1WXBA

Solution structure of the sh3 domain from human epidermal growth factor receptor pathway substrate 8-like protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
68
Chain Sequence
GSSGSSGKYVKILYDFTARNANELSVLKDEVLEVLEDGRQWWKLRSRSGQAGYVPCNILGEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Epidermal growth factor receptor pathway substrate 8-like pr
publication title Solution structure of the SH3 domain from human epidermal growth factor receptor pathway substrate 8-like protein
rcsb
source organism Homo sapiens
total genus 5
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wxbA00
2PZ1A 2DX1A 2EYXA 3C0CA 2GBQA 4J9BA 2GTJA 1HD3A 1AD5A 2JW4A 2YUNA 1BBZA 5L23A 1YNZA 4AFSC 1K9AA 2KROA 2RQWA 1GCQA 2J6OA 1ABOA 2DRKA 2RPNA 2KNBB 2O88A 2HEQA 2DYBA 3M0UA 2J6KA 2JMCA 2BTTA 1ZUUA 2OAWA 2RNAA 2L3SA 2RQRA 2RQVA 2PTKA 1UECA 1BB9A 4LN2A 5IXFA 2YSQA 1VA7A 4J9CA 2W10A 4Z89A 2F2XA 2DE0X 1GFCA 3VS5A 1U5SA 2LQWA 2EBPA 1Z9ZA 2DL4A 1M3AA 1S1NA 4AG2C 4GBQA 3VS2A 2KT8A 3M0QA 2EPDA 3M0PA 1WLPB 1UTIA 1YWPA 2LMJA 2I0NA 1UDLA 3QWYA 3PE0A 1ZX6A 3EG3A 2K79A 4RTUA 1UE9A 3EHQA 1SRMA 2F2VA 4JZ4A 4RTYA 1M3BA 2EYZA 1AOJA 2FRWA 1NLPC 3QWXX 1BK2A 4HVVA 3EG0A 5I11A 3M0RA 1VYUA 1UHFA 1WA7A 2O9SA 4KRTA 4R0KA 4JPBW 4A63B 1RLQC 1K76A 4WCIA 1SHGA 1AZGB 1NG2A 2V1QA 2OI3A 1PKTA 2CSQA 3EHRA 1W70A 1SPKA 1GBRA 1X2QA 2KXCA 2ED0A 2EKHA 1X2KA 3VRYA 3ZL7C 1ZUYA 2C0TA 2KRNA 2SRCA 1QKWA 1QLYA 1B3QA 2JTEA 2O2OA 1ARKA 2GNCA 1E7OA 2RN8A 3I5RA 4OMPA 2DBMA 2DVJA 2LP5A 4OMLA 3A98A 4J9EA 1W1FA 4JJDA 2EVRA 2L0AA 4ORZA 1E6GA 2LZ6B 5GJVB 1E6HA 2CDTA 1JEGA 2K3BA 1WX6A 3I5SA 1JU5C 4RTTA 1VYTA 2XMFA 2VKNA 3SEMA 4RUGA 3H41A 1WFWA 2J7IA 1AEYA 4IIOA 4X1VA 2LX7A 2V1RA 1YN8A 2K9GA 1TUDA 2FPDA 2EGEA 1GFDA 2FRYA 4RTWA 4OMOA 2C0IA 1AZEA 1K1ZA 1QKXA 2DBKA 1GBQA 2HBWA 2DL5A 3R6NA 2DMOA 1Z9QA 2BZ8A 1N5ZA 2DNUA 3H0FA 1I07A 2B86A 1GL5A 3NPFA 2LJ3A 2RQTA 2D0NA 2ECZA 1ABQA 1WI7A 5IHKA 2A08A 2KR3A 2LJ1A 3TVTA 2DF6A 2EGAA 1PHTA 1T3LA 1V1CA 4RTXA 5EC7A 2D1XA 3RNJA 4DEYA 1NLOC 2DL8A 2L2PA 2YT6A 2ROTA 2X3WD 2X3XD 3EGUA 3SHWA 2KRSA 5IHIA 2HCKA 1GRIA 2KEAA 2GGRA 2YUPA 2A37A 2VVKA 4AFZC 4QT7A 2CSIA 2VWFA 1JQQA 2ABLA 2CUDA 1H92A 4ZNXA 2JT4A 1TG0A 3THKA 2DJQA 2AZVA 2RF0A 5I22A 2J06A 1KIKA 2DRMA 1KFZA 2M0YA 2KYMA 1AWXA 1M30A 1H8KA 4HCKA 2KGTA 2O31A 1OV3A 1QCFA 1YWOA 1VYVA 3U23A 1TUCA 4CC4B 1FYNA 3UA6A 1WYXA 1PWTA 1IO6A 1Y57A 2DLPA 1A0NB 1WIEA 2ED1A 4J9DA 4F14A 4RTVA 2P4RA 3LH5A 1RI9A 3GBQA 1AWOA 1CKBA 1OEBA 3RBBB 4CC7A 2CH4W 1PKSA 1ZBJA 1LCKA 3EG2A 3ULRB 4D8KA 2CT3A 1UFFA 1M8MA 2D8HA 2E5KA 4JZ3A 2L3QA 3JV3A 1UJ0A 1PRLC 1OOTA 2CT4A 2O9VA 1QWEA 2IIMA 2BZYA 1QWFA 2MOXA 4CC2A 3O5ZA 1K4US 3H0IA 1X43A 4EIKA 1KSWA 2KXDA 3IQLA 1PRMC 2KRMA 2MIOA 1RUWA 2D8JA 2G6FX 2J6FA 1K0XA 3UA7A 3UATA 4AFUC 3NHNA 1U3OA 1YP5A 4E6RA 1SRLA 2A36A 2F2WA 1SHFA 2YDLA 2L3PA 1CSKA 2AKLA 3VRZA 3VS4A 5FW9A 1OPLA 2GQIA 1I1JA 1FMKA 2BZXA 2AZSA 2W0ZA 1WDXA 1ZLMA 1X69A 1BU1A 2EYWA 4ESRA 2KYBA 1NEGA 4RTZA 3VS3A 1NM7A 2OJ2A 2DILA 2JXBA 1GCQC 4F16A 1AVZC 4AFQC 2JM9A 4OMQA 5IXBA 2FPFA 4OMMA 4Z88A 4J9IA 3NGPA 2FPEA 3I9QA 2GTOA 3VS6A 2YUOA 1H3HA 3M0SA 2ROLA 3EG1A 4F17A 1G2BA 2EW3A 2NWMA 3KFVA 4GLMA 2KBTA 2SEMA 4IIMA 1AWJA 2J05A 2CREA 3I35A 2C0OA 5HCKA 2CUBA 1HSQA 1OPKA 2JS2A 4Y92A 1UGVA 1RLPC 2DM1A 5IHNA 1G83A 2FEIA 5ECAA 4JJCA 1M3CA 1UUEA 5FWCA 1X6BA 1T0HA 1NYGA 4LUEA 2LJ0A 2PNIA 1HJDA 1PNJA 1WXBA 2HSPA 2YUQA 2AK5A 5GJWB 1JXOA 2EYYA 3M0TA 4Z8AA 3VS7A 2K7AA 1GCPA 1JXMA 2RMOA 3TSZA 3TSWA 1CKAA 1KJWA 3PVLA 1X6GA 1YCSB 1NYFA 1SEMA 2FO0A 1Y0MA 4HXJA 2K6DA 4OMNA 2JMAA 2NUZA 2QDLA 2RQUA 2A28A 2M51A 4J9GA 1M27C 1UJYA 1U06A 3VS0A 4D8DA 1T0JA 1EFNA 4J9HA 1MV3A 2MCNA 1J3TA 4AG1C 1SSHA 1NEBA 2ESWA 2EGCA 4LE9A 2EQIA 5IH2A 2LQNA 1X27A 2JS0A 1WXTA 1T3SA 3PVQA 1MUZA 3REBB 4M4ZA 3NMZC 2KE9A 3CQTA 4JJBA 1K0SA 1WXUA 2LCSA 1JO8A 1UG1A 4HVWA 2DA9A 1ZUKA 4K11A 4HVUA 1UHCA 3UF4A 4LNPA 4J9FA 1W6XA 2HDAA 4LUDA 4DEXA 1AWWA 2K2MA 3H0HA 5FWBA 2JM8A 2FG0A 2H8HA 1I0CA 1ZSGA 2DL7A 2CH4A 3REAB 1XOVA 2LNHB 3VS1A 2ENMA 4CC3A 3FJ5A 2DL3A 1MV0B 1B07A 2AKKA 4FSSA 2KT1A
chains in the Genus database with same CATH superfamily
2MWPA 3M59A 3C0CA 3JRZA 3V7RA 1BCOA 3GPLA 4J9BA 2GTJA 3CCST 2PVOB 1AD5A 4QVDA 2DYIA 3SWNC 4M78F 1AT1B 4BY6B 4C5GA 1SKUB 1NE8A 1GCQA 3LWIA 1PCXA 1YFNA 2KNBB 2HEQA 2LDMA 3M0UA 4GLKA 4M7DE 2FZCB 2GCXA 2OAWA 4M77E 5IN1A 2EIFA 4F7UG 3A1PA 5GMKe 1VQPQ 1D09B 3RESA 2YSQA 4J9CA 3VUZA 3OYGA 2CZ6B 1IHVA 4MZTA 1JJ2A 1M90R 5GANg 3M4YA 4RG8A 1M3AA 4AG2C 4F7UA 3LGFA 3VS2A 1KQ1A 4FYYB 3M0QA 2RA2A 4M75F 4LDVA 4RTUA 1QVFP 5CKFA 1PC0A 3I55Q 1YIJT 1G5VA 4JZ4A 4RTYA 1M1GA 1M3BA 2HNIA 4L59A 1AOJA 2QQSA 4KGVB 1I4K1 3NTKA 3H6ZA 4C8QF 1BK2A 1ZSZB 3EG0A 3TREA 5I11A 5DLQE 3CCQQ 1OX8A 1U1SA 2CYZB 3TU4K 2RD1A 1K9MU 3G1JA 1NG2A 4E7KA 1QQJA 5KYWA 1BYMA 1PKTA 4M7DC 3LW5E 3EHRA 1OU8A 1SPKA 5GAOn 1YJ9Q 2ED0A 1GXIE 3JCMe 1VQ7A 4J6XA 2KRNA 2SRCA 4C92B 2O2OA 1C6VX 5DLOA 3P8DA 2CS7A 5EG2A 1NJIU 1JJ2S 5KYXB 4E7IA 1W1FA 2EVRA 1JB0E 5GJVB 2DXUA 4Y28E 4JRIA 1JEGA 3OMGA 3CCVT 4ANJA 3I5SA 1N8RU 4RTTA 2JVVA 4PLIA 3CMET 1AEYA 4IIOA 4X1VA 5GANh 1VQ8T 3DB4A 2IVWA 2K9GA 2VV5A 1TUDA 1GFDA 2FRYA 2RI2A 2C0IA 1OULA 3UPUA 2JUFA 9ATCB 1GBQA 2HBWA 3QUIA 2BE7D 2DMOA 4BY6C 3PNWC 4FYVB 2DNUA 3H0FA 1VQNT 3NPFA 2RQTA 3JAME 3OY9A 3MPUB 4R55A 1XJWB 8ATCB 1KHIA 2QEXA 1PHTA 3CCLT 1PM3A 2RHZA 2RHYA 2DZ9A 1VQ9A 1NLOC 2L2PA 2YT6A 2ROTA 3SHWA 2KRSA 4BDZA 5IHIA 3CC7Q 1LJOA 5GAMe 2EQMA 2GGRA 2HBPA 2YUPA 4FIBA 3JB9D 1IZ6A 3J7AF 2QGFB 2VWFA 4E2FB 2YRVA 3JCMQ 3X20B 1RAAB 5J26A 3CD6A 1Q86C 5KE2A 2F69A 3EFSA 2J06A 4A4GA 1KIKA 4BE1A 5HY6A 1OYXA 1K8AC 5CCAA 3G71T 1VQKQ 1FX7A 2XIDA 1H8KA 2K3YA 2YRCA 1VQ5T 2EYQA 1YWOA 3OYCA 2RJCA 4RMOA 3NTHA 4Y91A 4A4EA 4BE0A 1IO6A 3LGLA 3OYAA 2VUBA 3X28B 1ZSZC 1KD1U 3EG9B 2G3RA 1RI9A 3PFSA 1AWOA 1OEBA 3HRSA 4CC7A 2CH4W 3EG2A 3JB9G 3OA6A 5CKHA 2D6FA 2E5KA 4JZ3A 2QYZA 2ZAEA 3FC3A 1HYOA 1UJ0A 1OOTA 2O9VA 1QWEA 3SB2A 2CZ7B 2B8AA 1NPPA 3HTRA 1K4US 2FZGB 2CP3A 4EIKA 4IKFA 2DEUA 4C92C 4HT8A 3QZ9B 3DKMA 3JSCA 2J6FA 1VQOT 1I5LA 2OTJA 4C92A 2HD0A 1KC8U 1UB4A 4E6RA 5GAN7 4AT1B 4OB3B 2FVUA 3D7SB 1R0BG 2YDLA 2AKLA 5KYXA 1NJIC 2GQIA 2MYSA 1I1JA 1TWBA 3CCSQ 5IAYA 4KH1B 5FROA 5GANj 2LX9A 2IG0A 7AT1B 3JCMW 4ESRA 4RTZA 4M7AD 1N8RC 4OF1A 3V7CA 1VQ4T 1FMVA 4M78D 3CPFA 1F1BB 2JM9A 5IXBA 5GMKm 2FPFA 4OMMA 2EWNA 4M7DF 2FHDA 4M77F 1KG1A 3VS6A 2YUOA 2EJFA 2ROLA 2X4WA 2YLCA 4A4FA 1VQPT 1G2BA 2NWMA 4GLMA 4N4GA 3JCMf 8AT1B 1H3ZA 4XTZA 5FLXE 2CREA 4C0FA 2R57A 2C0OA 2M02A 1M1KU 3OS1A 4Y92A 3M5AA 3V8JA 3BDLA 1SF9A 2CP2A 2FEIA 1TUGB 1YIJQ 1Y7XA 3FJPA 3CCUA 4BDYA 4M7AG 1YJWA 3KUFA 3EGDB 1MNEA 4M78G 2LJ0A 2PNIA 2V8KA 2AK5A 2OTLT 3JCMb 1PSFA 4QVCA 3TEEA 3E9FA 2K7AA 2O4XB 1JXMA 2RMOA 1CKAA 3CCQT 3V7SA 1VQ6T 3PMTA 4C8QD 1K73U 1Y0MA 3ZBDA 4OMNA 2JMAA 3QO3A 2K3XA 1M27C 2P0PA 1EFNA 4J9HA 1MV3A 2QQBA 1J3TA 1G3YA 1SG5A 2V8JA 4LE9A 2EQIA 3S3MA 2JS0A 1WXTA 2QA4Q 1K9MR 1T3SA 2EFIA 3PVQA 2FYKA 5A0DA 3CPWA 4M75G 2E64A 3EG9A 4KUIA 2KE9A 1KD1C 2XI9A 3QDRB 4HVWA 2KVQG 3AHUA 3CBMA 2E6NA 4X9DA 4B9XA 4M75C 2QTVA 4NS5A 3WXMB 3H0HA 1BKBA 1QMCA 5GAN8 4JRKA 5LJ5g 4M75A 5LJ3g 3OYHA 3CCVQ 2CZ1B 5KE3A 4C8QG 4HCCA 3CMEQ 3MO8A 1NJIR 2RI3A 1OZ2A 2DL3A 1VQ8Q 1B07A 2LQ8A 2ZCFB 4FSSA 4OVAA 2KT1A 2PZ1A 4FT4A 2YXYA 4IUUA 1D0ZA 4C8QA 1WHJA 1IGQA 1N8RR 1KC8C 2JW4A 3BFMA 2YUNA 3TQ7P 3X25B 2RQWA 2J6OA 2HMAA 1VQNQ 2VXEA 3I56A 2E5QA 2WACA 4JDSA 4ZTJA 4PJOE 4HKEA 4D6WA 4A4KA 3A8GB 2BTTA 5GAN5 3JB9I 3CCEA 3CCLQ 2EAYA 4BE2A 1B7TA 4LN2A 4O5VA 5D6XA 2W10A 4Z89A 3CPWS 1R77A 2DE0X 1GFCA 3VS5A 4FYWB 1U5SA 1UGSB 2L3RA 2LQWA 3HFOA 1YJNT 5KCHA 5CR2A 1KK7A 3MEAA 2LC4A 1YI2T 4C92F 4GBQA 3JB9J 2X51A 1ACMB 3FDRA 1YWPA 1D1AA 2LMJA 1ZA1B 2I0NA 4IUQA 3CCMA 4IURA 2K79A 1VQ9T 1UE9A 1SRMA 3G71Q 4DOVA 1VQ5Q 1M1KC 1UEBA 3EFOB 5KH6A 2EQJA 2RJFA 2DTIA 1VUBA 2E3IA 3QWXX 2PVDB 2PVGB 4M77B 2Y4YA 2XDBA 3M0RA 1WA7A 3CD6T 5LJ5h 2O9SA 5LJ3h 3LLRA 2M16A 1K76A 4WCIA 1BI1A 1S72T 1WZOA 1M5Q1 3L1AA 2EJ9A 4PFPA 3ASKA 1KQSA 3LYIA 1GBRA 1R0CB 3RERA 4LD9K 2EKHA 1X2KA 1IREB 1D3BA 1MMNA 1KD1R 2FB7A 2OX7A 1IXDA 3VRYA 1K73C 4XTVA 1JRIA 2ZPEB 4QKUA 3M56A 3OYNA 1Q95G 2RH2A 4KH0B 1VQMQ 2X35A 1RI0A 2RN8A 3I5RA 2DBMA 2DVJA 2LP5A 3NFCA 4OMLA 4J9EA 2CGHA 4JJDA 4A53A 3M57A 1B34B 1XQHA 2CDTA 1YITA 2NUPB 2YWWA 4LDXA 2K3BA 2E1HA 4F7UE 2NUTB 2XK0A 5GMKi 2QQAA 2BE9B 2XMFA 2VKNA 3BE3A 4A54A 3BW1A 4QQDA 1KC8R 4ELYC 2V1RA 2FPDA 1VQ4Q 3SWNA 1Q82C 1AZEA 2QQ9A 4Q5WA 3MP6A 4FW1A 1N5ZA 2GQVA 1W4SA 1I07A 4X9CA 4N0AC 3EGXB 2D0NA 3A5ZB 1KQSS 2A08A 4KT0E 1N27A 5KYYA 4WTOB 2KR3A 2DK3A 2X9HA 2VXFA 3V8LA 1T3LA 1V1CA 5FU6B 5LJ3d 5KYUB 3RNJA 4MZPA 4EDUA 4C0DB 3MHXA 2KK4A 4XTWA 1UGRB 2V8IA 2VVKA 4QT7A 3HL8A 2ZPHB 3A8MB 1Y96B 2K4YA 1H92A 3GLXA 4ZNXA 3I55A 4AMCA 1M1KR 1DJ7B 3THKA 4RG2A 3PT9A 2OTLQ 1M2VA 2RF0A 2DRMA 1KFZA 4EMGA 2QTXA 2GFUA 4LXCA 2KYMA 5J3BA 1P92A 1AWXA 1M30A 2P4TA 4HCKA 2R5MA 4QW2A 1VQ6Q 4M7DG 3CCUT 4M77G 1FYNA 4NL3A 1I81A 3UA6A 3GOXA 1OX9A 1PWTA 1Y57A 1A0NB 1WIEA 2M1HA 5LJ3j 3EFOA 2DTHA 4J9DA 4M77C 4FT2A 5LJ5j 2DETA 4F14A 4PFOA 2PUKB 2P4RA 3LH5A 3GBQA 3RMSA 2K5IA 1KQ2A 4M7DA 1LCKA 4M77A 1K73R 1UFFA 2D8HA 1Q7YU 1QW1A 2QA4T 3HHTB 2L3QA 2F5KA 4E7LA 3MP1A 1PRLC 4L6V5 2IIMA 2MOXA 4CC2A 3CC4T 3CCRA 3L2WA 3GP8A 3H0IA 4HCBA 3EAEA 2E41A 3IQLA 1JJ2P 3DLLA 5GMKl 1RUWA 2G6FX 3R6OA 3JCMg 3DLMA 3M53A 1RAHB 4AFUC 1SRLA 2VASA 1TXQA 1SHFA 3JCMc 1CSKA 3EFRA 3VS4A 3VYHB 1JBMA 4ELZC 3WVDB 2BZXA 1B34A 2QI2A 1Q82R 4N4HA 1C0MA 3QG1A 1ZLMA 1X69A 2EYWA 2KYBA 4GY5A 1QCNA 4JLIA 3T9NA 5GMKh 5D6WA 5CKDA 3OQ5A 2KSSA 5GAN6 2Y4XA 1AHJB 4J9IA 2FPEA 4ZGEB 1WJRA 3GIBA 3OS2A 2VYTA 4C5HA 1D1CA 3M0SA 4WF2A 3L2VA 4BI8B 3M9QA 4F04B 3CC2T 1QVGA 2COZA 1YHQA 5HK0A 3I56T 1YJNQ 2DAQA 3OBYA 2EKOA 3CC7A 2J05A 1YI2Q 5HCKA 1EX4A 5GAN3 2QEXQ 2JS2A 3CCET 4XTXA 5FU6C 2DXCA 3MEVA 5KCOA 4C0DC 1VQ9Q 2CP6A 4XU2A 4C92D 2M9UA 5HKCA 4JRQA 1M3CA 6AT1B 1Q81U 5FWCA 4EPCA 1OI1A 1HJDA 2DKGA 5GJWB 1JXOA 2HZYA 5GAMg 3N5BB 3QJYA 3M0TA 3CD6Q 4XU1A 3TSZA 1I5OB 2MMPA 1NYFA 1S72Q 3M55A 4HCZA 3SD4A 2NUZA 3G4ST 1ZSZA 5CIUA 4D8DA 4PK4A 4AG1C 4NL2A 1NEBA 2I2LA 4QVZA 2V26A 5GANd 2BKDN 3INZA 5IH2A 2LQNA 1X27A 4IUPA 1K9MC 2X4JA 4C92G 4DA4A 4C0ZA 4BUGA 4M4ZA 2E3HA 3NMZC 3META 1WXUA 2LCSA 1UG1A 2MAMA 1ZUKA 1VQMT 4HVUA 1UHCA 2HL3A 1PSEA 5GAOm 2XU8A 2RB6A 3CCJT 2HDAA 4LUDA 1I8FA 3MJXA 1Y07A 2H8HA 1I0CA 5CVIA 4ZGDB 1ZSGA 2RM4A 3VS1A 4CC3A 3CEYA 3FJ5A 3LX7A 4LDYA 2LVMA 3AT1B 3X24B 2YHTA 1VQLT 5M9OA 1YITT 2EYXA 2COYA 2GBQA 2MWOA 4OMFB 2M0OA 3H8ZA 5GAOp 1HD3A 4CRIA 2P84A 1BBZA 3OB9A 1XNIA 5L23A 4AFSC 2KROA 3LWHA 2EQKA 2JN0A 4M7AE 1ABOA 2HKQB 2DRKA 2RPNA 2CZ0B 2O88A 2O01E 5D7UA 5GMKj 1M8VA 4M78E 4LDWA 1SSFA 2JMCA 5GAMh 2WSEE 2HQEA 3UWNA 2RNAA 2L3SA 4PLLA 2RQVA 1UECA 2E70A 1YBYA 1PD1A 1VA7A 2HL5C 3GNFB 1M90U 3QPHA 2DD5A 1VIFA 4EMHA 2D9TA 2K5FA 3CXCA 2EBPA 4E7ZA 1WQWA 4M75D 2EPDA 3M0PA 1UTIA 2DIQA 2L5QA 3OYMA 3FRNA 3PE0A 1ZX6A 1X75C 2DTOA 4CI0C 2LT4A 1R8OB 3MP8A 2VGNA 2L89A 1WGSA 4PJOB 2K2VA 3EH1A 3QJ6A 3CCUQ 2EYZA 1RL2A 2FRWA 2A0FB 1G8XA 2DIGA 4HVVA 2EQUA 4RCBA 4V2SA 4MDXA 1M1FA 4A63B 1RLQC 5CK9A 2HAXA 4RKUE 3RUXA 4C8QE 4E7JA 2V1QA 2OI3A 2DZCA 1MNDA 3P8HA 4OB0B 1X2QA 2KXCA 3CC4Q 2KQWA 1BI0A 3ZL7C 1MHNA 2A7YA 1B3QA 4JLGA 4ZTFA 1ARKA 2MPXC 1Q7YR 1VQ7T 3P8BB 4RCCA 4PNOA 4OMPA 1BI2A 3FEOA 5C6SA 3C95A 3CXCS 2XG8D 3RKYA 1NPRA 1QVPA 3OS5A 3GNGA 1E6GA 1WHHA 2LZ6B 5CQYA 3OW2A 5GAMd 3CMEA 3CMAA 3DB3A 3OYEA 3HP9A 1D0YA 3L42A 1JU5C 4FSXA 3SEMA 4RUGA 4VUBA 3H41A 1IHWA 2LCLA 1MMAA 3Q1JA 2J7IA 4E7HA 1WJQA 2LX7A 2QDYB 2VC8A 1KHCA 1TOVA 1RACB 4J6YA 4HA8A 3JCMX 1VQNA 1LVKA 2AHJB 1W2BA 2QQRA 2P0KA 1QKXA 2DBKA 3MEUA 5AYFA 3C12A 3QXEB 3R6NA 2BZ8A 3CBOA 3CC2Q 2B86A 3PTAA 2ECZA 3I56Q 1RADB 5GAMj 2EGAA 3RMQA 4Z02A 3CPWP 4PL6A 4F7UB 3OYDA 1QP3A 3HKSA 4RTXA 1IB8A 3CCEQ 3HSBA 5EC7A 2D1XA 4L5GA 4II1A 2CP5A 1N9RA 2DJZA 2HCKA 2QEXT 1GRIA 3C4SA 2A37A 3OYIA 4AFZC 1HXDA 2CSIA 1YHQT 2ABLA 3L2UA 2DFUA 4TVRA 3G71A 3OYYA 3OW2S 2JT4A 2QXFA 2JTFA 1NZ9A 2M0YA 4C5EA 2JOYA 2KGTA 2O31A 1QCFA 3EGDA 4J5YA 4DBHA 4PJOC 1TUCA 2ZPGB 3G4SQ 1WYXA 5LL6S 2DEQA 3CBPA 2ED1A 2O4XA 3QBYA 2RHUA 4XTUA 1H641 5FU7B 1W2BS 5I2MA 1CKBA 1IGUA 1QCOA 1PKSA 1ZBJA 4D8KA 3ULRB 2CT3A 1W2BP 1M8MA 2NLUA 1WNLA 3VV0A 2H3EB 2JTMA 1QWFA 4J7IA 4E7SA 3CCJQ 2MK5A 3O5ZA 4ZGJB 2VGMA 1PG5B 1X43A 1M2OA 3HFNA 1VQOA 1BI3A 3E9GA 2KXDA 4DBRA 1PRMC 4OB1B 4QQ6A 2KDSA 1BIAA 1M9SA 1K0XA 3G6EA 3UATA 1QVFA 2RJEA 1N9SA 1YP5A 2F2WA 3MEWA 2L3PA 2DD4A 1VQLQ 3VRZA 2E12A 2OTJT 1OPLA 1YITQ 2E6ZA 3A8HB 1NBEB 3G7ZA 1FMKA 3H9NA 2W0ZA 1VQ4A 4J83A 1NEGA 4M7AF 2RJDA 1GCQC 4F16A 3VKIA 5GANe 4Z88A 2QGGA 4M7DD 1VQPA 2JJ9A 3NGPA 4M77D 5I21A 4N0AA 3ER0A 1KQSP 1BIBA 3QKJA 5LJ5d 4F17A 1WHLA 5CO7A 5CQXA 2EW3A 3KFVA 2KBTA 2C06A 2SEMA 1AWJA 1TU0B 3OSVA 5L8RE 1C1AA 2CUBA 5LJ3f 3E2UA 4E47A 5LJ5f 1OPKA 2K5LA 2RHXA 1Q86U 2VB6A 5IHNA 1G83A 3OS0A 5D6YA 4DBFA 2QG9B 1K8AU 4A4HA 2OTLA 4DBQA 1X6BA 1QVFS 1T0HA 3PMIA 1NYGA 5GAN2 4JJNK 3RDVA 3FIFA 2HSPA 2YUQA 2RI5A 1BCMA 3CCQA 1YJWT 1VQ6A 5FRNA 1FWZA 2EYYA 5GAOl 4Z8AA 2BUDA 3VS7A 3URGA 1KJWA 3PVLA 1YCSB 1D0XA 2ZGWA 4XU0A 1ZBXA 2FO0A 4HXJA 1YJ9A 2ZPFB 1YCYA 2YRDA 3VS0A 1VOMA 3A8OB 1T0JA 3GF5A 2MCNA 4J8OA 3S3OA 1PD0A 5FU7C 2WSCE 3PGGA 1MUZA 1VQ7Q 4XQ3A 3CQTA 4JJBA 4KBMB 2KAFA 5GAOq 1K0SA 4MMKA 2HQHA 4EMKB 4K11A 3UF4A 4LNPA 2ZPBB 1W6XA 1AWWA 2K2MA 3CCRQ 1IRXA 2MF2A 2JM8A 2FG0A 4BD3A 1N6AA 2LQKA 4JUVA 1OU9A 4NOYA 2CH4A 4MZMA 3REAB 2LNHB 2FZKB 3OMCA 2COWA 2NUPA 3FB9A 2NUTA 3CMAT 1RAGB 2DX1A 4LDUA 3RIRA 4PJOF 4KULA 2K57A 1YNZA 2E4HA 4PJMA 3TCJA 1K9AA 4PJJA 2JZ2A 4FU6A 2DYBA 2LCCA 2J6KA 1FXXA 4JS5A 1EZZB 2KY9A 1ZUUA 3L2RA 2JNGA 2RQRA 2PQWA 2PTKA 3X26B 1BB9A 1LOJA 1YJNA 4FW2A 3QSUA 5IXFA 1MMGA 3EGXA 1YI2A 2F2XA 4KUDK 4YTLA 2CKKA 3OSSC 1YHQQ 1Z9ZA 2DL4A 1S1NA 2KT8A 5KYUA 3L2QA 1WLPB 3M58A 3QWYA 1UDLA 1VQKA 3NTIA 3UDCA 1VIEA 3EG3A 3EHQA 3UT1A 4C92E 1G3SA 3OYLA 3ZEHA 4M7AB 1RAEB 1Y96A 2F2VA 3CCMT 1LPLA 4M78B 3JCMh 1NLPC 2DXTA 1S72A 4BACA 4KRTA 1VYUA 1UHFA 4R0KA 4B6MA 2XHCA 3O8VA 4JPBW 3J81E 3EH2A 4XTYA 1SHGA 1AZGB 2EJGA 1ZQ1A 2CSQA 2WSFE 5J39A 1W70A 3QHSA 4ME7A 2XDDA 3C94A 1EIFA 1ZA2B 3E1SA 5GANf 1QVGS 3OYFA 1ZUYA 1M4ZA 2C0TA 4C5IA 1QKWA 4BI4A 1QLYA 5AT1B 1QVGP 3QZ5B 1G3WA 2D0QB 2JTEA 4MMLA 5A0GA 1Q7YC 1O75A 4M75B 2GNCA 2GFAA 1E7OA 2XKOC 4F7UF 4EMKC 3A98A 4IUTA 2L0AA 4ORZA 1E6HA 2HSEB 3RKWA 3QDFA 2QAZA 3JCMP 4EMKA 2R5AA 2OTJQ 1WHKA 3CCSA 1WX6A 3E19A 1X6OA 2RHIA 1VYTA 4C8QB 1U1TA 1FMWA 2YLBA 1WFWA 3A8LB 1Y71A 3G6ET 2KMTA 3JCMV 3J80E 1YN8A 2RK2A 2EGEA 4RTWA 2AT1B 4OMOA 1RAFB 1K1ZA 1XTDA 4O6JA 2XICA 2DL5A 2ZZDA 1Z9QA 2ATCB 4J6WA 3WVEB 2L8DA 1GL5A 2X4YA 4KGZB 5CKEA 3ME9A 2LJ3A 5I2SA 4BI3A 1ABQA 1WI7A 5IHKA 2LNVA 3JCMd 4DOWA 2RO0A 3TVTA 2LJ1A 2DF6A 5KYNA 2XDPA 4B9WA 2QASA 4DEYA 3MCAB 2DL8A 1YIJA 3EGUA 2X3WD 2X3XD 3RKXA 3HRTA 3KBGA 4N4IA 2KEAA 1OZ3A 1U8RA 2LTOA 3OYJA 3LH0A 1JQQA 2CUDA 2Y90A 4M75E 4ZN1A 3HRUA 5DM7R 1TG0A 1Q86R 4KGXB 1YJWQ 2DJQA 2AZVA 5I22A 1RABB 2GF7A 4FCYA 3I55T 1K8AR 3S6WA 1Q81C 1OV3A 4M7AC 5A2QE 2XD0A 1VYVA 3U23A 4CC4B 1TSFA 4FL6A 4P5NA 1MGQA 4M78C 5GAN4 4C0GA 4M7AA 2DLPA 1D3BB 4RTVA 2QA4A 4M78A 3OYBA 1WJSA 3RBBB 4OP0A 1TS9A 3SFMA 4OB2B 3CC4A 5LJ5e 5LJ3e 3JV3A 1YJ9T 2CT4A 4LD6A 2BZYA 1V76A 3QYHB 2F1LA 2HKNA 2CP7A 3CCVA 2Z0WA 1KSWA 3OYKA 2LT1A 2DO3A 4PFZA 3CXCP 2KRMA 3CCRT 2MIOA 4ATOA 2D8JA 3PIPA 1VQ8A 4HT9A 1TTHB 4FYXB 3UA7A 3JCMJ 2LRQA 2NYSA 2PU9B 3NHNA 4PKCC 1U3OA 1O9SA 4X34A 2A36A 2DVEA 3VJPA 5GAMf 4XAXB 5FW9A 1RAIB 3CMAQ 2KI7A 2RK1A 1Q82U 3SWNB 2F5TX 3M54A 2AZSA 4C8QC 3PIOA 1G3TA 1WDXA 3BY7A 4OGEA 5GAOr 1BU1A 5C0MA 2IPOB 3VS3A 1NM7A 2OJ2A 2DILA 4PJOD 2JXBA 4R56A 2H3JA 2QK0A 4J7FA 3CCLA 3MKDA 1AVZC 1X01A 4AFQC 3CC2A 2PUOB 4OMQA 5KYYB 5IT9E 5FRMA 4FM4B 1HK9A 3I9QA 2GTOA 5HK3A 1H3HA 1WQ7A 3EG1A 5A0LA 1UGPB 3L2ZA 3FLGA 4IIMA 3F70A 3JB9F 2HQXA 3I35A 1HSQA 1WHMA 2A3LA 1UGVA 3JB9H 1RLPC 2DM1A 1M90C 1M2VB 4PJLA 3CC7T 5ECAA 1VQ5A 3KXTA 4JJCA 2E10A 3OW2P 4PJOG 1UUEA 4JS4A 3CCMQ 4ZN3A 4LUEA 4XU3A 1Q81R 1PNJA 4QQGA 1WXBA 5CKBA 1MMDA 3OBWA 2MI6A 5KYWB 4PJNA 4UC4A 3G4SA 1GCPA 1VQKT 3TSWA 4PJOA 1X6GA 3RR6A 1OQKA 2P0QA 3M4GA 1SEMA 2OAUA 4M7DB 2K6DA 5DY9A 2QDLA 3QYGB 2RQUA 2A28A 2M51A 4J9GA 1UJYA 1U06A 1D1BA 1SSHA 2ESWA 2DXBA 1ZHIA 2EGCA 2DPPB 4MDWA 2FL7A 3BDUA 4OGCA 5CAIA 1VQMA 3REBB 3CCJA 3SDZA 2BIVA 1WPYA 4BB7A 1JO8A 2DA9A 3S3NA 1UGQB 4J9FA 4DEXA 3VU3C 1LNXA 3ZFJA 1TH7A 3HPWA 5FWBA 3VYGA 4IUVA 1VQOQ 2X4XA 2DERA 2ZPIB 1QP2A 2DL7A 3QIIA 2AIRB 1XOVA 1VQLA 1WHGA 1V29B 2E65A 2ENMA 2R58A 4DQ2A 4XK8E 4JRPA 3G6EQ 1MV0B 2AKKA 3VUBA 3V8KA 2CP0A
chains in the Genus database with same CATH topology
2PZ1A 2DX1A 2EYXA 3C0CA 2GBQA 4J9BA 2GTJA 1HD3A 1AD5A 2JW4A 2YUNA 1BBZA 5L23A 1YNZA 4AFSC 1K9AA 2KROA 2RQWA 1GCQA 2J6OA 1ABOA 2DRKA 2RPNA 2KNBB 2O88A 2HEQA 2DYBA 3M0UA 2J6KA 2JMCA 2BTTA 1ZUUA 2OAWA 2RNAA 2L3SA 2RQRA 2RQVA 2PTKA 1UECA 1BB9A 4LN2A 5IXFA 2YSQA 1VA7A 4J9CA 2W10A 4Z89A 2F2XA 2DE0X 1GFCA 3VS5A 1U5SA 2LQWA 2EBPA 1Z9ZA 2DL4A 1M3AA 1S1NA 4AG2C 4GBQA 3VS2A 2KT8A 3M0QA 2EPDA 3M0PA 1WLPB 1UTIA 1YWPA 2LMJA 2I0NA 1UDLA 3QWYA 3PE0A 1ZX6A 3EG3A 2K79A 4RTUA 1UE9A 3EHQA 1SRMA 2F2VA 4JZ4A 4RTYA 1M3BA 2EYZA 1AOJA 2FRWA 1NLPC 3QWXX 1BK2A 4HVVA 3EG0A 5I11A 3M0RA 1VYUA 1UHFA 1WA7A 2O9SA 4KRTA 4R0KA 4JPBW 4A63B 1RLQC 1K76A 4WCIA 1SHGA 1AZGB 1NG2A 2V1QA 2OI3A 1PKTA 2CSQA 3EHRA 1W70A 1SPKA 1GBRA 1X2QA 2KXCA 2ED0A 2EKHA 1X2KA 3VRYA 3ZL7C 1ZUYA 2C0TA 2KRNA 2SRCA 1QKWA 1QLYA 1B3QA 2JTEA 2O2OA 1ARKA 2GNCA 1E7OA 2RN8A 3I5RA 4OMPA 2DBMA 2DVJA 2LP5A 4OMLA 3A98A 4J9EA 1W1FA 4JJDA 2EVRA 2L0AA 4ORZA 1E6GA 2LZ6B 5GJVB 1E6HA 2CDTA 1JEGA 2K3BA 1WX6A 3I5SA 1JU5C 4RTTA 1VYTA 2XMFA 2VKNA 3SEMA 4RUGA 3H41A 1WFWA 2J7IA 1AEYA 4IIOA 4X1VA 2LX7A 2V1RA 1YN8A 2K9GA 1TUDA 2FPDA 2EGEA 1GFDA 2FRYA 4RTWA 4OMOA 2C0IA 1AZEA 1K1ZA 1QKXA 2DBKA 1GBQA 2HBWA 2DL5A 3R6NA 2DMOA 1Z9QA 2BZ8A 1N5ZA 2DNUA 3H0FA 1I07A 2B86A 1GL5A 3NPFA 2LJ3A 2RQTA 2D0NA 2ECZA 1ABQA 1WI7A 5IHKA 2A08A 2KR3A 2LJ1A 3TVTA 2DF6A 2EGAA 1PHTA 1T3LA 1V1CA 4RTXA 5EC7A 2D1XA 3RNJA 4DEYA 1NLOC 2DL8A 2L2PA 2YT6A 2ROTA 2X3WD 2X3XD 3EGUA 3SHWA 2KRSA 5IHIA 2HCKA 1GRIA 2KEAA 2GGRA 2YUPA 2A37A 2VVKA 4AFZC 4QT7A 2CSIA 2VWFA 1JQQA 2ABLA 2CUDA 1H92A 4ZNXA 2JT4A 1TG0A 3THKA 2DJQA 2AZVA 2RF0A 5I22A 2J06A 1KIKA 2DRMA 1KFZA 2M0YA 2KYMA 1AWXA 1M30A 1H8KA 4HCKA 2KGTA 2O31A 1OV3A 1QCFA 1YWOA 1VYVA 3U23A 1TUCA 4CC4B 1FYNA 3UA6A 1WYXA 1PWTA 1IO6A 1Y57A 2DLPA 1A0NB 1WIEA 2ED1A 4J9DA 4F14A 4RTVA 2P4RA 3LH5A 1RI9A 3GBQA 1AWOA 1CKBA 1OEBA 3RBBB 4CC7A 2CH4W 1PKSA 1ZBJA 1LCKA 3EG2A 3ULRB 4D8KA 2CT3A 1UFFA 1M8MA 2D8HA 2E5KA 4JZ3A 2L3QA 3JV3A 1UJ0A 1PRLC 1OOTA 2CT4A 2O9VA 1QWEA 2IIMA 2BZYA 1QWFA 2MOXA 4CC2A 3O5ZA 1K4US 3H0IA 1X43A 4EIKA 1KSWA 2KXDA 3IQLA 1PRMC 2KRMA 2MIOA 1RUWA 2D8JA 2G6FX 2J6FA 1K0XA 3UA7A 3UATA 4AFUC 3NHNA 1U3OA 1YP5A 4E6RA 1SRLA 2A36A 2F2WA 1SHFA 2YDLA 2L3PA 1CSKA 2AKLA 3VRZA 3VS4A 5FW9A 1OPLA 2GQIA 1I1JA 1FMKA 2BZXA 2AZSA 2W0ZA 1WDXA 1ZLMA 1X69A 1BU1A 2EYWA 4ESRA 2KYBA 1NEGA 4RTZA 3VS3A 1NM7A 2OJ2A 2DILA 2JXBA 1GCQC 4F16A 1AVZC 4AFQC 2JM9A 4OMQA 5IXBA 2FPFA 4OMMA 4Z88A 4J9IA 3NGPA 2FPEA 3I9QA 2GTOA 3VS6A 2YUOA 1H3HA 3M0SA 2ROLA 3EG1A 4F17A 1G2BA 2EW3A 2NWMA 3KFVA 4GLMA 2KBTA 2SEMA 4IIMA 1AWJA 2J05A 2CREA 3I35A 2C0OA 5HCKA 2CUBA 1HSQA 1OPKA 2JS2A 4Y92A 1UGVA 1RLPC 2DM1A 5IHNA 1G83A 2FEIA 5ECAA 4JJCA 1M3CA 1UUEA 5FWCA 1X6BA 1T0HA 1NYGA 4LUEA 2LJ0A 2PNIA 1HJDA 1PNJA 1WXBA 2HSPA 2YUQA 2AK5A 5GJWB 1JXOA 2EYYA 3M0TA 4Z8AA 3VS7A 2K7AA 1GCPA 1JXMA 2RMOA 3TSZA 3TSWA 1CKAA 1KJWA 3PVLA 1X6GA 1YCSB 1NYFA 1SEMA 2FO0A 1Y0MA 4HXJA 2K6DA 4OMNA 2JMAA 2NUZA 2QDLA 2RQUA 2A28A 2M51A 4J9GA 1M27C 1UJYA 1U06A 3VS0A 4D8DA 1T0JA 1EFNA 4J9HA 1MV3A 2MCNA 1J3TA 4AG1C 1SSHA 1NEBA 2ESWA 2EGCA 4LE9A 2EQIA 5IH2A 2LQNA 1X27A 2JS0A 1WXTA 1T3SA 3PVQA 1MUZA 3REBB 4M4ZA 3NMZC 2KE9A 3CQTA 4JJBA 1K0SA 1WXUA 2LCSA 1JO8A 1UG1A 4HVWA 2DA9A 1ZUKA 4K11A 4HVUA 1UHCA 3UF4A 4LNPA 4J9FA 1W6XA 2HDAA 4LUDA 4DEXA 1AWWA 2K2MA 3H0HA 5FWBA 2JM8A 2FG0A 2H8HA 1I0CA 1ZSGA 2DL7A 2CH4A 3REAB 1XOVA 2LNHB 3VS1A 2ENMA 4CC3A 3FJ5A 2DL3A 1MV0B 1B07A 2AKKA 4FSSA 2KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  2DX1 A;  2EYX A;  3C0C A;  2GBQ A;  4J9B A;  2GTJ A;  1HD3 A;  1AD5 A;  2JW4 A;  2YUN A;  1BBZ A;  5L23 A;  1YNZ A;  4AFS C;  1K9A A;  2KRO A;  2RQW A;  1GCQ A;  2J6O A;  1ABO A;  2DRK A;  2RPN A;  2KNB B;  2O88 A;  2HEQ A;  2DYB A;  3M0U A;  2J6K A;  2JMC A;  2BTT A;  1ZUU A;  2OAW A;  2RNA A;  2L3S A;  2RQR A;  2RQV A;  2PTK A;  1UEC A;  1BB9 A;  4LN2 A;  5IXF A;  2YSQ A;  1VA7 A;  4J9C A;  2W10 A;  4Z89 A;  2F2X A;  2DE0 X;  1GFC A;  3VS5 A;  1U5S A;  2LQW A;  2EBP A;  1Z9Z A;  2DL4 A;  1M3A A;  1S1N A;  4AG2 C;  4GBQ A;  3VS2 A;  2KT8 A;  3M0Q A;  2EPD A;  3M0P A;  1WLP B;  1UTI A;  1YWP A;  2LMJ A;  2I0N A;  1UDL A;  3QWY A;  3PE0 A;  1ZX6 A;  3EG3 A;  2K79 A;  4RTU A;  1UE9 A;  3EHQ A;  1SRM A;  2F2V A;  4JZ4 A;  4RTY A;  1M3B A;  2EYZ A;  1AOJ A;  2FRW A;  1NLP C;  3QWX X;  1BK2 A;  4HVV A;  3EG0 A;  5I11 A;  3M0R A;  1VYU A;  1UHF A;  1WA7 A;  2O9S A;  4KRT A;  4R0K A;  4JPB W;  4A63 B;  1RLQ C;  1K76 A;  4WCI A;  1SHG A;  1AZG B;  1NG2 A;  2V1Q A;  2OI3 A;  1PKT A;  2CSQ A;  3EHR A;  1W70 A;  1SPK A;  1GBR A;  1X2Q A;  2KXC A;  2ED0 A;  2EKH A;  1X2K A;  3VRY A;  3ZL7 C;  1ZUY A;  2C0T A;  2KRN A;  2SRC A;  1QKW A;  1QLY A;  1B3Q A;  2JTE A;  2O2O A;  1ARK A;  2GNC A;  1E7O A;  2RN8 A;  3I5R A;  4OMP A;  2DBM A;  2DVJ A;  2LP5 A;  4OML A;  3A98 A;  4J9E A;  1W1F A;  4JJD A;  2EVR A;  2L0A A;  4ORZ A;  1E6G A;  2LZ6 B;  5GJV B;  1E6H A;  2CDT A;  1JEG A;  2K3B A;  1WX6 A;  3I5S A;  1JU5 C;  4RTT A;  1VYT A;  2XMF A;  2VKN A;  3SEM A;  4RUG A;  3H41 A;  1WFW A;  2J7I A;  1AEY A;  4IIO A;  4X1V A;  2LX7 A;  2V1R A;  1YN8 A;  2K9G A;  1TUD A;  2FPD A;  2EGE A;  1GFD A;  2FRY A;  4RTW A;  4OMO A;  2C0I A;  1AZE A;  1K1Z A;  1QKX A;  2DBK A;  1GBQ A;  2HBW A;  2DL5 A;  3R6N A;  2DMO A;  1Z9Q A;  2BZ8 A;  1N5Z A;  2DNU A;  3H0F A;  1I07 A;  2B86 A;  1GL5 A;  3NPF A;  2LJ3 A;  2RQT A;  2D0N A;  2ECZ A;  1ABQ A;  1WI7 A;  5IHK A;  2A08 A;  2KR3 A;  2LJ1 A;  3TVT A;  2DF6 A;  2EGA A;  1PHT A;  1T3L A;  1V1C A;  4RTX A;  5EC7 A;  2D1X A;  3RNJ A;  4DEY A;  1NLO C;  2DL8 A;  2L2P A;  2YT6 A;  2ROT A;  2X3W D;  2X3X D;  3EGU A;  3SHW A;  2KRS A;  5IHI A;  2HCK A;  1GRI A;  2KEA A;  2GGR A;  2YUP A;  2A37 A;  2VVK A;  4AFZ C;  4QT7 A;  2CSI A;  2VWF A;  1JQQ A;  2ABL A;  2CUD A;  1H92 A;  4ZNX A;  2JT4 A;  1TG0 A;  3THK A;  2DJQ A;  2AZV A;  2RF0 A;  5I22 A;  2J06 A;  1KIK A;  2DRM A;  1KFZ A;  2M0Y A;  2KYM A;  1AWX A;  1M30 A;  1H8K A;  4HCK A;  2KGT A;  2O31 A;  1OV3 A;  1QCF A;  1YWO A;  1VYV A;  3U23 A;  1TUC A;  4CC4 B;  1FYN A;  3UA6 A;  1WYX A;  1PWT A;  1IO6 A;  1Y57 A;  2DLP A;  1A0N B;  1WIE A;  2ED1 A;  4J9D A;  4F14 A;  4RTV A;  2P4R A;  3LH5 A;  1RI9 A;  3GBQ A;  1AWO A;  1CKB A;  1OEB A;  3RBB B;  4CC7 A;  2CH4 W;  1PKS A;  1ZBJ A;  1LCK A;  3EG2 A;  3ULR B;  4D8K A;  2CT3 A;  1UFF A;  1M8M A;  2D8H A;  2E5K A;  4JZ3 A;  2L3Q A;  3JV3 A;  1UJ0 A;  1PRL C;  1OOT A;  2CT4 A;  2O9V A;  1QWE A;  2IIM A;  2BZY A;  1QWF A;  2MOX A;  4CC2 A;  3O5Z A;  1K4U S;  3H0I A;  1X43 A;  4EIK A;  1KSW A;  2KXD A;  3IQL A;  1PRM C;  2KRM A;  2MIO A;  1RUW A;  2D8J A;  2G6F X;  2J6F A;  1K0X A;  3UA7 A;  3UAT A;  4AFU C;  3NHN A;  1U3O A;  1YP5 A;  4E6R A;  1SRL A;  2A36 A;  2F2W A;  1SHF A;  2YDL A;  2L3P A;  1CSK A;  2AKL A;  3VRZ A;  3VS4 A;  5FW9 A;  1OPL A;  2GQI A;  1I1J A;  1FMK A;  2BZX A;  2AZS A;  2W0Z A;  1WDX A;  1ZLM A;  1X69 A;  1BU1 A;  2EYW A;  4ESR A;  2KYB A;  1NEG A;  4RTZ A;  3VS3 A;  1NM7 A;  2OJ2 A;  2DIL A;  2JXB A;  1GCQ C;  4F16 A;  1AVZ C;  4AFQ C;  2JM9 A;  4OMQ A;  5IXB A;  2FPF A;  4OMM A;  4Z88 A;  4J9I A;  3NGP A;  2FPE A;  3I9Q A;  2GTO A;  3VS6 A;  2YUO A;  1H3H A;  3M0S A;  2ROL A;  3EG1 A;  4F17 A;  1G2B A;  2EW3 A;  2NWM A;  3KFV A;  4GLM A;  2KBT A;  2SEM A;  4IIM A;  1AWJ A;  2J05 A;  2CRE A;  3I35 A;  2C0O A;  5HCK A;  2CUB A;  1HSQ A;  1OPK A;  2JS2 A;  4Y92 A;  1UGV A;  1RLP C;  2DM1 A;  5IHN A;  1G83 A;  2FEI A;  5ECA A;  4JJC A;  1M3C A;  1UUE A;  5FWC A;  1X6B A;  1T0H A;  1NYG A;  4LUE A;  2LJ0 A;  2PNI A;  1HJD A;  1PNJ A;  1WXB A;  2HSP A;  2YUQ A;  2AK5 A;  5GJW B;  1JXO A;  2EYY A;  3M0T A;  4Z8A A;  3VS7 A;  2K7A A;  1GCP A;  1JXM A;  2RMO A;  3TSZ A;  3TSW A;  1CKA A;  1KJW A;  3PVL A;  1X6G A;  1YCS B;  1NYF A;  1SEM A;  2FO0 A;  1Y0M A;  4HXJ A;  2K6D A;  4OMN A;  2JMA A;  2NUZ A;  2QDL A;  2RQU A;  2A28 A;  2M51 A;  4J9G A;  1M27 C;  1UJY A;  1U06 A;  3VS0 A;  4D8D A;  1T0J A;  1EFN A;  4J9H A;  1MV3 A;  2MCN A;  1J3T A;  4AG1 C;  1SSH A;  1NEB A;  2ESW A;  2EGC A;  4LE9 A;  2EQI A;  5IH2 A;  2LQN A;  1X27 A;  2JS0 A;  1WXT A;  1T3S A;  3PVQ A;  1MUZ A;  3REB B;  4M4Z A;  3NMZ C;  2KE9 A;  3CQT A;  4JJB A;  1K0S A;  1WXU A;  2LCS A;  1JO8 A;  1UG1 A;  4HVW A;  2DA9 A;  1ZUK A;  4K11 A;  4HVU A;  1UHC A;  3UF4 A;  4LNP A;  4J9F A;  1W6X A;  2HDA A;  4LUD A;  4DEX A;  1AWW A;  2K2M A;  3H0H A;  5FWB A;  2JM8 A;  2FG0 A;  2H8H A;  1I0C A;  1ZSG A;  2DL7 A;  2CH4 A;  3REA B;  1XOV A;  2LNH B;  3VS1 A;  2ENM A;  4CC3 A;  3FJ5 A;  2DL3 A;  1MV0 B;  1B07 A;  2AKK A;  4FSS A;  2KT1 A; 
#chains in the Genus database with same CATH topology
 2MWP A;  3M59 A;  3C0C A;  3JRZ A;  3V7R A;  1BCO A;  3GPL A;  4J9B A;  2GTJ A;  3CCS T;  2PVO B;  1AD5 A;  4QVD A;  2DYI A;  3SWN C;  4M78 F;  1AT1 B;  4BY6 B;  4C5G A;  1SKU B;  1NE8 A;  1GCQ A;  3LWI A;  1PCX A;  1YFN A;  2KNB B;  2HEQ A;  2LDM A;  3M0U A;  4GLK A;  4M7D E;  2FZC B;  2GCX A;  2OAW A;  4M77 E;  5IN1 A;  2EIF A;  4F7U G;  3A1P A;  5GMK e;  1VQP Q;  1D09 B;  3RES A;  2YSQ A;  4J9C A;  3VUZ A;  3OYG A;  2CZ6 B;  1IHV A;  4MZT A;  1JJ2 A;  1M90 R;  5GAN g;  3M4Y A;  4RG8 A;  1M3A A;  4AG2 C;  4F7U A;  3LGF A;  3VS2 A;  1KQ1 A;  4FYY B;  3M0Q A;  2RA2 A;  4M75 F;  4LDV A;  4RTU A;  1QVF P;  5CKF A;  1PC0 A;  3I55 Q;  1YIJ T;  1G5V A;  4JZ4 A;  4RTY A;  1M1G A;  1M3B A;  2HNI A;  4L59 A;  1AOJ A;  2QQS A;  4KGV B;  1I4K 1;  3NTK A;  3H6Z A;  4C8Q F;  1BK2 A;  1ZSZ B;  3EG0 A;  3TRE A;  5I11 A;  5DLQ E;  3CCQ Q;  1OX8 A;  1U1S A;  2CYZ B;  3TU4 K;  2RD1 A;  1K9M U;  3G1J A;  1NG2 A;  4E7K A;  1QQJ A;  5KYW A;  1BYM A;  1PKT A;  4M7D C;  3LW5 E;  3EHR A;  1OU8 A;  1SPK A;  5GAO n;  1YJ9 Q;  2ED0 A;  1GXI E;  3JCM e;  1VQ7 A;  4J6X A;  2KRN A;  2SRC A;  4C92 B;  2O2O A;  1C6V X;  5DLO A;  3P8D A;  2CS7 A;  5EG2 A;  1NJI U;  1JJ2 S;  5KYX B;  4E7I A;  1W1F A;  2EVR A;  1JB0 E;  5GJV B;  2DXU A;  4Y28 E;  4JRI A;  1JEG A;  3OMG A;  3CCV T;  4ANJ A;  3I5S A;  1N8R U;  4RTT A;  2JVV A;  4PLI A;  3CME T;  1AEY A;  4IIO A;  4X1V A;  5GAN h;  1VQ8 T;  3DB4 A;  2IVW A;  2K9G A;  2VV5 A;  1TUD A;  1GFD A;  2FRY A;  2RI2 A;  2C0I A;  1OUL A;  3UPU A;  2JUF A;  9ATC B;  1GBQ A;  2HBW A;  3QUI A;  2BE7 D;  2DMO A;  4BY6 C;  3PNW C;  4FYV B;  2DNU A;  3H0F A;  1VQN T;  3NPF A;  2RQT A;  3JAM E;  3OY9 A;  3MPU B;  4R55 A;  1XJW B;  8ATC B;  1KHI A;  2QEX A;  1PHT A;  3CCL T;  1PM3 A;  2RHZ A;  2RHY A;  2DZ9 A;  1VQ9 A;  1NLO C;  2L2P A;  2YT6 A;  2ROT A;  3SHW A;  2KRS A;  4BDZ A;  5IHI A;  3CC7 Q;  1LJO A;  5GAM e;  2EQM A;  2GGR A;  2HBP A;  2YUP A;  4FIB A;  3JB9 D;  1IZ6 A;  3J7A F;  2QGF B;  2VWF A;  4E2F B;  2YRV A;  3JCM Q;  3X20 B;  1RAA B;  5J26 A;  3CD6 A;  1Q86 C;  5KE2 A;  2F69 A;  3EFS A;  2J06 A;  4A4G A;  1KIK A;  4BE1 A;  5HY6 A;  1OYX A;  1K8A C;  5CCA A;  3G71 T;  1VQK Q;  1FX7 A;  2XID A;  1H8K A;  2K3Y A;  2YRC A;  1VQ5 T;  2EYQ A;  1YWO A;  3OYC A;  2RJC A;  4RMO A;  3NTH A;  4Y91 A;  4A4E A;  4BE0 A;  1IO6 A;  3LGL A;  3OYA A;  2VUB A;  3X28 B;  1ZSZ C;  1KD1 U;  3EG9 B;  2G3R A;  1RI9 A;  3PFS A;  1AWO A;  1OEB A;  3HRS A;  4CC7 A;  2CH4 W;  3EG2 A;  3JB9 G;  3OA6 A;  5CKH A;  2D6F A;  2E5K A;  4JZ3 A;  2QYZ A;  2ZAE A;  3FC3 A;  1HYO A;  1UJ0 A;  1OOT A;  2O9V A;  1QWE A;  3SB2 A;  2CZ7 B;  2B8A A;  1NPP A;  3HTR A;  1K4U S;  2FZG B;  2CP3 A;  4EIK A;  4IKF A;  2DEU A;  4C92 C;  4HT8 A;  3QZ9 B;  3DKM A;  3JSC A;  2J6F A;  1VQO T;  1I5L A;  2OTJ A;  4C92 A;  2HD0 A;  1KC8 U;  1UB4 A;  4E6R A;  5GAN 7;  4AT1 B;  4OB3 B;  2FVU A;  3D7S B;  1R0B G;  2YDL A;  2AKL A;  5KYX A;  1NJI C;  2GQI A;  2MYS A;  1I1J A;  1TWB A;  3CCS Q;  5IAY A;  4KH1 B;  5FRO A;  5GAN j;  2LX9 A;  2IG0 A;  7AT1 B;  3JCM W;  4ESR A;  4RTZ A;  4M7A D;  1N8R C;  4OF1 A;  3V7C A;  1VQ4 T;  1FMV A;  4M78 D;  3CPF A;  1F1B B;  2JM9 A;  5IXB A;  5GMK m;  2FPF A;  4OMM A;  2EWN A;  4M7D F;  2FHD A;  4M77 F;  1KG1 A;  3VS6 A;  2YUO A;  2EJF A;  2ROL A;  2X4W A;  2YLC A;  4A4F A;  1VQP T;  1G2B A;  2NWM A;  4GLM A;  4N4G A;  3JCM f;  8AT1 B;  1H3Z A;  4XTZ A;  5FLX E;  2CRE A;  4C0F A;  2R57 A;  2C0O A;  2M02 A;  1M1K U;  3OS1 A;  4Y92 A;  3M5A A;  3V8J A;  3BDL A;  1SF9 A;  2CP2 A;  2FEI A;  1TUG B;  1YIJ Q;  1Y7X A;  3FJP A;  3CCU A;  4BDY A;  4M7A G;  1YJW A;  3KUF A;  3EGD B;  1MNE A;  4M78 G;  2LJ0 A;  2PNI A;  2V8K A;  2AK5 A;  2OTL T;  3JCM b;  1PSF A;  4QVC A;  3TEE A;  3E9F A;  2K7A A;  2O4X B;  1JXM A;  2RMO A;  1CKA A;  3CCQ T;  3V7S A;  1VQ6 T;  3PMT A;  4C8Q D;  1K73 U;  1Y0M A;  3ZBD A;  4OMN A;  2JMA A;  3QO3 A;  2K3X A;  1M27 C;  2P0P A;  1EFN A;  4J9H A;  1MV3 A;  2QQB A;  1J3T A;  1G3Y A;  1SG5 A;  2V8J A;  4LE9 A;  2EQI A;  3S3M A;  2JS0 A;  1WXT A;  2QA4 Q;  1K9M R;  1T3S A;  2EFI A;  3PVQ A;  2FYK A;  5A0D A;  3CPW A;  4M75 G;  2E64 A;  3EG9 A;  4KUI A;  2KE9 A;  1KD1 C;  2XI9 A;  3QDR B;  4HVW A;  2KVQ G;  3AHU A;  3CBM A;  2E6N A;  4X9D A;  4B9X A;  4M75 C;  2QTV A;  4NS5 A;  3WXM B;  3H0H A;  1BKB A;  1QMC A;  5GAN 8;  4JRK A;  5LJ5 g;  4M75 A;  5LJ3 g;  3OYH A;  3CCV Q;  2CZ1 B;  5KE3 A;  4C8Q G;  4HCC A;  3CME Q;  3MO8 A;  1NJI R;  2RI3 A;  1OZ2 A;  2DL3 A;  1VQ8 Q;  1B07 A;  2LQ8 A;  2ZCF B;  4FSS A;  4OVA A;  2KT1 A;  2PZ1 A;  4FT4 A;  2YXY A;  4IUU A;  1D0Z A;  4C8Q A;  1WHJ A;  1IGQ A;  1N8R R;  1KC8 C;  2JW4 A;  3BFM A;  2YUN A;  3TQ7 P;  3X25 B;  2RQW A;  2J6O A;  2HMA A;  1VQN Q;  2VXE A;  3I56 A;  2E5Q A;  2WAC A;  4JDS A;  4ZTJ A;  4PJO E;  4HKE A;  4D6W A;  4A4K A;  3A8G B;  2BTT A;  5GAN 5;  3JB9 I;  3CCE A;  3CCL Q;  2EAY A;  4BE2 A;  1B7T A;  4LN2 A;  4O5V A;  5D6X A;  2W10 A;  4Z89 A;  3CPW S;  1R77 A;  2DE0 X;  1GFC A;  3VS5 A;  4FYW B;  1U5S A;  1UGS B;  2L3R A;  2LQW A;  3HFO A;  1YJN T;  5KCH A;  5CR2 A;  1KK7 A;  3MEA A;  2LC4 A;  1YI2 T;  4C92 F;  4GBQ A;  3JB9 J;  2X51 A;  1ACM B;  3FDR A;  1YWP A;  1D1A A;  2LMJ A;  1ZA1 B;  2I0N A;  4IUQ A;  3CCM A;  4IUR A;  2K79 A;  1VQ9 T;  1UE9 A;  1SRM A;  3G71 Q;  4DOV A;  1VQ5 Q;  1M1K C;  1UEB A;  3EFO B;  5KH6 A;  2EQJ A;  2RJF A;  2DTI A;  1VUB A;  2E3I A;  3QWX X;  2PVD B;  2PVG B;  4M77 B;  2Y4Y A;  2XDB A;  3M0R A;  1WA7 A;  3CD6 T;  5LJ5 h;  2O9S A;  5LJ3 h;  3LLR A;  2M16 A;  1K76 A;  4WCI A;  1BI1 A;  1S72 T;  1WZO A;  1M5Q 1;  3L1A A;  2EJ9 A;  4PFP A;  3ASK A;  1KQS A;  3LYI A;  1GBR A;  1R0C B;  3RER A;  4LD9 K;  2EKH A;  1X2K A;  1IRE B;  1D3B A;  1MMN A;  1KD1 R;  2FB7 A;  2OX7 A;  1IXD A;  3VRY A;  1K73 C;  4XTV A;  1JRI A;  2ZPE B;  4QKU A;  3M56 A;  3OYN A;  1Q95 G;  2RH2 A;  4KH0 B;  1VQM Q;  2X35 A;  1RI0 A;  2RN8 A;  3I5R A;  2DBM A;  2DVJ A;  2LP5 A;  3NFC A;  4OML A;  4J9E A;  2CGH A;  4JJD A;  4A53 A;  3M57 A;  1B34 B;  1XQH A;  2CDT A;  1YIT A;  2NUP B;  2YWW A;  4LDX A;  2K3B A;  2E1H A;  4F7U E;  2NUT B;  2XK0 A;  5GMK i;  2QQA A;  2BE9 B;  2XMF A;  2VKN A;  3BE3 A;  4A54 A;  3BW1 A;  4QQD A;  1KC8 R;  4ELY C;  2V1R A;  2FPD A;  1VQ4 Q;  3SWN A;  1Q82 C;  1AZE A;  2QQ9 A;  4Q5W A;  3MP6 A;  4FW1 A;  1N5Z A;  2GQV A;  1W4S A;  1I07 A;  4X9C A;  4N0A C;  3EGX B;  2D0N A;  3A5Z B;  1KQS S;  2A08 A;  4KT0 E;  1N27 A;  5KYY A;  4WTO B;  2KR3 A;  2DK3 A;  2X9H A;  2VXF A;  3V8L A;  1T3L A;  1V1C A;  5FU6 B;  5LJ3 d;  5KYU B;  3RNJ A;  4MZP A;  4EDU A;  4C0D B;  3MHX A;  2KK4 A;  4XTW A;  1UGR B;  2V8I A;  2VVK A;  4QT7 A;  3HL8 A;  2ZPH B;  3A8M B;  1Y96 B;  2K4Y A;  1H92 A;  3GLX A;  4ZNX A;  3I55 A;  4AMC A;  1M1K R;  1DJ7 B;  3THK A;  4RG2 A;  3PT9 A;  2OTL Q;  1M2V A;  2RF0 A;  2DRM A;  1KFZ A;  4EMG A;  2QTX A;  2GFU A;  4LXC A;  2KYM A;  5J3B A;  1P92 A;  1AWX A;  1M30 A;  2P4T A;  4HCK A;  2R5M A;  4QW2 A;  1VQ6 Q;  4M7D G;  3CCU T;  4M77 G;  1FYN A;  4NL3 A;  1I81 A;  3UA6 A;  3GOX A;  1OX9 A;  1PWT A;  1Y57 A;  1A0N B;  1WIE A;  2M1H A;  5LJ3 j;  3EFO A;  2DTH A;  4J9D A;  4M77 C;  4FT2 A;  5LJ5 j;  2DET A;  4F14 A;  4PFO A;  2PUK B;  2P4R A;  3LH5 A;  3GBQ A;  3RMS A;  2K5I A;  1KQ2 A;  4M7D A;  1LCK A;  4M77 A;  1K73 R;  1UFF A;  2D8H A;  1Q7Y U;  1QW1 A;  2QA4 T;  3HHT B;  2L3Q A;  2F5K A;  4E7L A;  3MP1 A;  1PRL C;  4L6V 5;  2IIM A;  2MOX A;  4CC2 A;  3CC4 T;  3CCR A;  3L2W A;  3GP8 A;  3H0I A;  4HCB A;  3EAE A;  2E41 A;  3IQL A;  1JJ2 P;  3DLL A;  5GMK l;  1RUW A;  2G6F X;  3R6O A;  3JCM g;  3DLM A;  3M53 A;  1RAH B;  4AFU C;  1SRL A;  2VAS A;  1TXQ A;  1SHF A;  3JCM c;  1CSK A;  3EFR A;  3VS4 A;  3VYH B;  1JBM A;  4ELZ C;  3WVD B;  2BZX A;  1B34 A;  2QI2 A;  1Q82 R;  4N4H A;  1C0M A;  3QG1 A;  1ZLM A;  1X69 A;  2EYW A;  2KYB A;  4GY5 A;  1QCN A;  4JLI A;  3T9N A;  5GMK h;  5D6W A;  5CKD A;  3OQ5 A;  2KSS A;  5GAN 6;  2Y4X A;  1AHJ B;  4J9I A;  2FPE A;  4ZGE B;  1WJR A;  3GIB A;  3OS2 A;  2VYT A;  4C5H A;  1D1C A;  3M0S A;  4WF2 A;  3L2V A;  4BI8 B;  3M9Q A;  4F04 B;  3CC2 T;  1QVG A;  2COZ A;  1YHQ A;  5HK0 A;  3I56 T;  1YJN Q;  2DAQ A;  3OBY A;  2EKO A;  3CC7 A;  2J05 A;  1YI2 Q;  5HCK A;  1EX4 A;  5GAN 3;  2QEX Q;  2JS2 A;  3CCE T;  4XTX A;  5FU6 C;  2DXC A;  3MEV A;  5KCO A;  4C0D C;  1VQ9 Q;  2CP6 A;  4XU2 A;  4C92 D;  2M9U A;  5HKC A;  4JRQ A;  1M3C A;  6AT1 B;  1Q81 U;  5FWC A;  4EPC A;  1OI1 A;  1HJD A;  2DKG A;  5GJW B;  1JXO A;  2HZY A;  5GAM g;  3N5B B;  3QJY A;  3M0T A;  3CD6 Q;  4XU1 A;  3TSZ A;  1I5O B;  2MMP A;  1NYF A;  1S72 Q;  3M55 A;  4HCZ A;  3SD4 A;  2NUZ A;  3G4S T;  1ZSZ A;  5CIU A;  4D8D A;  4PK4 A;  4AG1 C;  4NL2 A;  1NEB A;  2I2L A;  4QVZ A;  2V26 A;  5GAN d;  2BKD N;  3INZ A;  5IH2 A;  2LQN A;  1X27 A;  4IUP A;  1K9M C;  2X4J A;  4C92 G;  4DA4 A;  4C0Z A;  4BUG A;  4M4Z A;  2E3H A;  3NMZ C;  3MET A;  1WXU A;  2LCS A;  1UG1 A;  2MAM A;  1ZUK A;  1VQM T;  4HVU A;  1UHC A;  2HL3 A;  1PSE A;  5GAO m;  2XU8 A;  2RB6 A;  3CCJ T;  2HDA A;  4LUD A;  1I8F A;  3MJX A;  1Y07 A;  2H8H A;  1I0C A;  5CVI A;  4ZGD B;  1ZSG A;  2RM4 A;  3VS1 A;  4CC3 A;  3CEY A;  3FJ5 A;  3LX7 A;  4LDY A;  2LVM A;  3AT1 B;  3X24 B;  2YHT A;  1VQL T;  5M9O A;  1YIT T;  2EYX A;  2COY A;  2GBQ A;  2MWO A;  4OMF B;  2M0O A;  3H8Z A;  5GAO p;  1HD3 A;  4CRI A;  2P84 A;  1BBZ A;  3OB9 A;  1XNI A;  5L23 A;  4AFS C;  2KRO A;  3LWH A;  2EQK A;  2JN0 A;  4M7A E;  1ABO A;  2HKQ B;  2DRK A;  2RPN A;  2CZ0 B;  2O88 A;  2O01 E;  5D7U A;  5GMK j;  1M8V A;  4M78 E;  4LDW A;  1SSF A;  2JMC A;  5GAM h;  2WSE E;  2HQE A;  3UWN A;  2RNA A;  2L3S A;  4PLL A;  2RQV A;  1UEC A;  2E70 A;  1YBY A;  1PD1 A;  1VA7 A;  2HL5 C;  3GNF B;  1M90 U;  3QPH A;  2DD5 A;  1VIF A;  4EMH A;  2D9T A;  2K5F A;  3CXC A;  2EBP A;  4E7Z A;  1WQW A;  4M75 D;  2EPD A;  3M0P A;  1UTI A;  2DIQ A;  2L5Q A;  3OYM A;  3FRN A;  3PE0 A;  1ZX6 A;  1X75 C;  2DTO A;  4CI0 C;  2LT4 A;  1R8O B;  3MP8 A;  2VGN A;  2L89 A;  1WGS A;  4PJO B;  2K2V A;  3EH1 A;  3QJ6 A;  3CCU Q;  2EYZ A;  1RL2 A;  2FRW A;  2A0F B;  1G8X A;  2DIG A;  4HVV A;  2EQU A;  4RCB A;  4V2S A;  4MDX A;  1M1F A;  4A63 B;  1RLQ C;  5CK9 A;  2HAX A;  4RKU E;  3RUX A;  4C8Q E;  4E7J A;  2V1Q A;  2OI3 A;  2DZC A;  1MND A;  3P8H A;  4OB0 B;  1X2Q A;  2KXC A;  3CC4 Q;  2KQW A;  1BI0 A;  3ZL7 C;  1MHN A;  2A7Y A;  1B3Q A;  4JLG A;  4ZTF A;  1ARK A;  2MPX C;  1Q7Y R;  1VQ7 T;  3P8B B;  4RCC A;  4PNO A;  4OMP A;  1BI2 A;  3FEO A;  5C6S A;  3C95 A;  3CXC S;  2XG8 D;  3RKY A;  1NPR A;  1QVP A;  3OS5 A;  3GNG A;  1E6G A;  1WHH A;  2LZ6 B;  5CQY A;  3OW2 A;  5GAM d;  3CME A;  3CMA A;  3DB3 A;  3OYE A;  3HP9 A;  1D0Y A;  3L42 A;  1JU5 C;  4FSX A;  3SEM A;  4RUG A;  4VUB A;  3H41 A;  1IHW A;  2LCL A;  1MMA A;  3Q1J A;  2J7I A;  4E7H A;  1WJQ A;  2LX7 A;  2QDY B;  2VC8 A;  1KHC A;  1TOV A;  1RAC B;  4J6Y A;  4HA8 A;  3JCM X;  1VQN A;  1LVK A;  2AHJ B;  1W2B A;  2QQR A;  2P0K A;  1QKX A;  2DBK A;  3MEU A;  5AYF A;  3C12 A;  3QXE B;  3R6N A;  2BZ8 A;  3CBO A;  3CC2 Q;  2B86 A;  3PTA A;  2ECZ A;  3I56 Q;  1RAD B;  5GAM j;  2EGA A;  3RMQ A;  4Z02 A;  3CPW P;  4PL6 A;  4F7U B;  3OYD A;  1QP3 A;  3HKS A;  4RTX A;  1IB8 A;  3CCE Q;  3HSB A;  5EC7 A;  2D1X A;  4L5G A;  4II1 A;  2CP5 A;  1N9R A;  2DJZ A;  2HCK A;  2QEX T;  1GRI A;  3C4S A;  2A37 A;  3OYI A;  4AFZ C;  1HXD A;  2CSI A;  1YHQ T;  2ABL A;  3L2U A;  2DFU A;  4TVR A;  3G71 A;  3OYY A;  3OW2 S;  2JT4 A;  2QXF A;  2JTF A;  1NZ9 A;  2M0Y A;  4C5E A;  2JOY A;  2KGT A;  2O31 A;  1QCF A;  3EGD A;  4J5Y A;  4DBH A;  4PJO C;  1TUC A;  2ZPG B;  3G4S Q;  1WYX A;  5LL6 S;  2DEQ A;  3CBP A;  2ED1 A;  2O4X A;  3QBY A;  2RHU A;  4XTU A;  1H64 1;  5FU7 B;  1W2B S;  5I2M A;  1CKB A;  1IGU A;  1QCO A;  1PKS A;  1ZBJ A;  4D8K A;  3ULR B;  2CT3 A;  1W2B P;  1M8M A;  2NLU A;  1WNL A;  3VV0 A;  2H3E B;  2JTM A;  1QWF A;  4J7I A;  4E7S A;  3CCJ Q;  2MK5 A;  3O5Z A;  4ZGJ B;  2VGM A;  1PG5 B;  1X43 A;  1M2O A;  3HFN A;  1VQO A;  1BI3 A;  3E9G A;  2KXD A;  4DBR A;  1PRM C;  4OB1 B;  4QQ6 A;  2KDS A;  1BIA A;  1M9S A;  1K0X A;  3G6E A;  3UAT A;  1QVF A;  2RJE A;  1N9S A;  1YP5 A;  2F2W A;  3MEW A;  2L3P A;  2DD4 A;  1VQL Q;  3VRZ A;  2E12 A;  2OTJ T;  1OPL A;  1YIT Q;  2E6Z A;  3A8H B;  1NBE B;  3G7Z A;  1FMK A;  3H9N A;  2W0Z A;  1VQ4 A;  4J83 A;  1NEG A;  4M7A F;  2RJD A;  1GCQ C;  4F16 A;  3VKI A;  5GAN e;  4Z88 A;  2QGG A;  4M7D D;  1VQP A;  2JJ9 A;  3NGP A;  4M77 D;  5I21 A;  4N0A A;  3ER0 A;  1KQS P;  1BIB A;  3QKJ A;  5LJ5 d;  4F17 A;  1WHL A;  5CO7 A;  5CQX A;  2EW3 A;  3KFV A;  2KBT A;  2C06 A;  2SEM A;  1AWJ A;  1TU0 B;  3OSV A;  5L8R E;  1C1A A;  2CUB A;  5LJ3 f;  3E2U A;  4E47 A;  5LJ5 f;  1OPK A;  2K5L A;  2RHX A;  1Q86 U;  2VB6 A;  5IHN A;  1G83 A;  3OS0 A;  5D6Y A;  4DBF A;  2QG9 B;  1K8A U;  4A4H A;  2OTL A;  4DBQ A;  1X6B A;  1QVF S;  1T0H A;  3PMI A;  1NYG A;  5GAN 2;  4JJN K;  3RDV A;  3FIF A;  2HSP A;  2YUQ A;  2RI5 A;  1BCM A;  3CCQ A;  1YJW T;  1VQ6 A;  5FRN A;  1FWZ A;  2EYY A;  5GAO l;  4Z8A A;  2BUD A;  3VS7 A;  3URG A;  1KJW A;  3PVL A;  1YCS B;  1D0X A;  2ZGW A;  4XU0 A;  1ZBX A;  2FO0 A;  4HXJ A;  1YJ9 A;  2ZPF B;  1YCY A;  2YRD A;  3VS0 A;  1VOM A;  3A8O B;  1T0J A;  3GF5 A;  2MCN A;  4J8O A;  3S3O A;  1PD0 A;  5FU7 C;  2WSC E;  3PGG A;  1MUZ A;  1VQ7 Q;  4XQ3 A;  3CQT A;  4JJB A;  4KBM B;  2KAF A;  5GAO q;  1K0S A;  4MMK A;  2HQH A;  4EMK B;  4K11 A;  3UF4 A;  4LNP A;  2ZPB B;  1W6X A;  1AWW A;  2K2M A;  3CCR Q;  1IRX A;  2MF2 A;  2JM8 A;  2FG0 A;  4BD3 A;  1N6A A;  2LQK A;  4JUV A;  1OU9 A;  4NOY A;  2CH4 A;  4MZM A;  3REA B;  2LNH B;  2FZK B;  3OMC A;  2COW A;  2NUP A;  3FB9 A;  2NUT A;  3CMA T;  1RAG B;  2DX1 A;  4LDU A;  3RIR A;  4PJO F;  4KUL A;  2K57 A;  1YNZ A;  2E4H A;  4PJM A;  3TCJ A;  1K9A A;  4PJJ A;  2JZ2 A;  4FU6 A;  2DYB A;  2LCC A;  2J6K A;  1FXX A;  4JS5 A;  1EZZ B;  2KY9 A;  1ZUU A;  3L2R A;  2JNG A;  2RQR A;  2PQW A;  2PTK A;  3X26 B;  1BB9 A;  1LOJ A;  1YJN A;  4FW2 A;  3QSU A;  5IXF A;  1MMG A;  3EGX A;  1YI2 A;  2F2X A;  4KUD K;  4YTL A;  2CKK A;  3OSS C;  1YHQ Q;  1Z9Z A;  2DL4 A;  1S1N A;  2KT8 A;  5KYU A;  3L2Q A;  1WLP B;  3M58 A;  3QWY A;  1UDL A;  1VQK A;  3NTI A;  3UDC A;  1VIE A;  3EG3 A;  3EHQ A;  3UT1 A;  4C92 E;  1G3S A;  3OYL A;  3ZEH A;  4M7A B;  1RAE B;  1Y96 A;  2F2V A;  3CCM T;  1LPL A;  4M78 B;  3JCM h;  1NLP C;  2DXT A;  1S72 A;  4BAC A;  4KRT A;  1VYU A;  1UHF A;  4R0K A;  4B6M A;  2XHC A;  3O8V A;  4JPB W;  3J81 E;  3EH2 A;  4XTY A;  1SHG A;  1AZG B;  2EJG A;  1ZQ1 A;  2CSQ A;  2WSF E;  5J39 A;  1W70 A;  3QHS A;  4ME7 A;  2XDD A;  3C94 A;  1EIF A;  1ZA2 B;  3E1S A;  5GAN f;  1QVG S;  3OYF A;  1ZUY A;  1M4Z A;  2C0T A;  4C5I A;  1QKW A;  4BI4 A;  1QLY A;  5AT1 B;  1QVG P;  3QZ5 B;  1G3W A;  2D0Q B;  2JTE A;  4MML A;  5A0G A;  1Q7Y C;  1O75 A;  4M75 B;  2GNC A;  2GFA A;  1E7O A;  2XKO C;  4F7U F;  4EMK C;  3A98 A;  4IUT A;  2L0A A;  4ORZ A;  1E6H A;  2HSE B;  3RKW A;  3QDF A;  2QAZ A;  3JCM P;  4EMK A;  2R5A A;  2OTJ Q;  1WHK A;  3CCS A;  1WX6 A;  3E19 A;  1X6O A;  2RHI A;  1VYT A;  4C8Q B;  1U1T A;  1FMW A;  2YLB A;  1WFW A;  3A8L B;  1Y71 A;  3G6E T;  2KMT A;  3JCM V;  3J80 E;  1YN8 A;  2RK2 A;  2EGE A;  4RTW A;  2AT1 B;  4OMO A;  1RAF B;  1K1Z A;  1XTD A;  4O6J A;  2XIC A;  2DL5 A;  2ZZD A;  1Z9Q A;  2ATC B;  4J6W A;  3WVE B;  2L8D A;  1GL5 A;  2X4Y A;  4KGZ B;  5CKE A;  3ME9 A;  2LJ3 A;  5I2S A;  4BI3 A;  1ABQ A;  1WI7 A;  5IHK A;  2LNV A;  3JCM d;  4DOW A;  2RO0 A;  3TVT A;  2LJ1 A;  2DF6 A;  5KYN A;  2XDP A;  4B9W A;  2QAS A;  4DEY A;  3MCA B;  2DL8 A;  1YIJ A;  3EGU A;  2X3W D;  2X3X D;  3RKX A;  3HRT A;  3KBG A;  4N4I A;  2KEA A;  1OZ3 A;  1U8R A;  2LTO A;  3OYJ A;  3LH0 A;  1JQQ A;  2CUD A;  2Y90 A;  4M75 E;  4ZN1 A;  3HRU A;  5DM7 R;  1TG0 A;  1Q86 R;  4KGX B;  1YJW Q;  2DJQ A;  2AZV A;  5I22 A;  1RAB B;  2GF7 A;  4FCY A;  3I55 T;  1K8A R;  3S6W A;  1Q81 C;  1OV3 A;  4M7A C;  5A2Q E;  2XD0 A;  1VYV A;  3U23 A;  4CC4 B;  1TSF A;  4FL6 A;  4P5N A;  1MGQ A;  4M78 C;  5GAN 4;  4C0G A;  4M7A A;  2DLP A;  1D3B B;  4RTV A;  2QA4 A;  4M78 A;  3OYB A;  1WJS A;  3RBB B;  4OP0 A;  1TS9 A;  3SFM A;  4OB2 B;  3CC4 A;  5LJ5 e;  5LJ3 e;  3JV3 A;  1YJ9 T;  2CT4 A;  4LD6 A;  2BZY A;  1V76 A;  3QYH B;  2F1L A;  2HKN A;  2CP7 A;  3CCV A;  2Z0W A;  1KSW A;  3OYK A;  2LT1 A;  2DO3 A;  4PFZ A;  3CXC P;  2KRM A;  3CCR T;  2MIO A;  4ATO A;  2D8J A;  3PIP A;  1VQ8 A;  4HT9 A;  1TTH B;  4FYX B;  3UA7 A;  3JCM J;  2LRQ A;  2NYS A;  2PU9 B;  3NHN A;  4PKC C;  1U3O A;  1O9S A;  4X34 A;  2A36 A;  2DVE A;  3VJP A;  5GAM f;  4XAX B;  5FW9 A;  1RAI B;  3CMA Q;  2KI7 A;  2RK1 A;  1Q82 U;  3SWN B;  2F5T X;  3M54 A;  2AZS A;  4C8Q C;  3PIO A;  1G3T A;  1WDX A;  3BY7 A;  4OGE A;  5GAO r;  1BU1 A;  5C0M A;  2IPO B;  3VS3 A;  1NM7 A;  2OJ2 A;  2DIL A;  4PJO D;  2JXB A;  4R56 A;  2H3J A;  2QK0 A;  4J7F A;  3CCL A;  3MKD A;  1AVZ C;  1X01 A;  4AFQ C;  3CC2 A;  2PUO B;  4OMQ A;  5KYY B;  5IT9 E;  5FRM A;  4FM4 B;  1HK9 A;  3I9Q A;  2GTO A;  5HK3 A;  1H3H A;  1WQ7 A;  3EG1 A;  5A0L A;  1UGP B;  3L2Z A;  3FLG A;  4IIM A;  3F70 A;  3JB9 F;  2HQX A;  3I35 A;  1HSQ A;  1WHM A;  2A3L A;  1UGV A;  3JB9 H;  1RLP C;  2DM1 A;  1M90 C;  1M2V B;  4PJL A;  3CC7 T;  5ECA A;  1VQ5 A;  3KXT A;  4JJC A;  2E10 A;  3OW2 P;  4PJO G;  1UUE A;  4JS4 A;  3CCM Q;  4ZN3 A;  4LUE A;  4XU3 A;  1Q81 R;  1PNJ A;  4QQG A;  1WXB A;  5CKB A;  1MMD A;  3OBW A;  2MI6 A;  5KYW B;  4PJN A;  4UC4 A;  3G4S A;  1GCP A;  1VQK T;  3TSW A;  4PJO A;  1X6G A;  3RR6 A;  1OQK A;  2P0Q A;  3M4G A;  1SEM A;  2OAU A;  4M7D B;  2K6D A;  5DY9 A;  2QDL A;  3QYG B;  2RQU A;  2A28 A;  2M51 A;  4J9G A;  1UJY A;  1U06 A;  1D1B A;  1SSH A;  2ESW A;  2DXB A;  1ZHI A;  2EGC A;  2DPP B;  4MDW A;  2FL7 A;  3BDU A;  4OGC A;  5CAI A;  1VQM A;  3REB B;  3CCJ A;  3SDZ A;  2BIV A;  1WPY A;  4BB7 A;  1JO8 A;  2DA9 A;  3S3N A;  1UGQ B;  4J9F A;  4DEX A;  3VU3 C;  1LNX A;  3ZFJ A;  1TH7 A;  3HPW A;  5FWB A;  3VYG A;  4IUV A;  1VQO Q;  2X4X A;  2DER A;  2ZPI B;  1QP2 A;  2DL7 A;  3QII A;  2AIR B;  1XOV A;  1VQL A;  1WHG A;  1V29 B;  2E65 A;  2ENM A;  2R58 A;  4DQ2 A;  4XK8 E;  4JRP A;  3G6E Q;  1MV0 B;  2AKK A;  3VUB A;  3V8K A;  2CP0 A; 
#chains in the Genus database with same CATH homology
 2PZ1 A;  2DX1 A;  2EYX A;  3C0C A;  2GBQ A;  4J9B A;  2GTJ A;  1HD3 A;  1AD5 A;  2JW4 A;  2YUN A;  1BBZ A;  5L23 A;  1YNZ A;  4AFS C;  1K9A A;  2KRO A;  2RQW A;  1GCQ A;  2J6O A;  1ABO A;  2DRK A;  2RPN A;  2KNB B;  2O88 A;  2HEQ A;  2DYB A;  3M0U A;  2J6K A;  2JMC A;  2BTT A;  1ZUU A;  2OAW A;  2RNA A;  2L3S A;  2RQR A;  2RQV A;  2PTK A;  1UEC A;  1BB9 A;  4LN2 A;  5IXF A;  2YSQ A;  1VA7 A;  4J9C A;  2W10 A;  4Z89 A;  2F2X A;  2DE0 X;  1GFC A;  3VS5 A;  1U5S A;  2LQW A;  2EBP A;  1Z9Z A;  2DL4 A;  1M3A A;  1S1N A;  4AG2 C;  4GBQ A;  3VS2 A;  2KT8 A;  3M0Q A;  2EPD A;  3M0P A;  1WLP B;  1UTI A;  1YWP A;  2LMJ A;  2I0N A;  1UDL A;  3QWY A;  3PE0 A;  1ZX6 A;  3EG3 A;  2K79 A;  4RTU A;  1UE9 A;  3EHQ A;  1SRM A;  2F2V A;  4JZ4 A;  4RTY A;  1M3B A;  2EYZ A;  1AOJ A;  2FRW A;  1NLP C;  3QWX X;  1BK2 A;  4HVV A;  3EG0 A;  5I11 A;  3M0R A;  1VYU A;  1UHF A;  1WA7 A;  2O9S A;  4KRT A;  4R0K A;  4JPB W;  4A63 B;  1RLQ C;  1K76 A;  4WCI A;  1SHG A;  1AZG B;  1NG2 A;  2V1Q A;  2OI3 A;  1PKT A;  2CSQ A;  3EHR A;  1W70 A;  1SPK A;  1GBR A;  1X2Q A;  2KXC A;  2ED0 A;  2EKH A;  1X2K A;  3VRY A;  3ZL7 C;  1ZUY A;  2C0T A;  2KRN A;  2SRC A;  1QKW A;  1QLY A;  1B3Q A;  2JTE A;  2O2O A;  1ARK A;  2GNC A;  1E7O A;  2RN8 A;  3I5R A;  4OMP A;  2DBM A;  2DVJ A;  2LP5 A;  4OML A;  3A98 A;  4J9E A;  1W1F A;  4JJD A;  2EVR A;  2L0A A;  4ORZ A;  1E6G A;  2LZ6 B;  5GJV B;  1E6H A;  2CDT A;  1JEG A;  2K3B A;  1WX6 A;  3I5S A;  1JU5 C;  4RTT A;  1VYT A;  2XMF A;  2VKN A;  3SEM A;  4RUG A;  3H41 A;  1WFW A;  2J7I A;  1AEY A;  4IIO A;  4X1V A;  2LX7 A;  2V1R A;  1YN8 A;  2K9G A;  1TUD A;  2FPD A;  2EGE A;  1GFD A;  2FRY A;  4RTW A;  4OMO A;  2C0I A;  1AZE A;  1K1Z A;  1QKX A;  2DBK A;  1GBQ A;  2HBW A;  2DL5 A;  3R6N A;  2DMO A;  1Z9Q A;  2BZ8 A;  1N5Z A;  2DNU A;  3H0F A;  1I07 A;  2B86 A;  1GL5 A;  3NPF A;  2LJ3 A;  2RQT A;  2D0N A;  2ECZ A;  1ABQ A;  1WI7 A;  5IHK A;  2A08 A;  2KR3 A;  2LJ1 A;  3TVT A;  2DF6 A;  2EGA A;  1PHT A;  1T3L A;  1V1C A;  4RTX A;  5EC7 A;  2D1X A;  3RNJ A;  4DEY A;  1NLO C;  2DL8 A;  2L2P A;  2YT6 A;  2ROT A;  2X3W D;  2X3X D;  3EGU A;  3SHW A;  2KRS A;  5IHI A;  2HCK A;  1GRI A;  2KEA A;  2GGR A;  2YUP A;  2A37 A;  2VVK A;  4AFZ C;  4QT7 A;  2CSI A;  2VWF A;  1JQQ A;  2ABL A;  2CUD A;  1H92 A;  4ZNX A;  2JT4 A;  1TG0 A;  3THK A;  2DJQ A;  2AZV A;  2RF0 A;  5I22 A;  2J06 A;  1KIK A;  2DRM A;  1KFZ A;  2M0Y A;  2KYM A;  1AWX A;  1M30 A;  1H8K A;  4HCK A;  2KGT A;  2O31 A;  1OV3 A;  1QCF A;  1YWO A;  1VYV A;  3U23 A;  1TUC A;  4CC4 B;  1FYN A;  3UA6 A;  1WYX A;  1PWT A;  1IO6 A;  1Y57 A;  2DLP A;  1A0N B;  1WIE A;  2ED1 A;  4J9D A;  4F14 A;  4RTV A;  2P4R A;  3LH5 A;  1RI9 A;  3GBQ A;  1AWO A;  1CKB A;  1OEB A;  3RBB B;  4CC7 A;  2CH4 W;  1PKS A;  1ZBJ A;  1LCK A;  3EG2 A;  3ULR B;  4D8K A;  2CT3 A;  1UFF A;  1M8M A;  2D8H A;  2E5K A;  4JZ3 A;  2L3Q A;  3JV3 A;  1UJ0 A;  1PRL C;  1OOT A;  2CT4 A;  2O9V A;  1QWE A;  2IIM A;  2BZY A;  1QWF A;  2MOX A;  4CC2 A;  3O5Z A;  1K4U S;  3H0I A;  1X43 A;  4EIK A;  1KSW A;  2KXD A;  3IQL A;  1PRM C;  2KRM A;  2MIO A;  1RUW A;  2D8J A;  2G6F X;  2J6F A;  1K0X A;  3UA7 A;  3UAT A;  4AFU C;  3NHN A;  1U3O A;  1YP5 A;  4E6R A;  1SRL A;  2A36 A;  2F2W A;  1SHF A;  2YDL A;  2L3P A;  1CSK A;  2AKL A;  3VRZ A;  3VS4 A;  5FW9 A;  1OPL A;  2GQI A;  1I1J A;  1FMK A;  2BZX A;  2AZS A;  2W0Z A;  1WDX A;  1ZLM A;  1X69 A;  1BU1 A;  2EYW A;  4ESR A;  2KYB A;  1NEG A;  4RTZ A;  3VS3 A;  1NM7 A;  2OJ2 A;  2DIL A;  2JXB A;  1GCQ C;  4F16 A;  1AVZ C;  4AFQ C;  2JM9 A;  4OMQ A;  5IXB A;  2FPF A;  4OMM A;  4Z88 A;  4J9I A;  3NGP A;  2FPE A;  3I9Q A;  2GTO A;  3VS6 A;  2YUO A;  1H3H A;  3M0S A;  2ROL A;  3EG1 A;  4F17 A;  1G2B A;  2EW3 A;  2NWM A;  3KFV A;  4GLM A;  2KBT A;  2SEM A;  4IIM A;  1AWJ A;  2J05 A;  2CRE A;  3I35 A;  2C0O A;  5HCK A;  2CUB A;  1HSQ A;  1OPK A;  2JS2 A;  4Y92 A;  1UGV A;  1RLP C;  2DM1 A;  5IHN A;  1G83 A;  2FEI A;  5ECA A;  4JJC A;  1M3C A;  1UUE A;  5FWC A;  1X6B A;  1T0H A;  1NYG A;  4LUE A;  2LJ0 A;  2PNI A;  1HJD A;  1PNJ A;  1WXB A;  2HSP A;  2YUQ A;  2AK5 A;  5GJW B;  1JXO A;  2EYY A;  3M0T A;  4Z8A A;  3VS7 A;  2K7A A;  1GCP A;  1JXM A;  2RMO A;  3TSZ A;  3TSW A;  1CKA A;  1KJW A;  3PVL A;  1X6G A;  1YCS B;  1NYF A;  1SEM A;  2FO0 A;  1Y0M A;  4HXJ A;  2K6D A;  4OMN A;  2JMA A;  2NUZ A;  2QDL A;  2RQU A;  2A28 A;  2M51 A;  4J9G A;  1M27 C;  1UJY A;  1U06 A;  3VS0 A;  4D8D A;  1T0J A;  1EFN A;  4J9H A;  1MV3 A;  2MCN A;  1J3T A;  4AG1 C;  1SSH A;  1NEB A;  2ESW A;  2EGC A;  4LE9 A;  2EQI A;  5IH2 A;  2LQN A;  1X27 A;  2JS0 A;  1WXT A;  1T3S A;  3PVQ A;  1MUZ A;  3REB B;  4M4Z A;  3NMZ C;  2KE9 A;  3CQT A;  4JJB A;  1K0S A;  1WXU A;  2LCS A;  1JO8 A;  1UG1 A;  4HVW A;  2DA9 A;  1ZUK A;  4K11 A;  4HVU A;  1UHC A;  3UF4 A;  4LNP A;  4J9F A;  1W6X A;  2HDA A;  4LUD A;  4DEX A;  1AWW A;  2K2M A;  3H0H A;  5FWB A;  2JM8 A;  2FG0 A;  2H8H A;  1I0C A;  1ZSG A;  2DL7 A;  2CH4 A;  3REA B;  1XOV A;  2LNH B;  3VS1 A;  2ENM A;  4CC3 A;  3FJ5 A;  2DL3 A;  1MV0 B;  1B07 A;  2AKK A;  4FSS A;  2KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...