1M8MA

Solid-state mas nmr structure of the a-spectrin sh3 domain
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
56
structure length
56
Chain Sequence
ELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPECTRIN ALPHA CHAIN, BRAIN
publication title Structure of a protein determined by solid-state magic-angle-spinning NMR spectroscopy
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 2
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m8mA00
2CUBA 3EGUA 3UF4A 1BU1A 4LUEA 4HXJA 1UGVA 2DVJA 2O88A 4J9HA 2DBKA 2KR3A 2DL4A 2LJ3A 1K76A 2KBTA 2CT4A 2LQWA 2ROLA 1J3TA 1RI9A 1M27C 1ABQA 2KXDA 3EG1A 3LH5A 4CC3A 2B86A 3VS0A 2M51A 1SSHA 2EGEA 3SHWA 1QKXA 1Z9QA 3VRYA 3ULRB 1OPKA 2ROTA 1W1FA 2JT4A 4RTYA 5ECAA 4RTTA 1UHFA 1X43A 2DMOA 3UA7A 1M3AA 5GJVB 2O9VA 1T3LA 1K0XA 1V1CA 2EVRA 1QWEA 1U06A 2YSQA 1I07A 1Y0MA 2FO0A 2A36A 1VYTA 2BZYA 4J9GA 2FRWA 2V1QA 2G6FX 1AWXA 2JM8A 4J9BA 2AKKA 3VS1A 2OAWA 3I5SA 1KFZA 1PHTA 2ED1A 2VKNA 5GJWB 1U5SA 2DL5A 1PNJA 3C0CA 1AZEA 1JEGA 2C0OA 3QWXX 2YUQA 2EW3A 2F2VA 2HDAA 1H92A 1I1JA 1NEGA 2DM1A 1U3OA 3PE0A 3PVQA 2L2PA 2F2XA 1OOTA 2KROA 1X2KA 1CKBA 2DBMA 2DA9A 4AFSC 5L23A 2EKHA 4OMQA 4Y92A 4Z89A 2D0NA 4J9FA 2J6KA 1UUEA 2L3PA 3M0UA 1ZUUA 3M0RA 1YNZA 1WLPB 2CSIA 1SRMA 3O5ZA 5FWCA 3H0FA 1QWFA 1EFNA 2C0TA 2MIOA 4J9IA 2J6OA 2D8HA 2PNIA 4FSSA 4JJBA 5IH2A 2NUZA 2KNBB 2MOXA 3EHRA 2LNHB 3EHQA 5I11A 1QCFA 1JQQA 1WIEA 4LUDA 1PRLC 1T3SA 2RF0A 5FW9A 5FWBA 1OV3A 1A0NB 4QT7A 2MCNA 1K0SA 4AFQC 1OEBA 2A28A 4K11A 3QWYA 1GCQC 2NWMA 1IO6A 2K2MA 2JS2A 1KJWA 1I0CA 1GRIA 2QDLA 2DLPA 2GTJA 1SRLA 2AZVA 2ED0A 2OI3A 1WI7A 1FMKA 2EQIA 3VS6A 1JU5C 1CKAA 1JXMA 3NHNA 4AG1C 2KXCA 1VA7A 2LCSA 1WX6A 1X6BA 1WFWA 1RLPC 2EYWA 1HD3A 2PZ1A 4EIKA 1RUWA 2F2WA 5IHNA 2K7AA 4CC2A 5IXFA 1KIKA 3NGPA 1UJYA 2DX1A 1T0JA 2EGAA 2DL3A 2J7IA 2YUOA 2L3SA 4IIMA 4RUGA 1GFCA 2C0IA 4X1VA 4GLMA 2M0YA 1XOVA 1CSKA 1PWTA 3RNJA 3REBB 2D8JA 2GNCA 2YDLA 2W0ZA 2L3QA 4RTVA 2KT8A 2RQUA 3PVLA 2LQNA 1YWPA 2KRSA 1E6GA 3VS2A 3VRZA 3A98A 2HSPA 2ENMA 2A37A 2JTEA 3H41A 4OMOA 2DNUA 1JXOA 1GCPA 2BZXA 1NYFA 2D1XA 1SHFA 1KSWA 4LN2A 2J06A 1GBRA 2KRMA 2KYBA 1B07A 4JPBW 2YUNA 1M3BA 2ESWA 3U23A 1ZX6A 2DYBA 2EPDA 1LCKA 2RQRA 2KRNA 2L0AA 1Z9ZA 3EG3A 2HBWA 3IQLA 3SEMA 2AKLA 3NMZC 4HVUA 2HEQA 1G2BA 2ECZA 2KGTA 1AD5A 2K6DA 2O31A 3TSWA 3RBBB 4WCIA 2EYZA 2K3BA 2FEIA 4JZ3A 1HJDA 1FYNA 4LE9A 2PTKA 3M0TA 1YWOA 3I5RA 3TVTA 1HSQA 1NLPC 2LJ1A 1NLOC 3REAB 2DJQA 3VS4A 1TUCA 1X69A 1ABOA 1QLYA 1GCQA 1SPKA 5HCKA 2DE0X 4ESRA 1X27A 3THKA 4RTWA 1X6GA 1AZGB 2RMOA 2EBPA 4JJDA 2J05A 2H8HA 1AVZC 2DL7A 2YT6A 4F14A 2GTOA 1X2QA 1UG1A 2CDTA 1AOJA 3I9QA 2CREA 4HVVA 3UATA 2GBQA 4D8KA 1BB9A 1UTIA 3VS7A 1UE9A 2FPDA 5IXBA 2FG0A 1YCSB 4JJCA 5EC7A 2VWFA 1MV0B 1E6HA 3H0IA 1E7OA 4OMPA 4ORZA 4AFUC 2DILA 2KT1A 3KFVA 2E5KA 1K1ZA 2DRMA 4AG2C 1G83A 2DL8A 2IIMA 4E6RA 1RLQC 2RQTA 1M8MA 2JMAA 1WXUA 2OJ2A 2GQIA 3VS5A 2CT3A 3EG0A 1Y57A 1PKTA 2AZSA 2KYMA 4J9EA 1S1NA 1GBQA 2RQWA 4OMLA 2O2OA 2DRKA 2BTTA 1PKSA 1M30A 4J9DA 4RTUA 2FPEA 4CC4B 2CH4W 2AK5A 1MUZA 1UECA 4RTZA 2RQVA 3M0QA 4LNPA 2FRYA 4RTXA 2DF6A 4F16A 1NYGA 5I22A 2LX7A 3NPFA 1QKWA 4HVWA 3I35A 2GGRA 1UFFA 2X3XD 1ZLMA 2JXBA 4Z88A 3FJ5A 4D8DA 1H8KA 2JMCA 1AEYA 1WA7A 4F17A 2ABLA 2LMJA 1PRMC 2CSQA 2K79A 4J9CA 1N5ZA 1W6XA 1GL5A 1AWOA 1GFDA 4M4ZA 2LZ6B 1M3CA 2A08A 2RPNA 1JO8A 1AWWA 1TG0A 1UDLA 1NG2A 1ZBJA 2JM9A 2CUDA 1ZSGA 2J6FA 2VVKA 2XMFA 3M0PA 1WYXA 4HCKA 4KRTA 2RNAA 1MV3A 2X3WD 2JW4A 1NEBA 4IIOA 2V1RA 3ZL7C 3M0SA 1BBZA 4A63B 1AWJA 1SHGA 5IHIA 1K9AA 2LJ0A 3GBQA 1YN8A 2EGCA 1ZUKA 2K9GA 2KEAA 1UJ0A 1WXBA 3EG2A 2EYYA 2P4RA 3UA6A 2LP5A 3H0HA 3R6NA 1OPLA 3JV3A 2KE9A 4CC7A 1ARKA 1VYUA 4GBQA 4DEXA 2RN8A 4JZ4A 1H3HA 4OMMA 1T0HA 1BK2A 4ZNXA 3VS3A 1NM7A 2YUPA 3TSZA 2CH4A 2FPFA 5IHKA 3CQTA 2SRCA 2SEMA 1WXTA 2O9SA 1B3QA 2BZ8A 2EYXA 2I0NA 4DEYA 4R0KA 2HCKA 1K4US 2W10A 2JS0A 1ZUYA 1WDXA 1VYVA 1UHCA 4OMNA 1YP5A 4AFZC 4Z8AA 1W70A 1SEMA 1TUDA
chains in the Genus database with same CATH superfamily
3CXCP 1UEBA 4FU6A 3UF4A 4MZTA 3OYAA 2F5KA 2FVUA 1UGVA 1D09B 2PUKB 1VQ7A 4OB0B 3MP8A 2D9TA 2L89A 4J9HA 2KR3A 3URGA 5KYUB 3JRZA 3JCMX 3SFMA 1J3TA 4GLKA 4C8QA 5LJ3d 3GNFB 2D6FA 2BE9B 3JCMd 3OS0A 3VS0A 2RI2A 1O9SA 3SHWA 4M77E 3HSBA 3CC7T 5HK3A 2OTJA 4RTYA 2EJGA 3FC3A 2NUPB 2QQSA 1LJOA 4J7FA 1F1BB 2LTOA 3CXCS 4E7KA 5GJVB 5FU6B 2O9VA 1T3LA 2QI2A 1QWEA 2VXEA 2YSQA 3LWIA 5GAOl 1VYTA 1YJWA 3CC4T 2V1QA 1PSEA 1YJWT 2D0QB 2AKKA 5LJ3e 3JCMe 1KFZA 2RO0A 5GANd 2ED1A 2VKNA 5GJWB 4IUPA 2DL5A 1JEGA 2YUQA 1VQLA 2FYKA 1YJ9Q 1VQLT 1C1AA 3FLGA 2VYTA 1KQ2A 2HSEB 5DM7R 2WACA 3PE0A 3JCMV 2IPOB 2KROA 4WF2A 1X2KA 1Y71A 2MWPA 4OMQA 2MF2A 2OTLQ 2D0NA 3QIIA 2J6KA 2L3RA 4FIBA 4A54A 3QSUA 1MNEA 8ATCB 4RMOA 1YBYA 3O5ZA 4MZMA 5FWCA 3E1SA 2YRVA 2D8HA 4FSSA 3CCQT 5IH2A 4FL6A 5GAOn 2E6ZA 2JUFA 2LNVA 2LQKA 2BKDN 3EHRA 5I11A 3I56A 1WIEA 4QVZA 1T3SA 3I56T 5FW9A 1I8FA 5FWBA 4O6JA 4QT7A 1K0SA 1TOVA 2V8KA 5I21A 4OVAA 4XTWA 2COYA 5GMKi 2MPXC 3EAEA 2DLPA 3J81E 1K9MC 2H3JA 2AZVA 1WI7A 2FHDA 4M7DE 2EQIA 2PUOB 1YHQQ 4EMKA 1IGQA 3VS6A 3G4SQ 2ZAEA 4HCZA 3OYFA 1VQPQ 1CKAA 1MMDA 3NHNA 5GAMe 2KXCA 3RIRA 3P8HA 4Z02A 2XDDA 4DBRA 1Q7YC 1VIFA 3JAME 4N0AA 4M75C 1HD3A 1I4K1 2HKQB 2Y4XA 3ZFJA 2F2WA 5FLXE 4EIKA 3OB9A 1KIKA 1I5OB 2DX1A 3M56A 2EGAA 2L3SA 1NJIU 2C0IA 1Y07A 4X1VA 2HQHA 5LJ5j 3WVDB 3L2VA 3QZ5B 1KQSA 5LJ5g 5GAN5 3UDCA 1W2BP 1YJ9A 3CCUQ 3A8LB 3QG1A 1C6VX 3OS2A 5GAMh 3OYHA 4A4FA 1E6GA 2A3LA 5IT9E 2HSPA 2XDPA 1N27A 2ENMA 2OTLA 1R8OB 2JTEA 4DQ2A 1KD1R 1YI2T 2D1XA 3HTRA 2CP6A 1YITT 5DLQE 1NJIR 2E1HA 3VKIA 4JPBW 1W2BS 4MDXA 1W4SA 1QCNA 3U23A 2DYBA 2YWWA 5A0DA 2L0AA 1BI3A 2E3IA 2HBWA 1WJQA 3IQLA 1EIFA 4BE0A 3NMZC 4HVUA 4BDZA 3M4GA 1G2BA 2ECZA 1AD5A 2K6DA 4ZGJB 2O31A 3TSWA 3RBBB 1HK9A 2DVEA 4LE9A 1IHVA 2QG9B 3TVTA 1HSQA 3RMQA 2DEUA 3A8HB 1NLOC 1YHQA 2DEQA 3QJYA 3G4SA 4C92D 4OB2B 4A4HA 1YHQT 1VQPA 1ABOA 3LGFA 3G71Q 1VQPT 5A0LA 3JCMQ 1X27A 1X6GA 1AZGB 2EBPA 2J05A 3S3MA 3RR6A 4KGVB 3BW1A 1X2QA 4KH1B 5GMKe 1AOJA 1WZOA 2CREA 4HVVA 1WQ7A 4L6V5 3UATA 5LJ5f 1D3BB 3VS7A 1UE9A 2RI3A 2YXYA 3MJXA 4JJCA 5EC7A 2DD5A 2XKOC 4JRKA 1E6HA 1BYMA 1IHWA 2F5TX 4ORZA 3FIFA 1K73U 3OS5A 3G1JA 1K1ZA 2DL8A 4J6XA 2COZA 3CCUA 4M7AD 3C12A 3CCUT 4E6RA 1VQ9T 5KCHA 1WXUA 2OJ2A 4JJNK 2GQIA 2JN0A 3OYGA 4QVCA 4M78G 3V8KA 1VQKQ 1Y57A 1PKTA 5L8RE 2KYMA 5GMKh 2QDYB 1S1NA 2O2OA 4HCBA 2LDMA 1M30A 4E7HA 3EFOB 1NPPA 1UECA 1U1TA 2QTXA 3CPWA 4F16A 1SG5A 5I22A 2DZ9A 4RCCA 1K73R 3I35A 2EKOA 2M02A 4E2FB 4M75E 5LJ3j 3QJ6A 3MEUA 1H8KA 3M9QA 4F17A 4LDVA 1PRMC 4QW2A 1BI2A 1ACMB 3JCMg 2YRCA 1GL5A 4C8QB 4M7DF 2LZ6B 1M3CA 2A08A 4KUIA 4OGCA 2LT4A 1ZBJA 2CUDA 4F7UF 2DTHA 1OULA 2XMFA 1QVGA 4FT2A 4C8QD 1WYXA 3GOXA 4C92G 2X3WD 3M4YA 3G71A 4LD6A 2JW4A 4LDUA 3RUXA 3G71T 5CK9A 2PU9B 2QTVA 2P84A 4XK8E 4N4IA 1SHGA 3MKDA 1YN8A 2EGCA 1G3SA 1WXBA 2QA4Q 1V76A 3H0HA 5CKFA 5CO7A 1OPLA 2KE9A 4FW1A 1KD1C 3UT1A 2VXFA 5CAIA 1VYUA 4MMKA 3OW2A 2RN8A 1JRIA 2V8IA 1T0HA 2ZPHB 1NM7A 2CH4A 3CQTA 2SRCA 2GCXA 1B7TA 4XTZA 1VQ4T 3INZA 4JRQA 2I0NA 4M78A 3JB9D 1D1BA 3RKWA 2HL5C 3V7CA 2JS0A 1OU9A 1UHCA 1YP5A 1VQKT 4P5NA 3SWNA 3CCLQ 1W70A 5GAMj 5KYXA 2CUBA 4FYYB 2DKGA 1I81A 5GAMg 3MO8A 9ATCB 3CCJT 4O5VA 2RM4A 2ZPBB 1PCXA 1K76A 1PSFA 2CT4A 3G6ET 2LQWA 3L2ZA 1ABQA 1D0XA 3EG1A 4CC3A 2VASA 2K5LA 3TREA 2M51A 4R56A 1Z9QA 2CP3A 5C0MA 4FYWB 4XTXA 2EIFA 3BFMA 4RTTA 1VIEA 2RHXA 4ZN3A 4PJOC 2DMOA 3UA7A 2EVRA 1U06A 2HAXA 5D6XA 4EMKB 1S72T 4C92A 5KE2A 4HKEA 1Q7YU 1Y96B 2QEXQ 2A36A 3E19A 4J9GA 2OTJQ 2BIVA 2K4YA 1PHTA 1U5SA 2R5AA 1RAFB 4PJJA 5CKDA 1WQWA 1UGRB 2E10A 1H92A 1I1JA 3ASKA 1NEGA 2DM1A 2KAFA 3M5AA 2F2XA 1ZA2B 1X01A 2QA4A 3PGGA 2DBMA 2Z0WA 4AFSC 3L2QA 4Y92A 4J9FA 3L42A 5CIUA 1M1FA 1ZUUA 4ME7A 4YTLA 4JS5A 1Q7YR 4M7AA 1SRMA 2C0TA 1Q86C 4J9IA 1IGUA 4JJBA 5EG2A 1OX8A 2KNBB 2LNHB 3AHUA 1IXDA 3EHQA 1WHJA 2RK1A 3TCJA 5GAMf 5FRNA 3MCAB 2HL3A 4JS4A 2CZ1B 3CCLA 2MCNA 4AFQC 3TEEA 4B6MA 1OEBA 4C5GA 2A28A 2XICA 3QWYA 5GAN7 2DXTA 3QO3A 1FMWA 1EZZB 1IO6A 1MMNA 3LX7A 1RI0A 5GMKj 3FDRA 3GNGA 4OP0A 1TUGB 1YJNT 1RAEB 3QBYA 1D0YA 2BUDA 3FJPA 2ED0A 3I55Q 3F70A 2XHCA 1KC8R 1X6OA 5GAOr 3FEOA 1G5VA 1JJ2P 2WSEE 1VA7A 3X28B 1VQ7T 1OX9A 2CP7A 3JB9H 3X24B 1WX6A 1X6BA 2VC8A 1WFWA 1RUWA 2BE7D 2MK5A 2YRDA 3NGPA 2NLUA 3C4SA 2QEXA 2FZKB 2QEXT 2J7IA 2YUOA 2DETA 4M77G 1GFCA 2X35A 4GLMA 4N4HA 4BDYA 2OTJT 1QW1A 4JUVA 1R77A 1PWTA 2EQKA 2RHUA 3JB9I 2VGNA 1M5Q1 3RNJA 1JJ2S 3LH0A 5A0GA 1AHJB 2EQJA 4XU3A 2X4XA 2W0ZA 1KQ1A 2X51A 4E7ZA 3HKSA 1QP2A 4RTVA 1YIJA 2KT8A 2RA2A 2JVVA 2CP0A 3PIPA 3MPUB 4OMOA 2DNUA 2EAYA 3OYCA 2O01E 1SHFA 1KSWA 4KH0B 5CVIA 4IUTA 1ZQ1A 4XTYA 3OMGA 2F1LA 3P8DA 3LYIA 1B34A 3JCMc 3EGXA 3OYYA 4PJOE 1VQ5A 1PG5B 3PIOA 2HD0A 1YFNA 2DXBA 2DPPB 5GANe 2ZPGB 5LJ3h 3JCMh 2IVWA 3M0TA 1YWOA 2X4YA 5CKHA 3A1PA 3I55A 2DD4A 1OZ2A 2DJQA 3VS4A 3ZEHA 3V8JA 4N4GA 1QLYA 1GCQA 2DE0X 4ESRA 2CP5A 2QXFA 3THKA 1WHLA 2H8HA 2YT6A 4F14A 4M77A 2LCLA 2RJFA 1XJWB 5GANh 4M7DG 3CC2Q 1BB9A 1UTIA 4HT8A 1BI0A 1Y96A 4DOVA 2FPDA 5IXBA 4F7UE 2KI7A 4C8QF 2VWFA 3OYMA 3WVEB 4AMCA 1KD1U 1BCOA 2KT1A 3JCMW 2DRMA 3CD6Q 3R6OA 2XI9A 4X9CA 5CCAA 3EG0A 1W2BA 2AZSA 3EH2A 1TU0B 3NTIA 4PK4A 2GF7A 4M78B 1U8RA 2JZ2A 3N5BB 4OMLA 2DIQA 3OYJA 2KVQG 1YJ9T 4Q5WA 2BTTA 1N6AA 2CH4W 1WHMA 4RTZA 2RQVA 4LNPA 3ER0A 3FRNA 2FRYA 1NE8A 4M78D 1NYGA 3SWNB 4KUDK 2X9HA 1TTHB 2OTLT 5KYXB 4DBHA 3OY9A 4C0DB 2E41A 4C92C 3JB9F 2GGRA 1KQSP 1KC8C 2QASA 1ZLMA 1K8AR 1Y7XA 2DJZA 4Z88A 3FJ5A 4RKUE 2NYSA 5J3BA 4D8DA 3L2RA 4L5GA 2JMCA 1WA7A 2ABLA 2LMJA 3DLLA 4NOYA 5M9OA 2K79A 1QVFP 1W6XA 4R55A 1GFDA 4EMHA 3CMEA 2RPNA 1JO8A 3OYKA 1UDLA 2KMTA 1NG2A 1G3WA 3LWHA 2J6FA 3M0PA 2QGGA 1NBEB 4KRTA 2RNAA 4RG2A 5GMKm 4F04B 3RKYA 1KQSS 3QPHA 1NEBA 3CBMA 4PFOA 5GAN8 3MEVA 2WSFE 3NTKA 4C92B 5CQYA 3CBOA 4M7AC 3HRTA 1BBZA 4M7DA 3MP1A 5GAOp 1QVFS 5GAOq 1JBMA 4GY5A 5IHIA 3P8BB 2LJ0A 1ZUKA 3CC2A 1VQ6Q 3G4ST 1LVKA 2EYYA 3EFSA 4C0FA 5A2QE 3JV3A 3E2UA 4KBMB 1WHGA 3VUZA 4QQ6A 3M57A 3CD6A 3TSZA 1QMCA 5IHKA 2RHIA 2SEMA 4QKUA 5GAN2 2BZ8A 4DEYA 2E12A 1Q86U 1UGPB 4R0KA 2QQRA 4M7AB 4J83A 2W10A 1WDXA 1VYVA 5DY9A 4Z8AA 4BI4A 1UGQB 3EGUA 3GPLA 1BU1A 1TSFA 3E9FA 1VQNQ 2DVJA 4PJOF 3LGLA 2O88A 1ZHIA 3QXEB 1MGQA 2DBKA 1P92A 6AT1B 4CRIA 2KBTA 5HK0A 4C8QC 2RHYA 4E7LA 2A7YA 2KXDA 3EG9A 2E64A 2GFUA 5KCOA 2EGEA 3VJPA 1QKXA 1OPKA 2ROTA 2V8JA 1Q86R 1W1FA 2JT4A 4BD3A 2HQXA 1UHFA 1R0CB 1M3AA 5HY6A 2ZCFB 1V1CA 2CZ7B 2O4XA 1M1KC 1HYOA 1I07A 2LVMA 5CR2A 2FO0A 5CKEA 4A4EA 1MNDA 2BZYA 4M75G 2COWA 4XU2A 4TVRA 2G6FX 3RKXA 1AWXA 5LJ3g 2VGMA 2JM8A 4JLGA 3VS1A 4DBQA 2OAWA 1RAAB 4ZN1A 1KHIA 1WPYA 3OMCA 3C0CA 4ZTFA 2C0OA 4FW2A 2EW3A 2F2VA 1WJSA 4ATOA 3PVQA 1OOTA 2ZPIB 1VQ6A 1M90U 2YLBA 1CKBA 2PQWA 4LDYA 4PJNA 5L23A 4HCCA 1MHNA 2L3PA 3M0UA 2G3RA 3QDRB 3M0RA 4LDXA 1YNZA 5GANj 1WLPB 5KYNA 2H3EB 1RL2A 3QHSA 2PVOB 5GANg 4Y91A 3CMAQ 3CPWS 2J6OA 2PNIA 2CS7A 1QCFA 4LUDA 1PRLC 2DFUA 1TS9A 5GAN6 1K8AC 3LLRA 4NS5A 1A0NB 3CCMQ 3ME9A 1RAHB 4C5HA 3X25B 1WNLA 2WSCE 4K11A 3ZBDA 1M90R 1GCQC 1XTDA 1VQNA 2CGHA 1B34B 2JS2A 3EGXB 2DXUA 1GRIA 3OYDA 3CCRQ 4LD9K 5J39A 1SRLA 2OI3A 4EMKC 2LRQA 4M7AE 2VB6A 5LJ5d 4J8OA 4AG1C 2QK0A 2KY9A 2RB6A 1QQJA 1MMAA 4N0AC 3SDZA 2EYWA 2PZ1A 2XU8A 1SSFA 5LJ3f 3VYGA 1WGSA 3JCMf 4M75A 4CC2A 2K7AA 2E6NA 1T0JA 2LCCA 3DKMA 4WTOB 5FU7B 3H8ZA 2CP2A 4RUGA 3HL8A 3J7AF 1CSKA 4M77B 3OYBA 3REBB 2D8JA 2HMAA 3V7RA 2RI5A 3RERA 2GNCA 2YDLA 2XK0A 1IRXA 3HFNA 3V8LA 1M9SA 2L3QA 1WHKA 4JDSA 4M77D 3PVLA 1YCYA 4LXCA 4OB3B 3VS2A 2R58A 3VRZA 2E5QA 3A98A 5GANf 3CBPA 3RESA 2A37A 3UPUA 3H41A 1VUBA 1D0ZA 2Y4YA 3KXTA 1QP3A 4LN2A 1GBRA 2PVGB 4C8QE 2LQ8A 3GLXA 3CMAA 1YIJQ 2KYBA 5KYYA 3CMAT 4PFPA 1B07A 5DLOA 1N8RC 4BI8B 2YUNA 2QA4T 2VV5A 1M3BA 3M59A 4OF1A 1EX4A 1RADB 2EQUA 2EPDA 5D6YA 1LCKA 8AT1B 2DZCA 3HPWA 1Z9ZA 3EG3A 2CZ6B 1PD0A 3CC4Q 2AKLA 2RHZA 4V2SA 3CCMA 1KC8U 1R0BG 3CCMT 2HEQA 4D6WA 2KGTA 3GP8A 3FB9A 4WCIA 2K3BA 3CCRA 2FEIA 4JZ3A 2PTKA 3I5RA 4NL3A 1ZSZB 1NLPC 1VQ5Q 2LJ1A 2DERA 4QQDA 2RJEA 4M78F 3CCLT 2M0OA 2MYSA 1X69A 1OI1A 1SPKA 2NUTA 2CZ0B 2HNIA 1PC0A 1AVZC 2DL7A 2R5MA 5KYWA 2GTOA 3CPFA 1VQMQ 1UG1A 1IREB 3CXCA 3I9QA 4LDWA 2AHJB 1JJ2A 2GBQA 3BDUA 3M53A 3CCQQ 4XU0A 2RK2A 2DIGA 1Q82C 2FG0A 2LX9A 1OQKA 1VQ8Q 4M7DB 2ATCB 4FCYA 5LL6S 4XAXB 3KFVA 3KUFA 1NPRA 2HKNA 4AG2C 1G83A 4EDUA 3MEAA 4M7DD 4OMFB 3E9GA 1RLQC 3CEYA 4ZGEB 3PMIA 2PVDB 3VS5A 2FB7A 4C92F 2CT3A 2XIDA 3DB3A 4J9EA 2QGFB 2K5IA 1O75A 4RG8A 1M90C 1RABB 1GBQA 2RQWA 2K57A 4BB7A 3CC7A 2DRKA 4ZGDB 1PKSA 4RTUA 4CC4B 2FPEA 1YIJT 1OU8A 4OGEA 1BIBA 4ELYC 3M0QA 4J7IA 2DF6A 2QQ9A 5GAN4 4XQ3A 4IUQA 3EFRA 1FXXA 3NPFA 2X3XD 4C5IA 3CC4A 1AEYA 3EH1A 4X9DA 4M7AF 4ELZC 2K2VA 1G8XA 3EG9B 5GMKl 4JRIA 2JM9A 3EGDA 4PJOG 1ZSGA 5KE3A 2B8AA 1VQ5T 1M1KU 4HCKA 1H3ZA 4DA4A 1MV3A 4KGZB 1TXQA 2P0PA 1G3YA 2HZYA 2QAZA 4IIOA 2O4XB 2XDBA 3QDFA 3CMEQ 2DYIA 1YI2Q 2M1HA 2V1RA 3ZL7C 3MEWA 1MMGA 2AT1B 4PJLA 1VQMA 5D7UA 2L8DA 2MI6A 4A53A 1VQMT 1YITQ 1K9AA 2X4JA 3GBQA 2K9GA 2KEAA 3I55T 3S3NA 3CCQA 3VV0A 2P4RA 3UA6A 1XNIA 3R6NA 2KQWA 1ARKA 2MWOA 3A8OB 1VQ8A 2X4WA 4BI3A 2XD0A 4JZ4A 4E7SA 4E7IA 1VQ8T 1H3HA 4OMMA 4BE2A 1X75C 1M4ZA 1WHHA 1SKUB 5GAMd 3D7SB 1M1KR 1WXTA 4OB1B 2O9SA 4M78C 1DJ7B 2EYXA 4C0ZA 4MDWA 3HP9A 4F7UG 1OZ3A 2E65A 1K4US 3VYHB 4EMGA 3PNWC 4NL2A 1G3TA 1PM3A 3L2UA 1ZUYA 3SWNC 1JB0E 1BCMA 2CKKA 4C0DC 1TUDA 1K8AU 4HT9A 3MP6A 3OBWA 2E4HA 2EJFA 4LUEA 4HXJA 3V7SA 4E47A 4PL6A 5IN1A 2DL4A 2LJ3A 4B9WA 3GF5A 4ZTJA 2ROLA 1RI9A 2JTFA 1M27C 3LH5A 1TH7A 2B86A 1SSHA 3QYGB 3VRYA 1IZ6A 3ULRB 5ECAA 2KSSA 1X43A 5J26A 2RJCA 4FYVB 4PJOA 1K0XA 4PJMA 7AT1B 1Y0MA 4L59A 1ZSZA 4CI0C 4QVDA 4JRPA 3JB9J 3OYLA 2FRWA 2K3YA 3NFCA 1VQ9Q 1Q81U 1FX7A 4J5YA 1QVFA 3X26B 4J9BA 5GAOm 3I5SA 1GXIE 3VUBA 4M75B 2K5FA 1PNJA 1YI2A 1AZEA 2XG8D 3CMET 3QWXX 5CQXA 3CCVQ 2QQBA 2JNGA 2ZPEB 4XTUA 3META 3UWNA 3HFOA 2HDAA 1YITA 1RAGB 2JTMA 4M75D 1U3OA 1QCOA 2L2PA 5AT1B 2DA9A 4DOWA 2EKHA 1FWZA 4BUGA 4Z89A 4J6WA 1UUEA 3A5ZB 4Y28E 3VU3C 1M2VA 3OS1A 2CSIA 2EQMA 2HBPA 3H0FA 1QWFA 1EFNA 1V29B 2MIOA 4F7UA 1Q81R 3CC2T 2OX7A 2NUZA 4EPCA 2MOXA 4PNOA 3RDVA 1N8RU 1JQQA 4M77F 3BY7A 2RF0A 2IG0A 2JOYA 1AT1B 5KYUA 5KYYB 5CKBA 1OV3A 1U1SA 1LNXA 1VQOQ 3CD6T 2FZCB 2NWMA 3OYEA 3OBYA 3L2WA 2K2MA 5IAYA 1KJWA 1I0CA 2QDLA 2GFAA 4A4KA 1I5LA 2NUPA 3OSVA 1BKBA 2GTJA 3J80E 3H9NA 3JSCA 4BACA 1FMKA 2EWNA 3OA6A 2DK3A 1JU5C 1JXMA 1RAIB 2KK4A 1XQHA 1KK7A 2LCSA 1H641 1N8RR 3M54A 2CYZB 1RLPC 2ZPFB 1QVPA 2QYZA 5IHNA 5IXFA 1UJYA 1PD1A 1M8VA 1VQ4Q 3X20B 2DL3A 2NUTB 3MHXA 3TQ7P 2JJ9A 4IIMA 2DTOA 3QUIA 1VQ9A 4KULA 4DBFA 5I2MA 5KYWB 2DTIA 2M0YA 4M78E 1XOVA 2QQAA 5D6WA 1Q82U 3S6WA 4PFZA 5AYFA 2MAMA 3CCVA 3C94A 3CCVT 1M2OA 3CCJQ 3HRUA 2RQUA 2LQNA 1YWPA 2KRSA 2EYQA 1VOMA 3G6EQ 3SD4A 4J6YA 3CPWP 2VUBA 2C06A 4IURA 4PKCC 1JXOA 1GCPA 2BZXA 1NYFA 1D1AA 2E3HA 4IUVA 3L1AA 4QQGA 2J06A 1D1CA 3NTHA 2KRMA 3TU4K 2F69A 2MMPA 3AT1B 2E70A 2FZGB 3A8GB 3DLMA 1VQ6T 4PLLA 3CCSQ 2ESWA 1HXDA 1Q82R 4FT4A 4IUUA 1ZX6A 4E7JA 1S72Q 2RQRA 2KRNA 1NZ9A 5C6SA 3QKJA 1C0MA 4KT0E 1LOJA 1UGSB 3OYNA 2ZGWA 3PTAA 3SEMA 1Q95G 4C92E 1VQOA 2K3XA 1QVGP 1VQOT 4JLIA 1RACB 4KGXB 4UC4A 3LW5E 2EYZA 4BE1A 1HJDA 1FYNA 3GIBA 3JCMP 1BI1A 2RJDA 4X34A 2LT1A 2AIRB 5HKCA 1OYXA 2V26A 3REAB 5FROA 1TUCA 5HCKA 1VQNT 4PLIA 5FU7C 1N9SA 1SF9A 4RTWA 3EGDB 2DXCA 2RMOA 4JJDA 1QVGS 2P4TA 3KBGA 2L5QA 3OW2P 3H6ZA 2Y90A 4MZPA 4M77C 1BIAA 4BY6C 2HQEA 2CDTA 2YLCA 1NJIC 2M16A 1VQ4A 4M7AG 4D8KA 2GQVA 4II1A 1YCSB 4RCBA 1MV0B 2EJ9A 1ZA1B 3WXMB 3H0IA 1E7OA 2DO3A 4OMPA 1VQKA 4FSXA 4AFUC 2DILA 2E5KA 2LC4A 1Q81C 2IIMA 3M58A 4ANJA 2P0QA 3CCJA 3OW2S 2KDSA 3HHTB 4FM4B 2RQTA 1M8MA 2JMAA 4C5EA 2A0FB 1M1GA 3G6EA 3QYHB 2M9UA 3T9NA 3OSSC 1YJNQ 1WJRA 4BY6B 3CCEQ 2I2LA 3G7ZA 5LJ5e 5I2SA 4C0GA 3SB2A 1TWBA 4VUBA 1K9MU 3JCMb 2OAUA 4J9DA 1VQ7Q 1ZBXA 2AK5A 1MUZA 2R57A 3O8VA 2DAQA 4RTXA 3CCSA 3CCST 2LX7A 4B9XA 1S72A 1UB4A 1QKWA 4HVWA 1UFFA 2JXBA 1ZSZC 4C8QG 3CC7Q 1FMVA 3HRSA 2CSQA 3OQ5A 3PT9A 4J9CA 1N5ZA 1LPLA 1AWOA 4M4ZA 3JCMJ 3PMTA 1AWWA 1TG0A 5LJ5h 2EFIA 3BE3A 2VVKA 1N9RA 4A4GA 4XU1A 1K9MR 3RMSA 1YJWQ 4FYXB 4PJOB 4HA8A 1D3BA 5FRMA 2YHTA 3CCRT 3M0SA 3PFSA 4M7DC 4XTVA 3DB4A 4A63B 1VQLQ 4PJOD 1AWJA 3Q1JA 2RD1A 4IKFA 1IB8A 2RH2A 1UJ0A 3EG2A 2LP5A 3S3OA 4MMLA 3OYIA 3JB9G 4CC7A 1K73C 4DEXA 4GBQA 1KG1A 1BK2A 4ZNXA 3A8MB 3VS3A 2YUPA 3QZ9B 2FL7A 2FPFA 3BDLA 5GAN3 5KH6A 1B3QA 1M2VB 3C95A 3M55A 4M75F 1KHCA 4AT1B 2HCKA 3I56Q 3EFOA 1YJNA 3CCEA 4OMNA 5FU6C 3CCET 4F7UB 2ZZDA 4AFZC 1SEMA 2P0KA
chains in the Genus database with same CATH topology
2CUBA 3EGUA 3UF4A 1BU1A 4LUEA 4HXJA 1UGVA 2DVJA 2O88A 4J9HA 2DBKA 2KR3A 2DL4A 2LJ3A 1K76A 2KBTA 2CT4A 2LQWA 2ROLA 1J3TA 1RI9A 1M27C 1ABQA 2KXDA 3EG1A 3LH5A 4CC3A 2B86A 3VS0A 2M51A 1SSHA 2EGEA 3SHWA 1QKXA 1Z9QA 3VRYA 3ULRB 1OPKA 2ROTA 1W1FA 2JT4A 4RTYA 5ECAA 4RTTA 1UHFA 1X43A 2DMOA 3UA7A 1M3AA 5GJVB 2O9VA 1T3LA 1K0XA 1V1CA 2EVRA 1QWEA 1U06A 2YSQA 1I07A 1Y0MA 2FO0A 2A36A 1VYTA 2BZYA 4J9GA 2FRWA 2V1QA 2G6FX 1AWXA 2JM8A 4J9BA 2AKKA 3VS1A 2OAWA 3I5SA 1KFZA 1PHTA 2ED1A 2VKNA 5GJWB 1U5SA 2DL5A 1PNJA 3C0CA 1AZEA 1JEGA 2C0OA 3QWXX 2YUQA 2EW3A 2F2VA 2HDAA 1H92A 1I1JA 1NEGA 2DM1A 1U3OA 3PE0A 3PVQA 2L2PA 2F2XA 1OOTA 2KROA 1X2KA 1CKBA 2DBMA 2DA9A 4AFSC 5L23A 2EKHA 4OMQA 4Y92A 4Z89A 2D0NA 4J9FA 2J6KA 1UUEA 2L3PA 3M0UA 1ZUUA 3M0RA 1YNZA 1WLPB 2CSIA 1SRMA 3O5ZA 5FWCA 3H0FA 1QWFA 1EFNA 2C0TA 2MIOA 4J9IA 2J6OA 2D8HA 2PNIA 4FSSA 4JJBA 5IH2A 2NUZA 2KNBB 2MOXA 3EHRA 2LNHB 3EHQA 5I11A 1QCFA 1JQQA 1WIEA 4LUDA 1PRLC 1T3SA 2RF0A 5FW9A 5FWBA 1OV3A 1A0NB 4QT7A 2MCNA 1K0SA 4AFQC 1OEBA 2A28A 4K11A 3QWYA 1GCQC 2NWMA 1IO6A 2K2MA 2JS2A 1KJWA 1I0CA 1GRIA 2QDLA 2DLPA 2GTJA 1SRLA 2AZVA 2ED0A 2OI3A 1WI7A 1FMKA 2EQIA 3VS6A 1JU5C 1CKAA 1JXMA 3NHNA 4AG1C 2KXCA 1VA7A 2LCSA 1WX6A 1X6BA 1WFWA 1RLPC 2EYWA 1HD3A 2PZ1A 4EIKA 1RUWA 2F2WA 5IHNA 2K7AA 4CC2A 5IXFA 1KIKA 3NGPA 1UJYA 2DX1A 1T0JA 2EGAA 2DL3A 2J7IA 2YUOA 2L3SA 4IIMA 4RUGA 1GFCA 2C0IA 4X1VA 4GLMA 2M0YA 1XOVA 1CSKA 1PWTA 3RNJA 3REBB 2D8JA 2GNCA 2YDLA 2W0ZA 2L3QA 4RTVA 2KT8A 2RQUA 3PVLA 2LQNA 1YWPA 2KRSA 1E6GA 3VS2A 3VRZA 3A98A 2HSPA 2ENMA 2A37A 2JTEA 3H41A 4OMOA 2DNUA 1JXOA 1GCPA 2BZXA 1NYFA 2D1XA 1SHFA 1KSWA 4LN2A 2J06A 1GBRA 2KRMA 2KYBA 1B07A 4JPBW 2YUNA 1M3BA 2ESWA 3U23A 1ZX6A 2DYBA 2EPDA 1LCKA 2RQRA 2KRNA 2L0AA 1Z9ZA 3EG3A 2HBWA 3IQLA 3SEMA 2AKLA 3NMZC 4HVUA 2HEQA 1G2BA 2ECZA 2KGTA 1AD5A 2K6DA 2O31A 3TSWA 3RBBB 4WCIA 2EYZA 2K3BA 2FEIA 4JZ3A 1HJDA 1FYNA 4LE9A 2PTKA 3M0TA 1YWOA 3I5RA 3TVTA 1HSQA 1NLPC 2LJ1A 1NLOC 3REAB 2DJQA 3VS4A 1TUCA 1X69A 1ABOA 1QLYA 1GCQA 1SPKA 5HCKA 2DE0X 4ESRA 1X27A 3THKA 4RTWA 1X6GA 1AZGB 2RMOA 2EBPA 4JJDA 2J05A 2H8HA 1AVZC 2DL7A 2YT6A 4F14A 2GTOA 1X2QA 1UG1A 2CDTA 1AOJA 3I9QA 2CREA 4HVVA 3UATA 2GBQA 4D8KA 1BB9A 1UTIA 3VS7A 1UE9A 2FPDA 5IXBA 2FG0A 1YCSB 4JJCA 5EC7A 2VWFA 1MV0B 1E6HA 3H0IA 1E7OA 4OMPA 4ORZA 4AFUC 2DILA 2KT1A 3KFVA 2E5KA 1K1ZA 2DRMA 4AG2C 1G83A 2DL8A 2IIMA 4E6RA 1RLQC 2RQTA 1M8MA 2JMAA 1WXUA 2OJ2A 2GQIA 3VS5A 2CT3A 3EG0A 1Y57A 1PKTA 2AZSA 2KYMA 4J9EA 1S1NA 1GBQA 2RQWA 4OMLA 2O2OA 2DRKA 2BTTA 1PKSA 1M30A 4J9DA 4RTUA 2FPEA 4CC4B 2CH4W 2AK5A 1MUZA 1UECA 4RTZA 2RQVA 3M0QA 4LNPA 2FRYA 4RTXA 2DF6A 4F16A 1NYGA 5I22A 2LX7A 3NPFA 1QKWA 4HVWA 3I35A 2GGRA 1UFFA 2X3XD 1ZLMA 2JXBA 4Z88A 3FJ5A 4D8DA 1H8KA 2JMCA 1AEYA 1WA7A 4F17A 2ABLA 2LMJA 1PRMC 2CSQA 2K79A 4J9CA 1N5ZA 1W6XA 1GL5A 1AWOA 1GFDA 4M4ZA 2LZ6B 1M3CA 2A08A 2RPNA 1JO8A 1AWWA 1TG0A 1UDLA 1NG2A 1ZBJA 2JM9A 2CUDA 1ZSGA 2J6FA 2VVKA 2XMFA 3M0PA 1WYXA 4HCKA 4KRTA 2RNAA 1MV3A 2X3WD 2JW4A 1NEBA 4IIOA 2V1RA 3ZL7C 3M0SA 1BBZA 4A63B 1AWJA 1SHGA 5IHIA 1K9AA 2LJ0A 3GBQA 1YN8A 2EGCA 1ZUKA 2K9GA 2KEAA 1UJ0A 1WXBA 3EG2A 2EYYA 2P4RA 3UA6A 2LP5A 3H0HA 3R6NA 1OPLA 3JV3A 2KE9A 4CC7A 1ARKA 1VYUA 4GBQA 4DEXA 2RN8A 4JZ4A 1H3HA 4OMMA 1T0HA 1BK2A 4ZNXA 3VS3A 1NM7A 2YUPA 3TSZA 2CH4A 2FPFA 5IHKA 3CQTA 2SRCA 2SEMA 1WXTA 2O9SA 1B3QA 2BZ8A 2EYXA 2I0NA 4DEYA 4R0KA 2HCKA 1K4US 2W10A 2JS0A 1ZUYA 1WDXA 1VYVA 1UHCA 4OMNA 1YP5A 4AFZC 4Z8AA 1W70A 1SEMA 1TUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUB A;  3EGU A;  3UF4 A;  1BU1 A;  4LUE A;  4HXJ A;  1UGV A;  2DVJ A;  2O88 A;  4J9H A;  2DBK A;  2KR3 A;  2DL4 A;  2LJ3 A;  1K76 A;  2KBT A;  2CT4 A;  2LQW A;  2ROL A;  1J3T A;  1RI9 A;  1M27 C;  1ABQ A;  2KXD A;  3EG1 A;  3LH5 A;  4CC3 A;  2B86 A;  3VS0 A;  2M51 A;  1SSH A;  2EGE A;  3SHW A;  1QKX A;  1Z9Q A;  3VRY A;  3ULR B;  1OPK A;  2ROT A;  1W1F A;  2JT4 A;  4RTY A;  5ECA A;  4RTT A;  1UHF A;  1X43 A;  2DMO A;  3UA7 A;  1M3A A;  5GJV B;  2O9V A;  1T3L A;  1K0X A;  1V1C A;  2EVR A;  1QWE A;  1U06 A;  2YSQ A;  1I07 A;  1Y0M A;  2FO0 A;  2A36 A;  1VYT A;  2BZY A;  4J9G A;  2FRW A;  2V1Q A;  2G6F X;  1AWX A;  2JM8 A;  4J9B A;  2AKK A;  3VS1 A;  2OAW A;  3I5S A;  1KFZ A;  1PHT A;  2ED1 A;  2VKN A;  5GJW B;  1U5S A;  2DL5 A;  1PNJ A;  3C0C A;  1AZE A;  1JEG A;  2C0O A;  3QWX X;  2YUQ A;  2EW3 A;  2F2V A;  2HDA A;  1H92 A;  1I1J A;  1NEG A;  2DM1 A;  1U3O A;  3PE0 A;  3PVQ A;  2L2P A;  2F2X A;  1OOT A;  2KRO A;  1X2K A;  1CKB A;  2DBM A;  2DA9 A;  4AFS C;  5L23 A;  2EKH A;  4OMQ A;  4Y92 A;  4Z89 A;  2D0N A;  4J9F A;  2J6K A;  1UUE A;  2L3P A;  3M0U A;  1ZUU A;  3M0R A;  1YNZ A;  1WLP B;  2CSI A;  1SRM A;  3O5Z A;  5FWC A;  3H0F A;  1QWF A;  1EFN A;  2C0T A;  2MIO A;  4J9I A;  2J6O A;  2D8H A;  2PNI A;  4FSS A;  4JJB A;  5IH2 A;  2NUZ A;  2KNB B;  2MOX A;  3EHR A;  2LNH B;  3EHQ A;  5I11 A;  1QCF A;  1JQQ A;  1WIE A;  4LUD A;  1PRL C;  1T3S A;  2RF0 A;  5FW9 A;  5FWB A;  1OV3 A;  1A0N B;  4QT7 A;  2MCN A;  1K0S A;  4AFQ C;  1OEB A;  2A28 A;  4K11 A;  3QWY A;  1GCQ C;  2NWM A;  1IO6 A;  2K2M A;  2JS2 A;  1KJW A;  1I0C A;  1GRI A;  2QDL A;  2DLP A;  2GTJ A;  1SRL A;  2AZV A;  2ED0 A;  2OI3 A;  1WI7 A;  1FMK A;  2EQI A;  3VS6 A;  1JU5 C;  1CKA A;  1JXM A;  3NHN A;  4AG1 C;  2KXC A;  1VA7 A;  2LCS A;  1WX6 A;  1X6B A;  1WFW A;  1RLP C;  2EYW A;  1HD3 A;  2PZ1 A;  4EIK A;  1RUW A;  2F2W A;  5IHN A;  2K7A A;  4CC2 A;  5IXF A;  1KIK A;  3NGP A;  1UJY A;  2DX1 A;  1T0J A;  2EGA A;  2DL3 A;  2J7I A;  2YUO A;  2L3S A;  4IIM A;  4RUG A;  1GFC A;  2C0I A;  4X1V A;  4GLM A;  2M0Y A;  1XOV A;  1CSK A;  1PWT A;  3RNJ A;  3REB B;  2D8J A;  2GNC A;  2YDL A;  2W0Z A;  2L3Q A;  4RTV A;  2KT8 A;  2RQU A;  3PVL A;  2LQN A;  1YWP A;  2KRS A;  1E6G A;  3VS2 A;  3VRZ A;  3A98 A;  2HSP A;  2ENM A;  2A37 A;  2JTE A;  3H41 A;  4OMO A;  2DNU A;  1JXO A;  1GCP A;  2BZX A;  1NYF A;  2D1X A;  1SHF A;  1KSW A;  4LN2 A;  2J06 A;  1GBR A;  2KRM A;  2KYB A;  1B07 A;  4JPB W;  2YUN A;  1M3B A;  2ESW A;  3U23 A;  1ZX6 A;  2DYB A;  2EPD A;  1LCK A;  2RQR A;  2KRN A;  2L0A A;  1Z9Z A;  3EG3 A;  2HBW A;  3IQL A;  3SEM A;  2AKL A;  3NMZ C;  4HVU A;  2HEQ A;  1G2B A;  2ECZ A;  2KGT A;  1AD5 A;  2K6D A;  2O31 A;  3TSW A;  3RBB B;  4WCI A;  2EYZ A;  2K3B A;  2FEI A;  4JZ3 A;  1HJD A;  1FYN A;  4LE9 A;  2PTK A;  3M0T A;  1YWO A;  3I5R A;  3TVT A;  1HSQ A;  1NLP C;  2LJ1 A;  1NLO C;  3REA B;  2DJQ A;  3VS4 A;  1TUC A;  1X69 A;  1ABO A;  1QLY A;  1GCQ A;  1SPK A;  5HCK A;  2DE0 X;  4ESR A;  1X27 A;  3THK A;  4RTW A;  1X6G A;  1AZG B;  2RMO A;  2EBP A;  4JJD A;  2J05 A;  2H8H A;  1AVZ C;  2DL7 A;  2YT6 A;  4F14 A;  2GTO A;  1X2Q A;  1UG1 A;  2CDT A;  1AOJ A;  3I9Q A;  2CRE A;  4HVV A;  3UAT A;  2GBQ A;  4D8K A;  1BB9 A;  1UTI A;  3VS7 A;  1UE9 A;  2FPD A;  5IXB A;  2FG0 A;  1YCS B;  4JJC A;  5EC7 A;  2VWF A;  1MV0 B;  1E6H A;  3H0I A;  1E7O A;  4OMP A;  4ORZ A;  4AFU C;  2DIL A;  2KT1 A;  3KFV A;  2E5K A;  1K1Z A;  2DRM A;  4AG2 C;  1G83 A;  2DL8 A;  2IIM A;  4E6R A;  1RLQ C;  2RQT A;  1M8M A;  2JMA A;  1WXU A;  2OJ2 A;  2GQI A;  3VS5 A;  2CT3 A;  3EG0 A;  1Y57 A;  1PKT A;  2AZS A;  2KYM A;  4J9E A;  1S1N A;  1GBQ A;  2RQW A;  4OML A;  2O2O A;  2DRK A;  2BTT A;  1PKS A;  1M30 A;  4J9D A;  4RTU A;  2FPE A;  4CC4 B;  2CH4 W;  2AK5 A;  1MUZ A;  1UEC A;  4RTZ A;  2RQV A;  3M0Q A;  4LNP A;  2FRY A;  4RTX A;  2DF6 A;  4F16 A;  1NYG A;  5I22 A;  2LX7 A;  3NPF A;  1QKW A;  4HVW A;  3I35 A;  2GGR A;  1UFF A;  2X3X D;  1ZLM A;  2JXB A;  4Z88 A;  3FJ5 A;  4D8D A;  1H8K A;  2JMC A;  1AEY A;  1WA7 A;  4F17 A;  2ABL A;  2LMJ A;  1PRM C;  2CSQ A;  2K79 A;  4J9C A;  1N5Z A;  1W6X A;  1GL5 A;  1AWO A;  1GFD A;  4M4Z A;  2LZ6 B;  1M3C A;  2A08 A;  2RPN A;  1JO8 A;  1AWW A;  1TG0 A;  1UDL A;  1NG2 A;  1ZBJ A;  2JM9 A;  2CUD A;  1ZSG A;  2J6F A;  2VVK A;  2XMF A;  3M0P A;  1WYX A;  4HCK A;  4KRT A;  2RNA A;  1MV3 A;  2X3W D;  2JW4 A;  1NEB A;  4IIO A;  2V1R A;  3ZL7 C;  3M0S A;  1BBZ A;  4A63 B;  1AWJ A;  1SHG A;  5IHI A;  1K9A A;  2LJ0 A;  3GBQ A;  1YN8 A;  2EGC A;  1ZUK A;  2K9G A;  2KEA A;  1UJ0 A;  1WXB A;  3EG2 A;  2EYY A;  2P4R A;  3UA6 A;  2LP5 A;  3H0H A;  3R6N A;  1OPL A;  3JV3 A;  2KE9 A;  4CC7 A;  1ARK A;  1VYU A;  4GBQ A;  4DEX A;  2RN8 A;  4JZ4 A;  1H3H A;  4OMM A;  1T0H A;  1BK2 A;  4ZNX A;  3VS3 A;  1NM7 A;  2YUP A;  3TSZ A;  2CH4 A;  2FPF A;  5IHK A;  3CQT A;  2SRC A;  2SEM A;  1WXT A;  2O9S A;  1B3Q A;  2BZ8 A;  2EYX A;  2I0N A;  4DEY A;  4R0K A;  2HCK A;  1K4U S;  2W10 A;  2JS0 A;  1ZUY A;  1WDX A;  1VYV A;  1UHC A;  4OMN A;  1YP5 A;  4AFZ C;  4Z8A A;  1W70 A;  1SEM A;  1TUD A; 
#chains in the Genus database with same CATH topology
 3CXC P;  1UEB A;  4FU6 A;  3UF4 A;  4MZT A;  3OYA A;  2F5K A;  2FVU A;  1UGV A;  1D09 B;  2PUK B;  1VQ7 A;  4OB0 B;  3MP8 A;  2D9T A;  2L89 A;  4J9H A;  2KR3 A;  3URG A;  5KYU B;  3JRZ A;  3JCM X;  3SFM A;  1J3T A;  4GLK A;  4C8Q A;  5LJ3 d;  3GNF B;  2D6F A;  2BE9 B;  3JCM d;  3OS0 A;  3VS0 A;  2RI2 A;  1O9S A;  3SHW A;  4M77 E;  3HSB A;  3CC7 T;  5HK3 A;  2OTJ A;  4RTY A;  2EJG A;  3FC3 A;  2NUP B;  2QQS A;  1LJO A;  4J7F A;  1F1B B;  2LTO A;  3CXC S;  4E7K A;  5GJV B;  5FU6 B;  2O9V A;  1T3L A;  2QI2 A;  1QWE A;  2VXE A;  2YSQ A;  3LWI A;  5GAO l;  1VYT A;  1YJW A;  3CC4 T;  2V1Q A;  1PSE A;  1YJW T;  2D0Q B;  2AKK A;  5LJ3 e;  3JCM e;  1KFZ A;  2RO0 A;  5GAN d;  2ED1 A;  2VKN A;  5GJW B;  4IUP A;  2DL5 A;  1JEG A;  2YUQ A;  1VQL A;  2FYK A;  1YJ9 Q;  1VQL T;  1C1A A;  3FLG A;  2VYT A;  1KQ2 A;  2HSE B;  5DM7 R;  2WAC A;  3PE0 A;  3JCM V;  2IPO B;  2KRO A;  4WF2 A;  1X2K A;  1Y71 A;  2MWP A;  4OMQ A;  2MF2 A;  2OTL Q;  2D0N A;  3QII A;  2J6K A;  2L3R A;  4FIB A;  4A54 A;  3QSU A;  1MNE A;  8ATC B;  4RMO A;  1YBY A;  3O5Z A;  4MZM A;  5FWC A;  3E1S A;  2YRV A;  2D8H A;  4FSS A;  3CCQ T;  5IH2 A;  4FL6 A;  5GAO n;  2E6Z A;  2JUF A;  2LNV A;  2LQK A;  2BKD N;  3EHR A;  5I11 A;  3I56 A;  1WIE A;  4QVZ A;  1T3S A;  3I56 T;  5FW9 A;  1I8F A;  5FWB A;  4O6J A;  4QT7 A;  1K0S A;  1TOV A;  2V8K A;  5I21 A;  4OVA A;  4XTW A;  2COY A;  5GMK i;  2MPX C;  3EAE A;  2DLP A;  3J81 E;  1K9M C;  2H3J A;  2AZV A;  1WI7 A;  2FHD A;  4M7D E;  2EQI A;  2PUO B;  1YHQ Q;  4EMK A;  1IGQ A;  3VS6 A;  3G4S Q;  2ZAE A;  4HCZ A;  3OYF A;  1VQP Q;  1CKA A;  1MMD A;  3NHN A;  5GAM e;  2KXC A;  3RIR A;  3P8H A;  4Z02 A;  2XDD A;  4DBR A;  1Q7Y C;  1VIF A;  3JAM E;  4N0A A;  4M75 C;  1HD3 A;  1I4K 1;  2HKQ B;  2Y4X A;  3ZFJ A;  2F2W A;  5FLX E;  4EIK A;  3OB9 A;  1KIK A;  1I5O B;  2DX1 A;  3M56 A;  2EGA A;  2L3S A;  1NJI U;  2C0I A;  1Y07 A;  4X1V A;  2HQH A;  5LJ5 j;  3WVD B;  3L2V A;  3QZ5 B;  1KQS A;  5LJ5 g;  5GAN 5;  3UDC A;  1W2B P;  1YJ9 A;  3CCU Q;  3A8L B;  3QG1 A;  1C6V X;  3OS2 A;  5GAM h;  3OYH A;  4A4F A;  1E6G A;  2A3L A;  5IT9 E;  2HSP A;  2XDP A;  1N27 A;  2ENM A;  2OTL A;  1R8O B;  2JTE A;  4DQ2 A;  1KD1 R;  1YI2 T;  2D1X A;  3HTR A;  2CP6 A;  1YIT T;  5DLQ E;  1NJI R;  2E1H A;  3VKI A;  4JPB W;  1W2B S;  4MDX A;  1W4S A;  1QCN A;  3U23 A;  2DYB A;  2YWW A;  5A0D A;  2L0A A;  1BI3 A;  2E3I A;  2HBW A;  1WJQ A;  3IQL A;  1EIF A;  4BE0 A;  3NMZ C;  4HVU A;  4BDZ A;  3M4G A;  1G2B A;  2ECZ A;  1AD5 A;  2K6D A;  4ZGJ B;  2O31 A;  3TSW A;  3RBB B;  1HK9 A;  2DVE A;  4LE9 A;  1IHV A;  2QG9 B;  3TVT A;  1HSQ A;  3RMQ A;  2DEU A;  3A8H B;  1NLO C;  1YHQ A;  2DEQ A;  3QJY A;  3G4S A;  4C92 D;  4OB2 B;  4A4H A;  1YHQ T;  1VQP A;  1ABO A;  3LGF A;  3G71 Q;  1VQP T;  5A0L A;  3JCM Q;  1X27 A;  1X6G A;  1AZG B;  2EBP A;  2J05 A;  3S3M A;  3RR6 A;  4KGV B;  3BW1 A;  1X2Q A;  4KH1 B;  5GMK e;  1AOJ A;  1WZO A;  2CRE A;  4HVV A;  1WQ7 A;  4L6V 5;  3UAT A;  5LJ5 f;  1D3B B;  3VS7 A;  1UE9 A;  2RI3 A;  2YXY A;  3MJX A;  4JJC A;  5EC7 A;  2DD5 A;  2XKO C;  4JRK A;  1E6H A;  1BYM A;  1IHW A;  2F5T X;  4ORZ A;  3FIF A;  1K73 U;  3OS5 A;  3G1J A;  1K1Z A;  2DL8 A;  4J6X A;  2COZ A;  3CCU A;  4M7A D;  3C12 A;  3CCU T;  4E6R A;  1VQ9 T;  5KCH A;  1WXU A;  2OJ2 A;  4JJN K;  2GQI A;  2JN0 A;  3OYG A;  4QVC A;  4M78 G;  3V8K A;  1VQK Q;  1Y57 A;  1PKT A;  5L8R E;  2KYM A;  5GMK h;  2QDY B;  1S1N A;  2O2O A;  4HCB A;  2LDM A;  1M30 A;  4E7H A;  3EFO B;  1NPP A;  1UEC A;  1U1T A;  2QTX A;  3CPW A;  4F16 A;  1SG5 A;  5I22 A;  2DZ9 A;  4RCC A;  1K73 R;  3I35 A;  2EKO A;  2M02 A;  4E2F B;  4M75 E;  5LJ3 j;  3QJ6 A;  3MEU A;  1H8K A;  3M9Q A;  4F17 A;  4LDV A;  1PRM C;  4QW2 A;  1BI2 A;  1ACM B;  3JCM g;  2YRC A;  1GL5 A;  4C8Q B;  4M7D F;  2LZ6 B;  1M3C A;  2A08 A;  4KUI A;  4OGC A;  2LT4 A;  1ZBJ A;  2CUD A;  4F7U F;  2DTH A;  1OUL A;  2XMF A;  1QVG A;  4FT2 A;  4C8Q D;  1WYX A;  3GOX A;  4C92 G;  2X3W D;  3M4Y A;  3G71 A;  4LD6 A;  2JW4 A;  4LDU A;  3RUX A;  3G71 T;  5CK9 A;  2PU9 B;  2QTV A;  2P84 A;  4XK8 E;  4N4I A;  1SHG A;  3MKD A;  1YN8 A;  2EGC A;  1G3S A;  1WXB A;  2QA4 Q;  1V76 A;  3H0H A;  5CKF A;  5CO7 A;  1OPL A;  2KE9 A;  4FW1 A;  1KD1 C;  3UT1 A;  2VXF A;  5CAI A;  1VYU A;  4MMK A;  3OW2 A;  2RN8 A;  1JRI A;  2V8I A;  1T0H A;  2ZPH B;  1NM7 A;  2CH4 A;  3CQT A;  2SRC A;  2GCX A;  1B7T A;  4XTZ A;  1VQ4 T;  3INZ A;  4JRQ A;  2I0N A;  4M78 A;  3JB9 D;  1D1B A;  3RKW A;  2HL5 C;  3V7C A;  2JS0 A;  1OU9 A;  1UHC A;  1YP5 A;  1VQK T;  4P5N A;  3SWN A;  3CCL Q;  1W70 A;  5GAM j;  5KYX A;  2CUB A;  4FYY B;  2DKG A;  1I81 A;  5GAM g;  3MO8 A;  9ATC B;  3CCJ T;  4O5V A;  2RM4 A;  2ZPB B;  1PCX A;  1K76 A;  1PSF A;  2CT4 A;  3G6E T;  2LQW A;  3L2Z A;  1ABQ A;  1D0X A;  3EG1 A;  4CC3 A;  2VAS A;  2K5L A;  3TRE A;  2M51 A;  4R56 A;  1Z9Q A;  2CP3 A;  5C0M A;  4FYW B;  4XTX A;  2EIF A;  3BFM A;  4RTT A;  1VIE A;  2RHX A;  4ZN3 A;  4PJO C;  2DMO A;  3UA7 A;  2EVR A;  1U06 A;  2HAX A;  5D6X A;  4EMK B;  1S72 T;  4C92 A;  5KE2 A;  4HKE A;  1Q7Y U;  1Y96 B;  2QEX Q;  2A36 A;  3E19 A;  4J9G A;  2OTJ Q;  2BIV A;  2K4Y A;  1PHT A;  1U5S A;  2R5A A;  1RAF B;  4PJJ A;  5CKD A;  1WQW A;  1UGR B;  2E10 A;  1H92 A;  1I1J A;  3ASK A;  1NEG A;  2DM1 A;  2KAF A;  3M5A A;  2F2X A;  1ZA2 B;  1X01 A;  2QA4 A;  3PGG A;  2DBM A;  2Z0W A;  4AFS C;  3L2Q A;  4Y92 A;  4J9F A;  3L42 A;  5CIU A;  1M1F A;  1ZUU A;  4ME7 A;  4YTL A;  4JS5 A;  1Q7Y R;  4M7A A;  1SRM A;  2C0T A;  1Q86 C;  4J9I A;  1IGU A;  4JJB A;  5EG2 A;  1OX8 A;  2KNB B;  2LNH B;  3AHU A;  1IXD A;  3EHQ A;  1WHJ A;  2RK1 A;  3TCJ A;  5GAM f;  5FRN A;  3MCA B;  2HL3 A;  4JS4 A;  2CZ1 B;  3CCL A;  2MCN A;  4AFQ C;  3TEE A;  4B6M A;  1OEB A;  4C5G A;  2A28 A;  2XIC A;  3QWY A;  5GAN 7;  2DXT A;  3QO3 A;  1FMW A;  1EZZ B;  1IO6 A;  1MMN A;  3LX7 A;  1RI0 A;  5GMK j;  3FDR A;  3GNG A;  4OP0 A;  1TUG B;  1YJN T;  1RAE B;  3QBY A;  1D0Y A;  2BUD A;  3FJP A;  2ED0 A;  3I55 Q;  3F70 A;  2XHC A;  1KC8 R;  1X6O A;  5GAO r;  3FEO A;  1G5V A;  1JJ2 P;  2WSE E;  1VA7 A;  3X28 B;  1VQ7 T;  1OX9 A;  2CP7 A;  3JB9 H;  3X24 B;  1WX6 A;  1X6B A;  2VC8 A;  1WFW A;  1RUW A;  2BE7 D;  2MK5 A;  2YRD A;  3NGP A;  2NLU A;  3C4S A;  2QEX A;  2FZK B;  2QEX T;  2J7I A;  2YUO A;  2DET A;  4M77 G;  1GFC A;  2X35 A;  4GLM A;  4N4H A;  4BDY A;  2OTJ T;  1QW1 A;  4JUV A;  1R77 A;  1PWT A;  2EQK A;  2RHU A;  3JB9 I;  2VGN A;  1M5Q 1;  3RNJ A;  1JJ2 S;  3LH0 A;  5A0G A;  1AHJ B;  2EQJ A;  4XU3 A;  2X4X A;  2W0Z A;  1KQ1 A;  2X51 A;  4E7Z A;  3HKS A;  1QP2 A;  4RTV A;  1YIJ A;  2KT8 A;  2RA2 A;  2JVV A;  2CP0 A;  3PIP A;  3MPU B;  4OMO A;  2DNU A;  2EAY A;  3OYC A;  2O01 E;  1SHF A;  1KSW A;  4KH0 B;  5CVI A;  4IUT A;  1ZQ1 A;  4XTY A;  3OMG A;  2F1L A;  3P8D A;  3LYI A;  1B34 A;  3JCM c;  3EGX A;  3OYY A;  4PJO E;  1VQ5 A;  1PG5 B;  3PIO A;  2HD0 A;  1YFN A;  2DXB A;  2DPP B;  5GAN e;  2ZPG B;  5LJ3 h;  3JCM h;  2IVW A;  3M0T A;  1YWO A;  2X4Y A;  5CKH A;  3A1P A;  3I55 A;  2DD4 A;  1OZ2 A;  2DJQ A;  3VS4 A;  3ZEH A;  3V8J A;  4N4G A;  1QLY A;  1GCQ A;  2DE0 X;  4ESR A;  2CP5 A;  2QXF A;  3THK A;  1WHL A;  2H8H A;  2YT6 A;  4F14 A;  4M77 A;  2LCL A;  2RJF A;  1XJW B;  5GAN h;  4M7D G;  3CC2 Q;  1BB9 A;  1UTI A;  4HT8 A;  1BI0 A;  1Y96 A;  4DOV A;  2FPD A;  5IXB A;  4F7U E;  2KI7 A;  4C8Q F;  2VWF A;  3OYM A;  3WVE B;  4AMC A;  1KD1 U;  1BCO A;  2KT1 A;  3JCM W;  2DRM A;  3CD6 Q;  3R6O A;  2XI9 A;  4X9C A;  5CCA A;  3EG0 A;  1W2B A;  2AZS A;  3EH2 A;  1TU0 B;  3NTI A;  4PK4 A;  2GF7 A;  4M78 B;  1U8R A;  2JZ2 A;  3N5B B;  4OML A;  2DIQ A;  3OYJ A;  2KVQ G;  1YJ9 T;  4Q5W A;  2BTT A;  1N6A A;  2CH4 W;  1WHM A;  4RTZ A;  2RQV A;  4LNP A;  3ER0 A;  3FRN A;  2FRY A;  1NE8 A;  4M78 D;  1NYG A;  3SWN B;  4KUD K;  2X9H A;  1TTH B;  2OTL T;  5KYX B;  4DBH A;  3OY9 A;  4C0D B;  2E41 A;  4C92 C;  3JB9 F;  2GGR A;  1KQS P;  1KC8 C;  2QAS A;  1ZLM A;  1K8A R;  1Y7X A;  2DJZ A;  4Z88 A;  3FJ5 A;  4RKU E;  2NYS A;  5J3B A;  4D8D A;  3L2R A;  4L5G A;  2JMC A;  1WA7 A;  2ABL A;  2LMJ A;  3DLL A;  4NOY A;  5M9O A;  2K79 A;  1QVF P;  1W6X A;  4R55 A;  1GFD A;  4EMH A;  3CME A;  2RPN A;  1JO8 A;  3OYK A;  1UDL A;  2KMT A;  1NG2 A;  1G3W A;  3LWH A;  2J6F A;  3M0P A;  2QGG A;  1NBE B;  4KRT A;  2RNA A;  4RG2 A;  5GMK m;  4F04 B;  3RKY A;  1KQS S;  3QPH A;  1NEB A;  3CBM A;  4PFO A;  5GAN 8;  3MEV A;  2WSF E;  3NTK A;  4C92 B;  5CQY A;  3CBO A;  4M7A C;  3HRT A;  1BBZ A;  4M7D A;  3MP1 A;  5GAO p;  1QVF S;  5GAO q;  1JBM A;  4GY5 A;  5IHI A;  3P8B B;  2LJ0 A;  1ZUK A;  3CC2 A;  1VQ6 Q;  3G4S T;  1LVK A;  2EYY A;  3EFS A;  4C0F A;  5A2Q E;  3JV3 A;  3E2U A;  4KBM B;  1WHG A;  3VUZ A;  4QQ6 A;  3M57 A;  3CD6 A;  3TSZ A;  1QMC A;  5IHK A;  2RHI A;  2SEM A;  4QKU A;  5GAN 2;  2BZ8 A;  4DEY A;  2E12 A;  1Q86 U;  1UGP B;  4R0K A;  2QQR A;  4M7A B;  4J83 A;  2W10 A;  1WDX A;  1VYV A;  5DY9 A;  4Z8A A;  4BI4 A;  1UGQ B;  3EGU A;  3GPL A;  1BU1 A;  1TSF A;  3E9F A;  1VQN Q;  2DVJ A;  4PJO F;  3LGL A;  2O88 A;  1ZHI A;  3QXE B;  1MGQ A;  2DBK A;  1P92 A;  6AT1 B;  4CRI A;  2KBT A;  5HK0 A;  4C8Q C;  2RHY A;  4E7L A;  2A7Y A;  2KXD A;  3EG9 A;  2E64 A;  2GFU A;  5KCO A;  2EGE A;  3VJP A;  1QKX A;  1OPK A;  2ROT A;  2V8J A;  1Q86 R;  1W1F A;  2JT4 A;  4BD3 A;  2HQX A;  1UHF A;  1R0C B;  1M3A A;  5HY6 A;  2ZCF B;  1V1C A;  2CZ7 B;  2O4X A;  1M1K C;  1HYO A;  1I07 A;  2LVM A;  5CR2 A;  2FO0 A;  5CKE A;  4A4E A;  1MND A;  2BZY A;  4M75 G;  2COW A;  4XU2 A;  4TVR A;  2G6F X;  3RKX A;  1AWX A;  5LJ3 g;  2VGM A;  2JM8 A;  4JLG A;  3VS1 A;  4DBQ A;  2OAW A;  1RAA B;  4ZN1 A;  1KHI A;  1WPY A;  3OMC A;  3C0C A;  4ZTF A;  2C0O A;  4FW2 A;  2EW3 A;  2F2V A;  1WJS A;  4ATO A;  3PVQ A;  1OOT A;  2ZPI B;  1VQ6 A;  1M90 U;  2YLB A;  1CKB A;  2PQW A;  4LDY A;  4PJN A;  5L23 A;  4HCC A;  1MHN A;  2L3P A;  3M0U A;  2G3R A;  3QDR B;  3M0R A;  4LDX A;  1YNZ A;  5GAN j;  1WLP B;  5KYN A;  2H3E B;  1RL2 A;  3QHS A;  2PVO B;  5GAN g;  4Y91 A;  3CMA Q;  3CPW S;  2J6O A;  2PNI A;  2CS7 A;  1QCF A;  4LUD A;  1PRL C;  2DFU A;  1TS9 A;  5GAN 6;  1K8A C;  3LLR A;  4NS5 A;  1A0N B;  3CCM Q;  3ME9 A;  1RAH B;  4C5H A;  3X25 B;  1WNL A;  2WSC E;  4K11 A;  3ZBD A;  1M90 R;  1GCQ C;  1XTD A;  1VQN A;  2CGH A;  1B34 B;  2JS2 A;  3EGX B;  2DXU A;  1GRI A;  3OYD A;  3CCR Q;  4LD9 K;  5J39 A;  1SRL A;  2OI3 A;  4EMK C;  2LRQ A;  4M7A E;  2VB6 A;  5LJ5 d;  4J8O A;  4AG1 C;  2QK0 A;  2KY9 A;  2RB6 A;  1QQJ A;  1MMA A;  4N0A C;  3SDZ A;  2EYW A;  2PZ1 A;  2XU8 A;  1SSF A;  5LJ3 f;  3VYG A;  1WGS A;  3JCM f;  4M75 A;  4CC2 A;  2K7A A;  2E6N A;  1T0J A;  2LCC A;  3DKM A;  4WTO B;  5FU7 B;  3H8Z A;  2CP2 A;  4RUG A;  3HL8 A;  3J7A F;  1CSK A;  4M77 B;  3OYB A;  3REB B;  2D8J A;  2HMA A;  3V7R A;  2RI5 A;  3RER A;  2GNC A;  2YDL A;  2XK0 A;  1IRX A;  3HFN A;  3V8L A;  1M9S A;  2L3Q A;  1WHK A;  4JDS A;  4M77 D;  3PVL A;  1YCY A;  4LXC A;  4OB3 B;  3VS2 A;  2R58 A;  3VRZ A;  2E5Q A;  3A98 A;  5GAN f;  3CBP A;  3RES A;  2A37 A;  3UPU A;  3H41 A;  1VUB A;  1D0Z A;  2Y4Y A;  3KXT A;  1QP3 A;  4LN2 A;  1GBR A;  2PVG B;  4C8Q E;  2LQ8 A;  3GLX A;  3CMA A;  1YIJ Q;  2KYB A;  5KYY A;  3CMA T;  4PFP A;  1B07 A;  5DLO A;  1N8R C;  4BI8 B;  2YUN A;  2QA4 T;  2VV5 A;  1M3B A;  3M59 A;  4OF1 A;  1EX4 A;  1RAD B;  2EQU A;  2EPD A;  5D6Y A;  1LCK A;  8AT1 B;  2DZC A;  3HPW A;  1Z9Z A;  3EG3 A;  2CZ6 B;  1PD0 A;  3CC4 Q;  2AKL A;  2RHZ A;  4V2S A;  3CCM A;  1KC8 U;  1R0B G;  3CCM T;  2HEQ A;  4D6W A;  2KGT A;  3GP8 A;  3FB9 A;  4WCI A;  2K3B A;  3CCR A;  2FEI A;  4JZ3 A;  2PTK A;  3I5R A;  4NL3 A;  1ZSZ B;  1NLP C;  1VQ5 Q;  2LJ1 A;  2DER A;  4QQD A;  2RJE A;  4M78 F;  3CCL T;  2M0O A;  2MYS A;  1X69 A;  1OI1 A;  1SPK A;  2NUT A;  2CZ0 B;  2HNI A;  1PC0 A;  1AVZ C;  2DL7 A;  2R5M A;  5KYW A;  2GTO A;  3CPF A;  1VQM Q;  1UG1 A;  1IRE B;  3CXC A;  3I9Q A;  4LDW A;  2AHJ B;  1JJ2 A;  2GBQ A;  3BDU A;  3M53 A;  3CCQ Q;  4XU0 A;  2RK2 A;  2DIG A;  1Q82 C;  2FG0 A;  2LX9 A;  1OQK A;  1VQ8 Q;  4M7D B;  2ATC B;  4FCY A;  5LL6 S;  4XAX B;  3KFV A;  3KUF A;  1NPR A;  2HKN A;  4AG2 C;  1G83 A;  4EDU A;  3MEA A;  4M7D D;  4OMF B;  3E9G A;  1RLQ C;  3CEY A;  4ZGE B;  3PMI A;  2PVD B;  3VS5 A;  2FB7 A;  4C92 F;  2CT3 A;  2XID A;  3DB3 A;  4J9E A;  2QGF B;  2K5I A;  1O75 A;  4RG8 A;  1M90 C;  1RAB B;  1GBQ A;  2RQW A;  2K57 A;  4BB7 A;  3CC7 A;  2DRK A;  4ZGD B;  1PKS A;  4RTU A;  4CC4 B;  2FPE A;  1YIJ T;  1OU8 A;  4OGE A;  1BIB A;  4ELY C;  3M0Q A;  4J7I A;  2DF6 A;  2QQ9 A;  5GAN 4;  4XQ3 A;  4IUQ A;  3EFR A;  1FXX A;  3NPF A;  2X3X D;  4C5I A;  3CC4 A;  1AEY A;  3EH1 A;  4X9D A;  4M7A F;  4ELZ C;  2K2V A;  1G8X A;  3EG9 B;  5GMK l;  4JRI A;  2JM9 A;  3EGD A;  4PJO G;  1ZSG A;  5KE3 A;  2B8A A;  1VQ5 T;  1M1K U;  4HCK A;  1H3Z A;  4DA4 A;  1MV3 A;  4KGZ B;  1TXQ A;  2P0P A;  1G3Y A;  2HZY A;  2QAZ A;  4IIO A;  2O4X B;  2XDB A;  3QDF A;  3CME Q;  2DYI A;  1YI2 Q;  2M1H A;  2V1R A;  3ZL7 C;  3MEW A;  1MMG A;  2AT1 B;  4PJL A;  1VQM A;  5D7U A;  2L8D A;  2MI6 A;  4A53 A;  1VQM T;  1YIT Q;  1K9A A;  2X4J A;  3GBQ A;  2K9G A;  2KEA A;  3I55 T;  3S3N A;  3CCQ A;  3VV0 A;  2P4R A;  3UA6 A;  1XNI A;  3R6N A;  2KQW A;  1ARK A;  2MWO A;  3A8O B;  1VQ8 A;  2X4W A;  4BI3 A;  2XD0 A;  4JZ4 A;  4E7S A;  4E7I A;  1VQ8 T;  1H3H A;  4OMM A;  4BE2 A;  1X75 C;  1M4Z A;  1WHH A;  1SKU B;  5GAM d;  3D7S B;  1M1K R;  1WXT A;  4OB1 B;  2O9S A;  4M78 C;  1DJ7 B;  2EYX A;  4C0Z A;  4MDW A;  3HP9 A;  4F7U G;  1OZ3 A;  2E65 A;  1K4U S;  3VYH B;  4EMG A;  3PNW C;  4NL2 A;  1G3T A;  1PM3 A;  3L2U A;  1ZUY A;  3SWN C;  1JB0 E;  1BCM A;  2CKK A;  4C0D C;  1TUD A;  1K8A U;  4HT9 A;  3MP6 A;  3OBW A;  2E4H A;  2EJF A;  4LUE A;  4HXJ A;  3V7S A;  4E47 A;  4PL6 A;  5IN1 A;  2DL4 A;  2LJ3 A;  4B9W A;  3GF5 A;  4ZTJ A;  2ROL A;  1RI9 A;  2JTF A;  1M27 C;  3LH5 A;  1TH7 A;  2B86 A;  1SSH A;  3QYG B;  3VRY A;  1IZ6 A;  3ULR B;  5ECA A;  2KSS A;  1X43 A;  5J26 A;  2RJC A;  4FYV B;  4PJO A;  1K0X A;  4PJM A;  7AT1 B;  1Y0M A;  4L59 A;  1ZSZ A;  4CI0 C;  4QVD A;  4JRP A;  3JB9 J;  3OYL A;  2FRW A;  2K3Y A;  3NFC A;  1VQ9 Q;  1Q81 U;  1FX7 A;  4J5Y A;  1QVF A;  3X26 B;  4J9B A;  5GAO m;  3I5S A;  1GXI E;  3VUB A;  4M75 B;  2K5F A;  1PNJ A;  1YI2 A;  1AZE A;  2XG8 D;  3CME T;  3QWX X;  5CQX A;  3CCV Q;  2QQB A;  2JNG A;  2ZPE B;  4XTU A;  3MET A;  3UWN A;  3HFO A;  2HDA A;  1YIT A;  1RAG B;  2JTM A;  4M75 D;  1U3O A;  1QCO A;  2L2P A;  5AT1 B;  2DA9 A;  4DOW A;  2EKH A;  1FWZ A;  4BUG A;  4Z89 A;  4J6W A;  1UUE A;  3A5Z B;  4Y28 E;  3VU3 C;  1M2V A;  3OS1 A;  2CSI A;  2EQM A;  2HBP A;  3H0F A;  1QWF A;  1EFN A;  1V29 B;  2MIO A;  4F7U A;  1Q81 R;  3CC2 T;  2OX7 A;  2NUZ A;  4EPC A;  2MOX A;  4PNO A;  3RDV A;  1N8R U;  1JQQ A;  4M77 F;  3BY7 A;  2RF0 A;  2IG0 A;  2JOY A;  1AT1 B;  5KYU A;  5KYY B;  5CKB A;  1OV3 A;  1U1S A;  1LNX A;  1VQO Q;  3CD6 T;  2FZC B;  2NWM A;  3OYE A;  3OBY A;  3L2W A;  2K2M A;  5IAY A;  1KJW A;  1I0C A;  2QDL A;  2GFA A;  4A4K A;  1I5L A;  2NUP A;  3OSV A;  1BKB A;  2GTJ A;  3J80 E;  3H9N A;  3JSC A;  4BAC A;  1FMK A;  2EWN A;  3OA6 A;  2DK3 A;  1JU5 C;  1JXM A;  1RAI B;  2KK4 A;  1XQH A;  1KK7 A;  2LCS A;  1H64 1;  1N8R R;  3M54 A;  2CYZ B;  1RLP C;  2ZPF B;  1QVP A;  2QYZ A;  5IHN A;  5IXF A;  1UJY A;  1PD1 A;  1M8V A;  1VQ4 Q;  3X20 B;  2DL3 A;  2NUT B;  3MHX A;  3TQ7 P;  2JJ9 A;  4IIM A;  2DTO A;  3QUI A;  1VQ9 A;  4KUL A;  4DBF A;  5I2M A;  5KYW B;  2DTI A;  2M0Y A;  4M78 E;  1XOV A;  2QQA A;  5D6W A;  1Q82 U;  3S6W A;  4PFZ A;  5AYF A;  2MAM A;  3CCV A;  3C94 A;  3CCV T;  1M2O A;  3CCJ Q;  3HRU A;  2RQU A;  2LQN A;  1YWP A;  2KRS A;  2EYQ A;  1VOM A;  3G6E Q;  3SD4 A;  4J6Y A;  3CPW P;  2VUB A;  2C06 A;  4IUR A;  4PKC C;  1JXO A;  1GCP A;  2BZX A;  1NYF A;  1D1A A;  2E3H A;  4IUV A;  3L1A A;  4QQG A;  2J06 A;  1D1C A;  3NTH A;  2KRM A;  3TU4 K;  2F69 A;  2MMP A;  3AT1 B;  2E70 A;  2FZG B;  3A8G B;  3DLM A;  1VQ6 T;  4PLL A;  3CCS Q;  2ESW A;  1HXD A;  1Q82 R;  4FT4 A;  4IUU A;  1ZX6 A;  4E7J A;  1S72 Q;  2RQR A;  2KRN A;  1NZ9 A;  5C6S A;  3QKJ A;  1C0M A;  4KT0 E;  1LOJ A;  1UGS B;  3OYN A;  2ZGW A;  3PTA A;  3SEM A;  1Q95 G;  4C92 E;  1VQO A;  2K3X A;  1QVG P;  1VQO T;  4JLI A;  1RAC B;  4KGX B;  4UC4 A;  3LW5 E;  2EYZ A;  4BE1 A;  1HJD A;  1FYN A;  3GIB A;  3JCM P;  1BI1 A;  2RJD A;  4X34 A;  2LT1 A;  2AIR B;  5HKC A;  1OYX A;  2V26 A;  3REA B;  5FRO A;  1TUC A;  5HCK A;  1VQN T;  4PLI A;  5FU7 C;  1N9S A;  1SF9 A;  4RTW A;  3EGD B;  2DXC A;  2RMO A;  4JJD A;  1QVG S;  2P4T A;  3KBG A;  2L5Q A;  3OW2 P;  3H6Z A;  2Y90 A;  4MZP A;  4M77 C;  1BIA A;  4BY6 C;  2HQE A;  2CDT A;  2YLC A;  1NJI C;  2M16 A;  1VQ4 A;  4M7A G;  4D8K A;  2GQV A;  4II1 A;  1YCS B;  4RCB A;  1MV0 B;  2EJ9 A;  1ZA1 B;  3WXM B;  3H0I A;  1E7O A;  2DO3 A;  4OMP A;  1VQK A;  4FSX A;  4AFU C;  2DIL A;  2E5K A;  2LC4 A;  1Q81 C;  2IIM A;  3M58 A;  4ANJ A;  2P0Q A;  3CCJ A;  3OW2 S;  2KDS A;  3HHT B;  4FM4 B;  2RQT A;  1M8M A;  2JMA A;  4C5E A;  2A0F B;  1M1G A;  3G6E A;  3QYH B;  2M9U A;  3T9N A;  3OSS C;  1YJN Q;  1WJR A;  4BY6 B;  3CCE Q;  2I2L A;  3G7Z A;  5LJ5 e;  5I2S A;  4C0G A;  3SB2 A;  1TWB A;  4VUB A;  1K9M U;  3JCM b;  2OAU A;  4J9D A;  1VQ7 Q;  1ZBX A;  2AK5 A;  1MUZ A;  2R57 A;  3O8V A;  2DAQ A;  4RTX A;  3CCS A;  3CCS T;  2LX7 A;  4B9X A;  1S72 A;  1UB4 A;  1QKW A;  4HVW A;  1UFF A;  2JXB A;  1ZSZ C;  4C8Q G;  3CC7 Q;  1FMV A;  3HRS A;  2CSQ A;  3OQ5 A;  3PT9 A;  4J9C A;  1N5Z A;  1LPL A;  1AWO A;  4M4Z A;  3JCM J;  3PMT A;  1AWW A;  1TG0 A;  5LJ5 h;  2EFI A;  3BE3 A;  2VVK A;  1N9R A;  4A4G A;  4XU1 A;  1K9M R;  3RMS A;  1YJW Q;  4FYX B;  4PJO B;  4HA8 A;  1D3B A;  5FRM A;  2YHT A;  3CCR T;  3M0S A;  3PFS A;  4M7D C;  4XTV A;  3DB4 A;  4A63 B;  1VQL Q;  4PJO D;  1AWJ A;  3Q1J A;  2RD1 A;  4IKF A;  1IB8 A;  2RH2 A;  1UJ0 A;  3EG2 A;  2LP5 A;  3S3O A;  4MML A;  3OYI A;  3JB9 G;  4CC7 A;  1K73 C;  4DEX A;  4GBQ A;  1KG1 A;  1BK2 A;  4ZNX A;  3A8M B;  3VS3 A;  2YUP A;  3QZ9 B;  2FL7 A;  2FPF A;  3BDL A;  5GAN 3;  5KH6 A;  1B3Q A;  1M2V B;  3C95 A;  3M55 A;  4M75 F;  1KHC A;  4AT1 B;  2HCK A;  3I56 Q;  3EFO A;  1YJN A;  3CCE A;  4OMN A;  5FU6 C;  3CCE T;  4F7U B;  2ZZD A;  4AFZ C;  1SEM A;  2P0K A; 
#chains in the Genus database with same CATH homology
 2CUB A;  3EGU A;  3UF4 A;  1BU1 A;  4LUE A;  4HXJ A;  1UGV A;  2DVJ A;  2O88 A;  4J9H A;  2DBK A;  2KR3 A;  2DL4 A;  2LJ3 A;  1K76 A;  2KBT A;  2CT4 A;  2LQW A;  2ROL A;  1J3T A;  1RI9 A;  1M27 C;  1ABQ A;  2KXD A;  3EG1 A;  3LH5 A;  4CC3 A;  2B86 A;  3VS0 A;  2M51 A;  1SSH A;  2EGE A;  3SHW A;  1QKX A;  1Z9Q A;  3VRY A;  3ULR B;  1OPK A;  2ROT A;  1W1F A;  2JT4 A;  4RTY A;  5ECA A;  4RTT A;  1UHF A;  1X43 A;  2DMO A;  3UA7 A;  1M3A A;  5GJV B;  2O9V A;  1T3L A;  1K0X A;  1V1C A;  2EVR A;  1QWE A;  1U06 A;  2YSQ A;  1I07 A;  1Y0M A;  2FO0 A;  2A36 A;  1VYT A;  2BZY A;  4J9G A;  2FRW A;  2V1Q A;  2G6F X;  1AWX A;  2JM8 A;  4J9B A;  2AKK A;  3VS1 A;  2OAW A;  3I5S A;  1KFZ A;  1PHT A;  2ED1 A;  2VKN A;  5GJW B;  1U5S A;  2DL5 A;  1PNJ A;  3C0C A;  1AZE A;  1JEG A;  2C0O A;  3QWX X;  2YUQ A;  2EW3 A;  2F2V A;  2HDA A;  1H92 A;  1I1J A;  1NEG A;  2DM1 A;  1U3O A;  3PE0 A;  3PVQ A;  2L2P A;  2F2X A;  1OOT A;  2KRO A;  1X2K A;  1CKB A;  2DBM A;  2DA9 A;  4AFS C;  5L23 A;  2EKH A;  4OMQ A;  4Y92 A;  4Z89 A;  2D0N A;  4J9F A;  2J6K A;  1UUE A;  2L3P A;  3M0U A;  1ZUU A;  3M0R A;  1YNZ A;  1WLP B;  2CSI A;  1SRM A;  3O5Z A;  5FWC A;  3H0F A;  1QWF A;  1EFN A;  2C0T A;  2MIO A;  4J9I A;  2J6O A;  2D8H A;  2PNI A;  4FSS A;  4JJB A;  5IH2 A;  2NUZ A;  2KNB B;  2MOX A;  3EHR A;  2LNH B;  3EHQ A;  5I11 A;  1QCF A;  1JQQ A;  1WIE A;  4LUD A;  1PRL C;  1T3S A;  2RF0 A;  5FW9 A;  5FWB A;  1OV3 A;  1A0N B;  4QT7 A;  2MCN A;  1K0S A;  4AFQ C;  1OEB A;  2A28 A;  4K11 A;  3QWY A;  1GCQ C;  2NWM A;  1IO6 A;  2K2M A;  2JS2 A;  1KJW A;  1I0C A;  1GRI A;  2QDL A;  2DLP A;  2GTJ A;  1SRL A;  2AZV A;  2ED0 A;  2OI3 A;  1WI7 A;  1FMK A;  2EQI A;  3VS6 A;  1JU5 C;  1CKA A;  1JXM A;  3NHN A;  4AG1 C;  2KXC A;  1VA7 A;  2LCS A;  1WX6 A;  1X6B A;  1WFW A;  1RLP C;  2EYW A;  1HD3 A;  2PZ1 A;  4EIK A;  1RUW A;  2F2W A;  5IHN A;  2K7A A;  4CC2 A;  5IXF A;  1KIK A;  3NGP A;  1UJY A;  2DX1 A;  1T0J A;  2EGA A;  2DL3 A;  2J7I A;  2YUO A;  2L3S A;  4IIM A;  4RUG A;  1GFC A;  2C0I A;  4X1V A;  4GLM A;  2M0Y A;  1XOV A;  1CSK A;  1PWT A;  3RNJ A;  3REB B;  2D8J A;  2GNC A;  2YDL A;  2W0Z A;  2L3Q A;  4RTV A;  2KT8 A;  2RQU A;  3PVL A;  2LQN A;  1YWP A;  2KRS A;  1E6G A;  3VS2 A;  3VRZ A;  3A98 A;  2HSP A;  2ENM A;  2A37 A;  2JTE A;  3H41 A;  4OMO A;  2DNU A;  1JXO A;  1GCP A;  2BZX A;  1NYF A;  2D1X A;  1SHF A;  1KSW A;  4LN2 A;  2J06 A;  1GBR A;  2KRM A;  2KYB A;  1B07 A;  4JPB W;  2YUN A;  1M3B A;  2ESW A;  3U23 A;  1ZX6 A;  2DYB A;  2EPD A;  1LCK A;  2RQR A;  2KRN A;  2L0A A;  1Z9Z A;  3EG3 A;  2HBW A;  3IQL A;  3SEM A;  2AKL A;  3NMZ C;  4HVU A;  2HEQ A;  1G2B A;  2ECZ A;  2KGT A;  1AD5 A;  2K6D A;  2O31 A;  3TSW A;  3RBB B;  4WCI A;  2EYZ A;  2K3B A;  2FEI A;  4JZ3 A;  1HJD A;  1FYN A;  4LE9 A;  2PTK A;  3M0T A;  1YWO A;  3I5R A;  3TVT A;  1HSQ A;  1NLP C;  2LJ1 A;  1NLO C;  3REA B;  2DJQ A;  3VS4 A;  1TUC A;  1X69 A;  1ABO A;  1QLY A;  1GCQ A;  1SPK A;  5HCK A;  2DE0 X;  4ESR A;  1X27 A;  3THK A;  4RTW A;  1X6G A;  1AZG B;  2RMO A;  2EBP A;  4JJD A;  2J05 A;  2H8H A;  1AVZ C;  2DL7 A;  2YT6 A;  4F14 A;  2GTO A;  1X2Q A;  1UG1 A;  2CDT A;  1AOJ A;  3I9Q A;  2CRE A;  4HVV A;  3UAT A;  2GBQ A;  4D8K A;  1BB9 A;  1UTI A;  3VS7 A;  1UE9 A;  2FPD A;  5IXB A;  2FG0 A;  1YCS B;  4JJC A;  5EC7 A;  2VWF A;  1MV0 B;  1E6H A;  3H0I A;  1E7O A;  4OMP A;  4ORZ A;  4AFU C;  2DIL A;  2KT1 A;  3KFV A;  2E5K A;  1K1Z A;  2DRM A;  4AG2 C;  1G83 A;  2DL8 A;  2IIM A;  4E6R A;  1RLQ C;  2RQT A;  1M8M A;  2JMA A;  1WXU A;  2OJ2 A;  2GQI A;  3VS5 A;  2CT3 A;  3EG0 A;  1Y57 A;  1PKT A;  2AZS A;  2KYM A;  4J9E A;  1S1N A;  1GBQ A;  2RQW A;  4OML A;  2O2O A;  2DRK A;  2BTT A;  1PKS A;  1M30 A;  4J9D A;  4RTU A;  2FPE A;  4CC4 B;  2CH4 W;  2AK5 A;  1MUZ A;  1UEC A;  4RTZ A;  2RQV A;  3M0Q A;  4LNP A;  2FRY A;  4RTX A;  2DF6 A;  4F16 A;  1NYG A;  5I22 A;  2LX7 A;  3NPF A;  1QKW A;  4HVW A;  3I35 A;  2GGR A;  1UFF A;  2X3X D;  1ZLM A;  2JXB A;  4Z88 A;  3FJ5 A;  4D8D A;  1H8K A;  2JMC A;  1AEY A;  1WA7 A;  4F17 A;  2ABL A;  2LMJ A;  1PRM C;  2CSQ A;  2K79 A;  4J9C A;  1N5Z A;  1W6X A;  1GL5 A;  1AWO A;  1GFD A;  4M4Z A;  2LZ6 B;  1M3C A;  2A08 A;  2RPN A;  1JO8 A;  1AWW A;  1TG0 A;  1UDL A;  1NG2 A;  1ZBJ A;  2JM9 A;  2CUD A;  1ZSG A;  2J6F A;  2VVK A;  2XMF A;  3M0P A;  1WYX A;  4HCK A;  4KRT A;  2RNA A;  1MV3 A;  2X3W D;  2JW4 A;  1NEB A;  4IIO A;  2V1R A;  3ZL7 C;  3M0S A;  1BBZ A;  4A63 B;  1AWJ A;  1SHG A;  5IHI A;  1K9A A;  2LJ0 A;  3GBQ A;  1YN8 A;  2EGC A;  1ZUK A;  2K9G A;  2KEA A;  1UJ0 A;  1WXB A;  3EG2 A;  2EYY A;  2P4R A;  3UA6 A;  2LP5 A;  3H0H A;  3R6N A;  1OPL A;  3JV3 A;  2KE9 A;  4CC7 A;  1ARK A;  1VYU A;  4GBQ A;  4DEX A;  2RN8 A;  4JZ4 A;  1H3H A;  4OMM A;  1T0H A;  1BK2 A;  4ZNX A;  3VS3 A;  1NM7 A;  2YUP A;  3TSZ A;  2CH4 A;  2FPF A;  5IHK A;  3CQT A;  2SRC A;  2SEM A;  1WXT A;  2O9S A;  1B3Q A;  2BZ8 A;  2EYX A;  2I0N A;  4DEY A;  4R0K A;  2HCK A;  1K4U S;  2W10 A;  2JS0 A;  1ZUY A;  1WDX A;  1VYV A;  1UHC A;  4OMN A;  1YP5 A;  4AFZ C;  4Z8A A;  1W70 A;  1SEM A;  1TUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...