3CCEQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cceQ00
3CPWP 1NJIR 1S72Q 1VQ8Q 1QVFP 1KQSP 3I55Q 1KC8R 1JJ2P 1W2BP 1VQ4Q 1VQ6Q 3CD6Q 1Q86R 3CMEQ 1Q81R 1YI2Q 1VQOQ 3CCUQ 1YIJQ 1N8RR 1K73R 1VQ7Q 1YJ9Q 2QEXQ 1QVGP 1VQKQ 2QA4Q 2OTJQ 3CCJQ 3CCVQ 3I56Q 1VQ9Q 3CCMQ 1M90R 2OTLQ 3G4SQ 1K8AR 3CCQQ 1Q7YR 3CCLQ 1YITQ 3G71Q 1VQMQ 3OW2P 3CC7Q 1M1KR 3G6EQ 3CCRQ 3CCEQ 1VQ5Q 1VQPQ 1YJWQ 1YJNQ 1YHQQ 1VQLQ 3CXCP 3CC2Q 1KD1R 1Q82R 3CCSQ 3CC4Q 1VQNQ 3CMAQ 1K9MR
chains in the Genus database with same CATH superfamily
3CCQA 1RAIB 3JB9G 1AD5A 3BDLA 5GAMf 1VQKQ 3KXTA 3FJPA 3LGLA 1D3BA 2F2VA 4HVUA 3EGXA 3EAEA 4DQ2A 3S6WA 5FRMA 2ENMA 1TXQA 2QXFA 2FRYA 3A98A 4M75B 3WVEB 4JUVA 3OYNA 2IVWA 1QP3A 2OAUA 4C5GA 3EFRA 5DY9A 1VYVA 3CCUQ 1WHJA 4XTZA 3UWNA 5HKCA 3I56Q 1VQ9Q 2DK3A 1M9SA 5GAOr 5FROA 3JCMc 1BCMA 4Z02A 5HY6A 4L5GA 2JW4A 3HL8A 3JB9D 2E6ZA 4R0KA 1TG0A 3NTIA 1JJ2S 2QQ9A 1YNZA 1H641 2MPXC 2KXCA 1ZQ1A 1NLOC 3OYIA 1UJ0A 3OYFA 2O31A 2F2WA 3QG1A 5GANf 3T9NA 2CZ1B 2ZCFB 1T3LA 2HKQB 2RF0A 3INZA 1K9MU 4J9FA 2ROLA 1Q81U 2L3PA 4J6WA 1QVFS 2ECZA 4M7AF 3VRZA 4A4EA 5A0DA 4RG2A 2KQWA 3G4ST 4KT0E 1E7OA 5M9OA 4NL3A 2GQVA 5GMKm 3GBQA 3EHRA 4ELZC 3H6ZA 2HEQA 4D8KA 2RQVA 3NTHA 5KYUA 1VQKA 2AKLA 3HSBA 4A4FA 1WNLA 4L6V5 2M9UA 4JLIA 4C92E 2DBKA 4F14A 4FU6A 4EDUA 5CR2A 2JJ9A 2HCKA 3PVQA 1TUDA 4C92A 2E3IA 2YUPA 1ZBJA 3OSSC 1VIFA 2RI5A 5GANh 4PKCC 2EFIA 3CD6T 1I1JA 1TH7A 1UTIA 2D9TA 3V8LA 3CCUA 2PNIA 3M0UA 1PC0A 3I56A 1VQ9A 4IUUA 1WFWA 1SRLA 2VYTA 1JRIA 1QW1A 2W10A 2FRWA 2F5KA 1OPKA 2QG9B 1YCSB 4OGCA 2R5MA 1LJOA 1G2BA 2CZ0B 2V1RA 3GP8A 2EQIA 1YJ9T 2FPEA 3CCJT 1QP2A 1AVZC 2MOXA 1Q95G 4CC7A 2PTKA 1YITT 2E4HA 3MHXA 1KQSP 3PFSA 4LDXA 2OTJQ 4ZTJA 5IHKA 3X20B 2JN0A 1QQJA 4MZMA 2DF6A 2FEIA 5CKDA 2EAYA 2GTJA 2OAWA 3OSVA 4Z8AA 4PJOG 2DEUA 1VQLQ 2QGGA 5LJ5e 3UF4A 3QWXX 5GANd 1GCPA 2X3XD 4IUQA 4A4HA 1XQHA 1N6AA 1YI2Q 4KGXB 2RHUA 5KYXA 3OS1A 3H9NA 4J9GA 2CUDA 4J9BA 1JXMA 1CKAA 1KIKA 4E7LA 3PGGA 1X43A 4AFSC 4OVAA 3EG3A 4M78G 3OYAA 4M7DB 5D6YA 1AWJA 4A54A 2FVUA 3A8HB 3VUZA 1G3SA 1VQ8Q 1M2OA 1C0MA 1O75A 4M7AE 4X34A 1YP5A 2W0ZA 2D0QB 1I8FA 1HK9A 4C8QD 4M7AA 5GAN3 4PJOD 4EMKB 2QAZA 3L1AA 3X28B 4K11A 3PVLA 4TVRA 1UECA 1VQ4T 3EFOA 2HL5C 1VYUA 3RBBB 1G3TA 3CCSQ 3SEMA 4CC3A 3I55Q 3FDRA 1B07A 4A4KA 2JTEA 3V7RA 5GANj 3HFOA 5GAN2 4M78D 2XKOC 1CKBA 3TSWA 2D0NA 1W70A 4DA4A 1IRXA 3QKJA 1PSEA 4OP0A 2JNGA 2DNUA 3QSUA 1M2VB 2OTJA 3VV0A 1OV3A 3OA6A 2PU9B 1E6GA 1MV0B 3M0SA 4JPBW 2ZAEA 1VQLA 1K0XA 3BDUA 3CC4T 3M0TA 2D8JA 1K8AR 1JBMA 4A53A 3G71Q 2VKNA 3LLRA 2COZA 3MPUB 5FWBA 2FZCB 1YI2A 1AWOA 2MI6A 2K3XA 4C92C 3VS4A 3P8BB 2B8AA 4D8DA 4DBRA 2VXFA 2J6OA 3PTAA 2RQUA 4M78B 1I5OB 4RCBA 1WXTA 1M8VA 4E47A 3J80E 2CT3A 2CP3A 4XU2A 1VQ8A 4GY5A 2FB7A 1BIAA 3OMCA 1YIJT 2VV5A 4BE1A 1G3WA 2KY9A 1BI3A 5IHNA 1N9RA 5D7UA 4FIBA 3EG0A 1JJ2P 4HA8A 1FYNA 2HBWA 4LDVA 3S3NA 3CCSA 2CGHA 3CXCS 1UHFA 3I55A 1YBYA 3URGA 4BY6B 2RPNA 2CP0A 1KQSA 3EG1A 2Y4YA 1QVFP 2GCXA 2RHZA 3OYCA 2QQSA 3JCMX 4KRTA 3GF5A 3H0HA 2P4RA 2FG0A 1PCXA 2CREA 4FL6A 1NJIU 3C4SA 2JUFA 2BZYA 3OS2A 1ZUYA 3JRZA 3OYKA 2DL5A 2LNHB 3CCRQ 1K0SA 1SPKA 5FLXE 1IO6A 5A0GA 2OTLT 2XMFA 2P0KA 2DETA 3KBGA 1M27C 1WHHA 5L23A 3H0IA 3OMGA 2YDLA 1I5LA 4QQGA 3JCMe 3OYLA 4X1VA 2LVMA 2WSFE 3WXMB 1H3ZA 2DZ9A 1VQ5Q 1Q7YU 3RKYA 4M7AC 4BI4A 3E1SA 1X2QA 1D1AA 1Q86C 2KVQG 4Y28E 2J6FA 5GAMe 8AT1B 3MP1A 1ZBXA 2EQMA 2R58A 1GL5A 3M0QA 3L2VA 4PLLA 4M77G 2VWFA 2XD0A 3RUXA 1KQ2A 1RAHB 1NE8A 4FYXB 1VYTA 4IUTA 1Q82R 1VQNQ 3VKIA 2RK1A 2QTVA 1MMDA 3U23A 4M7DF 1BIBA 3PMTA 4JDSA 1X2KA 2PVDB 4RTTA 2GFUA 4JRPA 2DLPA 2KMTA 2MWPA 5A0LA 4B9XA 2DVEA 1VQPQ 1YJWQ 2KEAA 4LDWA 3HTRA 2ZPHB 2KT8A 3JCMJ 3FRNA 4M77D 3M55A 4J9EA 3A8OB 2XU8A 1X6OA 2CYZB 5GAN6 3CCRA 4DOVA 5GANe 1WYXA 3JCMP 3OW2S 1WHMA 1ZSZA 4FT4A 3TEEA 1UGPB 4CI0C 4F17A 1N27A 4NOYA 2EYYA 4XU1A 3EGDB 3OYDA 2QA4T 5KYWA 2FZKB 2EKHA 3A8MB 4XTYA 2DXUA 4XU0A 5HK0A 4JZ3A 3TREA 3M57A 3KUFA 4MZTA 4RG8A 4OF1A 2YRVA 5GMKl 1Y57A 3M58A 1VQ5A 4NL2A 3ER0A 2QEXQ 3M59A 1TUGB 5GAN7 3CCVQ 4IKFA 1M90R 2DVJA 2RD1A 3A8LB 1B34B 2GTOA 3L2UA 4M77B 1JJ2A 4PK4A 1PD1A 4FYVB 1HSQA 4KUIA 2KI7A 5GMKh 1VQKT 4Z88A 3NGPA 1OQKA 1RL2A 3X26B 1M1KU 1SEMA 1AOJA 1TU0B 1M4ZA 1ZLMA 1Q81R 1KK7A 3G7ZA 2L5QA 4HCBA 3VYHB 1VQNA 2BE7D 2KYBA 4Y92A 1QVFA 4C92F 4OMPA 5EC7A 4J9DA 2DEQA 4BI3A 3CCUT 3GNFB 4LD6A 3I56T 1ZA2B 1VQ9T 5LJ3g 2ESWA 1JQQA 2DFUA 2X4JA 1AWWA 2RK2A 4E6RA 3CBOA 2B86A 1VQPA 1YJWA 5HK3A 2EYQA 2O4XA 2EQKA 4HXJA 5FU6B 3L2WA 4XAXB 2RO0A 2I2LA 1MNEA 1PRMC 1V29B 5KE3A 2PUKB 1EX4A 1YHQQ 2K2MA 3MEVA 1X27A 1M5Q1 1W6XA 2DRMA 2YLCA 1M1GA 2CSQA 3LX7A 3SWNB 1BCOA 1ABQA 2M51A 1EIFA 2COWA 1ZSGA 1U5SA 1D3BB 2LJ1A 3PNWC 3CCLQ 3C12A 3SB2A 4QW2A 3M4YA 2HNIA 4LDUA 4OGEA 4M7DE 1KJWA 2QEXA 3JB9I 3CCVA 2X4YA 2NUPB 2YRDA 4M7DA 2XG8D 1UGSB 2EYZA 2GNCA 2EJ9A 4LD9K 1D1CA 2DL8A 4E7IA 2PVOB 2ZPBB 4OB0B 3LYIA 4QKUA 2LQNA 2WACA 1K8AC 3HPWA 4PFPA 3UDCA 2JM9A 3RNJA 3JCMh 4M75E 4HCKA 1YJNQ 3CC2Q 1M90U 2CP5A 1OZ3A 3QYGB 1AHJB 1S72Q 1QVPA 3UPUA 3CMEQ 3ULRB 2ATCB 4JJBA 1T0HA 2ZZDA 4N0AA 5J26A 3REBB 1UJYA 5GAMh 1KC8U 2MF2A 6AT1B 2CP6A 1G5VA 4Y91A 3M4GA 3QIIA 1RUWA 1U06A 5IXFA 1Y96B 2FZGB 5GMKj 2LNVA 1Y7XA 2XIDA 2K6DA 4RTZA 2Z0WA 1LCKA 1ZSZC 4J5YA 3RKXA 5DLQE 5CO7A 5I2MA 4F7UB 3VS6A 1F1BB 1YHQA 4IIOA 1X6BA 5GAOm 1OX8A 1NZ9A 3V8KA 2VASA 1JB0E 4N4GA 2J6KA 2LP5A 4JLGA 2OTJT 3QWYA 3EG9B 4P5NA 3CCLA 5DM7R 5EG2A 2P84A 3OBWA 2YUNA 4DBHA 2LDMA 3VS5A 3JCMd 3ZBDA 1WIEA 1VQLT 3VUBA 2GGRA 4RKUE 2G6FX 2JXBA 2XI9A 2O9VA 1YI2T 1GCQA 1NLPC 3CCEQ 2AK5A 3M54A 1K9AA 1RI0A 5FU7B 4M7AG 5GAMd 1TWBA 5CKFA 3L2ZA 2RHIA 1YJNA 3CC2A 2E5QA 3CCMQ 4GLKA 2JMCA 5GAN8 1S72A 1VQ8T 1RAGB 1WPYA 2XDDA 4KUDK 2LCSA 1SG5A 3SDZA 1NM7A 3CMEA 1IXDA 3OS5A 2ZPEB 2BKDN 2DIQA 3NTKA 4FW2A 2LQKA 3H41A 5GAOq 1TOVA 1VQOQ 3JCMW 4LUDA 1KD1U 2DE0X 1BU1A 2HMAA 2X4WA 5LJ5g 3CCST 1UHCA 2RN8A 4AG1C 4OB3B 1N8RU 4OMFB 2QDLA 3I55T 3OW2P 4M7AD 2A36A 4C8QG 1Q82C 2OJ2A 2M02A 2DA9A 2CS7A 4ZN1A 2K5IA 1QVGS 4OMLA 1WHLA 4JS5A 2E64A 3D7SB 3I35A 1WA7A 2HBPA 5GAMj 1MMNA 5GAN5 4RTYA 2LCLA 1VQMQ 3QYHB 4M7DC 1K73U 4HVWA 2YXYA 1YN8A 1IGQA 1G83A 2A08A 4QVZA 2KRSA 1PNJA 3MP8A 1JEGA 2CKKA 1UDLA 3CBPA 2E5KA 3G71T 3MO8A 1LPLA 5GAN4 3CCEA 2BE9B 4CC2A 1UGQB 4LE9A 3CXCA 2L0AA 1WZOA 2K5FA 1KHIA 2L3RA 1UUEA 2FPFA 4PJMA 4L59A 2DL7A 3PMIA 2V8IA 5CKEA 2G3RA 2VUBA 2YLBA 1QKXA 1SSHA 3Q1JA 2X35A 1UE9A 3FC3A 4O6JA 3CCMA 1XNIA 4RCCA 3UT1A 3VS2A 1PWTA 4N0AC 1U1TA 1NJIR 1EZZB 2KYMA 3HRSA 3ZL7C 1ZUKA 3LW5E 4EMKA 2DXBA 3WVDB 1P92A 1VQOA 3L42A 2MAMA 3NMZC 2DXTA 2FO0A 4XTUA 1K9MC 1RLQC 4C8QB 5GAOn 4PJOB 1Q81C 5AT1B 1KG1A 4JJDA 1FMWA 1WHKA 2QDYB 3M0PA 4JJNK 3OS0A 3JSCA 1Q7YR 3META 3QXEB 1VA7A 2RI3A 2YWWA 5GMKe 1KSWA 2CT4A 1M2VA 1W2BS 4FM4B 1ZX6A 3V8JA 2DRKA 2XDBA 3C95A 1VQMA 4GLMA 2QGFB 2LX9A 3CCRT 1GFDA 2AKKA 4RTVA 1UFFA 1MV3A 1GCQC 5ECAA 2CP7A 3I9QA 2ZPFB 2F1LA 2DPPB 3X25B 2O01E 2DTOA 1W4SA 3F70A 1VIEA 4KGVB 3HRTA 1BI0A 1VQ5T 2P0QA 4E2FB 3HHTB 2KXDA 3JV3A 4DEYA 1I4K1 4HT9A 1N5ZA 2V26A 4WF2A 2HAXA 3QJ6A 2JTFA 2CZ6B 4QQDA 1NEGA 1EFNA 3OW2A 1VQNT 3RMSA 2RH2A 4MDWA 1ARKA 1H92A 2X51A 1NEBA 1WDXA 5KYYB 4B9WA 3DB4A 3PIPA 2EYWA 3H8ZA 1YFNA 4RTXA 1VQPT 1BI1A 3TQ7P 4ANJA 1U3OA 2V1QA 3R6OA 1GRIA 5D6WA 1SKUB 5IH2A 4ESRA 2DTHA 2ROTA 3L2RA 4R56A 5C0MA 1Z9ZA 1M1KR 2RQWA 3N5BB 2O9SA 1W1FA 4PJNA 3GPLA 3CCQT 4LXCA 2QYZA 1ZHIA 2C0TA 3HP9A 3AHUA 3M9QA 1WJRA 2RHXA 1WX6A 2O2OA 2DYIA 2L3QA 4V2SA 2LX7A 2K9GA 1XJWB 1X75C 3CCVT 2EIFA 3G1JA 4EMKC 1I0CA 2JMAA 5DLOA 2RJFA 2NUTB 2K7AA 3LWIA 4C0FA 2LZ6B 1RAFB 2DX1A 1H8KA 1LNXA 4XQ3A 1PM3A 2EPDA 3E9FA 4R55A 1WQ7A 2LJ0A 3RESA 5GANg 1PKTA 1R0CB 1NYGA 5IT9E 2COYA 1PSFA 3UA7A 4A63B 4M75F 2KNBB 3FIFA 3R6NA 1QVGP 1I81A 4E7KA 1E6HA 4ORZA 4HT8A 1D0XA 1FX7A 2GQIA 3CPWS 1BI2A 2MCNA 4E7HA 3CMAQ 4OMMA 2KR3A 2P4TA 2DERA 1VOMA 4ZNXA 5CCAA 4BUGA 1RLPC 2VGNA 1BKBA 1S1NA 1QWEA 1UGRB 5GAOl 2AZSA 2BTTA 3M0RA 1XTDA 1YHQT 3RERA 1TUCA 3JB9J 4XTVA 3QZ9B 2QQRA 2D1XA 2WSCE 1ABOA 4RMOA 3J7AF 4M7DG 3GNGA 1AT1B 3EGDA 2JVVA 2PZ1A 1PG5B 2K2VA 1ACMB 3CCLT 1KC8R 4GBQA 2RHYA 3DKMA 3X24B 2GF7A 2DD5A 3FEOA 2YHTA 4VUBA 3OBYA 3C94A 4M77E 4F7UF 1B34A 2K3YA 2LQWA 3JB9F 1OU9A 4M77A 1MHNA 1HD3A 2CSIA 3PIOA 3JCMb 4RTWA 1Y07A 2C0IA 2DM1A 1SHFA 2KROA 2HSEB 1OU8A 1VQ6Q 3DLMA 4J7FA 5FRNA 3LH0A 2NUZA 1T3SA 4M7DD 2X3WD 3OYYA 4BY6C 1YJNT 4PFZA 3V7SA 4BDZA 1A0NB 1S72T 1WQWA 3CMET 1PD0A 3OYJA 4OB2B 1B7TA 2OTLA 1NJIC 2RNAA 1G3YA 4JZ4A 1W2BP 3QDRB 3VRYA 3AT1B 4Z89A 4ZGEB 3MEWA 2L8DA 2QA4Q 2LT4A 4IIMA 3CMAA 1H3HA 2DJZA 3EGXB 4KGZB 3CC7Q 1OEBA 2X4XA 2EJGA 4C5EA 2MWOA 3CBMA 4C92G 1OULA 1FMVA 2KDSA 3UATA 3SWNA 5IXBA 3FJ5A 2RA2A 1AZGB 1VQ7Q 5FWCA 4C0DC 1Q7YC 2RQRA 2QTXA 2CZ7B 3KFVA 1GBQA 2JS0A 1Y0MA 2FYKA 1QLYA 3QJYA 3NFCA 5GAOp 3CXCP 1KD1R 4IUVA 4M75A 2EGEA 2H8HA 2M1HA 2NUPA 4JRKA 1B3QA 5CKBA 3DB3A 3VS3A 1OOTA 1WLPB 2LTOA 1BYMA 4LDYA 1M3BA 4HKEA 1N8RR 3CCET 1M1FA 2YSQA 4QT7A 2DL3A 3E19A 2E10A 3SHWA 4BD3A 4C92D 4J83A 2O88A 1VQ6A 2FHDA 4WCIA 5CIUA 3G6EQ 4HCZA 1UB4A 4M4ZA 3ASKA 3CCMT 1QVGA 1FWZA 1KFZA 1AEYA 1I07A 1IZ6A 2NYSA 2HQXA 1Y71A 1K73R 4KH1B 3ZEHA 1MNDA 4FSXA 1RABB 1FMKA 3EGUA 3A8GB 3OQ5A 2IIMA 1RI9A 1SSFA 1Y96A 1VQOT 5KYUB 1UEBA 3QPHA 5J39A 2QA4A 4OMQA 3PT9A 1IHVA 4FYYB 2KSSA 4F7UE 1ZA1B 3RMQA 3CC7A 1Q86R 4C92B 3E9GA 4F7UA 4J6YA 1PHTA 1RAAB 1OZ2A 4ME7A 3TCJA 1M3AA 4AFQC 1CSKA 1QKWA 1VQ7A 4DBFA 2RJCA 2DAQA 2JS2A 2V8JA 2EKOA 5A2QE 5KYNA 1GFCA 3EG9A 2ED0A 5I21A 5AYFA 1M3CA 4N4IA 1VQMT 1BB9A 1IGUA 2EGCA 2GFAA 4ZTFA 2NLUA 2M0OA 2EVRA 2EJFA 3J81E 4C8QF 4M77C 1D0YA 5CVIA 4PJOF 2XK0A 1U8RA 1M1KC 4YTLA 2CUBA 4N4HA 2RB6A 1T0JA 2BZXA 2PQWA 3RR6A 1FXXA 2OI3A 2FPDA 3P8DA 5KCOA 1N9SA 1U1SA 1IB8A 3OY9A 2C06A 1JU5C 1QCFA 4II1A 3G6EA 4DEXA 2V8KA 4M78F 1AWXA 5LJ3f 4LN2A 3G4SQ 2F69A 3GOXA 2ZPIB 3O8VA 2K3BA 2HZYA 1W2BA 1KHCA 3VS7A 4MZPA 4C0GA 2E65A 3HFNA 3CPWP 4DBQA 4A4GA 3QZ5B 2H3JA 5FU6C 4LNPA 4EMHA 4EMGA 2A28A 5KYXB 3TU4K 2M0YA 4MDXA 1HYOA 2Y4XA 5HCKA 3OYGA 1RACB 2AT1B 2EYXA 1QMCA 1NPPA 3SWNC 2YUOA 4AFZC 4JRIA 1JO8A 2KE9A 3CD6Q 3TVTA 1WI7A 1XOVA 4IURA 3VS1A 2CDTA 2DMOA 4M7AB 2RMOA 5CAIA 3OYBA 1JXOA 2XDPA 4X9CA 1Q86U 1QWFA 4LUEA 1TS9A 1UG1A 4M75C 2E6NA 2JOYA 2CH4A 3EFOB 5LJ3h 5IAYA 3IQLA 3GIBA 2XICA 4AT1B 2KBTA 2QQBA 2P0PA 2VB6A 3QO3A 2ABLA 2RQTA 4F04B 2LQ8A 1SF9A 1YJ9Q 3CCJQ 1K76A 2ZPGB 4ZGJB 1R0BG 4MMLA 1M90C 3BY7A 3M53A 1YITQ 1NG2A 3QUIA 2DJQA 3OB9A 2KK4A 1UGVA 4OMOA 3G4SA 3A1PA 1KC8C 5GMKi 1MMGA 3A5ZB 3REAB 2A7YA 9ATCB 3GLXA 2K79A 2KT1A 4AG2C 1R8OB 2QASA 2PUOB 1AZEA 2DBMA 8ATCB 4C5IA 4UC4A 3CPFA 2HD0A 2H3EB 4C8QE 1DJ7B 4PJOE 2KRMA 4C8QA 2LCCA 2F5TX 4PJLA 2RJDA 4PJOA 5LL6S 3THKA 1V76A 2EBPA 2RM4A 2DYBA 3H0FA 4PFOA 3UA6A 5GJVB 5LJ3d 4XK8E 2X9HA 2JT4A 4MMKA 1OI1A 1LVKA 3CD6A 1J3TA 3E2UA 1ZUUA 4AFUC 2C0OA 2HSPA 3EG2A 2K57A 1M30A 1WJSA 5I2SA 4M78E 5KH6A 1YWPA 4KH0B 2YT6A 3M56A 2CH4W 4J7IA 2EW3A 5I11A 4M78A 1VQ4Q 2EQUA 1X6GA 2KGTA 2YRCA 4BDYA 3MEAA 2HL3A 3VU3C 2F2XA 3V7CA 4E7JA 3L2QA 2HKNA 4WTOB 3QBYA 1TTHB 1D09B 1PKSA 2DIGA 5FU7C 2SRCA 3EH2A 3RKWA 1MMAA 1YJ9A 2QK0A 2MK5A 2FL7A 3CCJA 4J9CA 4FW1A 2BUDA 3NHNA 1YITA 1GBRA 3VS0A 1R77A 4EIKA 1YWOA 3MP6A 2RI2A 3FLGA 1OYXA 4BACA 2KRNA 3FB9A 1HJDA 1X69A 4HVVA 7AT1B 5LJ3j 4J9HA 1QCOA 4AMCA 3CPWA 5CQXA 5CQYA 1C6VX 2EQJA 4D6WA 3HRUA 2J05A 3SFMA 2VXEA 1KD1C 5LJ5f 2DD4A 4C0ZA 3CC4Q 4X9DA 5IHIA 4CC4B 3JCMg 2VVKA 4M77F 1N8RC 1SRMA 3QDFA 4QVCA 3BE3A 2WSEE 2E70A 1YJWT 2LJ3A 1IREB 1BBZA 4E7SA 1X01A 4J8OA 2VGMA 5KE2A 2KAFA 5GAMg 3NPFA 5KYYA 1TSFA 2JTMA 1D1BA 3G71A 2AHJB 3M5AA 5I22A 1K73C 2NWMA 1YIJQ 3MJXA 4OB1B 2HDAA 4QQ6A 3VYGA 4JS4A 2K4YA 3CMAT 2DL4A 3EHQA 1VQ4A 3S3MA 3OYMA 1NBEB 3JAME 4C0DB 3VJPA 4F16A 1V1CA 3QHSA 1K8AU 2QEXT 3CQTA 4JJCA 1K1ZA 4PLIA 1IHWA 4RTUA 1BK2A 1WHGA 2XHCA 5LJ5h 2LT1A 2D6FA 4FYWB 2EWNA 3HKSA 2BZ8A 1WXBA 2E3HA 3MCAB 2GBQA 2DXCA 2DKGA 3I5SA 5KCHA 3SD4A 3OYHA 1LOJA 2PVGB 4IUPA 4ELYC 2SEMA 2L89A 5L8RE 2MYSA 4KULA 1WXUA 4J6XA 2LMJA 4E7ZA 2LRQA 2NUTA 4EPCA 4FSSA 5CK9A 2LC4A 3JCMV 5C6SA 2HQHA 1O9SA 1ZSZB 3BFMA 3CC4A 1M8MA 4XTXA 4HCCA 2OTLQ 1MUZA 1VQ6T 3LH5A 2BIVA 4C8QC 3EH1A 4PJOC 1KQSS 2ED1A 5KYWB 2DZCA 2IPOB 4RUGA 3LWHA 4PJJA 2QI2A 2YUQA 2M16A 3CCQQ 2OX7A 2JZ2A 2CP2A 1OX9A 3MEUA 3JB9H 1YIJA 4M78C 5LJ5d 4QVDA 2DILA 4ATOA 4O5VA 2A0FB 2HQEA 2AZVA 1K4US 3C0CA 1SHGA 2QQAA 3RIRA 4BE2A 1MGQA 5GJWB 1C1AA 3CC7T 3BW1A 1VUBA 2MMPA 2EGAA 2K5LA 4FCYA 2R57A 1PRLC 2DTIA 1HXDA 1OPLA 1D0ZA 4BE0A 1WGSA 1Z9QA 4M75G 4PL6A 2I0NA 5D6XA 2J06A 3O5ZA 4BI8B 4J9IA 3ZFJA 4KBMB 1VQ7T 4XTWA 3ME9A 1K9MR 3P8HA 1NPRA 2L3SA 3LGFA 1NYFA 3DLLA 2ZGWA 3OYEA 3I5RA 4XU3A 1G8XA 5J3BA 2AIRB 2E12A 1RAEB 3MKDA 4NS5A 4DOWA 3CC2T 2O4XB 4B6MA 5IN1A 2JM8A 2E1HA 2VC8A 3S3OA 4C5HA 1KQ1A 1RADB 3EFSA 4FT2A 4OMNA 1QCNA 2A3LA 2J7IA 4CRIA 5CKHA 2DO3A 5LJ5j 4PNOA 2A37A 2MIOA 2R5AA 2L2PA 2IG0A 1WJQA 1YCYA 3PE0A 4M75D 3G6ET 1Q82U 2RJEA 3JCMQ 3JCMf 2D8HA 2E41A 4ZGDB 4JRQA 5LJ3e 3CEYA 3RDVA 4Q5WA 5FW9A 4ZN3A 4BB7A 1GXIE 2Y90A 3TSZA 4F7UG
chains in the Genus database with same CATH topology
3CPWP 1NJIR 1S72Q 1VQ8Q 1QVFP 1KQSP 3I55Q 1KC8R 1JJ2P 1W2BP 1VQ4Q 1VQ6Q 3CD6Q 1Q86R 3CMEQ 1Q81R 1YI2Q 1VQOQ 3CCUQ 1YIJQ 1N8RR 1K73R 1VQ7Q 1YJ9Q 2QEXQ 1QVGP 1VQKQ 2QA4Q 2OTJQ 3CCJQ 3CCVQ 3I56Q 1VQ9Q 3CCMQ 1M90R 2OTLQ 3G4SQ 1K8AR 3CCQQ 1Q7YR 3CCLQ 1YITQ 3G71Q 1VQMQ 3OW2P 3CC7Q 1M1KR 3G6EQ 3CCRQ 3CCEQ 1VQ5Q 1VQPQ 1YJWQ 1YJNQ 1YHQQ 1VQLQ 3CXCP 3CC2Q 1KD1R 1Q82R 3CCSQ 3CC4Q 1VQNQ 3CMAQ 1K9MR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW P;  1NJI R;  1S72 Q;  1VQ8 Q;  1QVF P;  1KQS P;  3I55 Q;  1KC8 R;  1JJ2 P;  1W2B P;  1VQ4 Q;  1VQ6 Q;  3CD6 Q;  1Q86 R;  3CME Q;  1Q81 R;  1YI2 Q;  1VQO Q;  3CCU Q;  1YIJ Q;  1N8R R;  1K73 R;  1VQ7 Q;  1YJ9 Q;  2QEX Q;  1QVG P;  1VQK Q;  2QA4 Q;  2OTJ Q;  3CCJ Q;  3CCV Q;  3I56 Q;  1VQ9 Q;  3CCM Q;  1M90 R;  2OTL Q;  3G4S Q;  1K8A R;  3CCQ Q;  1Q7Y R;  3CCL Q;  1YIT Q;  3G71 Q;  1VQM Q;  3OW2 P;  3CC7 Q;  1M1K R;  3G6E Q;  3CCR Q;  3CCE Q;  1VQ5 Q;  1VQP Q;  1YJW Q;  1YJN Q;  1YHQ Q;  1VQL Q;  3CXC P;  3CC2 Q;  1KD1 R;  1Q82 R;  3CCS Q;  3CC4 Q;  1VQN Q;  3CMA Q;  1K9M R; 
#chains in the Genus database with same CATH topology
 3CCQ A;  1RAI B;  3JB9 G;  1AD5 A;  3BDL A;  5GAM f;  1VQK Q;  3KXT A;  3FJP A;  3LGL A;  1D3B A;  2F2V A;  4HVU A;  3EGX A;  3EAE A;  4DQ2 A;  3S6W A;  5FRM A;  2ENM A;  1TXQ A;  2QXF A;  2FRY A;  3A98 A;  4M75 B;  3WVE B;  4JUV A;  3OYN A;  2IVW A;  1QP3 A;  2OAU A;  4C5G A;  3EFR A;  5DY9 A;  1VYV A;  3CCU Q;  1WHJ A;  4XTZ A;  3UWN A;  5HKC A;  3I56 Q;  1VQ9 Q;  2DK3 A;  1M9S A;  5GAO r;  5FRO A;  3JCM c;  1BCM A;  4Z02 A;  5HY6 A;  4L5G A;  2JW4 A;  3HL8 A;  3JB9 D;  2E6Z A;  4R0K A;  1TG0 A;  3NTI A;  1JJ2 S;  2QQ9 A;  1YNZ A;  1H64 1;  2MPX C;  2KXC A;  1ZQ1 A;  1NLO C;  3OYI A;  1UJ0 A;  3OYF A;  2O31 A;  2F2W A;  3QG1 A;  5GAN f;  3T9N A;  2CZ1 B;  2ZCF B;  1T3L A;  2HKQ B;  2RF0 A;  3INZ A;  1K9M U;  4J9F A;  2ROL A;  1Q81 U;  2L3P A;  4J6W A;  1QVF S;  2ECZ A;  4M7A F;  3VRZ A;  4A4E A;  5A0D A;  4RG2 A;  2KQW A;  3G4S T;  4KT0 E;  1E7O A;  5M9O A;  4NL3 A;  2GQV A;  5GMK m;  3GBQ A;  3EHR A;  4ELZ C;  3H6Z A;  2HEQ A;  4D8K A;  2RQV A;  3NTH A;  5KYU A;  1VQK A;  2AKL A;  3HSB A;  4A4F A;  1WNL A;  4L6V 5;  2M9U A;  4JLI A;  4C92 E;  2DBK A;  4F14 A;  4FU6 A;  4EDU A;  5CR2 A;  2JJ9 A;  2HCK A;  3PVQ A;  1TUD A;  4C92 A;  2E3I A;  2YUP A;  1ZBJ A;  3OSS C;  1VIF A;  2RI5 A;  5GAN h;  4PKC C;  2EFI A;  3CD6 T;  1I1J A;  1TH7 A;  1UTI A;  2D9T A;  3V8L A;  3CCU A;  2PNI A;  3M0U A;  1PC0 A;  3I56 A;  1VQ9 A;  4IUU A;  1WFW A;  1SRL A;  2VYT A;  1JRI A;  1QW1 A;  2W10 A;  2FRW A;  2F5K A;  1OPK A;  2QG9 B;  1YCS B;  4OGC A;  2R5M A;  1LJO A;  1G2B A;  2CZ0 B;  2V1R A;  3GP8 A;  2EQI A;  1YJ9 T;  2FPE A;  3CCJ T;  1QP2 A;  1AVZ C;  2MOX A;  1Q95 G;  4CC7 A;  2PTK A;  1YIT T;  2E4H A;  3MHX A;  1KQS P;  3PFS A;  4LDX A;  2OTJ Q;  4ZTJ A;  5IHK A;  3X20 B;  2JN0 A;  1QQJ A;  4MZM A;  2DF6 A;  2FEI A;  5CKD A;  2EAY A;  2GTJ A;  2OAW A;  3OSV A;  4Z8A A;  4PJO G;  2DEU A;  1VQL Q;  2QGG A;  5LJ5 e;  3UF4 A;  3QWX X;  5GAN d;  1GCP A;  2X3X D;  4IUQ A;  4A4H A;  1XQH A;  1N6A A;  1YI2 Q;  4KGX B;  2RHU A;  5KYX A;  3OS1 A;  3H9N A;  4J9G A;  2CUD A;  4J9B A;  1JXM A;  1CKA A;  1KIK A;  4E7L A;  3PGG A;  1X43 A;  4AFS C;  4OVA A;  3EG3 A;  4M78 G;  3OYA A;  4M7D B;  5D6Y A;  1AWJ A;  4A54 A;  2FVU A;  3A8H B;  3VUZ A;  1G3S A;  1VQ8 Q;  1M2O A;  1C0M A;  1O75 A;  4M7A E;  4X34 A;  1YP5 A;  2W0Z A;  2D0Q B;  1I8F A;  1HK9 A;  4C8Q D;  4M7A A;  5GAN 3;  4PJO D;  4EMK B;  2QAZ A;  3L1A A;  3X28 B;  4K11 A;  3PVL A;  4TVR A;  1UEC A;  1VQ4 T;  3EFO A;  2HL5 C;  1VYU A;  3RBB B;  1G3T A;  3CCS Q;  3SEM A;  4CC3 A;  3I55 Q;  3FDR A;  1B07 A;  4A4K A;  2JTE A;  3V7R A;  5GAN j;  3HFO A;  5GAN 2;  4M78 D;  2XKO C;  1CKB A;  3TSW A;  2D0N A;  1W70 A;  4DA4 A;  1IRX A;  3QKJ A;  1PSE A;  4OP0 A;  2JNG A;  2DNU A;  3QSU A;  1M2V B;  2OTJ A;  3VV0 A;  1OV3 A;  3OA6 A;  2PU9 B;  1E6G A;  1MV0 B;  3M0S A;  4JPB W;  2ZAE A;  1VQL A;  1K0X A;  3BDU A;  3CC4 T;  3M0T A;  2D8J A;  1K8A R;  1JBM A;  4A53 A;  3G71 Q;  2VKN A;  3LLR A;  2COZ A;  3MPU B;  5FWB A;  2FZC B;  1YI2 A;  1AWO A;  2MI6 A;  2K3X A;  4C92 C;  3VS4 A;  3P8B B;  2B8A A;  4D8D A;  4DBR A;  2VXF A;  2J6O A;  3PTA A;  2RQU A;  4M78 B;  1I5O B;  4RCB A;  1WXT A;  1M8V A;  4E47 A;  3J80 E;  2CT3 A;  2CP3 A;  4XU2 A;  1VQ8 A;  4GY5 A;  2FB7 A;  1BIA A;  3OMC A;  1YIJ T;  2VV5 A;  4BE1 A;  1G3W A;  2KY9 A;  1BI3 A;  5IHN A;  1N9R A;  5D7U A;  4FIB A;  3EG0 A;  1JJ2 P;  4HA8 A;  1FYN A;  2HBW A;  4LDV A;  3S3N A;  3CCS A;  2CGH A;  3CXC S;  1UHF A;  3I55 A;  1YBY A;  3URG A;  4BY6 B;  2RPN A;  2CP0 A;  1KQS A;  3EG1 A;  2Y4Y A;  1QVF P;  2GCX A;  2RHZ A;  3OYC A;  2QQS A;  3JCM X;  4KRT A;  3GF5 A;  3H0H A;  2P4R A;  2FG0 A;  1PCX A;  2CRE A;  4FL6 A;  1NJI U;  3C4S A;  2JUF A;  2BZY A;  3OS2 A;  1ZUY A;  3JRZ A;  3OYK A;  2DL5 A;  2LNH B;  3CCR Q;  1K0S A;  1SPK A;  5FLX E;  1IO6 A;  5A0G A;  2OTL T;  2XMF A;  2P0K A;  2DET A;  3KBG A;  1M27 C;  1WHH A;  5L23 A;  3H0I A;  3OMG A;  2YDL A;  1I5L A;  4QQG A;  3JCM e;  3OYL A;  4X1V A;  2LVM A;  2WSF E;  3WXM B;  1H3Z A;  2DZ9 A;  1VQ5 Q;  1Q7Y U;  3RKY A;  4M7A C;  4BI4 A;  3E1S A;  1X2Q A;  1D1A A;  1Q86 C;  2KVQ G;  4Y28 E;  2J6F A;  5GAM e;  8AT1 B;  3MP1 A;  1ZBX A;  2EQM A;  2R58 A;  1GL5 A;  3M0Q A;  3L2V A;  4PLL A;  4M77 G;  2VWF A;  2XD0 A;  3RUX A;  1KQ2 A;  1RAH B;  1NE8 A;  4FYX B;  1VYT A;  4IUT A;  1Q82 R;  1VQN Q;  3VKI A;  2RK1 A;  2QTV A;  1MMD A;  3U23 A;  4M7D F;  1BIB A;  3PMT A;  4JDS A;  1X2K A;  2PVD B;  4RTT A;  2GFU A;  4JRP A;  2DLP A;  2KMT A;  2MWP A;  5A0L A;  4B9X A;  2DVE A;  1VQP Q;  1YJW Q;  2KEA A;  4LDW A;  3HTR A;  2ZPH B;  2KT8 A;  3JCM J;  3FRN A;  4M77 D;  3M55 A;  4J9E A;  3A8O B;  2XU8 A;  1X6O A;  2CYZ B;  5GAN 6;  3CCR A;  4DOV A;  5GAN e;  1WYX A;  3JCM P;  3OW2 S;  1WHM A;  1ZSZ A;  4FT4 A;  3TEE A;  1UGP B;  4CI0 C;  4F17 A;  1N27 A;  4NOY A;  2EYY A;  4XU1 A;  3EGD B;  3OYD A;  2QA4 T;  5KYW A;  2FZK B;  2EKH A;  3A8M B;  4XTY A;  2DXU A;  4XU0 A;  5HK0 A;  4JZ3 A;  3TRE A;  3M57 A;  3KUF A;  4MZT A;  4RG8 A;  4OF1 A;  2YRV A;  5GMK l;  1Y57 A;  3M58 A;  1VQ5 A;  4NL2 A;  3ER0 A;  2QEX Q;  3M59 A;  1TUG B;  5GAN 7;  3CCV Q;  4IKF A;  1M90 R;  2DVJ A;  2RD1 A;  3A8L B;  1B34 B;  2GTO A;  3L2U A;  4M77 B;  1JJ2 A;  4PK4 A;  1PD1 A;  4FYV B;  1HSQ A;  4KUI A;  2KI7 A;  5GMK h;  1VQK T;  4Z88 A;  3NGP A;  1OQK A;  1RL2 A;  3X26 B;  1M1K U;  1SEM A;  1AOJ A;  1TU0 B;  1M4Z A;  1ZLM A;  1Q81 R;  1KK7 A;  3G7Z A;  2L5Q A;  4HCB A;  3VYH B;  1VQN A;  2BE7 D;  2KYB A;  4Y92 A;  1QVF A;  4C92 F;  4OMP A;  5EC7 A;  4J9D A;  2DEQ A;  4BI3 A;  3CCU T;  3GNF B;  4LD6 A;  3I56 T;  1ZA2 B;  1VQ9 T;  5LJ3 g;  2ESW A;  1JQQ A;  2DFU A;  2X4J A;  1AWW A;  2RK2 A;  4E6R A;  3CBO A;  2B86 A;  1VQP A;  1YJW A;  5HK3 A;  2EYQ A;  2O4X A;  2EQK A;  4HXJ A;  5FU6 B;  3L2W A;  4XAX B;  2RO0 A;  2I2L A;  1MNE A;  1PRM C;  1V29 B;  5KE3 A;  2PUK B;  1EX4 A;  1YHQ Q;  2K2M A;  3MEV A;  1X27 A;  1M5Q 1;  1W6X A;  2DRM A;  2YLC A;  1M1G A;  2CSQ A;  3LX7 A;  3SWN B;  1BCO A;  1ABQ A;  2M51 A;  1EIF A;  2COW A;  1ZSG A;  1U5S A;  1D3B B;  2LJ1 A;  3PNW C;  3CCL Q;  3C12 A;  3SB2 A;  4QW2 A;  3M4Y A;  2HNI A;  4LDU A;  4OGE A;  4M7D E;  1KJW A;  2QEX A;  3JB9 I;  3CCV A;  2X4Y A;  2NUP B;  2YRD A;  4M7D A;  2XG8 D;  1UGS B;  2EYZ A;  2GNC A;  2EJ9 A;  4LD9 K;  1D1C A;  2DL8 A;  4E7I A;  2PVO B;  2ZPB B;  4OB0 B;  3LYI A;  4QKU A;  2LQN A;  2WAC A;  1K8A C;  3HPW A;  4PFP A;  3UDC A;  2JM9 A;  3RNJ A;  3JCM h;  4M75 E;  4HCK A;  1YJN Q;  3CC2 Q;  1M90 U;  2CP5 A;  1OZ3 A;  3QYG B;  1AHJ B;  1S72 Q;  1QVP A;  3UPU A;  3CME Q;  3ULR B;  2ATC B;  4JJB A;  1T0H A;  2ZZD A;  4N0A A;  5J26 A;  3REB B;  1UJY A;  5GAM h;  1KC8 U;  2MF2 A;  6AT1 B;  2CP6 A;  1G5V A;  4Y91 A;  3M4G A;  3QII A;  1RUW A;  1U06 A;  5IXF A;  1Y96 B;  2FZG B;  5GMK j;  2LNV A;  1Y7X A;  2XID A;  2K6D A;  4RTZ A;  2Z0W A;  1LCK A;  1ZSZ C;  4J5Y A;  3RKX A;  5DLQ E;  5CO7 A;  5I2M A;  4F7U B;  3VS6 A;  1F1B B;  1YHQ A;  4IIO A;  1X6B A;  5GAO m;  1OX8 A;  1NZ9 A;  3V8K A;  2VAS A;  1JB0 E;  4N4G A;  2J6K A;  2LP5 A;  4JLG A;  2OTJ T;  3QWY A;  3EG9 B;  4P5N A;  3CCL A;  5DM7 R;  5EG2 A;  2P84 A;  3OBW A;  2YUN A;  4DBH A;  2LDM A;  3VS5 A;  3JCM d;  3ZBD A;  1WIE A;  1VQL T;  3VUB A;  2GGR A;  4RKU E;  2G6F X;  2JXB A;  2XI9 A;  2O9V A;  1YI2 T;  1GCQ A;  1NLP C;  3CCE Q;  2AK5 A;  3M54 A;  1K9A A;  1RI0 A;  5FU7 B;  4M7A G;  5GAM d;  1TWB A;  5CKF A;  3L2Z A;  2RHI A;  1YJN A;  3CC2 A;  2E5Q A;  3CCM Q;  4GLK A;  2JMC A;  5GAN 8;  1S72 A;  1VQ8 T;  1RAG B;  1WPY A;  2XDD A;  4KUD K;  2LCS A;  1SG5 A;  3SDZ A;  1NM7 A;  3CME A;  1IXD A;  3OS5 A;  2ZPE B;  2BKD N;  2DIQ A;  3NTK A;  4FW2 A;  2LQK A;  3H41 A;  5GAO q;  1TOV A;  1VQO Q;  3JCM W;  4LUD A;  1KD1 U;  2DE0 X;  1BU1 A;  2HMA A;  2X4W A;  5LJ5 g;  3CCS T;  1UHC A;  2RN8 A;  4AG1 C;  4OB3 B;  1N8R U;  4OMF B;  2QDL A;  3I55 T;  3OW2 P;  4M7A D;  2A36 A;  4C8Q G;  1Q82 C;  2OJ2 A;  2M02 A;  2DA9 A;  2CS7 A;  4ZN1 A;  2K5I A;  1QVG S;  4OML A;  1WHL A;  4JS5 A;  2E64 A;  3D7S B;  3I35 A;  1WA7 A;  2HBP A;  5GAM j;  1MMN A;  5GAN 5;  4RTY A;  2LCL A;  1VQM Q;  3QYH B;  4M7D C;  1K73 U;  4HVW A;  2YXY A;  1YN8 A;  1IGQ A;  1G83 A;  2A08 A;  4QVZ A;  2KRS A;  1PNJ A;  3MP8 A;  1JEG A;  2CKK A;  1UDL A;  3CBP A;  2E5K A;  3G71 T;  3MO8 A;  1LPL A;  5GAN 4;  3CCE A;  2BE9 B;  4CC2 A;  1UGQ B;  4LE9 A;  3CXC A;  2L0A A;  1WZO A;  2K5F A;  1KHI A;  2L3R A;  1UUE A;  2FPF A;  4PJM A;  4L59 A;  2DL7 A;  3PMI A;  2V8I A;  5CKE A;  2G3R A;  2VUB A;  2YLB A;  1QKX A;  1SSH A;  3Q1J A;  2X35 A;  1UE9 A;  3FC3 A;  4O6J A;  3CCM A;  1XNI A;  4RCC A;  3UT1 A;  3VS2 A;  1PWT A;  4N0A C;  1U1T A;  1NJI R;  1EZZ B;  2KYM A;  3HRS A;  3ZL7 C;  1ZUK A;  3LW5 E;  4EMK A;  2DXB A;  3WVD B;  1P92 A;  1VQO A;  3L42 A;  2MAM A;  3NMZ C;  2DXT A;  2FO0 A;  4XTU A;  1K9M C;  1RLQ C;  4C8Q B;  5GAO n;  4PJO B;  1Q81 C;  5AT1 B;  1KG1 A;  4JJD A;  1FMW A;  1WHK A;  2QDY B;  3M0P A;  4JJN K;  3OS0 A;  3JSC A;  1Q7Y R;  3MET A;  3QXE B;  1VA7 A;  2RI3 A;  2YWW A;  5GMK e;  1KSW A;  2CT4 A;  1M2V A;  1W2B S;  4FM4 B;  1ZX6 A;  3V8J A;  2DRK A;  2XDB A;  3C95 A;  1VQM A;  4GLM A;  2QGF B;  2LX9 A;  3CCR T;  1GFD A;  2AKK A;  4RTV A;  1UFF A;  1MV3 A;  1GCQ C;  5ECA A;  2CP7 A;  3I9Q A;  2ZPF B;  2F1L A;  2DPP B;  3X25 B;  2O01 E;  2DTO A;  1W4S A;  3F70 A;  1VIE A;  4KGV B;  3HRT A;  1BI0 A;  1VQ5 T;  2P0Q A;  4E2F B;  3HHT B;  2KXD A;  3JV3 A;  4DEY A;  1I4K 1;  4HT9 A;  1N5Z A;  2V26 A;  4WF2 A;  2HAX A;  3QJ6 A;  2JTF A;  2CZ6 B;  4QQD A;  1NEG A;  1EFN A;  3OW2 A;  1VQN T;  3RMS A;  2RH2 A;  4MDW A;  1ARK A;  1H92 A;  2X51 A;  1NEB A;  1WDX A;  5KYY B;  4B9W A;  3DB4 A;  3PIP A;  2EYW A;  3H8Z A;  1YFN A;  4RTX A;  1VQP T;  1BI1 A;  3TQ7 P;  4ANJ A;  1U3O A;  2V1Q A;  3R6O A;  1GRI A;  5D6W A;  1SKU B;  5IH2 A;  4ESR A;  2DTH A;  2ROT A;  3L2R A;  4R56 A;  5C0M A;  1Z9Z A;  1M1K R;  2RQW A;  3N5B B;  2O9S A;  1W1F A;  4PJN A;  3GPL A;  3CCQ T;  4LXC A;  2QYZ A;  1ZHI A;  2C0T A;  3HP9 A;  3AHU A;  3M9Q A;  1WJR A;  2RHX A;  1WX6 A;  2O2O A;  2DYI A;  2L3Q A;  4V2S A;  2LX7 A;  2K9G A;  1XJW B;  1X75 C;  3CCV T;  2EIF A;  3G1J A;  4EMK C;  1I0C A;  2JMA A;  5DLO A;  2RJF A;  2NUT B;  2K7A A;  3LWI A;  4C0F A;  2LZ6 B;  1RAF B;  2DX1 A;  1H8K A;  1LNX A;  4XQ3 A;  1PM3 A;  2EPD A;  3E9F A;  4R55 A;  1WQ7 A;  2LJ0 A;  3RES A;  5GAN g;  1PKT A;  1R0C B;  1NYG A;  5IT9 E;  2COY A;  1PSF A;  3UA7 A;  4A63 B;  4M75 F;  2KNB B;  3FIF A;  3R6N A;  1QVG P;  1I81 A;  4E7K A;  1E6H A;  4ORZ A;  4HT8 A;  1D0X A;  1FX7 A;  2GQI A;  3CPW S;  1BI2 A;  2MCN A;  4E7H A;  3CMA Q;  4OMM A;  2KR3 A;  2P4T A;  2DER A;  1VOM A;  4ZNX A;  5CCA A;  4BUG A;  1RLP C;  2VGN A;  1BKB A;  1S1N A;  1QWE A;  1UGR B;  5GAO l;  2AZS A;  2BTT A;  3M0R A;  1XTD A;  1YHQ T;  3RER A;  1TUC A;  3JB9 J;  4XTV A;  3QZ9 B;  2QQR A;  2D1X A;  2WSC E;  1ABO A;  4RMO A;  3J7A F;  4M7D G;  3GNG A;  1AT1 B;  3EGD A;  2JVV A;  2PZ1 A;  1PG5 B;  2K2V A;  1ACM B;  3CCL T;  1KC8 R;  4GBQ A;  2RHY A;  3DKM A;  3X24 B;  2GF7 A;  2DD5 A;  3FEO A;  2YHT A;  4VUB A;  3OBY A;  3C94 A;  4M77 E;  4F7U F;  1B34 A;  2K3Y A;  2LQW A;  3JB9 F;  1OU9 A;  4M77 A;  1MHN A;  1HD3 A;  2CSI A;  3PIO A;  3JCM b;  4RTW A;  1Y07 A;  2C0I A;  2DM1 A;  1SHF A;  2KRO A;  2HSE B;  1OU8 A;  1VQ6 Q;  3DLM A;  4J7F A;  5FRN A;  3LH0 A;  2NUZ A;  1T3S A;  4M7D D;  2X3W D;  3OYY A;  4BY6 C;  1YJN T;  4PFZ A;  3V7S A;  4BDZ A;  1A0N B;  1S72 T;  1WQW A;  3CME T;  1PD0 A;  3OYJ A;  4OB2 B;  1B7T A;  2OTL A;  1NJI C;  2RNA A;  1G3Y A;  4JZ4 A;  1W2B P;  3QDR B;  3VRY A;  3AT1 B;  4Z89 A;  4ZGE B;  3MEW A;  2L8D A;  2QA4 Q;  2LT4 A;  4IIM A;  3CMA A;  1H3H A;  2DJZ A;  3EGX B;  4KGZ B;  3CC7 Q;  1OEB A;  2X4X A;  2EJG A;  4C5E A;  2MWO A;  3CBM A;  4C92 G;  1OUL A;  1FMV A;  2KDS A;  3UAT A;  3SWN A;  5IXB A;  3FJ5 A;  2RA2 A;  1AZG B;  1VQ7 Q;  5FWC A;  4C0D C;  1Q7Y C;  2RQR A;  2QTX A;  2CZ7 B;  3KFV A;  1GBQ A;  2JS0 A;  1Y0M A;  2FYK A;  1QLY A;  3QJY A;  3NFC A;  5GAO p;  3CXC P;  1KD1 R;  4IUV A;  4M75 A;  2EGE A;  2H8H A;  2M1H A;  2NUP A;  4JRK A;  1B3Q A;  5CKB A;  3DB3 A;  3VS3 A;  1OOT A;  1WLP B;  2LTO A;  1BYM A;  4LDY A;  1M3B A;  4HKE A;  1N8R R;  3CCE T;  1M1F A;  2YSQ A;  4QT7 A;  2DL3 A;  3E19 A;  2E10 A;  3SHW A;  4BD3 A;  4C92 D;  4J83 A;  2O88 A;  1VQ6 A;  2FHD A;  4WCI A;  5CIU A;  3G6E Q;  4HCZ A;  1UB4 A;  4M4Z A;  3ASK A;  3CCM T;  1QVG A;  1FWZ A;  1KFZ A;  1AEY A;  1I07 A;  1IZ6 A;  2NYS A;  2HQX A;  1Y71 A;  1K73 R;  4KH1 B;  3ZEH A;  1MND A;  4FSX A;  1RAB B;  1FMK A;  3EGU A;  3A8G B;  3OQ5 A;  2IIM A;  1RI9 A;  1SSF A;  1Y96 A;  1VQO T;  5KYU B;  1UEB A;  3QPH A;  5J39 A;  2QA4 A;  4OMQ A;  3PT9 A;  1IHV A;  4FYY B;  2KSS A;  4F7U E;  1ZA1 B;  3RMQ A;  3CC7 A;  1Q86 R;  4C92 B;  3E9G A;  4F7U A;  4J6Y A;  1PHT A;  1RAA B;  1OZ2 A;  4ME7 A;  3TCJ A;  1M3A A;  4AFQ C;  1CSK A;  1QKW A;  1VQ7 A;  4DBF A;  2RJC A;  2DAQ A;  2JS2 A;  2V8J A;  2EKO A;  5A2Q E;  5KYN A;  1GFC A;  3EG9 A;  2ED0 A;  5I21 A;  5AYF A;  1M3C A;  4N4I A;  1VQM T;  1BB9 A;  1IGU A;  2EGC A;  2GFA A;  4ZTF A;  2NLU A;  2M0O A;  2EVR A;  2EJF A;  3J81 E;  4C8Q F;  4M77 C;  1D0Y A;  5CVI A;  4PJO F;  2XK0 A;  1U8R A;  1M1K C;  4YTL A;  2CUB A;  4N4H A;  2RB6 A;  1T0J A;  2BZX A;  2PQW A;  3RR6 A;  1FXX A;  2OI3 A;  2FPD A;  3P8D A;  5KCO A;  1N9S A;  1U1S A;  1IB8 A;  3OY9 A;  2C06 A;  1JU5 C;  1QCF A;  4II1 A;  3G6E A;  4DEX A;  2V8K A;  4M78 F;  1AWX A;  5LJ3 f;  4LN2 A;  3G4S Q;  2F69 A;  3GOX A;  2ZPI B;  3O8V A;  2K3B A;  2HZY A;  1W2B A;  1KHC A;  3VS7 A;  4MZP A;  4C0G A;  2E65 A;  3HFN A;  3CPW P;  4DBQ A;  4A4G A;  3QZ5 B;  2H3J A;  5FU6 C;  4LNP A;  4EMH A;  4EMG A;  2A28 A;  5KYX B;  3TU4 K;  2M0Y A;  4MDX A;  1HYO A;  2Y4X A;  5HCK A;  3OYG A;  1RAC B;  2AT1 B;  2EYX A;  1QMC A;  1NPP A;  3SWN C;  2YUO A;  4AFZ C;  4JRI A;  1JO8 A;  2KE9 A;  3CD6 Q;  3TVT A;  1WI7 A;  1XOV A;  4IUR A;  3VS1 A;  2CDT A;  2DMO A;  4M7A B;  2RMO A;  5CAI A;  3OYB A;  1JXO A;  2XDP A;  4X9C A;  1Q86 U;  1QWF A;  4LUE A;  1TS9 A;  1UG1 A;  4M75 C;  2E6N A;  2JOY A;  2CH4 A;  3EFO B;  5LJ3 h;  5IAY A;  3IQL A;  3GIB A;  2XIC A;  4AT1 B;  2KBT A;  2QQB A;  2P0P A;  2VB6 A;  3QO3 A;  2ABL A;  2RQT A;  4F04 B;  2LQ8 A;  1SF9 A;  1YJ9 Q;  3CCJ Q;  1K76 A;  2ZPG B;  4ZGJ B;  1R0B G;  4MML A;  1M90 C;  3BY7 A;  3M53 A;  1YIT Q;  1NG2 A;  3QUI A;  2DJQ A;  3OB9 A;  2KK4 A;  1UGV A;  4OMO A;  3G4S A;  3A1P A;  1KC8 C;  5GMK i;  1MMG A;  3A5Z B;  3REA B;  2A7Y A;  9ATC B;  3GLX A;  2K79 A;  2KT1 A;  4AG2 C;  1R8O B;  2QAS A;  2PUO B;  1AZE A;  2DBM A;  8ATC B;  4C5I A;  4UC4 A;  3CPF A;  2HD0 A;  2H3E B;  4C8Q E;  1DJ7 B;  4PJO E;  2KRM A;  4C8Q A;  2LCC A;  2F5T X;  4PJL A;  2RJD A;  4PJO A;  5LL6 S;  3THK A;  1V76 A;  2EBP A;  2RM4 A;  2DYB A;  3H0F A;  4PFO A;  3UA6 A;  5GJV B;  5LJ3 d;  4XK8 E;  2X9H A;  2JT4 A;  4MMK A;  1OI1 A;  1LVK A;  3CD6 A;  1J3T A;  3E2U A;  1ZUU A;  4AFU C;  2C0O A;  2HSP A;  3EG2 A;  2K57 A;  1M30 A;  1WJS A;  5I2S A;  4M78 E;  5KH6 A;  1YWP A;  4KH0 B;  2YT6 A;  3M56 A;  2CH4 W;  4J7I A;  2EW3 A;  5I11 A;  4M78 A;  1VQ4 Q;  2EQU A;  1X6G A;  2KGT A;  2YRC A;  4BDY A;  3MEA A;  2HL3 A;  3VU3 C;  2F2X A;  3V7C A;  4E7J A;  3L2Q A;  2HKN A;  4WTO B;  3QBY A;  1TTH B;  1D09 B;  1PKS A;  2DIG A;  5FU7 C;  2SRC A;  3EH2 A;  3RKW A;  1MMA A;  1YJ9 A;  2QK0 A;  2MK5 A;  2FL7 A;  3CCJ A;  4J9C A;  4FW1 A;  2BUD A;  3NHN A;  1YIT A;  1GBR A;  3VS0 A;  1R77 A;  4EIK A;  1YWO A;  3MP6 A;  2RI2 A;  3FLG A;  1OYX A;  4BAC A;  2KRN A;  3FB9 A;  1HJD A;  1X69 A;  4HVV A;  7AT1 B;  5LJ3 j;  4J9H A;  1QCO A;  4AMC A;  3CPW A;  5CQX A;  5CQY A;  1C6V X;  2EQJ A;  4D6W A;  3HRU A;  2J05 A;  3SFM A;  2VXE A;  1KD1 C;  5LJ5 f;  2DD4 A;  4C0Z A;  3CC4 Q;  4X9D A;  5IHI A;  4CC4 B;  3JCM g;  2VVK A;  4M77 F;  1N8R C;  1SRM A;  3QDF A;  4QVC A;  3BE3 A;  2WSE E;  2E70 A;  1YJW T;  2LJ3 A;  1IRE B;  1BBZ A;  4E7S A;  1X01 A;  4J8O A;  2VGM A;  5KE2 A;  2KAF A;  5GAM g;  3NPF A;  5KYY A;  1TSF A;  2JTM A;  1D1B A;  3G71 A;  2AHJ B;  3M5A A;  5I22 A;  1K73 C;  2NWM A;  1YIJ Q;  3MJX A;  4OB1 B;  2HDA A;  4QQ6 A;  3VYG A;  4JS4 A;  2K4Y A;  3CMA T;  2DL4 A;  3EHQ A;  1VQ4 A;  3S3M A;  3OYM A;  1NBE B;  3JAM E;  4C0D B;  3VJP A;  4F16 A;  1V1C A;  3QHS A;  1K8A U;  2QEX T;  3CQT A;  4JJC A;  1K1Z A;  4PLI A;  1IHW A;  4RTU A;  1BK2 A;  1WHG A;  2XHC A;  5LJ5 h;  2LT1 A;  2D6F A;  4FYW B;  2EWN A;  3HKS A;  2BZ8 A;  1WXB A;  2E3H A;  3MCA B;  2GBQ A;  2DXC A;  2DKG A;  3I5S A;  5KCH A;  3SD4 A;  3OYH A;  1LOJ A;  2PVG B;  4IUP A;  4ELY C;  2SEM A;  2L89 A;  5L8R E;  2MYS A;  4KUL A;  1WXU A;  4J6X A;  2LMJ A;  4E7Z A;  2LRQ A;  2NUT A;  4EPC A;  4FSS A;  5CK9 A;  2LC4 A;  3JCM V;  5C6S A;  2HQH A;  1O9S A;  1ZSZ B;  3BFM A;  3CC4 A;  1M8M A;  4XTX A;  4HCC A;  2OTL Q;  1MUZ A;  1VQ6 T;  3LH5 A;  2BIV A;  4C8Q C;  3EH1 A;  4PJO C;  1KQS S;  2ED1 A;  5KYW B;  2DZC A;  2IPO B;  4RUG A;  3LWH A;  4PJJ A;  2QI2 A;  2YUQ A;  2M16 A;  3CCQ Q;  2OX7 A;  2JZ2 A;  2CP2 A;  1OX9 A;  3MEU A;  3JB9 H;  1YIJ A;  4M78 C;  5LJ5 d;  4QVD A;  2DIL A;  4ATO A;  4O5V A;  2A0F B;  2HQE A;  2AZV A;  1K4U S;  3C0C A;  1SHG A;  2QQA A;  3RIR A;  4BE2 A;  1MGQ A;  5GJW B;  1C1A A;  3CC7 T;  3BW1 A;  1VUB A;  2MMP A;  2EGA A;  2K5L A;  4FCY A;  2R57 A;  1PRL C;  2DTI A;  1HXD A;  1OPL A;  1D0Z A;  4BE0 A;  1WGS A;  1Z9Q A;  4M75 G;  4PL6 A;  2I0N A;  5D6X A;  2J06 A;  3O5Z A;  4BI8 B;  4J9I A;  3ZFJ A;  4KBM B;  1VQ7 T;  4XTW A;  3ME9 A;  1K9M R;  3P8H A;  1NPR A;  2L3S A;  3LGF A;  1NYF A;  3DLL A;  2ZGW A;  3OYE A;  3I5R A;  4XU3 A;  1G8X A;  5J3B A;  2AIR B;  2E12 A;  1RAE B;  3MKD A;  4NS5 A;  4DOW A;  3CC2 T;  2O4X B;  4B6M A;  5IN1 A;  2JM8 A;  2E1H A;  2VC8 A;  3S3O A;  4C5H A;  1KQ1 A;  1RAD B;  3EFS A;  4FT2 A;  4OMN A;  1QCN A;  2A3L A;  2J7I A;  4CRI A;  5CKH A;  2DO3 A;  5LJ5 j;  4PNO A;  2A37 A;  2MIO A;  2R5A A;  2L2P A;  2IG0 A;  1WJQ A;  1YCY A;  3PE0 A;  4M75 D;  3G6E T;  1Q82 U;  2RJE A;  3JCM Q;  3JCM f;  2D8H A;  2E41 A;  4ZGD B;  4JRQ A;  5LJ3 e;  3CEY A;  3RDV A;  4Q5W A;  5FW9 A;  4ZN3 A;  4BB7 A;  1GXI E;  2Y90 A;  3TSZ A;  4F7U G; 
#chains in the Genus database with same CATH homology
 3CPW P;  1NJI R;  1S72 Q;  1VQ8 Q;  1QVF P;  1KQS P;  3I55 Q;  1KC8 R;  1JJ2 P;  1W2B P;  1VQ4 Q;  1VQ6 Q;  3CD6 Q;  1Q86 R;  3CME Q;  1Q81 R;  1YI2 Q;  1VQO Q;  3CCU Q;  1YIJ Q;  1N8R R;  1K73 R;  1VQ7 Q;  1YJ9 Q;  2QEX Q;  1QVG P;  1VQK Q;  2QA4 Q;  2OTJ Q;  3CCJ Q;  3CCV Q;  3I56 Q;  1VQ9 Q;  3CCM Q;  1M90 R;  2OTL Q;  3G4S Q;  1K8A R;  3CCQ Q;  1Q7Y R;  3CCL Q;  1YIT Q;  3G71 Q;  1VQM Q;  3OW2 P;  3CC7 Q;  1M1K R;  3G6E Q;  3CCR Q;  3CCE Q;  1VQ5 Q;  1VQP Q;  1YJW Q;  1YJN Q;  1YHQ Q;  1VQL Q;  3CXC P;  3CC2 Q;  1KD1 R;  1Q82 R;  3CCS Q;  3CC4 Q;  1VQN Q;  3CMA Q;  1K9M R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...