1KQSP

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1kqsP00
3G71Q 1W2BP 1QVFP 3CXCP 1M1KR 3CCEQ 3OW2P 1VQ6Q 1VQKQ 3I55Q 1K73R 3CCVQ 1KC8R 1VQ5Q 1VQOQ 1YI2Q 3CCMQ 3CPWP 2QEXQ 1YJWQ 3CCQQ 3G6EQ 1VQ4Q 3CC7Q 3CMAQ 1K9MR 1S72Q 1VQLQ 1YIJQ 2OTLQ 1Q86R 3CCUQ 1K8AR 1NJIR 1Q82R 3CMEQ 3CC2Q 1N8RR 1VQ8Q 1KQSP 3CC4Q 3CCSQ 1VQ9Q 1KD1R 1YITQ 1JJ2P 3CCLQ 1VQMQ 1QVGP 1M90R 1VQNQ 3G4SQ 1Q81R 1YHQQ 1YJNQ 3CCJQ 3CCRQ 2QA4Q 1YJ9Q 1VQ7Q 3CD6Q 1VQPQ 3I56Q 1Q7YR 2OTJQ
chains in the Genus database with same CATH superfamily
4WCIA 5EC7A 1KD1C 1TU0B 5J26A 2YUQA 3QZ5B 1AT1B 2K57A 4RTUA 2A36A 2WSFE 4AFSC 3CCVT 1UGPB 3TREA 4KUIA 4D8KA 2HL5C 4ELYC 1YFNA 4C8QG 3H0FA 4LN2A 3VUZA 1U8RA 4J9GA 5HKCA 1NBEB 5IN1A 4Y91A 2A08A 2ED1A 1LVKA 1G5VA 4PJOC 3RIRA 1H641 3I35A 4UC4A 3OYIA 2RQTA 2RHUA 3CCUT 2CREA 5LJ5j 2IPOB 2LT4A 1QCOA 2PNIA 2JZ2A 1OULA 1GCQC 1QCNA 3QWXX 2RHIA 2KXDA 3OQ5A 4M7AF 2FL7A 1M2VB 3HFNA 3SD4A 5KE3A 4C5HA 3JCMg 4QQDA 4X9CA 2E12A 1QP2A 2G6FX 1PRMC 5GMKl 2VUBA 2EJ9A 2EWNA 1YP5A 1N5ZA 1RI0A 2E10A 1PC0A 3EGXA 1ZBXA 1LCKA 3CCMQ 1D3BB 1BIBA 2DJZA 3OB9A 1M8VA 2Y90A 2AIRB 4MMKA 4X34A 2DX1A 4ZNXA 2X4YA 1KIKA 4FYYB 5A2QE 2DTHA 1YJ9Q 4JDSA 1LNXA 5CK9A 2CUDA 2KE9A 2QA4T 2E5QA 3M57A 4AG2C 3OYHA 2H3EB 2KQWA 2MWOA 3VRYA 2EQUA 3CMAT 4FU6A 4FW2A 4BE2A 3BW1A 1P92A 2F1LA 5D7UA 1VQ8T 1Y96B 2ZPBB 1IZ6A 1MGQA 2JS2A 2I2LA 1PD1A 3T9NA 2EQKA 3I56T 4EMKB 1CKAA 2RJEA 3G1JA 2L8DA 4RKUE 2BZ8A 2OI3A 3V7SA 2GFUA 1VQ6T 4M7DE 1VQLQ 3URGA 1QQJA 1X6OA 1D0ZA 3CCQT 4FL6A 2K5FA 1FX7A 4IURA 1VIFA 1M3AA 5KYUA 1PRLC 2JVVA 4D8DA 4BE1A 1AOJA 1PM3A 1E6GA 2CP3A 4PNOA 2DL5A 1ZA2B 3A5ZB 1BI3A 1AWXA 1KQ1A 5LJ3d 1BI0A 4JRPA 3CCET 1C6VX 5GANf 4FT2A 2XHCA 1YHQA 2WSCE 2MAMA 2CKKA 1S72T 4M77C 1WHLA 3QJYA 4ME7A 2DILA 2EJFA 2M51A 2D0NA 3OYEA 3L2VA 1W2BP 1T0JA 4NL2A 4C5EA 1LPLA 3NGPA 1WFWA 2CUBA 2QDLA 1Q7YC 2RJDA 1ZA1B 2JM8A 1VQOQ 4M7DD 2LZ6B 1YJWQ 3H9NA 5CKBA 3LW5E 2XMFA 4HCBA 1MV3A 4QVZA 3JCMc 1KQSP 1GRIA 4B6MA 1G3TA 1K4US 3C12A 1UGQB 2QEXA 2EGCA 4A63B 3HKSA 2KSSA 2K2MA 3CD6T 1UE9A 3MHXA 1OV3A 1X6BA 2L3QA 2RN8A 2DIQA 4FCYA 2EYQA 2ECZA 3PFSA 2KYBA 2YUOA 4OMFB 3CXCS 2YRVA 3FLGA 1M1KU 4LD9K 1Q95G 4OMOA 1N27A 1Y07A 3Q1JA 4M78E 5FRMA 2QI2A 5CIUA 3H8ZA 1Q82U 2QTXA 3PT9A 4XQ3A 4RTTA 5J39A 3JCMe 4OGCA 1TS9A 1KHCA 3VS6A 1VQ4Q 4OMLA 4M78A 5A0LA 3QHSA 4C0ZA 1SF9A 1PG5B 4IUTA 2EYZA 4M75G 2KK4A 2M02A 1RAAB 4C92E 4AFUC 1WNLA 3G6EA 2R5AA 2DIGA 1WHJA 3MKDA 3OS2A 3E9FA 5GANg 1WXBA 2RB6A 3I55Q 2O4XB 4QQGA 3JCMX 1D09B 3NFCA 1UB4A 4C92A 2DBKA 1VQ7A 2BKDN 2DFUA 4XTUA 3M53A 5GAMd 4CC2A 2ENMA 3QBYA 4M7AG 1MMNA 3C95A 2F5TX 4M78D 1IHVA 3SB2A 4RUGA 2LQKA 3ASKA 3MJXA 2EYXA 3CC2A 4FM4B 1W70A 3QKJA 4HCZA 1QWFA 2EVRA 1QCFA 4EMHA 2OX7A 3VS7A 1H92A 5FWBA 3M0TA 2X35A 1XOVA 3QSUA 4IUUA 4C92D 3S3MA 4O5VA 4FYXB 3I5RA 2K4YA 1OU8A 1QW1A 1ZUYA 4HXJA 4E7HA 1OEBA 3JB9G 2CS7A 2VGNA 2HL3A 2KT8A 3QYGB 5GAOl 2EGAA 1TUDA 1YIJQ 3H6ZA 3M54A 3EAEA 5IAYA 3JCMJ 2LJ0A 4PJOE 2RD1A 2DA9A 4PL6A 1N8RC 2X4JA 3CCVA 5CVIA 2HDAA 4M7DB 2KGTA 4RTXA 1M1KR 4PJOA 2HKNA 3TVTA 5CR2A 1CSKA 1W1FA 5IXFA 1TOVA 1FYNA 4BI3A 3LWIA 1EFNA 3M55A 4FYWB 3CCJA 2P0KA 4KUDK 3MP8A 3CC4Q 5IHIA 1QKWA 1WPYA 2DLPA 2D9TA 3NTKA 5IHKA 2KYMA 3UATA 4A4GA 1JU5C 2FEIA 1AZEA 1B07A 1VYTA 4C0DB 4ESRA 1VQ9A 1OZ2A 1HK9A 1PD0A 2FVUA 3GNFB 1RUWA 4X9DA 4PJOD 1XTDA 2R57A 5KYYB 3WVDB 4R56A 1SKUB 2V8IA 4ZGDB 2CP6A 4N0AC 4OMNA 3ME9A 1TUCA 1AD5A 1YHQT 2ED0A 2X9HA 3UDCA 3GOXA 5FU6B 4ZGJB 2Z0WA 5CKHA 5GJWB 3P8DA 3CCSA 3M59A 2DL7A 3A8LB 5LJ5h 2JJ9A 3RESA 1S1NA 2FRYA 4LXCA 4ANJA 3X28B 3OA6A 1VQMQ 3QZ9B 2JTMA 1K76A 1YJNQ 1PWTA 1T3LA 2MWPA 1YI2A 1Q7YR 4KH1B 4C8QC 5FU7C 3JCMd 3OW2P 2BIVA 4II1A 3HRTA 4OB2B 2JN0A 4CRIA 2CT3A 3FIFA 5D6YA 3G4SA 1M90U 4JRKA 3CCRA 2YWWA 2QEXT 2RK2A 3NHNA 2LMJA 1HSQA 2VKNA 5GMKm 1ABOA 2CT4A 2QQBA 3EGUA 4J6YA 1NZ9A 4Y92A 1D3BA 4M78F 2W10A 3OYLA 1NEGA 2RQUA 4J9HA 4A4HA 5FU6C 1UJYA 2MOXA 2OTLQ 1M1FA 4C92B 1RL2A 3GPLA 3VJPA 3EG2A 3OS0A 4RG2A 3JAME 1JEGA 1JJ2P 3OYAA 2GNCA 1BK2A 3EFOA 4L6V5 4M77E 2O01E 2CZ7B 3A8HB 1QVFA 1IRXA 4LNPA 1YCYA 2DE0X 2JOYA 2ZGWA 3GBQA 1N9SA 2PVOB 4IIOA 3M0RA 1KQSA 2E41A 3G6ET 1I07A 1QVGA 4E7JA 2JM9A 1Y96A 3C94A 5CQXA 2RHZA 4OP0A 4PFOA 4EMKA 3OYDA 4MZMA 1VQ7T 2A0FB 2FB7A 4IIMA 1UHCA 2SRCA 4ELZC 4X1VA 4C0GA 4PLIA 2NUPB 2NUZA 1KHIA 1D1AA 3QO3A 3OBYA 3JB9H 2ZZDA 4RTZA 2DM1A 4JRIA 4M77D 3CC2T 2L3PA 1ZBJA 3CEYA 3X24B 3M0SA 1Y7XA 3P8BB 3RMSA 2QYZA 5HCKA 4DA4A 1WZOA 3LGLA 3CMEA 3CCVQ 1VQKT 2EPDA 1RAFB 2JTFA 1KK7A 3JSCA 1HYOA 2RJFA 2CGHA 1VIEA 4FYVB 2DKGA 1M90R 1ZSZC 2K79A 1SHFA 4PJOF 2J05A 1WJQA 1VQ5A 2EKHA 2Y4YA 3SWNB 3E2UA 4A4FA 3PVQA 3R6OA 2F2WA 1VQPT 2MIOA 4F7UG 1ZHIA 1WDXA 1QVPA 4OB1B 3PVLA 4JJNK 4JJCA 3ZL7C 6AT1B 3CCUQ 2ROTA 4XU0A 1N8RR 2AHJB 4HA8A 3IQLA 1WYXA 3FEOA 3E19A 3OYMA 5I2SA 5LJ5f 1U06A 3CCJT 2AKLA 2L5QA 3PTAA 2O9VA 1K1ZA 4LDVA 1UFFA 4ZTJA 1F1BB 2FHDA 3I5SA 1MUZA 3KFVA 1GCPA 2DJQA 1OOTA 1NYGA 1TUGB 2J6FA 5GAOp 1G83A 4M75B 4RTVA 1YWOA 2KXCA 4JUVA 1K73U 1VQ9T 1VQNT 1WJSA 3CC7A 2K3YA 5AYFA 4TVRA 4Y28E 1K8AU 3EGDB 3SWNC 4ORZA 1T0HA 3VV0A 5C0MA 2RI3A 4PFPA 2JW4A 1BBZA 5KCOA 2XDDA 2VV5A 2VC8A 2HBWA 4IUQA 5FW9A 1BYMA 1SPKA 2HEQA 1SHGA 5GANd 2QASA 1OPKA 1WX6A 4N4GA 2QA4Q 2VWFA 3CCST 4ZGEB 2YXYA 1RLQC 3CPWS 2C06A 2D8HA 2XDBA 4J9DA 2O4XA 4BDYA 1V76A 2DL3A 1LOJA 3RBBB 5I22A 3OYCA 4XTVA 2F69A 3MPUB 3A1PA 1FMVA 2EW3A 5IXBA 3CMAQ 4KBMB 3VS4A 1TG0A 1YCSB 1YI2T 3QUIA 3OMCA 1VQ8Q 2AZVA 3RERA 1MMDA 1X43A 3THKA 1UG1A 2LCCA 3I56Q 2E3HA 2F2VA 1OI1A 1JXMA 2E1HA 2L3SA 3EFOB 4M75C 3G4ST 2KRNA 3CCRT 1VQ6Q 2KRSA 3SDZA 3L2UA 1BIAA 4OMPA 3OMGA 1XQHA 2LCLA 3CCQQ 3M0QA 1M1KC 3CQTA 4M77B 2H3JA 4FT4A 4R0KA 2DETA 2PVDB 2XICA 3V7CA 5GAOq 2KAFA 2PZ1A 1Q82C 5LJ5g 5C6SA 2CDTA 4M7AC 1I5OB 2G3RA 2OTJQ 1TWBA 4A4KA 4JZ3A 3CCEQ 2CP7A 2DO3A 2DEQA 3CCLA 2L89A 3N5BB 4CI0C 3BY7A 1S72Q 4N0AA 2CH4A 3RKWA 5IHNA 2JNGA 2XK0A 2ZPEB 4MDXA 1WQWA 4F04B 5DLOA 5HK3A 2KRMA 4M7DA 2K5LA 2F5KA 1K0XA 3NMZC 5LL6S 3CBPA 4J9IA 3ULRB 4C8QE 1H8KA 2O88A 3LLRA 1RLPC 3M58A 3OSSC 1MNEA 3LH5A 1B34B 7AT1B 3LX7A 3OYGA 2B86A 4J5YA 4OMMA 1D1CA 4LDYA 1M27C 4R55A 3CD6Q 2B8AA 3V8LA 3JCMV 2QQ9A 2DRMA 1NE8A 1VYUA 4NS5A 4D6WA 4HCCA 2LCSA 3GIBA 2LDMA 5KYYA 1JJ2A 2K6DA 3G71A 1BI1A 3EG3A 2LNVA 3REBB 1TXQA 3CMET 1YN8A 4FIBA 1FXXA 4AT1B 3RMQA 4C8QD 3S3NA 2XD0A 1AEYA 1RI9A 2HD0A 5L23A 3RKYA 2J6OA 2EQJA 2RO0A 3EG0A 1WHMA 4OVAA 1VQ5T 2HMAA 5I2MA 4OF1A 1QLYA 3DB4A 1UGSB 1ZQ1A 2ATCB 4HVVA 1PKTA 2NLUA 4J9FA 2FPDA 4OGEA 4N4IA 1O9SA 1SSHA 3VYGA 1ZLMA 4B9XA 2DTIA 1YBYA 1AWJA 1RADB 3VKIA 4OB3B 4PJNA 1UUEA 3HTRA 5CAIA 3QDFA 1FMWA 1XJWB 2E6NA 4XU1A 3OYFA 2O31A 4JPBW 3CC7T 2GTOA 3F70A 1N6AA 3RKXA 4A54A 4FW1A 2KNBB 1BI2A 2RH2A 4BDZA 3FB9A 2CYZB 2EKOA 2K9GA 3CXCP 2C0IA 3EHQA 4XK8E 3V8JA 1UGVA 1LJOA 3TU4K 2KMTA 3M4GA 4IUVA 4VUBA 3RDVA 1X2QA 1UEBA 2KBTA 5LJ3j 2OAUA 5LJ5e 4JS5A 4XU3A 3EFSA 5GMKj 1VQKA 1X27A 3M56A 3SHWA 1UECA 1OZ3A 2VB6A 4QW2A 1M90C 5KCHA 1MNDA 2YHTA 2NUPA 3PGGA 4KRTA 1D1BA 1VQPA 4XTYA 1NPPA 3QXEB 5ECAA 3BDUA 3CBOA 3L2QA 3GF5A 5GAN7 4XAXB 2FZCB 1I81A 2LX7A 2EIFA 3WXMB 3TSZA 4F7UB 2K7AA 3KXTA 4BI8B 1U5SA 2QQRA 3MCAB 5KYNA 2GBQA 1NM7A 1JBMA 1A0NB 1AWOA 2RF0A 3JCMb 1Q82R 4JS4A 4M7DF 3AT1B 3EHRA 1X69A 3BE3A 1IXDA 1I8FA 1NPRA 2A28A 4FSSA 1GCQA 3SWNA 1YHQQ 2GQIA 4C8QB 3M4YA 4GLKA 5FU7B 4DBHA 3CCLT 4L5GA 2HAXA 1GL5A 1R77A 1ARKA 3O8VA 3EH2A 3M0UA 1YITA 2P4TA 4HVWA 1DJ7B 4OB0B 1VQNA 4M4ZA 4HT9A 2BE7D 2P0QA 4FSXA 1JRIA 2DK3A 1CKBA 2GF7A 4DQ2A 3RNJA 2YSQA 2KVQG 2D0QB 3ZEHA 3NPFA 5FRNA 4DEXA 1KFZA 4M75E 1NJIU 3OYBA 2QGFB 2QEXQ 2QG9B 5D6WA 4KGXB 4EPCA 2FPEA 3JCMQ 4M75A 3E1SA 1GBRA 3A8MB 2RM4A 2P84A 5FROA 5DY9A 2COYA 5KYXB 1PNJA 3H0HA 5GAMj 1PCXA 2L2PA 3EGDA 2DNUA 4M7AE 2R58A 2I0NA 3G71T 4EIKA 3LWHA 5GMKi 4GLMA 2E70A 3M9QA 3BDLA 4E2FB 1U1TA 3FRNA 3UA7A 1ACMB 4J7IA 1HJDA 2DL4A 4MZTA 1IGUA 4M75D 1MMAA 2DMOA 1Q86U 2DPPB 2NUTB 4C0FA 3GNGA 5EG2A 4KULA 1T3SA 3G6EQ 5A0GA 4HKEA 1G3YA 1RAHB 1GFCA 1QP3A 3J7AF 2YDLA 2JMAA 3H0IA 1I1JA 2DBMA 5I11A 1SSFA 3R6NA 2YUPA 1VQ7Q 2HZYA 1W2BA 3LH0A 1NLPC 3CCMA 1OYXA 4M7AD 2FZKB 2AK5A 4C92F 4WF2A 5CO7A 2EBPA 3QPHA 2XU8A 1IGQA 4M77A 2ROLA 2YT6A 2RQWA 5LJ5d 1Q81U 4RCCA 1YJ9A 2KT1A 3RUXA 1K73C 1FMKA 4ZTFA 3CC2Q 1ZSZB 1EIFA 1XNIA 2M16A 2ZAEA 5FLXE 1K8AC 3C0CA 5HK0A 2J06A 1QKXA 2ZPIB 5GAMg 1UJ0A 2HQEA 1RACB 2PUKB 4LD6A 2E65A 1Z9QA 4J7FA 2M0YA 2HNIA 1ABQA 1PHTA 3JB9D 2IVWA 1O75A 3SEMA 1KSWA 2W0ZA 2LTOA 4AFZC 1VQPQ 2YLBA 3X25B 4XTWA 3VS3A 1VQLA 1M5Q1 3QIIA 1WHKA 2LT1A 4GY5A 2Y4XA 1B34A 4Z02A 3HSBA 3OSVA 3OY9A 2XKOC 4PK4A 2BTTA 1OPLA 4NOYA 3FC3A 3CCJQ 5D6XA 2LRQA 2GTJA 1KC8U 3L42A 2EAYA 2VXEA 2L3RA 3FDRA 4IUPA 5GAN2 2EFIA 2JT4A 2V8KA 2OAWA 2IG0A 4CC4B 3NTIA 2KEAA 1YWPA 1OU9A 2MK5A 1WI7A 1VQ9Q 2X3XD 2JTEA 3CXCA 1VQOA 8ATCB 1MV0B 4F16A 1Y0MA 1YJWA 2COZA 3VRZA 4M7DG 2PVGB 2YRCA 3INZA 1OX8A 1OX9A 3HL8A 4J6XA 2XDPA 3ZFJA 3JB9J 3PMIA 4BY6B 3CCSQ 1W6XA 4NL3A 1V1CA 4LUDA 2NYSA 3VYHB 1VA7A 1M30A 1Q81R 1GFDA 3A8OB 2DXUA 1EX4A 1YITT 2RQVA 5CKFA 2JUFA 2OJ2A 3MEUA 1UTIA 2ZCFB 2D1XA 2MI6A 2DL8A 1N9RA 2FRWA 1X2KA 3QYHB 4HVUA 1YI2Q 4M75F 2WSEE 4XTZA 3TCJA 2KY9A 3PNWC 3OYJA 2EYYA 3A98A 4KGVB 1JO8A 4HCKA 4M7AB 2DF6A 3G4SQ 2ZPGB 4OMQA 3CCRQ 3WVEB 3BFMA 4RG8A 1U1SA 1VQ4A 4DOWA 1M8MA 2DAQA 4DEYA 5DM7R 1PSFA 2PQWA 3TSWA 3VUBA 4E6RA 2E5KA 5KYWB 2JS0A 1YNZA 4C5GA 4LDUA 3JRZA 4BY6C 4E7LA 2FYKA 3HRSA 3I55A 2DD4A 1I5LA 4B9WA 5GAN8 2X4XA 5I21A 2LNHB 2O2OA 3GLXA 1WXTA 2PTKA 4CC3A 1KC8R 1E7OA 3I9QA 5LJ3h 3TEEA 3UPUA 3FJPA 2KI7A 5AT1B 5GMKh 5DLQE 2CH4W 1JXOA 2VGMA 3JB9F 4M78G 3OS1A 5GAMe 2ESWA 5GAN6 1K0SA 1M3CA 4YTLA 4M77F 2FZGB 1RABB 1K9MU 1JB0E 2KROA 1GBQA 4JZ4A 2V8JA 2MF2A 2F2XA 1GXIE 3CPWP 1KD1U 5KH6A 4QVCA 4F7UE 1NLOC 3CCMT 4C92G 1W2BS 5GJVB 5GAOm 1QVFS 1J3TA 1B3QA 3VS2A 3EFRA 2CP2A 3PIPA 5CKDA 4F7UA 2RI5A 3HRUA 1SEMA 1WHGA 1M3BA 2BE9B 4QT7A 3OW2A 4J8OA 1YIJA 1YJ9T 2CSIA 3SFMA 1V29B 2VVKA 3QJ6A 2K3XA 1K73R 2FPFA 1WHHA 1KQSS 2QQSA 4J9CA 1VYVA 1BU1A 1QVGS 2EQIA 1K8AR 3CMEQ 4C5IA 1WQ7A 3UF4A 4GBQA 1WGSA 2XI9A 3P8HA 1C0MA 4C8QA 2C0TA 4F14A 3EG9B 4BI4A 1G3WA 1EZZB 2OTJT 3C4SA 4O6JA 3CC4A 2QTVA 3HHTB 1D0YA 1VQ5Q 3JCMW 2KR3A 4Z88A 3PMTA 2K5IA 1VQLT 1SRMA 5FWCA 2E6ZA 1BKBA 1QVFP 3CPFA 4A4EA 1X75C 5GANj 1IB8A 3PE0A 4IKFA 3OBWA 4V2SA 1KQ2A 4PJOG 4EMKC 1KJWA 1ZUUA 5KE2A 3NTHA 3DLMA 1FWZA 2XG8D 5GAMh 2VXFA 1QVGP 5KYXA 4LUEA 4LDXA 2LJ1A 2EJGA 4MZPA 3U23A 4E47A 4PLLA 4RCBA 2DERA 1TH7A 1Z9ZA 1VQMA 2GGRA 3CC7Q 1K9MR 1YJNA 1VQOT 4E7ZA 1YJWT 4JLGA 1KD1R 2EGEA 4JLIA 5M9OA 2FO0A 4KH0B 2XIDA 3A8GB 3V8KA 2NUTA 3LGFA 3EH1A 4Q5WA 5CCAA 2LVMA 2QQAA 3DLLA 1Y71A 2LX9A 1G8XA 2V26A 2D8JA 2J7IA 2RI2A 1R8OB 2X3WD 2O9SA 2E4HA 1VOMA 2DZCA 3META 2HBPA 2LQNA 1X6GA 5LJ3f 3J81E 1NJIC 2VASA 4MMLA 3PIOA 2DVEA 2OTLA 2SEMA 1B7TA 1WJRA 2HSEB 1I0CA 3EGXB 3M0PA 2L0AA 4RTYA 2BUDA 2CP0A 1ZSZA 3MEWA 3MP1A 1VQ4T 1U3OA 3TQ7P 4ZN3A 2RK1A 2VYTA 4JRQA 1QWEA 4WTOB 4EMGA 5IH2A 2PUOB 4LDWA 4KGZB 2RNAA 4MDWA 3M5AA 2RA2A 2M1HA 2AT1B 3ER0A 1RAGB 1PSEA 1W4SA 4DBFA 2PU9B 3AHUA 2GCXA 2H8HA 5CKEA 2DXTA 3EG1A 1NG2A 3I55T 4JJBA 2RMOA 1BCMA 4ZN1A 1IHWA 1TTHB 3JB9I 5CQYA 1SG5A 4LE9A 1Q7YU 2ZPHB 3S6WA 2X4WA 2LJ3A 1H3ZA 3CCLQ 1Q86C 2BZYA 1C1AA 2CZ1B 2DEUA 4DBRA 2MPXC 2P0PA 4BD3A 2HQHA 2V1RA 3S3OA 4KT0E 3O5ZA 2DXCA 1M2OA 2HCKA 3X20B 3L2RA 3OYYA 4M77G 8AT1B 2LQ8A 4F7UF 2NWMA 3UWNA 2YRDA 4AFQC 9ATCB 5HY6A 2YLCA 2HKQB 3E9GA 5KYUB 4QQ6A 1D0XA 3HP9A 1G2BA 1BCOA 4CC7A 1AZGB 3JCMh 1Q81C 4PJJA 2JMCA 2QDYB 1M1GA 3VU3C 3CBMA 4C8QF 2P4RA 2QK0A 4K11A 4J83A 2M0OA 3D7SB 1IREB 2K3BA 2EQMA 4EDUA 1HXDA 1ZUKA 5LJ3g 1YIJT 3G7ZA 4A53A 3OW2S 3QDRB 2DD5A 3G71Q 2DRKA 5GAN4 3CCUA 3MEVA 3LYIA 4XTXA 4Z8AA 4PFZA 2WACA 5GAMf 1MMGA 3HFOA 4J9BA 2DVJA 4HT8A 2AKKA 1H3HA 3QG1A 4P5NA 1R0BG 1KG1A 5GAN3 3CC4T 4PJMA 4DBQA 2RJCA 4AMCA 2CP5A 2D6FA 2AZSA 3CPWA 2CSQA 4M7DC 5IT9E 1X01A 1JJ2S 3L2WA 2LP5A 4PKCC 2CZ0B 4BACA 3JV3A 1UGRB 1WLPB 3UA6A 4M7AA 1JQQA 1HD3A 1KC8C 4XU2A 3VS5A 3VS1A 2DYBA 3GP8A 2A37A 3QWYA 2BZXA 1NYFA 1K9AA 1M2VA 2QGGA 1M9SA 4PJLA 1ZX6A 4RTWA 5KYWA 3DKMA 1E6HA 1SRLA 2JXBA 4BB7A 3OYKA 1R0CB 2YUNA 3J80E 1I4K1 4C0DC 2QA4A 4AG1C 3MO8A 2HSPA 4M78B 2RHXA 2LQWA 2GFAA 2E3IA 5GANe 1UHFA 1OQKA 1VQMT 1Y57A 3ZBDA 2K2VA 3CMAA 3MEAA 1YJNT 3FJ5A 2FG0A 2MCNA 1N8RU 1VQ8A 2C0OA 3UT1A 1RAEB 1G3SA 1AVZC 2KDSA 2RPNA 1QMCA 4N4HA 4Z89A 2J6KA 4RMOA 4J6WA 3I56A 4E7KA 1AHJB 2IIMA 5A0DA 1VQ6A 5L8RE 3VS0A 3H41A 1VUBA 2E64A 2CZ6B 1IO6A 2MYSA 3OYNA 3CCQA 2M9UA 5GAOn 4QKUA 4ATOA 1VQKQ 2RQRA 2DYIA 1NEBA 2RHYA 3JCMP 3OS5A 3KUFA 2A7YA 1WXUA 5J3BA 2HQXA 2OTJA 1NJIR 5GAN5 3CCEA 2OTLT 2GQVA 1WIEA 4M78C 1RAIB 4E7SA 1BB9A 3HPWA 4QVDA 3KBGA 1UDLA 1S72A 3MP6A 4F17A 3V7RA 4E7IA 2QAZA 2ZPFB 1TSFA 3L1AA 2X51A 2DTOA 2R5MA 2V1QA 3JCMf 2MMPA 3X26B 4DOVA 4C92C 2A3LA 3EG9A 4J9EA 4L59A 1WA7A 3RR6A 1MHNA 2LC4A 2DZ9A 5GAOr 4PJOB 4JJDA 1AWWA 4BUGA 5LJ3e 1PKSA 3DB3A 3CD6A 1Q86R 2QXFA 3REAB 2COWA 5GMKe 1YITQ 3L2ZA 5GANh 1K9MC 1VQNQ 4BE0A 1M4ZA 2ABLA 1ZSGA 2DXBA 2EYWA
chains in the Genus database with same CATH topology
3G71Q 1W2BP 1QVFP 3CXCP 1M1KR 3CCEQ 3OW2P 1VQ6Q 1VQKQ 3I55Q 1K73R 3CCVQ 1KC8R 1VQ5Q 1VQOQ 1YI2Q 3CCMQ 3CPWP 2QEXQ 1YJWQ 3CCQQ 3G6EQ 1VQ4Q 3CC7Q 3CMAQ 1K9MR 1S72Q 1VQLQ 1YIJQ 2OTLQ 1Q86R 3CCUQ 1K8AR 1NJIR 1Q82R 3CMEQ 3CC2Q 1N8RR 1VQ8Q 1KQSP 3CC4Q 3CCSQ 1VQ9Q 1KD1R 1YITQ 1JJ2P 3CCLQ 1VQMQ 1QVGP 1M90R 1VQNQ 3G4SQ 1Q81R 1YHQQ 1YJNQ 3CCJQ 3CCRQ 2QA4Q 1YJ9Q 1VQ7Q 3CD6Q 1VQPQ 3I56Q 1Q7YR 2OTJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 Q;  1W2B P;  1QVF P;  3CXC P;  1M1K R;  3CCE Q;  3OW2 P;  1VQ6 Q;  1VQK Q;  3I55 Q;  1K73 R;  3CCV Q;  1KC8 R;  1VQ5 Q;  1VQO Q;  1YI2 Q;  3CCM Q;  3CPW P;  2QEX Q;  1YJW Q;  3CCQ Q;  3G6E Q;  1VQ4 Q;  3CC7 Q;  3CMA Q;  1K9M R;  1S72 Q;  1VQL Q;  1YIJ Q;  2OTL Q;  1Q86 R;  3CCU Q;  1K8A R;  1NJI R;  1Q82 R;  3CME Q;  3CC2 Q;  1N8R R;  1VQ8 Q;  1KQS P;  3CC4 Q;  3CCS Q;  1VQ9 Q;  1KD1 R;  1YIT Q;  1JJ2 P;  3CCL Q;  1VQM Q;  1QVG P;  1M90 R;  1VQN Q;  3G4S Q;  1Q81 R;  1YHQ Q;  1YJN Q;  3CCJ Q;  3CCR Q;  2QA4 Q;  1YJ9 Q;  1VQ7 Q;  3CD6 Q;  1VQP Q;  3I56 Q;  1Q7Y R;  2OTJ Q; 
#chains in the Genus database with same CATH topology
 4WCI A;  5EC7 A;  1KD1 C;  1TU0 B;  5J26 A;  2YUQ A;  3QZ5 B;  1AT1 B;  2K57 A;  4RTU A;  2A36 A;  2WSF E;  4AFS C;  3CCV T;  1UGP B;  3TRE A;  4KUI A;  4D8K A;  2HL5 C;  4ELY C;  1YFN A;  4C8Q G;  3H0F A;  4LN2 A;  3VUZ A;  1U8R A;  4J9G A;  5HKC A;  1NBE B;  5IN1 A;  4Y91 A;  2A08 A;  2ED1 A;  1LVK A;  1G5V A;  4PJO C;  3RIR A;  1H64 1;  3I35 A;  4UC4 A;  3OYI A;  2RQT A;  2RHU A;  3CCU T;  2CRE A;  5LJ5 j;  2IPO B;  2LT4 A;  1QCO A;  2PNI A;  2JZ2 A;  1OUL A;  1GCQ C;  1QCN A;  3QWX X;  2RHI A;  2KXD A;  3OQ5 A;  4M7A F;  2FL7 A;  1M2V B;  3HFN A;  3SD4 A;  5KE3 A;  4C5H A;  3JCM g;  4QQD A;  4X9C A;  2E12 A;  1QP2 A;  2G6F X;  1PRM C;  5GMK l;  2VUB A;  2EJ9 A;  2EWN A;  1YP5 A;  1N5Z A;  1RI0 A;  2E10 A;  1PC0 A;  3EGX A;  1ZBX A;  1LCK A;  3CCM Q;  1D3B B;  1BIB A;  2DJZ A;  3OB9 A;  1M8V A;  2Y90 A;  2AIR B;  4MMK A;  4X34 A;  2DX1 A;  4ZNX A;  2X4Y A;  1KIK A;  4FYY B;  5A2Q E;  2DTH A;  1YJ9 Q;  4JDS A;  1LNX A;  5CK9 A;  2CUD A;  2KE9 A;  2QA4 T;  2E5Q A;  3M57 A;  4AG2 C;  3OYH A;  2H3E B;  2KQW A;  2MWO A;  3VRY A;  2EQU A;  3CMA T;  4FU6 A;  4FW2 A;  4BE2 A;  3BW1 A;  1P92 A;  2F1L A;  5D7U A;  1VQ8 T;  1Y96 B;  2ZPB B;  1IZ6 A;  1MGQ A;  2JS2 A;  2I2L A;  1PD1 A;  3T9N A;  2EQK A;  3I56 T;  4EMK B;  1CKA A;  2RJE A;  3G1J A;  2L8D A;  4RKU E;  2BZ8 A;  2OI3 A;  3V7S A;  2GFU A;  1VQ6 T;  4M7D E;  1VQL Q;  3URG A;  1QQJ A;  1X6O A;  1D0Z A;  3CCQ T;  4FL6 A;  2K5F A;  1FX7 A;  4IUR A;  1VIF A;  1M3A A;  5KYU A;  1PRL C;  2JVV A;  4D8D A;  4BE1 A;  1AOJ A;  1PM3 A;  1E6G A;  2CP3 A;  4PNO A;  2DL5 A;  1ZA2 B;  3A5Z B;  1BI3 A;  1AWX A;  1KQ1 A;  5LJ3 d;  1BI0 A;  4JRP A;  3CCE T;  1C6V X;  5GAN f;  4FT2 A;  2XHC A;  1YHQ A;  2WSC E;  2MAM A;  2CKK A;  1S72 T;  4M77 C;  1WHL A;  3QJY A;  4ME7 A;  2DIL A;  2EJF A;  2M51 A;  2D0N A;  3OYE A;  3L2V A;  1W2B P;  1T0J A;  4NL2 A;  4C5E A;  1LPL A;  3NGP A;  1WFW A;  2CUB A;  2QDL A;  1Q7Y C;  2RJD A;  1ZA1 B;  2JM8 A;  1VQO Q;  4M7D D;  2LZ6 B;  1YJW Q;  3H9N A;  5CKB A;  3LW5 E;  2XMF A;  4HCB A;  1MV3 A;  4QVZ A;  3JCM c;  1KQS P;  1GRI A;  4B6M A;  1G3T A;  1K4U S;  3C12 A;  1UGQ B;  2QEX A;  2EGC A;  4A63 B;  3HKS A;  2KSS A;  2K2M A;  3CD6 T;  1UE9 A;  3MHX A;  1OV3 A;  1X6B A;  2L3Q A;  2RN8 A;  2DIQ A;  4FCY A;  2EYQ A;  2ECZ A;  3PFS A;  2KYB A;  2YUO A;  4OMF B;  3CXC S;  2YRV A;  3FLG A;  1M1K U;  4LD9 K;  1Q95 G;  4OMO A;  1N27 A;  1Y07 A;  3Q1J A;  4M78 E;  5FRM A;  2QI2 A;  5CIU A;  3H8Z A;  1Q82 U;  2QTX A;  3PT9 A;  4XQ3 A;  4RTT A;  5J39 A;  3JCM e;  4OGC A;  1TS9 A;  1KHC A;  3VS6 A;  1VQ4 Q;  4OML A;  4M78 A;  5A0L A;  3QHS A;  4C0Z A;  1SF9 A;  1PG5 B;  4IUT A;  2EYZ A;  4M75 G;  2KK4 A;  2M02 A;  1RAA B;  4C92 E;  4AFU C;  1WNL A;  3G6E A;  2R5A A;  2DIG A;  1WHJ A;  3MKD A;  3OS2 A;  3E9F A;  5GAN g;  1WXB A;  2RB6 A;  3I55 Q;  2O4X B;  4QQG A;  3JCM X;  1D09 B;  3NFC A;  1UB4 A;  4C92 A;  2DBK A;  1VQ7 A;  2BKD N;  2DFU A;  4XTU A;  3M53 A;  5GAM d;  4CC2 A;  2ENM A;  3QBY A;  4M7A G;  1MMN A;  3C95 A;  2F5T X;  4M78 D;  1IHV A;  3SB2 A;  4RUG A;  2LQK A;  3ASK A;  3MJX A;  2EYX A;  3CC2 A;  4FM4 B;  1W70 A;  3QKJ A;  4HCZ A;  1QWF A;  2EVR A;  1QCF A;  4EMH A;  2OX7 A;  3VS7 A;  1H92 A;  5FWB A;  3M0T A;  2X35 A;  1XOV A;  3QSU A;  4IUU A;  4C92 D;  3S3M A;  4O5V A;  4FYX B;  3I5R A;  2K4Y A;  1OU8 A;  1QW1 A;  1ZUY A;  4HXJ A;  4E7H A;  1OEB A;  3JB9 G;  2CS7 A;  2VGN A;  2HL3 A;  2KT8 A;  3QYG B;  5GAO l;  2EGA A;  1TUD A;  1YIJ Q;  3H6Z A;  3M54 A;  3EAE A;  5IAY A;  3JCM J;  2LJ0 A;  4PJO E;  2RD1 A;  2DA9 A;  4PL6 A;  1N8R C;  2X4J A;  3CCV A;  5CVI A;  2HDA A;  4M7D B;  2KGT A;  4RTX A;  1M1K R;  4PJO A;  2HKN A;  3TVT A;  5CR2 A;  1CSK A;  1W1F A;  5IXF A;  1TOV A;  1FYN A;  4BI3 A;  3LWI A;  1EFN A;  3M55 A;  4FYW B;  3CCJ A;  2P0K A;  4KUD K;  3MP8 A;  3CC4 Q;  5IHI A;  1QKW A;  1WPY A;  2DLP A;  2D9T A;  3NTK A;  5IHK A;  2KYM A;  3UAT A;  4A4G A;  1JU5 C;  2FEI A;  1AZE A;  1B07 A;  1VYT A;  4C0D B;  4ESR A;  1VQ9 A;  1OZ2 A;  1HK9 A;  1PD0 A;  2FVU A;  3GNF B;  1RUW A;  4X9D A;  4PJO D;  1XTD A;  2R57 A;  5KYY B;  3WVD B;  4R56 A;  1SKU B;  2V8I A;  4ZGD B;  2CP6 A;  4N0A C;  4OMN A;  3ME9 A;  1TUC A;  1AD5 A;  1YHQ T;  2ED0 A;  2X9H A;  3UDC A;  3GOX A;  5FU6 B;  4ZGJ B;  2Z0W A;  5CKH A;  5GJW B;  3P8D A;  3CCS A;  3M59 A;  2DL7 A;  3A8L B;  5LJ5 h;  2JJ9 A;  3RES A;  1S1N A;  2FRY A;  4LXC A;  4ANJ A;  3X28 B;  3OA6 A;  1VQM Q;  3QZ9 B;  2JTM A;  1K76 A;  1YJN Q;  1PWT A;  1T3L A;  2MWP A;  1YI2 A;  1Q7Y R;  4KH1 B;  4C8Q C;  5FU7 C;  3JCM d;  3OW2 P;  2BIV A;  4II1 A;  3HRT A;  4OB2 B;  2JN0 A;  4CRI A;  2CT3 A;  3FIF A;  5D6Y A;  3G4S A;  1M90 U;  4JRK A;  3CCR A;  2YWW A;  2QEX T;  2RK2 A;  3NHN A;  2LMJ A;  1HSQ A;  2VKN A;  5GMK m;  1ABO A;  2CT4 A;  2QQB A;  3EGU A;  4J6Y A;  1NZ9 A;  4Y92 A;  1D3B A;  4M78 F;  2W10 A;  3OYL A;  1NEG A;  2RQU A;  4J9H A;  4A4H A;  5FU6 C;  1UJY A;  2MOX A;  2OTL Q;  1M1F A;  4C92 B;  1RL2 A;  3GPL A;  3VJP A;  3EG2 A;  3OS0 A;  4RG2 A;  3JAM E;  1JEG A;  1JJ2 P;  3OYA A;  2GNC A;  1BK2 A;  3EFO A;  4L6V 5;  4M77 E;  2O01 E;  2CZ7 B;  3A8H B;  1QVF A;  1IRX A;  4LNP A;  1YCY A;  2DE0 X;  2JOY A;  2ZGW A;  3GBQ A;  1N9S A;  2PVO B;  4IIO A;  3M0R A;  1KQS A;  2E41 A;  3G6E T;  1I07 A;  1QVG A;  4E7J A;  2JM9 A;  1Y96 A;  3C94 A;  5CQX A;  2RHZ A;  4OP0 A;  4PFO A;  4EMK A;  3OYD A;  4MZM A;  1VQ7 T;  2A0F B;  2FB7 A;  4IIM A;  1UHC A;  2SRC A;  4ELZ C;  4X1V A;  4C0G A;  4PLI A;  2NUP B;  2NUZ A;  1KHI A;  1D1A A;  3QO3 A;  3OBY A;  3JB9 H;  2ZZD A;  4RTZ A;  2DM1 A;  4JRI A;  4M77 D;  3CC2 T;  2L3P A;  1ZBJ A;  3CEY A;  3X24 B;  3M0S A;  1Y7X A;  3P8B B;  3RMS A;  2QYZ A;  5HCK A;  4DA4 A;  1WZO A;  3LGL A;  3CME A;  3CCV Q;  1VQK T;  2EPD A;  1RAF B;  2JTF A;  1KK7 A;  3JSC A;  1HYO A;  2RJF A;  2CGH A;  1VIE A;  4FYV B;  2DKG A;  1M90 R;  1ZSZ C;  2K79 A;  1SHF A;  4PJO F;  2J05 A;  1WJQ A;  1VQ5 A;  2EKH A;  2Y4Y A;  3SWN B;  3E2U A;  4A4F A;  3PVQ A;  3R6O A;  2F2W A;  1VQP T;  2MIO A;  4F7U G;  1ZHI A;  1WDX A;  1QVP A;  4OB1 B;  3PVL A;  4JJN K;  4JJC A;  3ZL7 C;  6AT1 B;  3CCU Q;  2ROT A;  4XU0 A;  1N8R R;  2AHJ B;  4HA8 A;  3IQL A;  1WYX A;  3FEO A;  3E19 A;  3OYM A;  5I2S A;  5LJ5 f;  1U06 A;  3CCJ T;  2AKL A;  2L5Q A;  3PTA A;  2O9V A;  1K1Z A;  4LDV A;  1UFF A;  4ZTJ A;  1F1B B;  2FHD A;  3I5S A;  1MUZ A;  3KFV A;  1GCP A;  2DJQ A;  1OOT A;  1NYG A;  1TUG B;  2J6F A;  5GAO p;  1G83 A;  4M75 B;  4RTV A;  1YWO A;  2KXC A;  4JUV A;  1K73 U;  1VQ9 T;  1VQN T;  1WJS A;  3CC7 A;  2K3Y A;  5AYF A;  4TVR A;  4Y28 E;  1K8A U;  3EGD B;  3SWN C;  4ORZ A;  1T0H A;  3VV0 A;  5C0M A;  2RI3 A;  4PFP A;  2JW4 A;  1BBZ A;  5KCO A;  2XDD A;  2VV5 A;  2VC8 A;  2HBW A;  4IUQ A;  5FW9 A;  1BYM A;  1SPK A;  2HEQ A;  1SHG A;  5GAN d;  2QAS A;  1OPK A;  1WX6 A;  4N4G A;  2QA4 Q;  2VWF A;  3CCS T;  4ZGE B;  2YXY A;  1RLQ C;  3CPW S;  2C06 A;  2D8H A;  2XDB A;  4J9D A;  2O4X A;  4BDY A;  1V76 A;  2DL3 A;  1LOJ A;  3RBB B;  5I22 A;  3OYC A;  4XTV A;  2F69 A;  3MPU B;  3A1P A;  1FMV A;  2EW3 A;  5IXB A;  3CMA Q;  4KBM B;  3VS4 A;  1TG0 A;  1YCS B;  1YI2 T;  3QUI A;  3OMC A;  1VQ8 Q;  2AZV A;  3RER A;  1MMD A;  1X43 A;  3THK A;  1UG1 A;  2LCC A;  3I56 Q;  2E3H A;  2F2V A;  1OI1 A;  1JXM A;  2E1H A;  2L3S A;  3EFO B;  4M75 C;  3G4S T;  2KRN A;  3CCR T;  1VQ6 Q;  2KRS A;  3SDZ A;  3L2U A;  1BIA A;  4OMP A;  3OMG A;  1XQH A;  2LCL A;  3CCQ Q;  3M0Q A;  1M1K C;  3CQT A;  4M77 B;  2H3J A;  4FT4 A;  4R0K A;  2DET A;  2PVD B;  2XIC A;  3V7C A;  5GAO q;  2KAF A;  2PZ1 A;  1Q82 C;  5LJ5 g;  5C6S A;  2CDT A;  4M7A C;  1I5O B;  2G3R A;  2OTJ Q;  1TWB A;  4A4K A;  4JZ3 A;  3CCE Q;  2CP7 A;  2DO3 A;  2DEQ A;  3CCL A;  2L89 A;  3N5B B;  4CI0 C;  3BY7 A;  1S72 Q;  4N0A A;  2CH4 A;  3RKW A;  5IHN A;  2JNG A;  2XK0 A;  2ZPE B;  4MDX A;  1WQW A;  4F04 B;  5DLO A;  5HK3 A;  2KRM A;  4M7D A;  2K5L A;  2F5K A;  1K0X A;  3NMZ C;  5LL6 S;  3CBP A;  4J9I A;  3ULR B;  4C8Q E;  1H8K A;  2O88 A;  3LLR A;  1RLP C;  3M58 A;  3OSS C;  1MNE A;  3LH5 A;  1B34 B;  7AT1 B;  3LX7 A;  3OYG A;  2B86 A;  4J5Y A;  4OMM A;  1D1C A;  4LDY A;  1M27 C;  4R55 A;  3CD6 Q;  2B8A A;  3V8L A;  3JCM V;  2QQ9 A;  2DRM A;  1NE8 A;  1VYU A;  4NS5 A;  4D6W A;  4HCC A;  2LCS A;  3GIB A;  2LDM A;  5KYY A;  1JJ2 A;  2K6D A;  3G71 A;  1BI1 A;  3EG3 A;  2LNV A;  3REB B;  1TXQ A;  3CME T;  1YN8 A;  4FIB A;  1FXX A;  4AT1 B;  3RMQ A;  4C8Q D;  3S3N A;  2XD0 A;  1AEY A;  1RI9 A;  2HD0 A;  5L23 A;  3RKY A;  2J6O A;  2EQJ A;  2RO0 A;  3EG0 A;  1WHM A;  4OVA A;  1VQ5 T;  2HMA A;  5I2M A;  4OF1 A;  1QLY A;  3DB4 A;  1UGS B;  1ZQ1 A;  2ATC B;  4HVV A;  1PKT A;  2NLU A;  4J9F A;  2FPD A;  4OGE A;  4N4I A;  1O9S A;  1SSH A;  3VYG A;  1ZLM A;  4B9X A;  2DTI A;  1YBY A;  1AWJ A;  1RAD B;  3VKI A;  4OB3 B;  4PJN A;  1UUE A;  3HTR A;  5CAI A;  3QDF A;  1FMW A;  1XJW B;  2E6N A;  4XU1 A;  3OYF A;  2O31 A;  4JPB W;  3CC7 T;  2GTO A;  3F70 A;  1N6A A;  3RKX A;  4A54 A;  4FW1 A;  2KNB B;  1BI2 A;  2RH2 A;  4BDZ A;  3FB9 A;  2CYZ B;  2EKO A;  2K9G A;  3CXC P;  2C0I A;  3EHQ A;  4XK8 E;  3V8J A;  1UGV A;  1LJO A;  3TU4 K;  2KMT A;  3M4G A;  4IUV A;  4VUB A;  3RDV A;  1X2Q A;  1UEB A;  2KBT A;  5LJ3 j;  2OAU A;  5LJ5 e;  4JS5 A;  4XU3 A;  3EFS A;  5GMK j;  1VQK A;  1X27 A;  3M56 A;  3SHW A;  1UEC A;  1OZ3 A;  2VB6 A;  4QW2 A;  1M90 C;  5KCH A;  1MND A;  2YHT A;  2NUP A;  3PGG A;  4KRT A;  1D1B A;  1VQP A;  4XTY A;  1NPP A;  3QXE B;  5ECA A;  3BDU A;  3CBO A;  3L2Q A;  3GF5 A;  5GAN 7;  4XAX B;  2FZC B;  1I81 A;  2LX7 A;  2EIF A;  3WXM B;  3TSZ A;  4F7U B;  2K7A A;  3KXT A;  4BI8 B;  1U5S A;  2QQR A;  3MCA B;  5KYN A;  2GBQ A;  1NM7 A;  1JBM A;  1A0N B;  1AWO A;  2RF0 A;  3JCM b;  1Q82 R;  4JS4 A;  4M7D F;  3AT1 B;  3EHR A;  1X69 A;  3BE3 A;  1IXD A;  1I8F A;  1NPR A;  2A28 A;  4FSS A;  1GCQ A;  3SWN A;  1YHQ Q;  2GQI A;  4C8Q B;  3M4Y A;  4GLK A;  5FU7 B;  4DBH A;  3CCL T;  4L5G A;  2HAX A;  1GL5 A;  1R77 A;  1ARK A;  3O8V A;  3EH2 A;  3M0U A;  1YIT A;  2P4T A;  4HVW A;  1DJ7 B;  4OB0 B;  1VQN A;  4M4Z A;  4HT9 A;  2BE7 D;  2P0Q A;  4FSX A;  1JRI A;  2DK3 A;  1CKB A;  2GF7 A;  4DQ2 A;  3RNJ A;  2YSQ A;  2KVQ G;  2D0Q B;  3ZEH A;  3NPF A;  5FRN A;  4DEX A;  1KFZ A;  4M75 E;  1NJI U;  3OYB A;  2QGF B;  2QEX Q;  2QG9 B;  5D6W A;  4KGX B;  4EPC A;  2FPE A;  3JCM Q;  4M75 A;  3E1S A;  1GBR A;  3A8M B;  2RM4 A;  2P84 A;  5FRO A;  5DY9 A;  2COY A;  5KYX B;  1PNJ A;  3H0H A;  5GAM j;  1PCX A;  2L2P A;  3EGD A;  2DNU A;  4M7A E;  2R58 A;  2I0N A;  3G71 T;  4EIK A;  3LWH A;  5GMK i;  4GLM A;  2E70 A;  3M9Q A;  3BDL A;  4E2F B;  1U1T A;  3FRN A;  3UA7 A;  1ACM B;  4J7I A;  1HJD A;  2DL4 A;  4MZT A;  1IGU A;  4M75 D;  1MMA A;  2DMO A;  1Q86 U;  2DPP B;  2NUT B;  4C0F A;  3GNG A;  5EG2 A;  4KUL A;  1T3S A;  3G6E Q;  5A0G A;  4HKE A;  1G3Y A;  1RAH B;  1GFC A;  1QP3 A;  3J7A F;  2YDL A;  2JMA A;  3H0I A;  1I1J A;  2DBM A;  5I11 A;  1SSF A;  3R6N A;  2YUP A;  1VQ7 Q;  2HZY A;  1W2B A;  3LH0 A;  1NLP C;  3CCM A;  1OYX A;  4M7A D;  2FZK B;  2AK5 A;  4C92 F;  4WF2 A;  5CO7 A;  2EBP A;  3QPH A;  2XU8 A;  1IGQ A;  4M77 A;  2ROL A;  2YT6 A;  2RQW A;  5LJ5 d;  1Q81 U;  4RCC A;  1YJ9 A;  2KT1 A;  3RUX A;  1K73 C;  1FMK A;  4ZTF A;  3CC2 Q;  1ZSZ B;  1EIF A;  1XNI A;  2M16 A;  2ZAE A;  5FLX E;  1K8A C;  3C0C A;  5HK0 A;  2J06 A;  1QKX A;  2ZPI B;  5GAM g;  1UJ0 A;  2HQE A;  1RAC B;  2PUK B;  4LD6 A;  2E65 A;  1Z9Q A;  4J7F A;  2M0Y A;  2HNI A;  1ABQ A;  1PHT A;  3JB9 D;  2IVW A;  1O75 A;  3SEM A;  1KSW A;  2W0Z A;  2LTO A;  4AFZ C;  1VQP Q;  2YLB A;  3X25 B;  4XTW A;  3VS3 A;  1VQL A;  1M5Q 1;  3QII A;  1WHK A;  2LT1 A;  4GY5 A;  2Y4X A;  1B34 A;  4Z02 A;  3HSB A;  3OSV A;  3OY9 A;  2XKO C;  4PK4 A;  2BTT A;  1OPL A;  4NOY A;  3FC3 A;  3CCJ Q;  5D6X A;  2LRQ A;  2GTJ A;  1KC8 U;  3L42 A;  2EAY A;  2VXE A;  2L3R A;  3FDR A;  4IUP A;  5GAN 2;  2EFI A;  2JT4 A;  2V8K A;  2OAW A;  2IG0 A;  4CC4 B;  3NTI A;  2KEA A;  1YWP A;  1OU9 A;  2MK5 A;  1WI7 A;  1VQ9 Q;  2X3X D;  2JTE A;  3CXC A;  1VQO A;  8ATC B;  1MV0 B;  4F16 A;  1Y0M A;  1YJW A;  2COZ A;  3VRZ A;  4M7D G;  2PVG B;  2YRC A;  3INZ A;  1OX8 A;  1OX9 A;  3HL8 A;  4J6X A;  2XDP A;  3ZFJ A;  3JB9 J;  3PMI A;  4BY6 B;  3CCS Q;  1W6X A;  4NL3 A;  1V1C A;  4LUD A;  2NYS A;  3VYH B;  1VA7 A;  1M30 A;  1Q81 R;  1GFD A;  3A8O B;  2DXU A;  1EX4 A;  1YIT T;  2RQV A;  5CKF A;  2JUF A;  2OJ2 A;  3MEU A;  1UTI A;  2ZCF B;  2D1X A;  2MI6 A;  2DL8 A;  1N9R A;  2FRW A;  1X2K A;  3QYH B;  4HVU A;  1YI2 Q;  4M75 F;  2WSE E;  4XTZ A;  3TCJ A;  2KY9 A;  3PNW C;  3OYJ A;  2EYY A;  3A98 A;  4KGV B;  1JO8 A;  4HCK A;  4M7A B;  2DF6 A;  3G4S Q;  2ZPG B;  4OMQ A;  3CCR Q;  3WVE B;  3BFM A;  4RG8 A;  1U1S A;  1VQ4 A;  4DOW A;  1M8M A;  2DAQ A;  4DEY A;  5DM7 R;  1PSF A;  2PQW A;  3TSW A;  3VUB A;  4E6R A;  2E5K A;  5KYW B;  2JS0 A;  1YNZ A;  4C5G A;  4LDU A;  3JRZ A;  4BY6 C;  4E7L A;  2FYK A;  3HRS A;  3I55 A;  2DD4 A;  1I5L A;  4B9W A;  5GAN 8;  2X4X A;  5I21 A;  2LNH B;  2O2O A;  3GLX A;  1WXT A;  2PTK A;  4CC3 A;  1KC8 R;  1E7O A;  3I9Q A;  5LJ3 h;  3TEE A;  3UPU A;  3FJP A;  2KI7 A;  5AT1 B;  5GMK h;  5DLQ E;  2CH4 W;  1JXO A;  2VGM A;  3JB9 F;  4M78 G;  3OS1 A;  5GAM e;  2ESW A;  5GAN 6;  1K0S A;  1M3C A;  4YTL A;  4M77 F;  2FZG B;  1RAB B;  1K9M U;  1JB0 E;  2KRO A;  1GBQ A;  4JZ4 A;  2V8J A;  2MF2 A;  2F2X A;  1GXI E;  3CPW P;  1KD1 U;  5KH6 A;  4QVC A;  4F7U E;  1NLO C;  3CCM T;  4C92 G;  1W2B S;  5GJV B;  5GAO m;  1QVF S;  1J3T A;  1B3Q A;  3VS2 A;  3EFR A;  2CP2 A;  3PIP A;  5CKD A;  4F7U A;  2RI5 A;  3HRU A;  1SEM A;  1WHG A;  1M3B A;  2BE9 B;  4QT7 A;  3OW2 A;  4J8O A;  1YIJ A;  1YJ9 T;  2CSI A;  3SFM A;  1V29 B;  2VVK A;  3QJ6 A;  2K3X A;  1K73 R;  2FPF A;  1WHH A;  1KQS S;  2QQS A;  4J9C A;  1VYV A;  1BU1 A;  1QVG S;  2EQI A;  1K8A R;  3CME Q;  4C5I A;  1WQ7 A;  3UF4 A;  4GBQ A;  1WGS A;  2XI9 A;  3P8H A;  1C0M A;  4C8Q A;  2C0T A;  4F14 A;  3EG9 B;  4BI4 A;  1G3W A;  1EZZ B;  2OTJ T;  3C4S A;  4O6J A;  3CC4 A;  2QTV A;  3HHT B;  1D0Y A;  1VQ5 Q;  3JCM W;  2KR3 A;  4Z88 A;  3PMT A;  2K5I A;  1VQL T;  1SRM A;  5FWC A;  2E6Z A;  1BKB A;  1QVF P;  3CPF A;  4A4E A;  1X75 C;  5GAN j;  1IB8 A;  3PE0 A;  4IKF A;  3OBW A;  4V2S A;  1KQ2 A;  4PJO G;  4EMK C;  1KJW A;  1ZUU A;  5KE2 A;  3NTH A;  3DLM A;  1FWZ A;  2XG8 D;  5GAM h;  2VXF A;  1QVG P;  5KYX A;  4LUE A;  4LDX A;  2LJ1 A;  2EJG A;  4MZP A;  3U23 A;  4E47 A;  4PLL A;  4RCB A;  2DER A;  1TH7 A;  1Z9Z A;  1VQM A;  2GGR A;  3CC7 Q;  1K9M R;  1YJN A;  1VQO T;  4E7Z A;  1YJW T;  4JLG A;  1KD1 R;  2EGE A;  4JLI A;  5M9O A;  2FO0 A;  4KH0 B;  2XID A;  3A8G B;  3V8K A;  2NUT A;  3LGF A;  3EH1 A;  4Q5W A;  5CCA A;  2LVM A;  2QQA A;  3DLL A;  1Y71 A;  2LX9 A;  1G8X A;  2V26 A;  2D8J A;  2J7I A;  2RI2 A;  1R8O B;  2X3W D;  2O9S A;  2E4H A;  1VOM A;  2DZC A;  3MET A;  2HBP A;  2LQN A;  1X6G A;  5LJ3 f;  3J81 E;  1NJI C;  2VAS A;  4MML A;  3PIO A;  2DVE A;  2OTL A;  2SEM A;  1B7T A;  1WJR A;  2HSE B;  1I0C A;  3EGX B;  3M0P A;  2L0A A;  4RTY A;  2BUD A;  2CP0 A;  1ZSZ A;  3MEW A;  3MP1 A;  1VQ4 T;  1U3O A;  3TQ7 P;  4ZN3 A;  2RK1 A;  2VYT A;  4JRQ A;  1QWE A;  4WTO B;  4EMG A;  5IH2 A;  2PUO B;  4LDW A;  4KGZ B;  2RNA A;  4MDW A;  3M5A A;  2RA2 A;  2M1H A;  2AT1 B;  3ER0 A;  1RAG B;  1PSE A;  1W4S A;  4DBF A;  2PU9 B;  3AHU A;  2GCX A;  2H8H A;  5CKE A;  2DXT A;  3EG1 A;  1NG2 A;  3I55 T;  4JJB A;  2RMO A;  1BCM A;  4ZN1 A;  1IHW A;  1TTH B;  3JB9 I;  5CQY A;  1SG5 A;  4LE9 A;  1Q7Y U;  2ZPH B;  3S6W A;  2X4W A;  2LJ3 A;  1H3Z A;  3CCL Q;  1Q86 C;  2BZY A;  1C1A A;  2CZ1 B;  2DEU A;  4DBR A;  2MPX C;  2P0P A;  4BD3 A;  2HQH A;  2V1R A;  3S3O A;  4KT0 E;  3O5Z A;  2DXC A;  1M2O A;  2HCK A;  3X20 B;  3L2R A;  3OYY A;  4M77 G;  8AT1 B;  2LQ8 A;  4F7U F;  2NWM A;  3UWN A;  2YRD A;  4AFQ C;  9ATC B;  5HY6 A;  2YLC A;  2HKQ B;  3E9G A;  5KYU B;  4QQ6 A;  1D0X A;  3HP9 A;  1G2B A;  1BCO A;  4CC7 A;  1AZG B;  3JCM h;  1Q81 C;  4PJJ A;  2JMC A;  2QDY B;  1M1G A;  3VU3 C;  3CBM A;  4C8Q F;  2P4R A;  2QK0 A;  4K11 A;  4J83 A;  2M0O A;  3D7S B;  1IRE B;  2K3B A;  2EQM A;  4EDU A;  1HXD A;  1ZUK A;  5LJ3 g;  1YIJ T;  3G7Z A;  4A53 A;  3OW2 S;  3QDR B;  2DD5 A;  3G71 Q;  2DRK A;  5GAN 4;  3CCU A;  3MEV A;  3LYI A;  4XTX A;  4Z8A A;  4PFZ A;  2WAC A;  5GAM f;  1MMG A;  3HFO A;  4J9B A;  2DVJ A;  4HT8 A;  2AKK A;  1H3H A;  3QG1 A;  4P5N A;  1R0B G;  1KG1 A;  5GAN 3;  3CC4 T;  4PJM A;  4DBQ A;  2RJC A;  4AMC A;  2CP5 A;  2D6F A;  2AZS A;  3CPW A;  2CSQ A;  4M7D C;  5IT9 E;  1X01 A;  1JJ2 S;  3L2W A;  2LP5 A;  4PKC C;  2CZ0 B;  4BAC A;  3JV3 A;  1UGR B;  1WLP B;  3UA6 A;  4M7A A;  1JQQ A;  1HD3 A;  1KC8 C;  4XU2 A;  3VS5 A;  3VS1 A;  2DYB A;  3GP8 A;  2A37 A;  3QWY A;  2BZX A;  1NYF A;  1K9A A;  1M2V A;  2QGG A;  1M9S A;  4PJL A;  1ZX6 A;  4RTW A;  5KYW A;  3DKM A;  1E6H A;  1SRL A;  2JXB A;  4BB7 A;  3OYK A;  1R0C B;  2YUN A;  3J80 E;  1I4K 1;  4C0D C;  2QA4 A;  4AG1 C;  3MO8 A;  2HSP A;  4M78 B;  2RHX A;  2LQW A;  2GFA A;  2E3I A;  5GAN e;  1UHF A;  1OQK A;  1VQM T;  1Y57 A;  3ZBD A;  2K2V A;  3CMA A;  3MEA A;  1YJN T;  3FJ5 A;  2FG0 A;  2MCN A;  1N8R U;  1VQ8 A;  2C0O A;  3UT1 A;  1RAE B;  1G3S A;  1AVZ C;  2KDS A;  2RPN A;  1QMC A;  4N4H A;  4Z89 A;  2J6K A;  4RMO A;  4J6W A;  3I56 A;  4E7K A;  1AHJ B;  2IIM A;  5A0D A;  1VQ6 A;  5L8R E;  3VS0 A;  3H41 A;  1VUB A;  2E64 A;  2CZ6 B;  1IO6 A;  2MYS A;  3OYN A;  3CCQ A;  2M9U A;  5GAO n;  4QKU A;  4ATO A;  1VQK Q;  2RQR A;  2DYI A;  1NEB A;  2RHY A;  3JCM P;  3OS5 A;  3KUF A;  2A7Y A;  1WXU A;  5J3B A;  2HQX A;  2OTJ A;  1NJI R;  5GAN 5;  3CCE A;  2OTL T;  2GQV A;  1WIE A;  4M78 C;  1RAI B;  4E7S A;  1BB9 A;  3HPW A;  4QVD A;  3KBG A;  1UDL A;  1S72 A;  3MP6 A;  4F17 A;  3V7R A;  4E7I A;  2QAZ A;  2ZPF B;  1TSF A;  3L1A A;  2X51 A;  2DTO A;  2R5M A;  2V1Q A;  3JCM f;  2MMP A;  3X26 B;  4DOV A;  4C92 C;  2A3L A;  3EG9 A;  4J9E A;  4L59 A;  1WA7 A;  3RR6 A;  1MHN A;  2LC4 A;  2DZ9 A;  5GAO r;  4PJO B;  4JJD A;  1AWW A;  4BUG A;  5LJ3 e;  1PKS A;  3DB3 A;  3CD6 A;  1Q86 R;  2QXF A;  3REA B;  2COW A;  5GMK e;  1YIT Q;  3L2Z A;  5GAN h;  1K9M C;  1VQN Q;  4BE0 A;  1M4Z A;  2ABL A;  1ZSG A;  2DXB A;  2EYW A; 
#chains in the Genus database with same CATH homology
 3G71 Q;  1W2B P;  1QVF P;  3CXC P;  1M1K R;  3CCE Q;  3OW2 P;  1VQ6 Q;  1VQK Q;  3I55 Q;  1K73 R;  3CCV Q;  1KC8 R;  1VQ5 Q;  1VQO Q;  1YI2 Q;  3CCM Q;  3CPW P;  2QEX Q;  1YJW Q;  3CCQ Q;  3G6E Q;  1VQ4 Q;  3CC7 Q;  3CMA Q;  1K9M R;  1S72 Q;  1VQL Q;  1YIJ Q;  2OTL Q;  1Q86 R;  3CCU Q;  1K8A R;  1NJI R;  1Q82 R;  3CME Q;  3CC2 Q;  1N8R R;  1VQ8 Q;  1KQS P;  3CC4 Q;  3CCS Q;  1VQ9 Q;  1KD1 R;  1YIT Q;  1JJ2 P;  3CCL Q;  1VQM Q;  1QVG P;  1M90 R;  1VQN Q;  3G4S Q;  1Q81 R;  1YHQ Q;  1YJN Q;  3CCJ Q;  3CCR Q;  2QA4 Q;  1YJ9 Q;  1VQ7 Q;  3CD6 Q;  1VQP Q;  3I56 Q;  1Q7Y R;  2OTJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...