4BB7A

Crystal structure of the yeast rsc2 bah domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
236
structure length
235
Chain Sequence
HMDEVIVNNISYHVGDWALLRNQNDPQKPIVGQIFRLWKTPDGKQWLNACWYYRPEQTVHRVDRLFYKNEVMKTGQYRDHLVSNLVGKCYVIHFTRYQRGNPDMKEGPLFVCEFRYNESDKIFNKIRTWKACLPEEIRDLDEATIPVNGRKFFKYPSPIRHLLPANATPHDRVPEPTMGSPDAPPLVGAVYMRPKMQRDDLGEYATSDDCPRYIIRPNDSPEEGQVDIETGTITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords CHROMATIN STRUCTURE-REMODELING COMPLEX SUBUNIT RSC2
publication title The Bah Domain of Rsc2 is a Histone H3 Binding Domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 54
structure length 235
sequence length 236
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4bb7A00
1W4SA 3PT9A 4KUIA 4DA4A 4DOVA 4DOWA 3TU4K 4FSXA 3PTAA 2FL7A 4LD9K 1ZBXA 4FT2A 1ZHIA 4KUDK 2FVUA 1M4ZA 4JJNK 4KULA 4FT4A 4BB7A
chains in the Genus database with same CATH superfamily
1W4SA 4AMCA 1G8XA 2EQKA 3FLGA 5GAOm 2DF6A 4GLKA 4DQ2A 4A4KA 1KC8C 4GY5A 2AT1B 2PVOB 1M5Q1 2CP3A 2MWOA 1JJ2S 4L6V5 4C5IA 1GFDA 1JXMA 2DBKA 4K11A 1Q82C 3OSVA 3TSZA 5GANf 2P0PA 3GOXA 3L2WA 4IUPA 3SEMA 4BY6B 1QCOA 4F7UE 1F1BB 2PVGB 1VIFA 4ORZA 3ZL7C 2F5KA 3I55T 2IPOB 1OYXA 5GAN5 2ZPGB 2HL3A 5GMKl 4PLIA 3JCMJ 1YIJA 3BDUA 5CIUA 1SG5A 2HL5C 1UUEA 2H8HA 3BW1A 4Y91A 1HYOA 2QQ9A 2VYTA 1SRLA 3CCEQ 2X3WD 1N9RA 2CP5A 3OYFA 1MNDA 4JRKA 2M02A 2DX1A 3WVDB 1OULA 4AG1C 2W10A 4C92G 1Y07A 3BDLA 1K8AU 2YUPA 4KGZB 4J9CA 2PZ1A 4MZTA 4OMLA 3OYAA 4M78A 4JS4A 1M3AA 3PGGA 3HRUA 5D6WA 1YITT 1G5VA 3V7RA 3PVQA 2L5QA 3WVEB 1VQLA 4RTYA 4C8QE 4FYXB 4KT0E 1W70A 2GF7A 3T9NA 2V8KA 4XK8E 3HTRA 4EMKB 2RN8A 1S72A 1D0ZA 5D6XA 1O9SA 1RAIB 2M9UA 2VC8A 2NYSA 3PTAA 3RESA 2QYZA 4E7ZA 1PCXA 5FU6B 3RKWA 3CCRT 2GTJA 1YIJQ 2DXCA 1RAFB 1LVKA 2L3SA 3VS2A 2J6OA 2K5FA 2HCKA 1UGQB 3CPWS 1KQ2A 1Q95G 1K9AA 2A37A 1SHFA 2DVJA 2E10A 2L2PA 3L2UA 1D0XA 1BYMA 1E6GA 1N8RU 4M75E 5FWBA 2PU9B 1LJOA 2P0QA 4N4GA 2CP2A 2DVEA 2LQWA 2JUFA 1YJNA 3TSWA 2LMJA 2D6FA 1VQLQ 2VKNA 1BCOA 4AFSC 5DY9A 4LN2A 1NZ9A 5CKFA 5LJ3g 5LJ5e 3R6NA 4B6MA 3WXMB 2JM9A 2JTMA 2EPDA 4EMKA 4QVCA 2Y4YA 2F2WA 4RTTA 3RKXA 1M27C 2FRYA 2OAUA 4WCIA 1OPKA 1BB9A 3EH1A 3HRTA 1VQMT 3JCMQ 5A0DA 4A4EA 3J81E 4JLIA 2J7IA 4Q5WA 1JXOA 4IUTA 5IN1A 5KYUB 1WHGA 6AT1B 5LJ3j 3QSUA 1VYVA 1YJWT 3QZ5B 4M75C 3GBQA 4ESRA 3CCLQ 2F2XA 4D6WA 1YP5A 2JNGA 4GBQA 4QVDA 2ED1A 2QEXT 1WZOA 4JJCA 2A36A 3GLXA 2EQIA 3FB9A 4J9BA 2CKKA 1AZEA 1BIAA 7AT1B 4HT9A 1BI0A 2RQWA 3CCUQ 1KQ1A 3M0SA 4PNOA 5GMKj 4DEYA 1CKBA 4EPCA 4KULA 4LE9A 4XTVA 5GAN4 3DLLA 2J6FA 4DA4A 3EFSA 3EFOB 1X01A 2JMCA 4KGXB 5GAN6 1G3SA 3CCVA 1X27A 2K3XA 3JCMW 4EDUA 1ZSGA 4IURA 1YHQT 3QZ9B 5GAN2 1YCYA 2LQKA 3CCET 2DTOA 5KYUA 3JCMg 1NJIC 1KD1R 4AFUC 1W2BS 1ZUKA 5GAMe 1VQ4Q 3BY7A 1WHJA 2EQJA 3RKYA 3VU3C 2QQRA 3FDRA 4L5GA 2VV5A 1KD1U 1TU0B 3CCJQ 5IHNA 1VUBA 2V1QA 3G6ET 1RUWA 4D8KA 2GCXA 1GCPA 1U1SA 2EQMA 3UA6A 5C0MA 1KC8R 2I0NA 3QUIA 1TWBA 2XU8A 4O6JA 2HKNA 4PJOF 1RLPC 3OMCA 3HP9A 5A0LA 1HXDA 3HKSA 1E6HA 3NFCA 3OYCA 2OI3A 2E1HA 2YLCA 2EJGA 5CVIA 3I56A 1VA7A 3CCVQ 3V7SA 4CC4B 2LJ1A 4KUDK 2HAXA 1PRLC 3E9GA 2HEQA 1Q82U 2BZYA 3PE0A 4M77F 4JUVA 2D8HA 4QW2A 2JN0A 4XTYA 3TU4K 2ROLA 3O5ZA 4HXJA 1KQSS 3UT1A 1NPPA 2EJ9A 1NEBA 1XJWB 4NL2A 3MEUA 4E47A 5AT1B 4DBRA 2ZPEB 3QHSA 4KUIA 4ANJA 2CUDA 3G71A 1D1AA 4X1VA 1GL5A 1JRIA 2Y4XA 1YI2A 3LH5A 3NMZC 3BE3A 2MAMA 5FRMA 1AWWA 4J9DA 2DD4A 1WXUA 2OTLQ 4F7UF 3I56Q 4JLGA 4Z8AA 3S3OA 4E7JA 1ZSZC 3EHRA 2D1XA 1K0SA 4HCZA 1UECA 3CBOA 2YUOA 3P8BB 2BE7D 4J6WA 2QG9B 4ME7A 3QO3A 3VS7A 3H0HA 1X6GA 1WFWA 2M0OA 3LLRA 5GANg 3VUBA 4J9IA 2EAYA 2ESWA 3X28B 2JM8A 3RMSA 3KBGA 3CCLT 2EBPA 3PMIA 4OB2B 4OF1A 4XU3A 5LJ5g 3ULRB 3OA6A 2ATCB 3H0IA 4JRIA 4C5GA 1D1BA 5GANj 3CCUT 2L8DA 2FL7A 5GAOr 1ZA1B 1NYGA 2JS0A 1CSKA 2VGMA 1QWFA 4C8QF 3LW5E 4KGVB 1CKAA 2JZ2A 1TS9A 1UGRB 3V8LA 1KSWA 3GP8A 5HY6A 1T0JA 1VQ6T 3E2UA 4RKUE 5GAMd 1ZSZB 1PNJA 2DRKA 3HFNA 5CR2A 3QKJA 4FU6A 1VQKA 1JO8A 2KVQG 1ZHIA 3OBYA 2EYYA 3JCMX 2RI5A 1VQ4T 2BKDN 2JVVA 2YUNA 3OW2A 4RTZA 4HA8A 3H8ZA 4BI8B 2CZ6B 3OY9A 3CCJT 1WDXA 2VXFA 1H3HA 4M75F 2QDYB 4M78E 3MEWA 1UFFA 3M0QA 1QCFA 3UDCA 1VQ8A 2GFAA 2E65A 3QDFA 4PKCC 3VYGA 1WHHA 4N0AA 5EG2A 2EGEA 4EMGA 1FX7A 5FROA 2NUTB 1NLOC 3UF4A 1X6OA 4F7UG 4A54A 1H641 4J9FA 4MZMA 2DJZA 1VQKQ 1N9SA 4OB3B 1WPYA 4CC3A 3OS1A 2OTJT 3C94A 2LT1A 3CBMA 5KYXB 1H3ZA 1AHJB 1UB4A 2FZKB 5DLOA 2YUQA 4MMKA 3OYKA 4BDZA 2PQWA 2C0IA 1M1KC 1QCNA 2KMTA 1X69A 2KRNA 4QQDA 2RQTA 1QKXA 1NJIR 4KH0B 4M78C 4B9WA 5J3BA 1D0YA 2K57A 4BUGA 2FZCB 4X9DA 2E5KA 2O9VA 3OYLA 4AG2C 2DZ9A 1NJIU 1TSFA 1KG1A 1M2VB 1UHFA 3O8VA 2YLBA 1NM7A 2H3JA 1K9MR 4BY6C 1Y7XA 3H9NA 1H92A 4C8QG 2F2VA 1VQNT 2K7AA 1K1ZA 2OTLT 4LD9K 1M1GA 2NUTA 2NWMA 3A98A 2E64A 3QWXX 5GAN3 2DL5A 2RMOA 2L3PA 4MZPA 3G4SA 2VGNA 2XICA 1OU9A 2HQXA 2GQVA 1Q7YR 1LOJA 1Y0MA 1OU8A 4JDSA 4ZNXA 5KYXA 4YTLA 5GAOq 2LC4A 1MV3A 1V29B 4A4GA 1GXIE 5GAMh 4E6RA 4OGEA 4C0GA 2FO0A 2P4RA 1GBRA 4J9EA 4XU0A 4J83A 2RHUA 4M78B 4M75G 2B86A 4Z02A 1W6XA 1FYNA 1C1AA 4AFQC 3QXEB 2RHIA 1M2VA 2KQWA 3CMEA 1XNIA 4QQGA 3CCQT 4PJMA 1R0BG 1S1NA 3L2ZA 1RABB 1AD5A 1PHTA 4EMKC 4RCBA 3LGLA 2KSSA 1BI1A 4JZ3A 5C6SA 4BDYA 2DL4A 3ASKA 4J5YA 4BE1A 3MJXA 2QASA 1PSEA 1B3QA 5FU6C 3G4SQ 1M30A 1QW1A 1QVFS 4NOYA 3NHNA 2COZA 3QJ6A 2QAZA 3FEOA 4M7DC 4M78D 2Z0WA 5LJ5f 1VQ7T 5I11A 2JTEA 4J6XA 3CCMA 3CC7Q 1RAGB 1ABOA 1Q81C 2G6FX 3G1JA 2E6ZA 1M2OA 4F16A 1YJ9Q 4TVRA 2A3LA 3NGPA 3MO8A 3M9QA 2AZVA 1QKWA 3CMEQ 5CKHA 3AHUA 2LCLA 4BE0A 2RI3A 1B7TA 5GMKm 4LDYA 1H8KA 4PFPA 4LUDA 2RM4A 2HBWA 3GNFB 5FWCA 5FRNA 1R77A 1XOVA 3DLMA 3PMTA 1G3WA 2D8JA 1GBQA 2NUPA 3I35A 3I9QA 1OOTA 1VQ9T 3CCMQ 4M7DB 4PFZA 2DERA 3OYNA 2DEUA 5D7UA 1HK9A 1JB0E 3RIRA 5LJ3d 3CC2A 1IXDA 4E2FB 1QVGA 1X43A 3NTHA 3CC4T 1O75A 2LNHB 2AZSA 2EKOA 2ZCFB 3FIFA 3OB9A 1I07A 1Y71A 5GAMf 2CZ7B 1IHVA 3X20B 2CUBA 1MUZA 4HVVA 4M7DD 1J3TA 4XTUA 4OVAA 3EGXA 4KH1B 2O4XB 1S72Q 2ENMA 3RBBB 2DMOA 3HL8A 3MHXA 2ZPFB 1VQPT 3ZBDA 3PIOA 4ZN1A 1WQ7A 4PJOA 1PKSA 3I5SA 4M4ZA 1RADB 4WTOB 4JRPA 2MOXA 1VQ5A 3JB9D 5HK0A 2W0ZA 3OW2P 4M7DA 3JSCA 3P8HA 1B34A 2RQRA 3OMGA 3CC2Q 2HMAA 2QXFA 4OMNA 2K4YA 4GLMA 3SD4A 2CYZB 2LVMA 2EYWA 2DILA 3JV3A 5HKCA 3OYYA 1M1KR 1ZQ1A 1TUGB 3AT1B 4M77A 1YJNQ 2KGTA 4M7AB 2ROTA 4PK4A 2LRQA 4QQ6A 1M3BA 2FPDA 2C0TA 2GTOA 4ZTJA 1M1KU 4N4HA 2LP5A 2P4TA 2P0KA 1PM3A 3A8LB 3A5ZB 4DBFA 4JZ4A 4XTXA 2RHXA 2O4XA 1I0CA 5I21A 2EKHA 2X4YA 1IO6A 2AIRB 2CDTA 2DPPB 4E7HA 5AYFA 4Y92A 2RJFA 2CH4A 2GNCA 3FRNA 2XK0A 4JJDA 2DRMA 2HQEA 5HK3A 3CMAA 1VQ5Q 4M7AD 2YSQA 3E9FA 3V8KA 4Z88A 1AEYA 4BD3A 1PC0A 1PKTA 3SFMA 3CC7T 2CT4A 8ATCB 3CCSA 3X26B 2D0NA 2M16A 1VQOA 2RHYA 2YRVA 2NUZA 4EMHA 3EGUA 3EAEA 1YJ9T 3A8HB 2DTHA 3TREA 3V8JA 2O88A 2QK0A 2CP7A 4MDWA 2H3EB 2DL3A 3HPWA 4J7FA 2X35A 4DBHA 4C92C 4M7AA 1K9MC 4KRTA 1BIBA 3LWHA 1C6VX 2O9SA 3CD6A 2A0FB 5IHKA 1RAEB 2L0AA 4IIMA 2DO3A 1I4K1 1TUCA 1X75C 1DJ7B 2BUDA 4QKUA 2QA4A 1YWPA 2FYKA 3PVLA 4BACA 1V76A 1E7OA 5IHIA 3URGA 1LNXA 2EW3A 1TUDA 2DM1A 1KC8U 1Q7YC 8AT1B 1YIJT 4X34A 3UA7A 5J26A 3OYHA 5ECAA 2KEAA 3VUZA 4ZTFA 2V8JA 2DL8A 3F70A 3M57A 1VIEA 4NS5A 2RNAA 1XQHA 3TEEA 4C5EA 1TG0A 1EX4A 2XMFA 1M8VA 2DIQA 1RI9A 1NE8A 4XQ3A 2FB7A 1FMVA 1Q81R 3OS2A 2BIVA 2LZ6B 1VQLT 3ME9A 1GRIA 4N0AC 3EG9B 4C92B 5GANd 3QJYA 1RLQC 1Q81U 4M78G 2QA4Q 4FYVB 1BK2A 1NYFA 1EIFA 2C0OA 3LYIA 1S72T 4IIOA 1BCMA 1YFNA 3M58A 2RPNA 4LXCA 1ZBXA 3SHWA 2I2LA 1IGQA 3ZEHA 1G3YA 1I5OB 2CH4W 1FXXA 1WXTA 4BB7A 1QWEA 3M53A 1Z9ZA 4MMLA 2OJ2A 1X2QA 3R6OA 1PSFA 1U8RA 4C92D 4FSXA 4ZN3A 1BI2A 4BE2A 2QI2A 2P84A 1WX6A 3H41A 4J6YA 1K73R 2AKLA 3VS5A 1K8AC 3CBPA 2JXBA 1YJNT 3OYGA 4QVZA 3I55A 4HVWA 3MEAA 1IHWA 4X9CA 2KT1A 1SSFA 2OAWA 2VB6A 1KJWA 2K9GA 4C5HA 1NBEB 3G71Q 3EG9A 2MPXC 4C92A 4F04B 1YI2Q 2CZ0B 2LJ0A 1P92A 2A08A 4XAXB 5CK9A 2K3BA 1I1JA 2D9TA 3A1PA 5IAYA 5IXBA 2FRWA 3JB9I 2LTOA 1UJYA 3HFOA 5LJ5j 2L3QA 1M3CA 3EG3A 4CC7A 2EJFA 2M0YA 1AVZC 2X4WA 1IRXA 1UGSB 1NLPC 4J9GA 1YITA 3M55A 3VRYA 3NTIA 1Y96B 1QVGP 1YWOA 2DLPA 2EWNA 2FVUA 3QG1A 3QWYA 5IT9E 2RQUA 1VYTA 2RK2A 4A63B 2RF0A 2O31A 2DE0X 3I55Q 1M9SA 2DJQA 2VVKA 1TH7A 2E70A 1UGVA 1N27A 1ZUUA 2EQUA 2GQIA 3M5AA 2DKGA 3JAME 3CCRA 3OS5A 3QYHB 5J39A 3M54A 2KXCA 3KFVA 2AK5A 3PFSA 2FHDA 2RI2A 4JJBA 2LQ8A 1W2BA 3LH0A 3GF5A 2KRMA 2M1HA 3KUFA 1RACB 5GAMg 1WIEA 3FJ5A 3CCVT 3L42A 1LPLA 4RUGA 5CAIA 2QDLA 1YITQ 3SDZA 1K4US 5KYWB 2FG0A 1Y96A 1A0NB 2DETA 3CXCP 1AOJA 2VXEA 2A28A 3UPUA 1T0HA 5KH6A 2E12A 5KYYA 3RDVA 3OYEA 3L2RA 4PJJA 2MIOA 5GAMj 2KYMA 1OEBA 4XTZA 5LJ3e 4LDVA 4J8OA 4JPBW 1LCKA 1VQMA 4HCCA 1UG1A 2EYXA 3VS6A 1VQ8Q 1KFZA 1UHCA 1KHIA 2K2VA 2RH2A 2QQBA 1YBYA 3SWNA 4XU2A 3L2VA 1ZA2B 5GAOn 1UTIA 5CQYA 1YJWA 2DFUA 2HZYA 3CQTA 5GAN8 1JU5C 3I56T 1KQSA 1K9MU 2Y90A 1NEGA 1IGUA 2BZXA 1JJ2P 2HD0A 3CEYA 2QEXA 2DD5A 5GMKe 4PJOE 1D1CA 5KYWA 3JB9H 2HDAA 4ZGEB 3EHQA 4M7DE 2WSCE 2AKKA 3OQ5A 2GFUA 4PFOA 1X6BA 2DBMA 1U06A 5CO7A 4IKFA 4II1A 2VUBA 1Q7YU 5FW9A 1SRMA 2RB6A 1SEMA 2RJDA 1SKUB 1VQMQ 2CP0A 2KR3A 3SB2A 4Z89A 3MP8A 4HCBA 2ZGWA 3G71T 1ZLMA 1YI2T 4RG8A 4LD6A 3A8GB 1YHQA 1GFCA 1MNEA 2X3XD 3CCEA 3A8OB 3EGDA 2RO0A 1Q86C 2LX7A 1ZBJA 3X24B 2JW4A 4FT4A 1HJDA 2EIFA 3CPFA 2R58A 2BZ8A 4PJOC 2QEXQ 2JOYA 3FJPA 4HT8A 3MKDA 3JCMe 1WA7A 1WJSA 4J9HA 2XDDA 2RJCA 2M51A 3V7CA 2NUPB 3G6EA 2HBPA 4N4IA 1MMNA 1RI0A 1ZUYA 1D09B 1M90C 1M1FA 2ZPBB 3OYBA 5EC7A 2K79A 4XU1A 2NLUA 2G3RA 4RTWA 2E41A 4FM4B 4M77C 4FCYA 1JBMA 4C0FA 2DAQA 2QTVA 2FZGB 1QLYA 1OPLA 4NL3A 2HKQB 2XHCA 1RAHB 2PTKA 4J7IA 1K8AR 4OB0B 4M7AE 3CPWP 1YHQQ 1JQQA 1M4ZA 3EG0A 3H0FA 2HQHA 2X4XA 4HCKA 3KXTA 4WF2A 1MMGA 2X9HA 4LDUA 3EGXB 4IUUA 2E5QA 2EYZA 2CREA 1SHGA 3M59A 3RMQA 2V8IA 4PJLA 2DTIA 2ABLA 2YXYA 1VQKT 1GCQA 4PJOB 1WHKA 3G6EQ 1WJQA 2O2OA 4CRIA 3REBB 3NPFA 1B34B 2RJEA 4R0KA 1K73C 1RAAB 2YRDA 3TVTA 2EGCA 1SF9A 3RUXA 1OQKA 1UEBA 4IUQA 3RR6A 2RQVA 4ZGJB 5A0GA 4R55A 4M7AC 1SPKA 2JS2A 1M8MA 2RK1A 2VWFA 4FT2A 4M77B 4F17A 1MMAA 3M4GA 1AWOA 1VQ8T 1U1TA 4PJOD 4B9XA 4C0ZA 1N8RR 3VKIA 3LGFA 3JB9J 4E7KA 5I2SA 1N6AA 1I8FA 2OX7A 2CSQA 4C0DC 3EH2A 3VRZA 2EGAA 2PVDB 1NPRA 3VS1A 3CCLA 1MHNA 4E7IA 3MPUB 2KDSA 4FW1A 5GANe 1OX9A 5HCKA 1OZ2A 4C8QC 2V26A 4IUVA 4AT1B 1ZX6A 4M77D 1YN8A 5GAN7 5GAOp 3QBYA 4LNPA 4KBMB 5GJVB 1SSHA 2K2MA 2YDLA 4F7UB 3CCUA 1QVPA 1W1FA 2K5LA 2JJ9A 2SRCA 1TXQA 5KYNA 1IZ6A 3CXCA 2MMPA 2ZPHB 3MP1A 2DNUA 2V1RA 5CKBA 4F14A 1PG5B 3C4SA 1K0XA 5CKDA 1VQ6A 1JEGA 1XTDA 3OSSC 3QPHA 4UC4A 2HNIA 1W2BP 4VUBA 4M78F 4PLLA 4C92E 2CT3A 2WSEE 3OYJA 3E1SA 2CP6A 2KI7A 3GNGA 4C0DB 3JCMd 3LWIA 2QTXA 1VQ4A 3OYDA 4RTVA 2ZZDA 1FMKA 2EYQA 2MYSA 2MCNA 2JMAA 1QP3A 3G4ST 1UDLA 4ZGDB 1IB8A 4DOVA 3VJPA 3I5RA 3CCJA 3FC3A 5GMKi 5DLQE 2QGGA 4C8QB 4ATOA 2E3HA 2F5TX 1JJ2A 3M4YA 4F7UA 3OW2S 3M56A 1IREB 1C0MA 4ELYC 3UATA 4FYYB 2J06A 3M0UA 5KCOA 2K5IA 1AWJA 1R8OB 3VYHB 3S3NA 2KAFA 3J80E 2COWA 3EFRA 1VQ6Q 4DEXA 4LDWA 1ARKA 1WXBA 1QVFA 4OP0A 2DK3A 3THKA 2J05A 5LJ3h 1KK7A 4C8QD 3CMET 4JS5A 1UJ0A 2LX9A 4L59A 1X2KA 2ECZA 2XKOC 1PWTA 5A2QE 2OTJA 2PUOB 3DB4A 3MP6A 1KQSP 4FYWB 4M75B 2E3IA 1VYUA 1QP2A 1I81A 1BBZA 3JCMb 4OGCA 2YT6A 1Q86R 2QQSA 1G2BA 4RTUA 2KE9A 3CMAQ 1OV3A 1I5LA 1U3OA 2FPFA 4EIKA 4HVUA 5GMKh 4C8QA 1ACMB 4E7LA 2YRCA 4OMMA 2R5MA 2EVRA 3CCMT 1Q86U 1T3LA 3X25B 3CCSQ 2R5AA 2ZAEA 2EFIA 2MF2A 2R57A 4CI0C 1VQOQ 3REAB 2XG8D 1Q82R 4M7DF 4M75D 1VQNA 2BTTA 2RD1A 2OTLA 3META 2O01E 1M90R 3EFOA 3VS0A 4CC2A 2X4JA 1N5ZA 1RL2A 3OYIA 1OX8A 3H6ZA 1WHLA 2OTJQ 2DYIA 3ER0A 3CD6Q 1ABQA 2LDMA 1M90U 2C06A 4D8DA 3N5BB 2DXTA 2FEIA 3CPWA 3JB9F 2HSEB 3S3MA 3M0TA 1AZGB 2MK5A 4M75A 5M9OA 3ZFJA 1V1CA 2IIMA 5LJ5d 2PUKB 3G7ZA 2KK4A 1AWXA 3JCMh 3M0PA 4LDXA 3A8MB 4FL6A 3TQ7P 2XIDA 3CC2T 3C0CA 3CCQA 5L23A 1VQNQ 4ELZC 4A53A 1MV0B 5I2MA 1R0CB 3P8DA 4PL6A 3C95A 3C12A 1KHCA 1BU1A 3RERA 1WNLA 4OMPA 2COYA 1WYXA 1WQWA 2MWPA 3NTKA 3VS4A 2CSIA 3SWNC 1K73U 1VQ7A 5KCHA 2CGHA 2RHZA 3PNWC 2AHJB 4M7AF 1PRMC 2DXBA 3GPLA 2LJ3A 1TTHB 3IQLA 4A4HA 2LQNA 4AFZC 3DKMA 5LJ3f 1NG2A 2WSFE 4Y28E 2DA9A 2FPEA 3PT9A 3S6WA 3OBWA 1PD0A 1VQ5T 4FW2A 2BE9B 2E4HA 2CS7A 1VOMA 3VV0A 2PNIA 2DZCA 2KT8A 1D3BB 3U23A 1BKBA 4XTWA 3CCQQ 4PJOG 2IG0A 1FWZA 1TOVA 3RNJA 5KYYB 3M0RA 4M7DG 4OB1B 3JCMP 1G3TA 2MI6A 5D6YA 4BI3A 4V2SA 1QMCA 1N8RC 1QQJA 3D7SB 2VASA 1VQ7Q 2KNBB 5LL6S 1YCSB 5IH2A 2XD0A 1WJRA 5KE3A 4M77G 2D0QB 3HHTB 2DYBA 4FIBA 2XDBA 1VQ9A 3SWNB 2X51A 3L2QA 5CCAA 2DIGA 2YHTA 3JB9G 2LCCA 2RA2A 5GJWB 3CC4A 2E6NA 2YWWA 5GANh 3CMAT 4DBQA 2LNVA 3QYGB 2KXDA 3JCMV 4RTXA 2F69A 2JT4A 5FU7C 4HKEA 2XI9A 3CCST 1D3BA 4BI4A 3MCAB 3INZA 4OMOA 3TCJA 5I22A 4RCCA 2L3RA 1U5SA 5LJ5h 5DM7R 1VQOT 1OZ3A 2KYBA 1QVGS 2B8AA 1OI1A 2KBTA 1MMDA 2KROA 5KE2A 2KY9A 1K76A 1Z9QA 3JCMf 1KIKA 2DL7A 1WI7A 3Q1JA 1BI3A 2ED0A 3L1AA 2IVWA 4OMFB 2JTFA 4P5NA 4FSSA 5CQXA 3VS3A 2J6KA 1VQPA 1ZSZA 4JJNK 1EZZB 3CCRQ 9ATCB 5IXFA 3OYMA 3CD6T 1UGPB 4JRQA 1PD1A 1WLPB 4RMOA 1VQ9Q 2A7YA 3LX7A 3UWNA 2QA4T 1EFNA 4M7AG 2QQAA 1MGQA 3GIBA 3E19A 3EGDB 2LT4A 1AT1B 5L8RE 4C92F 3CC4Q 1Y57A 2CZ1B 4E7SA 4QT7A 2WACA 3HRSA 3EG2A 3HSBA 4OMQA 1HD3A 1GCQC 3J7AF 2DXUA 3OS0A 4RG2A 1B07A 2KRSA 2DEQA 2SEMA 1T3SA 3QDRB 1G83A 1HSQA 2HSPA 2QGFB 5FU7B 2ZPIB 3QIIA 2L89A 5CKEA 3CXCS 2GBQA 4MDXA 2F1LA 3JCMc 3JRZA 2LCSA 3PIPA 5GAOl 1QVFP 4O5VA 4R56A 5FLXE 4PJNA 1VQPQ 4M77E 4DOWA 3DB3A 1KD1C 2XDPA 2K3YA 3MEVA 2K6DA 1WHMA 1UE9A 3CC7A 4LUEA 1YNZA 1YJWQ 3BFMA 1WGSA 2GGRA 1FMWA 3EG1A 4A4FA 1YJ9A
chains in the Genus database with same CATH topology
1W4SA 3M57A 2EQKA 1VIEA 4NS5A 5GAOp 3QBYA 3FLGA 1XQHA 3TEEA 5GAOm 4C5EA 4GLKA 4KBMB 4A4KA 4DQ2A 4HA8A 4GY5A 1KC8C 3H8ZA 2PVOB 1M5Q1 4BI8B 2CZ6B 2MWOA 3OY9A 1M8VA 3CCJT 1JJ2S 4L6V5 2DIQA 2VXFA 4F7UB 1QVPA 3CCUA 1NE8A 4C5IA 2K5LA 4M75F 2QDYB 4M78E 4XQ3A 2FB7A 3MEWA 3OS2A 1Q82C 3OSVA 5GANf 3GOXA 1IZ6A 2P0PA 3UDCA 3L2WA 2BIVA 4IUPA 4BY6B 2MMPA 2ZPHB 3CXCA 2GFAA 4F7UE 2E65A 3MP1A 1VQ8A 4PKCC 2PVGB 5CKBA 3VYGA 4N0AA 3C4SA 1VQLT 5EG2A 3ME9A 5CKDA 1VIFA 4N0AC 4C92B 5GANd 2F5KA 3I55T 1VQ6A 3QJYA 1Q81U 4M78G 1OYXA 5GAN5 4EMGA 1FX7A 2ZPGB 5FROA 1XTDA 1EIFA 3OSSC 3QPHA 1X6OA 4UC4A 3LYIA 4F7UG 1S72T 4A54A 4PLIA 5GMKl 3M58A 3JCMJ 2HNIA 1H641 3BDUA 4VUBA 4M78F 4PLLA 5CIUA 2WSEE 4C92E 3OYJA 1ZBXA 3E1SA 2I2LA 4MZMA 3BW1A 3ZEHA 1G3YA 4Y91A 2QQ9A 2DJZA 3GNGA 2VYTA 4C0DB 1N9SA 2QTXA 1WPYA 4OB3B 3JCMd 3OS1A 3OYDA 1FXXA 1VQ4A 1N9RA 2ZZDA 2OTJT 3C94A 2LT1A 4BB7A 3OYFA 2EYQA 3M53A 3CBMA 4JRKA 1QP3A 1AHJB 1UB4A 3WVDB 3G4ST 1H3ZA 5DLOA 4MMLA 4MMKA 4C92G 1Y07A 4ZGDB 3BDLA 4DOVA 3OYKA 1K8AU 3R6OA 1PSFA 3VJPA 4BDZA 1U8RA 2PQWA 3CCJA 3FC3A 1M1KC 4C92D 5GMKi 4MZTA 2KMTA 5DLQE 4C8QB 3OYAA 4FSXA 4ZN3A 1BI2A 4BE2A 4QQDA 4M78A 2QI2A 4JS4A 4ATOA 2F5TX 4M78C 3PGGA 3HRUA 5D6WA 4J6YA 1YITT 1JJ2A 3M4YA 1G5VA 3V7RA 4B9WA 4F7UA 5J3BA 3OW2S 3WVEB 2L5QA 3M56A 1IREB 4C8QE 1VQLA 4ELYC 2K57A 4BUGA 4KT0E 4X9DA 1K8AC 3CBPA 1YJNT 5KCOA 3OYGA 4QVZA 2K5IA 3OYLA 3I55A 1R8OB 2DZ9A 1NJIU 2GF7A 3MEAA 3VYHB 4X9CA 1KG1A 3T9NA 3S3NA 2KAFA 3O8VA 3J80E 2YLBA 1SSFA 2H3JA 3EFRA 4BY6C 2V8KA 1Y7XA 4LDWA 4XK8E 4EMKB 1S72A 5D6XA 4C5HA 1QVFA 4OP0A 1O9SA 4C8QG 2DK3A 4C92A 2M9UA 2VC8A 5LJ3h 2CZ0B 3PTAA 1VQNT 3RESA 2OTLT 4LD9K 4C8QD 1M1GA 1P92A 4XAXB 5FU6B 2LX9A 3RKWA 5CK9A 4L59A 3CMET 3CCRT 4JS5A 2DXCA 2XKOC 2D9TA 2OTJA 5A2QE 5IAYA 2E64A 2PUOB 5GAN3 2K5FA 3DB4A 3G4SA 4MZPA 3MP6A 3JB9I 2VGNA 2LTOA 2XICA 1UGQB 2HQXA 3HFOA 3CPWS 1KQ2A 2GQVA 5LJ5j 4M75B 1LOJA 1QP2A 1I81A 3JCMb 4OGCA 2EJFA 4JDSA 2E10A 2X4WA 4YTLA 1UGSB 2QQSA 3L2UA 5GAOq 2LC4A 1BYMA 1YITA 1V29B 3M55A 1N8RU 3NTIA 4M75E 1Y96B 4A4GA 2PU9B 1I5LA 1GXIE 5GAMh 1LJOA 2P0QA 4N4GA 2EWNA 4OGEA 4C0GA 4C8QA 2FVUA 5GMKh 2DVEA 4E7LA 2JUFA 3QG1A 5IT9E 1YJNA 2R5MA 2D6FA 3CCMT 4XU0A 2RK2A 1Q86U 4J83A 2RHUA 3X25B 2R5AA 5DY9A 2EFIA 2MF2A 1M9SA 1NZ9A 2R57A 4M75G 4M78B 4CI0C 1TH7A 4Z02A 5CKFA 2XG8D 5LJ3g 4M7DF 2E70A 1N27A 2EQUA 4M75D 5LJ5e 1VQNA 2RD1A 2OTLA 3WXMB 3M5AA 3META 2RHIA 3QXEB 2KQWA 3CCQT 2DKGA 1XNIA 2O01E 4QQGA 3JAME 3CMEA 3CCRA 2JTMA 3OS5A 3QYHB 4EMKA 3L2ZA 5J39A 3M54A 2X4JA 4QVCA 2Y4YA 4EMKC 1RL2A 3OYIA 4RCBA 3H6ZA 3RKXA 3LGLA 2KSSA 1BI1A 4BDYA 2OAUA 5C6SA 3ASKA 4J5YA 4BE1A 3PFSA 3ER0A 3HRTA 2FHDA 3JCMQ 1VQMT 2LDMA 2RI2A 5A0DA 1PSEA 4A4EA 3J81E 1M90U 5FU6C 4JLIA 2C06A 1QW1A 2LQ8A 4Q5WA 4NOYA 1W2BA 3LH0A 1QVFS 3QJ6A 3GF5A 3N5BB 2DXTA 3FEOA 2M1HA 3KUFA 3CPWA 3JB9F 3S3MA 4IUTA 4M78D 5IN1A 4M7DC 5LJ5f 5GAMg 1VQ7T 4M75A 5M9OA 5LJ3j 3CCVT 3QSUA 3L42A 1YJWT 3QZ5B 4M75C 3ZFJA 5CAIA 3SDZA 4J6XA 5LJ5d 3CCMA 2PUKB 3G7ZA 4D6WA 2KK4A 1Q81C 1Y96A 3JCMh 2JNGA 4QVDA 2QEXT 2E6ZA 3A8MB 2VXEA 4FL6A 4LDXA 3UPUA 5KH6A 2E12A 3GLXA 2XIDA 4TVRA 3FB9A 2A3LA 2CKKA 3CC2T 1BIAA 3CCQA 3OYEA 3MO8A 3M9QA 3L2RA 4HT9A 1BI0A 1KQ1A 4ELZC 5GAMj 4A53A 5CKHA 4PNOA 5I2MA 3AHUA 5GMKj 2LCLA 3P8DA 4BE0A 4XTZA 5LJ3e 4LDVA 4PL6A 4EPCA 3C95A 4J8OA 4KULA 1VQMA 2RI3A 4HCCA 5GMKm 4LDYA 4XTVA 3C12A 5GAN4 1KHCA 3DLLA 1YJ9A 3RERA 1WNLA 2RH2A 1KHIA 2K2VA 1WQWA 2RM4A 2QQBA 4DA4A 3GNFB 1YBYA 5FRNA 2MWPA 3NTKA 3SWNA 4XU2A 3L2VA 3EFSA 5GAOn 1X01A 3SWNC 1K73U 5GAN6 1G3SA 1VQ7A 5KCHA 1XOVA 2CGHA 3CCVA 5CQYA 2K3XA 3JCMW 2RHZA 4EDUA 1YJWA 3PNWC 2AHJB 4M7AF 3DLMA 5GAN8 4IURA 1YHQT 3QZ9B 5GAN2 3PMTA 1G3WA 3I56T 1YCYA 2DXBA 2LQKA 1KQSA 3CCET 2DTOA 3GPLA 3JCMg 4A4HA 1K9MU 2Y90A 3DKMA 5LJ3f 1NJIC 2HD0A 2WSFE 1W2BS 1VQ9T 5GAMe 4M7DB 3CEYA 3OYNA 3BY7A 4Y28E 2QEXA 2DD5A 5GMKe 3PT9A 3S6WA 2EQJA 3OBWA 3RKYA 1HK9A 4PJOE 3VU3C 1JB0E 3RIRA 5LJ3d 3JB9H 2QQRA 1VQ5T 3FDRA 4L5GA 3CC2A 1QVGA 3NTHA 2VV5A 2CS7A 4ZGEB 3CC4T 1O75A 3VV0A 1KD1U 4M7DE 2WSCE 2DZCA 3OQ5A 2GFUA 1D3BB 5CO7A 1VUBA 1BKBA 2EKOA 2ZCFB 3FIFA 4II1A 2VUBA 4XTWA 4IKFA 1Q7YU 4PJOG 3G6ET 2IG0A 1FWZA 2GCXA 2RB6A 1U1SA 2EQMA 5C0MA 3OB9A 1Y71A 3QUIA 2RJDA 5GAMf 4M7DG 2XU8A 4O6JA 4PJOF 2CZ7B 4OB1B 3SB2A 3X20B 3JCMP 1G3TA 3OMCA 3LWIA 3HP9A 2MI6A 3MP8A 5D6YA 5A0LA 1HXDA 4BI3A 4M7DD 4HCBA 3HKSA 4XTUA 4V2SA 2ZGWA 3G71T 3NFCA 1N8RC 4OVAA 3OYCA 1YI2T 4RG8A 4LD6A 3A8GB 2E1HA 2YLCA 2O4XB 1YHQA 2EJGA 5CVIA 5LL6S 3I56A 2XD0A 1WJRA 3CCEA 3V7SA 3A8OB 5KE3A 2RO0A 1Q86C 3HL8A 4M77G 4KUDK 2D0QB 3MHXA 2HAXA 3HHTB 3E9GA 2ZPFB 1VQPT 4FIBA 2XDBA 1VQ9A 3SWNB 3X24B 3ZBDA 3L2QA 1Q82U 4FT4A 5CCAA 3PIOA 2DIGA 4ZN1A 1WQ7A 2EIFA 3CPFA 4PJOA 2YHTA 3JB9G 2R58A 2LCCA 4M77F 4JUVA 4JRPA 4PJOC 1VQ5A 2JOYA 2RA2A 3FJPA 4QW2A 5HK0A 3JB9D 4HT8A 3CC4A 2E6NA 2JN0A 3JCMe 1WJSA 3JSCA 4XTYA 2RJCA 3P8HA 1B34A 2XDDA 5GANh 3TU4K 4M7DA 3CMAT 3OMGA 2QXFA 1KQSS 3UT1A 2LNVA 2K4YA 3QYGB 3V7CA 1NPPA 2EJ9A 3SD4A 3JCMV 3G6EA 2F69A 2CYZB 2HBPA 4N4IA 2LVMA 5FU7C 4HKEA 4NL2A 3MEUA 4E47A 2XI9A 1RI0A 3CCST 1D3BA 5HKCA 1M90C 3OYYA 1M1FA 4BI4A 2ZPBB 3MCAB 3INZA 1ZQ1A 2ZPEB 3TCJA 3OYBA 4XU1A 3QHSA 2L3RA 4M77A 2NLUA 2G3RA 4RCCA 5LJ5h 5DM7R 1VQOT 1OZ3A 2E41A 4KUIA 1QVGS 2B8AA 4FM4B 4M77C 4M7AB 1OI1A 1JBMA 2LRQA 4QQ6A 4C0FA 2DAQA 3G71A 1JRIA 2Y4XA 5KE2A 1YI2A 2KY9A 3JCMf 2MAMA 4NL3A 3Q1JA 1BI3A 4ZTJA 1M1KU 2XHCA 3L1AA 5FRMA 4N4HA 2IVWA 4J7IA 2JTFA 4OMFB 4P5NA 2P4TA 4M7AE 2P0KA 2DD4A 3A8LB 4OB0B 5CQXA 3A5ZB 4F7UF 1VQPA 4JLGA 1M4ZA 4JJNK 2X4XA 3S3OA 4E7JA 4XTXA 2RHXA 2O4XA 5I21A 3OYMA 3KXTA 3CD6T 4WF2A 2X4YA 1UGPB 4JRQA 4HCZA 3CBOA 2DPPB 4J6WA 3P8BB 4RMOA 4E7HA 2A7YA 5AYFA 4ME7A 2RJFA 3QO3A 3LX7A 4LDUA 3UWNA 2QA4T 2M0OA 3LLRA 3FRNA 5GANg 4IUUA 3VUBA 2XK0A 4M7AG 2QQAA 1MGQA 2E5QA 2HQEA 5HK3A 3CMAA 3GIBA 3E19A 2LT4A 4M7AD 2EAYA 5L8RE 4C92F 3M59A 3RMQA 3E9FA 2V8IA 3V8KA 2CZ1B 2DTIA 3X28B 2WACA 3RMSA 4BD3A 3KBGA 3HRSA 3CCLT 1VQKT 3SFMA 3CC7T 3HSBA 4PJOB 3PMIA 4OB2B 3CCSA 4OF1A 1WJQA 4XU3A 2DXUA 3J7AF 3X26B 5LJ5g 2M16A 4CRIA 3OS0A 1VQOA 4RG2A 3OA6A 2RHYA 2YRVA 1B34B 2RJEA 2DEQA 4EMHA 1K73C 3EAEA 3QDRB 1YJ9T 3A8HB 2DTHA 3TREA 3V8JA 4JRIA 3RUXA 4MDWA 5FU7B 2ZPIB 4C5GA 3HPWA 3QIIA 5GANj 1UEBA 4IUQA 2L89A 4J7FA 2X35A 5CKEA 3CXCS 2L8DA 4C92C 3CCUT 2FL7A 4M7AA 4MDXA 5GAOr 1K9MC 3JCMc 4ZGJB 5A0GA 4R55A 3JRZA 3PIPA 4M7AC 2VGMA 1BIBA 5GAOl 2RK1A 4FT2A 4O5VA 4M77B 3LW5E 4C8QF 4R56A 3LWHA 3CD6A 5FLXE 3M4GA 1VQ8T 2DO3A 1U1TA 1I4K1 1X75C 4B9XA 2JZ2A 1DJ7B 4C0ZA 4PJOD 3VKIA 1UGRB 2BUDA 3LGFA 2QA4A 3JB9J 3V8LA 3GP8A 4E7KA 5I2SA 1N6AA 2FYKA 1I8FA 4C0DC 5HY6A 4M77E 4BACA 1VQ6T 4DOWA 3DB3A 1KD1C 2XDPA 1YIJA 2K3YA 3MEVA 2PVDB 1NPRA 3URGA 1LNXA 5GAMd 4RKUE 1KC8U 3HFNA 5CR2A 1Q7YC 3CCLA 3QKJA 1MHNA 4FU6A 1YIJT 1VQKA 3CC7A 4E7IA 4X34A 2KDSA 2KVQG 5J26A 5GANe 3OYHA 1ZHIA 3BFMA 3OBYA 1WGSA 1OZ2A 3JCMX 4C8QC 2RI5A 3VUZA 4IUVA 1VQ4T 2BKDN 2JVVA 4ZTFA 2V8JA 4M77D 3OW2A 3F70A 4A4FA 5GAN7
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4S A;  3PT9 A;  4KUI A;  4DA4 A;  4DOV A;  4DOW A;  3TU4 K;  4FSX A;  3PTA A;  2FL7 A;  4LD9 K;  1ZBX A;  4FT2 A;  1ZHI A;  4KUD K;  2FVU A;  1M4Z A;  4JJN K;  4KUL A;  4FT4 A;  4BB7 A; 
#chains in the Genus database with same CATH topology
 1W4S A;  4AMC A;  1G8X A;  2EQK A;  3FLG A;  5GAO m;  2DF6 A;  4GLK A;  4DQ2 A;  4A4K A;  1KC8 C;  4GY5 A;  2AT1 B;  2PVO B;  1M5Q 1;  2CP3 A;  2MWO A;  1JJ2 S;  4L6V 5;  4C5I A;  1GFD A;  1JXM A;  2DBK A;  4K11 A;  1Q82 C;  3OSV A;  3TSZ A;  5GAN f;  2P0P A;  3GOX A;  3L2W A;  4IUP A;  3SEM A;  4BY6 B;  1QCO A;  4F7U E;  1F1B B;  2PVG B;  1VIF A;  4ORZ A;  3ZL7 C;  2F5K A;  3I55 T;  2IPO B;  1OYX A;  5GAN 5;  2ZPG B;  2HL3 A;  5GMK l;  4PLI A;  3JCM J;  1YIJ A;  3BDU A;  5CIU A;  1SG5 A;  2HL5 C;  1UUE A;  2H8H A;  3BW1 A;  4Y91 A;  1HYO A;  2QQ9 A;  2VYT A;  1SRL A;  3CCE Q;  2X3W D;  1N9R A;  2CP5 A;  3OYF A;  1MND A;  4JRK A;  2M02 A;  2DX1 A;  3WVD B;  1OUL A;  4AG1 C;  2W10 A;  4C92 G;  1Y07 A;  3BDL A;  1K8A U;  2YUP A;  4KGZ B;  4J9C A;  2PZ1 A;  4MZT A;  4OML A;  3OYA A;  4M78 A;  4JS4 A;  1M3A A;  3PGG A;  3HRU A;  5D6W A;  1YIT T;  1G5V A;  3V7R A;  3PVQ A;  2L5Q A;  3WVE B;  1VQL A;  4RTY A;  4C8Q E;  4FYX B;  4KT0 E;  1W70 A;  2GF7 A;  3T9N A;  2V8K A;  4XK8 E;  3HTR A;  4EMK B;  2RN8 A;  1S72 A;  1D0Z A;  5D6X A;  1O9S A;  1RAI B;  2M9U A;  2VC8 A;  2NYS A;  3PTA A;  3RES A;  2QYZ A;  4E7Z A;  1PCX A;  5FU6 B;  3RKW A;  3CCR T;  2GTJ A;  1YIJ Q;  2DXC A;  1RAF B;  1LVK A;  2L3S A;  3VS2 A;  2J6O A;  2K5F A;  2HCK A;  1UGQ B;  3CPW S;  1KQ2 A;  1Q95 G;  1K9A A;  2A37 A;  1SHF A;  2DVJ A;  2E10 A;  2L2P A;  3L2U A;  1D0X A;  1BYM A;  1E6G A;  1N8R U;  4M75 E;  5FWB A;  2PU9 B;  1LJO A;  2P0Q A;  4N4G A;  2CP2 A;  2DVE A;  2LQW A;  2JUF A;  1YJN A;  3TSW A;  2LMJ A;  2D6F A;  1VQL Q;  2VKN A;  1BCO A;  4AFS C;  5DY9 A;  4LN2 A;  1NZ9 A;  5CKF A;  5LJ3 g;  5LJ5 e;  3R6N A;  4B6M A;  3WXM B;  2JM9 A;  2JTM A;  2EPD A;  4EMK A;  4QVC A;  2Y4Y A;  2F2W A;  4RTT A;  3RKX A;  1M27 C;  2FRY A;  2OAU A;  4WCI A;  1OPK A;  1BB9 A;  3EH1 A;  3HRT A;  1VQM T;  3JCM Q;  5A0D A;  4A4E A;  3J81 E;  4JLI A;  2J7I A;  4Q5W A;  1JXO A;  4IUT A;  5IN1 A;  5KYU B;  1WHG A;  6AT1 B;  5LJ3 j;  3QSU A;  1VYV A;  1YJW T;  3QZ5 B;  4M75 C;  3GBQ A;  4ESR A;  3CCL Q;  2F2X A;  4D6W A;  1YP5 A;  2JNG A;  4GBQ A;  4QVD A;  2ED1 A;  2QEX T;  1WZO A;  4JJC A;  2A36 A;  3GLX A;  2EQI A;  3FB9 A;  4J9B A;  2CKK A;  1AZE A;  1BIA A;  7AT1 B;  4HT9 A;  1BI0 A;  2RQW A;  3CCU Q;  1KQ1 A;  3M0S A;  4PNO A;  5GMK j;  4DEY A;  1CKB A;  4EPC A;  4KUL A;  4LE9 A;  4XTV A;  5GAN 4;  3DLL A;  2J6F A;  4DA4 A;  3EFS A;  3EFO B;  1X01 A;  2JMC A;  4KGX B;  5GAN 6;  1G3S A;  3CCV A;  1X27 A;  2K3X A;  3JCM W;  4EDU A;  1ZSG A;  4IUR A;  1YHQ T;  3QZ9 B;  5GAN 2;  1YCY A;  2LQK A;  3CCE T;  2DTO A;  5KYU A;  3JCM g;  1NJI C;  1KD1 R;  4AFU C;  1W2B S;  1ZUK A;  5GAM e;  1VQ4 Q;  3BY7 A;  1WHJ A;  2EQJ A;  3RKY A;  3VU3 C;  2QQR A;  3FDR A;  4L5G A;  2VV5 A;  1KD1 U;  1TU0 B;  3CCJ Q;  5IHN A;  1VUB A;  2V1Q A;  3G6E T;  1RUW A;  4D8K A;  2GCX A;  1GCP A;  1U1S A;  2EQM A;  3UA6 A;  5C0M A;  1KC8 R;  2I0N A;  3QUI A;  1TWB A;  2XU8 A;  4O6J A;  2HKN A;  4PJO F;  1RLP C;  3OMC A;  3HP9 A;  5A0L A;  1HXD A;  3HKS A;  1E6H A;  3NFC A;  3OYC A;  2OI3 A;  2E1H A;  2YLC A;  2EJG A;  5CVI A;  3I56 A;  1VA7 A;  3CCV Q;  3V7S A;  4CC4 B;  2LJ1 A;  4KUD K;  2HAX A;  1PRL C;  3E9G A;  2HEQ A;  1Q82 U;  2BZY A;  3PE0 A;  4M77 F;  4JUV A;  2D8H A;  4QW2 A;  2JN0 A;  4XTY A;  3TU4 K;  2ROL A;  3O5Z A;  4HXJ A;  1KQS S;  3UT1 A;  1NPP A;  2EJ9 A;  1NEB A;  1XJW B;  4NL2 A;  3MEU A;  4E47 A;  5AT1 B;  4DBR A;  2ZPE B;  3QHS A;  4KUI A;  4ANJ A;  2CUD A;  3G71 A;  1D1A A;  4X1V A;  1GL5 A;  1JRI A;  2Y4X A;  1YI2 A;  3LH5 A;  3NMZ C;  3BE3 A;  2MAM A;  5FRM A;  1AWW A;  4J9D A;  2DD4 A;  1WXU A;  2OTL Q;  4F7U F;  3I56 Q;  4JLG A;  4Z8A A;  3S3O A;  4E7J A;  1ZSZ C;  3EHR A;  2D1X A;  1K0S A;  4HCZ A;  1UEC A;  3CBO A;  2YUO A;  3P8B B;  2BE7 D;  4J6W A;  2QG9 B;  4ME7 A;  3QO3 A;  3VS7 A;  3H0H A;  1X6G A;  1WFW A;  2M0O A;  3LLR A;  5GAN g;  3VUB A;  4J9I A;  2EAY A;  2ESW A;  3X28 B;  2JM8 A;  3RMS A;  3KBG A;  3CCL T;  2EBP A;  3PMI A;  4OB2 B;  4OF1 A;  4XU3 A;  5LJ5 g;  3ULR B;  3OA6 A;  2ATC B;  3H0I A;  4JRI A;  4C5G A;  1D1B A;  5GAN j;  3CCU T;  2L8D A;  2FL7 A;  5GAO r;  1ZA1 B;  1NYG A;  2JS0 A;  1CSK A;  2VGM A;  1QWF A;  4C8Q F;  3LW5 E;  4KGV B;  1CKA A;  2JZ2 A;  1TS9 A;  1UGR B;  3V8L A;  1KSW A;  3GP8 A;  5HY6 A;  1T0J A;  1VQ6 T;  3E2U A;  4RKU E;  5GAM d;  1ZSZ B;  1PNJ A;  2DRK A;  3HFN A;  5CR2 A;  3QKJ A;  4FU6 A;  1VQK A;  1JO8 A;  2KVQ G;  1ZHI A;  3OBY A;  2EYY A;  3JCM X;  2RI5 A;  1VQ4 T;  2BKD N;  2JVV A;  2YUN A;  3OW2 A;  4RTZ A;  4HA8 A;  3H8Z A;  4BI8 B;  2CZ6 B;  3OY9 A;  3CCJ T;  1WDX A;  2VXF A;  1H3H A;  4M75 F;  2QDY B;  4M78 E;  3MEW A;  1UFF A;  3M0Q A;  1QCF A;  3UDC A;  1VQ8 A;  2GFA A;  2E65 A;  3QDF A;  4PKC C;  3VYG A;  1WHH A;  4N0A A;  5EG2 A;  2EGE A;  4EMG A;  1FX7 A;  5FRO A;  2NUT B;  1NLO C;  3UF4 A;  1X6O A;  4F7U G;  4A54 A;  1H64 1;  4J9F A;  4MZM A;  2DJZ A;  1VQK Q;  1N9S A;  4OB3 B;  1WPY A;  4CC3 A;  3OS1 A;  2OTJ T;  3C94 A;  2LT1 A;  3CBM A;  5KYX B;  1H3Z A;  1AHJ B;  1UB4 A;  2FZK B;  5DLO A;  2YUQ A;  4MMK A;  3OYK A;  4BDZ A;  2PQW A;  2C0I A;  1M1K C;  1QCN A;  2KMT A;  1X69 A;  2KRN A;  4QQD A;  2RQT A;  1QKX A;  1NJI R;  4KH0 B;  4M78 C;  4B9W A;  5J3B A;  1D0Y A;  2K57 A;  4BUG A;  2FZC B;  4X9D A;  2E5K A;  2O9V A;  3OYL A;  4AG2 C;  2DZ9 A;  1NJI U;  1TSF A;  1KG1 A;  1M2V B;  1UHF A;  3O8V A;  2YLB A;  1NM7 A;  2H3J A;  1K9M R;  4BY6 C;  1Y7X A;  3H9N A;  1H92 A;  4C8Q G;  2F2V A;  1VQN T;  2K7A A;  1K1Z A;  2OTL T;  4LD9 K;  1M1G A;  2NUT A;  2NWM A;  3A98 A;  2E64 A;  3QWX X;  5GAN 3;  2DL5 A;  2RMO A;  2L3P A;  4MZP A;  3G4S A;  2VGN A;  2XIC A;  1OU9 A;  2HQX A;  2GQV A;  1Q7Y R;  1LOJ A;  1Y0M A;  1OU8 A;  4JDS A;  4ZNX A;  5KYX A;  4YTL A;  5GAO q;  2LC4 A;  1MV3 A;  1V29 B;  4A4G A;  1GXI E;  5GAM h;  4E6R A;  4OGE A;  4C0G A;  2FO0 A;  2P4R A;  1GBR A;  4J9E A;  4XU0 A;  4J83 A;  2RHU A;  4M78 B;  4M75 G;  2B86 A;  4Z02 A;  1W6X A;  1FYN A;  1C1A A;  4AFQ C;  3QXE B;  2RHI A;  1M2V A;  2KQW A;  3CME A;  1XNI A;  4QQG A;  3CCQ T;  4PJM A;  1R0B G;  1S1N A;  3L2Z A;  1RAB B;  1AD5 A;  1PHT A;  4EMK C;  4RCB A;  3LGL A;  2KSS A;  1BI1 A;  4JZ3 A;  5C6S A;  4BDY A;  2DL4 A;  3ASK A;  4J5Y A;  4BE1 A;  3MJX A;  2QAS A;  1PSE A;  1B3Q A;  5FU6 C;  3G4S Q;  1M30 A;  1QW1 A;  1QVF S;  4NOY A;  3NHN A;  2COZ A;  3QJ6 A;  2QAZ A;  3FEO A;  4M7D C;  4M78 D;  2Z0W A;  5LJ5 f;  1VQ7 T;  5I11 A;  2JTE A;  4J6X A;  3CCM A;  3CC7 Q;  1RAG B;  1ABO A;  1Q81 C;  2G6F X;  3G1J A;  2E6Z A;  1M2O A;  4F16 A;  1YJ9 Q;  4TVR A;  2A3L A;  3NGP A;  3MO8 A;  3M9Q A;  2AZV A;  1QKW A;  3CME Q;  5CKH A;  3AHU A;  2LCL A;  4BE0 A;  2RI3 A;  1B7T A;  5GMK m;  4LDY A;  1H8K A;  4PFP A;  4LUD A;  2RM4 A;  2HBW A;  3GNF B;  5FWC A;  5FRN A;  1R77 A;  1XOV A;  3DLM A;  3PMT A;  1G3W A;  2D8J A;  1GBQ A;  2NUP A;  3I35 A;  3I9Q A;  1OOT A;  1VQ9 T;  3CCM Q;  4M7D B;  4PFZ A;  2DER A;  3OYN A;  2DEU A;  5D7U A;  1HK9 A;  1JB0 E;  3RIR A;  5LJ3 d;  3CC2 A;  1IXD A;  4E2F B;  1QVG A;  1X43 A;  3NTH A;  3CC4 T;  1O75 A;  2LNH B;  2AZS A;  2EKO A;  2ZCF B;  3FIF A;  3OB9 A;  1I07 A;  1Y71 A;  5GAM f;  2CZ7 B;  1IHV A;  3X20 B;  2CUB A;  1MUZ A;  4HVV A;  4M7D D;  1J3T A;  4XTU A;  4OVA A;  3EGX A;  4KH1 B;  2O4X B;  1S72 Q;  2ENM A;  3RBB B;  2DMO A;  3HL8 A;  3MHX A;  2ZPF B;  1VQP T;  3ZBD A;  3PIO A;  4ZN1 A;  1WQ7 A;  4PJO A;  1PKS A;  3I5S A;  4M4Z A;  1RAD B;  4WTO B;  4JRP A;  2MOX A;  1VQ5 A;  3JB9 D;  5HK0 A;  2W0Z A;  3OW2 P;  4M7D A;  3JSC A;  3P8H A;  1B34 A;  2RQR A;  3OMG A;  3CC2 Q;  2HMA A;  2QXF A;  4OMN A;  2K4Y A;  4GLM A;  3SD4 A;  2CYZ B;  2LVM A;  2EYW A;  2DIL A;  3JV3 A;  5HKC A;  3OYY A;  1M1K R;  1ZQ1 A;  1TUG B;  3AT1 B;  4M77 A;  1YJN Q;  2KGT A;  4M7A B;  2ROT A;  4PK4 A;  2LRQ A;  4QQ6 A;  1M3B A;  2FPD A;  2C0T A;  2GTO A;  4ZTJ A;  1M1K U;  4N4H A;  2LP5 A;  2P4T A;  2P0K A;  1PM3 A;  3A8L B;  3A5Z B;  4DBF A;  4JZ4 A;  4XTX A;  2RHX A;  2O4X A;  1I0C A;  5I21 A;  2EKH A;  2X4Y A;  1IO6 A;  2AIR B;  2CDT A;  2DPP B;  4E7H A;  5AYF A;  4Y92 A;  2RJF A;  2CH4 A;  2GNC A;  3FRN A;  2XK0 A;  4JJD A;  2DRM A;  2HQE A;  5HK3 A;  3CMA A;  1VQ5 Q;  4M7A D;  2YSQ A;  3E9F A;  3V8K A;  4Z88 A;  1AEY A;  4BD3 A;  1PC0 A;  1PKT A;  3SFM A;  3CC7 T;  2CT4 A;  8ATC B;  3CCS A;  3X26 B;  2D0N A;  2M16 A;  1VQO A;  2RHY A;  2YRV A;  2NUZ A;  4EMH A;  3EGU A;  3EAE A;  1YJ9 T;  3A8H B;  2DTH A;  3TRE A;  3V8J A;  2O88 A;  2QK0 A;  2CP7 A;  4MDW A;  2H3E B;  2DL3 A;  3HPW A;  4J7F A;  2X35 A;  4DBH A;  4C92 C;  4M7A A;  1K9M C;  4KRT A;  1BIB A;  3LWH A;  1C6V X;  2O9S A;  3CD6 A;  2A0F B;  5IHK A;  1RAE B;  2L0A A;  4IIM A;  2DO3 A;  1I4K 1;  1TUC A;  1X75 C;  1DJ7 B;  2BUD A;  4QKU A;  2QA4 A;  1YWP A;  2FYK A;  3PVL A;  4BAC A;  1V76 A;  1E7O A;  5IHI A;  3URG A;  1LNX A;  2EW3 A;  1TUD A;  2DM1 A;  1KC8 U;  1Q7Y C;  8AT1 B;  1YIJ T;  4X34 A;  3UA7 A;  5J26 A;  3OYH A;  5ECA A;  2KEA A;  3VUZ A;  4ZTF A;  2V8J A;  2DL8 A;  3F70 A;  3M57 A;  1VIE A;  4NS5 A;  2RNA A;  1XQH A;  3TEE A;  4C5E A;  1TG0 A;  1EX4 A;  2XMF A;  1M8V A;  2DIQ A;  1RI9 A;  1NE8 A;  4XQ3 A;  2FB7 A;  1FMV A;  1Q81 R;  3OS2 A;  2BIV A;  2LZ6 B;  1VQL T;  3ME9 A;  1GRI A;  4N0A C;  3EG9 B;  4C92 B;  5GAN d;  3QJY A;  1RLQ C;  1Q81 U;  4M78 G;  2QA4 Q;  4FYV B;  1BK2 A;  1NYF A;  1EIF A;  2C0O A;  3LYI A;  1S72 T;  4IIO A;  1BCM A;  1YFN A;  3M58 A;  2RPN A;  4LXC A;  1ZBX A;  3SHW A;  2I2L A;  1IGQ A;  3ZEH A;  1G3Y A;  1I5O B;  2CH4 W;  1FXX A;  1WXT A;  4BB7 A;  1QWE A;  3M53 A;  1Z9Z A;  4MML A;  2OJ2 A;  1X2Q A;  3R6O A;  1PSF A;  1U8R A;  4C92 D;  4FSX A;  4ZN3 A;  1BI2 A;  4BE2 A;  2QI2 A;  2P84 A;  1WX6 A;  3H41 A;  4J6Y A;  1K73 R;  2AKL A;  3VS5 A;  1K8A C;  3CBP A;  2JXB A;  1YJN T;  3OYG A;  4QVZ A;  3I55 A;  4HVW A;  3MEA A;  1IHW A;  4X9C A;  2KT1 A;  1SSF A;  2OAW A;  2VB6 A;  1KJW A;  2K9G A;  4C5H A;  1NBE B;  3G71 Q;  3EG9 A;  2MPX C;  4C92 A;  4F04 B;  1YI2 Q;  2CZ0 B;  2LJ0 A;  1P92 A;  2A08 A;  4XAX B;  5CK9 A;  2K3B A;  1I1J A;  2D9T A;  3A1P A;  5IAY A;  5IXB A;  2FRW A;  3JB9 I;  2LTO A;  1UJY A;  3HFO A;  5LJ5 j;  2L3Q A;  1M3C A;  3EG3 A;  4CC7 A;  2EJF A;  2M0Y A;  1AVZ C;  2X4W A;  1IRX A;  1UGS B;  1NLP C;  4J9G A;  1YIT A;  3M55 A;  3VRY A;  3NTI A;  1Y96 B;  1QVG P;  1YWO A;  2DLP A;  2EWN A;  2FVU A;  3QG1 A;  3QWY A;  5IT9 E;  2RQU A;  1VYT A;  2RK2 A;  4A63 B;  2RF0 A;  2O31 A;  2DE0 X;  3I55 Q;  1M9S A;  2DJQ A;  2VVK A;  1TH7 A;  2E70 A;  1UGV A;  1N27 A;  1ZUU A;  2EQU A;  2GQI A;  3M5A A;  2DKG A;  3JAM E;  3CCR A;  3OS5 A;  3QYH B;  5J39 A;  3M54 A;  2KXC A;  3KFV A;  2AK5 A;  3PFS A;  2FHD A;  2RI2 A;  4JJB A;  2LQ8 A;  1W2B A;  3LH0 A;  3GF5 A;  2KRM A;  2M1H A;  3KUF A;  1RAC B;  5GAM g;  1WIE A;  3FJ5 A;  3CCV T;  3L42 A;  1LPL A;  4RUG A;  5CAI A;  2QDL A;  1YIT Q;  3SDZ A;  1K4U S;  5KYW B;  2FG0 A;  1Y96 A;  1A0N B;  2DET A;  3CXC P;  1AOJ A;  2VXE A;  2A28 A;  3UPU A;  1T0H A;  5KH6 A;  2E12 A;  5KYY A;  3RDV A;  3OYE A;  3L2R A;  4PJJ A;  2MIO A;  5GAM j;  2KYM A;  1OEB A;  4XTZ A;  5LJ3 e;  4LDV A;  4J8O A;  4JPB W;  1LCK A;  1VQM A;  4HCC A;  1UG1 A;  2EYX A;  3VS6 A;  1VQ8 Q;  1KFZ A;  1UHC A;  1KHI A;  2K2V A;  2RH2 A;  2QQB A;  1YBY A;  3SWN A;  4XU2 A;  3L2V A;  1ZA2 B;  5GAO n;  1UTI A;  5CQY A;  1YJW A;  2DFU A;  2HZY A;  3CQT A;  5GAN 8;  1JU5 C;  3I56 T;  1KQS A;  1K9M U;  2Y90 A;  1NEG A;  1IGU A;  2BZX A;  1JJ2 P;  2HD0 A;  3CEY A;  2QEX A;  2DD5 A;  5GMK e;  4PJO E;  1D1C A;  5KYW A;  3JB9 H;  2HDA A;  4ZGE B;  3EHQ A;  4M7D E;  2WSC E;  2AKK A;  3OQ5 A;  2GFU A;  4PFO A;  1X6B A;  2DBM A;  1U06 A;  5CO7 A;  4IKF A;  4II1 A;  2VUB A;  1Q7Y U;  5FW9 A;  1SRM A;  2RB6 A;  1SEM A;  2RJD A;  1SKU B;  1VQM Q;  2CP0 A;  2KR3 A;  3SB2 A;  4Z89 A;  3MP8 A;  4HCB A;  2ZGW A;  3G71 T;  1ZLM A;  1YI2 T;  4RG8 A;  4LD6 A;  3A8G B;  1YHQ A;  1GFC A;  1MNE A;  2X3X D;  3CCE A;  3A8O B;  3EGD A;  2RO0 A;  1Q86 C;  2LX7 A;  1ZBJ A;  3X24 B;  2JW4 A;  4FT4 A;  1HJD A;  2EIF A;  3CPF A;  2R58 A;  2BZ8 A;  4PJO C;  2QEX Q;  2JOY A;  3FJP A;  4HT8 A;  3MKD A;  3JCM e;  1WA7 A;  1WJS A;  4J9H A;  2XDD A;  2RJC A;  2M51 A;  3V7C A;  2NUP B;  3G6E A;  2HBP A;  4N4I A;  1MMN A;  1RI0 A;  1ZUY A;  1D09 B;  1M90 C;  1M1F A;  2ZPB B;  3OYB A;  5EC7 A;  2K79 A;  4XU1 A;  2NLU A;  2G3R A;  4RTW A;  2E41 A;  4FM4 B;  4M77 C;  4FCY A;  1JBM A;  4C0F A;  2DAQ A;  2QTV A;  2FZG B;  1QLY A;  1OPL A;  4NL3 A;  2HKQ B;  2XHC A;  1RAH B;  2PTK A;  4J7I A;  1K8A R;  4OB0 B;  4M7A E;  3CPW P;  1YHQ Q;  1JQQ A;  1M4Z A;  3EG0 A;  3H0F A;  2HQH A;  2X4X A;  4HCK A;  3KXT A;  4WF2 A;  1MMG A;  2X9H A;  4LDU A;  3EGX B;  4IUU A;  2E5Q A;  2EYZ A;  2CRE A;  1SHG A;  3M59 A;  3RMQ A;  2V8I A;  4PJL A;  2DTI A;  2ABL A;  2YXY A;  1VQK T;  1GCQ A;  4PJO B;  1WHK A;  3G6E Q;  1WJQ A;  2O2O A;  4CRI A;  3REB B;  3NPF A;  1B34 B;  2RJE A;  4R0K A;  1K73 C;  1RAA B;  2YRD A;  3TVT A;  2EGC A;  1SF9 A;  3RUX A;  1OQK A;  1UEB A;  4IUQ A;  3RR6 A;  2RQV A;  4ZGJ B;  5A0G A;  4R55 A;  4M7A C;  1SPK A;  2JS2 A;  1M8M A;  2RK1 A;  2VWF A;  4FT2 A;  4M77 B;  4F17 A;  1MMA A;  3M4G A;  1AWO A;  1VQ8 T;  1U1T A;  4PJO D;  4B9X A;  4C0Z A;  1N8R R;  3VKI A;  3LGF A;  3JB9 J;  4E7K A;  5I2S A;  1N6A A;  1I8F A;  2OX7 A;  2CSQ A;  4C0D C;  3EH2 A;  3VRZ A;  2EGA A;  2PVD B;  1NPR A;  3VS1 A;  3CCL A;  1MHN A;  4E7I A;  3MPU B;  2KDS A;  4FW1 A;  5GAN e;  1OX9 A;  5HCK A;  1OZ2 A;  4C8Q C;  2V26 A;  4IUV A;  4AT1 B;  1ZX6 A;  4M77 D;  1YN8 A;  5GAN 7;  5GAO p;  3QBY A;  4LNP A;  4KBM B;  5GJV B;  1SSH A;  2K2M A;  2YDL A;  4F7U B;  3CCU A;  1QVP A;  1W1F A;  2K5L A;  2JJ9 A;  2SRC A;  1TXQ A;  5KYN A;  1IZ6 A;  3CXC A;  2MMP A;  2ZPH B;  3MP1 A;  2DNU A;  2V1R A;  5CKB A;  4F14 A;  1PG5 B;  3C4S A;  1K0X A;  5CKD A;  1VQ6 A;  1JEG A;  1XTD A;  3OSS C;  3QPH A;  4UC4 A;  2HNI A;  1W2B P;  4VUB A;  4M78 F;  4PLL A;  4C92 E;  2CT3 A;  2WSE E;  3OYJ A;  3E1S A;  2CP6 A;  2KI7 A;  3GNG A;  4C0D B;  3JCM d;  3LWI A;  2QTX A;  1VQ4 A;  3OYD A;  4RTV A;  2ZZD A;  1FMK A;  2EYQ A;  2MYS A;  2MCN A;  2JMA A;  1QP3 A;  3G4S T;  1UDL A;  4ZGD B;  1IB8 A;  4DOV A;  3VJP A;  3I5R A;  3CCJ A;  3FC3 A;  5GMK i;  5DLQ E;  2QGG A;  4C8Q B;  4ATO A;  2E3H A;  2F5T X;  1JJ2 A;  3M4Y A;  4F7U A;  3OW2 S;  3M56 A;  1IRE B;  1C0M A;  4ELY C;  3UAT A;  4FYY B;  2J06 A;  3M0U A;  5KCO A;  2K5I A;  1AWJ A;  1R8O B;  3VYH B;  3S3N A;  2KAF A;  3J80 E;  2COW A;  3EFR A;  1VQ6 Q;  4DEX A;  4LDW A;  1ARK A;  1WXB A;  1QVF A;  4OP0 A;  2DK3 A;  3THK A;  2J05 A;  5LJ3 h;  1KK7 A;  4C8Q D;  3CME T;  4JS5 A;  1UJ0 A;  2LX9 A;  4L59 A;  1X2K A;  2ECZ A;  2XKO C;  1PWT A;  5A2Q E;  2OTJ A;  2PUO B;  3DB4 A;  3MP6 A;  1KQS P;  4FYW B;  4M75 B;  2E3I A;  1VYU A;  1QP2 A;  1I81 A;  1BBZ A;  3JCM b;  4OGC A;  2YT6 A;  1Q86 R;  2QQS A;  1G2B A;  4RTU A;  2KE9 A;  3CMA Q;  1OV3 A;  1I5L A;  1U3O A;  2FPF A;  4EIK A;  4HVU A;  5GMK h;  4C8Q A;  1ACM B;  4E7L A;  2YRC A;  4OMM A;  2R5M A;  2EVR A;  3CCM T;  1Q86 U;  1T3L A;  3X25 B;  3CCS Q;  2R5A A;  2ZAE A;  2EFI A;  2MF2 A;  2R57 A;  4CI0 C;  1VQO Q;  3REA B;  2XG8 D;  1Q82 R;  4M7D F;  4M75 D;  1VQN A;  2BTT A;  2RD1 A;  2OTL A;  3MET A;  2O01 E;  1M90 R;  3EFO A;  3VS0 A;  4CC2 A;  2X4J A;  1N5Z A;  1RL2 A;  3OYI A;  1OX8 A;  3H6Z A;  1WHL A;  2OTJ Q;  2DYI A;  3ER0 A;  3CD6 Q;  1ABQ A;  2LDM A;  1M90 U;  2C06 A;  4D8D A;  3N5B B;  2DXT A;  2FEI A;  3CPW A;  3JB9 F;  2HSE B;  3S3M A;  3M0T A;  1AZG B;  2MK5 A;  4M75 A;  5M9O A;  3ZFJ A;  1V1C A;  2IIM A;  5LJ5 d;  2PUK B;  3G7Z A;  2KK4 A;  1AWX A;  3JCM h;  3M0P A;  4LDX A;  3A8M B;  4FL6 A;  3TQ7 P;  2XID A;  3CC2 T;  3C0C A;  3CCQ A;  5L23 A;  1VQN Q;  4ELZ C;  4A53 A;  1MV0 B;  5I2M A;  1R0C B;  3P8D A;  4PL6 A;  3C95 A;  3C12 A;  1KHC A;  1BU1 A;  3RER A;  1WNL A;  4OMP A;  2COY A;  1WYX A;  1WQW A;  2MWP A;  3NTK A;  3VS4 A;  2CSI A;  3SWN C;  1K73 U;  1VQ7 A;  5KCH A;  2CGH A;  2RHZ A;  3PNW C;  2AHJ B;  4M7A F;  1PRM C;  2DXB A;  3GPL A;  2LJ3 A;  1TTH B;  3IQL A;  4A4H A;  2LQN A;  4AFZ C;  3DKM A;  5LJ3 f;  1NG2 A;  2WSF E;  4Y28 E;  2DA9 A;  2FPE A;  3PT9 A;  3S6W A;  3OBW A;  1PD0 A;  1VQ5 T;  4FW2 A;  2BE9 B;  2E4H A;  2CS7 A;  1VOM A;  3VV0 A;  2PNI A;  2DZC A;  2KT8 A;  1D3B B;  3U23 A;  1BKB A;  4XTW A;  3CCQ Q;  4PJO G;  2IG0 A;  1FWZ A;  1TOV A;  3RNJ A;  5KYY B;  3M0R A;  4M7D G;  4OB1 B;  3JCM P;  1G3T A;  2MI6 A;  5D6Y A;  4BI3 A;  4V2S A;  1QMC A;  1N8R C;  1QQJ A;  3D7S B;  2VAS A;  1VQ7 Q;  2KNB B;  5LL6 S;  1YCS B;  5IH2 A;  2XD0 A;  1WJR A;  5KE3 A;  4M77 G;  2D0Q B;  3HHT B;  2DYB A;  4FIB A;  2XDB A;  1VQ9 A;  3SWN B;  2X51 A;  3L2Q A;  5CCA A;  2DIG A;  2YHT A;  3JB9 G;  2LCC A;  2RA2 A;  5GJW B;  3CC4 A;  2E6N A;  2YWW A;  5GAN h;  3CMA T;  4DBQ A;  2LNV A;  3QYG B;  2KXD A;  3JCM V;  4RTX A;  2F69 A;  2JT4 A;  5FU7 C;  4HKE A;  2XI9 A;  3CCS T;  1D3B A;  4BI4 A;  3MCA B;  3INZ A;  4OMO A;  3TCJ A;  5I22 A;  4RCC A;  2L3R A;  1U5S A;  5LJ5 h;  5DM7 R;  1VQO T;  1OZ3 A;  2KYB A;  1QVG S;  2B8A A;  1OI1 A;  2KBT A;  1MMD A;  2KRO A;  5KE2 A;  2KY9 A;  1K76 A;  1Z9Q A;  3JCM f;  1KIK A;  2DL7 A;  1WI7 A;  3Q1J A;  1BI3 A;  2ED0 A;  3L1A A;  2IVW A;  4OMF B;  2JTF A;  4P5N A;  4FSS A;  5CQX A;  3VS3 A;  2J6K A;  1VQP A;  1ZSZ A;  4JJN K;  1EZZ B;  3CCR Q;  9ATC B;  5IXF A;  3OYM A;  3CD6 T;  1UGP B;  4JRQ A;  1PD1 A;  1WLP B;  4RMO A;  1VQ9 Q;  2A7Y A;  3LX7 A;  3UWN A;  2QA4 T;  1EFN A;  4M7A G;  2QQA A;  1MGQ A;  3GIB A;  3E19 A;  3EGD B;  2LT4 A;  1AT1 B;  5L8R E;  4C92 F;  3CC4 Q;  1Y57 A;  2CZ1 B;  4E7S A;  4QT7 A;  2WAC A;  3HRS A;  3EG2 A;  3HSB A;  4OMQ A;  1HD3 A;  1GCQ C;  3J7A F;  2DXU A;  3OS0 A;  4RG2 A;  1B07 A;  2KRS A;  2DEQ A;  2SEM A;  1T3S A;  3QDR B;  1G83 A;  1HSQ A;  2HSP A;  2QGF B;  5FU7 B;  2ZPI B;  3QII A;  2L89 A;  5CKE A;  3CXC S;  2GBQ A;  4MDX A;  2F1L A;  3JCM c;  3JRZ A;  2LCS A;  3PIP A;  5GAO l;  1QVF P;  4O5V A;  4R56 A;  5FLX E;  4PJN A;  1VQP Q;  4M77 E;  4DOW A;  3DB3 A;  1KD1 C;  2XDP A;  2K3Y A;  3MEV A;  2K6D A;  1WHM A;  1UE9 A;  3CC7 A;  4LUE A;  1YNZ A;  1YJW Q;  3BFM A;  1WGS A;  2GGR A;  1FMW A;  3EG1 A;  4A4F A;  1YJ9 A; 
#chains in the Genus database with same CATH homology
 1W4S A;  3M57 A;  2EQK A;  1VIE A;  4NS5 A;  5GAO p;  3QBY A;  3FLG A;  1XQH A;  3TEE A;  5GAO m;  4C5E A;  4GLK A;  4KBM B;  4A4K A;  4DQ2 A;  4HA8 A;  4GY5 A;  1KC8 C;  3H8Z A;  2PVO B;  1M5Q 1;  4BI8 B;  2CZ6 B;  2MWO A;  3OY9 A;  1M8V A;  3CCJ T;  1JJ2 S;  4L6V 5;  2DIQ A;  2VXF A;  4F7U B;  1QVP A;  3CCU A;  1NE8 A;  4C5I A;  2K5L A;  4M75 F;  2QDY B;  4M78 E;  4XQ3 A;  2FB7 A;  3MEW A;  3OS2 A;  1Q82 C;  3OSV A;  5GAN f;  3GOX A;  1IZ6 A;  2P0P A;  3UDC A;  3L2W A;  2BIV A;  4IUP A;  4BY6 B;  2MMP A;  2ZPH B;  3CXC A;  2GFA A;  4F7U E;  2E65 A;  3MP1 A;  1VQ8 A;  4PKC C;  2PVG B;  5CKB A;  3VYG A;  4N0A A;  3C4S A;  1VQL T;  5EG2 A;  3ME9 A;  5CKD A;  1VIF A;  4N0A C;  4C92 B;  5GAN d;  2F5K A;  3I55 T;  1VQ6 A;  3QJY A;  1Q81 U;  4M78 G;  1OYX A;  5GAN 5;  4EMG A;  1FX7 A;  2ZPG B;  5FRO A;  1XTD A;  1EIF A;  3OSS C;  3QPH A;  1X6O A;  4UC4 A;  3LYI A;  4F7U G;  1S72 T;  4A54 A;  4PLI A;  5GMK l;  3M58 A;  3JCM J;  2HNI A;  1H64 1;  3BDU A;  4VUB A;  4M78 F;  4PLL A;  5CIU A;  2WSE E;  4C92 E;  3OYJ A;  1ZBX A;  3E1S A;  2I2L A;  4MZM A;  3BW1 A;  3ZEH A;  1G3Y A;  4Y91 A;  2QQ9 A;  2DJZ A;  3GNG A;  2VYT A;  4C0D B;  1N9S A;  2QTX A;  1WPY A;  4OB3 B;  3JCM d;  3OS1 A;  3OYD A;  1FXX A;  1VQ4 A;  1N9R A;  2ZZD A;  2OTJ T;  3C94 A;  2LT1 A;  4BB7 A;  3OYF A;  2EYQ A;  3M53 A;  3CBM A;  4JRK A;  1QP3 A;  1AHJ B;  1UB4 A;  3WVD B;  3G4S T;  1H3Z A;  5DLO A;  4MML A;  4MMK A;  4C92 G;  1Y07 A;  4ZGD B;  3BDL A;  4DOV A;  3OYK A;  1K8A U;  3R6O A;  1PSF A;  3VJP A;  4BDZ A;  1U8R A;  2PQW A;  3CCJ A;  3FC3 A;  1M1K C;  4C92 D;  5GMK i;  4MZT A;  2KMT A;  5DLQ E;  4C8Q B;  3OYA A;  4FSX A;  4ZN3 A;  1BI2 A;  4BE2 A;  4QQD A;  4M78 A;  2QI2 A;  4JS4 A;  4ATO A;  2F5T X;  4M78 C;  3PGG A;  3HRU A;  5D6W A;  4J6Y A;  1YIT T;  1JJ2 A;  3M4Y A;  1G5V A;  3V7R A;  4B9W A;  4F7U A;  5J3B A;  3OW2 S;  3WVE B;  2L5Q A;  3M56 A;  1IRE B;  4C8Q E;  1VQL A;  4ELY C;  2K57 A;  4BUG A;  4KT0 E;  4X9D A;  1K8A C;  3CBP A;  1YJN T;  5KCO A;  3OYG A;  4QVZ A;  2K5I A;  3OYL A;  3I55 A;  1R8O B;  2DZ9 A;  1NJI U;  2GF7 A;  3MEA A;  3VYH B;  4X9C A;  1KG1 A;  3T9N A;  3S3N A;  2KAF A;  3O8V A;  3J80 E;  2YLB A;  1SSF A;  2H3J A;  3EFR A;  4BY6 C;  2V8K A;  1Y7X A;  4LDW A;  4XK8 E;  4EMK B;  1S72 A;  5D6X A;  4C5H A;  1QVF A;  4OP0 A;  1O9S A;  4C8Q G;  2DK3 A;  4C92 A;  2M9U A;  2VC8 A;  5LJ3 h;  2CZ0 B;  3PTA A;  1VQN T;  3RES A;  2OTL T;  4LD9 K;  4C8Q D;  1M1G A;  1P92 A;  4XAX B;  5FU6 B;  2LX9 A;  3RKW A;  5CK9 A;  4L59 A;  3CME T;  3CCR T;  4JS5 A;  2DXC A;  2XKO C;  2D9T A;  2OTJ A;  5A2Q E;  5IAY A;  2E64 A;  2PUO B;  5GAN 3;  2K5F A;  3DB4 A;  3G4S A;  4MZP A;  3MP6 A;  3JB9 I;  2VGN A;  2LTO A;  2XIC A;  1UGQ B;  2HQX A;  3HFO A;  3CPW S;  1KQ2 A;  2GQV A;  5LJ5 j;  4M75 B;  1LOJ A;  1QP2 A;  1I81 A;  3JCM b;  4OGC A;  2EJF A;  4JDS A;  2E10 A;  2X4W A;  4YTL A;  1UGS B;  2QQS A;  3L2U A;  5GAO q;  2LC4 A;  1BYM A;  1YIT A;  1V29 B;  3M55 A;  1N8R U;  3NTI A;  4M75 E;  1Y96 B;  4A4G A;  2PU9 B;  1I5L A;  1GXI E;  5GAM h;  1LJO A;  2P0Q A;  4N4G A;  2EWN A;  4OGE A;  4C0G A;  4C8Q A;  2FVU A;  5GMK h;  2DVE A;  4E7L A;  2JUF A;  3QG1 A;  5IT9 E;  1YJN A;  2R5M A;  2D6F A;  3CCM T;  4XU0 A;  2RK2 A;  1Q86 U;  4J83 A;  2RHU A;  3X25 B;  2R5A A;  5DY9 A;  2EFI A;  2MF2 A;  1M9S A;  1NZ9 A;  2R57 A;  4M75 G;  4M78 B;  4CI0 C;  1TH7 A;  4Z02 A;  5CKF A;  2XG8 D;  5LJ3 g;  4M7D F;  2E70 A;  1N27 A;  2EQU A;  4M75 D;  5LJ5 e;  1VQN A;  2RD1 A;  2OTL A;  3WXM B;  3M5A A;  3MET A;  2RHI A;  3QXE B;  2KQW A;  3CCQ T;  2DKG A;  1XNI A;  2O01 E;  4QQG A;  3JAM E;  3CME A;  3CCR A;  2JTM A;  3OS5 A;  3QYH B;  4EMK A;  3L2Z A;  5J39 A;  3M54 A;  2X4J A;  4QVC A;  2Y4Y A;  4EMK C;  1RL2 A;  3OYI A;  4RCB A;  3H6Z A;  3RKX A;  3LGL A;  2KSS A;  1BI1 A;  4BDY A;  2OAU A;  5C6S A;  3ASK A;  4J5Y A;  4BE1 A;  3PFS A;  3ER0 A;  3HRT A;  2FHD A;  3JCM Q;  1VQM T;  2LDM A;  2RI2 A;  5A0D A;  1PSE A;  4A4E A;  3J81 E;  1M90 U;  5FU6 C;  4JLI A;  2C06 A;  1QW1 A;  2LQ8 A;  4Q5W A;  4NOY A;  1W2B A;  3LH0 A;  1QVF S;  3QJ6 A;  3GF5 A;  3N5B B;  2DXT A;  3FEO A;  2M1H A;  3KUF A;  3CPW A;  3JB9 F;  3S3M A;  4IUT A;  4M78 D;  5IN1 A;  4M7D C;  5LJ5 f;  5GAM g;  1VQ7 T;  4M75 A;  5M9O A;  5LJ3 j;  3CCV T;  3QSU A;  3L42 A;  1YJW T;  3QZ5 B;  4M75 C;  3ZFJ A;  5CAI A;  3SDZ A;  4J6X A;  5LJ5 d;  3CCM A;  2PUK B;  3G7Z A;  4D6W A;  2KK4 A;  1Q81 C;  1Y96 A;  3JCM h;  2JNG A;  4QVD A;  2QEX T;  2E6Z A;  3A8M B;  2VXE A;  4FL6 A;  4LDX A;  3UPU A;  5KH6 A;  2E12 A;  3GLX A;  2XID A;  4TVR A;  3FB9 A;  2A3L A;  2CKK A;  3CC2 T;  1BIA A;  3CCQ A;  3OYE A;  3MO8 A;  3M9Q A;  3L2R A;  4HT9 A;  1BI0 A;  1KQ1 A;  4ELZ C;  5GAM j;  4A53 A;  5CKH A;  4PNO A;  5I2M A;  3AHU A;  5GMK j;  2LCL A;  3P8D A;  4BE0 A;  4XTZ A;  5LJ3 e;  4LDV A;  4PL6 A;  4EPC A;  3C95 A;  4J8O A;  4KUL A;  1VQM A;  2RI3 A;  4HCC A;  5GMK m;  4LDY A;  4XTV A;  3C12 A;  5GAN 4;  1KHC A;  3DLL A;  1YJ9 A;  3RER A;  1WNL A;  2RH2 A;  1KHI A;  2K2V A;  1WQW A;  2RM4 A;  2QQB A;  4DA4 A;  3GNF B;  1YBY A;  5FRN A;  2MWP A;  3NTK A;  3SWN A;  4XU2 A;  3L2V A;  3EFS A;  5GAO n;  1X01 A;  3SWN C;  1K73 U;  5GAN 6;  1G3S A;  1VQ7 A;  5KCH A;  1XOV A;  2CGH A;  3CCV A;  5CQY A;  2K3X A;  3JCM W;  2RHZ A;  4EDU A;  1YJW A;  3PNW C;  2AHJ B;  4M7A F;  3DLM A;  5GAN 8;  4IUR A;  1YHQ T;  3QZ9 B;  5GAN 2;  3PMT A;  1G3W A;  3I56 T;  1YCY A;  2DXB A;  2LQK A;  1KQS A;  3CCE T;  2DTO A;  3GPL A;  3JCM g;  4A4H A;  1K9M U;  2Y90 A;  3DKM A;  5LJ3 f;  1NJI C;  2HD0 A;  2WSF E;  1W2B S;  1VQ9 T;  5GAM e;  4M7D B;  3CEY A;  3OYN A;  3BY7 A;  4Y28 E;  2QEX A;  2DD5 A;  5GMK e;  3PT9 A;  3S6W A;  2EQJ A;  3OBW A;  3RKY A;  1HK9 A;  4PJO E;  3VU3 C;  1JB0 E;  3RIR A;  5LJ3 d;  3JB9 H;  2QQR A;  1VQ5 T;  3FDR A;  4L5G A;  3CC2 A;  1QVG A;  3NTH A;  2VV5 A;  2CS7 A;  4ZGE B;  3CC4 T;  1O75 A;  3VV0 A;  1KD1 U;  4M7D E;  2WSC E;  2DZC A;  3OQ5 A;  2GFU A;  1D3B B;  5CO7 A;  1VUB A;  1BKB A;  2EKO A;  2ZCF B;  3FIF A;  4II1 A;  2VUB A;  4XTW A;  4IKF A;  1Q7Y U;  4PJO G;  3G6E T;  2IG0 A;  1FWZ A;  2GCX A;  2RB6 A;  1U1S A;  2EQM A;  5C0M A;  3OB9 A;  1Y71 A;  3QUI A;  2RJD A;  5GAM f;  4M7D G;  2XU8 A;  4O6J A;  4PJO F;  2CZ7 B;  4OB1 B;  3SB2 A;  3X20 B;  3JCM P;  1G3T A;  3OMC A;  3LWI A;  3HP9 A;  2MI6 A;  3MP8 A;  5D6Y A;  5A0L A;  1HXD A;  4BI3 A;  4M7D D;  4HCB A;  3HKS A;  4XTU A;  4V2S A;  2ZGW A;  3G71 T;  3NFC A;  1N8R C;  4OVA A;  3OYC A;  1YI2 T;  4RG8 A;  4LD6 A;  3A8G B;  2E1H A;  2YLC A;  2O4X B;  1YHQ A;  2EJG A;  5CVI A;  5LL6 S;  3I56 A;  2XD0 A;  1WJR A;  3CCE A;  3V7S A;  3A8O B;  5KE3 A;  2RO0 A;  1Q86 C;  3HL8 A;  4M77 G;  4KUD K;  2D0Q B;  3MHX A;  2HAX A;  3HHT B;  3E9G A;  2ZPF B;  1VQP T;  4FIB A;  2XDB A;  1VQ9 A;  3SWN B;  3X24 B;  3ZBD A;  3L2Q A;  1Q82 U;  4FT4 A;  5CCA A;  3PIO A;  2DIG A;  4ZN1 A;  1WQ7 A;  2EIF A;  3CPF A;  4PJO A;  2YHT A;  3JB9 G;  2R58 A;  2LCC A;  4M77 F;  4JUV A;  4JRP A;  4PJO C;  1VQ5 A;  2JOY A;  2RA2 A;  3FJP A;  4QW2 A;  5HK0 A;  3JB9 D;  4HT8 A;  3CC4 A;  2E6N A;  2JN0 A;  3JCM e;  1WJS A;  3JSC A;  4XTY A;  2RJC A;  3P8H A;  1B34 A;  2XDD A;  5GAN h;  3TU4 K;  4M7D A;  3CMA T;  3OMG A;  2QXF A;  1KQS S;  3UT1 A;  2LNV A;  2K4Y A;  3QYG B;  3V7C A;  1NPP A;  2EJ9 A;  3SD4 A;  3JCM V;  3G6E A;  2F69 A;  2CYZ B;  2HBP A;  4N4I A;  2LVM A;  5FU7 C;  4HKE A;  4NL2 A;  3MEU A;  4E47 A;  2XI9 A;  1RI0 A;  3CCS T;  1D3B A;  5HKC A;  1M90 C;  3OYY A;  1M1F A;  4BI4 A;  2ZPB B;  3MCA B;  3INZ A;  1ZQ1 A;  2ZPE B;  3TCJ A;  3OYB A;  4XU1 A;  3QHS A;  2L3R A;  4M77 A;  2NLU A;  2G3R A;  4RCC A;  5LJ5 h;  5DM7 R;  1VQO T;  1OZ3 A;  2E41 A;  4KUI A;  1QVG S;  2B8A A;  4FM4 B;  4M77 C;  4M7A B;  1OI1 A;  1JBM A;  2LRQ A;  4QQ6 A;  4C0F A;  2DAQ A;  3G71 A;  1JRI A;  2Y4X A;  5KE2 A;  1YI2 A;  2KY9 A;  3JCM f;  2MAM A;  4NL3 A;  3Q1J A;  1BI3 A;  4ZTJ A;  1M1K U;  2XHC A;  3L1A A;  5FRM A;  4N4H A;  2IVW A;  4J7I A;  2JTF A;  4OMF B;  4P5N A;  2P4T A;  4M7A E;  2P0K A;  2DD4 A;  3A8L B;  4OB0 B;  5CQX A;  3A5Z B;  4F7U F;  1VQP A;  4JLG A;  1M4Z A;  4JJN K;  2X4X A;  3S3O A;  4E7J A;  4XTX A;  2RHX A;  2O4X A;  5I21 A;  3OYM A;  3KXT A;  3CD6 T;  4WF2 A;  2X4Y A;  1UGP B;  4JRQ A;  4HCZ A;  3CBO A;  2DPP B;  4J6W A;  3P8B B;  4RMO A;  4E7H A;  2A7Y A;  5AYF A;  4ME7 A;  2RJF A;  3QO3 A;  3LX7 A;  4LDU A;  3UWN A;  2QA4 T;  2M0O A;  3LLR A;  3FRN A;  5GAN g;  4IUU A;  3VUB A;  2XK0 A;  4M7A G;  2QQA A;  1MGQ A;  2E5Q A;  2HQE A;  5HK3 A;  3CMA A;  3GIB A;  3E19 A;  2LT4 A;  4M7A D;  2EAY A;  5L8R E;  4C92 F;  3M59 A;  3RMQ A;  3E9F A;  2V8I A;  3V8K A;  2CZ1 B;  2DTI A;  3X28 B;  2WAC A;  3RMS A;  4BD3 A;  3KBG A;  3HRS A;  3CCL T;  1VQK T;  3SFM A;  3CC7 T;  3HSB A;  4PJO B;  3PMI A;  4OB2 B;  3CCS A;  4OF1 A;  1WJQ A;  4XU3 A;  2DXU A;  3J7A F;  3X26 B;  5LJ5 g;  2M16 A;  4CRI A;  3OS0 A;  1VQO A;  4RG2 A;  3OA6 A;  2RHY A;  2YRV A;  1B34 B;  2RJE A;  2DEQ A;  4EMH A;  1K73 C;  3EAE A;  3QDR B;  1YJ9 T;  3A8H B;  2DTH A;  3TRE A;  3V8J A;  4JRI A;  3RUX A;  4MDW A;  5FU7 B;  2ZPI B;  4C5G A;  3HPW A;  3QII A;  5GAN j;  1UEB A;  4IUQ A;  2L89 A;  4J7F A;  2X35 A;  5CKE A;  3CXC S;  2L8D A;  4C92 C;  3CCU T;  2FL7 A;  4M7A A;  4MDX A;  5GAO r;  1K9M C;  3JCM c;  4ZGJ B;  5A0G A;  4R55 A;  3JRZ A;  3PIP A;  4M7A C;  2VGM A;  1BIB A;  5GAO l;  2RK1 A;  4FT2 A;  4O5V A;  4M77 B;  3LW5 E;  4C8Q F;  4R56 A;  3LWH A;  3CD6 A;  5FLX E;  3M4G A;  1VQ8 T;  2DO3 A;  1U1T A;  1I4K 1;  1X75 C;  4B9X A;  2JZ2 A;  1DJ7 B;  4C0Z A;  4PJO D;  3VKI A;  1UGR B;  2BUD A;  3LGF A;  2QA4 A;  3JB9 J;  3V8L A;  3GP8 A;  4E7K A;  5I2S A;  1N6A A;  2FYK A;  1I8F A;  4C0D C;  5HY6 A;  4M77 E;  4BAC A;  1VQ6 T;  4DOW A;  3DB3 A;  1KD1 C;  2XDP A;  1YIJ A;  2K3Y A;  3MEV A;  2PVD B;  1NPR A;  3URG A;  1LNX A;  5GAM d;  4RKU E;  1KC8 U;  3HFN A;  5CR2 A;  1Q7Y C;  3CCL A;  3QKJ A;  1MHN A;  4FU6 A;  1YIJ T;  1VQK A;  3CC7 A;  4E7I A;  4X34 A;  2KDS A;  2KVQ G;  5J26 A;  5GAN e;  3OYH A;  1ZHI A;  3BFM A;  3OBY A;  1WGS A;  1OZ2 A;  3JCM X;  4C8Q C;  2RI5 A;  3VUZ A;  4IUV A;  1VQ4 T;  2BKD N;  2JVV A;  4ZTF A;  2V8J A;  4M77 D;  3OW2 A;  3F70 A;  4A4F A;  5GAN 7; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...