1WXBA

Solution structure of the sh3 domain from human epidermal growth factor receptor pathway substrate 8-like protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
68
Chain Sequence
GSSGSSGKYVKILYDFTARNANELSVLKDEVLEVLEDGRQWWKLRSRSGQAGYVPCNILGEASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epidermal growth factor receptor pathway substrate 8-like pr
publication title Solution structure of the SH3 domain from human epidermal growth factor receptor pathway substrate 8-like protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 5
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wxbA00
2RPNA 3U23A 2RQRA 1X6GA 5I11A 2B86A 1QLYA 1BU1A 1PRLC 3M0PA 3RBBB 2A08A 3H0IA 1Z9QA 1EFNA 4J9FA 1SRMA 2GGRA 3M0UA 2RN8A 1I1JA 1JXOA 1ZUYA 2DVJA 2HCKA 2VKNA 2JM9A 2K9GA 3VRZA 2ABLA 2ENMA 2EYXA 1NLOC 3ULRB 1YP5A 3LH5A 4CC3A 2MCNA 1WFWA 3TSWA 1GCQC 4LN2A 2CSQA 2HBWA 1W1FA 2ECZA 1MV0B 2VWFA 2FO0A 2O9VA 3GBQA 2YUPA 4AFUC 2O9SA 3EHRA 2W10A 1SRLA 2A36A 4HVWA 1CKBA 2C0OA 2ED0A 2DMOA 1GFDA 1I07A 2HSPA 1OPLA 5IHNA 2RMOA 3H0FA 1OOTA 1X6BA 3M0RA 1ABOA 2FPEA 2LNHB 1BK2A 2OAWA 3PVQA 1GBRA 4CC2A 1X69A 1AWOA 3EG0A 2XMFA 1JQQA 3A98A 2DBKA 2O2OA 1GCQA 1UJ0A 2D8JA 2MOXA 2F2VA 4Y92A 2CH4A 2NUZA 1AVZC 2LZ6B 4R0KA 4LNPA 1SEMA 4HXJA 4RTYA 3H0HA 1M8MA 1E7OA 3THKA 1W6XA 1OV3A 1X27A 1K9AA 4IIOA 4LE9A 4OMOA 2L3QA 1RI9A 2JM8A 3O5ZA 2LJ0A 4J9DA 4RTXA 1SPKA 1PWTA 1QWEA 1X2KA 2EYYA 1YCSB 1SHFA 1ZX6A 1AWJA 3SEMA 1KJWA 1N5ZA 3M0TA 1UE9A 3NHNA 3SHWA 3EG2A 4Z8AA 3VRYA 1ARKA 1Y0MA 2CT4A 3TVTA 2KYMA 1WDXA 4EIKA 1H92A 2AKLA 2GTJA 2HDAA 1K0SA 2H8HA 4JJCA 4Z88A 1XOVA 1X43A 4HVVA 3VS2A 3I5RA 2DRMA 1WLPB 3CQTA 2JMCA 1U3OA 4JJBA 3UF4A 1WA7A 1UFFA 2W0ZA 2L3PA 2BZ8A 4ZNXA 3NMZC 2SRCA 2L2PA 4A63B 3QWXX 2DE0X 1ZBJA 5I22A 1HJDA 2PNIA 2SEMA 1KSWA 1SSHA 3REBB 2YUNA 1TUCA 4OMPA 1WI7A 2M51A 2J06A 1IO6A 3EHQA 1W70A 2BZYA 1ZUUA 2CDTA 2JMAA 3EGUA 1BB9A 1WXUA 3EG3A 1NLPC 3REAB 1B3QA 2LMJA 2X3XD 4K11A 1JXMA 1M3AA 1QKWA 2RQUA 1WXTA 2BZXA 2JT4A 3ZL7C 3RNJA 2K6DA 2KBTA 2EYZA 1AEYA 3NPFA 2P4RA 1TG0A 2F2WA 1Z9ZA 4DEYA 5IHKA 4AG1C 1JEGA 4OMMA 1AZEA 5IH2A 2O88A 3UA6A 1BBZA 2DL3A 2RF0A 3PE0A 1JO8A 1VYTA 2J6OA 4J9HA 5IXBA 2IIMA 1TUDA 4ORZA 1NYFA 1VA7A 1CSKA 4AG2C 2DL7A 5IXFA 2K79A 2D1XA 4E6RA 5IHIA 2GNCA 1WYXA 2ROTA 1GFCA 2X3WD 2EPDA 3VS3A 1KIKA 2AK5A 2CUBA 2BTTA 2JS2A 1QKXA 2RQWA 4QT7A 2D0NA 4F16A 4F14A 1YWOA 2GQIA 2PTKA 1WIEA 2FEIA 1FMKA 2DL5A 4OMQA 2K7AA 2RNAA 2KNBB 4Z89A 1YWPA 2K2MA 2KRNA 1E6HA 3I5SA 3VS6A 4LUEA 1PKTA 3PVLA 4J9BA 1MV3A 2EQIA 2DL4A 4CC4B 2EVRA 1B07A 1M30A 2EW3A 1S1NA 1UUEA 1X2QA 1H8KA 3NGPA 1A0NB 2JW4A 4J9EA 2D8HA 2DL8A 3M0SA 1Y57A 2AZSA 1E6GA 2C0IA 1K1ZA 2HEQA 2A37A 1UHCA 2LP5A 2AZVA 2CUDA 2LX7A 1U06A 1GCPA 1NEGA 2LJ3A 4J9CA 2V1QA 1GRIA 2DBMA 3KFVA 1T3SA 2ROLA 1T0JA 4OMNA 3I35A 5EC7A 1RLPC 1UJYA 2DX1A 2ESWA 4X1VA 2GBQA 2EGCA 1U5SA 5HCKA 4JPBW 2FPDA 2YSQA 1AWWA 1G2BA 5FW9A 2JXBA 3UA7A 5GJWB 1UECA 1LCKA 3IQLA 2KRMA 3VS7A 2G6FX 1YNZA 2KEAA 1HSQA 1J3TA 3FJ5A 1T0HA 2FPFA 1UG1A 1WXBA 2OJ2A 4GBQA 4J9GA 4WCIA 1FYNA 2K3BA 2KT1A 3UATA 5ECAA 1PRMC 2DJQA 4JJDA 4AFQC 2KYBA 4AFZC 1YN8A 1HD3A 2MIOA 1ZSGA 1OPKA 2DYBA 1NM7A 2KR3A 2E5KA 2I0NA 1CKAA 1VYVA 2KXCA 2YUOA 2EGAA 4HVUA 1I0CA 1OEBA 2JS0A 2O31A 1UGVA 1QWFA 4DEXA 1AD5A 5FWCA 1ZLMA 4RTTA 4LUDA 4IIMA 1PHTA 4RTVA 2M0YA 2YUQA 4FSSA 1V1CA 2LQNA 2OI3A 2YT6A 1VYUA 2CSIA 2V1RA 4J9IA 1KFZA 1AOJA 2DRKA 2LQWA 1NEBA 3H41A 2LJ1A 3QWYA 1NG2A 3I9QA 4D8KA 2CH4W 1H3HA 2FRYA 2AKKA 2DNUA 1M3BA 1QCFA 2KE9A 1GBQA 4RTZA 2FG0A 2DF6A 2EKHA 1JU5C 1SHGA 2DILA 4KRTA 1PNJA 2L3SA 4RTWA 3VS4A 4RTUA 5GJVB 2QDLA 4AFSC 1ABQA 5L23A 2A28A 1M3CA 4D8DA 5FWBA 2L0AA 2DLPA 4JZ3A 2KGTA 1RLQC 2YDLA 2JTEA 4M4ZA 2EBPA 1UTIA 1G83A 1RUWA 1AZGB 2J6KA 2KXDA 3VS0A 2LCSA 3M0QA 4CC7A 4F17A 3R6NA 3TSZA 1M27C 3JV3A 2CT3A 2NWMA 4RUGA 3EG1A 1K4US 2EYWA 2RQTA 1MUZA 2KT8A 1NYGA 2FRWA 2J7IA 2DM1A 1WX6A 1UDLA 2RQVA 4OMLA 1GL5A 3C0CA 2C0TA 4JZ4A 2J6FA 2J05A 1ZUKA 1UHFA 2VVKA 4HCKA 2ED1A 2DA9A 1K0XA 2GTOA 1K76A 2KROA 3VS5A 2CREA 4GLMA 1T3LA 1AWXA 3VS1A 1PKSA 2PZ1A 4ESRA 2KRSA 2EGEA 2F2XA
chains in the Genus database with same CATH superfamily
2L5QA 2F1LA 4J6XA 2DTOA 3LLRA 2MAMA 4M78D 5I11A 1X6GA 4PFOA 5A0LA 1ZSZA 2DIQA 4OB1B 3RBBB 2A08A 2HQEA 3TQ7P 3S3MA 1YJ9Q 2LT1A 4PJOF 3LWIA 3OYMA 1I1JA 3OYBA 1WHLA 2VASA 2JM9A 2K9GA 4BI4A 3UDCA 2LCLA 4HCZA 1YP5A 2QGGA 4J6WA 1GCQC 3GP8A 2HBWA 4J7FA 4DBHA 3JCMW 5IAYA 1LVKA 5KYUA 2LC4A 2W10A 4MZMA 3F70A 4XTUA 2DMOA 1N8RC 2OTJT 3NTHA 1M1KU 1OPLA 2B8AA 3CXCA 1OOTA 4OGEA 2GF7A 1V29B 1ABOA 4EMGA 1O75A 3BFMA 2ZGWA 1VQ8Q 2I2LA 4HKEA 3G7ZA 4CC2A 4C92E 1X69A 4JRQA 1PC0A 4C8QA 1JQQA 5C6SA 3A98A 5GAMj 1VQMT 4AMCA 1VQ9T 2NYSA 3BDLA 1X75C 4PJLA 4Y92A 2CH4A 4N4GA 3CCMQ 4RTYA 5KYYB 3V8KA 1IGQA 4M7DE 3TU4K 3THKA 1BI3A 1W6XA 3MCAB 5CKHA 2YWWA 4QVCA 1K9AA 1WQWA 2X4JA 1SF9A 1YIJT 2QG9B 5FU7C 2LDMA 1PWTA 1KQ2A 1K73R 1SHFA 5LJ5d 1KJWA 3M57A 3M0TA 2DAQA 2PUOB 2L8DA 3SHWA 2E10A 2YRVA 2CT4A 3TVTA 4QQGA 1VUBA 3QJ6A 4ME7A 3X26B 1M2OA 1WHGA 3QHSA 1QVFP 4HVVA 2DRMA 4M77B 1U3OA 1SKUB 3QZ9B 4QQDA 4LDYA 2DERA 3QWXX 2DE0X 5I22A 1HJDA 2EFIA 5LJ3j 8ATCB 3VYHB 1KSWA 4E7ZA 3G4ST 2HL5C 1IO6A 3RESA 3EHQA 2BZYA 1ZUUA 2CYZB 2JMAA 3QBYA 5CIUA 5DM7R 3REAB 3NTKA 3MEUA 1JXMA 3EG9B 1WXTA 3ZL7C 4C92G 3CCLT 1B34A 3V8LA 3A8MB 3H9NA 4M75D 2NUTA 3J81E 5IHKA 3CCVQ 4BE2A 5GMKe 1G8XA 2P84A 5FLXE 5LJ5e 4IUPA 2CGHA 4JJNK 1BBZA 3ZFJA 1RI0A 1VYTA 2Y90A 4J9HA 1QVGS 3OSSC 4OVAA 4X9CA 2DL7A 5IXFA 3P8BB 2DVEA 1WYXA 2ROTA 4M75F 2ZZDA 2E6NA 1O9SA 2EPDA 3JB9H 4L59A 4ZTFA 2BTTA 2JS2A 1QKXA 4QT7A 3PMTA 1W2BA 1I8FA 2PTKA 2GQIA 1WIEA 2FEIA 4BE1A 3R6OA 2YLCA 5HY6A 2K7AA 3L2WA 3CPWP 1K73C 2OTJQ 2FB7A 1E6HA 3I5SA 4B9XA 1TWBA 1PKTA 4EPCA 4X34A 1MV3A 1VQ5T 4ZGJB 3MKDA 2EW3A 1K9MU 4M7AF 2HBPA 2RJFA 1X2QA 3AT1B 3CCJT 1A0NB 4IUUA 4PJOB 4D6WA 2LQ8A 3HRTA 3I56A 1VQMQ 1VQ9Q 3HPWA 4MZTA 2JTMA 1Q82C 1E6GA 2D9TA 2C0IA 1K1ZA 1NPRA 3P8DA 4BI3A 1KC8U 3EGXA 4C92A 4VUBA 1MNEA 2CUDA 1S72T 2JZ2A 2LX7A 1XNIA 1GCPA 1NEGA 3HKSA 4J9CA 4XTVA 4ELYC 1YIJQ 4HT9A 1GRIA 3SWNA 5M9OA 2L89A 1WJRA 1IGUA 3TREA 3KFVA 4M7DA 4HCCA 2CP7A 4E7LA 1T0JA 3I35A 1VQPT 3DLMA 2GBQA 4M77C 3CC7T 1IRXA 1G2BA 2LVMA 3OBYA 3H6ZA 5GMKl 3HP9A 1K8AU 5LL6S 4F7UF 3OQ5A 3FJ5A 1T0HA 2HSEB 3OMGA 4A4GA 4FT4A 1I5OB 3JCMh 1WXBA 5I2SA 2OJ2A 1M9SA 3EAEA 5I2MA 1IZ6A 4J9GA 1YJNA 3J80E 3UATA 1VQLA 1G3YA 5D6WA 1G3WA 3G4SQ 4B6MA 4E7KA 5C0MA 1M1KR 2HQHA 1OPKA 1RAFB 1NM7A 3O8VA 2E5KA 2PVDB 4PLLA 5CKBA 3CCET 3CPWA 4OB0B 3BW1A 3RKXA 2EGAA 4HVUA 2JS0A 1FWZA 1AD5A 3JCMe 4O6JA 1PHTA 3CCLQ 2M0YA 2YUQA 4R55A 3HSBA 1ZQ1A 2CSIA 1AOJA 1VQKT 3QKJA 3X25B 3GIBA 2XI9A 4XU2A 1ZA1B 3UT1A 4FYVB 2QQBA 2DZCA 4A4FA 3UPUA 3LGFA 1HK9A 3FC3A 1QCFA 1GBQA 3QDFA 2DPPB 2EKHA 5AT1B 1SHGA 3CCRA 2DILA 3HL8A 3VS4A 4RTUA 5GANj 3LWHA 4JDSA 1JB0E 4C8QF 4D8DA 5FWBA 2A3LA 2K57A 3WVEB 2DLPA 4JZ3A 1VQ8A 4BUGA 5CAIA 2F5KA 1IREB 1TS9A 2BE9B 2VUBA 4KUIA 3VS0A 2KXDA 3CCMA 2RH2A 2BKDN 3M0QA 3R6NA 3TSZA 4PJOC 1WQ7A 1KD1U 1K4US 3A8OB 2QI2A 3PFSA 2RJCA 2K3XA 3CCJQ 2HL3A 3OYLA 1G3TA 2C0TA 2J6FA 3M4YA 2J05A 3BY7A 4BI8B 1VQ7A 3BDUA 3FRNA 3EFSA 5CKFA 4M7AG 4HCKA 1V76A 2DA9A 1K0XA 1M5Q1 2GTOA 2GFAA 5GAMh 4M75B 4GLMA 3QG1A 2OAUA 1AWXA 4ZGDB 4ESRA 2R58A 2EGEA 4C0FA 1VQOA 2F2XA 2RHUA 2ZPFB 1S72Q 3GOXA 1XTDA 2VXEA 2DETA 3C95A 2MWPA 1F1BB 4L5GA 1M90U 4RCCA 4IURA 2DTHA 5CKEA 3H0IA 3NFCA 4FU6A 1ACMB 2CZ0B 1VQPQ 3M0UA 3MEVA 4M77D 1U1TA 1JXOA 1ZUYA 2VKNA 3WVDB 1RAGB 3CC7Q 3EGDA 2V26A 1QP3A 1NLOC 3LH5A 2JVVA 2MCNA 1WFWA 2K5LA 2K2VA 2CSQA 3M4GA 1W1FA 2IVWA 4KGVB 5A2QE 4FCYA 2CZ6B 2A7YA 2E3HA 1JJ2S 2YUPA 4E7JA 4AFUC 4IKFA 4BY6B 3RR6A 5DLOA 2KY9A 1GFDA 3CCVA 1WHKA 1IB8A 5LJ3h 4C5GA 5IHNA 2RMOA 1VIEA 4RMOA 2HD0A 3CCEQ 3M0RA 2RJDA 2LNHB 1K9MR 2OAWA 2DJZA 1AWOA 2XMFA 2QQAA 2DBKA 2RJEA 1GCQA 1UJ0A 2MOXA 3A5ZB 4BDYA 1KC8R 1N27A 1RL2A 2NUZA 2MK5A 2WSFE 1VQKQ 3G71T 1AVZC 5IT9E 1W2BS 4LNPA 4C0DB 4B9WA 1M8MA 1E7OA 5LJ3e 3EFOB 1OV3A 2QDYB 2DD5A 1X27A 3ZEHA 4F7UB 2YRCA 4IIOA 2FZKB 1AT1B 4OMOA 1D09B 4RKUE 1WHMA 1QQJA 2LJ0A 4J9DA 1ZSZB 2OTJA 3L1AA 4LXCA 2P4TA 5GAN8 1YCSB 5KE3A 1N5ZA 4FYWB 1D1AA 3I55A 3CCUA 1OULA 3EH2A 3VRYA 2RHIA 3CMET 3G6ET 4EIKA 1H92A 1WDXA 4KGZB 4KH1B 2QA4T 1VQMA 4JJCA 3CBOA 3M56A 1OZ2A 5LJ5f 5GAOl 1VQ9A 1X43A 4C92F 3VS2A 1K8AR 5CO7A 1WLPB 3MJXA 2JMCA 5IN1A 2E65A 3SD4A 4NS5A 4J6YA 2VC8A 3RERA 4ZNXA 4N4HA 2L2PA 4A63B 5KYUB 4BDZA 4M7DF 1YIJA 2SEMA 1U1SA 1UEBA 2QQRA 3CD6T 3REBB 1HYOA 4M75C 1U8RA 2CDTA 4QVZA 3JB9J 2H3EB 3LYIA 4FYXB 4OB3B 6AT1B 3P8HA 2LMJA 2XG8D 4C8QB 3OYJA 2K6DA 1KQSA 2KBTA 3PMIA 1FX7A 4IUQA 1AEYA 4JLGA 2MPXC 4C5HA 4DEYA 4OMMA 2QAZA 3L2QA 1M2VB 2RI3A 2M02A 5FROA 5FRNA 1Q7YU 3OS0A 4E7SA 1JO8A 2PQWA 2YLBA 3MP6A 5HK0A 1TUDA 4ORZA 3G4SA 1X6OA 4AG2C 1MMGA 4ELZC 3OS2A 1XJWB 4P5NA 2EQUA 4BY6C 1WNLA 1MGQA 2X3WD 2VB6A 3OSVA 1BI0A 4MZPA 4BE0A 2HAXA 5J39A 2AK5A 2BE7D 4FIBA 1M4ZA 4F16A 2R5MA 4F14A 1YWOA 2M0OA 3RMSA 4OMQA 1NE8A 4R56A 4PLIA 2EKOA 2OTLT 1BIAA 5GMKi 1KD1R 1JJ2P 3E1SA 3SB2A 2DEUA 2ZPHB 1VQ6T 3RKWA 3PGGA 3CC4A 2WSEE 3M5AA 1D3BB 1WPYA 1B07A 4HA8A 1M30A 1S1NA 3OYHA 2Z0WA 3C94A 4C0DC 2MMPA 2FZCB 2QYZA 3JB9F 5GAN5 3D7SB 2RHZA 1D1BA 2DL8A 2P0PA 2Y4YA 2AZSA 3ER0A 2HEQA 3OYDA 2A37A 3G71Q 3DLLA 1FXXA 2XU8A 1ZSZC 3CMAQ 5GAOr 1U06A 3KXTA 2M1HA 2V1QA 4A53A 1YHQT 1M90R 2NUTB 1FMVA 3GNGA 4PK4A 1YJWA 1TTHB 3PNWC 4FM4B 4M78E 4QQ6A 3DB4A 1T3SA 1BCOA 2ROLA 3ASKA 4OMNA 5EC7A 1UJYA 3RIRA 3JCMf 3JCMg 5GANh 3CMEQ 3JRZA 5HCKA 3CCJA 2FPDA 1NJIU 3G6EQ 4ZTJA 5FW9A 2JXBA 2AHJB 2XDPA 1UECA 1LCKA 3IQLA 2KRMA 4PJMA 2LRQA 1KQ1A 1YNZA 1HSQA 4CI0C 5I21A 3INZA 1RAEB 1UG1A 3QYHB 3S3NA 2QXFA 2XDDA 1S72A 2KT1A 4KH0B 2O01E 3CBPA 2AIRB 2BIVA 4FW1A 1Y96A 1MNDA 2EIFA 2MIOA 3E19A 4C8QC 1VQPA 4M7DG 1I4K1 2KR3A 1HXDA 2KXCA 2YRDA 4PL6A 2RK1A 2PVOB 3CC7A 3HRSA 4DEXA 5GAN4 1AHJB 5FWCA 4LUDA 4RTVA 4ZN1A 4FSSA 2OI3A 1VYUA 4PKCC 1KD1C 2V1RA 4J9IA 3BE3A 2LQWA 4M7AD 3H41A 3EGXB 3OYGA 3QWYA 4C92B 4DOVA 2XKOC 2COWA 4LDWA 2AKKA 2KE9A 3OW2S 2E3IA 1M8VA 1PSEA 2KSSA 1QVFA 4M78G 3JAME 1QCOA 5GJVB 2QDLA 4NL3A 2JNGA 1PD1A 2ZPGB 4XQ3A 3CCEA 2VV5A 2GCXA 1N9SA 4LDUA 2YDLA 2JTEA 3CCST 4C5EA 5GAN7 2EBPA 1UTIA 1M90C 1XQHA 3M53A 3A1PA 1Q86U 4O5VA 3OMCA 5KE2A 5FU6B 5KYWA 1PG5B 2LCSA 1VQKA 2OTLQ 4GLKA 1M27C 5D7UA 2JUFA 3JCMd 5GAMf 3A8HB 1VQ6Q 3CCQA 4LDVA 4KGXB 5GAMg 1MUZA 2KT8A 2V8IA 2MF2A 1WX6A 1BI1A 1B7TA 3C0CA 3JCMJ 4C0GA 1YFNA 1EX4A 4MMKA 1ZUKA 2XDBA 2E6ZA 1K76A 2KROA 3RMQA 3E2UA 3JB9G 1YITA 2CREA 3JCMb 4ATOA 2HZYA 3LX7A 2GQVA 2RPNA 1YHQQ 3U23A 2RQRA 3L2VA 2B86A 1BU1A 3GLXA 4RG2A 1EIFA 2KMTA 1Z9QA 9ATCB 4J9FA 4Y28E 1Q7YR 1SRMA 3EFRA 2DVJA 3X24B 2HCKA 2X9HA 2LQKA 3OYNA 1VIFA 2VYTA 4M78A 2ENMA 3ULRB 4CC3A 1BIBA 2E70A 1YJ9A 4LN2A 5LJ3f 2KDSA 4IUTA 5LJ3g 4OGCA 2FO0A 2ZPEB 3OYYA 5KH6A 3M55A 2O9SA 3EHRA 1SRLA 4HVWA 1CKBA 4C8QD 1Y7XA 1I07A 2DEQA 2HSPA 3FLGA 3I56T 5AYFA 3CXCS 3T9NA 3CC2T 5KYXA 1BK2A 2E41A 2QK0A 4FW2A 1GBRA 3EG0A 3PTAA 4C92C 5CVIA 2O2OA 1UGQB 1QVGP 3OB9A 3OYIA 2LZ6B 5GAMd 1SEMA 2PU9B 2DIGA 1Q81U 4PNOA 2JN0A 2LCCA 2V8KA 2QGFB 2NUPA 4WTOB 2DK3A 5GMKj 3O5ZA 2JM8A 5LJ5j 2DFUA 1VQNT 4RTXA 1BI2A 1SPKA 1QWEA 1X2KA 2LT4A 3MPUB 1ZX6A 1VQ5Q 1SSFA 1UE9A 2K5FA 3HHTB 3NHNA 5FU6C 1NJIR 2KAFA 3QYGB 4Z8AA 3EGDB 2K5IA 1Y0MA 3CCSQ 2AKLA 4KBMB 3JCMV 2HDAA 4Z88A 1XOVA 1YJNT 3EH1A 3I5RA 2DXTA 4E7IA 3CQTA 3G71A 1VQLT 3HFOA 4L6V5 2RK2A 4JJBA 1H641 3UF4A 2HQXA 1Q7YC 3M9QA 2RI2A 2X4YA 1UFFA 2W0ZA 2L3PA 1C6VX 2BZ8A 3NMZC 2CZ7B 3CMAA 2SRCA 1K73U 1M1KC 1EZZB 1QMCA 1ZBJA 3V8JA 2X4WA 2PUKB 2RHXA 5GAOn 2YUNA 1TUCA 4OMPA 2ZPBB 2M51A 5LJ3d 1W70A 1TSFA 3EGUA 1WXUA 5CKDA 2H3JA 5GAMe 3EG3A 1NLPC 4N4IA 3CMEA 1NPPA 1ZHIA 4K11A 1Q82U 4EMKA 3Q1JA 4M7AB 2BZXA 2JT4A 4J7IA 2EYZA 2BUDA 1Q95G 4EMHA 2F2WA 1Z9ZA 1YBYA 3CCRT 2COZA 2EJGA 2RF0A 3PE0A 1PD0A 3GPLA 2J6OA 1WJQA 1NYFA 1CSKA 3OYKA 2KK4A 4DBFA 2K79A 1R8OB 2RM4A 4E6RA 3VUZA 4JS4A 3L2UA 2GNCA 2KVQG 1GFCA 2XICA 3HTRA 4XTZA 3RUXA 2F69A 3VS3A 4BB7A 1RAAB 1M1FA 2CP2A 2CUBA 2CP5A 2D0NA 3VU3C 1Q86R 2YXYA 4F04B 3V7SA 2RNAA 2KNBB 3QPHA 1YWPA 3VS6A 3I56Q 4LUEA 1IHWA 3PVLA 4J9BA 1VQ7T 4ZGEB 2EQIA 3CC2Q 2DL4A 4CC4B 2EVRA 4C92D 1QVFS 1C0MA 1JRIA 1UUEA 3NGPA 1H8KA 3S6WA 2JW4A 3KUFA 2D8HA 2M9UA 4KULA 1VQOT 3M0SA 3CXCP 4BD3A 2FYKA 2WACA 4DQ2A 4M7DD 4PFZA 4XU0A 1C1AA 2LP5A 1YI2T 3LW5E 5GANf 1VOMA 4NOYA 4Y91A 5GANg 1VQNQ 1KK7A 4FL6A 1I81A 2O4XA 4MDXA 3MEAA 4E47A 4M77E 2ESWA 4X1VA 5L8RE 2EGCA 1U5SA 4ZN3A 4JPBW 2JOYA 1AWWA 4A4KA 3HFNA 5GAOq 3UA7A 1ZBXA 1G5VA 4KUDK 3EFOA 1YJNQ 2G6FX 3UWNA 2KEAA 2DO3A 1BYMA 3PIOA 1VQLQ 2QEXT 2MI6A 4LD6A 1OZ3A 2FPFA 3CCVT 1OU9A 2V8JA 3MO8A 1D0ZA 2EAYA 1BCMA 1PRMC 5ECAA 2XHCA 1YHQA 1OI1A 1WHJA 4JJDA 3VKIA 2DXCA 2KYBA 4XU3A 1YN8A 4PJNA 3CEYA 1HD3A 1K9MC 4N0AC 4M7AC 1UGPB 1ZSGA 4M78F 3MP1A 2I0NA 2FHDA 3JSCA 1JBMA 1TOVA 3RDVA 2YUOA 4QKUA 1OEBA 4XK8E 3CPWS 4DOWA 1UGVA 1QWFA 4X9DA 1Q86C 1KC8C 3GF5A 1ZLMA 5J3BA 4IIMA 3OYFA 4V2SA 1WHHA 3C4SA 2QQSA 2CP0A 2YT6A 3FB9A 1KFZA 2DRKA 3QXEB 1IHVA 1NEBA 3CCRQ 1Q81R 2XK0A 3JB9D 2ZCFB 3I9QA 5DY9A 7AT1B 3S3OA 3CCLA 2QTXA 2CH4W 3JCMX 2FRYA 3A8GB 1VQ4T 4RTZA 2FG0A 4J83A 3I55T 1JU5C 3CCUT 2RI5A 4KRTA 1PNJA 2L3SA 3GNFB 3DKMA 4AT1B 4HCBA 4AFSC 1ABQA 5L23A 1M3CA 3J7AF 1MMAA 3OYEA 3FEOA 2L0AA 5GANd 1NBEB 4M77G 1K8AC 1M2VA 1BKBA 3E9GA 1G83A 1RUWA 1AZGB 1UGRB 2AT1B 3URGA 4PJOE 4CC7A 3JV3A 5CK9A 2CT3A 2NWMA 4RUGA 3EG1A 2EQJA 1TH7A 1B34B 4A54A 1VQ7Q 1NYGA 2FRWA 2J7IA 2DM1A 1W2BP 5CCAA 2RQVA 4OMLA 1GL5A 4JZ4A 2HKNA 4FSXA 1GXIE 2C06A 5CQXA 1UHFA 1Y96B 1VQOQ 1VQ5A 2VVKA 1X01A 4JRIA 1R0CB 3AHUA 2X35A 3CPFA 1YI2Q 5KYYA 3VS5A 2QA4Q 1Q82R 1T3LA 3CCSA 4II1A 4OP0A 4JS5A 2NLUA 1QLYA 1RADB 3DB3A 4JLIA 1D3BA 2E4HA 1PRLC 3MP8A 4LD9K 3M0PA 2CS7A 4E2FB 1OX9A 5GMKh 1EFNA 5LJ5h 1NZ9A 1MMNA 2GGRA 2RN8A 3WXMB 1RAIB 3CD6Q 2KI7A 1P92A 5GANe 3VRZA 2ABLA 2EYXA 3FIFA 3TSWA 2QTVA 4OF1A 5A0DA 2ECZA 1MV0B 2VWFA 1JJ2A 1Q81C 4M77A 3M54A 2QEXQ 1WGSA 2DKGA 2O9VA 3GBQA 3L2ZA 2QQ9A 3OYAA 2P0KA 4J5YA 2CP6A 4FT2A 3MEWA 2A36A 3OA6A 3HRUA 2C0OA 2ED0A 2JTFA 4XU1A 5KYWB 3CC4T 5CQYA 3ME9A 4A4EA 2E5QA 5J26A 1RABB 2DYIA 4PJOG 3H0FA 1X6BA 1QP2A 2A0FB 3SWNB 2FPEA 4LDXA 3PVQA 1N9RA 4M7DB 3EG9A 2KQWA 3VV0A 2D8JA 2F2VA 4Z02A 4R0KA 4HXJA 1YJWT 3H0HA 1LJOA 4PFPA 2CZ1B 2X4XA 2ZAEA 3ZBDA 4OMFB 4LE9A 1OX8A 2E64A 2L3QA 1VQ4Q 1RI9A 1OU8A 4QW2A 3JCMc 3I55Q 3CCUQ 1WJSA 1N8RU 2EYYA 1AWJA 3SEMA 2RHYA 2L3RA 3OBWA 3CC2A 3A8LB 1KHCA 1LNXA 2VGMA 3MHXA 3QJYA 1DJ7B 3EG2A 3VJPA 1ARKA 4M78B 2KYMA 1ZA2B 2GTJA 1K0SA 2H8HA 2D6FA 3V7RA 2LTOA 4XTWA 4IUVA 5GAN6 4JRKA 1D0XA 2ZPIB 1WA7A 3L2RA 2D0QB 1IXDA 3QIIA 2M16A 2MYSA 2PNIA 3QSUA 1WZOA 4BACA 1SSHA 5GMKm 1VQNA 4M75E 5KCHA 1D1CA 4PJOA 4XTXA 1WI7A 4QVDA 2J06A 1RAHB 2MWOA 1MHNA 5HK3A 3VYGA 3FDRA 2GFUA 1BB9A 2FVUA 4DBQA 5KYXB 1B3QA 1W4SA 2X3XD 1G3SA 1M3AA 1QKWA 2RQUA 4C0ZA 3QUIA 3RNJA 2EQMA 3PT9A 3M59A 3TCJA 1M1GA 4MMLA 5DLQE 3NPFA 2P4RA 1KQSS 1TG0A 2CKKA 4AG1C 1JEGA 3OS5A 3JCMQ 2DTIA 1AZEA 4PJJA 5IH2A 4M7AE 2O88A 2IPOB 3UA6A 2DL3A 2NUPB 5GAN3 5GAOp 5IXBA 3QDRB 2IIMA 2HNIA 1VA7A 4XAXB 3OYCA 2D1XA 2HMAA 5IHIA 4DA4A 2HKQB 1LPLA 1KIKA 2JJ9A 3OY9A 1OYXA 2RQWA 3CCQT 3CBMA 2YHTA 1Y71A 4EDUA 3SWNC 1FMKA 2DL5A 3CC4Q 1TXQA 2RD1A 2K3YA 3OS1A 4Z89A 2RB6A 4UC4A 2K2MA 2KRNA 4M7DC 2RA2A 4YTLA 2CP3A 1PM3A 3LH0A 1N6AA 3N5BB 3X28B 4ANJA 1YITT 1QVPA 4J9EA 4F7UE 4M75G 2P0QA 2DZ9A 5CR2A 2Y4XA 1Y57A 2DD4A 3OW2P 1UHCA 4A4HA 1YJWQ 2AZVA 4EMKB 2LJ3A 4JRPA 2FZGB 4DBRA 2DBMA 4M78C 1R0BG 4WF2A 8AT1B 1YJ9T 1RLPC 2K4YA 2DX1A 4CRIA 1QW1A 2OX7A 4JUVA 4MDWA 2YSQA 3L42A 2VXFA 1FMWA 5GJWB 3VS7A 3E9FA 1I5LA 1J3TA 3FJPA 3G6EA 4C5IA 1YI2A 1H3ZA 2QA4A 2DXUA 4GBQA 2E1HA 4WCIA 1FYNA 2K3BA 4GY5A 5A0GA 5D6XA 4J8OA 2FL7A 2X51A 4RCBA 3TEEA 2DJQA 1PCXA 3QO3A 3NTIA 2G3RA 4AFQC 4AFZC 4C8QE 2LX9A 1QVGA 2DYBA 2IG0A 1KHIA 5KCOA 2PVGB 3CD6A 1CKAA 1VYVA 4TVRA 2XIDA 3JB9I 1I0CA 4M75A 1VQ8T 2O31A 5KYNA 2EWNA 4M77F 4RTTA 5D6YA 1V1CA 2LQNA 2WSCE 3RKYA 4F7UG 3CCMT 2QEXA 3QZ5B 2LJ1A 4NL2A 3C12A 1NG2A 3META 2R5AA 5GAN2 2VGNA 4XTYA 2EJ9A 4HT8A 4D8KA 5HKCA 4OB2B 3KBGA 3OW2A 1SG5A 1H3HA 2DNUA 1M3BA 1UB4A 1KQSP 2DF6A 3LGLA 1UGSB 1N8RR 2E12A 5EG2A 1R77A 1D0YA 4RTWA 1RACB 4N0AA 4M7AA 1NJIC 2O4XB 2A28A 4Q5WA 2RO0A 4KT0E 5FU7B 2KGTA 1RLQC 2DXBA 2EQKA 4M4ZA 5FRMA 4E7HA 3CCQQ 3JCMP 3M58A 3CMAT 2ATCB 1TUGB 3PIPA 2J6KA 4F17A 3VUBA 1QCNA 4FYYB 3V7CA 2XD0A 1TU0B 2F5TX 1OQKA 1PSFA 2EYWA 4RG8A 2RQTA 2EYQA 1YCYA 1VQ4A 3X20B 3SFMA 2OTLA 1MMDA 1UDLA 1YITQ 5GAOm 2COYA 2R57A 1VQ6A 3SDZA 4EMKC 1KG1A 2EJFA 4C8QG 2ED1A 4PJOD 1Y07A 5LJ5g 3H8ZA 2QASA 3VS1A 1PKSA 1LOJA 2LNVA 2KRSA 2PZ1A 3G1JA 4F7UA
chains in the Genus database with same CATH topology
2RPNA 3U23A 2RQRA 1X6GA 5I11A 2B86A 1QLYA 1BU1A 1PRLC 3M0PA 3RBBB 2A08A 3H0IA 1Z9QA 1EFNA 4J9FA 1SRMA 2GGRA 3M0UA 2RN8A 1I1JA 1JXOA 1ZUYA 2DVJA 2HCKA 2VKNA 2JM9A 2K9GA 3VRZA 2ABLA 2ENMA 2EYXA 1NLOC 3ULRB 1YP5A 3LH5A 4CC3A 2MCNA 1WFWA 3TSWA 1GCQC 4LN2A 2CSQA 2HBWA 1W1FA 2ECZA 1MV0B 2VWFA 2FO0A 2O9VA 3GBQA 2YUPA 4AFUC 2O9SA 3EHRA 2W10A 1SRLA 2A36A 4HVWA 1CKBA 2C0OA 2ED0A 2DMOA 1GFDA 1I07A 2HSPA 1OPLA 5IHNA 2RMOA 3H0FA 1OOTA 1X6BA 3M0RA 1ABOA 2FPEA 2LNHB 1BK2A 2OAWA 3PVQA 1GBRA 4CC2A 1X69A 1AWOA 3EG0A 2XMFA 1JQQA 3A98A 2DBKA 2O2OA 1GCQA 1UJ0A 2D8JA 2MOXA 2F2VA 4Y92A 2CH4A 2NUZA 1AVZC 2LZ6B 4R0KA 4LNPA 1SEMA 4HXJA 4RTYA 3H0HA 1M8MA 1E7OA 3THKA 1W6XA 1OV3A 1X27A 1K9AA 4IIOA 4LE9A 4OMOA 2L3QA 1RI9A 2JM8A 3O5ZA 2LJ0A 4J9DA 4RTXA 1SPKA 1PWTA 1QWEA 1X2KA 2EYYA 1YCSB 1SHFA 1ZX6A 1AWJA 3SEMA 1KJWA 1N5ZA 3M0TA 1UE9A 3NHNA 3SHWA 3EG2A 4Z8AA 3VRYA 1ARKA 1Y0MA 2CT4A 3TVTA 2KYMA 1WDXA 4EIKA 1H92A 2AKLA 2GTJA 2HDAA 1K0SA 2H8HA 4JJCA 4Z88A 1XOVA 1X43A 4HVVA 3VS2A 3I5RA 2DRMA 1WLPB 3CQTA 2JMCA 1U3OA 4JJBA 3UF4A 1WA7A 1UFFA 2W0ZA 2L3PA 2BZ8A 4ZNXA 3NMZC 2SRCA 2L2PA 4A63B 3QWXX 2DE0X 1ZBJA 5I22A 1HJDA 2PNIA 2SEMA 1KSWA 1SSHA 3REBB 2YUNA 1TUCA 4OMPA 1WI7A 2M51A 2J06A 1IO6A 3EHQA 1W70A 2BZYA 1ZUUA 2CDTA 2JMAA 3EGUA 1BB9A 1WXUA 3EG3A 1NLPC 3REAB 1B3QA 2LMJA 2X3XD 4K11A 1JXMA 1M3AA 1QKWA 2RQUA 1WXTA 2BZXA 2JT4A 3ZL7C 3RNJA 2K6DA 2KBTA 2EYZA 1AEYA 3NPFA 2P4RA 1TG0A 2F2WA 1Z9ZA 4DEYA 5IHKA 4AG1C 1JEGA 4OMMA 1AZEA 5IH2A 2O88A 3UA6A 1BBZA 2DL3A 2RF0A 3PE0A 1JO8A 1VYTA 2J6OA 4J9HA 5IXBA 2IIMA 1TUDA 4ORZA 1NYFA 1VA7A 1CSKA 4AG2C 2DL7A 5IXFA 2K79A 2D1XA 4E6RA 5IHIA 2GNCA 1WYXA 2ROTA 1GFCA 2X3WD 2EPDA 3VS3A 1KIKA 2AK5A 2CUBA 2BTTA 2JS2A 1QKXA 2RQWA 4QT7A 2D0NA 4F16A 4F14A 1YWOA 2GQIA 2PTKA 1WIEA 2FEIA 1FMKA 2DL5A 4OMQA 2K7AA 2RNAA 2KNBB 4Z89A 1YWPA 2K2MA 2KRNA 1E6HA 3I5SA 3VS6A 4LUEA 1PKTA 3PVLA 4J9BA 1MV3A 2EQIA 2DL4A 4CC4B 2EVRA 1B07A 1M30A 2EW3A 1S1NA 1UUEA 1X2QA 1H8KA 3NGPA 1A0NB 2JW4A 4J9EA 2D8HA 2DL8A 3M0SA 1Y57A 2AZSA 1E6GA 2C0IA 1K1ZA 2HEQA 2A37A 1UHCA 2LP5A 2AZVA 2CUDA 2LX7A 1U06A 1GCPA 1NEGA 2LJ3A 4J9CA 2V1QA 1GRIA 2DBMA 3KFVA 1T3SA 2ROLA 1T0JA 4OMNA 3I35A 5EC7A 1RLPC 1UJYA 2DX1A 2ESWA 4X1VA 2GBQA 2EGCA 1U5SA 5HCKA 4JPBW 2FPDA 2YSQA 1AWWA 1G2BA 5FW9A 2JXBA 3UA7A 5GJWB 1UECA 1LCKA 3IQLA 2KRMA 3VS7A 2G6FX 1YNZA 2KEAA 1HSQA 1J3TA 3FJ5A 1T0HA 2FPFA 1UG1A 1WXBA 2OJ2A 4GBQA 4J9GA 4WCIA 1FYNA 2K3BA 2KT1A 3UATA 5ECAA 1PRMC 2DJQA 4JJDA 4AFQC 2KYBA 4AFZC 1YN8A 1HD3A 2MIOA 1ZSGA 1OPKA 2DYBA 1NM7A 2KR3A 2E5KA 2I0NA 1CKAA 1VYVA 2KXCA 2YUOA 2EGAA 4HVUA 1I0CA 1OEBA 2JS0A 2O31A 1UGVA 1QWFA 4DEXA 1AD5A 5FWCA 1ZLMA 4RTTA 4LUDA 4IIMA 1PHTA 4RTVA 2M0YA 2YUQA 4FSSA 1V1CA 2LQNA 2OI3A 2YT6A 1VYUA 2CSIA 2V1RA 4J9IA 1KFZA 1AOJA 2DRKA 2LQWA 1NEBA 3H41A 2LJ1A 3QWYA 1NG2A 3I9QA 4D8KA 2CH4W 1H3HA 2FRYA 2AKKA 2DNUA 1M3BA 1QCFA 2KE9A 1GBQA 4RTZA 2FG0A 2DF6A 2EKHA 1JU5C 1SHGA 2DILA 4KRTA 1PNJA 2L3SA 4RTWA 3VS4A 4RTUA 5GJVB 2QDLA 4AFSC 1ABQA 5L23A 2A28A 1M3CA 4D8DA 5FWBA 2L0AA 2DLPA 4JZ3A 2KGTA 1RLQC 2YDLA 2JTEA 4M4ZA 2EBPA 1UTIA 1G83A 1RUWA 1AZGB 2J6KA 2KXDA 3VS0A 2LCSA 3M0QA 4CC7A 4F17A 3R6NA 3TSZA 1M27C 3JV3A 2CT3A 2NWMA 4RUGA 3EG1A 1K4US 2EYWA 2RQTA 1MUZA 2KT8A 1NYGA 2FRWA 2J7IA 2DM1A 1WX6A 1UDLA 2RQVA 4OMLA 1GL5A 3C0CA 2C0TA 4JZ4A 2J6FA 2J05A 1ZUKA 1UHFA 2VVKA 4HCKA 2ED1A 2DA9A 1K0XA 2GTOA 1K76A 2KROA 3VS5A 2CREA 4GLMA 1T3LA 1AWXA 3VS1A 1PKSA 2PZ1A 4ESRA 2KRSA 2EGEA 2F2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPN A;  3U23 A;  2RQR A;  1X6G A;  5I11 A;  2B86 A;  1QLY A;  1BU1 A;  1PRL C;  3M0P A;  3RBB B;  2A08 A;  3H0I A;  1Z9Q A;  1EFN A;  4J9F A;  1SRM A;  2GGR A;  3M0U A;  2RN8 A;  1I1J A;  1JXO A;  1ZUY A;  2DVJ A;  2HCK A;  2VKN A;  2JM9 A;  2K9G A;  3VRZ A;  2ABL A;  2ENM A;  2EYX A;  1NLO C;  3ULR B;  1YP5 A;  3LH5 A;  4CC3 A;  2MCN A;  1WFW A;  3TSW A;  1GCQ C;  4LN2 A;  2CSQ A;  2HBW A;  1W1F A;  2ECZ A;  1MV0 B;  2VWF A;  2FO0 A;  2O9V A;  3GBQ A;  2YUP A;  4AFU C;  2O9S A;  3EHR A;  2W10 A;  1SRL A;  2A36 A;  4HVW A;  1CKB A;  2C0O A;  2ED0 A;  2DMO A;  1GFD A;  1I07 A;  2HSP A;  1OPL A;  5IHN A;  2RMO A;  3H0F A;  1OOT A;  1X6B A;  3M0R A;  1ABO A;  2FPE A;  2LNH B;  1BK2 A;  2OAW A;  3PVQ A;  1GBR A;  4CC2 A;  1X69 A;  1AWO A;  3EG0 A;  2XMF A;  1JQQ A;  3A98 A;  2DBK A;  2O2O A;  1GCQ A;  1UJ0 A;  2D8J A;  2MOX A;  2F2V A;  4Y92 A;  2CH4 A;  2NUZ A;  1AVZ C;  2LZ6 B;  4R0K A;  4LNP A;  1SEM A;  4HXJ A;  4RTY A;  3H0H A;  1M8M A;  1E7O A;  3THK A;  1W6X A;  1OV3 A;  1X27 A;  1K9A A;  4IIO A;  4LE9 A;  4OMO A;  2L3Q A;  1RI9 A;  2JM8 A;  3O5Z A;  2LJ0 A;  4J9D A;  4RTX A;  1SPK A;  1PWT A;  1QWE A;  1X2K A;  2EYY A;  1YCS B;  1SHF A;  1ZX6 A;  1AWJ A;  3SEM A;  1KJW A;  1N5Z A;  3M0T A;  1UE9 A;  3NHN A;  3SHW A;  3EG2 A;  4Z8A A;  3VRY A;  1ARK A;  1Y0M A;  2CT4 A;  3TVT A;  2KYM A;  1WDX A;  4EIK A;  1H92 A;  2AKL A;  2GTJ A;  2HDA A;  1K0S A;  2H8H A;  4JJC A;  4Z88 A;  1XOV A;  1X43 A;  4HVV A;  3VS2 A;  3I5R A;  2DRM A;  1WLP B;  3CQT A;  2JMC A;  1U3O A;  4JJB A;  3UF4 A;  1WA7 A;  1UFF A;  2W0Z A;  2L3P A;  2BZ8 A;  4ZNX A;  3NMZ C;  2SRC A;  2L2P A;  4A63 B;  3QWX X;  2DE0 X;  1ZBJ A;  5I22 A;  1HJD A;  2PNI A;  2SEM A;  1KSW A;  1SSH A;  3REB B;  2YUN A;  1TUC A;  4OMP A;  1WI7 A;  2M51 A;  2J06 A;  1IO6 A;  3EHQ A;  1W70 A;  2BZY A;  1ZUU A;  2CDT A;  2JMA A;  3EGU A;  1BB9 A;  1WXU A;  3EG3 A;  1NLP C;  3REA B;  1B3Q A;  2LMJ A;  2X3X D;  4K11 A;  1JXM A;  1M3A A;  1QKW A;  2RQU A;  1WXT A;  2BZX A;  2JT4 A;  3ZL7 C;  3RNJ A;  2K6D A;  2KBT A;  2EYZ A;  1AEY A;  3NPF A;  2P4R A;  1TG0 A;  2F2W A;  1Z9Z A;  4DEY A;  5IHK A;  4AG1 C;  1JEG A;  4OMM A;  1AZE A;  5IH2 A;  2O88 A;  3UA6 A;  1BBZ A;  2DL3 A;  2RF0 A;  3PE0 A;  1JO8 A;  1VYT A;  2J6O A;  4J9H A;  5IXB A;  2IIM A;  1TUD A;  4ORZ A;  1NYF A;  1VA7 A;  1CSK A;  4AG2 C;  2DL7 A;  5IXF A;  2K79 A;  2D1X A;  4E6R A;  5IHI A;  2GNC A;  1WYX A;  2ROT A;  1GFC A;  2X3W D;  2EPD A;  3VS3 A;  1KIK A;  2AK5 A;  2CUB A;  2BTT A;  2JS2 A;  1QKX A;  2RQW A;  4QT7 A;  2D0N A;  4F16 A;  4F14 A;  1YWO A;  2GQI A;  2PTK A;  1WIE A;  2FEI A;  1FMK A;  2DL5 A;  4OMQ A;  2K7A A;  2RNA A;  2KNB B;  4Z89 A;  1YWP A;  2K2M A;  2KRN A;  1E6H A;  3I5S A;  3VS6 A;  4LUE A;  1PKT A;  3PVL A;  4J9B A;  1MV3 A;  2EQI A;  2DL4 A;  4CC4 B;  2EVR A;  1B07 A;  1M30 A;  2EW3 A;  1S1N A;  1UUE A;  1X2Q A;  1H8K A;  3NGP A;  1A0N B;  2JW4 A;  4J9E A;  2D8H A;  2DL8 A;  3M0S A;  1Y57 A;  2AZS A;  1E6G A;  2C0I A;  1K1Z A;  2HEQ A;  2A37 A;  1UHC A;  2LP5 A;  2AZV A;  2CUD A;  2LX7 A;  1U06 A;  1GCP A;  1NEG A;  2LJ3 A;  4J9C A;  2V1Q A;  1GRI A;  2DBM A;  3KFV A;  1T3S A;  2ROL A;  1T0J A;  4OMN A;  3I35 A;  5EC7 A;  1RLP C;  1UJY A;  2DX1 A;  2ESW A;  4X1V A;  2GBQ A;  2EGC A;  1U5S A;  5HCK A;  4JPB W;  2FPD A;  2YSQ A;  1AWW A;  1G2B A;  5FW9 A;  2JXB A;  3UA7 A;  5GJW B;  1UEC A;  1LCK A;  3IQL A;  2KRM A;  3VS7 A;  2G6F X;  1YNZ A;  2KEA A;  1HSQ A;  1J3T A;  3FJ5 A;  1T0H A;  2FPF A;  1UG1 A;  1WXB A;  2OJ2 A;  4GBQ A;  4J9G A;  4WCI A;  1FYN A;  2K3B A;  2KT1 A;  3UAT A;  5ECA A;  1PRM C;  2DJQ A;  4JJD A;  4AFQ C;  2KYB A;  4AFZ C;  1YN8 A;  1HD3 A;  2MIO A;  1ZSG A;  1OPK A;  2DYB A;  1NM7 A;  2KR3 A;  2E5K A;  2I0N A;  1CKA A;  1VYV A;  2KXC A;  2YUO A;  2EGA A;  4HVU A;  1I0C A;  1OEB A;  2JS0 A;  2O31 A;  1UGV A;  1QWF A;  4DEX A;  1AD5 A;  5FWC A;  1ZLM A;  4RTT A;  4LUD A;  4IIM A;  1PHT A;  4RTV A;  2M0Y A;  2YUQ A;  4FSS A;  1V1C A;  2LQN A;  2OI3 A;  2YT6 A;  1VYU A;  2CSI A;  2V1R A;  4J9I A;  1KFZ A;  1AOJ A;  2DRK A;  2LQW A;  1NEB A;  3H41 A;  2LJ1 A;  3QWY A;  1NG2 A;  3I9Q A;  4D8K A;  2CH4 W;  1H3H A;  2FRY A;  2AKK A;  2DNU A;  1M3B A;  1QCF A;  2KE9 A;  1GBQ A;  4RTZ A;  2FG0 A;  2DF6 A;  2EKH A;  1JU5 C;  1SHG A;  2DIL A;  4KRT A;  1PNJ A;  2L3S A;  4RTW A;  3VS4 A;  4RTU A;  5GJV B;  2QDL A;  4AFS C;  1ABQ A;  5L23 A;  2A28 A;  1M3C A;  4D8D A;  5FWB A;  2L0A A;  2DLP A;  4JZ3 A;  2KGT A;  1RLQ C;  2YDL A;  2JTE A;  4M4Z A;  2EBP A;  1UTI A;  1G83 A;  1RUW A;  1AZG B;  2J6K A;  2KXD A;  3VS0 A;  2LCS A;  3M0Q A;  4CC7 A;  4F17 A;  3R6N A;  3TSZ A;  1M27 C;  3JV3 A;  2CT3 A;  2NWM A;  4RUG A;  3EG1 A;  1K4U S;  2EYW A;  2RQT A;  1MUZ A;  2KT8 A;  1NYG A;  2FRW A;  2J7I A;  2DM1 A;  1WX6 A;  1UDL A;  2RQV A;  4OML A;  1GL5 A;  3C0C A;  2C0T A;  4JZ4 A;  2J6F A;  2J05 A;  1ZUK A;  1UHF A;  2VVK A;  4HCK A;  2ED1 A;  2DA9 A;  1K0X A;  2GTO A;  1K76 A;  2KRO A;  3VS5 A;  2CRE A;  4GLM A;  1T3L A;  1AWX A;  3VS1 A;  1PKS A;  2PZ1 A;  4ESR A;  2KRS A;  2EGE A;  2F2X A; 
#chains in the Genus database with same CATH topology
 2L5Q A;  2F1L A;  4J6X A;  2DTO A;  3LLR A;  2MAM A;  4M78 D;  5I11 A;  1X6G A;  4PFO A;  5A0L A;  1ZSZ A;  2DIQ A;  4OB1 B;  3RBB B;  2A08 A;  2HQE A;  3TQ7 P;  3S3M A;  1YJ9 Q;  2LT1 A;  4PJO F;  3LWI A;  3OYM A;  1I1J A;  3OYB A;  1WHL A;  2VAS A;  2JM9 A;  2K9G A;  4BI4 A;  3UDC A;  2LCL A;  4HCZ A;  1YP5 A;  2QGG A;  4J6W A;  1GCQ C;  3GP8 A;  2HBW A;  4J7F A;  4DBH A;  3JCM W;  5IAY A;  1LVK A;  5KYU A;  2LC4 A;  2W10 A;  4MZM A;  3F70 A;  4XTU A;  2DMO A;  1N8R C;  2OTJ T;  3NTH A;  1M1K U;  1OPL A;  2B8A A;  3CXC A;  1OOT A;  4OGE A;  2GF7 A;  1V29 B;  1ABO A;  4EMG A;  1O75 A;  3BFM A;  2ZGW A;  1VQ8 Q;  2I2L A;  4HKE A;  3G7Z A;  4CC2 A;  4C92 E;  1X69 A;  4JRQ A;  1PC0 A;  4C8Q A;  1JQQ A;  5C6S A;  3A98 A;  5GAM j;  1VQM T;  4AMC A;  1VQ9 T;  2NYS A;  3BDL A;  1X75 C;  4PJL A;  4Y92 A;  2CH4 A;  4N4G A;  3CCM Q;  4RTY A;  5KYY B;  3V8K A;  1IGQ A;  4M7D E;  3TU4 K;  3THK A;  1BI3 A;  1W6X A;  3MCA B;  5CKH A;  2YWW A;  4QVC A;  1K9A A;  1WQW A;  2X4J A;  1SF9 A;  1YIJ T;  2QG9 B;  5FU7 C;  2LDM A;  1PWT A;  1KQ2 A;  1K73 R;  1SHF A;  5LJ5 d;  1KJW A;  3M57 A;  3M0T A;  2DAQ A;  2PUO B;  2L8D A;  3SHW A;  2E10 A;  2YRV A;  2CT4 A;  3TVT A;  4QQG A;  1VUB A;  3QJ6 A;  4ME7 A;  3X26 B;  1M2O A;  1WHG A;  3QHS A;  1QVF P;  4HVV A;  2DRM A;  4M77 B;  1U3O A;  1SKU B;  3QZ9 B;  4QQD A;  4LDY A;  2DER A;  3QWX X;  2DE0 X;  5I22 A;  1HJD A;  2EFI A;  5LJ3 j;  8ATC B;  3VYH B;  1KSW A;  4E7Z A;  3G4S T;  2HL5 C;  1IO6 A;  3RES A;  3EHQ A;  2BZY A;  1ZUU A;  2CYZ B;  2JMA A;  3QBY A;  5CIU A;  5DM7 R;  3REA B;  3NTK A;  3MEU A;  1JXM A;  3EG9 B;  1WXT A;  3ZL7 C;  4C92 G;  3CCL T;  1B34 A;  3V8L A;  3A8M B;  3H9N A;  4M75 D;  2NUT A;  3J81 E;  5IHK A;  3CCV Q;  4BE2 A;  5GMK e;  1G8X A;  2P84 A;  5FLX E;  5LJ5 e;  4IUP A;  2CGH A;  4JJN K;  1BBZ A;  3ZFJ A;  1RI0 A;  1VYT A;  2Y90 A;  4J9H A;  1QVG S;  3OSS C;  4OVA A;  4X9C A;  2DL7 A;  5IXF A;  3P8B B;  2DVE A;  1WYX A;  2ROT A;  4M75 F;  2ZZD A;  2E6N A;  1O9S A;  2EPD A;  3JB9 H;  4L59 A;  4ZTF A;  2BTT A;  2JS2 A;  1QKX A;  4QT7 A;  3PMT A;  1W2B A;  1I8F A;  2PTK A;  2GQI A;  1WIE A;  2FEI A;  4BE1 A;  3R6O A;  2YLC A;  5HY6 A;  2K7A A;  3L2W A;  3CPW P;  1K73 C;  2OTJ Q;  2FB7 A;  1E6H A;  3I5S A;  4B9X A;  1TWB A;  1PKT A;  4EPC A;  4X34 A;  1MV3 A;  1VQ5 T;  4ZGJ B;  3MKD A;  2EW3 A;  1K9M U;  4M7A F;  2HBP A;  2RJF A;  1X2Q A;  3AT1 B;  3CCJ T;  1A0N B;  4IUU A;  4PJO B;  4D6W A;  2LQ8 A;  3HRT A;  3I56 A;  1VQM Q;  1VQ9 Q;  3HPW A;  4MZT A;  2JTM A;  1Q82 C;  1E6G A;  2D9T A;  2C0I A;  1K1Z A;  1NPR A;  3P8D A;  4BI3 A;  1KC8 U;  3EGX A;  4C92 A;  4VUB A;  1MNE A;  2CUD A;  1S72 T;  2JZ2 A;  2LX7 A;  1XNI A;  1GCP A;  1NEG A;  3HKS A;  4J9C A;  4XTV A;  4ELY C;  1YIJ Q;  4HT9 A;  1GRI A;  3SWN A;  5M9O A;  2L89 A;  1WJR A;  1IGU A;  3TRE A;  3KFV A;  4M7D A;  4HCC A;  2CP7 A;  4E7L A;  1T0J A;  3I35 A;  1VQP T;  3DLM A;  2GBQ A;  4M77 C;  3CC7 T;  1IRX A;  1G2B A;  2LVM A;  3OBY A;  3H6Z A;  5GMK l;  3HP9 A;  1K8A U;  5LL6 S;  4F7U F;  3OQ5 A;  3FJ5 A;  1T0H A;  2HSE B;  3OMG A;  4A4G A;  4FT4 A;  1I5O B;  3JCM h;  1WXB A;  5I2S A;  2OJ2 A;  1M9S A;  3EAE A;  5I2M A;  1IZ6 A;  4J9G A;  1YJN A;  3J80 E;  3UAT A;  1VQL A;  1G3Y A;  5D6W A;  1G3W A;  3G4S Q;  4B6M A;  4E7K A;  5C0M A;  1M1K R;  2HQH A;  1OPK A;  1RAF B;  1NM7 A;  3O8V A;  2E5K A;  2PVD B;  4PLL A;  5CKB A;  3CCE T;  3CPW A;  4OB0 B;  3BW1 A;  3RKX A;  2EGA A;  4HVU A;  2JS0 A;  1FWZ A;  1AD5 A;  3JCM e;  4O6J A;  1PHT A;  3CCL Q;  2M0Y A;  2YUQ A;  4R55 A;  3HSB A;  1ZQ1 A;  2CSI A;  1AOJ A;  1VQK T;  3QKJ A;  3X25 B;  3GIB A;  2XI9 A;  4XU2 A;  1ZA1 B;  3UT1 A;  4FYV B;  2QQB A;  2DZC A;  4A4F A;  3UPU A;  3LGF A;  1HK9 A;  3FC3 A;  1QCF A;  1GBQ A;  3QDF A;  2DPP B;  2EKH A;  5AT1 B;  1SHG A;  3CCR A;  2DIL A;  3HL8 A;  3VS4 A;  4RTU A;  5GAN j;  3LWH A;  4JDS A;  1JB0 E;  4C8Q F;  4D8D A;  5FWB A;  2A3L A;  2K57 A;  3WVE B;  2DLP A;  4JZ3 A;  1VQ8 A;  4BUG A;  5CAI A;  2F5K A;  1IRE B;  1TS9 A;  2BE9 B;  2VUB A;  4KUI A;  3VS0 A;  2KXD A;  3CCM A;  2RH2 A;  2BKD N;  3M0Q A;  3R6N A;  3TSZ A;  4PJO C;  1WQ7 A;  1KD1 U;  1K4U S;  3A8O B;  2QI2 A;  3PFS A;  2RJC A;  2K3X A;  3CCJ Q;  2HL3 A;  3OYL A;  1G3T A;  2C0T A;  2J6F A;  3M4Y A;  2J05 A;  3BY7 A;  4BI8 B;  1VQ7 A;  3BDU A;  3FRN A;  3EFS A;  5CKF A;  4M7A G;  4HCK A;  1V76 A;  2DA9 A;  1K0X A;  1M5Q 1;  2GTO A;  2GFA A;  5GAM h;  4M75 B;  4GLM A;  3QG1 A;  2OAU A;  1AWX A;  4ZGD B;  4ESR A;  2R58 A;  2EGE A;  4C0F A;  1VQO A;  2F2X A;  2RHU A;  2ZPF B;  1S72 Q;  3GOX A;  1XTD A;  2VXE A;  2DET A;  3C95 A;  2MWP A;  1F1B B;  4L5G A;  1M90 U;  4RCC A;  4IUR A;  2DTH A;  5CKE A;  3H0I A;  3NFC A;  4FU6 A;  1ACM B;  2CZ0 B;  1VQP Q;  3M0U A;  3MEV A;  4M77 D;  1U1T A;  1JXO A;  1ZUY A;  2VKN A;  3WVD B;  1RAG B;  3CC7 Q;  3EGD A;  2V26 A;  1QP3 A;  1NLO C;  3LH5 A;  2JVV A;  2MCN A;  1WFW A;  2K5L A;  2K2V A;  2CSQ A;  3M4G A;  1W1F A;  2IVW A;  4KGV B;  5A2Q E;  4FCY A;  2CZ6 B;  2A7Y A;  2E3H A;  1JJ2 S;  2YUP A;  4E7J A;  4AFU C;  4IKF A;  4BY6 B;  3RR6 A;  5DLO A;  2KY9 A;  1GFD A;  3CCV A;  1WHK A;  1IB8 A;  5LJ3 h;  4C5G A;  5IHN A;  2RMO A;  1VIE A;  4RMO A;  2HD0 A;  3CCE Q;  3M0R A;  2RJD A;  2LNH B;  1K9M R;  2OAW A;  2DJZ A;  1AWO A;  2XMF A;  2QQA A;  2DBK A;  2RJE A;  1GCQ A;  1UJ0 A;  2MOX A;  3A5Z B;  4BDY A;  1KC8 R;  1N27 A;  1RL2 A;  2NUZ A;  2MK5 A;  2WSF E;  1VQK Q;  3G71 T;  1AVZ C;  5IT9 E;  1W2B S;  4LNP A;  4C0D B;  4B9W A;  1M8M A;  1E7O A;  5LJ3 e;  3EFO B;  1OV3 A;  2QDY B;  2DD5 A;  1X27 A;  3ZEH A;  4F7U B;  2YRC A;  4IIO A;  2FZK B;  1AT1 B;  4OMO A;  1D09 B;  4RKU E;  1WHM A;  1QQJ A;  2LJ0 A;  4J9D A;  1ZSZ B;  2OTJ A;  3L1A A;  4LXC A;  2P4T A;  5GAN 8;  1YCS B;  5KE3 A;  1N5Z A;  4FYW B;  1D1A A;  3I55 A;  3CCU A;  1OUL A;  3EH2 A;  3VRY A;  2RHI A;  3CME T;  3G6E T;  4EIK A;  1H92 A;  1WDX A;  4KGZ B;  4KH1 B;  2QA4 T;  1VQM A;  4JJC A;  3CBO A;  3M56 A;  1OZ2 A;  5LJ5 f;  5GAO l;  1VQ9 A;  1X43 A;  4C92 F;  3VS2 A;  1K8A R;  5CO7 A;  1WLP B;  3MJX A;  2JMC A;  5IN1 A;  2E65 A;  3SD4 A;  4NS5 A;  4J6Y A;  2VC8 A;  3RER A;  4ZNX A;  4N4H A;  2L2P A;  4A63 B;  5KYU B;  4BDZ A;  4M7D F;  1YIJ A;  2SEM A;  1U1S A;  1UEB A;  2QQR A;  3CD6 T;  3REB B;  1HYO A;  4M75 C;  1U8R A;  2CDT A;  4QVZ A;  3JB9 J;  2H3E B;  3LYI A;  4FYX B;  4OB3 B;  6AT1 B;  3P8H A;  2LMJ A;  2XG8 D;  4C8Q B;  3OYJ A;  2K6D A;  1KQS A;  2KBT A;  3PMI A;  1FX7 A;  4IUQ A;  1AEY A;  4JLG A;  2MPX C;  4C5H A;  4DEY A;  4OMM A;  2QAZ A;  3L2Q A;  1M2V B;  2RI3 A;  2M02 A;  5FRO A;  5FRN A;  1Q7Y U;  3OS0 A;  4E7S A;  1JO8 A;  2PQW A;  2YLB A;  3MP6 A;  5HK0 A;  1TUD A;  4ORZ A;  3G4S A;  1X6O A;  4AG2 C;  1MMG A;  4ELZ C;  3OS2 A;  1XJW B;  4P5N A;  2EQU A;  4BY6 C;  1WNL A;  1MGQ A;  2X3W D;  2VB6 A;  3OSV A;  1BI0 A;  4MZP A;  4BE0 A;  2HAX A;  5J39 A;  2AK5 A;  2BE7 D;  4FIB A;  1M4Z A;  4F16 A;  2R5M A;  4F14 A;  1YWO A;  2M0O A;  3RMS A;  4OMQ A;  1NE8 A;  4R56 A;  4PLI A;  2EKO A;  2OTL T;  1BIA A;  5GMK i;  1KD1 R;  1JJ2 P;  3E1S A;  3SB2 A;  2DEU A;  2ZPH B;  1VQ6 T;  3RKW A;  3PGG A;  3CC4 A;  2WSE E;  3M5A A;  1D3B B;  1WPY A;  1B07 A;  4HA8 A;  1M30 A;  1S1N A;  3OYH A;  2Z0W A;  3C94 A;  4C0D C;  2MMP A;  2FZC B;  2QYZ A;  3JB9 F;  5GAN 5;  3D7S B;  2RHZ A;  1D1B A;  2DL8 A;  2P0P A;  2Y4Y A;  2AZS A;  3ER0 A;  2HEQ A;  3OYD A;  2A37 A;  3G71 Q;  3DLL A;  1FXX A;  2XU8 A;  1ZSZ C;  3CMA Q;  5GAO r;  1U06 A;  3KXT A;  2M1H A;  2V1Q A;  4A53 A;  1YHQ T;  1M90 R;  2NUT B;  1FMV A;  3GNG A;  4PK4 A;  1YJW A;  1TTH B;  3PNW C;  4FM4 B;  4M78 E;  4QQ6 A;  3DB4 A;  1T3S A;  1BCO A;  2ROL A;  3ASK A;  4OMN A;  5EC7 A;  1UJY A;  3RIR A;  3JCM f;  3JCM g;  5GAN h;  3CME Q;  3JRZ A;  5HCK A;  3CCJ A;  2FPD A;  1NJI U;  3G6E Q;  4ZTJ A;  5FW9 A;  2JXB A;  2AHJ B;  2XDP A;  1UEC A;  1LCK A;  3IQL A;  2KRM A;  4PJM A;  2LRQ A;  1KQ1 A;  1YNZ A;  1HSQ A;  4CI0 C;  5I21 A;  3INZ A;  1RAE B;  1UG1 A;  3QYH B;  3S3N A;  2QXF A;  2XDD A;  1S72 A;  2KT1 A;  4KH0 B;  2O01 E;  3CBP A;  2AIR B;  2BIV A;  4FW1 A;  1Y96 A;  1MND A;  2EIF A;  2MIO A;  3E19 A;  4C8Q C;  1VQP A;  4M7D G;  1I4K 1;  2KR3 A;  1HXD A;  2KXC A;  2YRD A;  4PL6 A;  2RK1 A;  2PVO B;  3CC7 A;  3HRS A;  4DEX A;  5GAN 4;  1AHJ B;  5FWC A;  4LUD A;  4RTV A;  4ZN1 A;  4FSS A;  2OI3 A;  1VYU A;  4PKC C;  1KD1 C;  2V1R A;  4J9I A;  3BE3 A;  2LQW A;  4M7A D;  3H41 A;  3EGX B;  3OYG A;  3QWY A;  4C92 B;  4DOV A;  2XKO C;  2COW A;  4LDW A;  2AKK A;  2KE9 A;  3OW2 S;  2E3I A;  1M8V A;  1PSE A;  2KSS A;  1QVF A;  4M78 G;  3JAM E;  1QCO A;  5GJV B;  2QDL A;  4NL3 A;  2JNG A;  1PD1 A;  2ZPG B;  4XQ3 A;  3CCE A;  2VV5 A;  2GCX A;  1N9S A;  4LDU A;  2YDL A;  2JTE A;  3CCS T;  4C5E A;  5GAN 7;  2EBP A;  1UTI A;  1M90 C;  1XQH A;  3M53 A;  3A1P A;  1Q86 U;  4O5V A;  3OMC A;  5KE2 A;  5FU6 B;  5KYW A;  1PG5 B;  2LCS A;  1VQK A;  2OTL Q;  4GLK A;  1M27 C;  5D7U A;  2JUF A;  3JCM d;  5GAM f;  3A8H B;  1VQ6 Q;  3CCQ A;  4LDV A;  4KGX B;  5GAM g;  1MUZ A;  2KT8 A;  2V8I A;  2MF2 A;  1WX6 A;  1BI1 A;  1B7T A;  3C0C A;  3JCM J;  4C0G A;  1YFN A;  1EX4 A;  4MMK A;  1ZUK A;  2XDB A;  2E6Z A;  1K76 A;  2KRO A;  3RMQ A;  3E2U A;  3JB9 G;  1YIT A;  2CRE A;  3JCM b;  4ATO A;  2HZY A;  3LX7 A;  2GQV A;  2RPN A;  1YHQ Q;  3U23 A;  2RQR A;  3L2V A;  2B86 A;  1BU1 A;  3GLX A;  4RG2 A;  1EIF A;  2KMT A;  1Z9Q A;  9ATC B;  4J9F A;  4Y28 E;  1Q7Y R;  1SRM A;  3EFR A;  2DVJ A;  3X24 B;  2HCK A;  2X9H A;  2LQK A;  3OYN A;  1VIF A;  2VYT A;  4M78 A;  2ENM A;  3ULR B;  4CC3 A;  1BIB A;  2E70 A;  1YJ9 A;  4LN2 A;  5LJ3 f;  2KDS A;  4IUT A;  5LJ3 g;  4OGC A;  2FO0 A;  2ZPE B;  3OYY A;  5KH6 A;  3M55 A;  2O9S A;  3EHR A;  1SRL A;  4HVW A;  1CKB A;  4C8Q D;  1Y7X A;  1I07 A;  2DEQ A;  2HSP A;  3FLG A;  3I56 T;  5AYF A;  3CXC S;  3T9N A;  3CC2 T;  5KYX A;  1BK2 A;  2E41 A;  2QK0 A;  4FW2 A;  1GBR A;  3EG0 A;  3PTA A;  4C92 C;  5CVI A;  2O2O A;  1UGQ B;  1QVG P;  3OB9 A;  3OYI A;  2LZ6 B;  5GAM d;  1SEM A;  2PU9 B;  2DIG A;  1Q81 U;  4PNO A;  2JN0 A;  2LCC A;  2V8K A;  2QGF B;  2NUP A;  4WTO B;  2DK3 A;  5GMK j;  3O5Z A;  2JM8 A;  5LJ5 j;  2DFU A;  1VQN T;  4RTX A;  1BI2 A;  1SPK A;  1QWE A;  1X2K A;  2LT4 A;  3MPU B;  1ZX6 A;  1VQ5 Q;  1SSF A;  1UE9 A;  2K5F A;  3HHT B;  3NHN A;  5FU6 C;  1NJI R;  2KAF A;  3QYG B;  4Z8A A;  3EGD B;  2K5I A;  1Y0M A;  3CCS Q;  2AKL A;  4KBM B;  3JCM V;  2HDA A;  4Z88 A;  1XOV A;  1YJN T;  3EH1 A;  3I5R A;  2DXT A;  4E7I A;  3CQT A;  3G71 A;  1VQL T;  3HFO A;  4L6V 5;  2RK2 A;  4JJB A;  1H64 1;  3UF4 A;  2HQX A;  1Q7Y C;  3M9Q A;  2RI2 A;  2X4Y A;  1UFF A;  2W0Z A;  2L3P A;  1C6V X;  2BZ8 A;  3NMZ C;  2CZ7 B;  3CMA A;  2SRC A;  1K73 U;  1M1K C;  1EZZ B;  1QMC A;  1ZBJ A;  3V8J A;  2X4W A;  2PUK B;  2RHX A;  5GAO n;  2YUN A;  1TUC A;  4OMP A;  2ZPB B;  2M51 A;  5LJ3 d;  1W70 A;  1TSF A;  3EGU A;  1WXU A;  5CKD A;  2H3J A;  5GAM e;  3EG3 A;  1NLP C;  4N4I A;  3CME A;  1NPP A;  1ZHI A;  4K11 A;  1Q82 U;  4EMK A;  3Q1J A;  4M7A B;  2BZX A;  2JT4 A;  4J7I A;  2EYZ A;  2BUD A;  1Q95 G;  4EMH A;  2F2W A;  1Z9Z A;  1YBY A;  3CCR T;  2COZ A;  2EJG A;  2RF0 A;  3PE0 A;  1PD0 A;  3GPL A;  2J6O A;  1WJQ A;  1NYF A;  1CSK A;  3OYK A;  2KK4 A;  4DBF A;  2K79 A;  1R8O B;  2RM4 A;  4E6R A;  3VUZ A;  4JS4 A;  3L2U A;  2GNC A;  2KVQ G;  1GFC A;  2XIC A;  3HTR A;  4XTZ A;  3RUX A;  2F69 A;  3VS3 A;  4BB7 A;  1RAA B;  1M1F A;  2CP2 A;  2CUB A;  2CP5 A;  2D0N A;  3VU3 C;  1Q86 R;  2YXY A;  4F04 B;  3V7S A;  2RNA A;  2KNB B;  3QPH A;  1YWP A;  3VS6 A;  3I56 Q;  4LUE A;  1IHW A;  3PVL A;  4J9B A;  1VQ7 T;  4ZGE B;  2EQI A;  3CC2 Q;  2DL4 A;  4CC4 B;  2EVR A;  4C92 D;  1QVF S;  1C0M A;  1JRI A;  1UUE A;  3NGP A;  1H8K A;  3S6W A;  2JW4 A;  3KUF A;  2D8H A;  2M9U A;  4KUL A;  1VQO T;  3M0S A;  3CXC P;  4BD3 A;  2FYK A;  2WAC A;  4DQ2 A;  4M7D D;  4PFZ A;  4XU0 A;  1C1A A;  2LP5 A;  1YI2 T;  3LW5 E;  5GAN f;  1VOM A;  4NOY A;  4Y91 A;  5GAN g;  1VQN Q;  1KK7 A;  4FL6 A;  1I81 A;  2O4X A;  4MDX A;  3MEA A;  4E47 A;  4M77 E;  2ESW A;  4X1V A;  5L8R E;  2EGC A;  1U5S A;  4ZN3 A;  4JPB W;  2JOY A;  1AWW A;  4A4K A;  3HFN A;  5GAO q;  3UA7 A;  1ZBX A;  1G5V A;  4KUD K;  3EFO A;  1YJN Q;  2G6F X;  3UWN A;  2KEA A;  2DO3 A;  1BYM A;  3PIO A;  1VQL Q;  2QEX T;  2MI6 A;  4LD6 A;  1OZ3 A;  2FPF A;  3CCV T;  1OU9 A;  2V8J A;  3MO8 A;  1D0Z A;  2EAY A;  1BCM A;  1PRM C;  5ECA A;  2XHC A;  1YHQ A;  1OI1 A;  1WHJ A;  4JJD A;  3VKI A;  2DXC A;  2KYB A;  4XU3 A;  1YN8 A;  4PJN A;  3CEY A;  1HD3 A;  1K9M C;  4N0A C;  4M7A C;  1UGP B;  1ZSG A;  4M78 F;  3MP1 A;  2I0N A;  2FHD A;  3JSC A;  1JBM A;  1TOV A;  3RDV A;  2YUO A;  4QKU A;  1OEB A;  4XK8 E;  3CPW S;  4DOW A;  1UGV A;  1QWF A;  4X9D A;  1Q86 C;  1KC8 C;  3GF5 A;  1ZLM A;  5J3B A;  4IIM A;  3OYF A;  4V2S A;  1WHH A;  3C4S A;  2QQS A;  2CP0 A;  2YT6 A;  3FB9 A;  1KFZ A;  2DRK A;  3QXE B;  1IHV A;  1NEB A;  3CCR Q;  1Q81 R;  2XK0 A;  3JB9 D;  2ZCF B;  3I9Q A;  5DY9 A;  7AT1 B;  3S3O A;  3CCL A;  2QTX A;  2CH4 W;  3JCM X;  2FRY A;  3A8G B;  1VQ4 T;  4RTZ A;  2FG0 A;  4J83 A;  3I55 T;  1JU5 C;  3CCU T;  2RI5 A;  4KRT A;  1PNJ A;  2L3S A;  3GNF B;  3DKM A;  4AT1 B;  4HCB A;  4AFS C;  1ABQ A;  5L23 A;  1M3C A;  3J7A F;  1MMA A;  3OYE A;  3FEO A;  2L0A A;  5GAN d;  1NBE B;  4M77 G;  1K8A C;  1M2V A;  1BKB A;  3E9G A;  1G83 A;  1RUW A;  1AZG B;  1UGR B;  2AT1 B;  3URG A;  4PJO E;  4CC7 A;  3JV3 A;  5CK9 A;  2CT3 A;  2NWM A;  4RUG A;  3EG1 A;  2EQJ A;  1TH7 A;  1B34 B;  4A54 A;  1VQ7 Q;  1NYG A;  2FRW A;  2J7I A;  2DM1 A;  1W2B P;  5CCA A;  2RQV A;  4OML A;  1GL5 A;  4JZ4 A;  2HKN A;  4FSX A;  1GXI E;  2C06 A;  5CQX A;  1UHF A;  1Y96 B;  1VQO Q;  1VQ5 A;  2VVK A;  1X01 A;  4JRI A;  1R0C B;  3AHU A;  2X35 A;  3CPF A;  1YI2 Q;  5KYY A;  3VS5 A;  2QA4 Q;  1Q82 R;  1T3L A;  3CCS A;  4II1 A;  4OP0 A;  4JS5 A;  2NLU A;  1QLY A;  1RAD B;  3DB3 A;  4JLI A;  1D3B A;  2E4H A;  1PRL C;  3MP8 A;  4LD9 K;  3M0P A;  2CS7 A;  4E2F B;  1OX9 A;  5GMK h;  1EFN A;  5LJ5 h;  1NZ9 A;  1MMN A;  2GGR A;  2RN8 A;  3WXM B;  1RAI B;  3CD6 Q;  2KI7 A;  1P92 A;  5GAN e;  3VRZ A;  2ABL A;  2EYX A;  3FIF A;  3TSW A;  2QTV A;  4OF1 A;  5A0D A;  2ECZ A;  1MV0 B;  2VWF A;  1JJ2 A;  1Q81 C;  4M77 A;  3M54 A;  2QEX Q;  1WGS A;  2DKG A;  2O9V A;  3GBQ A;  3L2Z A;  2QQ9 A;  3OYA A;  2P0K A;  4J5Y A;  2CP6 A;  4FT2 A;  3MEW A;  2A36 A;  3OA6 A;  3HRU A;  2C0O A;  2ED0 A;  2JTF A;  4XU1 A;  5KYW B;  3CC4 T;  5CQY A;  3ME9 A;  4A4E A;  2E5Q A;  5J26 A;  1RAB B;  2DYI A;  4PJO G;  3H0F A;  1X6B A;  1QP2 A;  2A0F B;  3SWN B;  2FPE A;  4LDX A;  3PVQ A;  1N9R A;  4M7D B;  3EG9 A;  2KQW A;  3VV0 A;  2D8J A;  2F2V A;  4Z02 A;  4R0K A;  4HXJ A;  1YJW T;  3H0H A;  1LJO A;  4PFP A;  2CZ1 B;  2X4X A;  2ZAE A;  3ZBD A;  4OMF B;  4LE9 A;  1OX8 A;  2E64 A;  2L3Q A;  1VQ4 Q;  1RI9 A;  1OU8 A;  4QW2 A;  3JCM c;  3I55 Q;  3CCU Q;  1WJS A;  1N8R U;  2EYY A;  1AWJ A;  3SEM A;  2RHY A;  2L3R A;  3OBW A;  3CC2 A;  3A8L B;  1KHC A;  1LNX A;  2VGM A;  3MHX A;  3QJY A;  1DJ7 B;  3EG2 A;  3VJP A;  1ARK A;  4M78 B;  2KYM A;  1ZA2 B;  2GTJ A;  1K0S A;  2H8H A;  2D6F A;  3V7R A;  2LTO A;  4XTW A;  4IUV A;  5GAN 6;  4JRK A;  1D0X A;  2ZPI B;  1WA7 A;  3L2R A;  2D0Q B;  1IXD A;  3QII A;  2M16 A;  2MYS A;  2PNI A;  3QSU A;  1WZO A;  4BAC A;  1SSH A;  5GMK m;  1VQN A;  4M75 E;  5KCH A;  1D1C A;  4PJO A;  4XTX A;  1WI7 A;  4QVD A;  2J06 A;  1RAH B;  2MWO A;  1MHN A;  5HK3 A;  3VYG A;  3FDR A;  2GFU A;  1BB9 A;  2FVU A;  4DBQ A;  5KYX B;  1B3Q A;  1W4S A;  2X3X D;  1G3S A;  1M3A A;  1QKW A;  2RQU A;  4C0Z A;  3QUI A;  3RNJ A;  2EQM A;  3PT9 A;  3M59 A;  3TCJ A;  1M1G A;  4MML A;  5DLQ E;  3NPF A;  2P4R A;  1KQS S;  1TG0 A;  2CKK A;  4AG1 C;  1JEG A;  3OS5 A;  3JCM Q;  2DTI A;  1AZE A;  4PJJ A;  5IH2 A;  4M7A E;  2O88 A;  2IPO B;  3UA6 A;  2DL3 A;  2NUP B;  5GAN 3;  5GAO p;  5IXB A;  3QDR B;  2IIM A;  2HNI A;  1VA7 A;  4XAX B;  3OYC A;  2D1X A;  2HMA A;  5IHI A;  4DA4 A;  2HKQ B;  1LPL A;  1KIK A;  2JJ9 A;  3OY9 A;  1OYX A;  2RQW A;  3CCQ T;  3CBM A;  2YHT A;  1Y71 A;  4EDU A;  3SWN C;  1FMK A;  2DL5 A;  3CC4 Q;  1TXQ A;  2RD1 A;  2K3Y A;  3OS1 A;  4Z89 A;  2RB6 A;  4UC4 A;  2K2M A;  2KRN A;  4M7D C;  2RA2 A;  4YTL A;  2CP3 A;  1PM3 A;  3LH0 A;  1N6A A;  3N5B B;  3X28 B;  4ANJ A;  1YIT T;  1QVP A;  4J9E A;  4F7U E;  4M75 G;  2P0Q A;  2DZ9 A;  5CR2 A;  2Y4X A;  1Y57 A;  2DD4 A;  3OW2 P;  1UHC A;  4A4H A;  1YJW Q;  2AZV A;  4EMK B;  2LJ3 A;  4JRP A;  2FZG B;  4DBR A;  2DBM A;  4M78 C;  1R0B G;  4WF2 A;  8AT1 B;  1YJ9 T;  1RLP C;  2K4Y A;  2DX1 A;  4CRI A;  1QW1 A;  2OX7 A;  4JUV A;  4MDW A;  2YSQ A;  3L42 A;  2VXF A;  1FMW A;  5GJW B;  3VS7 A;  3E9F A;  1I5L A;  1J3T A;  3FJP A;  3G6E A;  4C5I A;  1YI2 A;  1H3Z A;  2QA4 A;  2DXU A;  4GBQ A;  2E1H A;  4WCI A;  1FYN A;  2K3B A;  4GY5 A;  5A0G A;  5D6X A;  4J8O A;  2FL7 A;  2X51 A;  4RCB A;  3TEE A;  2DJQ A;  1PCX A;  3QO3 A;  3NTI A;  2G3R A;  4AFQ C;  4AFZ C;  4C8Q E;  2LX9 A;  1QVG A;  2DYB A;  2IG0 A;  1KHI A;  5KCO A;  2PVG B;  3CD6 A;  1CKA A;  1VYV A;  4TVR A;  2XID A;  3JB9 I;  1I0C A;  4M75 A;  1VQ8 T;  2O31 A;  5KYN A;  2EWN A;  4M77 F;  4RTT A;  5D6Y A;  1V1C A;  2LQN A;  2WSC E;  3RKY A;  4F7U G;  3CCM T;  2QEX A;  3QZ5 B;  2LJ1 A;  4NL2 A;  3C12 A;  1NG2 A;  3MET A;  2R5A A;  5GAN 2;  2VGN A;  4XTY A;  2EJ9 A;  4HT8 A;  4D8K A;  5HKC A;  4OB2 B;  3KBG A;  3OW2 A;  1SG5 A;  1H3H A;  2DNU A;  1M3B A;  1UB4 A;  1KQS P;  2DF6 A;  3LGL A;  1UGS B;  1N8R R;  2E12 A;  5EG2 A;  1R77 A;  1D0Y A;  4RTW A;  1RAC B;  4N0A A;  4M7A A;  1NJI C;  2O4X B;  2A28 A;  4Q5W A;  2RO0 A;  4KT0 E;  5FU7 B;  2KGT A;  1RLQ C;  2DXB A;  2EQK A;  4M4Z A;  5FRM A;  4E7H A;  3CCQ Q;  3JCM P;  3M58 A;  3CMA T;  2ATC B;  1TUG B;  3PIP A;  2J6K A;  4F17 A;  3VUB A;  1QCN A;  4FYY B;  3V7C A;  2XD0 A;  1TU0 B;  2F5T X;  1OQK A;  1PSF A;  2EYW A;  4RG8 A;  2RQT A;  2EYQ A;  1YCY A;  1VQ4 A;  3X20 B;  3SFM A;  2OTL A;  1MMD A;  1UDL A;  1YIT Q;  5GAO m;  2COY A;  2R57 A;  1VQ6 A;  3SDZ A;  4EMK C;  1KG1 A;  2EJF A;  4C8Q G;  2ED1 A;  4PJO D;  1Y07 A;  5LJ5 g;  3H8Z A;  2QAS A;  3VS1 A;  1PKS A;  1LOJ A;  2LNV A;  2KRS A;  2PZ1 A;  3G1J A;  4F7U A; 
#chains in the Genus database with same CATH homology
 2RPN A;  3U23 A;  2RQR A;  1X6G A;  5I11 A;  2B86 A;  1QLY A;  1BU1 A;  1PRL C;  3M0P A;  3RBB B;  2A08 A;  3H0I A;  1Z9Q A;  1EFN A;  4J9F A;  1SRM A;  2GGR A;  3M0U A;  2RN8 A;  1I1J A;  1JXO A;  1ZUY A;  2DVJ A;  2HCK A;  2VKN A;  2JM9 A;  2K9G A;  3VRZ A;  2ABL A;  2ENM A;  2EYX A;  1NLO C;  3ULR B;  1YP5 A;  3LH5 A;  4CC3 A;  2MCN A;  1WFW A;  3TSW A;  1GCQ C;  4LN2 A;  2CSQ A;  2HBW A;  1W1F A;  2ECZ A;  1MV0 B;  2VWF A;  2FO0 A;  2O9V A;  3GBQ A;  2YUP A;  4AFU C;  2O9S A;  3EHR A;  2W10 A;  1SRL A;  2A36 A;  4HVW A;  1CKB A;  2C0O A;  2ED0 A;  2DMO A;  1GFD A;  1I07 A;  2HSP A;  1OPL A;  5IHN A;  2RMO A;  3H0F A;  1OOT A;  1X6B A;  3M0R A;  1ABO A;  2FPE A;  2LNH B;  1BK2 A;  2OAW A;  3PVQ A;  1GBR A;  4CC2 A;  1X69 A;  1AWO A;  3EG0 A;  2XMF A;  1JQQ A;  3A98 A;  2DBK A;  2O2O A;  1GCQ A;  1UJ0 A;  2D8J A;  2MOX A;  2F2V A;  4Y92 A;  2CH4 A;  2NUZ A;  1AVZ C;  2LZ6 B;  4R0K A;  4LNP A;  1SEM A;  4HXJ A;  4RTY A;  3H0H A;  1M8M A;  1E7O A;  3THK A;  1W6X A;  1OV3 A;  1X27 A;  1K9A A;  4IIO A;  4LE9 A;  4OMO A;  2L3Q A;  1RI9 A;  2JM8 A;  3O5Z A;  2LJ0 A;  4J9D A;  4RTX A;  1SPK A;  1PWT A;  1QWE A;  1X2K A;  2EYY A;  1YCS B;  1SHF A;  1ZX6 A;  1AWJ A;  3SEM A;  1KJW A;  1N5Z A;  3M0T A;  1UE9 A;  3NHN A;  3SHW A;  3EG2 A;  4Z8A A;  3VRY A;  1ARK A;  1Y0M A;  2CT4 A;  3TVT A;  2KYM A;  1WDX A;  4EIK A;  1H92 A;  2AKL A;  2GTJ A;  2HDA A;  1K0S A;  2H8H A;  4JJC A;  4Z88 A;  1XOV A;  1X43 A;  4HVV A;  3VS2 A;  3I5R A;  2DRM A;  1WLP B;  3CQT A;  2JMC A;  1U3O A;  4JJB A;  3UF4 A;  1WA7 A;  1UFF A;  2W0Z A;  2L3P A;  2BZ8 A;  4ZNX A;  3NMZ C;  2SRC A;  2L2P A;  4A63 B;  3QWX X;  2DE0 X;  1ZBJ A;  5I22 A;  1HJD A;  2PNI A;  2SEM A;  1KSW A;  1SSH A;  3REB B;  2YUN A;  1TUC A;  4OMP A;  1WI7 A;  2M51 A;  2J06 A;  1IO6 A;  3EHQ A;  1W70 A;  2BZY A;  1ZUU A;  2CDT A;  2JMA A;  3EGU A;  1BB9 A;  1WXU A;  3EG3 A;  1NLP C;  3REA B;  1B3Q A;  2LMJ A;  2X3X D;  4K11 A;  1JXM A;  1M3A A;  1QKW A;  2RQU A;  1WXT A;  2BZX A;  2JT4 A;  3ZL7 C;  3RNJ A;  2K6D A;  2KBT A;  2EYZ A;  1AEY A;  3NPF A;  2P4R A;  1TG0 A;  2F2W A;  1Z9Z A;  4DEY A;  5IHK A;  4AG1 C;  1JEG A;  4OMM A;  1AZE A;  5IH2 A;  2O88 A;  3UA6 A;  1BBZ A;  2DL3 A;  2RF0 A;  3PE0 A;  1JO8 A;  1VYT A;  2J6O A;  4J9H A;  5IXB A;  2IIM A;  1TUD A;  4ORZ A;  1NYF A;  1VA7 A;  1CSK A;  4AG2 C;  2DL7 A;  5IXF A;  2K79 A;  2D1X A;  4E6R A;  5IHI A;  2GNC A;  1WYX A;  2ROT A;  1GFC A;  2X3W D;  2EPD A;  3VS3 A;  1KIK A;  2AK5 A;  2CUB A;  2BTT A;  2JS2 A;  1QKX A;  2RQW A;  4QT7 A;  2D0N A;  4F16 A;  4F14 A;  1YWO A;  2GQI A;  2PTK A;  1WIE A;  2FEI A;  1FMK A;  2DL5 A;  4OMQ A;  2K7A A;  2RNA A;  2KNB B;  4Z89 A;  1YWP A;  2K2M A;  2KRN A;  1E6H A;  3I5S A;  3VS6 A;  4LUE A;  1PKT A;  3PVL A;  4J9B A;  1MV3 A;  2EQI A;  2DL4 A;  4CC4 B;  2EVR A;  1B07 A;  1M30 A;  2EW3 A;  1S1N A;  1UUE A;  1X2Q A;  1H8K A;  3NGP A;  1A0N B;  2JW4 A;  4J9E A;  2D8H A;  2DL8 A;  3M0S A;  1Y57 A;  2AZS A;  1E6G A;  2C0I A;  1K1Z A;  2HEQ A;  2A37 A;  1UHC A;  2LP5 A;  2AZV A;  2CUD A;  2LX7 A;  1U06 A;  1GCP A;  1NEG A;  2LJ3 A;  4J9C A;  2V1Q A;  1GRI A;  2DBM A;  3KFV A;  1T3S A;  2ROL A;  1T0J A;  4OMN A;  3I35 A;  5EC7 A;  1RLP C;  1UJY A;  2DX1 A;  2ESW A;  4X1V A;  2GBQ A;  2EGC A;  1U5S A;  5HCK A;  4JPB W;  2FPD A;  2YSQ A;  1AWW A;  1G2B A;  5FW9 A;  2JXB A;  3UA7 A;  5GJW B;  1UEC A;  1LCK A;  3IQL A;  2KRM A;  3VS7 A;  2G6F X;  1YNZ A;  2KEA A;  1HSQ A;  1J3T A;  3FJ5 A;  1T0H A;  2FPF A;  1UG1 A;  1WXB A;  2OJ2 A;  4GBQ A;  4J9G A;  4WCI A;  1FYN A;  2K3B A;  2KT1 A;  3UAT A;  5ECA A;  1PRM C;  2DJQ A;  4JJD A;  4AFQ C;  2KYB A;  4AFZ C;  1YN8 A;  1HD3 A;  2MIO A;  1ZSG A;  1OPK A;  2DYB A;  1NM7 A;  2KR3 A;  2E5K A;  2I0N A;  1CKA A;  1VYV A;  2KXC A;  2YUO A;  2EGA A;  4HVU A;  1I0C A;  1OEB A;  2JS0 A;  2O31 A;  1UGV A;  1QWF A;  4DEX A;  1AD5 A;  5FWC A;  1ZLM A;  4RTT A;  4LUD A;  4IIM A;  1PHT A;  4RTV A;  2M0Y A;  2YUQ A;  4FSS A;  1V1C A;  2LQN A;  2OI3 A;  2YT6 A;  1VYU A;  2CSI A;  2V1R A;  4J9I A;  1KFZ A;  1AOJ A;  2DRK A;  2LQW A;  1NEB A;  3H41 A;  2LJ1 A;  3QWY A;  1NG2 A;  3I9Q A;  4D8K A;  2CH4 W;  1H3H A;  2FRY A;  2AKK A;  2DNU A;  1M3B A;  1QCF A;  2KE9 A;  1GBQ A;  4RTZ A;  2FG0 A;  2DF6 A;  2EKH A;  1JU5 C;  1SHG A;  2DIL A;  4KRT A;  1PNJ A;  2L3S A;  4RTW A;  3VS4 A;  4RTU A;  5GJV B;  2QDL A;  4AFS C;  1ABQ A;  5L23 A;  2A28 A;  1M3C A;  4D8D A;  5FWB A;  2L0A A;  2DLP A;  4JZ3 A;  2KGT A;  1RLQ C;  2YDL A;  2JTE A;  4M4Z A;  2EBP A;  1UTI A;  1G83 A;  1RUW A;  1AZG B;  2J6K A;  2KXD A;  3VS0 A;  2LCS A;  3M0Q A;  4CC7 A;  4F17 A;  3R6N A;  3TSZ A;  1M27 C;  3JV3 A;  2CT3 A;  2NWM A;  4RUG A;  3EG1 A;  1K4U S;  2EYW A;  2RQT A;  1MUZ A;  2KT8 A;  1NYG A;  2FRW A;  2J7I A;  2DM1 A;  1WX6 A;  1UDL A;  2RQV A;  4OML A;  1GL5 A;  3C0C A;  2C0T A;  4JZ4 A;  2J6F A;  2J05 A;  1ZUK A;  1UHF A;  2VVK A;  4HCK A;  2ED1 A;  2DA9 A;  1K0X A;  2GTO A;  1K76 A;  2KRO A;  3VS5 A;  2CRE A;  4GLM A;  1T3L A;  1AWX A;  3VS1 A;  1PKS A;  2PZ1 A;  4ESR A;  2KRS A;  2EGE A;  2F2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...