUBA 2KI7A 4IKFA 3CCLA 1SRMA 4C8QE 3CCJT 4KGXB 1UHFA 2R5AA 2BZYA 2NUPA 4F7UB 2H8HA 5KE3A 1VQMT 3P8BB 4XU0A 4JRKA 1VQ5T 4Z88A 1YWPA 2LNVA 3UA6A 4QT7A 5AT1B 3OS5A 5HKCA 3G4ST 3F70A 3EFRA 2D0QB 2K57A 1CSKA 4CC3A 5FRNA 4F7UG 2CT4A 3TQ7P 4FL6A 2DXTA 3L2ZA 4A4GA 3CC4A 1H641 2ZPHB 5I22A 1ZX6A 4C0DC 4EMKB 1YHQT 4ZNXA 2DKGA 1N9RA 1X27A 5D6XA 2YSQA 2O88A 1VQOT 2KMTA 2RA2A 3QG1A 1NZ9A 4RUGA 3NTKA 4AG1C 2VUBA 7AT1B 3GNFB 4A63B 4PNOA 4PJOC 4CRIA 1BCMA 3NPFA 3G71Q 5FROA 2WSEE 1K73C 4WCIA 3EGDB 2ENMA 2LJ1A 2RQVA 4XU2A 4KUDK 4M7DF 4KH1B 4Q5WA 2EQMA 3N5BB 3QWYA 2YLBA 3M9QA 1YI2T 4JPBW 2A28A 3I9QA 3CQTA 4IURA 4KBMB 1D1CA 3J7AF 4KH0B 4Y92A 2JM9A 1WI7A 1M3BA 1V1CA 1UGVA 3V7RA 3VS7A 5KYWB 3G6EA 1ZUYA 1YITT 2NUZA 1K8AR 4FW1A 2JXBA 4FSXA 4RKUE 2DX1A 2GTJA 1Y57A 2K5FA 2J6FA 4M78F 4KULA 1RLQC 2HAXA 2VXFA 3I55Q 2KRNA 2CZ1B 1EX4A 1WXUA 4C92A 2NUTB 1Q81C 3MO8A 3I56Q 1C1AA 1BI2A 3CXCA 5DY9A 1W2BA 1JXMA 1UGSB 2F2VA 2JVVA 5CKFA 3MHXA 2RPNA 3SWNC 3VKIA 1UB4A 3META 1W6XA 2BKDN 3M5AA 1B34B 3V7SA 5GAMj 1IO6A 3CC7T 1G3WA 2L3QA 2FB7A 3IQLA 3M55A 4OF1A 3JCMJ 1VQ4Q 3R6NA 1O9SA 2F5TX 2D8HA 5GMKl 1C6VX 3CCRT 4OMMA 4QVZA 4IUPA 2J6KA 2M1HA 2KXCA 2X4XA 5J39A 4LDXA 1D1AA 3FJ5A 1QCFA 1OZ3A 1OYXA 3VUZA 4OMQA 3VS5A 2QGGA 4ANJA 2KYBA 2EFIA 4Z8AA 1OQKA 3T9NA 4IUVA 5GAMh 3X25B 3M53A 4BUGA 4ZGDB 1SEMA 1MMNA 4J7FA 4FYWB 2XDDA 2FZKB 5DM7R 1H8KA 4F17A 2RM4A 1WQ7A 3QHSA 4RMOA 1VQ7T 3JV3A 5LJ3j 3OYBA 3GP8A 4DOWA 3CCJA 4PFOA 3OMGA 2EQIA 4RTZA 1ZUKA 2AKLA 3PFSA 1VQMA 3WXMB 3CD6Q 2YUPA 2FEIA 1VQ5A 3V8JA 4X1VA 1JB0E 4J8OA 5FWBA 5CKDA 4QVCA 3JCMh 1K8AU 2LJ3A 4R0KA 5CO7A 4KT0E 3OYLA 3A8LB 4FYXB 2XICA 2RQWA 3I5RA 4N4IA 4EDUA 1QW1A 2FL7A 2EJ9A 1G8XA 4KUIA 1YHQA 2BZXA 1VIEA 4MMLA 4Y28E 1EZZB 2F1LA 3JCMX 3OYAA 5LJ3h 2GBQA 3X24B 1RAEB 1O75A 4BI8B 4Y91A 2KROA 4ZN1A 1VQOA 2VB6A 3VS0A 2OTJQ 2RNAA 1AWJA 2JTEA 4XTWA 5IH2A 4RCCA 5KCOA 2P0KA 2CGHA 1HJDA 3EH1A 4E7IA 2DFUA 3CCET 1M27C 1U06A 2EGEA 2QG9B 1KD1R 2J06A 1WHGA 2XDBA 2MYSA 3FC3A 2X3WD 2DL5A 2KT1A 1A0NB 1P92A 1Y96A 3MJXA 2CP3A 1SKUB 4BDYA 3M0PA 1TS9A 1WQWA 1WX6A 1UGPB 3RR6A 4JJDA 1FX7A 4A53A 3HKSA 3BDUA 4LD6A 1MUZA 4C5HA 2M16A 3PIOA 1XQHA 3PGGA 3S3NA 1WXTA 3C4SA 1R0CB 1AZGB 2OX7A 3EG9A 2EQKA 2LX7A 1M5Q1 2SRCA 1GL5A 5GAN3 3M0UA 1FYNA 1YITA 1RI9A 3ASKA 1MV0B 2QA4T 2R58A 2K3XA 2KAFA 5KYUB 4KGVB 4JLGA 4M77A 4XQ3A 5LL6S 3GNGA 4M78B 2HNIA 2E41A 1KFZA 1JRIA 3BFMA 3M57A 3CPWP 3LH0A 1IZ6A 3CCLQ 3VRZA 4OMNA 1QKWA 4BACA 1X2KA 1VQNT 4C8QA 3EG3A 3PIPA 4C92E 3FLGA 2E4HA 1X6OA 2JTMA 1U3OA 4M78G 3CC7A 1ZSZA 2J7IA 4M75E 3HFNA 2HL5C 1TTHB 3CCQQ 2QAZA 3NFCA 4LUEA 1GFDA 4HXJA 3X26B 3C12A 3CCRA 3JCMP 2L3PA 2A08A 3CMET 4EMHA 4J9BA 3D7SB 3CC4Q 1OEBA 4A4FA 1QP3A 1WFWA 1JEGA 1AWOA 1GCQA 4HVVA 3PNWC 1KD1U 4M7AD 3A1PA 1UG1A 2F69A 2RN8A 2RQRA 4N0AA 5LJ5f 2A3LA 3QJYA 4LN2A 2ATCB 2E12A 1NEBA 4XTXA 4C92C 2M0YA 4N4GA 2XI9A 5CKEA 2RI3A 1BI1A 2FVUA 2V8IA 1NPPA 4PKCC 1VQ7A 2A36A 2EGAA 2P84A 1Q7YC 2ESWA 2DD5A 2F2XA 1X6GA 3R6OA 5GMKm 1M90R 3RKYA 3CC2Q 3C94A 1K1ZA 1LCKA 3OW2A 1N9SA 4FW2A 2AKKA 1YJ9A 4XU1A 1BIBA 2LCCA 4J6XA 4MZPA 4XTZA 2VXEA 2DLPA 2C0IA 2NWMA 5IHNA 2V1RA 3OSSC 1NYFA 3RKWA 2XMFA 1IXDA 5GANj 2GTOA 2LRQA 2LT4A 4IIOA 2OTLT 1M3CA 4PK4A 1TUDA 2VYTA 4MZTA 4O5VA 3EFSA 3JCMb 2IG0A 4F7UE 1M3AA 2RQTA 2D1XA 4HA8A 2A37A 1WPYA 5DLQE 2PVGB 3CCVT 3OY9A 3CCEA 5CIUA 4ELZC 2FRYA 1D3BB 1X6BA 1YNZA 3OYKA 2EPDA 1U8RA 2EW3A 5KYYB 5GANh 4OGCA 2P4TA 3CCMT 1ZHIA 1YJNT 2GNCA 3RKXA 2EVRA 4UC4A 4PJOF 3E9FA 3JCMd 3TCJA 4D8DA 4M7DD 2RO0A 1PSFA 1YCYA 2EGCA 2MK5A 1FMKA 2P0QA 2QI2A 3UF4A 2RJEA 1VQ9T 1SSHA 4NS5A 3CMAT 3H0HA 1X2QA 2DF6A 4M7AF 1M30A 3HRTA 2QA4A 1SSFA 3EGXA 4L5GA 1M90U 3G7ZA 2K6DA 1G3YA 1ZBXA 3UATA 1ZUUA 1TXQA 4JRIA 3QSUA 3BY7A 1AWWA 1D0XA 3LYIA 1TUGB 3C95A 1MV3A 3OYHA 3E1SA 2OJ2A 5J26A 5GAMg 1VQNA 3E19A 4AT1B 1RAHB 1OOTA 2O4XA 1JQQA 2FZCB 2MAMA 3CBMA 3OYNA 5FU7B 4J7IA 3J81E 4PJLA 1WLPB 4M78A 5GMKe 1YN8A 3OYIA 1RAFB 5I2SA 3EGUA 2RHUA 1UTIA 2LP5A 1QKXA 2V8JA 3UT1A 3ULRB 3CMEA 4A4EA 2LQWA 1YJWT 3CCST 2EYYA 4BE0A 3JCMg 2KY9A 4X9CA 2HEQA 4DBHA 2DILA 1VQPA 1M1KR 1QCOA 1K9MC 1JJ2P 1S72A 4M77C 2JT4A 2O01E 2KEAA 3SEMA 5LJ3g 2B8AA 2QYZA 3M0RA 5DLOA 2LT1A 1G5VA 1NJIU 5GAOl 1HYOA 1T0JA 1I0CA 5FU6C 4GY5A 4C8QC 2ZZDA 2ZPFB 3QWXX 1W2BS 1ZSZC 2MWOA 1NBEB 1LJOA 2DK3A 2HQHA 2E70A 4C0FA 4F14A 2B86A 1M9SA 4LDYA 4OMPA 1WHHA 2DETA 1YP5A 2JMAA 5GAOn 2HCKA 1WA7A 4X9DA 4PFPA 1RL2A 1DJ7B 2MWPA 1JO8A 1TU0B 3I5SA 1I8FA 1PC0A 4XTUA 1GCQC 4LNPA 5KE2A 1VQ6Q 4N0AC 4OMFB 1VOMA 3RMQA 2OTLA 2PZ1A 1PSEA 2QQBA 2E5QA 1MHNA 1JU5C 1F1BB 3HTRA 1R0BG 1K76A 4HT8A 1VIFA 1I81A 4AFUC 2K4YA 3MEWA 1Y71A 2L5QA 2ZPEB 1GRIA 3G71T 4DA4A 4CC2A 5LJ5e 2MOXA 3FIFA 4J6YA 1IRXA 1PNJA 1X01A 4HCCA 4C0DB 1QVPA 2VGMA 5GMKi 3CC7Q 2M9UA 4P5NA 1IGQA 2AK5A 4BY6C 3L2VA 3LWIA 1HK9A 2PVOB 4M75A 1K73R 1RABB 2CDTA 1M1KU 1MMGA 3H0IA 4E7ZA 3DLLA 3CCMA 1YJNA 2QQ9A 3MKDA 1NM7A 2VGNA 4LD9K 3GF5A 1HXDA 3QDRB 5GAN5 2O2OA 4PJOB 3UPUA 1PKTA 4C0ZA 1QVFA 2CUDA 4ME7A 3CMAA 3SHWA 1B07A 3V8KA 4E2FB 1M2VB 3QZ9B 2VWFA 3FJPA 2X4WA 1T0HA 2XG8D 4M7AB 2QXFA 3NTHA 1WZOA 1UE9A 2JS0A 4PJOG 3VS1A 1MGQA 1IHVA 1D1BA 2QEXQ 4X34A 3I56T 5FW9A 1OZ2A 3REBB 3PTAA 2CYZB 1GBRA 2RK2A 4RTXA 1VA7A 1QVGP 3SB2A 5KYXB 4J9HA 1YIJT 3GBQA 1Q81R 5KH6A 1TSFA 1VQ8A 4M7AG 1QLYA 4FYVB 4IUQA 2G3RA 1XOVA 2RHIA 1VQKQ 2LZ6B 2EYWA 5GAN4 2V26A 1UDLA 2X35A 1Z9QA 1KQSP 1OU9A 2E5KA 1FXXA 2EYZA 2M02A 3O5ZA 1VQLQ 4ELYC 1YJ9Q 5GANd 1X75C 3KUFA 1JJ2S 5EC7A 3PMTA 1NE8A 4FCYA 3TSZA 5A0DA 1WIEA 2ROLA 3NMZC 4FM4B 4R56A 3I35A 4M78E 3SWNB 3G4SA 4DBRA 2GCXA 4JJNK 1WJSA 4J5YA 2JUFA 2K3YA 1PRMC 1X43A 3OYGA 5D6YA 1AHJB 1UJ0A 1KHIA 2LMJA 3AT1B 4E7JA 1MMDA 3JB9I 4DBFA 1K73U 4F7UA 1Q82C 1T3SA 1JBMA 4QQGA 1N6AA 2MF2A 8ATCB 3LLRA 2O31A 2GFUA 4RTUA 4ATOA 1AEYA 3VS6A 2E6ZA 2NYSA 4II1A 2KBTA 2K2MA 3SDZA 1IREB 1KC8C 3QO3A 4J9CA 3OYFA 4C92F 2HQEA 2QQSA 4M78C 1UGQB 4EMKA 1KG1A 3P8HA 2YUNA 1GFCA 1N8RC 4NOYA 3HSBA 2KVQG 1SF9A 3TEEA 2DBMA 1Q86C 1WHKA 3VRYA 5GANg 3NGPA 5FWCA 4M7DB 1BB9A 3BDLA 3QJ6A 1K9AA 1Q81U 1YI2A 4GLKA 1OX9A 2X4JA 2OTJT 4IIMA 4Z02A 4FYYB 2HDAA 2SEMA 1LNXA 5GAOm 2YHTA 1PHTA 2OI3A 2DO3A 3QDFA 1D0YA 2KYMA 3EH2A 1G3SA 4M7DG 1ARKA 3EGDA 4OB0B 4PJNA 3ME9A 3G71A 3NTIA 1KC8R 5HY6A 1K4US 1NLOC 2WSCE 1KJWA 4B6MA 4ZGJB 3H6ZA 4M77D 1MNDA 2RI5A 1H3ZA 2DA9A 4PJMA 2HMAA 1UUEA 1FMWA 2KRMA 2JTFA 2RJCA 3REAB 1SHFA 2G6FX 4XTYA 5KYWA 3L2UA 2RHYA 1M4ZA 3PT9A 2COWA 2JM8A 2LQKA 3OW2S 1QWEA 1U5SA 1WGSA 5J3BA 1BCOA 3JCMc 1QVGS 2NUPB 3JB9H 4PJOD 2NUTA 1VQPQ 1QP2A 2EQJA 1ABOA 1TUCA 1S72Q 1D09B 1D0ZA 3L2WA 1KQSS 2K79A 2P4RA 4DEYA 1QMCA 3OB9A 4F16A 3I56A 1RLPC 1B34A 2YXYA 5FLXE 2DL4A 2QTXA 1ABQA 1XTDA 4DBQA 2COYA 3CCLT 3M59A 1E7OA 3V7CA 1YIJA 2ZPGB 3OYYA 5HK0A 5CVIA 1I4K1 2DXBA 4C5EA 4AMCA 1AZEA 3MPUB 1M2VA 1UFFA 2LNHB 2Y4YA 2DXUA 3CPFA 4M75C 4JLIA 4M7AA 1G83A 3CCQT 2A0FB 4J9EA 3ZL7C 2PVDB 1OU8A 2DAQA 2YUQA 1G2BA 3VU3C 4JRPA 2I2LA 4QQDA 1H92A 1G3TA 1Y0MA 5KYXA 5IXBA 2V1QA 1PWTA 3CCUT 5GJWB 2EAYA 4HCBA 4ORZA 2LQNA 2F5KA 1UJYA 2XK0A 2CT3A 2HBWA 4NL2A 2OTLQ 1BKBA 3OYJA 1RAGB 3M0QA 3CXCP 1W2BP 3SD4A 1NG2A 1NEGA 2DRMA 2L3RA 5GAOq 1XNIA 4XU3A 4MMKA 5KYNA 2GGRA 3G6EQ 3GLXA 5CK9A 3TREA 2IPOB 2E64A 2XDPA 3JCMf 1LPLA 1FMVA 2QGFB 4QW2A 2E1HA 3CC2T 1BU1A 1Q7YR 5GAMd 2CP6A 4M77F 3X20B 2QDYB 1R8OB 5C0MA 1YJNQ 3MP1A 1KIKA 4JZ4A 1BBZA 2DMOA 5LJ3f 1OX8A 3BW1A 2FG0A 4HCKA 1Y7XA 3JCMW 2RK1A 2PQWA 3QUIA 3HRUA 4C8QF 2ED1A 4RG8A 1KQ1A 3SFMA 2EJGA 3PE0A 2E10A 4FU6A 2F2WA 3VYHB 3EG1A 1IB8A 2JN0A 3EG2A 2QQAA 5FU7C 4C0GA 3C0CA 1VYUA 3X28B 2DEQA 1ZBJA 2LX9A 3H9NA 2LDMA 4C5IA 2MMPA 5IAYA 3O8VA 1WNLA 3DKMA 1VYVA 3MEVA 1NYGA 4R55A 4RTVA 1VQ8Q 5LJ3d 4M7DA 1SPKA 2EIFA 4MZMA 5GAOp 3RERA 3OS1A 1HD3A 4J9GA 1OULA 4DQ2A 4JZ3A 2CP0A 4E7LA 4PLIA 5GAN8 2JS2A 4EMKC 4LDUA 1XJWB 2RJDA 1KSWA 2EWNA 2Y4XA 2FHDA 3CCJQ 4NL3A 2HD0A 5GAN2 2RI2A 1VQMQ 5KCHA 2E65A 3M54A 1VQ5Q 2D6FA 1PCXA 5KYUA 2HL3A 2FYKA
chains in the Genus database with same CATH topology
2CDTA 1M27C 1U06A 3H0IA 2EGEA 3EHRA 1K0SA 2J06A 4HVUA 2X3WD 2DL5A 1NM7A 2KT1A 1TG0A 1A0NB 2KRSA 1VYTA 2KXDA 2L3SA 2BTTA 2KE9A 2O2OA 1PKTA 3M0PA 2IIMA 1RUWA 1WX6A 4K11A 2GQIA 4JJDA 2CUDA 3SHWA 1B07A 1MUZA 4AFSC 2VWFA 2X3XD 2FPFA 1T0HA 5HCKA 1WXTA 2D8JA 1UE9A 2JS0A 1AZGB 2ROTA 3VS1A 2O9VA 2CH4W 3H41A 2LX7A 1JXOA 2SRCA 2VVKA 1GL5A 5FW9A 3REBB 2O9SA 3M0UA 1FYNA 4KRTA 1GBRA 4RTXA 1VA7A 1RI9A 2J05A 4J9HA 3GBQA 1MV0B 2C0OA 1QLYA 1XOVA 3PVQA 2PTKA 2LZ6B 2EYWA 1K0XA 2W0ZA 1UDLA 1Z9QA 2DRKA 1KFZA 2E5KA 2EYZA 4HVWA 1UHCA 3O5ZA 2FO0A 3VRZA 4OMNA 1QKWA 1X2KA 5EC7A 4E6RA 3EG3A 3TSZA 2YT6A 1UECA 2K7AA 1WIEA 1U3OA 2ABLA 2J7IA 2ROLA 3NMZC 2AZSA 3I35A 2CSQA 1QWFA 2K3BA 2DJQA 3RBBB 1WYXA 1ZSGA 4LUEA 1I07A 1GFDA 4HXJA 2L3PA 3NHNA 5IHKA 2A08A 1HSQA 2DNUA 1PRMC 1X43A 4RTYA 1W1FA 4J9BA 1UJ0A 3UA7A 1OEBA 2LMJA 1W70A 1J3TA 1WFWA 2LCSA 1BK2A 1JEGA 1AWOA 2KNBB 1T3SA 1GCQA 1AOJA 4HVVA 5IXFA 3VS3A 1M8MA 2YUOA 1UG1A 2FPDA 2RN8A 2L0AA 2KGTA 2O31A 2RQRA 4RTUA 2M51A 4RTTA 4LN2A 3RNJA 1AEYA 3VS6A 4JJCA 5I11A 1NEBA 2KBTA 1AVZC 2RF0A 2K2MA 2M0YA 4J9FA 2DL3A 1OPLA 4J9CA 4ESRA 2K9GA 2A36A 2EGAA 2YUNA 1GFCA 2BZ8A 5ECAA 2DE0X 2ESWA 1NLPC 1OPKA 4J9DA 2F2XA 2CREA 1AWXA 1X6GA 2DBMA 2DL7A 2HSPA 3VRYA 2C0TA 2RMOA 2ECZA 3NGPA 1K1ZA 1ZLMA 1LCKA 3KFVA 4LE9A 5GJVB 4GBQA 2RQUA 5FWCA 1BB9A 4M4ZA 2CUBA 1K9AA 1SRMA 2AKKA 4IIMA 1UHFA 2D0NA 2HDAA 2SEMA 2BZYA 2H8HA 2W10A 3EG0A 1PHTA 2KT8A 2DLPA 2C0IA 2NWMA 2OI3A 3PVLA 4Z88A 1YWPA 1E6GA 3UA6A 2KYMA 5IHNA 2V1RA 4QT7A 2KR3A 1NYFA 1ARKA 2XMFA 2GTOA 4OMOA 4IIOA 1M3CA 1CSKA 1TUDA 4CC3A 1K4US 1NLOC 2JW4A 1KJWA 1YCSB 2CT4A 1WXBA 2PNIA 1M3AA 5I22A 1ZX6A 2DA9A 2RQTA 4ZNXA 2AZVA 2D1XA 2A37A 1X27A 1GBQA 2CH4A 1EFNA 2YSQA 2O88A 2MCNA 1UUEA 5L23A 2KRMA 3REAB 1SHFA 2G6FX 2CSIA 3U23A 2FRYA 1YNZA 1X6BA 1AD5A 4RUGA 2EPDA 1I1JA 2JM8A 4CC7A 4AG1C 1PKSA 2EW3A 1QWEA 4A63B 1U5SA 4EIKA 1B3QA 1E6HA 2I0NA 3NPFA 2GNCA 2L2PA 2EVRA 3H0FA 1ABOA 1TUCA 4LUDA 4D8DA 4WCIA 2EGCA 2ENMA 2LJ1A 2K79A 2YDLA 1FMKA 2RQVA 2P4RA 4DEYA 4F16A 3UF4A 2EBPA 1RLPC 3QWYA 2DL4A 1ABQA 1SSHA 3H0HA 4JPBW 1X2QA 2DF6A 1E7OA 1M30A 2A28A 3I9QA 3CQTA 4J9IA 2DBKA 2DYBA 2K6DA 4Y92A 3A98A 1AZEA 1Z9ZA 2JM9A 1UFFA 1WDXA 1WI7A 2LNHB 1ZUUA 1M3BA 2JMCA 3UATA 1OV3A 1UGVA 1V1CA 1AWWA 4CC4B 3VS7A 1G83A 1ZUYA 4J9EA 3ZL7C 1SRLA 1MV3A 2OJ2A 4DEXA 2NUZA 2MIOA 3M0TA 2JXBA 2DX1A 2YUQA 2GTJA 1Y57A 1G2BA 4AG2C 2J6FA 1H92A 1RLQC 1Y0MA 5IXBA 2KRNA 1OOTA 2V1QA 1PWTA 1JQQA 1WXUA 1T3LA 1PRLC 5GJWB 2ED0A 1H3HA 3VS4A 2LQNA 1JXMA 4ORZA 1UJYA 2F2VA 2DVJA 1WLPB 2CT3A 2HBWA 1YN8A 2RPNA 4JJBA 3EGUA 1W6XA 1UTIA 3M0QA 2LP5A 1QKXA 3ULRB 1NG2A 2LQWA 1NEGA 2DRMA 1IO6A 2EYYA 2OAWA 2L3QA 5IHIA 3IQLA 2GGRA 2HEQA 3R6NA 2DILA 2D8HA 4OMMA 3VS2A 2J6KA 2KXCA 1GCPA 2JT4A 3FJ5A 1QCFA 2KEAA 3SEMA 1BU1A 2EKHA 3M0RA 4OMQA 4GLMA 3VS5A 2KYBA 1X69A 1T0JA 1I0CA 4Z8AA 1KIKA 4JZ4A 1BBZA 2DMOA 4RTWA 3QWXX 3M0SA 1YWOA 2FG0A 4HCKA 1SEMA 1CKBA 1CKAA 2ED1A 3TVTA 2DM1A 1H8KA 2FRWA 4F14A 2B86A 3PE0A 4F17A 3EHQA 2F2WA 3JV3A 4OMPA 3EG1A 3EG2A 1YP5A 2JMAA 2HCKA 1WA7A 3C0CA 1VYUA 2EQIA 4RTZA 1ZUKA 2AKLA 1JO8A 4FSSA 1ZBJA 2YUPA 2FEIA 3I5SA 3TSWA 4X1VA 1GCQC 4LNPA 5FWBA 1S1NA 4Z89A 2LJ3A 4R0KA 2J6OA 2PZ1A 1VYVA 4AFQC 1NYGA 4RTVA 2FPEA 1JU5C 1SPKA 3I5RA 2RQWA 1K76A 1HD3A 4J9GA 2BZXA 4AFUC 2LJ0A 1SHGA 4JZ3A 2VKNA 2GBQA 1GRIA 2JS2A 1N5ZA 4AFZC 2DL8A 2KROA 1KSWA 3VS0A 4CC2A 2MOXA 3THKA 2QDLA 2RNAA 1PNJA 4OMLA 1AWJA 2JTEA 3LH5A 2EYXA 5IH2A 2AK5A 1HJDA 4D8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CDT A;  1M27 C;  1U06 A;  3H0I A;  2EGE A;  3EHR A;  1K0S A;  2J06 A;  4HVU A;  2X3W D;  2DL5 A;  1NM7 A;  2KT1 A;  1TG0 A;  1A0N B;  2KRS A;  1VYT A;  2KXD A;  2L3S A;  2BTT A;  2KE9 A;  2O2O A;  1PKT A;  3M0P A;  2IIM A;  1RUW A;  1WX6 A;  4K11 A;  2GQI A;  4JJD A;  2CUD A;  3SHW A;  1B07 A;  1MUZ A;  4AFS C;  2VWF A;  2X3X D;  2FPF A;  1T0H A;  5HCK A;  1WXT A;  2D8J A;  1UE9 A;  2JS0 A;  1AZG B;  2ROT A;  3VS1 A;  2O9V A;  2CH4 W;  3H41 A;  2LX7 A;  1JXO A;  2SRC A;  2VVK A;  1GL5 A;  5FW9 A;  3REB B;  2O9S A;  3M0U A;  1FYN A;  4KRT A;  1GBR A;  4RTX A;  1VA7 A;  1RI9 A;  2J05 A;  4J9H A;  3GBQ A;  1MV0 B;  2C0O A;  1QLY A;  1XOV A;  3PVQ A;  2PTK A;  2LZ6 B;  2EYW A;  1K0X A;  2W0Z A;  1UDL A;  1Z9Q A;  2DRK A;  1KFZ A;  2E5K A;  2EYZ A;  4HVW A;  1UHC A;  3O5Z A;  2FO0 A;  3VRZ A;  4OMN A;  1QKW A;  1X2K A;  5EC7 A;  4E6R A;  3EG3 A;  3TSZ A;  2YT6 A;  1UEC A;  2K7A A;  1WIE A;  1U3O A;  2ABL A;  2J7I A;  2ROL A;  3NMZ C;  2AZS A;  3I35 A;  2CSQ A;  1QWF A;  2K3B A;  2DJQ A;  3RBB B;  1WYX A;  1ZSG A;  4LUE A;  1I07 A;  1GFD A;  4HXJ A;  2L3P A;  3NHN A;  5IHK A;  2A08 A;  1HSQ A;  2DNU A;  1PRM C;  1X43 A;  4RTY A;  1W1F A;  4J9B A;  1UJ0 A;  3UA7 A;  1OEB A;  2LMJ A;  1W70 A;  1J3T A;  1WFW A;  2LCS A;  1BK2 A;  1JEG A;  1AWO A;  2KNB B;  1T3S A;  1GCQ A;  1AOJ A;  4HVV A;  5IXF A;  3VS3 A;  1M8M A;  2YUO A;  1UG1 A;  2FPD A;  2RN8 A;  2L0A A;  2KGT A;  2O31 A;  2RQR A;  4RTU A;  2M51 A;  4RTT A;  4LN2 A;  3RNJ A;  1AEY A;  3VS6 A;  4JJC A;  5I11 A;  1NEB A;  2KBT A;  1AVZ C;  2RF0 A;  2K2M A;  2M0Y A;  4J9F A;  2DL3 A;  1OPL A;  4J9C A;  4ESR A;  2K9G A;  2A36 A;  2EGA A;  2YUN A;  1GFC A;  2BZ8 A;  5ECA A;  2DE0 X;  2ESW A;  1NLP C;  1OPK A;  4J9D A;  2F2X A;  2CRE A;  1AWX A;  1X6G A;  2DBM A;  2DL7 A;  2HSP A;  3VRY A;  2C0T A;  2RMO A;  2ECZ A;  3NGP A;  1K1Z A;  1ZLM A;  1LCK A;  3KFV A;  4LE9 A;  5GJV B;  4GBQ A;  2RQU A;  5FWC A;  1BB9 A;  4M4Z A;  2CUB A;  1K9A A;  1SRM A;  2AKK A;  4IIM A;  1UHF A;  2D0N A;  2HDA A;  2SEM A;  2BZY A;  2H8H A;  2W10 A;  3EG0 A;  1PHT A;  2KT8 A;  2DLP A;  2C0I A;  2NWM A;  2OI3 A;  3PVL A;  4Z88 A;  1YWP A;  1E6G A;  3UA6 A;  2KYM A;  5IHN A;  2V1R A;  4QT7 A;  2KR3 A;  1NYF A;  1ARK A;  2XMF A;  2GTO A;  4OMO A;  4IIO A;  1M3C A;  1CSK A;  1TUD A;  4CC3 A;  1K4U S;  1NLO C;  2JW4 A;  1KJW A;  1YCS B;  2CT4 A;  1WXB A;  2PNI A;  1M3A A;  5I22 A;  1ZX6 A;  2DA9 A;  2RQT A;  4ZNX A;  2AZV A;  2D1X A;  2A37 A;  1X27 A;  1GBQ A;  2CH4 A;  1EFN A;  2YSQ A;  2O88 A;  2MCN A;  1UUE A;  5L23 A;  2KRM A;  3REA B;  1SHF A;  2G6F X;  2CSI A;  3U23 A;  2FRY A;  1YNZ A;  1X6B A;  1AD5 A;  4RUG A;  2EPD A;  1I1J A;  2JM8 A;  4CC7 A;  4AG1 C;  1PKS A;  2EW3 A;  1QWE A;  4A63 B;  1U5S A;  4EIK A;  1B3Q A;  1E6H A;  2I0N A;  3NPF A;  2GNC A;  2L2P A;  2EVR A;  3H0F A;  1ABO A;  1TUC A;  4LUD A;  4D8D A;  4WCI A;  2EGC A;  2ENM A;  2LJ1 A;  2K79 A;  2YDL A;  1FMK A;  2RQV A;  2P4R A;  4DEY A;  4F16 A;  3UF4 A;  2EBP A;  1RLP C;  3QWY A;  2DL4 A;  1ABQ A;  1SSH A;  3H0H A;  4JPB W;  1X2Q A;  2DF6 A;  1E7O A;  1M30 A;  2A28 A;  3I9Q A;  3CQT A;  4J9I A;  2DBK A;  2DYB A;  2K6D A;  4Y92 A;  3A98 A;  1AZE A;  1Z9Z A;  2JM9 A;  1UFF A;  1WDX A;  1WI7 A;  2LNH B;  1ZUU A;  1M3B A;  2JMC A;  3UAT A;  1OV3 A;  1UGV A;  1V1C A;  1AWW A;  4CC4 B;  3VS7 A;  1G83 A;  1ZUY A;  4J9E A;  3ZL7 C;  1SRL A;  1MV3 A;  2OJ2 A;  4DEX A;  2NUZ A;  2MIO A;  3M0T A;  2JXB A;  2DX1 A;  2YUQ A;  2GTJ A;  1Y57 A;  1G2B A;  4AG2 C;  2J6F A;  1H92 A;  1RLQ C;  1Y0M A;  5IXB A;  2KRN A;  1OOT A;  2V1Q A;  1PWT A;  1JQQ A;  1WXU A;  1T3L A;  1PRL C;  5GJW B;  2ED0 A;  1H3H A;  3VS4 A;  2LQN A;  1JXM A;  4ORZ A;  1UJY A;  2F2V A;  2DVJ A;  1WLP B;  2CT3 A;  2HBW A;  1YN8 A;  2RPN A;  4JJB A;  3EGU A;  1W6X A;  1UTI A;  3M0Q A;  2LP5 A;  1QKX A;  3ULR B;  1NG2 A;  2LQW A;  1NEG A;  2DRM A;  1IO6 A;  2EYY A;  2OAW A;  2L3Q A;  5IHI A;  3IQL A;  2GGR A;  2HEQ A;  3R6N A;  2DIL A;  2D8H A;  4OMM A;  3VS2 A;  2J6K A;  2KXC A;  1GCP A;  2JT4 A;  3FJ5 A;  1QCF A;  2KEA A;  3SEM A;  1BU1 A;  2EKH A;  3M0R A;  4OMQ A;  4GLM A;  3VS5 A;  2KYB A;  1X69 A;  1T0J A;  1I0C A;  4Z8A A;  1KIK A;  4JZ4 A;  1BBZ A;  2DMO A;  4RTW A;  3QWX X;  3M0S A;  1YWO A;  2FG0 A;  4HCK A;  1SEM A;  1CKB A;  1CKA A;  2ED1 A;  3TVT A;  2DM1 A;  1H8K A;  2FRW A;  4F14 A;  2B86 A;  3PE0 A;  4F17 A;  3EHQ A;  2F2W A;  3JV3 A;  4OMP A;  3EG1 A;  3EG2 A;  1YP5 A;  2JMA A;  2HCK A;  1WA7 A;  3C0C A;  1VYU A;  2EQI A;  4RTZ A;  1ZUK A;  2AKL A;  1JO8 A;  4FSS A;  1ZBJ A;  2YUP A;  2FEI A;  3I5S A;  3TSW A;  4X1V A;  1GCQ C;  4LNP A;  5FWB A;  1S1N A;  4Z89 A;  2LJ3 A;  4R0K A;  2J6O A;  2PZ1 A;  1VYV A;  4AFQ C;  1NYG A;  4RTV A;  2FPE A;  1JU5 C;  1SPK A;  3I5R A;  2RQW A;  1K76 A;  1HD3 A;  4J9G A;  2BZX A;  4AFU C;  2LJ0 A;  1SHG A;  4JZ3 A;  2VKN A;  2GBQ A;  1GRI A;  2JS2 A;  1N5Z A;  4AFZ C;  2DL8 A;  2KRO A;  1KSW A;  3VS0 A;  4CC2 A;  2MOX A;  3THK A;  2QDL A;  2RNA A;  1PNJ A;  4OML A;  1AWJ A;  2JTE A;  3LH5 A;  2EYX A;  5IH2 A;  2AK5 A;  1HJD A;  4D8K A; 
#chains in the Genus database with same CATH topology
 3G4S Q;  3E2U A;  6AT1 B;  3EHR A;  1I5L A;  3KXT A;  4HVU A;  4OB3 B;  1TG0 A;  2E3H A;  3J80 E;  2QAS A;  1VYT A;  3OYE A;  1Q7Y U;  4A54 A;  4BDZ A;  2QQR A;  2KQW A;  1YHQ Q;  4FT4 A;  4K11 A;  2GQI A;  5GMK j;  1IGU A;  2XKO C;  1VQO Q;  2HQX A;  3V8L A;  4AFS C;  2X3X D;  1C0M A;  5HCK A;  2D8J A;  3MEU A;  4RG2 A;  2CP5 A;  2QK0 A;  3MEA A;  2CH4 W;  2NLU A;  1U1T A;  4PJO E;  1JXO A;  2VVK A;  3FB9 A;  3M4Y A;  3CCQ A;  1U1S A;  4JDS A;  3CEY A;  2CP7 A;  2J05 A;  3L1A A;  2C0O A;  3CPW A;  5CQX A;  2C06 A;  3CXC S;  3DLM A;  3M4G A;  1BYM A;  4BI3 A;  4L6V 5;  1K0X A;  4M7A E;  2W0Z A;  3OYD A;  1YBY A;  2DRK A;  5GMK h;  3CCU A;  2FZG B;  2EYQ A;  2AIR B;  5D6W A;  4FT2 A;  3H8Z A;  1UHC A;  1YI2 Q;  2FO0 A;  1Y96 B;  3OSV A;  2BE9 B;  3JB9 D;  4F04 B;  1QVF S;  1WHM A;  4E6R A;  5HK3 A;  3ER0 A;  4PJJ A;  4E7H A;  2YT6 A;  1K8A C;  2K7A A;  2ZPI B;  5A2Q E;  1K9M R;  8AT1 B;  2WSF E;  2AZS A;  4E7S A;  4E47 A;  3ZEH A;  2DJQ A;  1YIT Q;  2LTO A;  2QTV A;  4A4K A;  3EG9 B;  5IHK A;  2DER A;  3INZ A;  3HP9 A;  3E9G A;  4RTY A;  1W1F A;  4CI0 C;  2AT1 B;  1W70 A;  3CC2 A;  3QII A;  1J3T A;  3OQ5 A;  1I5O B;  4M7A C;  1BK2 A;  4HCZ A;  2OAU A;  1PM3 A;  2K5L A;  2YLC A;  4HT9 A;  1MMA A;  3OYC A;  4XK8 E;  3CCV A;  3A8M B;  2L0A A;  3HHT B;  4QQ6 A;  4M77 B;  3EFO B;  3QPH A;  4RTT A;  2DTO A;  3RNJ A;  3WVE B;  3MCA B;  1NPR A;  4RCB A;  3TU4 K;  2RF0 A;  4J9F A;  2DL3 A;  4C92 D;  5FU6 B;  1WJQ A;  5LJ5 j;  4M75 D;  4C8Q B;  2X4Y A;  1VQ6 T;  2K9G A;  2R57 A;  4M77 G;  3QKJ A;  2BZ8 A;  3CCR Q;  5M9O A;  1ZSZ B;  2CRE A;  1AWX A;  2DL7 A;  2D9T A;  1WHL A;  4MDX A;  2KK4 A;  3URG A;  2RMO A;  4J6W A;  1D3B A;  5GAM e;  1ZLM A;  5AYF A;  2VV5 A;  4GBQ A;  5GJV B;  2RQU A;  3VV0 A;  4C8Q G;  1VQ9 A;  4M4Z A;  1Y07 A;  5KYY A;  2L89 A;  1YIJ Q;  5GAN f;  3VJP A;  2D0N A;  3L2Q A;  3JB9 J;  2W10 A;  3EG0 A;  3I55 T;  2KT8 A;  4PFZ A;  3OW2 P;  3PVL A;  4ZTF A;  3QBY A;  4BE2 A;  4IUU A;  5LJ5 h;  1E6G A;  1AT1 B;  2DXC A;  3JCM V;  4LDV A;  2XID A;  4ZN3 A;  2KR3 A;  1VQ7 Q;  4OMO A;  3KBG A;  3ZBD A;  4XAX B;  4M7D E;  4ZTJ A;  2DIG A;  3S3M A;  3JCM e;  2JW4 A;  3OBY A;  1YCS B;  1K9M U;  1WXB A;  2PNI A;  2PUK B;  2X9H A;  5A0L A;  3DB4 A;  2AZV A;  3HL8 A;  1GBQ A;  2CH4 A;  4VUB A;  1EFN A;  2M0O A;  2XU8 A;  4B9X A;  1VQ4 T;  4EPC A;  4BB7 A;  4D6W A;  2EKO A;  2CKK A;  2MCN A;  1KQ2 A;  5L23 A;  2CSI A;  3U23 A;  1BI3 A;  4QVD A;  3MP8 A;  5LJ3 e;  1AD5 A;  1I1J A;  4BY6 B;  3JB9 F;  4CC7 A;  1PD0 A;  1PKS A;  1YJW A;  1N27 A;  3CCS A;  3ZFJ A;  2QEX T;  4EIK A;  1WJR A;  5I21 A;  1B3Q A;  5CCA A;  1E6H A;  2I0N A;  1EIF A;  5CAI A;  4BI4 A;  3UDC A;  2L2P A;  3H0F A;  4M7D C;  4LUD A;  5CR2 A;  2LC4 A;  3L42 A;  1UGR B;  1VQK T;  1KD1 C;  2KSS A;  4XTV A;  2YDL A;  2DVE A;  1V76 A;  2CZ7 B;  1M2O A;  2ZGW A;  2EBP A;  2CZ0 B;  2EQU A;  4WF2 A;  1M8V A;  2HKN A;  3CCE Q;  1VQL T;  4DOV A;  4OB1 B;  1YJ9 T;  4J9I A;  2DBK A;  2DYB A;  3VUB A;  3A98 A;  1Z9Z A;  1WDX A;  3CD6 T;  2YWW A;  2MI6 A;  2JMC A;  3QYG B;  3GOX A;  3HPW A;  1OV3 A;  2RH2 A;  4CC4 B;  1KK7 A;  1SRL A;  1RAD B;  2X51 A;  3A8O B;  3MP6 A;  4DEX A;  2MIO A;  2DD4 A;  4JS5 A;  3M0T A;  1RI0 A;  4M75 F;  2K5I A;  9ATC B;  4AG2 C;  1Q95 G;  1ZA2 B;  3Q1J A;  1IHW A;  4YTL A;  3GPL A;  3UWN A;  1FWZ A;  1YFN A;  1T3L A;  1PRL C;  4E7K A;  3OS0 A;  3QXE B;  2ED0 A;  4KGZ B;  1H3H A;  3VS4 A;  4HKE A;  4BD3 A;  2DVJ A;  2RHX A;  2QA4 Q;  1M1F A;  2H3J A;  4JJB A;  2HZY A;  1Q82 R;  2OAW A;  1JJ2 A;  5IHI A;  3EGX B;  4A4H A;  1M1G A;  4PL6 A;  3VS2 A;  3LWH A;  5D7U A;  1VQN Q;  3LGL A;  1TWB A;  1GCP A;  2Y90 A;  2ZCF B;  1ZA1 B;  5FRM A;  2EKH A;  1RAI B;  1N8R R;  2GFA A;  4GLM A;  3EAE A;  1Q86 R;  1X69 A;  2VC8 A;  1VQ6 A;  2AHJ B;  2BIV A;  1PG5 B;  2O4X B;  1GXI E;  5C6S A;  4JS4 A;  4RTW A;  3OMC A;  3M0S A;  4C8Q D;  1YWO A;  3CME Q;  3EFO A;  1CKB A;  1CKA A;  3TVT A;  2GF7 A;  2DM1 A;  2FRW A;  3EHQ A;  4PLL A;  2XHC A;  3FRN A;  3JSC A;  3FEO A;  5L8R E;  5CQY A;  2YRV A;  3LX7 A;  1LVK A;  2COZ A;  3JAM E;  2LCL A;  4JUV A;  2IVW A;  3I55 A;  4FSS A;  2JNG A;  2MPX C;  5IT9 E;  3TSW A;  1OI1 A;  2Z0W A;  2V8K A;  3OBW A;  2WAC A;  3OYM A;  1S1N A;  2BUD A;  2RB6 A;  4Z89 A;  4PJO A;  5CKB A;  1M90 C;  5A0G A;  2JJ9 A;  4F7U F;  2J6O A;  2CP2 A;  4AFQ C;  1R77 A;  2FPE A;  5GAN 7;  2A7Y A;  4C5G A;  4LXC A;  2L8D A;  5GAO r;  2DTI A;  3CCU Q;  2LJ0 A;  1SHG A;  2VKN A;  2E3I A;  1VQ4 A;  2PU9 B;  1N5Z A;  4AFZ C;  2DL8 A;  2RJF A;  1VQP T;  1Q82 U;  3THK A;  2P0P A;  2DJZ A;  2QDL A;  2DTH A;  4JRQ A;  1S72 T;  4OML A;  2JZ2 A;  3LH5 A;  2EYX A;  3RES A;  3CC4 T;  3JCM Q;  2HKQ B;  2QEX A;  3FDR A;  5GAM f;  1RAA B;  1UEB A;  5I2M A;  4D8K A;  3S6W A;  4B9W A;  1KC8 U;  1K0S A;  3BE3 A;  2XD0 A;  4J83 A;  2KRS A;  2KXD A;  2L3S A;  2JOY A;  2YRC A;  3VYG A;  2BTT A;  2KE9 A;  1N8R U;  1VQK A;  4O6J A;  2IIM A;  4TVR A;  3JB9 G;  1RUW A;  1Q86 U;  5EG2 A;  3CCV Q;  1VQL A;  1B7T A;  5GAN e;  5LJ5 d;  1BIA A;  5IN1 A;  4EMG A;  3M56 A;  3SWN A;  2FPF A;  1RAC B;  1QVF P;  2LVM A;  1QCN A;  3WVD B;  1QVG A;  2E6N A;  2ROT A;  1NJI C;  3CD6 A;  2K2V A;  2DZC A;  2O9V A;  3RMS A;  3H41 A;  1ACM B;  1MNE A;  1KHC A;  2O9S A;  4KRT A;  2RHZ A;  2DZ9 A;  1KQS A;  3CCM Q;  3GIB A;  4C92 B;  2LQ8 A;  3RDV A;  3CBP A;  4LDW A;  2DEU A;  4M75 B;  3PVQ A;  2PTK A;  1ZQ1 A;  3DB3 A;  3G1J A;  1QQJ A;  3M58 A;  5GAN 6;  3G6E T;  1VQ9 Q;  4HVW A;  2H3E B;  3CMA Q;  5CKH A;  2DYI A;  2HSE B;  2ZAE A;  3LW5 E;  4C92 G;  2OTJ A;  4WTO B;  1W4S A;  4M75 G;  1UEC A;  3JRZ A;  1TOV A;  2ABL A;  4BE1 A;  3S3O A;  1WHJ A;  3HRS A;  3RIR A;  1LOJ A;  2CSQ A;  1QWF A;  2K3B A;  3RBB B;  4OGE A;  1WYX A;  2PUO B;  1ZSG A;  3A8G B;  2VAS A;  1I07 A;  1NJI R;  4QKU A;  4OP0 A;  3NHN A;  3LGF A;  1HSQ A;  2DNU A;  3QZ5 B;  3P8D A;  3PMI A;  3OS2 A;  3UA7 A;  3CBO A;  5LJ5 g;  1V29 B;  2DPP B;  1SG5 A;  4OVA A;  2LCS A;  3CPW S;  2RD1 A;  2KNB B;  1AOJ A;  2HBP A;  5IXF A;  3VS3 A;  1M8M A;  4FIB A;  3RUX A;  2KDS A;  2YUO A;  1PD1 A;  2GQV A;  2FPD A;  2KGT A;  3QYH B;  1TH7 A;  2M51 A;  2CS7 A;  3A8H B;  4JJC A;  5I11 A;  2YRD A;  1AVZ C;  1YJW Q;  4IUT A;  2CZ6 B;  3CCS Q;  3AHU A;  1M1K C;  2BE7 D;  1OPL A;  4OB2 B;  2DIQ A;  4ESR A;  4ZGE B;  2R5M A;  4M78 D;  2EJF A;  5ECA A;  2DE0 X;  3L2R A;  4V2S A;  1VQ8 T;  4M77 E;  3HFO A;  1NLP C;  1OPK A;  4J9D A;  3OA6 A;  1VUB A;  2HSP A;  2C0T A;  2ECZ A;  2ZPB B;  3KFV A;  4L59 A;  4LE9 A;  4MDW A;  1BI0 A;  4N4H A;  3A5Z B;  2CUB A;  2KI7 A;  4IKF A;  3CCL A;  1SRM A;  4C8Q E;  3CCJ T;  4KGX B;  1UHF A;  2R5A A;  2BZY A;  2NUP A;  4F7U B;  2H8H A;  5KE3 A;  1VQM T;  3P8B B;  4XU0 A;  4JRK A;  1VQ5 T;  4Z88 A;  1YWP A;  2LNV A;  3UA6 A;  4QT7 A;  5AT1 B;  3OS5 A;  5HKC A;  3G4S T;  3F70 A;  3EFR A;  2D0Q B;  2K57 A;  1CSK A;  4CC3 A;  5FRN A;  4F7U G;  2CT4 A;  3TQ7 P;  4FL6 A;  2DXT A;  3L2Z A;  4A4G A;  3CC4 A;  1H64 1;  2ZPH B;  5I22 A;  1ZX6 A;  4C0D C;  4EMK B;  1YHQ T;  4ZNX A;  2DKG A;  1N9R A;  1X27 A;  5D6X A;  2YSQ A;  2O88 A;  1VQO T;  2KMT A;  2RA2 A;  3QG1 A;  1NZ9 A;  4RUG A;  3NTK A;  4AG1 C;  2VUB A;  7AT1 B;  3GNF B;  4A63 B;  4PNO A;  4PJO C;  4CRI A;  1BCM A;  3NPF A;  3G71 Q;  5FRO A;  2WSE E;  1K73 C;  4WCI A;  3EGD B;  2ENM A;  2LJ1 A;  2RQV A;  4XU2 A;  4KUD K;  4M7D F;  4KH1 B;  4Q5W A;  2EQM A;  3N5B B;  3QWY A;  2YLB A;  3M9Q A;  1YI2 T;  4JPB W;  2A28 A;  3I9Q A;  3CQT A;  4IUR A;  4KBM B;  1D1C A;  3J7A F;  4KH0 B;  4Y92 A;  2JM9 A;  1WI7 A;  1M3B A;  1V1C A;  1UGV A;  3V7R A;  3VS7 A;  5KYW B;  3G6E A;  1ZUY A;  1YIT T;  2NUZ A;  1K8A R;  4FW1 A;  2JXB A;  4FSX A;  4RKU E;  2DX1 A;  2GTJ A;  1Y57 A;  2K5F A;  2J6F A;  4M78 F;  4KUL A;  1RLQ C;  2HAX A;  2VXF A;  3I55 Q;  2KRN A;  2CZ1 B;  1EX4 A;  1WXU A;  4C92 A;  2NUT B;  1Q81 C;  3MO8 A;  3I56 Q;  1C1A A;  1BI2 A;  3CXC A;  5DY9 A;  1W2B A;  1JXM A;  1UGS B;  2F2V A;  2JVV A;  5CKF A;  3MHX A;  2RPN A;  3SWN C;  3VKI A;  1UB4 A;  3MET A;  1W6X A;  2BKD N;  3M5A A;  1B34 B;  3V7S A;  5GAM j;  1IO6 A;  3CC7 T;  1G3W A;  2L3Q A;  2FB7 A;  3IQL A;  3M55 A;  4OF1 A;  3JCM J;  1VQ4 Q;  3R6N A;  1O9S A;  2F5T X;  2D8H A;  5GMK l;  1C6V X;  3CCR T;  4OMM A;  4QVZ A;  4IUP A;  2J6K A;  2M1H A;  2KXC A;  2X4X A;  5J39 A;  4LDX A;  1D1A A;  3FJ5 A;  1QCF A;  1OZ3 A;  1OYX A;  3VUZ A;  4OMQ A;  3VS5 A;  2QGG A;  4ANJ A;  2KYB A;  2EFI A;  4Z8A A;  1OQK A;  3T9N A;  4IUV A;  5GAM h;  3X25 B;  3M53 A;  4BUG A;  4ZGD B;  1SEM A;  1MMN A;  4J7F A;  4FYW B;  2XDD A;  2FZK B;  5DM7 R;  1H8K A;  4F17 A;  2RM4 A;  1WQ7 A;  3QHS A;  4RMO A;  1VQ7 T;  3JV3 A;  5LJ3 j;  3OYB A;  3GP8 A;  4DOW A;  3CCJ A;  4PFO A;  3OMG A;  2EQI A;  4RTZ A;  1ZUK A;  2AKL A;  3PFS A;  1VQM A;  3WXM B;  3CD6 Q;  2YUP A;  2FEI A;  1VQ5 A;  3V8J A;  4X1V A;  1JB0 E;  4J8O A;  5FWB A;  5CKD A;  4QVC A;  3JCM h;  1K8A U;  2LJ3 A;  4R0K A;  5CO7 A;  4KT0 E;  3OYL A;  3A8L B;  4FYX B;  2XIC A;  2RQW A;  3I5R A;  4N4I A;  4EDU A;  1QW1 A;  2FL7 A;  2EJ9 A;  1G8X A;  4KUI A;  1YHQ A;  2BZX A;  1VIE A;  4MML A;  4Y28 E;  1EZZ B;  2F1L A;  3JCM X;  3OYA A;  5LJ3 h;  2GBQ A;  3X24 B;  1RAE B;  1O75 A;  4BI8 B;  4Y91 A;  2KRO A;  4ZN1 A;  1VQO A;  2VB6 A;  3VS0 A;  2OTJ Q;  2RNA A;  1AWJ A;  2JTE A;  4XTW A;  5IH2 A;  4RCC A;  5KCO A;  2P0K A;  2CGH A;  1HJD A;  3EH1 A;  4E7I A;  2DFU A;  3CCE T;  1M27 C;  1U06 A;  2EGE A;  2QG9 B;  1KD1 R;  2J06 A;  1WHG A;  2XDB A;  2MYS A;  3FC3 A;  2X3W D;  2DL5 A;  2KT1 A;  1A0N B;  1P92 A;  1Y96 A;  3MJX A;  2CP3 A;  1SKU B;  4BDY A;  3M0P A;  1TS9 A;  1WQW A;  1WX6 A;  1UGP B;  3RR6 A;  4JJD A;  1FX7 A;  4A53 A;  3HKS A;  3BDU A;  4LD6 A;  1MUZ A;  4C5H A;  2M16 A;  3PIO A;  1XQH A;  3PGG A;  3S3N A;  1WXT A;  3C4S A;  1R0C B;  1AZG B;  2OX7 A;  3EG9 A;  2EQK A;  2LX7 A;  1M5Q 1;  2SRC A;  1GL5 A;  5GAN 3;  3M0U A;  1FYN A;  1YIT A;  1RI9 A;  3ASK A;  1MV0 B;  2QA4 T;  2R58 A;  2K3X A;  2KAF A;  5KYU B;  4KGV B;  4JLG A;  4M77 A;  4XQ3 A;  5LL6 S;  3GNG A;  4M78 B;  2HNI A;  2E41 A;  1KFZ A;  1JRI A;  3BFM A;  3M57 A;  3CPW P;  3LH0 A;  1IZ6 A;  3CCL Q;  3VRZ A;  4OMN A;  1QKW A;  4BAC A;  1X2K A;  1VQN T;  4C8Q A;  3EG3 A;  3PIP A;  4C92 E;  3FLG A;  2E4H A;  1X6O A;  2JTM A;  1U3O A;  4M78 G;  3CC7 A;  1ZSZ A;  2J7I A;  4M75 E;  3HFN A;  2HL5 C;  1TTH B;  3CCQ Q;  2QAZ A;  3NFC A;  4LUE A;  1GFD A;  4HXJ A;  3X26 B;  3C12 A;  3CCR A;  3JCM P;  2L3P A;  2A08 A;  3CME T;  4EMH A;  4J9B A;  3D7S B;  3CC4 Q;  1OEB A;  4A4F A;  1QP3 A;  1WFW A;  1JEG A;  1AWO A;  1GCQ A;  4HVV A;  3PNW C;  1KD1 U;  4M7A D;  3A1P A;  1UG1 A;  2F69 A;  2RN8 A;  2RQR A;  4N0A A;  5LJ5 f;  2A3L A;  3QJY A;  4LN2 A;  2ATC B;  2E12 A;  1NEB A;  4XTX A;  4C92 C;  2M0Y A;  4N4G A;  2XI9 A;  5CKE A;  2RI3 A;  1BI1 A;  2FVU A;  2V8I A;  1NPP A;  4PKC C;  1VQ7 A;  2A36 A;  2EGA A;  2P84 A;  1Q7Y C;  2ESW A;  2DD5 A;  2F2X A;  1X6G A;  3R6O A;  5GMK m;  1M90 R;  3RKY A;  3CC2 Q;  3C94 A;  1K1Z A;  1LCK A;  3OW2 A;  1N9S A;  4FW2 A;  2AKK A;  1YJ9 A;  4XU1 A;  1BIB A;  2LCC A;  4J6X A;  4MZP A;  4XTZ A;  2VXE A;  2DLP A;  2C0I A;  2NWM A;  5IHN A;  2V1R A;  3OSS C;  1NYF A;  3RKW A;  2XMF A;  1IXD A;  5GAN j;  2GTO A;  2LRQ A;  2LT4 A;  4IIO A;  2OTL T;  1M3C A;  4PK4 A;  1TUD A;  2VYT A;  4MZT A;  4O5V A;  3EFS A;  3JCM b;  2IG0 A;  4F7U E;  1M3A A;  2RQT A;  2D1X A;  4HA8 A;  2A37 A;  1WPY A;  5DLQ E;  2PVG B;  3CCV T;  3OY9 A;  3CCE A;  5CIU A;  4ELZ C;  2FRY A;  1D3B B;  1X6B A;  1YNZ A;  3OYK A;  2EPD A;  1U8R A;  2EW3 A;  5KYY B;  5GAN h;  4OGC A;  2P4T A;  3CCM T;  1ZHI A;  1YJN T;  2GNC A;  3RKX A;  2EVR A;  4UC4 A;  4PJO F;  3E9F A;  3JCM d;  3TCJ A;  4D8D A;  4M7D D;  2RO0 A;  1PSF A;  1YCY A;  2EGC A;  2MK5 A;  1FMK A;  2P0Q A;  2QI2 A;  3UF4 A;  2RJE A;  1VQ9 T;  1SSH A;  4NS5 A;  3CMA T;  3H0H A;  1X2Q A;  2DF6 A;  4M7A F;  1M30 A;  3HRT A;  2QA4 A;  1SSF A;  3EGX A;  4L5G A;  1M90 U;  3G7Z A;  2K6D A;  1G3Y A;  1ZBX A;  3UAT A;  1ZUU A;  1TXQ A;  4JRI A;  3QSU A;  3BY7 A;  1AWW A;  1D0X A;  3LYI A;  1TUG B;  3C95 A;  1MV3 A;  3OYH A;  3E1S A;  2OJ2 A;  5J26 A;  5GAM g;  1VQN A;  3E19 A;  4AT1 B;  1RAH B;  1OOT A;  2O4X A;  1JQQ A;  2FZC B;  2MAM A;  3CBM A;  3OYN A;  5FU7 B;  4J7I A;  3J81 E;  4PJL A;  1WLP B;  4M78 A;  5GMK e;  1YN8 A;  3OYI A;  1RAF B;  5I2S A;  3EGU A;  2RHU A;  1UTI A;  2LP5 A;  1QKX A;  2V8J A;  3UT1 A;  3ULR B;  3CME A;  4A4E A;  2LQW A;  1YJW T;  3CCS T;  2EYY A;  4BE0 A;  3JCM g;  2KY9 A;  4X9C A;  2HEQ A;  4DBH A;  2DIL A;  1VQP A;  1M1K R;  1QCO A;  1K9M C;  1JJ2 P;  1S72 A;  4M77 C;  2JT4 A;  2O01 E;  2KEA A;  3SEM A;  5LJ3 g;  2B8A A;  2QYZ A;  3M0R A;  5DLO A;  2LT1 A;  1G5V A;  1NJI U;  5GAO l;  1HYO A;  1T0J A;  1I0C A;  5FU6 C;  4GY5 A;  4C8Q C;  2ZZD A;  2ZPF B;  3QWX X;  1W2B S;  1ZSZ C;  2MWO A;  1NBE B;  1LJO A;  2DK3 A;  2HQH A;  2E70 A;  4C0F A;  4F14 A;  2B86 A;  1M9S A;  4LDY A;  4OMP A;  1WHH A;  2DET A;  1YP5 A;  2JMA A;  5GAO n;  2HCK A;  1WA7 A;  4X9D A;  4PFP A;  1RL2 A;  1DJ7 B;  2MWP A;  1JO8 A;  1TU0 B;  3I5S A;  1I8F A;  1PC0 A;  4XTU A;  1GCQ C;  4LNP A;  5KE2 A;  1VQ6 Q;  4N0A C;  4OMF B;  1VOM A;  3RMQ A;  2OTL A;  2PZ1 A;  1PSE A;  2QQB A;  2E5Q A;  1MHN A;  1JU5 C;  1F1B B;  3HTR A;  1R0B G;  1K76 A;  4HT8 A;  1VIF A;  1I81 A;  4AFU C;  2K4Y A;  3MEW A;  1Y71 A;  2L5Q A;  2ZPE B;  1GRI A;  3G71 T;  4DA4 A;  4CC2 A;  5LJ5 e;  2MOX A;  3FIF A;  4J6Y A;  1IRX A;  1PNJ A;  1X01 A;  4HCC A;  4C0D B;  1QVP A;  2VGM A;  5GMK i;  3CC7 Q;  2M9U A;  4P5N A;  1IGQ A;  2AK5 A;  4BY6 C;  3L2V A;  3LWI A;  1HK9 A;  2PVO B;  4M75 A;  1K73 R;  1RAB B;  2CDT A;  1M1K U;  1MMG A;  3H0I A;  4E7Z A;  3DLL A;  3CCM A;  1YJN A;  2QQ9 A;  3MKD A;  1NM7 A;  2VGN A;  4LD9 K;  3GF5 A;  1HXD A;  3QDR B;  5GAN 5;  2O2O A;  4PJO B;  3UPU A;  1PKT A;  4C0Z A;  1QVF A;  2CUD A;  4ME7 A;  3CMA A;  3SHW A;  1B07 A;  3V8K A;  4E2F B;  1M2V B;  3QZ9 B;  2VWF A;  3FJP A;  2X4W A;  1T0H A;  2XG8 D;  4M7A B;  2QXF A;  3NTH A;  1WZO A;  1UE9 A;  2JS0 A;  4PJO G;  3VS1 A;  1MGQ A;  1IHV A;  1D1B A;  2QEX Q;  4X34 A;  3I56 T;  5FW9 A;  1OZ2 A;  3REB B;  3PTA A;  2CYZ B;  1GBR A;  2RK2 A;  4RTX A;  1VA7 A;  1QVG P;  3SB2 A;  5KYX B;  4J9H A;  1YIJ T;  3GBQ A;  1Q81 R;  5KH6 A;  1TSF A;  1VQ8 A;  4M7A G;  1QLY A;  4FYV B;  4IUQ A;  2G3R A;  1XOV A;  2RHI A;  1VQK Q;  2LZ6 B;  2EYW A;  5GAN 4;  2V26 A;  1UDL A;  2X35 A;  1Z9Q A;  1KQS P;  1OU9 A;  2E5K A;  1FXX A;  2EYZ A;  2M02 A;  3O5Z A;  1VQL Q;  4ELY C;  1YJ9 Q;  5GAN d;  1X75 C;  3KUF A;  1JJ2 S;  5EC7 A;  3PMT A;  1NE8 A;  4FCY A;  3TSZ A;  5A0D A;  1WIE A;  2ROL A;  3NMZ C;  4FM4 B;  4R56 A;  3I35 A;  4M78 E;  3SWN B;  3G4S A;  4DBR A;  2GCX A;  4JJN K;  1WJS A;  4J5Y A;  2JUF A;  2K3Y A;  1PRM C;  1X43 A;  3OYG A;  5D6Y A;  1AHJ B;  1UJ0 A;  1KHI A;  2LMJ A;  3AT1 B;  4E7J A;  1MMD A;  3JB9 I;  4DBF A;  1K73 U;  4F7U A;  1Q82 C;  1T3S A;  1JBM A;  4QQG A;  1N6A A;  2MF2 A;  8ATC B;  3LLR A;  2O31 A;  2GFU A;  4RTU A;  4ATO A;  1AEY A;  3VS6 A;  2E6Z A;  2NYS A;  4II1 A;  2KBT A;  2K2M A;  3SDZ A;  1IRE B;  1KC8 C;  3QO3 A;  4J9C A;  3OYF A;  4C92 F;  2HQE A;  2QQS A;  4M78 C;  1UGQ B;  4EMK A;  1KG1 A;  3P8H A;  2YUN A;  1GFC A;  1N8R C;  4NOY A;  3HSB A;  2KVQ G;  1SF9 A;  3TEE A;  2DBM A;  1Q86 C;  1WHK A;  3VRY A;  5GAN g;  3NGP A;  5FWC A;  4M7D B;  1BB9 A;  3BDL A;  3QJ6 A;  1K9A A;  1Q81 U;  1YI2 A;  4GLK A;  1OX9 A;  2X4J A;  2OTJ T;  4IIM A;  4Z02 A;  4FYY B;  2HDA A;  2SEM A;  1LNX A;  5GAO m;  2YHT A;  1PHT A;  2OI3 A;  2DO3 A;  3QDF A;  1D0Y A;  2KYM A;  3EH2 A;  1G3S A;  4M7D G;  1ARK A;  3EGD A;  4OB0 B;  4PJN A;  3ME9 A;  3G71 A;  3NTI A;  1KC8 R;  5HY6 A;  1K4U S;  1NLO C;  2WSC E;  1KJW A;  4B6M A;  4ZGJ B;  3H6Z A;  4M77 D;  1MND A;  2RI5 A;  1H3Z A;  2DA9 A;  4PJM A;  2HMA A;  1UUE A;  1FMW A;  2KRM A;  2JTF A;  2RJC A;  3REA B;  1SHF A;  2G6F X;  4XTY A;  5KYW A;  3L2U A;  2RHY A;  1M4Z A;  3PT9 A;  2COW A;  2JM8 A;  2LQK A;  3OW2 S;  1QWE A;  1U5S A;  1WGS A;  5J3B A;  1BCO A;  3JCM c;  1QVG S;  2NUP B;  3JB9 H;  4PJO D;  2NUT A;  1VQP Q;  1QP2 A;  2EQJ A;  1ABO A;  1TUC A;  1S72 Q;  1D09 B;  1D0Z A;  3L2W A;  1KQS S;  2K79 A;  2P4R A;  4DEY A;  1QMC A;  3OB9 A;  4F16 A;  3I56 A;  1RLP C;  1B34 A;  2YXY A;  5FLX E;  2DL4 A;  2QTX A;  1ABQ A;  1XTD A;  4DBQ A;  2COY A;  3CCL T;  3M59 A;  1E7O A;  3V7C A;  1YIJ A;  2ZPG B;  3OYY A;  5HK0 A;  5CVI A;  1I4K 1;  2DXB A;  4C5E A;  4AMC A;  1AZE A;  3MPU B;  1M2V A;  1UFF A;  2LNH B;  2Y4Y A;  2DXU A;  3CPF A;  4M75 C;  4JLI A;  4M7A A;  1G83 A;  3CCQ T;  2A0F B;  4J9E A;  3ZL7 C;  2PVD B;  1OU8 A;  2DAQ A;  2YUQ A;  1G2B A;  3VU3 C;  4JRP A;  2I2L A;  4QQD A;  1H92 A;  1G3T A;  1Y0M A;  5KYX A;  5IXB A;  2V1Q A;  1PWT A;  3CCU T;  5GJW B;  2EAY A;  4HCB A;  4ORZ A;  2LQN A;  2F5K A;  1UJY A;  2XK0 A;  2CT3 A;  2HBW A;  4NL2 A;  2OTL Q;  1BKB A;  3OYJ A;  1RAG B;  3M0Q A;  3CXC P;  1W2B P;  3SD4 A;  1NG2 A;  1NEG A;  2DRM A;  2L3R A;  5GAO q;  1XNI A;  4XU3 A;  4MMK A;  5KYN A;  2GGR A;  3G6E Q;  3GLX A;  5CK9 A;  3TRE A;  2IPO B;  2E64 A;  2XDP A;  3JCM f;  1LPL A;  1FMV A;  2QGF B;  4QW2 A;  2E1H A;  3CC2 T;  1BU1 A;  1Q7Y R;  5GAM d;  2CP6 A;  4M77 F;  3X20 B;  2QDY B;  1R8O B;  5C0M A;  1YJN Q;  3MP1 A;  1KIK A;  4JZ4 A;  1BBZ A;  2DMO A;  5LJ3 f;  1OX8 A;  3BW1 A;  2FG0 A;  4HCK A;  1Y7X A;  3JCM W;  2RK1 A;  2PQW A;  3QUI A;  3HRU A;  4C8Q F;  2ED1 A;  4RG8 A;  1KQ1 A;  3SFM A;  2EJG A;  3PE0 A;  2E10 A;  4FU6 A;  2F2W A;  3VYH B;  3EG1 A;  1IB8 A;  2JN0 A;  3EG2 A;  2QQA A;  5FU7 C;  4C0G A;  3C0C A;  1VYU A;  3X28 B;  2DEQ A;  1ZBJ A;  2LX9 A;  3H9N A;  2LDM A;  4C5I A;  2MMP A;  5IAY A;  3O8V A;  1WNL A;  3DKM A;  1VYV A;  3MEV A;  1NYG A;  4R55 A;  4RTV A;  1VQ8 Q;  5LJ3 d;  4M7D A;  1SPK A;  2EIF A;  4MZM A;  5GAO p;  3RER A;  3OS1 A;  1HD3 A;  4J9G A;  1OUL A;  4DQ2 A;  4JZ3 A;  2CP0 A;  4E7L A;  4PLI A;  5GAN 8;  2JS2 A;  4EMK C;  4LDU A;  1XJW B;  2RJD A;  1KSW A;  2EWN A;  2Y4X A;  2FHD A;  3CCJ Q;  4NL3 A;  2HD0 A;  5GAN 2;  2RI2 A;  1VQM Q;  5KCH A;  2E65 A;  3M54 A;  1VQ5 Q;  2D6F A;  1PCX A;  5KYU A;  2HL3 A;  2FYK A; 
#chains in the Genus database with same CATH homology
 2CDT A;  1M27 C;  1U06 A;  3H0I A;  2EGE A;  3EHR A;  1K0S A;  2J06 A;  4HVU A;  2X3W D;  2DL5 A;  1NM7 A;  2KT1 A;  1TG0 A;  1A0N B;  2KRS A;  1VYT A;  2KXD A;  2L3S A;  2BTT A;  2KE9 A;  2O2O A;  1PKT A;  3M0P A;  2IIM A;  1RUW A;  1WX6 A;  4K11 A;  2GQI A;  4JJD A;  2CUD A;  3SHW A;  1B07 A;  1MUZ A;  4AFS C;  2VWF A;  2X3X D;  2FPF A;  1T0H A;  5HCK A;  1WXT A;  2D8J A;  1UE9 A;  2JS0 A;  1AZG B;  2ROT A;  3VS1 A;  2O9V A;  2CH4 W;  3H41 A;  2LX7 A;  1JXO A;  2SRC A;  2VVK A;  1GL5 A;  5FW9 A;  3REB B;  2O9S A;  3M0U A;  1FYN A;  4KRT A;  1GBR A;  4RTX A;  1VA7 A;  1RI9 A;  2J05 A;  4J9H A;  3GBQ A;  1MV0 B;  2C0O A;  1QLY A;  1XOV A;  3PVQ A;  2PTK A;  2LZ6 B;  2EYW A;  1K0X A;  2W0Z A;  1UDL A;  1Z9Q A;  2DRK A;  1KFZ A;  2E5K A;  2EYZ A;  4HVW A;  1UHC A;  3O5Z A;  2FO0 A;  3VRZ A;  4OMN A;  1QKW A;  1X2K A;  5EC7 A;  4E6R A;  3EG3 A;  3TSZ A;  2YT6 A;  1UEC A;  2K7A A;  1WIE A;  1U3O A;  2ABL A;  2J7I A;  2ROL A;  3NMZ C;  2AZS A;  3I35 A;  2CSQ A;  1QWF A;  2K3B A;  2DJQ A;  3RBB B;  1WYX A;  1ZSG A;  4LUE A;  1I07 A;  1GFD A;  4HXJ A;  2L3P A;  3NHN A;  5IHK A;  2A08 A;  1HSQ A;  2DNU A;  1PRM C;  1X43 A;  4RTY A;  1W1F A;  4J9B A;  1UJ0 A;  3UA7 A;  1OEB A;  2LMJ A;  1W70 A;  1J3T A;  1WFW A;  2LCS A;  1BK2 A;  1JEG A;  1AWO A;  2KNB B;  1T3S A;  1GCQ A;  1AOJ A;  4HVV A;  5IXF A;  3VS3 A;  1M8M A;  2YUO A;  1UG1 A;  2FPD A;  2RN8 A;  2L0A A;  2KGT A;  2O31 A;  2RQR A;  4RTU A;  2M51 A;  4RTT A;  4LN2 A;  3RNJ A;  1AEY A;  3VS6 A;  4JJC A;  5I11 A;  1NEB A;  2KBT A;  1AVZ C;  2RF0 A;  2K2M A;  2M0Y A;  4J9F A;  2DL3 A;  1OPL A;  4J9C A;  4ESR A;  2K9G A;  2A36 A;  2EGA A;  2YUN A;  1GFC A;  2BZ8 A;  5ECA A;  2DE0 X;  2ESW A;  1NLP C;  1OPK A;  4J9D A;  2F2X A;  2CRE A;  1AWX A;  1X6G A;  2DBM A;  2DL7 A;  2HSP A;  3VRY A;  2C0T A;  2RMO A;  2ECZ A;  3NGP A;  1K1Z A;  1ZLM A;  1LCK A;  3KFV A;  4LE9 A;  5GJV B;  4GBQ A;  2RQU A;  5FWC A;  1BB9 A;  4M4Z A;  2CUB A;  1K9A A;  1SRM A;  2AKK A;  4IIM A;  1UHF A;  2D0N A;  2HDA A;  2SEM A;  2BZY A;  2H8H A;  2W10 A;  3EG0 A;  1PHT A;  2KT8 A;  2DLP A;  2C0I A;  2NWM A;  2OI3 A;  3PVL A;  4Z88 A;  1YWP A;  1E6G A;  3UA6 A;  2KYM A;  5IHN A;  2V1R A;  4QT7 A;  2KR3 A;  1NYF A;  1ARK A;  2XMF A;  2GTO A;  4OMO A;  4IIO A;  1M3C A;  1CSK A;  1TUD A;  4CC3 A;  1K4U S;  1NLO C;  2JW4 A;  1KJW A;  1YCS B;  2CT4 A;  1WXB A;  2PNI A;  1M3A A;  5I22 A;  1ZX6 A;  2DA9 A;  2RQT A;  4ZNX A;  2AZV A;  2D1X A;  2A37 A;  1X27 A;  1GBQ A;  2CH4 A;  1EFN A;  2YSQ A;  2O88 A;  2MCN A;  1UUE A;  5L23 A;  2KRM A;  3REA B;  1SHF A;  2G6F X;  2CSI A;  3U23 A;  2FRY A;  1YNZ A;  1X6B A;  1AD5 A;  4RUG A;  2EPD A;  1I1J A;  2JM8 A;  4CC7 A;  4AG1 C;  1PKS A;  2EW3 A;  1QWE A;  4A63 B;  1U5S A;  4EIK A;  1B3Q A;  1E6H A;  2I0N A;  3NPF A;  2GNC A;  2L2P A;  2EVR A;  3H0F A;  1ABO A;  1TUC A;  4LUD A;  4D8D A;  4WCI A;  2EGC A;  2ENM A;  2LJ1 A;  2K79 A;  2YDL A;  1FMK A;  2RQV A;  2P4R A;  4DEY A;  4F16 A;  3UF4 A;  2EBP A;  1RLP C;  3QWY A;  2DL4 A;  1ABQ A;  1SSH A;  3H0H A;  4JPB W;  1X2Q A;  2DF6 A;  1E7O A;  1M30 A;  2A28 A;  3I9Q A;  3CQT A;  4J9I A;  2DBK A;  2DYB A;  2K6D A;  4Y92 A;  3A98 A;  1AZE A;  1Z9Z A;  2JM9 A;  1UFF A;  1WDX A;  1WI7 A;  2LNH B;  1ZUU A;  1M3B A;  2JMC A;  3UAT A;  1OV3 A;  1UGV A;  1V1C A;  1AWW A;  4CC4 B;  3VS7 A;  1G83 A;  1ZUY A;  4J9E A;  3ZL7 C;  1SRL A;  1MV3 A;  2OJ2 A;  4DEX A;  2NUZ A;  2MIO A;  3M0T A;  2JXB A;  2DX1 A;  2YUQ A;  2GTJ A;  1Y57 A;  1G2B A;  4AG2 C;  2J6F A;  1H92 A;  1RLQ C;  1Y0M A;  5IXB A;  2KRN A;  1OOT A;  2V1Q A;  1PWT A;  1JQQ A;  1WXU A;  1T3L A;  1PRL C;  5GJW B;  2ED0 A;  1H3H A;  3VS4 A;  2LQN A;  1JXM A;  4ORZ A;  1UJY A;  2F2V A;  2DVJ A;  1WLP B;  2CT3 A;  2HBW A;  1YN8 A;  2RPN A;  4JJB A;  3EGU A;  1W6X A;  1UTI A;  3M0Q A;  2LP5 A;  1QKX A;  3ULR B;  1NG2 A;  2LQW A;  1NEG A;  2DRM A;  1IO6 A;  2EYY A;  2OAW A;  2L3Q A;  5IHI A;  3IQL A;  2GGR A;  2HEQ A;  3R6N A;  2DIL A;  2D8H A;  4OMM A;  3VS2 A;  2J6K A;  2KXC A;  1GCP A;  2JT4 A;  3FJ5 A;  1QCF A;  2KEA A;  3SEM A;  1BU1 A;  2EKH A;  3M0R A;  4OMQ A;  4GLM A;  3VS5 A;  2KYB A;  1X69 A;  1T0J A;  1I0C A;  4Z8A A;  1KIK A;  4JZ4 A;  1BBZ A;  2DMO A;  4RTW A;  3QWX X;  3M0S A;  1YWO A;  2FG0 A;  4HCK A;  1SEM A;  1CKB A;  1CKA A;  2ED1 A;  3TVT A;  2DM1 A;  1H8K A;  2FRW A;  4F14 A;  2B86 A;  3PE0 A;  4F17 A;  3EHQ A;  2F2W A;  3JV3 A;  4OMP A;  3EG1 A;  3EG2 A;  1YP5 A;  2JMA A;  2HCK A;  1WA7 A;  3C0C A;  1VYU A;  2EQI A;  4RTZ A;  1ZUK A;  2AKL A;  1JO8 A;  4FSS A;  1ZBJ A;  2YUP A;  2FEI A;  3I5S A;  3TSW A;  4X1V A;  1GCQ C;  4LNP A;  5FWB A;  1S1N A;  4Z89 A;  2LJ3 A;  4R0K A;  2J6O A;  2PZ1 A;  1VYV A;  4AFQ C;  1NYG A;  4RTV A;  2FPE A;  1JU5 C;  1SPK A;  3I5R A;  2RQW A;  1K76 A;  1HD3 A;  4J9G A;  2BZX A;  4AFU C;  2LJ0 A;  1SHG A;  4JZ3 A;  2VKN A;  2GBQ A;  1GRI A;  2JS2 A;  1N5Z A;  4AFZ C;  2DL8 A;  2KRO A;  1KSW A;  3VS0 A;  4CC2 A;  2MOX A;  3THK A;  2QDL A;  2RNA A;  1PNJ A;  4OML A;  1AWJ A;  2JTE A;  3LH5 A;  2EYX A;  5IH2 A;  2AK5 A;  1HJD A;  4D8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...