1YWOA

Phospholipase cgamma1 sh3 in complex with a slp-76 motif
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
SAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Structural Basis for Recognition of the T Cell Adaptor Protein SLP-76 by the SH3 Domain of Phospholipase Cgamma1
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase, signaling protein
total genus 12
structure length 55
sequence length 55
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ywoA00
1KIKA 3NPFA 1AWOA 4JJBA 1KJWA 3IQLA 1YNZA 1K0XA 2K9GA 2MIOA 4AG1C 1GCQC 2LJ0A 2FRYA 1AVZC 2LX7A 5L23A 3VS2A 4J9CA 2FPEA 2PTKA 4F17A 2MOXA 2RF0A 2EYZA 4K11A 1JQQA 2CT4A 1Z9QA 4ESRA 4HVVA 3I35A 5I22A 2DYBA 1N5ZA 2DRMA 2F2XA 1UJYA 4RTXA 2BZ8A 1T3SA 1M3AA 1ZSGA 1IO6A 1GFDA 1HD3A 1NM7A 1S1NA 1A0NB 2NUZA 3VS0A 2KT8A 2W0ZA 2DA9A 3H0IA 2CUDA 2K79A 2YUNA 1U06A 2BZXA 2EQIA 4J9IA 1ZBJA 2P4RA 1WI7A 4HCKA 1GRIA 3M0UA 1AEYA 1HSQA 2CSQA 4AFZC 4GLMA 1U5SA 4X1VA 2KEAA 3VRZA 3EG2A 1JXMA 1G83A 2ESWA 1AWJA 5IH2A 1ZX6A 2PZ1A 3NMZC 3TVTA 2FO0A 4CC4B 2CH4A 1UUEA 3EG0A 3SEMA 1K0SA 4OMNA 2CH4W 3TSWA 3M0TA 2EYYA 1JEGA 2CSIA 1T0HA 1K76A 1VYVA 4JZ3A 2K7AA 1UG1A 3THKA 3UA7A 3REAB 4QT7A 4GBQA 4JZ4A 1AZGB 2DL4A 1SPKA 3C0CA 4J9GA 2VKNA 2EGCA 3EG1A 4D8DA 3EHRA 2O9SA 2DL7A 3NGPA 1TG0A 2KGTA 1AWWA 1LCKA 1QWEA 2A28A 1ZUKA 1AWXA 1YWOA 2MCNA 1VA7A 2J06A 5IHNA 2JW4A 4DEXA 2RMOA 3O5ZA 1GL5A 3M0RA 3QWXX 2X3WD 1TUDA 1WYXA 3CQTA 2DNUA 1I1JA 1BB9A 1EFNA 1QWFA 2ECZA 4RTUA 3TSZA 1GCPA 2EKHA 3I9QA 2AKKA 4EIKA 2SEMA 2DF6A 2KE9A 2X3XD 1SEMA 2DLPA 1NYGA 2GNCA 3EHQA 1FMKA 2AKLA 1UHFA 2GTJA 3H0HA 1WIEA 3ZL7C 3QWYA 2D1XA 2LZ6B 4HVWA 1NYFA 2O9VA 1GFCA 1K4US 1E6HA 1PKSA 2DVJA 1NEBA 2DBMA 4IIOA 4LE9A 4LN2A 2AZVA 4LNPA 2EVRA 4CC2A 2B86A 2AZSA 2O88A 4J9FA 1I0CA 2EYWA 1K9AA 2ED0A 1H8KA 1BU1A 4D8KA 1E7OA 1GBQA 1XOVA 2YDLA 4LUDA 1H3HA 2LJ1A 2JS2A 3FJ5A 2V1RA 3SHWA 5IHIA 2F2VA 4IIMA 2DL3A 4JPBW 2DRKA 1X43A 2CT3A 2KBTA 4OMPA 1AZEA 3M0SA 4R0KA 1M30A 1PWTA 2RQUA 1UECA 1CKAA 2D0NA 1BBZA 1YCSB 3VS1A 4CC7A 1SRMA 4J9BA 2V1QA 4Z88A 1CSKA 1M8MA 1MV0B 1KFZA 5EC7A 2CUBA 2J6FA 3VRYA 1PKTA 1AOJA 2M51A 2XMFA 2A08A 4RTVA 1JXOA 3VS6A 2YUPA 3A98A 5GJVB 1VYTA 1RI9A 2QDLA 2EBPA 1UJ0A 2J6OA 1ZUUA 1UHCA 2KRMA 1NEGA 2DBKA 2EW3A 5ECAA 1OEBA 2CDTA 1ARKA 1OV3A 2HEQA 4RTTA 1M27C 2VWFA 2J05A 1H92A 2JMCA 1RLPC 1CKBA 1YN8A 4OMLA 3H0FA 1I07A 1RLQC 4Y92A 2KRSA 3PE0A 3VS4A 1JO8A 2JXBA 1UGVA 1W1FA 2FG0A 1UTIA 3GBQA 4M4ZA 1GBRA 3I5SA 2FRWA 1UE9A 3EGUA 2YSQA 2DX1A 1ZUYA 1V1CA 1WLPB 1ABQA 2F2WA 2EYXA 2KR3A 5FWBA 1QCFA 2ROTA 1Z9ZA 1MUZA 4RTYA 2JM8A 2HSPA 1E6GA 2L3SA 2ENMA 2E5KA 1U3OA 4HVUA 2NWMA 2G6FX 5IXBA 2ABLA 2LNHB 2RQWA 3VS7A 3VS3A 2I0NA 2HBWA 4Z8AA 2EGEA 5I11A 1J3TA 4ORZA 2O31A 1M3CA 1PRMC 2GQIA 4JJDA 2JMAA 5IXFA 1PNJA 1OPKA 4OMOA 4AG2C 4ZNXA 1X27A 4RTZA 5FW9A 1UFFA 4DEYA 1NG2A 1Y57A 3PVLA 2RQTA 1T0JA 3LH5A 1M3BA 2KRNA 2HCKA 2OJ2A 4WCIA 1ZLMA 1PRLC 1W70A 5GJWB 1G2BA 5HCKA 4F16A 4OMQA 1NLPC 3VS5A 2DL5A 2DILA 2VVKA 2IIMA 3EG3A 5FWCA 2GBQA 2KYBA 2HDAA 2GTOA 4J9EA 2D8JA 4AFQC 1QKWA 2J6KA 1YWPA 2ED1A 2K3BA 1B07A 2FEIA 1BK2A 2A37A 3RNJA 2KROA 4RTWA 3NHNA 4E6RA 1X6BA 3ULRB 2LQNA 2O2OA 3I5RA 2BTTA 2KXDA 2CREA 1WA7A 2BZYA 3R6NA 2FPFA 1RUWA 2RQVA 1WFWA 1SHGA 1WXUA 2DE0X 2KT1A 2PNIA 2KNBB 4RUGA 2RQRA 1QLYA 2LMJA 4LUEA 1QKXA 1OPLA 1WDXA 3M0PA 2D8HA 1W6XA 4OMMA 2L3PA 3M0QA 2DL8A 1JU5C 2EPDA 2L0AA 1PHTA 2YUQA 3REBB 2W10A 3RBBB 1HJDA 1Y0MA 2ROLA 2DJQA 1GCQA 2KYMA 4HXJA 4CC3A 1X2KA 1WX6A 1T3LA 3PVQA 2RPNA 3JV3A 2JS0A 1WXTA 3UF4A 2JT4A 4JJCA 3UATA 1UDLA 2DMOA 2A36A 2M0YA 2AK5A 2DM1A 2OAWA 2FPDA 1K1ZA 2JTEA 1YP5A 2OI3A 4A63B 4J9HA 2C0IA 2LJ3A 3KFVA 4AFUC 1OOTA 2C0OA 1MV3A 4FSSA 1ABOA 2C0TA 4J9DA 1X69A 2YUOA 2H8HA 4KRTA 2RN8A 2GGRA 1X2QA 1WXBA 3U23A 2L2PA 3H41A 1SRLA 2KXCA 2J7IA 2EGAA 2LP5A 3UA6A 4F14A 1X6GA 2RNAA 1VYUA 2SRCA 1AD5A 1SSHA 2K6DA 2YT6A 2LCSA 2LQWA 5IHKA 1KSWA 1SHFA 2K2MA 4Z89A 2L3QA 1B3QA 4AFSC 1FYNA 2JM9A 1TUCA 1NLOC
chains in the Genus database with same CATH superfamily
1VQMQ 1KJWA 3CCMT 1NJIU 4A4KA 1M9SA 1K0XA 2K9GA 2MIOA 1GCQC 3VV0A 1OULA 2LJ0A 2FZCB 5L23A 2B8AA 1I4K1 2P0KA 4ANJA 4K11A 4M7DB 2CT4A 4E7KA 3S3NA 1M1KR 1RL2A 2RB6A 4ESRA 2PUKB 4HVVA 1N5ZA 1QVFA 4JJNK 3Q1JA 3LH0A 3E2UA 2V8KA 1M3AA 1WHJA 3TEEA 1ZSGA 1U8RA 2X9HA 1HD3A 2QK0A 3BDUA 1S1NA 5GAOr 1A0NB 3VS0A 4KUIA 1O75A 2DA9A 3H0IA 2BZXA 9ATCB 1G8XA 4J9IA 3EAEA 2QEXT 2OTJQ 2YWWA 3C4SA 1R77A 4BI3A 1SKUB 3OYYA 4PFZA 4IUQA 4GLMA 1YI2A 2A3LA 4M7DF 3N5BB 4M78G 1QVFS 1G83A 1K73U 3CC7Q 4E7LA 2ESWA 1AWJA 5IH2A 1ZX6A 4II1A 2KVQG 3OYJA 2QQ9A 4XAXB 2H3EB 2FO0A 3GF5A 4CC4B 2CH4A 1UUEA 1K0SA 4XU0A 2CH4W 3UDCA 3M0TA 2GFUA 4FYWB 2D6FA 2VGMA 4JZ3A 3EGXA 2CP6A 2X4YA 3UA7A 4PFPA 2HKQB 4QT7A 4X34A 3I56A 2FL7A 1IZ6A 2DAQA 2E12A 1AZGB 4HCBA 5GMKh 1S72Q 3CD6A 1XNIA 4FL6A 1VQ6T 4D8DA 3RKXA 2LQ8A 1KQSA 3NGPA 1OI1A 2JTFA 1AWWA 3G4ST 1LCKA 1D0YA 1Q86U 4J7IA 2MCNA 4J5YA 3E9FA 4FT2A 3L2ZA 5IHNA 3M58A 1VQ7T 3O5ZA 2X3WD 1WYXA 1WHLA 3OYNA 1YJ9A 1I1JA 2PU9B 4M77C 2JN0A 1IHWA 1N27A 3M54A 4ZGDB 2X35A 1ZSZA 1D3BA 3G71T 1RACB 1SEMA 2DLPA 3CC4Q 2GNCA 5CKBA 3MJXA 3HPWA 2LRQA 1KQSS 3HTRA 2ZPHB 5FRNA 2LZ6B 1K4US 2O9VA 1E6HA 1RADB 5FRMA 1G3SA 2LQKA 2DJZA 1NEBA 5CCAA 5KYUA 2DIQA 4LD6A 3VUZA 5GAN4 1O9SA 3CXCA 4MZMA 4IIOA 3OS5A 4LNPA 2EVRA 2O88A 4J9FA 3VU3C 2ED0A 2K57A 1H8KA 1BU1A 2M16A 3X26B 4N0AC 2LJ1A 3G1JA 2VB6A 2YLCA 3V8LA 1K8AU 2C06A 2L8DA 4IIMA 1NZ9A 3MEUA 1VUBA 1U1SA 5FU7C 1NPRA 4XK8E 2CT3A 4M77F 1M90C 1Q81R 1AZEA 1KD1R 3M0SA 3QZ9B 2EQMA 4M78B 2BKDN 4BE1A 1UGPB 1BIAA 1VQ8A 4CC7A 2YRCA 2DXCA 4XTZA 3G6EA 2V1QA 4Z88A 4J6YA 1CSKA 2EAYA 5GAMj 1W2BA 1HXDA 1VQKQ 3OYBA 2F1LA 1YI2T 2M51A 3JCMX 4OB3B 2PVDB 1JXOA 2ZPGB 3QG1A 3RDVA 4WTOB 3QBYA 3ASKA 1H3ZA 4FYYB 2J6OA 3URGA 1ZUUA 2KRMA 1V76A 1OEBA 1OV3A 1M27C 2RJCA 1LNXA 4C92C 1H92A 4C0DC 2JMCA 2E4HA 1CKBA 5CVIA 4OMLA 3H0FA 4EMKC 5GAMg 2CP2A 4E2FB 1VQKT 4PKCC 4LDXA 1TWBA 1HYOA 1UGVA 2JXBA 2HL3A 3GNFB 5EG2A 3I56T 3CCUQ 1YIJQ 1YITA 2PUOB 4VUBA 1V1CA 1WLPB 2F2WA 4M75G 1XQHA 2QG9B 2ROTA 1MUZA 3LGLA 4O6JA 2JM8A 3CPWS 2HQHA 1IB8A 4Y28E 3CCRA 4PL6A 3LYIA 2KY9A 1E6GA 4X9DA 2E5KA 4JLGA 3RMQA 4PLIA 2ABLA 3OQ5A 3PNWC 3VS7A 3VS3A 3LW5E 1VQNQ 4Z8AA 3MP1A 3JCMe 2O31A 2OTLA 3V7RA 1JJ2S 1YFNA 4DOWA 2DXTA 2RA2A 3MPUB 4C92F 4N4IA 3WXMB 3GIBA 5J39A 3VYGA 1IRXA 1OU8A 4JS4A 1N9SA 2WACA 4ZNXA 3PVLA 4OGCA 3JCMJ 1T0JA 5KE3A 1VQ9A 2BIVA 2HCKA 2K5LA 3DKMA 3EFOB 1QW1A 5GJWB 3CPFA 4NS5A 3CCLQ 2DD5A 2DTIA 2R5MA 1VQPA 5FWCA 3L2RA 2EQJA 2HDAA 4QQDA 5KYYB 3CCSQ 5AYFA 3PMTA 1B34B 2XDDA 1YWPA 6AT1B 1OQKA 4C8QE 1RAHB 2RD1A 2NUPA 5D6WA 3OB9A 1PD0A 5GAMe 2O2OA 3OYGA 1Q7YC 4KH1B 2KXDA 1C0MA 1KQ1A 2M0OA 2BZYA 2E65A 3CCLT 5GANd 3JCMW 3META 1SHGA 5DLOA 4GLKA 4E7ZA 3G6ET 3CMEQ 2RQRA 2WSCE 1QKXA 1OPLA 2P84A 1Q95G 5LJ3e 5GAOq 3ZBDA 2D8HA 4OMMA 3HSBA 1QVFP 2L3PA 4F7UB 1PSEA 1WQWA 1PHTA 3REBB 1EX4A 4PJOG 1GCQA 1ZSZB 1D3BB 2QTXA 1K9MC 4Y91A 3PVQA 4M75B 1WXTA 3UF4A 3LLRA 1UDLA 2DMOA 3QZ5B 4JLIA 1Q81U 4A4GA 2FPDA 2JTEA 2EQKA 4J9HA 1R0BG 5CAIA 3OMGA 3KFVA 4JRIA 4F7UF 3JB9H 3ZEHA 4FSSA 1ABOA 4J9DA 3CCVA 2YUOA 2E6ZA 3S3MA 2FZKB 2RHYA 2KXCA 3CCRT 2DIGA 2J7IA 3QDFA 2LP5A 4M75F 2NUTB 5IAYA 3CCMA 2RM4A 1X6GA 3CEYA 3OA6A 2RNAA 5IT9E 2K6DA 2VYTA 2CGHA 1MGQA 4M7DE 2LQWA 2XIDA 1IXDA 1U1TA 4QVDA 2HD0A 1LOJA 4Z89A 4AFSC 2OTLT 1KIKA 3NPFA 3CMAQ 1AWOA 4JJBA 3CCJQ 1KC8C 1G3WA 1KQSP 4AG1C 2X4XA 3JAME 3LGFA 2DEQA 5L8RE 2JUFA 3RR6A 1AVZC 2HNIA 1V29B 4F17A 2EFIA 3OY9A 1Z9QA 2XKOC 3CCEQ 2DYBA 1TS9A 3OYMA 4RTXA 2BZ8A 1T3SA 1KK7A 1NM7A 2E6NA 2NUZA 1VQPT 4BACA 2W0ZA 3UPUA 1WJRA 2K79A 1WHKA 4C8QC 2EQIA 3GNGA 4PLLA 1WI7A 3DLLA 2HBPA 1BCOA 5LJ5d 4BUGA 2DO3A 4LDUA 2VXEA 5FLXE 4AFZC 3SWNC 2DETA 2Y4XA 2KEAA 4DOVA 3CXCP 3M53A 4RG2A 4M77A 1JXMA 1GXIE 1BKBA 3PIPA 5FU6B 4PJOB 1WGSA 4KGXB 4GY5A 5GAMh 2QQAA 2YXYA 2ZPIB 2KK4A 3EG0A 1Y96A 2MMPA 3M59A 3JB9D 5KYXA 4OMNA 4RG8A 5GAOp 5KCHA 1UGRB 3OS2A 1VQ6A 5LJ3f 1UEBA 4IKFA 4C8QD 2K7AA 3BE3A 4HCCA 2EQUA 3NTKA 1W4SA 3THKA 3G4SA 3OYEA 4XTWA 1UGSB 2DL4A 3C12A 1FXXA 1SPKA 2EIFA 3OBWA 3EG1A 1OZ2A 1I5OB 1PSFA 2O9SA 1VQ7A 2DL7A 3EGDB 4N0AA 2GF7A 1QWEA 1ZUKA 1W2BP 1IREB 2QA4Q 1YWOA 3S3OA 4A53A 1S72A 1OX9A 2XICA 3QIIA 2KAFA 2LX9A 4M77E 2KQWA 2RMOA 1GL5A 3M0RA 3AT1B 4ATOA 1TUDA 1JRIA 3CQTA 4Z02A 4IUPA 3OYAA 2LVMA 4RTUA 3TSZA 1YJWQ 3RESA 5CQXA 2DVEA 2CZ6B 1RABB 2DF6A 3QXEB 4EDUA 1NYGA 4ELYC 2QQRA 1FMKA 2BE9B 1KG1A 4M7DC 3H0HA 1WIEA 4M7AB 3MEVA 3OW2S 3QWYA 2D1XA 4PFOA 1GFCA 3CC4A 2DBMA 2E3IA 3OYFA 3V7SA 1C1AA 3UWNA 1YJWT 3EG9B 4J7FA 2B86A 4OMFB 3RUXA 4MDWA 3JRZA 4B6MA 1I0CA 1NJIC 4R55A 2L5QA 4BI4A 4EMKA 1GBQA 2YDLA 1VQMT 4OVAA 3PFSA 2JS2A 2V1RA 5DLQE 4V2SA 4JUVA 4JPBW 2DRKA 2JOYA 2P0PA 4M7AF 4JS5A 2DYIA 4R0KA 4M7DD 1KHCA 3TCJA 1IGUA 3X20B 2XK0A 1CKAA 2MI6A 2YHTA 5DM7R 1YCSB 5GAN7 1HK9A 4HKEA 4EMHA 2Y90A 1LPLA 4J9BA 5LJ5f 3DB4A 2R5AA 5HY6A 4FU6A 5EC7A 2CP3A 3EFSA 4XTYA 4IUTA 2O4XB 2XDBA 2NYSA 3TU4K 3CCQQ 1NBEB 1Y7XA 1RI9A 2QDLA 2RI5A 4RCBA 2EBPA 2OTJT 4C92E 2XG8D 2X51A 4PJLA 2DBKA 1VQKA 2CDTA 3QUIA 4RTTA 2VUBA 2DXBA 3CC7T 2MWPA 3G7ZA 2R58A 4FT4A 4L5GA 2PVOB 2FZGB 3VS4A 3PMIA 3MP6A 1UTIA 3JCMP 2YRDA 3CCQT 2EJ9A 3EGUA 3CC2Q 2DX1A 1ABQA 1VIEA 5FWBA 4KGZB 1QCFA 3OYIA 4RTYA 1VQ4Q 4OB1B 3CCUA 1I8FA 1YIJA 3H9NA 2FYKA 2OAUA 4OB0B 4DBRA 1Q7YR 1AHJB 4ME7A 5KYWA 1S72T 1ZA2B 4HVUA 1Q86C 2DZCA 3OYLA 2RQWA 2EGEA 3JCMb 2F5TX 1PRMC 5KCOA 2RK1A 4JJDA 1G3TA 4EPCA 4J6WA 2JMAA 5IXFA 2JNGA 2IPOB 3RERA 1OPKA 1MHNA 2QGGA 4AG2C 1VQ4T 3JSCA 1X27A 4A54A 4IURA 2VGNA 4RTZA 3VJPA 1LJOA 2LTOA 2RQTA 1M2VA 1R0CB 3WVDB 2DXUA 3I55Q 1M3BA 1K9MR 4WCIA 3CC4T 4M78C 1PRLC 4M77D 2P0QA 4C5EA 2QYZA 1NLPC 2DL5A 2HQEA 2IIMA 4RKUE 3JCMg 1D1AA 3EG3A 2A7YA 2F69A 4TVRA 3T9NA 5GAOl 1QKWA 3SFMA 2RJDA 2CP0A 3CCLA 4PJJA 2F5KA 2DZ9A 1K8AC 4RMOA 4F7UE 3ULRB 2ZCFB 2X4WA 1QVGS 2BTTA 3AHUA 4KULA 3OS0A 1YJNQ 3R6NA 1RUWA 4OB2B 4M75E 1VQOQ 5A0LA 4LUEA 4HT8A 1WDXA 4N4HA 3CPWA 3M0PA 4M78F 1KC8R 5LJ3j 2DL8A 2AT1B 1JU5C 2L0AA 1M1KU 5I2MA 2YUQA 3CMEA 3TQ7P 3JCMV 3M55A 3RBBB 3RKYA 1Y0MA 1IGQA 2KI7A 1M2OA 3MP8A 4CC3A 1M8VA 4DA4A 2DPPB 3CD6Q 3X28B 1JJ2A 4JRKA 1OYXA 2V26A 2CKKA 4JJCA 1VQOT 1ZQ1A 5CKEA 1UB4A 2AK5A 2CS7A 1Q82R 2IG0A 5LJ3g 2XHCA 3MEAA 2C0IA 5GAOn 4AFUC 3VYHB 4JRPA 1YJ9Q 3L2UA 1X69A 2H8HA 4C8QA 1FX7A 3PIOA 4C92D 2RN8A 2GGRA 3RIRA 1D0XA 1WXBA 3U23A 2L2PA 3CCUT 1YIJT 3S6WA 2RJEA 3UA6A 1AD5A 1SSHA 3RKWA 2LCSA 5A2QE 1SHFA 2K2MA 4ZGEB 2JM9A 1NLOC 3KBGA 2RI3A 1MNEA 5GMKl 1BIBA 3FLGA 1YNZA 2JTMA 3H8ZA 3HRUA 3OYHA 1VQNT 4QVCA 4J9CA 2FPEA 3FJPA 4BDYA 4A4FA 3CCJA 2RF0A 4C5GA 3I35A 5D7UA 3CBOA 1X6OA 2L89A 4FW2A 2EYQA 1IO6A 3EGXB 1B7TA 3UT1A 2M1HA 4PJOE 2KT8A 1FWZA 4QQ6A 1N8RC 2RJFA 2CUDA 3BDLA 4BE2A 2HZYA 2P4RA 5LJ5j 2XI9A 4HCKA 1TTHB 4AMCA 1GRIA 2LCCA 2ZZDA 1BI2A 1AEYA 2EWNA 1HSQA 1WHHA 1SSFA 2CSQA 3A8GB 2KMTA 3CCST 2BE7D 3EG2A 3L2QA 1ZSZC 1MMDA 2PZ1A 3TVTA 3X25B 2FVUA 4M75C 4CI0C 1H641 5GAMd 5J3BA 1TUGB 4BI8B 4M7DA 3SEMA 3A8MB 1RI0A 4C0FA 1K9MU 5LJ5g 3JB9G 2YRVA 2EYYA 1T0HA 1K76A 1VYVA 1UG1A 3REAB 1TU0B 3CMET 4GBQA 4JZ4A 5GMKj 4C8QG 2K5FA 2MF2A 3ME9A 1KD1U 4QQGA 3KUFA 4J9GA 2EGCA 2L3RA 5KYUB 1UGQB 1RAIB 3LX7A 4N4GA 3CBPA 3ER0A 2KGTA 5KYNA 3MKDA 2A28A 2M9UA 2ZPBB 2LNVA 2K2VA 1NPPA 3M56A 1VA7A 4M7AE 2J06A 3HHTB 4AT1B 4PJMA 4A4HA 1Q81C 5M9OA 5DY9A 4X9CA 2DNUA 4B9XA 5HK3A 2E5QA 2QA4A 1QWFA 4WF2A 5CK9A 2EKHA 3I9QA 4EIKA 1Y71A 5CR2A 2KE9A 4UC4A 3HKSA 2DEUA 2MAMA 4PJNA 5GAN8 1UHFA 5I2SA 2EKOA 2GTJA 1YJWA 3ZL7C 1OX8A 4JRQA 3A1PA 2VV5A 4KUDK 1PKSA 1ZHIA 3JCMh 4XTXA 2LT1A 2DVJA 4J8OA 1VQMA 4FIBA 4PK4A 3OSSC 2E1HA 2HQXA 4FYVB 2CYZB 1FMVA 1EIFA 2RH2A 2RHXA 4MMLA 2FHDA 4D8KA 1SG5A 4LUDA 1Q82U 2DTHA 1H3HA 3NTIA 3FJ5A 3CMAT 2HMAA 3CCJT 1DJ7B 2HSEB 2F2VA 5GMKi 1R8OB 3A8HB 1X75C 4C5HA 5LJ5e 1RAGB 4OMPA 5FU6C 4PJOC 1PWTA 1VQLQ 2CZ7B 5GAOm 2DERA 4M7DG 1BBZA 3VS1A 3CCET 1SRMA 3OMCA 5GANf 2OTJA 1MMNA 5J26A 1P92A 1M8MA 1MV0B 3LWIA 3VRYA 4E7JA 1AOJA 2XMFA 3NFCA 2A08A 3GP8A 3VS6A 2YUPA 5GJVB 3QHSA 3CC7A 3NTHA 4LD9K 1VQLT 1UHCA 4XTVA 4A4EA 2EW3A 4XU3A 5ECAA 4F04B 3HRSA 4E7IA 1ARKA 3MO8A 4LXCA 2HEQA 5GMKe 4MZTA 5LJ3h 2VWFA 3CCQA 2XU8A 3ZFJA 1YHQQ 1YN8A 1BCMA 5CO7A 5I21A 1RLQC 4Y92A 2KRSA 3PE0A 3QDRB 4M78A 1JO8A 4PJOF 3OBYA 2FG0A 2KSSA 3M9QA 3OW2A 1M90R 3JB9F 2FRWA 3EH2A 4ZN3A 1ZUYA 2EYXA 2ZPFB 1Z9ZA 2QDYB 2K3XA 4LDYA 3HP9A 3PT9A 3CPWP 4M7AC 3J80E 2L3SA 1U3OA 2NWMA 5IXBA 1F1BB 2LT4A 2LNHB 1VQ4A 2NUPB 2I0NA 2HBWA 4ORZA 3P8HA 2QA4T 1M3CA 2KDSA 2LDMA 1MMAA 5CQYA 5CKFA 2GQIA 3LWHA 1JJ2P 3FB9A 2HAXA 3C94A 2ZGWA 1PNJA 3M5AA 2RHIA 3VUBA 4M78E 1UFFA 4BY6B 4C92A 5GMKm 4R56A 2OJ2A 4M7AD 5HCKA 2QEXQ 2MYSA 1X01A 2RI2A 2IVWA 3VS5A 2CZ1B 4M77G 2VVKA 1VQ5Q 2CP7A 3V8JA 3I55A 2GBQA 2AIRB 3QO3A 2GTOA 4J9EA 4AFQC 3L42A 3TREA 4NOYA 4HT9A 2FEIA 2PVGB 1BK2A 1YCYA 2A37A 3RNJA 2KROA 1BI0A 4LDVA 3NHNA 3E19A 4BD3A 4E6RA 1X6BA 1QP2A 3I5RA 3J7AF 1D1BA 5LJ5h 2FPFA 2RQVA 1WFWA 1VQ5T 1M1GA 2JVVA 5KH6A 2DE0X 2KT1A 3BY7A 4RUGA 2ATCB 2LMJA 1VIFA 5C0MA 3EFOA 1YJNA 1W6XA 1K73C 1VQ6Q 3M0QA 4ZTJA 2EPDA 2K4YA 1I5LA 1IHVA 1KHIA 1WPYA 1VQOA 3G4SQ 1OZ3A 1HJDA 3PTAA 2ROLA 2KYMA 5KYYA 4HXJA 1X2KA 4D6WA 1B34A 1WX6A 1T3LA 7AT1B 4B9WA 2CP5A 2OX7A 3OSVA 1VQ7Q 3X24B 2JS0A 4QVZA 2JT4A 3UATA 3GPLA 1VOMA 2M0YA 2OAWA 3G71Q 3FEOA 1PG5B 4XU1A 1YP5A 4A63B 1N8RR 2LJ3A 1MV3A 3F70A 2C0TA 3HRTA 5IN1A 3L1AA 1QVPA 4E7SA 2RHZA 1X2QA 3H41A 4F7UA 4XU2A 4C92G 1MNDA 3QPHA 3CC2T 1G5VA 2DKGA 1ZBXA 2RHUA 4P5NA 5IHKA 2VC8A 1KSWA 1M4ZA 4ZN1A 2V8JA 1VQNA 1B3QA 1QCOA 2P4TA 1FYNA 1TUCA 4M75A 4FW1A 3IQLA 3A8LB 4M77B 1QVGA 5HK0A 2LC4A 3EH1A 2FRYA 2LX7A 3VS2A 1D1CA 2PTKA 2MOXA 3HL8A 4EMGA 2EYZA 1JQQA 1Y96B 1M90U 5CKDA 5KYXB 3OYCA 5I22A 2Z0WA 2DRMA 2F2XA 1UJYA 3A8OB 4BE0A 2QQBA 1LVKA 1GFDA 2JJ9A 8ATCB 5GAN2 5GAN5 3I55T 1YI2Q 2NUTA 4ZTFA 5D6XA 3CCSA 4XTUA 2YUNA 1U06A 1YBYA 1ZBJA 5GANj 3M0UA 4J6XA 4FSXA 4M78D 1WHMA 3CXCS 1U5SA 4X1VA 5FU7B 1KQ2A 3VRZA 3M4YA 3VKIA 1RAAB 1SF9A 1OU9A 3NMZC 1QCNA 2RK2A 5KE2A 3I56Q 1ZA1B 3TSWA 1G3YA 2X4JA 1TOVA 1EZZB 5GANg 1YJNT 1JEGA 2CSIA 3JB9J 2K5IA 2A0FB 2ZPEB 1M1FA 1WJQA 1ACMB 4C0GA 3L2VA 2CZ0B 1M1KC 3C0CA 2VKNA 1RAFB 3KXTA 1WQ7A 3EHRA 4OP0A 3A5ZB 4F7UG 1C6VX 3BFMA 1TG0A 1AT1B 3C95A 4DBFA 1W2BS 4E7HA 1RAEB 1Y07A 2QXFA 1XJWB 1AWXA 4C92B 4NL2A 4C0DB 1TH7A 4ZGJB 4EMKB 3CD6T 4DBQA 4PJOA 3JCMc 4MDXA 2JW4A 2D9TA 3P8BB 4RCCA 4DEXA 3QWXX 3CBMA 3SWNA 1BB9A 1EFNA 2ECZA 1GCPA 2AKKA 2HL5C 4Q5WA 1WNLA 2SEMA 2X3XD 2QQSA 3GOXA 3EHQA 4PNOA 2AKLA 4FM4B 5A0GA 2VXFA 2E41A 4E47A 1YJ9T 3OW2P 4HVWA 1NYFA 2COYA 3JCMd 2PQWA 3FRNA 3RMSA 3EFRA 3CMAA 3EGDA 4LE9A 4LN2A 4LDWA 2AZVA 1QQJA 4XQ3A 4CC2A 2AZSA 2DFUA 2EYWA 1K9AA 1QMCA 5GAN6 2V8IA 1E7OA 1XOVA 3P8DA 3PGGA 2ZAEA 3SHWA 5IHIA 3MCAB 1PCXA 3QJYA 3DLMA 1N8RU 3CCEA 1VQ8Q 2DL3A 1Q7YU 1X43A 3O8VA 5GANe 2KBTA 3G6EQ 1M30A 2RQUA 1D0ZA 2MK5A 2QTVA 1UECA 2D0NA 4MZPA 4NL3A 4M7AA 2D0QB 1WJSA 1VQLA 1KFZA 2CUBA 3OS1A 4MMKA 2J6FA 2GQVA 4OGEA 1PKTA 4QW2A 1PC0A 4RTVA 1VQ8T 2XDPA 3EG9A 4JDSA 3JB9I 5KYWB 3A98A 1VYTA 3HFNA 3QYGB 4FCYA 3WVEB 4KT0E 1UJ0A 2GFAA 4C5IA 2WSFE 5AT1B 3INZA 1NEGA 4L59A 4DBHA 3DB3A 1NJIR 2YLBA 5LJ3d 2J05A 1YITQ 2BUDA 5LL6S 1RLPC 2K3YA 4KGVB 4KH0B 3OYDA 1N9RA 1I07A 3MHXA 1W1FA 3OYKA 1WHGA 3GBQA 4M4ZA 1GBRA 3I5SA 1M2VB 5D6YA 3CCRQ 1UE9A 2O01E 1YHQA 2YSQA 4M75D 8AT1B 3QKJA 2KR3A 2FB7A 1KD1C 1JB0E 3FC3A 5FROA 1PM3A 2HSPA 1JBMA 2O4XA 1YITT 2OTLQ 2ENMA 2G6FX 1TXQA 1KC8U 5I11A 1J3TA 5C6SA 5HKCA 2E3HA 3E9GA 1VQ9Q 1K73R 4OMOA 3QJ6A 2RO0A 5FW9A 2E64A 4DEYA 1NG2A 1Y57A 3LH5A 3JCMf 4O5VA 1N6AA 2AHJB 2HKNA 1VQPQ 2KRNA 3M57A 4HA8A 4OF1A 1ZLMA 2JZ2A 1W70A 3H6ZA 1G2BA 3SB2A 3L2WA 1I81A 4F16A 2MWOA 4OMQA 2Y4YA 1M5Q1 2DILA 4M7AG 2MPXC 4J83A 4CRIA 5GAN3 2COZA 2KYBA 1VQ9T 4QKUA 1XTDA 2D8JA 3D7SB 3JCMQ 2J6KA 1BI3A 2QI2A 2ED1A 2QEXA 2K3BA 1B07A 2VASA 1VQ5A 1Q82C 4IUVA 1Q86R 4RTWA 3E1SA 3FDRA 4KBMB 3V7CA 2LQNA 2E70A 4C0ZA 2CREA 1QVGP 1WA7A 2H3JA 3HFOA 3MEWA 1NE8A 4FYXB 5GANh 3SD4A 4ELZC 1MMGA 1WXUA 3FIFA 2PNIA 3R6OA 1QP3A 2KNBB 2QASA 2XD0A 1QLYA 2EJGA 4C8QB 3BW1A 5GAMf 1D09B 2EJFA 3M4GA 1FMWA 1WZOA 4PJOD 3SWNB 3QSUA 2W10A 1BYMA 2DJQA 2LCLA 2RPNA 2M02A 1PD1A 3QYHB 3JV3A 3V8KA 2E10A 3SDZA 4BB7A 3CCVQ 2A36A 5CIUA 2DM1A 2NLUA 4C8QF 1K1ZA 1K8AR 2OI3A 2QGFB 4IUUA 3GLXA 1YHQT 3CC2A 2DD4A 1OOTA 2C0OA 4BDZA 3CCMQ 2I2LA 3J81E 4KRTA 3G71A 2G3RA 1SRLA 2R57A 4L6V5 2EGAA 4BY6C 4F14A 1TSFA 1VYUA 2SRCA 4HCZA 2YT6A 5A0DA 4YTLA 3CCVT 2QAZA 2DK3A 2DTOA 5CKHA 4DQ2A 2L3QA 1BI1A 2WSEE 2COWA 2GCXA
chains in the Genus database with same CATH topology
1KIKA 3NPFA 1AWOA 4JJBA 1KJWA 3IQLA 1YNZA 1K0XA 2K9GA 2MIOA 4AG1C 1GCQC 2LJ0A 2FRYA 1AVZC 2LX7A 5L23A 3VS2A 4J9CA 2FPEA 2PTKA 4F17A 2MOXA 2RF0A 2EYZA 4K11A 1JQQA 2CT4A 1Z9QA 4ESRA 4HVVA 3I35A 5I22A 2DYBA 1N5ZA 2DRMA 2F2XA 1UJYA 4RTXA 2BZ8A 1T3SA 1M3AA 1ZSGA 1IO6A 1GFDA 1HD3A 1NM7A 1S1NA 1A0NB 2NUZA 3VS0A 2KT8A 2W0ZA 2DA9A 3H0IA 2CUDA 2K79A 2YUNA 1U06A 2BZXA 2EQIA 4J9IA 1ZBJA 2P4RA 1WI7A 4HCKA 1GRIA 3M0UA 1AEYA 1HSQA 2CSQA 4AFZC 4GLMA 1U5SA 4X1VA 2KEAA 3VRZA 3EG2A 1JXMA 1G83A 2ESWA 1AWJA 5IH2A 1ZX6A 2PZ1A 3NMZC 3TVTA 2FO0A 4CC4B 2CH4A 1UUEA 3EG0A 3SEMA 1K0SA 4OMNA 2CH4W 3TSWA 3M0TA 2EYYA 1JEGA 2CSIA 1T0HA 1K76A 1VYVA 4JZ3A 2K7AA 1UG1A 3THKA 3UA7A 3REAB 4QT7A 4GBQA 4JZ4A 1AZGB 2DL4A 1SPKA 3C0CA 4J9GA 2VKNA 2EGCA 3EG1A 4D8DA 3EHRA 2O9SA 2DL7A 3NGPA 1TG0A 2KGTA 1AWWA 1LCKA 1QWEA 2A28A 1ZUKA 1AWXA 1YWOA 2MCNA 1VA7A 2J06A 5IHNA 2JW4A 4DEXA 2RMOA 3O5ZA 1GL5A 3M0RA 3QWXX 2X3WD 1TUDA 1WYXA 3CQTA 2DNUA 1I1JA 1BB9A 1EFNA 1QWFA 2ECZA 4RTUA 3TSZA 1GCPA 2EKHA 3I9QA 2AKKA 4EIKA 2SEMA 2DF6A 2KE9A 2X3XD 1SEMA 2DLPA 1NYGA 2GNCA 3EHQA 1FMKA 2AKLA 1UHFA 2GTJA 3H0HA 1WIEA 3ZL7C 3QWYA 2D1XA 2LZ6B 4HVWA 1NYFA 2O9VA 1GFCA 1K4US 1E6HA 1PKSA 2DVJA 1NEBA 2DBMA 4IIOA 4LE9A 4LN2A 2AZVA 4LNPA 2EVRA 4CC2A 2B86A 2AZSA 2O88A 4J9FA 1I0CA 2EYWA 1K9AA 2ED0A 1H8KA 1BU1A 4D8KA 1E7OA 1GBQA 1XOVA 2YDLA 4LUDA 1H3HA 2LJ1A 2JS2A 3FJ5A 2V1RA 3SHWA 5IHIA 2F2VA 4IIMA 2DL3A 4JPBW 2DRKA 1X43A 2CT3A 2KBTA 4OMPA 1AZEA 3M0SA 4R0KA 1M30A 1PWTA 2RQUA 1UECA 1CKAA 2D0NA 1BBZA 1YCSB 3VS1A 4CC7A 1SRMA 4J9BA 2V1QA 4Z88A 1CSKA 1M8MA 1MV0B 1KFZA 5EC7A 2CUBA 2J6FA 3VRYA 1PKTA 1AOJA 2M51A 2XMFA 2A08A 4RTVA 1JXOA 3VS6A 2YUPA 3A98A 5GJVB 1VYTA 1RI9A 2QDLA 2EBPA 1UJ0A 2J6OA 1ZUUA 1UHCA 2KRMA 1NEGA 2DBKA 2EW3A 5ECAA 1OEBA 2CDTA 1ARKA 1OV3A 2HEQA 4RTTA 1M27C 2VWFA 2J05A 1H92A 2JMCA 1RLPC 1CKBA 1YN8A 4OMLA 3H0FA 1I07A 1RLQC 4Y92A 2KRSA 3PE0A 3VS4A 1JO8A 2JXBA 1UGVA 1W1FA 2FG0A 1UTIA 3GBQA 4M4ZA 1GBRA 3I5SA 2FRWA 1UE9A 3EGUA 2YSQA 2DX1A 1ZUYA 1V1CA 1WLPB 1ABQA 2F2WA 2EYXA 2KR3A 5FWBA 1QCFA 2ROTA 1Z9ZA 1MUZA 4RTYA 2JM8A 2HSPA 1E6GA 2L3SA 2ENMA 2E5KA 1U3OA 4HVUA 2NWMA 2G6FX 5IXBA 2ABLA 2LNHB 2RQWA 3VS7A 3VS3A 2I0NA 2HBWA 4Z8AA 2EGEA 5I11A 1J3TA 4ORZA 2O31A 1M3CA 1PRMC 2GQIA 4JJDA 2JMAA 5IXFA 1PNJA 1OPKA 4OMOA 4AG2C 4ZNXA 1X27A 4RTZA 5FW9A 1UFFA 4DEYA 1NG2A 1Y57A 3PVLA 2RQTA 1T0JA 3LH5A 1M3BA 2KRNA 2HCKA 2OJ2A 4WCIA 1ZLMA 1PRLC 1W70A 5GJWB 1G2BA 5HCKA 4F16A 4OMQA 1NLPC 3VS5A 2DL5A 2DILA 2VVKA 2IIMA 3EG3A 5FWCA 2GBQA 2KYBA 2HDAA 2GTOA 4J9EA 2D8JA 4AFQC 1QKWA 2J6KA 1YWPA 2ED1A 2K3BA 1B07A 2FEIA 1BK2A 2A37A 3RNJA 2KROA 4RTWA 3NHNA 4E6RA 1X6BA 3ULRB 2LQNA 2O2OA 3I5RA 2BTTA 2KXDA 2CREA 1WA7A 2BZYA 3R6NA 2FPFA 1RUWA 2RQVA 1WFWA 1SHGA 1WXUA 2DE0X 2KT1A 2PNIA 2KNBB 4RUGA 2RQRA 1QLYA 2LMJA 4LUEA 1QKXA 1OPLA 1WDXA 3M0PA 2D8HA 1W6XA 4OMMA 2L3PA 3M0QA 2DL8A 1JU5C 2EPDA 2L0AA 1PHTA 2YUQA 3REBB 2W10A 3RBBB 1HJDA 1Y0MA 2ROLA 2DJQA 1GCQA 2KYMA 4HXJA 4CC3A 1X2KA 1WX6A 1T3LA 3PVQA 2RPNA 3JV3A 2JS0A 1WXTA 3UF4A 2JT4A 4JJCA 3UATA 1UDLA 2DMOA 2A36A 2M0YA 2AK5A 2DM1A 2OAWA 2FPDA 1K1ZA 2JTEA 1YP5A 2OI3A 4A63B 4J9HA 2C0IA 2LJ3A 3KFVA 4AFUC 1OOTA 2C0OA 1MV3A 4FSSA 1ABOA 2C0TA 4J9DA 1X69A 2YUOA 2H8HA 4KRTA 2RN8A 2GGRA 1X2QA 1WXBA 3U23A 2L2PA 3H41A 1SRLA 2KXCA 2J7IA 2EGAA 2LP5A 3UA6A 4F14A 1X6GA 2RNAA 1VYUA 2SRCA 1AD5A 1SSHA 2K6DA 2YT6A 2LCSA 2LQWA 5IHKA 1KSWA 1SHFA 2K2MA 4Z89A 2L3QA 1B3QA 4AFSC 1FYNA 2JM9A 1TUCA 1NLOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIK A;  3NPF A;  1AWO A;  4JJB A;  1KJW A;  3IQL A;  1YNZ A;  1K0X A;  2K9G A;  2MIO A;  4AG1 C;  1GCQ C;  2LJ0 A;  2FRY A;  1AVZ C;  2LX7 A;  5L23 A;  3VS2 A;  4J9C A;  2FPE A;  2PTK A;  4F17 A;  2MOX A;  2RF0 A;  2EYZ A;  4K11 A;  1JQQ A;  2CT4 A;  1Z9Q A;  4ESR A;  4HVV A;  3I35 A;  5I22 A;  2DYB A;  1N5Z A;  2DRM A;  2F2X A;  1UJY A;  4RTX A;  2BZ8 A;  1T3S A;  1M3A A;  1ZSG A;  1IO6 A;  1GFD A;  1HD3 A;  1NM7 A;  1S1N A;  1A0N B;  2NUZ A;  3VS0 A;  2KT8 A;  2W0Z A;  2DA9 A;  3H0I A;  2CUD A;  2K79 A;  2YUN A;  1U06 A;  2BZX A;  2EQI A;  4J9I A;  1ZBJ A;  2P4R A;  1WI7 A;  4HCK A;  1GRI A;  3M0U A;  1AEY A;  1HSQ A;  2CSQ A;  4AFZ C;  4GLM A;  1U5S A;  4X1V A;  2KEA A;  3VRZ A;  3EG2 A;  1JXM A;  1G83 A;  2ESW A;  1AWJ A;  5IH2 A;  1ZX6 A;  2PZ1 A;  3NMZ C;  3TVT A;  2FO0 A;  4CC4 B;  2CH4 A;  1UUE A;  3EG0 A;  3SEM A;  1K0S A;  4OMN A;  2CH4 W;  3TSW A;  3M0T A;  2EYY A;  1JEG A;  2CSI A;  1T0H A;  1K76 A;  1VYV A;  4JZ3 A;  2K7A A;  1UG1 A;  3THK A;  3UA7 A;  3REA B;  4QT7 A;  4GBQ A;  4JZ4 A;  1AZG B;  2DL4 A;  1SPK A;  3C0C A;  4J9G A;  2VKN A;  2EGC A;  3EG1 A;  4D8D A;  3EHR A;  2O9S A;  2DL7 A;  3NGP A;  1TG0 A;  2KGT A;  1AWW A;  1LCK A;  1QWE A;  2A28 A;  1ZUK A;  1AWX A;  1YWO A;  2MCN A;  1VA7 A;  2J06 A;  5IHN A;  2JW4 A;  4DEX A;  2RMO A;  3O5Z A;  1GL5 A;  3M0R A;  3QWX X;  2X3W D;  1TUD A;  1WYX A;  3CQT A;  2DNU A;  1I1J A;  1BB9 A;  1EFN A;  1QWF A;  2ECZ A;  4RTU A;  3TSZ A;  1GCP A;  2EKH A;  3I9Q A;  2AKK A;  4EIK A;  2SEM A;  2DF6 A;  2KE9 A;  2X3X D;  1SEM A;  2DLP A;  1NYG A;  2GNC A;  3EHQ A;  1FMK A;  2AKL A;  1UHF A;  2GTJ A;  3H0H A;  1WIE A;  3ZL7 C;  3QWY A;  2D1X A;  2LZ6 B;  4HVW A;  1NYF A;  2O9V A;  1GFC A;  1K4U S;  1E6H A;  1PKS A;  2DVJ A;  1NEB A;  2DBM A;  4IIO A;  4LE9 A;  4LN2 A;  2AZV A;  4LNP A;  2EVR A;  4CC2 A;  2B86 A;  2AZS A;  2O88 A;  4J9F A;  1I0C A;  2EYW A;  1K9A A;  2ED0 A;  1H8K A;  1BU1 A;  4D8K A;  1E7O A;  1GBQ A;  1XOV A;  2YDL A;  4LUD A;  1H3H A;  2LJ1 A;  2JS2 A;  3FJ5 A;  2V1R A;  3SHW A;  5IHI A;  2F2V A;  4IIM A;  2DL3 A;  4JPB W;  2DRK A;  1X43 A;  2CT3 A;  2KBT A;  4OMP A;  1AZE A;  3M0S A;  4R0K A;  1M30 A;  1PWT A;  2RQU A;  1UEC A;  1CKA A;  2D0N A;  1BBZ A;  1YCS B;  3VS1 A;  4CC7 A;  1SRM A;  4J9B A;  2V1Q A;  4Z88 A;  1CSK A;  1M8M A;  1MV0 B;  1KFZ A;  5EC7 A;  2CUB A;  2J6F A;  3VRY A;  1PKT A;  1AOJ A;  2M51 A;  2XMF A;  2A08 A;  4RTV A;  1JXO A;  3VS6 A;  2YUP A;  3A98 A;  5GJV B;  1VYT A;  1RI9 A;  2QDL A;  2EBP A;  1UJ0 A;  2J6O A;  1ZUU A;  1UHC A;  2KRM A;  1NEG A;  2DBK A;  2EW3 A;  5ECA A;  1OEB A;  2CDT A;  1ARK A;  1OV3 A;  2HEQ A;  4RTT A;  1M27 C;  2VWF A;  2J05 A;  1H92 A;  2JMC A;  1RLP C;  1CKB A;  1YN8 A;  4OML A;  3H0F A;  1I07 A;  1RLQ C;  4Y92 A;  2KRS A;  3PE0 A;  3VS4 A;  1JO8 A;  2JXB A;  1UGV A;  1W1F A;  2FG0 A;  1UTI A;  3GBQ A;  4M4Z A;  1GBR A;  3I5S A;  2FRW A;  1UE9 A;  3EGU A;  2YSQ A;  2DX1 A;  1ZUY A;  1V1C A;  1WLP B;  1ABQ A;  2F2W A;  2EYX A;  2KR3 A;  5FWB A;  1QCF A;  2ROT A;  1Z9Z A;  1MUZ A;  4RTY A;  2JM8 A;  2HSP A;  1E6G A;  2L3S A;  2ENM A;  2E5K A;  1U3O A;  4HVU A;  2NWM A;  2G6F X;  5IXB A;  2ABL A;  2LNH B;  2RQW A;  3VS7 A;  3VS3 A;  2I0N A;  2HBW A;  4Z8A A;  2EGE A;  5I11 A;  1J3T A;  4ORZ A;  2O31 A;  1M3C A;  1PRM C;  2GQI A;  4JJD A;  2JMA A;  5IXF A;  1PNJ A;  1OPK A;  4OMO A;  4AG2 C;  4ZNX A;  1X27 A;  4RTZ A;  5FW9 A;  1UFF A;  4DEY A;  1NG2 A;  1Y57 A;  3PVL A;  2RQT A;  1T0J A;  3LH5 A;  1M3B A;  2KRN A;  2HCK A;  2OJ2 A;  4WCI A;  1ZLM A;  1PRL C;  1W70 A;  5GJW B;  1G2B A;  5HCK A;  4F16 A;  4OMQ A;  1NLP C;  3VS5 A;  2DL5 A;  2DIL A;  2VVK A;  2IIM A;  3EG3 A;  5FWC A;  2GBQ A;  2KYB A;  2HDA A;  2GTO A;  4J9E A;  2D8J A;  4AFQ C;  1QKW A;  2J6K A;  1YWP A;  2ED1 A;  2K3B A;  1B07 A;  2FEI A;  1BK2 A;  2A37 A;  3RNJ A;  2KRO A;  4RTW A;  3NHN A;  4E6R A;  1X6B A;  3ULR B;  2LQN A;  2O2O A;  3I5R A;  2BTT A;  2KXD A;  2CRE A;  1WA7 A;  2BZY A;  3R6N A;  2FPF A;  1RUW A;  2RQV A;  1WFW A;  1SHG A;  1WXU A;  2DE0 X;  2KT1 A;  2PNI A;  2KNB B;  4RUG A;  2RQR A;  1QLY A;  2LMJ A;  4LUE A;  1QKX A;  1OPL A;  1WDX A;  3M0P A;  2D8H A;  1W6X A;  4OMM A;  2L3P A;  3M0Q A;  2DL8 A;  1JU5 C;  2EPD A;  2L0A A;  1PHT A;  2YUQ A;  3REB B;  2W10 A;  3RBB B;  1HJD A;  1Y0M A;  2ROL A;  2DJQ A;  1GCQ A;  2KYM A;  4HXJ A;  4CC3 A;  1X2K A;  1WX6 A;  1T3L A;  3PVQ A;  2RPN A;  3JV3 A;  2JS0 A;  1WXT A;  3UF4 A;  2JT4 A;  4JJC A;  3UAT A;  1UDL A;  2DMO A;  2A36 A;  2M0Y A;  2AK5 A;  2DM1 A;  2OAW A;  2FPD A;  1K1Z A;  2JTE A;  1YP5 A;  2OI3 A;  4A63 B;  4J9H A;  2C0I A;  2LJ3 A;  3KFV A;  4AFU C;  1OOT A;  2C0O A;  1MV3 A;  4FSS A;  1ABO A;  2C0T A;  4J9D A;  1X69 A;  2YUO A;  2H8H A;  4KRT A;  2RN8 A;  2GGR A;  1X2Q A;  1WXB A;  3U23 A;  2L2P A;  3H41 A;  1SRL A;  2KXC A;  2J7I A;  2EGA A;  2LP5 A;  3UA6 A;  4F14 A;  1X6G A;  2RNA A;  1VYU A;  2SRC A;  1AD5 A;  1SSH A;  2K6D A;  2YT6 A;  2LCS A;  2LQW A;  5IHK A;  1KSW A;  1SHF A;  2K2M A;  4Z89 A;  2L3Q A;  1B3Q A;  4AFS C;  1FYN A;  2JM9 A;  1TUC A;  1NLO C; 
#chains in the Genus database with same CATH topology
 1VQM Q;  1KJW A;  3CCM T;  1NJI U;  4A4K A;  1M9S A;  1K0X A;  2K9G A;  2MIO A;  1GCQ C;  3VV0 A;  1OUL A;  2LJ0 A;  2FZC B;  5L23 A;  2B8A A;  1I4K 1;  2P0K A;  4ANJ A;  4K11 A;  4M7D B;  2CT4 A;  4E7K A;  3S3N A;  1M1K R;  1RL2 A;  2RB6 A;  4ESR A;  2PUK B;  4HVV A;  1N5Z A;  1QVF A;  4JJN K;  3Q1J A;  3LH0 A;  3E2U A;  2V8K A;  1M3A A;  1WHJ A;  3TEE A;  1ZSG A;  1U8R A;  2X9H A;  1HD3 A;  2QK0 A;  3BDU A;  1S1N A;  5GAO r;  1A0N B;  3VS0 A;  4KUI A;  1O75 A;  2DA9 A;  3H0I A;  2BZX A;  9ATC B;  1G8X A;  4J9I A;  3EAE A;  2QEX T;  2OTJ Q;  2YWW A;  3C4S A;  1R77 A;  4BI3 A;  1SKU B;  3OYY A;  4PFZ A;  4IUQ A;  4GLM A;  1YI2 A;  2A3L A;  4M7D F;  3N5B B;  4M78 G;  1QVF S;  1G83 A;  1K73 U;  3CC7 Q;  4E7L A;  2ESW A;  1AWJ A;  5IH2 A;  1ZX6 A;  4II1 A;  2KVQ G;  3OYJ A;  2QQ9 A;  4XAX B;  2H3E B;  2FO0 A;  3GF5 A;  4CC4 B;  2CH4 A;  1UUE A;  1K0S A;  4XU0 A;  2CH4 W;  3UDC A;  3M0T A;  2GFU A;  4FYW B;  2D6F A;  2VGM A;  4JZ3 A;  3EGX A;  2CP6 A;  2X4Y A;  3UA7 A;  4PFP A;  2HKQ B;  4QT7 A;  4X34 A;  3I56 A;  2FL7 A;  1IZ6 A;  2DAQ A;  2E12 A;  1AZG B;  4HCB A;  5GMK h;  1S72 Q;  3CD6 A;  1XNI A;  4FL6 A;  1VQ6 T;  4D8D A;  3RKX A;  2LQ8 A;  1KQS A;  3NGP A;  1OI1 A;  2JTF A;  1AWW A;  3G4S T;  1LCK A;  1D0Y A;  1Q86 U;  4J7I A;  2MCN A;  4J5Y A;  3E9F A;  4FT2 A;  3L2Z A;  5IHN A;  3M58 A;  1VQ7 T;  3O5Z A;  2X3W D;  1WYX A;  1WHL A;  3OYN A;  1YJ9 A;  1I1J A;  2PU9 B;  4M77 C;  2JN0 A;  1IHW A;  1N27 A;  3M54 A;  4ZGD B;  2X35 A;  1ZSZ A;  1D3B A;  3G71 T;  1RAC B;  1SEM A;  2DLP A;  3CC4 Q;  2GNC A;  5CKB A;  3MJX A;  3HPW A;  2LRQ A;  1KQS S;  3HTR A;  2ZPH B;  5FRN A;  2LZ6 B;  1K4U S;  2O9V A;  1E6H A;  1RAD B;  5FRM A;  1G3S A;  2LQK A;  2DJZ A;  1NEB A;  5CCA A;  5KYU A;  2DIQ A;  4LD6 A;  3VUZ A;  5GAN 4;  1O9S A;  3CXC A;  4MZM A;  4IIO A;  3OS5 A;  4LNP A;  2EVR A;  2O88 A;  4J9F A;  3VU3 C;  2ED0 A;  2K57 A;  1H8K A;  1BU1 A;  2M16 A;  3X26 B;  4N0A C;  2LJ1 A;  3G1J A;  2VB6 A;  2YLC A;  3V8L A;  1K8A U;  2C06 A;  2L8D A;  4IIM A;  1NZ9 A;  3MEU A;  1VUB A;  1U1S A;  5FU7 C;  1NPR A;  4XK8 E;  2CT3 A;  4M77 F;  1M90 C;  1Q81 R;  1AZE A;  1KD1 R;  3M0S A;  3QZ9 B;  2EQM A;  4M78 B;  2BKD N;  4BE1 A;  1UGP B;  1BIA A;  1VQ8 A;  4CC7 A;  2YRC A;  2DXC A;  4XTZ A;  3G6E A;  2V1Q A;  4Z88 A;  4J6Y A;  1CSK A;  2EAY A;  5GAM j;  1W2B A;  1HXD A;  1VQK Q;  3OYB A;  2F1L A;  1YI2 T;  2M51 A;  3JCM X;  4OB3 B;  2PVD B;  1JXO A;  2ZPG B;  3QG1 A;  3RDV A;  4WTO B;  3QBY A;  3ASK A;  1H3Z A;  4FYY B;  2J6O A;  3URG A;  1ZUU A;  2KRM A;  1V76 A;  1OEB A;  1OV3 A;  1M27 C;  2RJC A;  1LNX A;  4C92 C;  1H92 A;  4C0D C;  2JMC A;  2E4H A;  1CKB A;  5CVI A;  4OML A;  3H0F A;  4EMK C;  5GAM g;  2CP2 A;  4E2F B;  1VQK T;  4PKC C;  4LDX A;  1TWB A;  1HYO A;  1UGV A;  2JXB A;  2HL3 A;  3GNF B;  5EG2 A;  3I56 T;  3CCU Q;  1YIJ Q;  1YIT A;  2PUO B;  4VUB A;  1V1C A;  1WLP B;  2F2W A;  4M75 G;  1XQH A;  2QG9 B;  2ROT A;  1MUZ A;  3LGL A;  4O6J A;  2JM8 A;  3CPW S;  2HQH A;  1IB8 A;  4Y28 E;  3CCR A;  4PL6 A;  3LYI A;  2KY9 A;  1E6G A;  4X9D A;  2E5K A;  4JLG A;  3RMQ A;  4PLI A;  2ABL A;  3OQ5 A;  3PNW C;  3VS7 A;  3VS3 A;  3LW5 E;  1VQN Q;  4Z8A A;  3MP1 A;  3JCM e;  2O31 A;  2OTL A;  3V7R A;  1JJ2 S;  1YFN A;  4DOW A;  2DXT A;  2RA2 A;  3MPU B;  4C92 F;  4N4I A;  3WXM B;  3GIB A;  5J39 A;  3VYG A;  1IRX A;  1OU8 A;  4JS4 A;  1N9S A;  2WAC A;  4ZNX A;  3PVL A;  4OGC A;  3JCM J;  1T0J A;  5KE3 A;  1VQ9 A;  2BIV A;  2HCK A;  2K5L A;  3DKM A;  3EFO B;  1QW1 A;  5GJW B;  3CPF A;  4NS5 A;  3CCL Q;  2DD5 A;  2DTI A;  2R5M A;  1VQP A;  5FWC A;  3L2R A;  2EQJ A;  2HDA A;  4QQD A;  5KYY B;  3CCS Q;  5AYF A;  3PMT A;  1B34 B;  2XDD A;  1YWP A;  6AT1 B;  1OQK A;  4C8Q E;  1RAH B;  2RD1 A;  2NUP A;  5D6W A;  3OB9 A;  1PD0 A;  5GAM e;  2O2O A;  3OYG A;  1Q7Y C;  4KH1 B;  2KXD A;  1C0M A;  1KQ1 A;  2M0O A;  2BZY A;  2E65 A;  3CCL T;  5GAN d;  3JCM W;  3MET A;  1SHG A;  5DLO A;  4GLK A;  4E7Z A;  3G6E T;  3CME Q;  2RQR A;  2WSC E;  1QKX A;  1OPL A;  2P84 A;  1Q95 G;  5LJ3 e;  5GAO q;  3ZBD A;  2D8H A;  4OMM A;  3HSB A;  1QVF P;  2L3P A;  4F7U B;  1PSE A;  1WQW A;  1PHT A;  3REB B;  1EX4 A;  4PJO G;  1GCQ A;  1ZSZ B;  1D3B B;  2QTX A;  1K9M C;  4Y91 A;  3PVQ A;  4M75 B;  1WXT A;  3UF4 A;  3LLR A;  1UDL A;  2DMO A;  3QZ5 B;  4JLI A;  1Q81 U;  4A4G A;  2FPD A;  2JTE A;  2EQK A;  4J9H A;  1R0B G;  5CAI A;  3OMG A;  3KFV A;  4JRI A;  4F7U F;  3JB9 H;  3ZEH A;  4FSS A;  1ABO A;  4J9D A;  3CCV A;  2YUO A;  2E6Z A;  3S3M A;  2FZK B;  2RHY A;  2KXC A;  3CCR T;  2DIG A;  2J7I A;  3QDF A;  2LP5 A;  4M75 F;  2NUT B;  5IAY A;  3CCM A;  2RM4 A;  1X6G A;  3CEY A;  3OA6 A;  2RNA A;  5IT9 E;  2K6D A;  2VYT A;  2CGH A;  1MGQ A;  4M7D E;  2LQW A;  2XID A;  1IXD A;  1U1T A;  4QVD A;  2HD0 A;  1LOJ A;  4Z89 A;  4AFS C;  2OTL T;  1KIK A;  3NPF A;  3CMA Q;  1AWO A;  4JJB A;  3CCJ Q;  1KC8 C;  1G3W A;  1KQS P;  4AG1 C;  2X4X A;  3JAM E;  3LGF A;  2DEQ A;  5L8R E;  2JUF A;  3RR6 A;  1AVZ C;  2HNI A;  1V29 B;  4F17 A;  2EFI A;  3OY9 A;  1Z9Q A;  2XKO C;  3CCE Q;  2DYB A;  1TS9 A;  3OYM A;  4RTX A;  2BZ8 A;  1T3S A;  1KK7 A;  1NM7 A;  2E6N A;  2NUZ A;  1VQP T;  4BAC A;  2W0Z A;  3UPU A;  1WJR A;  2K79 A;  1WHK A;  4C8Q C;  2EQI A;  3GNG A;  4PLL A;  1WI7 A;  3DLL A;  2HBP A;  1BCO A;  5LJ5 d;  4BUG A;  2DO3 A;  4LDU A;  2VXE A;  5FLX E;  4AFZ C;  3SWN C;  2DET A;  2Y4X A;  2KEA A;  4DOV A;  3CXC P;  3M53 A;  4RG2 A;  4M77 A;  1JXM A;  1GXI E;  1BKB A;  3PIP A;  5FU6 B;  4PJO B;  1WGS A;  4KGX B;  4GY5 A;  5GAM h;  2QQA A;  2YXY A;  2ZPI B;  2KK4 A;  3EG0 A;  1Y96 A;  2MMP A;  3M59 A;  3JB9 D;  5KYX A;  4OMN A;  4RG8 A;  5GAO p;  5KCH A;  1UGR B;  3OS2 A;  1VQ6 A;  5LJ3 f;  1UEB A;  4IKF A;  4C8Q D;  2K7A A;  3BE3 A;  4HCC A;  2EQU A;  3NTK A;  1W4S A;  3THK A;  3G4S A;  3OYE A;  4XTW A;  1UGS B;  2DL4 A;  3C12 A;  1FXX A;  1SPK A;  2EIF A;  3OBW A;  3EG1 A;  1OZ2 A;  1I5O B;  1PSF A;  2O9S A;  1VQ7 A;  2DL7 A;  3EGD B;  4N0A A;  2GF7 A;  1QWE A;  1ZUK A;  1W2B P;  1IRE B;  2QA4 Q;  1YWO A;  3S3O A;  4A53 A;  1S72 A;  1OX9 A;  2XIC A;  3QII A;  2KAF A;  2LX9 A;  4M77 E;  2KQW A;  2RMO A;  1GL5 A;  3M0R A;  3AT1 B;  4ATO A;  1TUD A;  1JRI A;  3CQT A;  4Z02 A;  4IUP A;  3OYA A;  2LVM A;  4RTU A;  3TSZ A;  1YJW Q;  3RES A;  5CQX A;  2DVE A;  2CZ6 B;  1RAB B;  2DF6 A;  3QXE B;  4EDU A;  1NYG A;  4ELY C;  2QQR A;  1FMK A;  2BE9 B;  1KG1 A;  4M7D C;  3H0H A;  1WIE A;  4M7A B;  3MEV A;  3OW2 S;  3QWY A;  2D1X A;  4PFO A;  1GFC A;  3CC4 A;  2DBM A;  2E3I A;  3OYF A;  3V7S A;  1C1A A;  3UWN A;  1YJW T;  3EG9 B;  4J7F A;  2B86 A;  4OMF B;  3RUX A;  4MDW A;  3JRZ A;  4B6M A;  1I0C A;  1NJI C;  4R55 A;  2L5Q A;  4BI4 A;  4EMK A;  1GBQ A;  2YDL A;  1VQM T;  4OVA A;  3PFS A;  2JS2 A;  2V1R A;  5DLQ E;  4V2S A;  4JUV A;  4JPB W;  2DRK A;  2JOY A;  2P0P A;  4M7A F;  4JS5 A;  2DYI A;  4R0K A;  4M7D D;  1KHC A;  3TCJ A;  1IGU A;  3X20 B;  2XK0 A;  1CKA A;  2MI6 A;  2YHT A;  5DM7 R;  1YCS B;  5GAN 7;  1HK9 A;  4HKE A;  4EMH A;  2Y90 A;  1LPL A;  4J9B A;  5LJ5 f;  3DB4 A;  2R5A A;  5HY6 A;  4FU6 A;  5EC7 A;  2CP3 A;  3EFS A;  4XTY A;  4IUT A;  2O4X B;  2XDB A;  2NYS A;  3TU4 K;  3CCQ Q;  1NBE B;  1Y7X A;  1RI9 A;  2QDL A;  2RI5 A;  4RCB A;  2EBP A;  2OTJ T;  4C92 E;  2XG8 D;  2X51 A;  4PJL A;  2DBK A;  1VQK A;  2CDT A;  3QUI A;  4RTT A;  2VUB A;  2DXB A;  3CC7 T;  2MWP A;  3G7Z A;  2R58 A;  4FT4 A;  4L5G A;  2PVO B;  2FZG B;  3VS4 A;  3PMI A;  3MP6 A;  1UTI A;  3JCM P;  2YRD A;  3CCQ T;  2EJ9 A;  3EGU A;  3CC2 Q;  2DX1 A;  1ABQ A;  1VIE A;  5FWB A;  4KGZ B;  1QCF A;  3OYI A;  4RTY A;  1VQ4 Q;  4OB1 B;  3CCU A;  1I8F A;  1YIJ A;  3H9N A;  2FYK A;  2OAU A;  4OB0 B;  4DBR A;  1Q7Y R;  1AHJ B;  4ME7 A;  5KYW A;  1S72 T;  1ZA2 B;  4HVU A;  1Q86 C;  2DZC A;  3OYL A;  2RQW A;  2EGE A;  3JCM b;  2F5T X;  1PRM C;  5KCO A;  2RK1 A;  4JJD A;  1G3T A;  4EPC A;  4J6W A;  2JMA A;  5IXF A;  2JNG A;  2IPO B;  3RER A;  1OPK A;  1MHN A;  2QGG A;  4AG2 C;  1VQ4 T;  3JSC A;  1X27 A;  4A54 A;  4IUR A;  2VGN A;  4RTZ A;  3VJP A;  1LJO A;  2LTO A;  2RQT A;  1M2V A;  1R0C B;  3WVD B;  2DXU A;  3I55 Q;  1M3B A;  1K9M R;  4WCI A;  3CC4 T;  4M78 C;  1PRL C;  4M77 D;  2P0Q A;  4C5E A;  2QYZ A;  1NLP C;  2DL5 A;  2HQE A;  2IIM A;  4RKU E;  3JCM g;  1D1A A;  3EG3 A;  2A7Y A;  2F69 A;  4TVR A;  3T9N A;  5GAO l;  1QKW A;  3SFM A;  2RJD A;  2CP0 A;  3CCL A;  4PJJ A;  2F5K A;  2DZ9 A;  1K8A C;  4RMO A;  4F7U E;  3ULR B;  2ZCF B;  2X4W A;  1QVG S;  2BTT A;  3AHU A;  4KUL A;  3OS0 A;  1YJN Q;  3R6N A;  1RUW A;  4OB2 B;  4M75 E;  1VQO Q;  5A0L A;  4LUE A;  4HT8 A;  1WDX A;  4N4H A;  3CPW A;  3M0P A;  4M78 F;  1KC8 R;  5LJ3 j;  2DL8 A;  2AT1 B;  1JU5 C;  2L0A A;  1M1K U;  5I2M A;  2YUQ A;  3CME A;  3TQ7 P;  3JCM V;  3M55 A;  3RBB B;  3RKY A;  1Y0M A;  1IGQ A;  2KI7 A;  1M2O A;  3MP8 A;  4CC3 A;  1M8V A;  4DA4 A;  2DPP B;  3CD6 Q;  3X28 B;  1JJ2 A;  4JRK A;  1OYX A;  2V26 A;  2CKK A;  4JJC A;  1VQO T;  1ZQ1 A;  5CKE A;  1UB4 A;  2AK5 A;  2CS7 A;  1Q82 R;  2IG0 A;  5LJ3 g;  2XHC A;  3MEA A;  2C0I A;  5GAO n;  4AFU C;  3VYH B;  4JRP A;  1YJ9 Q;  3L2U A;  1X69 A;  2H8H A;  4C8Q A;  1FX7 A;  3PIO A;  4C92 D;  2RN8 A;  2GGR A;  3RIR A;  1D0X A;  1WXB A;  3U23 A;  2L2P A;  3CCU T;  1YIJ T;  3S6W A;  2RJE A;  3UA6 A;  1AD5 A;  1SSH A;  3RKW A;  2LCS A;  5A2Q E;  1SHF A;  2K2M A;  4ZGE B;  2JM9 A;  1NLO C;  3KBG A;  2RI3 A;  1MNE A;  5GMK l;  1BIB A;  3FLG A;  1YNZ A;  2JTM A;  3H8Z A;  3HRU A;  3OYH A;  1VQN T;  4QVC A;  4J9C A;  2FPE A;  3FJP A;  4BDY A;  4A4F A;  3CCJ A;  2RF0 A;  4C5G A;  3I35 A;  5D7U A;  3CBO A;  1X6O A;  2L89 A;  4FW2 A;  2EYQ A;  1IO6 A;  3EGX B;  1B7T A;  3UT1 A;  2M1H A;  4PJO E;  2KT8 A;  1FWZ A;  4QQ6 A;  1N8R C;  2RJF A;  2CUD A;  3BDL A;  4BE2 A;  2HZY A;  2P4R A;  5LJ5 j;  2XI9 A;  4HCK A;  1TTH B;  4AMC A;  1GRI A;  2LCC A;  2ZZD A;  1BI2 A;  1AEY A;  2EWN A;  1HSQ A;  1WHH A;  1SSF A;  2CSQ A;  3A8G B;  2KMT A;  3CCS T;  2BE7 D;  3EG2 A;  3L2Q A;  1ZSZ C;  1MMD A;  2PZ1 A;  3TVT A;  3X25 B;  2FVU A;  4M75 C;  4CI0 C;  1H64 1;  5GAM d;  5J3B A;  1TUG B;  4BI8 B;  4M7D A;  3SEM A;  3A8M B;  1RI0 A;  4C0F A;  1K9M U;  5LJ5 g;  3JB9 G;  2YRV A;  2EYY A;  1T0H A;  1K76 A;  1VYV A;  1UG1 A;  3REA B;  1TU0 B;  3CME T;  4GBQ A;  4JZ4 A;  5GMK j;  4C8Q G;  2K5F A;  2MF2 A;  3ME9 A;  1KD1 U;  4QQG A;  3KUF A;  4J9G A;  2EGC A;  2L3R A;  5KYU B;  1UGQ B;  1RAI B;  3LX7 A;  4N4G A;  3CBP A;  3ER0 A;  2KGT A;  5KYN A;  3MKD A;  2A28 A;  2M9U A;  2ZPB B;  2LNV A;  2K2V A;  1NPP A;  3M56 A;  1VA7 A;  4M7A E;  2J06 A;  3HHT B;  4AT1 B;  4PJM A;  4A4H A;  1Q81 C;  5M9O A;  5DY9 A;  4X9C A;  2DNU A;  4B9X A;  5HK3 A;  2E5Q A;  2QA4 A;  1QWF A;  4WF2 A;  5CK9 A;  2EKH A;  3I9Q A;  4EIK A;  1Y71 A;  5CR2 A;  2KE9 A;  4UC4 A;  3HKS A;  2DEU A;  2MAM A;  4PJN A;  5GAN 8;  1UHF A;  5I2S A;  2EKO A;  2GTJ A;  1YJW A;  3ZL7 C;  1OX8 A;  4JRQ A;  3A1P A;  2VV5 A;  4KUD K;  1PKS A;  1ZHI A;  3JCM h;  4XTX A;  2LT1 A;  2DVJ A;  4J8O A;  1VQM A;  4FIB A;  4PK4 A;  3OSS C;  2E1H A;  2HQX A;  4FYV B;  2CYZ B;  1FMV A;  1EIF A;  2RH2 A;  2RHX A;  4MML A;  2FHD A;  4D8K A;  1SG5 A;  4LUD A;  1Q82 U;  2DTH A;  1H3H A;  3NTI A;  3FJ5 A;  3CMA T;  2HMA A;  3CCJ T;  1DJ7 B;  2HSE B;  2F2V A;  5GMK i;  1R8O B;  3A8H B;  1X75 C;  4C5H A;  5LJ5 e;  1RAG B;  4OMP A;  5FU6 C;  4PJO C;  1PWT A;  1VQL Q;  2CZ7 B;  5GAO m;  2DER A;  4M7D G;  1BBZ A;  3VS1 A;  3CCE T;  1SRM A;  3OMC A;  5GAN f;  2OTJ A;  1MMN A;  5J26 A;  1P92 A;  1M8M A;  1MV0 B;  3LWI A;  3VRY A;  4E7J A;  1AOJ A;  2XMF A;  3NFC A;  2A08 A;  3GP8 A;  3VS6 A;  2YUP A;  5GJV B;  3QHS A;  3CC7 A;  3NTH A;  4LD9 K;  1VQL T;  1UHC A;  4XTV A;  4A4E A;  2EW3 A;  4XU3 A;  5ECA A;  4F04 B;  3HRS A;  4E7I A;  1ARK A;  3MO8 A;  4LXC A;  2HEQ A;  5GMK e;  4MZT A;  5LJ3 h;  2VWF A;  3CCQ A;  2XU8 A;  3ZFJ A;  1YHQ Q;  1YN8 A;  1BCM A;  5CO7 A;  5I21 A;  1RLQ C;  4Y92 A;  2KRS A;  3PE0 A;  3QDR B;  4M78 A;  1JO8 A;  4PJO F;  3OBY A;  2FG0 A;  2KSS A;  3M9Q A;  3OW2 A;  1M90 R;  3JB9 F;  2FRW A;  3EH2 A;  4ZN3 A;  1ZUY A;  2EYX A;  2ZPF B;  1Z9Z A;  2QDY B;  2K3X A;  4LDY A;  3HP9 A;  3PT9 A;  3CPW P;  4M7A C;  3J80 E;  2L3S A;  1U3O A;  2NWM A;  5IXB A;  1F1B B;  2LT4 A;  2LNH B;  1VQ4 A;  2NUP B;  2I0N A;  2HBW A;  4ORZ A;  3P8H A;  2QA4 T;  1M3C A;  2KDS A;  2LDM A;  1MMA A;  5CQY A;  5CKF A;  2GQI A;  3LWH A;  1JJ2 P;  3FB9 A;  2HAX A;  3C94 A;  2ZGW A;  1PNJ A;  3M5A A;  2RHI A;  3VUB A;  4M78 E;  1UFF A;  4BY6 B;  4C92 A;  5GMK m;  4R56 A;  2OJ2 A;  4M7A D;  5HCK A;  2QEX Q;  2MYS A;  1X01 A;  2RI2 A;  2IVW A;  3VS5 A;  2CZ1 B;  4M77 G;  2VVK A;  1VQ5 Q;  2CP7 A;  3V8J A;  3I55 A;  2GBQ A;  2AIR B;  3QO3 A;  2GTO A;  4J9E A;  4AFQ C;  3L42 A;  3TRE A;  4NOY A;  4HT9 A;  2FEI A;  2PVG B;  1BK2 A;  1YCY A;  2A37 A;  3RNJ A;  2KRO A;  1BI0 A;  4LDV A;  3NHN A;  3E19 A;  4BD3 A;  4E6R A;  1X6B A;  1QP2 A;  3I5R A;  3J7A F;  1D1B A;  5LJ5 h;  2FPF A;  2RQV A;  1WFW A;  1VQ5 T;  1M1G A;  2JVV A;  5KH6 A;  2DE0 X;  2KT1 A;  3BY7 A;  4RUG A;  2ATC B;  2LMJ A;  1VIF A;  5C0M A;  3EFO A;  1YJN A;  1W6X A;  1K73 C;  1VQ6 Q;  3M0Q A;  4ZTJ A;  2EPD A;  2K4Y A;  1I5L A;  1IHV A;  1KHI A;  1WPY A;  1VQO A;  3G4S Q;  1OZ3 A;  1HJD A;  3PTA A;  2ROL A;  2KYM A;  5KYY A;  4HXJ A;  1X2K A;  4D6W A;  1B34 A;  1WX6 A;  1T3L A;  7AT1 B;  4B9W A;  2CP5 A;  2OX7 A;  3OSV A;  1VQ7 Q;  3X24 B;  2JS0 A;  4QVZ A;  2JT4 A;  3UAT A;  3GPL A;  1VOM A;  2M0Y A;  2OAW A;  3G71 Q;  3FEO A;  1PG5 B;  4XU1 A;  1YP5 A;  4A63 B;  1N8R R;  2LJ3 A;  1MV3 A;  3F70 A;  2C0T A;  3HRT A;  5IN1 A;  3L1A A;  1QVP A;  4E7S A;  2RHZ A;  1X2Q A;  3H41 A;  4F7U A;  4XU2 A;  4C92 G;  1MND A;  3QPH A;  3CC2 T;  1G5V A;  2DKG A;  1ZBX A;  2RHU A;  4P5N A;  5IHK A;  2VC8 A;  1KSW A;  1M4Z A;  4ZN1 A;  2V8J A;  1VQN A;  1B3Q A;  1QCO A;  2P4T A;  1FYN A;  1TUC A;  4M75 A;  4FW1 A;  3IQL A;  3A8L B;  4M77 B;  1QVG A;  5HK0 A;  2LC4 A;  3EH1 A;  2FRY A;  2LX7 A;  3VS2 A;  1D1C A;  2PTK A;  2MOX A;  3HL8 A;  4EMG A;  2EYZ A;  1JQQ A;  1Y96 B;  1M90 U;  5CKD A;  5KYX B;  3OYC A;  5I22 A;  2Z0W A;  2DRM A;  2F2X A;  1UJY A;  3A8O B;  4BE0 A;  2QQB A;  1LVK A;  1GFD A;  2JJ9 A;  8ATC B;  5GAN 2;  5GAN 5;  3I55 T;  1YI2 Q;  2NUT A;  4ZTF A;  5D6X A;  3CCS A;  4XTU A;  2YUN A;  1U06 A;  1YBY A;  1ZBJ A;  5GAN j;  3M0U A;  4J6X A;  4FSX A;  4M78 D;  1WHM A;  3CXC S;  1U5S A;  4X1V A;  5FU7 B;  1KQ2 A;  3VRZ A;  3M4Y A;  3VKI A;  1RAA B;  1SF9 A;  1OU9 A;  3NMZ C;  1QCN A;  2RK2 A;  5KE2 A;  3I56 Q;  1ZA1 B;  3TSW A;  1G3Y A;  2X4J A;  1TOV A;  1EZZ B;  5GAN g;  1YJN T;  1JEG A;  2CSI A;  3JB9 J;  2K5I A;  2A0F B;  2ZPE B;  1M1F A;  1WJQ A;  1ACM B;  4C0G A;  3L2V A;  2CZ0 B;  1M1K C;  3C0C A;  2VKN A;  1RAF B;  3KXT A;  1WQ7 A;  3EHR A;  4OP0 A;  3A5Z B;  4F7U G;  1C6V X;  3BFM A;  1TG0 A;  1AT1 B;  3C95 A;  4DBF A;  1W2B S;  4E7H A;  1RAE B;  1Y07 A;  2QXF A;  1XJW B;  1AWX A;  4C92 B;  4NL2 A;  4C0D B;  1TH7 A;  4ZGJ B;  4EMK B;  3CD6 T;  4DBQ A;  4PJO A;  3JCM c;  4MDX A;  2JW4 A;  2D9T A;  3P8B B;  4RCC A;  4DEX A;  3QWX X;  3CBM A;  3SWN A;  1BB9 A;  1EFN A;  2ECZ A;  1GCP A;  2AKK A;  2HL5 C;  4Q5W A;  1WNL A;  2SEM A;  2X3X D;  2QQS A;  3GOX A;  3EHQ A;  4PNO A;  2AKL A;  4FM4 B;  5A0G A;  2VXF A;  2E41 A;  4E47 A;  1YJ9 T;  3OW2 P;  4HVW A;  1NYF A;  2COY A;  3JCM d;  2PQW A;  3FRN A;  3RMS A;  3EFR A;  3CMA A;  3EGD A;  4LE9 A;  4LN2 A;  4LDW A;  2AZV A;  1QQJ A;  4XQ3 A;  4CC2 A;  2AZS A;  2DFU A;  2EYW A;  1K9A A;  1QMC A;  5GAN 6;  2V8I A;  1E7O A;  1XOV A;  3P8D A;  3PGG A;  2ZAE A;  3SHW A;  5IHI A;  3MCA B;  1PCX A;  3QJY A;  3DLM A;  1N8R U;  3CCE A;  1VQ8 Q;  2DL3 A;  1Q7Y U;  1X43 A;  3O8V A;  5GAN e;  2KBT A;  3G6E Q;  1M30 A;  2RQU A;  1D0Z A;  2MK5 A;  2QTV A;  1UEC A;  2D0N A;  4MZP A;  4NL3 A;  4M7A A;  2D0Q B;  1WJS A;  1VQL A;  1KFZ A;  2CUB A;  3OS1 A;  4MMK A;  2J6F A;  2GQV A;  4OGE A;  1PKT A;  4QW2 A;  1PC0 A;  4RTV A;  1VQ8 T;  2XDP A;  3EG9 A;  4JDS A;  3JB9 I;  5KYW B;  3A98 A;  1VYT A;  3HFN A;  3QYG B;  4FCY A;  3WVE B;  4KT0 E;  1UJ0 A;  2GFA A;  4C5I A;  2WSF E;  5AT1 B;  3INZ A;  1NEG A;  4L59 A;  4DBH A;  3DB3 A;  1NJI R;  2YLB A;  5LJ3 d;  2J05 A;  1YIT Q;  2BUD A;  5LL6 S;  1RLP C;  2K3Y A;  4KGV B;  4KH0 B;  3OYD A;  1N9R A;  1I07 A;  3MHX A;  1W1F A;  3OYK A;  1WHG A;  3GBQ A;  4M4Z A;  1GBR A;  3I5S A;  1M2V B;  5D6Y A;  3CCR Q;  1UE9 A;  2O01 E;  1YHQ A;  2YSQ A;  4M75 D;  8AT1 B;  3QKJ A;  2KR3 A;  2FB7 A;  1KD1 C;  1JB0 E;  3FC3 A;  5FRO A;  1PM3 A;  2HSP A;  1JBM A;  2O4X A;  1YIT T;  2OTL Q;  2ENM A;  2G6F X;  1TXQ A;  1KC8 U;  5I11 A;  1J3T A;  5C6S A;  5HKC A;  2E3H A;  3E9G A;  1VQ9 Q;  1K73 R;  4OMO A;  3QJ6 A;  2RO0 A;  5FW9 A;  2E64 A;  4DEY A;  1NG2 A;  1Y57 A;  3LH5 A;  3JCM f;  4O5V A;  1N6A A;  2AHJ B;  2HKN A;  1VQP Q;  2KRN A;  3M57 A;  4HA8 A;  4OF1 A;  1ZLM A;  2JZ2 A;  1W70 A;  3H6Z A;  1G2B A;  3SB2 A;  3L2W A;  1I81 A;  4F16 A;  2MWO A;  4OMQ A;  2Y4Y A;  1M5Q 1;  2DIL A;  4M7A G;  2MPX C;  4J83 A;  4CRI A;  5GAN 3;  2COZ A;  2KYB A;  1VQ9 T;  4QKU A;  1XTD A;  2D8J A;  3D7S B;  3JCM Q;  2J6K A;  1BI3 A;  2QI2 A;  2ED1 A;  2QEX A;  2K3B A;  1B07 A;  2VAS A;  1VQ5 A;  1Q82 C;  4IUV A;  1Q86 R;  4RTW A;  3E1S A;  3FDR A;  4KBM B;  3V7C A;  2LQN A;  2E70 A;  4C0Z A;  2CRE A;  1QVG P;  1WA7 A;  2H3J A;  3HFO A;  3MEW A;  1NE8 A;  4FYX B;  5GAN h;  3SD4 A;  4ELZ C;  1MMG A;  1WXU A;  3FIF A;  2PNI A;  3R6O A;  1QP3 A;  2KNB B;  2QAS A;  2XD0 A;  1QLY A;  2EJG A;  4C8Q B;  3BW1 A;  5GAM f;  1D09 B;  2EJF A;  3M4G A;  1FMW A;  1WZO A;  4PJO D;  3SWN B;  3QSU A;  2W10 A;  1BYM A;  2DJQ A;  2LCL A;  2RPN A;  2M02 A;  1PD1 A;  3QYH B;  3JV3 A;  3V8K A;  2E10 A;  3SDZ A;  4BB7 A;  3CCV Q;  2A36 A;  5CIU A;  2DM1 A;  2NLU A;  4C8Q F;  1K1Z A;  1K8A R;  2OI3 A;  2QGF B;  4IUU A;  3GLX A;  1YHQ T;  3CC2 A;  2DD4 A;  1OOT A;  2C0O A;  4BDZ A;  3CCM Q;  2I2L A;  3J81 E;  4KRT A;  3G71 A;  2G3R A;  1SRL A;  2R57 A;  4L6V 5;  2EGA A;  4BY6 C;  4F14 A;  1TSF A;  1VYU A;  2SRC A;  4HCZ A;  2YT6 A;  5A0D A;  4YTL A;  3CCV T;  2QAZ A;  2DK3 A;  2DTO A;  5CKH A;  4DQ2 A;  2L3Q A;  1BI1 A;  2WSE E;  2COW A;  2GCX A; 
#chains in the Genus database with same CATH homology
 1KIK A;  3NPF A;  1AWO A;  4JJB A;  1KJW A;  3IQL A;  1YNZ A;  1K0X A;  2K9G A;  2MIO A;  4AG1 C;  1GCQ C;  2LJ0 A;  2FRY A;  1AVZ C;  2LX7 A;  5L23 A;  3VS2 A;  4J9C A;  2FPE A;  2PTK A;  4F17 A;  2MOX A;  2RF0 A;  2EYZ A;  4K11 A;  1JQQ A;  2CT4 A;  1Z9Q A;  4ESR A;  4HVV A;  3I35 A;  5I22 A;  2DYB A;  1N5Z A;  2DRM A;  2F2X A;  1UJY A;  4RTX A;  2BZ8 A;  1T3S A;  1M3A A;  1ZSG A;  1IO6 A;  1GFD A;  1HD3 A;  1NM7 A;  1S1N A;  1A0N B;  2NUZ A;  3VS0 A;  2KT8 A;  2W0Z A;  2DA9 A;  3H0I A;  2CUD A;  2K79 A;  2YUN A;  1U06 A;  2BZX A;  2EQI A;  4J9I A;  1ZBJ A;  2P4R A;  1WI7 A;  4HCK A;  1GRI A;  3M0U A;  1AEY A;  1HSQ A;  2CSQ A;  4AFZ C;  4GLM A;  1U5S A;  4X1V A;  2KEA A;  3VRZ A;  3EG2 A;  1JXM A;  1G83 A;  2ESW A;  1AWJ A;  5IH2 A;  1ZX6 A;  2PZ1 A;  3NMZ C;  3TVT A;  2FO0 A;  4CC4 B;  2CH4 A;  1UUE A;  3EG0 A;  3SEM A;  1K0S A;  4OMN A;  2CH4 W;  3TSW A;  3M0T A;  2EYY A;  1JEG A;  2CSI A;  1T0H A;  1K76 A;  1VYV A;  4JZ3 A;  2K7A A;  1UG1 A;  3THK A;  3UA7 A;  3REA B;  4QT7 A;  4GBQ A;  4JZ4 A;  1AZG B;  2DL4 A;  1SPK A;  3C0C A;  4J9G A;  2VKN A;  2EGC A;  3EG1 A;  4D8D A;  3EHR A;  2O9S A;  2DL7 A;  3NGP A;  1TG0 A;  2KGT A;  1AWW A;  1LCK A;  1QWE A;  2A28 A;  1ZUK A;  1AWX A;  1YWO A;  2MCN A;  1VA7 A;  2J06 A;  5IHN A;  2JW4 A;  4DEX A;  2RMO A;  3O5Z A;  1GL5 A;  3M0R A;  3QWX X;  2X3W D;  1TUD A;  1WYX A;  3CQT A;  2DNU A;  1I1J A;  1BB9 A;  1EFN A;  1QWF A;  2ECZ A;  4RTU A;  3TSZ A;  1GCP A;  2EKH A;  3I9Q A;  2AKK A;  4EIK A;  2SEM A;  2DF6 A;  2KE9 A;  2X3X D;  1SEM A;  2DLP A;  1NYG A;  2GNC A;  3EHQ A;  1FMK A;  2AKL A;  1UHF A;  2GTJ A;  3H0H A;  1WIE A;  3ZL7 C;  3QWY A;  2D1X A;  2LZ6 B;  4HVW A;  1NYF A;  2O9V A;  1GFC A;  1K4U S;  1E6H A;  1PKS A;  2DVJ A;  1NEB A;  2DBM A;  4IIO A;  4LE9 A;  4LN2 A;  2AZV A;  4LNP A;  2EVR A;  4CC2 A;  2B86 A;  2AZS A;  2O88 A;  4J9F A;  1I0C A;  2EYW A;  1K9A A;  2ED0 A;  1H8K A;  1BU1 A;  4D8K A;  1E7O A;  1GBQ A;  1XOV A;  2YDL A;  4LUD A;  1H3H A;  2LJ1 A;  2JS2 A;  3FJ5 A;  2V1R A;  3SHW A;  5IHI A;  2F2V A;  4IIM A;  2DL3 A;  4JPB W;  2DRK A;  1X43 A;  2CT3 A;  2KBT A;  4OMP A;  1AZE A;  3M0S A;  4R0K A;  1M30 A;  1PWT A;  2RQU A;  1UEC A;  1CKA A;  2D0N A;  1BBZ A;  1YCS B;  3VS1 A;  4CC7 A;  1SRM A;  4J9B A;  2V1Q A;  4Z88 A;  1CSK A;  1M8M A;  1MV0 B;  1KFZ A;  5EC7 A;  2CUB A;  2J6F A;  3VRY A;  1PKT A;  1AOJ A;  2M51 A;  2XMF A;  2A08 A;  4RTV A;  1JXO A;  3VS6 A;  2YUP A;  3A98 A;  5GJV B;  1VYT A;  1RI9 A;  2QDL A;  2EBP A;  1UJ0 A;  2J6O A;  1ZUU A;  1UHC A;  2KRM A;  1NEG A;  2DBK A;  2EW3 A;  5ECA A;  1OEB A;  2CDT A;  1ARK A;  1OV3 A;  2HEQ A;  4RTT A;  1M27 C;  2VWF A;  2J05 A;  1H92 A;  2JMC A;  1RLP C;  1CKB A;  1YN8 A;  4OML A;  3H0F A;  1I07 A;  1RLQ C;  4Y92 A;  2KRS A;  3PE0 A;  3VS4 A;  1JO8 A;  2JXB A;  1UGV A;  1W1F A;  2FG0 A;  1UTI A;  3GBQ A;  4M4Z A;  1GBR A;  3I5S A;  2FRW A;  1UE9 A;  3EGU A;  2YSQ A;  2DX1 A;  1ZUY A;  1V1C A;  1WLP B;  1ABQ A;  2F2W A;  2EYX A;  2KR3 A;  5FWB A;  1QCF A;  2ROT A;  1Z9Z A;  1MUZ A;  4RTY A;  2JM8 A;  2HSP A;  1E6G A;  2L3S A;  2ENM A;  2E5K A;  1U3O A;  4HVU A;  2NWM A;  2G6F X;  5IXB A;  2ABL A;  2LNH B;  2RQW A;  3VS7 A;  3VS3 A;  2I0N A;  2HBW A;  4Z8A A;  2EGE A;  5I11 A;  1J3T A;  4ORZ A;  2O31 A;  1M3C A;  1PRM C;  2GQI A;  4JJD A;  2JMA A;  5IXF A;  1PNJ A;  1OPK A;  4OMO A;  4AG2 C;  4ZNX A;  1X27 A;  4RTZ A;  5FW9 A;  1UFF A;  4DEY A;  1NG2 A;  1Y57 A;  3PVL A;  2RQT A;  1T0J A;  3LH5 A;  1M3B A;  2KRN A;  2HCK A;  2OJ2 A;  4WCI A;  1ZLM A;  1PRL C;  1W70 A;  5GJW B;  1G2B A;  5HCK A;  4F16 A;  4OMQ A;  1NLP C;  3VS5 A;  2DL5 A;  2DIL A;  2VVK A;  2IIM A;  3EG3 A;  5FWC A;  2GBQ A;  2KYB A;  2HDA A;  2GTO A;  4J9E A;  2D8J A;  4AFQ C;  1QKW A;  2J6K A;  1YWP A;  2ED1 A;  2K3B A;  1B07 A;  2FEI A;  1BK2 A;  2A37 A;  3RNJ A;  2KRO A;  4RTW A;  3NHN A;  4E6R A;  1X6B A;  3ULR B;  2LQN A;  2O2O A;  3I5R A;  2BTT A;  2KXD A;  2CRE A;  1WA7 A;  2BZY A;  3R6N A;  2FPF A;  1RUW A;  2RQV A;  1WFW A;  1SHG A;  1WXU A;  2DE0 X;  2KT1 A;  2PNI A;  2KNB B;  4RUG A;  2RQR A;  1QLY A;  2LMJ A;  4LUE A;  1QKX A;  1OPL A;  1WDX A;  3M0P A;  2D8H A;  1W6X A;  4OMM A;  2L3P A;  3M0Q A;  2DL8 A;  1JU5 C;  2EPD A;  2L0A A;  1PHT A;  2YUQ A;  3REB B;  2W10 A;  3RBB B;  1HJD A;  1Y0M A;  2ROL A;  2DJQ A;  1GCQ A;  2KYM A;  4HXJ A;  4CC3 A;  1X2K A;  1WX6 A;  1T3L A;  3PVQ A;  2RPN A;  3JV3 A;  2JS0 A;  1WXT A;  3UF4 A;  2JT4 A;  4JJC A;  3UAT A;  1UDL A;  2DMO A;  2A36 A;  2M0Y A;  2AK5 A;  2DM1 A;  2OAW A;  2FPD A;  1K1Z A;  2JTE A;  1YP5 A;  2OI3 A;  4A63 B;  4J9H A;  2C0I A;  2LJ3 A;  3KFV A;  4AFU C;  1OOT A;  2C0O A;  1MV3 A;  4FSS A;  1ABO A;  2C0T A;  4J9D A;  1X69 A;  2YUO A;  2H8H A;  4KRT A;  2RN8 A;  2GGR A;  1X2Q A;  1WXB A;  3U23 A;  2L2P A;  3H41 A;  1SRL A;  2KXC A;  2J7I A;  2EGA A;  2LP5 A;  3UA6 A;  4F14 A;  1X6G A;  2RNA A;  1VYU A;  2SRC A;  1AD5 A;  1SSH A;  2K6D A;  2YT6 A;  2LCS A;  2LQW A;  5IHK A;  1KSW A;  1SHF A;  2K2M A;  4Z89 A;  2L3Q A;  1B3Q A;  4AFS C;  1FYN A;  2JM9 A;  1TUC A;  1NLO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...