3CCEQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cceQ00
1VQ7Q 3CXCP 1YJWQ 1M90R 1Q86R 1VQKQ 3CC4Q 3CMEQ 1K9MR 1VQNQ 1VQPQ 3CC2Q 3OW2P 3CMAQ 1N8RR 1Q82R 1S72Q 1Q81R 3CCQQ 1KC8R 1Q7YR 2OTLQ 1W2BP 3CCJQ 1NJIR 1VQ9Q 1K73R 1K8AR 3CCLQ 1VQOQ 1VQ4Q 1YJ9Q 1YJNQ 1QVFP 1YITQ 1JJ2P 3CCSQ 3G4SQ 1VQ5Q 1YIJQ 3CCRQ 1VQLQ 3CC7Q 1KD1R 1VQ6Q 3G6EQ 1VQMQ 1QVGP 3CCUQ 1YI2Q 1KQSP 2QEXQ 1VQ8Q 2QA4Q 2OTJQ 3G71Q 3CCMQ 3CCEQ 3CCVQ 3CD6Q 1YHQQ 3I56Q 3I55Q 3CPWP 1M1KR
chains in the Genus database with same CATH superfamily
3I35A 5IAYA 4M75D 4F7UE 3M59A 3G4SA 2M0YA 5LJ5h 4XU1A 1W2BP 2OTJA 4K11A 2HL5C 2NWMA 2V1RA 1RABB 4PJOG 1VYUA 4R0KA 3OS0A 3MP1A 1NJIC 3JB9I 3CC2T 1U06A 2ZCFB 1WXUA 2PTKA 5CO7A 3REAB 1BBZA 2C0OA 4PJLA 3CPFA 3I9QA 1KG1A 5GMKh 1X2QA 2RJEA 2HDAA 4A54A 2OJ2A 5GMKi 2FPEA 3CCQQ 1NM7A 1ZUUA 2M9UA 1OU8A 2JMCA 4OMMA 4KH0B 3CCVT 2RF0A 1O9SA 5GJWB 1Y0MA 2ZPGB 3OY9A 4PFOA 1LJOA 2Y4XA 1ZSGA 3ULRB 2RM4A 2JMAA 2EYYA 4Z02A 1PRMC 3S3OA 2QQRA 4RG8A 3OYCA 2XDBA 2BKDN 2A36A 5DLQE 2FL7A 2V8KA 4M7AG 3A8LB 3BDLA 1VQKT 2F2WA 1KQ2A 2CT3A 2R57A 4A63B 2C0IA 1JO8A 2LT4A 4JRQA 4EMHA 4FU6A 1E7OA 1WJRA 3ZBDA 5DY9A 4ORZA 5GMKl 4RTUA 4F17A 2PVGB 4J8OA 5LJ5f 2L5QA 1IZ6A 2OAWA 3EFOA 3X28B 3G4SQ 5GAMe 3OW2A 2OTJQ 3JCMX 2CP3A 4M77E 2EVRA 5CK9A 2XKOC 4JRKA 2FO0A 1SF9A 4JJNK 4NS5A 4DA4A 3VS4A 3JB9D 3VJPA 4C5GA 4DOVA 3QJ6A 3X26B 1CKBA 3RMSA 4F7UB 2RB6A 3V8LA 1NPPA 4XTWA 3RESA 2E6NA 3QDFA 3IQLA 4PJOE 4RTTA 3WVDB 1FYNA 2HEQA 3VKIA 2PVDB 1OV3A 1BI1A 2CH4A 2J6KA 2LJ3A 2JS2A 5CQXA 4UC4A 2LC4A 2EWNA 1ABOA 1VQMA 1OULA 3FLGA 2NUTA 1WLPB 3V7SA 2K5FA 4QVCA 2EYZA 1WYXA 1Y07A 1LVKA 1RAGB 2O2OA 2RO0A 4J5YA 3T9NA 4BY6B 2EAYA 1K0SA 1FMVA 3J80E 2JVVA 3M0QA 2WSFE 1OPKA 1JRIA 2DL5A 1G3SA 2QDLA 5GAOq 2C06A 3PT9A 2RN8A 2KGTA 1WI7A 3CXCS 2RQUA 5GAN3 4AFQC 2EGEA 4J83A 4E6RA 1B07A 3EFRA 2GFAA 1SRLA 2HD0A 1YIJA 2L3PA 2DERA 2YXYA 2KRMA 2MAMA 4M7DE 2DZ9A 4ME7A 2FZKB 1RADB 2K5LA 3MEVA 3L2UA 1ZLMA 4IUUA 2SEMA 4BB7A 4RTWA 2JTMA 4JRIA 4A4KA 4OMQA 1FX7A 4WCIA 2K2MA 5GAOn 1U3OA 2CYZB 1BB9A 4OMLA 1U8RA 4C5EA 3EGDB 1A0NB 4M77B 4PJNA 1YJ9T 4BE0A 2FEIA 1RAEB 1TS9A 1X75C 1OOTA 1Q86U 4C8QD 4PNOA 4DBFA 4C92G 2DYIA 1GBQA 2OI3A 2LJ0A 3JCMb 1VQMQ 1QCNA 3JCMh 4C92A 3NGPA 1NYGA 2D1XA 3RUXA 4KULA 2P4RA 4PJOB 2BZXA 4YTLA 3O5ZA 3GF5A 3A5ZB 3OSSC 3PFSA 3G4ST 2E70A 2QK0A 3EG1A 3MO8A 2OTJT 1WHLA 3I5RA 2A7YA 3LWHA 2EGCA 2F5KA 2X3XD 2KR3A 1H3HA 2PU9B 4JRPA 2RQVA 1R8OB 2QXFA 4II1A 1HSQA 4C0DC 4ZNXA 5IHIA 3EGUA 5GMKm 3JB9F 3PMTA 3GBQA 1YWPA 1E6GA 5GAN8 7AT1B 2K3BA 3H8ZA 3M5AA 4RTYA 3G6EA 1KQSA 4PFZA 2RK2A 1GXIE 1K1ZA 4HXJA 4M78G 1YIJQ 4J7IA 2XG8D 2NUPA 1QVGP 4HCBA 3JCMc 2K3XA 2CSQA 2YUNA 1WFWA 4M75G 4HVUA 2VGMA 3H0HA 4KRTA 1TG0A 3RDVA 3QSUA 4FIBA 2VWFA 3QZ5B 1K9MC 2QDYB 2QTVA 2D8JA 1DJ7B 3HFOA 2YLBA 4ZGDB 2FVUA 2ATCB 2DIQA 2CP0A 1ZSZA 4M7DB 2LMJA 1PHTA 4KGVB 1WHHA 2M16A 5M9OA 4FT2A 5GANg 3A98A 1GCQA 1JXOA 2DD4A 1MUZA 3UATA 1QWFA 1YITT 5HK0A 2LNHB 2DRKA 1MGQA 1EFNA 5IHNA 1IXDA 1JXMA 2PVOB 4ZTJA 2YSQA 4B6MA 1XOVA 2R5AA 1AWOA 3TVTA 4FYYB 3SWNC 4ANJA 2DTHA 2DE0X 2QQSA 5FU6C 3JV3A 3M4YA 4C0FA 1M1GA 1WHMA 4EDUA 2K5IA 1VQ6A 4IUPA 1HK9A 1AVZC 5L8RE 5GAN4 2BIVA 2F1LA 3OYYA 5KYWB 4X9DA 1QVFP 3E1SA 1T3LA 2J6FA 2D8HA 1YBYA 3G6EQ 2P0QA 4EPCA 2MF2A 2M02A 1J3TA 1V29B 1KHIA 1PM3A 1N6AA 4LUDA 4AG1C 3CPWS 3NMZC 3AHUA 2GNCA 3OYGA 3CCLA 2FRYA 5CR2A 1VQMT 1W6XA 1VQ8A 1OX8A 3H41A 4DBQA 5FRMA 3VS5A 3I55A 2G6FX 3CD6T 1BCMA 4JJCA 3ZFJA 2LCCA 3G1JA 3CMAA 3VRYA 5FW9A 2I2LA 3P8HA 2D0NA 1QW1A 5LJ5g 2E5QA 2E41A 4XQ3A 2EJFA 3EAEA 2JT4A 4ZN3A 3CCRA 1TWBA 5KE3A 3HL8A 3QUIA 2MI6A 1TXQA 3PE0A 1N8RU 2DFUA 4LDVA 3INZA 2KT8A 2P0PA 2ROLA 1VQNT 3CC4A 1YJWT 3EH2A 2BUDA 2EJGA 4EMKC 4IUTA 4FYXB 2X4XA 4RCBA 5IXBA 4LDWA 4OMPA 3C12A 2QQ9A 2OTLA 4FW2A 2E64A 4PJJA 1T0HA 2KQWA 1FMKA 3X24B 1JB0E 2JXBA 1VQ5A 1YIJT 3L42A 3JB9H 2FHDA 2QEXT 3VV0A 4HVVA 2O9SA 2WSCE 1CSKA 2W10A 2E3IA 1VQ6Q 4GY5A 1M8VA 1WHJA 2DTIA 1CKAA 4C5IA 2AHJB 4HT9A 3HHTB 2HQHA 3CC7A 1QVPA 5GAMh 2X9HA 3CCLQ 2EJ9A 4F7UA 1TUGB 2X4JA 2EQUA 1VQ8Q 2DVEA 2QYZA 3EHRA 3OYKA 3TCJA 4Q5WA 3I55Q 2H3JA 2RHZA 2EQIA 4Y91A 4PLIA 4X9CA 1R0CB 3EG9B 3TREA 1OU9A 1VQ4A 3TQ7P 3CMAQ 2V1QA 4J9BA 2WACA 3DB3A 1PSFA 5C0MA 3FDRA 3M54A 1ZBXA 1GCPA 1UGQB 1AD5A 1ZQ1A 3CCRQ 1FMWA 4TVRA 2D9TA 4XTYA 3HRTA 2KEAA 1S72A 1NEBA 1M3CA 3J7AF 3OS2A 3CC4Q 3JSCA 1VQOA 5CIUA 2RI5A 4LXCA 4C8QG 5J26A 2RJDA 2KMTA 2OTLQ 1WXBA 3CCMA 3LWIA 5IH2A 3M0UA 1VQ5Q 5LJ3d 2L8DA 2GCXA 1YP5A 1OZ2A 3QG1A 1WJQA 2VKNA 3CBPA 4C0GA 3VS6A 4QKUA 2CDTA 1TUCA 3OW2P 2PUOB 2PUKB 5FROA 2GTOA 4Y28E 1MMGA 4NL3A 1Y96B 5GAN2 3PVQA 4R56A 4RTXA 2QQBA 3CC7Q 1VA7A 2DL3A 2GTJA 3MJXA 2RHIA 4AT1B 3A8GB 5GJVB 5A0LA 2E10A 4M77A 1QKWA 1Q82R 1Q86C 4N0AA 4E7SA 1ZHIA 3RKXA 4XTXA 1LCKA 1T3SA 1Q81C 1VQ4Q 3L2QA 3SHWA 4IUQA 1QP3A 2CH4W 5GANf 2DXBA 2DXTA 1OQKA 2COZA 3PVLA 4FW1A 4LD6A 2E5KA 4PJOA 3WXMB 2CGHA 3BFMA 2LQKA 2CUBA 3CCJT 2DBKA 2C0TA 4LDUA 3JCMV 1S72Q 2A37A 5FU7B 3NTHA 4VUBA 1MV3A 5LL6S 4XAXB 4CC3A 1QWEA 2YRDA 3CQTA 3TEEA 4QVDA 1VQOQ 2YRCA 1Q7YC 1VQ7A 2GGRA 4FYVB 2K9GA 1VQPA 2XMFA 3RERA 5KCOA 3CCMQ 2DETA 4AMCA 1NBEB 2F2XA 2OAUA 3CCLT 1G8XA 4WTOB 2JS0A 3F70A 1MMDA 5KYNA 1H641 5I2MA 3M9QA 4C8QE 2EW3A 1VQ8T 3JCMQ 1LNXA 1K8AR 3JCMg 2KNBB 1Z9ZA 5EC7A 1K9AA 5CCAA 3CMAT 4OGCA 1IHVA 1BCOA 3LGFA 5KYYB 1YCYA 1AZEA 3ZEHA 1Y57A 2A08A 4M7AA 1M9SA 2LVMA 2DJQA 3MEWA 3CCRT 1PWTA 3I5SA 4M7DG 4X1VA 4BI3A 2SRCA 4OB1B 1BI3A 3GNFB 1MMNA 2DK3A 3CC4T 3SWNB 5FU6B 1PKSA 2CZ1B 1UJYA 1RAIB 4NL2A 2BZ8A 4J9EA 2ZPIB 1UGRB 1NE8A 2QASA 1KK7A 3M0RA 2DXUA 5CKBA 1UDLA 1XNIA 3OYIA 1PKTA 4CC7A 5AYFA 3H0IA 1YI2A 2QA4A 2GQVA 2KROA 1OEBA 2RK1A 1YNZA 3CXCA 5IHKA 4AFSC 3DKMA 9ATCB 1D09B 5KYXA 4BDZA 1KD1U 1VQ7Q 1VQPQ 1SHFA 1M1KC 2ED1A 5FWBA 4CI0C 1W1FA 4PLLA 2DEUA 4DEYA 5KYWA 4LNPA 2RHXA 4MMLA 5CKHA 4Z88A 1KD1R 1RLPC 5GANe 1K73U 1XQHA 1KQSP 1VYTA 3NTIA 3NFCA 2J7IA 3M0SA 3FIFA 1M3AA 1VQ4T 1YJNA 1S1NA 2KE9A 5GANj 4WF2A 4EMKB 1K73R 3FB9A 4J6XA 4DQ2A 4O6JA 2KXCA 1N27A 2KYMA 1M2VA 3R6NA 4C8QB 1RLQC 5HY6A 2HMAA 2DM1A 4OP0A 2J06A 1S72T 1G83A 2RD1A 5GAMd 2A0FB 3CCQT 2CUDA 1MV0B 3QIIA 1B34B 1VQOT 4L5GA 3VS0A 1SPKA 2BE9B 1B3QA 3RNJA 4A53A 2BTTA 2GBQA 4GBQA 2KVQG 3PNWC 4J9HA 2RQRA 2KAFA 5ECAA 1N8RC 2M0OA 2HBPA 3PIOA 3SB2A 4KH1B 1C1AA 3CMEA 1TH7A 3NTKA 1YI2Q 2QA4Q 2LCSA 1M8MA 2EBPA 3GP8A 3S3MA 2CZ0B 4N4IA 2DD5A 1RL2A 2FYKA 2HL3A 1M90U 2J05A 1W2BS 8AT1B 2D6FA 3OYEA 4ZGEB 1W70A 1NG2A 5LJ5e 2EYWA 1U5SA 2PNIA 3KXTA 5GAN7 3OMGA 2JOYA 2A28A 2L0AA 2X35A 4J6YA 1M90R 5LJ3h 3VS7A 1OZ3A 4QQGA 5LJ5j 2O4XA 1GCQC 4XTVA 5IXFA 2YRVA 3E2UA 2MYSA 1N5ZA 1G5VA 1Z9QA 3I56A 1BI2A 1YJNQ 1IHWA 4J7FA 2GQIA 1X6BA 1AEYA 2RJFA 3WVEB 1M27C 4LD9K 1ZA1B 5GMKj 3CBMA 1BI0A 4KUDK 2JTFA 4QVZA 5CVIA 2VXFA 3CCEA 2QGGA 1FXXA 2DNUA 3EFSA 4HA8A 1GBRA 2ZPEB 1VQPT 2O01E 2MK5A 4QQ6A 3REBB 4ZTFA 3SFMA 2LJ1A 4JJDA 1Y71A 1I0CA 3OYFA 3QDRB 1ZA2B 5GAMg 3CMEQ 3FJ5A 4M78A 2DRMA 3RKWA 4DBHA 3A1PA 1FWZA 3X25B 3OA6A 4D8KA 1F1BB 3FJPA 3SDZA 4M75A 4F04B 3CPWA 2E1HA 1WA7A 3JCMJ 1ZUKA 5I21A 1TUDA 1T0JA 1UFFA 2ESWA 3X20B 3OS1A 3P8DA 4MDXA 1VYVA 1P92A 3JCMf 3RIRA 5LJ3f 3GIBA 3ZL7C 1Y96A 3EFOB 3HTRA 2CT4A 1G3WA 2JM9A 4F16A 5A0GA 2JNGA 1X43A 1D3BB 3I56Q 4F7UF 3PTAA 4J6WA 1TOVA 2DL4A 4IKFA 1UE9A 2RI3A 3MP8A 3TSZA 3LX7A 2QA4T 2YT6A 2K3YA 1YHQA 3L2ZA 4M7AD 1KHCA 2CS7A 3SD4A 3SEMA 3CCEQ 3V8JA 2O31A 3MKDA 3H0FA 5IT9E 3KUFA 4PFPA 1YWOA 3ER0A 1BYMA 3CCUA 2E12A 1NPRA 3M57A 1SSFA 1WQWA 3HKSA 3NHNA 3CEYA 5DM7R 3OQ5A 3JB9G 5GAOl 4BUGA 5KH6A 3VYGA 3CCSA 3E9FA 3JCMP 2O88A 3JCMW 2ECZA 1KC8U 2DX1A 1VQKA 1G3TA 1V1CA 1UHFA 2HAXA 2KDSA 2LQWA 4XU0A 1M30A 5KYYA 4JZ4A 3THKA 1I5LA 5A2QE 1SSHA 4NOYA 4E7JA 1O75A 1KC8R 4A4GA 3QXEB 2VC8A 4JS4A 1IGQA 1QCFA 3C0CA 1OPLA 3OYNA 4J9IA 2GF7A 4N4GA 2D0QB 2CP6A 3PMIA 1WDXA 2CKKA 3SWNA 4LDXA 1YHQQ 2XDDA 1I07A 2CREA 2NUZA 4E7ZA 5D6YA 5I2SA 3JCMe 1QCOA 1LOJA 3HFNA 1IB8A 2FRWA 2XK0A 1UEBA 3M53A 1E6HA 2HZYA 4MDWA 4AG2C 4PJOF 3C94A 1KQ1A 1X6OA 3CCUQ 1PD0A 3M0PA 1PG5B 3HRSA 4KBMB 1G3YA 4O5VA 3L1AA 2WSEE 1I1JA 1VUBA 4E7LA 2P0KA 2CP7A 3QJYA 2E4HA 2KYBA 1N9RA 4N0AC 5KYUB 3I56T 3EHQA 4JJBA 2IIMA 3P8BB 1XTDA 1K73C 3CCSQ 1PRLC 6AT1B 2MMPA 1QVGS 2B8AA 3S3NA 3FC3A 2DO3A 2KRNA 3HPWA 4MMKA 2X4YA 4B9WA 2XU8A 2ED0A 2W0ZA 4KGXB 5D7UA 1VQ9A 1VQKQ 4AFUC 3L2WA 4PJOC 1I81A 1MHNA 3UA6A 2HNIA 3G6ET 3VUZA 2FB7A 3JAME 2AK5A 1I5OB 4EMKA 2COWA 4C92D 3RMQA 4M7AF 2CSIA 1ZBJA 1X6GA 3QKJA 2DIGA 4C8QA 2B86A 4R55A 4XU2A 1BK2A 2ZZDA 1BKBA 1OYXA 3BDUA 2HQEA 1WPYA 3VU3C 4XU3A 3QWYA 4CRIA 3LYIA 4RMOA 2GFUA 2XDPA 2COYA 1QLYA 3VS1A 2M1HA 1GFDA 4MZPA 4QW2A 1Q82U 2DEQA 5GAMf 5HK3A 5HCKA 3EG3A 4FL6A 2V8IA 2JTEA 4BI8B 2DBMA 1VIEA 4KGZB 2EKOA 2YUQA 4BE1A 2M51A 3VYHB 3CXCP 1K9MR 1UHCA 1YJ9A 4M7AC 3EGDA 1KSWA 4OMOA 2DL8A 3LH0A 1QVFS 2FZGB 1LPLA 2QQAA 3FEOA 1D0XA 4Z89A 5GAOm 2CZ7B 4C0DB 4LE9A 2QI2A 2EFIA 1YCSB 2H3EB 3RKYA 4E47A 2ZPFB 1IRXA 1VQ6T 4EMGA 1U1TA 3QBYA 4IURA 3V8KA 1VQ9Q 1YHQT 4MZTA 2FZCB 1SRMA 3GPLA 3A8MB 4DOWA 2HKQB 1K8AU 5CKDA 1IGUA 3UF4A 1WQ7A 2LX9A 5CKFA 3PIPA 3OYBA 1JJ2A 1D0YA 3AT1B 3CCUT 4KT0E 2RHUA 2LCLA 3I55T 1AWXA 2DKGA 3M4GA 4Z8AA 5LJ3g 1VOMA 4HCKA 2RMOA 2FPDA 2LNVA 2BZYA 3CCST 5A0DA 2X3WD 4BI4A 1YJ9Q 1Q95G 2AZVA 2ZAEA 1SEMA 2DZCA 4JPBW 1OX9A 2VXEA 2HBWA 4C0ZA 4RTVA 4M7DA 5EG2A 3ASKA 3DB4A 5GAN5 1I4K1 2AKKA 3EH1A 2J6OA 4E7HA 2OTLT 2E6ZA 2YLCA 4HCZA 3A8HB 4OVAA 1YITA 1GL5A 1VQ5T 3OBYA 2KBTA 1SG5A 2ZGWA 4C92F 4RUGA 3J81E 4N4HA 4JLGA 1H3ZA 4E7IA 1AWWA 1JJ2S 3RR6A 1V76A 3QO3A 2RQWA 2EPDA 2ZPBB 1GRIA 1D3BA 1AT1B 3G7ZA 2LQ8A 2A3LA 2IVWA 3C95A 2AIRB 4P5NA 2HSPA 2IPOB 1RAAB 2RNAA 5GAMj 3CC7T 2X4WA 2VVKA 5J3BA 3TU4K 1K4US 4ZGJB 1X69A 2XD0A 3BE3A 3KBGA 4IUVA 3Q1JA 1TU0B 1ZUYA 3UPUA 4PK4A 1K0XA 5CKEA 1AWJA 2ROTA 5D6XA 1W2BA 1PCXA 1WJSA 4PJMA 3OBWA 4C92C 3UWNA 3UT1A 5I11A 3V7CA 1MMAA 4IIOA 4ESRA 1GFCA 2DL7A 3CD6A 5CAIA 2YUOA 2DXCA 2EQJA 4M78F 4JUVA 2IG0A 1W4SA 4FT4A 1ARKA 1JQQA 2K4YA 3URGA 3CPWP 4M75F 2BE7D 4FM4B 1VQ9T 1UGPB 2PQWA 2KXDA 3JB9J 2EQMA 2E65A 3S6WA 3OW2S 4CC4B 4HT8A 2EYXA 3OYHA 2L2PA 3C4SA 4BACA 2MIOA 1KC8C 3CCMT 3GNGA 1HXDA 4XTZA 2L3SA 1VQNA 1JEGA 1N9SA 1YITQ 1YJWA 4M7AE 3RBBB 3MEUA 3OSVA 2F5TX 3M56A 1X27A 4RG2A 1UJ0A 3VS3A 5FWCA 4J9CA 2ABLA 3DLLA 3EGXB 4D8DA 2K57A 3OMCA 5FLXE 4M78C 2QEXA 1RI0A 3OYMA 8ATCB 4FYWB 3TSWA 1M2OA 4FSSA 4M75C 2VV5A 2MPXC 5IN1A 4X34A 4BDYA 2KSSA 5GAOr 2LQNA 2JUFA 2DLPA 5GANd 1ZSZC 2VYTA 2EGAA 1QKXA 1ZX6A 1YFNA 3LLRA 1JBMA 2FG0A 2RJCA 2VB6A 1NEGA 5D6WA 2CP5A 1PNJA 3LH5A 4M4ZA 5GMKe 1R0BG 1D1BA 4J9GA 2EQKA 4A4FA 1Q81U 2YWWA 1NJIU 3L2VA 5DLOA 1TSFA 2AZSA 5C6SA 2K2VA 1QMCA 1MNDA 4L59A 2VGNA 1WX6A 3CD6Q 2VUBA 2JM8A 3QYGB 1OI1A 2LRQA 2I0NA 1Q86R 5FRNA 3D7SB 2DTOA 1WHGA 1M4ZA 2QTXA 3EG9A 2V8JA 4JDSA 1Q81R 2LDMA 2XICA 3VUBA 1NJIR 3BY7A 5KYUA 1WIEA 4ELYC 1M3BA 3VRZA 1SHGA 1Q7YU 1VQ7T 3MHXA 2LX7A 1U1SA 3M0TA 3V7RA 4JS5A 4PKCC 4M77D 4OB3B 2VASA 5I22A 1M1FA 1YJWQ 1VQNQ 1G2BA 1VQLA 3BW1A 2ENMA 2YHTA 4C5HA 3OYDA 1Q7YR 5FU7C 3R6OA 4V2SA 4PJOD 2JN0A 1X01A 1WGSA 4QT7A 5LJ5d 2QEXQ 2MOXA 4M7AB 2G3RA 1K76A 2HSEB 1KJWA 4FSXA 1C6VX 3JRZA 1SKUB 2P4TA 5J39A 3G71A 3MP6A 2QG9B 1Q82C 1WZOA 3VS2A 2DJZA 4BE2A 2RA2A 1R77A 1AHJB 2R5MA 1PD1A 1RACB 1RAHB 1X2KA 1VIFA 1C0MA 3HRUA 1AOJA 1Y7XA 3E9GA 1MNEA 4KUIA 1ABQA 1YI2T 1PSEA 2K7AA 2DPPB 1TTHB 3FRNA 4C92E 3MCAB 4OB2B 1YN8A 1UB4A 3CC2A 1KQSS 2KRSA 3GOXA 5KYXB 3KFVA 4OMFB 4OGEA 1UG1A 2MCNA 4HKEA 2DYBA 5HKCA 2V26A 4GLMA 4CC2A 1BIBA 3CCJA 4HCCA 2QGFB 2KK4A 1WXTA 1M1KU 2CZ6B 3ME9A 1JU5C 2MWPA 4M7DD 3QZ9B 3CCVA 2NUTB 3M55A 4XTUA 4DEXA 3QPHA 2LP5A 2RH2A 1VQLQ 1K8AC 4E7KA 1D1CA 4LDYA 3HP9A 2HKNA 5GAN6 1M5Q1 1M1KR 1WHKA 4MZMA 2RPNA 2E3HA 2JJ9A 1YJNT 3UA7A 4C8QF 2MWOA 2AT1B 4A4EA 3H6ZA 4A4HA 1M2VB 1B7TA 1NYFA 4DBRA 4M78E 3O8VA 1KFZA 1UECA 2L3RA 3G71Q 1NLPC 4LN2A 1QP2A 4FCYA 1H8KA 2YDLA 1WNLA 4RTZA 4M75E 2X51A 1UUEA 2JW4A 1UGVA 2OX7A 3NPFA 1NLOC 1QQJA 4BY6C 4L6V5 1QVGA 2FPFA 2L3QA 3DLMA 1RI9A 4E2FB 2R58A 2LTOA 1H92A 3OYLA 4OMNA 4RKUE 3EG2A 3CMET 2P84A 2RHYA 4M77F 1EZZB 4OB0B 2YUPA 4IIMA 4C8QC 4F14A 3H9NA 2L89A 3CC2Q 2HQXA 2XIDA 4RCCA 1N8RR 2O9VA 3OB9A 4ATOA 3CCJQ 5LJ3e 2DVJA 2NLUA 3M58A 1PC0A 2DAQA 3QYHB 2H8HA 3N5BB 1EX4A 4C92B 3U23A 3CCVQ 4J9FA 3GLXA 1KD1C 3LGLA 1UGSB 3CBOA 4F7UG 4D6WA 5LJ3j 2O4XB 4QQDA 3MPUB 3OYAA 2XHCA 4B9XA 3UDCA 4M77C 1D0ZA 2Y90A 4HVWA 1JJ2P 2K79A 4JZ3A 1BU1A 1RUWA 2EYQA 3META 1IREB 1XJWB 2EKHA 1RAFB 5GAOp 3HSBA 5AT1B 3A8OB 4AFZC 3PGGA 1QVFA 2HCKA 1HJDA 4JLIA 3MEAA 4GLKA 2AKLA 2LT1A 5CQYA 3EG0A 5GANh 3CCET 2LZ6B 2KY9A 1AZGB 2JZ2A 3E19A 2NUPB 4XK8E 1KIKA 2F2VA 2PZ1A 4ZN1A 3CCQA 4M78B 1BIAA 4EIKA 4PL6A 2KI7A 1B34A 1VQLT 1ACMB 2DF6A 1IO6A 4M75B 4M7DF 2RI2A 3JCMd 1K9MU 1D1AA 2DILA 1NZ9A 4BD3A 2KT1A 2XI9A 1ZSZB 2QAZA 5L23A 3QHSA 2RQTA 1EIFA 4Y92A 2ZPHB 5KE2A 2DMOA 2K6DA 1HYOA 3EGXA 3OS5A 4LUEA 1M90C 1UTIA 2Z0WA 3G71T 2DA9A 2NYSA 5KCHA 4OF1A 4M77G 4M78D 1HD3A 3QWXX 2Y4YA 4J9DA 4ELZC 3L2RA 3LW5E 3OYJA 2CP2A 2F69A 4M7DC 1I8FA 2EIFA
chains in the Genus database with same CATH topology
1VQ7Q 3CXCP 1YJWQ 1M90R 1Q86R 1VQKQ 3CC4Q 3CMEQ 1K9MR 1VQNQ 1VQPQ 3CC2Q 3OW2P 3CMAQ 1N8RR 1Q82R 1S72Q 1Q81R 3CCQQ 1KC8R 1Q7YR 2OTLQ 1W2BP 3CCJQ 1NJIR 1VQ9Q 1K73R 1K8AR 3CCLQ 1VQOQ 1VQ4Q 1YJ9Q 1YJNQ 1QVFP 1YITQ 1JJ2P 3CCSQ 3G4SQ 1VQ5Q 1YIJQ 3CCRQ 1VQLQ 3CC7Q 1KD1R 1VQ6Q 3G6EQ 1VQMQ 1QVGP 3CCUQ 1YI2Q 1KQSP 2QEXQ 1VQ8Q 2QA4Q 2OTJQ 3G71Q 3CCMQ 3CCEQ 3CCVQ 3CD6Q 1YHQQ 3I56Q 3I55Q 3CPWP 1M1KR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 Q;  3CXC P;  1YJW Q;  1M90 R;  1Q86 R;  1VQK Q;  3CC4 Q;  3CME Q;  1K9M R;  1VQN Q;  1VQP Q;  3CC2 Q;  3OW2 P;  3CMA Q;  1N8R R;  1Q82 R;  1S72 Q;  1Q81 R;  3CCQ Q;  1KC8 R;  1Q7Y R;  2OTL Q;  1W2B P;  3CCJ Q;  1NJI R;  1VQ9 Q;  1K73 R;  1K8A R;  3CCL Q;  1VQO Q;  1VQ4 Q;  1YJ9 Q;  1YJN Q;  1QVF P;  1YIT Q;  1JJ2 P;  3CCS Q;  3G4S Q;  1VQ5 Q;  1YIJ Q;  3CCR Q;  1VQL Q;  3CC7 Q;  1KD1 R;  1VQ6 Q;  3G6E Q;  1VQM Q;  1QVG P;  3CCU Q;  1YI2 Q;  1KQS P;  2QEX Q;  1VQ8 Q;  2QA4 Q;  2OTJ Q;  3G71 Q;  3CCM Q;  3CCE Q;  3CCV Q;  3CD6 Q;  1YHQ Q;  3I56 Q;  3I55 Q;  3CPW P;  1M1K R; 
#chains in the Genus database with same CATH topology
 3I35 A;  5IAY A;  4M75 D;  4F7U E;  3M59 A;  3G4S A;  2M0Y A;  5LJ5 h;  4XU1 A;  1W2B P;  2OTJ A;  4K11 A;  2HL5 C;  2NWM A;  2V1R A;  1RAB B;  4PJO G;  1VYU A;  4R0K A;  3OS0 A;  3MP1 A;  1NJI C;  3JB9 I;  3CC2 T;  1U06 A;  2ZCF B;  1WXU A;  2PTK A;  5CO7 A;  3REA B;  1BBZ A;  2C0O A;  4PJL A;  3CPF A;  3I9Q A;  1KG1 A;  5GMK h;  1X2Q A;  2RJE A;  2HDA A;  4A54 A;  2OJ2 A;  5GMK i;  2FPE A;  3CCQ Q;  1NM7 A;  1ZUU A;  2M9U A;  1OU8 A;  2JMC A;  4OMM A;  4KH0 B;  3CCV T;  2RF0 A;  1O9S A;  5GJW B;  1Y0M A;  2ZPG B;  3OY9 A;  4PFO A;  1LJO A;  2Y4X A;  1ZSG A;  3ULR B;  2RM4 A;  2JMA A;  2EYY A;  4Z02 A;  1PRM C;  3S3O A;  2QQR A;  4RG8 A;  3OYC A;  2XDB A;  2BKD N;  2A36 A;  5DLQ E;  2FL7 A;  2V8K A;  4M7A G;  3A8L B;  3BDL A;  1VQK T;  2F2W A;  1KQ2 A;  2CT3 A;  2R57 A;  4A63 B;  2C0I A;  1JO8 A;  2LT4 A;  4JRQ A;  4EMH A;  4FU6 A;  1E7O A;  1WJR A;  3ZBD A;  5DY9 A;  4ORZ A;  5GMK l;  4RTU A;  4F17 A;  2PVG B;  4J8O A;  5LJ5 f;  2L5Q A;  1IZ6 A;  2OAW A;  3EFO A;  3X28 B;  3G4S Q;  5GAM e;  3OW2 A;  2OTJ Q;  3JCM X;  2CP3 A;  4M77 E;  2EVR A;  5CK9 A;  2XKO C;  4JRK A;  2FO0 A;  1SF9 A;  4JJN K;  4NS5 A;  4DA4 A;  3VS4 A;  3JB9 D;  3VJP A;  4C5G A;  4DOV A;  3QJ6 A;  3X26 B;  1CKB A;  3RMS A;  4F7U B;  2RB6 A;  3V8L A;  1NPP A;  4XTW A;  3RES A;  2E6N A;  3QDF A;  3IQL A;  4PJO E;  4RTT A;  3WVD B;  1FYN A;  2HEQ A;  3VKI A;  2PVD B;  1OV3 A;  1BI1 A;  2CH4 A;  2J6K A;  2LJ3 A;  2JS2 A;  5CQX A;  4UC4 A;  2LC4 A;  2EWN A;  1ABO A;  1VQM A;  1OUL A;  3FLG A;  2NUT A;  1WLP B;  3V7S A;  2K5F A;  4QVC A;  2EYZ A;  1WYX A;  1Y07 A;  1LVK A;  1RAG B;  2O2O A;  2RO0 A;  4J5Y A;  3T9N A;  4BY6 B;  2EAY A;  1K0S A;  1FMV A;  3J80 E;  2JVV A;  3M0Q A;  2WSF E;  1OPK A;  1JRI A;  2DL5 A;  1G3S A;  2QDL A;  5GAO q;  2C06 A;  3PT9 A;  2RN8 A;  2KGT A;  1WI7 A;  3CXC S;  2RQU A;  5GAN 3;  4AFQ C;  2EGE A;  4J83 A;  4E6R A;  1B07 A;  3EFR A;  2GFA A;  1SRL A;  2HD0 A;  1YIJ A;  2L3P A;  2DER A;  2YXY A;  2KRM A;  2MAM A;  4M7D E;  2DZ9 A;  4ME7 A;  2FZK B;  1RAD B;  2K5L A;  3MEV A;  3L2U A;  1ZLM A;  4IUU A;  2SEM A;  4BB7 A;  4RTW A;  2JTM A;  4JRI A;  4A4K A;  4OMQ A;  1FX7 A;  4WCI A;  2K2M A;  5GAO n;  1U3O A;  2CYZ B;  1BB9 A;  4OML A;  1U8R A;  4C5E A;  3EGD B;  1A0N B;  4M77 B;  4PJN A;  1YJ9 T;  4BE0 A;  2FEI A;  1RAE B;  1TS9 A;  1X75 C;  1OOT A;  1Q86 U;  4C8Q D;  4PNO A;  4DBF A;  4C92 G;  2DYI A;  1GBQ A;  2OI3 A;  2LJ0 A;  3JCM b;  1VQM Q;  1QCN A;  3JCM h;  4C92 A;  3NGP A;  1NYG A;  2D1X A;  3RUX A;  4KUL A;  2P4R A;  4PJO B;  2BZX A;  4YTL A;  3O5Z A;  3GF5 A;  3A5Z B;  3OSS C;  3PFS A;  3G4S T;  2E70 A;  2QK0 A;  3EG1 A;  3MO8 A;  2OTJ T;  1WHL A;  3I5R A;  2A7Y A;  3LWH A;  2EGC A;  2F5K A;  2X3X D;  2KR3 A;  1H3H A;  2PU9 B;  4JRP A;  2RQV A;  1R8O B;  2QXF A;  4II1 A;  1HSQ A;  4C0D C;  4ZNX A;  5IHI A;  3EGU A;  5GMK m;  3JB9 F;  3PMT A;  3GBQ A;  1YWP A;  1E6G A;  5GAN 8;  7AT1 B;  2K3B A;  3H8Z A;  3M5A A;  4RTY A;  3G6E A;  1KQS A;  4PFZ A;  2RK2 A;  1GXI E;  1K1Z A;  4HXJ A;  4M78 G;  1YIJ Q;  4J7I A;  2XG8 D;  2NUP A;  1QVG P;  4HCB A;  3JCM c;  2K3X A;  2CSQ A;  2YUN A;  1WFW A;  4M75 G;  4HVU A;  2VGM A;  3H0H A;  4KRT A;  1TG0 A;  3RDV A;  3QSU A;  4FIB A;  2VWF A;  3QZ5 B;  1K9M C;  2QDY B;  2QTV A;  2D8J A;  1DJ7 B;  3HFO A;  2YLB A;  4ZGD B;  2FVU A;  2ATC B;  2DIQ A;  2CP0 A;  1ZSZ A;  4M7D B;  2LMJ A;  1PHT A;  4KGV B;  1WHH A;  2M16 A;  5M9O A;  4FT2 A;  5GAN g;  3A98 A;  1GCQ A;  1JXO A;  2DD4 A;  1MUZ A;  3UAT A;  1QWF A;  1YIT T;  5HK0 A;  2LNH B;  2DRK A;  1MGQ A;  1EFN A;  5IHN A;  1IXD A;  1JXM A;  2PVO B;  4ZTJ A;  2YSQ A;  4B6M A;  1XOV A;  2R5A A;  1AWO A;  3TVT A;  4FYY B;  3SWN C;  4ANJ A;  2DTH A;  2DE0 X;  2QQS A;  5FU6 C;  3JV3 A;  3M4Y A;  4C0F A;  1M1G A;  1WHM A;  4EDU A;  2K5I A;  1VQ6 A;  4IUP A;  1HK9 A;  1AVZ C;  5L8R E;  5GAN 4;  2BIV A;  2F1L A;  3OYY A;  5KYW B;  4X9D A;  1QVF P;  3E1S A;  1T3L A;  2J6F A;  2D8H A;  1YBY A;  3G6E Q;  2P0Q A;  4EPC A;  2MF2 A;  2M02 A;  1J3T A;  1V29 B;  1KHI A;  1PM3 A;  1N6A A;  4LUD A;  4AG1 C;  3CPW S;  3NMZ C;  3AHU A;  2GNC A;  3OYG A;  3CCL A;  2FRY A;  5CR2 A;  1VQM T;  1W6X A;  1VQ8 A;  1OX8 A;  3H41 A;  4DBQ A;  5FRM A;  3VS5 A;  3I55 A;  2G6F X;  3CD6 T;  1BCM A;  4JJC A;  3ZFJ A;  2LCC A;  3G1J A;  3CMA A;  3VRY A;  5FW9 A;  2I2L A;  3P8H A;  2D0N A;  1QW1 A;  5LJ5 g;  2E5Q A;  2E41 A;  4XQ3 A;  2EJF A;  3EAE A;  2JT4 A;  4ZN3 A;  3CCR A;  1TWB A;  5KE3 A;  3HL8 A;  3QUI A;  2MI6 A;  1TXQ A;  3PE0 A;  1N8R U;  2DFU A;  4LDV A;  3INZ A;  2KT8 A;  2P0P A;  2ROL A;  1VQN T;  3CC4 A;  1YJW T;  3EH2 A;  2BUD A;  2EJG A;  4EMK C;  4IUT A;  4FYX B;  2X4X A;  4RCB A;  5IXB A;  4LDW A;  4OMP A;  3C12 A;  2QQ9 A;  2OTL A;  4FW2 A;  2E64 A;  4PJJ A;  1T0H A;  2KQW A;  1FMK A;  3X24 B;  1JB0 E;  2JXB A;  1VQ5 A;  1YIJ T;  3L42 A;  3JB9 H;  2FHD A;  2QEX T;  3VV0 A;  4HVV A;  2O9S A;  2WSC E;  1CSK A;  2W10 A;  2E3I A;  1VQ6 Q;  4GY5 A;  1M8V A;  1WHJ A;  2DTI A;  1CKA A;  4C5I A;  2AHJ B;  4HT9 A;  3HHT B;  2HQH A;  3CC7 A;  1QVP A;  5GAM h;  2X9H A;  3CCL Q;  2EJ9 A;  4F7U A;  1TUG B;  2X4J A;  2EQU A;  1VQ8 Q;  2DVE A;  2QYZ A;  3EHR A;  3OYK A;  3TCJ A;  4Q5W A;  3I55 Q;  2H3J A;  2RHZ A;  2EQI A;  4Y91 A;  4PLI A;  4X9C A;  1R0C B;  3EG9 B;  3TRE A;  1OU9 A;  1VQ4 A;  3TQ7 P;  3CMA Q;  2V1Q A;  4J9B A;  2WAC A;  3DB3 A;  1PSF A;  5C0M A;  3FDR A;  3M54 A;  1ZBX A;  1GCP A;  1UGQ B;  1AD5 A;  1ZQ1 A;  3CCR Q;  1FMW A;  4TVR A;  2D9T A;  4XTY A;  3HRT A;  2KEA A;  1S72 A;  1NEB A;  1M3C A;  3J7A F;  3OS2 A;  3CC4 Q;  3JSC A;  1VQO A;  5CIU A;  2RI5 A;  4LXC A;  4C8Q G;  5J26 A;  2RJD A;  2KMT A;  2OTL Q;  1WXB A;  3CCM A;  3LWI A;  5IH2 A;  3M0U A;  1VQ5 Q;  5LJ3 d;  2L8D A;  2GCX A;  1YP5 A;  1OZ2 A;  3QG1 A;  1WJQ A;  2VKN A;  3CBP A;  4C0G A;  3VS6 A;  4QKU A;  2CDT A;  1TUC A;  3OW2 P;  2PUO B;  2PUK B;  5FRO A;  2GTO A;  4Y28 E;  1MMG A;  4NL3 A;  1Y96 B;  5GAN 2;  3PVQ A;  4R56 A;  4RTX A;  2QQB A;  3CC7 Q;  1VA7 A;  2DL3 A;  2GTJ A;  3MJX A;  2RHI A;  4AT1 B;  3A8G B;  5GJV B;  5A0L A;  2E10 A;  4M77 A;  1QKW A;  1Q82 R;  1Q86 C;  4N0A A;  4E7S A;  1ZHI A;  3RKX A;  4XTX A;  1LCK A;  1T3S A;  1Q81 C;  1VQ4 Q;  3L2Q A;  3SHW A;  4IUQ A;  1QP3 A;  2CH4 W;  5GAN f;  2DXB A;  2DXT A;  1OQK A;  2COZ A;  3PVL A;  4FW1 A;  4LD6 A;  2E5K A;  4PJO A;  3WXM B;  2CGH A;  3BFM A;  2LQK A;  2CUB A;  3CCJ T;  2DBK A;  2C0T A;  4LDU A;  3JCM V;  1S72 Q;  2A37 A;  5FU7 B;  3NTH A;  4VUB A;  1MV3 A;  5LL6 S;  4XAX B;  4CC3 A;  1QWE A;  2YRD A;  3CQT A;  3TEE A;  4QVD A;  1VQO Q;  2YRC A;  1Q7Y C;  1VQ7 A;  2GGR A;  4FYV B;  2K9G A;  1VQP A;  2XMF A;  3RER A;  5KCO A;  3CCM Q;  2DET A;  4AMC A;  1NBE B;  2F2X A;  2OAU A;  3CCL T;  1G8X A;  4WTO B;  2JS0 A;  3F70 A;  1MMD A;  5KYN A;  1H64 1;  5I2M A;  3M9Q A;  4C8Q E;  2EW3 A;  1VQ8 T;  3JCM Q;  1LNX A;  1K8A R;  3JCM g;  2KNB B;  1Z9Z A;  5EC7 A;  1K9A A;  5CCA A;  3CMA T;  4OGC A;  1IHV A;  1BCO A;  3LGF A;  5KYY B;  1YCY A;  1AZE A;  3ZEH A;  1Y57 A;  2A08 A;  4M7A A;  1M9S A;  2LVM A;  2DJQ A;  3MEW A;  3CCR T;  1PWT A;  3I5S A;  4M7D G;  4X1V A;  4BI3 A;  2SRC A;  4OB1 B;  1BI3 A;  3GNF B;  1MMN A;  2DK3 A;  3CC4 T;  3SWN B;  5FU6 B;  1PKS A;  2CZ1 B;  1UJY A;  1RAI B;  4NL2 A;  2BZ8 A;  4J9E A;  2ZPI B;  1UGR B;  1NE8 A;  2QAS A;  1KK7 A;  3M0R A;  2DXU A;  5CKB A;  1UDL A;  1XNI A;  3OYI A;  1PKT A;  4CC7 A;  5AYF A;  3H0I A;  1YI2 A;  2QA4 A;  2GQV A;  2KRO A;  1OEB A;  2RK1 A;  1YNZ A;  3CXC A;  5IHK A;  4AFS C;  3DKM A;  9ATC B;  1D09 B;  5KYX A;  4BDZ A;  1KD1 U;  1VQ7 Q;  1VQP Q;  1SHF A;  1M1K C;  2ED1 A;  5FWB A;  4CI0 C;  1W1F A;  4PLL A;  2DEU A;  4DEY A;  5KYW A;  4LNP A;  2RHX A;  4MML A;  5CKH A;  4Z88 A;  1KD1 R;  1RLP C;  5GAN e;  1K73 U;  1XQH A;  1KQS P;  1VYT A;  3NTI A;  3NFC A;  2J7I A;  3M0S A;  3FIF A;  1M3A A;  1VQ4 T;  1YJN A;  1S1N A;  2KE9 A;  5GAN j;  4WF2 A;  4EMK B;  1K73 R;  3FB9 A;  4J6X A;  4DQ2 A;  4O6J A;  2KXC A;  1N27 A;  2KYM A;  1M2V A;  3R6N A;  4C8Q B;  1RLQ C;  5HY6 A;  2HMA A;  2DM1 A;  4OP0 A;  2J06 A;  1S72 T;  1G83 A;  2RD1 A;  5GAM d;  2A0F B;  3CCQ T;  2CUD A;  1MV0 B;  3QII A;  1B34 B;  1VQO T;  4L5G A;  3VS0 A;  1SPK A;  2BE9 B;  1B3Q A;  3RNJ A;  4A53 A;  2BTT A;  2GBQ A;  4GBQ A;  2KVQ G;  3PNW C;  4J9H A;  2RQR A;  2KAF A;  5ECA A;  1N8R C;  2M0O A;  2HBP A;  3PIO A;  3SB2 A;  4KH1 B;  1C1A A;  3CME A;  1TH7 A;  3NTK A;  1YI2 Q;  2QA4 Q;  2LCS A;  1M8M A;  2EBP A;  3GP8 A;  3S3M A;  2CZ0 B;  4N4I A;  2DD5 A;  1RL2 A;  2FYK A;  2HL3 A;  1M90 U;  2J05 A;  1W2B S;  8AT1 B;  2D6F A;  3OYE A;  4ZGE B;  1W70 A;  1NG2 A;  5LJ5 e;  2EYW A;  1U5S A;  2PNI A;  3KXT A;  5GAN 7;  3OMG A;  2JOY A;  2A28 A;  2L0A A;  2X35 A;  4J6Y A;  1M90 R;  5LJ3 h;  3VS7 A;  1OZ3 A;  4QQG A;  5LJ5 j;  2O4X A;  1GCQ C;  4XTV A;  5IXF A;  2YRV A;  3E2U A;  2MYS A;  1N5Z A;  1G5V A;  1Z9Q A;  3I56 A;  1BI2 A;  1YJN Q;  1IHW A;  4J7F A;  2GQI A;  1X6B A;  1AEY A;  2RJF A;  3WVE B;  1M27 C;  4LD9 K;  1ZA1 B;  5GMK j;  3CBM A;  1BI0 A;  4KUD K;  2JTF A;  4QVZ A;  5CVI A;  2VXF A;  3CCE A;  2QGG A;  1FXX A;  2DNU A;  3EFS A;  4HA8 A;  1GBR A;  2ZPE B;  1VQP T;  2O01 E;  2MK5 A;  4QQ6 A;  3REB B;  4ZTF A;  3SFM A;  2LJ1 A;  4JJD A;  1Y71 A;  1I0C A;  3OYF A;  3QDR B;  1ZA2 B;  5GAM g;  3CME Q;  3FJ5 A;  4M78 A;  2DRM A;  3RKW A;  4DBH A;  3A1P A;  1FWZ A;  3X25 B;  3OA6 A;  4D8K A;  1F1B B;  3FJP A;  3SDZ A;  4M75 A;  4F04 B;  3CPW A;  2E1H A;  1WA7 A;  3JCM J;  1ZUK A;  5I21 A;  1TUD A;  1T0J A;  1UFF A;  2ESW A;  3X20 B;  3OS1 A;  3P8D A;  4MDX A;  1VYV A;  1P92 A;  3JCM f;  3RIR A;  5LJ3 f;  3GIB A;  3ZL7 C;  1Y96 A;  3EFO B;  3HTR A;  2CT4 A;  1G3W A;  2JM9 A;  4F16 A;  5A0G A;  2JNG A;  1X43 A;  1D3B B;  3I56 Q;  4F7U F;  3PTA A;  4J6W A;  1TOV A;  2DL4 A;  4IKF A;  1UE9 A;  2RI3 A;  3MP8 A;  3TSZ A;  3LX7 A;  2QA4 T;  2YT6 A;  2K3Y A;  1YHQ A;  3L2Z A;  4M7A D;  1KHC A;  2CS7 A;  3SD4 A;  3SEM A;  3CCE Q;  3V8J A;  2O31 A;  3MKD A;  3H0F A;  5IT9 E;  3KUF A;  4PFP A;  1YWO A;  3ER0 A;  1BYM A;  3CCU A;  2E12 A;  1NPR A;  3M57 A;  1SSF A;  1WQW A;  3HKS A;  3NHN A;  3CEY A;  5DM7 R;  3OQ5 A;  3JB9 G;  5GAO l;  4BUG A;  5KH6 A;  3VYG A;  3CCS A;  3E9F A;  3JCM P;  2O88 A;  3JCM W;  2ECZ A;  1KC8 U;  2DX1 A;  1VQK A;  1G3T A;  1V1C A;  1UHF A;  2HAX A;  2KDS A;  2LQW A;  4XU0 A;  1M30 A;  5KYY A;  4JZ4 A;  3THK A;  1I5L A;  5A2Q E;  1SSH A;  4NOY A;  4E7J A;  1O75 A;  1KC8 R;  4A4G A;  3QXE B;  2VC8 A;  4JS4 A;  1IGQ A;  1QCF A;  3C0C A;  1OPL A;  3OYN A;  4J9I A;  2GF7 A;  4N4G A;  2D0Q B;  2CP6 A;  3PMI A;  1WDX A;  2CKK A;  3SWN A;  4LDX A;  1YHQ Q;  2XDD A;  1I07 A;  2CRE A;  2NUZ A;  4E7Z A;  5D6Y A;  5I2S A;  3JCM e;  1QCO A;  1LOJ A;  3HFN A;  1IB8 A;  2FRW A;  2XK0 A;  1UEB A;  3M53 A;  1E6H A;  2HZY A;  4MDW A;  4AG2 C;  4PJO F;  3C94 A;  1KQ1 A;  1X6O A;  3CCU Q;  1PD0 A;  3M0P A;  1PG5 B;  3HRS A;  4KBM B;  1G3Y A;  4O5V A;  3L1A A;  2WSE E;  1I1J A;  1VUB A;  4E7L A;  2P0K A;  2CP7 A;  3QJY A;  2E4H A;  2KYB A;  1N9R A;  4N0A C;  5KYU B;  3I56 T;  3EHQ A;  4JJB A;  2IIM A;  3P8B B;  1XTD A;  1K73 C;  3CCS Q;  1PRL C;  6AT1 B;  2MMP A;  1QVG S;  2B8A A;  3S3N A;  3FC3 A;  2DO3 A;  2KRN A;  3HPW A;  4MMK A;  2X4Y A;  4B9W A;  2XU8 A;  2ED0 A;  2W0Z A;  4KGX B;  5D7U A;  1VQ9 A;  1VQK Q;  4AFU C;  3L2W A;  4PJO C;  1I81 A;  1MHN A;  3UA6 A;  2HNI A;  3G6E T;  3VUZ A;  2FB7 A;  3JAM E;  2AK5 A;  1I5O B;  4EMK A;  2COW A;  4C92 D;  3RMQ A;  4M7A F;  2CSI A;  1ZBJ A;  1X6G A;  3QKJ A;  2DIG A;  4C8Q A;  2B86 A;  4R55 A;  4XU2 A;  1BK2 A;  2ZZD A;  1BKB A;  1OYX A;  3BDU A;  2HQE A;  1WPY A;  3VU3 C;  4XU3 A;  3QWY A;  4CRI A;  3LYI A;  4RMO A;  2GFU A;  2XDP A;  2COY A;  1QLY A;  3VS1 A;  2M1H A;  1GFD A;  4MZP A;  4QW2 A;  1Q82 U;  2DEQ A;  5GAM f;  5HK3 A;  5HCK A;  3EG3 A;  4FL6 A;  2V8I A;  2JTE A;  4BI8 B;  2DBM A;  1VIE A;  4KGZ B;  2EKO A;  2YUQ A;  4BE1 A;  2M51 A;  3VYH B;  3CXC P;  1K9M R;  1UHC A;  1YJ9 A;  4M7A C;  3EGD A;  1KSW A;  4OMO A;  2DL8 A;  3LH0 A;  1QVF S;  2FZG B;  1LPL A;  2QQA A;  3FEO A;  1D0X A;  4Z89 A;  5GAO m;  2CZ7 B;  4C0D B;  4LE9 A;  2QI2 A;  2EFI A;  1YCS B;  2H3E B;  3RKY A;  4E47 A;  2ZPF B;  1IRX A;  1VQ6 T;  4EMG A;  1U1T A;  3QBY A;  4IUR A;  3V8K A;  1VQ9 Q;  1YHQ T;  4MZT A;  2FZC B;  1SRM A;  3GPL A;  3A8M B;  4DOW A;  2HKQ B;  1K8A U;  5CKD A;  1IGU A;  3UF4 A;  1WQ7 A;  2LX9 A;  5CKF A;  3PIP A;  3OYB A;  1JJ2 A;  1D0Y A;  3AT1 B;  3CCU T;  4KT0 E;  2RHU A;  2LCL A;  3I55 T;  1AWX A;  2DKG A;  3M4G A;  4Z8A A;  5LJ3 g;  1VOM A;  4HCK A;  2RMO A;  2FPD A;  2LNV A;  2BZY A;  3CCS T;  5A0D A;  2X3W D;  4BI4 A;  1YJ9 Q;  1Q95 G;  2AZV A;  2ZAE A;  1SEM A;  2DZC A;  4JPB W;  1OX9 A;  2VXE A;  2HBW A;  4C0Z A;  4RTV A;  4M7D A;  5EG2 A;  3ASK A;  3DB4 A;  5GAN 5;  1I4K 1;  2AKK A;  3EH1 A;  2J6O A;  4E7H A;  2OTL T;  2E6Z A;  2YLC A;  4HCZ A;  3A8H B;  4OVA A;  1YIT A;  1GL5 A;  1VQ5 T;  3OBY A;  2KBT A;  1SG5 A;  2ZGW A;  4C92 F;  4RUG A;  3J81 E;  4N4H A;  4JLG A;  1H3Z A;  4E7I A;  1AWW A;  1JJ2 S;  3RR6 A;  1V76 A;  3QO3 A;  2RQW A;  2EPD A;  2ZPB B;  1GRI A;  1D3B A;  1AT1 B;  3G7Z A;  2LQ8 A;  2A3L A;  2IVW A;  3C95 A;  2AIR B;  4P5N A;  2HSP A;  2IPO B;  1RAA B;  2RNA A;  5GAM j;  3CC7 T;  2X4W A;  2VVK A;  5J3B A;  3TU4 K;  1K4U S;  4ZGJ B;  1X69 A;  2XD0 A;  3BE3 A;  3KBG A;  4IUV A;  3Q1J A;  1TU0 B;  1ZUY A;  3UPU A;  4PK4 A;  1K0X A;  5CKE A;  1AWJ A;  2ROT A;  5D6X A;  1W2B A;  1PCX A;  1WJS A;  4PJM A;  3OBW A;  4C92 C;  3UWN A;  3UT1 A;  5I11 A;  3V7C A;  1MMA A;  4IIO A;  4ESR A;  1GFC A;  2DL7 A;  3CD6 A;  5CAI A;  2YUO A;  2DXC A;  2EQJ A;  4M78 F;  4JUV A;  2IG0 A;  1W4S A;  4FT4 A;  1ARK A;  1JQQ A;  2K4Y A;  3URG A;  3CPW P;  4M75 F;  2BE7 D;  4FM4 B;  1VQ9 T;  1UGP B;  2PQW A;  2KXD A;  3JB9 J;  2EQM A;  2E65 A;  3S6W A;  3OW2 S;  4CC4 B;  4HT8 A;  2EYX A;  3OYH A;  2L2P A;  3C4S A;  4BAC A;  2MIO A;  1KC8 C;  3CCM T;  3GNG A;  1HXD A;  4XTZ A;  2L3S A;  1VQN A;  1JEG A;  1N9S A;  1YIT Q;  1YJW A;  4M7A E;  3RBB B;  3MEU A;  3OSV A;  2F5T X;  3M56 A;  1X27 A;  4RG2 A;  1UJ0 A;  3VS3 A;  5FWC A;  4J9C A;  2ABL A;  3DLL A;  3EGX B;  4D8D A;  2K57 A;  3OMC A;  5FLX E;  4M78 C;  2QEX A;  1RI0 A;  3OYM A;  8ATC B;  4FYW B;  3TSW A;  1M2O A;  4FSS A;  4M75 C;  2VV5 A;  2MPX C;  5IN1 A;  4X34 A;  4BDY A;  2KSS A;  5GAO r;  2LQN A;  2JUF A;  2DLP A;  5GAN d;  1ZSZ C;  2VYT A;  2EGA A;  1QKX A;  1ZX6 A;  1YFN A;  3LLR A;  1JBM A;  2FG0 A;  2RJC A;  2VB6 A;  1NEG A;  5D6W A;  2CP5 A;  1PNJ A;  3LH5 A;  4M4Z A;  5GMK e;  1R0B G;  1D1B A;  4J9G A;  2EQK A;  4A4F A;  1Q81 U;  2YWW A;  1NJI U;  3L2V A;  5DLO A;  1TSF A;  2AZS A;  5C6S A;  2K2V A;  1QMC A;  1MND A;  4L59 A;  2VGN A;  1WX6 A;  3CD6 Q;  2VUB A;  2JM8 A;  3QYG B;  1OI1 A;  2LRQ A;  2I0N A;  1Q86 R;  5FRN A;  3D7S B;  2DTO A;  1WHG A;  1M4Z A;  2QTX A;  3EG9 A;  2V8J A;  4JDS A;  1Q81 R;  2LDM A;  2XIC A;  3VUB A;  1NJI R;  3BY7 A;  5KYU A;  1WIE A;  4ELY C;  1M3B A;  3VRZ A;  1SHG A;  1Q7Y U;  1VQ7 T;  3MHX A;  2LX7 A;  1U1S A;  3M0T A;  3V7R A;  4JS5 A;  4PKC C;  4M77 D;  4OB3 B;  2VAS A;  5I22 A;  1M1F A;  1YJW Q;  1VQN Q;  1G2B A;  1VQL A;  3BW1 A;  2ENM A;  2YHT A;  4C5H A;  3OYD A;  1Q7Y R;  5FU7 C;  3R6O A;  4V2S A;  4PJO D;  2JN0 A;  1X01 A;  1WGS A;  4QT7 A;  5LJ5 d;  2QEX Q;  2MOX A;  4M7A B;  2G3R A;  1K76 A;  2HSE B;  1KJW A;  4FSX A;  1C6V X;  3JRZ A;  1SKU B;  2P4T A;  5J39 A;  3G71 A;  3MP6 A;  2QG9 B;  1Q82 C;  1WZO A;  3VS2 A;  2DJZ A;  4BE2 A;  2RA2 A;  1R77 A;  1AHJ B;  2R5M A;  1PD1 A;  1RAC B;  1RAH B;  1X2K A;  1VIF A;  1C0M A;  3HRU A;  1AOJ A;  1Y7X A;  3E9G A;  1MNE A;  4KUI A;  1ABQ A;  1YI2 T;  1PSE A;  2K7A A;  2DPP B;  1TTH B;  3FRN A;  4C92 E;  3MCA B;  4OB2 B;  1YN8 A;  1UB4 A;  3CC2 A;  1KQS S;  2KRS A;  3GOX A;  5KYX B;  3KFV A;  4OMF B;  4OGE A;  1UG1 A;  2MCN A;  4HKE A;  2DYB A;  5HKC A;  2V26 A;  4GLM A;  4CC2 A;  1BIB A;  3CCJ A;  4HCC A;  2QGF B;  2KK4 A;  1WXT A;  1M1K U;  2CZ6 B;  3ME9 A;  1JU5 C;  2MWP A;  4M7D D;  3QZ9 B;  3CCV A;  2NUT B;  3M55 A;  4XTU A;  4DEX A;  3QPH A;  2LP5 A;  2RH2 A;  1VQL Q;  1K8A C;  4E7K A;  1D1C A;  4LDY A;  3HP9 A;  2HKN A;  5GAN 6;  1M5Q 1;  1M1K R;  1WHK A;  4MZM A;  2RPN A;  2E3H A;  2JJ9 A;  1YJN T;  3UA7 A;  4C8Q F;  2MWO A;  2AT1 B;  4A4E A;  3H6Z A;  4A4H A;  1M2V B;  1B7T A;  1NYF A;  4DBR A;  4M78 E;  3O8V A;  1KFZ A;  1UEC A;  2L3R A;  3G71 Q;  1NLP C;  4LN2 A;  1QP2 A;  4FCY A;  1H8K A;  2YDL A;  1WNL A;  4RTZ A;  4M75 E;  2X51 A;  1UUE A;  2JW4 A;  1UGV A;  2OX7 A;  3NPF A;  1NLO C;  1QQJ A;  4BY6 C;  4L6V 5;  1QVG A;  2FPF A;  2L3Q A;  3DLM A;  1RI9 A;  4E2F B;  2R58 A;  2LTO A;  1H92 A;  3OYL A;  4OMN A;  4RKU E;  3EG2 A;  3CME T;  2P84 A;  2RHY A;  4M77 F;  1EZZ B;  4OB0 B;  2YUP A;  4IIM A;  4C8Q C;  4F14 A;  3H9N A;  2L89 A;  3CC2 Q;  2HQX A;  2XID A;  4RCC A;  1N8R R;  2O9V A;  3OB9 A;  4ATO A;  3CCJ Q;  5LJ3 e;  2DVJ A;  2NLU A;  3M58 A;  1PC0 A;  2DAQ A;  3QYH B;  2H8H A;  3N5B B;  1EX4 A;  4C92 B;  3U23 A;  3CCV Q;  4J9F A;  3GLX A;  1KD1 C;  3LGL A;  1UGS B;  3CBO A;  4F7U G;  4D6W A;  5LJ3 j;  2O4X B;  4QQD A;  3MPU B;  3OYA A;  2XHC A;  4B9X A;  3UDC A;  4M77 C;  1D0Z A;  2Y90 A;  4HVW A;  1JJ2 P;  2K79 A;  4JZ3 A;  1BU1 A;  1RUW A;  2EYQ A;  3MET A;  1IRE B;  1XJW B;  2EKH A;  1RAF B;  5GAO p;  3HSB A;  5AT1 B;  3A8O B;  4AFZ C;  3PGG A;  1QVF A;  2HCK A;  1HJD A;  4JLI A;  3MEA A;  4GLK A;  2AKL A;  2LT1 A;  5CQY A;  3EG0 A;  5GAN h;  3CCE T;  2LZ6 B;  2KY9 A;  1AZG B;  2JZ2 A;  3E19 A;  2NUP B;  4XK8 E;  1KIK A;  2F2V A;  2PZ1 A;  4ZN1 A;  3CCQ A;  4M78 B;  1BIA A;  4EIK A;  4PL6 A;  2KI7 A;  1B34 A;  1VQL T;  1ACM B;  2DF6 A;  1IO6 A;  4M75 B;  4M7D F;  2RI2 A;  3JCM d;  1K9M U;  1D1A A;  2DIL A;  1NZ9 A;  4BD3 A;  2KT1 A;  2XI9 A;  1ZSZ B;  2QAZ A;  5L23 A;  3QHS A;  2RQT A;  1EIF A;  4Y92 A;  2ZPH B;  5KE2 A;  2DMO A;  2K6D A;  1HYO A;  3EGX A;  3OS5 A;  4LUE A;  1M90 C;  1UTI A;  2Z0W A;  3G71 T;  2DA9 A;  2NYS A;  5KCH A;  4OF1 A;  4M77 G;  4M78 D;  1HD3 A;  3QWX X;  2Y4Y A;  4J9D A;  4ELZ C;  3L2R A;  3LW5 E;  3OYJ A;  2CP2 A;  2F69 A;  4M7D C;  1I8F A;  2EIF A; 
#chains in the Genus database with same CATH homology
 1VQ7 Q;  3CXC P;  1YJW Q;  1M90 R;  1Q86 R;  1VQK Q;  3CC4 Q;  3CME Q;  1K9M R;  1VQN Q;  1VQP Q;  3CC2 Q;  3OW2 P;  3CMA Q;  1N8R R;  1Q82 R;  1S72 Q;  1Q81 R;  3CCQ Q;  1KC8 R;  1Q7Y R;  2OTL Q;  1W2B P;  3CCJ Q;  1NJI R;  1VQ9 Q;  1K73 R;  1K8A R;  3CCL Q;  1VQO Q;  1VQ4 Q;  1YJ9 Q;  1YJN Q;  1QVF P;  1YIT Q;  1JJ2 P;  3CCS Q;  3G4S Q;  1VQ5 Q;  1YIJ Q;  3CCR Q;  1VQL Q;  3CC7 Q;  1KD1 R;  1VQ6 Q;  3G6E Q;  1VQM Q;  1QVG P;  3CCU Q;  1YI2 Q;  1KQS P;  2QEX Q;  1VQ8 Q;  2QA4 Q;  2OTJ Q;  3G71 Q;  3CCM Q;  3CCE Q;  3CCV Q;  3CD6 Q;  1YHQ Q;  3I56 Q;  3I55 Q;  3CPW P;  1M1K R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...