1YWOA

Phospholipase cgamma1 sh3 in complex with a slp-76 motif
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
SAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, signaling protein
molecule keywords 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase ga
publication title Structural Basis for Recognition of the T Cell Adaptor Protein SLP-76 by the SH3 Domain of Phospholipase Cgamma1
pubmed doi rcsb
source organism Rattus norvegicus
total genus 12
structure length 55
sequence length 55
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ywoA00
3UF4A 1U5SA 4OMOA 1U06A 3H0HA 3PE0A 2C0TA 1JO8A 2L2PA 1WYXA 1WA7A 4J9CA 2CDTA 1ABOA 1ZUKA 1PKTA 2FPDA 1SRLA 1Y57A 2ESWA 5L23A 4LUDA 2SEMA 4J9EA 2DL7A 4J9DA 2XMFA 2BTTA 2J6FA 2DX1A 3I5RA 4AG1C 2A28A 3GBQA 1BB9A 4RTVA 1JEGA 1JXMA 2QDLA 2FPEA 3FJ5A 1VYUA 2YT6A 3NHNA 2K6DA 3VS4A 2ROLA 2V1QA 3A98A 3H0FA 1PHTA 1YWOA 1G83A 2KGTA 2EBPA 2L0AA 1OPKA 1UDLA 1VA7A 2DL4A 3KFVA 2KEAA 4RTUA 3U23A 1W70A 1W6XA 5ECAA 1AD5A 2AZVA 2AK5A 1AWJA 3VS5A 1GFCA 2CT4A 5EC7A 1CKBA 2B86A 3O5ZA 2A08A 1NEGA 1SPKA 3VS1A 1NG2A 1M27C 1AZGB 4LUEA 2RQTA 3H0IA 2KRMA 3PVQA 2J6KA 1AWWA 1ZUYA 1WI7A 4OMQA 2LNHB 4JZ3A 2JM8A 3C0CA 1HSQA 1X43A 2KT8A 1EFNA 2RPNA 1WIEA 2KRNA 2ROTA 4JJDA 3REAB 1BBZA 4Z88A 1VYVA 1SEMA 3RBBB 1WDXA 1GFDA 2EVRA 2JTEA 2D1XA 4HVVA 2HBWA 4F16A 1W1FA 3VS3A 4J9FA 1TG0A 5FWCA 1ABQA 2PZ1A 3EG2A 1M8MA 2KRSA 1MUZA 4DEXA 1QWEA 2JMCA 1NYFA 2LZ6B 4K11A 2DBMA 5IHKA 4HVWA 2CH4W 1UJYA 2BZ8A 3EG3A 1RLPC 2A36A 1PNJA 2MCNA 2EQIA 2D8HA 3REBB 1XOVA 1UUEA 3TSWA 3UATA 3H41A 2J6OA 1RLQC 2DJQA 1S1NA 1YN8A 1T0HA 1M3CA 4GBQA 3IQLA 1SSHA 2DL8A 2J7IA 1H92A 2F2XA 1VYTA 4A63B 2EYXA 1K9AA 1WXTA 2V1RA 2CSIA 3UA7A 2JS0A 1BU1A 1JU5C 2ENMA 1UFFA 2RF0A 1AOJA 2JXBA 4HCKA 1K4US 3VRYA 3RNJA 4D8DA 2LQWA 2KBTA 2KYMA 4RTWA 4RTZA 3JV3A 1U3OA 2VKNA 1I1JA 4IIMA 4CC4B 5IHNA 1RI9A 2EKHA 2RQWA 2W10A 4R0KA 1N5ZA 2LJ1A 1GRIA 1AZEA 1E7OA 2DRMA 2ECZA 4AFQC 1OOTA 1AWXA 2GBQA 4HVUA 2VWFA 4J9IA 2DNUA 1K1ZA 1ZBJA 1T3SA 1PKSA 2MOXA 2K7AA 3EGUA 2YUOA 2RQVA 1RUWA 2CH4A 1NLPC 4OMPA 2FO0A 2RN8A 1YCSB 5IHIA 1K0SA 2K79A 1GCQC 1M3BA 1QKWA 2FRYA 3ZL7C 2KXCA 1NLOC 1WXUA 1UE9A 3VRZA 2JT4A 2GNCA 1A0NB 2HDAA 2DYBA 2F2WA 1TUCA 1ZUUA 2P4RA 2HEQA 1I0CA 2LP5A 2O88A 1OPLA 1CKAA 3THKA 2DM1A 2I0NA 2JS2A 2HSPA 2NWMA 2GQIA 2L3QA 1K76A 3EG0A 3PVLA 4EIKA 2JW4A 1X6GA 1YNZA 2LJ3A 1X69A 2CT3A 4M4ZA 1PRLC 1KSWA 1JXOA 1E6GA 2O31A 1NM7A 2FRWA 2KXDA 2GTJA 5I22A 1QWFA 1YWPA 2EGEA 3VS7A 2C0IA 1UHCA 2DL5A 2DBKA 1WXBA 1T3LA 1GL5A 3QWXX 3LH5A 5FWBA 3SEMA 3VS2A 4CC7A 2K3BA 4CC2A 2DILA 2X3WD 2IIMA 1PWTA 3M0TA 4RUGA 2RMOA 1CSKA 1SHGA 2CREA 5GJWB 1FMKA 1PRMC 3M0UA 5FW9A 1QKXA 2G6FX 1K0XA 4D8KA 2GTOA 1GBQA 1NEBA 1QLYA 5IXFA 3M0RA 2YSQA 1AVZC 2ABLA 2GGRA 2PNIA 4HXJA 4Z8AA 3VS0A 1BK2A 2LJ0A 2O9SA 3CQTA 3TSZA 5I11A 4J9GA 1B3QA 1ZLMA 2KT1A 3NGPA 1SRMA 2A37A 1Y0MA 3NPFA 2YUNA 2BZYA 1KJWA 2VVKA 4ORZA 2LMJA 1V1CA 4DEYA 2LQNA 2F2VA 4IIOA 2KROA 4OMLA 2YUPA 4F17A 1MV3A 2C0OA 2DE0X 1QCFA 2AZSA 2O2OA 4E6RA 4LE9A 4JPBW 1FYNA 2DVJA 3TVTA 1I07A 1UGVA 5HCKA 1B07A 1M30A 2OJ2A 2E5KA 1UECA 4LNPA 4AFSC 2M51A 1H3HA 2DA9A 4AG2C 3NMZC 3M0SA 4J9BA 1YP5A 4JZ4A 4J9HA 1H8KA 2H8HA 1OV3A 1UTIA 1M3AA 4X1VA 2ED0A 1HD3A 2EW3A 3EG1A 4AFZC 4CC3A 1ARKA 1GCPA 2FG0A 1KIKA 2L3SA 3EHRA 1AWOA 1AEYA 1GCQA 1HJDA 2OAWA 2CSQA 2EYWA 2RQUA 2L3PA 5GJVB 4RTTA 1LCKA 2FPFA 1GBRA 1T0JA 4QT7A 2MIOA 1MV0B 3I35A 3I9QA 1NYGA 3VS6A 2LCSA 2KR3A 4RTXA 1SHFA 2FEIA 2K2MA 1X6BA 2AKKA 4OMNA 1Z9QA 3QWYA 3I5SA 2YUQA 2RNAA 4Y92A 3SHWA 2DLPA 1IO6A 2DMOA 2DF6A 2LX7A 4LN2A 2KE9A 1UJ0A 2PTKA 1Z9ZA 2JM9A 1JQQA 1WFWA 3ULRB 2O9VA 3EHQA 5IXBA 2OI3A 2J05A 4ZNXA 2CUDA 2EPDA 2K9GA 2EYZA 1WX6A 1G2BA 1ZSGA 1KFZA 4JJCA 4WCIA 2EGCA 3R6NA 2HCKA 4KRTA 1ZX6A 4AFUC 1WLPB 2EGAA 1X2KA 2BZXA 4OMMA 2W0ZA 1X27A 2X3XD 4ESRA 4Z89A 1X2QA 1UHFA 2RQRA 2NUZA 2AKLA 2SRCA 4JJBA 4RTYA 2J06A 2DL3A 3M0QA 1OEBA 3M0PA 1TUDA 1UG1A 4GLMA 2JMAA 2D0NA 4FSSA 2YDLA 2ED1A 5IH2A 2D8JA 2CUBA 2KYBA 2M0YA 1J3TA 3UA6A 4F14A 2DRKA 2KNBB 2EYYA 1E6HA
chains in the Genus database with same CATH superfamily
2P84A 5AYFA 3JCMW 3HSBA 1WA7A 1I81A 3RMSA 5CKEA 4FYWB 1SRLA 3N5BB 4M7DG 2SEMA 2DL7A 1VUBA 2XMFA 5CIUA 3GBQA 3HTRA 5I2SA 1BB9A 5GANd 2IVWA 1WNLA 4VUBA 5GAN2 5GAOp 2FPEA 2KY9A 1VQ4Q 4F7UB 3GP8A 2RH2A 2KVQG 3VS4A 3CCSQ 4KGZB 2YXYA 1SKUB 1PHTA 1G83A 5KYWB 3VV0A 5LL6S 3SWNB 4XTXA 2L0AA 4II1A 2EQUA 2RHYA 3JSCA 4B9WA 2KEAA 4J7IA 1W70A 5GAOn 2COZA 1W6XA 5HK0A 3G71A 2AK5A 2JJ9A 3VS5A 1GFCA 2CT4A 4C5IA 2QGGA 2B86A 3O5ZA 2CP7A 2A08A 1NG2A 1BCOA 3C4SA 4LUEA 2XD0A 1UB4A 2DZCA 4XU1A 5LJ3f 2X4JA 3VUZA 2J6KA 1OQKA 4PLLA 5GMKi 2K4YA 2E65A 2CP2A 4OMQA 3FB9A 4M7AA 3V7RA 3C0CA 1V29B 2RPNA 2QA4A 1WIEA 4IUTA 2ROTA 4M75A 1X75C 4Z88A 1SEMA 2DERA 1G3WA 3A8MB 2EVRA 3ME9A 2JTEA 4PKCC 4HKEA 3DKMA 2QXFA 4HVVA 4HT8A 4F16A 3CCVT 4C92C 3JB9I 2PZ1A 3FDRA 1Y7XA 4C8QC 1N9RA 5CKBA 4F7UE 3CCMA 4KGXB 2LC4A 3WXMB 4K11A 2CP5A 3LWIA 2DBMA 5IHKA 2NUPA 2HKQB 3QJ6A 4M7AF 1PCXA 5J39A 1UJYA 2MWPA 3TQ7P 3G4ST 3JCMJ 1N6AA 4M75F 1QVFP 3J80E 3L2VA 4MMLA 4M78G 1HXDA 2RA2A 4KUDK 3H41A 3QDFA 2J6OA 1RLQC 1OX8A 2HMAA 3ZBDA 1IREB 1G3YA 1PM3A 1VYTA 4A63B 1D1CA 3S6WA 4BUGA 1MNEA 1JU5C 1VQ7T 1UFFA 4OVAA 1FMWA 1VQLT 1WQWA 2JXBA 4XTZA 2WACA 3V8LA 5GANe 5A2QE 3RNJA 4D8DA 4ZN3A 3MJXA 2EKOA 2VKNA 4EPCA 2BE9B 1KD1C 4LDXA 2IPOB 2EKHA 4R0KA 1AZEA 4FYYB 1RAHB 5CKDA 2DRMA 2DZ9A 2DXTA 2X51A 4HVUA 4J9IA 1K1ZA 2QQSA 4NS5A 3TREA 1T3SA 5I2MA 3BDLA 4JLGA 3M4YA 5A0GA 2YUOA 3TCJA 5HK3A 1NLPC 1IRXA 4OMPA 2P0QA 5KH6A 2PVOB 5IHIA 4MZPA 1YJWA 5IT9E 1GCQC 3L2WA 1U1TA 1QKWA 2FRYA 2K3YA 1QP3A 2LNVA 3VRZA 2JT4A 4OGEA 3CC2T 4C8QB 1A0NB 1PD1A 3MEVA 1KD1U 2LP5A 1OPLA 4A53A 4FW2A 4HCCA 4F7UA 4ZGEB 3EG9B 1K76A 3CCUT 1X6GA 4LXCA 2ZPHB 4ELZC 3L2QA 1NM7A 2D0QB 1VQOT 2KXDA 2GTJA 3GPLA 1YWPA 3VS7A 1M8VA 1Q82C 3CCEA 4OF1A 2DL5A 5DLOA 1WXBA 2EWNA 3JCMh 5GAMh 3G4SQ 3OS1A 1C6VX 3LH5A 5FWBA 3VS2A 4F7UF 3BE3A 1N9SA 3H8ZA 4TVRA 2LDMA 2DILA 1MMDA 1D0YA 3UDCA 1UGRB 3L1AA 2VYTA 2HQEA 1PWTA 3M0TA 5GAN3 4FL6A 2RMOA 1SHGA 3CCLT 1PD0A 2R58A 1ZSZC 1VQLQ 4C8QE 1KQSP 2GTOA 2NYSA 2YSQA 4C5GA 4Z8AA 3VS0A 1BK2A 4A4EA 3OYAA 4ANJA 3CQTA 2FZGB 3TSZA 1ZHIA 4J9GA 2KT1A 2CP6A 1SRMA 1Q82U 2VXFA 2BZYA 8AT1B 1OX9A 2F69A 1V1CA 1JRIA 2F2VA 4LD6A 4IIOA 1KK7A 4OMLA 5GAMf 1KHIA 3OYKA 4ZGDB 2QEXT 2CP3A 4LE9A 2CS7A 1FYNA 3CCQQ 3OY9A 2RHXA 4M77G 1MMAA 1FMVA 2EQKA 1O9SA 1UGVA 1B07A 1M30A 4R55A 1R0BG 1C1AA 3GOXA 2M1HA 2DA9A 4E7KA 3CC2Q 2OTJA 5CQYA 1VOMA 3JCMQ 3JCMg 2RHIA 1OV3A 1UTIA 4BI8B 4X1VA 4BDYA 3OS0A 2AHJB 1ARKA 1U8RA 1KIKA 2XG8D 5KCOA 3M59A 2L3SA 5CVIA 1OYXA 1HK9A 3CCUQ 3CC4A 2VGMA 2L3PA 3NFCA 5D7UA 1GBRA 2MIOA 1UGQB 2DEQA 1YCYA 3OYEA 2ATCB 2KR3A 3G6ET 4AT1B 1X6BA 4BACA 4DOWA 2AKKA 4OMNA 3OYCA 1Z9QA 3QWYA 1ZSZB 2CZ1B 2RNAA 3CPWP 4M75C 2RI3A 1YHQT 3CC7Q 2H3EB 1UJ0A 4C8QA 1IGQA 2QGFB 2R57A 3CCLQ 1JQQA 2O9VA 2EIFA 2COYA 3EHQA 4E7SA 3WVEB 4ZNXA 2EYQA 2EPDA 2K9GA 1MNDA 2EYZA 1G2BA 3VJPA 3M57A 4PL6A 3HFNA 3DLMA 9ATCB 3CCVA 2MAMA 3LGLA 3JCMd 1ZX6A 1LNXA 4EMKB 2L5QA 3QYGB 1BKBA 4OMMA 2BZXA 4A4FA 3OYYA 1X27A 1GXIE 4ESRA 4C8QF 4KH1B 4BE2A 2F5KA 4FT4A 4RCBA 4PJOD 1TUDA 4GLMA 4M7DD 5GMKm 3A5ZB 1IGUA 2E64A 3L2RA 2QEXQ 2ED1A 4ZGJB 1QVGA 2CUBA 3VUBA 3V8JA 1K9MC 3UA6A 1QVGS 3OYGA 4OP0A 4NL3A 3L42A 2DPPB 1D1AA 4N4HA 1U5SA 1VQNT 2KDSA 2DK3A 1JO8A 2L2PA 3X24B 1RAAB 3CBPA 2X9HA 1VQ7A 1PKTA 2K5FA 3RKWA 3GNGA 4LUDA 4IURA 2ZAEA 2VGNA 5GAN6 4ELYC 1WQ7A 2J6FA 5LJ3j 2MYSA 2DD5A 2BUDA 4M7DB 2ZPEB 1KC8C 1VQPT 5FLXE 1X6OA 3JCMX 2K6DA 2ROLA 2V1QA 2DFUA 5GAOr 1VQ6Q 2OTLT 1VQ4T 3JB9H 3C94A 1VA7A 3P8DA 4KGVB 2MI6A 3KFVA 1M1KR 1K9MU 3CCST 4RTUA 1R77A 2V8JA 1AD5A 2ZZDA 2NLUA 4QQ6A 1WHHA 3Q1JA 2V8IA 5EC7A 1XTDA 3X26B 1NE8A 1YHQQ 1M27C 1AZGB 2GQVA 2RQTA 4BY6C 1ZUYA 1WI7A 3RKXA 3OYFA 3M4GA 1RAEB 3M53A 1D09B 1DJ7B 4JZ3A 2JM8A 5L8RE 5GANf 1HSQA 2KT8A 3CPFA 1KC8U 3OS2A 2KRNA 1QP2A 3JCMe 1BBZA 1VYVA 4L5GA 3RBBB 3JAME 1RAFB 4M7DE 4M78D 1K73C 2JZ2A 1MMNA 3VS3A 1ABQA 1LOJA 3EG2A 1VQOA 2EJGA 1VQMT 1NYFA 2LZ6B 2KI7A 1Q95G 2JVVA 4F04B 3J81E 4A4GA 4PFZA 1OZ2A 1AHJB 1YJNT 5FRMA 1ZSZA 2MCNA 1M90R 3REBB 1N27A 1UUEA 2IG0A 3MPUB 4KULA 3JB9J 5GAN5 3META 1S1NA 3F70A 1VQNQ 1T0HA 4E7JA 2J7IA 2CZ0B 2JUFA 1K9AA 2LT4A 3HHTB 2JS0A 1BYMA 1H3ZA 1O75A 1NJIR 3EGDA 3GF5A 5LJ3h 2EQMA 4HCKA 1W2BP 3CXCA 3SFMA 1K73U 2KBTA 3CXCS 4RTWA 1B34A 4PJOG 4RCCA 4EMKA 2DIGA 1U3OA 4FSXA 1I1JA 4CC4B 3OB9A 1VQPQ 5IHNA 1YJ9A 4DBQA 2XDDA 2ECZA 4AFQC 3EAEA 1OOTA 3EFRA 5GAN4 2K5IA 2OTLQ 2BKDN 5GAOm 1VQ8T 3OYBA 3QG1A 3CMAA 1OU8A 1Q81R 2KMTA 2XI9A 2DO3A 3M54A 2E6NA 4FIBA 4BY6B 2RJFA 2Y4YA 1VQ9Q 2FO0A 1YCSB 3M55A 4BB7A 5A0LA 3INZA 4XU3A 2F1LA 2X4XA 3QZ5B 2XHCA 1Y96B 2KXCA 3MO8A 3QUIA 1NLOC 1UE9A 4DA4A 3OYMA 2GNCA 2HDAA 4WTOB 3D7SB 3SB2A 2KK4A 4M7DA 4CI0C 4JUVA 3TU4K 4EMHA 2B8AA 2NWMA 4KBMB 1AT1B 4FYXB 3CMEQ 2LQ8A 2LJ3A 1X69A 3KBGA 3S3NA 1KSWA 1JXOA 1VQMQ 3G1JA 2EFIA 3QZ9B 4NOYA 1IHVA 3EH1A 4ZTJA 1QWFA 5AT1B 2YRDA 3G6EA 3A8OB 4ME7A 5LJ3g 5IN1A 4M7DF 3HL8A 1R8OB 1YJNQ 3QWXX 4BD3A 4OMFB 2K3BA 3QBYA 2X3WD 3NTIA 3V7SA 1WHKA 5GAMj 4JRKA 4LDWA 3QPHA 3FIFA 2DD4A 2G6FX 2AT1B 1GBQA 1NEBA 1QLYA 3M0RA 3HRUA 1TU0B 2PNIA 1WJRA 2E6ZA 2XK0A 3J7AF 2O9SA 3A8GB 1B3QA 4M77D 2A37A 2LCCA 5FU7C 1M1GA 3OBYA 3OQ5A 2VVKA 1TOVA 3KUFA 3UWNA 3QO3A 1VQ8Q 3DB3A 4DEYA 1YITT 2EJFA 3JB9D 3G7ZA 2KROA 2YUPA 4F17A 1TUGB 4XU2A 2XKOC 3I56T 2AZSA 4E6RA 4RG2A 2K57A 4ZTFA 2KQWA 3OYJA 1OI1A 1I07A 3OW2A 4M78A 3OW2S 2OJ2A 2E5KA 2PQWA 3CD6T 4LNPA 4Y91A 1SSFA 3T9NA 3PMTA 4C92D 3CCQT 4IKFA 1KG1A 3MKDA 2GFAA 1UGPB 3FC3A 1S72Q 5FROA 5DM7R 1YP5A 5CKHA 1H8KA 2H8HA 4HCZA 5J26A 1RADB 1YI2T 2ED0A 4J5YA 5D6XA 2FVUA 4CC3A 2FG0A 4YTLA 4IUVA 1AWOA 4QQGA 4N4GA 3S3MA 4PJMA 2E1HA 3M5AA 3O8VA 1D0XA 3QDRB 5GJVB 4RTTA 3CCJQ 3BDUA 1RAGB 1VQ4A 1QQJA 5CO7A 4JRIA 1XNIA 4Y28E 3CCSA 2DXBA 1I4K1 1YBYA 4RTXA 3HKSA 4LDVA 1M5Q1 2P4TA 2YUQA 4Y92A 2ZGWA 1K8AR 3P8BB 2DLPA 3SHWA 1Y96A 1EIFA 4L59A 3FEOA 4HA8A 2KE9A 2CZ7B 2X4YA 4J7FA 1KD1R 3ULRB 3MHXA 5FU7B 3RERA 3CC7T 4ZN1A 2HL5C 2CUDA 1XQHA 2DXCA 3E9FA 2RJEA 3L2UA 2LTOA 4KH0B 1MGQA 1D3BB 4MMKA 1Y07A 4HCBA 1BI3A 2EGAA 1X2KA 2X3XD 1X2QA 1UHFA 2ZPGB 2DTHA 2NUZA 3LX7A 2PU9B 4RTYA 2J06A 1VQKT 1FX7A 1OEBA 1YITQ 1IXDA 4QVZA 2Y4XA 1WZOA 2D0NA 1VQ5T 2E5QA 2YDLA 1M2OA 3I56Q 4FW1A 2D8JA 2KYBA 2M0YA 2RHUA 2YHTA 5LJ5h 4F14A 2DRKA 2EYYA 3V7CA 1E6HA 4OB0B 2XU8A 4OMOA 4EMKC 3PE0A 1ZQ1A 2C0TA 3CD6Q 1WYXA 1JJ2A 4J9CA 2QQAA 1JJ2S 2FPDA 4FYVB 2PUOB 4OGCA 2EAYA 2HZYA 2MK5A 5L23A 4BE0A 1QMCA 4DBFA 5EG2A 1YI2Q 2E41A 3I5RA 3M56A 4AG1C 2QK0A 4XTYA 5CAIA 1H641 1Q86C 2MWOA 1JEGA 3JB9G 2QAZA 1Q82R 5GAMg 1VYUA 5GANj 3C95A 5FU6C 3A98A 3PIPA 2VC8A 2A0FB 1OPKA 1UDLA 3S3OA 2NUTA 3OSSC 2QQRA 4C92G 4JRQA 2O01E 4LDYA 4JDSA 3U23A 1I5LA 2MMPA 4X34A 1VQ6T 5ECAA 2AZVA 1AWJA 3OYIA 1Q7YC 4M7DC 5LJ5f 3I55Q 1TSFA 3VS1A 2DVEA 3MEUA 4M77A 4OB2B 3H0IA 3PVQA 2DJZA 3E1SA 4J6YA 2DETA 1Q86U 2LNHB 2RD1A 1X43A 2VASA 4HT9A 1WDXA 1GFDA 3CCMT 3PNWC 1N8RC 3RIRA 2D1XA 3CCRQ 4A4HA 1ZBXA 4J9FA 1TG0A 3EGDB 4C0FA 3LWHA 1WHJA 1RI0A 3OSVA 4DEXA 1QWEA 4PFPA 1OZ3A 2JMCA 3OYLA 1B34B 1QVPA 2PVGB 5GAMd 1WHLA 1VQKQ 4HVWA 2CH4W 1Q7YU 2BZ8A 1VQ5Q 3EG3A 1RLPC 2A36A 1PNJA 4C0ZA 2EQIA 3TSWA 2QTVA 2FHDA 4XTVA 2L89A 5DY9A 3MP6A 4EDUA 3H9NA 4C5EA 3G4SA 2DKGA 1QVFA 4Z02A 1YN8A 2QI2A 2YRVA 1QVFS 2HNIA 3IQLA 2DL8A 1BIAA 2WSCE 2E12A 2F2XA 3E2UA 3HP9A 2CSIA 3UA7A 2DTIA 2RF0A 1WJSA 5FU6B 5KYUA 4DBHA 3VKIA 1N8RU 4RTZA 2HKNA 2KYMA 4E7HA 2FZCB 2YRCA 4PJNA 1VQLA 1D3BA 1BCMA 3JV3A 4DBRA 4OB3B 5GANh 1RI9A 2YLCA 2RQWA 4M7AD 3RR6A 3LLRA 2JOYA 2CZ6B 4PJOB 1W4SA 2PVDB 4M78C 2DNUA 2VXEA 3QJYA 1G3TA 2XIDA 1PKSA 5GMKj 5KYYA 2RQVA 2CP0A 1YJWT 3E9GA 2MPXC 2RM4A 2XICA 3H6ZA 4L6V5 1K0SA 3RDVA 2ZPFB 3CCQA 2RK2A 1VIEA 2FL7A 4C0GA 3ASKA 3FLGA 1BI1A 3KXTA 1VQ9T 2QA4Q 3A8HB 1TTHB 2DYBA 1PC0A 3P8HA 2F2WA 1YI2A 4LDUA 1ZUUA 3GNFB 2P4RA 2HEQA 4P5NA 2JN0A 4B6MA 3CC2A 1CKAA 3THKA 4A4KA 2JS2A 2R5AA 2RO0A 3CCMQ 2GQIA 1BI0A 1M1FA 3EG0A 4JLIA 2COWA 4EIKA 5C6SA 3ER0A 2M9UA 1YNZA 4XTWA 2O4XB 4M4ZA 3CCET 1PRLC 4PLIA 1E6GA 3NTKA 5GAMe 1JB0E 5CCAA 2FRWA 1M2VB 3M58A 4PJOE 1K9MR 3CCUA 1D0ZA 1UEBA 1IZ6A 1LPLA 3PMIA 4D6WA 4JJNK 3CMET 3JCMb 1T3LA 5J3BA 1GL5A 3SEMA 4QKUA 2AIRB 3OBWA 4CC7A 5GANg 1D1BA 3LYIA 4E7IA 2IIMA 2LVMA 1CSKA 2CREA 1KC8R 4E2FB 3CC7A 3UPUA 4PJJA 3M0UA 5FW9A 2D6FA 4XTUA 1K0XA 3OYDA 4M78B 3CCLA 5IXFA 1VIFA 3GLXA 5KE2A 2DIQA 4HXJA 3TEEA 2LJ0A 3FRNA 3BFMA 1KQSS 4MZTA 1Y0MA 3NPFA 2YUNA 1KJWA 3QKJA 4B9XA 1RL2A 6AT1B 4R56A 2CGHA 5GMKh 4X9DA 1JJ2P 3JCMV 3CBOA 2C0OA 2WSEE 2DE0X 1YJWQ 3MEAA 4JPBW 1C0MA 2KAFA 4GY5A 2DVJA 3TVTA 1G8XA 2I2LA 2QEXA 2OTJT 2HD0A 4AFSC 4M7AG 1G5VA 1H3HA 3EH2A 3NMZC 1K73R 4M75G 4ATOA 4J9HA 4PFOA 5CK9A 2ZCFB 2C06A 1M3AA 3C12A 3ZFJA 1HD3A 2EW3A 3EG1A 4BDZA 3EFOA 4IUUA 2MF2A 1GCPA 4M78E 3CC4T 1NPRA 1XJWB 4IUPA 1S72T 3EHRA 1AEYA 4PJOA 3CCEQ 2YLBA 3PFSA 1R0CB 1LCKA 2FPFA 3E19A 1M9SA 4M77C 4QT7A 3R6OA 3OMGA 4FT2A 3I35A 1QW1A 1NYGA 5GMKl 4FU6A 5D6YA 1VQ6A 2RB6A 2LCSA 3CCJT 4PJLA 2K2MA 2QASA 4JRPA 4PJOF 8ATCB 3RKYA 3OA6A 2RI5A 4QW2A 3CPWA 1M4ZA 4RKUE 4E47A 3CPWS 1Z9ZA 2JM9A 1YHQA 3PT9A 1KQ2A 5IXBA 1KHCA 2J05A 3QHSA 2A3LA 3WVDB 4XQ3A 1KFZA 4AMCA 4JJCA 1U1SA 2EGCA 4WCIA 4N4IA 4E7ZA 2PUKB 2O4XA 3LH0A 3OYHA 3RUXA 1M2VA 2W0ZA 2EJ9A 4Z89A 2QQ9A 2GF7A 4MDWA 2SRCA 4JJBA 3M0QA 1TS9A 1QVGP 3M0PA 2FB7A 1UG1A 2JMAA 2P0PA 3UT1A 5GAN7 5IH2A 4IUQA 3QSUA 1J3TA 2KNBB 2H3JA 3UF4A 1U06A 1K8AC 2NUTB 3H0HA 2OTJQ 1RABB 3X28B 1LVKA 1V76A 2F5TX 5KCHA 3RMQA 2CDTA 1VQNA 1ABOA 1ZUKA 5LJ5j 5M9OA 1Y57A 5LJ3d 2ESWA 4J9EA 3DB4A 2VB6A 4J9DA 2BTTA 2HL3A 2DX1A 2HQXA 4F7UG 3EGXA 2A28A 5CQXA 4JS4A 4M77B 4PNOA 4RTVA 4C8QD 3CC4Q 2CKKA 4NL2A 1JXMA 1FXXA 2RHZA 2E3HA 2QDLA 3FJ5A 4FM4B 2YT6A 3NHNA 4KUIA 1VQPA 1Y71A 3H0FA 1YWOA 2KGTA 2EBPA 1IHWA 2DAQA 1QCNA 4M78F 4OB1B 3FJPA 2DL4A 2HAXA 2A7YA 2OTLA 2ZPBB 1ZA1B 1K8AU 1I5OB 4MDXA 3HPWA 4C92B 5GAOq 1CKBA 1WHGA 3QXEB 4DOVA 1NEGA 1SPKA 3JCMP 2QTXA 2HBPA 1VQ9A 4N0AC 2KRMA 1AWWA 4JS5A 2WSFE 3I55T 2LRQA 1NBEB 3OS5A 3CCVQ 1SF9A 1EFNA 3MP1A 5KYWA 4JJDA 3SWNA 3REAB 1KQ1A 4M77E 2HBWA 1W1FA 3HRSA 5FWCA 1M8MA 5KYUB 2KRSA 3QIIA 5KYXB 1MUZA 5GAOl 3CMEA 3CCRT 1ZA2B 1TWBA 1VQMA 1YIJT 2D8HA 1XOVA 3UATA 2GFUA 1YJNA 2DJQA 1VQ7Q 5CKFA 1M3CA 4C92E 4GBQA 3ZEHA 1SSHA 1H92A 5LJ3e 1PSFA 3AT1B 5KYYB 2EYXA 1WXTA 2V1RA 2RK1A 1BI2A 3CXCP 1BU1A 2ENMA 4KT0E 1AOJA 1K4US 5GAN8 3VRYA 1EZZB 2LQWA 2L3RA 1YJ9T 5GMKe 2JTMA 1LJOA 3LGFA 4IIMA 1I8FA 4RMOA 1W2BA 1WJQA 1W2BS 2W10A 3OYNA 5FRNA 1N5ZA 2LJ1A 1GRIA 1E7OA 2DTOA 1ACMB 4BE1A 4UC4A 3JCMf 4LD9K 1AWXA 4CRIA 2GBQA 4WF2A 3CMAT 2VWFA 5HKCA 2VUBA 3URGA 1ZBJA 2QQBA 2D9TA 4X9CA 4XK8E 2MOXA 2V8KA 2K7AA 3EGUA 2E4HA 3V8KA 1VQ8A 1NZ9A 4J8OA 1RUWA 2CH4A 2K3XA 3G71T 2RN8A 5KE3A 4C8QG 2K79A 2QDYB 5CR2A 2Y90A 4BI4A 1PG5B 1M3BA 1G3SA 1RAIB 3ZL7C 4PJOC 1WXUA 4A54A 1TUCA 1I0CA 2O88A 1UGSB 4MZMA 1S72A 2DM1A 2QA4T 2I0NA 1VQOQ 2HSPA 4Q5WA 2VV5A 2L3QA 3PVLA 4C5HA 2JW4A 2CT3A 2DYIA 3QYHB 3NTHA 4O6JA 2O31A 5LJ5g 5I22A 1MHNA 4M7AC 2EGEA 2C0IA 1UHCA 2JTFA 4M77F 3GIBA 2DBKA 5DLQE 3CCJA 2RJDA 2E10A 1YIJQ 2GCXA 2M0OA 3DLLA 4C92A 4PK4A 4J6XA 4C0DC 3JB9F 4CC2A 1M1KC 2DEUA 3SDZA 2FZKB 4E7LA 2KSSA 2YWWA 2HSEB 1Q86R 4RUGA 3EG9A 5GJWB 2Z0WA 1FMKA 1PRMC 1WPYA 4XAXB 2OX7A 1QKXA 4D8KA 2X35A 1YJ9Q 4C92F 1AVZC 2ABLA 5C0MA 2GGRA 3X20B 1TXQA 5I11A 3HFOA 1ZLMA 3NGPA 5KYXA 4QQDA 1WGSA 4QVCA 4O5VA 3CMAQ 2FYKA 1Q7YR 3EFOB 5IAYA 4ORZA 3VYGA 2LMJA 2LQNA 2G3RA 3BW1A 2P0KA 4M75D 1MV3A 5LJ5d 4XU0A 3OW2P 1QCFA 2O2OA 1M1KU 1EX4A 1YITA 1FWZA 2RJCA 3CEYA 3G71Q 4EMGA 2M16A 5HCKA 1F1BB 4J6WA 3I56A 1PSEA 1X01A 1UECA 1OULA 1M90C 2M51A 3BY7A 4AG2C 1MMGA 2HQHA 1N8RR 2X4WA 1OU9A 2XDPA 1HYOA 3M0SA 3PGGA 3CD6A 4J9BA 4JZ4A 2M02A 4M7AB 4AFZC 1BIBA 1IB8A 3M9QA 4M75B 1GCQA 1NJIC 1HJDA 2OAWA 2CSQA 2E3IA 3A1PA 3OMCA 2EYWA 3MEWA 2RQUA 3L2ZA 2LQKA 2JNGA 5D6WA 7AT1B 5I21A 3G6EQ 2XDBA 4QVDA 4C0DB 1T0JA 3X25B 3JCMc 4FCYA 2EQJA 1MV0B 4N0AA 4GLKA 3I9QA 3VS6A 3HRTA 2NUPB 2R5MA 1SHFA 2FEIA 1P92A 2LCLA 1JBMA 2ZPIB 3I5SA 4V2SA 1M90U 3RESA 3SWNC 1NPPA 1IO6A 2DMOA 1YFNA 3MCAB 2DF6A 1Q81C 2L8DA 2LX7A 2QYZA 4LN2A 4BI3A 2QG9B 3VU3C 2LT1A 2PTKA 3EFSA 3I55A 1WFWA 3PTAA 3AHUA 1TH7A 2OI3A 1RACB 3CBMA 1NJIU 3SD4A 1WX6A 1ZSGA 3VYHB 4M7AE 3R6NA 2HCKA 4KRTA 3LW5E 2RI2A 4AFUC 2BE7D 5HY6A 1WLPB 4M75E 3JRZA 1WHMA 2V26A 3EGXB 4J83A 2OAUA 4RG8A 3CCRA 2RQRA 2AKLA 3A8LB 1KQSA 2BIVA 2DL3A 1B7TA 3PIOA 2DXUA 5LJ5e 1YIJA 2E70A 2K5LA 2K2VA 4FSSA 1SG5A 1QCOA 2LX9A 4DQ2A 1VQKA 5KYNA 3MP8A 5A0DA 1Q81U 1VQ5A 2CYZB
chains in the Genus database with same CATH topology
3UF4A 1U5SA 4OMOA 1U06A 3H0HA 3PE0A 2C0TA 1JO8A 2L2PA 1WYXA 1WA7A 4J9CA 2CDTA 1ABOA 1ZUKA 1PKTA 2FPDA 1SRLA 1Y57A 2ESWA 5L23A 4LUDA 2SEMA 4J9EA 2DL7A 4J9DA 2XMFA 2BTTA 2J6FA 2DX1A 3I5RA 4AG1C 2A28A 3GBQA 1BB9A 4RTVA 1JEGA 1JXMA 2QDLA 2FPEA 3FJ5A 1VYUA 2YT6A 3NHNA 2K6DA 3VS4A 2ROLA 2V1QA 3A98A 3H0FA 1PHTA 1YWOA 1G83A 2KGTA 2EBPA 2L0AA 1OPKA 1UDLA 1VA7A 2DL4A 3KFVA 2KEAA 4RTUA 3U23A 1W70A 1W6XA 5ECAA 1AD5A 2AZVA 2AK5A 1AWJA 3VS5A 1GFCA 2CT4A 5EC7A 1CKBA 2B86A 3O5ZA 2A08A 1NEGA 1SPKA 3VS1A 1NG2A 1M27C 1AZGB 4LUEA 2RQTA 3H0IA 2KRMA 3PVQA 2J6KA 1AWWA 1ZUYA 1WI7A 4OMQA 2LNHB 4JZ3A 2JM8A 3C0CA 1HSQA 1X43A 2KT8A 1EFNA 2RPNA 1WIEA 2KRNA 2ROTA 4JJDA 3REAB 1BBZA 4Z88A 1VYVA 1SEMA 3RBBB 1WDXA 1GFDA 2EVRA 2JTEA 2D1XA 4HVVA 2HBWA 4F16A 1W1FA 3VS3A 4J9FA 1TG0A 5FWCA 1ABQA 2PZ1A 3EG2A 1M8MA 2KRSA 1MUZA 4DEXA 1QWEA 2JMCA 1NYFA 2LZ6B 4K11A 2DBMA 5IHKA 4HVWA 2CH4W 1UJYA 2BZ8A 3EG3A 1RLPC 2A36A 1PNJA 2MCNA 2EQIA 2D8HA 3REBB 1XOVA 1UUEA 3TSWA 3UATA 3H41A 2J6OA 1RLQC 2DJQA 1S1NA 1YN8A 1T0HA 1M3CA 4GBQA 3IQLA 1SSHA 2DL8A 2J7IA 1H92A 2F2XA 1VYTA 4A63B 2EYXA 1K9AA 1WXTA 2V1RA 2CSIA 3UA7A 2JS0A 1BU1A 1JU5C 2ENMA 1UFFA 2RF0A 1AOJA 2JXBA 4HCKA 1K4US 3VRYA 3RNJA 4D8DA 2LQWA 2KBTA 2KYMA 4RTWA 4RTZA 3JV3A 1U3OA 2VKNA 1I1JA 4IIMA 4CC4B 5IHNA 1RI9A 2EKHA 2RQWA 2W10A 4R0KA 1N5ZA 2LJ1A 1GRIA 1AZEA 1E7OA 2DRMA 2ECZA 4AFQC 1OOTA 1AWXA 2GBQA 4HVUA 2VWFA 4J9IA 2DNUA 1K1ZA 1ZBJA 1T3SA 1PKSA 2MOXA 2K7AA 3EGUA 2YUOA 2RQVA 1RUWA 2CH4A 1NLPC 4OMPA 2FO0A 2RN8A 1YCSB 5IHIA 1K0SA 2K79A 1GCQC 1M3BA 1QKWA 2FRYA 3ZL7C 2KXCA 1NLOC 1WXUA 1UE9A 3VRZA 2JT4A 2GNCA 1A0NB 2HDAA 2DYBA 2F2WA 1TUCA 1ZUUA 2P4RA 2HEQA 1I0CA 2LP5A 2O88A 1OPLA 1CKAA 3THKA 2DM1A 2I0NA 2JS2A 2HSPA 2NWMA 2GQIA 2L3QA 1K76A 3EG0A 3PVLA 4EIKA 2JW4A 1X6GA 1YNZA 2LJ3A 1X69A 2CT3A 4M4ZA 1PRLC 1KSWA 1JXOA 1E6GA 2O31A 1NM7A 2FRWA 2KXDA 2GTJA 5I22A 1QWFA 1YWPA 2EGEA 3VS7A 2C0IA 1UHCA 2DL5A 2DBKA 1WXBA 1T3LA 1GL5A 3QWXX 3LH5A 5FWBA 3SEMA 3VS2A 4CC7A 2K3BA 4CC2A 2DILA 2X3WD 2IIMA 1PWTA 3M0TA 4RUGA 2RMOA 1CSKA 1SHGA 2CREA 5GJWB 1FMKA 1PRMC 3M0UA 5FW9A 1QKXA 2G6FX 1K0XA 4D8KA 2GTOA 1GBQA 1NEBA 1QLYA 5IXFA 3M0RA 2YSQA 1AVZC 2ABLA 2GGRA 2PNIA 4HXJA 4Z8AA 3VS0A 1BK2A 2LJ0A 2O9SA 3CQTA 3TSZA 5I11A 4J9GA 1B3QA 1ZLMA 2KT1A 3NGPA 1SRMA 2A37A 1Y0MA 3NPFA 2YUNA 2BZYA 1KJWA 2VVKA 4ORZA 2LMJA 1V1CA 4DEYA 2LQNA 2F2VA 4IIOA 2KROA 4OMLA 2YUPA 4F17A 1MV3A 2C0OA 2DE0X 1QCFA 2AZSA 2O2OA 4E6RA 4LE9A 4JPBW 1FYNA 2DVJA 3TVTA 1I07A 1UGVA 5HCKA 1B07A 1M30A 2OJ2A 2E5KA 1UECA 4LNPA 4AFSC 2M51A 1H3HA 2DA9A 4AG2C 3NMZC 3M0SA 4J9BA 1YP5A 4JZ4A 4J9HA 1H8KA 2H8HA 1OV3A 1UTIA 1M3AA 4X1VA 2ED0A 1HD3A 2EW3A 3EG1A 4AFZC 4CC3A 1ARKA 1GCPA 2FG0A 1KIKA 2L3SA 3EHRA 1AWOA 1AEYA 1GCQA 1HJDA 2OAWA 2CSQA 2EYWA 2RQUA 2L3PA 5GJVB 4RTTA 1LCKA 2FPFA 1GBRA 1T0JA 4QT7A 2MIOA 1MV0B 3I35A 3I9QA 1NYGA 3VS6A 2LCSA 2KR3A 4RTXA 1SHFA 2FEIA 2K2MA 1X6BA 2AKKA 4OMNA 1Z9QA 3QWYA 3I5SA 2YUQA 2RNAA 4Y92A 3SHWA 2DLPA 1IO6A 2DMOA 2DF6A 2LX7A 4LN2A 2KE9A 1UJ0A 2PTKA 1Z9ZA 2JM9A 1JQQA 1WFWA 3ULRB 2O9VA 3EHQA 5IXBA 2OI3A 2J05A 4ZNXA 2CUDA 2EPDA 2K9GA 2EYZA 1WX6A 1G2BA 1ZSGA 1KFZA 4JJCA 4WCIA 2EGCA 3R6NA 2HCKA 4KRTA 1ZX6A 4AFUC 1WLPB 2EGAA 1X2KA 2BZXA 4OMMA 2W0ZA 1X27A 2X3XD 4ESRA 4Z89A 1X2QA 1UHFA 2RQRA 2NUZA 2AKLA 2SRCA 4JJBA 4RTYA 2J06A 2DL3A 3M0QA 1OEBA 3M0PA 1TUDA 1UG1A 4GLMA 2JMAA 2D0NA 4FSSA 2YDLA 2ED1A 5IH2A 2D8JA 2CUBA 2KYBA 2M0YA 1J3TA 3UA6A 4F14A 2DRKA 2KNBB 2EYYA 1E6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UF4 A;  1U5S A;  4OMO A;  1U06 A;  3H0H A;  3PE0 A;  2C0T A;  1JO8 A;  2L2P A;  1WYX A;  1WA7 A;  4J9C A;  2CDT A;  1ABO A;  1ZUK A;  1PKT A;  2FPD A;  1SRL A;  1Y57 A;  2ESW A;  5L23 A;  4LUD A;  2SEM A;  4J9E A;  2DL7 A;  4J9D A;  2XMF A;  2BTT A;  2J6F A;  2DX1 A;  3I5R A;  4AG1 C;  2A28 A;  3GBQ A;  1BB9 A;  4RTV A;  1JEG A;  1JXM A;  2QDL A;  2FPE A;  3FJ5 A;  1VYU A;  2YT6 A;  3NHN A;  2K6D A;  3VS4 A;  2ROL A;  2V1Q A;  3A98 A;  3H0F A;  1PHT A;  1YWO A;  1G83 A;  2KGT A;  2EBP A;  2L0A A;  1OPK A;  1UDL A;  1VA7 A;  2DL4 A;  3KFV A;  2KEA A;  4RTU A;  3U23 A;  1W70 A;  1W6X A;  5ECA A;  1AD5 A;  2AZV A;  2AK5 A;  1AWJ A;  3VS5 A;  1GFC A;  2CT4 A;  5EC7 A;  1CKB A;  2B86 A;  3O5Z A;  2A08 A;  1NEG A;  1SPK A;  3VS1 A;  1NG2 A;  1M27 C;  1AZG B;  4LUE A;  2RQT A;  3H0I A;  2KRM A;  3PVQ A;  2J6K A;  1AWW A;  1ZUY A;  1WI7 A;  4OMQ A;  2LNH B;  4JZ3 A;  2JM8 A;  3C0C A;  1HSQ A;  1X43 A;  2KT8 A;  1EFN A;  2RPN A;  1WIE A;  2KRN A;  2ROT A;  4JJD A;  3REA B;  1BBZ A;  4Z88 A;  1VYV A;  1SEM A;  3RBB B;  1WDX A;  1GFD A;  2EVR A;  2JTE A;  2D1X A;  4HVV A;  2HBW A;  4F16 A;  1W1F A;  3VS3 A;  4J9F A;  1TG0 A;  5FWC A;  1ABQ A;  2PZ1 A;  3EG2 A;  1M8M A;  2KRS A;  1MUZ A;  4DEX A;  1QWE A;  2JMC A;  1NYF A;  2LZ6 B;  4K11 A;  2DBM A;  5IHK A;  4HVW A;  2CH4 W;  1UJY A;  2BZ8 A;  3EG3 A;  1RLP C;  2A36 A;  1PNJ A;  2MCN A;  2EQI A;  2D8H A;  3REB B;  1XOV A;  1UUE A;  3TSW A;  3UAT A;  3H41 A;  2J6O A;  1RLQ C;  2DJQ A;  1S1N A;  1YN8 A;  1T0H A;  1M3C A;  4GBQ A;  3IQL A;  1SSH A;  2DL8 A;  2J7I A;  1H92 A;  2F2X A;  1VYT A;  4A63 B;  2EYX A;  1K9A A;  1WXT A;  2V1R A;  2CSI A;  3UA7 A;  2JS0 A;  1BU1 A;  1JU5 C;  2ENM A;  1UFF A;  2RF0 A;  1AOJ A;  2JXB A;  4HCK A;  1K4U S;  3VRY A;  3RNJ A;  4D8D A;  2LQW A;  2KBT A;  2KYM A;  4RTW A;  4RTZ A;  3JV3 A;  1U3O A;  2VKN A;  1I1J A;  4IIM A;  4CC4 B;  5IHN A;  1RI9 A;  2EKH A;  2RQW A;  2W10 A;  4R0K A;  1N5Z A;  2LJ1 A;  1GRI A;  1AZE A;  1E7O A;  2DRM A;  2ECZ A;  4AFQ C;  1OOT A;  1AWX A;  2GBQ A;  4HVU A;  2VWF A;  4J9I A;  2DNU A;  1K1Z A;  1ZBJ A;  1T3S A;  1PKS A;  2MOX A;  2K7A A;  3EGU A;  2YUO A;  2RQV A;  1RUW A;  2CH4 A;  1NLP C;  4OMP A;  2FO0 A;  2RN8 A;  1YCS B;  5IHI A;  1K0S A;  2K79 A;  1GCQ C;  1M3B A;  1QKW A;  2FRY A;  3ZL7 C;  2KXC A;  1NLO C;  1WXU A;  1UE9 A;  3VRZ A;  2JT4 A;  2GNC A;  1A0N B;  2HDA A;  2DYB A;  2F2W A;  1TUC A;  1ZUU A;  2P4R A;  2HEQ A;  1I0C A;  2LP5 A;  2O88 A;  1OPL A;  1CKA A;  3THK A;  2DM1 A;  2I0N A;  2JS2 A;  2HSP A;  2NWM A;  2GQI A;  2L3Q A;  1K76 A;  3EG0 A;  3PVL A;  4EIK A;  2JW4 A;  1X6G A;  1YNZ A;  2LJ3 A;  1X69 A;  2CT3 A;  4M4Z A;  1PRL C;  1KSW A;  1JXO A;  1E6G A;  2O31 A;  1NM7 A;  2FRW A;  2KXD A;  2GTJ A;  5I22 A;  1QWF A;  1YWP A;  2EGE A;  3VS7 A;  2C0I A;  1UHC A;  2DL5 A;  2DBK A;  1WXB A;  1T3L A;  1GL5 A;  3QWX X;  3LH5 A;  5FWB A;  3SEM A;  3VS2 A;  4CC7 A;  2K3B A;  4CC2 A;  2DIL A;  2X3W D;  2IIM A;  1PWT A;  3M0T A;  4RUG A;  2RMO A;  1CSK A;  1SHG A;  2CRE A;  5GJW B;  1FMK A;  1PRM C;  3M0U A;  5FW9 A;  1QKX A;  2G6F X;  1K0X A;  4D8K A;  2GTO A;  1GBQ A;  1NEB A;  1QLY A;  5IXF A;  3M0R A;  2YSQ A;  1AVZ C;  2ABL A;  2GGR A;  2PNI A;  4HXJ A;  4Z8A A;  3VS0 A;  1BK2 A;  2LJ0 A;  2O9S A;  3CQT A;  3TSZ A;  5I11 A;  4J9G A;  1B3Q A;  1ZLM A;  2KT1 A;  3NGP A;  1SRM A;  2A37 A;  1Y0M A;  3NPF A;  2YUN A;  2BZY A;  1KJW A;  2VVK A;  4ORZ A;  2LMJ A;  1V1C A;  4DEY A;  2LQN A;  2F2V A;  4IIO A;  2KRO A;  4OML A;  2YUP A;  4F17 A;  1MV3 A;  2C0O A;  2DE0 X;  1QCF A;  2AZS A;  2O2O A;  4E6R A;  4LE9 A;  4JPB W;  1FYN A;  2DVJ A;  3TVT A;  1I07 A;  1UGV A;  5HCK A;  1B07 A;  1M30 A;  2OJ2 A;  2E5K A;  1UEC A;  4LNP A;  4AFS C;  2M51 A;  1H3H A;  2DA9 A;  4AG2 C;  3NMZ C;  3M0S A;  4J9B A;  1YP5 A;  4JZ4 A;  4J9H A;  1H8K A;  2H8H A;  1OV3 A;  1UTI A;  1M3A A;  4X1V A;  2ED0 A;  1HD3 A;  2EW3 A;  3EG1 A;  4AFZ C;  4CC3 A;  1ARK A;  1GCP A;  2FG0 A;  1KIK A;  2L3S A;  3EHR A;  1AWO A;  1AEY A;  1GCQ A;  1HJD A;  2OAW A;  2CSQ A;  2EYW A;  2RQU A;  2L3P A;  5GJV B;  4RTT A;  1LCK A;  2FPF A;  1GBR A;  1T0J A;  4QT7 A;  2MIO A;  1MV0 B;  3I35 A;  3I9Q A;  1NYG A;  3VS6 A;  2LCS A;  2KR3 A;  4RTX A;  1SHF A;  2FEI A;  2K2M A;  1X6B A;  2AKK A;  4OMN A;  1Z9Q A;  3QWY A;  3I5S A;  2YUQ A;  2RNA A;  4Y92 A;  3SHW A;  2DLP A;  1IO6 A;  2DMO A;  2DF6 A;  2LX7 A;  4LN2 A;  2KE9 A;  1UJ0 A;  2PTK A;  1Z9Z A;  2JM9 A;  1JQQ A;  1WFW A;  3ULR B;  2O9V A;  3EHQ A;  5IXB A;  2OI3 A;  2J05 A;  4ZNX A;  2CUD A;  2EPD A;  2K9G A;  2EYZ A;  1WX6 A;  1G2B A;  1ZSG A;  1KFZ A;  4JJC A;  4WCI A;  2EGC A;  3R6N A;  2HCK A;  4KRT A;  1ZX6 A;  4AFU C;  1WLP B;  2EGA A;  1X2K A;  2BZX A;  4OMM A;  2W0Z A;  1X27 A;  2X3X D;  4ESR A;  4Z89 A;  1X2Q A;  1UHF A;  2RQR A;  2NUZ A;  2AKL A;  2SRC A;  4JJB A;  4RTY A;  2J06 A;  2DL3 A;  3M0Q A;  1OEB A;  3M0P A;  1TUD A;  1UG1 A;  4GLM A;  2JMA A;  2D0N A;  4FSS A;  2YDL A;  2ED1 A;  5IH2 A;  2D8J A;  2CUB A;  2KYB A;  2M0Y A;  1J3T A;  3UA6 A;  4F14 A;  2DRK A;  2KNB B;  2EYY A;  1E6H A; 
#chains in the Genus database with same CATH topology
 2P84 A;  5AYF A;  3JCM W;  3HSB A;  1WA7 A;  1I81 A;  3RMS A;  5CKE A;  4FYW B;  1SRL A;  3N5B B;  4M7D G;  2SEM A;  2DL7 A;  1VUB A;  2XMF A;  5CIU A;  3GBQ A;  3HTR A;  5I2S A;  1BB9 A;  5GAN d;  2IVW A;  1WNL A;  4VUB A;  5GAN 2;  5GAO p;  2FPE A;  2KY9 A;  1VQ4 Q;  4F7U B;  3GP8 A;  2RH2 A;  2KVQ G;  3VS4 A;  3CCS Q;  4KGZ B;  2YXY A;  1SKU B;  1PHT A;  1G83 A;  5KYW B;  3VV0 A;  5LL6 S;  3SWN B;  4XTX A;  2L0A A;  4II1 A;  2EQU A;  2RHY A;  3JSC A;  4B9W A;  2KEA A;  4J7I A;  1W70 A;  5GAO n;  2COZ A;  1W6X A;  5HK0 A;  3G71 A;  2AK5 A;  2JJ9 A;  3VS5 A;  1GFC A;  2CT4 A;  4C5I A;  2QGG A;  2B86 A;  3O5Z A;  2CP7 A;  2A08 A;  1NG2 A;  1BCO A;  3C4S A;  4LUE A;  2XD0 A;  1UB4 A;  2DZC A;  4XU1 A;  5LJ3 f;  2X4J A;  3VUZ A;  2J6K A;  1OQK A;  4PLL A;  5GMK i;  2K4Y A;  2E65 A;  2CP2 A;  4OMQ A;  3FB9 A;  4M7A A;  3V7R A;  3C0C A;  1V29 B;  2RPN A;  2QA4 A;  1WIE A;  4IUT A;  2ROT A;  4M75 A;  1X75 C;  4Z88 A;  1SEM A;  2DER A;  1G3W A;  3A8M B;  2EVR A;  3ME9 A;  2JTE A;  4PKC C;  4HKE A;  3DKM A;  2QXF A;  4HVV A;  4HT8 A;  4F16 A;  3CCV T;  4C92 C;  3JB9 I;  2PZ1 A;  3FDR A;  1Y7X A;  4C8Q C;  1N9R A;  5CKB A;  4F7U E;  3CCM A;  4KGX B;  2LC4 A;  3WXM B;  4K11 A;  2CP5 A;  3LWI A;  2DBM A;  5IHK A;  2NUP A;  2HKQ B;  3QJ6 A;  4M7A F;  1PCX A;  5J39 A;  1UJY A;  2MWP A;  3TQ7 P;  3G4S T;  3JCM J;  1N6A A;  4M75 F;  1QVF P;  3J80 E;  3L2V A;  4MML A;  4M78 G;  1HXD A;  2RA2 A;  4KUD K;  3H41 A;  3QDF A;  2J6O A;  1RLQ C;  1OX8 A;  2HMA A;  3ZBD A;  1IRE B;  1G3Y A;  1PM3 A;  1VYT A;  4A63 B;  1D1C A;  3S6W A;  4BUG A;  1MNE A;  1JU5 C;  1VQ7 T;  1UFF A;  4OVA A;  1FMW A;  1VQL T;  1WQW A;  2JXB A;  4XTZ A;  2WAC A;  3V8L A;  5GAN e;  5A2Q E;  3RNJ A;  4D8D A;  4ZN3 A;  3MJX A;  2EKO A;  2VKN A;  4EPC A;  2BE9 B;  1KD1 C;  4LDX A;  2IPO B;  2EKH A;  4R0K A;  1AZE A;  4FYY B;  1RAH B;  5CKD A;  2DRM A;  2DZ9 A;  2DXT A;  2X51 A;  4HVU A;  4J9I A;  1K1Z A;  2QQS A;  4NS5 A;  3TRE A;  1T3S A;  5I2M A;  3BDL A;  4JLG A;  3M4Y A;  5A0G A;  2YUO A;  3TCJ A;  5HK3 A;  1NLP C;  1IRX A;  4OMP A;  2P0Q A;  5KH6 A;  2PVO B;  5IHI A;  4MZP A;  1YJW A;  5IT9 E;  1GCQ C;  3L2W A;  1U1T A;  1QKW A;  2FRY A;  2K3Y A;  1QP3 A;  2LNV A;  3VRZ A;  2JT4 A;  4OGE A;  3CC2 T;  4C8Q B;  1A0N B;  1PD1 A;  3MEV A;  1KD1 U;  2LP5 A;  1OPL A;  4A53 A;  4FW2 A;  4HCC A;  4F7U A;  4ZGE B;  3EG9 B;  1K76 A;  3CCU T;  1X6G A;  4LXC A;  2ZPH B;  4ELZ C;  3L2Q A;  1NM7 A;  2D0Q B;  1VQO T;  2KXD A;  2GTJ A;  3GPL A;  1YWP A;  3VS7 A;  1M8V A;  1Q82 C;  3CCE A;  4OF1 A;  2DL5 A;  5DLO A;  1WXB A;  2EWN A;  3JCM h;  5GAM h;  3G4S Q;  3OS1 A;  1C6V X;  3LH5 A;  5FWB A;  3VS2 A;  4F7U F;  3BE3 A;  1N9S A;  3H8Z A;  4TVR A;  2LDM A;  2DIL A;  1MMD A;  1D0Y A;  3UDC A;  1UGR B;  3L1A A;  2VYT A;  2HQE A;  1PWT A;  3M0T A;  5GAN 3;  4FL6 A;  2RMO A;  1SHG A;  3CCL T;  1PD0 A;  2R58 A;  1ZSZ C;  1VQL Q;  4C8Q E;  1KQS P;  2GTO A;  2NYS A;  2YSQ A;  4C5G A;  4Z8A A;  3VS0 A;  1BK2 A;  4A4E A;  3OYA A;  4ANJ A;  3CQT A;  2FZG B;  3TSZ A;  1ZHI A;  4J9G A;  2KT1 A;  2CP6 A;  1SRM A;  1Q82 U;  2VXF A;  2BZY A;  8AT1 B;  1OX9 A;  2F69 A;  1V1C A;  1JRI A;  2F2V A;  4LD6 A;  4IIO A;  1KK7 A;  4OML A;  5GAM f;  1KHI A;  3OYK A;  4ZGD B;  2QEX T;  2CP3 A;  4LE9 A;  2CS7 A;  1FYN A;  3CCQ Q;  3OY9 A;  2RHX A;  4M77 G;  1MMA A;  1FMV A;  2EQK A;  1O9S A;  1UGV A;  1B07 A;  1M30 A;  4R55 A;  1R0B G;  1C1A A;  3GOX A;  2M1H A;  2DA9 A;  4E7K A;  3CC2 Q;  2OTJ A;  5CQY A;  1VOM A;  3JCM Q;  3JCM g;  2RHI A;  1OV3 A;  1UTI A;  4BI8 B;  4X1V A;  4BDY A;  3OS0 A;  2AHJ B;  1ARK A;  1U8R A;  1KIK A;  2XG8 D;  5KCO A;  3M59 A;  2L3S A;  5CVI A;  1OYX A;  1HK9 A;  3CCU Q;  3CC4 A;  2VGM A;  2L3P A;  3NFC A;  5D7U A;  1GBR A;  2MIO A;  1UGQ B;  2DEQ A;  1YCY A;  3OYE A;  2ATC B;  2KR3 A;  3G6E T;  4AT1 B;  1X6B A;  4BAC A;  4DOW A;  2AKK A;  4OMN A;  3OYC A;  1Z9Q A;  3QWY A;  1ZSZ B;  2CZ1 B;  2RNA A;  3CPW P;  4M75 C;  2RI3 A;  1YHQ T;  3CC7 Q;  2H3E B;  1UJ0 A;  4C8Q A;  1IGQ A;  2QGF B;  2R57 A;  3CCL Q;  1JQQ A;  2O9V A;  2EIF A;  2COY A;  3EHQ A;  4E7S A;  3WVE B;  4ZNX A;  2EYQ A;  2EPD A;  2K9G A;  1MND A;  2EYZ A;  1G2B A;  3VJP A;  3M57 A;  4PL6 A;  3HFN A;  3DLM A;  9ATC B;  3CCV A;  2MAM A;  3LGL A;  3JCM d;  1ZX6 A;  1LNX A;  4EMK B;  2L5Q A;  3QYG B;  1BKB A;  4OMM A;  2BZX A;  4A4F A;  3OYY A;  1X27 A;  1GXI E;  4ESR A;  4C8Q F;  4KH1 B;  4BE2 A;  2F5K A;  4FT4 A;  4RCB A;  4PJO D;  1TUD A;  4GLM A;  4M7D D;  5GMK m;  3A5Z B;  1IGU A;  2E64 A;  3L2R A;  2QEX Q;  2ED1 A;  4ZGJ B;  1QVG A;  2CUB A;  3VUB A;  3V8J A;  1K9M C;  3UA6 A;  1QVG S;  3OYG A;  4OP0 A;  4NL3 A;  3L42 A;  2DPP B;  1D1A A;  4N4H A;  1U5S A;  1VQN T;  2KDS A;  2DK3 A;  1JO8 A;  2L2P A;  3X24 B;  1RAA B;  3CBP A;  2X9H A;  1VQ7 A;  1PKT A;  2K5F A;  3RKW A;  3GNG A;  4LUD A;  4IUR A;  2ZAE A;  2VGN A;  5GAN 6;  4ELY C;  1WQ7 A;  2J6F A;  5LJ3 j;  2MYS A;  2DD5 A;  2BUD A;  4M7D B;  2ZPE B;  1KC8 C;  1VQP T;  5FLX E;  1X6O A;  3JCM X;  2K6D A;  2ROL A;  2V1Q A;  2DFU A;  5GAO r;  1VQ6 Q;  2OTL T;  1VQ4 T;  3JB9 H;  3C94 A;  1VA7 A;  3P8D A;  4KGV B;  2MI6 A;  3KFV A;  1M1K R;  1K9M U;  3CCS T;  4RTU A;  1R77 A;  2V8J A;  1AD5 A;  2ZZD A;  2NLU A;  4QQ6 A;  1WHH A;  3Q1J A;  2V8I A;  5EC7 A;  1XTD A;  3X26 B;  1NE8 A;  1YHQ Q;  1M27 C;  1AZG B;  2GQV A;  2RQT A;  4BY6 C;  1ZUY A;  1WI7 A;  3RKX A;  3OYF A;  3M4G A;  1RAE B;  3M53 A;  1D09 B;  1DJ7 B;  4JZ3 A;  2JM8 A;  5L8R E;  5GAN f;  1HSQ A;  2KT8 A;  3CPF A;  1KC8 U;  3OS2 A;  2KRN A;  1QP2 A;  3JCM e;  1BBZ A;  1VYV A;  4L5G A;  3RBB B;  3JAM E;  1RAF B;  4M7D E;  4M78 D;  1K73 C;  2JZ2 A;  1MMN A;  3VS3 A;  1ABQ A;  1LOJ A;  3EG2 A;  1VQO A;  2EJG A;  1VQM T;  1NYF A;  2LZ6 B;  2KI7 A;  1Q95 G;  2JVV A;  4F04 B;  3J81 E;  4A4G A;  4PFZ A;  1OZ2 A;  1AHJ B;  1YJN T;  5FRM A;  1ZSZ A;  2MCN A;  1M90 R;  3REB B;  1N27 A;  1UUE A;  2IG0 A;  3MPU B;  4KUL A;  3JB9 J;  5GAN 5;  3MET A;  1S1N A;  3F70 A;  1VQN Q;  1T0H A;  4E7J A;  2J7I A;  2CZ0 B;  2JUF A;  1K9A A;  2LT4 A;  3HHT B;  2JS0 A;  1BYM A;  1H3Z A;  1O75 A;  1NJI R;  3EGD A;  3GF5 A;  5LJ3 h;  2EQM A;  4HCK A;  1W2B P;  3CXC A;  3SFM A;  1K73 U;  2KBT A;  3CXC S;  4RTW A;  1B34 A;  4PJO G;  4RCC A;  4EMK A;  2DIG A;  1U3O A;  4FSX A;  1I1J A;  4CC4 B;  3OB9 A;  1VQP Q;  5IHN A;  1YJ9 A;  4DBQ A;  2XDD A;  2ECZ A;  4AFQ C;  3EAE A;  1OOT A;  3EFR A;  5GAN 4;  2K5I A;  2OTL Q;  2BKD N;  5GAO m;  1VQ8 T;  3OYB A;  3QG1 A;  3CMA A;  1OU8 A;  1Q81 R;  2KMT A;  2XI9 A;  2DO3 A;  3M54 A;  2E6N A;  4FIB A;  4BY6 B;  2RJF A;  2Y4Y A;  1VQ9 Q;  2FO0 A;  1YCS B;  3M55 A;  4BB7 A;  5A0L A;  3INZ A;  4XU3 A;  2F1L A;  2X4X A;  3QZ5 B;  2XHC A;  1Y96 B;  2KXC A;  3MO8 A;  3QUI A;  1NLO C;  1UE9 A;  4DA4 A;  3OYM A;  2GNC A;  2HDA A;  4WTO B;  3D7S B;  3SB2 A;  2KK4 A;  4M7D A;  4CI0 C;  4JUV A;  3TU4 K;  4EMH A;  2B8A A;  2NWM A;  4KBM B;  1AT1 B;  4FYX B;  3CME Q;  2LQ8 A;  2LJ3 A;  1X69 A;  3KBG A;  3S3N A;  1KSW A;  1JXO A;  1VQM Q;  3G1J A;  2EFI A;  3QZ9 B;  4NOY A;  1IHV A;  3EH1 A;  4ZTJ A;  1QWF A;  5AT1 B;  2YRD A;  3G6E A;  3A8O B;  4ME7 A;  5LJ3 g;  5IN1 A;  4M7D F;  3HL8 A;  1R8O B;  1YJN Q;  3QWX X;  4BD3 A;  4OMF B;  2K3B A;  3QBY A;  2X3W D;  3NTI A;  3V7S A;  1WHK A;  5GAM j;  4JRK A;  4LDW A;  3QPH A;  3FIF A;  2DD4 A;  2G6F X;  2AT1 B;  1GBQ A;  1NEB A;  1QLY A;  3M0R A;  3HRU A;  1TU0 B;  2PNI A;  1WJR A;  2E6Z A;  2XK0 A;  3J7A F;  2O9S A;  3A8G B;  1B3Q A;  4M77 D;  2A37 A;  2LCC A;  5FU7 C;  1M1G A;  3OBY A;  3OQ5 A;  2VVK A;  1TOV A;  3KUF A;  3UWN A;  3QO3 A;  1VQ8 Q;  3DB3 A;  4DEY A;  1YIT T;  2EJF A;  3JB9 D;  3G7Z A;  2KRO A;  2YUP A;  4F17 A;  1TUG B;  4XU2 A;  2XKO C;  3I56 T;  2AZS A;  4E6R A;  4RG2 A;  2K57 A;  4ZTF A;  2KQW A;  3OYJ A;  1OI1 A;  1I07 A;  3OW2 A;  4M78 A;  3OW2 S;  2OJ2 A;  2E5K A;  2PQW A;  3CD6 T;  4LNP A;  4Y91 A;  1SSF A;  3T9N A;  3PMT A;  4C92 D;  3CCQ T;  4IKF A;  1KG1 A;  3MKD A;  2GFA A;  1UGP B;  3FC3 A;  1S72 Q;  5FRO A;  5DM7 R;  1YP5 A;  5CKH A;  1H8K A;  2H8H A;  4HCZ A;  5J26 A;  1RAD B;  1YI2 T;  2ED0 A;  4J5Y A;  5D6X A;  2FVU A;  4CC3 A;  2FG0 A;  4YTL A;  4IUV A;  1AWO A;  4QQG A;  4N4G A;  3S3M A;  4PJM A;  2E1H A;  3M5A A;  3O8V A;  1D0X A;  3QDR B;  5GJV B;  4RTT A;  3CCJ Q;  3BDU A;  1RAG B;  1VQ4 A;  1QQJ A;  5CO7 A;  4JRI A;  1XNI A;  4Y28 E;  3CCS A;  2DXB A;  1I4K 1;  1YBY A;  4RTX A;  3HKS A;  4LDV A;  1M5Q 1;  2P4T A;  2YUQ A;  4Y92 A;  2ZGW A;  1K8A R;  3P8B B;  2DLP A;  3SHW A;  1Y96 A;  1EIF A;  4L59 A;  3FEO A;  4HA8 A;  2KE9 A;  2CZ7 B;  2X4Y A;  4J7F A;  1KD1 R;  3ULR B;  3MHX A;  5FU7 B;  3RER A;  3CC7 T;  4ZN1 A;  2HL5 C;  2CUD A;  1XQH A;  2DXC A;  3E9F A;  2RJE A;  3L2U A;  2LTO A;  4KH0 B;  1MGQ A;  1D3B B;  4MMK A;  1Y07 A;  4HCB A;  1BI3 A;  2EGA A;  1X2K A;  2X3X D;  1X2Q A;  1UHF A;  2ZPG B;  2DTH A;  2NUZ A;  3LX7 A;  2PU9 B;  4RTY A;  2J06 A;  1VQK T;  1FX7 A;  1OEB A;  1YIT Q;  1IXD A;  4QVZ A;  2Y4X A;  1WZO A;  2D0N A;  1VQ5 T;  2E5Q A;  2YDL A;  1M2O A;  3I56 Q;  4FW1 A;  2D8J A;  2KYB A;  2M0Y A;  2RHU A;  2YHT A;  5LJ5 h;  4F14 A;  2DRK A;  2EYY A;  3V7C A;  1E6H A;  4OB0 B;  2XU8 A;  4OMO A;  4EMK C;  3PE0 A;  1ZQ1 A;  2C0T A;  3CD6 Q;  1WYX A;  1JJ2 A;  4J9C A;  2QQA A;  1JJ2 S;  2FPD A;  4FYV B;  2PUO B;  4OGC A;  2EAY A;  2HZY A;  2MK5 A;  5L23 A;  4BE0 A;  1QMC A;  4DBF A;  5EG2 A;  1YI2 Q;  2E41 A;  3I5R A;  3M56 A;  4AG1 C;  2QK0 A;  4XTY A;  5CAI A;  1H64 1;  1Q86 C;  2MWO A;  1JEG A;  3JB9 G;  2QAZ A;  1Q82 R;  5GAM g;  1VYU A;  5GAN j;  3C95 A;  5FU6 C;  3A98 A;  3PIP A;  2VC8 A;  2A0F B;  1OPK A;  1UDL A;  3S3O A;  2NUT A;  3OSS C;  2QQR A;  4C92 G;  4JRQ A;  2O01 E;  4LDY A;  4JDS A;  3U23 A;  1I5L A;  2MMP A;  4X34 A;  1VQ6 T;  5ECA A;  2AZV A;  1AWJ A;  3OYI A;  1Q7Y C;  4M7D C;  5LJ5 f;  3I55 Q;  1TSF A;  3VS1 A;  2DVE A;  3MEU A;  4M77 A;  4OB2 B;  3H0I A;  3PVQ A;  2DJZ A;  3E1S A;  4J6Y A;  2DET A;  1Q86 U;  2LNH B;  2RD1 A;  1X43 A;  2VAS A;  4HT9 A;  1WDX A;  1GFD A;  3CCM T;  3PNW C;  1N8R C;  3RIR A;  2D1X A;  3CCR Q;  4A4H A;  1ZBX A;  4J9F A;  1TG0 A;  3EGD B;  4C0F A;  3LWH A;  1WHJ A;  1RI0 A;  3OSV A;  4DEX A;  1QWE A;  4PFP A;  1OZ3 A;  2JMC A;  3OYL A;  1B34 B;  1QVP A;  2PVG B;  5GAM d;  1WHL A;  1VQK Q;  4HVW A;  2CH4 W;  1Q7Y U;  2BZ8 A;  1VQ5 Q;  3EG3 A;  1RLP C;  2A36 A;  1PNJ A;  4C0Z A;  2EQI A;  3TSW A;  2QTV A;  2FHD A;  4XTV A;  2L89 A;  5DY9 A;  3MP6 A;  4EDU A;  3H9N A;  4C5E A;  3G4S A;  2DKG A;  1QVF A;  4Z02 A;  1YN8 A;  2QI2 A;  2YRV A;  1QVF S;  2HNI A;  3IQL A;  2DL8 A;  1BIA A;  2WSC E;  2E12 A;  2F2X A;  3E2U A;  3HP9 A;  2CSI A;  3UA7 A;  2DTI A;  2RF0 A;  1WJS A;  5FU6 B;  5KYU A;  4DBH A;  3VKI A;  1N8R U;  4RTZ A;  2HKN A;  2KYM A;  4E7H A;  2FZC B;  2YRC A;  4PJN A;  1VQL A;  1D3B A;  1BCM A;  3JV3 A;  4DBR A;  4OB3 B;  5GAN h;  1RI9 A;  2YLC A;  2RQW A;  4M7A D;  3RR6 A;  3LLR A;  2JOY A;  2CZ6 B;  4PJO B;  1W4S A;  2PVD B;  4M78 C;  2DNU A;  2VXE A;  3QJY A;  1G3T A;  2XID A;  1PKS A;  5GMK j;  5KYY A;  2RQV A;  2CP0 A;  1YJW T;  3E9G A;  2MPX C;  2RM4 A;  2XIC A;  3H6Z A;  4L6V 5;  1K0S A;  3RDV A;  2ZPF B;  3CCQ A;  2RK2 A;  1VIE A;  2FL7 A;  4C0G A;  3ASK A;  3FLG A;  1BI1 A;  3KXT A;  1VQ9 T;  2QA4 Q;  3A8H B;  1TTH B;  2DYB A;  1PC0 A;  3P8H A;  2F2W A;  1YI2 A;  4LDU A;  1ZUU A;  3GNF B;  2P4R A;  2HEQ A;  4P5N A;  2JN0 A;  4B6M A;  3CC2 A;  1CKA A;  3THK A;  4A4K A;  2JS2 A;  2R5A A;  2RO0 A;  3CCM Q;  2GQI A;  1BI0 A;  1M1F A;  3EG0 A;  4JLI A;  2COW A;  4EIK A;  5C6S A;  3ER0 A;  2M9U A;  1YNZ A;  4XTW A;  2O4X B;  4M4Z A;  3CCE T;  1PRL C;  4PLI A;  1E6G A;  3NTK A;  5GAM e;  1JB0 E;  5CCA A;  2FRW A;  1M2V B;  3M58 A;  4PJO E;  1K9M R;  3CCU A;  1D0Z A;  1UEB A;  1IZ6 A;  1LPL A;  3PMI A;  4D6W A;  4JJN K;  3CME T;  3JCM b;  1T3L A;  5J3B A;  1GL5 A;  3SEM A;  4QKU A;  2AIR B;  3OBW A;  4CC7 A;  5GAN g;  1D1B A;  3LYI A;  4E7I A;  2IIM A;  2LVM A;  1CSK A;  2CRE A;  1KC8 R;  4E2F B;  3CC7 A;  3UPU A;  4PJJ A;  3M0U A;  5FW9 A;  2D6F A;  4XTU A;  1K0X A;  3OYD A;  4M78 B;  3CCL A;  5IXF A;  1VIF A;  3GLX A;  5KE2 A;  2DIQ A;  4HXJ A;  3TEE A;  2LJ0 A;  3FRN A;  3BFM A;  1KQS S;  4MZT A;  1Y0M A;  3NPF A;  2YUN A;  1KJW A;  3QKJ A;  4B9X A;  1RL2 A;  6AT1 B;  4R56 A;  2CGH A;  5GMK h;  4X9D A;  1JJ2 P;  3JCM V;  3CBO A;  2C0O A;  2WSE E;  2DE0 X;  1YJW Q;  3MEA A;  4JPB W;  1C0M A;  2KAF A;  4GY5 A;  2DVJ A;  3TVT A;  1G8X A;  2I2L A;  2QEX A;  2OTJ T;  2HD0 A;  4AFS C;  4M7A G;  1G5V A;  1H3H A;  3EH2 A;  3NMZ C;  1K73 R;  4M75 G;  4ATO A;  4J9H A;  4PFO A;  5CK9 A;  2ZCF B;  2C06 A;  1M3A A;  3C12 A;  3ZFJ A;  1HD3 A;  2EW3 A;  3EG1 A;  4BDZ A;  3EFO A;  4IUU A;  2MF2 A;  1GCP A;  4M78 E;  3CC4 T;  1NPR A;  1XJW B;  4IUP A;  1S72 T;  3EHR A;  1AEY A;  4PJO A;  3CCE Q;  2YLB A;  3PFS A;  1R0C B;  1LCK A;  2FPF A;  3E19 A;  1M9S A;  4M77 C;  4QT7 A;  3R6O A;  3OMG A;  4FT2 A;  3I35 A;  1QW1 A;  1NYG A;  5GMK l;  4FU6 A;  5D6Y A;  1VQ6 A;  2RB6 A;  2LCS A;  3CCJ T;  4PJL A;  2K2M A;  2QAS A;  4JRP A;  4PJO F;  8ATC B;  3RKY A;  3OA6 A;  2RI5 A;  4QW2 A;  3CPW A;  1M4Z A;  4RKU E;  4E47 A;  3CPW S;  1Z9Z A;  2JM9 A;  1YHQ A;  3PT9 A;  1KQ2 A;  5IXB A;  1KHC A;  2J05 A;  3QHS A;  2A3L A;  3WVD B;  4XQ3 A;  1KFZ A;  4AMC A;  4JJC A;  1U1S A;  2EGC A;  4WCI A;  4N4I A;  4E7Z A;  2PUK B;  2O4X A;  3LH0 A;  3OYH A;  3RUX A;  1M2V A;  2W0Z A;  2EJ9 A;  4Z89 A;  2QQ9 A;  2GF7 A;  4MDW A;  2SRC A;  4JJB A;  3M0Q A;  1TS9 A;  1QVG P;  3M0P A;  2FB7 A;  1UG1 A;  2JMA A;  2P0P A;  3UT1 A;  5GAN 7;  5IH2 A;  4IUQ A;  3QSU A;  1J3T A;  2KNB B;  2H3J A;  3UF4 A;  1U06 A;  1K8A C;  2NUT B;  3H0H A;  2OTJ Q;  1RAB B;  3X28 B;  1LVK A;  1V76 A;  2F5T X;  5KCH A;  3RMQ A;  2CDT A;  1VQN A;  1ABO A;  1ZUK A;  5LJ5 j;  5M9O A;  1Y57 A;  5LJ3 d;  2ESW A;  4J9E A;  3DB4 A;  2VB6 A;  4J9D A;  2BTT A;  2HL3 A;  2DX1 A;  2HQX A;  4F7U G;  3EGX A;  2A28 A;  5CQX A;  4JS4 A;  4M77 B;  4PNO A;  4RTV A;  4C8Q D;  3CC4 Q;  2CKK A;  4NL2 A;  1JXM A;  1FXX A;  2RHZ A;  2E3H A;  2QDL A;  3FJ5 A;  4FM4 B;  2YT6 A;  3NHN A;  4KUI A;  1VQP A;  1Y71 A;  3H0F A;  1YWO A;  2KGT A;  2EBP A;  1IHW A;  2DAQ A;  1QCN A;  4M78 F;  4OB1 B;  3FJP A;  2DL4 A;  2HAX A;  2A7Y A;  2OTL A;  2ZPB B;  1ZA1 B;  1K8A U;  1I5O B;  4MDX A;  3HPW A;  4C92 B;  5GAO q;  1CKB A;  1WHG A;  3QXE B;  4DOV A;  1NEG A;  1SPK A;  3JCM P;  2QTX A;  2HBP A;  1VQ9 A;  4N0A C;  2KRM A;  1AWW A;  4JS5 A;  2WSF E;  3I55 T;  2LRQ A;  1NBE B;  3OS5 A;  3CCV Q;  1SF9 A;  1EFN A;  3MP1 A;  5KYW A;  4JJD A;  3SWN A;  3REA B;  1KQ1 A;  4M77 E;  2HBW A;  1W1F A;  3HRS A;  5FWC A;  1M8M A;  5KYU B;  2KRS A;  3QII A;  5KYX B;  1MUZ A;  5GAO l;  3CME A;  3CCR T;  1ZA2 B;  1TWB A;  1VQM A;  1YIJ T;  2D8H A;  1XOV A;  3UAT A;  2GFU A;  1YJN A;  2DJQ A;  1VQ7 Q;  5CKF A;  1M3C A;  4C92 E;  4GBQ A;  3ZEH A;  1SSH A;  1H92 A;  5LJ3 e;  1PSF A;  3AT1 B;  5KYY B;  2EYX A;  1WXT A;  2V1R A;  2RK1 A;  1BI2 A;  3CXC P;  1BU1 A;  2ENM A;  4KT0 E;  1AOJ A;  1K4U S;  5GAN 8;  3VRY A;  1EZZ B;  2LQW A;  2L3R A;  1YJ9 T;  5GMK e;  2JTM A;  1LJO A;  3LGF A;  4IIM A;  1I8F A;  4RMO A;  1W2B A;  1WJQ A;  1W2B S;  2W10 A;  3OYN A;  5FRN A;  1N5Z A;  2LJ1 A;  1GRI A;  1E7O A;  2DTO A;  1ACM B;  4BE1 A;  4UC4 A;  3JCM f;  4LD9 K;  1AWX A;  4CRI A;  2GBQ A;  4WF2 A;  3CMA T;  2VWF A;  5HKC A;  2VUB A;  3URG A;  1ZBJ A;  2QQB A;  2D9T A;  4X9C A;  4XK8 E;  2MOX A;  2V8K A;  2K7A A;  3EGU A;  2E4H A;  3V8K A;  1VQ8 A;  1NZ9 A;  4J8O A;  1RUW A;  2CH4 A;  2K3X A;  3G71 T;  2RN8 A;  5KE3 A;  4C8Q G;  2K79 A;  2QDY B;  5CR2 A;  2Y90 A;  4BI4 A;  1PG5 B;  1M3B A;  1G3S A;  1RAI B;  3ZL7 C;  4PJO C;  1WXU A;  4A54 A;  1TUC A;  1I0C A;  2O88 A;  1UGS B;  4MZM A;  1S72 A;  2DM1 A;  2QA4 T;  2I0N A;  1VQO Q;  2HSP A;  4Q5W A;  2VV5 A;  2L3Q A;  3PVL A;  4C5H A;  2JW4 A;  2CT3 A;  2DYI A;  3QYH B;  3NTH A;  4O6J A;  2O31 A;  5LJ5 g;  5I22 A;  1MHN A;  4M7A C;  2EGE A;  2C0I A;  1UHC A;  2JTF A;  4M77 F;  3GIB A;  2DBK A;  5DLQ E;  3CCJ A;  2RJD A;  2E10 A;  1YIJ Q;  2GCX A;  2M0O A;  3DLL A;  4C92 A;  4PK4 A;  4J6X A;  4C0D C;  3JB9 F;  4CC2 A;  1M1K C;  2DEU A;  3SDZ A;  2FZK B;  4E7L A;  2KSS A;  2YWW A;  2HSE B;  1Q86 R;  4RUG A;  3EG9 A;  5GJW B;  2Z0W A;  1FMK A;  1PRM C;  1WPY A;  4XAX B;  2OX7 A;  1QKX A;  4D8K A;  2X35 A;  1YJ9 Q;  4C92 F;  1AVZ C;  2ABL A;  5C0M A;  2GGR A;  3X20 B;  1TXQ A;  5I11 A;  3HFO A;  1ZLM A;  3NGP A;  5KYX A;  4QQD A;  1WGS A;  4QVC A;  4O5V A;  3CMA Q;  2FYK A;  1Q7Y R;  3EFO B;  5IAY A;  4ORZ A;  3VYG A;  2LMJ A;  2LQN A;  2G3R A;  3BW1 A;  2P0K A;  4M75 D;  1MV3 A;  5LJ5 d;  4XU0 A;  3OW2 P;  1QCF A;  2O2O A;  1M1K U;  1EX4 A;  1YIT A;  1FWZ A;  2RJC A;  3CEY A;  3G71 Q;  4EMG A;  2M16 A;  5HCK A;  1F1B B;  4J6W A;  3I56 A;  1PSE A;  1X01 A;  1UEC A;  1OUL A;  1M90 C;  2M51 A;  3BY7 A;  4AG2 C;  1MMG A;  2HQH A;  1N8R R;  2X4W A;  1OU9 A;  2XDP A;  1HYO A;  3M0S A;  3PGG A;  3CD6 A;  4J9B A;  4JZ4 A;  2M02 A;  4M7A B;  4AFZ C;  1BIB A;  1IB8 A;  3M9Q A;  4M75 B;  1GCQ A;  1NJI C;  1HJD A;  2OAW A;  2CSQ A;  2E3I A;  3A1P A;  3OMC A;  2EYW A;  3MEW A;  2RQU A;  3L2Z A;  2LQK A;  2JNG A;  5D6W A;  7AT1 B;  5I21 A;  3G6E Q;  2XDB A;  4QVD A;  4C0D B;  1T0J A;  3X25 B;  3JCM c;  4FCY A;  2EQJ A;  1MV0 B;  4N0A A;  4GLK A;  3I9Q A;  3VS6 A;  3HRT A;  2NUP B;  2R5M A;  1SHF A;  2FEI A;  1P92 A;  2LCL A;  1JBM A;  2ZPI B;  3I5S A;  4V2S A;  1M90 U;  3RES A;  3SWN C;  1NPP A;  1IO6 A;  2DMO A;  1YFN A;  3MCA B;  2DF6 A;  1Q81 C;  2L8D A;  2LX7 A;  2QYZ A;  4LN2 A;  4BI3 A;  2QG9 B;  3VU3 C;  2LT1 A;  2PTK A;  3EFS A;  3I55 A;  1WFW A;  3PTA A;  3AHU A;  1TH7 A;  2OI3 A;  1RAC B;  3CBM A;  1NJI U;  3SD4 A;  1WX6 A;  1ZSG A;  3VYH B;  4M7A E;  3R6N A;  2HCK A;  4KRT A;  3LW5 E;  2RI2 A;  4AFU C;  2BE7 D;  5HY6 A;  1WLP B;  4M75 E;  3JRZ A;  1WHM A;  2V26 A;  3EGX B;  4J83 A;  2OAU A;  4RG8 A;  3CCR A;  2RQR A;  2AKL A;  3A8L B;  1KQS A;  2BIV A;  2DL3 A;  1B7T A;  3PIO A;  2DXU A;  5LJ5 e;  1YIJ A;  2E70 A;  2K5L A;  2K2V A;  4FSS A;  1SG5 A;  1QCO A;  2LX9 A;  4DQ2 A;  1VQK A;  5KYN A;  3MP8 A;  5A0D A;  1Q81 U;  1VQ5 A;  2CYZ B; 
#chains in the Genus database with same CATH homology
 3UF4 A;  1U5S A;  4OMO A;  1U06 A;  3H0H A;  3PE0 A;  2C0T A;  1JO8 A;  2L2P A;  1WYX A;  1WA7 A;  4J9C A;  2CDT A;  1ABO A;  1ZUK A;  1PKT A;  2FPD A;  1SRL A;  1Y57 A;  2ESW A;  5L23 A;  4LUD A;  2SEM A;  4J9E A;  2DL7 A;  4J9D A;  2XMF A;  2BTT A;  2J6F A;  2DX1 A;  3I5R A;  4AG1 C;  2A28 A;  3GBQ A;  1BB9 A;  4RTV A;  1JEG A;  1JXM A;  2QDL A;  2FPE A;  3FJ5 A;  1VYU A;  2YT6 A;  3NHN A;  2K6D A;  3VS4 A;  2ROL A;  2V1Q A;  3A98 A;  3H0F A;  1PHT A;  1YWO A;  1G83 A;  2KGT A;  2EBP A;  2L0A A;  1OPK A;  1UDL A;  1VA7 A;  2DL4 A;  3KFV A;  2KEA A;  4RTU A;  3U23 A;  1W70 A;  1W6X A;  5ECA A;  1AD5 A;  2AZV A;  2AK5 A;  1AWJ A;  3VS5 A;  1GFC A;  2CT4 A;  5EC7 A;  1CKB A;  2B86 A;  3O5Z A;  2A08 A;  1NEG A;  1SPK A;  3VS1 A;  1NG2 A;  1M27 C;  1AZG B;  4LUE A;  2RQT A;  3H0I A;  2KRM A;  3PVQ A;  2J6K A;  1AWW A;  1ZUY A;  1WI7 A;  4OMQ A;  2LNH B;  4JZ3 A;  2JM8 A;  3C0C A;  1HSQ A;  1X43 A;  2KT8 A;  1EFN A;  2RPN A;  1WIE A;  2KRN A;  2ROT A;  4JJD A;  3REA B;  1BBZ A;  4Z88 A;  1VYV A;  1SEM A;  3RBB B;  1WDX A;  1GFD A;  2EVR A;  2JTE A;  2D1X A;  4HVV A;  2HBW A;  4F16 A;  1W1F A;  3VS3 A;  4J9F A;  1TG0 A;  5FWC A;  1ABQ A;  2PZ1 A;  3EG2 A;  1M8M A;  2KRS A;  1MUZ A;  4DEX A;  1QWE A;  2JMC A;  1NYF A;  2LZ6 B;  4K11 A;  2DBM A;  5IHK A;  4HVW A;  2CH4 W;  1UJY A;  2BZ8 A;  3EG3 A;  1RLP C;  2A36 A;  1PNJ A;  2MCN A;  2EQI A;  2D8H A;  3REB B;  1XOV A;  1UUE A;  3TSW A;  3UAT A;  3H41 A;  2J6O A;  1RLQ C;  2DJQ A;  1S1N A;  1YN8 A;  1T0H A;  1M3C A;  4GBQ A;  3IQL A;  1SSH A;  2DL8 A;  2J7I A;  1H92 A;  2F2X A;  1VYT A;  4A63 B;  2EYX A;  1K9A A;  1WXT A;  2V1R A;  2CSI A;  3UA7 A;  2JS0 A;  1BU1 A;  1JU5 C;  2ENM A;  1UFF A;  2RF0 A;  1AOJ A;  2JXB A;  4HCK A;  1K4U S;  3VRY A;  3RNJ A;  4D8D A;  2LQW A;  2KBT A;  2KYM A;  4RTW A;  4RTZ A;  3JV3 A;  1U3O A;  2VKN A;  1I1J A;  4IIM A;  4CC4 B;  5IHN A;  1RI9 A;  2EKH A;  2RQW A;  2W10 A;  4R0K A;  1N5Z A;  2LJ1 A;  1GRI A;  1AZE A;  1E7O A;  2DRM A;  2ECZ A;  4AFQ C;  1OOT A;  1AWX A;  2GBQ A;  4HVU A;  2VWF A;  4J9I A;  2DNU A;  1K1Z A;  1ZBJ A;  1T3S A;  1PKS A;  2MOX A;  2K7A A;  3EGU A;  2YUO A;  2RQV A;  1RUW A;  2CH4 A;  1NLP C;  4OMP A;  2FO0 A;  2RN8 A;  1YCS B;  5IHI A;  1K0S A;  2K79 A;  1GCQ C;  1M3B A;  1QKW A;  2FRY A;  3ZL7 C;  2KXC A;  1NLO C;  1WXU A;  1UE9 A;  3VRZ A;  2JT4 A;  2GNC A;  1A0N B;  2HDA A;  2DYB A;  2F2W A;  1TUC A;  1ZUU A;  2P4R A;  2HEQ A;  1I0C A;  2LP5 A;  2O88 A;  1OPL A;  1CKA A;  3THK A;  2DM1 A;  2I0N A;  2JS2 A;  2HSP A;  2NWM A;  2GQI A;  2L3Q A;  1K76 A;  3EG0 A;  3PVL A;  4EIK A;  2JW4 A;  1X6G A;  1YNZ A;  2LJ3 A;  1X69 A;  2CT3 A;  4M4Z A;  1PRL C;  1KSW A;  1JXO A;  1E6G A;  2O31 A;  1NM7 A;  2FRW A;  2KXD A;  2GTJ A;  5I22 A;  1QWF A;  1YWP A;  2EGE A;  3VS7 A;  2C0I A;  1UHC A;  2DL5 A;  2DBK A;  1WXB A;  1T3L A;  1GL5 A;  3QWX X;  3LH5 A;  5FWB A;  3SEM A;  3VS2 A;  4CC7 A;  2K3B A;  4CC2 A;  2DIL A;  2X3W D;  2IIM A;  1PWT A;  3M0T A;  4RUG A;  2RMO A;  1CSK A;  1SHG A;  2CRE A;  5GJW B;  1FMK A;  1PRM C;  3M0U A;  5FW9 A;  1QKX A;  2G6F X;  1K0X A;  4D8K A;  2GTO A;  1GBQ A;  1NEB A;  1QLY A;  5IXF A;  3M0R A;  2YSQ A;  1AVZ C;  2ABL A;  2GGR A;  2PNI A;  4HXJ A;  4Z8A A;  3VS0 A;  1BK2 A;  2LJ0 A;  2O9S A;  3CQT A;  3TSZ A;  5I11 A;  4J9G A;  1B3Q A;  1ZLM A;  2KT1 A;  3NGP A;  1SRM A;  2A37 A;  1Y0M A;  3NPF A;  2YUN A;  2BZY A;  1KJW A;  2VVK A;  4ORZ A;  2LMJ A;  1V1C A;  4DEY A;  2LQN A;  2F2V A;  4IIO A;  2KRO A;  4OML A;  2YUP A;  4F17 A;  1MV3 A;  2C0O A;  2DE0 X;  1QCF A;  2AZS A;  2O2O A;  4E6R A;  4LE9 A;  4JPB W;  1FYN A;  2DVJ A;  3TVT A;  1I07 A;  1UGV A;  5HCK A;  1B07 A;  1M30 A;  2OJ2 A;  2E5K A;  1UEC A;  4LNP A;  4AFS C;  2M51 A;  1H3H A;  2DA9 A;  4AG2 C;  3NMZ C;  3M0S A;  4J9B A;  1YP5 A;  4JZ4 A;  4J9H A;  1H8K A;  2H8H A;  1OV3 A;  1UTI A;  1M3A A;  4X1V A;  2ED0 A;  1HD3 A;  2EW3 A;  3EG1 A;  4AFZ C;  4CC3 A;  1ARK A;  1GCP A;  2FG0 A;  1KIK A;  2L3S A;  3EHR A;  1AWO A;  1AEY A;  1GCQ A;  1HJD A;  2OAW A;  2CSQ A;  2EYW A;  2RQU A;  2L3P A;  5GJV B;  4RTT A;  1LCK A;  2FPF A;  1GBR A;  1T0J A;  4QT7 A;  2MIO A;  1MV0 B;  3I35 A;  3I9Q A;  1NYG A;  3VS6 A;  2LCS A;  2KR3 A;  4RTX A;  1SHF A;  2FEI A;  2K2M A;  1X6B A;  2AKK A;  4OMN A;  1Z9Q A;  3QWY A;  3I5S A;  2YUQ A;  2RNA A;  4Y92 A;  3SHW A;  2DLP A;  1IO6 A;  2DMO A;  2DF6 A;  2LX7 A;  4LN2 A;  2KE9 A;  1UJ0 A;  2PTK A;  1Z9Z A;  2JM9 A;  1JQQ A;  1WFW A;  3ULR B;  2O9V A;  3EHQ A;  5IXB A;  2OI3 A;  2J05 A;  4ZNX A;  2CUD A;  2EPD A;  2K9G A;  2EYZ A;  1WX6 A;  1G2B A;  1ZSG A;  1KFZ A;  4JJC A;  4WCI A;  2EGC A;  3R6N A;  2HCK A;  4KRT A;  1ZX6 A;  4AFU C;  1WLP B;  2EGA A;  1X2K A;  2BZX A;  4OMM A;  2W0Z A;  1X27 A;  2X3X D;  4ESR A;  4Z89 A;  1X2Q A;  1UHF A;  2RQR A;  2NUZ A;  2AKL A;  2SRC A;  4JJB A;  4RTY A;  2J06 A;  2DL3 A;  3M0Q A;  1OEB A;  3M0P A;  1TUD A;  1UG1 A;  4GLM A;  2JMA A;  2D0N A;  4FSS A;  2YDL A;  2ED1 A;  5IH2 A;  2D8J A;  2CUB A;  2KYB A;  2M0Y A;  1J3T A;  3UA6 A;  4F14 A;  2DRK A;  2KNB B;  2EYY A;  1E6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...