1KQSP

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
molecule tags Ribosome
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1kqsP00
1YI2Q 1YITQ 1KC8R 1K8AR 3CXCP 3CC4Q 3CCJQ 1NJIR 1KD1R 3G6EQ 3CCEQ 3CCMQ 1VQ9Q 3CCSQ 3I55Q 1VQMQ 3CCQQ 1YHQQ 1Q86R 1M90R 1VQ4Q 3OW2P 3CPWP 3I56Q 3CMEQ 1VQNQ 1VQ8Q 3CCRQ 1VQPQ 1N8RR 1VQOQ 1VQ5Q 3CD6Q 2QEXQ 1W2BP 1YIJQ 3CCVQ 1K9MR 1Q81R 1YJWQ 1QVFP 3CCLQ 1VQ6Q 3CC7Q 2QA4Q 1YJ9Q 2OTJQ 3CMAQ 1S72Q 1JJ2P 3G4SQ 1M1KR 1YJNQ 1VQLQ 1KQSP 2OTLQ 1VQKQ 1Q82R 1VQ7Q 1K73R 1Q7YR 3G71Q 3CCUQ 1QVGP 3CC2Q
chains in the Genus database with same CATH superfamily
1RAGB 2LX7A 5CKFA 2QQ9A 5LJ3f 2RI3A 1Y07A 3MP6A 5LJ3h 4OGEA 3VV0A 2HZYA 2BKDN 4JPBW 1XTDA 2F2XA 2A28A 5LL6S 1WZOA 5GAOp 4HVVA 2PVOB 3JCMP 3LYIA 4C92E 5A0GA 4EMHA 1Q82R 5KYUA 2AZSA 4E2FB 4M77C 3RMQA 3L1AA 4B9XA 1VQMQ 5KYXB 1QVGS 2RPNA 4J9GA 4M78D 2EGCA 2QDLA 2J05A 2X51A 4R0KA 3NMZC 2C0IA 4N4GA 3LX7A 1UUEA 3U23A 1Y71A 1TG0A 2RO0A 4E7ZA 3JCMJ 1M90C 1KSWA 2KI7A 1AWWA 1FMVA 1WFWA 2JTMA 2ZPHB 2DXBA 3CCMT 4QW2A 1K8AC 4C5GA 2EJGA 4BACA 1J3TA 4BI3A 3KFVA 4E7SA 1IXDA 4EMKB 3OYGA 1WQ7A 4C8QF 5KE2A 5KYWB 3URGA 1VQ6A 3QDFA 3CCJQ 1KQSA 3HKSA 2L89A 5KCOA 2F2VA 5A2QE 1ABQA 2A3LA 5GMKl 2DNUA 2D0QB 4C8QA 1PD0A 2DL3A 3H9NA 4ZGJB 1VQ9T 3CMEA 1RL2A 1N27A 3CCRA 2MPXC 1JEGA 5FU6C 3M57A 3THKA 1Y96B 1D1AA 2FRYA 1NJIU 5L8RE 1NPPA 3CCQQ 1NZ9A 5IHNA 1RAIB 1ZUUA 1UB4A 1OU8A 1JRIA 4HT8A 5FWBA 3CCET 4P5NA 3CXCS 1PRMC 2PU9B 2V1QA 2KRMA 3ASKA 4QQ6A 2DTIA 1WHHA 1M5Q1 2G6FX 2COYA 3G4ST 4RTUA 1UGVA 1EFNA 5HY6A 2BZ8A 4OF1A 5HKCA 3MEUA 4RTVA 2QQAA 1HJDA 2HSPA 2HBPA 4PLIA 1QQJA 3P8BB 3TVTA 3CCUT 5GAN6 1M1KU 3PGGA 2CH4W 4DBQA 2K9GA 1OU9A 4AG1C 5CKBA 1GFDA 3MEAA 3OYIA 2BE7D 3VRZA 3RDVA 1YJNA 4LE9A 4FSSA 1IREB 2CP3A 5FU7B 3CC4T 2KRNA 4E7LA 2K5LA 2E6NA 1VQ8A 2YXYA 2O9SA 2LJ0A 4M7AG 3CD6A 2CZ1B 3JB9I 4ZTJA 2HD0A 3CEYA 3SWNC 3UATA 2X9HA 1GL5A 3V7SA 2L2PA 3WVDB 5HK3A 4BUGA 2EKOA 4DBFA 1BK2A 5KYNA 4F04B 2HEQA 1QVFP 3SFMA 4GBQA 4N0AC 4ZGEB 3I9QA 4M77D 1QVPA 2R5MA 1YJNQ 2LCLA 2DD5A 2ED0A 1UGSB 4J9FA 3BFMA 3BY7A 2BUDA 1NPRA 4BB7A 4A54A 2L5QA 1PSFA 3LWHA 3V7CA 5GAN3 3C95A 1WQWA 3LW5E 1Y96A 5CKEA 2DVJA 4FIBA 3L2ZA 1PKSA 3C12A 4AFZC 3CCQA 1UGQB 2DIGA 2XI9A 4C0DB 3OSVA 1NE8A 2YWWA 3CBOA 1CKAA 1VQ5A 5GAOn 3OA6A 2E1HA 4D8DA 2CP2A 2EQMA 4Y92A 4JRQA 2ZAEA 5A0DA 5J39A 2EJ9A 4M78G 2NUPA 3WXMB 2WACA 4AFUC 3X25B 2GTOA 1ZA2B 2MI6A 1ZA1B 2LCSA 1MGQA 5DM7R 3X26B 1QW1A 2DEUA 2FPDA 3QYGB 1D09B 4KH1B 2M1HA 2JMCA 1VQLT 2OTLT 2JW4A 3L2UA 1KHIA 2LNVA 1ZX6A 2L3PA 5GAOm 3VUZA 1M3CA 3JB9H 3L2RA 1V1CA 4JUVA 1ZUYA 2F1LA 2ESWA 4QQGA 2CKKA 1BYMA 3H41A 2RN8A 5DLQE 1MMGA 4GY5A 2KY9A 3EG9B 2O4XB 1NEGA 1Q7YR 3OB9A 4M7DF 4M75A 4LUDA 4LN2A 2EGAA 3CCLT 2PTKA 1TTHB 4C5IA 2JTFA 1IB8A 4B9WA 1VQKA 3CD6Q 1SEMA 1U8RA 2JJ9A 4M7DA 5GAMf 5CCAA 1B34A 1Z9ZA 3M59A 4J9IA 3NTHA 1RLQC 1Y7XA 4C92D 1PHTA 2E4HA 1I5OB 5LJ5e 1KQSP 3JB9G 1UFFA 1UHFA 1WHLA 2RQUA 2LQKA 3JV3A 2L3RA 5GAMe 1BIAA 5FU6B 3FIFA 1SKUB 2ZPFB 4RTTA 2E10A 2ROTA 4C92B 5CAIA 3OS1A 3P8HA 1EZZB 4BE1A 2JMAA 3A8GB 2QTXA 3H0HA 4MZMA 5DLOA 3CPWP 1FWZA 4DOVA 2VUBA 4ATOA 1VQ5Q 4M4ZA 3QXEB 2D8JA 3CC2A 2FZGB 4GLKA 1OULA 1WX6A 1KJWA 1JXMA 4F7UG 4DBHA 2LCCA 3SB2A 4ELYC 1SRLA 1YCSB 3LGLA 5D7UA 1MV3A 4PJNA 5LJ3j 2RNAA 2OTJA 1ARKA 2KEAA 1JJ2S 2LNHB 2CREA 2DZ9A 1G2BA 3CCUA 1H641 2E5QA 1OPLA 3GIBA 1OX9A 2DMOA 3SWNB 3CMAQ 2ZGWA 2E6ZA 3REBB 2X3XD 1FMWA 5IHKA 1WJQA 2D9TA 3UDCA 2GFUA 2HSEB 4J9CA 1QVFA 4A4GA 2MCNA 3TCJA 3JB9J 1SF9A 4HCCA 2E3IA 4LD9K 2QG9B 3RNJA 2KAFA 2MIOA 4BI8B 3CBPA 5GAN5 1JU5C 2V8JA 3JCMd 4KT0E 2E41A 1KIKA 5IHIA 5GAMj 2ZZDA 4JLIA 4RTZA 4RTYA 1ZLMA 1Q82U 1VQKQ 3MHXA 4N4IA 4ELZC 1BBZA 1T0HA 1E6HA 2OI3A 5GMKh 4RKUE 3V8LA 4IUVA 4MDXA 1VYTA 2XD0A 2IVWA 4RUGA 3NFCA 5CR2A 2KR3A 2P4TA 4E47A 3LGFA 2RQTA 1Y57A 4XTXA 3EH2A 1TUCA 3EG2A 3T9NA 1QCOA 1VQ6T 2HL5C 1FYNA 1YJ9A 3OYMA 2DL4A 1ZQ1A 4FSXA 1YIJT 1K73C 2DA9A 2YUNA 5GJWB 3CCQT 5EC7A 5EG2A 2FHDA 3DLLA 4DA4A 5LJ5d 1Q7YC 2R5AA 1LJOA 1I0CA 1PRLC 4Z8AA 2YLCA 4BDZA 2OTJT 2LJ3A 1WGSA 3UPUA 3M0SA 4F14A 1OZ3A 3CCSQ 4HT9A 3R6NA 4HCBA 3M5AA 3A5ZB 2C0OA 1A0NB 2CUBA 5GAMd 2A7YA 1K9MR 1D3BB 2RHIA 1M30A 4C0FA 1K1ZA 2KROA 4J9HA 2QQSA 1PWTA 4C92F 1OOTA 3CMAT 1MHNA 2DZCA 1Q82C 2KT1A 1BI1A 3PMTA 1AT1B 1NJIR 2RJDA 5IXFA 3CMAA 2A36A 5GJVB 1AZGB 4EMKC 3VYGA 1GXIE 5KYYB 2K5FA 2ED1A 4ME7A 2O9VA 2CDTA 2QXFA 3OYYA 2J6FA 2P0KA 4N4HA 2HKQB 3L42A 1YI2Q 2DIQA 4F7UB 3WVEB 4KH0B 2VWFA 5CKHA 4EIKA 3OYDA 5KYYA 4OGCA 4BY6C 2RJFA 4J9BA 4Y28E 1V76A 2NUPB 3MCAB 4Y91A 1KFZA 4X1VA 1OEBA 1WJSA 3SEMA 2AZVA 3QWYA 1YITT 1GBRA 3H8ZA 2KSSA 4KBMB 5CIUA 1K73R 3EFSA 5D6XA 2FPFA 1IRXA 1NLPC 3M56A 1R0BG 4OVAA 3ME9A 3MO8A 1AWXA 5GAOl 2VC8A 3OBWA 1M1KC 3MEWA 2YLBA 2HAXA 2J06A 2QI2A 4FU6A 1WDXA 5FW9A 4F7UF 3OYKA 4LDXA 1UEBA 2OTLQ 2I0NA 1WHJA 1KQ2A 2NUZA 4O6JA 3QZ9B 1KC8U 1Q86U 2GCXA 4FM4B 4IKFA 3CMET 3NTIA 1C6VX 4HCZA 3I35A 1JJ2A 2F69A 2OJ2A 1VIEA 2O31A 3CCSA 4C5HA 2KBTA 5GMKj 2MYSA 5GAMg 2RD1A 3M0UA 2JN0A 1WHMA 4QVZA 5FLXE 3HL8A 1M90R 3KBGA 4WCIA 1X43A 2JOYA 3G1JA 1MNDA 1I5LA 2XDBA 3RERA 9ATCB 2ZPGB 2NLUA 3MJXA 1ZUKA 3LWIA 4MMLA 2EQKA 5ECAA 2RB6A 1BKBA 1EX4A 1VYUA 4Z88A 3J7AF 5GANd 2EGEA 1EIFA 3VS4A 4J8OA 4QQDA 1S72A 1ZSZC 3CXCA 4DEXA 1KQSS 1VQPQ 5I22A 4PJOF 3BDLA 1NYFA 2CSIA 2CGHA 5GAN7 1Q81U 2FYKA 2CP6A 2J6OA 2K57A 2EVRA 4PJMA 2P84A 4EMKA 6AT1B 3OMCA 1G5VA 2HKNA 4OP0A 3SWNA 1IHVA 2QA4T 2OAWA 5J26A 1JQQA 4PJOG 2EW3A 3RKWA 1IHWA 1C1AA 4XU3A 3G71T 2C06A 2GTJA 1M8VA 1NJIC 3TQ7P 3VKIA 3JRZA 2K5IA 2JUFA 2LVMA 4ESRA 4BE2A 2QTVA 1U3OA 3O5ZA 1LVKA 2DFUA 4PJJA 3E1SA 3PMIA 4JS4A 2Y4YA 4XQ3A 4OMLA 2YHTA 3OYHA 5IXBA 4M78F 2EQUA 4M75D 4D8KA 5KYXA 2QA4Q 1Q95G 2V8IA 2XMFA 4N0AA 2O01E 4JRKA 4M77F 4XTYA 4BI4A 4CC7A 2BE9B 5GAOq 3CCLA 5GAN8 5J3BA 2L0AA 1NLOC 2L3SA 4HCKA 1G3SA 1PM3A 2C0TA 2O2OA 2NUTA 1QP3A 2JXBA 4NL3A 3PT9A 2JM8A 1K9MU 2VXFA 2YRVA 1UG1A 3QPHA 2KE9A 3V7RA 5IH2A 3REAB 2DTOA 1UECA 5FU7C 5KYUB 1UE9A 1AZEA 5KH6A 2LC4A 3QJYA 1QVGP 4IUQA 2QA4A 1M2VB 3RESA 4AFQC 1G83A 4BD3A 5GMKm 2X4JA 2LDMA 2F5TX 2HCKA 1BI3A 4ORZA 2YSQA 1YJWQ 4BDYA 1G3TA 1N6AA 3VS5A 3VU3C 2DK3A 5I11A 3CPWA 5DY9A 3JCMh 1AD5A 1CKBA 2COWA 3A8MB 1LOJA 4J9DA 2XIDA 4OMMA 1W2BP 1TOVA 1XOVA 4LDYA 1BCOA 1TUGB 1M2VA 2D6FA 1YHQA 2H3EB 1TSFA 1VQ7T 1H92A 4X34A 1M3BA 4FT2A 4DEYA 2ZCFB 1VOMA 1YWPA 1AEYA 3VS6A 4UC4A 2KGTA 1S1NA 4MDWA 1F1BB 1K76A 3OSSC 2V26A 3QUIA 4JZ3A 3CCST 3C4SA 3CCJA 2HBWA 2RM4A 1M2OA 4AT1B 3M55A 1M27C 4C92G 2FG0A 1MUZA 1KC8R 3CC7A 1K0XA 3VRYA 2DO3A 1PSEA 1TU0B 5LJ3g 4A4EA 4F17A 4XU0A 3FEOA 4FYVB 3RMSA 2BIVA 1QLYA 3JSCA 4KUDK 2QAZA 2E70A 4OB3B 2LZ6B 3CC4A 4JZ4A 4A4KA 3RIRA 1IZ6A 1H8KA 2DM1A 4M78A 2R58A 3E2UA 1GRIA 4PK4A 3CCEQ 1BIBA 2QGGA 3VS0A 2LMJA 3RKXA 2QEXT 4JJCA 1T3LA 2FO0A 3EHRA 1B3QA 4A63B 2QDYB 3EG3A 3HFNA 4PFPA 4PJOB 3E19A 2JTEA 4M77G 3D7SB 2KMTA 3JCMb 3EG9A 4PJLA 2QEXA 5AT1B 2QYZA 2DXUA 5GMKi 1MV0B 1TWBA 4AG2C 2VB6A 2DJZA 3G4SA 1ZSGA 4HVUA 2M16A 2DE0X 1G8XA 1W2BA 4AFSC 3CCEA 1Q81C 3CC2T 4EDUA 2ENMA 1WHKA 3NTKA 5IAYA 1M9SA 2XKOC 4CI0C 4C8QD 2DXTA 1WXTA 2KT8A 2LT1A 3MPUB 3OW2A 1YHQQ 3M53A 3CMEQ 2BZXA 2VVKA 2KRSA 4J6YA 3OYLA 3P8DA 4KGVB 3FC3A 2OAUA 4OMFB 4OMQA 4M7AE 1WYXA 4A53A 2LTOA 3H0IA 2CP7A 4PNOA 4QT7A 1S72T 4FYYB 2RHYA 2GQIA 3EG0A 3LLRA 4L6V5 2AKKA 1WXBA 3MKDA 3FB9A 7AT1B 1M4ZA 4TVRA 3M4GA 2RK1A 1VQ7A 2DF6A 3R6OA 3E9FA 3CPWS 4M7AD 4FYWB 2K6DA 1E7OA 3UF4A 2NWMA 3M9QA 4KGZB 1YIJA 2MWOA 4M7AA 2FPEA 3QBYA 4FYXB 3E9GA 2CS7A 1N5ZA 1D0XA 1WPYA 3EFRA 1SSHA 5HCKA 3UT1A 1VQ6Q 5D6WA 2YRDA 4F7UA 4EMGA 4M7AF 1JJ2P 4BY6B 5GAN2 3VUBA 1RUWA 3QSUA 1Q86C 1R8OB 2DRKA 2G3RA 2PQWA 1VQ8Q 1U06A 1GBQA 2DYIA 1ABOA 2Y90A 1DJ7B 2RQVA 4M75C 8ATCB 2CUDA 2O88A 3ZL7C 3HRTA 2DVEA 3FRNA 4E6RA 3QJ6A 3OW2S 3QKJA 4KRTA 4ZNXA 3NHNA 3JCMQ 1I8FA 2XDPA 3A8OB 1TH7A 4X9CA 5GANg 3I5SA 2WSEE 4C8QB 4HA8A 1VQ5T 2VV5A 1W70A 1IGQA 2RK2A 1C0MA 1YITA 2DL5A 4JJBA 2K7AA 4BE0A 2SEMA 2ZPEB 1AHJB 4ANJA 2MMPA 3GP8A 1YP5A 2HDAA 3VS2A 2V8KA 4II1A 1QVFS 1I07A 4HVWA 1PNJA 2CT4A 1ZSZB 2RI2A 2HQHA 2LP5A 4L5GA 2PVGB 2FZKB 4C5EA 1WIEA 2DL8A 1NG2A 4DBRA 2SRCA 2JT4A 4YTLA 2GF7A 2RF0A 1BU1A 1HK9A 1PKTA 2RJEA 2B86A 4ZN1A 1FMKA 5FWCA 4LD6A 1RI9A 4PLLA 2JM9A 4WTOB 3GF5A 4HKEA 1UJ0A 2FEIA 3QHSA 2M9UA 3AHUA 3OYFA 3O8VA 4XTWA 2RH2A 3OBYA 2DERA 1CSKA 3TREA 3OYJA 4C8QG 2WSCE 1RADB 4LDVA 3JCMe 3ZFJA 2EQJA 2XU8A 1YJNT 1M8MA 1PC0A 2HMAA 4IIMA 4A4FA 1IO6A 2J7IA 2AK5A 1UGPB 1RAEB 3JCMV 4C0ZA 3KUFA 1UGRB 4PKCC 2EFIA 2X4WA 3Q1JA 3HTRA 3S3NA 4JRIA 2HL3A 4DQ2A 1MMDA 5CQXA 1SSFA 1XJWB 1X2KA 3UA6A 5GANe 2ABLA 2A08A 2AT1B 1M1KR 2KK4A 2K79A 5AYFA 3IQLA 3FDRA 3BW1A 4RCCA 4M7DD 4FW1A 1H3HA 1HYOA 3HP9A 3OS5A 2M0OA 3J81E 2A37A 4MZPA 1N8RR 2M51A 1TUDA 1YNZA 4EPCA 5KYWA 3OS0A 3PE0A 1R77A 4ZTFA 1K8AU 1YITQ 1ACMB 4LDUA 1MNEA 3PIOA 1VQ4Q 4HXJA 2HQEA 2VASA 1WA7A 4PL6A 1YBYA 2K2VA 3L2QA 2RJCA 5GAOr 2J6KA 3S3OA 3EFOA 1SHGA 1O9SA 1NBEB 2X3WD 2CSQA 4R56A 3EGUA 2FVUA 1X6BA 5KE3A 1UJYA 2AHJB 1ZHIA 2DETA 3AT1B 1JBMA 2CT3A 2HNIA 3RBBB 2YUPA 3A1PA 2A0FB 1VQNQ 1SRMA 2EWNA 3KXTA 2P4RA 3GPLA 2EIFA 3JB9D 1T0JA 5CKDA 2DEQA 3TU4K 1YJ9Q 1HSQA 1VQ4A 1VUBA 1WLPB 4PFZA 2O4XA 3BE3A 4OMNA 5I21A 4M7DE 2GGRA 1PCXA 1X6OA 1B07A 3C94A 4IIOA 5GANf 4J9EA 1M90U 4XU1A 2R57A 4M75E 5HK0A 1OYXA 1D1BA 2JNGA 1VQ4T 4CC2A 2DTHA 3G6ET 4V2SA 2IG0A 4FL6A 3EHQA 1OPKA 4M75B 1W4SA 2DYBA 1VQNA 3V8JA 2ATCB 3UWNA 3NGPA 1N8RC 2FRWA 4JDSA 3JCMf 1N9SA 1VA7A 3QYHB 2GNCA 3TEEA 4M7DB 1I1JA 4O5VA 3META 1V29B 4B6MA 1G3WA 2EQIA 3VS7A 1M1GA 2EYYA 5D6YA 1R0CB 3M4YA 3CC2Q 2M0YA 1WI7A 1M1FA 1YWOA 4FW2A 3M0TA 2ZPIB 3A98A 2GFAA 1BCMA 1UTIA 3NPFA 3JAME 2RHXA 1G3YA 4M75F 1JB0E 2WSFE 1VQMT 3VJPA 1TS9A 3FJ5A 4OMOA 1NYGA 2DL7A 2EYQA 2MWPA 1U5SA 3M0PA 4X9DA 2ROLA 2E3HA 2EPDA 1VQKT 1RAFB 1QCNA 3A8LB 4L59A 3CCUQ 1GCPA 3L2WA 3I5RA 2PUKB 2CZ0B 1YJ9T 3GLXA 4FCYA 2JVVA 1K9AA 1WHGA 3GBQA 4OB0B 4KUIA 1X75C 3SHWA 1UDLA 3H6ZA 2DX1A 2RI5A 4C0DC 3TSZA 1PD1A 4NL2A 4ZGDB 4VUBA 2QASA 2DBKA 4M7DG 5M9OA 2DD4A 4J5YA 3GNFB 4Z89A 2QGFB 2QQRA 2M02A 2V1RA 4M7DC 4RMOA 4JJNK 2OX7A 5GANj 3RUXA 1AWJA 2X4XA 3QO3A 3QIIA 3V8KA 3ULRB 2KYBA 2EKHA 3PIPA 2FL7A 4K11A 2PUOB 1OQKA 4E7KA 1B7TA 3EGDA 2K3XA 4XU2A 3JCMW 1OI1A 1X6GA 1YCYA 2W0ZA 4KULA 5GAN4 3CBMA 3MP8A 4IUTA 2K3YA 3G6EA 2OTJQ 5LJ5f 2D0NA 2JZ2A 2QK0A 3X20B 1YFNA 2RA2A 2CH4A 2DPPB 1VQLQ 1D0ZA 1NEBA 1I81A 2VXEA 1I4K1 2GBQA 2K3BA 3ZBDA 3OS2A 1W6XA 5KCHA 2EYWA 2D1XA 3HFOA 1P92A 3DB4A 1VYVA 1N8RU 3EH1A 2BTTA 4LDWA 4M7AC 4A4HA 3J80E 3JCMc 1WNLA 3GOXA 4F7UE 1K9MC 1SPKA 2RQRA 3TSWA 1ZBJA 3PVLA 1M3AA 2KXDA 1IGUA 4PJOA 1BI2A 1FXXA 1KC8C 2GQVA 3OW2P 4LUEA 4M78C 3CD6T 2E65A 2EBPA 1Q81R 2XHCA 2KDSA 2DLPA 3CQTA 2ZPBB 1W1FA 5C0MA 4MZTA 1OV3A 4DOWA 3GNGA 3PVQA 1FX7A 1QMCA 2YUQA 3M0RA 5GMKe 1VQOA 2DRMA 2PVDB 4C8QE 3OY9A 1Q7YU 5GAMh 3VS1A 2DJQA 4QVDA 2AKLA 1B34B 1MMAA 4MMKA 1QCFA 2P0PA 4C0GA 1U1TA 2XG8D 2KQWA 1YI2A 1GCQC 1HXDA 4Q5WA 3CCJT 3M0QA 2F2WA 3FJPA 3OYEA 2COZA 1KHCA 1LPLA 3C0CA 1AVZC 2L3QA 1H3ZA 1X01A 2DAQA 2IPOB 2DXCA 3CCVA 1K0SA 2EYZA 1K4US 3HRUA 2CZ7B 1MMNA 4RTWA 2MAMA 4J6XA 3S3MA 2XDDA 2XK0A 1ZSZA 2QQBA 2LQNA 1YHQT 2LQWA 3X28B 5IT9E 2W10A 4IUPA 1X69A 3BDUA 2DBMA 3M54A 3EGXB 4LXCA 2P0QA 1T3SA 1VQPA 1QKXA 4OMPA 3EGXA 4XK8E 3QDRB 4NOYA 2D8HA 3G6EQ 2AIRB 1QWEA 1YJWT 5FROA 4D6WA 2OTLA 3HHTB 2CYZB 1VQLA 2LJ1A 3CCVQ 4PJOD 1VQ9A 2NYSA 2H3JA 3HPWA 5LJ5h 4CC3A 5C6SA 5FRNA 1YJWA 1KD1R 1U1SA 1RLPC 2DKGA 1GFCA 1SG5A 5CQYA 1VQPT 5A0LA 5LJ5j 1VQNT 4M78E 4XAXB 2B8AA 3FLGA 4OB1B 4WF2A 4RCBA 3SDZA 4CC4B 1PG5B 2E5KA 2E64A 3EAEA 4QKUA 3DB3A 1UHCA 3SD4A 2CP5A 3PNWC 1E6GA 1Y0MA 1K73U 4C92C 4C8QC 2PZ1A 8AT1B 2EAYA 5I2SA 1VQ9Q 4OB2B 3H0FA 2YUOA 3CCVT 1LNXA 4E7HA 3LH5A 5FRMA 1ZBXA 1JO8A 1VQOQ 2NUTB 3CCLQ 4M7AB 4J7IA 3I55T 3OYNA 2YT6A 1XQHA 1SHFA 5LJ5g 4J6WA 3OQ5A 4XTVA 2RQWA 2LRQA 1RAHB 4NS5A 2I2LA 3CCMQ 3I55Q 3ZEHA 4GLMA 1Q86R 2YRCA 2KVQG 1VQOT 1RAAB 3MP1A 1VQ8T 3G71A 4PJOE 4PFOA 1QVGA 3PFSA 2HQXA 1AWOA 3LH0A 4XTUA 2Y4XA 4RTXA 4CRIA 3OYAA 4JRPA 5L23A 3OMGA 4J83A 2CZ6B 1N9RA 3CC7T 1QP2A 2X35A 2YDLA 3DKMA 3A8HB 3HSBA 4RG8A 1WJRA 1X2QA 3EG1A 4M77A 2ECZA 2VYTA 1LCKA 3X24B 3MEVA 4FT4A 3EGDB 2LQ8A 3CPFA 3I55A 1Z9QA 3N5BB 4M78B 3QWXX 2FZCB 1RABB 1KK7A 2CP0A 2DILA 3EFOB 3QG1A 4C92A 1RACB 1AOJA 4M75G 5CK9A 2KYMA 3VYHB 2MK5A 4KGXB 1VIFA 2L8DA 3S6WA 4IURA 1XNIA 2JS0A 2PNIA 3HRSA 4E7IA 2X4YA 5I2MA 2MOXA 1WXUA 1OZ2A 2KNBB 3I56A 2EJFA 2RHUA 2VGMA 1S72Q 4ZN3A 3G4SQ 4M77E 1KG1A 2VGNA 2MF2A 5IN1A 2H8HA 2K4YA 3L2VA 4Z02A 5LJ3d 4RG2A 3CCRT 1GCQA 2F5KA 3OYBA 3CC7Q 3QZ5B 1RI0A 4E7JA 1W2BS 2BZYA 1QWFA 3JCMX 3F70A 5GANh 2LT4A 3OYCA 2K2MA 1D1CA 1X27A 3CXCP 3CC4Q 1D3BA 4M77B 2FB7A 3RKYA 3I56Q 2VKNA 4JJDA 3ER0A 1HD3A 3I56T 2RHZA 4QVCA 2EYXA 2KXCA 4JLGA 4PJOC 1O75A 5LJ3e 3G7ZA 3CCMA 5CVIA 1NM7A 4JS5A 4LNPA 1KD1C 2E12A 2LX9A 5CO7A 1VQ7Q 3G71Q 4R55A 4J7FA 1YN8A 1K8AR 2Z0WA 1KD1U 1OX8A 3PTAA 1BI0A 3DLMA 3RR6A 1D0YA 3CCRQ 2IIMA 2QEXQ 1KQ1A 1YIJQ 1JXOA 2XICA 3JCMg 2RMOA 4XTZA 3UA7A 4AMCA 1VQMA 1BB9A 3JB9F 1YI2T 2JS2A 4F16A 1TXQA 3VS3A 3INZA 4IUUA 3M58A 1QKWA
chains in the Genus database with same CATH topology
1YI2Q 1YITQ 1KC8R 1K8AR 3CXCP 3CC4Q 3CCJQ 1NJIR 1KD1R 3G6EQ 3CCEQ 3CCMQ 1VQ9Q 3CCSQ 3I55Q 1VQMQ 3CCQQ 1YHQQ 1Q86R 1M90R 1VQ4Q 3OW2P 3CPWP 3I56Q 3CMEQ 1VQNQ 1VQ8Q 3CCRQ 1VQPQ 1N8RR 1VQOQ 1VQ5Q 3CD6Q 2QEXQ 1W2BP 1YIJQ 3CCVQ 1K9MR 1Q81R 1YJWQ 1QVFP 3CCLQ 1VQ6Q 3CC7Q 2QA4Q 1YJ9Q 2OTJQ 3CMAQ 1S72Q 1JJ2P 3G4SQ 1M1KR 1YJNQ 1VQLQ 1KQSP 2OTLQ 1VQKQ 1Q82R 1VQ7Q 1K73R 1Q7YR 3G71Q 3CCUQ 1QVGP 3CC2Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 Q;  1YIT Q;  1KC8 R;  1K8A R;  3CXC P;  3CC4 Q;  3CCJ Q;  1NJI R;  1KD1 R;  3G6E Q;  3CCE Q;  3CCM Q;  1VQ9 Q;  3CCS Q;  3I55 Q;  1VQM Q;  3CCQ Q;  1YHQ Q;  1Q86 R;  1M90 R;  1VQ4 Q;  3OW2 P;  3CPW P;  3I56 Q;  3CME Q;  1VQN Q;  1VQ8 Q;  3CCR Q;  1VQP Q;  1N8R R;  1VQO Q;  1VQ5 Q;  3CD6 Q;  2QEX Q;  1W2B P;  1YIJ Q;  3CCV Q;  1K9M R;  1Q81 R;  1YJW Q;  1QVF P;  3CCL Q;  1VQ6 Q;  3CC7 Q;  2QA4 Q;  1YJ9 Q;  2OTJ Q;  3CMA Q;  1S72 Q;  1JJ2 P;  3G4S Q;  1M1K R;  1YJN Q;  1VQL Q;  1KQS P;  2OTL Q;  1VQK Q;  1Q82 R;  1VQ7 Q;  1K73 R;  1Q7Y R;  3G71 Q;  3CCU Q;  1QVG P;  3CC2 Q; 
#chains in the Genus database with same CATH topology
 1RAG B;  2LX7 A;  5CKF A;  2QQ9 A;  5LJ3 f;  2RI3 A;  1Y07 A;  3MP6 A;  5LJ3 h;  4OGE A;  3VV0 A;  2HZY A;  2BKD N;  4JPB W;  1XTD A;  2F2X A;  2A28 A;  5LL6 S;  1WZO A;  5GAO p;  4HVV A;  2PVO B;  3JCM P;  3LYI A;  4C92 E;  5A0G A;  4EMH A;  1Q82 R;  5KYU A;  2AZS A;  4E2F B;  4M77 C;  3RMQ A;  3L1A A;  4B9X A;  1VQM Q;  5KYX B;  1QVG S;  2RPN A;  4J9G A;  4M78 D;  2EGC A;  2QDL A;  2J05 A;  2X51 A;  4R0K A;  3NMZ C;  2C0I A;  4N4G A;  3LX7 A;  1UUE A;  3U23 A;  1Y71 A;  1TG0 A;  2RO0 A;  4E7Z A;  3JCM J;  1M90 C;  1KSW A;  2KI7 A;  1AWW A;  1FMV A;  1WFW A;  2JTM A;  2ZPH B;  2DXB A;  3CCM T;  4QW2 A;  1K8A C;  4C5G A;  2EJG A;  4BAC A;  1J3T A;  4BI3 A;  3KFV A;  4E7S A;  1IXD A;  4EMK B;  3OYG A;  1WQ7 A;  4C8Q F;  5KE2 A;  5KYW B;  3URG A;  1VQ6 A;  3QDF A;  3CCJ Q;  1KQS A;  3HKS A;  2L89 A;  5KCO A;  2F2V A;  5A2Q E;  1ABQ A;  2A3L A;  5GMK l;  2DNU A;  2D0Q B;  4C8Q A;  1PD0 A;  2DL3 A;  3H9N A;  4ZGJ B;  1VQ9 T;  3CME A;  1RL2 A;  1N27 A;  3CCR A;  2MPX C;  1JEG A;  5FU6 C;  3M57 A;  3THK A;  1Y96 B;  1D1A A;  2FRY A;  1NJI U;  5L8R E;  1NPP A;  3CCQ Q;  1NZ9 A;  5IHN A;  1RAI B;  1ZUU A;  1UB4 A;  1OU8 A;  1JRI A;  4HT8 A;  5FWB A;  3CCE T;  4P5N A;  3CXC S;  1PRM C;  2PU9 B;  2V1Q A;  2KRM A;  3ASK A;  4QQ6 A;  2DTI A;  1WHH A;  1M5Q 1;  2G6F X;  2COY A;  3G4S T;  4RTU A;  1UGV A;  1EFN A;  5HY6 A;  2BZ8 A;  4OF1 A;  5HKC A;  3MEU A;  4RTV A;  2QQA A;  1HJD A;  2HSP A;  2HBP A;  4PLI A;  1QQJ A;  3P8B B;  3TVT A;  3CCU T;  5GAN 6;  1M1K U;  3PGG A;  2CH4 W;  4DBQ A;  2K9G A;  1OU9 A;  4AG1 C;  5CKB A;  1GFD A;  3MEA A;  3OYI A;  2BE7 D;  3VRZ A;  3RDV A;  1YJN A;  4LE9 A;  4FSS A;  1IRE B;  2CP3 A;  5FU7 B;  3CC4 T;  2KRN A;  4E7L A;  2K5L A;  2E6N A;  1VQ8 A;  2YXY A;  2O9S A;  2LJ0 A;  4M7A G;  3CD6 A;  2CZ1 B;  3JB9 I;  4ZTJ A;  2HD0 A;  3CEY A;  3SWN C;  3UAT A;  2X9H A;  1GL5 A;  3V7S A;  2L2P A;  3WVD B;  5HK3 A;  4BUG A;  2EKO A;  4DBF A;  1BK2 A;  5KYN A;  4F04 B;  2HEQ A;  1QVF P;  3SFM A;  4GBQ A;  4N0A C;  4ZGE B;  3I9Q A;  4M77 D;  1QVP A;  2R5M A;  1YJN Q;  2LCL A;  2DD5 A;  2ED0 A;  1UGS B;  4J9F A;  3BFM A;  3BY7 A;  2BUD A;  1NPR A;  4BB7 A;  4A54 A;  2L5Q A;  1PSF A;  3LWH A;  3V7C A;  5GAN 3;  3C95 A;  1WQW A;  3LW5 E;  1Y96 A;  5CKE A;  2DVJ A;  4FIB A;  3L2Z A;  1PKS A;  3C12 A;  4AFZ C;  3CCQ A;  1UGQ B;  2DIG A;  2XI9 A;  4C0D B;  3OSV A;  1NE8 A;  2YWW A;  3CBO A;  1CKA A;  1VQ5 A;  5GAO n;  3OA6 A;  2E1H A;  4D8D A;  2CP2 A;  2EQM A;  4Y92 A;  4JRQ A;  2ZAE A;  5A0D A;  5J39 A;  2EJ9 A;  4M78 G;  2NUP A;  3WXM B;  2WAC A;  4AFU C;  3X25 B;  2GTO A;  1ZA2 B;  2MI6 A;  1ZA1 B;  2LCS A;  1MGQ A;  5DM7 R;  3X26 B;  1QW1 A;  2DEU A;  2FPD A;  3QYG B;  1D09 B;  4KH1 B;  2M1H A;  2JMC A;  1VQL T;  2OTL T;  2JW4 A;  3L2U A;  1KHI A;  2LNV A;  1ZX6 A;  2L3P A;  5GAO m;  3VUZ A;  1M3C A;  3JB9 H;  3L2R A;  1V1C A;  4JUV A;  1ZUY A;  2F1L A;  2ESW A;  4QQG A;  2CKK A;  1BYM A;  3H41 A;  2RN8 A;  5DLQ E;  1MMG A;  4GY5 A;  2KY9 A;  3EG9 B;  2O4X B;  1NEG A;  1Q7Y R;  3OB9 A;  4M7D F;  4M75 A;  4LUD A;  4LN2 A;  2EGA A;  3CCL T;  2PTK A;  1TTH B;  4C5I A;  2JTF A;  1IB8 A;  4B9W A;  1VQK A;  3CD6 Q;  1SEM A;  1U8R A;  2JJ9 A;  4M7D A;  5GAM f;  5CCA A;  1B34 A;  1Z9Z A;  3M59 A;  4J9I A;  3NTH A;  1RLQ C;  1Y7X A;  4C92 D;  1PHT A;  2E4H A;  1I5O B;  5LJ5 e;  1KQS P;  3JB9 G;  1UFF A;  1UHF A;  1WHL A;  2RQU A;  2LQK A;  3JV3 A;  2L3R A;  5GAM e;  1BIA A;  5FU6 B;  3FIF A;  1SKU B;  2ZPF B;  4RTT A;  2E10 A;  2ROT A;  4C92 B;  5CAI A;  3OS1 A;  3P8H A;  1EZZ B;  4BE1 A;  2JMA A;  3A8G B;  2QTX A;  3H0H A;  4MZM A;  5DLO A;  3CPW P;  1FWZ A;  4DOV A;  2VUB A;  4ATO A;  1VQ5 Q;  4M4Z A;  3QXE B;  2D8J A;  3CC2 A;  2FZG B;  4GLK A;  1OUL A;  1WX6 A;  1KJW A;  1JXM A;  4F7U G;  4DBH A;  2LCC A;  3SB2 A;  4ELY C;  1SRL A;  1YCS B;  3LGL A;  5D7U A;  1MV3 A;  4PJN A;  5LJ3 j;  2RNA A;  2OTJ A;  1ARK A;  2KEA A;  1JJ2 S;  2LNH B;  2CRE A;  2DZ9 A;  1G2B A;  3CCU A;  1H64 1;  2E5Q A;  1OPL A;  3GIB A;  1OX9 A;  2DMO A;  3SWN B;  3CMA Q;  2ZGW A;  2E6Z A;  3REB B;  2X3X D;  1FMW A;  5IHK A;  1WJQ A;  2D9T A;  3UDC A;  2GFU A;  2HSE B;  4J9C A;  1QVF A;  4A4G A;  2MCN A;  3TCJ A;  3JB9 J;  1SF9 A;  4HCC A;  2E3I A;  4LD9 K;  2QG9 B;  3RNJ A;  2KAF A;  2MIO A;  4BI8 B;  3CBP A;  5GAN 5;  1JU5 C;  2V8J A;  3JCM d;  4KT0 E;  2E41 A;  1KIK A;  5IHI A;  5GAM j;  2ZZD A;  4JLI A;  4RTZ A;  4RTY A;  1ZLM A;  1Q82 U;  1VQK Q;  3MHX A;  4N4I A;  4ELZ C;  1BBZ A;  1T0H A;  1E6H A;  2OI3 A;  5GMK h;  4RKU E;  3V8L A;  4IUV A;  4MDX A;  1VYT A;  2XD0 A;  2IVW A;  4RUG A;  3NFC A;  5CR2 A;  2KR3 A;  2P4T A;  4E47 A;  3LGF A;  2RQT A;  1Y57 A;  4XTX A;  3EH2 A;  1TUC A;  3EG2 A;  3T9N A;  1QCO A;  1VQ6 T;  2HL5 C;  1FYN A;  1YJ9 A;  3OYM A;  2DL4 A;  1ZQ1 A;  4FSX A;  1YIJ T;  1K73 C;  2DA9 A;  2YUN A;  5GJW B;  3CCQ T;  5EC7 A;  5EG2 A;  2FHD A;  3DLL A;  4DA4 A;  5LJ5 d;  1Q7Y C;  2R5A A;  1LJO A;  1I0C A;  1PRL C;  4Z8A A;  2YLC A;  4BDZ A;  2OTJ T;  2LJ3 A;  1WGS A;  3UPU A;  3M0S A;  4F14 A;  1OZ3 A;  3CCS Q;  4HT9 A;  3R6N A;  4HCB A;  3M5A A;  3A5Z B;  2C0O A;  1A0N B;  2CUB A;  5GAM d;  2A7Y A;  1K9M R;  1D3B B;  2RHI A;  1M30 A;  4C0F A;  1K1Z A;  2KRO A;  4J9H A;  2QQS A;  1PWT A;  4C92 F;  1OOT A;  3CMA T;  1MHN A;  2DZC A;  1Q82 C;  2KT1 A;  1BI1 A;  3PMT A;  1AT1 B;  1NJI R;  2RJD A;  5IXF A;  3CMA A;  2A36 A;  5GJV B;  1AZG B;  4EMK C;  3VYG A;  1GXI E;  5KYY B;  2K5F A;  2ED1 A;  4ME7 A;  2O9V A;  2CDT A;  2QXF A;  3OYY A;  2J6F A;  2P0K A;  4N4H A;  2HKQ B;  3L42 A;  1YI2 Q;  2DIQ A;  4F7U B;  3WVE B;  4KH0 B;  2VWF A;  5CKH A;  4EIK A;  3OYD A;  5KYY A;  4OGC A;  4BY6 C;  2RJF A;  4J9B A;  4Y28 E;  1V76 A;  2NUP B;  3MCA B;  4Y91 A;  1KFZ A;  4X1V A;  1OEB A;  1WJS A;  3SEM A;  2AZV A;  3QWY A;  1YIT T;  1GBR A;  3H8Z A;  2KSS A;  4KBM B;  5CIU A;  1K73 R;  3EFS A;  5D6X A;  2FPF A;  1IRX A;  1NLP C;  3M56 A;  1R0B G;  4OVA A;  3ME9 A;  3MO8 A;  1AWX A;  5GAO l;  2VC8 A;  3OBW A;  1M1K C;  3MEW A;  2YLB A;  2HAX A;  2J06 A;  2QI2 A;  4FU6 A;  1WDX A;  5FW9 A;  4F7U F;  3OYK A;  4LDX A;  1UEB A;  2OTL Q;  2I0N A;  1WHJ A;  1KQ2 A;  2NUZ A;  4O6J A;  3QZ9 B;  1KC8 U;  1Q86 U;  2GCX A;  4FM4 B;  4IKF A;  3CME T;  3NTI A;  1C6V X;  4HCZ A;  3I35 A;  1JJ2 A;  2F69 A;  2OJ2 A;  1VIE A;  2O31 A;  3CCS A;  4C5H A;  2KBT A;  5GMK j;  2MYS A;  5GAM g;  2RD1 A;  3M0U A;  2JN0 A;  1WHM A;  4QVZ A;  5FLX E;  3HL8 A;  1M90 R;  3KBG A;  4WCI A;  1X43 A;  2JOY A;  3G1J A;  1MND A;  1I5L A;  2XDB A;  3RER A;  9ATC B;  2ZPG B;  2NLU A;  3MJX A;  1ZUK A;  3LWI A;  4MML A;  2EQK A;  5ECA A;  2RB6 A;  1BKB A;  1EX4 A;  1VYU A;  4Z88 A;  3J7A F;  5GAN d;  2EGE A;  1EIF A;  3VS4 A;  4J8O A;  4QQD A;  1S72 A;  1ZSZ C;  3CXC A;  4DEX A;  1KQS S;  1VQP Q;  5I22 A;  4PJO F;  3BDL A;  1NYF A;  2CSI A;  2CGH A;  5GAN 7;  1Q81 U;  2FYK A;  2CP6 A;  2J6O A;  2K57 A;  2EVR A;  4PJM A;  2P84 A;  4EMK A;  6AT1 B;  3OMC A;  1G5V A;  2HKN A;  4OP0 A;  3SWN A;  1IHV A;  2QA4 T;  2OAW A;  5J26 A;  1JQQ A;  4PJO G;  2EW3 A;  3RKW A;  1IHW A;  1C1A A;  4XU3 A;  3G71 T;  2C06 A;  2GTJ A;  1M8V A;  1NJI C;  3TQ7 P;  3VKI A;  3JRZ A;  2K5I A;  2JUF A;  2LVM A;  4ESR A;  4BE2 A;  2QTV A;  1U3O A;  3O5Z A;  1LVK A;  2DFU A;  4PJJ A;  3E1S A;  3PMI A;  4JS4 A;  2Y4Y A;  4XQ3 A;  4OML A;  2YHT A;  3OYH A;  5IXB A;  4M78 F;  2EQU A;  4M75 D;  4D8K A;  5KYX A;  2QA4 Q;  1Q95 G;  2V8I A;  2XMF A;  4N0A A;  2O01 E;  4JRK A;  4M77 F;  4XTY A;  4BI4 A;  4CC7 A;  2BE9 B;  5GAO q;  3CCL A;  5GAN 8;  5J3B A;  2L0A A;  1NLO C;  2L3S A;  4HCK A;  1G3S A;  1PM3 A;  2C0T A;  2O2O A;  2NUT A;  1QP3 A;  2JXB A;  4NL3 A;  3PT9 A;  2JM8 A;  1K9M U;  2VXF A;  2YRV A;  1UG1 A;  3QPH A;  2KE9 A;  3V7R A;  5IH2 A;  3REA B;  2DTO A;  1UEC A;  5FU7 C;  5KYU B;  1UE9 A;  1AZE A;  5KH6 A;  2LC4 A;  3QJY A;  1QVG P;  4IUQ A;  2QA4 A;  1M2V B;  3RES A;  4AFQ C;  1G83 A;  4BD3 A;  5GMK m;  2X4J A;  2LDM A;  2F5T X;  2HCK A;  1BI3 A;  4ORZ A;  2YSQ A;  1YJW Q;  4BDY A;  1G3T A;  1N6A A;  3VS5 A;  3VU3 C;  2DK3 A;  5I11 A;  3CPW A;  5DY9 A;  3JCM h;  1AD5 A;  1CKB A;  2COW A;  3A8M B;  1LOJ A;  4J9D A;  2XID A;  4OMM A;  1W2B P;  1TOV A;  1XOV A;  4LDY A;  1BCO A;  1TUG B;  1M2V A;  2D6F A;  1YHQ A;  2H3E B;  1TSF A;  1VQ7 T;  1H92 A;  4X34 A;  1M3B A;  4FT2 A;  4DEY A;  2ZCF B;  1VOM A;  1YWP A;  1AEY A;  3VS6 A;  4UC4 A;  2KGT A;  1S1N A;  4MDW A;  1F1B B;  1K76 A;  3OSS C;  2V26 A;  3QUI A;  4JZ3 A;  3CCS T;  3C4S A;  3CCJ A;  2HBW A;  2RM4 A;  1M2O A;  4AT1 B;  3M55 A;  1M27 C;  4C92 G;  2FG0 A;  1MUZ A;  1KC8 R;  3CC7 A;  1K0X A;  3VRY A;  2DO3 A;  1PSE A;  1TU0 B;  5LJ3 g;  4A4E A;  4F17 A;  4XU0 A;  3FEO A;  4FYV B;  3RMS A;  2BIV A;  1QLY A;  3JSC A;  4KUD K;  2QAZ A;  2E70 A;  4OB3 B;  2LZ6 B;  3CC4 A;  4JZ4 A;  4A4K A;  3RIR A;  1IZ6 A;  1H8K A;  2DM1 A;  4M78 A;  2R58 A;  3E2U A;  1GRI A;  4PK4 A;  3CCE Q;  1BIB A;  2QGG A;  3VS0 A;  2LMJ A;  3RKX A;  2QEX T;  4JJC A;  1T3L A;  2FO0 A;  3EHR A;  1B3Q A;  4A63 B;  2QDY B;  3EG3 A;  3HFN A;  4PFP A;  4PJO B;  3E19 A;  2JTE A;  4M77 G;  3D7S B;  2KMT A;  3JCM b;  3EG9 A;  4PJL A;  2QEX A;  5AT1 B;  2QYZ A;  2DXU A;  5GMK i;  1MV0 B;  1TWB A;  4AG2 C;  2VB6 A;  2DJZ A;  3G4S A;  1ZSG A;  4HVU A;  2M16 A;  2DE0 X;  1G8X A;  1W2B A;  4AFS C;  3CCE A;  1Q81 C;  3CC2 T;  4EDU A;  2ENM A;  1WHK A;  3NTK A;  5IAY A;  1M9S A;  2XKO C;  4CI0 C;  4C8Q D;  2DXT A;  1WXT A;  2KT8 A;  2LT1 A;  3MPU B;  3OW2 A;  1YHQ Q;  3M53 A;  3CME Q;  2BZX A;  2VVK A;  2KRS A;  4J6Y A;  3OYL A;  3P8D A;  4KGV B;  3FC3 A;  2OAU A;  4OMF B;  4OMQ A;  4M7A E;  1WYX A;  4A53 A;  2LTO A;  3H0I A;  2CP7 A;  4PNO A;  4QT7 A;  1S72 T;  4FYY B;  2RHY A;  2GQI A;  3EG0 A;  3LLR A;  4L6V 5;  2AKK A;  1WXB A;  3MKD A;  3FB9 A;  7AT1 B;  1M4Z A;  4TVR A;  3M4G A;  2RK1 A;  1VQ7 A;  2DF6 A;  3R6O A;  3E9F A;  3CPW S;  4M7A D;  4FYW B;  2K6D A;  1E7O A;  3UF4 A;  2NWM A;  3M9Q A;  4KGZ B;  1YIJ A;  2MWO A;  4M7A A;  2FPE A;  3QBY A;  4FYX B;  3E9G A;  2CS7 A;  1N5Z A;  1D0X A;  1WPY A;  3EFR A;  1SSH A;  5HCK A;  3UT1 A;  1VQ6 Q;  5D6W A;  2YRD A;  4F7U A;  4EMG A;  4M7A F;  1JJ2 P;  4BY6 B;  5GAN 2;  3VUB A;  1RUW A;  3QSU A;  1Q86 C;  1R8O B;  2DRK A;  2G3R A;  2PQW A;  1VQ8 Q;  1U06 A;  1GBQ A;  2DYI A;  1ABO A;  2Y90 A;  1DJ7 B;  2RQV A;  4M75 C;  8ATC B;  2CUD A;  2O88 A;  3ZL7 C;  3HRT A;  2DVE A;  3FRN A;  4E6R A;  3QJ6 A;  3OW2 S;  3QKJ A;  4KRT A;  4ZNX A;  3NHN A;  3JCM Q;  1I8F A;  2XDP A;  3A8O B;  1TH7 A;  4X9C A;  5GAN g;  3I5S A;  2WSE E;  4C8Q B;  4HA8 A;  1VQ5 T;  2VV5 A;  1W70 A;  1IGQ A;  2RK2 A;  1C0M A;  1YIT A;  2DL5 A;  4JJB A;  2K7A A;  4BE0 A;  2SEM A;  2ZPE B;  1AHJ B;  4ANJ A;  2MMP A;  3GP8 A;  1YP5 A;  2HDA A;  3VS2 A;  2V8K A;  4II1 A;  1QVF S;  1I07 A;  4HVW A;  1PNJ A;  2CT4 A;  1ZSZ B;  2RI2 A;  2HQH A;  2LP5 A;  4L5G A;  2PVG B;  2FZK B;  4C5E A;  1WIE A;  2DL8 A;  1NG2 A;  4DBR A;  2SRC A;  2JT4 A;  4YTL A;  2GF7 A;  2RF0 A;  1BU1 A;  1HK9 A;  1PKT A;  2RJE A;  2B86 A;  4ZN1 A;  1FMK A;  5FWC A;  4LD6 A;  1RI9 A;  4PLL A;  2JM9 A;  4WTO B;  3GF5 A;  4HKE A;  1UJ0 A;  2FEI A;  3QHS A;  2M9U A;  3AHU A;  3OYF A;  3O8V A;  4XTW A;  2RH2 A;  3OBY A;  2DER A;  1CSK A;  3TRE A;  3OYJ A;  4C8Q G;  2WSC E;  1RAD B;  4LDV A;  3JCM e;  3ZFJ A;  2EQJ A;  2XU8 A;  1YJN T;  1M8M A;  1PC0 A;  2HMA A;  4IIM A;  4A4F A;  1IO6 A;  2J7I A;  2AK5 A;  1UGP B;  1RAE B;  3JCM V;  4C0Z A;  3KUF A;  1UGR B;  4PKC C;  2EFI A;  2X4W A;  3Q1J A;  3HTR A;  3S3N A;  4JRI A;  2HL3 A;  4DQ2 A;  1MMD A;  5CQX A;  1SSF A;  1XJW B;  1X2K A;  3UA6 A;  5GAN e;  2ABL A;  2A08 A;  2AT1 B;  1M1K R;  2KK4 A;  2K79 A;  5AYF A;  3IQL A;  3FDR A;  3BW1 A;  4RCC A;  4M7D D;  4FW1 A;  1H3H A;  1HYO A;  3HP9 A;  3OS5 A;  2M0O A;  3J81 E;  2A37 A;  4MZP A;  1N8R R;  2M51 A;  1TUD A;  1YNZ A;  4EPC A;  5KYW A;  3OS0 A;  3PE0 A;  1R77 A;  4ZTF A;  1K8A U;  1YIT Q;  1ACM B;  4LDU A;  1MNE A;  3PIO A;  1VQ4 Q;  4HXJ A;  2HQE A;  2VAS A;  1WA7 A;  4PL6 A;  1YBY A;  2K2V A;  3L2Q A;  2RJC A;  5GAO r;  2J6K A;  3S3O A;  3EFO A;  1SHG A;  1O9S A;  1NBE B;  2X3W D;  2CSQ A;  4R56 A;  3EGU A;  2FVU A;  1X6B A;  5KE3 A;  1UJY A;  2AHJ B;  1ZHI A;  2DET A;  3AT1 B;  1JBM A;  2CT3 A;  2HNI A;  3RBB B;  2YUP A;  3A1P A;  2A0F B;  1VQN Q;  1SRM A;  2EWN A;  3KXT A;  2P4R A;  3GPL A;  2EIF A;  3JB9 D;  1T0J A;  5CKD A;  2DEQ A;  3TU4 K;  1YJ9 Q;  1HSQ A;  1VQ4 A;  1VUB A;  1WLP B;  4PFZ A;  2O4X A;  3BE3 A;  4OMN A;  5I21 A;  4M7D E;  2GGR A;  1PCX A;  1X6O A;  1B07 A;  3C94 A;  4IIO A;  5GAN f;  4J9E A;  1M90 U;  4XU1 A;  2R57 A;  4M75 E;  5HK0 A;  1OYX A;  1D1B A;  2JNG A;  1VQ4 T;  4CC2 A;  2DTH A;  3G6E T;  4V2S A;  2IG0 A;  4FL6 A;  3EHQ A;  1OPK A;  4M75 B;  1W4S A;  2DYB A;  1VQN A;  3V8J A;  2ATC B;  3UWN A;  3NGP A;  1N8R C;  2FRW A;  4JDS A;  3JCM f;  1N9S A;  1VA7 A;  3QYH B;  2GNC A;  3TEE A;  4M7D B;  1I1J A;  4O5V A;  3MET A;  1V29 B;  4B6M A;  1G3W A;  2EQI A;  3VS7 A;  1M1G A;  2EYY A;  5D6Y A;  1R0C B;  3M4Y A;  3CC2 Q;  2M0Y A;  1WI7 A;  1M1F A;  1YWO A;  4FW2 A;  3M0T A;  2ZPI B;  3A98 A;  2GFA A;  1BCM A;  1UTI A;  3NPF A;  3JAM E;  2RHX A;  1G3Y A;  4M75 F;  1JB0 E;  2WSF E;  1VQM T;  3VJP A;  1TS9 A;  3FJ5 A;  4OMO A;  1NYG A;  2DL7 A;  2EYQ A;  2MWP A;  1U5S A;  3M0P A;  4X9D A;  2ROL A;  2E3H A;  2EPD A;  1VQK T;  1RAF B;  1QCN A;  3A8L B;  4L59 A;  3CCU Q;  1GCP A;  3L2W A;  3I5R A;  2PUK B;  2CZ0 B;  1YJ9 T;  3GLX A;  4FCY A;  2JVV A;  1K9A A;  1WHG A;  3GBQ A;  4OB0 B;  4KUI A;  1X75 C;  3SHW A;  1UDL A;  3H6Z A;  2DX1 A;  2RI5 A;  4C0D C;  3TSZ A;  1PD1 A;  4NL2 A;  4ZGD B;  4VUB A;  2QAS A;  2DBK A;  4M7D G;  5M9O A;  2DD4 A;  4J5Y A;  3GNF B;  4Z89 A;  2QGF B;  2QQR A;  2M02 A;  2V1R A;  4M7D C;  4RMO A;  4JJN K;  2OX7 A;  5GAN j;  3RUX A;  1AWJ A;  2X4X A;  3QO3 A;  3QII A;  3V8K A;  3ULR B;  2KYB A;  2EKH A;  3PIP A;  2FL7 A;  4K11 A;  2PUO B;  1OQK A;  4E7K A;  1B7T A;  3EGD A;  2K3X A;  4XU2 A;  3JCM W;  1OI1 A;  1X6G A;  1YCY A;  2W0Z A;  4KUL A;  5GAN 4;  3CBM A;  3MP8 A;  4IUT A;  2K3Y A;  3G6E A;  2OTJ Q;  5LJ5 f;  2D0N A;  2JZ2 A;  2QK0 A;  3X20 B;  1YFN A;  2RA2 A;  2CH4 A;  2DPP B;  1VQL Q;  1D0Z A;  1NEB A;  1I81 A;  2VXE A;  1I4K 1;  2GBQ A;  2K3B A;  3ZBD A;  3OS2 A;  1W6X A;  5KCH A;  2EYW A;  2D1X A;  3HFO A;  1P92 A;  3DB4 A;  1VYV A;  1N8R U;  3EH1 A;  2BTT A;  4LDW A;  4M7A C;  4A4H A;  3J80 E;  3JCM c;  1WNL A;  3GOX A;  4F7U E;  1K9M C;  1SPK A;  2RQR A;  3TSW A;  1ZBJ A;  3PVL A;  1M3A A;  2KXD A;  1IGU A;  4PJO A;  1BI2 A;  1FXX A;  1KC8 C;  2GQV A;  3OW2 P;  4LUE A;  4M78 C;  3CD6 T;  2E65 A;  2EBP A;  1Q81 R;  2XHC A;  2KDS A;  2DLP A;  3CQT A;  2ZPB B;  1W1F A;  5C0M A;  4MZT A;  1OV3 A;  4DOW A;  3GNG A;  3PVQ A;  1FX7 A;  1QMC A;  2YUQ A;  3M0R A;  5GMK e;  1VQO A;  2DRM A;  2PVD B;  4C8Q E;  3OY9 A;  1Q7Y U;  5GAM h;  3VS1 A;  2DJQ A;  4QVD A;  2AKL A;  1B34 B;  1MMA A;  4MMK A;  1QCF A;  2P0P A;  4C0G A;  1U1T A;  2XG8 D;  2KQW A;  1YI2 A;  1GCQ C;  1HXD A;  4Q5W A;  3CCJ T;  3M0Q A;  2F2W A;  3FJP A;  3OYE A;  2COZ A;  1KHC A;  1LPL A;  3C0C A;  1AVZ C;  2L3Q A;  1H3Z A;  1X01 A;  2DAQ A;  2IPO B;  2DXC A;  3CCV A;  1K0S A;  2EYZ A;  1K4U S;  3HRU A;  2CZ7 B;  1MMN A;  4RTW A;  2MAM A;  4J6X A;  3S3M A;  2XDD A;  2XK0 A;  1ZSZ A;  2QQB A;  2LQN A;  1YHQ T;  2LQW A;  3X28 B;  5IT9 E;  2W10 A;  4IUP A;  1X69 A;  3BDU A;  2DBM A;  3M54 A;  3EGX B;  4LXC A;  2P0Q A;  1T3S A;  1VQP A;  1QKX A;  4OMP A;  3EGX A;  4XK8 E;  3QDR B;  4NOY A;  2D8H A;  3G6E Q;  2AIR B;  1QWE A;  1YJW T;  5FRO A;  4D6W A;  2OTL A;  3HHT B;  2CYZ B;  1VQL A;  2LJ1 A;  3CCV Q;  4PJO D;  1VQ9 A;  2NYS A;  2H3J A;  3HPW A;  5LJ5 h;  4CC3 A;  5C6S A;  5FRN A;  1YJW A;  1KD1 R;  1U1S A;  1RLP C;  2DKG A;  1GFC A;  1SG5 A;  5CQY A;  1VQP T;  5A0L A;  5LJ5 j;  1VQN T;  4M78 E;  4XAX B;  2B8A A;  3FLG A;  4OB1 B;  4WF2 A;  4RCB A;  3SDZ A;  4CC4 B;  1PG5 B;  2E5K A;  2E64 A;  3EAE A;  4QKU A;  3DB3 A;  1UHC A;  3SD4 A;  2CP5 A;  3PNW C;  1E6G A;  1Y0M A;  1K73 U;  4C92 C;  4C8Q C;  2PZ1 A;  8AT1 B;  2EAY A;  5I2S A;  1VQ9 Q;  4OB2 B;  3H0F A;  2YUO A;  3CCV T;  1LNX A;  4E7H A;  3LH5 A;  5FRM A;  1ZBX A;  1JO8 A;  1VQO Q;  2NUT B;  3CCL Q;  4M7A B;  4J7I A;  3I55 T;  3OYN A;  2YT6 A;  1XQH A;  1SHF A;  5LJ5 g;  4J6W A;  3OQ5 A;  4XTV A;  2RQW A;  2LRQ A;  1RAH B;  4NS5 A;  2I2L A;  3CCM Q;  3I55 Q;  3ZEH A;  4GLM A;  1Q86 R;  2YRC A;  2KVQ G;  1VQO T;  1RAA B;  3MP1 A;  1VQ8 T;  3G71 A;  4PJO E;  4PFO A;  1QVG A;  3PFS A;  2HQX A;  1AWO A;  3LH0 A;  4XTU A;  2Y4X A;  4RTX A;  4CRI A;  3OYA A;  4JRP A;  5L23 A;  3OMG A;  4J83 A;  2CZ6 B;  1N9R A;  3CC7 T;  1QP2 A;  2X35 A;  2YDL A;  3DKM A;  3A8H B;  3HSB A;  4RG8 A;  1WJR A;  1X2Q A;  3EG1 A;  4M77 A;  2ECZ A;  2VYT A;  1LCK A;  3X24 B;  3MEV A;  4FT4 A;  3EGD B;  2LQ8 A;  3CPF A;  3I55 A;  1Z9Q A;  3N5B B;  4M78 B;  3QWX X;  2FZC B;  1RAB B;  1KK7 A;  2CP0 A;  2DIL A;  3EFO B;  3QG1 A;  4C92 A;  1RAC B;  1AOJ A;  4M75 G;  5CK9 A;  2KYM A;  3VYH B;  2MK5 A;  4KGX B;  1VIF A;  2L8D A;  3S6W A;  4IUR A;  1XNI A;  2JS0 A;  2PNI A;  3HRS A;  4E7I A;  2X4Y A;  5I2M A;  2MOX A;  1WXU A;  1OZ2 A;  2KNB B;  3I56 A;  2EJF A;  2RHU A;  2VGM A;  1S72 Q;  4ZN3 A;  3G4S Q;  4M77 E;  1KG1 A;  2VGN A;  2MF2 A;  5IN1 A;  2H8H A;  2K4Y A;  3L2V A;  4Z02 A;  5LJ3 d;  4RG2 A;  3CCR T;  1GCQ A;  2F5K A;  3OYB A;  3CC7 Q;  3QZ5 B;  1RI0 A;  4E7J A;  1W2B S;  2BZY A;  1QWF A;  3JCM X;  3F70 A;  5GAN h;  2LT4 A;  3OYC A;  2K2M A;  1D1C A;  1X27 A;  3CXC P;  3CC4 Q;  1D3B A;  4M77 B;  2FB7 A;  3RKY A;  3I56 Q;  2VKN A;  4JJD A;  3ER0 A;  1HD3 A;  3I56 T;  2RHZ A;  4QVC A;  2EYX A;  2KXC A;  4JLG A;  4PJO C;  1O75 A;  5LJ3 e;  3G7Z A;  3CCM A;  5CVI A;  1NM7 A;  4JS5 A;  4LNP A;  1KD1 C;  2E12 A;  2LX9 A;  5CO7 A;  1VQ7 Q;  3G71 Q;  4R55 A;  4J7F A;  1YN8 A;  1K8A R;  2Z0W A;  1KD1 U;  1OX8 A;  3PTA A;  1BI0 A;  3DLM A;  3RR6 A;  1D0Y A;  3CCR Q;  2IIM A;  2QEX Q;  1KQ1 A;  1YIJ Q;  1JXO A;  2XIC A;  3JCM g;  2RMO A;  4XTZ A;  3UA7 A;  4AMC A;  1VQM A;  1BB9 A;  3JB9 F;  1YI2 T;  2JS2 A;  4F16 A;  1TXQ A;  3VS3 A;  3INZ A;  4IUU A;  3M58 A;  1QKW A; 
#chains in the Genus database with same CATH homology
 1YI2 Q;  1YIT Q;  1KC8 R;  1K8A R;  3CXC P;  3CC4 Q;  3CCJ Q;  1NJI R;  1KD1 R;  3G6E Q;  3CCE Q;  3CCM Q;  1VQ9 Q;  3CCS Q;  3I55 Q;  1VQM Q;  3CCQ Q;  1YHQ Q;  1Q86 R;  1M90 R;  1VQ4 Q;  3OW2 P;  3CPW P;  3I56 Q;  3CME Q;  1VQN Q;  1VQ8 Q;  3CCR Q;  1VQP Q;  1N8R R;  1VQO Q;  1VQ5 Q;  3CD6 Q;  2QEX Q;  1W2B P;  1YIJ Q;  3CCV Q;  1K9M R;  1Q81 R;  1YJW Q;  1QVF P;  3CCL Q;  1VQ6 Q;  3CC7 Q;  2QA4 Q;  1YJ9 Q;  2OTJ Q;  3CMA Q;  1S72 Q;  1JJ2 P;  3G4S Q;  1M1K R;  1YJN Q;  1VQL Q;  1KQS P;  2OTL Q;  1VQK Q;  1Q82 R;  1VQ7 Q;  1K73 R;  1Q7Y R;  3G71 Q;  3CCU Q;  1QVG P;  3CC2 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...