1KQSP

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1kqsP00
3CMAQ 1K8AR 3CCLQ 3CCRQ 1NJIR 1QVFP 1YITQ 1KD1R 1N8RR 1VQ6Q 1YHQQ 1Q86R 1Q82R 1KC8R 1QVGP 3CC7Q 3G6EQ 2QEXQ 1VQ9Q 1VQPQ 3G4SQ 3CXCP 1K9MR 3CCMQ 3CCUQ 3CCJQ 1VQOQ 1VQLQ 3CCQQ 1KQSP 1YI2Q 1VQ7Q 1YJ9Q 3I55Q 1JJ2P 1Q81R 1YJNQ 1M90R 3I56Q 1YJWQ 1VQNQ 1VQ5Q 3CD6Q 3CPWP 1Q7YR 1VQ8Q 3CCSQ 3CMEQ 3OW2P 1VQKQ 2QA4Q 1K73R 1YIJQ 3CC4Q 3G71Q 3CC2Q 1VQ4Q 1S72Q 1VQMQ 1W2BP 3CCEQ 3CCVQ 2OTJQ 1M1KR 2OTLQ
chains in the Genus database with same CATH superfamily
4RTWA 2CZ0B 1XQHA 4M7AE 4KBMB 3RBBB 4RG8A 2ABLA 1CKAA 3VUBA 2LQ8A 2DF6A 1AD5A 1N5ZA 3VYHB 2X4XA 4DQ2A 2DILA 1KSWA 3CCQT 5GMKj 2OI3A 2L3QA 3TREA 1GFCA 3RKYA 1YJNA 2PZ1A 2KK4A 2HKNA 1VQMQ 2VASA 3CCEQ 1T0JA 1YJWA 2M0YA 2R5AA 1BI1A 3PFSA 1NM7A 2FHDA 4M77F 4JZ4A 2R58A 4BUGA 2HEQA 4IUQA 5LJ5h 3OYIA 3OYGA 4AFUC 2F69A 3CCUA 3SB2A 2NLUA 2PQWA 1ZBJA 4ZGJB 3BDLA 4AFQC 1AZEA 3HHTB 4L59A 2BZYA 1ZHIA 2NUTB 1QCFA 4HCCA 2OTJA 4C8QD 1N8RC 3EGXB 1IHVA 2QEXT 1LVKA 4XU1A 4CRIA 3C95A 2EVRA 5LJ3g 4LDXA 3G4ST 4M78A 5CCAA 1K9MC 1YI2T 4KH1B 1WQ7A 2DL3A 2JN0A 2SEMA 1H92A 1AOJA 2RF0A 2LCCA 3X28B 2HL3A 1U8RA 4Q5WA 1D1AA 2D8HA 3ZBDA 4KUIA 2YUOA 3MP8A 4JLGA 2SRCA 4MMLA 3TSWA 2LQWA 1MMDA 1VQLQ 5C6SA 3CCJT 3L1AA 1RAGB 2K3XA 4KH0B 4ZGEB 3DB4A 3S3NA 4OB0B 3I56T 2GFUA 2GTJA 1OV3A 3H41A 1W2BP 4J9DA 3JB9J 2RHUA 4DEYA 3LGLA 1RAIB 3CCLQ 1VQ4T 4BE0A 2FRYA 4AFZC 3ZL7C 1Q82R 3DB3A 2Y4XA 4MZPA 4PJOD 2KY9A 5CKHA 4DA4A 4FW2A 1NYFA 3RKWA 5GAMf 2D6FA 4HVWA 2DD5A 4M77D 3ZFJA 2AHJB 3X24B 1RUWA 5D6XA 2KI7A 4J6YA 3I9QA 2ZPGB 1WXTA 1X27A 1JU5C 1WHLA 2XDDA 2DTOA 2BTTA 4GLMA 4M78F 5KCOA 2K5IA 3CC2A 1WNLA 1IGUA 1NEGA 4RTZA 1QMCA 3DLLA 1A0NB 4ZTJA 1YJNQ 3QZ9B 4LE9A 2EQIA 2LX7A 5KYXB 5GANf 4N4GA 4JDSA 5GAOq 2DJQA 2P4TA 4J9CA 1YIJT 1FX7A 2EKHA 4PL6A 2LVMA 2HQHA 4FM4B 2LJ0A 2XI9A 1I5LA 2CP5A 1IXDA 1UE9A 5GAOr 1VQ9T 3CC7A 3D7SB 4FSSA 2JVVA 1Q7YR 2A0FB 2FO0A 1VQNT 1AEYA 4E7LA 2F5KA 2COWA 3L2WA 2LNHB 3OA6A 4EDUA 2P84A 2E3IA 1YITA 4AT1B 3CXCP 1UECA 1OX8A 1RAHB 7AT1B 4OGEA 2X4YA 1M4ZA 5M9OA 3EG9B 1D1CA 3PIOA 4O6JA 4Y92A 1WYXA 1SSHA 2PUOB 3MEUA 2GQVA 5LJ5j 2K5LA 3HFOA 5J39A 3F70A 4KT0E 1GL5A 2E5QA 1I8FA 4M75C 2E6ZA 2FPFA 2NUTA 3OYYA 2RMOA 1QVGP 1RI0A 1X75C 2EYYA 3EGXA 5KYWB 3PMTA 4C5EA 2DIQA 3UT1A 3M4GA 2V8KA 1EZZB 2QK0A 1X69A 3JCMf 1KHCA 3CMEA 2V1RA 2B86A 5GAOm 2KVQG 2KXCA 2DL7A 5GAN7 2WSFE 1HSQA 4QKUA 1OPKA 2P4RA 2XU8A 2CT4A 1N9RA 3MEWA 1U3OA 4M75B 4JS4A 1ZUKA 1MNDA 2EIFA 2Y4YA 3HRSA 4ESRA 4C92E 1UFFA 1Y07A 4GLKA 1PRMC 2JXBA 1QWFA 1S72A 1GXIE 2CZ7B 1GRIA 2BUDA 5CK9A 1JJ2A 2XDBA 4F7UB 3L2ZA 3CCMQ 3META 3OB9A 5D6WA 2VVKA 2NUZA 1QKWA 3EH2A 4M75G 3QO3A 4BI8B 4II1A 4RCCA 3UPUA 1X6OA 3EG1A 3GPLA 5LJ3e 3PIPA 4CC2A 3VS6A 4WF2A 2AK5A 2H3EB 2K6DA 4M7DD 3J80E 4X1VA 4PJNA 4XTZA 3REBB 4F7UG 2D8JA 4J7FA 3OS1A 2O88A 3RDVA 3OMCA 1I1JA 2FRWA 3JV3A 5KE3A 5KYXA 3WVEB 8AT1B 3OS5A 4OGCA 2BZXA 1M1KR 4JJBA 4OB1B 4J9BA 1I0CA 1GFDA 3C12A 4X9DA 4ELYC 5C0MA 3G1JA 3CMAA 1KD1C 3E9FA 1VQ6A 2QAZA 4TVRA 1Q7YU 1KQSP 2XDPA 1D0YA 3VS3A 3O5ZA 5CO7A 2YRDA 2J6OA 3JB9G 4LD9K 2V26A 1ABQA 5HCKA 2GF7A 2GNCA 2AT1B 2ED0A 2KT8A 3CCRT 2E12A 2PVOB 3RMSA 1YHQA 4J83A 2FEIA 1OPLA 1ZSGA 2NYSA 5CIUA 1RI9A 1VQPT 2ZPFB 1F1BB 3EG9A 1PHTA 1VQOA 1RACB 1IB8A 1E6GA 4ANJA 1U1TA 1QVPA 3VS1A 4Z8AA 2K3BA 4M7AD 1T3LA 2VWFA 3QDRB 2E70A 4FCYA 5KYWA 2VYTA 1OYXA 1W2BS 4IURA 2JJ9A 1PG5B 1RADB 3MEAA 1QQJA 3C0CA 2K7AA 1YJ9A 3CD6T 4E7HA 1J3TA 4KRTA 2L0AA 1QVFP 4MZMA 4IIMA 1XOVA 2W10A 2HBPA 1QLYA 4FYXB 2JS2A 4M78E 2YWWA 3I55Q 4MMKA 2KRMA 4FYYB 4PKCC 1G2BA 2GFAA 1X43A 4C5HA 1UHCA 5HK0A 4M75A 2A7YA 3V8KA 2QA4Q 1K1ZA 4CC3A 5FWBA 1B7TA 2K5FA 1AT1B 1UDLA 3CCVA 1XNIA 2VXEA 4FL6A 2JUFA 4F7UA 4EIKA 2DEQA 3EGDB 4HCKA 3NTIA 1M2VB 4BI3A 1KHIA 2JNGA 3R6OA 1RLQC 5A0DA 3OS0A 4OF1A 3EG2A 5GAN8 1FMVA 4K11A 1K73C 2DIGA 4B6MA 1WZOA 1VQMA 1JQQA 1WIEA 3OBYA 3CCEA 3E19A 1NPPA 1KC8C 3JCMP 1ARKA 2DZ9A 1Y0MA 2KYMA 5IHIA 1Q81R 4M4ZA 2QASA 3QSUA 3IQLA 1BB9A 3FIFA 1M1KU 3QIIA 1M5Q1 1VOMA 3UA7A 4BACA 1SPKA 4PLLA 4N4HA 2EJGA 4PJJA 1H8KA 4J9IA 2DXCA 2DO3A 2ZZDA 2O9SA 4NOYA 3WVDB 3QHSA 3MHXA 1MV3A 2WACA 1WHHA 5GJWB 1AWWA 2LNVA 3V7CA 4EMKC 5KYUB 1TU0B 4BI4A 2L3RA 4PFOA 3M55A 4FU6A 4AG1C 1QVGS 4LN2A 2RNAA 1TXQA 1BKBA 4F7UF 3M0UA 3JCMQ 1X6BA 2IPOB 4HKEA 1VQ8T 4OMPA 1G5VA 1K8AR 3G71T 1N8RR 4OB2B 3EFOB 2Y90A 4LXCA 2PVGB 1VA7A 1TG0A 5GAN4 1K9MR 2XHCA 4LD6A 3RUXA 2DFUA 1YJ9Q 1IZ6A 1MUZA 2YHTA 2KDSA 1KQ2A 2JMCA 2A28A 1VQKQ 1G3SA 1P92A 2JTMA 2LQNA 5I22A 3OMGA 2KT1A 3UDCA 4JRQA 5A2QE 1I4K1 3NTHA 2DTIA 2LC4A 3CCLA 1M3AA 4EMKB 4RMOA 4MDXA 2CYZB 1D09B 4IUUA 3EFSA 3CPWP 4QVZA 3PE0A 4ZN1A 1YJWT 1VIFA 2RHZA 2X9HA 3T9NA 1HD3A 2KRNA 3M0PA 3NHNA 3H0FA 3U23A 9ATCB 2GGRA 2EJFA 3VYGA 1D0ZA 2NUPB 1ZA1B 2JT4A 3JCMJ 2QQAA 4JRIA 4X34A 3CCUT 4QT7A 1W2BA 3TQ7P 5I2MA 3EG0A 2RQRA 2L89A 5GAMg 2OTJT 1VUBA 1TUDA 4RTYA 1KG1A 5LJ5f 1TTHB 3EGDA 1ACMB 1SEMA 1M2VA 1VYUA 2DJZA 1K0SA 4DEXA 2K3YA 2LTOA 1KQSS 4F14A 3JCMc 2D1XA 1Q81U 5HKCA 3G6ET 1M30A 2COZA 3FJ5A 5GANg 4P5NA 3LX7A 3CCVQ 1BIBA 2FZKB 2RO0A 1PM3A 2MI6A 3HPWA 4C92D 3CBPA 5FWCA 1JJ2S 2DERA 1JO8A 1TWBA 1NBEB 4B9XA 2ZPEB 2FZCB 5KYUA 3KXTA 2C0TA 3VU3C 5IH2A 2JS0A 4GBQA 2EQUA 2IIMA 1K8AU 3OW2P 2RHIA 1WGSA 1C0MA 3CPFA 3CC4Q 2K2MA 2LCSA 3CC2T 5FW9A 3EFOA 3CXCA 1KQ1A 1K9MU 2ESWA 1O75A 4C0GA 1WXBA 1X01A 3S6WA 1ZQ1A 2DE0X 2QEXA 4D6WA 1IO6A 2CT3A 2DZCA 2RD1A 3MP6A 2J6KA 2CP0A 3P8DA 3VV0A 5DM7R 1QVGA 4R56A 3HL8A 4RKUE 4D8DA 1WPYA 3ME9A 3KUFA 4EMKA 3TU4K 3CC7T 5CKBA 3LW5E 2LJ1A 2DBMA 1Y96B 1AZGB 3JCMg 2MWOA 2H3JA 2VB6A 1UEBA 4JPBW 3UA6A 3CCMA 3CCSQ 4JRKA 4AMCA 4D8KA 5KYYB 4J9FA 5DLQE 1WQWA 2OAWA 2CS7A 2ROLA 2E6NA 1B3QA 1YITT 2A3LA 1HXDA 2EW3A 2MPXC 2NUPA 3PGGA 2DLPA 4ZTFA 1FMKA 4N0AC 1VQ5Q 4RG2A 1PNJA 3HRTA 5LJ3f 2NWMA 2ZAEA 5IXBA 1TUCA 3GP8A 2B8AA 5AT1B 2W0ZA 2YLCA 3H6ZA 5GAN2 5DLOA 5LJ3h 2KE9A 2CZ6B 4FIBA 3CCQQ 1QCNA 1BCOA 2A36A 2IVWA 2QGFB 2EPDA 4M75E 5GMKm 2YSQA 1HYOA 4KGVB 4OP0A 3CMET 2MOXA 5CQXA 1KD1R 2OAUA 3EAEA 1YIJA 3VS4A 2OTLT 4F7UE 2DVEA 4LDWA 1AWOA 2CREA 1O9SA 4M78D 3OYDA 2LDMA 4JS5A 5GAOl 3QJYA 1JEGA 2YLBA 2ZCFB 4XU2A 3TSZA 3FJPA 4OVAA 1S72T 3ER0A 1V29B 5J26A 1UGQB 1NYGA 1K9AA 4YTLA 3L2VA 1KQSA 2QEXQ 2HD0A 5DY9A 2R57A 2L5QA 2E4HA 3G4SQ 2KMTA 1OZ3A 1YI2Q 1QWEA 3X25B 4C5GA 2JW4A 1VQ7T 2X4WA 2A37A 5GAMe 1LJOA 2DXUA 1YP5A 1Q82U 3EFRA 2RI5A 2DPPB 1R8OB 2R5MA 2ZPIB 1U06A 4Z89A 3CPWS 2X4JA 2RJFA 2QDLA 3FB9A 3L42A 4RCBA 1QP2A 3FEOA 1YCSB 1C6VX 4Y91A 1TUGB 3CCJQ 4A53A 2EYXA 3ASKA 4JZ3A 3I56Q 4C8QC 1V76A 4JJDA 3I55A 5IHNA 4CC4B 3GOXA 2AIRB 1VQ4Q 3QJ6A 2QQSA 2EQJA 2CH4A 4WCIA 2QA4A 3MO8A 1G3WA 2BZ8A 5GANe 2J05A 2MK5A 4HVVA 3CMAT 4DBRA 2DMOA 1VQ6T 3OSSC 1UGRB 5FRNA 2IG0A 2P0QA 1Y96A 1KIKA 4JLIA 1WLPB 4DBFA 3AHUA 4IIOA 3JAME 4XTYA 5KYYA 4OMNA 2FG0A 2M0OA 1N27A 4DOVA 3MP1A 3DKMA 3Q1JA 1NJIR 2CP2A 2DNUA 4F17A 1YHQT 3PTAA 2LT1A 5CVIA 4A63B 1JBMA 1YBYA 2JTEA 4C8QB 4FW1A 4PJOC 2KYBA 1VQOT 1WA7A 2O01E 1YCYA 2ZGWA 4IUPA 1FYNA 1K73R 3EGUA 1YIJQ 3M0TA 2LCLA 3QBYA 4M77C 1NE8A 1GBQA 2O9VA 2RA2A 1KC8R 2F1LA 4J6WA 1VQ9Q 2H8HA 2DL5A 2D9TA 4E7JA 1I81A 5LJ3j 2EFIA 4C8QG 4CC7A 1VQNQ 2CGHA 2DBKA 2X35A 1KD1U 4HT9A 2ATCB 1CSKA 2WSEE 1ZLMA 2EQKA 4FYVB 3OS2A 1FMWA 1NEBA 2FPEA 3OW2S 2HL5C 3JCMe 2AZSA 3OYAA 5CKFA 2GTOA 3UATA 4PJOB 4N0AA 3THKA 4NL3A 3VRZA 1YWPA 3M53A 4OMFB 1GBRA 3LH5A 4RTTA 2DVJA 4M77B 1UGSB 1V1CA 3REAB 1VQKA 3HRUA 3CCVT 1OI1A 3QYGB 5GMKi 2L3SA 1TOVA 3QG1A 1M3BA 3JB9I 1X2QA 2RJCA 4EMGA 4PJOG 1RAFB 1WHJA 5GAN5 3X26B 5GAN6 2K2VA 2PU9B 3BW1A 4BD3A 2PNIA 4C5IA 1K0XA 5I11A 3QPHA 3O8VA 2DYIA 4M77G 2MAMA 3ULRB 3CEYA 2KAFA 2RI3A 3N5BB 3A8LB 3CCET 1Q86R 2AZVA 1BBZA 1QCOA 1IHWA 2QDYB 3PNWC 4UC4A 2X3WD 4ZNXA 2HBWA 3MKDA 1M90R 3A8GB 3UF4A 5KYNA 3GF5A 3NFCA 1UB4A 2XKOC 5GAMd 4PJMA 4RUGA 6AT1B 4OMOA 1VYVA 4LDUA 2HSEB 1GCQC 1M1KC 1OZ2A 3OYJA 3LGFA 1OQKA 1QW1A 4J8OA 3CPWA 4N4IA 1LCKA 4QQDA 2DYBA 1ZA2B 3BFMA 4QVDA 4E7ZA 1TSFA 1MV0B 1NJIU 2HKQB 4LUDA 5CKDA 4ME7A 4EPCA 3L2UA 1R0BG 1UGVA 3CXCS 3PMIA 3M9QA 1WFWA 2DL8A 3I5SA 2I0NA 2O31A 4LUEA 3M56A 4M75F 3OBWA 5GANd 4C8QA 1K73U 3NMZC 4IUVA 4AG2C 1H3HA 2DL4A 2P0PA 1VQLT 4PJLA 4Y28E 3EG3A 4XQ3A 4XU3A 1EIFA 1OULA 1KC8U 1GCPA 2Z0WA 2VUBA 4HA8A 3OSVA 4A4FA 3CCLT 3E1SA 1KJWA 2QGGA 3SHWA 8ATCB 1YN8A 4WTOB 1JXMA 3H8ZA 5CQYA 2C0IA 1UHFA 2DRKA 2EGCA 2FL7A 5CR2A 4QQGA 4HCBA 3JB9H 5AYFA 4M7DC 3S3MA 2X51A 2O2OA 2DXBA 4X9CA 2FB7A 4PNOA 4A4HA 3MEVA 1Y71A 3CCRQ 5HK3A 3JB9F 3CC4A 2RHXA 3KBGA 1I07A 5EC7A 4PJOA 5GMKe 1VQPQ 2CUDA 2DX1A 3NTKA 2XD0A 2YRVA 4A54A 3QKJA 2K9GA 3M5AA 4LDYA 3CBOA 3TVTA 1YJNT 1XTDA 4M77A 3HFNA 2GCXA 4C8QF 3MPUB 3QWXX 1VQ8A 4KGZB 2M1HA 2PUKB 3G71A 2D0QB 3SWNC 1UUEA 2E1HA 1IRXA 5GJVB 2L3PA 4LNPA 4R55A 3JCMd 2A08A 3SD4A 3OW2A 4XTUA 4M7DB 1OEBA 3OYBA 2BE9B 2RM4A 1T0HA 2EGEA 4M75D 2XG8D 2HMAA 3CD6Q 3QDFA 4Z88A 1Q86U 2RQTA 2M16A 2KROA 1H641 3MJXA 3CCSA 2CKKA 3QYHB 4FYWB 2RQUA 1M90U 2MYSA 1M27C 4F04B 1N6AA 2G6FX 4BY6C 4M7AC 4M7DG 1RAEB 1PKTA 2YRCA 2HQXA 4QQ6A 1D3BB 1Q81C 3GNFB 3V7SA 2RI2A 2RB6A 4PJOF 1UJYA 3VRYA 3OYMA 2YUQA 4GY5A 1D1BA 1VQ5A 1M2OA 3SWNB 4ZN3A 2LX9A 2D0NA 2DA9A 2VV5A 1VYTA 3TEEA 3A8OB 3PVQA 2VXFA 3L2QA 3VS5A 2V8JA 4E6RA 1AWXA 1OU9A 1WHMA 3JB9D 2JZ2A 4J9HA 4XTWA 2E10A 2KQWA 2KR3A 3SFMA 1JXOA 3DLMA 2KBTA 1SF9A 3CCQA 1EX4A 4RTXA 1HK9A 1SRLA 1T3SA 3JCMb 1K8AC 2C06A 4BY6B 1KK7A 2ZPHB 3BY7A 4M7AB 1M8MA 3H9NA 1K4US 3HKSA 4PFPA 1W1FA 4J5YA 2PVDB 2FVUA 1WHGA 3M0RA 2FYKA 1WXUA 1N8RU 2MF2A 1GCQA 3BE3A 1MHNA 1PCXA 2CDTA 4QW2A 1B34B 2F2VA 2DM1A 1Y57A 4M7AG 3G6EA 1JRIA 1QVFS 4VUBA 3CCMT 4ZGDB 2AKLA 3G4SA 1VQ8Q 1YI2A 2KEAA 3G7ZA 3G71Q 3CBMA 2DTHA 2LZ6B 2E3HA 1W4SA 1YFNA 4JJCA 3EHRA 5IT9E 1BU1A 3JCMX 2HQEA 4MZTA 3X20B 4XTVA 3CCJA 2O4XB 1OOTA 5GAMh 1M1FA 3I56A 2HZYA 2E64A 2LRQA 2KXDA 2RQWA 1VQ4A 4HT8A 2QQRA 3J7AF 3FRNA 2V1QA 2QQ9A 4OMQA 4M7DA 3M59A 2FPDA 3M54A 3OQ5A 5LJ5e 1NLOC 2QXFA 1YJWQ 3L2RA 3A1PA 5FU6C 5KH6A 4J9EA 2F2WA 5A0LA 4C0ZA 4A4EA 5GMKl 2M02A 4J6XA 5GANh 5L8RE 1LPLA 3GIBA 1NLPC 3CCUQ 2EYQA 2JM8A 1HJDA 3RNJA 2QQBA 4BB7A 1D3BA 2J6FA 1X6GA 1G3TA 1LNXA 1R77A 2RQVA 3HTRA 3NPFA 1WHKA 1PKSA 4MDWA 3SWNA 2OTJQ 2DRMA 4IKFA 3RMQA 3J81E 1XJWB 1H3ZA 2MCNA 3A8HB 5FU7C 1BK2A 3UWNA 3QXEB 4HVUA 5FU6B 4E2FB 3JCMV 1VQ9A 3INZA 4J7IA 2OJ2A 3RESA 4XK8E 2G3RA 3QUIA 1PD0A 4FT4A 1VQNA 4M7DF 3BDUA 4BDZA 5D7UA 1WJRA 3VJPA 2ENMA 3SDZA 2LMJA 2RK2A 2CP6A 5GAN3 4CI0C 2LQKA 3ZEHA 3G6EQ 4EMHA 4M7AA 2BIVA 3AT1B 2CH4W 1Q82C 4PK4A 3EHQA 4PLIA 1R0CB 4HXJA 1KFZA 2J06A 2X3XD 3I5RA 2XMFA 1PWTA 5IN1A 3OY9A 3I55T 3M0QA 2DEUA 4E7SA 2HSPA 2ROTA 2RJEA 2QA4T 1QKXA 3NGPA 3I35A 3M4YA 5I21A 2LT4A 1B34A 2YXYA 2OTLA 5FU7B 2E65A 4C8QE 4JJNK 3JCMh 2JM9A 3VKIA 2E5KA 4JUVA 1UG1A 2DK3A 1N9SA 1BYMA 4E47A 1MMGA 2K79A 4DBHA 3LWIA 2EYZA 1LOJA 3OYHA 2DXTA 3CC2Q 2JTFA 4B9WA 2GQIA 3RKXA 4JRPA 2YUNA 4C0DC 4ORZA 4C92C 1RL2A 5IAYA 1MNEA 3LLRA 4R0KA 3LWHA 1U5SA 1YNZA 1PC0A 4KGXB 1E7OA 1S1NA 5J3BA 1BI0A 1PRLC 2O4XA 1VQ7A 4M7AF 2P0KA 1QVFA 2I2LA 1Q7YC 3WXMB 2QI2A 5GAMj 1RLPC 3M58A 5EG2A 4NS5A 3MCAB 3CC7Q 1AVZC 4PJOE 4QVCA 1W6XA 2EBPA 2DETA 3HP9A 3A98A 3C94A 3JCMW 1ZUYA 2LJ3A 1ZSZC 2LP5A 4BDYA 3PT9A 4M77E 4LDVA 3QWYA 1DJ7B 3JRZA 3S3OA 3LH0A 4C0DB 1BI2A 1M9SA 2HDAA 4XAXB 4XU0A 2CP7A 1ABOA 1M3CA 2CUBA 1E6HA 1Z9QA 3VS2A 1YITQ 2VGNA 4C92B 2C0OA 1FWZA 1MMAA 1AHJB 1CKBA 1SHFA 2GBQA 2KRSA 3GBQA 5GANj 1B07A 2WSCE 2BKDN 2J7IA 3LYIA 1WJQA 1YJ9T 2L2PA 5LJ5d 1MGQA 3P8HA 2M51A 2QTVA 1VQKT 2XIDA 2OX7A 3A5ZB 3E9GA 3FDRA 1BIAA 2EGAA 1X2KA 4C92G 4DOWA 1Q95G 3HSBA 4IUTA 1ZSZB 2RJDA 3E2UA 2XK0A 2COYA 4DBQA 1JJ2P 2CZ1B 4A4GA 2K4YA 2K57A 1W70A 3CMEQ 2F2XA 3M57A 1UJ0A 1EFNA 1ZUUA 2OTLQ 1TS9A 2V8IA 2ZPBB 1BCMA 1BI3A 1IREB 2CSIA 1SRMA 1I5OB 2F5TX 3P8BB 4C0FA 3CCRA 2PTKA 2QYZA 4RTVA 5FLXE 5KE2A 3PVLA 1QP3A 1VQPA 1IGQA 3EH1A 1JB0E 3SEMA 5LL6S 1S72Q 1YWOA 2CSQA 1NG2A 3A8MB 5IHKA 1VQMT 2ECZA 4OMMA 2MWPA 4L6V5 1AWJA 2MIOA 2EWNA 2DAQA 5CAIA 1FXXA 4A4KA 5GMKh 4BE1A 2FZGB 1VQ7Q 3V8JA 1M8VA 1G3YA 4NL2A 3OYNA 3QZ5B 4M78C 4L5GA 2YUPA 1ZBXA 3CD6A 1D0XA 4E7IA 2XICA 2VKNA 2VC8A 1NJIC 4HCZA 5CKEA 3VUZA 3TCJA 3RIRA 4BE2A 4O5VA 2BE7D 5I2SA 3RR6A 3JSCA 4KULA 2RPNA 1MMNA 2VGMA 3H0IA 3CMAQ 1VQ6Q 2AKKA 4V2SA 4ELZC 2YT6A 2L8DA 1OX9A 1K76A 1NZ9A 2KNBB 2ED1A 4FT2A 4KUDK 1UTIA 4FSXA 1C1AA 2JMAA 1SKUB 3H0HA 2RHYA 4M78B 1G83A 5IXFA 2KSSA 3VS7A 1UGPB 4E7KA 3C4SA 2MMPA 2YDLA 5LJ5g 3CC4T 2HCKA 4C92A 1YHQQ 4Z02A 2QTXA 1SHGA 4ATOA 1PSEA 4F16A 4J9GA 4OB3B 1SSFA 2CP3A 3V8LA 1RAAB 3FLGA 5GAOn 4M7DE 5LJ3d 1M1GA 5FROA 1VQOQ 2HAXA 2KGTA 4M78G 2QG9B 3RERA 1WJSA 1Z9ZA 3URGA 5A0GA 1WDXA 3FC3A 1TH7A 2JOYA 2M9UA 1PSFA 1ZX6A 1PD1A 4PFZA 1NPRA 4RTUA 2DKGA 5FRMA 2HNIA 1ZSZA 4XTXA 1WI7A 3GNGA 1OU8A 5HY6A 3OYFA 2EYWA 2EJ9A 2DD4A 3OYKA 3OYEA 3M0SA 3CQTA 4OMLA 3KFVA 1VQLA 3GLXA 4AFSC 1WX6A 3V7RA 2EQMA 3CCST 3R6NA 1Y7XA 3VS0A 1U1SA 3OYCA 1SG5A 2EAYA 5KCHA 3OYLA 1RABB 1VIEA 1Q86C 1G8XA 2RN8A 4C92F 5GAOp 5D6YA 5L23A 2RH2A 1M90C 2E41A 1VQ5T 2EKOA 5ECAA 2RK1A
chains in the Genus database with same CATH topology
3CMAQ 1K8AR 3CCLQ 3CCRQ 1NJIR 1QVFP 1YITQ 1KD1R 1N8RR 1VQ6Q 1YHQQ 1Q86R 1Q82R 1KC8R 1QVGP 3CC7Q 3G6EQ 2QEXQ 1VQ9Q 1VQPQ 3G4SQ 3CXCP 1K9MR 3CCMQ 3CCUQ 3CCJQ 1VQOQ 1VQLQ 3CCQQ 1KQSP 1YI2Q 1VQ7Q 1YJ9Q 3I55Q 1JJ2P 1Q81R 1YJNQ 1M90R 3I56Q 1YJWQ 1VQNQ 1VQ5Q 3CD6Q 3CPWP 1Q7YR 1VQ8Q 3CCSQ 3CMEQ 3OW2P 1VQKQ 2QA4Q 1K73R 1YIJQ 3CC4Q 3G71Q 3CC2Q 1VQ4Q 1S72Q 1VQMQ 1W2BP 3CCEQ 3CCVQ 2OTJQ 1M1KR 2OTLQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA Q;  1K8A R;  3CCL Q;  3CCR Q;  1NJI R;  1QVF P;  1YIT Q;  1KD1 R;  1N8R R;  1VQ6 Q;  1YHQ Q;  1Q86 R;  1Q82 R;  1KC8 R;  1QVG P;  3CC7 Q;  3G6E Q;  2QEX Q;  1VQ9 Q;  1VQP Q;  3G4S Q;  3CXC P;  1K9M R;  3CCM Q;  3CCU Q;  3CCJ Q;  1VQO Q;  1VQL Q;  3CCQ Q;  1KQS P;  1YI2 Q;  1VQ7 Q;  1YJ9 Q;  3I55 Q;  1JJ2 P;  1Q81 R;  1YJN Q;  1M90 R;  3I56 Q;  1YJW Q;  1VQN Q;  1VQ5 Q;  3CD6 Q;  3CPW P;  1Q7Y R;  1VQ8 Q;  3CCS Q;  3CME Q;  3OW2 P;  1VQK Q;  2QA4 Q;  1K73 R;  1YIJ Q;  3CC4 Q;  3G71 Q;  3CC2 Q;  1VQ4 Q;  1S72 Q;  1VQM Q;  1W2B P;  3CCE Q;  3CCV Q;  2OTJ Q;  1M1K R;  2OTL Q; 
#chains in the Genus database with same CATH topology
 4RTW A;  2CZ0 B;  1XQH A;  4M7A E;  4KBM B;  3RBB B;  4RG8 A;  2ABL A;  1CKA A;  3VUB A;  2LQ8 A;  2DF6 A;  1AD5 A;  1N5Z A;  3VYH B;  2X4X A;  4DQ2 A;  2DIL A;  1KSW A;  3CCQ T;  5GMK j;  2OI3 A;  2L3Q A;  3TRE A;  1GFC A;  3RKY A;  1YJN A;  2PZ1 A;  2KK4 A;  2HKN A;  1VQM Q;  2VAS A;  3CCE Q;  1T0J A;  1YJW A;  2M0Y A;  2R5A A;  1BI1 A;  3PFS A;  1NM7 A;  2FHD A;  4M77 F;  4JZ4 A;  2R58 A;  4BUG A;  2HEQ A;  4IUQ A;  5LJ5 h;  3OYI A;  3OYG A;  4AFU C;  2F69 A;  3CCU A;  3SB2 A;  2NLU A;  2PQW A;  1ZBJ A;  4ZGJ B;  3BDL A;  4AFQ C;  1AZE A;  3HHT B;  4L59 A;  2BZY A;  1ZHI A;  2NUT B;  1QCF A;  4HCC A;  2OTJ A;  4C8Q D;  1N8R C;  3EGX B;  1IHV A;  2QEX T;  1LVK A;  4XU1 A;  4CRI A;  3C95 A;  2EVR A;  5LJ3 g;  4LDX A;  3G4S T;  4M78 A;  5CCA A;  1K9M C;  1YI2 T;  4KH1 B;  1WQ7 A;  2DL3 A;  2JN0 A;  2SEM A;  1H92 A;  1AOJ A;  2RF0 A;  2LCC A;  3X28 B;  2HL3 A;  1U8R A;  4Q5W A;  1D1A A;  2D8H A;  3ZBD A;  4KUI A;  2YUO A;  3MP8 A;  4JLG A;  2SRC A;  4MML A;  3TSW A;  2LQW A;  1MMD A;  1VQL Q;  5C6S A;  3CCJ T;  3L1A A;  1RAG B;  2K3X A;  4KH0 B;  4ZGE B;  3DB4 A;  3S3N A;  4OB0 B;  3I56 T;  2GFU A;  2GTJ A;  1OV3 A;  3H41 A;  1W2B P;  4J9D A;  3JB9 J;  2RHU A;  4DEY A;  3LGL A;  1RAI B;  3CCL Q;  1VQ4 T;  4BE0 A;  2FRY A;  4AFZ C;  3ZL7 C;  1Q82 R;  3DB3 A;  2Y4X A;  4MZP A;  4PJO D;  2KY9 A;  5CKH A;  4DA4 A;  4FW2 A;  1NYF A;  3RKW A;  5GAM f;  2D6F A;  4HVW A;  2DD5 A;  4M77 D;  3ZFJ A;  2AHJ B;  3X24 B;  1RUW A;  5D6X A;  2KI7 A;  4J6Y A;  3I9Q A;  2ZPG B;  1WXT A;  1X27 A;  1JU5 C;  1WHL A;  2XDD A;  2DTO A;  2BTT A;  4GLM A;  4M78 F;  5KCO A;  2K5I A;  3CC2 A;  1WNL A;  1IGU A;  1NEG A;  4RTZ A;  1QMC A;  3DLL A;  1A0N B;  4ZTJ A;  1YJN Q;  3QZ9 B;  4LE9 A;  2EQI A;  2LX7 A;  5KYX B;  5GAN f;  4N4G A;  4JDS A;  5GAO q;  2DJQ A;  2P4T A;  4J9C A;  1YIJ T;  1FX7 A;  2EKH A;  4PL6 A;  2LVM A;  2HQH A;  4FM4 B;  2LJ0 A;  2XI9 A;  1I5L A;  2CP5 A;  1IXD A;  1UE9 A;  5GAO r;  1VQ9 T;  3CC7 A;  3D7S B;  4FSS A;  2JVV A;  1Q7Y R;  2A0F B;  2FO0 A;  1VQN T;  1AEY A;  4E7L A;  2F5K A;  2COW A;  3L2W A;  2LNH B;  3OA6 A;  4EDU A;  2P84 A;  2E3I A;  1YIT A;  4AT1 B;  3CXC P;  1UEC A;  1OX8 A;  1RAH B;  7AT1 B;  4OGE A;  2X4Y A;  1M4Z A;  5M9O A;  3EG9 B;  1D1C A;  3PIO A;  4O6J A;  4Y92 A;  1WYX A;  1SSH A;  2PUO B;  3MEU A;  2GQV A;  5LJ5 j;  2K5L A;  3HFO A;  5J39 A;  3F70 A;  4KT0 E;  1GL5 A;  2E5Q A;  1I8F A;  4M75 C;  2E6Z A;  2FPF A;  2NUT A;  3OYY A;  2RMO A;  1QVG P;  1RI0 A;  1X75 C;  2EYY A;  3EGX A;  5KYW B;  3PMT A;  4C5E A;  2DIQ A;  3UT1 A;  3M4G A;  2V8K A;  1EZZ B;  2QK0 A;  1X69 A;  3JCM f;  1KHC A;  3CME A;  2V1R A;  2B86 A;  5GAO m;  2KVQ G;  2KXC A;  2DL7 A;  5GAN 7;  2WSF E;  1HSQ A;  4QKU A;  1OPK A;  2P4R A;  2XU8 A;  2CT4 A;  1N9R A;  3MEW A;  1U3O A;  4M75 B;  4JS4 A;  1ZUK A;  1MND A;  2EIF A;  2Y4Y A;  3HRS A;  4ESR A;  4C92 E;  1UFF A;  1Y07 A;  4GLK A;  1PRM C;  2JXB A;  1QWF A;  1S72 A;  1GXI E;  2CZ7 B;  1GRI A;  2BUD A;  5CK9 A;  1JJ2 A;  2XDB A;  4F7U B;  3L2Z A;  3CCM Q;  3MET A;  3OB9 A;  5D6W A;  2VVK A;  2NUZ A;  1QKW A;  3EH2 A;  4M75 G;  3QO3 A;  4BI8 B;  4II1 A;  4RCC A;  3UPU A;  1X6O A;  3EG1 A;  3GPL A;  5LJ3 e;  3PIP A;  4CC2 A;  3VS6 A;  4WF2 A;  2AK5 A;  2H3E B;  2K6D A;  4M7D D;  3J80 E;  4X1V A;  4PJN A;  4XTZ A;  3REB B;  4F7U G;  2D8J A;  4J7F A;  3OS1 A;  2O88 A;  3RDV A;  3OMC A;  1I1J A;  2FRW A;  3JV3 A;  5KE3 A;  5KYX A;  3WVE B;  8AT1 B;  3OS5 A;  4OGC A;  2BZX A;  1M1K R;  4JJB A;  4OB1 B;  4J9B A;  1I0C A;  1GFD A;  3C12 A;  4X9D A;  4ELY C;  5C0M A;  3G1J A;  3CMA A;  1KD1 C;  3E9F A;  1VQ6 A;  2QAZ A;  4TVR A;  1Q7Y U;  1KQS P;  2XDP A;  1D0Y A;  3VS3 A;  3O5Z A;  5CO7 A;  2YRD A;  2J6O A;  3JB9 G;  4LD9 K;  2V26 A;  1ABQ A;  5HCK A;  2GF7 A;  2GNC A;  2AT1 B;  2ED0 A;  2KT8 A;  3CCR T;  2E12 A;  2PVO B;  3RMS A;  1YHQ A;  4J83 A;  2FEI A;  1OPL A;  1ZSG A;  2NYS A;  5CIU A;  1RI9 A;  1VQP T;  2ZPF B;  1F1B B;  3EG9 A;  1PHT A;  1VQO A;  1RAC B;  1IB8 A;  1E6G A;  4ANJ A;  1U1T A;  1QVP A;  3VS1 A;  4Z8A A;  2K3B A;  4M7A D;  1T3L A;  2VWF A;  3QDR B;  2E70 A;  4FCY A;  5KYW A;  2VYT A;  1OYX A;  1W2B S;  4IUR A;  2JJ9 A;  1PG5 B;  1RAD B;  3MEA A;  1QQJ A;  3C0C A;  2K7A A;  1YJ9 A;  3CD6 T;  4E7H A;  1J3T A;  4KRT A;  2L0A A;  1QVF P;  4MZM A;  4IIM A;  1XOV A;  2W10 A;  2HBP A;  1QLY A;  4FYX B;  2JS2 A;  4M78 E;  2YWW A;  3I55 Q;  4MMK A;  2KRM A;  4FYY B;  4PKC C;  1G2B A;  2GFA A;  1X43 A;  4C5H A;  1UHC A;  5HK0 A;  4M75 A;  2A7Y A;  3V8K A;  2QA4 Q;  1K1Z A;  4CC3 A;  5FWB A;  1B7T A;  2K5F A;  1AT1 B;  1UDL A;  3CCV A;  1XNI A;  2VXE A;  4FL6 A;  2JUF A;  4F7U A;  4EIK A;  2DEQ A;  3EGD B;  4HCK A;  3NTI A;  1M2V B;  4BI3 A;  1KHI A;  2JNG A;  3R6O A;  1RLQ C;  5A0D A;  3OS0 A;  4OF1 A;  3EG2 A;  5GAN 8;  1FMV A;  4K11 A;  1K73 C;  2DIG A;  4B6M A;  1WZO A;  1VQM A;  1JQQ A;  1WIE A;  3OBY A;  3CCE A;  3E19 A;  1NPP A;  1KC8 C;  3JCM P;  1ARK A;  2DZ9 A;  1Y0M A;  2KYM A;  5IHI A;  1Q81 R;  4M4Z A;  2QAS A;  3QSU A;  3IQL A;  1BB9 A;  3FIF A;  1M1K U;  3QII A;  1M5Q 1;  1VOM A;  3UA7 A;  4BAC A;  1SPK A;  4PLL A;  4N4H A;  2EJG A;  4PJJ A;  1H8K A;  4J9I A;  2DXC A;  2DO3 A;  2ZZD A;  2O9S A;  4NOY A;  3WVD B;  3QHS A;  3MHX A;  1MV3 A;  2WAC A;  1WHH A;  5GJW B;  1AWW A;  2LNV A;  3V7C A;  4EMK C;  5KYU B;  1TU0 B;  4BI4 A;  2L3R A;  4PFO A;  3M55 A;  4FU6 A;  4AG1 C;  1QVG S;  4LN2 A;  2RNA A;  1TXQ A;  1BKB A;  4F7U F;  3M0U A;  3JCM Q;  1X6B A;  2IPO B;  4HKE A;  1VQ8 T;  4OMP A;  1G5V A;  1K8A R;  3G71 T;  1N8R R;  4OB2 B;  3EFO B;  2Y90 A;  4LXC A;  2PVG B;  1VA7 A;  1TG0 A;  5GAN 4;  1K9M R;  2XHC A;  4LD6 A;  3RUX A;  2DFU A;  1YJ9 Q;  1IZ6 A;  1MUZ A;  2YHT A;  2KDS A;  1KQ2 A;  2JMC A;  2A28 A;  1VQK Q;  1G3S A;  1P92 A;  2JTM A;  2LQN A;  5I22 A;  3OMG A;  2KT1 A;  3UDC A;  4JRQ A;  5A2Q E;  1I4K 1;  3NTH A;  2DTI A;  2LC4 A;  3CCL A;  1M3A A;  4EMK B;  4RMO A;  4MDX A;  2CYZ B;  1D09 B;  4IUU A;  3EFS A;  3CPW P;  4QVZ A;  3PE0 A;  4ZN1 A;  1YJW T;  1VIF A;  2RHZ A;  2X9H A;  3T9N A;  1HD3 A;  2KRN A;  3M0P A;  3NHN A;  3H0F A;  3U23 A;  9ATC B;  2GGR A;  2EJF A;  3VYG A;  1D0Z A;  2NUP B;  1ZA1 B;  2JT4 A;  3JCM J;  2QQA A;  4JRI A;  4X34 A;  3CCU T;  4QT7 A;  1W2B A;  3TQ7 P;  5I2M A;  3EG0 A;  2RQR A;  2L89 A;  5GAM g;  2OTJ T;  1VUB A;  1TUD A;  4RTY A;  1KG1 A;  5LJ5 f;  1TTH B;  3EGD A;  1ACM B;  1SEM A;  1M2V A;  1VYU A;  2DJZ A;  1K0S A;  4DEX A;  2K3Y A;  2LTO A;  1KQS S;  4F14 A;  3JCM c;  2D1X A;  1Q81 U;  5HKC A;  3G6E T;  1M30 A;  2COZ A;  3FJ5 A;  5GAN g;  4P5N A;  3LX7 A;  3CCV Q;  1BIB A;  2FZK B;  2RO0 A;  1PM3 A;  2MI6 A;  3HPW A;  4C92 D;  3CBP A;  5FWC A;  1JJ2 S;  2DER A;  1JO8 A;  1TWB A;  1NBE B;  4B9X A;  2ZPE B;  2FZC B;  5KYU A;  3KXT A;  2C0T A;  3VU3 C;  5IH2 A;  2JS0 A;  4GBQ A;  2EQU A;  2IIM A;  1K8A U;  3OW2 P;  2RHI A;  1WGS A;  1C0M A;  3CPF A;  3CC4 Q;  2K2M A;  2LCS A;  3CC2 T;  5FW9 A;  3EFO A;  3CXC A;  1KQ1 A;  1K9M U;  2ESW A;  1O75 A;  4C0G A;  1WXB A;  1X01 A;  3S6W A;  1ZQ1 A;  2DE0 X;  2QEX A;  4D6W A;  1IO6 A;  2CT3 A;  2DZC A;  2RD1 A;  3MP6 A;  2J6K A;  2CP0 A;  3P8D A;  3VV0 A;  5DM7 R;  1QVG A;  4R56 A;  3HL8 A;  4RKU E;  4D8D A;  1WPY A;  3ME9 A;  3KUF A;  4EMK A;  3TU4 K;  3CC7 T;  5CKB A;  3LW5 E;  2LJ1 A;  2DBM A;  1Y96 B;  1AZG B;  3JCM g;  2MWO A;  2H3J A;  2VB6 A;  1UEB A;  4JPB W;  3UA6 A;  3CCM A;  3CCS Q;  4JRK A;  4AMC A;  4D8K A;  5KYY B;  4J9F A;  5DLQ E;  1WQW A;  2OAW A;  2CS7 A;  2ROL A;  2E6N A;  1B3Q A;  1YIT T;  2A3L A;  1HXD A;  2EW3 A;  2MPX C;  2NUP A;  3PGG A;  2DLP A;  4ZTF A;  1FMK A;  4N0A C;  1VQ5 Q;  4RG2 A;  1PNJ A;  3HRT A;  5LJ3 f;  2NWM A;  2ZAE A;  5IXB A;  1TUC A;  3GP8 A;  2B8A A;  5AT1 B;  2W0Z A;  2YLC A;  3H6Z A;  5GAN 2;  5DLO A;  5LJ3 h;  2KE9 A;  2CZ6 B;  4FIB A;  3CCQ Q;  1QCN A;  1BCO A;  2A36 A;  2IVW A;  2QGF B;  2EPD A;  4M75 E;  5GMK m;  2YSQ A;  1HYO A;  4KGV B;  4OP0 A;  3CME T;  2MOX A;  5CQX A;  1KD1 R;  2OAU A;  3EAE A;  1YIJ A;  3VS4 A;  2OTL T;  4F7U E;  2DVE A;  4LDW A;  1AWO A;  2CRE A;  1O9S A;  4M78 D;  3OYD A;  2LDM A;  4JS5 A;  5GAO l;  3QJY A;  1JEG A;  2YLB A;  2ZCF B;  4XU2 A;  3TSZ A;  3FJP A;  4OVA A;  1S72 T;  3ER0 A;  1V29 B;  5J26 A;  1UGQ B;  1NYG A;  1K9A A;  4YTL A;  3L2V A;  1KQS A;  2QEX Q;  2HD0 A;  5DY9 A;  2R57 A;  2L5Q A;  2E4H A;  3G4S Q;  2KMT A;  1OZ3 A;  1YI2 Q;  1QWE A;  3X25 B;  4C5G A;  2JW4 A;  1VQ7 T;  2X4W A;  2A37 A;  5GAM e;  1LJO A;  2DXU A;  1YP5 A;  1Q82 U;  3EFR A;  2RI5 A;  2DPP B;  1R8O B;  2R5M A;  2ZPI B;  1U06 A;  4Z89 A;  3CPW S;  2X4J A;  2RJF A;  2QDL A;  3FB9 A;  3L42 A;  4RCB A;  1QP2 A;  3FEO A;  1YCS B;  1C6V X;  4Y91 A;  1TUG B;  3CCJ Q;  4A53 A;  2EYX A;  3ASK A;  4JZ3 A;  3I56 Q;  4C8Q C;  1V76 A;  4JJD A;  3I55 A;  5IHN A;  4CC4 B;  3GOX A;  2AIR B;  1VQ4 Q;  3QJ6 A;  2QQS A;  2EQJ A;  2CH4 A;  4WCI A;  2QA4 A;  3MO8 A;  1G3W A;  2BZ8 A;  5GAN e;  2J05 A;  2MK5 A;  4HVV A;  3CMA T;  4DBR A;  2DMO A;  1VQ6 T;  3OSS C;  1UGR B;  5FRN A;  2IG0 A;  2P0Q A;  1Y96 A;  1KIK A;  4JLI A;  1WLP B;  4DBF A;  3AHU A;  4IIO A;  3JAM E;  4XTY A;  5KYY A;  4OMN A;  2FG0 A;  2M0O A;  1N27 A;  4DOV A;  3MP1 A;  3DKM A;  3Q1J A;  1NJI R;  2CP2 A;  2DNU A;  4F17 A;  1YHQ T;  3PTA A;  2LT1 A;  5CVI A;  4A63 B;  1JBM A;  1YBY A;  2JTE A;  4C8Q B;  4FW1 A;  4PJO C;  2KYB A;  1VQO T;  1WA7 A;  2O01 E;  1YCY A;  2ZGW A;  4IUP A;  1FYN A;  1K73 R;  3EGU A;  1YIJ Q;  3M0T A;  2LCL A;  3QBY A;  4M77 C;  1NE8 A;  1GBQ A;  2O9V A;  2RA2 A;  1KC8 R;  2F1L A;  4J6W A;  1VQ9 Q;  2H8H A;  2DL5 A;  2D9T A;  4E7J A;  1I81 A;  5LJ3 j;  2EFI A;  4C8Q G;  4CC7 A;  1VQN Q;  2CGH A;  2DBK A;  2X35 A;  1KD1 U;  4HT9 A;  2ATC B;  1CSK A;  2WSE E;  1ZLM A;  2EQK A;  4FYV B;  3OS2 A;  1FMW A;  1NEB A;  2FPE A;  3OW2 S;  2HL5 C;  3JCM e;  2AZS A;  3OYA A;  5CKF A;  2GTO A;  3UAT A;  4PJO B;  4N0A A;  3THK A;  4NL3 A;  3VRZ A;  1YWP A;  3M53 A;  4OMF B;  1GBR A;  3LH5 A;  4RTT A;  2DVJ A;  4M77 B;  1UGS B;  1V1C A;  3REA B;  1VQK A;  3HRU A;  3CCV T;  1OI1 A;  3QYG B;  5GMK i;  2L3S A;  1TOV A;  3QG1 A;  1M3B A;  3JB9 I;  1X2Q A;  2RJC A;  4EMG A;  4PJO G;  1RAF B;  1WHJ A;  5GAN 5;  3X26 B;  5GAN 6;  2K2V A;  2PU9 B;  3BW1 A;  4BD3 A;  2PNI A;  4C5I A;  1K0X A;  5I11 A;  3QPH A;  3O8V A;  2DYI A;  4M77 G;  2MAM A;  3ULR B;  3CEY A;  2KAF A;  2RI3 A;  3N5B B;  3A8L B;  3CCE T;  1Q86 R;  2AZV A;  1BBZ A;  1QCO A;  1IHW A;  2QDY B;  3PNW C;  4UC4 A;  2X3W D;  4ZNX A;  2HBW A;  3MKD A;  1M90 R;  3A8G B;  3UF4 A;  5KYN A;  3GF5 A;  3NFC A;  1UB4 A;  2XKO C;  5GAM d;  4PJM A;  4RUG A;  6AT1 B;  4OMO A;  1VYV A;  4LDU A;  2HSE B;  1GCQ C;  1M1K C;  1OZ2 A;  3OYJ A;  3LGF A;  1OQK A;  1QW1 A;  4J8O A;  3CPW A;  4N4I A;  1LCK A;  4QQD A;  2DYB A;  1ZA2 B;  3BFM A;  4QVD A;  4E7Z A;  1TSF A;  1MV0 B;  1NJI U;  2HKQ B;  4LUD A;  5CKD A;  4ME7 A;  4EPC A;  3L2U A;  1R0B G;  1UGV A;  3CXC S;  3PMI A;  3M9Q A;  1WFW A;  2DL8 A;  3I5S A;  2I0N A;  2O31 A;  4LUE A;  3M56 A;  4M75 F;  3OBW A;  5GAN d;  4C8Q A;  1K73 U;  3NMZ C;  4IUV A;  4AG2 C;  1H3H A;  2DL4 A;  2P0P A;  1VQL T;  4PJL A;  4Y28 E;  3EG3 A;  4XQ3 A;  4XU3 A;  1EIF A;  1OUL A;  1KC8 U;  1GCP A;  2Z0W A;  2VUB A;  4HA8 A;  3OSV A;  4A4F A;  3CCL T;  3E1S A;  1KJW A;  2QGG A;  3SHW A;  8ATC B;  1YN8 A;  4WTO B;  1JXM A;  3H8Z A;  5CQY A;  2C0I A;  1UHF A;  2DRK A;  2EGC A;  2FL7 A;  5CR2 A;  4QQG A;  4HCB A;  3JB9 H;  5AYF A;  4M7D C;  3S3M A;  2X51 A;  2O2O A;  2DXB A;  4X9C A;  2FB7 A;  4PNO A;  4A4H A;  3MEV A;  1Y71 A;  3CCR Q;  5HK3 A;  3JB9 F;  3CC4 A;  2RHX A;  3KBG A;  1I07 A;  5EC7 A;  4PJO A;  5GMK e;  1VQP Q;  2CUD A;  2DX1 A;  3NTK A;  2XD0 A;  2YRV A;  4A54 A;  3QKJ A;  2K9G A;  3M5A A;  4LDY A;  3CBO A;  3TVT A;  1YJN T;  1XTD A;  4M77 A;  3HFN A;  2GCX A;  4C8Q F;  3MPU B;  3QWX X;  1VQ8 A;  4KGZ B;  2M1H A;  2PUK B;  3G71 A;  2D0Q B;  3SWN C;  1UUE A;  2E1H A;  1IRX A;  5GJV B;  2L3P A;  4LNP A;  4R55 A;  3JCM d;  2A08 A;  3SD4 A;  3OW2 A;  4XTU A;  4M7D B;  1OEB A;  3OYB A;  2BE9 B;  2RM4 A;  1T0H A;  2EGE A;  4M75 D;  2XG8 D;  2HMA A;  3CD6 Q;  3QDF A;  4Z88 A;  1Q86 U;  2RQT A;  2M16 A;  2KRO A;  1H64 1;  3MJX A;  3CCS A;  2CKK A;  3QYH B;  4FYW B;  2RQU A;  1M90 U;  2MYS A;  1M27 C;  4F04 B;  1N6A A;  2G6F X;  4BY6 C;  4M7A C;  4M7D G;  1RAE B;  1PKT A;  2YRC A;  2HQX A;  4QQ6 A;  1D3B B;  1Q81 C;  3GNF B;  3V7S A;  2RI2 A;  2RB6 A;  4PJO F;  1UJY A;  3VRY A;  3OYM A;  2YUQ A;  4GY5 A;  1D1B A;  1VQ5 A;  1M2O A;  3SWN B;  4ZN3 A;  2LX9 A;  2D0N A;  2DA9 A;  2VV5 A;  1VYT A;  3TEE A;  3A8O B;  3PVQ A;  2VXF A;  3L2Q A;  3VS5 A;  2V8J A;  4E6R A;  1AWX A;  1OU9 A;  1WHM A;  3JB9 D;  2JZ2 A;  4J9H A;  4XTW A;  2E10 A;  2KQW A;  2KR3 A;  3SFM A;  1JXO A;  3DLM A;  2KBT A;  1SF9 A;  3CCQ A;  1EX4 A;  4RTX A;  1HK9 A;  1SRL A;  1T3S A;  3JCM b;  1K8A C;  2C06 A;  4BY6 B;  1KK7 A;  2ZPH B;  3BY7 A;  4M7A B;  1M8M A;  3H9N A;  1K4U S;  3HKS A;  4PFP A;  1W1F A;  4J5Y A;  2PVD B;  2FVU A;  1WHG A;  3M0R A;  2FYK A;  1WXU A;  1N8R U;  2MF2 A;  1GCQ A;  3BE3 A;  1MHN A;  1PCX A;  2CDT A;  4QW2 A;  1B34 B;  2F2V A;  2DM1 A;  1Y57 A;  4M7A G;  3G6E A;  1JRI A;  1QVF S;  4VUB A;  3CCM T;  4ZGD B;  2AKL A;  3G4S A;  1VQ8 Q;  1YI2 A;  2KEA A;  3G7Z A;  3G71 Q;  3CBM A;  2DTH A;  2LZ6 B;  2E3H A;  1W4S A;  1YFN A;  4JJC A;  3EHR A;  5IT9 E;  1BU1 A;  3JCM X;  2HQE A;  4MZT A;  3X20 B;  4XTV A;  3CCJ A;  2O4X B;  1OOT A;  5GAM h;  1M1F A;  3I56 A;  2HZY A;  2E64 A;  2LRQ A;  2KXD A;  2RQW A;  1VQ4 A;  4HT8 A;  2QQR A;  3J7A F;  3FRN A;  2V1Q A;  2QQ9 A;  4OMQ A;  4M7D A;  3M59 A;  2FPD A;  3M54 A;  3OQ5 A;  5LJ5 e;  1NLO C;  2QXF A;  1YJW Q;  3L2R A;  3A1P A;  5FU6 C;  5KH6 A;  4J9E A;  2F2W A;  5A0L A;  4C0Z A;  4A4E A;  5GMK l;  2M02 A;  4J6X A;  5GAN h;  5L8R E;  1LPL A;  3GIB A;  1NLP C;  3CCU Q;  2EYQ A;  2JM8 A;  1HJD A;  3RNJ A;  2QQB A;  4BB7 A;  1D3B A;  2J6F A;  1X6G A;  1G3T A;  1LNX A;  1R77 A;  2RQV A;  3HTR A;  3NPF A;  1WHK A;  1PKS A;  4MDW A;  3SWN A;  2OTJ Q;  2DRM A;  4IKF A;  3RMQ A;  3J81 E;  1XJW B;  1H3Z A;  2MCN A;  3A8H B;  5FU7 C;  1BK2 A;  3UWN A;  3QXE B;  4HVU A;  5FU6 B;  4E2F B;  3JCM V;  1VQ9 A;  3INZ A;  4J7I A;  2OJ2 A;  3RES A;  4XK8 E;  2G3R A;  3QUI A;  1PD0 A;  4FT4 A;  1VQN A;  4M7D F;  3BDU A;  4BDZ A;  5D7U A;  1WJR A;  3VJP A;  2ENM A;  3SDZ A;  2LMJ A;  2RK2 A;  2CP6 A;  5GAN 3;  4CI0 C;  2LQK A;  3ZEH A;  3G6E Q;  4EMH A;  4M7A A;  2BIV A;  3AT1 B;  2CH4 W;  1Q82 C;  4PK4 A;  3EHQ A;  4PLI A;  1R0C B;  4HXJ A;  1KFZ A;  2J06 A;  2X3X D;  3I5R A;  2XMF A;  1PWT A;  5IN1 A;  3OY9 A;  3I55 T;  3M0Q A;  2DEU A;  4E7S A;  2HSP A;  2ROT A;  2RJE A;  2QA4 T;  1QKX A;  3NGP A;  3I35 A;  3M4Y A;  5I21 A;  2LT4 A;  1B34 A;  2YXY A;  2OTL A;  5FU7 B;  2E65 A;  4C8Q E;  4JJN K;  3JCM h;  2JM9 A;  3VKI A;  2E5K A;  4JUV A;  1UG1 A;  2DK3 A;  1N9S A;  1BYM A;  4E47 A;  1MMG A;  2K79 A;  4DBH A;  3LWI A;  2EYZ A;  1LOJ A;  3OYH A;  2DXT A;  3CC2 Q;  2JTF A;  4B9W A;  2GQI A;  3RKX A;  4JRP A;  2YUN A;  4C0D C;  4ORZ A;  4C92 C;  1RL2 A;  5IAY A;  1MNE A;  3LLR A;  4R0K A;  3LWH A;  1U5S A;  1YNZ A;  1PC0 A;  4KGX B;  1E7O A;  1S1N A;  5J3B A;  1BI0 A;  1PRL C;  2O4X A;  1VQ7 A;  4M7A F;  2P0K A;  1QVF A;  2I2L A;  1Q7Y C;  3WXM B;  2QI2 A;  5GAM j;  1RLP C;  3M58 A;  5EG2 A;  4NS5 A;  3MCA B;  3CC7 Q;  1AVZ C;  4PJO E;  4QVC A;  1W6X A;  2EBP A;  2DET A;  3HP9 A;  3A98 A;  3C94 A;  3JCM W;  1ZUY A;  2LJ3 A;  1ZSZ C;  2LP5 A;  4BDY A;  3PT9 A;  4M77 E;  4LDV A;  3QWY A;  1DJ7 B;  3JRZ A;  3S3O A;  3LH0 A;  4C0D B;  1BI2 A;  1M9S A;  2HDA A;  4XAX B;  4XU0 A;  2CP7 A;  1ABO A;  1M3C A;  2CUB A;  1E6H A;  1Z9Q A;  3VS2 A;  1YIT Q;  2VGN A;  4C92 B;  2C0O A;  1FWZ A;  1MMA A;  1AHJ B;  1CKB A;  1SHF A;  2GBQ A;  2KRS A;  3GBQ A;  5GAN j;  1B07 A;  2WSC E;  2BKD N;  2J7I A;  3LYI A;  1WJQ A;  1YJ9 T;  2L2P A;  5LJ5 d;  1MGQ A;  3P8H A;  2M51 A;  2QTV A;  1VQK T;  2XID A;  2OX7 A;  3A5Z B;  3E9G A;  3FDR A;  1BIA A;  2EGA A;  1X2K A;  4C92 G;  4DOW A;  1Q95 G;  3HSB A;  4IUT A;  1ZSZ B;  2RJD A;  3E2U A;  2XK0 A;  2COY A;  4DBQ A;  1JJ2 P;  2CZ1 B;  4A4G A;  2K4Y A;  2K57 A;  1W70 A;  3CME Q;  2F2X A;  3M57 A;  1UJ0 A;  1EFN A;  1ZUU A;  2OTL Q;  1TS9 A;  2V8I A;  2ZPB B;  1BCM A;  1BI3 A;  1IRE B;  2CSI A;  1SRM A;  1I5O B;  2F5T X;  3P8B B;  4C0F A;  3CCR A;  2PTK A;  2QYZ A;  4RTV A;  5FLX E;  5KE2 A;  3PVL A;  1QP3 A;  1VQP A;  1IGQ A;  3EH1 A;  1JB0 E;  3SEM A;  5LL6 S;  1S72 Q;  1YWO A;  2CSQ A;  1NG2 A;  3A8M B;  5IHK A;  1VQM T;  2ECZ A;  4OMM A;  2MWP A;  4L6V 5;  1AWJ A;  2MIO A;  2EWN A;  2DAQ A;  5CAI A;  1FXX A;  4A4K A;  5GMK h;  4BE1 A;  2FZG B;  1VQ7 Q;  3V8J A;  1M8V A;  1G3Y A;  4NL2 A;  3OYN A;  3QZ5 B;  4M78 C;  4L5G A;  2YUP A;  1ZBX A;  3CD6 A;  1D0X A;  4E7I A;  2XIC A;  2VKN A;  2VC8 A;  1NJI C;  4HCZ A;  5CKE A;  3VUZ A;  3TCJ A;  3RIR A;  4BE2 A;  4O5V A;  2BE7 D;  5I2S A;  3RR6 A;  3JSC A;  4KUL A;  2RPN A;  1MMN A;  2VGM A;  3H0I A;  3CMA Q;  1VQ6 Q;  2AKK A;  4V2S A;  4ELZ C;  2YT6 A;  2L8D A;  1OX9 A;  1K76 A;  1NZ9 A;  2KNB B;  2ED1 A;  4FT2 A;  4KUD K;  1UTI A;  4FSX A;  1C1A A;  2JMA A;  1SKU B;  3H0H A;  2RHY A;  4M78 B;  1G83 A;  5IXF A;  2KSS A;  3VS7 A;  1UGP B;  4E7K A;  3C4S A;  2MMP A;  2YDL A;  5LJ5 g;  3CC4 T;  2HCK A;  4C92 A;  1YHQ Q;  4Z02 A;  2QTX A;  1SHG A;  4ATO A;  1PSE A;  4F16 A;  4J9G A;  4OB3 B;  1SSF A;  2CP3 A;  3V8L A;  1RAA B;  3FLG A;  5GAO n;  4M7D E;  5LJ3 d;  1M1G A;  5FRO A;  1VQO Q;  2HAX A;  2KGT A;  4M78 G;  2QG9 B;  3RER A;  1WJS A;  1Z9Z A;  3URG A;  5A0G A;  1WDX A;  3FC3 A;  1TH7 A;  2JOY A;  2M9U A;  1PSF A;  1ZX6 A;  1PD1 A;  4PFZ A;  1NPR A;  4RTU A;  2DKG A;  5FRM A;  2HNI A;  1ZSZ A;  4XTX A;  1WI7 A;  3GNG A;  1OU8 A;  5HY6 A;  3OYF A;  2EYW A;  2EJ9 A;  2DD4 A;  3OYK A;  3OYE A;  3M0S A;  3CQT A;  4OML A;  3KFV A;  1VQL A;  3GLX A;  4AFS C;  1WX6 A;  3V7R A;  2EQM A;  3CCS T;  3R6N A;  1Y7X A;  3VS0 A;  1U1S A;  3OYC A;  1SG5 A;  2EAY A;  5KCH A;  3OYL A;  1RAB B;  1VIE A;  1Q86 C;  1G8X A;  2RN8 A;  4C92 F;  5GAO p;  5D6Y A;  5L23 A;  2RH2 A;  1M90 C;  2E41 A;  1VQ5 T;  2EKO A;  5ECA A;  2RK1 A; 
#chains in the Genus database with same CATH homology
 3CMA Q;  1K8A R;  3CCL Q;  3CCR Q;  1NJI R;  1QVF P;  1YIT Q;  1KD1 R;  1N8R R;  1VQ6 Q;  1YHQ Q;  1Q86 R;  1Q82 R;  1KC8 R;  1QVG P;  3CC7 Q;  3G6E Q;  2QEX Q;  1VQ9 Q;  1VQP Q;  3G4S Q;  3CXC P;  1K9M R;  3CCM Q;  3CCU Q;  3CCJ Q;  1VQO Q;  1VQL Q;  3CCQ Q;  1KQS P;  1YI2 Q;  1VQ7 Q;  1YJ9 Q;  3I55 Q;  1JJ2 P;  1Q81 R;  1YJN Q;  1M90 R;  3I56 Q;  1YJW Q;  1VQN Q;  1VQ5 Q;  3CD6 Q;  3CPW P;  1Q7Y R;  1VQ8 Q;  3CCS Q;  3CME Q;  3OW2 P;  1VQK Q;  2QA4 Q;  1K73 R;  1YIJ Q;  3CC4 Q;  3G71 Q;  3CC2 Q;  1VQ4 Q;  1S72 Q;  1VQM Q;  1W2B P;  3CCE Q;  3CCV Q;  2OTJ Q;  1M1K R;  2OTL Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...