1YWOA

Phospholipase cgamma1 sh3 in complex with a slp-76 motif
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
b'SAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
molecule tags Hydrolase, signaling protein
source organism Rattus norvegicus
publication title Structural Basis for Recognition of the T Cell Adaptor Protein SLP-76 by the SH3 Domain of Phospholipase Cgamma1
pubmed doi rcsb
total genus 12
structure length 55
sequence length 55
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ywoA00
1OOTA 1SRMA 1GCQA 1ZBJA 2F2WA 1NEBA 4ESRA 1M8MA 3EHQA 2EGCA 1W70A 1YNZA 2ECZA 1WDXA 3RNJA 5HCKA 2RNAA 4OMPA 3EG3A 2PZ1A 2KXDA 3SEMA 2CH4A 4Z88A 4F17A 1K0XA 1H3HA 2B86A 1U3OA 3EHRA 1PKTA 2JS0A 3PVLA 4FSSA 4DEXA 1PHTA 1IO6A 2KNBB 2DL4A 2DX1A 1JXMA 5FWBA 2C0OA 2KR3A 2YDLA 2JW4A 1NLOC 3H0FA 2DBMA 1KSWA 5IH2A 4JZ4A 5IHNA 1RUWA 1WI7A 1UUEA 1AD5A 3M0RA 1JEGA 1UHCA 2K79A 1M3AA 1GBQA 3NPFA 1ABOA 1KIKA 2M51A 1QWFA 2LZ6B 2ESWA 4J9GA 2YUNA 1TUDA 1CKAA 1A0NB 2SRCA 1BK2A 1X2QA 4RTXA 5ECAA 1I0CA 5IXBA 4AFZC 3THKA 2XMFA 5IHIA 4RTZA 3VS1A 2K2MA 4R0KA 1ZX6A 3UA6A 2YUOA 4D8DA 1QCFA 2LQNA 1UHFA 1T0JA 2YUPA 1OPLA 2KE9A 1PNJA 3M0SA 4OMOA 2DBKA 4JJBA 1NYFA 2KT1A 1K76A 3NGPA 2ABLA 2D0NA 2EQIA 1W6XA 2DA9A 4OMMA 4AFQC 1BU1A 1E6GA 2CSQA 1YWOA 2AK5A 2YUQA 2LJ0A 1K9AA 2J6OA 2HEQA 1SRLA 2HBWA 2LJ3A 4X1VA 2K3BA 3VS5A 2A08A 4EIKA 2YSQA 1AEYA 1WFWA 2GTOA 2LQWA 4E6RA 2O88A 1BB9A 2DL3A 1PRLC 2G6FX 1FMKA 2F2VA 4LN2A 2SEMA 2DILA 2ROTA 3KFVA 2CH4W 3ZL7C 4J9CA 1NG2A 4RTTA 3RBBB 2CDTA 2GGRA 1Z9ZA 3UATA 4HVUA 2CREA 3VS6A 4J9HA 4ORZA 4D8KA 1X69A 3NMZC 2LCSA 5EC7A 2VKNA 1J3TA 5FW9A 1VA7A 1BBZA 4JPBW 5GJWB 3UA7A 4J9DA 1RI9A 1Y0MA 2DL7A 3H0IA 2J05A 1HSQA 2L3PA 1QKWA 1X43A 1CSKA 2EYYA 2KYMA 3U23A 1ARKA 1WA7A 2X3XD 1UGVA 2HSPA 1YP5A 1U06A 1NYGA 3I5SA 3I5RA 3R6NA 2DF6A 4J9IA 2KEAA 2JS2A 2EYWA 2DL8A 3VS4A 2RPNA 1TG0A 2MCNA 2EGAA 3C0CA 1T3SA 3EGUA 2JM9A 4RTUA 1UG1A 2FRWA 2FRYA 1ZUUA 4CC3A 5I22A 2YT6A 3A98A 3FJ5A 4M4ZA 3QWXX 3VS3A 1WLPB 1K1ZA 4JJCA 2FO0A 2L2PA 2FPEA 2MOXA 2L3QA 2GQIA 1AWXA 1OEBA 1KJWA 1V1CA 1GL5A 2RQVA 2J6KA 2J7IA 2JXBA 2DJQA 2CT4A 2DNUA 3I9QA 4IIOA 3I35A 1M3BA 2GBQA 2P4RA 2DRKA 1X2KA 1OV3A 1YCSB 2V1QA 2EKHA 2RF0A 4A63B 1WXBA 1SSHA 2PTKA 1K4US 2A36A 4GLMA 1VYTA 1UDLA 1AZGB 1AVZC 2AZSA 2OJ2A 1AWWA 2DMOA 1PRMC 2KT8A 1M30A 1ZUKA 1MUZA 3QWYA 1ZLMA 2JTEA 2I0NA 3M0QA 2RQUA 2BTTA 1PWTA 1LCKA 4HCKA 2IIMA 2EPDA 2O9SA 2CT3A 4KRTA 1WXUA 1SHGA 4JZ3A 2HCKA 2J6FA 1AWOA 2HDAA 4J9FA 4RUGA 2K9GA 1NEGA 2RN8A 2LNHB 2FEIA 4CC4B 1Z9QA 2J06A 2OI3A 2KRMA 4WCIA 1WXTA 2K6DA 2CSIA 4J9EA 1G83A 1XOVA 2A37A 3VRYA 3JV3A 1QKXA 4QT7A 2X3WD 1WX6A 3VRZA 5L23A 2DE0X 1UECA 2EYXA 2EW3A 4CC2A 1B07A 3TSWA 1WYXA 1NM7A 5FWCA 3VS2A 2O2OA 2KROA 5IHKA 1GRIA 1UFFA 2A28A 2O31A 2O9VA 3TSZA 2EBPA 1T0HA 4IIMA 1JQQA 2EGEA 1ABQA 1T3LA 2RQWA 2ROLA 3REAB 1JO8A 2OAWA 4F14A 1GFCA 3VS7A 1Y57A 3GBQA 2DVJA 2ED0A 1AWJA 2RQRA 3H41A 3EG0A 4RTWA 2JM8A 2FPDA 2JMAA 4HVVA 2L0AA 2L3SA 2DM1A 4CC7A 2LMJA 3UF4A 1U5SA 1WIEA 2FG0A 2CUBA 2ENMA 1AZEA 2K7AA 4LUEA 4OMLA 4DEYA 4AFSC 4AG1C 2F2XA 2V1RA 1H8KA 1E7OA 3LH5A 4F16A 4HVWA 5I11A 1I07A 1RLQC 1SEMA 3SHWA 4OMQA 1TUCA 2D8HA 2ED1A 4OMNA 2LP5A 1MV3A 2JT4A 1NLPC 3M0TA 4J9BA 2BZXA 1QWEA 1CKBA 1ZUYA 4HXJA 2AZVA 4LE9A 2AKLA 1UJYA 3M0UA 3NHNA 3H0HA 1W1FA 1X6BA 2GNCA 1UTIA 4K11A 1VYVA 2DRMA 4ZNXA 4RTVA 2D8JA 4LUDA 1X6GA 3M0PA 2AKKA 1G2BA 2LJ1A 1JXOA 1E6HA 3EG2A 2RQTA 3ULRB 2VWFA 4JJDA 1H92A 4Z8AA 1GCQC 2E5KA 2NUZA 1AOJA 1I1JA 2W0ZA 1X27A 1S1NA 1SPKA 1RLPC 2DL5A 2LX7A 2KRNA 2H8HA 4Y92A 3PVQA 2KYBA 3PE0A 1UE9A 1OPKA 1YWPA 3VS0A 2C0IA 1GCPA 2GTJA 3TVTA 1UJ0A 2CUDA 1M27C 2W10A 1JU5C 2KBTA 4AG2C 1HJDA 1YN8A 2KGTA 2BZYA 2C0TA 2FPFA 1VYUA 1HD3A 2EYZA 2NWMA 2MIOA 3REBB 2KRSA 1FYNA 4RTYA 3CQTA 3IQLA 1ZSGA 4Z89A 2RMOA 1GBRA 1SHFA 2DLPA 4LNPA 1GFDA 1K0SA 4GBQA 1M3CA 4AFUC 2QDLA 2D1XA 1KFZA 1MV0B 2PNIA 1PKSA 3O5ZA 1EFNA 2BZ8A 1B3QA 3EG1A 5GJVB 2M0YA 1QLYA 2JMCA 2EVRA 2KXCA 1N5ZA 2DYBA 2VVKA 5IXFA
chains in the Genus database with same CATH superfamily
4PLIA 2O4XB 4PJOA 1LVKA 4M7DG 3GIBA 3MEUA 1N8RU 1N8RC 3CC7A 1UEBA 2Y90A 5HCKA 4OMPA 1VQMT 3L1AA 4QVDA 3CMAT 2BE7D 1VQKQ 2KXDA 2CH4A 3CCLA 2HD0A 4BUGA 2CZ1B 3EHRA 1U3OA 3OW2S 1YJ9T 1H3HA 1Y71A 2JS0A 3PVLA 3QIIA 3UDCA 3C12A 2DTIA 2DL4A 1EX4A 1PG5B 2XG8D 2EFIA 3H0FA 1KSWA 1K8AR 2YXYA 4N4IA 4KGXB 1JEGA 3S3NA 1RADB 4C0FA 1OQKA 2ESWA 4J9GA 1TS9A 2E64A 1TUDA 1OU8A 3EGXB 2K5FA 2LCLA 1X2QA 4RTXA 4XAXB 5ECAA 2NUPA 4AFZC 4C8QE 3RIRA 4RTZA 5EG2A 3I55T 3FC3A 3UA6A 1YI2Q 4D8DA 2YUPA 1M2VB 2CP5A 3M0SA 3UWNA 4C0DC 1JBMA 1NYFA 2KT1A 2QEXA 1AT1B 2D0QB 4M7DB 1KD1C 4M7AE 3QYGB 1K9MR 3DLMA 2EQIA 2DA9A 2F69A 4M75D 2LC4A 1KD1U 1BU1A 1R77A 1YWOA 2AK5A 5LJ5g 2P0PA 2J6OA 4M7AD 1NJIU 2HBWA 2K2VA 2LJ3A 2A08A 2DXCA 2YSQA 4QKUA 1WFWA 2LQWA 4E6RA 5HK3A 2G6FX 1YJNT 4KGVB 4E7ZA 1BKBA 5FLXE 1Y96B 2R57A 3SD4A 3KFVA 1Q7YU 4JS5A 3QSUA 1PM3A 3QDFA 1NG2A 4O6JA 4RTTA 3RBBB 3VS6A 4J9HA 3MJXA 4MZMA 3NMZC 2GFAA 5HK0A 1PCXA 5FW9A 1WJRA 4M77C 3DB3A 3QZ5B 1HK9A 1K73R 4EMGA 1X43A 1K8AC 1CSKA 2EYYA 1QVFP 1ARKA 3CBMA 1EIFA 5GAN2 3FIFA 1D09B 1I5LA 5A0DA 3R6NA 2DF6A 3JCMJ 2A7YA 3JCMg 2YLBA 2EYWA 1MMGA 3GP8A 2MCNA 2AIRB 3EAEA 1T3SA 2HKNA 4OF1A 4RTUA 1VQMQ 2FZGB 3A8LB 3M54A 1MNEA 2OTLA 2FRYA 2H3JA 1O75A 3QWXX 4M4ZA 3VS3A 1S72Q 2YHTA 1WLPB 5GMKe 2EIFA 2D6FA 4JJCA 5LJ5e 2LX9A 2BIVA 3VUBA 1WJSA 1I8FA 1M1KU 3SWNB 3PFSA 4A4GA 1AWXA 1OEBA 1KJWA 2RI2A 2JXBA 2DJQA 2CT4A 3G71T 2K5IA 3I35A 5GAOm 1M3BA 2DRKA 1X2KA 1YCSB 2RF0A 4E7HA 1WXBA 1SSHA 2CP0A 4GLMA 1VQPQ 4DBQA 1XQHA 1B34A 1AZGB 4C92F 2KT8A 1ZUKA 1MUZA 4JS4A 2WSCE 2JTEA 2QGFB 2RQUA 4KH0B 5IN1A 1FWZA 1LPLA 4C0DB 2IIMA 3RMQA 4KRTA 3UT1A 2OTLQ 1VQ6T 1EZZB 2HDAA 2K9GA 2RN8A 4HA8A 4DBRA 2D9TA 4M77D 2FEIA 3V8LA 4CC4B 1Z9QA 3OYCA 4RCBA 2FYKA 2CSIA 1G83A 2F1LA 4FIBA 4E2FB 3LW5E 2EYXA 3M4GA 3E1SA 3PGGA 5LJ5j 1V76A 3H9NA 3QPHA 5DY9A 4C92C 1VQ7A 2KROA 2RHUA 3EGDB 1RAFB 1WHKA 1JJ2A 2A28A 2DO3A 2ZZDA 2O9VA 5LL6S 2QI2A 3TSZA 1VQPA 4IIMA 1TSFA 4EMKA 5GAOl 4IUTA 1ABQA 2ROLA 2RD1A 3CC4Q 1OZ3A 1Y96A 2VXEA 2DVJA 1IXDA 3PIOA 4JRPA 3JAME 2RQRA 2YRVA 4CRIA 2JM8A 3GLXA 2FPDA 2JMAA 4AMCA 2P4TA 4F7UE 3SFMA 4RKUE 3CCVA 2JTFA 2DM1A 4FYVB 3UF4A 2FG0A 3CC7Q 2E4HA 1VOMA 2PVOB 3CPFA 1KQSA 2DPPB 2LCCA 1XJWB 3VJPA 5CKBA 1LNXA 4M7AB 2CZ6B 4AG1C 2XICA 1I81A 2V1RA 4EMHA 5I11A 1RLQC 5FRMA 3CCMA 3CCRQ 2E6ZA 2D8HA 3EFSA 2ED1A 4OMNA 4PJOC 2LP5A 1MV3A 2JT4A 4XU2A 1TOVA 3CCET 3M0TA 2BZXA 3PMIA 2QEXQ 3LGFA 2HQHA 4LE9A 2AKLA 4FYWB 2QA4A 3OYGA 1QW1A 3KXTA 1X6BA 2V26A 1S72T 3GNFB 4J8OA 2CKKA 4ELYC 3CCSA 2D8JA 3M0PA 4IUVA 3OSVA 4M77F 3CMAQ 2I2LA 3M5AA 3ULRB 1D3BA 1KK7A 4MDWA 2VUBA 4J6YA 1VQ5A 1I1JA 4RMOA 3CCLT 2W0ZA 4R56A 1RACB 2EJFA 1S1NA 4XTZA 4KUDK 5I2MA 4HCBA 2KRNA 2IPOB 3TEEA 2KYBA 2YRCA 3MP6A 5D6XA 1YITA 2RJEA 2M02A 4A4KA 1VQ8Q 4C92D 3MCAB 5KYWA 3VS0A 3RMSA 2LTOA 2KK4A 2EQKA 1VQOT 1JU5C 4AG2C 5HY6A 4AT1B 5CO7A 2MIOA 3REBB 4KT0E 4PJMA 4RTYA 3JCMc 3CCMT 1ZSGA 4BDZA 4LNPA 1GFDA 1NZ9A 4BY6C 4GBQA 3HFNA 4AFUC 1SF9A 2D1XA 1KFZA 1MV0B 4FYYB 5C0MA 2DIGA 3JCMd 2CP2A 1M5Q1 5GJVB 1QLYA 1WHJA 2JMCA 2EVRA 2K3XA 2DYBA 3META 1OOTA 1SRMA 3CCUT 1GCQA 3C4SA 2ZPEB 5GAN3 4XQ3A 4M78G 3RNJA 2RNAA 2M9UA 2K3YA 3E19A 4M75A 3EG3A 3KUFA 2PZ1A 4A54A 1HXDA 4C8QA 2H3EB 3BDUA 3CC7T 3HRUA 4FSSA 1PHTA 4C8QB 1TWBA 2ZPHB 3QHSA 2DX1A 1YJ9A 1JXMA 1OZ2A 3CPWA 1Y7XA 2YDLA 2JW4A 2DBMA 3P8BB 3VYHB 3OY9A 4XTVA 2X9HA 4JZ4A 2CS7A 3TREA 5A0LA 1UUEA 2F5TX 1UHCA 1M3AA 1GBQA 3JB9J 4M7DC 3NTHA 3ER0A 1K8AU 3I56T 2YUNA 1CKAA 2ATCB 1A0NB 1BK2A 1WHHA 1UGQB 1YBYA 1ZBXA 4IUQA 5J39A 1AHJB 5IHIA 4R0KA 2QQBA 1ZX6A 3L2ZA 4QQ6A 3JB9F 2LQNA 1T0JA 1PD1A 1OPLA 5HKCA 1PNJA 3OYNA 5DM7R 4OMOA 2MK5A 4JJBA 1WPYA 5GAN8 3NGPA 1NPPA 2FL7A 2ABLA 1VQ9Q 2L5QA 4LDVA 2LNVA 4OMMA 2OTLT 1VQ6Q 2VC8A 2KAFA 3MPUB 2LQ8A 3CPWP 5GANe 2CSQA 5DLQE 3PT9A 3ZFJA 3A8MB 2JJ9A 1VQLQ 5GAOn 1K73C 1BCMA 2X4JA 5CCAA 1MHNA 1MMNA 2DERA 1M90R 1K73U 4LD6A 4WTOB 2HKQB 1VQNQ 8AT1B 4TVRA 1PRLC 5D6YA 2QK0A 4M78D 1FMKA 4LN2A 3MP1A 2CH4W 1U1SA 1FMVA 4LDYA 3ZL7C 3S6WA 2GGRA 5GAMh 1ZHIA 2CREA 3G1JA 1ZSZC 4OB3B 4J83A 3CD6Q 2RJFA 1J3TA 3D7SB 3I55A 1VA7A 3HP9A 1RI9A 1YHQT 2WSFE 3RKXA 4M7DF 2RHZA 5M9OA 3H8ZA 2EYQA 4PJOG 3CCVQ 2PUKB 2QEXT 2HSPA 2XKOC 2PVDB 1NYGA 3GF5A 3CXCA 4EDUA 3CC2A 4J9IA 2JS2A 1YITQ 3VS4A 2K57A 2RPNA 1TG0A 1D0YA 2EGAA 3C0CA 3OW2P 2QXFA 5CKEA 2FRWA 1WJQA 4CC3A 5I22A 4YTLA 1OI1A 3OS5A 2RO0A 4FT2A 1K1ZA 1B7TA 3QJ6A 3CBOA 3JCMV 2MOXA 2JOYA 2MPXC 1V1CA 1GL5A 1ZA2B 2HSEB 2J6KA 2J7IA 2KY9A 4DOVA 3I9QA 3CC4A 1VQ4Q 3OYLA 2P4RA 5GANf 2V1QA 1KD1R 3OMCA 1N6AA 2A36A 2K4YA 4BACA 2MMPA 4C5GA 4M7DE 1WHMA 1UDLA 1AVZC 2OJ2A 1AWWA 4B9WA 1WGSA 3PNWC 3EFOA 1U1TA 1D0ZA 5CIUA 1W2BS 2LRQA 1NBEB 3RUXA 3CCQA 4E7LA 1LCKA 1VUBA 2EJ9A 2DEUA 1PC0A 4HCKA 2KSSA 2E41A 2EPDA 3CC2T 1WXUA 4HCCA 3GNGA 3NFCA 1IB8A 2MI6A 1BI2A 1QCNA 4RUGA 3L2QA 1Q82C 4E47A 4HCZA 1VQNA 2LNHB 3HKSA 2DTOA 4RG8A 1HYOA 1Q81C 2KRMA 4V2SA 4WCIA 1V29B 2JN0A 2K6DA 4BY6B 3QKJA 2A37A 4JUVA 1WX6A 3VRZA 1C0MA 2KMTA 4II1A 3CCRA 4CC2A 5CKFA 1K9MU 1WYXA 1X75C 3VS2A 5GAN7 5IHKA 1GRIA 4NS5A 1XNIA 1T0HA 2DJZA 2CGHA 3MP8A 3CMEA 3CCSQ 1QP3A 4F14A 1KQSS 1DJ7B 3VS7A 3M4YA 1SKUB 2VASA 2ED0A 4JLIA 1AWJA 1M1FA 5LJ3g 4L59A 3H41A 2EWNA 4RTWA 2RK1A 3TCJA 3CCQT 2L0AA 4C0GA 3QYHB 5GAOr 4M7AA 4IKFA 2K7AA 1FXXA 1VQ6A 2JUFA 1BIAA 4ZGEB 3HL8A 1RAHB 3LH5A 1E7OA 1WZOA 4F16A 3MO8A 4BI3A 2FZCB 2HL3A 5GANg 1KHCA 3SHWA 4C5EA 1Q95G 2OX7A 4OMQA 1TUCA 3L2WA 2HNIA 5GAMd 3RDVA 3JB9D 3X20B 1M1GA 1QWEA 1ZUYA 4HXJA 6AT1B 1KQ1A 2A3LA 3M0UA 3G6ET 4PFOA 4NL3A 3H0HA 2DD4A 5GANd 1UTIA 2LDMA 1VYVA 1Q7YR 2DRMA 2RHIA 4ZNXA 3EGDA 5FU6C 4BE1A 1G2BA 5GMKl 1M8VA 2IVWA 3OYMA 2DETA 1E6HA 3EG2A 3OYJA 2EQJA 2RQTA 4GLKA 3WVDB 5KYUB 3JB9G 3OSSC 1H92A 4B9XA 2NUZA 1AOJA 2QDYB 3AHUA 2E3HA 1X27A 1RLPC 3PMTA 3CCJQ 1UGRB 2LX7A 3ASKA 2LQKA 1M4ZA 3CEYA 4ZN3A 1M1KR 1W4SA 4Q5WA 5CQXA 4E7SA 1QP2A 2R58A 4PJNA 1BI3A 3FRNA 2DZ9A 3FEOA 1YWPA 4CI0C 2CZ0B 2C0IA 1GCPA 3HHTB 4ANJA 5LJ3e 3TVTA 1UGSB 2VYTA 4C92B 2DZCA 2BZYA 2FPFA 2MAMA 2NWMA 1FYNA 1TUGB 9ATCB 2RMOA 1GBRA 4PJOE 3SB2A 1K0SA 1B34B 4IUPA 3CCEA 1O9SA 2QDLA 3HSBA 2PNIA 5CR2A 1N8RR 5KYWB 5LJ5d 5KCHA 3EGXA 2QASA 1I4K1 4N0AA 2VVKA 3CC2Q 5L8RE 1BI1A 3SWNA 3CCJA 2VGNA 2KI7A 1W2BA 2ZPGB 1ZBJA 5GAMe 1NEBA 2R5MA 3V7RA 3OW2A 1M8MA 1RAIB 1RI0A 1W70A 1YNZA 2ECZA 3JB9H 3M58A 1OX8A 4C8QC 2RB6A 3EH2A 3LWHA 4LDXA 3SEMA 4F17A 1K0XA 2LT1A 3TU4K 2B86A 4ZTFA 1ZQ1A 4DEXA 1VQ4T 2PVGB 2QQSA 4PKCC 4BI8B 4OMFB 4KBMB 1M2OA 4DOWA 2RJDA 2KQWA 5FWBA 2KR3A 1Q82R 1R8OB 1NLOC 2M0OA 5IHNA 1VQKT 2O01E 3M0RA 5KYNA 1M9SA 3L2VA 3NPFA 1KIKA 2M51A 2LZ6B 4PJOD 2E5QA 2SRCA 4J7FA 1XTDA 4JJNK 2DXTA 1KQ2A 1RAAB 2VGMA 1I0CA 5IXBA 2QA4Q 3G7ZA 4M77A 5GANj 2YWWA 3P8HA 4C8QG 1YJWT 2YUOA 1PSEA 1WHGA 2GF7A 3C94A 1UHFA 1M1KC 1UGPB 3VV0A 3CCUA 4M78C 3X25B 1K76A 5KYXB 1KQSP 1TTHB 4F7UG 3QUIA 4FYXB 1IHWA 3S3MA 1IRXA 4EMKB 1NE8A 4ZGDB 2Y4XA 4AFQC 1YHQQ 5GAN4 4M77B 2BE9B 4BE0A 2ZCFB 1E6GA 5D7UA 5GAMg 2NLUA 3RESA 2YUQA 3OYIA 4ATOA 2HEQA 2BKDN 2FB7A 1SRLA 2OAUA 2L3RA 5LJ3f 2K3BA 1QVGA 4EIKA 1AEYA 2QAZA 4QVCA 2O88A 1BB9A 2DL3A 3T9NA 2E6NA 2HQEA 3JCMf 4P5NA 2F2VA 2ROTA 4IURA 3X24B 2GFUA 3JCMQ 4J9CA 1NJIC 2CDTA 2BUDA 1Z9ZA 3UATA 3LGLA 3WVEB 2LCSA 5EC7A 2VKNA 4MZTA 3PTAA 1YIJQ 2VXFA 1BBZA 3UA7A 2DL7A 2J05A 2X51A 3M55A 4XTWA 3LH0A 4KULA 3BFMA 3BDLA 1WQWA 4XU3A 2KYMA 3U23A 1OULA 1WA7A 2X3XD 1UGVA 1WNLA 4FCYA 3X26B 4GY5A 3X28B 2AHJB 4M75G 2DL8A 5LJ3d 5GAN6 3L2UA 1H3ZA 3EGUA 2Y4YA 2JM9A 4C5HA 2E12A 1VQ5Q 3CCST 1ZUUA 3I56Q 2XDPA 1C1AA 3A98A 3FJ5A 1MMAA 4OB1B 1N9RA 3FDRA 4XTYA 1VQ5T 4BE2A 2LT4A 2DYIA 2MYSA 3QXEB 4C92A 4M7AG 2FPEA 4ZTJA 2GCXA 2GQIA 5DLOA 5J3BA 2WACA 5A0GA 2R5AA 2XU8A 4OGEA 3V8JA 2RQVA 5KCOA 2DNUA 3MEWA 2MWOA 4IIOA 3INZA 2GBQA 1QVPA 3MHXA 4A63B 5FROA 5IAYA 4QQDA 2QYZA 3CC4T 2QTXA 3ZBDA 1PRMC 2EQUA 1M30A 5J26A 3QWYA 1N27A 4QW2A 2I0NA 5KYUA 3EFRA 3NTIA 5I21A 3M0QA 4FW2A 4C0ZA 1D1BA 4M78F 1PD0A 3G4ST 1FX7A 4LDWA 4Y91A 3H6ZA 3BW1A 4X9CA 2CT3A 4JZ3A 4E7JA 2HCKA 4J9FA 1NEGA 4M75B 4Y28E 4EMKC 2NUTB 8ATCB 1G3TA 1YCYA 2OI3A 1R0CB 1WXTA 1P92A 1D1CA 5FU6B 1X6OA 1XOVA 4M7DD 3JV3A 4A53A 1QKXA 4QT7A 5L23A 1UECA 3RKYA 1ZSZA 3CCMQ 1B07A 3TSWA 1MNDA 3LYIA 5FWCA 1NM7A 2QGGA 5FU7B 2GQVA 2ZPBB 1VQMA 2X4XA 2O31A 3TQ7P 4J6WA 4HT8A 2EBPA 4MDXA 2V8KA 2WSEE 1JB0E 1T3LA 3FLGA 4KGZB 4OGCA 4M7DA 2RQWA 2RH2A 4UC4A 1GFCA 1FMWA 3GBQA 2YRDA 3CMET 4X9DA 3EG0A 2ZPIB 3QZ9B 3QBYA 2L3SA 3KBGA 1M90C 3OYFA 1W2BP 4CC7A 2JZ2A 4KH1B 1WIEA 1ACMB 5KYYA 4HKEA 2NUPB 4DBHA 1LOJA 5GMKi 3CCVT 2ENMA 1AZEA 4LUEA 4OMLA 3EG9A 7AT1B 3L2RA 3GPLA 4AFSC 3M53A 1QVFA 4M75C 3VYGA 4PFPA 2F2XA 3OYHA 4J7IA 1H8KA 4XTUA 3CCQQ 3N5BB 3CD6A 1SEMA 1LJOA 3A8GB 2KVQG 3JRZA 5KYXA 3A8HB 2L8DA 2COYA 3CCRT 4F7UB 4RG2A 1JJ2P 2G3RA 2HL5C 3ME9A 4J9BA 1RABB 2A0FB 1CKBA 4JDSA 3NHNA 3Q1JA 2XDDA 4EPCA 2GNCA 3OQ5A 5GAOq 2DVEA 4RTVA 1X6GA 3OA6A 5AT1B 3MKDA 3P8DA 2IG0A 2DEQA 2JTMA 2VWFA 4OP0A 4JJDA 3C95A 1GCQC 3EFOB 1VQLT 2PUOB 2JVVA 2XHCA 3MEVA 2KDSA 2B8AA 2OTJQ 2O4XA 4PJOB 2VV5A 3PVQA 4F7UF 4PJOF 3L42A 3DB4A 1VQ9A 3M56A 2HAXA 1OPKA 2MWPA 4VUBA 4E7KA 1VQOA 4XU0A 5GAMf 5FRNA 1G8XA 3ZEHA 3E2UA 1UJ0A 1X01A 2KBTA 3AT1B 5CKHA 1YN8A 3HPWA 4MZPA 3R6OA 4F7UA 4LDUA 3CQTA 2P84A 4BDYA 1Y07A 4Z89A 5IT9E 2FVUA 3JCMe 1YHQA 2DLPA 1QVGP 3OYAA 1M3CA 1K9MC 2PQWA 2M16A 4PJJA 1F1BB 1EFNA 4OB2B 3G6EA 2CYZB 3EG9B 2DD5A 3EG1A 1OX9A 2EKOA 2ZAEA 3M9QA 1N5ZA 4C92E 5IXFA 1U8RA 3J7AF 4A4HA 2F2WA 4M78E 3QO3A 4ZN1A 1YI2T 3I55Q 4ESRA 2E65A 5LJ5f 2MF2A 3LLRA 3EHQA 2EGCA 4FM4B 3OBYA 1WDXA 1BIBA 1M2VA 1VQPT 1VQLA 4RCCA 4PJLA 2FHDA 4Z88A 5GMKm 1PKTA 3G6EQ 1IO6A 2KNBB 2F5KA 4PNOA 1KC8C 1VQ4A 1YJWQ 1G3YA 2C0OA 4C5IA 2OTJA 2COZA 3JCMh 4FSXA 4J5YA 3J81E 1KG1A 3M57A 3CMEQ 1ZSZB 4F04B 5IH2A 1Q81R 3FJPA 1RUWA 1WI7A 4DQ2A 1AD5A 2K79A 3CBPA 3OYKA 1ABOA 1QWFA 1VQKA 3OS2A 4M7AF 2NUTA 2DAQA 2DIQA 1Q86C 3PIPA 3THKA 2RA2A 2XMFA 4XTXA 3OYYA 1N9SA 4OB0B 3VS1A 2K2MA 2L89A 4O5VA 1QCFA 4LD9K 2KE9A 2ZPFB 2DBKA 5CQYA 1IZ6A 4BI4A 2RHXA 4C92G 3URGA 1VQ8T 1WHLA 3FB9A 1TH7A 2D0NA 1W6XA 4N4GA 5GAN5 2HMAA 2E1HA 3GOXA 4L5GA 1YI2A 1IHVA 5CKDA 3SDZA 3G4SQ 3A8OB 4PFZA 3CCLQ 3CXCP 3EH1A 1Q86R 2LJ0A 1K9AA 3V7SA 1VQ7T 2X35A 1H641 2X4WA 2E70A 2EJGA 5AYFA 3CMAA 4A4EA 4X1VA 1YJNA 3VS5A 3HRTA 2DFUA 2GTOA 1TU0B 1MMDA 3HRSA 3NTKA 1IGQA 1MGQA 1QMCA 2SEMA 2DILA 2OTJT 3CCEQ 2EQMA 4M77E 4XK8E 4FU6A 2EAYA 4HVUA 2CP6A 4ORZA 4JRIA 4D8KA 1X69A 3G71A 2PU9B 2RJCA 3LWIA 2YLCA 5GJWB 4JPBW 3O8VA 4J9DA 4PL6A 1RL2A 1Y0MA 3H0IA 3HTRA 1HSQA 2L3PA 1BYMA 1QKWA 1M90U 3OMGA 3QJYA 4LXCA 3A1PA 1C6VX 1YP5A 1U06A 2CZ7B 1Q86U 4WF2A 1YFNA 3BE3A 3JB9I 3VKIA 1VIFA 3I5SA 3I5RA 2XIDA 1ZA1B 4Z02A 2KEAA 5CK9A 3CCJT 5KYYB 4B6MA 1VQ8A 1D1AA 4QVZA 1JRIA 2P0QA 4DA4A 1S72A 1UG1A 2V8JA 2CP3A 3RERA 5C6SA 5LJ3j 2YT6A 4BD3A 1JJ2S 3JCMP 2XD0A 3JCMX 3OYBA 1OYXA 1D0XA 3DKMA 3VU3C 2V8IA 2FO0A 2X4YA 2L2PA 3DLLA 1RAGB 1NPRA 2RK2A 1SSFA 2L3QA 2XK0A 2RI3A 5CVIA 4FW1A 2HBPA 4N0AC 2AT1B 4FT4A 5A2QE 2K5LA 4M77G 1OV3A 1YJ9Q 2EKHA 1K4US 2PTKA 1Q81U 5KE2A 1VYTA 1QVFS 1OU9A 5GMKj 2AZSA 2DMOA 3S3OA 1Q82U 1BCOA 1ZLMA 1D3BB 1R0BG 4N4HA 4E7IA 2BTTA 2DXUA 1G5VA 1PWTA 3SWNC 3V8KA 2O9SA 2E3IA 1SHGA 2J6FA 1IREB 1AWOA 1IGUA 4PK4A 4X34A 3QDRB 2J06A 3RKWA 2Z0WA 4J9EA 2QTVA 1UB4A 3OS0A 1VQNT 2M1HA 5LJ3h 3VRYA 2X3WD 3A5ZB 3OBWA 3OYDA 2DE0X 2EW3A 4ELZC 4DBFA 2RHYA 1YIJA 1KC8U 1KHIA 3LX7A 5GAOp 2QA4T 3MEAA 3UPUA 2O2OA 1QVGS 1UFFA 4JRQA 2QG9B 1G3WA 1JQQA 2DXBA 2EGEA 3M59A 1VQ9T 3REAB 5KH6A 1JO8A 2OAWA 4M7AC 4C8QF 4A4FA 1Y57A 3OB9A 2LVMA 2DTHA 4L6V5 4XU1A 4PLLA 2FZKB 2VB6A 2QQRA 4M78B 4HVVA 3JCMW 2LMJA 1U5SA 4M75F 3OS1A 4J6XA 2HZYA 2CUBA 2NYSA 3BY7A 2DKGA 3OYEA 4DEYA 4JLGA 4JRKA 2ZGWA 1Q7YC 4HVWA 4HT9A 1TXQA 2QQAA 1I07A 3JSCA 3WXMB 1YJWA 4ME7A 5D6WA 1NLPC 2COWA 4BB7A 1PSFA 2AZVA 1UJYA 3V7CA 5KE3A 1YJNQ 4D6WA 1W1FA 4K11A 3JCMb 4LUDA 3RR6A 2AKKA 4NL2A 2XDBA 2LJ1A 2HQXA 2JNGA 2RI5A 1YIJT 1JXOA 5GANh 4MMKA 5GMKh 3VUZA 4Z8AA 2E5KA 1I5OB 1QCOA 1SPKA 2DL5A 1YITT 1NJIR 4NOYA 2H8HA 5I2SA 4Y92A 3CCUQ 1RAEB 2P0KA 3CPWS 3PE0A 1GXIE 2QQ9A 3CXCS 1UE9A 4FL6A 4M75E 1SG5A 4OVAA 2GTJA 2XI9A 2CUDA 2W10A 1M27C 3J80E 5FU7C 4IUUA 1HJDA 4M78A 2KGTA 2C0TA 1VYUA 4C8QD 1VIEA 1HD3A 2EYZA 3CD6T 3HFOA 2KRSA 4KUIA 1VQ7Q 3G4SA 3IQLA 2C06A 5GAMj 3E9FA 1SHFA 4MMLA 4QQGA 3E9GA 1G3SA 3F70A 1QQJA 3I56A 2DK3A 1VQOQ 4R55A 1PKSA 3O5ZA 5CAIA 3G71Q 4ZGJB 2BZ8A 1B3QA 1WQ7A 2CP7A 2M0YA 1BI0A 1KC8R 2RM4A 2E10A 2KXCA 3QG1A 5LJ5h
chains in the Genus database with same CATH topology
1OOTA 1SRMA 1GCQA 1ZBJA 2F2WA 1NEBA 4ESRA 1M8MA 3EHQA 2EGCA 1W70A 1YNZA 2ECZA 1WDXA 3RNJA 5HCKA 2RNAA 4OMPA 3EG3A 2PZ1A 2KXDA 3SEMA 2CH4A 4Z88A 4F17A 1K0XA 1H3HA 2B86A 1U3OA 3EHRA 1PKTA 2JS0A 3PVLA 4FSSA 4DEXA 1PHTA 1IO6A 2KNBB 2DL4A 2DX1A 1JXMA 5FWBA 2C0OA 2KR3A 2YDLA 2JW4A 1NLOC 3H0FA 2DBMA 1KSWA 5IH2A 4JZ4A 5IHNA 1RUWA 1WI7A 1UUEA 1AD5A 3M0RA 1JEGA 1UHCA 2K79A 1M3AA 1GBQA 3NPFA 1ABOA 1KIKA 2M51A 1QWFA 2LZ6B 2ESWA 4J9GA 2YUNA 1TUDA 1CKAA 1A0NB 2SRCA 1BK2A 1X2QA 4RTXA 5ECAA 1I0CA 5IXBA 4AFZC 3THKA 2XMFA 5IHIA 4RTZA 3VS1A 2K2MA 4R0KA 1ZX6A 3UA6A 2YUOA 4D8DA 1QCFA 2LQNA 1UHFA 1T0JA 2YUPA 1OPLA 2KE9A 1PNJA 3M0SA 4OMOA 2DBKA 4JJBA 1NYFA 2KT1A 1K76A 3NGPA 2ABLA 2D0NA 2EQIA 1W6XA 2DA9A 4OMMA 4AFQC 1BU1A 1E6GA 2CSQA 1YWOA 2AK5A 2YUQA 2LJ0A 1K9AA 2J6OA 2HEQA 1SRLA 2HBWA 2LJ3A 4X1VA 2K3BA 3VS5A 2A08A 4EIKA 2YSQA 1AEYA 1WFWA 2GTOA 2LQWA 4E6RA 2O88A 1BB9A 2DL3A 1PRLC 2G6FX 1FMKA 2F2VA 4LN2A 2SEMA 2DILA 2ROTA 3KFVA 2CH4W 3ZL7C 4J9CA 1NG2A 4RTTA 3RBBB 2CDTA 2GGRA 1Z9ZA 3UATA 4HVUA 2CREA 3VS6A 4J9HA 4ORZA 4D8KA 1X69A 3NMZC 2LCSA 5EC7A 2VKNA 1J3TA 5FW9A 1VA7A 1BBZA 4JPBW 5GJWB 3UA7A 4J9DA 1RI9A 1Y0MA 2DL7A 3H0IA 2J05A 1HSQA 2L3PA 1QKWA 1X43A 1CSKA 2EYYA 2KYMA 3U23A 1ARKA 1WA7A 2X3XD 1UGVA 2HSPA 1YP5A 1U06A 1NYGA 3I5SA 3I5RA 3R6NA 2DF6A 4J9IA 2KEAA 2JS2A 2EYWA 2DL8A 3VS4A 2RPNA 1TG0A 2MCNA 2EGAA 3C0CA 1T3SA 3EGUA 2JM9A 4RTUA 1UG1A 2FRWA 2FRYA 1ZUUA 4CC3A 5I22A 2YT6A 3A98A 3FJ5A 4M4ZA 3QWXX 3VS3A 1WLPB 1K1ZA 4JJCA 2FO0A 2L2PA 2FPEA 2MOXA 2L3QA 2GQIA 1AWXA 1OEBA 1KJWA 1V1CA 1GL5A 2RQVA 2J6KA 2J7IA 2JXBA 2DJQA 2CT4A 2DNUA 3I9QA 4IIOA 3I35A 1M3BA 2GBQA 2P4RA 2DRKA 1X2KA 1OV3A 1YCSB 2V1QA 2EKHA 2RF0A 4A63B 1WXBA 1SSHA 2PTKA 1K4US 2A36A 4GLMA 1VYTA 1UDLA 1AZGB 1AVZC 2AZSA 2OJ2A 1AWWA 2DMOA 1PRMC 2KT8A 1M30A 1ZUKA 1MUZA 3QWYA 1ZLMA 2JTEA 2I0NA 3M0QA 2RQUA 2BTTA 1PWTA 1LCKA 4HCKA 2IIMA 2EPDA 2O9SA 2CT3A 4KRTA 1WXUA 1SHGA 4JZ3A 2HCKA 2J6FA 1AWOA 2HDAA 4J9FA 4RUGA 2K9GA 1NEGA 2RN8A 2LNHB 2FEIA 4CC4B 1Z9QA 2J06A 2OI3A 2KRMA 4WCIA 1WXTA 2K6DA 2CSIA 4J9EA 1G83A 1XOVA 2A37A 3VRYA 3JV3A 1QKXA 4QT7A 2X3WD 1WX6A 3VRZA 5L23A 2DE0X 1UECA 2EYXA 2EW3A 4CC2A 1B07A 3TSWA 1WYXA 1NM7A 5FWCA 3VS2A 2O2OA 2KROA 5IHKA 1GRIA 1UFFA 2A28A 2O31A 2O9VA 3TSZA 2EBPA 1T0HA 4IIMA 1JQQA 2EGEA 1ABQA 1T3LA 2RQWA 2ROLA 3REAB 1JO8A 2OAWA 4F14A 1GFCA 3VS7A 1Y57A 3GBQA 2DVJA 2ED0A 1AWJA 2RQRA 3H41A 3EG0A 4RTWA 2JM8A 2FPDA 2JMAA 4HVVA 2L0AA 2L3SA 2DM1A 4CC7A 2LMJA 3UF4A 1U5SA 1WIEA 2FG0A 2CUBA 2ENMA 1AZEA 2K7AA 4LUEA 4OMLA 4DEYA 4AFSC 4AG1C 2F2XA 2V1RA 1H8KA 1E7OA 3LH5A 4F16A 4HVWA 5I11A 1I07A 1RLQC 1SEMA 3SHWA 4OMQA 1TUCA 2D8HA 2ED1A 4OMNA 2LP5A 1MV3A 2JT4A 1NLPC 3M0TA 4J9BA 2BZXA 1QWEA 1CKBA 1ZUYA 4HXJA 2AZVA 4LE9A 2AKLA 1UJYA 3M0UA 3NHNA 3H0HA 1W1FA 1X6BA 2GNCA 1UTIA 4K11A 1VYVA 2DRMA 4ZNXA 4RTVA 2D8JA 4LUDA 1X6GA 3M0PA 2AKKA 1G2BA 2LJ1A 1JXOA 1E6HA 3EG2A 2RQTA 3ULRB 2VWFA 4JJDA 1H92A 4Z8AA 1GCQC 2E5KA 2NUZA 1AOJA 1I1JA 2W0ZA 1X27A 1S1NA 1SPKA 1RLPC 2DL5A 2LX7A 2KRNA 2H8HA 4Y92A 3PVQA 2KYBA 3PE0A 1UE9A 1OPKA 1YWPA 3VS0A 2C0IA 1GCPA 2GTJA 3TVTA 1UJ0A 2CUDA 1M27C 2W10A 1JU5C 2KBTA 4AG2C 1HJDA 1YN8A 2KGTA 2BZYA 2C0TA 2FPFA 1VYUA 1HD3A 2EYZA 2NWMA 2MIOA 3REBB 2KRSA 1FYNA 4RTYA 3CQTA 3IQLA 1ZSGA 4Z89A 2RMOA 1GBRA 1SHFA 2DLPA 4LNPA 1GFDA 1K0SA 4GBQA 1M3CA 4AFUC 2QDLA 2D1XA 1KFZA 1MV0B 2PNIA 1PKSA 3O5ZA 1EFNA 2BZ8A 1B3QA 3EG1A 5GJVB 2M0YA 1QLYA 2JMCA 2EVRA 2KXCA 1N5ZA 2DYBA 2VVKA 5IXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOT A;  1SRM A;  1GCQ A;  1ZBJ A;  2F2W A;  1NEB A;  4ESR A;  1M8M A;  3EHQ A;  2EGC A;  1W70 A;  1YNZ A;  2ECZ A;  1WDX A;  3RNJ A;  5HCK A;  2RNA A;  4OMP A;  3EG3 A;  2PZ1 A;  2KXD A;  3SEM A;  2CH4 A;  4Z88 A;  4F17 A;  1K0X A;  1H3H A;  2B86 A;  1U3O A;  3EHR A;  1PKT A;  2JS0 A;  3PVL A;  4FSS A;  4DEX A;  1PHT A;  1IO6 A;  2KNB B;  2DL4 A;  2DX1 A;  1JXM A;  5FWB A;  2C0O A;  2KR3 A;  2YDL A;  2JW4 A;  1NLO C;  3H0F A;  2DBM A;  1KSW A;  5IH2 A;  4JZ4 A;  5IHN A;  1RUW A;  1WI7 A;  1UUE A;  1AD5 A;  3M0R A;  1JEG A;  1UHC A;  2K79 A;  1M3A A;  1GBQ A;  3NPF A;  1ABO A;  1KIK A;  2M51 A;  1QWF A;  2LZ6 B;  2ESW A;  4J9G A;  2YUN A;  1TUD A;  1CKA A;  1A0N B;  2SRC A;  1BK2 A;  1X2Q A;  4RTX A;  5ECA A;  1I0C A;  5IXB A;  4AFZ C;  3THK A;  2XMF A;  5IHI A;  4RTZ A;  3VS1 A;  2K2M A;  4R0K A;  1ZX6 A;  3UA6 A;  2YUO A;  4D8D A;  1QCF A;  2LQN A;  1UHF A;  1T0J A;  2YUP A;  1OPL A;  2KE9 A;  1PNJ A;  3M0S A;  4OMO A;  2DBK A;  4JJB A;  1NYF A;  2KT1 A;  1K76 A;  3NGP A;  2ABL A;  2D0N A;  2EQI A;  1W6X A;  2DA9 A;  4OMM A;  4AFQ C;  1BU1 A;  1E6G A;  2CSQ A;  1YWO A;  2AK5 A;  2YUQ A;  2LJ0 A;  1K9A A;  2J6O A;  2HEQ A;  1SRL A;  2HBW A;  2LJ3 A;  4X1V A;  2K3B A;  3VS5 A;  2A08 A;  4EIK A;  2YSQ A;  1AEY A;  1WFW A;  2GTO A;  2LQW A;  4E6R A;  2O88 A;  1BB9 A;  2DL3 A;  1PRL C;  2G6F X;  1FMK A;  2F2V A;  4LN2 A;  2SEM A;  2DIL A;  2ROT A;  3KFV A;  2CH4 W;  3ZL7 C;  4J9C A;  1NG2 A;  4RTT A;  3RBB B;  2CDT A;  2GGR A;  1Z9Z A;  3UAT A;  4HVU A;  2CRE A;  3VS6 A;  4J9H A;  4ORZ A;  4D8K A;  1X69 A;  3NMZ C;  2LCS A;  5EC7 A;  2VKN A;  1J3T A;  5FW9 A;  1VA7 A;  1BBZ A;  4JPB W;  5GJW B;  3UA7 A;  4J9D A;  1RI9 A;  1Y0M A;  2DL7 A;  3H0I A;  2J05 A;  1HSQ A;  2L3P A;  1QKW A;  1X43 A;  1CSK A;  2EYY A;  2KYM A;  3U23 A;  1ARK A;  1WA7 A;  2X3X D;  1UGV A;  2HSP A;  1YP5 A;  1U06 A;  1NYG A;  3I5S A;  3I5R A;  3R6N A;  2DF6 A;  4J9I A;  2KEA A;  2JS2 A;  2EYW A;  2DL8 A;  3VS4 A;  2RPN A;  1TG0 A;  2MCN A;  2EGA A;  3C0C A;  1T3S A;  3EGU A;  2JM9 A;  4RTU A;  1UG1 A;  2FRW A;  2FRY A;  1ZUU A;  4CC3 A;  5I22 A;  2YT6 A;  3A98 A;  3FJ5 A;  4M4Z A;  3QWX X;  3VS3 A;  1WLP B;  1K1Z A;  4JJC A;  2FO0 A;  2L2P A;  2FPE A;  2MOX A;  2L3Q A;  2GQI A;  1AWX A;  1OEB A;  1KJW A;  1V1C A;  1GL5 A;  2RQV A;  2J6K A;  2J7I A;  2JXB A;  2DJQ A;  2CT4 A;  2DNU A;  3I9Q A;  4IIO A;  3I35 A;  1M3B A;  2GBQ A;  2P4R A;  2DRK A;  1X2K A;  1OV3 A;  1YCS B;  2V1Q A;  2EKH A;  2RF0 A;  4A63 B;  1WXB A;  1SSH A;  2PTK A;  1K4U S;  2A36 A;  4GLM A;  1VYT A;  1UDL A;  1AZG B;  1AVZ C;  2AZS A;  2OJ2 A;  1AWW A;  2DMO A;  1PRM C;  2KT8 A;  1M30 A;  1ZUK A;  1MUZ A;  3QWY A;  1ZLM A;  2JTE A;  2I0N A;  3M0Q A;  2RQU A;  2BTT A;  1PWT A;  1LCK A;  4HCK A;  2IIM A;  2EPD A;  2O9S A;  2CT3 A;  4KRT A;  1WXU A;  1SHG A;  4JZ3 A;  2HCK A;  2J6F A;  1AWO A;  2HDA A;  4J9F A;  4RUG A;  2K9G A;  1NEG A;  2RN8 A;  2LNH B;  2FEI A;  4CC4 B;  1Z9Q A;  2J06 A;  2OI3 A;  2KRM A;  4WCI A;  1WXT A;  2K6D A;  2CSI A;  4J9E A;  1G83 A;  1XOV A;  2A37 A;  3VRY A;  3JV3 A;  1QKX A;  4QT7 A;  2X3W D;  1WX6 A;  3VRZ A;  5L23 A;  2DE0 X;  1UEC A;  2EYX A;  2EW3 A;  4CC2 A;  1B07 A;  3TSW A;  1WYX A;  1NM7 A;  5FWC A;  3VS2 A;  2O2O A;  2KRO A;  5IHK A;  1GRI A;  1UFF A;  2A28 A;  2O31 A;  2O9V A;  3TSZ A;  2EBP A;  1T0H A;  4IIM A;  1JQQ A;  2EGE A;  1ABQ A;  1T3L A;  2RQW A;  2ROL A;  3REA B;  1JO8 A;  2OAW A;  4F14 A;  1GFC A;  3VS7 A;  1Y57 A;  3GBQ A;  2DVJ A;  2ED0 A;  1AWJ A;  2RQR A;  3H41 A;  3EG0 A;  4RTW A;  2JM8 A;  2FPD A;  2JMA A;  4HVV A;  2L0A A;  2L3S A;  2DM1 A;  4CC7 A;  2LMJ A;  3UF4 A;  1U5S A;  1WIE A;  2FG0 A;  2CUB A;  2ENM A;  1AZE A;  2K7A A;  4LUE A;  4OML A;  4DEY A;  4AFS C;  4AG1 C;  2F2X A;  2V1R A;  1H8K A;  1E7O A;  3LH5 A;  4F16 A;  4HVW A;  5I11 A;  1I07 A;  1RLQ C;  1SEM A;  3SHW A;  4OMQ A;  1TUC A;  2D8H A;  2ED1 A;  4OMN A;  2LP5 A;  1MV3 A;  2JT4 A;  1NLP C;  3M0T A;  4J9B A;  2BZX A;  1QWE A;  1CKB A;  1ZUY A;  4HXJ A;  2AZV A;  4LE9 A;  2AKL A;  1UJY A;  3M0U A;  3NHN A;  3H0H A;  1W1F A;  1X6B A;  2GNC A;  1UTI A;  4K11 A;  1VYV A;  2DRM A;  4ZNX A;  4RTV A;  2D8J A;  4LUD A;  1X6G A;  3M0P A;  2AKK A;  1G2B A;  2LJ1 A;  1JXO A;  1E6H A;  3EG2 A;  2RQT A;  3ULR B;  2VWF A;  4JJD A;  1H92 A;  4Z8A A;  1GCQ C;  2E5K A;  2NUZ A;  1AOJ A;  1I1J A;  2W0Z A;  1X27 A;  1S1N A;  1SPK A;  1RLP C;  2DL5 A;  2LX7 A;  2KRN A;  2H8H A;  4Y92 A;  3PVQ A;  2KYB A;  3PE0 A;  1UE9 A;  1OPK A;  1YWP A;  3VS0 A;  2C0I A;  1GCP A;  2GTJ A;  3TVT A;  1UJ0 A;  2CUD A;  1M27 C;  2W10 A;  1JU5 C;  2KBT A;  4AG2 C;  1HJD A;  1YN8 A;  2KGT A;  2BZY A;  2C0T A;  2FPF A;  1VYU A;  1HD3 A;  2EYZ A;  2NWM A;  2MIO A;  3REB B;  2KRS A;  1FYN A;  4RTY A;  3CQT A;  3IQL A;  1ZSG A;  4Z89 A;  2RMO A;  1GBR A;  1SHF A;  2DLP A;  4LNP A;  1GFD A;  1K0S A;  4GBQ A;  1M3C A;  4AFU C;  2QDL A;  2D1X A;  1KFZ A;  1MV0 B;  2PNI A;  1PKS A;  3O5Z A;  1EFN A;  2BZ8 A;  1B3Q A;  3EG1 A;  5GJV B;  2M0Y A;  1QLY A;  2JMC A;  2EVR A;  2KXC A;  1N5Z A;  2DYB A;  2VVK A;  5IXF A; 
#chains in the Genus database with same CATH topology
 4PLI A;  2O4X B;  4PJO A;  1LVK A;  4M7D G;  3GIB A;  3MEU A;  1N8R U;  1N8R C;  3CC7 A;  1UEB A;  2Y90 A;  5HCK A;  4OMP A;  1VQM T;  3L1A A;  4QVD A;  3CMA T;  2BE7 D;  1VQK Q;  2KXD A;  2CH4 A;  3CCL A;  2HD0 A;  4BUG A;  2CZ1 B;  3EHR A;  1U3O A;  3OW2 S;  1YJ9 T;  1H3H A;  1Y71 A;  2JS0 A;  3PVL A;  3QII A;  3UDC A;  3C12 A;  2DTI A;  2DL4 A;  1EX4 A;  1PG5 B;  2XG8 D;  2EFI A;  3H0F A;  1KSW A;  1K8A R;  2YXY A;  4N4I A;  4KGX B;  1JEG A;  3S3N A;  1RAD B;  4C0F A;  1OQK A;  2ESW A;  4J9G A;  1TS9 A;  2E64 A;  1TUD A;  1OU8 A;  3EGX B;  2K5F A;  2LCL A;  1X2Q A;  4RTX A;  4XAX B;  5ECA A;  2NUP A;  4AFZ C;  4C8Q E;  3RIR A;  4RTZ A;  5EG2 A;  3I55 T;  3FC3 A;  3UA6 A;  1YI2 Q;  4D8D A;  2YUP A;  1M2V B;  2CP5 A;  3M0S A;  3UWN A;  4C0D C;  1JBM A;  1NYF A;  2KT1 A;  2QEX A;  1AT1 B;  2D0Q B;  4M7D B;  1KD1 C;  4M7A E;  3QYG B;  1K9M R;  3DLM A;  2EQI A;  2DA9 A;  2F69 A;  4M75 D;  2LC4 A;  1KD1 U;  1BU1 A;  1R77 A;  1YWO A;  2AK5 A;  5LJ5 g;  2P0P A;  2J6O A;  4M7A D;  1NJI U;  2HBW A;  2K2V A;  2LJ3 A;  2A08 A;  2DXC A;  2YSQ A;  4QKU A;  1WFW A;  2LQW A;  4E6R A;  5HK3 A;  2G6F X;  1YJN T;  4KGV B;  4E7Z A;  1BKB A;  5FLX E;  1Y96 B;  2R57 A;  3SD4 A;  3KFV A;  1Q7Y U;  4JS5 A;  3QSU A;  1PM3 A;  3QDF A;  1NG2 A;  4O6J A;  4RTT A;  3RBB B;  3VS6 A;  4J9H A;  3MJX A;  4MZM A;  3NMZ C;  2GFA A;  5HK0 A;  1PCX A;  5FW9 A;  1WJR A;  4M77 C;  3DB3 A;  3QZ5 B;  1HK9 A;  1K73 R;  4EMG A;  1X43 A;  1K8A C;  1CSK A;  2EYY A;  1QVF P;  1ARK A;  3CBM A;  1EIF A;  5GAN 2;  3FIF A;  1D09 B;  1I5L A;  5A0D A;  3R6N A;  2DF6 A;  3JCM J;  2A7Y A;  3JCM g;  2YLB A;  2EYW A;  1MMG A;  3GP8 A;  2MCN A;  2AIR B;  3EAE A;  1T3S A;  2HKN A;  4OF1 A;  4RTU A;  1VQM Q;  2FZG B;  3A8L B;  3M54 A;  1MNE A;  2OTL A;  2FRY A;  2H3J A;  1O75 A;  3QWX X;  4M4Z A;  3VS3 A;  1S72 Q;  2YHT A;  1WLP B;  5GMK e;  2EIF A;  2D6F A;  4JJC A;  5LJ5 e;  2LX9 A;  2BIV A;  3VUB A;  1WJS A;  1I8F A;  1M1K U;  3SWN B;  3PFS A;  4A4G A;  1AWX A;  1OEB A;  1KJW A;  2RI2 A;  2JXB A;  2DJQ A;  2CT4 A;  3G71 T;  2K5I A;  3I35 A;  5GAO m;  1M3B A;  2DRK A;  1X2K A;  1YCS B;  2RF0 A;  4E7H A;  1WXB A;  1SSH A;  2CP0 A;  4GLM A;  1VQP Q;  4DBQ A;  1XQH A;  1B34 A;  1AZG B;  4C92 F;  2KT8 A;  1ZUK A;  1MUZ A;  4JS4 A;  2WSC E;  2JTE A;  2QGF B;  2RQU A;  4KH0 B;  5IN1 A;  1FWZ A;  1LPL A;  4C0D B;  2IIM A;  3RMQ A;  4KRT A;  3UT1 A;  2OTL Q;  1VQ6 T;  1EZZ B;  2HDA A;  2K9G A;  2RN8 A;  4HA8 A;  4DBR A;  2D9T A;  4M77 D;  2FEI A;  3V8L A;  4CC4 B;  1Z9Q A;  3OYC A;  4RCB A;  2FYK A;  2CSI A;  1G83 A;  2F1L A;  4FIB A;  4E2F B;  3LW5 E;  2EYX A;  3M4G A;  3E1S A;  3PGG A;  5LJ5 j;  1V76 A;  3H9N A;  3QPH A;  5DY9 A;  4C92 C;  1VQ7 A;  2KRO A;  2RHU A;  3EGD B;  1RAF B;  1WHK A;  1JJ2 A;  2A28 A;  2DO3 A;  2ZZD A;  2O9V A;  5LL6 S;  2QI2 A;  3TSZ A;  1VQP A;  4IIM A;  1TSF A;  4EMK A;  5GAO l;  4IUT A;  1ABQ A;  2ROL A;  2RD1 A;  3CC4 Q;  1OZ3 A;  1Y96 A;  2VXE A;  2DVJ A;  1IXD A;  3PIO A;  4JRP A;  3JAM E;  2RQR A;  2YRV A;  4CRI A;  2JM8 A;  3GLX A;  2FPD A;  2JMA A;  4AMC A;  2P4T A;  4F7U E;  3SFM A;  4RKU E;  3CCV A;  2JTF A;  2DM1 A;  4FYV B;  3UF4 A;  2FG0 A;  3CC7 Q;  2E4H A;  1VOM A;  2PVO B;  3CPF A;  1KQS A;  2DPP B;  2LCC A;  1XJW B;  3VJP A;  5CKB A;  1LNX A;  4M7A B;  2CZ6 B;  4AG1 C;  2XIC A;  1I81 A;  2V1R A;  4EMH A;  5I11 A;  1RLQ C;  5FRM A;  3CCM A;  3CCR Q;  2E6Z A;  2D8H A;  3EFS A;  2ED1 A;  4OMN A;  4PJO C;  2LP5 A;  1MV3 A;  2JT4 A;  4XU2 A;  1TOV A;  3CCE T;  3M0T A;  2BZX A;  3PMI A;  2QEX Q;  3LGF A;  2HQH A;  4LE9 A;  2AKL A;  4FYW B;  2QA4 A;  3OYG A;  1QW1 A;  3KXT A;  1X6B A;  2V26 A;  1S72 T;  3GNF B;  4J8O A;  2CKK A;  4ELY C;  3CCS A;  2D8J A;  3M0P A;  4IUV A;  3OSV A;  4M77 F;  3CMA Q;  2I2L A;  3M5A A;  3ULR B;  1D3B A;  1KK7 A;  4MDW A;  2VUB A;  4J6Y A;  1VQ5 A;  1I1J A;  4RMO A;  3CCL T;  2W0Z A;  4R56 A;  1RAC B;  2EJF A;  1S1N A;  4XTZ A;  4KUD K;  5I2M A;  4HCB A;  2KRN A;  2IPO B;  3TEE A;  2KYB A;  2YRC A;  3MP6 A;  5D6X A;  1YIT A;  2RJE A;  2M02 A;  4A4K A;  1VQ8 Q;  4C92 D;  3MCA B;  5KYW A;  3VS0 A;  3RMS A;  2LTO A;  2KK4 A;  2EQK A;  1VQO T;  1JU5 C;  4AG2 C;  5HY6 A;  4AT1 B;  5CO7 A;  2MIO A;  3REB B;  4KT0 E;  4PJM A;  4RTY A;  3JCM c;  3CCM T;  1ZSG A;  4BDZ A;  4LNP A;  1GFD A;  1NZ9 A;  4BY6 C;  4GBQ A;  3HFN A;  4AFU C;  1SF9 A;  2D1X A;  1KFZ A;  1MV0 B;  4FYY B;  5C0M A;  2DIG A;  3JCM d;  2CP2 A;  1M5Q 1;  5GJV B;  1QLY A;  1WHJ A;  2JMC A;  2EVR A;  2K3X A;  2DYB A;  3MET A;  1OOT A;  1SRM A;  3CCU T;  1GCQ A;  3C4S A;  2ZPE B;  5GAN 3;  4XQ3 A;  4M78 G;  3RNJ A;  2RNA A;  2M9U A;  2K3Y A;  3E19 A;  4M75 A;  3EG3 A;  3KUF A;  2PZ1 A;  4A54 A;  1HXD A;  4C8Q A;  2H3E B;  3BDU A;  3CC7 T;  3HRU A;  4FSS A;  1PHT A;  4C8Q B;  1TWB A;  2ZPH B;  3QHS A;  2DX1 A;  1YJ9 A;  1JXM A;  1OZ2 A;  3CPW A;  1Y7X A;  2YDL A;  2JW4 A;  2DBM A;  3P8B B;  3VYH B;  3OY9 A;  4XTV A;  2X9H A;  4JZ4 A;  2CS7 A;  3TRE A;  5A0L A;  1UUE A;  2F5T X;  1UHC A;  1M3A A;  1GBQ A;  3JB9 J;  4M7D C;  3NTH A;  3ER0 A;  1K8A U;  3I56 T;  2YUN A;  1CKA A;  2ATC B;  1A0N B;  1BK2 A;  1WHH A;  1UGQ B;  1YBY A;  1ZBX A;  4IUQ A;  5J39 A;  1AHJ B;  5IHI A;  4R0K A;  2QQB A;  1ZX6 A;  3L2Z A;  4QQ6 A;  3JB9 F;  2LQN A;  1T0J A;  1PD1 A;  1OPL A;  5HKC A;  1PNJ A;  3OYN A;  5DM7 R;  4OMO A;  2MK5 A;  4JJB A;  1WPY A;  5GAN 8;  3NGP A;  1NPP A;  2FL7 A;  2ABL A;  1VQ9 Q;  2L5Q A;  4LDV A;  2LNV A;  4OMM A;  2OTL T;  1VQ6 Q;  2VC8 A;  2KAF A;  3MPU B;  2LQ8 A;  3CPW P;  5GAN e;  2CSQ A;  5DLQ E;  3PT9 A;  3ZFJ A;  3A8M B;  2JJ9 A;  1VQL Q;  5GAO n;  1K73 C;  1BCM A;  2X4J A;  5CCA A;  1MHN A;  1MMN A;  2DER A;  1M90 R;  1K73 U;  4LD6 A;  4WTO B;  2HKQ B;  1VQN Q;  8AT1 B;  4TVR A;  1PRL C;  5D6Y A;  2QK0 A;  4M78 D;  1FMK A;  4LN2 A;  3MP1 A;  2CH4 W;  1U1S A;  1FMV A;  4LDY A;  3ZL7 C;  3S6W A;  2GGR A;  5GAM h;  1ZHI A;  2CRE A;  3G1J A;  1ZSZ C;  4OB3 B;  4J83 A;  3CD6 Q;  2RJF A;  1J3T A;  3D7S B;  3I55 A;  1VA7 A;  3HP9 A;  1RI9 A;  1YHQ T;  2WSF E;  3RKX A;  4M7D F;  2RHZ A;  5M9O A;  3H8Z A;  2EYQ A;  4PJO G;  3CCV Q;  2PUK B;  2QEX T;  2HSP A;  2XKO C;  2PVD B;  1NYG A;  3GF5 A;  3CXC A;  4EDU A;  3CC2 A;  4J9I A;  2JS2 A;  1YIT Q;  3VS4 A;  2K57 A;  2RPN A;  1TG0 A;  1D0Y A;  2EGA A;  3C0C A;  3OW2 P;  2QXF A;  5CKE A;  2FRW A;  1WJQ A;  4CC3 A;  5I22 A;  4YTL A;  1OI1 A;  3OS5 A;  2RO0 A;  4FT2 A;  1K1Z A;  1B7T A;  3QJ6 A;  3CBO A;  3JCM V;  2MOX A;  2JOY A;  2MPX C;  1V1C A;  1GL5 A;  1ZA2 B;  2HSE B;  2J6K A;  2J7I A;  2KY9 A;  4DOV A;  3I9Q A;  3CC4 A;  1VQ4 Q;  3OYL A;  2P4R A;  5GAN f;  2V1Q A;  1KD1 R;  3OMC A;  1N6A A;  2A36 A;  2K4Y A;  4BAC A;  2MMP A;  4C5G A;  4M7D E;  1WHM A;  1UDL A;  1AVZ C;  2OJ2 A;  1AWW A;  4B9W A;  1WGS A;  3PNW C;  3EFO A;  1U1T A;  1D0Z A;  5CIU A;  1W2B S;  2LRQ A;  1NBE B;  3RUX A;  3CCQ A;  4E7L A;  1LCK A;  1VUB A;  2EJ9 A;  2DEU A;  1PC0 A;  4HCK A;  2KSS A;  2E41 A;  2EPD A;  3CC2 T;  1WXU A;  4HCC A;  3GNG A;  3NFC A;  1IB8 A;  2MI6 A;  1BI2 A;  1QCN A;  4RUG A;  3L2Q A;  1Q82 C;  4E47 A;  4HCZ A;  1VQN A;  2LNH B;  3HKS A;  2DTO A;  4RG8 A;  1HYO A;  1Q81 C;  2KRM A;  4V2S A;  4WCI A;  1V29 B;  2JN0 A;  2K6D A;  4BY6 B;  3QKJ A;  2A37 A;  4JUV A;  1WX6 A;  3VRZ A;  1C0M A;  2KMT A;  4II1 A;  3CCR A;  4CC2 A;  5CKF A;  1K9M U;  1WYX A;  1X75 C;  3VS2 A;  5GAN 7;  5IHK A;  1GRI A;  4NS5 A;  1XNI A;  1T0H A;  2DJZ A;  2CGH A;  3MP8 A;  3CME A;  3CCS Q;  1QP3 A;  4F14 A;  1KQS S;  1DJ7 B;  3VS7 A;  3M4Y A;  1SKU B;  2VAS A;  2ED0 A;  4JLI A;  1AWJ A;  1M1F A;  5LJ3 g;  4L59 A;  3H41 A;  2EWN A;  4RTW A;  2RK1 A;  3TCJ A;  3CCQ T;  2L0A A;  4C0G A;  3QYH B;  5GAO r;  4M7A A;  4IKF A;  2K7A A;  1FXX A;  1VQ6 A;  2JUF A;  1BIA A;  4ZGE B;  3HL8 A;  1RAH B;  3LH5 A;  1E7O A;  1WZO A;  4F16 A;  3MO8 A;  4BI3 A;  2FZC B;  2HL3 A;  5GAN g;  1KHC A;  3SHW A;  4C5E A;  1Q95 G;  2OX7 A;  4OMQ A;  1TUC A;  3L2W A;  2HNI A;  5GAM d;  3RDV A;  3JB9 D;  3X20 B;  1M1G A;  1QWE A;  1ZUY A;  4HXJ A;  6AT1 B;  1KQ1 A;  2A3L A;  3M0U A;  3G6E T;  4PFO A;  4NL3 A;  3H0H A;  2DD4 A;  5GAN d;  1UTI A;  2LDM A;  1VYV A;  1Q7Y R;  2DRM A;  2RHI A;  4ZNX A;  3EGD A;  5FU6 C;  4BE1 A;  1G2B A;  5GMK l;  1M8V A;  2IVW A;  3OYM A;  2DET A;  1E6H A;  3EG2 A;  3OYJ A;  2EQJ A;  2RQT A;  4GLK A;  3WVD B;  5KYU B;  3JB9 G;  3OSS C;  1H92 A;  4B9X A;  2NUZ A;  1AOJ A;  2QDY B;  3AHU A;  2E3H A;  1X27 A;  1RLP C;  3PMT A;  3CCJ Q;  1UGR B;  2LX7 A;  3ASK A;  2LQK A;  1M4Z A;  3CEY A;  4ZN3 A;  1M1K R;  1W4S A;  4Q5W A;  5CQX A;  4E7S A;  1QP2 A;  2R58 A;  4PJN A;  1BI3 A;  3FRN A;  2DZ9 A;  3FEO A;  1YWP A;  4CI0 C;  2CZ0 B;  2C0I A;  1GCP A;  3HHT B;  4ANJ A;  5LJ3 e;  3TVT A;  1UGS B;  2VYT A;  4C92 B;  2DZC A;  2BZY A;  2FPF A;  2MAM A;  2NWM A;  1FYN A;  1TUG B;  9ATC B;  2RMO A;  1GBR A;  4PJO E;  3SB2 A;  1K0S A;  1B34 B;  4IUP A;  3CCE A;  1O9S A;  2QDL A;  3HSB A;  2PNI A;  5CR2 A;  1N8R R;  5KYW B;  5LJ5 d;  5KCH A;  3EGX A;  2QAS A;  1I4K 1;  4N0A A;  2VVK A;  3CC2 Q;  5L8R E;  1BI1 A;  3SWN A;  3CCJ A;  2VGN A;  2KI7 A;  1W2B A;  2ZPG B;  1ZBJ A;  5GAM e;  1NEB A;  2R5M A;  3V7R A;  3OW2 A;  1M8M A;  1RAI B;  1RI0 A;  1W70 A;  1YNZ A;  2ECZ A;  3JB9 H;  3M58 A;  1OX8 A;  4C8Q C;  2RB6 A;  3EH2 A;  3LWH A;  4LDX A;  3SEM A;  4F17 A;  1K0X A;  2LT1 A;  3TU4 K;  2B86 A;  4ZTF A;  1ZQ1 A;  4DEX A;  1VQ4 T;  2PVG B;  2QQS A;  4PKC C;  4BI8 B;  4OMF B;  4KBM B;  1M2O A;  4DOW A;  2RJD A;  2KQW A;  5FWB A;  2KR3 A;  1Q82 R;  1R8O B;  1NLO C;  2M0O A;  5IHN A;  1VQK T;  2O01 E;  3M0R A;  5KYN A;  1M9S A;  3L2V A;  3NPF A;  1KIK A;  2M51 A;  2LZ6 B;  4PJO D;  2E5Q A;  2SRC A;  4J7F A;  1XTD A;  4JJN K;  2DXT A;  1KQ2 A;  1RAA B;  2VGM A;  1I0C A;  5IXB A;  2QA4 Q;  3G7Z A;  4M77 A;  5GAN j;  2YWW A;  3P8H A;  4C8Q G;  1YJW T;  2YUO A;  1PSE A;  1WHG A;  2GF7 A;  3C94 A;  1UHF A;  1M1K C;  1UGP B;  3VV0 A;  3CCU A;  4M78 C;  3X25 B;  1K76 A;  5KYX B;  1KQS P;  1TTH B;  4F7U G;  3QUI A;  4FYX B;  1IHW A;  3S3M A;  1IRX A;  4EMK B;  1NE8 A;  4ZGD B;  2Y4X A;  4AFQ C;  1YHQ Q;  5GAN 4;  4M77 B;  2BE9 B;  4BE0 A;  2ZCF B;  1E6G A;  5D7U A;  5GAM g;  2NLU A;  3RES A;  2YUQ A;  3OYI A;  4ATO A;  2HEQ A;  2BKD N;  2FB7 A;  1SRL A;  2OAU A;  2L3R A;  5LJ3 f;  2K3B A;  1QVG A;  4EIK A;  1AEY A;  2QAZ A;  4QVC A;  2O88 A;  1BB9 A;  2DL3 A;  3T9N A;  2E6N A;  2HQE A;  3JCM f;  4P5N A;  2F2V A;  2ROT A;  4IUR A;  3X24 B;  2GFU A;  3JCM Q;  4J9C A;  1NJI C;  2CDT A;  2BUD A;  1Z9Z A;  3UAT A;  3LGL A;  3WVE B;  2LCS A;  5EC7 A;  2VKN A;  4MZT A;  3PTA A;  1YIJ Q;  2VXF A;  1BBZ A;  3UA7 A;  2DL7 A;  2J05 A;  2X51 A;  3M55 A;  4XTW A;  3LH0 A;  4KUL A;  3BFM A;  3BDL A;  1WQW A;  4XU3 A;  2KYM A;  3U23 A;  1OUL A;  1WA7 A;  2X3X D;  1UGV A;  1WNL A;  4FCY A;  3X26 B;  4GY5 A;  3X28 B;  2AHJ B;  4M75 G;  2DL8 A;  5LJ3 d;  5GAN 6;  3L2U A;  1H3Z A;  3EGU A;  2Y4Y A;  2JM9 A;  4C5H A;  2E12 A;  1VQ5 Q;  3CCS T;  1ZUU A;  3I56 Q;  2XDP A;  1C1A A;  3A98 A;  3FJ5 A;  1MMA A;  4OB1 B;  1N9R A;  3FDR A;  4XTY A;  1VQ5 T;  4BE2 A;  2LT4 A;  2DYI A;  2MYS A;  3QXE B;  4C92 A;  4M7A G;  2FPE A;  4ZTJ A;  2GCX A;  2GQI A;  5DLO A;  5J3B A;  2WAC A;  5A0G A;  2R5A A;  2XU8 A;  4OGE A;  3V8J A;  2RQV A;  5KCO A;  2DNU A;  3MEW A;  2MWO A;  4IIO A;  3INZ A;  2GBQ A;  1QVP A;  3MHX A;  4A63 B;  5FRO A;  5IAY A;  4QQD A;  2QYZ A;  3CC4 T;  2QTX A;  3ZBD A;  1PRM C;  2EQU A;  1M30 A;  5J26 A;  3QWY A;  1N27 A;  4QW2 A;  2I0N A;  5KYU A;  3EFR A;  3NTI A;  5I21 A;  3M0Q A;  4FW2 A;  4C0Z A;  1D1B A;  4M78 F;  1PD0 A;  3G4S T;  1FX7 A;  4LDW A;  4Y91 A;  3H6Z A;  3BW1 A;  4X9C A;  2CT3 A;  4JZ3 A;  4E7J A;  2HCK A;  4J9F A;  1NEG A;  4M75 B;  4Y28 E;  4EMK C;  2NUT B;  8ATC B;  1G3T A;  1YCY A;  2OI3 A;  1R0C B;  1WXT A;  1P92 A;  1D1C A;  5FU6 B;  1X6O A;  1XOV A;  4M7D D;  3JV3 A;  4A53 A;  1QKX A;  4QT7 A;  5L23 A;  1UEC A;  3RKY A;  1ZSZ A;  3CCM Q;  1B07 A;  3TSW A;  1MND A;  3LYI A;  5FWC A;  1NM7 A;  2QGG A;  5FU7 B;  2GQV A;  2ZPB B;  1VQM A;  2X4X A;  2O31 A;  3TQ7 P;  4J6W A;  4HT8 A;  2EBP A;  4MDX A;  2V8K A;  2WSE E;  1JB0 E;  1T3L A;  3FLG A;  4KGZ B;  4OGC A;  4M7D A;  2RQW A;  2RH2 A;  4UC4 A;  1GFC A;  1FMW A;  3GBQ A;  2YRD A;  3CME T;  4X9D A;  3EG0 A;  2ZPI B;  3QZ9 B;  3QBY A;  2L3S A;  3KBG A;  1M90 C;  3OYF A;  1W2B P;  4CC7 A;  2JZ2 A;  4KH1 B;  1WIE A;  1ACM B;  5KYY A;  4HKE A;  2NUP B;  4DBH A;  1LOJ A;  5GMK i;  3CCV T;  2ENM A;  1AZE A;  4LUE A;  4OML A;  3EG9 A;  7AT1 B;  3L2R A;  3GPL A;  4AFS C;  3M53 A;  1QVF A;  4M75 C;  3VYG A;  4PFP A;  2F2X A;  3OYH A;  4J7I A;  1H8K A;  4XTU A;  3CCQ Q;  3N5B B;  3CD6 A;  1SEM A;  1LJO A;  3A8G B;  2KVQ G;  3JRZ A;  5KYX A;  3A8H B;  2L8D A;  2COY A;  3CCR T;  4F7U B;  4RG2 A;  1JJ2 P;  2G3R A;  2HL5 C;  3ME9 A;  4J9B A;  1RAB B;  2A0F B;  1CKB A;  4JDS A;  3NHN A;  3Q1J A;  2XDD A;  4EPC A;  2GNC A;  3OQ5 A;  5GAO q;  2DVE A;  4RTV A;  1X6G A;  3OA6 A;  5AT1 B;  3MKD A;  3P8D A;  2IG0 A;  2DEQ A;  2JTM A;  2VWF A;  4OP0 A;  4JJD A;  3C95 A;  1GCQ C;  3EFO B;  1VQL T;  2PUO B;  2JVV A;  2XHC A;  3MEV A;  2KDS A;  2B8A A;  2OTJ Q;  2O4X A;  4PJO B;  2VV5 A;  3PVQ A;  4F7U F;  4PJO F;  3L42 A;  3DB4 A;  1VQ9 A;  3M56 A;  2HAX A;  1OPK A;  2MWP A;  4VUB A;  4E7K A;  1VQO A;  4XU0 A;  5GAM f;  5FRN A;  1G8X A;  3ZEH A;  3E2U A;  1UJ0 A;  1X01 A;  2KBT A;  3AT1 B;  5CKH A;  1YN8 A;  3HPW A;  4MZP A;  3R6O A;  4F7U A;  4LDU A;  3CQT A;  2P84 A;  4BDY A;  1Y07 A;  4Z89 A;  5IT9 E;  2FVU A;  3JCM e;  1YHQ A;  2DLP A;  1QVG P;  3OYA A;  1M3C A;  1K9M C;  2PQW A;  2M16 A;  4PJJ A;  1F1B B;  1EFN A;  4OB2 B;  3G6E A;  2CYZ B;  3EG9 B;  2DD5 A;  3EG1 A;  1OX9 A;  2EKO A;  2ZAE A;  3M9Q A;  1N5Z A;  4C92 E;  5IXF A;  1U8R A;  3J7A F;  4A4H A;  2F2W A;  4M78 E;  3QO3 A;  4ZN1 A;  1YI2 T;  3I55 Q;  4ESR A;  2E65 A;  5LJ5 f;  2MF2 A;  3LLR A;  3EHQ A;  2EGC A;  4FM4 B;  3OBY A;  1WDX A;  1BIB A;  1M2V A;  1VQP T;  1VQL A;  4RCC A;  4PJL A;  2FHD A;  4Z88 A;  5GMK m;  1PKT A;  3G6E Q;  1IO6 A;  2KNB B;  2F5K A;  4PNO A;  1KC8 C;  1VQ4 A;  1YJW Q;  1G3Y A;  2C0O A;  4C5I A;  2OTJ A;  2COZ A;  3JCM h;  4FSX A;  4J5Y A;  3J81 E;  1KG1 A;  3M57 A;  3CME Q;  1ZSZ B;  4F04 B;  5IH2 A;  1Q81 R;  3FJP A;  1RUW A;  1WI7 A;  4DQ2 A;  1AD5 A;  2K79 A;  3CBP A;  3OYK A;  1ABO A;  1QWF A;  1VQK A;  3OS2 A;  4M7A F;  2NUT A;  2DAQ A;  2DIQ A;  1Q86 C;  3PIP A;  3THK A;  2RA2 A;  2XMF A;  4XTX A;  3OYY A;  1N9S A;  4OB0 B;  3VS1 A;  2K2M A;  2L89 A;  4O5V A;  1QCF A;  4LD9 K;  2KE9 A;  2ZPF B;  2DBK A;  5CQY A;  1IZ6 A;  4BI4 A;  2RHX A;  4C92 G;  3URG A;  1VQ8 T;  1WHL A;  3FB9 A;  1TH7 A;  2D0N A;  1W6X A;  4N4G A;  5GAN 5;  2HMA A;  2E1H A;  3GOX A;  4L5G A;  1YI2 A;  1IHV A;  5CKD A;  3SDZ A;  3G4S Q;  3A8O B;  4PFZ A;  3CCL Q;  3CXC P;  3EH1 A;  1Q86 R;  2LJ0 A;  1K9A A;  3V7S A;  1VQ7 T;  2X35 A;  1H64 1;  2X4W A;  2E70 A;  2EJG A;  5AYF A;  3CMA A;  4A4E A;  4X1V A;  1YJN A;  3VS5 A;  3HRT A;  2DFU A;  2GTO A;  1TU0 B;  1MMD A;  3HRS A;  3NTK A;  1IGQ A;  1MGQ A;  1QMC A;  2SEM A;  2DIL A;  2OTJ T;  3CCE Q;  2EQM A;  4M77 E;  4XK8 E;  4FU6 A;  2EAY A;  4HVU A;  2CP6 A;  4ORZ A;  4JRI A;  4D8K A;  1X69 A;  3G71 A;  2PU9 B;  2RJC A;  3LWI A;  2YLC A;  5GJW B;  4JPB W;  3O8V A;  4J9D A;  4PL6 A;  1RL2 A;  1Y0M A;  3H0I A;  3HTR A;  1HSQ A;  2L3P A;  1BYM A;  1QKW A;  1M90 U;  3OMG A;  3QJY A;  4LXC A;  3A1P A;  1C6V X;  1YP5 A;  1U06 A;  2CZ7 B;  1Q86 U;  4WF2 A;  1YFN A;  3BE3 A;  3JB9 I;  3VKI A;  1VIF A;  3I5S A;  3I5R A;  2XID A;  1ZA1 B;  4Z02 A;  2KEA A;  5CK9 A;  3CCJ T;  5KYY B;  4B6M A;  1VQ8 A;  1D1A A;  4QVZ A;  1JRI A;  2P0Q A;  4DA4 A;  1S72 A;  1UG1 A;  2V8J A;  2CP3 A;  3RER A;  5C6S A;  5LJ3 j;  2YT6 A;  4BD3 A;  1JJ2 S;  3JCM P;  2XD0 A;  3JCM X;  3OYB A;  1OYX A;  1D0X A;  3DKM A;  3VU3 C;  2V8I A;  2FO0 A;  2X4Y A;  2L2P A;  3DLL A;  1RAG B;  1NPR A;  2RK2 A;  1SSF A;  2L3Q A;  2XK0 A;  2RI3 A;  5CVI A;  4FW1 A;  2HBP A;  4N0A C;  2AT1 B;  4FT4 A;  5A2Q E;  2K5L A;  4M77 G;  1OV3 A;  1YJ9 Q;  2EKH A;  1K4U S;  2PTK A;  1Q81 U;  5KE2 A;  1VYT A;  1QVF S;  1OU9 A;  5GMK j;  2AZS A;  2DMO A;  3S3O A;  1Q82 U;  1BCO A;  1ZLM A;  1D3B B;  1R0B G;  4N4H A;  4E7I A;  2BTT A;  2DXU A;  1G5V A;  1PWT A;  3SWN C;  3V8K A;  2O9S A;  2E3I A;  1SHG A;  2J6F A;  1IRE B;  1AWO A;  1IGU A;  4PK4 A;  4X34 A;  3QDR B;  2J06 A;  3RKW A;  2Z0W A;  4J9E A;  2QTV A;  1UB4 A;  3OS0 A;  1VQN T;  2M1H A;  5LJ3 h;  3VRY A;  2X3W D;  3A5Z B;  3OBW A;  3OYD A;  2DE0 X;  2EW3 A;  4ELZ C;  4DBF A;  2RHY A;  1YIJ A;  1KC8 U;  1KHI A;  3LX7 A;  5GAO p;  2QA4 T;  3MEA A;  3UPU A;  2O2O A;  1QVG S;  1UFF A;  4JRQ A;  2QG9 B;  1G3W A;  1JQQ A;  2DXB A;  2EGE A;  3M59 A;  1VQ9 T;  3REA B;  5KH6 A;  1JO8 A;  2OAW A;  4M7A C;  4C8Q F;  4A4F A;  1Y57 A;  3OB9 A;  2LVM A;  2DTH A;  4L6V 5;  4XU1 A;  4PLL A;  2FZK B;  2VB6 A;  2QQR A;  4M78 B;  4HVV A;  3JCM W;  2LMJ A;  1U5S A;  4M75 F;  3OS1 A;  4J6X A;  2HZY A;  2CUB A;  2NYS A;  3BY7 A;  2DKG A;  3OYE A;  4DEY A;  4JLG A;  4JRK A;  2ZGW A;  1Q7Y C;  4HVW A;  4HT9 A;  1TXQ A;  2QQA A;  1I07 A;  3JSC A;  3WXM B;  1YJW A;  4ME7 A;  5D6W A;  1NLP C;  2COW A;  4BB7 A;  1PSF A;  2AZV A;  1UJY A;  3V7C A;  5KE3 A;  1YJN Q;  4D6W A;  1W1F A;  4K11 A;  3JCM b;  4LUD A;  3RR6 A;  2AKK A;  4NL2 A;  2XDB A;  2LJ1 A;  2HQX A;  2JNG A;  2RI5 A;  1YIJ T;  1JXO A;  5GAN h;  4MMK A;  5GMK h;  3VUZ A;  4Z8A A;  2E5K A;  1I5O B;  1QCO A;  1SPK A;  2DL5 A;  1YIT T;  1NJI R;  4NOY A;  2H8H A;  5I2S A;  4Y92 A;  3CCU Q;  1RAE B;  2P0K A;  3CPW S;  3PE0 A;  1GXI E;  2QQ9 A;  3CXC S;  1UE9 A;  4FL6 A;  4M75 E;  1SG5 A;  4OVA A;  2GTJ A;  2XI9 A;  2CUD A;  2W10 A;  1M27 C;  3J80 E;  5FU7 C;  4IUU A;  1HJD A;  4M78 A;  2KGT A;  2C0T A;  1VYU A;  4C8Q D;  1VIE A;  1HD3 A;  2EYZ A;  3CD6 T;  3HFO A;  2KRS A;  4KUI A;  1VQ7 Q;  3G4S A;  3IQL A;  2C06 A;  5GAM j;  3E9F A;  1SHF A;  4MML A;  4QQG A;  3E9G A;  1G3S A;  3F70 A;  1QQJ A;  3I56 A;  2DK3 A;  1VQO Q;  4R55 A;  1PKS A;  3O5Z A;  5CAI A;  3G71 Q;  4ZGJ B;  2BZ8 A;  1B3Q A;  1WQ7 A;  2CP7 A;  2M0Y A;  1BI0 A;  1KC8 R;  2RM4 A;  2E10 A;  2KXC A;  3QG1 A;  5LJ5 h; 
#chains in the Genus database with same CATH homology
 1OOT A;  1SRM A;  1GCQ A;  1ZBJ A;  2F2W A;  1NEB A;  4ESR A;  1M8M A;  3EHQ A;  2EGC A;  1W70 A;  1YNZ A;  2ECZ A;  1WDX A;  3RNJ A;  5HCK A;  2RNA A;  4OMP A;  3EG3 A;  2PZ1 A;  2KXD A;  3SEM A;  2CH4 A;  4Z88 A;  4F17 A;  1K0X A;  1H3H A;  2B86 A;  1U3O A;  3EHR A;  1PKT A;  2JS0 A;  3PVL A;  4FSS A;  4DEX A;  1PHT A;  1IO6 A;  2KNB B;  2DL4 A;  2DX1 A;  1JXM A;  5FWB A;  2C0O A;  2KR3 A;  2YDL A;  2JW4 A;  1NLO C;  3H0F A;  2DBM A;  1KSW A;  5IH2 A;  4JZ4 A;  5IHN A;  1RUW A;  1WI7 A;  1UUE A;  1AD5 A;  3M0R A;  1JEG A;  1UHC A;  2K79 A;  1M3A A;  1GBQ A;  3NPF A;  1ABO A;  1KIK A;  2M51 A;  1QWF A;  2LZ6 B;  2ESW A;  4J9G A;  2YUN A;  1TUD A;  1CKA A;  1A0N B;  2SRC A;  1BK2 A;  1X2Q A;  4RTX A;  5ECA A;  1I0C A;  5IXB A;  4AFZ C;  3THK A;  2XMF A;  5IHI A;  4RTZ A;  3VS1 A;  2K2M A;  4R0K A;  1ZX6 A;  3UA6 A;  2YUO A;  4D8D A;  1QCF A;  2LQN A;  1UHF A;  1T0J A;  2YUP A;  1OPL A;  2KE9 A;  1PNJ A;  3M0S A;  4OMO A;  2DBK A;  4JJB A;  1NYF A;  2KT1 A;  1K76 A;  3NGP A;  2ABL A;  2D0N A;  2EQI A;  1W6X A;  2DA9 A;  4OMM A;  4AFQ C;  1BU1 A;  1E6G A;  2CSQ A;  1YWO A;  2AK5 A;  2YUQ A;  2LJ0 A;  1K9A A;  2J6O A;  2HEQ A;  1SRL A;  2HBW A;  2LJ3 A;  4X1V A;  2K3B A;  3VS5 A;  2A08 A;  4EIK A;  2YSQ A;  1AEY A;  1WFW A;  2GTO A;  2LQW A;  4E6R A;  2O88 A;  1BB9 A;  2DL3 A;  1PRL C;  2G6F X;  1FMK A;  2F2V A;  4LN2 A;  2SEM A;  2DIL A;  2ROT A;  3KFV A;  2CH4 W;  3ZL7 C;  4J9C A;  1NG2 A;  4RTT A;  3RBB B;  2CDT A;  2GGR A;  1Z9Z A;  3UAT A;  4HVU A;  2CRE A;  3VS6 A;  4J9H A;  4ORZ A;  4D8K A;  1X69 A;  3NMZ C;  2LCS A;  5EC7 A;  2VKN A;  1J3T A;  5FW9 A;  1VA7 A;  1BBZ A;  4JPB W;  5GJW B;  3UA7 A;  4J9D A;  1RI9 A;  1Y0M A;  2DL7 A;  3H0I A;  2J05 A;  1HSQ A;  2L3P A;  1QKW A;  1X43 A;  1CSK A;  2EYY A;  2KYM A;  3U23 A;  1ARK A;  1WA7 A;  2X3X D;  1UGV A;  2HSP A;  1YP5 A;  1U06 A;  1NYG A;  3I5S A;  3I5R A;  3R6N A;  2DF6 A;  4J9I A;  2KEA A;  2JS2 A;  2EYW A;  2DL8 A;  3VS4 A;  2RPN A;  1TG0 A;  2MCN A;  2EGA A;  3C0C A;  1T3S A;  3EGU A;  2JM9 A;  4RTU A;  1UG1 A;  2FRW A;  2FRY A;  1ZUU A;  4CC3 A;  5I22 A;  2YT6 A;  3A98 A;  3FJ5 A;  4M4Z A;  3QWX X;  3VS3 A;  1WLP B;  1K1Z A;  4JJC A;  2FO0 A;  2L2P A;  2FPE A;  2MOX A;  2L3Q A;  2GQI A;  1AWX A;  1OEB A;  1KJW A;  1V1C A;  1GL5 A;  2RQV A;  2J6K A;  2J7I A;  2JXB A;  2DJQ A;  2CT4 A;  2DNU A;  3I9Q A;  4IIO A;  3I35 A;  1M3B A;  2GBQ A;  2P4R A;  2DRK A;  1X2K A;  1OV3 A;  1YCS B;  2V1Q A;  2EKH A;  2RF0 A;  4A63 B;  1WXB A;  1SSH A;  2PTK A;  1K4U S;  2A36 A;  4GLM A;  1VYT A;  1UDL A;  1AZG B;  1AVZ C;  2AZS A;  2OJ2 A;  1AWW A;  2DMO A;  1PRM C;  2KT8 A;  1M30 A;  1ZUK A;  1MUZ A;  3QWY A;  1ZLM A;  2JTE A;  2I0N A;  3M0Q A;  2RQU A;  2BTT A;  1PWT A;  1LCK A;  4HCK A;  2IIM A;  2EPD A;  2O9S A;  2CT3 A;  4KRT A;  1WXU A;  1SHG A;  4JZ3 A;  2HCK A;  2J6F A;  1AWO A;  2HDA A;  4J9F A;  4RUG A;  2K9G A;  1NEG A;  2RN8 A;  2LNH B;  2FEI A;  4CC4 B;  1Z9Q A;  2J06 A;  2OI3 A;  2KRM A;  4WCI A;  1WXT A;  2K6D A;  2CSI A;  4J9E A;  1G83 A;  1XOV A;  2A37 A;  3VRY A;  3JV3 A;  1QKX A;  4QT7 A;  2X3W D;  1WX6 A;  3VRZ A;  5L23 A;  2DE0 X;  1UEC A;  2EYX A;  2EW3 A;  4CC2 A;  1B07 A;  3TSW A;  1WYX A;  1NM7 A;  5FWC A;  3VS2 A;  2O2O A;  2KRO A;  5IHK A;  1GRI A;  1UFF A;  2A28 A;  2O31 A;  2O9V A;  3TSZ A;  2EBP A;  1T0H A;  4IIM A;  1JQQ A;  2EGE A;  1ABQ A;  1T3L A;  2RQW A;  2ROL A;  3REA B;  1JO8 A;  2OAW A;  4F14 A;  1GFC A;  3VS7 A;  1Y57 A;  3GBQ A;  2DVJ A;  2ED0 A;  1AWJ A;  2RQR A;  3H41 A;  3EG0 A;  4RTW A;  2JM8 A;  2FPD A;  2JMA A;  4HVV A;  2L0A A;  2L3S A;  2DM1 A;  4CC7 A;  2LMJ A;  3UF4 A;  1U5S A;  1WIE A;  2FG0 A;  2CUB A;  2ENM A;  1AZE A;  2K7A A;  4LUE A;  4OML A;  4DEY A;  4AFS C;  4AG1 C;  2F2X A;  2V1R A;  1H8K A;  1E7O A;  3LH5 A;  4F16 A;  4HVW A;  5I11 A;  1I07 A;  1RLQ C;  1SEM A;  3SHW A;  4OMQ A;  1TUC A;  2D8H A;  2ED1 A;  4OMN A;  2LP5 A;  1MV3 A;  2JT4 A;  1NLP C;  3M0T A;  4J9B A;  2BZX A;  1QWE A;  1CKB A;  1ZUY A;  4HXJ A;  2AZV A;  4LE9 A;  2AKL A;  1UJY A;  3M0U A;  3NHN A;  3H0H A;  1W1F A;  1X6B A;  2GNC A;  1UTI A;  4K11 A;  1VYV A;  2DRM A;  4ZNX A;  4RTV A;  2D8J A;  4LUD A;  1X6G A;  3M0P A;  2AKK A;  1G2B A;  2LJ1 A;  1JXO A;  1E6H A;  3EG2 A;  2RQT A;  3ULR B;  2VWF A;  4JJD A;  1H92 A;  4Z8A A;  1GCQ C;  2E5K A;  2NUZ A;  1AOJ A;  1I1J A;  2W0Z A;  1X27 A;  1S1N A;  1SPK A;  1RLP C;  2DL5 A;  2LX7 A;  2KRN A;  2H8H A;  4Y92 A;  3PVQ A;  2KYB A;  3PE0 A;  1UE9 A;  1OPK A;  1YWP A;  3VS0 A;  2C0I A;  1GCP A;  2GTJ A;  3TVT A;  1UJ0 A;  2CUD A;  1M27 C;  2W10 A;  1JU5 C;  2KBT A;  4AG2 C;  1HJD A;  1YN8 A;  2KGT A;  2BZY A;  2C0T A;  2FPF A;  1VYU A;  1HD3 A;  2EYZ A;  2NWM A;  2MIO A;  3REB B;  2KRS A;  1FYN A;  4RTY A;  3CQT A;  3IQL A;  1ZSG A;  4Z89 A;  2RMO A;  1GBR A;  1SHF A;  2DLP A;  4LNP A;  1GFD A;  1K0S A;  4GBQ A;  1M3C A;  4AFU C;  2QDL A;  2D1X A;  1KFZ A;  1MV0 B;  2PNI A;  1PKS A;  3O5Z A;  1EFN A;  2BZ8 A;  1B3Q A;  3EG1 A;  5GJV B;  2M0Y A;  1QLY A;  2JMC A;  2EVR A;  2KXC A;  1N5Z A;  2DYB A;  2VVK A;  5IXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...