1M8MA

Solid-state mas nmr structure of the a-spectrin sh3 domain
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
56
structure length
56
Chain Sequence
ELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a protein determined by solid-state magic-angle-spinning NMR spectroscopy
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords SPECTRIN ALPHA CHAIN, BRAIN
total genus 2
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m8mA00
1AWJA 2LQNA 2F2VA 2CT3A 5FWBA 1M3AA 1Y0MA 2ABLA 2KROA 1WYXA 4JJCA 1E7OA 4D8KA 4EIKA 1YNZA 3I5RA 5ECAA 2EW3A 4JZ3A 3M0SA 2HBWA 2X3XD 2RNAA 3EHRA 1EFNA 1W6XA 3VS4A 3H0IA 2DL5A 2EYXA 2FEIA 2CH4W 2E5KA 2L3SA 2EYWA 1M27C 4M4ZA 4FSSA 1NLPC 1H92A 2KT1A 2YDLA 1Z9QA 2J6OA 2DL8A 1T3LA 2EYZA 4LE9A 4GBQA 2RQUA 3VS6A 2C0TA 2JTEA 3VS7A 4KRTA 2K7AA 1AEYA 2O9VA 1GBQA 4GLMA 1V1CA 4F17A 4J9DA 1GFCA 2LJ3A 4ESRA 2V1QA 1U5SA 3M0UA 2DL3A 2F2XA 1KIKA 4JJDA 1ZLMA 5EC7A 2L3PA 3EG1A 2LCSA 2LP5A 2L2PA 1WX6A 1UGVA 1RI9A 4AFSC 1UHFA 4QT7A 4AG2C 2SEMA 4OMQA 2K79A 2ENMA 1G2BA 3EG2A 1SRMA 2D8JA 2G6FX 2ED1A 2F2WA 3VS0A 1NYGA 4AG1C 2DX1A 1S1NA 2FRYA 1CSKA 1GBRA 1RLPC 2C0OA 4RTVA 1GL5A 1PKTA 5IHKA 3I9QA 1SPKA 3A98A 1AZGB 2CDTA 2OAWA 4RUGA 1WIEA 3NPFA 1OPKA 4RTYA 1T0HA 4Y92A 2DBMA 1SHGA 1PKSA 2MIOA 2LZ6B 1K76A 1UECA 1JU5C 3ULRB 1WDXA 5FW9A 1HSQA 5IHIA 2QDLA 1QWFA 1ZUYA 4HVUA 1ABQA 1YWOA 1SRLA 1TG0A 1AWXA 1I1JA 1VYTA 1NLOC 1HD3A 1X2QA 2DLPA 3FJ5A 2RQRA 1RLQC 2KYMA 2DILA 2AZSA 1B07A 1QKWA 1MV0B 2LJ1A 1UHCA 1U06A 2CH4A 1Y57A 2DM1A 4LUEA 1KFZA 2KEAA 1AWOA 1AD5A 1VA7A 2A08A 2FPFA 4Z8AA 3VS5A 1ZSGA 1UJYA 2FRWA 2YUOA 1AZEA 3VRZA 2J6KA 1X27A 1KSWA 2GQIA 1VYUA 2YUPA 3I35A 3M0PA 2GGRA 1JEGA 1GCQA 1GCPA 2AKKA 4J9IA 2EBPA 2RN8A 4J9CA 3GBQA 4J9BA 5IXFA 1BBZA 2LJ0A 1WA7A 4IIOA 4LNPA 1M8MA 5HCKA 2V1RA 1FYNA 4JPBW 4CC4B 3VRYA 5L23A 2KXDA 2L0AA 2DRKA 3QWXX 5IHNA 2J7IA 2FPDA 4RTWA 3H41A 2YUNA 1PHTA 1ZBJA 1QWEA 4JJBA 1MV3A 3NMZC 3UATA 4OMMA 2GNCA 2NUZA 2RQTA 1G83A 1ZX6A 2OJ2A 3QWYA 3M0RA 1X43A 4RTZA 1W1FA 1K0XA 4X1VA 2DYBA 1M3BA 4CC2A 1B3QA 4CC7A 2J06A 2EKHA 1UUEA 2K6DA 1U3OA 4LN2A 1ABOA 4DEYA 2DBKA 2NWMA 2VKNA 3VS2A 2DVJA 1YN8A 2EYYA 2GTOA 4E6RA 1ZUKA 4HXJA 2PNIA 2K3BA 2DMOA 2CUDA 1NG2A 4OMLA 2CREA 2M51A 3UF4A 1PWTA 1QLYA 2KRNA 2W10A 3SEMA 2CSIA 2BTTA 4ZNXA 3M0TA 1GCQC 1IO6A 4RTXA 3M0QA 2FPEA 2C0IA 2VWFA 5I11A 3TVTA 2H8HA 1UG1A 2O88A 1ARKA 1X69A 2JMCA 1CKBA 1H3HA 1LCKA 2RMOA 1GRIA 2HEQA 2ED0A 1OEBA 1UE9A 4DEXA 2EGAA 4Z89A 2PTKA 3H0HA 1NM7A 2FG0A 2AZVA 2D1XA 2GTJA 2ROTA 2HCKA 2OI3A 2JM9A 1KJWA 1A0NB 2LX7A 2DA9A 1YCSB 2X3WD 1Z9ZA 3EG3A 1N5ZA 1PRLC 1I0CA 2KBTA 1NYFA 1AVZC 3PVLA 4F14A 1XOVA 4LUDA 1ZUUA 2CSQA 2EVRA 2RQWA 4AFZC 3PE0A 2RQVA 3JV3A 2BZXA 4OMOA 3H0FA 4ORZA 1M3CA 2EQIA 3NGPA 1TUDA 2IIMA 2DJQA 2YUQA 3ZL7C 4J9FA 2EGEA 2EPDA 1H8KA 2I0NA 5GJVB 2A28A 3TSZA 1UJ0A 4HVVA 2KYBA 4A63B 2DNUA 2RF0A 4J9EA 3NHNA 4Z88A 2KNBB 1UFFA 3VS1A 2O9SA 1JQQA 2PZ1A 2KGTA 2JM8A 2VVKA 4AFUC 3TSWA 2YT6A 1WI7A 2K2MA 2HSPA 4F16A 4K11A 3THKA 1QKXA 2ECZA 3U23A 1AWWA 2KT8A 4R0KA 1WXTA 1BK2A 1SSHA 1JXMA 4D8DA 3RNJA 5I22A 1UTIA 1X2KA 3O5ZA 1W70A 1VYVA 2B86A 2O31A 2K9GA 1K1ZA 2AKLA 2JT4A 2JW4A 3REAB 2JMAA 2J05A 2ROLA 2LMJA 2KRSA 1JO8A 2EGCA 4AFQC 3EGUA 2JS2A 2JS0A 2J6FA 2FO0A 4RTTA 1WLPB 2CT4A 1NEBA 1JXOA 3EG0A 5IH2A 1OPLA 2KR3A 1NEGA 1OV3A 2BZYA 4RTUA 2P4RA 5GJWB 2CUBA 1X6BA 3C0CA 3EHQA 1K4US 2XMFA 2JXBA 1SEMA 3KFVA 3LH5A 1YP5A 4WCIA 1YWPA 2DL7A 3RBBB 1TUCA 1BB9A 2SRCA 2HDAA 3SHWA 3REBB 2O2OA 1MUZA 1WFWA 1WXUA 1QCFA 2GBQA 1J3TA 2KXCA 1I07A 1GFDA 2D8HA 3I5SA 2DF6A 2MCNA 3CQTA 2LQWA 1M30A 1WXBA 2W0ZA 2L3QA 4JZ4A 2LNHB 4IIMA 1FMKA 2M0YA 3IQLA 1OOTA 1T3SA 3PVQA 2BZ8A 2A36A 2D0NA 3UA6A 4CC3A 2A37A 1SHFA 2MOXA 4J9HA 1E6GA 1PNJA 2DL4A 5FWCA 2DRMA 2ESWA 1CKAA 2YSQA 4OMPA 3UA7A 4J9GA 2DE0X 2RPNA 4HCKA 1K0SA 1K9AA 2KRMA 1AOJA 1BU1A 1HJDA 1X6GA 3R6NA 4OMNA 1T0JA 4HVWA 3VS3A 2KE9A 5IXBA 1UDLA 2AK5A 1E6HA 1PRMC 1RUWA
chains in the Genus database with same CATH superfamily
5GANe 3GLXA 1QW1A 8AT1B 3FDRA 4PJOE 1PC0A 5FWBA 1WHKA 1YI2T 3SB2A 3C4SA 4HA8A 5IAYA 4JJCA 1E7OA 4D8KA 4LD6A 1D1AA 1YNZA 2EW3A 1R8OB 5GANd 2RNAA 3EHRA 1EFNA 1MMDA 4RKUE 4QVCA 2RH2A 1VQ8T 4DQ2A 3JCMd 1NLPC 2K3YA 1H92A 3M53A 3LH0A 5LJ3f 2DD4A 2YDLA 1Z9QA 4FU6A 4LE9A 1IZ6A 2RQUA 4M7DF 4M78B 3M4GA 4Y28E 3VS7A 3VU3C 1OX8A 4KRTA 2O9VA 1GBQA 3WVDB 2JJ9A 2YRVA 2LJ3A 3ASKA 3V7SA 2V1QA 1YITQ 4P5NA 1KQSA 2XDPA 4C0DB 1VQOT 2F2XA 1K9MU 1OZ2A 5EC7A 2XK0A 2HKQB 1OZ3A 4HCZA 2L3PA 4PJLA 3HRTA 5CCAA 1OQKA 1VQPQ 4OF1A 4BE0A 4IUQA 1SSFA 3L1AA 1VQ4A 4AMCA 1NZ9A 2SEMA 2EIFA 3Q1JA 1OU9A 1M8VA 2D8JA 1OI1A 1H641 3RR6A 1CSKA 1GBRA 3PMIA 1NPPA 3OSSC 3JCMJ 5KYWB 1SPKA 3JRZA 2CDTA 2OAWA 4RUGA 1WIEA 1OPKA 1YITA 2DBMA 2DIGA 3OMGA 1VQKA 2LZ6B 1QQJA 1WDXA 5FW9A 3JB9G 1YBYA 3CXCP 2E1HA 4HVUA 1XQHA 1VQ7T 4M7AC 2B8AA 5I2SA 3OYGA 4C92A 1UGRB 4E2FB 2CP6A 3FJ5A 1OULA 1Y7XA 3QUIA 2AZSA 1V76A 1B07A 1YJ9A 4BD3A 4M78G 2DM1A 2VC8A 4J7FA 3A8GB 1VA7A 3VS5A 2RHYA 5FU7C 3DLLA 4C8QA 4L5GA 3MPUB 2AIRB 2FRWA 2RM4A 1AZEA 5A0LA 5CAIA 1U1TA 2J6KA 3DB3A 4KGZB 3I35A 1GCQA 4KUIA 1ZSZA 1VQNT 1Q86R 4J9CA 1BCOA 4J9BA 2HQHA 4ME7A 1WA7A 4IIOA 1YJNA 2KVQG 2V1RA 4DBQA 2VXEA 1VQNA 5L23A 3H9NA 1RAIB 2Y4XA 1LVKA 1UB4A 2J7IA 4RCCA 2FPDA 4RTWA 1RADB 3MP6A 1MV3A 2PU9B 2DERA 1BCMA 4OMMA 2NUZA 4BE2A 2P0KA 3CXCS 5DLQE 3HL8A 4RTZA 3OYAA 4X1VA 3C12A 4E7LA 1N9SA 2V8KA 4CC2A 1B3QA 3HPWA 3LLRA 2RJEA 4CC7A 2OTLA 2DBKA 2NWMA 1WHHA 1RAHB 2EYYA 3OY9A 2DFUA 1VQNQ 4C92D 2BE9B 3OYIA 3HKSA 2EAYA 2KRNA 5FROA 1WHJA 1WHMA 3F70A 3QZ9B 4N0AC 2YRDA 3OS1A 3OYNA 4RTXA 1QVFA 3M0QA 4PL6A 5HKCA 2DD5A 3KUFA 2C0IA 2VWFA 2QG9B 3TVTA 4FYXB 4C8QC 4PKCC 2HZYA 2O88A 2CP0A 3L2WA 1LCKA 2RMOA 3DLMA 3E2UA 3RDVA 2ED0A 2YXYA 3L2RA 1OEBA 4Z89A 3H0HA 2FG0A 4M77A 3L42A 3CCSA 1VQKQ 4BI3A 4QVDA 1JJ2S 2QA4T 2JM9A 5LJ3j 2LX7A 3OYLA 4XU3A 3EG3A 2O4XB 1PRLC 1KD1U 3PTAA 1NYFA 4F14A 2WSFE 1XOVA 4LUDA 3G6EA 1GXIE 2F1LA 4KULA 4BUGA 3G4SA 2RQVA 2BZXA 2X4JA 4JLGA 2KQWA 4ORZA 4BB7A 4OMFB 2RD1A 3JB9F 3NGPA 2AT1B 4L59A 2IIMA 2EGEA 2EPDA 3OYBA 4M7AD 5GJVB 1VQPA 3G6ET 2CP3A 5LL6S 3RESA 1WQWA 1JQQA 2O9SA 2JM8A 2FZGB 1WI7A 3VYHB 2LQ8A 4F16A 1U8RA 2FYKA 3WVEB 3U23A 4J5YA 2QGFB 2KT8A 4FCYA 2DEQA 5AYFA 4E47A 1JXMA 4D8DA 4ZGEB 1C6VX 3CEYA 2RA2A 3QHSA 2EJFA 3M59A 1IHVA 1MHNA 3NTIA 3OYMA 5GAOm 2JW4A 4X9DA 2XG8D 2OTJQ 3REAB 2J05A 5CKHA 2ROLA 4O5VA 1EX4A 2DZ9A 1YI2Q 2XD0A 1JO8A 4PFZA 3OBWA 4C5HA 4C5IA 2NUTA 2JS0A 2J6FA 1XJWB 1M90C 3GF5A 2OTJA 1JXOA 4M78D 4FYVB 1NEGA 4IUTA 2BZYA 5GJWB 2CUBA 4OP0A 3M58A 2RHUA 3C0CA 3EHQA 1K4US 2R5AA 2XMFA 4Q5WA 5A2QE 2JXBA 1SEMA 1G5VA 1LNXA 3A8LB 3HFNA 4BDZA 1TUCA 3OYCA 2SRCA 2HDAA 2MWOA 4NL2A 3RKXA 2GFAA 1KHIA 1QCFA 2QTVA 4J6WA 3C95A 5HK0A 1J3TA 3V7RA 2XKOC 3I5SA 1YIJQ 3ZEHA 2LQWA 3J80E 1M4ZA 4N4GA 2E12A 5AT1B 1M1KU 3GOXA 4ATOA 3E19A 4M75F 2VUBA 4MZPA 1FMKA 2X4XA 3RIRA 2X35A 3IQLA 2X51A 1RACB 2EJGA 2F5KA 1BIBA 1N6AA 5CKEA 1PNJA 3G1JA 3PGGA 4XTZA 3MJXA 5FWCA 2DRMA 2ESWA 3QBYA 1TUGB 4J9GA 2RPNA 1QVGP 4HCKA 1K9MC 4PJOB 5LJ5f 3SD4A 2LT1A 2VB6A 4C8QF 1G3YA 2RK2A 3R6NA 4HVWA 3M54A 1PCXA 1EIFA 3C94A 1D0ZA 1PRMC 3EG9B 3X28B 5GANh 3E9GA 2E65A 2DAQA 1W2BP 4KH0B 1VUBA 1Y71A 2F2VA 4PJNA 1BI1A 2CT3A 1H3ZA 1S72Q 2V8IA 2ABLA 2V8JA 2KROA 1G3WA 1KQSP 3I5RA 2BIVA 4N4HA 3GNFB 3O8VA 3M5AA 4ZN1A 3CXCA 1TXQA 2K5IA 1D1CA 1BKBA 3H0IA 4M7DA 2YRCA 2EYXA 2VGMA 4PK4A 5D6WA 2CH4W 4ELYC 3JB9H 4F7UB 1XTDA 3CPWA 1BIAA 4OB3B 2YWWA 3EFOB 1T3LA 2EYZA 5GAN7 3VS6A 5A0DA 2C0TA 3GIBA 1R77A 3T9NA 3CD6T 4CRIA 1AEYA 2DTOA 4J9DA 1I5LA 3I56Q 5D7UA 2DL3A 2GF7A 4JJNK 1WZOA 1RI9A 4J8OA 3RKWA 4AFSC 1UHFA 3FLGA 4QT7A 4N4IA 2EQJA 2K79A 3SWNB 3JCMP 2ENMA 1G2BA 2RB6A 3EG2A 2QDYB 2ZPHB 3ZBDA 3VS0A 3CMET 4QKUA 2FRYA 1BI2A 2C0OA 1WGSA 4RTVA 5KCOA 5IHKA 5GAN6 2EJ9A 2QEXA 3QSUA 3CCVA 5HK3A 3A98A 2FVUA 1QP3A 3PMTA 4RTYA 4C8QD 1HSQA 5IHIA 4XU1A 3CCUA 1QWFA 2FZCB 1ABQA 1YWOA 1HXDA 3X26B 4D6WA 2ZPGB 1NLOC 1X2QA 1YI2A 2XICA 3CC2T 1RLQC 1YHQA 1QKWA 1UHCA 1U06A 1B34A 1KFZA 3ME9A 3PNWC 1AWOA 2A08A 4HCCA 2KSSA 2QA4A 3TQ7P 2R57A 1UJYA 5M9OA 2YUOA 1X27A 2FHDA 3KBGA 2H3EB 2G3RA 2GQIA 1VYUA 2YUPA 3MCAB 2WSCE 2VASA 1JEGA 1ZBXA 2HQXA 2F5TX 2RN8A 1VQKT 3GBQA 3MP8A 1VQ7Q 4RG2A 2HBPA 3EGDA 3MHXA 5HCKA 2L3RA 4GY5A 4M7AB 1C1AA 2YLCA 1NJIR 5IHNA 3CCUQ 3OYJA 2DXCA 1M1KC 3H41A 3OYYA 1QWEA 4JJBA 5FU7B 1YJNQ 1IGQA 2LQKA 4IKFA 1VQLA 3UATA 4M78F 3HSBA 2KK4A 2GNCA 2LVMA 2RQTA 2OJ2A 3QWYA 3CBPA 4M77E 3OYEA 1VQ9A 1B7TA 3CCVT 1X43A 3P8HA 1W1FA 1K0XA 3A5ZB 2CS7A 1I4K1 2K6DA 4LN2A 2VKNA 1PSFA 1TSFA 2GTOA 1YN8A 3H8ZA 4AT1B 3META 1JJ2A 2PNIA 2K3BA 2CUDA 5LJ5e 2IVWA 4OMLA 1IGUA 4JRQA 4M7DD 1HYOA 2MYSA 5L8RE 4ZNXA 2BTTA 3EGXA 2Y4YA 2DXUA 2QQ9A 1KQ1A 3OYKA 2KMTA 2LT4A 3JCMW 3UT1A 5KYNA 4TVRA 2DIQA 1GRIA 2HEQA 3JB9D 2FB7A 3CCVQ 4WTOB 2ZPFB 3I56T 1SF9A 3RMQA 1XNIA 2D1XA 2ROTA 1D09B 5CQYA 5A0GA 2XU8A 1KJWA 2EFIA 2DA9A 2X3WD 4XTWA 1D0XA 1FX7A 2E4HA 1N5ZA 2DZCA 1ZSZC 1MMNA 4E7JA 3PVLA 2X4YA 3HHTB 2PUKB 1AHJB 1ZUUA 4J7IA 2FL7A 3PFSA 1NE8A 2ZPIB 5KYUA 4AFZC 5GAMf 4C8QG 4M77C 2OTLT 1VQ6Q 2EQIA 5KE2A 3L2ZA 1TUDA 1ZQ1A 2YUQA 4J9FA 3TREA 2QYZA 1N8RC 1KQSS 1H8KA 3EFRA 4PJJA 2RI5A 1M90R 1YITT 3TSZA 3G71T 4HVVA 2KYBA 1MMAA 2RF0A 1HK9A 3M4YA 3NHNA 1VQ4Q 1TH7A 1W2BS 1ACMB 2PZ1A 4ZGDB 1VQ4T 2VVKA 3TSWA 5FU6B 2CZ0B 3S3MA 4K11A 2RHZA 1QKXA 3PIOA 2PUOB 1WJSA 2EWNA 3QKJA 4MDXA 1WXTA 2RI2A 1PSEA 3KXTA 2C06A 4JLIA 5CKBA 2L89A 5GAMj 4A4GA 4C92F 3LGFA 1QVGS 3R6OA 3CC2Q 2P0PA 3O5ZA 1W70A 3CCJQ 4PFPA 3VJPA 3FRNA 1Q86C 1M90U 1YIJA 4O6JA 2JMAA 3QZ5B 2M1HA 2JTFA 2XDBA 4PJOF 4M77B 3UWNA 7AT1B 2KRSA 3N5BB 3EGUA 4RTTA 2ZGWA 1LJOA 2XI9A 2QTXA 2QXFA 3J81E 3EG0A 2QA4Q 2ATCB 2DYIA 3CC7T 4FT4A 1OV3A 2NYSA 4M75B 2RI3A 5J3BA 3LX7A 2DPPB 1G3TA 3VYGA 5KE3A 4WCIA 1YWPA 1BB9A 3BDLA 2OTJT 2O2OA 3QYGB 3L2QA 2GBQA 2BE7D 1GFDA 2HL3A 2D8HA 3OA6A 2MCNA 3CQTA 4RG8A 4KUDK 1Q82C 1M30A 1UGQB 1WXBA 4J83A 4BACA 2W0ZA 4DBFA 3INZA 1WQ7A 1MMGA 2NUTB 5EG2A 1Q81C 2M9UA 4M78A 2M0YA 1QP2A 1T3SA 3PVQA 4CC3A 2A37A 2COZA 1R0BG 2M02A 4JS5A 2H3JA 1SHFA 4C0ZA 2CZ7B 2MOXA 1LOJA 4FL6A 4EDUA 1MNDA 1S72T 2DL4A 5CR2A 4PJOD 1WHGA 1N8RR 4M7AA 3OYFA 1X01A 3GNGA 3UA7A 4QW2A 2LCCA 1RAFB 2KRMA 4JDSA 1P92A 1HJDA 2PVOB 1NJIC 1VQ6A 1S72A 1UDLA 4IURA 3CPWS 1W2BA 4QQ6A 5GAOn 4XU2A 1G3SA 4Y91A 1PG5B 2LQNA 1K73R 1VQOA 1M3AA 4X9CA 3PIPA 1JB0E 4XTXA 2MF2A 5ECAA 4B9WA 4JZ3A 3M0SA 5KYXB 2HKNA 2KY9A 5FLXE 1W6XA 1SKUB 2E41A 5LJ5g 2DL5A 3JAME 3P8BB 3WXMB 2E5KA 2L3SA 1M27C 4M4ZA 5I21A 1FWZA 4FSSA 2D9TA 1IB8A 2KT1A 2HSEB 4E7KA 2HAXA 2J6OA 2DL8A 2RJFA 3EH2A 3QDRB 4OB2B 5C6SA 2JTEA 5GMKe 3L2UA 2K7AA 5GAN8 4GLMA 3X20B 4QVZA 4BY6C 4F7UF 1WJQA 3M0UA 5J39A 4JJDA 1ZLMA 3MEUA 3CCUT 3JCMc 4OGEA 4PNOA 1UEBA 2LP5A 2L2PA 1WX6A 1UGVA 2IPOB 3CCEA 4A4EA 1YHQT 1D3BB 4HT9A 4OMQA 2QQAA 1SRMA 2QEXT 4JUVA 2ED1A 2F2WA 1NYGA 1S1NA 4KT0E 3P8DA 4FYWB 3G4ST 1GL5A 1PKTA 3V8KA 3H6ZA 2Y90A 4NL3A 3NPFA 1VQ5Q 4Y92A 4BY6B 1EZZB 1K76A 2CP2A 4DBHA 1Q86U 3ULRB 1JU5C 4FT2A 1M9SA 5GMKj 2QDLA 1ZUYA 2RHXA 2LCLA 4M7DE 1SRLA 1TG0A 1VYTA 2YLBA 1OX9A 2DLPA 4F7UA 1VQMA 2CP5A 2K57A 2DILA 3RMSA 3X25B 4C0FA 1K73U 1Y96A 1TS9A 2R5MA 1Q81R 2CH4A 4LUEA 5LJ3d 3JCMV 5GANf 2FPFA 3OW2S 2D0QB 5GAMe 4PFOA 2LDMA 3HTRA 4EPCA 1G8XA 5GAN4 5FU6C 3VRZA 1DJ7B 1X75C 2GGRA 4X34A 5GAOq 1RAEB 4J6YA 2EBPA 5D6YA 3JCMg 4M77G 1BBZA 5IN1A 1UGSB 1FYNA 4CC4B 1D3BA 2KXDA 2L0AA 2CP7A 2DRKA 1KG1A 3QWXX 3CCST 3JB9I 2QK0A 5GAMg 2YUNA 1PHTA 1Q81U 1ZBJA 4F7UE 4EMKC 1JBMA 5LJ5j 4C5GA 2P4TA 2L5QA 1ZHIA 2ZAEA 5CKDA 1G83A 1ZX6A 3CC4T 5KYYB 2I2LA 3M0RA 2K5FA 2CZ6B 2PQWA 1KD1C 3JCMQ 3RKYA 2GQVA 3G71Q 4M7AF 2EQKA 2LTOA 1M3BA 1LPLA 4GLKA 3S3OA 3G7ZA 4EMHA 4EMGA 5GAOr 3QXEB 2J06A 1UUEA 5KYXA 1U3OA 4DEYA 1F1BB 3ZFJA 3VS2A 2GFUA 5LJ3g 4QQDA 4E6RA 4HXJA 1WNLA 2DMOA 3ER0A 2F69A 4M7DB 4C92G 1PWTA 3HRSA 4ELZC 4LDWA 3SEMA 2CSIA 3M0TA 2QQSA 1GCQC 1KD1R 1IO6A 4XTVA 3CCJT 3CMEA 2HL5C 3A8OB 4XQ3A 1YJ9T 3UPUA 3HP9A 1X69A 2JMCA 1CKBA 1VQ5T 3MKDA 5FRMA 1H3HA 4LD9K 4ZN3A 4XTUA 2EGAA 3CMAQ 3RUXA 2AZVA 4C0DC 2GTJA 2DKGA 1K8AU 1M5Q1 2XDDA 2OI3A 4FW2A 4OB0B 3FIFA 1Z9ZA 4MMLA 4XU0A 4BDYA 3JCMX 1YJNT 2KBTA 2MK5A 1AVZC 1VQ9T 1V29B 2VV5A 1QVGA 1M2VA 4OMOA 3A8HB 3EAEA 3H0FA 1BI3A 2E5QA 3SDZA 4PLLA 1AT1B 2DJQA 2AHJB 3CCEQ 2A28A 1Q7YU 1UJ0A 5DLOA 4KBMB 2LNVA 4C92E 2E64A 2DNUA 4Z88A 1RI0A 2KNBB 3VS1A 4MMKA 2VYTA 4AFUC 4C92B 4A54A 4EMKB 4R0KA 1BK2A 2O01E 1SSHA 3EGXB 1WPYA 4M7AE 2JUFA 1X2KA 4E7IA 3CCMT 2B86A 3QJYA 2O31A 4E7HA 2AKLA 1VQLT 2KDSA 4HT8A 3MO8A 1Q7YR 1KC8C 2IG0A 5D6XA 2DK3A 3A8MB 2LMJA 2EGCA 5GAN5 2JS2A 2VXFA 5GAN3 1M2OA 1WLPB 3LWHA 4M7DC 3M9QA 1NEBA 5IH2A 4VUBA 2XIDA 4M75D 1OPLA 2KR3A 2ZPEB 2P4RA 2HQEA 1X6BA 3EFOA 4LDVA 1M2VB 1N9RA 5LJ5h 2X4WA 3LH5A 3OS0A 1YP5A 1VQ7A 3GPLA 3MEAA 3SWNC 2COYA 3SHWA 1QMCA 3REBB 3CC4Q 3M56A 1WFWA 1WXUA 1KK7A 1TTHB 3OB9A 1K8AR 3FEOA 1PM3A 3URGA 1TU0B 6AT1B 2L3QA 4JZ4A 1VQLQ 4DA4A 2L8DA 2DXBA 1FMVA 5KYUB 1R0CB 5KH6A 1D0YA 1OOTA 2M16A 5CKFA 3OW2A 2BZ8A 2A36A 2JNGA 2QASA 1VQPT 3CCQT 1E6GA 1Q7YC 9ATCB 3CCRT 1YCYA 2MWPA 1BI0A 2NUPB 3CCRQ 1JJ2P 2DE0X 3EFSA 1PD1A 2WACA 1K9AA 2EQMA 3QIIA 1AOJA 4L6V5 5GAMd 2X9HA 1X6GA 3MEVA 3QDFA 1T0JA 4J6XA 3BDUA 2KE9A 2JTMA 1U1SA 1M1KR 3S3NA 1E6HA 4JS4A 5I2MA 1RUWA 3CD6A 2P0QA 4LDYA 1AWJA 1QCNA 4C8QE 2DTIA 1Y0MA 2HMAA 1WYXA 4EIKA 2COWA 3BFMA 2RO0A 2HBWA 2X3XD 3VS4A 3BY7A 5KYWA 1VIEA 1NPRA 2NUPA 3E1SA 4EMKA 2FEIA 5HY6A 3CCQQ 5CQXA 3FJPA 4PJMA 2EYWA 1RL2A 3CC2A 5DY9A 1VQ9Q 2K2VA 3LYIA 4XK8E 3TCJA 3I56A 2JVVA 5J26A 1WHLA 3AT1B 4GBQA 3I55A 4NOYA 3OSVA 3GP8A 4QQGA 1K73C 3CD6Q 3X24B 4M77F 2EKOA 4M78E 3MEWA 1V1CA 3QG1A 4F17A 1GFCA 1B34B 3OYDA 4ESRA 3JCMh 3G4SQ 1U5SA 1M1FA 4PJOG 3G6EQ 4B9XA 1MGQA 1KIKA 4FSXA 2FZKB 8ATCB 2DTHA 3EG1A 2LCSA 4A4KA 3JB9J 3BW1A 5GAMh 3CC7A 4XTYA 2RJCA 5GMKl 4AG2C 5GAN2 1VQ6T 2G6FX 2JZ2A 2MI6A 3CMEQ 4N0AA 2JN0A 5CIUA 4MZTA 1W4SA 2Z0WA 2DX1A 4AG1C 4R55A 4M78C 4KH1B 1RLPC 2BKDN 4JRPA 2MAMA 2ZCFB 1MNEA 3I9QA 4FIBA 3S6WA 4II1A 1AZGB 5CVIA 1D1BA 4XAXB 1T0HA 4BI4A 1SHGA 1PKSA 2MIOA 4BE1A 1UECA 5LJ3h 4M75G 3CBOA 2KI7A 3OYHA 1AWXA 1I1JA 1O75A 1QVPA 4F7UG 1HD3A 2BUDA 2RQRA 2KYMA 2RK1A 1VIFA 1MV0B 3MP1A 2LJ1A 1Y57A 3V7CA 1VQ8Q 2KEAA 4HKEA 3LW5E 1AD5A 4Z8AA 5GANg 3JSCA 5CK9A 1VQMQ 3LGLA 1ZSGA 4ZTFA 4ZTJA 2DO3A 3TEEA 1KSWA 2LC4A 3M0PA 1VQ8A 1GCPA 2AKKA 4J9IA 1FMWA 3QPHA 5IXFA 4B6MA 2LJ0A 1VQOQ 1VQ5A 2RJDA 3SWNA 4LNPA 2QAZA 1M8MA 3V8LA 4JPBW 3VRYA 2CGHA 2DVEA 3PT9A 3BE3A 2EYQA 3QJ6A 4YTLA 2NLUA 3JCMe 1K8AC 1Y96B 3NMZC 1O9SA 1YJWA 1YHQQ 1Q95G 5GMKi 2XHCA 4V2SA 4A4FA 3CCET 2EQUA 4FM4B 4LXCA 5FRNA 4E7ZA 4IUVA 1YJWQ 3AHUA 2DYBA 2MPXC 2VGNA 4R56A 2DEUA 3VUBA 4C8QB 2YHTA 2EKHA 4A53A 1SG5A 4RMOA 4HCBA 1ABOA 2ZZDA 1M1GA 2E10A 1NJIU 3OW2P 2K3XA 3V8JA 3A1PA 2DVJA 1ZUKA 4DOVA 2E70A 3E9FA 1NG2A 1OU8A 2CREA 2M51A 3UF4A 3LWIA 4DOWA 1QLYA 4IUUA 4PLIA 3CCMQ 2W10A 1BYMA 4PJOA 3QYHB 1TOVA 3I55T 5GAOp 2FPEA 2GCXA 2R58A 4FYYB 5I11A 4Z02A 3EGDB 2H8HA 1UG1A 2JOYA 4OGCA 3CPWP 4BI8B 4M7AG 5LJ3e 1ARKA 3OQ5A 3G71A 4KGVB 1KQ2A 2E3HA 4ANJA 4MZMA 1UE9A 4DEXA 2PTKA 3VV0A 1NM7A 5GMKm 1ZA2B 1YJWT 4E7SA 2RHIA 2DJZA 1KC8U 2LRQA 2HCKA 4C92C 5DM7R 3J7AF 1UGPB 1A0NB 4F04B 3CPFA 1YCSB 2V26A 2M0OA 3VKIA 4DBRA 3CMAA 1RAAB 1I0CA 2CKKA 3CCMA 2PVDB 4IUPA 5KYYA 1QVFS 1VOMA 2EVRA 2CSQA 3CCJA 5IT9E 2RQWA 1VQMT 3PE0A 3M55A 3JV3A 4M75A 2QQBA 4C5EA 3RERA 5C0MA 1M3CA 1YIJT 2HNIA 3OS2A 1C0MA 5GANj 3ZL7C 3CMAT 3UDCA 2I0NA 2ZPBB 4OB1B 3TU4K 3HFOA 1RABB 3JCMb 4WF2A 3CC7Q 1RAGB 4A63B 1KC8R 4LDXA 4J9EA 3DKMA 1UFFA 2KGTA 3OMCA 2YT6A 2LX9A 2K2MA 3OS5A 2HSPA 3THKA 2O4XA 2ECZA 1AWWA 4A4HA 2QI2A 4JRKA 4LDUA 3NTKA 3OBYA 1OYXA 3RNJA 5I22A 3CCQA 5KCHA 1UTIA 3CCLQ 3QO3A 1IRXA 2QEXQ 1KHCA 3CC4A 1VYVA 2K9GA 1K1ZA 2E6NA 1ZA1B 1NBEB 2JT4A 3D7SB 1YJ9Q 5LJ5d 1IHWA 4AFQC 2QGGA 2D6FA 1X6OA 2K4YA 1N27A 2FO0A 1I5OB 1Y07A 2CT4A 1QCOA 4NS5A 1YFNA 3M57A 5GAOl 4RTUA 3NFCA 3EG9A 4CI0C 3SFMA 3CCRA 1Q82R 3KFVA 2KAFA 2DL7A 1N8RU 3RBBB 3CCLA 4PJOC 3FC3A 1MUZA 3JCMf 1K9MR 1TWBA 4C0GA 2CZ1B 2DETA 1IXDA 1WJRA 2KXCA 2A0FB 1I07A 3CCLT 2DF6A 3NTHA 3CBMA 4M75E 2PVGB 2A3LA 2E6ZA 4OVAA 4M7DG 2LNHB 4IIMA 1QVFP 2MMPA 4RCBA 3VUZA 3CCSQ 1I81A 3UA6A 1JRIA 2D0NA 5GMKh 1ZSZB 1Q82U 1PD0A 4ZGJB 4J9HA 2OAUA 3HRUA 2P84A 3FB9A 3DB4A 1CKAA 1IREB 1FXXA 2YSQA 2CYZB 4OMPA 3L2VA 2OTLQ 4MDWA 2HD0A 4FW1A 1K0SA 1BU1A 2DXTA 1I8FA 2OX7A 4OMNA 2QQRA 4M75C 3VS3A 2E3IA 3I55Q 2A7YA 2K5LA 4UC4A 4KGXB 5IXBA 3EH1A 4JRIA 2AK5A 4M77D 2WSEE 5CO7A
chains in the Genus database with same CATH topology
1AWJA 2LQNA 2F2VA 2CT3A 5FWBA 1M3AA 1Y0MA 2ABLA 2KROA 1WYXA 4JJCA 1E7OA 4D8KA 4EIKA 1YNZA 3I5RA 5ECAA 2EW3A 4JZ3A 3M0SA 2HBWA 2X3XD 2RNAA 3EHRA 1EFNA 1W6XA 3VS4A 3H0IA 2DL5A 2EYXA 2FEIA 2CH4W 2E5KA 2L3SA 2EYWA 1M27C 4M4ZA 4FSSA 1NLPC 1H92A 2KT1A 2YDLA 1Z9QA 2J6OA 2DL8A 1T3LA 2EYZA 4LE9A 4GBQA 2RQUA 3VS6A 2C0TA 2JTEA 3VS7A 4KRTA 2K7AA 1AEYA 2O9VA 1GBQA 4GLMA 1V1CA 4F17A 4J9DA 1GFCA 2LJ3A 4ESRA 2V1QA 1U5SA 3M0UA 2DL3A 2F2XA 1KIKA 4JJDA 1ZLMA 5EC7A 2L3PA 3EG1A 2LCSA 2LP5A 2L2PA 1WX6A 1UGVA 1RI9A 4AFSC 1UHFA 4QT7A 4AG2C 2SEMA 4OMQA 2K79A 2ENMA 1G2BA 3EG2A 1SRMA 2D8JA 2G6FX 2ED1A 2F2WA 3VS0A 1NYGA 4AG1C 2DX1A 1S1NA 2FRYA 1CSKA 1GBRA 1RLPC 2C0OA 4RTVA 1GL5A 1PKTA 5IHKA 3I9QA 1SPKA 3A98A 1AZGB 2CDTA 2OAWA 4RUGA 1WIEA 3NPFA 1OPKA 4RTYA 1T0HA 4Y92A 2DBMA 1SHGA 1PKSA 2MIOA 2LZ6B 1K76A 1UECA 1JU5C 3ULRB 1WDXA 5FW9A 1HSQA 5IHIA 2QDLA 1QWFA 1ZUYA 4HVUA 1ABQA 1YWOA 1SRLA 1TG0A 1AWXA 1I1JA 1VYTA 1NLOC 1HD3A 1X2QA 2DLPA 3FJ5A 2RQRA 1RLQC 2KYMA 2DILA 2AZSA 1B07A 1QKWA 1MV0B 2LJ1A 1UHCA 1U06A 2CH4A 1Y57A 2DM1A 4LUEA 1KFZA 2KEAA 1AWOA 1AD5A 1VA7A 2A08A 2FPFA 4Z8AA 3VS5A 1ZSGA 1UJYA 2FRWA 2YUOA 1AZEA 3VRZA 2J6KA 1X27A 1KSWA 2GQIA 1VYUA 2YUPA 3I35A 3M0PA 2GGRA 1JEGA 1GCQA 1GCPA 2AKKA 4J9IA 2EBPA 2RN8A 4J9CA 3GBQA 4J9BA 5IXFA 1BBZA 2LJ0A 1WA7A 4IIOA 4LNPA 1M8MA 5HCKA 2V1RA 1FYNA 4JPBW 4CC4B 3VRYA 5L23A 2KXDA 2L0AA 2DRKA 3QWXX 5IHNA 2J7IA 2FPDA 4RTWA 3H41A 2YUNA 1PHTA 1ZBJA 1QWEA 4JJBA 1MV3A 3NMZC 3UATA 4OMMA 2GNCA 2NUZA 2RQTA 1G83A 1ZX6A 2OJ2A 3QWYA 3M0RA 1X43A 4RTZA 1W1FA 1K0XA 4X1VA 2DYBA 1M3BA 4CC2A 1B3QA 4CC7A 2J06A 2EKHA 1UUEA 2K6DA 1U3OA 4LN2A 1ABOA 4DEYA 2DBKA 2NWMA 2VKNA 3VS2A 2DVJA 1YN8A 2EYYA 2GTOA 4E6RA 1ZUKA 4HXJA 2PNIA 2K3BA 2DMOA 2CUDA 1NG2A 4OMLA 2CREA 2M51A 3UF4A 1PWTA 1QLYA 2KRNA 2W10A 3SEMA 2CSIA 2BTTA 4ZNXA 3M0TA 1GCQC 1IO6A 4RTXA 3M0QA 2FPEA 2C0IA 2VWFA 5I11A 3TVTA 2H8HA 1UG1A 2O88A 1ARKA 1X69A 2JMCA 1CKBA 1H3HA 1LCKA 2RMOA 1GRIA 2HEQA 2ED0A 1OEBA 1UE9A 4DEXA 2EGAA 4Z89A 2PTKA 3H0HA 1NM7A 2FG0A 2AZVA 2D1XA 2GTJA 2ROTA 2HCKA 2OI3A 2JM9A 1KJWA 1A0NB 2LX7A 2DA9A 1YCSB 2X3WD 1Z9ZA 3EG3A 1N5ZA 1PRLC 1I0CA 2KBTA 1NYFA 1AVZC 3PVLA 4F14A 1XOVA 4LUDA 1ZUUA 2CSQA 2EVRA 2RQWA 4AFZC 3PE0A 2RQVA 3JV3A 2BZXA 4OMOA 3H0FA 4ORZA 1M3CA 2EQIA 3NGPA 1TUDA 2IIMA 2DJQA 2YUQA 3ZL7C 4J9FA 2EGEA 2EPDA 1H8KA 2I0NA 5GJVB 2A28A 3TSZA 1UJ0A 4HVVA 2KYBA 4A63B 2DNUA 2RF0A 4J9EA 3NHNA 4Z88A 2KNBB 1UFFA 3VS1A 2O9SA 1JQQA 2PZ1A 2KGTA 2JM8A 2VVKA 4AFUC 3TSWA 2YT6A 1WI7A 2K2MA 2HSPA 4F16A 4K11A 3THKA 1QKXA 2ECZA 3U23A 1AWWA 2KT8A 4R0KA 1WXTA 1BK2A 1SSHA 1JXMA 4D8DA 3RNJA 5I22A 1UTIA 1X2KA 3O5ZA 1W70A 1VYVA 2B86A 2O31A 2K9GA 1K1ZA 2AKLA 2JT4A 2JW4A 3REAB 2JMAA 2J05A 2ROLA 2LMJA 2KRSA 1JO8A 2EGCA 4AFQC 3EGUA 2JS2A 2JS0A 2J6FA 2FO0A 4RTTA 1WLPB 2CT4A 1NEBA 1JXOA 3EG0A 5IH2A 1OPLA 2KR3A 1NEGA 1OV3A 2BZYA 4RTUA 2P4RA 5GJWB 2CUBA 1X6BA 3C0CA 3EHQA 1K4US 2XMFA 2JXBA 1SEMA 3KFVA 3LH5A 1YP5A 4WCIA 1YWPA 2DL7A 3RBBB 1TUCA 1BB9A 2SRCA 2HDAA 3SHWA 3REBB 2O2OA 1MUZA 1WFWA 1WXUA 1QCFA 2GBQA 1J3TA 2KXCA 1I07A 1GFDA 2D8HA 3I5SA 2DF6A 2MCNA 3CQTA 2LQWA 1M30A 1WXBA 2W0ZA 2L3QA 4JZ4A 2LNHB 4IIMA 1FMKA 2M0YA 3IQLA 1OOTA 1T3SA 3PVQA 2BZ8A 2A36A 2D0NA 3UA6A 4CC3A 2A37A 1SHFA 2MOXA 4J9HA 1E6GA 1PNJA 2DL4A 5FWCA 2DRMA 2ESWA 1CKAA 2YSQA 4OMPA 3UA7A 4J9GA 2DE0X 2RPNA 4HCKA 1K0SA 1K9AA 2KRMA 1AOJA 1BU1A 1HJDA 1X6GA 3R6NA 4OMNA 1T0JA 4HVWA 3VS3A 2KE9A 5IXBA 1UDLA 2AK5A 1E6HA 1PRMC 1RUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWJ A;  2LQN A;  2F2V A;  2CT3 A;  5FWB A;  1M3A A;  1Y0M A;  2ABL A;  2KRO A;  1WYX A;  4JJC A;  1E7O A;  4D8K A;  4EIK A;  1YNZ A;  3I5R A;  5ECA A;  2EW3 A;  4JZ3 A;  3M0S A;  2HBW A;  2X3X D;  2RNA A;  3EHR A;  1EFN A;  1W6X A;  3VS4 A;  3H0I A;  2DL5 A;  2EYX A;  2FEI A;  2CH4 W;  2E5K A;  2L3S A;  2EYW A;  1M27 C;  4M4Z A;  4FSS A;  1NLP C;  1H92 A;  2KT1 A;  2YDL A;  1Z9Q A;  2J6O A;  2DL8 A;  1T3L A;  2EYZ A;  4LE9 A;  4GBQ A;  2RQU A;  3VS6 A;  2C0T A;  2JTE A;  3VS7 A;  4KRT A;  2K7A A;  1AEY A;  2O9V A;  1GBQ A;  4GLM A;  1V1C A;  4F17 A;  4J9D A;  1GFC A;  2LJ3 A;  4ESR A;  2V1Q A;  1U5S A;  3M0U A;  2DL3 A;  2F2X A;  1KIK A;  4JJD A;  1ZLM A;  5EC7 A;  2L3P A;  3EG1 A;  2LCS A;  2LP5 A;  2L2P A;  1WX6 A;  1UGV A;  1RI9 A;  4AFS C;  1UHF A;  4QT7 A;  4AG2 C;  2SEM A;  4OMQ A;  2K79 A;  2ENM A;  1G2B A;  3EG2 A;  1SRM A;  2D8J A;  2G6F X;  2ED1 A;  2F2W A;  3VS0 A;  1NYG A;  4AG1 C;  2DX1 A;  1S1N A;  2FRY A;  1CSK A;  1GBR A;  1RLP C;  2C0O A;  4RTV A;  1GL5 A;  1PKT A;  5IHK A;  3I9Q A;  1SPK A;  3A98 A;  1AZG B;  2CDT A;  2OAW A;  4RUG A;  1WIE A;  3NPF A;  1OPK A;  4RTY A;  1T0H A;  4Y92 A;  2DBM A;  1SHG A;  1PKS A;  2MIO A;  2LZ6 B;  1K76 A;  1UEC A;  1JU5 C;  3ULR B;  1WDX A;  5FW9 A;  1HSQ A;  5IHI A;  2QDL A;  1QWF A;  1ZUY A;  4HVU A;  1ABQ A;  1YWO A;  1SRL A;  1TG0 A;  1AWX A;  1I1J A;  1VYT A;  1NLO C;  1HD3 A;  1X2Q A;  2DLP A;  3FJ5 A;  2RQR A;  1RLQ C;  2KYM A;  2DIL A;  2AZS A;  1B07 A;  1QKW A;  1MV0 B;  2LJ1 A;  1UHC A;  1U06 A;  2CH4 A;  1Y57 A;  2DM1 A;  4LUE A;  1KFZ A;  2KEA A;  1AWO A;  1AD5 A;  1VA7 A;  2A08 A;  2FPF A;  4Z8A A;  3VS5 A;  1ZSG A;  1UJY A;  2FRW A;  2YUO A;  1AZE A;  3VRZ A;  2J6K A;  1X27 A;  1KSW A;  2GQI A;  1VYU A;  2YUP A;  3I35 A;  3M0P A;  2GGR A;  1JEG A;  1GCQ A;  1GCP A;  2AKK A;  4J9I A;  2EBP A;  2RN8 A;  4J9C A;  3GBQ A;  4J9B A;  5IXF A;  1BBZ A;  2LJ0 A;  1WA7 A;  4IIO A;  4LNP A;  1M8M A;  5HCK A;  2V1R A;  1FYN A;  4JPB W;  4CC4 B;  3VRY A;  5L23 A;  2KXD A;  2L0A A;  2DRK A;  3QWX X;  5IHN A;  2J7I A;  2FPD A;  4RTW A;  3H41 A;  2YUN A;  1PHT A;  1ZBJ A;  1QWE A;  4JJB A;  1MV3 A;  3NMZ C;  3UAT A;  4OMM A;  2GNC A;  2NUZ A;  2RQT A;  1G83 A;  1ZX6 A;  2OJ2 A;  3QWY A;  3M0R A;  1X43 A;  4RTZ A;  1W1F A;  1K0X A;  4X1V A;  2DYB A;  1M3B A;  4CC2 A;  1B3Q A;  4CC7 A;  2J06 A;  2EKH A;  1UUE A;  2K6D A;  1U3O A;  4LN2 A;  1ABO A;  4DEY A;  2DBK A;  2NWM A;  2VKN A;  3VS2 A;  2DVJ A;  1YN8 A;  2EYY A;  2GTO A;  4E6R A;  1ZUK A;  4HXJ A;  2PNI A;  2K3B A;  2DMO A;  2CUD A;  1NG2 A;  4OML A;  2CRE A;  2M51 A;  3UF4 A;  1PWT A;  1QLY A;  2KRN A;  2W10 A;  3SEM A;  2CSI A;  2BTT A;  4ZNX A;  3M0T A;  1GCQ C;  1IO6 A;  4RTX A;  3M0Q A;  2FPE A;  2C0I A;  2VWF A;  5I11 A;  3TVT A;  2H8H A;  1UG1 A;  2O88 A;  1ARK A;  1X69 A;  2JMC A;  1CKB A;  1H3H A;  1LCK A;  2RMO A;  1GRI A;  2HEQ A;  2ED0 A;  1OEB A;  1UE9 A;  4DEX A;  2EGA A;  4Z89 A;  2PTK A;  3H0H A;  1NM7 A;  2FG0 A;  2AZV A;  2D1X A;  2GTJ A;  2ROT A;  2HCK A;  2OI3 A;  2JM9 A;  1KJW A;  1A0N B;  2LX7 A;  2DA9 A;  1YCS B;  2X3W D;  1Z9Z A;  3EG3 A;  1N5Z A;  1PRL C;  1I0C A;  2KBT A;  1NYF A;  1AVZ C;  3PVL A;  4F14 A;  1XOV A;  4LUD A;  1ZUU A;  2CSQ A;  2EVR A;  2RQW A;  4AFZ C;  3PE0 A;  2RQV A;  3JV3 A;  2BZX A;  4OMO A;  3H0F A;  4ORZ A;  1M3C A;  2EQI A;  3NGP A;  1TUD A;  2IIM A;  2DJQ A;  2YUQ A;  3ZL7 C;  4J9F A;  2EGE A;  2EPD A;  1H8K A;  2I0N A;  5GJV B;  2A28 A;  3TSZ A;  1UJ0 A;  4HVV A;  2KYB A;  4A63 B;  2DNU A;  2RF0 A;  4J9E A;  3NHN A;  4Z88 A;  2KNB B;  1UFF A;  3VS1 A;  2O9S A;  1JQQ A;  2PZ1 A;  2KGT A;  2JM8 A;  2VVK A;  4AFU C;  3TSW A;  2YT6 A;  1WI7 A;  2K2M A;  2HSP A;  4F16 A;  4K11 A;  3THK A;  1QKX A;  2ECZ A;  3U23 A;  1AWW A;  2KT8 A;  4R0K A;  1WXT A;  1BK2 A;  1SSH A;  1JXM A;  4D8D A;  3RNJ A;  5I22 A;  1UTI A;  1X2K A;  3O5Z A;  1W70 A;  1VYV A;  2B86 A;  2O31 A;  2K9G A;  1K1Z A;  2AKL A;  2JT4 A;  2JW4 A;  3REA B;  2JMA A;  2J05 A;  2ROL A;  2LMJ A;  2KRS A;  1JO8 A;  2EGC A;  4AFQ C;  3EGU A;  2JS2 A;  2JS0 A;  2J6F A;  2FO0 A;  4RTT A;  1WLP B;  2CT4 A;  1NEB A;  1JXO A;  3EG0 A;  5IH2 A;  1OPL A;  2KR3 A;  1NEG A;  1OV3 A;  2BZY A;  4RTU A;  2P4R A;  5GJW B;  2CUB A;  1X6B A;  3C0C A;  3EHQ A;  1K4U S;  2XMF A;  2JXB A;  1SEM A;  3KFV A;  3LH5 A;  1YP5 A;  4WCI A;  1YWP A;  2DL7 A;  3RBB B;  1TUC A;  1BB9 A;  2SRC A;  2HDA A;  3SHW A;  3REB B;  2O2O A;  1MUZ A;  1WFW A;  1WXU A;  1QCF A;  2GBQ A;  1J3T A;  2KXC A;  1I07 A;  1GFD A;  2D8H A;  3I5S A;  2DF6 A;  2MCN A;  3CQT A;  2LQW A;  1M30 A;  1WXB A;  2W0Z A;  2L3Q A;  4JZ4 A;  2LNH B;  4IIM A;  1FMK A;  2M0Y A;  3IQL A;  1OOT A;  1T3S A;  3PVQ A;  2BZ8 A;  2A36 A;  2D0N A;  3UA6 A;  4CC3 A;  2A37 A;  1SHF A;  2MOX A;  4J9H A;  1E6G A;  1PNJ A;  2DL4 A;  5FWC A;  2DRM A;  2ESW A;  1CKA A;  2YSQ A;  4OMP A;  3UA7 A;  4J9G A;  2DE0 X;  2RPN A;  4HCK A;  1K0S A;  1K9A A;  2KRM A;  1AOJ A;  1BU1 A;  1HJD A;  1X6G A;  3R6N A;  4OMN A;  1T0J A;  4HVW A;  3VS3 A;  2KE9 A;  5IXB A;  1UDL A;  2AK5 A;  1E6H A;  1PRM C;  1RUW A; 
#chains in the Genus database with same CATH topology
 5GAN e;  3GLX A;  1QW1 A;  8AT1 B;  3FDR A;  4PJO E;  1PC0 A;  5FWB A;  1WHK A;  1YI2 T;  3SB2 A;  3C4S A;  4HA8 A;  5IAY A;  4JJC A;  1E7O A;  4D8K A;  4LD6 A;  1D1A A;  1YNZ A;  2EW3 A;  1R8O B;  5GAN d;  2RNA A;  3EHR A;  1EFN A;  1MMD A;  4RKU E;  4QVC A;  2RH2 A;  1VQ8 T;  4DQ2 A;  3JCM d;  1NLP C;  2K3Y A;  1H92 A;  3M53 A;  3LH0 A;  5LJ3 f;  2DD4 A;  2YDL A;  1Z9Q A;  4FU6 A;  4LE9 A;  1IZ6 A;  2RQU A;  4M7D F;  4M78 B;  3M4G A;  4Y28 E;  3VS7 A;  3VU3 C;  1OX8 A;  4KRT A;  2O9V A;  1GBQ A;  3WVD B;  2JJ9 A;  2YRV A;  2LJ3 A;  3ASK A;  3V7S A;  2V1Q A;  1YIT Q;  4P5N A;  1KQS A;  2XDP A;  4C0D B;  1VQO T;  2F2X A;  1K9M U;  1OZ2 A;  5EC7 A;  2XK0 A;  2HKQ B;  1OZ3 A;  4HCZ A;  2L3P A;  4PJL A;  3HRT A;  5CCA A;  1OQK A;  1VQP Q;  4OF1 A;  4BE0 A;  4IUQ A;  1SSF A;  3L1A A;  1VQ4 A;  4AMC A;  1NZ9 A;  2SEM A;  2EIF A;  3Q1J A;  1OU9 A;  1M8V A;  2D8J A;  1OI1 A;  1H64 1;  3RR6 A;  1CSK A;  1GBR A;  3PMI A;  1NPP A;  3OSS C;  3JCM J;  5KYW B;  1SPK A;  3JRZ A;  2CDT A;  2OAW A;  4RUG A;  1WIE A;  1OPK A;  1YIT A;  2DBM A;  2DIG A;  3OMG A;  1VQK A;  2LZ6 B;  1QQJ A;  1WDX A;  5FW9 A;  3JB9 G;  1YBY A;  3CXC P;  2E1H A;  4HVU A;  1XQH A;  1VQ7 T;  4M7A C;  2B8A A;  5I2S A;  3OYG A;  4C92 A;  1UGR B;  4E2F B;  2CP6 A;  3FJ5 A;  1OUL A;  1Y7X A;  3QUI A;  2AZS A;  1V76 A;  1B07 A;  1YJ9 A;  4BD3 A;  4M78 G;  2DM1 A;  2VC8 A;  4J7F A;  3A8G B;  1VA7 A;  3VS5 A;  2RHY A;  5FU7 C;  3DLL A;  4C8Q A;  4L5G A;  3MPU B;  2AIR B;  2FRW A;  2RM4 A;  1AZE A;  5A0L A;  5CAI A;  1U1T A;  2J6K A;  3DB3 A;  4KGZ B;  3I35 A;  1GCQ A;  4KUI A;  1ZSZ A;  1VQN T;  1Q86 R;  4J9C A;  1BCO A;  4J9B A;  2HQH A;  4ME7 A;  1WA7 A;  4IIO A;  1YJN A;  2KVQ G;  2V1R A;  4DBQ A;  2VXE A;  1VQN A;  5L23 A;  3H9N A;  1RAI B;  2Y4X A;  1LVK A;  1UB4 A;  2J7I A;  4RCC A;  2FPD A;  4RTW A;  1RAD B;  3MP6 A;  1MV3 A;  2PU9 B;  2DER A;  1BCM A;  4OMM A;  2NUZ A;  4BE2 A;  2P0K A;  3CXC S;  5DLQ E;  3HL8 A;  4RTZ A;  3OYA A;  4X1V A;  3C12 A;  4E7L A;  1N9S A;  2V8K A;  4CC2 A;  1B3Q A;  3HPW A;  3LLR A;  2RJE A;  4CC7 A;  2OTL A;  2DBK A;  2NWM A;  1WHH A;  1RAH B;  2EYY A;  3OY9 A;  2DFU A;  1VQN Q;  4C92 D;  2BE9 B;  3OYI A;  3HKS A;  2EAY A;  2KRN A;  5FRO A;  1WHJ A;  1WHM A;  3F70 A;  3QZ9 B;  4N0A C;  2YRD A;  3OS1 A;  3OYN A;  4RTX A;  1QVF A;  3M0Q A;  4PL6 A;  5HKC A;  2DD5 A;  3KUF A;  2C0I A;  2VWF A;  2QG9 B;  3TVT A;  4FYX B;  4C8Q C;  4PKC C;  2HZY A;  2O88 A;  2CP0 A;  3L2W A;  1LCK A;  2RMO A;  3DLM A;  3E2U A;  3RDV A;  2ED0 A;  2YXY A;  3L2R A;  1OEB A;  4Z89 A;  3H0H A;  2FG0 A;  4M77 A;  3L42 A;  3CCS A;  1VQK Q;  4BI3 A;  4QVD A;  1JJ2 S;  2QA4 T;  2JM9 A;  5LJ3 j;  2LX7 A;  3OYL A;  4XU3 A;  3EG3 A;  2O4X B;  1PRL C;  1KD1 U;  3PTA A;  1NYF A;  4F14 A;  2WSF E;  1XOV A;  4LUD A;  3G6E A;  1GXI E;  2F1L A;  4KUL A;  4BUG A;  3G4S A;  2RQV A;  2BZX A;  2X4J A;  4JLG A;  2KQW A;  4ORZ A;  4BB7 A;  4OMF B;  2RD1 A;  3JB9 F;  3NGP A;  2AT1 B;  4L59 A;  2IIM A;  2EGE A;  2EPD A;  3OYB A;  4M7A D;  5GJV B;  1VQP A;  3G6E T;  2CP3 A;  5LL6 S;  3RES A;  1WQW A;  1JQQ A;  2O9S A;  2JM8 A;  2FZG B;  1WI7 A;  3VYH B;  2LQ8 A;  4F16 A;  1U8R A;  2FYK A;  3WVE B;  3U23 A;  4J5Y A;  2QGF B;  2KT8 A;  4FCY A;  2DEQ A;  5AYF A;  4E47 A;  1JXM A;  4D8D A;  4ZGE B;  1C6V X;  3CEY A;  2RA2 A;  3QHS A;  2EJF A;  3M59 A;  1IHV A;  1MHN A;  3NTI A;  3OYM A;  5GAO m;  2JW4 A;  4X9D A;  2XG8 D;  2OTJ Q;  3REA B;  2J05 A;  5CKH A;  2ROL A;  4O5V A;  1EX4 A;  2DZ9 A;  1YI2 Q;  2XD0 A;  1JO8 A;  4PFZ A;  3OBW A;  4C5H A;  4C5I A;  2NUT A;  2JS0 A;  2J6F A;  1XJW B;  1M90 C;  3GF5 A;  2OTJ A;  1JXO A;  4M78 D;  4FYV B;  1NEG A;  4IUT A;  2BZY A;  5GJW B;  2CUB A;  4OP0 A;  3M58 A;  2RHU A;  3C0C A;  3EHQ A;  1K4U S;  2R5A A;  2XMF A;  4Q5W A;  5A2Q E;  2JXB A;  1SEM A;  1G5V A;  1LNX A;  3A8L B;  3HFN A;  4BDZ A;  1TUC A;  3OYC A;  2SRC A;  2HDA A;  2MWO A;  4NL2 A;  3RKX A;  2GFA A;  1KHI A;  1QCF A;  2QTV A;  4J6W A;  3C95 A;  5HK0 A;  1J3T A;  3V7R A;  2XKO C;  3I5S A;  1YIJ Q;  3ZEH A;  2LQW A;  3J80 E;  1M4Z A;  4N4G A;  2E12 A;  5AT1 B;  1M1K U;  3GOX A;  4ATO A;  3E19 A;  4M75 F;  2VUB A;  4MZP A;  1FMK A;  2X4X A;  3RIR A;  2X35 A;  3IQL A;  2X51 A;  1RAC B;  2EJG A;  2F5K A;  1BIB A;  1N6A A;  5CKE A;  1PNJ A;  3G1J A;  3PGG A;  4XTZ A;  3MJX A;  5FWC A;  2DRM A;  2ESW A;  3QBY A;  1TUG B;  4J9G A;  2RPN A;  1QVG P;  4HCK A;  1K9M C;  4PJO B;  5LJ5 f;  3SD4 A;  2LT1 A;  2VB6 A;  4C8Q F;  1G3Y A;  2RK2 A;  3R6N A;  4HVW A;  3M54 A;  1PCX A;  1EIF A;  3C94 A;  1D0Z A;  1PRM C;  3EG9 B;  3X28 B;  5GAN h;  3E9G A;  2E65 A;  2DAQ A;  1W2B P;  4KH0 B;  1VUB A;  1Y71 A;  2F2V A;  4PJN A;  1BI1 A;  2CT3 A;  1H3Z A;  1S72 Q;  2V8I A;  2ABL A;  2V8J A;  2KRO A;  1G3W A;  1KQS P;  3I5R A;  2BIV A;  4N4H A;  3GNF B;  3O8V A;  3M5A A;  4ZN1 A;  3CXC A;  1TXQ A;  2K5I A;  1D1C A;  1BKB A;  3H0I A;  4M7D A;  2YRC A;  2EYX A;  2VGM A;  4PK4 A;  5D6W A;  2CH4 W;  4ELY C;  3JB9 H;  4F7U B;  1XTD A;  3CPW A;  1BIA A;  4OB3 B;  2YWW A;  3EFO B;  1T3L A;  2EYZ A;  5GAN 7;  3VS6 A;  5A0D A;  2C0T A;  3GIB A;  1R77 A;  3T9N A;  3CD6 T;  4CRI A;  1AEY A;  2DTO A;  4J9D A;  1I5L A;  3I56 Q;  5D7U A;  2DL3 A;  2GF7 A;  4JJN K;  1WZO A;  1RI9 A;  4J8O A;  3RKW A;  4AFS C;  1UHF A;  3FLG A;  4QT7 A;  4N4I A;  2EQJ A;  2K79 A;  3SWN B;  3JCM P;  2ENM A;  1G2B A;  2RB6 A;  3EG2 A;  2QDY B;  2ZPH B;  3ZBD A;  3VS0 A;  3CME T;  4QKU A;  2FRY A;  1BI2 A;  2C0O A;  1WGS A;  4RTV A;  5KCO A;  5IHK A;  5GAN 6;  2EJ9 A;  2QEX A;  3QSU A;  3CCV A;  5HK3 A;  3A98 A;  2FVU A;  1QP3 A;  3PMT A;  4RTY A;  4C8Q D;  1HSQ A;  5IHI A;  4XU1 A;  3CCU A;  1QWF A;  2FZC B;  1ABQ A;  1YWO A;  1HXD A;  3X26 B;  4D6W A;  2ZPG B;  1NLO C;  1X2Q A;  1YI2 A;  2XIC A;  3CC2 T;  1RLQ C;  1YHQ A;  1QKW A;  1UHC A;  1U06 A;  1B34 A;  1KFZ A;  3ME9 A;  3PNW C;  1AWO A;  2A08 A;  4HCC A;  2KSS A;  2QA4 A;  3TQ7 P;  2R57 A;  1UJY A;  5M9O A;  2YUO A;  1X27 A;  2FHD A;  3KBG A;  2H3E B;  2G3R A;  2GQI A;  1VYU A;  2YUP A;  3MCA B;  2WSC E;  2VAS A;  1JEG A;  1ZBX A;  2HQX A;  2F5T X;  2RN8 A;  1VQK T;  3GBQ A;  3MP8 A;  1VQ7 Q;  4RG2 A;  2HBP A;  3EGD A;  3MHX A;  5HCK A;  2L3R A;  4GY5 A;  4M7A B;  1C1A A;  2YLC A;  1NJI R;  5IHN A;  3CCU Q;  3OYJ A;  2DXC A;  1M1K C;  3H41 A;  3OYY A;  1QWE A;  4JJB A;  5FU7 B;  1YJN Q;  1IGQ A;  2LQK A;  4IKF A;  1VQL A;  3UAT A;  4M78 F;  3HSB A;  2KK4 A;  2GNC A;  2LVM A;  2RQT A;  2OJ2 A;  3QWY A;  3CBP A;  4M77 E;  3OYE A;  1VQ9 A;  1B7T A;  3CCV T;  1X43 A;  3P8H A;  1W1F A;  1K0X A;  3A5Z B;  2CS7 A;  1I4K 1;  2K6D A;  4LN2 A;  2VKN A;  1PSF A;  1TSF A;  2GTO A;  1YN8 A;  3H8Z A;  4AT1 B;  3MET A;  1JJ2 A;  2PNI A;  2K3B A;  2CUD A;  5LJ5 e;  2IVW A;  4OML A;  1IGU A;  4JRQ A;  4M7D D;  1HYO A;  2MYS A;  5L8R E;  4ZNX A;  2BTT A;  3EGX A;  2Y4Y A;  2DXU A;  2QQ9 A;  1KQ1 A;  3OYK A;  2KMT A;  2LT4 A;  3JCM W;  3UT1 A;  5KYN A;  4TVR A;  2DIQ A;  1GRI A;  2HEQ A;  3JB9 D;  2FB7 A;  3CCV Q;  4WTO B;  2ZPF B;  3I56 T;  1SF9 A;  3RMQ A;  1XNI A;  2D1X A;  2ROT A;  1D09 B;  5CQY A;  5A0G A;  2XU8 A;  1KJW A;  2EFI A;  2DA9 A;  2X3W D;  4XTW A;  1D0X A;  1FX7 A;  2E4H A;  1N5Z A;  2DZC A;  1ZSZ C;  1MMN A;  4E7J A;  3PVL A;  2X4Y A;  3HHT B;  2PUK B;  1AHJ B;  1ZUU A;  4J7I A;  2FL7 A;  3PFS A;  1NE8 A;  2ZPI B;  5KYU A;  4AFZ C;  5GAM f;  4C8Q G;  4M77 C;  2OTL T;  1VQ6 Q;  2EQI A;  5KE2 A;  3L2Z A;  1TUD A;  1ZQ1 A;  2YUQ A;  4J9F A;  3TRE A;  2QYZ A;  1N8R C;  1KQS S;  1H8K A;  3EFR A;  4PJJ A;  2RI5 A;  1M90 R;  1YIT T;  3TSZ A;  3G71 T;  4HVV A;  2KYB A;  1MMA A;  2RF0 A;  1HK9 A;  3M4Y A;  3NHN A;  1VQ4 Q;  1TH7 A;  1W2B S;  1ACM B;  2PZ1 A;  4ZGD B;  1VQ4 T;  2VVK A;  3TSW A;  5FU6 B;  2CZ0 B;  3S3M A;  4K11 A;  2RHZ A;  1QKX A;  3PIO A;  2PUO B;  1WJS A;  2EWN A;  3QKJ A;  4MDX A;  1WXT A;  2RI2 A;  1PSE A;  3KXT A;  2C06 A;  4JLI A;  5CKB A;  2L89 A;  5GAM j;  4A4G A;  4C92 F;  3LGF A;  1QVG S;  3R6O A;  3CC2 Q;  2P0P A;  3O5Z A;  1W70 A;  3CCJ Q;  4PFP A;  3VJP A;  3FRN A;  1Q86 C;  1M90 U;  1YIJ A;  4O6J A;  2JMA A;  3QZ5 B;  2M1H A;  2JTF A;  2XDB A;  4PJO F;  4M77 B;  3UWN A;  7AT1 B;  2KRS A;  3N5B B;  3EGU A;  4RTT A;  2ZGW A;  1LJO A;  2XI9 A;  2QTX A;  2QXF A;  3J81 E;  3EG0 A;  2QA4 Q;  2ATC B;  2DYI A;  3CC7 T;  4FT4 A;  1OV3 A;  2NYS A;  4M75 B;  2RI3 A;  5J3B A;  3LX7 A;  2DPP B;  1G3T A;  3VYG A;  5KE3 A;  4WCI A;  1YWP A;  1BB9 A;  3BDL A;  2OTJ T;  2O2O A;  3QYG B;  3L2Q A;  2GBQ A;  2BE7 D;  1GFD A;  2HL3 A;  2D8H A;  3OA6 A;  2MCN A;  3CQT A;  4RG8 A;  4KUD K;  1Q82 C;  1M30 A;  1UGQ B;  1WXB A;  4J83 A;  4BAC A;  2W0Z A;  4DBF A;  3INZ A;  1WQ7 A;  1MMG A;  2NUT B;  5EG2 A;  1Q81 C;  2M9U A;  4M78 A;  2M0Y A;  1QP2 A;  1T3S A;  3PVQ A;  4CC3 A;  2A37 A;  2COZ A;  1R0B G;  2M02 A;  4JS5 A;  2H3J A;  1SHF A;  4C0Z A;  2CZ7 B;  2MOX A;  1LOJ A;  4FL6 A;  4EDU A;  1MND A;  1S72 T;  2DL4 A;  5CR2 A;  4PJO D;  1WHG A;  1N8R R;  4M7A A;  3OYF A;  1X01 A;  3GNG A;  3UA7 A;  4QW2 A;  2LCC A;  1RAF B;  2KRM A;  4JDS A;  1P92 A;  1HJD A;  2PVO B;  1NJI C;  1VQ6 A;  1S72 A;  1UDL A;  4IUR A;  3CPW S;  1W2B A;  4QQ6 A;  5GAO n;  4XU2 A;  1G3S A;  4Y91 A;  1PG5 B;  2LQN A;  1K73 R;  1VQO A;  1M3A A;  4X9C A;  3PIP A;  1JB0 E;  4XTX A;  2MF2 A;  5ECA A;  4B9W A;  4JZ3 A;  3M0S A;  5KYX B;  2HKN A;  2KY9 A;  5FLX E;  1W6X A;  1SKU B;  2E41 A;  5LJ5 g;  2DL5 A;  3JAM E;  3P8B B;  3WXM B;  2E5K A;  2L3S A;  1M27 C;  4M4Z A;  5I21 A;  1FWZ A;  4FSS A;  2D9T A;  1IB8 A;  2KT1 A;  2HSE B;  4E7K A;  2HAX A;  2J6O A;  2DL8 A;  2RJF A;  3EH2 A;  3QDR B;  4OB2 B;  5C6S A;  2JTE A;  5GMK e;  3L2U A;  2K7A A;  5GAN 8;  4GLM A;  3X20 B;  4QVZ A;  4BY6 C;  4F7U F;  1WJQ A;  3M0U A;  5J39 A;  4JJD A;  1ZLM A;  3MEU A;  3CCU T;  3JCM c;  4OGE A;  4PNO A;  1UEB A;  2LP5 A;  2L2P A;  1WX6 A;  1UGV A;  2IPO B;  3CCE A;  4A4E A;  1YHQ T;  1D3B B;  4HT9 A;  4OMQ A;  2QQA A;  1SRM A;  2QEX T;  4JUV A;  2ED1 A;  2F2W A;  1NYG A;  1S1N A;  4KT0 E;  3P8D A;  4FYW B;  3G4S T;  1GL5 A;  1PKT A;  3V8K A;  3H6Z A;  2Y90 A;  4NL3 A;  3NPF A;  1VQ5 Q;  4Y92 A;  4BY6 B;  1EZZ B;  1K76 A;  2CP2 A;  4DBH A;  1Q86 U;  3ULR B;  1JU5 C;  4FT2 A;  1M9S A;  5GMK j;  2QDL A;  1ZUY A;  2RHX A;  2LCL A;  4M7D E;  1SRL A;  1TG0 A;  1VYT A;  2YLB A;  1OX9 A;  2DLP A;  4F7U A;  1VQM A;  2CP5 A;  2K57 A;  2DIL A;  3RMS A;  3X25 B;  4C0F A;  1K73 U;  1Y96 A;  1TS9 A;  2R5M A;  1Q81 R;  2CH4 A;  4LUE A;  5LJ3 d;  3JCM V;  5GAN f;  2FPF A;  3OW2 S;  2D0Q B;  5GAM e;  4PFO A;  2LDM A;  3HTR A;  4EPC A;  1G8X A;  5GAN 4;  5FU6 C;  3VRZ A;  1DJ7 B;  1X75 C;  2GGR A;  4X34 A;  5GAO q;  1RAE B;  4J6Y A;  2EBP A;  5D6Y A;  3JCM g;  4M77 G;  1BBZ A;  5IN1 A;  1UGS B;  1FYN A;  4CC4 B;  1D3B A;  2KXD A;  2L0A A;  2CP7 A;  2DRK A;  1KG1 A;  3QWX X;  3CCS T;  3JB9 I;  2QK0 A;  5GAM g;  2YUN A;  1PHT A;  1Q81 U;  1ZBJ A;  4F7U E;  4EMK C;  1JBM A;  5LJ5 j;  4C5G A;  2P4T A;  2L5Q A;  1ZHI A;  2ZAE A;  5CKD A;  1G83 A;  1ZX6 A;  3CC4 T;  5KYY B;  2I2L A;  3M0R A;  2K5F A;  2CZ6 B;  2PQW A;  1KD1 C;  3JCM Q;  3RKY A;  2GQV A;  3G71 Q;  4M7A F;  2EQK A;  2LTO A;  1M3B A;  1LPL A;  4GLK A;  3S3O A;  3G7Z A;  4EMH A;  4EMG A;  5GAO r;  3QXE B;  2J06 A;  1UUE A;  5KYX A;  1U3O A;  4DEY A;  1F1B B;  3ZFJ A;  3VS2 A;  2GFU A;  5LJ3 g;  4QQD A;  4E6R A;  4HXJ A;  1WNL A;  2DMO A;  3ER0 A;  2F69 A;  4M7D B;  4C92 G;  1PWT A;  3HRS A;  4ELZ C;  4LDW A;  3SEM A;  2CSI A;  3M0T A;  2QQS A;  1GCQ C;  1KD1 R;  1IO6 A;  4XTV A;  3CCJ T;  3CME A;  2HL5 C;  3A8O B;  4XQ3 A;  1YJ9 T;  3UPU A;  3HP9 A;  1X69 A;  2JMC A;  1CKB A;  1VQ5 T;  3MKD A;  5FRM A;  1H3H A;  4LD9 K;  4ZN3 A;  4XTU A;  2EGA A;  3CMA Q;  3RUX A;  2AZV A;  4C0D C;  2GTJ A;  2DKG A;  1K8A U;  1M5Q 1;  2XDD A;  2OI3 A;  4FW2 A;  4OB0 B;  3FIF A;  1Z9Z A;  4MML A;  4XU0 A;  4BDY A;  3JCM X;  1YJN T;  2KBT A;  2MK5 A;  1AVZ C;  1VQ9 T;  1V29 B;  2VV5 A;  1QVG A;  1M2V A;  4OMO A;  3A8H B;  3EAE A;  3H0F A;  1BI3 A;  2E5Q A;  3SDZ A;  4PLL A;  1AT1 B;  2DJQ A;  2AHJ B;  3CCE Q;  2A28 A;  1Q7Y U;  1UJ0 A;  5DLO A;  4KBM B;  2LNV A;  4C92 E;  2E64 A;  2DNU A;  4Z88 A;  1RI0 A;  2KNB B;  3VS1 A;  4MMK A;  2VYT A;  4AFU C;  4C92 B;  4A54 A;  4EMK B;  4R0K A;  1BK2 A;  2O01 E;  1SSH A;  3EGX B;  1WPY A;  4M7A E;  2JUF A;  1X2K A;  4E7I A;  3CCM T;  2B86 A;  3QJY A;  2O31 A;  4E7H A;  2AKL A;  1VQL T;  2KDS A;  4HT8 A;  3MO8 A;  1Q7Y R;  1KC8 C;  2IG0 A;  5D6X A;  2DK3 A;  3A8M B;  2LMJ A;  2EGC A;  5GAN 5;  2JS2 A;  2VXF A;  5GAN 3;  1M2O A;  1WLP B;  3LWH A;  4M7D C;  3M9Q A;  1NEB A;  5IH2 A;  4VUB A;  2XID A;  4M75 D;  1OPL A;  2KR3 A;  2ZPE B;  2P4R A;  2HQE A;  1X6B A;  3EFO A;  4LDV A;  1M2V B;  1N9R A;  5LJ5 h;  2X4W A;  3LH5 A;  3OS0 A;  1YP5 A;  1VQ7 A;  3GPL A;  3MEA A;  3SWN C;  2COY A;  3SHW A;  1QMC A;  3REB B;  3CC4 Q;  3M56 A;  1WFW A;  1WXU A;  1KK7 A;  1TTH B;  3OB9 A;  1K8A R;  3FEO A;  1PM3 A;  3URG A;  1TU0 B;  6AT1 B;  2L3Q A;  4JZ4 A;  1VQL Q;  4DA4 A;  2L8D A;  2DXB A;  1FMV A;  5KYU B;  1R0C B;  5KH6 A;  1D0Y A;  1OOT A;  2M16 A;  5CKF A;  3OW2 A;  2BZ8 A;  2A36 A;  2JNG A;  2QAS A;  1VQP T;  3CCQ T;  1E6G A;  1Q7Y C;  9ATC B;  3CCR T;  1YCY A;  2MWP A;  1BI0 A;  2NUP B;  3CCR Q;  1JJ2 P;  2DE0 X;  3EFS A;  1PD1 A;  2WAC A;  1K9A A;  2EQM A;  3QII A;  1AOJ A;  4L6V 5;  5GAM d;  2X9H A;  1X6G A;  3MEV A;  3QDF A;  1T0J A;  4J6X A;  3BDU A;  2KE9 A;  2JTM A;  1U1S A;  1M1K R;  3S3N A;  1E6H A;  4JS4 A;  5I2M A;  1RUW A;  3CD6 A;  2P0Q A;  4LDY A;  1AWJ A;  1QCN A;  4C8Q E;  2DTI A;  1Y0M A;  2HMA A;  1WYX A;  4EIK A;  2COW A;  3BFM A;  2RO0 A;  2HBW A;  2X3X D;  3VS4 A;  3BY7 A;  5KYW A;  1VIE A;  1NPR A;  2NUP A;  3E1S A;  4EMK A;  2FEI A;  5HY6 A;  3CCQ Q;  5CQX A;  3FJP A;  4PJM A;  2EYW A;  1RL2 A;  3CC2 A;  5DY9 A;  1VQ9 Q;  2K2V A;  3LYI A;  4XK8 E;  3TCJ A;  3I56 A;  2JVV A;  5J26 A;  1WHL A;  3AT1 B;  4GBQ A;  3I55 A;  4NOY A;  3OSV A;  3GP8 A;  4QQG A;  1K73 C;  3CD6 Q;  3X24 B;  4M77 F;  2EKO A;  4M78 E;  3MEW A;  1V1C A;  3QG1 A;  4F17 A;  1GFC A;  1B34 B;  3OYD A;  4ESR A;  3JCM h;  3G4S Q;  1U5S A;  1M1F A;  4PJO G;  3G6E Q;  4B9X A;  1MGQ A;  1KIK A;  4FSX A;  2FZK B;  8ATC B;  2DTH A;  3EG1 A;  2LCS A;  4A4K A;  3JB9 J;  3BW1 A;  5GAM h;  3CC7 A;  4XTY A;  2RJC A;  5GMK l;  4AG2 C;  5GAN 2;  1VQ6 T;  2G6F X;  2JZ2 A;  2MI6 A;  3CME Q;  4N0A A;  2JN0 A;  5CIU A;  4MZT A;  1W4S A;  2Z0W A;  2DX1 A;  4AG1 C;  4R55 A;  4M78 C;  4KH1 B;  1RLP C;  2BKD N;  4JRP A;  2MAM A;  2ZCF B;  1MNE A;  3I9Q A;  4FIB A;  3S6W A;  4II1 A;  1AZG B;  5CVI A;  1D1B A;  4XAX B;  1T0H A;  4BI4 A;  1SHG A;  1PKS A;  2MIO A;  4BE1 A;  1UEC A;  5LJ3 h;  4M75 G;  3CBO A;  2KI7 A;  3OYH A;  1AWX A;  1I1J A;  1O75 A;  1QVP A;  4F7U G;  1HD3 A;  2BUD A;  2RQR A;  2KYM A;  2RK1 A;  1VIF A;  1MV0 B;  3MP1 A;  2LJ1 A;  1Y57 A;  3V7C A;  1VQ8 Q;  2KEA A;  4HKE A;  3LW5 E;  1AD5 A;  4Z8A A;  5GAN g;  3JSC A;  5CK9 A;  1VQM Q;  3LGL A;  1ZSG A;  4ZTF A;  4ZTJ A;  2DO3 A;  3TEE A;  1KSW A;  2LC4 A;  3M0P A;  1VQ8 A;  1GCP A;  2AKK A;  4J9I A;  1FMW A;  3QPH A;  5IXF A;  4B6M A;  2LJ0 A;  1VQO Q;  1VQ5 A;  2RJD A;  3SWN A;  4LNP A;  2QAZ A;  1M8M A;  3V8L A;  4JPB W;  3VRY A;  2CGH A;  2DVE A;  3PT9 A;  3BE3 A;  2EYQ A;  3QJ6 A;  4YTL A;  2NLU A;  3JCM e;  1K8A C;  1Y96 B;  3NMZ C;  1O9S A;  1YJW A;  1YHQ Q;  1Q95 G;  5GMK i;  2XHC A;  4V2S A;  4A4F A;  3CCE T;  2EQU A;  4FM4 B;  4LXC A;  5FRN A;  4E7Z A;  4IUV A;  1YJW Q;  3AHU A;  2DYB A;  2MPX C;  2VGN A;  4R56 A;  2DEU A;  3VUB A;  4C8Q B;  2YHT A;  2EKH A;  4A53 A;  1SG5 A;  4RMO A;  4HCB A;  1ABO A;  2ZZD A;  1M1G A;  2E10 A;  1NJI U;  3OW2 P;  2K3X A;  3V8J A;  3A1P A;  2DVJ A;  1ZUK A;  4DOV A;  2E70 A;  3E9F A;  1NG2 A;  1OU8 A;  2CRE A;  2M51 A;  3UF4 A;  3LWI A;  4DOW A;  1QLY A;  4IUU A;  4PLI A;  3CCM Q;  2W10 A;  1BYM A;  4PJO A;  3QYH B;  1TOV A;  3I55 T;  5GAO p;  2FPE A;  2GCX A;  2R58 A;  4FYY B;  5I11 A;  4Z02 A;  3EGD B;  2H8H A;  1UG1 A;  2JOY A;  4OGC A;  3CPW P;  4BI8 B;  4M7A G;  5LJ3 e;  1ARK A;  3OQ5 A;  3G71 A;  4KGV B;  1KQ2 A;  2E3H A;  4ANJ A;  4MZM A;  1UE9 A;  4DEX A;  2PTK A;  3VV0 A;  1NM7 A;  5GMK m;  1ZA2 B;  1YJW T;  4E7S A;  2RHI A;  2DJZ A;  1KC8 U;  2LRQ A;  2HCK A;  4C92 C;  5DM7 R;  3J7A F;  1UGP B;  1A0N B;  4F04 B;  3CPF A;  1YCS B;  2V26 A;  2M0O A;  3VKI A;  4DBR A;  3CMA A;  1RAA B;  1I0C A;  2CKK A;  3CCM A;  2PVD B;  4IUP A;  5KYY A;  1QVF S;  1VOM A;  2EVR A;  2CSQ A;  3CCJ A;  5IT9 E;  2RQW A;  1VQM T;  3PE0 A;  3M55 A;  3JV3 A;  4M75 A;  2QQB A;  4C5E A;  3RER A;  5C0M A;  1M3C A;  1YIJ T;  2HNI A;  3OS2 A;  1C0M A;  5GAN j;  3ZL7 C;  3CMA T;  3UDC A;  2I0N A;  2ZPB B;  4OB1 B;  3TU4 K;  3HFO A;  1RAB B;  3JCM b;  4WF2 A;  3CC7 Q;  1RAG B;  4A63 B;  1KC8 R;  4LDX A;  4J9E A;  3DKM A;  1UFF A;  2KGT A;  3OMC A;  2YT6 A;  2LX9 A;  2K2M A;  3OS5 A;  2HSP A;  3THK A;  2O4X A;  2ECZ A;  1AWW A;  4A4H A;  2QI2 A;  4JRK A;  4LDU A;  3NTK A;  3OBY A;  1OYX A;  3RNJ A;  5I22 A;  3CCQ A;  5KCH A;  1UTI A;  3CCL Q;  3QO3 A;  1IRX A;  2QEX Q;  1KHC A;  3CC4 A;  1VYV A;  2K9G A;  1K1Z A;  2E6N A;  1ZA1 B;  1NBE B;  2JT4 A;  3D7S B;  1YJ9 Q;  5LJ5 d;  1IHW A;  4AFQ C;  2QGG A;  2D6F A;  1X6O A;  2K4Y A;  1N27 A;  2FO0 A;  1I5O B;  1Y07 A;  2CT4 A;  1QCO A;  4NS5 A;  1YFN A;  3M57 A;  5GAO l;  4RTU A;  3NFC A;  3EG9 A;  4CI0 C;  3SFM A;  3CCR A;  1Q82 R;  3KFV A;  2KAF A;  2DL7 A;  1N8R U;  3RBB B;  3CCL A;  4PJO C;  3FC3 A;  1MUZ A;  3JCM f;  1K9M R;  1TWB A;  4C0G A;  2CZ1 B;  2DET A;  1IXD A;  1WJR A;  2KXC A;  2A0F B;  1I07 A;  3CCL T;  2DF6 A;  3NTH A;  3CBM A;  4M75 E;  2PVG B;  2A3L A;  2E6Z A;  4OVA A;  4M7D G;  2LNH B;  4IIM A;  1QVF P;  2MMP A;  4RCB A;  3VUZ A;  3CCS Q;  1I81 A;  3UA6 A;  1JRI A;  2D0N A;  5GMK h;  1ZSZ B;  1Q82 U;  1PD0 A;  4ZGJ B;  4J9H A;  2OAU A;  3HRU A;  2P84 A;  3FB9 A;  3DB4 A;  1CKA A;  1IRE B;  1FXX A;  2YSQ A;  2CYZ B;  4OMP A;  3L2V A;  2OTL Q;  4MDW A;  2HD0 A;  4FW1 A;  1K0S A;  1BU1 A;  2DXT A;  1I8F A;  2OX7 A;  4OMN A;  2QQR A;  4M75 C;  3VS3 A;  2E3I A;  3I55 Q;  2A7Y A;  2K5L A;  4UC4 A;  4KGX B;  5IXB A;  3EH1 A;  4JRI A;  2AK5 A;  4M77 D;  2WSE E;  5CO7 A; 
#chains in the Genus database with same CATH homology
 1AWJ A;  2LQN A;  2F2V A;  2CT3 A;  5FWB A;  1M3A A;  1Y0M A;  2ABL A;  2KRO A;  1WYX A;  4JJC A;  1E7O A;  4D8K A;  4EIK A;  1YNZ A;  3I5R A;  5ECA A;  2EW3 A;  4JZ3 A;  3M0S A;  2HBW A;  2X3X D;  2RNA A;  3EHR A;  1EFN A;  1W6X A;  3VS4 A;  3H0I A;  2DL5 A;  2EYX A;  2FEI A;  2CH4 W;  2E5K A;  2L3S A;  2EYW A;  1M27 C;  4M4Z A;  4FSS A;  1NLP C;  1H92 A;  2KT1 A;  2YDL A;  1Z9Q A;  2J6O A;  2DL8 A;  1T3L A;  2EYZ A;  4LE9 A;  4GBQ A;  2RQU A;  3VS6 A;  2C0T A;  2JTE A;  3VS7 A;  4KRT A;  2K7A A;  1AEY A;  2O9V A;  1GBQ A;  4GLM A;  1V1C A;  4F17 A;  4J9D A;  1GFC A;  2LJ3 A;  4ESR A;  2V1Q A;  1U5S A;  3M0U A;  2DL3 A;  2F2X A;  1KIK A;  4JJD A;  1ZLM A;  5EC7 A;  2L3P A;  3EG1 A;  2LCS A;  2LP5 A;  2L2P A;  1WX6 A;  1UGV A;  1RI9 A;  4AFS C;  1UHF A;  4QT7 A;  4AG2 C;  2SEM A;  4OMQ A;  2K79 A;  2ENM A;  1G2B A;  3EG2 A;  1SRM A;  2D8J A;  2G6F X;  2ED1 A;  2F2W A;  3VS0 A;  1NYG A;  4AG1 C;  2DX1 A;  1S1N A;  2FRY A;  1CSK A;  1GBR A;  1RLP C;  2C0O A;  4RTV A;  1GL5 A;  1PKT A;  5IHK A;  3I9Q A;  1SPK A;  3A98 A;  1AZG B;  2CDT A;  2OAW A;  4RUG A;  1WIE A;  3NPF A;  1OPK A;  4RTY A;  1T0H A;  4Y92 A;  2DBM A;  1SHG A;  1PKS A;  2MIO A;  2LZ6 B;  1K76 A;  1UEC A;  1JU5 C;  3ULR B;  1WDX A;  5FW9 A;  1HSQ A;  5IHI A;  2QDL A;  1QWF A;  1ZUY A;  4HVU A;  1ABQ A;  1YWO A;  1SRL A;  1TG0 A;  1AWX A;  1I1J A;  1VYT A;  1NLO C;  1HD3 A;  1X2Q A;  2DLP A;  3FJ5 A;  2RQR A;  1RLQ C;  2KYM A;  2DIL A;  2AZS A;  1B07 A;  1QKW A;  1MV0 B;  2LJ1 A;  1UHC A;  1U06 A;  2CH4 A;  1Y57 A;  2DM1 A;  4LUE A;  1KFZ A;  2KEA A;  1AWO A;  1AD5 A;  1VA7 A;  2A08 A;  2FPF A;  4Z8A A;  3VS5 A;  1ZSG A;  1UJY A;  2FRW A;  2YUO A;  1AZE A;  3VRZ A;  2J6K A;  1X27 A;  1KSW A;  2GQI A;  1VYU A;  2YUP A;  3I35 A;  3M0P A;  2GGR A;  1JEG A;  1GCQ A;  1GCP A;  2AKK A;  4J9I A;  2EBP A;  2RN8 A;  4J9C A;  3GBQ A;  4J9B A;  5IXF A;  1BBZ A;  2LJ0 A;  1WA7 A;  4IIO A;  4LNP A;  1M8M A;  5HCK A;  2V1R A;  1FYN A;  4JPB W;  4CC4 B;  3VRY A;  5L23 A;  2KXD A;  2L0A A;  2DRK A;  3QWX X;  5IHN A;  2J7I A;  2FPD A;  4RTW A;  3H41 A;  2YUN A;  1PHT A;  1ZBJ A;  1QWE A;  4JJB A;  1MV3 A;  3NMZ C;  3UAT A;  4OMM A;  2GNC A;  2NUZ A;  2RQT A;  1G83 A;  1ZX6 A;  2OJ2 A;  3QWY A;  3M0R A;  1X43 A;  4RTZ A;  1W1F A;  1K0X A;  4X1V A;  2DYB A;  1M3B A;  4CC2 A;  1B3Q A;  4CC7 A;  2J06 A;  2EKH A;  1UUE A;  2K6D A;  1U3O A;  4LN2 A;  1ABO A;  4DEY A;  2DBK A;  2NWM A;  2VKN A;  3VS2 A;  2DVJ A;  1YN8 A;  2EYY A;  2GTO A;  4E6R A;  1ZUK A;  4HXJ A;  2PNI A;  2K3B A;  2DMO A;  2CUD A;  1NG2 A;  4OML A;  2CRE A;  2M51 A;  3UF4 A;  1PWT A;  1QLY A;  2KRN A;  2W10 A;  3SEM A;  2CSI A;  2BTT A;  4ZNX A;  3M0T A;  1GCQ C;  1IO6 A;  4RTX A;  3M0Q A;  2FPE A;  2C0I A;  2VWF A;  5I11 A;  3TVT A;  2H8H A;  1UG1 A;  2O88 A;  1ARK A;  1X69 A;  2JMC A;  1CKB A;  1H3H A;  1LCK A;  2RMO A;  1GRI A;  2HEQ A;  2ED0 A;  1OEB A;  1UE9 A;  4DEX A;  2EGA A;  4Z89 A;  2PTK A;  3H0H A;  1NM7 A;  2FG0 A;  2AZV A;  2D1X A;  2GTJ A;  2ROT A;  2HCK A;  2OI3 A;  2JM9 A;  1KJW A;  1A0N B;  2LX7 A;  2DA9 A;  1YCS B;  2X3W D;  1Z9Z A;  3EG3 A;  1N5Z A;  1PRL C;  1I0C A;  2KBT A;  1NYF A;  1AVZ C;  3PVL A;  4F14 A;  1XOV A;  4LUD A;  1ZUU A;  2CSQ A;  2EVR A;  2RQW A;  4AFZ C;  3PE0 A;  2RQV A;  3JV3 A;  2BZX A;  4OMO A;  3H0F A;  4ORZ A;  1M3C A;  2EQI A;  3NGP A;  1TUD A;  2IIM A;  2DJQ A;  2YUQ A;  3ZL7 C;  4J9F A;  2EGE A;  2EPD A;  1H8K A;  2I0N A;  5GJV B;  2A28 A;  3TSZ A;  1UJ0 A;  4HVV A;  2KYB A;  4A63 B;  2DNU A;  2RF0 A;  4J9E A;  3NHN A;  4Z88 A;  2KNB B;  1UFF A;  3VS1 A;  2O9S A;  1JQQ A;  2PZ1 A;  2KGT A;  2JM8 A;  2VVK A;  4AFU C;  3TSW A;  2YT6 A;  1WI7 A;  2K2M A;  2HSP A;  4F16 A;  4K11 A;  3THK A;  1QKX A;  2ECZ A;  3U23 A;  1AWW A;  2KT8 A;  4R0K A;  1WXT A;  1BK2 A;  1SSH A;  1JXM A;  4D8D A;  3RNJ A;  5I22 A;  1UTI A;  1X2K A;  3O5Z A;  1W70 A;  1VYV A;  2B86 A;  2O31 A;  2K9G A;  1K1Z A;  2AKL A;  2JT4 A;  2JW4 A;  3REA B;  2JMA A;  2J05 A;  2ROL A;  2LMJ A;  2KRS A;  1JO8 A;  2EGC A;  4AFQ C;  3EGU A;  2JS2 A;  2JS0 A;  2J6F A;  2FO0 A;  4RTT A;  1WLP B;  2CT4 A;  1NEB A;  1JXO A;  3EG0 A;  5IH2 A;  1OPL A;  2KR3 A;  1NEG A;  1OV3 A;  2BZY A;  4RTU A;  2P4R A;  5GJW B;  2CUB A;  1X6B A;  3C0C A;  3EHQ A;  1K4U S;  2XMF A;  2JXB A;  1SEM A;  3KFV A;  3LH5 A;  1YP5 A;  4WCI A;  1YWP A;  2DL7 A;  3RBB B;  1TUC A;  1BB9 A;  2SRC A;  2HDA A;  3SHW A;  3REB B;  2O2O A;  1MUZ A;  1WFW A;  1WXU A;  1QCF A;  2GBQ A;  1J3T A;  2KXC A;  1I07 A;  1GFD A;  2D8H A;  3I5S A;  2DF6 A;  2MCN A;  3CQT A;  2LQW A;  1M30 A;  1WXB A;  2W0Z A;  2L3Q A;  4JZ4 A;  2LNH B;  4IIM A;  1FMK A;  2M0Y A;  3IQL A;  1OOT A;  1T3S A;  3PVQ A;  2BZ8 A;  2A36 A;  2D0N A;  3UA6 A;  4CC3 A;  2A37 A;  1SHF A;  2MOX A;  4J9H A;  1E6G A;  1PNJ A;  2DL4 A;  5FWC A;  2DRM A;  2ESW A;  1CKA A;  2YSQ A;  4OMP A;  3UA7 A;  4J9G A;  2DE0 X;  2RPN A;  4HCK A;  1K0S A;  1K9A A;  2KRM A;  1AOJ A;  1BU1 A;  1HJD A;  1X6G A;  3R6N A;  4OMN A;  1T0J A;  4HVW A;  3VS3 A;  2KE9 A;  5IXB A;  1UDL A;  2AK5 A;  1E6H A;  1PRM C;  1RUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...