1KQSP

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1kqsP00
3CCSQ 1VQOQ 2QEXQ 1VQLQ 3CMEQ 1VQ5Q 1QVFP 1YIJQ 3CCLQ 3CCRQ 1Q82R 1YJWQ 1Q7YR 3CC7Q 1JJ2P 3G6EQ 1VQPQ 3CC4Q 1QVGP 1VQ9Q 1YJNQ 3CC2Q 1VQNQ 1YHQQ 1N8RR 1VQKQ 3CCJQ 1YJ9Q 1KC8R 1YI2Q 1M90R 1Q81R 1S72Q 1YITQ 3I56Q 1Q86R 3G4SQ 1KQSP 2QA4Q 1M1KR 1VQ4Q 1KD1R 3CPWP 3CXCP 1VQ6Q 3I55Q 2OTJQ 1K9MR 3CCQQ 3CMAQ 3G71Q 3OW2P 3CCUQ 1VQ8Q 3CD6Q 1K8AR 1K73R 2OTLQ 3CCEQ 3CCMQ 1VQMQ 1W2BP 1VQ7Q 3CCVQ 1NJIR
chains in the Genus database with same CATH superfamily
3JCMc 2P0PA 5GAN4 1N9RA 4M7AB 1HXDA 3BY7A 2CT4A 2ENMA 1VQKT 2PU9B 1BKBA 1SRMA 1Q81U 1CKBA 2M1HA 5IH2A 1OI1A 1QWFA 5FU7C 1ZQ1A 2O4XB 4PFOA 3A5ZB 2CZ0B 1UDLA 1X27A 3OB9A 1VYVA 1K8AU 3TQ7P 1M1GA 1Q95G 1H3ZA 1M9SA 2C06A 2ZPIB 2KRSA 3TVTA 4EMGA 2CP6A 2LDMA 2SEMA 1VQKQ 2KAFA 2LT4A 2ESWA 4C92F 2PVOB 4ESRA 3OS1A 3QHSA 5DY9A 1K4US 1M1KU 2DNUA 3CBMA 1M90C 4P5NA 4M75B 4E6RA 1VQ7T 4D8DA 5GAN5 2W10A 4MZMA 2COYA 2E10A 2DILA 1WDXA 2IIMA 4OB1B 3RKYA 1M3CA 3EFRA 2KY9A 2BE9B 1TWBA 2M9UA 3CCQT 1B34B 1NZ9A 5I22A 5LJ5d 4J9IA 1VQ7Q 1JRIA 4XTVA 4MDWA 3NHNA 5FWCA 1ABOA 4OB0B 1WPYA 4M7AC 5I2SA 1VQKA 2D6FA 2HL3A 3M54A 4LNPA 1TUGB 2EQKA 3NTIA 4AMCA 2KI7A 1RL2A 2QQSA 3M55A 1TH7A 3FEOA 3FJ5A 4RTYA 3CCQQ 4QQGA 2BZYA 3JRZA 1I1JA 3CCEQ 3VS7A 2K5FA 4F14A 5KYYB 2VC8A 1MNEA 1Q81C 3VS6A 5AT1B 2V8JA 3A8LB 3X26B 1R77A 3BDUA 3QSUA 3MP6A 1QVGS 4ANJA 2X3XD 1K8AC 1B34A 3OS2A 4XU0A 3T9NA 3LX7A 3I56T 2DM1A 1HD3A 5CQXA 3VS4A 3DB3A 4A54A 1RAHB 1ZBXA 1PC0A 2DRKA 3I55T 3G71T 1RAGB 1VQ7A 3S6WA 1M1KC 4JRKA 1QCFA 2A08A 1QVGP 3G4SA 2OAWA 1HJDA 3TREA 2LQKA 3R6OA 2HKQB 4MMKA 4M77C 3I56Q 3M56A 3J80E 2MAMA 2CYZB 2LQNA 1ABQA 4A63B 1BU1A 4E47A 3I55Q 5A2QE 2FPDA 3CQTA 3LLRA 1M8VA 4LD6A 4EDUA 2GTJA 1MMDA 2XDPA 4F7UA 1RLQC 2EW3A 2JS0A 4J6XA 3C94A 3VS5A 2A7YA 3REAB 4A4GA 3V7RA 3G6ET 1VQNT 4JJNK 3HFOA 4OMQA 2HSPA 1U06A 3A8GB 4E7SA 1IGQA 3PMIA 2PVDB 2ROTA 1G2BA 3BW1A 2MCNA 4LD9K 2EIFA 4DOWA 1YNZA 1ZA2B 2JM8A 4L6V5 2H3EB 4FW2A 1GCQA 1EIFA 3I56A 4AG2C 2QI2A 4JJBA 3H8ZA 3I55A 3G71A 3CPWP 4M4ZA 4XQ3A 4M78A 1X01A 2DAQA 2JZ2A 2KNBB 4LE9A 3MEVA 3QBYA 2KT1A 2DTIA 3OYNA 2GFAA 2XDDA 2K9GA 2NUZA 2QA4T 2EYZA 3MO8A 2QAZA 4FYVB 3JCMb 1AWOA 2FHDA 4OMNA 2OI3A 2JMAA 4LN2A 1N27A 5LJ5j 2HL5C 2HDAA 3G6EA 1VQNA 1IHWA 2YSQA 2DL7A 4KT0E 1T3LA 4OGCA 3L2RA 1BI2A 4JJCA 3L2QA 1WJSA 2WSEE 4M75F 1TTHB 3QPHA 4Z88A 2AKKA 3L1AA 3RKWA 3ULRB 4C0FA 2V26A 3H0IA 4IIMA 4MZPA 3SFMA 3HP9A 1IZ6A 1VQLT 1UGRB 1IGUA 2G3RA 3QO3A 1ARKA 4M7DB 2RK1A 2DTHA 4AFZC 2WACA 3EGDA 2EGAA 2JM9A 2K57A 1RLPC 4Q5WA 2EAYA 2P0KA 5IXFA 1VQ8Q 4M7AE 2AKLA 3UDCA 3V7SA 2KXCA 2LJ3A 1VQLQ 2SRCA 4OMFB 3EGXB 3RKXA 5J39A 2DLPA 3CC2T 1WGSA 1UGQB 4DQ2A 2PTKA 3U23A 2QA4A 3OMCA 2FRWA 1D0ZA 3M0RA 5J3BA 4OP0A 1Y96B 4J7IA 2DL4A 4XTYA 5LJ5e 4F7UF 2DTOA 1X2KA 5HK0A 2LJ1A 2HD0A 4M7AD 4RTUA 1Z9QA 3UPUA 3CC2Q 2VASA 4JLGA 2ZPEB 1BK2A 1YP5A 1AZEA 1M2VB 4FSXA 4N0AC 5GAOp 1Q86R 1RAEB 4OMLA 2EPDA 2JT4A 4QW2A 1HSQA 3JCMJ 1C1AA 5IT9E 4O6JA 2IVWA 1VQLA 3INZA 4QT7A 1D0XA 4N4HA 5CIUA 3CCVT 5KH6A 1UGPB 4J9FA 4M77E 3A98A 3EFSA 1N8RR 2J06A 2QQRA 4QVZA 3OBYA 2DPPB 1LNXA 2EWNA 1ZBJA 3SEMA 2JTMA 1I07A 2ECZA 2H8HA 3OW2A 2O9SA 8ATCB 1QLYA 2XG8D 3CCRA 3CCVQ 4EPCA 1VIFA 1NPRA 2KBTA 1ZSZC 2YLBA 1UHCA 3AT1B 4M7AG 4PJNA 1QVFS 2J05A 4DBFA 3SWNB 1G3SA 5LJ5g 2RJDA 2XKOC 3X25B 4M77D 1KQSA 1UG1A 1FMKA 3HPWA 3OSVA 1SRLA 2HAXA 1M1FA 1GBQA 2K3BA 2DE0X 2YT6A 1FYNA 3NTHA 5CAIA 2E6ZA 5A0LA 1QVFP 4X1VA 1P92A 2BKDN 4RCBA 1PNJA 3A8OB 1B07A 4JLIA 2VYTA 4JJDA 2IG0A 4PJOB 3EFOB 2RI5A 2CREA 1MMGA 1YWOA 1KFZA 1YN8A 2YUOA 3GPLA 1W2BA 2O9VA 2EYXA 4R55A 4JRQA 2QK0A 2CP7A 2E41A 3L42A 4OMOA 2FYKA 4M77G 2K7AA 5HY6A 1OZ3A 2C0IA 4PLLA 1G5VA 1Q86U 1UUEA 2RF0A 1WX6A 3M0TA 2DKGA 4C8QD 4AFUC 4D8KA 1WNLA 2AIRB 5KCHA 2CP5A 2QYZA 4PJOA 2KQWA 3CBPA 5KYUA 4CRIA 3QXEB 4BACA 2E3IA 3OYEA 2E70A 1RAIB 1Y07A 3CPFA 3QG1A 4B6MA 1UJ0A 2V8IA 2PQWA 5GMKi 1WHMA 3O8VA 1N8RU 1YBYA 5HKCA 1X75C 1AWJA 1VQMT 4C92C 5CKDA 1V1CA 3OY9A 2DL3A 3MHXA 5A0GA 1EFNA 3V8LA 4ME7A 2DK3A 3VS1A 3JB9F 5KCOA 2OTJA 3UT1A 3E1SA 3S3OA 3M5AA 1M30A 1PD0A 2GQIA 2RHYA 3F70A 2F5TX 4VUBA 1KIKA 1WHJA 4KBMB 4E7IA 1H3HA 3DB4A 1TXQA 5LJ3j 2OJ2A 5AYFA 1YFNA 3M58A 5GMKh 2EQJA 4C5GA 2KE9A 1VQ4A 3SHWA 3TSZA 5GAOm 4XU1A 4J5YA 3MKDA 4FT4A 5GAOl 2BTTA 2EQMA 3OYBA 1MMAA 3L2ZA 1QCNA 2RQUA 2DVJA 5GAOr 4OGEA 2ZZDA 1QW1A 4E7HA 3FIFA 4RMOA 2EJGA 1Q86C 1X6GA 3META 1VQ5T 3RUXA 3V8KA 1O75A 3TU4K 2JMCA 4HVWA 4QVDA 3ZFJA 5IHIA 3GNFB 2MWPA 5FLXE 3PNWC 1U5SA 2EQUA 4J9DA 1VQMA 3SD4A 1E7OA 2VUBA 3OYDA 4DBQA 3TEEA 2QASA 1N8RC 2DBMA 4M7DE 1EX4A 1BI1A 2KROA 2CSQA 1NLOC 4F04B 2QEXT 1VQ5Q 4LDUA 2XICA 1KHIA 3HKSA 3JCMe 3MCAB 1FX7A 5D7UA 1BCMA 3L2WA 3PVLA 2J6KA 5CK9A 1ZA1B 1FMWA 5FRMA 2AK5A 1XTDA 2D8HA 1GBRA 1OU8A 1IHVA 2JNGA 4XAXB 5DLQE 1WJRA 1I81A 2CS7A 1OULA 1KSWA 1M5Q1 2QEXQ 1WJQA 5LJ3e 2BE7D 4LXCA 2KXDA 3I5SA 5I2MA 4OVAA 5FU6C 5EG2A 3JV3A 3C0CA 2AT1B 1PCXA 1SSHA 4KGZB 1D09B 2HNIA 2W0ZA 1C0MA 1VQ5A 4FSSA 3M0UA 1XNIA 3FDRA 2EVRA 2ZAEA 3GNGA 2BIVA 4Z89A 4LDYA 4PJMA 4PJOF 4C5HA 2A37A 4FIBA 4BY6C 2KRNA 2LRQA 2R5AA 2IPOB 2L3SA 4KUIA 3KXTA 1TUCA 3G4ST 3GBQA 4XK8E 3JCMg 2L8DA 4X9DA 4A4FA 1PD1A 2RHUA 1PSFA 2QEXA 2JTEA 1T0HA 1LJOA 2E6NA 4AT1B 2F2WA 4M7DG 1OPKA 3C12A 4OB2B 2R58A 4J9EA 3H0HA 4PJLA 1R0CB 3H0FA 3CEYA 5L23A 5LJ3g 3G4SQ 3JB9H 1E6GA 3KFVA 4ZTJA 4NL2A 4DA4A 2V1RA 4EMKB 3RIRA 1VQ6T 2CGHA 5GAMj 2A0FB 3AHUA 1OX8A 2GF7A 3NPFA 2LNVA 2EGCA 2F5KA 4HVUA 2C0TA 1WQ7A 1K1ZA 4JRPA 3P8BB 3RESA 5KYWA 2XI9A 4F7UB 2KT8A 4ATOA 1PKTA 1EZZB 1BI3A 3E9GA 5GANe 3OYAA 1UE9A 4C92E 2RJEA 1VQ6Q 1HK9A 3CXCA 4OMPA 2XDBA 2WSFE 2E12A 3CCMT 1TS9A 1K9MR 1OZ2A 4M75C 3CMET 4C0ZA 1UGVA 1ZX6A 1LVKA 2CUDA 4EIKA 4EMKA 3MEUA 1Z9ZA 2NUPA 4FM4B 4LDWA 1VUBA 2VKNA 1SKUB 1YWPA 1T3SA 3PIOA 3EGUA 4J9CA 2CDTA 3FJPA 1PG5B 1JBMA 3G71Q 1I5OB 1QP2A 4IUVA 3CCMQ 2A3LA 1XJWB 1PWTA 2FZGB 2J6OA 4C92D 1Y0MA 3UA6A 1W4SA 1I4K1 3E9FA 2FZKB 3HL8A 5A0DA 2D0QB 1X43A 4M78B 1I8FA 1VQ6A 4FT2A 4CC7A 2ZPGB 3NGPA 3G1JA 5GAMe 2I0NA 8AT1B 1WQWA 4DBRA 1WYXA 3KUFA 2YRCA 4K11A 2DL5A 1N6AA 4HCZA 4YTLA 4TVRA 1ZSGA 1YI2A 1R8OB 1YJWT 3G6EQ 1AZGB 4C8QA 1VQNQ 5LL6S 4PNOA 1KJWA 4WTOB 2EJFA 4LDVA 5KYNA 2MWOA 1UECA 3CCMA 2EQIA 3CMEA 4IIOA 4C92G 1E6HA 3S3MA 5KE3A 3QJYA 1YJWQ 4J9BA 1JXMA 2RQVA 2DZCA 3LH5A 2DO3A 3EH1A 1K0SA 1W1FA 1SF9A 3OYGA 3M0PA 3VUZA 4A4HA 4BE2A 2YRDA 1ZUKA 3VS3A 1GCQC 1M2OA 2KRMA 1QWEA 2L2PA 3EGDB 3RR6A 4MZTA 3RMQA 3E19A 3DLLA 2CH4W 2Z0WA 5GAMg 1LPLA 4XTZA 3NTKA 4CC2A 2RJFA 3EHQA 2KK4A 4CC3A 3I5RA 4FYWB 4C5EA 2PZ1A 4Z02A 2QA4Q 4BDZA 1OPLA 1MHNA 4FL6A 1WHGA 5KE2A 2DXCA 2YRVA 1D1CA 2LVMA 3C95A 3LGLA 3MEWA 1YJWA 3V8JA 4RTWA 1TG0A 1D1AA 1RAFB 4LUEA 2OAUA 1YHQT 1ZUUA 3Q1JA 4R56A 3H41A 2QDLA 2O88A 2RHZA 2H3JA 2KSSA 1V29B 2DJZA 2HBWA 4PKCC 4IUUA 1IXDA 2FPEA 1M3AA 2E5QA 1SPKA 4E7KA 2VXFA 5GAN3 3CCRT 2YLCA 3URGA 1AOJA 5GMKm 1WHLA 2DYIA 5GMKl 4X34A 3P8HA 2RD1A 5ECAA 3QKJA 4BE1A 4C0DB 3MPUB 2BUDA 2RO0A 1IRXA 3P8DA 2V1QA 4N0AA 3H6ZA 2EYQA 4RG2A 4UC4A 2B8AA 3OYJA 3CCRQ 1KHCA 2YUPA 3VRZA 4HKEA 4DBHA 3JCMd 1JQQA 1CKAA 3HRUA 1WA7A 5GAN6 1VA7A 1K9MC 2QTVA 3SB2A 1KK7A 4IUQA 4M75E 2F2XA 4QQDA 4KGXB 1JO8A 3OW2S 2FVUA 1QVPA 1YCYA 1YHQA 3VJPA 2E65A 5LJ3d 2WSCE 2O01E 4C8QF 4M7DC 3HFNA 2RQWA 4J83A 2HQHA 1ZSZA 3BFMA 1KQSS 3MP8A 4E2FB 3REBB 1F1BB 2M0OA 2M16A 1D3BA 4FYXB 4RUGA 3WVDB 3GIBA 3OW2P 4D6WA 3E2UA 1AT1B 3O5ZA 4M78F 2FL7A 4M75D 3WXMB 1M3BA 2K6DA 4OB3B 2K2VA 3IQLA 1CSKA 2FRYA 2JTFA 4ELYC 2RI2A 1KQSP 2CP3A 4BDYA 3KBGA 4Y28E 1U8RA 1HYOA 1N5ZA 4XTWA 2OTLT 2X4YA 4N4GA 4PK4A 2EKHA 1I5LA 3ER0A 2ATCB 2GNCA 3OYYA 4V2SA 1W2BS 4F7UE 2NWMA 4KRTA 4L59A 3G7ZA 1JJ2A 1BBZA 1VQ9T 2P4RA 2RK2A 2QQAA 1M27C 3ASKA 1QCOA 2NUTB 2ROLA 1WHKA 1KQ2A 1Y7XA 2OTJT 5KYUB 1NEGA 1NYFA 2OTLQ 2FPFA 4ELZC 1W2BP 4KGVB 4M75G 1RADB 4RCCA 4ZGDB 1VYUA 1VQ9Q 1VQPT 3EG9A 1AHJB 2VXEA 1MV0B 1ZHIA 1YITT 1GRIA 2DETA 3VUBA 1VQ4T 3VV0A 1WLPB 5GANd 5LJ5h 3QUIA 2OTJQ 1GFCA 1W6XA 4HT8A 1VOMA 2P4TA 4NL3A 2EGEA 3HSBA 2XIDA 2YUQA 2KEAA 2AZSA 2DVEA 2ABLA 1YIJT 2NUTA 1OQKA 4HT9A 5HK3A 3SWNC 1VQPQ 4XU2A 4A53A 2QG9B 2XK0A 4BB7A 4C92A 2M0YA 4C0GA 1YITQ 5D6XA 5I21A 1FXXA 3EG0A 3OQ5A 2VB6A 5GAN7 1VQ4Q 3OYMA 2OTLA 4L5GA 3CMAT 3LWHA 4F16A 1WXBA 5GAOq 4WCIA 3PT9A 3CCST 3OMGA 3OS5A 1AVZC 4J9GA 4DOVA 1YIJQ 1VQ9A 3QWYA 1T0JA 2LQWA 3GLXA 4F7UG 3JSCA 4LUDA 2QXFA 2X9HA 2MF2A 4BI8B 2CH4A 4PJOC 1OOTA 2HQXA 4GLKA 5GAMd 1IB8A 1VQMQ 4PLIA 1VQOT 3CC7T 1VQPA 1ZUYA 2DX1A 2MOXA 3PTAA 1JB0E 2I2LA 2RN8A 2QQ9A 1YITA 3QDFA 1KC8R 2JN0A 2DMOA 2VWFA 4WF2A 4JS5A 3FRNA 2VV5A 3HTRA 1M4ZA 5GJWB 2K5IA 5FU7B 3TSWA 2D8JA 3MP1A 2DL8A 1I0CA 1YIJA 3OYLA 3CC7Q 2DBKA 5LJ5f 3VS2A 3M57A 3LW5E 4CI0C 4X9CA 2DF6A 2RMOA 3DKMA 4QKUA 2RB6A 1U3OA 4J6WA 2ED1A 2X51A 5IHKA 2P84A 4HCBA 1PRMC 2Y4XA 3CMAA 2HCKA 5CKBA 4B9WA 1JU5C 1ZLMA 2RI3A 4PL6A 3QDRB 3CCSA 2LTOA 2KMTA 2DA9A 5KYXB 1N9SA 2D9TA 3X28B 1PHTA 4KULA 1KG1A 1Y57A 2FZCB 5L8RE 1BIBA 1S72A 3SDZA 1QKWA 3RMSA 2HKNA 6AT1B 3EH2A 1YJ9T 4BD3A 5HCKA 2KR3A 2X3WD 2G6FX 4JZ4A 2R5MA 1WI7A 1VQOA 4MMLA 3CC7A 3CCUT 2L89A 2DXTA 2RQTA 5FRNA 4NOYA 1K76A 3D7SB 3GP8A 4ZGEB 3EG1A 1NG2A 5DM7R 1G83A 2X4XA 4M7DD 1J3TA 1YJ9Q 3J7AF 2RNAA 1WZOA 5KYXA 4ZN3A 5GANj 4Y91A 2CKKA 3CCUQ 4JS4A 4R0KA 2RA2A 2VGMA 5IN1A 4JPBW 3JB9D 2PUKB 4HVVA 1Q82R 3CCJA 3UWNA 1IO6A 2X4JA 1WHHA 4Y92A 3I35A 1KC8U 5IHNA 2M51A 4M7AA 2L5QA 2DEQA 1U1TA 2HMAA 2D1XA 2F1LA 2DYBA 2Y4YA 3THKA 5KYWB 4IUTA 2E1HA 2QTXA 4KUDK 1YJ9A 2O4XA 4ZGJB 5FWBA 4QQ6A 2CP0A 4M77B 3LYIA 2J6FA 2LMJA 1G3TA 3N5BB 3CCUA 2KGTA 4Z8AA 1WXTA 3CXCS 1UGSB 3CCET 3HHTB 1OX9A 2NUPB 2M02A 2K3YA 3JB9G 2MPXC 2PVGB 2LNHB 2BZ8A 3VRYA 4ZNXA 2RQRA 2R57A 2D0NA 2RH2A 2E64A 4KH0B 1SSFA 1YI2T 4M75A 1NPPA 5CKFA 2Y90A 2XD0A 2GGRA 1B3QA 3CXCP 1VYTA 1G3YA 2CZ1B 2DEUA 5CKHA 1G3WA 4M77A 3JCMh 2LCLA 2HSEB 1LOJA 4PJOE 3H9NA 1YI2Q 2F69A 5IXBA 2YUNA 2GTOA 3JB9J 2E3HA 4C8QB 2K3XA 2FB7A 5LJ3h 1KC8C 3CMEQ 2K5LA 3X24B 4F17A 4QVCA 1Q7YR 2DJQA 1QVGA 1YJNT 1Q82U 2EBPA 2E5KA 5CO7A 4J7FA 5KYYA 1SHGA 3CCQA 2EYYA 4GBQA 4PJOD 3CCEA 1LCKA 1PRLC 3NMZC 1X6BA 2RM4A 4EMKC 1X2QA 2DXUA 3R6NA 2K79A 1QMCA 5I11A 1XQHA 2MYSA 5GANg 2DFUA 4HCKA 1NM7A 1YJNQ 2YXYA 2JVVA 1DJ7B 2LP5A 3JCMV 1PM3A 2XMFA 2ZPHB 1TUDA 3DLMA 4J6YA 1AD5A 2LC4A 3RBBB 3CPWS 2X4WA 1GL5A 2EJ9A 4KH1B 1IREB 4E7LA 2HZYA 2ED0A 3BDLA 1H641 2CUBA 4J9HA 3MEAA 3VYGA 4IUPA 3JCMf 2CZ7B 3EAEA 1RI9A 3M0QA 5GJVB 2P0QA 2VGNA 3LGFA 1K9AA 4RTZA 2AHJB 4PJOG 2JUFA 1RI0A 2HBPA 4PJJA 3GOXA 4M7AF 3A8HB 1X6OA 4RTVA 3CPWA 4C8QC 3QZ9B 4MDXA 3HRTA 4CC4B 5EC7A 1S1NA 3VYHB 1VIEA 2QQBA 1YJNA 5GAN2 1K9MU 5LJ3f 2JXBA 4EMHA 1NE8A 1BIAA 2LX9A 4IURA 1NEBA 1QKXA 5GANh 1OV3A 1RUWA 4M78C 1MNDA 2QGGA 4XTXA 3PE0A 1KD1R 4A4KA 3OYKA 2NYSA 4AFQC 1Q82C 4IKFA 3M4YA 3QJ6A 2YDLA 1UTIA 2CP2A 4E7JA 4BE0A 1PSEA 3A8MB 1Q7YU 4HCCA 1TSFA 5CKEA 3PIPA 4AFSC 1UEBA 2K4YA 1VQ8T 5CQYA 1K0XA 2GQVA 3QWXX 2GCXA 1TOVA 2OX7A 4M77F 4BUGA 3OA6A 3JCMW 3X20B 3QIIA 3UA7A 1YHQQ 2L0AA 2XHCA 2JW4A 4JZ3A 4OMMA 3C4SA 5GAMh 4A4EA 9ATCB 3PVQA 2MIOA 5DLOA 3RNJA 4XTUA 1OU9A 1NJIR 1ZSZB 4NS5A 4RTTA 1MV3A 1M8MA 2LZ6B 1D3BB 1BB9A 2L3PA 4LDXA 2ZGWA 3FLGA 1X69A 5GMKj 4RKUE 4JDSA 3OS0A 3OYFA 5GANf 3J81E 2QGFB 1OEBA 4M7DA 1WXUA 1MUZA 1K73R 2COWA 1OYXA 1W70A 4HXJA 1AWWA 3ME9A 1UB4A 2FO0A 1BYMA 2ZPFB 3M53A 4J8OA 2RPNA 4JRIA 3HRSA 4C5IA 2GFUA 3EG3A 2KDSA 1VQ8A 1D1BA 3EGXA 4OF1A 1FWZA 1Q7YC 2EKOA 1KD1U 3ZL7C 2LX7A 3CBOA 3FB9A 5CCAA 2KVQG 2O2OA 3JAME 1Y96A 3CCLT 1KQ1A 4O5VA 2HEQA 3CC4T 2YWWA 1JJ2S 5FW9A 3M4GA 1R0BG 3QYGB 4XU3A 3EG9B 4C0DC 5GAMf 1YCSB 4PFPA 3JB9I 4GY5A 1M2VA 3CC2A 1MGQA 3V7CA 3CCLQ 4ZTFA 3VU3C 2DZ9A 1JJ2P 3CC4Q 2LCCA 3VS0A 1GCPA 1JEGA 5GMKe 2KYBA 4JUVA 1NYGA 2LT1A 2ZPBB 2COZA 3OYCA 1UHFA 1NBEB 3NFCA 2PNIA 3WVEB 2DIQA 3OBWA 4FW1A 4B9XA 1B7TA 4C92B 1SEMA 2BZXA 1QVFA 1BI0A 1H92A 1NJIU 4ORZA 2RJCA 5CVIA 2L3RA 2LCSA 2DIGA 1M90R 4C8QE 2YHTA 2JOYA 1AWXA 2KYMA 1GFDA 2A36A 3SWNA 2J7IA 3CCVA 2LJ0A 7AT1B 2B86A 1FMVA 1NLPC 3QZ5B 5GAN8 1K73U 2MMPA 3CCLA 1C6VX 4BI3A 1WFWA 3CC4A 3ZEHA 2RHXA 4M78E 2FEIA 1KD1C 3EHRA 3PGGA 1SHFA 3QYHB 2RHIA 3FC3A 1UFFA 4II1A 5GAOn 1QQJA 2C0OA 1TU0B 1O9SA 3OYHA 5M9OA 3PFSA 3L2VA 1PKSA 3CD6T 1RABB 2JS2A 4RTXA 3TCJA 1D0YA 2MK5A 2X35A 3EFOA 3S3NA 2A28A 2DD5A 2FG0A 2CT3A 2JJ9A 1SG5A 3I9QA 4RG8A 2DXBA 1Q81R 2L3QA 1S72T 4M78D 1Y71A 2AZVA 3LH0A 4FCYA 3JCMQ 2CSIA 5D6WA 1AEYA 4GLMA 4M7DF 3CMAQ 3CD6Q 2MI6A 5C0MA 1K8AR 2VVKA 4AG1C 1WIEA 3CCSQ 3JCMX 2DD4A 1BCOA 1QP3A 4DEXA 2O31A 1U1SA 3RERA 2PUOB 3BE3A 1RAAB 2CZ6B 3OYIA 3M59A 4N4IA 2K2MA 1JXOA 1MMNA 1XOVA 1UJYA 5FROA 3VKIA 2E4HA 3A1PA 1S72Q 5C6SA 3LWIA 3EG2A 2HQEA 3PMTA 1NJIC 1M1KR 1H8KA 2XU8A 4C8QG 2GBQA 3UATA 4DEYA 3UF4A 1VQOQ 5D6YA 1V76A 3RDVA 3M0SA 4BI4A 4FU6A 3ZBDA 3MJXA 4FYYB 1GXIE 2EFIA 1ACMB 5FU6B 1K73C 3L2UA 3CCJT 3JCMP 5CR2A 4M78G 4HA8A 1M90U 4E7ZA 3CD6A 1G8XA 3OSSC 4PFZA 2V8KA 4ZN1A 4BY6B 2LQ8A 5J26A 3CCJQ 3GF5A 2F2VA 2EYWA 2ZCFB 2DERA 2NLUA 3M9QA 1A0NB 5IAYA 2DRMA 2QDYB 1RACB
chains in the Genus database with same CATH topology
3CCSQ 1VQOQ 2QEXQ 1VQLQ 3CMEQ 1VQ5Q 1QVFP 1YIJQ 3CCLQ 3CCRQ 1Q82R 1YJWQ 1Q7YR 3CC7Q 1JJ2P 3G6EQ 1VQPQ 3CC4Q 1QVGP 1VQ9Q 1YJNQ 3CC2Q 1VQNQ 1YHQQ 1N8RR 1VQKQ 3CCJQ 1YJ9Q 1KC8R 1YI2Q 1M90R 1Q81R 1S72Q 1YITQ 3I56Q 1Q86R 3G4SQ 1KQSP 2QA4Q 1M1KR 1VQ4Q 1KD1R 3CPWP 3CXCP 1VQ6Q 3I55Q 2OTJQ 1K9MR 3CCQQ 3CMAQ 3G71Q 3OW2P 3CCUQ 1VQ8Q 3CD6Q 1K8AR 1K73R 2OTLQ 3CCEQ 3CCMQ 1VQMQ 1W2BP 1VQ7Q 3CCVQ 1NJIR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS Q;  1VQO Q;  2QEX Q;  1VQL Q;  3CME Q;  1VQ5 Q;  1QVF P;  1YIJ Q;  3CCL Q;  3CCR Q;  1Q82 R;  1YJW Q;  1Q7Y R;  3CC7 Q;  1JJ2 P;  3G6E Q;  1VQP Q;  3CC4 Q;  1QVG P;  1VQ9 Q;  1YJN Q;  3CC2 Q;  1VQN Q;  1YHQ Q;  1N8R R;  1VQK Q;  3CCJ Q;  1YJ9 Q;  1KC8 R;  1YI2 Q;  1M90 R;  1Q81 R;  1S72 Q;  1YIT Q;  3I56 Q;  1Q86 R;  3G4S Q;  1KQS P;  2QA4 Q;  1M1K R;  1VQ4 Q;  1KD1 R;  3CPW P;  3CXC P;  1VQ6 Q;  3I55 Q;  2OTJ Q;  1K9M R;  3CCQ Q;  3CMA Q;  3G71 Q;  3OW2 P;  3CCU Q;  1VQ8 Q;  3CD6 Q;  1K8A R;  1K73 R;  2OTL Q;  3CCE Q;  3CCM Q;  1VQM Q;  1W2B P;  1VQ7 Q;  3CCV Q;  1NJI R; 
#chains in the Genus database with same CATH topology
 3JCM c;  2P0P A;  5GAN 4;  1N9R A;  4M7A B;  1HXD A;  3BY7 A;  2CT4 A;  2ENM A;  1VQK T;  2PU9 B;  1BKB A;  1SRM A;  1Q81 U;  1CKB A;  2M1H A;  5IH2 A;  1OI1 A;  1QWF A;  5FU7 C;  1ZQ1 A;  2O4X B;  4PFO A;  3A5Z B;  2CZ0 B;  1UDL A;  1X27 A;  3OB9 A;  1VYV A;  1K8A U;  3TQ7 P;  1M1G A;  1Q95 G;  1H3Z A;  1M9S A;  2C06 A;  2ZPI B;  2KRS A;  3TVT A;  4EMG A;  2CP6 A;  2LDM A;  2SEM A;  1VQK Q;  2KAF A;  2LT4 A;  2ESW A;  4C92 F;  2PVO B;  4ESR A;  3OS1 A;  3QHS A;  5DY9 A;  1K4U S;  1M1K U;  2DNU A;  3CBM A;  1M90 C;  4P5N A;  4M75 B;  4E6R A;  1VQ7 T;  4D8D A;  5GAN 5;  2W10 A;  4MZM A;  2COY A;  2E10 A;  2DIL A;  1WDX A;  2IIM A;  4OB1 B;  3RKY A;  1M3C A;  3EFR A;  2KY9 A;  2BE9 B;  1TWB A;  2M9U A;  3CCQ T;  1B34 B;  1NZ9 A;  5I22 A;  5LJ5 d;  4J9I A;  1VQ7 Q;  1JRI A;  4XTV A;  4MDW A;  3NHN A;  5FWC A;  1ABO A;  4OB0 B;  1WPY A;  4M7A C;  5I2S A;  1VQK A;  2D6F A;  2HL3 A;  3M54 A;  4LNP A;  1TUG B;  2EQK A;  3NTI A;  4AMC A;  2KI7 A;  1RL2 A;  2QQS A;  3M55 A;  1TH7 A;  3FEO A;  3FJ5 A;  4RTY A;  3CCQ Q;  4QQG A;  2BZY A;  3JRZ A;  1I1J A;  3CCE Q;  3VS7 A;  2K5F A;  4F14 A;  5KYY B;  2VC8 A;  1MNE A;  1Q81 C;  3VS6 A;  5AT1 B;  2V8J A;  3A8L B;  3X26 B;  1R77 A;  3BDU A;  3QSU A;  3MP6 A;  1QVG S;  4ANJ A;  2X3X D;  1K8A C;  1B34 A;  3OS2 A;  4XU0 A;  3T9N A;  3LX7 A;  3I56 T;  2DM1 A;  1HD3 A;  5CQX A;  3VS4 A;  3DB3 A;  4A54 A;  1RAH B;  1ZBX A;  1PC0 A;  2DRK A;  3I55 T;  3G71 T;  1RAG B;  1VQ7 A;  3S6W A;  1M1K C;  4JRK A;  1QCF A;  2A08 A;  1QVG P;  3G4S A;  2OAW A;  1HJD A;  3TRE A;  2LQK A;  3R6O A;  2HKQ B;  4MMK A;  4M77 C;  3I56 Q;  3M56 A;  3J80 E;  2MAM A;  2CYZ B;  2LQN A;  1ABQ A;  4A63 B;  1BU1 A;  4E47 A;  3I55 Q;  5A2Q E;  2FPD A;  3CQT A;  3LLR A;  1M8V A;  4LD6 A;  4EDU A;  2GTJ A;  1MMD A;  2XDP A;  4F7U A;  1RLQ C;  2EW3 A;  2JS0 A;  4J6X A;  3C94 A;  3VS5 A;  2A7Y A;  3REA B;  4A4G A;  3V7R A;  3G6E T;  1VQN T;  4JJN K;  3HFO A;  4OMQ A;  2HSP A;  1U06 A;  3A8G B;  4E7S A;  1IGQ A;  3PMI A;  2PVD B;  2ROT A;  1G2B A;  3BW1 A;  2MCN A;  4LD9 K;  2EIF A;  4DOW A;  1YNZ A;  1ZA2 B;  2JM8 A;  4L6V 5;  2H3E B;  4FW2 A;  1GCQ A;  1EIF A;  3I56 A;  4AG2 C;  2QI2 A;  4JJB A;  3H8Z A;  3I55 A;  3G71 A;  3CPW P;  4M4Z A;  4XQ3 A;  4M78 A;  1X01 A;  2DAQ A;  2JZ2 A;  2KNB B;  4LE9 A;  3MEV A;  3QBY A;  2KT1 A;  2DTI A;  3OYN A;  2GFA A;  2XDD A;  2K9G A;  2NUZ A;  2QA4 T;  2EYZ A;  3MO8 A;  2QAZ A;  4FYV B;  3JCM b;  1AWO A;  2FHD A;  4OMN A;  2OI3 A;  2JMA A;  4LN2 A;  1N27 A;  5LJ5 j;  2HL5 C;  2HDA A;  3G6E A;  1VQN A;  1IHW A;  2YSQ A;  2DL7 A;  4KT0 E;  1T3L A;  4OGC A;  3L2R A;  1BI2 A;  4JJC A;  3L2Q A;  1WJS A;  2WSE E;  4M75 F;  1TTH B;  3QPH A;  4Z88 A;  2AKK A;  3L1A A;  3RKW A;  3ULR B;  4C0F A;  2V26 A;  3H0I A;  4IIM A;  4MZP A;  3SFM A;  3HP9 A;  1IZ6 A;  1VQL T;  1UGR B;  1IGU A;  2G3R A;  3QO3 A;  1ARK A;  4M7D B;  2RK1 A;  2DTH A;  4AFZ C;  2WAC A;  3EGD A;  2EGA A;  2JM9 A;  2K57 A;  1RLP C;  4Q5W A;  2EAY A;  2P0K A;  5IXF A;  1VQ8 Q;  4M7A E;  2AKL A;  3UDC A;  3V7S A;  2KXC A;  2LJ3 A;  1VQL Q;  2SRC A;  4OMF B;  3EGX B;  3RKX A;  5J39 A;  2DLP A;  3CC2 T;  1WGS A;  1UGQ B;  4DQ2 A;  2PTK A;  3U23 A;  2QA4 A;  3OMC A;  2FRW A;  1D0Z A;  3M0R A;  5J3B A;  4OP0 A;  1Y96 B;  4J7I A;  2DL4 A;  4XTY A;  5LJ5 e;  4F7U F;  2DTO A;  1X2K A;  5HK0 A;  2LJ1 A;  2HD0 A;  4M7A D;  4RTU A;  1Z9Q A;  3UPU A;  3CC2 Q;  2VAS A;  4JLG A;  2ZPE B;  1BK2 A;  1YP5 A;  1AZE A;  1M2V B;  4FSX A;  4N0A C;  5GAO p;  1Q86 R;  1RAE B;  4OML A;  2EPD A;  2JT4 A;  4QW2 A;  1HSQ A;  3JCM J;  1C1A A;  5IT9 E;  4O6J A;  2IVW A;  1VQL A;  3INZ A;  4QT7 A;  1D0X A;  4N4H A;  5CIU A;  3CCV T;  5KH6 A;  1UGP B;  4J9F A;  4M77 E;  3A98 A;  3EFS A;  1N8R R;  2J06 A;  2QQR A;  4QVZ A;  3OBY A;  2DPP B;  1LNX A;  2EWN A;  1ZBJ A;  3SEM A;  2JTM A;  1I07 A;  2ECZ A;  2H8H A;  3OW2 A;  2O9S A;  8ATC B;  1QLY A;  2XG8 D;  3CCR A;  3CCV Q;  4EPC A;  1VIF A;  1NPR A;  2KBT A;  1ZSZ C;  2YLB A;  1UHC A;  3AT1 B;  4M7A G;  4PJN A;  1QVF S;  2J05 A;  4DBF A;  3SWN B;  1G3S A;  5LJ5 g;  2RJD A;  2XKO C;  3X25 B;  4M77 D;  1KQS A;  1UG1 A;  1FMK A;  3HPW A;  3OSV A;  1SRL A;  2HAX A;  1M1F A;  1GBQ A;  2K3B A;  2DE0 X;  2YT6 A;  1FYN A;  3NTH A;  5CAI A;  2E6Z A;  5A0L A;  1QVF P;  4X1V A;  1P92 A;  2BKD N;  4RCB A;  1PNJ A;  3A8O B;  1B07 A;  4JLI A;  2VYT A;  4JJD A;  2IG0 A;  4PJO B;  3EFO B;  2RI5 A;  2CRE A;  1MMG A;  1YWO A;  1KFZ A;  1YN8 A;  2YUO A;  3GPL A;  1W2B A;  2O9V A;  2EYX A;  4R55 A;  4JRQ A;  2QK0 A;  2CP7 A;  2E41 A;  3L42 A;  4OMO A;  2FYK A;  4M77 G;  2K7A A;  5HY6 A;  1OZ3 A;  2C0I A;  4PLL A;  1G5V A;  1Q86 U;  1UUE A;  2RF0 A;  1WX6 A;  3M0T A;  2DKG A;  4C8Q D;  4AFU C;  4D8K A;  1WNL A;  2AIR B;  5KCH A;  2CP5 A;  2QYZ A;  4PJO A;  2KQW A;  3CBP A;  5KYU A;  4CRI A;  3QXE B;  4BAC A;  2E3I A;  3OYE A;  2E70 A;  1RAI B;  1Y07 A;  3CPF A;  3QG1 A;  4B6M A;  1UJ0 A;  2V8I A;  2PQW A;  5GMK i;  1WHM A;  3O8V A;  1N8R U;  1YBY A;  5HKC A;  1X75 C;  1AWJ A;  1VQM T;  4C92 C;  5CKD A;  1V1C A;  3OY9 A;  2DL3 A;  3MHX A;  5A0G A;  1EFN A;  3V8L A;  4ME7 A;  2DK3 A;  3VS1 A;  3JB9 F;  5KCO A;  2OTJ A;  3UT1 A;  3E1S A;  3S3O A;  3M5A A;  1M30 A;  1PD0 A;  2GQI A;  2RHY A;  3F70 A;  2F5T X;  4VUB A;  1KIK A;  1WHJ A;  4KBM B;  4E7I A;  1H3H A;  3DB4 A;  1TXQ A;  5LJ3 j;  2OJ2 A;  5AYF A;  1YFN A;  3M58 A;  5GMK h;  2EQJ A;  4C5G A;  2KE9 A;  1VQ4 A;  3SHW A;  3TSZ A;  5GAO m;  4XU1 A;  4J5Y A;  3MKD A;  4FT4 A;  5GAO l;  2BTT A;  2EQM A;  3OYB A;  1MMA A;  3L2Z A;  1QCN A;  2RQU A;  2DVJ A;  5GAO r;  4OGE A;  2ZZD A;  1QW1 A;  4E7H A;  3FIF A;  4RMO A;  2EJG A;  1Q86 C;  1X6G A;  3MET A;  1VQ5 T;  3RUX A;  3V8K A;  1O75 A;  3TU4 K;  2JMC A;  4HVW A;  4QVD A;  3ZFJ A;  5IHI A;  3GNF B;  2MWP A;  5FLX E;  3PNW C;  1U5S A;  2EQU A;  4J9D A;  1VQM A;  3SD4 A;  1E7O A;  2VUB A;  3OYD A;  4DBQ A;  3TEE A;  2QAS A;  1N8R C;  2DBM A;  4M7D E;  1EX4 A;  1BI1 A;  2KRO A;  2CSQ A;  1NLO C;  4F04 B;  2QEX T;  1VQ5 Q;  4LDU A;  2XIC A;  1KHI A;  3HKS A;  3JCM e;  3MCA B;  1FX7 A;  5D7U A;  1BCM A;  3L2W A;  3PVL A;  2J6K A;  5CK9 A;  1ZA1 B;  1FMW A;  5FRM A;  2AK5 A;  1XTD A;  2D8H A;  1GBR A;  1OU8 A;  1IHV A;  2JNG A;  4XAX B;  5DLQ E;  1WJR A;  1I81 A;  2CS7 A;  1OUL A;  1KSW A;  1M5Q 1;  2QEX Q;  1WJQ A;  5LJ3 e;  2BE7 D;  4LXC A;  2KXD A;  3I5S A;  5I2M A;  4OVA A;  5FU6 C;  5EG2 A;  3JV3 A;  3C0C A;  2AT1 B;  1PCX A;  1SSH A;  4KGZ B;  1D09 B;  2HNI A;  2W0Z A;  1C0M A;  1VQ5 A;  4FSS A;  3M0U A;  1XNI A;  3FDR A;  2EVR A;  2ZAE A;  3GNG A;  2BIV A;  4Z89 A;  4LDY A;  4PJM A;  4PJO F;  4C5H A;  2A37 A;  4FIB A;  4BY6 C;  2KRN A;  2LRQ A;  2R5A A;  2IPO B;  2L3S A;  4KUI A;  3KXT A;  1TUC A;  3G4S T;  3GBQ A;  4XK8 E;  3JCM g;  2L8D A;  4X9D A;  4A4F A;  1PD1 A;  2RHU A;  1PSF A;  2QEX A;  2JTE A;  1T0H A;  1LJO A;  2E6N A;  4AT1 B;  2F2W A;  4M7D G;  1OPK A;  3C12 A;  4OB2 B;  2R58 A;  4J9E A;  3H0H A;  4PJL A;  1R0C B;  3H0F A;  3CEY A;  5L23 A;  5LJ3 g;  3G4S Q;  3JB9 H;  1E6G A;  3KFV A;  4ZTJ A;  4NL2 A;  4DA4 A;  2V1R A;  4EMK B;  3RIR A;  1VQ6 T;  2CGH A;  5GAM j;  2A0F B;  3AHU A;  1OX8 A;  2GF7 A;  3NPF A;  2LNV A;  2EGC A;  2F5K A;  4HVU A;  2C0T A;  1WQ7 A;  1K1Z A;  4JRP A;  3P8B B;  3RES A;  5KYW A;  2XI9 A;  4F7U B;  2KT8 A;  4ATO A;  1PKT A;  1EZZ B;  1BI3 A;  3E9G A;  5GAN e;  3OYA A;  1UE9 A;  4C92 E;  2RJE A;  1VQ6 Q;  1HK9 A;  3CXC A;  4OMP A;  2XDB A;  2WSF E;  2E12 A;  3CCM T;  1TS9 A;  1K9M R;  1OZ2 A;  4M75 C;  3CME T;  4C0Z A;  1UGV A;  1ZX6 A;  1LVK A;  2CUD A;  4EIK A;  4EMK A;  3MEU A;  1Z9Z A;  2NUP A;  4FM4 B;  4LDW A;  1VUB A;  2VKN A;  1SKU B;  1YWP A;  1T3S A;  3PIO A;  3EGU A;  4J9C A;  2CDT A;  3FJP A;  1PG5 B;  1JBM A;  3G71 Q;  1I5O B;  1QP2 A;  4IUV A;  3CCM Q;  2A3L A;  1XJW B;  1PWT A;  2FZG B;  2J6O A;  4C92 D;  1Y0M A;  3UA6 A;  1W4S A;  1I4K 1;  3E9F A;  2FZK B;  3HL8 A;  5A0D A;  2D0Q B;  1X43 A;  4M78 B;  1I8F A;  1VQ6 A;  4FT2 A;  4CC7 A;  2ZPG B;  3NGP A;  3G1J A;  5GAM e;  2I0N A;  8AT1 B;  1WQW A;  4DBR A;  1WYX A;  3KUF A;  2YRC A;  4K11 A;  2DL5 A;  1N6A A;  4HCZ A;  4YTL A;  4TVR A;  1ZSG A;  1YI2 A;  1R8O B;  1YJW T;  3G6E Q;  1AZG B;  4C8Q A;  1VQN Q;  5LL6 S;  4PNO A;  1KJW A;  4WTO B;  2EJF A;  4LDV A;  5KYN A;  2MWO A;  1UEC A;  3CCM A;  2EQI A;  3CME A;  4IIO A;  4C92 G;  1E6H A;  3S3M A;  5KE3 A;  3QJY A;  1YJW Q;  4J9B A;  1JXM A;  2RQV A;  2DZC A;  3LH5 A;  2DO3 A;  3EH1 A;  1K0S A;  1W1F A;  1SF9 A;  3OYG A;  3M0P A;  3VUZ A;  4A4H A;  4BE2 A;  2YRD A;  1ZUK A;  3VS3 A;  1GCQ C;  1M2O A;  2KRM A;  1QWE A;  2L2P A;  3EGD B;  3RR6 A;  4MZT A;  3RMQ A;  3E19 A;  3DLL A;  2CH4 W;  2Z0W A;  5GAM g;  1LPL A;  4XTZ A;  3NTK A;  4CC2 A;  2RJF A;  3EHQ A;  2KK4 A;  4CC3 A;  3I5R A;  4FYW B;  4C5E A;  2PZ1 A;  4Z02 A;  2QA4 Q;  4BDZ A;  1OPL A;  1MHN A;  4FL6 A;  1WHG A;  5KE2 A;  2DXC A;  2YRV A;  1D1C A;  2LVM A;  3C95 A;  3LGL A;  3MEW A;  1YJW A;  3V8J A;  4RTW A;  1TG0 A;  1D1A A;  1RAF B;  4LUE A;  2OAU A;  1YHQ T;  1ZUU A;  3Q1J A;  4R56 A;  3H41 A;  2QDL A;  2O88 A;  2RHZ A;  2H3J A;  2KSS A;  1V29 B;  2DJZ A;  2HBW A;  4PKC C;  4IUU A;  1IXD A;  2FPE A;  1M3A A;  2E5Q A;  1SPK A;  4E7K A;  2VXF A;  5GAN 3;  3CCR T;  2YLC A;  3URG A;  1AOJ A;  5GMK m;  1WHL A;  2DYI A;  5GMK l;  4X34 A;  3P8H A;  2RD1 A;  5ECA A;  3QKJ A;  4BE1 A;  4C0D B;  3MPU B;  2BUD A;  2RO0 A;  1IRX A;  3P8D A;  2V1Q A;  4N0A A;  3H6Z A;  2EYQ A;  4RG2 A;  4UC4 A;  2B8A A;  3OYJ A;  3CCR Q;  1KHC A;  2YUP A;  3VRZ A;  4HKE A;  4DBH A;  3JCM d;  1JQQ A;  1CKA A;  3HRU A;  1WA7 A;  5GAN 6;  1VA7 A;  1K9M C;  2QTV A;  3SB2 A;  1KK7 A;  4IUQ A;  4M75 E;  2F2X A;  4QQD A;  4KGX B;  1JO8 A;  3OW2 S;  2FVU A;  1QVP A;  1YCY A;  1YHQ A;  3VJP A;  2E65 A;  5LJ3 d;  2WSC E;  2O01 E;  4C8Q F;  4M7D C;  3HFN A;  2RQW A;  4J83 A;  2HQH A;  1ZSZ A;  3BFM A;  1KQS S;  3MP8 A;  4E2F B;  3REB B;  1F1B B;  2M0O A;  2M16 A;  1D3B A;  4FYX B;  4RUG A;  3WVD B;  3GIB A;  3OW2 P;  4D6W A;  3E2U A;  1AT1 B;  3O5Z A;  4M78 F;  2FL7 A;  4M75 D;  3WXM B;  1M3B A;  2K6D A;  4OB3 B;  2K2V A;  3IQL A;  1CSK A;  2FRY A;  2JTF A;  4ELY C;  2RI2 A;  1KQS P;  2CP3 A;  4BDY A;  3KBG A;  4Y28 E;  1U8R A;  1HYO A;  1N5Z A;  4XTW A;  2OTL T;  2X4Y A;  4N4G A;  4PK4 A;  2EKH A;  1I5L A;  3ER0 A;  2ATC B;  2GNC A;  3OYY A;  4V2S A;  1W2B S;  4F7U E;  2NWM A;  4KRT A;  4L59 A;  3G7Z A;  1JJ2 A;  1BBZ A;  1VQ9 T;  2P4R A;  2RK2 A;  2QQA A;  1M27 C;  3ASK A;  1QCO A;  2NUT B;  2ROL A;  1WHK A;  1KQ2 A;  1Y7X A;  2OTJ T;  5KYU B;  1NEG A;  1NYF A;  2OTL Q;  2FPF A;  4ELZ C;  1W2B P;  4KGV B;  4M75 G;  1RAD B;  4RCC A;  4ZGD B;  1VYU A;  1VQ9 Q;  1VQP T;  3EG9 A;  1AHJ B;  2VXE A;  1MV0 B;  1ZHI A;  1YIT T;  1GRI A;  2DET A;  3VUB A;  1VQ4 T;  3VV0 A;  1WLP B;  5GAN d;  5LJ5 h;  3QUI A;  2OTJ Q;  1GFC A;  1W6X A;  4HT8 A;  1VOM A;  2P4T A;  4NL3 A;  2EGE A;  3HSB A;  2XID A;  2YUQ A;  2KEA A;  2AZS A;  2DVE A;  2ABL A;  1YIJ T;  2NUT A;  1OQK A;  4HT9 A;  5HK3 A;  3SWN C;  1VQP Q;  4XU2 A;  4A53 A;  2QG9 B;  2XK0 A;  4BB7 A;  4C92 A;  2M0Y A;  4C0G A;  1YIT Q;  5D6X A;  5I21 A;  1FXX A;  3EG0 A;  3OQ5 A;  2VB6 A;  5GAN 7;  1VQ4 Q;  3OYM A;  2OTL A;  4L5G A;  3CMA T;  3LWH A;  4F16 A;  1WXB A;  5GAO q;  4WCI A;  3PT9 A;  3CCS T;  3OMG A;  3OS5 A;  1AVZ C;  4J9G A;  4DOV A;  1YIJ Q;  1VQ9 A;  3QWY A;  1T0J A;  2LQW A;  3GLX A;  4F7U G;  3JSC A;  4LUD A;  2QXF A;  2X9H A;  2MF2 A;  4BI8 B;  2CH4 A;  4PJO C;  1OOT A;  2HQX A;  4GLK A;  5GAM d;  1IB8 A;  1VQM Q;  4PLI A;  1VQO T;  3CC7 T;  1VQP A;  1ZUY A;  2DX1 A;  2MOX A;  3PTA A;  1JB0 E;  2I2L A;  2RN8 A;  2QQ9 A;  1YIT A;  3QDF A;  1KC8 R;  2JN0 A;  2DMO A;  2VWF A;  4WF2 A;  4JS5 A;  3FRN A;  2VV5 A;  3HTR A;  1M4Z A;  5GJW B;  2K5I A;  5FU7 B;  3TSW A;  2D8J A;  3MP1 A;  2DL8 A;  1I0C A;  1YIJ A;  3OYL A;  3CC7 Q;  2DBK A;  5LJ5 f;  3VS2 A;  3M57 A;  3LW5 E;  4CI0 C;  4X9C A;  2DF6 A;  2RMO A;  3DKM A;  4QKU A;  2RB6 A;  1U3O A;  4J6W A;  2ED1 A;  2X51 A;  5IHK A;  2P84 A;  4HCB A;  1PRM C;  2Y4X A;  3CMA A;  2HCK A;  5CKB A;  4B9W A;  1JU5 C;  1ZLM A;  2RI3 A;  4PL6 A;  3QDR B;  3CCS A;  2LTO A;  2KMT A;  2DA9 A;  5KYX B;  1N9S A;  2D9T A;  3X28 B;  1PHT A;  4KUL A;  1KG1 A;  1Y57 A;  2FZC B;  5L8R E;  1BIB A;  1S72 A;  3SDZ A;  1QKW A;  3RMS A;  2HKN A;  6AT1 B;  3EH2 A;  1YJ9 T;  4BD3 A;  5HCK A;  2KR3 A;  2X3W D;  2G6F X;  4JZ4 A;  2R5M A;  1WI7 A;  1VQO A;  4MML A;  3CC7 A;  3CCU T;  2L89 A;  2DXT A;  2RQT A;  5FRN A;  4NOY A;  1K76 A;  3D7S B;  3GP8 A;  4ZGE B;  3EG1 A;  1NG2 A;  5DM7 R;  1G83 A;  2X4X A;  4M7D D;  1J3T A;  1YJ9 Q;  3J7A F;  2RNA A;  1WZO A;  5KYX A;  4ZN3 A;  5GAN j;  4Y91 A;  2CKK A;  3CCU Q;  4JS4 A;  4R0K A;  2RA2 A;  2VGM A;  5IN1 A;  4JPB W;  3JB9 D;  2PUK B;  4HVV A;  1Q82 R;  3CCJ A;  3UWN A;  1IO6 A;  2X4J A;  1WHH A;  4Y92 A;  3I35 A;  1KC8 U;  5IHN A;  2M51 A;  4M7A A;  2L5Q A;  2DEQ A;  1U1T A;  2HMA A;  2D1X A;  2F1L A;  2DYB A;  2Y4Y A;  3THK A;  5KYW B;  4IUT A;  2E1H A;  2QTX A;  4KUD K;  1YJ9 A;  2O4X A;  4ZGJ B;  5FWB A;  4QQ6 A;  2CP0 A;  4M77 B;  3LYI A;  2J6F A;  2LMJ A;  1G3T A;  3N5B B;  3CCU A;  2KGT A;  4Z8A A;  1WXT A;  3CXC S;  1UGS B;  3CCE T;  3HHT B;  1OX9 A;  2NUP B;  2M02 A;  2K3Y A;  3JB9 G;  2MPX C;  2PVG B;  2LNH B;  2BZ8 A;  3VRY A;  4ZNX A;  2RQR A;  2R57 A;  2D0N A;  2RH2 A;  2E64 A;  4KH0 B;  1SSF A;  1YI2 T;  4M75 A;  1NPP A;  5CKF A;  2Y90 A;  2XD0 A;  2GGR A;  1B3Q A;  3CXC P;  1VYT A;  1G3Y A;  2CZ1 B;  2DEU A;  5CKH A;  1G3W A;  4M77 A;  3JCM h;  2LCL A;  2HSE B;  1LOJ A;  4PJO E;  3H9N A;  1YI2 Q;  2F69 A;  5IXB A;  2YUN A;  2GTO A;  3JB9 J;  2E3H A;  4C8Q B;  2K3X A;  2FB7 A;  5LJ3 h;  1KC8 C;  3CME Q;  2K5L A;  3X24 B;  4F17 A;  4QVC A;  1Q7Y R;  2DJQ A;  1QVG A;  1YJN T;  1Q82 U;  2EBP A;  2E5K A;  5CO7 A;  4J7F A;  5KYY A;  1SHG A;  3CCQ A;  2EYY A;  4GBQ A;  4PJO D;  3CCE A;  1LCK A;  1PRL C;  3NMZ C;  1X6B A;  2RM4 A;  4EMK C;  1X2Q A;  2DXU A;  3R6N A;  2K79 A;  1QMC A;  5I11 A;  1XQH A;  2MYS A;  5GAN g;  2DFU A;  4HCK A;  1NM7 A;  1YJN Q;  2YXY A;  2JVV A;  1DJ7 B;  2LP5 A;  3JCM V;  1PM3 A;  2XMF A;  2ZPH B;  1TUD A;  3DLM A;  4J6Y A;  1AD5 A;  2LC4 A;  3RBB B;  3CPW S;  2X4W A;  1GL5 A;  2EJ9 A;  4KH1 B;  1IRE B;  4E7L A;  2HZY A;  2ED0 A;  3BDL A;  1H64 1;  2CUB A;  4J9H A;  3MEA A;  3VYG A;  4IUP A;  3JCM f;  2CZ7 B;  3EAE A;  1RI9 A;  3M0Q A;  5GJV B;  2P0Q A;  2VGN A;  3LGF A;  1K9A A;  4RTZ A;  2AHJ B;  4PJO G;  2JUF A;  1RI0 A;  2HBP A;  4PJJ A;  3GOX A;  4M7A F;  3A8H B;  1X6O A;  4RTV A;  3CPW A;  4C8Q C;  3QZ9 B;  4MDX A;  3HRT A;  4CC4 B;  5EC7 A;  1S1N A;  3VYH B;  1VIE A;  2QQB A;  1YJN A;  5GAN 2;  1K9M U;  5LJ3 f;  2JXB A;  4EMH A;  1NE8 A;  1BIA A;  2LX9 A;  4IUR A;  1NEB A;  1QKX A;  5GAN h;  1OV3 A;  1RUW A;  4M78 C;  1MND A;  2QGG A;  4XTX A;  3PE0 A;  1KD1 R;  4A4K A;  3OYK A;  2NYS A;  4AFQ C;  1Q82 C;  4IKF A;  3M4Y A;  3QJ6 A;  2YDL A;  1UTI A;  2CP2 A;  4E7J A;  4BE0 A;  1PSE A;  3A8M B;  1Q7Y U;  4HCC A;  1TSF A;  5CKE A;  3PIP A;  4AFS C;  1UEB A;  2K4Y A;  1VQ8 T;  5CQY A;  1K0X A;  2GQV A;  3QWX X;  2GCX A;  1TOV A;  2OX7 A;  4M77 F;  4BUG A;  3OA6 A;  3JCM W;  3X20 B;  3QII A;  3UA7 A;  1YHQ Q;  2L0A A;  2XHC A;  2JW4 A;  4JZ3 A;  4OMM A;  3C4S A;  5GAM h;  4A4E A;  9ATC B;  3PVQ A;  2MIO A;  5DLO A;  3RNJ A;  4XTU A;  1OU9 A;  1NJI R;  1ZSZ B;  4NS5 A;  4RTT A;  1MV3 A;  1M8M A;  2LZ6 B;  1D3B B;  1BB9 A;  2L3P A;  4LDX A;  2ZGW A;  3FLG A;  1X69 A;  5GMK j;  4RKU E;  4JDS A;  3OS0 A;  3OYF A;  5GAN f;  3J81 E;  2QGF B;  1OEB A;  4M7D A;  1WXU A;  1MUZ A;  1K73 R;  2COW A;  1OYX A;  1W70 A;  4HXJ A;  1AWW A;  3ME9 A;  1UB4 A;  2FO0 A;  1BYM A;  2ZPF B;  3M53 A;  4J8O A;  2RPN A;  4JRI A;  3HRS A;  4C5I A;  2GFU A;  3EG3 A;  2KDS A;  1VQ8 A;  1D1B A;  3EGX A;  4OF1 A;  1FWZ A;  1Q7Y C;  2EKO A;  1KD1 U;  3ZL7 C;  2LX7 A;  3CBO A;  3FB9 A;  5CCA A;  2KVQ G;  2O2O A;  3JAM E;  1Y96 A;  3CCL T;  1KQ1 A;  4O5V A;  2HEQ A;  3CC4 T;  2YWW A;  1JJ2 S;  5FW9 A;  3M4G A;  1R0B G;  3QYG B;  4XU3 A;  3EG9 B;  4C0D C;  5GAM f;  1YCS B;  4PFP A;  3JB9 I;  4GY5 A;  1M2V A;  3CC2 A;  1MGQ A;  3V7C A;  3CCL Q;  4ZTF A;  3VU3 C;  2DZ9 A;  1JJ2 P;  3CC4 Q;  2LCC A;  3VS0 A;  1GCP A;  1JEG A;  5GMK e;  2KYB A;  4JUV A;  1NYG A;  2LT1 A;  2ZPB B;  2COZ A;  3OYC A;  1UHF A;  1NBE B;  3NFC A;  2PNI A;  3WVE B;  2DIQ A;  3OBW A;  4FW1 A;  4B9X A;  1B7T A;  4C92 B;  1SEM A;  2BZX A;  1QVF A;  1BI0 A;  1H92 A;  1NJI U;  4ORZ A;  2RJC A;  5CVI A;  2L3R A;  2LCS A;  2DIG A;  1M90 R;  4C8Q E;  2YHT A;  2JOY A;  1AWX A;  2KYM A;  1GFD A;  2A36 A;  3SWN A;  2J7I A;  3CCV A;  2LJ0 A;  7AT1 B;  2B86 A;  1FMV A;  1NLP C;  3QZ5 B;  5GAN 8;  1K73 U;  2MMP A;  3CCL A;  1C6V X;  4BI3 A;  1WFW A;  3CC4 A;  3ZEH A;  2RHX A;  4M78 E;  2FEI A;  1KD1 C;  3EHR A;  3PGG A;  1SHF A;  3QYH B;  2RHI A;  3FC3 A;  1UFF A;  4II1 A;  5GAO n;  1QQJ A;  2C0O A;  1TU0 B;  1O9S A;  3OYH A;  5M9O A;  3PFS A;  3L2V A;  1PKS A;  3CD6 T;  1RAB B;  2JS2 A;  4RTX A;  3TCJ A;  1D0Y A;  2MK5 A;  2X35 A;  3EFO A;  3S3N A;  2A28 A;  2DD5 A;  2FG0 A;  2CT3 A;  2JJ9 A;  1SG5 A;  3I9Q A;  4RG8 A;  2DXB A;  1Q81 R;  2L3Q A;  1S72 T;  4M78 D;  1Y71 A;  2AZV A;  3LH0 A;  4FCY A;  3JCM Q;  2CSI A;  5D6W A;  1AEY A;  4GLM A;  4M7D F;  3CMA Q;  3CD6 Q;  2MI6 A;  5C0M A;  1K8A R;  2VVK A;  4AG1 C;  1WIE A;  3CCS Q;  3JCM X;  2DD4 A;  1BCO A;  1QP3 A;  4DEX A;  2O31 A;  1U1S A;  3RER A;  2PUO B;  3BE3 A;  1RAA B;  2CZ6 B;  3OYI A;  3M59 A;  4N4I A;  2K2M A;  1JXO A;  1MMN A;  1XOV A;  1UJY A;  5FRO A;  3VKI A;  2E4H A;  3A1P A;  1S72 Q;  5C6S A;  3LWI A;  3EG2 A;  2HQE A;  3PMT A;  1NJI C;  1M1K R;  1H8K A;  2XU8 A;  4C8Q G;  2GBQ A;  3UAT A;  4DEY A;  3UF4 A;  1VQO Q;  5D6Y A;  1V76 A;  3RDV A;  3M0S A;  4BI4 A;  4FU6 A;  3ZBD A;  3MJX A;  4FYY B;  1GXI E;  2EFI A;  1ACM B;  5FU6 B;  1K73 C;  3L2U A;  3CCJ T;  3JCM P;  5CR2 A;  4M78 G;  4HA8 A;  1M90 U;  4E7Z A;  3CD6 A;  1G8X A;  3OSS C;  4PFZ A;  2V8K A;  4ZN1 A;  4BY6 B;  2LQ8 A;  5J26 A;  3CCJ Q;  3GF5 A;  2F2V A;  2EYW A;  2ZCF B;  2DER A;  2NLU A;  3M9Q A;  1A0N B;  5IAY A;  2DRM A;  2QDY B;  1RAC B; 
#chains in the Genus database with same CATH homology
 3CCS Q;  1VQO Q;  2QEX Q;  1VQL Q;  3CME Q;  1VQ5 Q;  1QVF P;  1YIJ Q;  3CCL Q;  3CCR Q;  1Q82 R;  1YJW Q;  1Q7Y R;  3CC7 Q;  1JJ2 P;  3G6E Q;  1VQP Q;  3CC4 Q;  1QVG P;  1VQ9 Q;  1YJN Q;  3CC2 Q;  1VQN Q;  1YHQ Q;  1N8R R;  1VQK Q;  3CCJ Q;  1YJ9 Q;  1KC8 R;  1YI2 Q;  1M90 R;  1Q81 R;  1S72 Q;  1YIT Q;  3I56 Q;  1Q86 R;  3G4S Q;  1KQS P;  2QA4 Q;  1M1K R;  1VQ4 Q;  1KD1 R;  3CPW P;  3CXC P;  1VQ6 Q;  3I55 Q;  2OTJ Q;  1K9M R;  3CCQ Q;  3CMA Q;  3G71 Q;  3OW2 P;  3CCU Q;  1VQ8 Q;  3CD6 Q;  1K8A R;  1K73 R;  2OTL Q;  3CCE Q;  3CCM Q;  1VQM Q;  1W2B P;  1VQ7 Q;  3CCV Q;  1NJI R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...