1YWOA

Phospholipase cgamma1 sh3 in complex with a slp-76 motif
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
b'SAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Structural Basis for Recognition of the T Cell Adaptor Protein SLP-76 by the SH3 Domain of Phospholipase Cgamma1
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase, signaling protein
total genus 12
structure length 55
sequence length 55
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ywoA00
1K76A 1N5ZA 1K9AA 4GBQA 1UFFA 2DNUA 1PRLC 1GCPA 4A63B 1BBZA 2ED1A 4AG1C 3NGPA 1G83A 2HSPA 4GLMA 2RQTA 4WCIA 2O31A 2JS2A 1WXTA 2JTEA 2FEIA 4F17A 4J9EA 3TSWA 2L2PA 4OMPA 1JO8A 1SSHA 2BZYA 2DA9A 3I9QA 5FWCA 3FJ5A 1JEGA 1K4US 2JXBA 2L3QA 1CKAA 4FSSA 2XMFA 2DL7A 1FYNA 2L0AA 2X3WD 1SPKA 1UECA 2LP5A 2EGEA 2F2VA 4JJDA 2C0TA 2CT4A 5L23A 1M8MA 1U3OA 1NG2A 2LJ0A 2FG0A 2DL8A 2FRYA 2KT1A 1X6BA 1QKWA 2EKHA 1G2BA 2JM8A 2HDAA 2KRMA 2EVRA 2LJ3A 2I0NA 2MOXA 3JV3A 2GTOA 2J05A 2KT8A 2LMJA 1ZLMA 2CSIA 2ABLA 1TUDA 2D1XA 2LX7A 2EGAA 5GJWB 2A36A 2JM9A 4RTVA 1W1FA 1MV0B 2CDTA 5GJVB 1YWPA 1U5SA 1FMKA 3ZL7C 2GQIA 4OMQA 2PNIA 4JZ4A 1PKTA 2KXDA 2J6OA 1B07A 5ECAA 2EPDA 1PNJA 2CUBA 3U23A 2O2OA 2IIMA 2F2XA 2J06A 3QWYA 3PE0A 3I5SA 2MIOA 4KRTA 1M30A 3CQTA 2J6KA 4J9FA 1PRMC 2K7AA 2KRNA 2YUOA 1NM7A 1H3HA 4LE9A 2HCKA 4RTZA 5FWBA 1OOTA 1WXBA 2JT4A 1ZBJA 2BTTA 1VYTA 2D8JA 1E6GA 1I07A 2H8HA 2JS0A 1VA7A 4JJCA 2DRKA 2ESWA 1RLQC 2EYWA 3VS6A 1I0CA 4RTTA 4AFUC 1YN8A 3VRZA 3H0FA 3QWXX 1KIKA 1MV3A 2NWMA 3A98A 2O9VA 1V1CA 5HCKA 1SRMA 2DRMA 3VS3A 3VS2A 2KNBB 1X2KA 4M4ZA 1A0NB 4LNPA 4Z88A 1SHFA 2DJQA 2M0YA 2EBPA 3H41A 1GRIA 1KSWA 1B3QA 1VYVA 1KJWA 1WA7A 1K1ZA 4CC7A 1AZEA 4RTWA 3I35A 3R6NA 1GL5A 4AFSC 4J9CA 1RLPC 5I22A 2AKLA 2RNAA 2E5KA 4CC2A 2AK5A 1QWEA 1YP5A 2YUQA 1YNZA 2CH4W 2X3XD 1CKBA 1ZUYA 2AZSA 2RQUA 2JW4A 2LCSA 1H92A 1W6XA 2LJ1A 3UA7A 1E6HA 1GCQC 1UJYA 1PWTA 2BZXA 5FW9A 1JQQA 4RTXA 1WYXA 1ARKA 1X6GA 4J9BA 1U06A 1GFCA 3UA6A 1ABOA 4DEYA 3IQLA 1QLYA 1ZUKA 2DF6A 2EW3A 3H0IA 2DILA 1AOJA 2P4RA 1Y57A 1OPLA 1WLPB 2CREA 1BU1A 3TSZA 2JMCA 2FPDA 2K79A 3VS4A 4LN2A 1KFZA 2CUDA 2RMOA 2EGCA 1VYUA 1T0JA 2DL3A 1NEGA 5IH2A 3ULRB 1UUEA 1W70A 2GBQA 2OI3A 2QDLA 3LH5A 3THKA 2DBKA 1AWOA 2LQWA 4K11A 1Z9ZA 2D0NA 1UHFA 2KR3A 3TVTA 1HJDA 4AFQC 1JXOA 4RTYA 3REAB 1WX6A 1M3BA 1XOVA 3EG1A 2EYXA 2DX1A 1AZGB 2K9GA 3M0SA 1UTIA 2F2WA 2K3BA 2EYYA 3M0QA 1OEBA 2W0ZA 2O88A 1NLPC 1WDXA 2KYMA 1NYFA 2KE9A 4ORZA 1JXMA 1WXUA 2EYZA 4CC4B 5IHKA 3VRYA 1ZX6A 1BK2A 1RUWA 4LUDA 1EFNA 3PVLA 1E7OA 4F14A 4OMMA 1ABQA 2ENMA 2C0OA 1TUCA 2KGTA 3EGUA 1WIEA 1QKXA 4EIKA 2YUNA 2DM1A 1OPKA 3EHQA 4JZ3A 1JU5C 2V1QA 3SEMA 2VWFA 1NLOC 2YSQA 2B86A 2DYBA 2ED0A 5IHNA 1LCKA 3UATA 2D8HA 3O5ZA 4X1VA 2DLPA 2GNCA 2DL5A 2RF0A 2DBMA 1CSKA 2KBTA 5EC7A 4D8KA 1Y0MA 2JMAA 2YUPA 3KFVA 5IXFA 1X27A 2PZ1A 1GCQA 2RPNA 2SEMA 1SRLA 2ROLA 4IIMA 2DL4A 4OMNA 2AZVA 1HSQA 4Z8AA 3NPFA 2RQWA 3M0PA 2L3SA 2ECZA 4RTUA 1SEMA 2RQRA 3M0UA 2KXCA 1PKSA 2PTKA 1OV3A 1SHGA 3VS7A 4HVWA 2SRCA 2C0IA 1AWXA 2K2MA 1WFWA 1J3TA 1UE9A 1T0HA 2J7IA 1M27C 2YDLA 3EG2A 2HEQA 1H8KA 2V1RA 2KRSA 3REBB 2MCNA 3VS0A 1T3LA 4HVUA 1S1NA 2K6DA 3EHRA 1QWFA 3NHNA 1AWJA 2VKNA 2CT3A 4LUEA 2LZ6B 3H0HA 1UDLA 1I1JA 3RBBB 1T3SA 4OMOA 3C0CA 1UGVA 4J9GA 3M0RA 1MUZA 1Z9QA 4IIOA 4D8DA 4J9IA 2CH4A 3EG0A 4J9HA 2L3PA 3UF4A 4Y92A 1HD3A 1UJ0A 2DVJA 1GBRA 4CC3A 3PVQA 4ESRA 4OMLA 2FO0A 2ROTA 2FPEA 4J9DA 3VS1A 4F16A 3I5RA 2KROA 2A08A 1NYGA 1ZUUA 4AFZC 2KYBA 1QCFA 2RN8A 1ZSGA 1GBQA 1X69A 1WI7A 3RNJA 3VS5A 2KEAA 1IO6A 1AEYA 2OAWA 4JPBW 2AKKA 5I11A 4AG2C 1K0SA 2GTJA 2YT6A 1UHCA 2LNHB 1AWWA 1K0XA 4QT7A 2G6FX 3SHWA 2VVKA 2O9SA 5IXBA 2W10A 2GGRA 5IHIA 1BB9A 1X2QA 2A28A 4RUGA 4HCKA 4HVVA 4JJBA 2DMOA 1PHTA 3NMZC 1AD5A 1GFDA 2A37A 2BZ8A 2EQIA 4R0KA 2CSQA 1M3CA 4Z89A 1X43A 2FPFA 2LQNA 1TG0A 2NUZA 4ZNXA 3EG3A 2OJ2A 3GBQA 4HXJA 1YWOA 1M3AA 2FRWA 4DEXA 1AVZC 1NEBA 2J6FA 2M51A 4E6RA 1YCSB 1UG1A 2DE0X 1RI9A 2RQVA 3M0TA 2HBWA
chains in the Genus database with same CATH superfamily
4PKCC 4GBQA 1UFFA 2FZCB 3SD4A 1PRLC 1IRXA 1VQ5A 4JRQA 2KMTA 2K57A 3NGPA 3RUXA 3MEAA 4M77F 3CEYA 2X4JA 1M90U 4DBRA 2PVOB 1U1TA 1VQLQ 2O31A 2JS2A 1WXTA 2FEIA 1SSHA 2DA9A 2BZYA 3I9QA 3S6WA 4C0FA 4PJLA 2MF2A 1OX8A 4FSSA 2VC8A 3VUZA 2DL7A 2C06A 1QCNA 2ZPGB 2X3WD 3G1JA 2LP5A 3L2VA 1Y96A 5KYUA 5A2QE 4FT4A 4M77G 3DKMA 1M8MA 1BIBA 3KBGA 5J26A 2DL8A 4M7DE 1PM3A 2EKHA 1G2BA 2O01E 2HDAA 3SDZA 2VXFA 1HK9A 2J05A 4FYVB 2LMJA 4PJOB 2ABLA 3MP6A 3OS5A 2D1XA 1VQKQ 2EGAA 5I2SA 3G4SA 4RTVA 1NPRA 2QQBA 3TQ7P 1MV0B 2CDTA 3JCMV 1U5SA 2FB7A 4JZ4A 2O4XB 2J6OA 4BACA 5CKEA 3ASKA 1PNJA 2IIMA 4R55A 4PK4A 3G6EQ 3X25B 4A4FA 2MIOA 4KRTA 1M30A 3RESA 7AT1B 1KC8R 2KQWA 5CQYA 1PRMC 2KRNA 4OVAA 3JB9F 2XD0A 1KHCA 1G3SA 3SWNA 5GAN5 1G8XA 4JS4A 4ZGDB 1QP3A 1VQ6A 4KH1B 4LDUA 1I07A 2JS0A 2JTMA 4FW1A 3DLLA 3PTAA 4AFUC 3H0FA 1RAIB 4Y91A 4M75E 4QVDA 2O9VA 3SB2A 5HCKA 2EJFA 4M4ZA 1A0NB 2K3YA 2M0YA 2HL5C 4M7AE 1WA7A 1YI2A 4RTWA 3I35A 1PG5B 2RM4A 1M2VB 3L2QA 2QASA 4C92D 5I22A 1VQ5T 2AKLA 4XTWA 4P5NA 3QKJA 2OTJA 1YNZA 1DJ7B 2VV5A 1ZUYA 2X3XD 4PJOE 2RQUA 2JW4A 2LJ1A 3UA7A 2NUPB 5GAMe 1UGRB 1GCQC 1SSFA 1WYXA 2JJ9A 3OYFA 1ARKA 1X6GA 3G7ZA 1U06A 2KK4A 2K5FA 5AYFA 1D1CA 3OQ5A 2DF6A 3CMAA 3BY7A 1Y57A 5GAMh 1AHJB 1NPPA 3VS4A 4BD3A 3M4YA 1VQ7A 1VYUA 3GLXA 3TU4K 4BE1A 4XU3A 2E1HA 2OI3A 3OBYA 3EAEA 5D6WA 3THKA 1K9MC 3MPUB 1BCMA 2LQWA 2YRVA 1EIFA 1K8AR 2E6ZA 2D0NA 3G4ST 5CKFA 5C0MA 2WACA 4MZPA 4AFQC 2R5MA 1K73R 3REAB 2K5LA 2NLUA 4J7IA 3OBWA 4ZTJA 3EG1A 4HCCA 4PJMA 4D6WA 2EYXA 3OYCA 3A8HB 3FRNA 2MAMA 2XDDA 1Y71A 5KYYB 2WSCE 5D7UA 3M54A 2HKQB 1M8VA 3QXEB 3HHTB 1QMCA 3JAME 5A0GA 1Q86C 4ORZA 4M75C 5LJ5d 1ZX6A 2DD5A 3JCMQ 1E7OA 2FYKA 3VU3C 1ABQA 1TUCA 2KGTA 3CPWP 1KQSS 1TU0B 2FZKB 4M7AC 2NUTA 4XAXB 4EIKA 4C8QF 2OTLQ 1JU5C 2V1QA 1V29B 1LCKA 1R0CB 8AT1B 3UATA 1N27A 4X9DA 3X26B 2GNCA 2DL5A 3H8ZA 1YITA 3OYMA 1I4K1 5FU6B 2E65A 5EC7A 4II1A 1YI2T 1Y96B 2MWPA 4BDYA 1IHWA 2MMPA 2LQKA 5GAOm 4X34A 3OYEA 1X27A 1GCQA 3QIIA 4KULA 1FWZA 2DL4A 2OTJT 3NPFA 4A53A 5FLXE 3M56A 2KDSA 4M7DA 4PL6A 2RQRA 4BY6B 1ACMB 2A3LA 1K9MU 4E7LA 2CS7A 1PKSA 2RI5A 4HVWA 2VGMA 1WQWA 2EQKA 3CD6A 3HTRA 4M77D 2PUKB 2YRDA 2J7IA 3CMAT 2YXYA 3RKXA 2JVVA 1H8KA 2CGHA 1RACB 3GNGA 5LJ3j 2X35A 1TTHB 3REBB 2MCNA 1VQ7T 3CCEQ 2DPPB 4KH0B 4J5YA 1S1NA 2LVMA 2VKNA 5LJ3f 4LUEA 3H0HA 3HFOA 1UDLA 1Q86U 1I1JA 3RBBB 3LX7A 3SWNB 4A4HA 1PD1A 1UGVA 3QBYA 2VXEA 4IIOA 5GAN2 2CH4A 4A4KA 4IUVA 3GOXA 2L3PA 3UF4A 4Y92A 1MNDA 1UJ0A 1VQMA 4CC3A 2F5KA 4ESRA 4OMLA 2G3RA 1KG1A 3HP9A 2FPEA 2FL7A 1H3ZA 2CZ0B 4J83A 5LJ5e 4FCYA 4HCBA 4M75A 4AFZC 2E4HA 3MCAB 3M58A 3JCMh 1G3WA 3SFMA 4WTOB 4M7AA 2DAQA 2HL3A 2EFIA 1IO6A 2HQXA 1D3BA 2YT6A 3MKDA 1K0XA 1AWWA 1BKBA 2CZ6B 2VVKA 3P8BB 2O9SA 5IXBA 3CCLA 2CP6A 3NTHA 1BB9A 2ZGWA 4RUGA 2DXCA 2HNIA 4JJBA 3RDVA 2V8IA 2H3JA 1GFDA 1YITT 1WJSA 2D6FA 1KD1C 2EQIA 4M7DF 1YHQQ 4N0AC 5LJ5f 2PVDB 3NTIA 1HYOA 4QVZA 2CSQA 3HRUA 1C6VX 2DEQA 1RAGB 1NBEB 4ZNXA 4N4HA 1D0XA 2HQHA 3EG3A 4HXJA 4C92F 1YWOA 3JCMP 4IUUA 3OMCA 4BE2A 1NEBA 4ZGEB 1YCSB 3JCMd 2HBWA 3GPLA 3I56A 1N8RR 2DNUA 1BBZA 4M7DG 2CZ7B 2E64A 3RIRA 2XDBA 4GLKA 4IURA 3I55Q 2ZPFB 4A54A 4XTYA 1Q82R 4IUTA 4LDVA 4FYXB 4EMHA 3CC7Q 3LH0A 4F17A 3CCVA 3M59A 4O6JA 4OMPA 1Q81C 4J6WA 3CCSA 2COZA 3FJ5A 2RHZA 1K4US 2XIDA 2VGNA 1XNIA 2L3QA 1IXDA 1CKAA 2FVUA 1PSFA 2DXTA 2L0AA 2QGGA 3P8DA 1UECA 5J3BA 1M2VA 1ZSZC 1VQ9A 4ZTFA 3INZA 5C6SA 4L59A 2FRYA 5IT9E 2JM8A 2EVRA 2LJ3A 2I0NA 3EG9A 3JV3A 2KT8A 2NUPA 1ZLMA 3E2UA 1VIEA 2VB6A 5GJWB 1S72A 1JRIA 2JM9A 1P92A 4XTUA 2EJ9A 2E10A 5GJVB 3ZL7C 3JB9H 2GQIA 2KAFA 4OMQA 2CP7A 2KXDA 1VQNA 4PJOF 2E41A 4M75G 4IKFA 2EPDA 4E7ZA 2YHTA 2CUBA 4DQ2A 3QWYA 4M7AG 3OYBA 5CO7A 1ZHIA 3CCLT 1G3YA 4N0AA 2YUOA 1NM7A 1JBMA 1WHLA 1OU9A 4EMKC 2BTTA 2D8JA 3M53A 1E6GA 1RABB 4BI8B 4B9WA 1VA7A 2DRKA 1RLQC 4RTTA 4QKUA 1TUGB 1YN8A 3VRZA 5I2MA 4IUPA 3OW2A 1YFNA 1KIKA 2NWMA 1TSFA 1Q81U 5KYYA 5GANj 1SRMA 3HRTA 1X2KA 1Y7XA 4LNPA 1SHFA 1IB8A 2IG0A 4MZMA 1JJ2A 2XU8A 3EGXB 4M78C 3I56T 2JOYA 2P0PA 4J9CA 1Q7YC 5GANf 4KBMB 5KYXA 4QVCA 5HK3A 2RNAA 4FT2A 5GMKl 3CCUQ 1YP5A 1VQOQ 1I5OB 5IN1A 2IVWA 2YLCA 1QVPA 1UJYA 3HKSA 1PWTA 2BZXA 1JQQA 4LD6A 2KY9A 3J81E 3CCVT 4E7IA 2CYZB 3VUBA 4OP0A 3PT9A 4M75B 3CCST 1ABOA 4ZN1A 1VQ5Q 1ZSZA 1ZUKA 3H0IA 3JCMf 2DILA 5GAMd 1OPLA 3HFNA 3TSZA 2FPDA 4O5VA 2K79A 3FIFA 4M7AB 4LDXA 5DLQE 2CUDA 2RMOA 2RA2A 1TXQA 2EGCA 2DTHA 3LGFA 1VQ9T 1T0JA 2CP3A 3FEOA 3ULRB 1D3BB 2QDLA 3LH5A 4XTVA 4N4IA 2P0QA 2BUDA 4K11A 3CBOA 5GAOr 1S72T 2KR3A 1N6AA 3TVTA 2HBPA 1HJDA 1RADB 4HT8A 4RTYA 2YRCA 1F1BB 1VQNT 2HD0A 2Y4XA 2M0OA 3G6EA 5LJ3g 2DKGA 2K9GA 1WHGA 5GAOn 1UTIA 3A8LB 9ATCB 2EYYA 1OEBA 2O88A 1NLPC 4EMKA 1YCYA 2K3XA 2KYMA 4RCBA 1V76A 3VYHB 4JS5A 2EYZA 1WQ7A 3F70A 5IAYA 1BI1A 1Q7YU 4E7HA 2B8AA 3GF5A 2X9HA 2F5TX 5HKCA 1YJ9A 1KC8C 3LLRA 3PVLA 4F14A 4OMMA 1B7TA 2C0OA 2L3RA 3EHQA 1OPKA 2DIQA 3V8KA 1NJIR 2VWFA 4M78A 1WHKA 2ED0A 5IHNA 3ME9A 4PFZA 3O5ZA 4BDZA 4X1VA 3JCMc 3EFSA 4M7DD 2DZ9A 3MHXA 2DBMA 3QG1A 4C5GA 1CSKA 5GAOp 2AHJB 3PFSA 2YUPA 3KFVA 5IXFA 3D7SB 3CPWS 2PZ1A 2RPNA 1W2BP 1RAHB 4IIMA 3BE3A 3GP8A 4OMNA 2AZVA 4Z8AA 3EG9B 2L3SA 2A0FB 4KGZB 3CBMA 3CCJA 2ZZDA 2Z0WA 2DTIA 3EGDA 2PTKA 2M9UA 1YI2Q 2SRCA 2E12A 4C5IA 3X24B 2E6NA 1T0HA 4JRKA 1X6OA 4OF1A 5CAIA 3G71A 1KQSA 2V1RA 2EYQA 1YJNA 3TEEA 4MMKA 1XJWB 4B9XA 4PFOA 3EHRA 1M2OA 1QWFA 4ZGJB 3OYDA 2CT3A 4DOWA 4E7JA 1R0BG 3S3MA 2CP0A 3BDLA 4DBHA 4FYYB 3CXCA 4OMOA 4M75D 1VQ7Q 4J9GA 5GAMf 3M0RA 1KC8U 1D09B 4J9HA 2X51A 2E70A 1K8AC 1YIJQ 2LT4A 2DVJA 1GBRA 1WZOA 3CCMQ 1QVGA 4M7AD 1FMVA 1K73C 1TH7A 3I5RA 1QVFA 3G6ET 5HK0A 4FL6A 2LX9A 3C12A 3QZ9B 3JSCA 4PJOD 1QCFA 1VQ8Q 1LNXA 3M55A 2RN8A 2LT1A 5KYXB 3P8HA 1YJ9T 1M1KR 1AEYA 3LGLA 1VQ6T 1XQHA 2QTXA 5KCHA 1K0SA 2QEXQ 3Q1JA 4FM4B 3H6ZA 1UHCA 4JJNK 3QO3A 2G6FX 3L1AA 3ER0A 3UDCA 1Q95G 1LPLA 3LWIA 2A28A 4HVVA 1WGSA 3CCRA 1PHTA 3OYHA 4ME7A 3NMZC 1ZSZB 1AD5A 2BZ8A 3E19A 3OSVA 4R0KA 4M78G 1LJOA 1M3CA 1X01A 4A4EA 3ZFJA 1TG0A 2NUZA 4C0DC 2E3IA 3QDFA 4PJNA 4R56A 3JRZA 1YITQ 3OS0A 2J6FA 4E6RA 3CCJT 1RI9A 3M0TA 3OA6A 2DO3A 3ZEHA 3CMEQ 1N5ZA 4CI0C 3META 3OYKA 1W4SA 2BKDN 1GCPA 1D0ZA 3TREA 4AG1C 1OX9A 1K8AU 3G71T 3E1SA 3QJYA 2HSPA 1LOJA 2RQTA 4WCIA 1WPYA 2JTEA 3FLGA 2RJEA 1YJNT 2HZYA 1K73U 4QQGA 4QW2A 4J9EA 4OB3B 2KVQG 3J80E 3RERA 1JO8A 5FWCA 1JEGA 4EMKB 3HL8A 2RK1A 2XMFA 5GANg 2X4WA 3EGXA 1VOMA 2EGEA 2F2VA 4C5HA 2C0TA 1BI0A 5D6XA 4MMLA 1U3OA 2HMAA 1NG2A 2FG0A 1N9SA 1X6BA 3OS1A 2KRMA 2MOXA 5CCAA 2GTOA 3VYGA 2PUOB 2CSIA 4M78B 3X20B 3JCMg 1TUDA 1EZZB 2LX7A 5CKHA 4M77C 4V2SA 1PSEA 1W1FA 2L8DA 2F1LA 3CCQA 2V26A 3O8VA 1YWPA 2F69A 1FMKA 2RK2A 2PNIA 1PKTA 1R77A 1B07A 3RMSA 3RKWA 3V7CA 4L5GA 3QPHA 5GAN7 2O2OA 2PU9B 2F2XA 3QYGB 1VQPA 3PE0A 3I5SA 4EPCA 2R57A 2VYTA 2RB6A 3EGDB 5LJ5j 3LW5E 3L2WA 2K7AA 3UT1A 1KK7A 2HSEB 1H3HA 4LE9A 3CCRT 2QA4A 4JLIA 2HCKA 4RTZA 5FWBA 3E9GA 1OOTA 3R6OA 4F7UA 2JT4A 3BDUA 1VYTA 4RKUE 1YHQA 4N4GA 3PIOA 2EYWA 2VUBA 1I0CA 1YJWQ 5GMKj 4MDWA 1MV3A 3S3OA 2DXUA 3CC2Q 1RAFB 2DRMA 3VJPA 3VS3A 2KNBB 4Z88A 2DJQA 2EBPA 3H41A 1GRIA 1KSWA 2P4TA 1SF9A 4XK8E 1R8OB 1IHVA 3CD6T 1RLPC 3V8LA 4LD9K 2E5KA 3PNWC 4Y28E 4CC2A 2AK5A 1QWEA 4TVRA 2CH4W 2GFAA 1CKBA 1N8RC 2LCSA 1H92A 4M78E 3CBPA 3CC7A 3JCMb 5FW9A 4RTXA 2H3EB 3OYAA 2DYIA 4J9BA 5GAN4 4KUIA 1GFCA 3UA6A 4DEYA 1LVKA 3IQLA 3V7RA 1Q82C 1PCXA 1QLYA 2EW3A 1WLPB 2WSFE 2CREA 1BU1A 2JMCA 1M9SA 1KFZA 4BI3A 2DL3A 1NEGA 1AT1B 4M75F 1UUEA 3FB9A 4MZTA 3CCSQ 5DY9A 1VQMT 4C8QE 3AT1B 1ZA1B 2LCCA 2IPOB 3CC4A 1G3TA 4M7AF 2JNGA 3OYYA 1M90R 2LQ8A 2RJDA 1Y07A 3QJ6A 2QG9B 1TOVA 4A4GA 1JXOA 1KD1U 3CCQT 4PJJA 1WX6A 3RR6A 2R58A 3L42A 2K4YA 4GY5A 5GAN6 2DX1A 1AZGB 3WXMB 1S72Q 1VQPT 1U1SA 1WJQA 2JUFA 1WJRA 1M5Q1 2QI2A 2V8JA 1VQ4A 3M0QA 1BIAA 4OMFB 2W0ZA 1WDXA 4JRPA 1OI1A 5FU7C 2YWWA 1JXMA 5IHKA 4CC4B 3J7AF 2QA4T 1RUWA 3C95A 4LUDA 3M57A 3MEUA 1EFNA 3OYIA 1N9RA 5GAN8 1YHQT 3A8OB 3DB3A 3EGUA 1WIEA 2P0KA 2QAZA 1QKXA 4L6V5 2YUNA 2DM1A 5A0DA 3SEMA 4F7UG 2YSQA 1WHHA 2DLPA 2PVGB 1Q82U 2P84A 3C4SA 5GMKm 2KBTA 4D8KA 3EFOA 3S3NA 2JMAA 3QUIA 3CCUA 4XU0A 1VQOA 2RHIA 3KUFA 1HSQA 4AMCA 2RHUA 2ECZA 1VQLA 4RTUA 2DERA 1SEMA 1RAEB 5EG2A 3CC7T 1SHGA 2JZ2A 3OB9A 3VS7A 3OSSC 2C0IA 1AWXA 1MHNA 2JN0A 3OYGA 1UE9A 4ELZC 4F04B 2YDLA 3EG2A 2QYZA 1IGUA 4C8QC 1W2BS 2BE7D 2DVEA 2KRSA 5KYWB 3WVDB 4HT9A 3MP1A 1MMNA 2COWA 2K5IA 2XG8D 4LDYA 2K6DA 4J8OA 3NHNA 3HSBA 4YTLA 1IZ6A 3CC4T 1VQKA 1B34A 2QK0A 1FMWA 3CPWA 1MUZA 1Z9QA 4F7UB 5CKDA 4J9IA 1OYXA 3EG0A 4C0DB 4RCCA 1HD3A 1MMGA 3PVQA 1KQ1A 3A5ZB 2FO0A 3OW2S 1G5VA 3QSUA 4J9DA 3VS1A 4BUGA 1VIFA 4F16A 4DOVA 2KROA 4OGCA 1OULA 3QHSA 4C92E 1NYGA 3EH2A 3G4SQ 3UPUA 2FZGB 1VQ4T 2R5AA 3NFCA 1JJ2S 2QDYB 4DA4A 1GXIE 2M16A 4J6XA 4FYWB 2GF7A 2ZPHB 3RNJA 5FRNA 3VS5A 2KEAA 4JPBW 1WNLA 5I11A 4AG2C 3V7SA 1UEBA 2LNHB 2QQRA 5GAOq 4QT7A 3OYNA 3MP8A 2A7YA 4MDXA 2W10A 2GGRA 2ZAEA 1X2QA 4HCKA 4J7FA 2DMOA 3BFMA 2RH2A 4ZN3A 1YJ9Q 1NJIC 2RHXA 2A37A 1VQ6Q 1FXXA 3RMQA 4J6YA 4XQ3A 2NYSA 3QZ5B 3RKYA 2Y4YA 4NL3A 1NE8A 1X43A 2FPFA 5AT1B 1UGSB 3CCUT 4VUBA 2OJ2A 3GBQA 1VQOT 4M77B 2M02A 2DFUA 1VQLT 1M3AA 2FRWA 1AVZC 3PMTA 4CRIA 3OYLA 3JB9G 1UG1A 5J39A 3L2UA 4KGXB 1K76A 1OZ3A 4C8QA 1K9AA 4F7UE 1M4ZA 4PNOA 4A63B 4OB0B 5LJ5g 2ED1A 2RJFA 2MI6A 3HPWA 1G83A 5HY6A 3DB4A 2OTJQ 4FIBA 3A8GB 4RMOA 4HCZA 4GLMA 2X4YA 3CCJQ 3FC3A 4UC4A 5LJ3d 4RG8A 2DETA 3TSWA 2L2PA 2E3HA 3VV0A 1KHIA 5GAMj 3OW2P 2M1HA 2CZ1B 4LDWA 2LC4A 4M7DC 2JXBA 4X9CA 3CMAQ 5KH6A 3AHUA 2LRQA 3G71Q 1JB0E 4FSXA 1FYNA 1I8FA 2EIFA 1SPKA 2QQ9A 4JJDA 1D0YA 1VQKT 1OZ2A 3DLMA 2CT4A 1YJNQ 2DD4A 1JJ2P 4C92C 5L23A 2EQMA 4KUDK 2LJ0A 1PD0A 1K9MR 2KT1A 5M9OA 1QKWA 1YIJA 1C0MA 4OB1B 2X4XA 3CCMA 2EJGA 5CIUA 2RI3A 3LWHA 2GCXA 3FDRA 1QP2A 2A36A 2EKOA 1UGPB 1NJIU 3JB9I 4C0ZA 2L5QA 5KE3A 4FW2A 3JCMJ 1VQ8A 2DTOA 3EFOB 3ZBDA 3V8JA 4EDUA 5ECAA 3GIBA 4M78F 3NTKA 3U23A 4M77E 4BB7A 1O9SA 2J06A 1Q86R 2QEXA 5FRMA 3CQTA 4WF2A 2RI2A 2J6KA 4C0GA 4J9FA 1D1BA 1M1KC 3EFRA 2LTOA 2OTLA 2DK3A 2XKOC 5I21A 2BIVA 2WSEE 2DEUA 1WXBA 2ZCFB 1ZBJA 2ATCB 4NOYA 4ATOA 2H8HA 4PLIA 4E7KA 4JJCA 4KT0E 2ESWA 3VS6A 1RI0A 3QWXX 4AT1B 3A98A 1V1CA 3VS2A 2XHCA 3CCRQ 1ZA2B 4XU2A 3CPFA 4PJOC 4BE0A 1VYVA 1B3QA 8ATCB 5CK9A 1KJWA 3CMEA 1K1ZA 4ANJA 4CC7A 1BCOA 1AZEA 5KYUB 3FJPA 1B34B 3OMGA 3CXCS 3R6NA 1GL5A 2XICA 4AFSC 3HRSA 4C5EA 2JTFA 5LJ3e 2YUQA 4C8QG 2AZSA 2QTVA 1QVGS 1W6XA 5GAOl 2LNVA 1E6HA 2PQWA 3CCEA 5FU7B 1TS9A 1QVFS 5LJ3h 4XU1A 2RD1A 3CD6Q 1C1AA 2KSSA 1M1GA 4C92A 1AOJA 2P4RA 4JDSA 1UGQB 3OS2A 4LN2A 1I5LA 4XTZA 1I81A 2XDPA 5IH2A 4NS5A 3JCMW 1W70A 2GBQA 2VASA 1YBYA 1YIJT 2GFUA 2QQAA 1OQKA 3CCMT 4JUVA 2QXFA 2DBKA 1AWOA 1M1KU 2CP2A 3OYJA 2CKKA 2DZCA 1Z9ZA 4Q5WA 1RL2A 4BI4A 1TWBA 1UHFA 1BI2A 1QW1A 4LXCA 3WVEB 5DM7R 3L2ZA 2D9TA 1VQ8T 1M3BA 1VQMQ 1XOVA 2AIRB 5KYWA 2EAYA 1KQSP 5GMKi 4HA8A 2ZPBB 2RHYA 2XI9A 3M0SA 2CP5A 2F2WA 2QEXT 2K3BA 4E7SA 2L89A 3MEVA 3CCQQ 2OTLT 2HQEA 1NYFA 1WHJA 1BYMA 2DIGA 3PIPA 4C8QB 3A8MB 2KE9A 1WXUA 3VRYA 3GNFB 5LJ5h 1BK2A 5GMKe 1WHMA 3CXCP 2HAXA 1VQPQ 1PC0A 3M4GA 3PGGA 3VKIA 2ENMA 5CQXA 2AT1B 1YJWA 4QQ6A 2Y90A 3JB9D 3TCJA 4JZ3A 4PJOA 3CCLQ 1NLOC 2B86A 2DYBA 1KD1R 3CC2A 1QVGP 2EQJA 4EMGA 5GMKh 2D8HA 1H641 1IGQA 4ELYC 2QA4Q 1O75A 2RF0A 1SKUB 1QVFP 5GANd 4IUQA 3N5BB 1Y0MA 3CMET 5GAN3 3L2RA 1VUBA 2O4XA 2HKNA 4KGVB 2GQVA 2SEMA 2KI7A 1SRLA 4OB2B 2ROLA 1HXDA 1MNEA 3KXTA 4XTXA 2MPXC 4OGEA 2LCLA 4E47A 3I55A 2RQWA 3M0PA 5D6YA 3M0UA 2KXCA 1EX4A 4DBQA 1MMAA 3T9NA 3CCET 1OV3A 3UWNA 2BE9B 3JCMX 2K2MA 1WFWA 3I56Q 1X75C 3C94A 1J3TA 2D0QB 1QQJA 1D1AA 2QGFB 5KCOA 3H9NA 1M27C 4B6MA 4QQDA 2E5QA 2HEQA 3MJXA 4FU6A 4JRIA 1Q81R 3LYIA 2OAUA 4PLLA 3M5AA 3BW1A 3VS0A 2DXBA 4C92G 1T3LA 3CCVQ 1IREB 4HVUA 2ZPIB 4M77A 1AWJA 1SG5A 3A1PA 2LZ6B 3EH1A 3MEWA 1U8RA 2MYSA 2EWNA 1T3SA 2LDMA 3C0CA 1QCOA 1ZQ1A 2MK5A 5CVIA 4D8DA 2RO0A 1VQ9Q 5FU6C 2FHDA 4DBFA 4PFPA 5CKBA 1M90C 1NZ9A 2V8KA 2NUTB 5KE2A 2DJZA 1BI3A 2ROTA 3URGA 3CC4Q 4Z02A 4E2FB 1RAAB 3QYHB 2A08A 1ZUUA 4F7UF 1MGQA 2XK0A 2KYBA 1XTDA 4BY6C 4HKEA 5GAMg 4M78D 2EQUA 1W2BA 1ZSGA 1VQNQ 3E9FA 1GBQA 1X69A 2YLBA 1WI7A 5FROA 1FX7A 4RG2A 5LL6S 2OAWA 2AKKA 2GTJA 4JLGA 1N8RU 4M7DB 3SHWA 1YJWT 1VQ4Q 1M1FA 3X28B 5GANe 1MMDA 5IHIA 5A0LA 3QDRB 6AT1B 3CC2T 2ZPEB 5DLOA 1UB4A 5KYNA 4C92B 1OU8A 2MWOA 3OY9A 5GANh 4PJOG 2COYA 3JB9J 4C8QD 2QQSA 3SWNC 1ZBXA 4Z89A 2RJCA 3JCMe 5CR2A 5L8RE 2LQNA 2I2LA 2OX7A 4NL2A 3M9QA 2K2VA 3I55T 3PMIA 4DEXA 1Q7YR 2M51A 2DE0X 2RQVA 3MO8A 1KQ2A
chains in the Genus database with same CATH topology
1K76A 1N5ZA 1K9AA 4GBQA 1UFFA 2DNUA 1PRLC 1GCPA 4A63B 1BBZA 2ED1A 4AG1C 3NGPA 1G83A 2HSPA 4GLMA 2RQTA 4WCIA 2O31A 2JS2A 1WXTA 2JTEA 2FEIA 4F17A 4J9EA 3TSWA 2L2PA 4OMPA 1JO8A 1SSHA 2BZYA 2DA9A 3I9QA 5FWCA 3FJ5A 1JEGA 1K4US 2JXBA 2L3QA 1CKAA 4FSSA 2XMFA 2DL7A 1FYNA 2L0AA 2X3WD 1SPKA 1UECA 2LP5A 2EGEA 2F2VA 4JJDA 2C0TA 2CT4A 5L23A 1M8MA 1U3OA 1NG2A 2LJ0A 2FG0A 2DL8A 2FRYA 2KT1A 1X6BA 1QKWA 2EKHA 1G2BA 2JM8A 2HDAA 2KRMA 2EVRA 2LJ3A 2I0NA 2MOXA 3JV3A 2GTOA 2J05A 2KT8A 2LMJA 1ZLMA 2CSIA 2ABLA 1TUDA 2D1XA 2LX7A 2EGAA 5GJWB 2A36A 2JM9A 4RTVA 1W1FA 1MV0B 2CDTA 5GJVB 1YWPA 1U5SA 1FMKA 3ZL7C 2GQIA 4OMQA 2PNIA 4JZ4A 1PKTA 2KXDA 2J6OA 1B07A 5ECAA 2EPDA 1PNJA 2CUBA 3U23A 2O2OA 2IIMA 2F2XA 2J06A 3QWYA 3PE0A 3I5SA 2MIOA 4KRTA 1M30A 3CQTA 2J6KA 4J9FA 1PRMC 2K7AA 2KRNA 2YUOA 1NM7A 1H3HA 4LE9A 2HCKA 4RTZA 5FWBA 1OOTA 1WXBA 2JT4A 1ZBJA 2BTTA 1VYTA 2D8JA 1E6GA 1I07A 2H8HA 2JS0A 1VA7A 4JJCA 2DRKA 2ESWA 1RLQC 2EYWA 3VS6A 1I0CA 4RTTA 4AFUC 1YN8A 3VRZA 3H0FA 3QWXX 1KIKA 1MV3A 2NWMA 3A98A 2O9VA 1V1CA 5HCKA 1SRMA 2DRMA 3VS3A 3VS2A 2KNBB 1X2KA 4M4ZA 1A0NB 4LNPA 4Z88A 1SHFA 2DJQA 2M0YA 2EBPA 3H41A 1GRIA 1KSWA 1B3QA 1VYVA 1KJWA 1WA7A 1K1ZA 4CC7A 1AZEA 4RTWA 3I35A 3R6NA 1GL5A 4AFSC 4J9CA 1RLPC 5I22A 2AKLA 2RNAA 2E5KA 4CC2A 2AK5A 1QWEA 1YP5A 2YUQA 1YNZA 2CH4W 2X3XD 1CKBA 1ZUYA 2AZSA 2RQUA 2JW4A 2LCSA 1H92A 1W6XA 2LJ1A 3UA7A 1E6HA 1GCQC 1UJYA 1PWTA 2BZXA 5FW9A 1JQQA 4RTXA 1WYXA 1ARKA 1X6GA 4J9BA 1U06A 1GFCA 3UA6A 1ABOA 4DEYA 3IQLA 1QLYA 1ZUKA 2DF6A 2EW3A 3H0IA 2DILA 1AOJA 2P4RA 1Y57A 1OPLA 1WLPB 2CREA 1BU1A 3TSZA 2JMCA 2FPDA 2K79A 3VS4A 4LN2A 1KFZA 2CUDA 2RMOA 2EGCA 1VYUA 1T0JA 2DL3A 1NEGA 5IH2A 3ULRB 1UUEA 1W70A 2GBQA 2OI3A 2QDLA 3LH5A 3THKA 2DBKA 1AWOA 2LQWA 4K11A 1Z9ZA 2D0NA 1UHFA 2KR3A 3TVTA 1HJDA 4AFQC 1JXOA 4RTYA 3REAB 1WX6A 1M3BA 1XOVA 3EG1A 2EYXA 2DX1A 1AZGB 2K9GA 3M0SA 1UTIA 2F2WA 2K3BA 2EYYA 3M0QA 1OEBA 2W0ZA 2O88A 1NLPC 1WDXA 2KYMA 1NYFA 2KE9A 4ORZA 1JXMA 1WXUA 2EYZA 4CC4B 5IHKA 3VRYA 1ZX6A 1BK2A 1RUWA 4LUDA 1EFNA 3PVLA 1E7OA 4F14A 4OMMA 1ABQA 2ENMA 2C0OA 1TUCA 2KGTA 3EGUA 1WIEA 1QKXA 4EIKA 2YUNA 2DM1A 1OPKA 3EHQA 4JZ3A 1JU5C 2V1QA 3SEMA 2VWFA 1NLOC 2YSQA 2B86A 2DYBA 2ED0A 5IHNA 1LCKA 3UATA 2D8HA 3O5ZA 4X1VA 2DLPA 2GNCA 2DL5A 2RF0A 2DBMA 1CSKA 2KBTA 5EC7A 4D8KA 1Y0MA 2JMAA 2YUPA 3KFVA 5IXFA 1X27A 2PZ1A 1GCQA 2RPNA 2SEMA 1SRLA 2ROLA 4IIMA 2DL4A 4OMNA 2AZVA 1HSQA 4Z8AA 3NPFA 2RQWA 3M0PA 2L3SA 2ECZA 4RTUA 1SEMA 2RQRA 3M0UA 2KXCA 1PKSA 2PTKA 1OV3A 1SHGA 3VS7A 4HVWA 2SRCA 2C0IA 1AWXA 2K2MA 1WFWA 1J3TA 1UE9A 1T0HA 2J7IA 1M27C 2YDLA 3EG2A 2HEQA 1H8KA 2V1RA 2KRSA 3REBB 2MCNA 3VS0A 1T3LA 4HVUA 1S1NA 2K6DA 3EHRA 1QWFA 3NHNA 1AWJA 2VKNA 2CT3A 4LUEA 2LZ6B 3H0HA 1UDLA 1I1JA 3RBBB 1T3SA 4OMOA 3C0CA 1UGVA 4J9GA 3M0RA 1MUZA 1Z9QA 4IIOA 4D8DA 4J9IA 2CH4A 3EG0A 4J9HA 2L3PA 3UF4A 4Y92A 1HD3A 1UJ0A 2DVJA 1GBRA 4CC3A 3PVQA 4ESRA 4OMLA 2FO0A 2ROTA 2FPEA 4J9DA 3VS1A 4F16A 3I5RA 2KROA 2A08A 1NYGA 1ZUUA 4AFZC 2KYBA 1QCFA 2RN8A 1ZSGA 1GBQA 1X69A 1WI7A 3RNJA 3VS5A 2KEAA 1IO6A 1AEYA 2OAWA 4JPBW 2AKKA 5I11A 4AG2C 1K0SA 2GTJA 2YT6A 1UHCA 2LNHB 1AWWA 1K0XA 4QT7A 2G6FX 3SHWA 2VVKA 2O9SA 5IXBA 2W10A 2GGRA 5IHIA 1BB9A 1X2QA 2A28A 4RUGA 4HCKA 4HVVA 4JJBA 2DMOA 1PHTA 3NMZC 1AD5A 1GFDA 2A37A 2BZ8A 2EQIA 4R0KA 2CSQA 1M3CA 4Z89A 1X43A 2FPFA 2LQNA 1TG0A 2NUZA 4ZNXA 3EG3A 2OJ2A 3GBQA 4HXJA 1YWOA 1M3AA 2FRWA 4DEXA 1AVZC 1NEBA 2J6FA 2M51A 4E6RA 1YCSB 1UG1A 2DE0X 1RI9A 2RQVA 3M0TA 2HBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K76 A;  1N5Z A;  1K9A A;  4GBQ A;  1UFF A;  2DNU A;  1PRL C;  1GCP A;  4A63 B;  1BBZ A;  2ED1 A;  4AG1 C;  3NGP A;  1G83 A;  2HSP A;  4GLM A;  2RQT A;  4WCI A;  2O31 A;  2JS2 A;  1WXT A;  2JTE A;  2FEI A;  4F17 A;  4J9E A;  3TSW A;  2L2P A;  4OMP A;  1JO8 A;  1SSH A;  2BZY A;  2DA9 A;  3I9Q A;  5FWC A;  3FJ5 A;  1JEG A;  1K4U S;  2JXB A;  2L3Q A;  1CKA A;  4FSS A;  2XMF A;  2DL7 A;  1FYN A;  2L0A A;  2X3W D;  1SPK A;  1UEC A;  2LP5 A;  2EGE A;  2F2V A;  4JJD A;  2C0T A;  2CT4 A;  5L23 A;  1M8M A;  1U3O A;  1NG2 A;  2LJ0 A;  2FG0 A;  2DL8 A;  2FRY A;  2KT1 A;  1X6B A;  1QKW A;  2EKH A;  1G2B A;  2JM8 A;  2HDA A;  2KRM A;  2EVR A;  2LJ3 A;  2I0N A;  2MOX A;  3JV3 A;  2GTO A;  2J05 A;  2KT8 A;  2LMJ A;  1ZLM A;  2CSI A;  2ABL A;  1TUD A;  2D1X A;  2LX7 A;  2EGA A;  5GJW B;  2A36 A;  2JM9 A;  4RTV A;  1W1F A;  1MV0 B;  2CDT A;  5GJV B;  1YWP A;  1U5S A;  1FMK A;  3ZL7 C;  2GQI A;  4OMQ A;  2PNI A;  4JZ4 A;  1PKT A;  2KXD A;  2J6O A;  1B07 A;  5ECA A;  2EPD A;  1PNJ A;  2CUB A;  3U23 A;  2O2O A;  2IIM A;  2F2X A;  2J06 A;  3QWY A;  3PE0 A;  3I5S A;  2MIO A;  4KRT A;  1M30 A;  3CQT A;  2J6K A;  4J9F A;  1PRM C;  2K7A A;  2KRN A;  2YUO A;  1NM7 A;  1H3H A;  4LE9 A;  2HCK A;  4RTZ A;  5FWB A;  1OOT A;  1WXB A;  2JT4 A;  1ZBJ A;  2BTT A;  1VYT A;  2D8J A;  1E6G A;  1I07 A;  2H8H A;  2JS0 A;  1VA7 A;  4JJC A;  2DRK A;  2ESW A;  1RLQ C;  2EYW A;  3VS6 A;  1I0C A;  4RTT A;  4AFU C;  1YN8 A;  3VRZ A;  3H0F A;  3QWX X;  1KIK A;  1MV3 A;  2NWM A;  3A98 A;  2O9V A;  1V1C A;  5HCK A;  1SRM A;  2DRM A;  3VS3 A;  3VS2 A;  2KNB B;  1X2K A;  4M4Z A;  1A0N B;  4LNP A;  4Z88 A;  1SHF A;  2DJQ A;  2M0Y A;  2EBP A;  3H41 A;  1GRI A;  1KSW A;  1B3Q A;  1VYV A;  1KJW A;  1WA7 A;  1K1Z A;  4CC7 A;  1AZE A;  4RTW A;  3I35 A;  3R6N A;  1GL5 A;  4AFS C;  4J9C A;  1RLP C;  5I22 A;  2AKL A;  2RNA A;  2E5K A;  4CC2 A;  2AK5 A;  1QWE A;  1YP5 A;  2YUQ A;  1YNZ A;  2CH4 W;  2X3X D;  1CKB A;  1ZUY A;  2AZS A;  2RQU A;  2JW4 A;  2LCS A;  1H92 A;  1W6X A;  2LJ1 A;  3UA7 A;  1E6H A;  1GCQ C;  1UJY A;  1PWT A;  2BZX A;  5FW9 A;  1JQQ A;  4RTX A;  1WYX A;  1ARK A;  1X6G A;  4J9B A;  1U06 A;  1GFC A;  3UA6 A;  1ABO A;  4DEY A;  3IQL A;  1QLY A;  1ZUK A;  2DF6 A;  2EW3 A;  3H0I A;  2DIL A;  1AOJ A;  2P4R A;  1Y57 A;  1OPL A;  1WLP B;  2CRE A;  1BU1 A;  3TSZ A;  2JMC A;  2FPD A;  2K79 A;  3VS4 A;  4LN2 A;  1KFZ A;  2CUD A;  2RMO A;  2EGC A;  1VYU A;  1T0J A;  2DL3 A;  1NEG A;  5IH2 A;  3ULR B;  1UUE A;  1W70 A;  2GBQ A;  2OI3 A;  2QDL A;  3LH5 A;  3THK A;  2DBK A;  1AWO A;  2LQW A;  4K11 A;  1Z9Z A;  2D0N A;  1UHF A;  2KR3 A;  3TVT A;  1HJD A;  4AFQ C;  1JXO A;  4RTY A;  3REA B;  1WX6 A;  1M3B A;  1XOV A;  3EG1 A;  2EYX A;  2DX1 A;  1AZG B;  2K9G A;  3M0S A;  1UTI A;  2F2W A;  2K3B A;  2EYY A;  3M0Q A;  1OEB A;  2W0Z A;  2O88 A;  1NLP C;  1WDX A;  2KYM A;  1NYF A;  2KE9 A;  4ORZ A;  1JXM A;  1WXU A;  2EYZ A;  4CC4 B;  5IHK A;  3VRY A;  1ZX6 A;  1BK2 A;  1RUW A;  4LUD A;  1EFN A;  3PVL A;  1E7O A;  4F14 A;  4OMM A;  1ABQ A;  2ENM A;  2C0O A;  1TUC A;  2KGT A;  3EGU A;  1WIE A;  1QKX A;  4EIK A;  2YUN A;  2DM1 A;  1OPK A;  3EHQ A;  4JZ3 A;  1JU5 C;  2V1Q A;  3SEM A;  2VWF A;  1NLO C;  2YSQ A;  2B86 A;  2DYB A;  2ED0 A;  5IHN A;  1LCK A;  3UAT A;  2D8H A;  3O5Z A;  4X1V A;  2DLP A;  2GNC A;  2DL5 A;  2RF0 A;  2DBM A;  1CSK A;  2KBT A;  5EC7 A;  4D8K A;  1Y0M A;  2JMA A;  2YUP A;  3KFV A;  5IXF A;  1X27 A;  2PZ1 A;  1GCQ A;  2RPN A;  2SEM A;  1SRL A;  2ROL A;  4IIM A;  2DL4 A;  4OMN A;  2AZV A;  1HSQ A;  4Z8A A;  3NPF A;  2RQW A;  3M0P A;  2L3S A;  2ECZ A;  4RTU A;  1SEM A;  2RQR A;  3M0U A;  2KXC A;  1PKS A;  2PTK A;  1OV3 A;  1SHG A;  3VS7 A;  4HVW A;  2SRC A;  2C0I A;  1AWX A;  2K2M A;  1WFW A;  1J3T A;  1UE9 A;  1T0H A;  2J7I A;  1M27 C;  2YDL A;  3EG2 A;  2HEQ A;  1H8K A;  2V1R A;  2KRS A;  3REB B;  2MCN A;  3VS0 A;  1T3L A;  4HVU A;  1S1N A;  2K6D A;  3EHR A;  1QWF A;  3NHN A;  1AWJ A;  2VKN A;  2CT3 A;  4LUE A;  2LZ6 B;  3H0H A;  1UDL A;  1I1J A;  3RBB B;  1T3S A;  4OMO A;  3C0C A;  1UGV A;  4J9G A;  3M0R A;  1MUZ A;  1Z9Q A;  4IIO A;  4D8D A;  4J9I A;  2CH4 A;  3EG0 A;  4J9H A;  2L3P A;  3UF4 A;  4Y92 A;  1HD3 A;  1UJ0 A;  2DVJ A;  1GBR A;  4CC3 A;  3PVQ A;  4ESR A;  4OML A;  2FO0 A;  2ROT A;  2FPE A;  4J9D A;  3VS1 A;  4F16 A;  3I5R A;  2KRO A;  2A08 A;  1NYG A;  1ZUU A;  4AFZ C;  2KYB A;  1QCF A;  2RN8 A;  1ZSG A;  1GBQ A;  1X69 A;  1WI7 A;  3RNJ A;  3VS5 A;  2KEA A;  1IO6 A;  1AEY A;  2OAW A;  4JPB W;  2AKK A;  5I11 A;  4AG2 C;  1K0S A;  2GTJ A;  2YT6 A;  1UHC A;  2LNH B;  1AWW A;  1K0X A;  4QT7 A;  2G6F X;  3SHW A;  2VVK A;  2O9S A;  5IXB A;  2W10 A;  2GGR A;  5IHI A;  1BB9 A;  1X2Q A;  2A28 A;  4RUG A;  4HCK A;  4HVV A;  4JJB A;  2DMO A;  1PHT A;  3NMZ C;  1AD5 A;  1GFD A;  2A37 A;  2BZ8 A;  2EQI A;  4R0K A;  2CSQ A;  1M3C A;  4Z89 A;  1X43 A;  2FPF A;  2LQN A;  1TG0 A;  2NUZ A;  4ZNX A;  3EG3 A;  2OJ2 A;  3GBQ A;  4HXJ A;  1YWO A;  1M3A A;  2FRW A;  4DEX A;  1AVZ C;  1NEB A;  2J6F A;  2M51 A;  4E6R A;  1YCS B;  1UG1 A;  2DE0 X;  1RI9 A;  2RQV A;  3M0T A;  2HBW A; 
#chains in the Genus database with same CATH topology
 4PKC C;  4GBQ A;  1UFF A;  2FZC B;  3SD4 A;  1PRL C;  1IRX A;  1VQ5 A;  4JRQ A;  2KMT A;  2K57 A;  3NGP A;  3RUX A;  3MEA A;  4M77 F;  3CEY A;  2X4J A;  1M90 U;  4DBR A;  2PVO B;  1U1T A;  1VQL Q;  2O31 A;  2JS2 A;  1WXT A;  2FEI A;  1SSH A;  2DA9 A;  2BZY A;  3I9Q A;  3S6W A;  4C0F A;  4PJL A;  2MF2 A;  1OX8 A;  4FSS A;  2VC8 A;  3VUZ A;  2DL7 A;  2C06 A;  1QCN A;  2ZPG B;  2X3W D;  3G1J A;  2LP5 A;  3L2V A;  1Y96 A;  5KYU A;  5A2Q E;  4FT4 A;  4M77 G;  3DKM A;  1M8M A;  1BIB A;  3KBG A;  5J26 A;  2DL8 A;  4M7D E;  1PM3 A;  2EKH A;  1G2B A;  2O01 E;  2HDA A;  3SDZ A;  2VXF A;  1HK9 A;  2J05 A;  4FYV B;  2LMJ A;  4PJO B;  2ABL A;  3MP6 A;  3OS5 A;  2D1X A;  1VQK Q;  2EGA A;  5I2S A;  3G4S A;  4RTV A;  1NPR A;  2QQB A;  3TQ7 P;  1MV0 B;  2CDT A;  3JCM V;  1U5S A;  2FB7 A;  4JZ4 A;  2O4X B;  2J6O A;  4BAC A;  5CKE A;  3ASK A;  1PNJ A;  2IIM A;  4R55 A;  4PK4 A;  3G6E Q;  3X25 B;  4A4F A;  2MIO A;  4KRT A;  1M30 A;  3RES A;  7AT1 B;  1KC8 R;  2KQW A;  5CQY A;  1PRM C;  2KRN A;  4OVA A;  3JB9 F;  2XD0 A;  1KHC A;  1G3S A;  3SWN A;  5GAN 5;  1G8X A;  4JS4 A;  4ZGD B;  1QP3 A;  1VQ6 A;  4KH1 B;  4LDU A;  1I07 A;  2JS0 A;  2JTM A;  4FW1 A;  3DLL A;  3PTA A;  4AFU C;  3H0F A;  1RAI B;  4Y91 A;  4M75 E;  4QVD A;  2O9V A;  3SB2 A;  5HCK A;  2EJF A;  4M4Z A;  1A0N B;  2K3Y A;  2M0Y A;  2HL5 C;  4M7A E;  1WA7 A;  1YI2 A;  4RTW A;  3I35 A;  1PG5 B;  2RM4 A;  1M2V B;  3L2Q A;  2QAS A;  4C92 D;  5I22 A;  1VQ5 T;  2AKL A;  4XTW A;  4P5N A;  3QKJ A;  2OTJ A;  1YNZ A;  1DJ7 B;  2VV5 A;  1ZUY A;  2X3X D;  4PJO E;  2RQU A;  2JW4 A;  2LJ1 A;  3UA7 A;  2NUP B;  5GAM e;  1UGR B;  1GCQ C;  1SSF A;  1WYX A;  2JJ9 A;  3OYF A;  1ARK A;  1X6G A;  3G7Z A;  1U06 A;  2KK4 A;  2K5F A;  5AYF A;  1D1C A;  3OQ5 A;  2DF6 A;  3CMA A;  3BY7 A;  1Y57 A;  5GAM h;  1AHJ B;  1NPP A;  3VS4 A;  4BD3 A;  3M4Y A;  1VQ7 A;  1VYU A;  3GLX A;  3TU4 K;  4BE1 A;  4XU3 A;  2E1H A;  2OI3 A;  3OBY A;  3EAE A;  5D6W A;  3THK A;  1K9M C;  3MPU B;  1BCM A;  2LQW A;  2YRV A;  1EIF A;  1K8A R;  2E6Z A;  2D0N A;  3G4S T;  5CKF A;  5C0M A;  2WAC A;  4MZP A;  4AFQ C;  2R5M A;  1K73 R;  3REA B;  2K5L A;  2NLU A;  4J7I A;  3OBW A;  4ZTJ A;  3EG1 A;  4HCC A;  4PJM A;  4D6W A;  2EYX A;  3OYC A;  3A8H B;  3FRN A;  2MAM A;  2XDD A;  1Y71 A;  5KYY B;  2WSC E;  5D7U A;  3M54 A;  2HKQ B;  1M8V A;  3QXE B;  3HHT B;  1QMC A;  3JAM E;  5A0G A;  1Q86 C;  4ORZ A;  4M75 C;  5LJ5 d;  1ZX6 A;  2DD5 A;  3JCM Q;  1E7O A;  2FYK A;  3VU3 C;  1ABQ A;  1TUC A;  2KGT A;  3CPW P;  1KQS S;  1TU0 B;  2FZK B;  4M7A C;  2NUT A;  4XAX B;  4EIK A;  4C8Q F;  2OTL Q;  1JU5 C;  2V1Q A;  1V29 B;  1LCK A;  1R0C B;  8AT1 B;  3UAT A;  1N27 A;  4X9D A;  3X26 B;  2GNC A;  2DL5 A;  3H8Z A;  1YIT A;  3OYM A;  1I4K 1;  5FU6 B;  2E65 A;  5EC7 A;  4II1 A;  1YI2 T;  1Y96 B;  2MWP A;  4BDY A;  1IHW A;  2MMP A;  2LQK A;  5GAO m;  4X34 A;  3OYE A;  1X27 A;  1GCQ A;  3QII A;  4KUL A;  1FWZ A;  2DL4 A;  2OTJ T;  3NPF A;  4A53 A;  5FLX E;  3M56 A;  2KDS A;  4M7D A;  4PL6 A;  2RQR A;  4BY6 B;  1ACM B;  2A3L A;  1K9M U;  4E7L A;  2CS7 A;  1PKS A;  2RI5 A;  4HVW A;  2VGM A;  1WQW A;  2EQK A;  3CD6 A;  3HTR A;  4M77 D;  2PUK B;  2YRD A;  2J7I A;  3CMA T;  2YXY A;  3RKX A;  2JVV A;  1H8K A;  2CGH A;  1RAC B;  3GNG A;  5LJ3 j;  2X35 A;  1TTH B;  3REB B;  2MCN A;  1VQ7 T;  3CCE Q;  2DPP B;  4KH0 B;  4J5Y A;  1S1N A;  2LVM A;  2VKN A;  5LJ3 f;  4LUE A;  3H0H A;  3HFO A;  1UDL A;  1Q86 U;  1I1J A;  3RBB B;  3LX7 A;  3SWN B;  4A4H A;  1PD1 A;  1UGV A;  3QBY A;  2VXE A;  4IIO A;  5GAN 2;  2CH4 A;  4A4K A;  4IUV A;  3GOX A;  2L3P A;  3UF4 A;  4Y92 A;  1MND A;  1UJ0 A;  1VQM A;  4CC3 A;  2F5K A;  4ESR A;  4OML A;  2G3R A;  1KG1 A;  3HP9 A;  2FPE A;  2FL7 A;  1H3Z A;  2CZ0 B;  4J83 A;  5LJ5 e;  4FCY A;  4HCB A;  4M75 A;  4AFZ C;  2E4H A;  3MCA B;  3M58 A;  3JCM h;  1G3W A;  3SFM A;  4WTO B;  4M7A A;  2DAQ A;  2HL3 A;  2EFI A;  1IO6 A;  2HQX A;  1D3B A;  2YT6 A;  3MKD A;  1K0X A;  1AWW A;  1BKB A;  2CZ6 B;  2VVK A;  3P8B B;  2O9S A;  5IXB A;  3CCL A;  2CP6 A;  3NTH A;  1BB9 A;  2ZGW A;  4RUG A;  2DXC A;  2HNI A;  4JJB A;  3RDV A;  2V8I A;  2H3J A;  1GFD A;  1YIT T;  1WJS A;  2D6F A;  1KD1 C;  2EQI A;  4M7D F;  1YHQ Q;  4N0A C;  5LJ5 f;  2PVD B;  3NTI A;  1HYO A;  4QVZ A;  2CSQ A;  3HRU A;  1C6V X;  2DEQ A;  1RAG B;  1NBE B;  4ZNX A;  4N4H A;  1D0X A;  2HQH A;  3EG3 A;  4HXJ A;  4C92 F;  1YWO A;  3JCM P;  4IUU A;  3OMC A;  4BE2 A;  1NEB A;  4ZGE B;  1YCS B;  3JCM d;  2HBW A;  3GPL A;  3I56 A;  1N8R R;  2DNU A;  1BBZ A;  4M7D G;  2CZ7 B;  2E64 A;  3RIR A;  2XDB A;  4GLK A;  4IUR A;  3I55 Q;  2ZPF B;  4A54 A;  4XTY A;  1Q82 R;  4IUT A;  4LDV A;  4FYX B;  4EMH A;  3CC7 Q;  3LH0 A;  4F17 A;  3CCV A;  3M59 A;  4O6J A;  4OMP A;  1Q81 C;  4J6W A;  3CCS A;  2COZ A;  3FJ5 A;  2RHZ A;  1K4U S;  2XID A;  2VGN A;  1XNI A;  2L3Q A;  1IXD A;  1CKA A;  2FVU A;  1PSF A;  2DXT A;  2L0A A;  2QGG A;  3P8D A;  1UEC A;  5J3B A;  1M2V A;  1ZSZ C;  1VQ9 A;  4ZTF A;  3INZ A;  5C6S A;  4L59 A;  2FRY A;  5IT9 E;  2JM8 A;  2EVR A;  2LJ3 A;  2I0N A;  3EG9 A;  3JV3 A;  2KT8 A;  2NUP A;  1ZLM A;  3E2U A;  1VIE A;  2VB6 A;  5GJW B;  1S72 A;  1JRI A;  2JM9 A;  1P92 A;  4XTU A;  2EJ9 A;  2E10 A;  5GJV B;  3ZL7 C;  3JB9 H;  2GQI A;  2KAF A;  4OMQ A;  2CP7 A;  2KXD A;  1VQN A;  4PJO F;  2E41 A;  4M75 G;  4IKF A;  2EPD A;  4E7Z A;  2YHT A;  2CUB A;  4DQ2 A;  3QWY A;  4M7A G;  3OYB A;  5CO7 A;  1ZHI A;  3CCL T;  1G3Y A;  4N0A A;  2YUO A;  1NM7 A;  1JBM A;  1WHL A;  1OU9 A;  4EMK C;  2BTT A;  2D8J A;  3M53 A;  1E6G A;  1RAB B;  4BI8 B;  4B9W A;  1VA7 A;  2DRK A;  1RLQ C;  4RTT A;  4QKU A;  1TUG B;  1YN8 A;  3VRZ A;  5I2M A;  4IUP A;  3OW2 A;  1YFN A;  1KIK A;  2NWM A;  1TSF A;  1Q81 U;  5KYY A;  5GAN j;  1SRM A;  3HRT A;  1X2K A;  1Y7X A;  4LNP A;  1SHF A;  1IB8 A;  2IG0 A;  4MZM A;  1JJ2 A;  2XU8 A;  3EGX B;  4M78 C;  3I56 T;  2JOY A;  2P0P A;  4J9C A;  1Q7Y C;  5GAN f;  4KBM B;  5KYX A;  4QVC A;  5HK3 A;  2RNA A;  4FT2 A;  5GMK l;  3CCU Q;  1YP5 A;  1VQO Q;  1I5O B;  5IN1 A;  2IVW A;  2YLC A;  1QVP A;  1UJY A;  3HKS A;  1PWT A;  2BZX A;  1JQQ A;  4LD6 A;  2KY9 A;  3J81 E;  3CCV T;  4E7I A;  2CYZ B;  3VUB A;  4OP0 A;  3PT9 A;  4M75 B;  3CCS T;  1ABO A;  4ZN1 A;  1VQ5 Q;  1ZSZ A;  1ZUK A;  3H0I A;  3JCM f;  2DIL A;  5GAM d;  1OPL A;  3HFN A;  3TSZ A;  2FPD A;  4O5V A;  2K79 A;  3FIF A;  4M7A B;  4LDX A;  5DLQ E;  2CUD A;  2RMO A;  2RA2 A;  1TXQ A;  2EGC A;  2DTH A;  3LGF A;  1VQ9 T;  1T0J A;  2CP3 A;  3FEO A;  3ULR B;  1D3B B;  2QDL A;  3LH5 A;  4XTV A;  4N4I A;  2P0Q A;  2BUD A;  4K11 A;  3CBO A;  5GAO r;  1S72 T;  2KR3 A;  1N6A A;  3TVT A;  2HBP A;  1HJD A;  1RAD B;  4HT8 A;  4RTY A;  2YRC A;  1F1B B;  1VQN T;  2HD0 A;  2Y4X A;  2M0O A;  3G6E A;  5LJ3 g;  2DKG A;  2K9G A;  1WHG A;  5GAO n;  1UTI A;  3A8L B;  9ATC B;  2EYY A;  1OEB A;  2O88 A;  1NLP C;  4EMK A;  1YCY A;  2K3X A;  2KYM A;  4RCB A;  1V76 A;  3VYH B;  4JS5 A;  2EYZ A;  1WQ7 A;  3F70 A;  5IAY A;  1BI1 A;  1Q7Y U;  4E7H A;  2B8A A;  3GF5 A;  2X9H A;  2F5T X;  5HKC A;  1YJ9 A;  1KC8 C;  3LLR A;  3PVL A;  4F14 A;  4OMM A;  1B7T A;  2C0O A;  2L3R A;  3EHQ A;  1OPK A;  2DIQ A;  3V8K A;  1NJI R;  2VWF A;  4M78 A;  1WHK A;  2ED0 A;  5IHN A;  3ME9 A;  4PFZ A;  3O5Z A;  4BDZ A;  4X1V A;  3JCM c;  3EFS A;  4M7D D;  2DZ9 A;  3MHX A;  2DBM A;  3QG1 A;  4C5G A;  1CSK A;  5GAO p;  2AHJ B;  3PFS A;  2YUP A;  3KFV A;  5IXF A;  3D7S B;  3CPW S;  2PZ1 A;  2RPN A;  1W2B P;  1RAH B;  4IIM A;  3BE3 A;  3GP8 A;  4OMN A;  2AZV A;  4Z8A A;  3EG9 B;  2L3S A;  2A0F B;  4KGZ B;  3CBM A;  3CCJ A;  2ZZD A;  2Z0W A;  2DTI A;  3EGD A;  2PTK A;  2M9U A;  1YI2 Q;  2SRC A;  2E12 A;  4C5I A;  3X24 B;  2E6N A;  1T0H A;  4JRK A;  1X6O A;  4OF1 A;  5CAI A;  3G71 A;  1KQS A;  2V1R A;  2EYQ A;  1YJN A;  3TEE A;  4MMK A;  1XJW B;  4B9X A;  4PFO A;  3EHR A;  1M2O A;  1QWF A;  4ZGJ B;  3OYD A;  2CT3 A;  4DOW A;  4E7J A;  1R0B G;  3S3M A;  2CP0 A;  3BDL A;  4DBH A;  4FYY B;  3CXC A;  4OMO A;  4M75 D;  1VQ7 Q;  4J9G A;  5GAM f;  3M0R A;  1KC8 U;  1D09 B;  4J9H A;  2X51 A;  2E70 A;  1K8A C;  1YIJ Q;  2LT4 A;  2DVJ A;  1GBR A;  1WZO A;  3CCM Q;  1QVG A;  4M7A D;  1FMV A;  1K73 C;  1TH7 A;  3I5R A;  1QVF A;  3G6E T;  5HK0 A;  4FL6 A;  2LX9 A;  3C12 A;  3QZ9 B;  3JSC A;  4PJO D;  1QCF A;  1VQ8 Q;  1LNX A;  3M55 A;  2RN8 A;  2LT1 A;  5KYX B;  3P8H A;  1YJ9 T;  1M1K R;  1AEY A;  3LGL A;  1VQ6 T;  1XQH A;  2QTX A;  5KCH A;  1K0S A;  2QEX Q;  3Q1J A;  4FM4 B;  3H6Z A;  1UHC A;  4JJN K;  3QO3 A;  2G6F X;  3L1A A;  3ER0 A;  3UDC A;  1Q95 G;  1LPL A;  3LWI A;  2A28 A;  4HVV A;  1WGS A;  3CCR A;  1PHT A;  3OYH A;  4ME7 A;  3NMZ C;  1ZSZ B;  1AD5 A;  2BZ8 A;  3E19 A;  3OSV A;  4R0K A;  4M78 G;  1LJO A;  1M3C A;  1X01 A;  4A4E A;  3ZFJ A;  1TG0 A;  2NUZ A;  4C0D C;  2E3I A;  3QDF A;  4PJN A;  4R56 A;  3JRZ A;  1YIT Q;  3OS0 A;  2J6F A;  4E6R A;  3CCJ T;  1RI9 A;  3M0T A;  3OA6 A;  2DO3 A;  3ZEH A;  3CME Q;  1N5Z A;  4CI0 C;  3MET A;  3OYK A;  1W4S A;  2BKD N;  1GCP A;  1D0Z A;  3TRE A;  4AG1 C;  1OX9 A;  1K8A U;  3G71 T;  3E1S A;  3QJY A;  2HSP A;  1LOJ A;  2RQT A;  4WCI A;  1WPY A;  2JTE A;  3FLG A;  2RJE A;  1YJN T;  2HZY A;  1K73 U;  4QQG A;  4QW2 A;  4J9E A;  4OB3 B;  2KVQ G;  3J80 E;  3RER A;  1JO8 A;  5FWC A;  1JEG A;  4EMK B;  3HL8 A;  2RK1 A;  2XMF A;  5GAN g;  2X4W A;  3EGX A;  1VOM A;  2EGE A;  2F2V A;  4C5H A;  2C0T A;  1BI0 A;  5D6X A;  4MML A;  1U3O A;  2HMA A;  1NG2 A;  2FG0 A;  1N9S A;  1X6B A;  3OS1 A;  2KRM A;  2MOX A;  5CCA A;  2GTO A;  3VYG A;  2PUO B;  2CSI A;  4M78 B;  3X20 B;  3JCM g;  1TUD A;  1EZZ B;  2LX7 A;  5CKH A;  4M77 C;  4V2S A;  1PSE A;  1W1F A;  2L8D A;  2F1L A;  3CCQ A;  2V26 A;  3O8V A;  1YWP A;  2F69 A;  1FMK A;  2RK2 A;  2PNI A;  1PKT A;  1R77 A;  1B07 A;  3RMS A;  3RKW A;  3V7C A;  4L5G A;  3QPH A;  5GAN 7;  2O2O A;  2PU9 B;  2F2X A;  3QYG B;  1VQP A;  3PE0 A;  3I5S A;  4EPC A;  2R57 A;  2VYT A;  2RB6 A;  3EGD B;  5LJ5 j;  3LW5 E;  3L2W A;  2K7A A;  3UT1 A;  1KK7 A;  2HSE B;  1H3H A;  4LE9 A;  3CCR T;  2QA4 A;  4JLI A;  2HCK A;  4RTZ A;  5FWB A;  3E9G A;  1OOT A;  3R6O A;  4F7U A;  2JT4 A;  3BDU A;  1VYT A;  4RKU E;  1YHQ A;  4N4G A;  3PIO A;  2EYW A;  2VUB A;  1I0C A;  1YJW Q;  5GMK j;  4MDW A;  1MV3 A;  3S3O A;  2DXU A;  3CC2 Q;  1RAF B;  2DRM A;  3VJP A;  3VS3 A;  2KNB B;  4Z88 A;  2DJQ A;  2EBP A;  3H41 A;  1GRI A;  1KSW A;  2P4T A;  1SF9 A;  4XK8 E;  1R8O B;  1IHV A;  3CD6 T;  1RLP C;  3V8L A;  4LD9 K;  2E5K A;  3PNW C;  4Y28 E;  4CC2 A;  2AK5 A;  1QWE A;  4TVR A;  2CH4 W;  2GFA A;  1CKB A;  1N8R C;  2LCS A;  1H92 A;  4M78 E;  3CBP A;  3CC7 A;  3JCM b;  5FW9 A;  4RTX A;  2H3E B;  3OYA A;  2DYI A;  4J9B A;  5GAN 4;  4KUI A;  1GFC A;  3UA6 A;  4DEY A;  1LVK A;  3IQL A;  3V7R A;  1Q82 C;  1PCX A;  1QLY A;  2EW3 A;  1WLP B;  2WSF E;  2CRE A;  1BU1 A;  2JMC A;  1M9S A;  1KFZ A;  4BI3 A;  2DL3 A;  1NEG A;  1AT1 B;  4M75 F;  1UUE A;  3FB9 A;  4MZT A;  3CCS Q;  5DY9 A;  1VQM T;  4C8Q E;  3AT1 B;  1ZA1 B;  2LCC A;  2IPO B;  3CC4 A;  1G3T A;  4M7A F;  2JNG A;  3OYY A;  1M90 R;  2LQ8 A;  2RJD A;  1Y07 A;  3QJ6 A;  2QG9 B;  1TOV A;  4A4G A;  1JXO A;  1KD1 U;  3CCQ T;  4PJJ A;  1WX6 A;  3RR6 A;  2R58 A;  3L42 A;  2K4Y A;  4GY5 A;  5GAN 6;  2DX1 A;  1AZG B;  3WXM B;  1S72 Q;  1VQP T;  1U1S A;  1WJQ A;  2JUF A;  1WJR A;  1M5Q 1;  2QI2 A;  2V8J A;  1VQ4 A;  3M0Q A;  1BIA A;  4OMF B;  2W0Z A;  1WDX A;  4JRP A;  1OI1 A;  5FU7 C;  2YWW A;  1JXM A;  5IHK A;  4CC4 B;  3J7A F;  2QA4 T;  1RUW A;  3C95 A;  4LUD A;  3M57 A;  3MEU A;  1EFN A;  3OYI A;  1N9R A;  5GAN 8;  1YHQ T;  3A8O B;  3DB3 A;  3EGU A;  1WIE A;  2P0K A;  2QAZ A;  1QKX A;  4L6V 5;  2YUN A;  2DM1 A;  5A0D A;  3SEM A;  4F7U G;  2YSQ A;  1WHH A;  2DLP A;  2PVG B;  1Q82 U;  2P84 A;  3C4S A;  5GMK m;  2KBT A;  4D8K A;  3EFO A;  3S3N A;  2JMA A;  3QUI A;  3CCU A;  4XU0 A;  1VQO A;  2RHI A;  3KUF A;  1HSQ A;  4AMC A;  2RHU A;  2ECZ A;  1VQL A;  4RTU A;  2DER A;  1SEM A;  1RAE B;  5EG2 A;  3CC7 T;  1SHG A;  2JZ2 A;  3OB9 A;  3VS7 A;  3OSS C;  2C0I A;  1AWX A;  1MHN A;  2JN0 A;  3OYG A;  1UE9 A;  4ELZ C;  4F04 B;  2YDL A;  3EG2 A;  2QYZ A;  1IGU A;  4C8Q C;  1W2B S;  2BE7 D;  2DVE A;  2KRS A;  5KYW B;  3WVD B;  4HT9 A;  3MP1 A;  1MMN A;  2COW A;  2K5I A;  2XG8 D;  4LDY A;  2K6D A;  4J8O A;  3NHN A;  3HSB A;  4YTL A;  1IZ6 A;  3CC4 T;  1VQK A;  1B34 A;  2QK0 A;  1FMW A;  3CPW A;  1MUZ A;  1Z9Q A;  4F7U B;  5CKD A;  4J9I A;  1OYX A;  3EG0 A;  4C0D B;  4RCC A;  1HD3 A;  1MMG A;  3PVQ A;  1KQ1 A;  3A5Z B;  2FO0 A;  3OW2 S;  1G5V A;  3QSU A;  4J9D A;  3VS1 A;  4BUG A;  1VIF A;  4F16 A;  4DOV A;  2KRO A;  4OGC A;  1OUL A;  3QHS A;  4C92 E;  1NYG A;  3EH2 A;  3G4S Q;  3UPU A;  2FZG B;  1VQ4 T;  2R5A A;  3NFC A;  1JJ2 S;  2QDY B;  4DA4 A;  1GXI E;  2M16 A;  4J6X A;  4FYW B;  2GF7 A;  2ZPH B;  3RNJ A;  5FRN A;  3VS5 A;  2KEA A;  4JPB W;  1WNL A;  5I11 A;  4AG2 C;  3V7S A;  1UEB A;  2LNH B;  2QQR A;  5GAO q;  4QT7 A;  3OYN A;  3MP8 A;  2A7Y A;  4MDX A;  2W10 A;  2GGR A;  2ZAE A;  1X2Q A;  4HCK A;  4J7F A;  2DMO A;  3BFM A;  2RH2 A;  4ZN3 A;  1YJ9 Q;  1NJI C;  2RHX A;  2A37 A;  1VQ6 Q;  1FXX A;  3RMQ A;  4J6Y A;  4XQ3 A;  2NYS A;  3QZ5 B;  3RKY A;  2Y4Y A;  4NL3 A;  1NE8 A;  1X43 A;  2FPF A;  5AT1 B;  1UGS B;  3CCU T;  4VUB A;  2OJ2 A;  3GBQ A;  1VQO T;  4M77 B;  2M02 A;  2DFU A;  1VQL T;  1M3A A;  2FRW A;  1AVZ C;  3PMT A;  4CRI A;  3OYL A;  3JB9 G;  1UG1 A;  5J39 A;  3L2U A;  4KGX B;  1K76 A;  1OZ3 A;  4C8Q A;  1K9A A;  4F7U E;  1M4Z A;  4PNO A;  4A63 B;  4OB0 B;  5LJ5 g;  2ED1 A;  2RJF A;  2MI6 A;  3HPW A;  1G83 A;  5HY6 A;  3DB4 A;  2OTJ Q;  4FIB A;  3A8G B;  4RMO A;  4HCZ A;  4GLM A;  2X4Y A;  3CCJ Q;  3FC3 A;  4UC4 A;  5LJ3 d;  4RG8 A;  2DET A;  3TSW A;  2L2P A;  2E3H A;  3VV0 A;  1KHI A;  5GAM j;  3OW2 P;  2M1H A;  2CZ1 B;  4LDW A;  2LC4 A;  4M7D C;  2JXB A;  4X9C A;  3CMA Q;  5KH6 A;  3AHU A;  2LRQ A;  3G71 Q;  1JB0 E;  4FSX A;  1FYN A;  1I8F A;  2EIF A;  1SPK A;  2QQ9 A;  4JJD A;  1D0Y A;  1VQK T;  1OZ2 A;  3DLM A;  2CT4 A;  1YJN Q;  2DD4 A;  1JJ2 P;  4C92 C;  5L23 A;  2EQM A;  4KUD K;  2LJ0 A;  1PD0 A;  1K9M R;  2KT1 A;  5M9O A;  1QKW A;  1YIJ A;  1C0M A;  4OB1 B;  2X4X A;  3CCM A;  2EJG A;  5CIU A;  2RI3 A;  3LWH A;  2GCX A;  3FDR A;  1QP2 A;  2A36 A;  2EKO A;  1UGP B;  1NJI U;  3JB9 I;  4C0Z A;  2L5Q A;  5KE3 A;  4FW2 A;  3JCM J;  1VQ8 A;  2DTO A;  3EFO B;  3ZBD A;  3V8J A;  4EDU A;  5ECA A;  3GIB A;  4M78 F;  3NTK A;  3U23 A;  4M77 E;  4BB7 A;  1O9S A;  2J06 A;  1Q86 R;  2QEX A;  5FRM A;  3CQT A;  4WF2 A;  2RI2 A;  2J6K A;  4C0G A;  4J9F A;  1D1B A;  1M1K C;  3EFR A;  2LTO A;  2OTL A;  2DK3 A;  2XKO C;  5I21 A;  2BIV A;  2WSE E;  2DEU A;  1WXB A;  2ZCF B;  1ZBJ A;  2ATC B;  4NOY A;  4ATO A;  2H8H A;  4PLI A;  4E7K A;  4JJC A;  4KT0 E;  2ESW A;  3VS6 A;  1RI0 A;  3QWX X;  4AT1 B;  3A98 A;  1V1C A;  3VS2 A;  2XHC A;  3CCR Q;  1ZA2 B;  4XU2 A;  3CPF A;  4PJO C;  4BE0 A;  1VYV A;  1B3Q A;  8ATC B;  5CK9 A;  1KJW A;  3CME A;  1K1Z A;  4ANJ A;  4CC7 A;  1BCO A;  1AZE A;  5KYU B;  3FJP A;  1B34 B;  3OMG A;  3CXC S;  3R6N A;  1GL5 A;  2XIC A;  4AFS C;  3HRS A;  4C5E A;  2JTF A;  5LJ3 e;  2YUQ A;  4C8Q G;  2AZS A;  2QTV A;  1QVG S;  1W6X A;  5GAO l;  2LNV A;  1E6H A;  2PQW A;  3CCE A;  5FU7 B;  1TS9 A;  1QVF S;  5LJ3 h;  4XU1 A;  2RD1 A;  3CD6 Q;  1C1A A;  2KSS A;  1M1G A;  4C92 A;  1AOJ A;  2P4R A;  4JDS A;  1UGQ B;  3OS2 A;  4LN2 A;  1I5L A;  4XTZ A;  1I81 A;  2XDP A;  5IH2 A;  4NS5 A;  3JCM W;  1W70 A;  2GBQ A;  2VAS A;  1YBY A;  1YIJ T;  2GFU A;  2QQA A;  1OQK A;  3CCM T;  4JUV A;  2QXF A;  2DBK A;  1AWO A;  1M1K U;  2CP2 A;  3OYJ A;  2CKK A;  2DZC A;  1Z9Z A;  4Q5W A;  1RL2 A;  4BI4 A;  1TWB A;  1UHF A;  1BI2 A;  1QW1 A;  4LXC A;  3WVE B;  5DM7 R;  3L2Z A;  2D9T A;  1VQ8 T;  1M3B A;  1VQM Q;  1XOV A;  2AIR B;  5KYW A;  2EAY A;  1KQS P;  5GMK i;  4HA8 A;  2ZPB B;  2RHY A;  2XI9 A;  3M0S A;  2CP5 A;  2F2W A;  2QEX T;  2K3B A;  4E7S A;  2L89 A;  3MEV A;  3CCQ Q;  2OTL T;  2HQE A;  1NYF A;  1WHJ A;  1BYM A;  2DIG A;  3PIP A;  4C8Q B;  3A8M B;  2KE9 A;  1WXU A;  3VRY A;  3GNF B;  5LJ5 h;  1BK2 A;  5GMK e;  1WHM A;  3CXC P;  2HAX A;  1VQP Q;  1PC0 A;  3M4G A;  3PGG A;  3VKI A;  2ENM A;  5CQX A;  2AT1 B;  1YJW A;  4QQ6 A;  2Y90 A;  3JB9 D;  3TCJ A;  4JZ3 A;  4PJO A;  3CCL Q;  1NLO C;  2B86 A;  2DYB A;  1KD1 R;  3CC2 A;  1QVG P;  2EQJ A;  4EMG A;  5GMK h;  2D8H A;  1H64 1;  1IGQ A;  4ELY C;  2QA4 Q;  1O75 A;  2RF0 A;  1SKU B;  1QVF P;  5GAN d;  4IUQ A;  3N5B B;  1Y0M A;  3CME T;  5GAN 3;  3L2R A;  1VUB A;  2O4X A;  2HKN A;  4KGV B;  2GQV A;  2SEM A;  2KI7 A;  1SRL A;  4OB2 B;  2ROL A;  1HXD A;  1MNE A;  3KXT A;  4XTX A;  2MPX C;  4OGE A;  2LCL A;  4E47 A;  3I55 A;  2RQW A;  3M0P A;  5D6Y A;  3M0U A;  2KXC A;  1EX4 A;  4DBQ A;  1MMA A;  3T9N A;  3CCE T;  1OV3 A;  3UWN A;  2BE9 B;  3JCM X;  2K2M A;  1WFW A;  3I56 Q;  1X75 C;  3C94 A;  1J3T A;  2D0Q B;  1QQJ A;  1D1A A;  2QGF B;  5KCO A;  3H9N A;  1M27 C;  4B6M A;  4QQD A;  2E5Q A;  2HEQ A;  3MJX A;  4FU6 A;  4JRI A;  1Q81 R;  3LYI A;  2OAU A;  4PLL A;  3M5A A;  3BW1 A;  3VS0 A;  2DXB A;  4C92 G;  1T3L A;  3CCV Q;  1IRE B;  4HVU A;  2ZPI B;  4M77 A;  1AWJ A;  1SG5 A;  3A1P A;  2LZ6 B;  3EH1 A;  3MEW A;  1U8R A;  2MYS A;  2EWN A;  1T3S A;  2LDM A;  3C0C A;  1QCO A;  1ZQ1 A;  2MK5 A;  5CVI A;  4D8D A;  2RO0 A;  1VQ9 Q;  5FU6 C;  2FHD A;  4DBF A;  4PFP A;  5CKB A;  1M90 C;  1NZ9 A;  2V8K A;  2NUT B;  5KE2 A;  2DJZ A;  1BI3 A;  2ROT A;  3URG A;  3CC4 Q;  4Z02 A;  4E2F B;  1RAA B;  3QYH B;  2A08 A;  1ZUU A;  4F7U F;  1MGQ A;  2XK0 A;  2KYB A;  1XTD A;  4BY6 C;  4HKE A;  5GAM g;  4M78 D;  2EQU A;  1W2B A;  1ZSG A;  1VQN Q;  3E9F A;  1GBQ A;  1X69 A;  2YLB A;  1WI7 A;  5FRO A;  1FX7 A;  4RG2 A;  5LL6 S;  2OAW A;  2AKK A;  2GTJ A;  4JLG A;  1N8R U;  4M7D B;  3SHW A;  1YJW T;  1VQ4 Q;  1M1F A;  3X28 B;  5GAN e;  1MMD A;  5IHI A;  5A0L A;  3QDR B;  6AT1 B;  3CC2 T;  2ZPE B;  5DLO A;  1UB4 A;  5KYN A;  4C92 B;  1OU8 A;  2MWO A;  3OY9 A;  5GAN h;  4PJO G;  2COY A;  3JB9 J;  4C8Q D;  2QQS A;  3SWN C;  1ZBX A;  4Z89 A;  2RJC A;  3JCM e;  5CR2 A;  5L8R E;  2LQN A;  2I2L A;  2OX7 A;  4NL2 A;  3M9Q A;  2K2V A;  3I55 T;  3PMI A;  4DEX A;  1Q7Y R;  2M51 A;  2DE0 X;  2RQV A;  3MO8 A;  1KQ2 A; 
#chains in the Genus database with same CATH homology
 1K76 A;  1N5Z A;  1K9A A;  4GBQ A;  1UFF A;  2DNU A;  1PRL C;  1GCP A;  4A63 B;  1BBZ A;  2ED1 A;  4AG1 C;  3NGP A;  1G83 A;  2HSP A;  4GLM A;  2RQT A;  4WCI A;  2O31 A;  2JS2 A;  1WXT A;  2JTE A;  2FEI A;  4F17 A;  4J9E A;  3TSW A;  2L2P A;  4OMP A;  1JO8 A;  1SSH A;  2BZY A;  2DA9 A;  3I9Q A;  5FWC A;  3FJ5 A;  1JEG A;  1K4U S;  2JXB A;  2L3Q A;  1CKA A;  4FSS A;  2XMF A;  2DL7 A;  1FYN A;  2L0A A;  2X3W D;  1SPK A;  1UEC A;  2LP5 A;  2EGE A;  2F2V A;  4JJD A;  2C0T A;  2CT4 A;  5L23 A;  1M8M A;  1U3O A;  1NG2 A;  2LJ0 A;  2FG0 A;  2DL8 A;  2FRY A;  2KT1 A;  1X6B A;  1QKW A;  2EKH A;  1G2B A;  2JM8 A;  2HDA A;  2KRM A;  2EVR A;  2LJ3 A;  2I0N A;  2MOX A;  3JV3 A;  2GTO A;  2J05 A;  2KT8 A;  2LMJ A;  1ZLM A;  2CSI A;  2ABL A;  1TUD A;  2D1X A;  2LX7 A;  2EGA A;  5GJW B;  2A36 A;  2JM9 A;  4RTV A;  1W1F A;  1MV0 B;  2CDT A;  5GJV B;  1YWP A;  1U5S A;  1FMK A;  3ZL7 C;  2GQI A;  4OMQ A;  2PNI A;  4JZ4 A;  1PKT A;  2KXD A;  2J6O A;  1B07 A;  5ECA A;  2EPD A;  1PNJ A;  2CUB A;  3U23 A;  2O2O A;  2IIM A;  2F2X A;  2J06 A;  3QWY A;  3PE0 A;  3I5S A;  2MIO A;  4KRT A;  1M30 A;  3CQT A;  2J6K A;  4J9F A;  1PRM C;  2K7A A;  2KRN A;  2YUO A;  1NM7 A;  1H3H A;  4LE9 A;  2HCK A;  4RTZ A;  5FWB A;  1OOT A;  1WXB A;  2JT4 A;  1ZBJ A;  2BTT A;  1VYT A;  2D8J A;  1E6G A;  1I07 A;  2H8H A;  2JS0 A;  1VA7 A;  4JJC A;  2DRK A;  2ESW A;  1RLQ C;  2EYW A;  3VS6 A;  1I0C A;  4RTT A;  4AFU C;  1YN8 A;  3VRZ A;  3H0F A;  3QWX X;  1KIK A;  1MV3 A;  2NWM A;  3A98 A;  2O9V A;  1V1C A;  5HCK A;  1SRM A;  2DRM A;  3VS3 A;  3VS2 A;  2KNB B;  1X2K A;  4M4Z A;  1A0N B;  4LNP A;  4Z88 A;  1SHF A;  2DJQ A;  2M0Y A;  2EBP A;  3H41 A;  1GRI A;  1KSW A;  1B3Q A;  1VYV A;  1KJW A;  1WA7 A;  1K1Z A;  4CC7 A;  1AZE A;  4RTW A;  3I35 A;  3R6N A;  1GL5 A;  4AFS C;  4J9C A;  1RLP C;  5I22 A;  2AKL A;  2RNA A;  2E5K A;  4CC2 A;  2AK5 A;  1QWE A;  1YP5 A;  2YUQ A;  1YNZ A;  2CH4 W;  2X3X D;  1CKB A;  1ZUY A;  2AZS A;  2RQU A;  2JW4 A;  2LCS A;  1H92 A;  1W6X A;  2LJ1 A;  3UA7 A;  1E6H A;  1GCQ C;  1UJY A;  1PWT A;  2BZX A;  5FW9 A;  1JQQ A;  4RTX A;  1WYX A;  1ARK A;  1X6G A;  4J9B A;  1U06 A;  1GFC A;  3UA6 A;  1ABO A;  4DEY A;  3IQL A;  1QLY A;  1ZUK A;  2DF6 A;  2EW3 A;  3H0I A;  2DIL A;  1AOJ A;  2P4R A;  1Y57 A;  1OPL A;  1WLP B;  2CRE A;  1BU1 A;  3TSZ A;  2JMC A;  2FPD A;  2K79 A;  3VS4 A;  4LN2 A;  1KFZ A;  2CUD A;  2RMO A;  2EGC A;  1VYU A;  1T0J A;  2DL3 A;  1NEG A;  5IH2 A;  3ULR B;  1UUE A;  1W70 A;  2GBQ A;  2OI3 A;  2QDL A;  3LH5 A;  3THK A;  2DBK A;  1AWO A;  2LQW A;  4K11 A;  1Z9Z A;  2D0N A;  1UHF A;  2KR3 A;  3TVT A;  1HJD A;  4AFQ C;  1JXO A;  4RTY A;  3REA B;  1WX6 A;  1M3B A;  1XOV A;  3EG1 A;  2EYX A;  2DX1 A;  1AZG B;  2K9G A;  3M0S A;  1UTI A;  2F2W A;  2K3B A;  2EYY A;  3M0Q A;  1OEB A;  2W0Z A;  2O88 A;  1NLP C;  1WDX A;  2KYM A;  1NYF A;  2KE9 A;  4ORZ A;  1JXM A;  1WXU A;  2EYZ A;  4CC4 B;  5IHK A;  3VRY A;  1ZX6 A;  1BK2 A;  1RUW A;  4LUD A;  1EFN A;  3PVL A;  1E7O A;  4F14 A;  4OMM A;  1ABQ A;  2ENM A;  2C0O A;  1TUC A;  2KGT A;  3EGU A;  1WIE A;  1QKX A;  4EIK A;  2YUN A;  2DM1 A;  1OPK A;  3EHQ A;  4JZ3 A;  1JU5 C;  2V1Q A;  3SEM A;  2VWF A;  1NLO C;  2YSQ A;  2B86 A;  2DYB A;  2ED0 A;  5IHN A;  1LCK A;  3UAT A;  2D8H A;  3O5Z A;  4X1V A;  2DLP A;  2GNC A;  2DL5 A;  2RF0 A;  2DBM A;  1CSK A;  2KBT A;  5EC7 A;  4D8K A;  1Y0M A;  2JMA A;  2YUP A;  3KFV A;  5IXF A;  1X27 A;  2PZ1 A;  1GCQ A;  2RPN A;  2SEM A;  1SRL A;  2ROL A;  4IIM A;  2DL4 A;  4OMN A;  2AZV A;  1HSQ A;  4Z8A A;  3NPF A;  2RQW A;  3M0P A;  2L3S A;  2ECZ A;  4RTU A;  1SEM A;  2RQR A;  3M0U A;  2KXC A;  1PKS A;  2PTK A;  1OV3 A;  1SHG A;  3VS7 A;  4HVW A;  2SRC A;  2C0I A;  1AWX A;  2K2M A;  1WFW A;  1J3T A;  1UE9 A;  1T0H A;  2J7I A;  1M27 C;  2YDL A;  3EG2 A;  2HEQ A;  1H8K A;  2V1R A;  2KRS A;  3REB B;  2MCN A;  3VS0 A;  1T3L A;  4HVU A;  1S1N A;  2K6D A;  3EHR A;  1QWF A;  3NHN A;  1AWJ A;  2VKN A;  2CT3 A;  4LUE A;  2LZ6 B;  3H0H A;  1UDL A;  1I1J A;  3RBB B;  1T3S A;  4OMO A;  3C0C A;  1UGV A;  4J9G A;  3M0R A;  1MUZ A;  1Z9Q A;  4IIO A;  4D8D A;  4J9I A;  2CH4 A;  3EG0 A;  4J9H A;  2L3P A;  3UF4 A;  4Y92 A;  1HD3 A;  1UJ0 A;  2DVJ A;  1GBR A;  4CC3 A;  3PVQ A;  4ESR A;  4OML A;  2FO0 A;  2ROT A;  2FPE A;  4J9D A;  3VS1 A;  4F16 A;  3I5R A;  2KRO A;  2A08 A;  1NYG A;  1ZUU A;  4AFZ C;  2KYB A;  1QCF A;  2RN8 A;  1ZSG A;  1GBQ A;  1X69 A;  1WI7 A;  3RNJ A;  3VS5 A;  2KEA A;  1IO6 A;  1AEY A;  2OAW A;  4JPB W;  2AKK A;  5I11 A;  4AG2 C;  1K0S A;  2GTJ A;  2YT6 A;  1UHC A;  2LNH B;  1AWW A;  1K0X A;  4QT7 A;  2G6F X;  3SHW A;  2VVK A;  2O9S A;  5IXB A;  2W10 A;  2GGR A;  5IHI A;  1BB9 A;  1X2Q A;  2A28 A;  4RUG A;  4HCK A;  4HVV A;  4JJB A;  2DMO A;  1PHT A;  3NMZ C;  1AD5 A;  1GFD A;  2A37 A;  2BZ8 A;  2EQI A;  4R0K A;  2CSQ A;  1M3C A;  4Z89 A;  1X43 A;  2FPF A;  2LQN A;  1TG0 A;  2NUZ A;  4ZNX A;  3EG3 A;  2OJ2 A;  3GBQ A;  4HXJ A;  1YWO A;  1M3A A;  2FRW A;  4DEX A;  1AVZ C;  1NEB A;  2J6F A;  2M51 A;  4E6R A;  1YCS B;  1UG1 A;  2DE0 X;  1RI9 A;  2RQV A;  3M0T A;  2HBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...