3CCEQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cceQ00
1JJ2P 3G4SQ 1VQ7Q 1KD1R 2QA4Q 3CMEQ 1YJ9Q 3CMAQ 1K9MR 1M1KR 1VQ8Q 1QVFP 2QEXQ 1VQOQ 1K73R 1VQPQ 3CCQQ 3CCMQ 1Q82R 1KC8R 3CPWP 1K8AR 3G71Q 3CC2Q 3CCLQ 1VQ9Q 1YIJQ 1YJWQ 3I56Q 3CCSQ 3CC4Q 3CCUQ 3OW2P 1YHQQ 3CCRQ 3CD6Q 1VQLQ 3CCJQ 2OTJQ 2OTLQ 1N8RR 1KQSP 1M90R 1NJIR 1VQ4Q 3CCEQ 3CC7Q 1VQ5Q 3CXCP 1YITQ 1VQKQ 1S72Q 3I55Q 1Q81R 1YJNQ 1Q7YR 1QVGP 1VQMQ 1Q86R 1VQNQ 1W2BP 3CCVQ 1YI2Q 1VQ6Q 3G6EQ
chains in the Genus database with same CATH superfamily
1YITT 1VIEA 1I1JA 1IGQA 3A8LB 3SHWA 2QTXA 1F1BB 1HXDA 2ESWA 1VQ9Q 1Z9QA 4GBQA 1M3CA 3CBOA 3RIRA 4LUEA 2RJCA 2EJGA 5GAOr 2D9TA 3E9GA 2CSIA 3VYGA 2DRMA 2LJ3A 5GAMf 1D1BA 2DJQA 1MHNA 1AZGB 1IHWA 4J9HA 2CP3A 2K57A 3H9NA 4Y91A 5LJ5d 3LH5A 2ZGWA 2JT4A 5C6SA 3C95A 4EMKB 3JCMJ 4Z02A 2GQVA 2QYZA 2PNIA 1R8OB 5L8RE 1IO6A 4EDUA 1IXDA 2KK4A 1G3TA 1M2VB 1YIJQ 3NTIA 1ZUUA 1OZ3A 1YWPA 3DLLA 1VQOA 1NLPC 3EG9A 1LVKA 1WA7A 1G83A 3OYHA 3JB9H 1UEBA 1ACMB 1VQ4T 2RJFA 4DOVA 1IGUA 2L3RA 1WHJA 4JS4A 3A8MB 3M0PA 1TOVA 1NEBA 1VQ6T 1PWTA 5CO7A 1AWXA 2LT1A 5KYWB 5HK0A 2YDLA 3CCLQ 4E7KA 3QKJA 3DKMA 3JB9I 4FYWB 3CCRQ 3TVTA 1R0CB 4OMPA 1V29B 2J6OA 1QCFA 4C0ZA 3UPUA 2AIRB 1BI3A 3EG1A 1VQ8Q 2X51A 3EHRA 2MYSA 3VS1A 1M8VA 2QTVA 1FX7A 2XD0A 2B8AA 5CR2A 2V8IA 1WXTA 2B86A 3P8HA 2FO0A 1W1FA 3VS5A 4L6V5 2RQUA 1WDXA 5FWBA 3CPWA 2OTJT 2JUFA 3JCMV 1VQ5T 1K76A 1S72A 3ME9A 2MIOA 1K9MR 3SEMA 2ENMA 3CCQQ 3CCVT 2KAFA 1KC8R 3G6ET 1OQKA 1AEYA 2KVQG 3CC4Q 3HRUA 2P4TA 1YHQQ 3L2ZA 3EGUA 4PFPA 1I5OB 5FU6B 2KGTA 3OS5A 4EMKC 2O9SA 2YSQA 3HPWA 2AT1B 1D3BB 2FPDA 2BIVA 2E4HA 1BIBA 4BE1A 3EG0A 1MV3A 3HRSA 2AHJB 4PJOB 2CP2A 4P5NA 2CP7A 4C92A 3GIBA 1BYMA 1JXOA 5GMKm 1PSFA 2J7IA 2CZ0B 3NTHA 1OI1A 2QXFA 3BDUA 2K5FA 2M0YA 4M78A 2ZPEB 1H641 1AVZC 3S3NA 4FT4A 3I5RA 1RI0A 3PMIA 1VYTA 1WJSA 1AWWA 2RPNA 1E6GA 2DMOA 3OS1A 4HKEA 1IREB 2NLUA 1VOMA 4XTZA 2DETA 2SEMA 3ZEHA 2M16A 3JCMW 4RUGA 1E6HA 5GAMd 1A0NB 1XNIA 2K7AA 3R6OA 2IVWA 1RABB 1GCQA 1WQWA 5KYYB 2NUPB 1BCMA 3JV3A 3WVDB 2KBTA 1PCXA 2VV5A 4BB7A 2YLBA 2QDYB 1W70A 5GAN2 2XU8A 2DYBA 2EKHA 2Y4XA 2CUDA 1NPPA 3BFMA 1TUDA 1X2KA 1I81A 1QLYA 2GNCA 2QQRA 2Y4YA 4Z8AA 1G3YA 3MEWA 2M9UA 4II1A 3GPLA 1YJ9T 4J83A 3QHSA 2EQUA 4LDYA 6AT1B 5FU6C 5IHKA 1WFWA 2D6FA 2NUTB 3L2UA 3NPFA 4J7IA 5A0DA 5I11A 1M8MA 2DNUA 3EG9B 1ABOA 3N5BB 1BI1A 3NFCA 3L2RA 2XDPA 1QP3A 3JCMc 3V8KA 5GAOn 3EG2A 5GANf 2DPPB 4CI0C 2NWMA 4XQ3A 4OF1A 3CC7A 2FZGB 2QG9B 2HEQA 1U3OA 4OB3B 4DA4A 2V8JA 1VQOQ 5GAOl 4KH0B 2JOYA 2A7YA 1OX9A 2BTTA 2QEXA 3E19A 2EGAA 2XDDA 4KUIA 5HKCA 3A8OB 1Y57A 4B9WA 3S3MA 5GAN7 5HY6A 3OYAA 3A98A 2ZAEA 5LJ3h 4EPCA 3I55A 2HL3A 1YI2T 1Q82R 1MMNA 2A3LA 4C0FA 3QSUA 2DA9A 2QASA 3OYMA 2DFUA 2K4YA 4V2SA 3LH0A 3QJ6A 1VQLT 2CYZB 4M78D 2RK2A 5KE3A 1B07A 2M1HA 4HT9A 1JXMA 2F5KA 2RQTA 1KHIA 5GANj 4MZTA 4FYXB 4O5VA 4PK4A 2HCKA 1S72Q 4Z89A 4C92B 2C06A 4RKUE 4OP0A 3JCMP 2WSCE 3GP8A 2KRNA 4M78B 3VU3C 2XG8D 4KULA 1QVFS 3FEOA 5CK9A 1D1CA 3CCST 4C0DC 2VGMA 3OB9A 3T9NA 1TTHB 2K3BA 2L89A 1U1TA 3QPHA 2YXYA 4PJOG 1NG2A 4J6YA 4KBMB 1W4SA 2ZPHB 2VVKA 3HP9A 1M9SA 2OI3A 2LQWA 2GGRA 4OMNA 1QP2A 2VYTA 2XHCA 2RHXA 2X3XD 4OMOA 1W2BP 3MHXA 4FW1A 3ASKA 3M55A 5GMKh 2DEUA 2VUBA 2E64A 4BY6B 4JRQA 4GY5A 4F7UA 2BZYA 1VQ7T 4ZGEB 2WACA 3CMAT 1YP5A 3BW1A 1GL5A 3G71A 2ABLA 2L2PA 1BI0A 2DX1A 4E7HA 2FB7A 1MNEA 1X75C 4C5IA 5KCHA 1JJ2P 1K1ZA 4QQGA 3M4YA 4R56A 1WHHA 2F2VA 3A1PA 4ELZC 4DBHA 1MMGA 1LOJA 4M7DG 1KFZA 1R77A 2JXBA 2F69A 3VS4A 4J8OA 1SSFA 2G6FX 5DM7R 1TS9A 1N8RR 1SPKA 1VQ9T 2LJ1A 4LD6A 2DO3A 3ER0A 5IHNA 3REAB 4E7IA 4C92C 5I2MA 3Q1JA 4BDYA 4BACA 1AWOA 3HFNA 2DL5A 3HSBA 3VS6A 1VQMA 1VQNA 1I07A 1OU9A 1UGRB 4M78C 1KC8C 5FWCA 4M7AA 2O31A 3QYGB 3OW2P 4ATOA 3OS0A 3CCMA 4FCYA 2EBPA 2ROTA 1M3BA 2R5AA 3I56A 2DM1A 3M9QA 2DILA 3M5AA 3OY9A 3VUBA 4JRKA 4F04B 4F14A 3CBPA 3FDRA 2CSQA 3F70A 1X2QA 1IZ6A 5GANe 4JZ3A 3M59A 3MP6A 3FC3A 2DXBA 1CKAA 1PD1A 3LWIA 4KGXB 2DXUA 4BDZA 1YIJT 3KBGA 3CC7Q 1I8FA 2P4RA 1GCQC 2M51A 4ESRA 4PFOA 3PIPA 4NOYA 1K9MU 1RL2A 4BE0A 2J05A 3UDCA 3H0IA 3RESA 2DXTA 1KC8U 2P84A 5KYXA 2QEXQ 4CC3A 1ABQA 3DLMA 4FM4B 3VS3A 4BI3A 3PIOA 1U06A 3EGDA 3M54A 8ATCB 2OAUA 1ZUKA 1JBMA 4AFQC 2YUOA 4JS5A 1YWOA 2ROLA 4CRIA 3CCLT 4LNPA 2EGEA 1UFFA 2YUQA 4TVRA 3UA7A 3GBQA 3I55Q 5FRMA 3CCRT 5EC7A 2J6FA 3SWNA 1T3SA 3CEYA 2DE0X 4JJBA 2RHUA 2YLCA 3PVLA 1H8KA 4PJNA 2LP5A 2PZ1A 5HK3A 4AFZC 4DOWA 1VQ8T 3CC2A 3J7AF 4M7DA 4IIOA 3R6NA 1YNZA 3RERA 1NYFA 2A08A 4J9BA 5LJ5h 4MZMA 1GFCA 1PG5B 3QWXX 2E10A 2WSEE 1C6VX 1RAGB 2HKNA 2EIFA 1HSQA 2D8HA 2O01E 3U23A 4C8QA 1VA7A 2DBKA 1LNXA 2DIGA 4JLIA 3UATA 3RMSA 3CCQT 4A53A 3HKSA 4RTYA 2E3HA 2DZ9A 3H41A 5GMKl 2DLPA 3CC4T 1KHCA 3S6WA 4NS5A 3V7RA 1YHQT 4EMGA 1QVGP 2HSEB 4N0AA 2H8HA 3L1AA 1MMDA 5IN1A 1SRMA 4PLLA 4C92G 2AZVA 1RAIB 1YJNT 3QXEB 2EYZA 3JRZA 1WGSA 1X6BA 3P8DA 2DL7A 2XMFA 2GTJA 4E2FB 1C0MA 4JDSA 1OPKA 1RAFB 1JRIA 2RN8A 4M78G 4A4FA 2ZZDA 2KXDA 2RMOA 4EIKA 2PVDB 5CQYA 3M53A 2LNHB 1S1NA 1QVFA 2DKGA 2CS7A 1BI2A 1GXIE 4PFZA 3RR6A 2KT8A 4RG2A 2FRYA 2VXFA 3TSWA 2DRKA 4AMCA 4N4IA 2EFIA 1BK2A 2KRSA 3VYHB 1PSEA 3VJPA 2K3YA 3ZBDA 2ED1A 4ANJA 3X26B 4HCBA 1Q81R 2FVUA 1GRIA 4RTVA 2K3XA 9ATCB 1QCNA 2DBMA 2CGHA 2PUOB 3J81E 3A8HB 2RH2A 1WHMA 2YUPA 1M1KC 1FWZA 1Q82C 3G71Q 1D0XA 3URGA 4J9FA 2HBPA 3CPFA 1EZZB 2QQBA 1NJIR 5D6XA 2RHIA 2CZ6B 4PJOD 2RA2A 4A4EA 2KY9A 4M7AB 1D0YA 1HJDA 3OYNA 4FYVB 1UJ0A 2KQWA 3A8GB 4PJJA 4KRTA 5CAIA 2DYIA 4J6XA 4ORZA 3SFMA 3OS2A 3O5ZA 2GBQA 2RB6A 1P92A 3THKA 1YJNQ 1VQMQ 1VQNQ 1TWBA 4AT1B 1WJRA 5D7UA 1K0XA 3TSZA 1M1KU 3JAME 1Q82U 4HCKA 1WPYA 2QQAA 3MP8A 3CCMQ 2D8JA 2L3SA 1AT1B 3I56Q 2VASA 3G1JA 3LLRA 4ZNXA 1YJWA 2EYQA 4JZ4A 2RQWA 1WHGA 2YWWA 5KYXB 4ZTJA 3FLGA 1ZBJA 4M7DD 2LCCA 1PC0A 3EGDB 4B6MA 1VQKA 4HXJA 4HVWA 4X9CA 3A5ZB 2JZ2A 1RUWA 1SEMA 4XTYA 3OMCA 1SHGA 1ZQ1A 2RI2A 3SWNB 1HD3A 3QIIA 1OPLA 4GLMA 1VQOT 5D6WA 4XU0A 2L3QA 3BY7A 2VWFA 2EYWA 3CD6A 1QMCA 3E1SA 4FIBA 1IRXA 3I9QA 4XU2A 2DD5A 4JJDA 3EH1A 1RAAB 4ELYC 4M7DB 4C5HA 5FLXE 3VS0A 2X3WD 1CSKA 5GANg 3G7ZA 1MV0B 1QKWA 1SKUB 1WX6A 2XDBA 1H3ZA 2RF0A 1RAHB 2MF2A 3FB9A 4M7AC 2EJ9A 1GFDA 1UUEA 1ZBXA 2QDLA 2CP6A 2PQWA 1WHLA 1HYOA 1W2BS 5L23A 5LJ3j 2XK0A 3AT1B 3VUZA 3QG1A 2IIMA 3JCMX 3VRZA 2VKNA 3RKYA 1FXXA 1VQPA 1QCOA 1N8RC 4KGZB 1D09B 2V1QA 3ULRB 2J06A 3I5SA 1WYXA 1S72T 4QVDA 5A0LA 2GFUA 4PJOC 4JJCA 1MMAA 1JU5C 1PHTA 1JJ2S 2GFAA 2A28A 1FMKA 2QGFB 2E3IA 4IUQA 1U1SA 1NZ9A 2RQVA 5GAOp 2SRCA 3TCJA 3M0SA 2EPDA 4E7ZA 3RMQA 3CCEA 4D8KA 2ZCFB 4OB1B 2KMTA 5KCOA 1ZUYA 1AOJA 2ATCB 1N8RU 5KYUA 1JO8A 4F17A 2JM8A 2K5LA 3OW2S 3MEAA 3OA6A 4F7UG 1G5VA 2X4XA 1B34A 5EG2A 3RKXA 3WVEB 1WJQA 4LDUA 2RI3A 8AT1B 1B3QA 4M7DC 3M0TA 2HKQB 2RJEA 4PJOF 4FU6A 4C92D 3LX7A 1UTIA 1C1AA 3H0FA 3C4SA 2VC8A 1AWJA 3CXCP 3OQ5A 3QO3A 5IXBA 2OTLA 5GAN8 2LC4A 1I4K1 4KUDK 4D8DA 2LJ0A 3LW5E 3LGLA 1VUBA 3MEUA 3NGPA 1EX4A 4QQDA 5GMKj 3C12A 1UE9A 2MWOA 4MDWA 2LT4A 4Y92A 1OV3A 3G4SA 2X9HA 3CMEA 2BKDN 4FYYB 3TQ7P 5IT9E 3HTRA 2O2OA 4HCCA 2DJZA 2ZPFB 2EAYA 3CQTA 1LJOA 2LVMA 4CC2A 2AKLA 4AG1C 2QAZA 1UG1A 2KYBA 1OOTA 3V8LA 4M7AG 2CT3A 2AKKA 5FROA 3LWHA 1TU0B 3RDVA 3SB2A 1YN8A 4PJOE 3JB9D 2QA4A 4M7DF 1WZOA 1AHJB 2HZYA 2YRCA 5KH6A 3CCUA 4IIMA 3TREA 4XTVA 2JM9A 3M0RA 4F16A 2MMPA 2MWPA 1M5Q1 5LJ3e 1ARKA 1K4US 3JB9J 1ZSGA 2X4JA 2R5MA 4HT8A 2YT6A 5I2SA 3NMZC 2HBWA 1YJWQ 4JRPA 2HAXA 4BD3A 2FL7A 1VQKQ 3MEVA 4M77A 2NUZA 2JVVA 4AFUC 1KQ2A 3CC7T 4LD9K 1HK9A 1QVGS 3X28B 2EQJA 2DL8A 4M7DE 1EIFA 1Q95G 1RADB 5GAN3 2D0NA 2HQXA 3PTAA 2QEXT 3E2UA 3CD6Q 4LDXA 2EGCA 1B7TA 3EFSA 3OYYA 5KE2A 5LL6S 4X1VA 4NL3A 3CCJA 1Q7YR 4OMLA 1YITA 1RLPC 5GMKi 1K0SA 2X4YA 3GNFB 4WTOB 3I55T 3QZ9B 1ZSZA 4DBRA 1PRMC 2M02A 1Y96A 2JJ9A 2I0NA 4AG2C 2K5IA 4O6JA 4LN2A 4QQ6A 1KIKA 5GAN5 1UJYA 4IUPA 3QZ5B 1XJWB 2DERA 2EYXA 2FRWA 1KQSP 1NJIC 2QGGA 2XKOC 1FMWA 4J6WA 2DD4A 2X4WA 1ZHIA 1M1GA 2O4XA 3VRYA 5GANd 4C8QG 2YUNA 2JTFA 2QI2A 4QVCA 4XU1A 1QW1A 4FW2A 1UGPB 1K9MC 2CREA 1VQPQ 1VYUA 4IKFA 3OYIA 2F1LA 3L42A 2P0KA 1U5SA 1YBYA 1W2BA 2LZ6B 1Q81U 4M75A 2E6NA 2P0PA 2BE9B 4DBQA 2K6DA 3KXTA 2H3EB 1W6XA 2RK1A 1TXQA 5KYUB 5LJ5j 2WSFE 5GMKe 3I35A 2JS0A 4RG8A 2E65A 2E1HA 3EGXA 1B34B 1NJIU 2YRVA 2CH4A 3OYFA 5IHIA 5ECAA 3CCEQ 1O9SA 1JJ2A 3H6ZA 2GTOA 2RD1A 2L8DA 2DIQA 4X34A 1VQ4A 3GNGA 3TEEA 1KSWA 2OAWA 1N27A 3JCMh 3TU4K 4C92F 4PL6A 4BY6C 2RHZA 1VQ6A 2HQEA 3OYJA 2DL3A 5J39A 1J3TA 2HNIA 3HL8A 4LDVA 4M78F 4LE9A 2R58A 3EFRA 3OBYA 4R55A 5FW9A 1PNJA 3RBBB 5CKEA 2D1XA 5A0GA 3UA6A 1H3HA 3PT9A 4QVZA 3OW2A 2ZPIB 1K73R 3LYIA 1DJ7B 1UDLA 2H3JA 5I22A 3RUXA 4RTTA 1U8RA 3L2WA 5CQXA 4QKUA 4Q5WA 2OTLQ 3G71T 1IHVA 1M3AA 2D0QB 1NLOC 3M57A 2F5TX 3FRNA 2IPOB 3OYDA 2OTJA 1GBRA 1Q86R 3JB9F 3MP1A 4C92E 4M77D 1SF9A 4RTXA 1VQ5A 1NBEB 1NE8A 1X43A 4BI4A 1PKTA 4FSXA 4J9CA 5DLOA 3G4SQ 1RLQC 1KJWA 3CMEQ 1QVFP 4E6RA 3CCVA 5GJVB 3G6EA 1K8AR 2CT4A 4M78E 2EKOA 2JW4A 2V26A 3H8ZA 1QVPA 2CP0A 4J9DA 2KT1A 5GAN6 5CCAA 1BIAA 1JQQA 1TUCA 1D0ZA 5KYYA 2NUPA 1V1CA 1E7OA 3V7SA 4IURA 3IQLA 1X6OA 1QWFA 1XTDA 2COYA 3JCMe 3OYKA 2FYKA 2QA4Q 1VQMT 1VQNT 2DEQA 3QJYA 2E5QA 4M77B 1YFNA 2LDMA 3CBMA 3CCUQ 2COZA 2MCNA 1YCYA 2W10A 3CCMT 3DB3A 1PKSA 3HFOA 3I56T 1MNDA 4F7UB 3ZFJA 1EFNA 2JNGA 5FU7B 2NUTA 5CKDA 3UT1A 3CPWP 2L0AA 4OGCA 4J5YA 1R0BG 2CKKA 2EJFA 3OMGA 4JLGA 2Y90A 3DB4A 4M7AD 1ZSZB 1NYGA 1Y96B 1KK7A 3HRTA 2PUKB 3OYLA 3JB9G 4M75D 4LXCA 1Y71A 3OSVA 4DEYA 5LJ5e 1WXUA 3P8BB 1UHCA 3GOXA 2EQIA 5AYFA 3NHNA 2R57A 5LJ3g 2X35A 2JN0A 2ED0A 4AFSC 2RI5A 2GF7A 1K9AA 2O4XB 2A37A 2HQHA 1SHFA 1QVGA 1D1AA 3AHUA 3JCMQ 3EH2A 5KYNA 3CCJQ 1VYVA 1M30A 5GAMj 1X27A 1XOVA 1YITQ 2RHYA 2L5QA 4PJMA 2HD0A 2F2WA 4M75B 2MPXC 4J9GA 3QBYA 1YJ9A 2XIDA 2FZCB 2LCLA 1X01A 4A4HA 3CC2T 2MAMA 3D7SB 1M90R 1TUGB 4L59A 2V1RA 1M2OA 2K79A 2E70A 1JB0E 3EGXB 3CXCS 2KEAA 3VV0A 3RNJA 1KD1R 1QQJA 2RM4A 3VS2A 2KI7A 4ZTFA 4ZN3A 1G2BA 4M77C 3FJPA 5FRNA 5CKHA 1BB9A 4JPBW 4XAXB 2DTOA 3QDRB 5LJ3f 2P0QA 2EQMA 1MGQA 1JEGA 2O88A 2FZKB 2OJ2A 2ZPGB 4XTWA 2FEIA 4RCBA 2FHDA 4MMKA 5FU7C 3EHQA 4KGVB 3QWYA 4OMMA 4FSSA 2EQKA 3MO8A 4NL2A 4XTUA 4C8QD 5GAMh 1OX8A 2PU9B 4HA8A 4IUVA 1ZSZC 1VQ4Q 2E12A 4XU3A 3E9FA 1ZX6A 4LDWA 1XQHA 1VQ6Q 5C0MA 4Y28E 1NM7A 4MDXA 1QKXA 4L5GA 3VKIA 1YI2A 3M0QA 5D6YA 5GAOq 1G3SA 2DTIA 2E5KA 2FPFA 2LQNA 4C5EA 4M77F 3M58A 1KG1A 5HCKA 3VS7A 1UGSB 1N5ZA 2O9VA 3RKWA 3M4GA 4C8QB 2MK5A 4UC4A 1Q7YC 1VQLA 4KH1B 2KDSA 4HVVA 4F7UF 3C0CA 2BZ8A 2RNAA 2VGNA 3OYGA 2HSPA 4M75C 4MZPA 1GBQA 1I5LA 3UF4A 3CC2Q 1G8XA 2FG0A 2JMCA 2BUDA 3OBWA 4LUDA 1QWEA 2OTJQ 2FPEA 1UGVA 2AK5A 4XTXA 3MPUB 1WI7A 1VQ5Q 4OMFB 3MKDA 2DF6A 2MI6A 2KROA 4DQ2A 2GCXA 1TH7A 2JS2A 3SD4A 3CCVQ 3G6EQ 1M27C 2C0IA 2RQRA 1OZ2A 4ZGDB 4CC4B 2CZ1B 4M77E 1TSFA 2I2LA 4JUVA 5GAMe 3BE3A 3CCSA 4D6WA 5CVIA 1Q7YU 2DAQA 2VB6A 5DY9A 3PMTA 4Z88A 3L2VA 3X20B 4F7UE 1KQSS 4C5GA 4CC7A 2DVJA 1OYXA 5IH2A 1UB4A 7AT1B 2KNBB 2LX9A 3FJ5A 4M7AF 2DVEA 2CP5A 1LCKA 3JSCA 4M75F 4PJLA 2LQ8A 3SWNC 2LCSA 2CH4W 2EYYA 4M77G 3OSSC 1SG5A 1YJWT 2RO0A 4KT0E 4C0DB 3V8JA 3PVQA 2KR3A 4DEXA 3EAEA 4BI8B 5AT1B 1VQKT 2JTMA 2YHTA 2A36A 3JCMg 4PKCC 1N6AA 1VQ7A 3M0UA 2RJDA 3CMAA 2KRMA 2EWNA 2LMJA 4X9DA 2A0FB 4M4ZA 2YRDA 3QYHB 2KYMA 4C8QC 3X24B 3J80E 3CD6T 2CUBA 3C94A 1TG0A 3V7CA 2LTOA 3EFOA 4WCIA 4M7AE 4FL6A 3PGGA 1M1KR 1Y07A 1K73C 1ZA1B 4M75E 2EW3A 2ZPBB 4N0AC 4N4GA 2XI9A 2KE9A 5LJ3d 4A4KA 1VQ9A 2E41A 2QQSA 3REBB 4YTLA 4PNOA 2PVGB 1M4ZA 2LQKA 1V76A 1Q86C 4VUBA 4OB0B 4J7FA 2M0OA 2C0TA 5LJ5g 1YJ9Q 3FIFA 1K8AC 4M75G 2E6ZA 4RMOA 3LGFA 3UWNA 3GLXA 3OYBA 3JCMf 1VQPT 4N4HA 1H92A 2XICA 1SSHA 4B9XA 3KFVA 4QT7A 2QQ9A 1FYNA 4C8QF 1ZLMA 1K73U 4WF2A 4DBFA 3O8VA 4PLIA 1N9RA 1WHKA 4C0GA 3PNWC 2ECZA 2HMAA 1KQ1A 3PFSA 3CXCA 5CKFA 1T0JA 5DLQE 5CKBA 1OU8A 2LRQA 2IG0A 1YIJA 1I0CA 2DZCA 1Q86U 4MMLA 3S3OA 3H0HA 3QDFA 3CCET 4OMQA 3QUIA 4HCZA 1BKBA 5J3BA 1K8AU 2DK3A 2L3PA 3L2QA 2AZSA 2W0ZA 4EMKA 5IAYA 2DL4A 2COWA 4FT2A 5LJ5f 2PVOB 1AD5A 1OULA 1GCPA 3WXMB 3CCLA 1X69A 1WLPB 2DXCA 4RCCA 4XK8E 1M2VA 4C8QE 3CCRA 1Q81C 2K2VA 3GF5A 4EMHA 1RI9A 1MUZA 1WQ7A 2NYSA 4J9EA 1YI2Q 5GAOm 2JTEA 4GLKA 4K11A 1X6GA 2V8KA 4HVUA 5GANh 2CDTA 2C0OA 3META 1VQ8A 2VXEA 4OGEA 3CPWS 2CZ7B 1VQLQ 2GQIA 3HHTB 1Z9ZA 4ZN1A 5KYWA 2HDAA 1SRLA 1N9SA 2OTLT 1O75A 5I21A 3BDLA 2HL5C 2QK0A 1NPRA 2LNVA 5M9OA 1Y7XA 2EVRA 2DTHA 3MJXA 4A54A 3OYEA 1BBZA 1BCOA 3G4ST 1Y0MA 2MOXA 3CMET 4QW2A 4RTZA 3CCQA 1LPLA 4JJNK 3NTKA 1M90C 1M1FA 2Z0WA 3CC4A 1UHFA 2LX7A 1YHQA 1RACB 5J26A 2F2XA 4A4GA 2G3RA 1NEGA 2OX7A 1YJNA 3PE0A 1AZEA 1KD1C 4E7JA 3EG3A 2KSSA 4ME7A 4OVAA 1FMVA 5GJWB 3CCSQ 2QA4T 2J6KA 3ZL7C 2KXCA 4ZGJB 1ZA2B 4A63B 3CCUT 2BZXA 1UGQB 4IUTA 3OYCA 3KUFA 5GAN4 1G3WA 4E47A 3MCAB 1KQSA 1D3BA 1BU1A 1M90U 1T3LA 1IB8A 2BE7D 4RTWA 3EFOB 1CKBA 4OB2B 5GAMg 4PJOA 4IUUA 4J9IA 1T0HA 1YCSB 1KD1U 1RAEB 4E7LA 1VQ7Q 4BUGA 5IXFA 1WXBA 3CMAQ 1OEBA 5CIUA 4RTUA 3M56A 2JMAA 3JCMb 2PTKA 1PM3A 3X25B 4JRIA 1PRLC 4R0KA 4E7SA 3JCMd 4BE2A 5A2QE 3SDZA 1WNLA 2K2MA 3CCJT 2K9GA 1VIFA 1UECA 3INZA 1PD0A 1WIEA
chains in the Genus database with same CATH topology
1JJ2P 3G4SQ 1VQ7Q 1KD1R 2QA4Q 3CMEQ 1YJ9Q 3CMAQ 1K9MR 1M1KR 1VQ8Q 1QVFP 2QEXQ 1VQOQ 1K73R 1VQPQ 3CCQQ 3CCMQ 1Q82R 1KC8R 3CPWP 1K8AR 3G71Q 3CC2Q 3CCLQ 1VQ9Q 1YIJQ 1YJWQ 3I56Q 3CCSQ 3CC4Q 3CCUQ 3OW2P 1YHQQ 3CCRQ 3CD6Q 1VQLQ 3CCJQ 2OTJQ 2OTLQ 1N8RR 1KQSP 1M90R 1NJIR 1VQ4Q 3CCEQ 3CC7Q 1VQ5Q 3CXCP 1YITQ 1VQKQ 1S72Q 3I55Q 1Q81R 1YJNQ 1Q7YR 1QVGP 1VQMQ 1Q86R 1VQNQ 1W2BP 3CCVQ 1YI2Q 1VQ6Q 3G6EQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 P;  3G4S Q;  1VQ7 Q;  1KD1 R;  2QA4 Q;  3CME Q;  1YJ9 Q;  3CMA Q;  1K9M R;  1M1K R;  1VQ8 Q;  1QVF P;  2QEX Q;  1VQO Q;  1K73 R;  1VQP Q;  3CCQ Q;  3CCM Q;  1Q82 R;  1KC8 R;  3CPW P;  1K8A R;  3G71 Q;  3CC2 Q;  3CCL Q;  1VQ9 Q;  1YIJ Q;  1YJW Q;  3I56 Q;  3CCS Q;  3CC4 Q;  3CCU Q;  3OW2 P;  1YHQ Q;  3CCR Q;  3CD6 Q;  1VQL Q;  3CCJ Q;  2OTJ Q;  2OTL Q;  1N8R R;  1KQS P;  1M90 R;  1NJI R;  1VQ4 Q;  3CCE Q;  3CC7 Q;  1VQ5 Q;  3CXC P;  1YIT Q;  1VQK Q;  1S72 Q;  3I55 Q;  1Q81 R;  1YJN Q;  1Q7Y R;  1QVG P;  1VQM Q;  1Q86 R;  1VQN Q;  1W2B P;  3CCV Q;  1YI2 Q;  1VQ6 Q;  3G6E Q; 
#chains in the Genus database with same CATH topology
 1YIT T;  1VIE A;  1I1J A;  1IGQ A;  3A8L B;  3SHW A;  2QTX A;  1F1B B;  1HXD A;  2ESW A;  1VQ9 Q;  1Z9Q A;  4GBQ A;  1M3C A;  3CBO A;  3RIR A;  4LUE A;  2RJC A;  2EJG A;  5GAO r;  2D9T A;  3E9G A;  2CSI A;  3VYG A;  2DRM A;  2LJ3 A;  5GAM f;  1D1B A;  2DJQ A;  1MHN A;  1AZG B;  1IHW A;  4J9H A;  2CP3 A;  2K57 A;  3H9N A;  4Y91 A;  5LJ5 d;  3LH5 A;  2ZGW A;  2JT4 A;  5C6S A;  3C95 A;  4EMK B;  3JCM J;  4Z02 A;  2GQV A;  2QYZ A;  2PNI A;  1R8O B;  5L8R E;  1IO6 A;  4EDU A;  1IXD A;  2KK4 A;  1G3T A;  1M2V B;  1YIJ Q;  3NTI A;  1ZUU A;  1OZ3 A;  1YWP A;  3DLL A;  1VQO A;  1NLP C;  3EG9 A;  1LVK A;  1WA7 A;  1G83 A;  3OYH A;  3JB9 H;  1UEB A;  1ACM B;  1VQ4 T;  2RJF A;  4DOV A;  1IGU A;  2L3R A;  1WHJ A;  4JS4 A;  3A8M B;  3M0P A;  1TOV A;  1NEB A;  1VQ6 T;  1PWT A;  5CO7 A;  1AWX A;  2LT1 A;  5KYW B;  5HK0 A;  2YDL A;  3CCL Q;  4E7K A;  3QKJ A;  3DKM A;  3JB9 I;  4FYW B;  3CCR Q;  3TVT A;  1R0C B;  4OMP A;  1V29 B;  2J6O A;  1QCF A;  4C0Z A;  3UPU A;  2AIR B;  1BI3 A;  3EG1 A;  1VQ8 Q;  2X51 A;  3EHR A;  2MYS A;  3VS1 A;  1M8V A;  2QTV A;  1FX7 A;  2XD0 A;  2B8A A;  5CR2 A;  2V8I A;  1WXT A;  2B86 A;  3P8H A;  2FO0 A;  1W1F A;  3VS5 A;  4L6V 5;  2RQU A;  1WDX A;  5FWB A;  3CPW A;  2OTJ T;  2JUF A;  3JCM V;  1VQ5 T;  1K76 A;  1S72 A;  3ME9 A;  2MIO A;  1K9M R;  3SEM A;  2ENM A;  3CCQ Q;  3CCV T;  2KAF A;  1KC8 R;  3G6E T;  1OQK A;  1AEY A;  2KVQ G;  3CC4 Q;  3HRU A;  2P4T A;  1YHQ Q;  3L2Z A;  3EGU A;  4PFP A;  1I5O B;  5FU6 B;  2KGT A;  3OS5 A;  4EMK C;  2O9S A;  2YSQ A;  3HPW A;  2AT1 B;  1D3B B;  2FPD A;  2BIV A;  2E4H A;  1BIB A;  4BE1 A;  3EG0 A;  1MV3 A;  3HRS A;  2AHJ B;  4PJO B;  2CP2 A;  4P5N A;  2CP7 A;  4C92 A;  3GIB A;  1BYM A;  1JXO A;  5GMK m;  1PSF A;  2J7I A;  2CZ0 B;  3NTH A;  1OI1 A;  2QXF A;  3BDU A;  2K5F A;  2M0Y A;  4M78 A;  2ZPE B;  1H64 1;  1AVZ C;  3S3N A;  4FT4 A;  3I5R A;  1RI0 A;  3PMI A;  1VYT A;  1WJS A;  1AWW A;  2RPN A;  1E6G A;  2DMO A;  3OS1 A;  4HKE A;  1IRE B;  2NLU A;  1VOM A;  4XTZ A;  2DET A;  2SEM A;  3ZEH A;  2M16 A;  3JCM W;  4RUG A;  1E6H A;  5GAM d;  1A0N B;  1XNI A;  2K7A A;  3R6O A;  2IVW A;  1RAB B;  1GCQ A;  1WQW A;  5KYY B;  2NUP B;  1BCM A;  3JV3 A;  3WVD B;  2KBT A;  1PCX A;  2VV5 A;  4BB7 A;  2YLB A;  2QDY B;  1W70 A;  5GAN 2;  2XU8 A;  2DYB A;  2EKH A;  2Y4X A;  2CUD A;  1NPP A;  3BFM A;  1TUD A;  1X2K A;  1I81 A;  1QLY A;  2GNC A;  2QQR A;  2Y4Y A;  4Z8A A;  1G3Y A;  3MEW A;  2M9U A;  4II1 A;  3GPL A;  1YJ9 T;  4J83 A;  3QHS A;  2EQU A;  4LDY A;  6AT1 B;  5FU6 C;  5IHK A;  1WFW A;  2D6F A;  2NUT B;  3L2U A;  3NPF A;  4J7I A;  5A0D A;  5I11 A;  1M8M A;  2DNU A;  3EG9 B;  1ABO A;  3N5B B;  1BI1 A;  3NFC A;  3L2R A;  2XDP A;  1QP3 A;  3JCM c;  3V8K A;  5GAO n;  3EG2 A;  5GAN f;  2DPP B;  4CI0 C;  2NWM A;  4XQ3 A;  4OF1 A;  3CC7 A;  2FZG B;  2QG9 B;  2HEQ A;  1U3O A;  4OB3 B;  4DA4 A;  2V8J A;  1VQO Q;  5GAO l;  4KH0 B;  2JOY A;  2A7Y A;  1OX9 A;  2BTT A;  2QEX A;  3E19 A;  2EGA A;  2XDD A;  4KUI A;  5HKC A;  3A8O B;  1Y57 A;  4B9W A;  3S3M A;  5GAN 7;  5HY6 A;  3OYA A;  3A98 A;  2ZAE A;  5LJ3 h;  4EPC A;  3I55 A;  2HL3 A;  1YI2 T;  1Q82 R;  1MMN A;  2A3L A;  4C0F A;  3QSU A;  2DA9 A;  2QAS A;  3OYM A;  2DFU A;  2K4Y A;  4V2S A;  3LH0 A;  3QJ6 A;  1VQL T;  2CYZ B;  4M78 D;  2RK2 A;  5KE3 A;  1B07 A;  2M1H A;  4HT9 A;  1JXM A;  2F5K A;  2RQT A;  1KHI A;  5GAN j;  4MZT A;  4FYX B;  4O5V A;  4PK4 A;  2HCK A;  1S72 Q;  4Z89 A;  4C92 B;  2C06 A;  4RKU E;  4OP0 A;  3JCM P;  2WSC E;  3GP8 A;  2KRN A;  4M78 B;  3VU3 C;  2XG8 D;  4KUL A;  1QVF S;  3FEO A;  5CK9 A;  1D1C A;  3CCS T;  4C0D C;  2VGM A;  3OB9 A;  3T9N A;  1TTH B;  2K3B A;  2L89 A;  1U1T A;  3QPH A;  2YXY A;  4PJO G;  1NG2 A;  4J6Y A;  4KBM B;  1W4S A;  2ZPH B;  2VVK A;  3HP9 A;  1M9S A;  2OI3 A;  2LQW A;  2GGR A;  4OMN A;  1QP2 A;  2VYT A;  2XHC A;  2RHX A;  2X3X D;  4OMO A;  1W2B P;  3MHX A;  4FW1 A;  3ASK A;  3M55 A;  5GMK h;  2DEU A;  2VUB A;  2E64 A;  4BY6 B;  4JRQ A;  4GY5 A;  4F7U A;  2BZY A;  1VQ7 T;  4ZGE B;  2WAC A;  3CMA T;  1YP5 A;  3BW1 A;  1GL5 A;  3G71 A;  2ABL A;  2L2P A;  1BI0 A;  2DX1 A;  4E7H A;  2FB7 A;  1MNE A;  1X75 C;  4C5I A;  5KCH A;  1JJ2 P;  1K1Z A;  4QQG A;  3M4Y A;  4R56 A;  1WHH A;  2F2V A;  3A1P A;  4ELZ C;  4DBH A;  1MMG A;  1LOJ A;  4M7D G;  1KFZ A;  1R77 A;  2JXB A;  2F69 A;  3VS4 A;  4J8O A;  1SSF A;  2G6F X;  5DM7 R;  1TS9 A;  1N8R R;  1SPK A;  1VQ9 T;  2LJ1 A;  4LD6 A;  2DO3 A;  3ER0 A;  5IHN A;  3REA B;  4E7I A;  4C92 C;  5I2M A;  3Q1J A;  4BDY A;  4BAC A;  1AWO A;  3HFN A;  2DL5 A;  3HSB A;  3VS6 A;  1VQM A;  1VQN A;  1I07 A;  1OU9 A;  1UGR B;  4M78 C;  1KC8 C;  5FWC A;  4M7A A;  2O31 A;  3QYG B;  3OW2 P;  4ATO A;  3OS0 A;  3CCM A;  4FCY A;  2EBP A;  2ROT A;  1M3B A;  2R5A A;  3I56 A;  2DM1 A;  3M9Q A;  2DIL A;  3M5A A;  3OY9 A;  3VUB A;  4JRK A;  4F04 B;  4F14 A;  3CBP A;  3FDR A;  2CSQ A;  3F70 A;  1X2Q A;  1IZ6 A;  5GAN e;  4JZ3 A;  3M59 A;  3MP6 A;  3FC3 A;  2DXB A;  1CKA A;  1PD1 A;  3LWI A;  4KGX B;  2DXU A;  4BDZ A;  1YIJ T;  3KBG A;  3CC7 Q;  1I8F A;  2P4R A;  1GCQ C;  2M51 A;  4ESR A;  4PFO A;  3PIP A;  4NOY A;  1K9M U;  1RL2 A;  4BE0 A;  2J05 A;  3UDC A;  3H0I A;  3RES A;  2DXT A;  1KC8 U;  2P84 A;  5KYX A;  2QEX Q;  4CC3 A;  1ABQ A;  3DLM A;  4FM4 B;  3VS3 A;  4BI3 A;  3PIO A;  1U06 A;  3EGD A;  3M54 A;  8ATC B;  2OAU A;  1ZUK A;  1JBM A;  4AFQ C;  2YUO A;  4JS5 A;  1YWO A;  2ROL A;  4CRI A;  3CCL T;  4LNP A;  2EGE A;  1UFF A;  2YUQ A;  4TVR A;  3UA7 A;  3GBQ A;  3I55 Q;  5FRM A;  3CCR T;  5EC7 A;  2J6F A;  3SWN A;  1T3S A;  3CEY A;  2DE0 X;  4JJB A;  2RHU A;  2YLC A;  3PVL A;  1H8K A;  4PJN A;  2LP5 A;  2PZ1 A;  5HK3 A;  4AFZ C;  4DOW A;  1VQ8 T;  3CC2 A;  3J7A F;  4M7D A;  4IIO A;  3R6N A;  1YNZ A;  3RER A;  1NYF A;  2A08 A;  4J9B A;  5LJ5 h;  4MZM A;  1GFC A;  1PG5 B;  3QWX X;  2E10 A;  2WSE E;  1C6V X;  1RAG B;  2HKN A;  2EIF A;  1HSQ A;  2D8H A;  2O01 E;  3U23 A;  4C8Q A;  1VA7 A;  2DBK A;  1LNX A;  2DIG A;  4JLI A;  3UAT A;  3RMS A;  3CCQ T;  4A53 A;  3HKS A;  4RTY A;  2E3H A;  2DZ9 A;  3H41 A;  5GMK l;  2DLP A;  3CC4 T;  1KHC A;  3S6W A;  4NS5 A;  3V7R A;  1YHQ T;  4EMG A;  1QVG P;  2HSE B;  4N0A A;  2H8H A;  3L1A A;  1MMD A;  5IN1 A;  1SRM A;  4PLL A;  4C92 G;  2AZV A;  1RAI B;  1YJN T;  3QXE B;  2EYZ A;  3JRZ A;  1WGS A;  1X6B A;  3P8D A;  2DL7 A;  2XMF A;  2GTJ A;  4E2F B;  1C0M A;  4JDS A;  1OPK A;  1RAF B;  1JRI A;  2RN8 A;  4M78 G;  4A4F A;  2ZZD A;  2KXD A;  2RMO A;  4EIK A;  2PVD B;  5CQY A;  3M53 A;  2LNH B;  1S1N A;  1QVF A;  2DKG A;  2CS7 A;  1BI2 A;  1GXI E;  4PFZ A;  3RR6 A;  2KT8 A;  4RG2 A;  2FRY A;  2VXF A;  3TSW A;  2DRK A;  4AMC A;  4N4I A;  2EFI A;  1BK2 A;  2KRS A;  3VYH B;  1PSE A;  3VJP A;  2K3Y A;  3ZBD A;  2ED1 A;  4ANJ A;  3X26 B;  4HCB A;  1Q81 R;  2FVU A;  1GRI A;  4RTV A;  2K3X A;  9ATC B;  1QCN A;  2DBM A;  2CGH A;  2PUO B;  3J81 E;  3A8H B;  2RH2 A;  1WHM A;  2YUP A;  1M1K C;  1FWZ A;  1Q82 C;  3G71 Q;  1D0X A;  3URG A;  4J9F A;  2HBP A;  3CPF A;  1EZZ B;  2QQB A;  1NJI R;  5D6X A;  2RHI A;  2CZ6 B;  4PJO D;  2RA2 A;  4A4E A;  2KY9 A;  4M7A B;  1D0Y A;  1HJD A;  3OYN A;  4FYV B;  1UJ0 A;  2KQW A;  3A8G B;  4PJJ A;  4KRT A;  5CAI A;  2DYI A;  4J6X A;  4ORZ A;  3SFM A;  3OS2 A;  3O5Z A;  2GBQ A;  2RB6 A;  1P92 A;  3THK A;  1YJN Q;  1VQM Q;  1VQN Q;  1TWB A;  4AT1 B;  1WJR A;  5D7U A;  1K0X A;  3TSZ A;  1M1K U;  3JAM E;  1Q82 U;  4HCK A;  1WPY A;  2QQA A;  3MP8 A;  3CCM Q;  2D8J A;  2L3S A;  1AT1 B;  3I56 Q;  2VAS A;  3G1J A;  3LLR A;  4ZNX A;  1YJW A;  2EYQ A;  4JZ4 A;  2RQW A;  1WHG A;  2YWW A;  5KYX B;  4ZTJ A;  3FLG A;  1ZBJ A;  4M7D D;  2LCC A;  1PC0 A;  3EGD B;  4B6M A;  1VQK A;  4HXJ A;  4HVW A;  4X9C A;  3A5Z B;  2JZ2 A;  1RUW A;  1SEM A;  4XTY A;  3OMC A;  1SHG A;  1ZQ1 A;  2RI2 A;  3SWN B;  1HD3 A;  3QII A;  1OPL A;  4GLM A;  1VQO T;  5D6W A;  4XU0 A;  2L3Q A;  3BY7 A;  2VWF A;  2EYW A;  3CD6 A;  1QMC A;  3E1S A;  4FIB A;  1IRX A;  3I9Q A;  4XU2 A;  2DD5 A;  4JJD A;  3EH1 A;  1RAA B;  4ELY C;  4M7D B;  4C5H A;  5FLX E;  3VS0 A;  2X3W D;  1CSK A;  5GAN g;  3G7Z A;  1MV0 B;  1QKW A;  1SKU B;  1WX6 A;  2XDB A;  1H3Z A;  2RF0 A;  1RAH B;  2MF2 A;  3FB9 A;  4M7A C;  2EJ9 A;  1GFD A;  1UUE A;  1ZBX A;  2QDL A;  2CP6 A;  2PQW A;  1WHL A;  1HYO A;  1W2B S;  5L23 A;  5LJ3 j;  2XK0 A;  3AT1 B;  3VUZ A;  3QG1 A;  2IIM A;  3JCM X;  3VRZ A;  2VKN A;  3RKY A;  1FXX A;  1VQP A;  1QCO A;  1N8R C;  4KGZ B;  1D09 B;  2V1Q A;  3ULR B;  2J06 A;  3I5S A;  1WYX A;  1S72 T;  4QVD A;  5A0L A;  2GFU A;  4PJO C;  4JJC A;  1MMA A;  1JU5 C;  1PHT A;  1JJ2 S;  2GFA A;  2A28 A;  1FMK A;  2QGF B;  2E3I A;  4IUQ A;  1U1S A;  1NZ9 A;  2RQV A;  5GAO p;  2SRC A;  3TCJ A;  3M0S A;  2EPD A;  4E7Z A;  3RMQ A;  3CCE A;  4D8K A;  2ZCF B;  4OB1 B;  2KMT A;  5KCO A;  1ZUY A;  1AOJ A;  2ATC B;  1N8R U;  5KYU A;  1JO8 A;  4F17 A;  2JM8 A;  2K5L A;  3OW2 S;  3MEA A;  3OA6 A;  4F7U G;  1G5V A;  2X4X A;  1B34 A;  5EG2 A;  3RKX A;  3WVE B;  1WJQ A;  4LDU A;  2RI3 A;  8AT1 B;  1B3Q A;  4M7D C;  3M0T A;  2HKQ B;  2RJE A;  4PJO F;  4FU6 A;  4C92 D;  3LX7 A;  1UTI A;  1C1A A;  3H0F A;  3C4S A;  2VC8 A;  1AWJ A;  3CXC P;  3OQ5 A;  3QO3 A;  5IXB A;  2OTL A;  5GAN 8;  2LC4 A;  1I4K 1;  4KUD K;  4D8D A;  2LJ0 A;  3LW5 E;  3LGL A;  1VUB A;  3MEU A;  3NGP A;  1EX4 A;  4QQD A;  5GMK j;  3C12 A;  1UE9 A;  2MWO A;  4MDW A;  2LT4 A;  4Y92 A;  1OV3 A;  3G4S A;  2X9H A;  3CME A;  2BKD N;  4FYY B;  3TQ7 P;  5IT9 E;  3HTR A;  2O2O A;  4HCC A;  2DJZ A;  2ZPF B;  2EAY A;  3CQT A;  1LJO A;  2LVM A;  4CC2 A;  2AKL A;  4AG1 C;  2QAZ A;  1UG1 A;  2KYB A;  1OOT A;  3V8L A;  4M7A G;  2CT3 A;  2AKK A;  5FRO A;  3LWH A;  1TU0 B;  3RDV A;  3SB2 A;  1YN8 A;  4PJO E;  3JB9 D;  2QA4 A;  4M7D F;  1WZO A;  1AHJ B;  2HZY A;  2YRC A;  5KH6 A;  3CCU A;  4IIM A;  3TRE A;  4XTV A;  2JM9 A;  3M0R A;  4F16 A;  2MMP A;  2MWP A;  1M5Q 1;  5LJ3 e;  1ARK A;  1K4U S;  3JB9 J;  1ZSG A;  2X4J A;  2R5M A;  4HT8 A;  2YT6 A;  5I2S A;  3NMZ C;  2HBW A;  1YJW Q;  4JRP A;  2HAX A;  4BD3 A;  2FL7 A;  1VQK Q;  3MEV A;  4M77 A;  2NUZ A;  2JVV A;  4AFU C;  1KQ2 A;  3CC7 T;  4LD9 K;  1HK9 A;  1QVG S;  3X28 B;  2EQJ A;  2DL8 A;  4M7D E;  1EIF A;  1Q95 G;  1RAD B;  5GAN 3;  2D0N A;  2HQX A;  3PTA A;  2QEX T;  3E2U A;  3CD6 Q;  4LDX A;  2EGC A;  1B7T A;  3EFS A;  3OYY A;  5KE2 A;  5LL6 S;  4X1V A;  4NL3 A;  3CCJ A;  1Q7Y R;  4OML A;  1YIT A;  1RLP C;  5GMK i;  1K0S A;  2X4Y A;  3GNF B;  4WTO B;  3I55 T;  3QZ9 B;  1ZSZ A;  4DBR A;  1PRM C;  2M02 A;  1Y96 A;  2JJ9 A;  2I0N A;  4AG2 C;  2K5I A;  4O6J A;  4LN2 A;  4QQ6 A;  1KIK A;  5GAN 5;  1UJY A;  4IUP A;  3QZ5 B;  1XJW B;  2DER A;  2EYX A;  2FRW A;  1KQS P;  1NJI C;  2QGG A;  2XKO C;  1FMW A;  4J6W A;  2DD4 A;  2X4W A;  1ZHI A;  1M1G A;  2O4X A;  3VRY A;  5GAN d;  4C8Q G;  2YUN A;  2JTF A;  2QI2 A;  4QVC A;  4XU1 A;  1QW1 A;  4FW2 A;  1UGP B;  1K9M C;  2CRE A;  1VQP Q;  1VYU A;  4IKF A;  3OYI A;  2F1L A;  3L42 A;  2P0K A;  1U5S A;  1YBY A;  1W2B A;  2LZ6 B;  1Q81 U;  4M75 A;  2E6N A;  2P0P A;  2BE9 B;  4DBQ A;  2K6D A;  3KXT A;  2H3E B;  1W6X A;  2RK1 A;  1TXQ A;  5KYU B;  5LJ5 j;  2WSF E;  5GMK e;  3I35 A;  2JS0 A;  4RG8 A;  2E65 A;  2E1H A;  3EGX A;  1B34 B;  1NJI U;  2YRV A;  2CH4 A;  3OYF A;  5IHI A;  5ECA A;  3CCE Q;  1O9S A;  1JJ2 A;  3H6Z A;  2GTO A;  2RD1 A;  2L8D A;  2DIQ A;  4X34 A;  1VQ4 A;  3GNG A;  3TEE A;  1KSW A;  2OAW A;  1N27 A;  3JCM h;  3TU4 K;  4C92 F;  4PL6 A;  4BY6 C;  2RHZ A;  1VQ6 A;  2HQE A;  3OYJ A;  2DL3 A;  5J39 A;  1J3T A;  2HNI A;  3HL8 A;  4LDV A;  4M78 F;  4LE9 A;  2R58 A;  3EFR A;  3OBY A;  4R55 A;  5FW9 A;  1PNJ A;  3RBB B;  5CKE A;  2D1X A;  5A0G A;  3UA6 A;  1H3H A;  3PT9 A;  4QVZ A;  3OW2 A;  2ZPI B;  1K73 R;  3LYI A;  1DJ7 B;  1UDL A;  2H3J A;  5I22 A;  3RUX A;  4RTT A;  1U8R A;  3L2W A;  5CQX A;  4QKU A;  4Q5W A;  2OTL Q;  3G71 T;  1IHV A;  1M3A A;  2D0Q B;  1NLO C;  3M57 A;  2F5T X;  3FRN A;  2IPO B;  3OYD A;  2OTJ A;  1GBR A;  1Q86 R;  3JB9 F;  3MP1 A;  4C92 E;  4M77 D;  1SF9 A;  4RTX A;  1VQ5 A;  1NBE B;  1NE8 A;  1X43 A;  4BI4 A;  1PKT A;  4FSX A;  4J9C A;  5DLO A;  3G4S Q;  1RLQ C;  1KJW A;  3CME Q;  1QVF P;  4E6R A;  3CCV A;  5GJV B;  3G6E A;  1K8A R;  2CT4 A;  4M78 E;  2EKO A;  2JW4 A;  2V26 A;  3H8Z A;  1QVP A;  2CP0 A;  4J9D A;  2KT1 A;  5GAN 6;  5CCA A;  1BIA A;  1JQQ A;  1TUC A;  1D0Z A;  5KYY A;  2NUP A;  1V1C A;  1E7O A;  3V7S A;  4IUR A;  3IQL A;  1X6O A;  1QWF A;  1XTD A;  2COY A;  3JCM e;  3OYK A;  2FYK A;  2QA4 Q;  1VQM T;  1VQN T;  2DEQ A;  3QJY A;  2E5Q A;  4M77 B;  1YFN A;  2LDM A;  3CBM A;  3CCU Q;  2COZ A;  2MCN A;  1YCY A;  2W10 A;  3CCM T;  3DB3 A;  1PKS A;  3HFO A;  3I56 T;  1MND A;  4F7U B;  3ZFJ A;  1EFN A;  2JNG A;  5FU7 B;  2NUT A;  5CKD A;  3UT1 A;  3CPW P;  2L0A A;  4OGC A;  4J5Y A;  1R0B G;  2CKK A;  2EJF A;  3OMG A;  4JLG A;  2Y90 A;  3DB4 A;  4M7A D;  1ZSZ B;  1NYG A;  1Y96 B;  1KK7 A;  3HRT A;  2PUK B;  3OYL A;  3JB9 G;  4M75 D;  4LXC A;  1Y71 A;  3OSV A;  4DEY A;  5LJ5 e;  1WXU A;  3P8B B;  1UHC A;  3GOX A;  2EQI A;  5AYF A;  3NHN A;  2R57 A;  5LJ3 g;  2X35 A;  2JN0 A;  2ED0 A;  4AFS C;  2RI5 A;  2GF7 A;  1K9A A;  2O4X B;  2A37 A;  2HQH A;  1SHF A;  1QVG A;  1D1A A;  3AHU A;  3JCM Q;  3EH2 A;  5KYN A;  3CCJ Q;  1VYV A;  1M30 A;  5GAM j;  1X27 A;  1XOV A;  1YIT Q;  2RHY A;  2L5Q A;  4PJM A;  2HD0 A;  2F2W A;  4M75 B;  2MPX C;  4J9G A;  3QBY A;  1YJ9 A;  2XID A;  2FZC B;  2LCL A;  1X01 A;  4A4H A;  3CC2 T;  2MAM A;  3D7S B;  1M90 R;  1TUG B;  4L59 A;  2V1R A;  1M2O A;  2K79 A;  2E70 A;  1JB0 E;  3EGX B;  3CXC S;  2KEA A;  3VV0 A;  3RNJ A;  1KD1 R;  1QQJ A;  2RM4 A;  3VS2 A;  2KI7 A;  4ZTF A;  4ZN3 A;  1G2B A;  4M77 C;  3FJP A;  5FRN A;  5CKH A;  1BB9 A;  4JPB W;  4XAX B;  2DTO A;  3QDR B;  5LJ3 f;  2P0Q A;  2EQM A;  1MGQ A;  1JEG A;  2O88 A;  2FZK B;  2OJ2 A;  2ZPG B;  4XTW A;  2FEI A;  4RCB A;  2FHD A;  4MMK A;  5FU7 C;  3EHQ A;  4KGV B;  3QWY A;  4OMM A;  4FSS A;  2EQK A;  3MO8 A;  4NL2 A;  4XTU A;  4C8Q D;  5GAM h;  1OX8 A;  2PU9 B;  4HA8 A;  4IUV A;  1ZSZ C;  1VQ4 Q;  2E12 A;  4XU3 A;  3E9F A;  1ZX6 A;  4LDW A;  1XQH A;  1VQ6 Q;  5C0M A;  4Y28 E;  1NM7 A;  4MDX A;  1QKX A;  4L5G A;  3VKI A;  1YI2 A;  3M0Q A;  5D6Y A;  5GAO q;  1G3S A;  2DTI A;  2E5K A;  2FPF A;  2LQN A;  4C5E A;  4M77 F;  3M58 A;  1KG1 A;  5HCK A;  3VS7 A;  1UGS B;  1N5Z A;  2O9V A;  3RKW A;  3M4G A;  4C8Q B;  2MK5 A;  4UC4 A;  1Q7Y C;  1VQL A;  4KH1 B;  2KDS A;  4HVV A;  4F7U F;  3C0C A;  2BZ8 A;  2RNA A;  2VGN A;  3OYG A;  2HSP A;  4M75 C;  4MZP A;  1GBQ A;  1I5L A;  3UF4 A;  3CC2 Q;  1G8X A;  2FG0 A;  2JMC A;  2BUD A;  3OBW A;  4LUD A;  1QWE A;  2OTJ Q;  2FPE A;  1UGV A;  2AK5 A;  4XTX A;  3MPU B;  1WI7 A;  1VQ5 Q;  4OMF B;  3MKD A;  2DF6 A;  2MI6 A;  2KRO A;  4DQ2 A;  2GCX A;  1TH7 A;  2JS2 A;  3SD4 A;  3CCV Q;  3G6E Q;  1M27 C;  2C0I A;  2RQR A;  1OZ2 A;  4ZGD B;  4CC4 B;  2CZ1 B;  4M77 E;  1TSF A;  2I2L A;  4JUV A;  5GAM e;  3BE3 A;  3CCS A;  4D6W A;  5CVI A;  1Q7Y U;  2DAQ A;  2VB6 A;  5DY9 A;  3PMT A;  4Z88 A;  3L2V A;  3X20 B;  4F7U E;  1KQS S;  4C5G A;  4CC7 A;  2DVJ A;  1OYX A;  5IH2 A;  1UB4 A;  7AT1 B;  2KNB B;  2LX9 A;  3FJ5 A;  4M7A F;  2DVE A;  2CP5 A;  1LCK A;  3JSC A;  4M75 F;  4PJL A;  2LQ8 A;  3SWN C;  2LCS A;  2CH4 W;  2EYY A;  4M77 G;  3OSS C;  1SG5 A;  1YJW T;  2RO0 A;  4KT0 E;  4C0D B;  3V8J A;  3PVQ A;  2KR3 A;  4DEX A;  3EAE A;  4BI8 B;  5AT1 B;  1VQK T;  2JTM A;  2YHT A;  2A36 A;  3JCM g;  4PKC C;  1N6A A;  1VQ7 A;  3M0U A;  2RJD A;  3CMA A;  2KRM A;  2EWN A;  2LMJ A;  4X9D A;  2A0F B;  4M4Z A;  2YRD A;  3QYH B;  2KYM A;  4C8Q C;  3X24 B;  3J80 E;  3CD6 T;  2CUB A;  3C94 A;  1TG0 A;  3V7C A;  2LTO A;  3EFO A;  4WCI A;  4M7A E;  4FL6 A;  3PGG A;  1M1K R;  1Y07 A;  1K73 C;  1ZA1 B;  4M75 E;  2EW3 A;  2ZPB B;  4N0A C;  4N4G A;  2XI9 A;  2KE9 A;  5LJ3 d;  4A4K A;  1VQ9 A;  2E41 A;  2QQS A;  3REB B;  4YTL A;  4PNO A;  2PVG B;  1M4Z A;  2LQK A;  1V76 A;  1Q86 C;  4VUB A;  4OB0 B;  4J7F A;  2M0O A;  2C0T A;  5LJ5 g;  1YJ9 Q;  3FIF A;  1K8A C;  4M75 G;  2E6Z A;  4RMO A;  3LGF A;  3UWN A;  3GLX A;  3OYB A;  3JCM f;  1VQP T;  4N4H A;  1H92 A;  2XIC A;  1SSH A;  4B9X A;  3KFV A;  4QT7 A;  2QQ9 A;  1FYN A;  4C8Q F;  1ZLM A;  1K73 U;  4WF2 A;  4DBF A;  3O8V A;  4PLI A;  1N9R A;  1WHK A;  4C0G A;  3PNW C;  2ECZ A;  2HMA A;  1KQ1 A;  3PFS A;  3CXC A;  5CKF A;  1T0J A;  5DLQ E;  5CKB A;  1OU8 A;  2LRQ A;  2IG0 A;  1YIJ A;  1I0C A;  2DZC A;  1Q86 U;  4MML A;  3S3O A;  3H0H A;  3QDF A;  3CCE T;  4OMQ A;  3QUI A;  4HCZ A;  1BKB A;  5J3B A;  1K8A U;  2DK3 A;  2L3P A;  3L2Q A;  2AZS A;  2W0Z A;  4EMK A;  5IAY A;  2DL4 A;  2COW A;  4FT2 A;  5LJ5 f;  2PVO B;  1AD5 A;  1OUL A;  1GCP A;  3WXM B;  3CCL A;  1X69 A;  1WLP B;  2DXC A;  4RCC A;  4XK8 E;  1M2V A;  4C8Q E;  3CCR A;  1Q81 C;  2K2V A;  3GF5 A;  4EMH A;  1RI9 A;  1MUZ A;  1WQ7 A;  2NYS A;  4J9E A;  1YI2 Q;  5GAO m;  2JTE A;  4GLK A;  4K11 A;  1X6G A;  2V8K A;  4HVU A;  5GAN h;  2CDT A;  2C0O A;  3MET A;  1VQ8 A;  2VXE A;  4OGE A;  3CPW S;  2CZ7 B;  1VQL Q;  2GQI A;  3HHT B;  1Z9Z A;  4ZN1 A;  5KYW A;  2HDA A;  1SRL A;  1N9S A;  2OTL T;  1O75 A;  5I21 A;  3BDL A;  2HL5 C;  2QK0 A;  1NPR A;  2LNV A;  5M9O A;  1Y7X A;  2EVR A;  2DTH A;  3MJX A;  4A54 A;  3OYE A;  1BBZ A;  1BCO A;  3G4S T;  1Y0M A;  2MOX A;  3CME T;  4QW2 A;  4RTZ A;  3CCQ A;  1LPL A;  4JJN K;  3NTK A;  1M90 C;  1M1F A;  2Z0W A;  3CC4 A;  1UHF A;  2LX7 A;  1YHQ A;  1RAC B;  5J26 A;  2F2X A;  4A4G A;  2G3R A;  1NEG A;  2OX7 A;  1YJN A;  3PE0 A;  1AZE A;  1KD1 C;  4E7J A;  3EG3 A;  2KSS A;  4ME7 A;  4OVA A;  1FMV A;  5GJW B;  3CCS Q;  2QA4 T;  2J6K A;  3ZL7 C;  2KXC A;  4ZGJ B;  1ZA2 B;  4A63 B;  3CCU T;  2BZX A;  1UGQ B;  4IUT A;  3OYC A;  3KUF A;  5GAN 4;  1G3W A;  4E47 A;  3MCA B;  1KQS A;  1D3B A;  1BU1 A;  1M90 U;  1T3L A;  1IB8 A;  2BE7 D;  4RTW A;  3EFO B;  1CKB A;  4OB2 B;  5GAM g;  4PJO A;  4IUU A;  4J9I A;  1T0H A;  1YCS B;  1KD1 U;  1RAE B;  4E7L A;  1VQ7 Q;  4BUG A;  5IXF A;  1WXB A;  3CMA Q;  1OEB A;  5CIU A;  4RTU A;  3M56 A;  2JMA A;  3JCM b;  2PTK A;  1PM3 A;  3X25 B;  4JRI A;  1PRL C;  4R0K A;  4E7S A;  3JCM d;  4BE2 A;  5A2Q E;  3SDZ A;  1WNL A;  2K2M A;  3CCJ T;  2K9G A;  1VIF A;  1UEC A;  3INZ A;  1PD0 A;  1WIE A; 
#chains in the Genus database with same CATH homology
 1JJ2 P;  3G4S Q;  1VQ7 Q;  1KD1 R;  2QA4 Q;  3CME Q;  1YJ9 Q;  3CMA Q;  1K9M R;  1M1K R;  1VQ8 Q;  1QVF P;  2QEX Q;  1VQO Q;  1K73 R;  1VQP Q;  3CCQ Q;  3CCM Q;  1Q82 R;  1KC8 R;  3CPW P;  1K8A R;  3G71 Q;  3CC2 Q;  3CCL Q;  1VQ9 Q;  1YIJ Q;  1YJW Q;  3I56 Q;  3CCS Q;  3CC4 Q;  3CCU Q;  3OW2 P;  1YHQ Q;  3CCR Q;  3CD6 Q;  1VQL Q;  3CCJ Q;  2OTJ Q;  2OTL Q;  1N8R R;  1KQS P;  1M90 R;  1NJI R;  1VQ4 Q;  3CCE Q;  3CC7 Q;  1VQ5 Q;  3CXC P;  1YIT Q;  1VQK Q;  1S72 Q;  3I55 Q;  1Q81 R;  1YJN Q;  1Q7Y R;  1QVG P;  1VQM Q;  1Q86 R;  1VQN Q;  1W2B P;  3CCV Q;  1YI2 Q;  1VQ6 Q;  3G6E Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...