3RMSA

Crystal structure of uncharacterized protein svir_20580 from saccharomonospora viridis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
109
Chain Sequence
QRYLWQQADGKRHVYDTARHRVQAGRPFTALCGETVTPQTERGDLTAGLWFDGECPVCTIALAKALGWPVREISDLAHRFDWSPALITRLAEVLHCSFGEVVELTGARM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Crystal structure of uncharacterized protein Svir_20580 from Saccharomonospora viridis
rcsb
source organism Saccharomonospora viridis
total genus 32
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16827 zf-HC3 zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.990 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rmsA01
3RMQA 3RMSA
chains in the Genus database with same CATH superfamily
3I35A 2QXFA 1QW1A 1WIEA 2CGHA 2YHTA 1K73C 1H641 3TQ7P 1VQ6A 5KYNA 1W6XA 2KEAA 5DY9A 4GLMA 3A8OB 1M3BA 2P4TA 1Y57A 4HCZA 1YJWT 2DIQA 2IVWA 4DBFA 4C8QB 5IHNA 2O01E 1JU5C 2DL5A 1YJ9T 2AKKA 2LQKA 1E6HA 3SFMA 4MZTA 2JTMA 1MGQA 3PVLA 3JB9H 3PTAA 3GOXA 1F1BB 1VQKA 1LPLA 4FYYB 4AFUC 1WZOA 1W1FA 2YLBA 3RR6A 1KSWA 1I5LA 3LH0A 1X6OA 4KULA 3X26B 1RAHB 5KYYA 2CP3A 5FWBA 3CC4A 3UF4A 1C0MA 1YI2Q 3X24B 2E3HA 1B34A 1VQ4T 2A0FB 4LDVA 4Z88A 5GMKi 2LJ0A 2LTOA 4JLIA 4N0AA 3CCUA 1QCFA 3RMSA 5CKHA 2DAQA 3M58A 3PMIA 3EG9A 3OMGA 1ZLMA 2ZPIB 4JZ3A 4M7AD 3LX7A 1JQQA 3SD4A 1GCPA 3CCLT 1N6AA 1YWPA 4RTTA 1SG5A 4LD9K 4HVWA 3RKYA 3PIOA 2VGNA 2JM9A 1AT1B 1Q82R 2V1QA 2ED1A 1WHJA 1D09B 4IUPA 2M02A 2OTJA 3LGLA 1R77A 3L2QA 3O5ZA 3CCMA 4C92G 1JXOA 1WJSA 4HKEA 1K9MC 2DILA 2DLPA 3X20B 4XTXA 4JUVA 1C6VX 3CCSA 2FYKA 4XTYA 2P84A 2HD0A 2ECZA 2PVOB 4XU2A 3VS3A 4XTZA 1AD5A 4PJOG 4OF1A 2QGGA 5HCKA 2DD4A 1YHQT 1M90U 1ZSZC 1VQ9T 2DRKA 1VQMT 1ZBXA 1YJNT 2MAMA 2DX1A 2FRYA 2DIGA 3P8DA 4QQDA 4C8QA 1OULA 2EYXA 4Y91A 4A54A 1VA7A 3JCMW 3I56Q 1Y7XA 2RI5A 3U23A 1JBMA 5I11A 1QMCA 4HT8A 1QVGA 2E12A 4J6WA 1M5Q1 1SHFA 4M7AB 3HPWA 2YLCA 5KYUA 2E6ZA 1VQ6Q 2YRVA 1FMWA 5D6XA 2DPPB 3I5RA 2W10A 2E4HA 1KC8R 3E2UA 4ATOA 4E6RA 3JCMP 1PC0A 1WQWA 4J9EA 2JM8A 2XU8A 5LJ3e 3QIIA 5GMKh 2K3XA 4DEXA 2F2WA 5GANh 2RHIA 4A4FA 3QDRB 5LJ5h 2JT4A 1VQKQ 1K0SA 4C92E 4M78F 4JJBA 1WI7A 4RMOA 1M8VA 3LLRA 1VQOT 4A63B 3BY7A 4M78G 2BTTA 4X1VA 4PJLA 1IXDA 2EJFA 2YXYA 3E9GA 3G6EQ 2GFAA 5GAN6 3CCUQ 3REBB 2KYBA 1K73R 4XK8E 4PJOE 4PFZA 1B3QA 1OOTA 2EJGA 3FIFA 5HK0A 2NYSA 1Q7YC 3KXTA 3OYIA 2KROA 1VQPA 3EHRA 4N4GA 3CBPA 2EW3A 4DA4A 1W2BA 1ZSZB 3TU4K 3EGUA 1Y71A 4OB3B 4KUIA 4AT1B 3OYKA 2HQHA 3MP1A 4C5EA 2AZVA 1UE9A 2KVQG 3JCMf 3CMAA 4NOYA 1I8FA 3URGA 2R58A 4F04B 1VIFA 5GAMg 2L2PA 4PFPA 3RERA 3EGXB 1WDXA 4C0DC 2PQWA 3RBBB 2L3RA 2V8JA 3OYCA 2CP0A 1X2KA 1OZ3A 4F7UA 3BDUA 1M2VA 2CT4A 1Q86C 3MO8A 1D1CA 2LVMA 1IREB 2EWNA 2E41A 2PZ1A 3NTIA 1K0XA 2AIRB 2PUOB 2OTJQ 3S6WA 3CCMQ 1YP5A 3MEAA 3CCRQ 1QVPA 4C92C 3CCVT 2OJ2A 3QJ6A 5KCHA 2ZPFB 1IGQA 3PMTA 1J3TA 3CCSQ 3E1SA 2VASA 1AZGB 3N5BB 2WACA 2J06A 1NPRA 1BU1A 2YDLA 1RACB 1QVGS 3J7AF 1OPKA 1WHHA 2KBTA 4M7AA 2F5TX 4PJOC 2FPDA 1WYXA 2E3IA 2P0KA 1VQ8A 3H6ZA 4M75A 2M1HA 3OSVA 1RLPC 4LN2A 2CSIA 4PJJA 4Z02A 2KXCA 5HY6A 2FHDA 3R6NA 2L89A 1V29B 1VYTA 5GANd 4D8DA 5LJ5d 2B8AA 4NL2A 3ZFJA 1QKWA 5D7UA 3OYLA 1YFNA 2M51A 3CCEA 1NE8A 3CBMA 1G3YA 4V2SA 4BACA 2HBWA 4CRIA 3QYHB 4HVUA 2YRDA 1K9MR 4OB2B 4OB0B 3A8MB 3TVTA 2RB6A 4X9DA 3L2ZA 4DBQA 1PSEA 4BI3A 4C0DB 3JB9F 4AMCA 2XK0A 3JSCA 3QSUA 3KFVA 4Y28E 2YUQA 2FO0A 2K57A 1YIJA 3M4GA 5M9OA 1WHLA 2DXTA 1KHCA 2EQIA 1GCQA 3OW2S 1RAFB 4C92B 1WJRA 1UJ0A 1RI0A 4PLLA 1G8XA 4C8QF 2E1HA 2LNVA 4A4EA 4KRTA 4M78C 2EYWA 1NG2A 1R0BG 5CQYA 4C8QG 1KQSS 1M1FA 5A2QE 2A36A 2O9VA 1YJWA 4HCKA 2H8HA 4PJOB 1HK9A 1RAGB 1VQPQ 2LZ6B 4CC3A 1WXTA 1XOVA 2M0YA 3V7RA 1YJ9A 1UECA 4JS4A 2R5MA 1JEGA 3HRTA 1O75A 2CT3A 3FB9A 2O31A 2ED0A 2QEXQ 3CMAQ 1YWOA 3G71T 1GL5A 1UGPB 2JTEA 2RHXA 1UDLA 2PTKA 1TU0B 1TUGB 3EG2A 2HDAA 1OU9A 1BK2A 4ZTJA 3VJPA 2RH2A 2JS0A 3CC2A 3CXCS 1WX6A 3DKMA 4O5VA 1X6BA 2CP5A 2VWFA 1NLOC 1VQLT 2FVUA 3CPFA 3H0HA 2JTFA 2VYTA 1VOMA 1AZEA 4JPBW 2XMFA 2RK1A 1KC8U 3S3NA 2JMAA 1YCSB 2K6DA 3M5AA 1FX7A 4N0AC 4A4HA 1T0JA 2CZ1B 1SSHA 5GAOl 4C5HA 1QQJA 4NL3A 3ZBDA 3JCMJ 4OGCA 2ZZDA 3HTRA 2G6FX 2XDBA 1P92A 3L2VA 1VQ8Q 2FL7A 3NGPA 1TTHB 1G2BA 1D1BA 2K5LA 2COWA 2C0IA 2DTHA 4RCBA 3UWNA 1ZUUA 2RF0A 5GAMf 4RTZA 1OV3A 4XTUA 1Q86R 2E5KA 1D1AA 2CSQA 3MP6A 1K73U 3QUIA 1M8MA 1ZA1B 2GTOA 2O4XA 3PGGA 5AT1B 1LJOA 4F16A 1K4US 1YHQA 3UT1A 1VQ9A 4M7AF 1B07A 3C94A 1YJNA 4R0KA 2IPOB 2LX9A 4GBQA 4M7AG 1S72T 1YIJQ 2L5QA 3CD6A 1HXDA 1X43A 1UHFA 1U1TA 1UUEA 2NUZA 3F70A 4MZPA 3CCQT 5CKFA 2SEMA 3PE0A 1X69A 2DZ9A 4C8QC 3JCMe 2KRMA 5A0GA 1M2OA 4OB1B 2HCKA 1YITT 2QASA 1KD1C 3EG9B 1WFWA 3OYYA 2FB7A 2FG0A 2FZGB 4N4IA 2EPDA 2DA9A 2X4YA 1WHGA 5IH2A 1N9RA 4OP0A 1K8AC 3OYHA 1VQNT 3M0UA 3OYGA 2ZPHB 1YCYA 3CCJA 5LJ3j 1PRMC 1VQOA 2MMPA 4F7UE 2OTLT 5KH6A 3BW1A 5DM7R 4J9HA 2P4RA 1FYNA 3NTHA 3CC2Q 3EAEA 1IB8A 1PWTA 4MMKA 3V7CA 3VS0A 2KRSA 3BDLA 1QVFP 2LCLA 3SWNA 1G3SA 3I55A 2K2VA 2M9UA 2KT1A 2X51A 3S3MA 1T3SA 1AHJB 4QW2A 1WHKA 1Q81U 1GFDA 5GAOn 4E7SA 1X75C 4JS5A 3L1AA 1KIKA 2RQRA 3HSBA 2BZYA 1NLPC 1OX8A 4WTOB 3VU3C 1Y96A 3OSSC 4M75E 4JRKA 4J7FA 4FSXA 2FZKB 2L8DA 1OQKA 4J7IA 4ESRA 1ZA2B 4A53A 4RTXA 2ZCFB 3EG3A 2EQUA 1BKBA 1VQ5T 2DL8A 2J7IA 2K3YA 4B9XA 3VYHB 3CCVA 2A08A 4QKUA 3C95A 3M0SA 2Y4YA 3QZ5B 3CPWP 3MJXA 5KYUB 2QAZA 1U5SA 2HMAA 3GBQA 2KGTA 1Y0MA 4BY6C 2MIOA 3WXMB 2EGEA 5L23A 3OBWA 1GRIA 4M77D 2PNIA 2ZAEA 1KJWA 5L8RE 3VKIA 3VS1A 1ZBJA 1YHQQ 3GP8A 2YUNA 1RAEB 4UC4A 1U3OA 2DL4A 4J9FA 3V8LA 5GAN7 4KUDK 4HA8A 2HZYA 3MKDA 2GFUA 1BIBA 3META 4M7AC 3FEOA 3CD6Q 4BI8B 5GAN3 1R8OB 4MDWA 3SDZA 4M75D 4M75C 4ZN3A 2C06A 2RJDA 2C0TA 2CKKA 3DLMA 3EH2A 2QQBA 4RTWA 1MHNA 5A0LA 5C6SA 2GCXA 3A8LB 3G4SA 2E64A 5I2SA 2RA2A 2CH4A 1VQ7T 4C92F 1EX4A 2JXBA 1AEYA 5CQXA 4A4KA 2CS7A 2L3QA 2E6NA 3VUBA 5GAN2 2EFIA 1BI2A 2JVVA 3JCMX 4E7KA 2HL5C 3CCJQ 2DETA 2QDYB 1CSKA 2XG8D 4HCCA 2LJ1A 3T9NA 3PFSA 1G3TA 3MEWA 4PJOF 3FC3A 4F7UB 1M2VB 1K9AA 1KHIA 5EC7A 3M59A 4BY6B 2RHYA 2KSSA 4L59A 1KQ1A 2E5QA 3GNGA 3M53A 3I55Q 2QTXA 3PT9A 1GCQC 1TOVA 3LYIA 7AT1B 1UGSB 1M1KU 5GAN8 5CKEA 2YSQA 1KD1R 4L5GA 1U1SA 5GAMe 2FRWA 3AHUA 3TREA 5CVIA 1UG1A 1YI2T 4CI0C 3INZA 2CREA 3FRNA 4VUBA 3G71A 4AFSC 4DBRA 1K8AR 2FZCB 3CMEA 4PL6A 3QYGB 2C0OA 1PHTA 3VYGA 3C12A 5IHKA 4M75B 4IUQA 2F2XA 1M3AA 1MMGA 1N8RC 1N5ZA 1E7OA 1I07A 3EGDA 1O9SA 1MUZA 1C1AA 2DVJA 3DB3A 1DJ7B 2VGMA 1VQLA 5FRMA 2RNAA 3L2RA 5GJWB 1VUBA 3VS5A 3ZL7C 1MMNA 2RHUA 3QWXX 4FM4B 2HAXA 4C0GA 4RG8A 1OU8A 5J26A 3MP8A 2L3SA 4WF2A 3CC4Q 6AT1B 3REAB 4BD3A 1GBRA 2EQMA 4OMNA 2PVDB 2D8JA 5LJ3h 4FT4A 3CC7T 5I22A 2J05A 1WXUA 2QQ9A 2MI6A 2E70A 3IQLA 4R55A 1M30A 1M9SA 3OW2A 4OMFB 3A8GB 1LCKA 3EHQA 3FJ5A 3E19A 3G1JA 2CP2A 2LNHB 1KQ2A 2X3WD 2GTJA 1LOJA 1KQSA 2HKQB 2DXBA 1TXQA 3WVDB 4IUUA 4PK4A 1GBQA 2LT1A 3G4SQ 2AK5A 1AVZC 1PD1A 5CAIA 1TS9A 2IIMA 2XKOC 2L3PA 3I56T 4E7LA 2DEUA 4JRQA 2EIFA 2V26A 3CQTA 5I2MA 3LWHA 5GMKl 4M77A 4E7IA 2V8IA 1I1JA 3HHTB 1X6GA 5HKCA 1VQ6T 5GANg 1XQHA 5LJ5g 3LW5E 4R56A 1E6GA 4KGZB 3CXCA 5GAN5 5CO7A 4EMKC 2Y4XA 3CCQA 2DVEA 2E65A 2DYBA 5ECAA 1GFCA 1WNLA 2NUPA 5J3BA 1YITA 4DQ2A 4OMPA 4C5IA 4BE0A 2F5KA 1VQKT 2EVRA 2DRMA 3QPHA 3QWYA 3EFOA 1UGRB 1V76A 2RHZA 5I21A 1ZX6A 2HL3A 4CC4B 4RKUE 1MNDA 2BUDA 2LX7A 4KBMB 4EMGA 3G6ET 3G71Q 3CMEQ 3OYNA 2MOXA 3CCUT 5IXFA 2OTLA 2DERA 2EBPA 1TUDA 4ZNXA 5IN1A 2QI2A 2K4YA 5J39A 3LH5A 2QYZA 4QQGA 1UJYA 2KRNA 3OMCA 3CEYA 4K11A 5GMKm 2SRCA 4IIOA 5LJ3d 3QKJA 4D8KA 4LE9A 1IO6A 5CR2A 3TSZA 1Q82U 1UGVA 5D6YA 2KYMA 2O4XB 4RCCA 1RL2A 2KQWA 2DL7A 2YWWA 3SWNC 1H92A 4MZMA 4LUEA 2JOYA 3QDFA 2CZ0B 1YNZA 2OTJT 1PD0A 3CCMT 3NMZC 3CCRT 3AT1B 4EMKB 3MPUB 2QA4T 5FU6C 3I9QA 2BE9B 4PFOA 4Z89A 4YTLA 1VQ5A 1WXBA 1X27A 2M0OA 3CCST 1N8RR 2ZPEB 3GNFB 2EYQA 2P0QA 4A4GA 1Y07A 3NHNA 1IHVA 5DLQE 4PNOA 2O88A 2AHJB 4AG1C 3SHWA 3A98A 1H8KA 2X4WA 2DFUA 2DF6A 4HCBA 5KYWB 2LMJA 1XTDA 1PRLC 4BUGA 1UEBA 4J6XA 4LNPA 1VQ4A 1QVGP 2X3XD 3RDVA 2RQUA 2VV5A 4II1A 2AZSA 1K8AU 1KK7A 2GF7A 1ABOA 3PNWC 2ENMA 2XDDA 3J80E 4BDZA 1QWFA 4M7DE 5CCAA 1Q7YR 5LL6S 4C0ZA 3JCMV 2R57A 1T3LA 3CCLA 3TCJA 3CCQQ 1HD3A 3QBYA 3THKA 4DBHA 4RG2A 4BDYA 3NTKA 1BIAA 3SWNB 2J6FA 1WGSA 3P8HA 4CC7A 1RI9A 1YITQ 1MV0B 2YUPA 2KE9A 2MYSA 2JN0A 3X25B 1RAIB 2MCNA 3KUFA 1NZ9A 1VQ7A 2DTIA 1IGUA 4KGXB 4P5NA 4F7UF 5FU6B 2KXDA 2RJCA 4LXCA 3A5ZB 4JLGA 1QVFS 1SPKA 4DOWA 4QT7A 4F7UG 3CCEQ 1D0YA 2LQNA 1PG5B 1B7TA 1Y96B 4OMLA 2OTLQ 2I0NA 2VXEA 1ARKA 1U06A 1EZZB 2K5IA 4M77G 4PJNA 1W2BP 4WCIA 5GANf 2KNBB 1D0ZA 3H9NA 5LJ5f 4B9WA 2EQKA 1VYUA 1WLPB 1Q95G 4EDUA 2DNUA 1VQMA 4EMKA 4M7DD 4ANJA 4OGEA 2RPNA 2D0NA 2QEXT 2DEQA 3HP9A 2F1LA 1EIFA 4M75F 2RJFA 2MWPA 3FJPA 1PM3A 3ASKA 2XI9A 1MV3A 1H3ZA 1ZHIA 2PUKB 4M75G 1GXIE 1QCNA 2VXFA 3PVQA 3S3OA 4JJNK 3VS2A 1NJIC 2EGAA 5GAMj 2X4XA 2H3JA 2AKLA 5KYWA 2JNGA 3CPWS 1JJ2P 3RKWA 3NPFA 2BE7D 1YJWQ 1IRXA 4FW2A 3JB9D 1SF9A 4DOVA 3M0RA 3OB9A 1YJ9Q 2CZ6B 1RLQC 2DMOA 4E7ZA 3RUXA 5GMKj 1PCXA 2X35A 2ZPBB 2W0ZA 4QVDA 4HXJA 2GGRA 1YBYA 3HL8A 3JRZA 1VQ8T 5GJVB 3JCMh 4M4ZA 1W4SA 2RQVA 1W70A 4Z8AA 1WPYA 1OI1A 3OA6A 3OS1A 3FDRA 1VQ4Q 1QP3A 2FPFA 4M77E 2D0QB 2MWOA 2H3EB 1BI3A 3H0FA 3CC7A 1K9MU 4JRIA 5GAN4 1EFNA 1QLYA 3E9FA 2BKDN 4HT9A 3M0QA 3CBOA 3OYAA 1S1NA 2VUBA 1UB4A 4M7DB 3QG1A 3CCLQ 2L0AA 5CIUA 1M27C 1BBZA 3M56A 5KCOA 4XU3A 8ATCB 3DB4A 1JRIA 1NPPA 3C0CA 4FIBA 1G3WA 1HSQA 1VQ7Q 3I56A 4O6JA 4JRPA 3M54A 1SRLA 2BZ8A 1NYGA 3OQ5A 4BE1A 1N8RU 4DEYA 2GQIA 1TSFA 4M77C 3JCMg 3EGDB 2DJZA 2LC4A 2D9TA 3M9QA 4X34A 3OS2A 1VQ9Q 1VQMQ 3JB9J 2WSCE 1YJNQ 2DZCA 4JZ4A 5FWCA 1LVKA 2DTOA 2HKNA 3CC2T 4J9CA 3G6EA 4KH0B 1D0XA 4IIMA 5KYXB 4FU6A 1RABB 1SKUB 4HVVA 3JCMd 1A0NB 4OMMA 1IZ6A 1PKTA 2RMOA 1ZUKA 1Q7YU 1N9SA 1UGQB 4ZGEB 4FYXB 5FLXE 2BZXA 1AWJA 1WQ7A 1ZSGA 3JCMQ 2VKNA 4ELZC 2X9HA 3A8HB 5A0DA 3GIBA 3BFMA 2F69A 2FEIA 2KR3A 2JS2A 1ABQA 1FMKA 1ZUYA 5IXBA 1VQOQ 5CKBA 2DXUA 2WSEE 3OBYA 2DBMA 5HK3A 4M7DA 1QCOA 2NUTB 2LCSA 1Q86U 5FRNA 2LQWA 2RN8A 2GBQA 2KDSA 2KY9A 2LQ8A 3EG1A 4J9GA 3CCRA 2QA4A 1NJIR 3CC7Q 4M77B 1T0HA 1U8RA 1Q81C 1Z9ZA 2A3LA 3WVEB 3HFNA 3V8KA 2M16A 3M0TA 4QVCA 2QGFB 5FW9A 2NUPB 2YT6A 1CKBA 1TH7A 2F2VA 1YN8A 2DL3A 4J9IA 4KH1B 1G5VA 3P8BB 3EFOB 1D3BB 4LDYA 3CD6T 5GMKe 5IT9E 1UFFA 3VS6A 5GANe 2QTVA 5LJ5e 1JB0E 4Q5WA 4L6V5 3QHSA 5GAMh 1PKSA 2O9SA 3CCVQ 5CK9A 3V7SA 2ABLA 1NEBA 4ELYC 4OMOA 1UHCA 1VIEA 5KYXA 4LDXA 5EG2A 2LJ3A 1TG0A 2DKGA 1JXMA 1BI1A 2LT4A 1FMVA 1ACMB 4F17A 3CCJT 2R5AA 3O8VA 1AWXA 3R6OA 5D6WA 2OAUA 2MF2A 3M0PA 1AWOA 1NEGA 2HSPA 5CKDA 4KGVB 1MNEA 1XNIA 4ZGJB 2XD0A 2MK5A 4OVAA 3I55T 1TWBA 4RTVA 2MPXC 4JJDA 1BB9A 1KFZA 2NUTA 1RADB 4IUTA 2VB6A 1WA7A 3VS4A 3NFCA 2ROTA 5GAOp 4J83A 4AFQC 4XQ3A 1HJDA 2OAWA 4RUGA 2QEXA 3X28B 4PJMA 4LDUA 1K76A 2ZPGB 1S72A 1QWEA 3OYEA 2RI2A 1RUWA 2RM4A 4ZN1A 4KT0E 2D1XA 3BE3A 3H0IA 1FWZA 3JAME 2CP7A 3UATA 3H41A 3VUZA 4XTWA 4F14A 1OX9A 1VYVA 1M90C 2QA4Q 4C92D 4FSSA 2DBKA 2DD5A 1OPLA 2GNCA 2QQRA 1JJ2A 1JO8A 1HYOA 1RAAB 1M1KC 2D6FA 2BIVA 3I5SA 5LJ3g 1D3BA 4LD6A 3GPLA 5GAMd 3JCMb 3KBGA 1VQNA 2EKHA 3CC4T 2Z0WA 4PJOD 4IURA 4RTYA 4M78E 3EFSA 2E10A 2Y90A 2V1RA 2KAFA 3OYMA 3RESA 1V1CA 1BI0A 3OS0A 2CH4W 3RMQA 5GAOq 4FYVB 2XIDA 3HRUA 2DM1A 4M7DF 3D7SB 4EMHA 2LP5A 1WJQA 1BYMA 1QVFA 4OMQA 2AT1B 2COZA 1VQLQ 3MHXA 2LDMA 2DJQA 3L42A 1SHGA 1PNJA 4M7DG 4XAXB 1MMAA 2V8KA 2XDPA 4FT2A 4QVZA 4MDXA 3QJYA 3UPUA 3G4ST 1Q81R 4BI4A 2P0PA 3SEMA 2IG0A 4IUVA 4AG2C 2HBPA 3L2UA 4AFZC 2CP6A 3OYDA 4PKCC 2EYYA 1BCOA 1OZ2A 3OS5A 3EFRA 4J5YA 5KE3A 3MEUA 3JB9G 3VV0A 1K1ZA 1PSFA 4GLKA 3OYJA 1ZSZA 2KT8A 1W2BS 2EAYA 3DLLA 4M78D 3EH1A 1I4K1 3H8ZA 1NJIU 2CZ7B 2D8HA 3ER0A 2RQWA 2EKOA 5FU7C 4PLIA 2RO0A 3CPWA 3EGXA 1KD1U 2KK4A 4D6WA 3A1PA 1I0CA 3VS7A 1SSFA 2QK0A 3G7ZA 3V8JA 3ULRB 3LWIA 1FXXA 1SRMA 3TEEA 3L2WA 2JZ2A 2CDTA 1G83A 3CMET 2DXCA 1JJ2S 1S72Q 2HEQA 1X01A 2G3RA 4TVRA 3RNJA 4LDWA 2LRQA 5IHIA 5DLOA 3RIRA 1NYFA 1M4ZA 2K79A 4RTUA 3UA7A 4JDSA 1QKXA 5KE2A 2K7AA 3JB9I 4J8OA 4ORZA 5C0MA 2QQAA 3OYFA 3HRSA 3JV3A 2COYA 2NWMA 2YUOA 4XU0A 2FPEA 2RK2A 1MMDA 2QQSA 1SEMA 3Q1JA 2RJEA 4IKFA 4E47A 2I2LA 3JCMc 2WSFE 1QP2A 1VQNQ 2XHCA 1M1GA 1LNXA 1H3HA 4C0FA 4M77F 4LUDA 4M78B 3RKXA 4C8QE 2KI7A 2EQJA 1BCMA 3OW2P 8AT1B 1VQPT 5FU7B 2RD1A 2A37A 2DK3A 3OYBA 2PU9B 2JW4A 5GAOr 1NM7A 1KQSP 4ZGDB 2ESWA 3QXEB 1M90R 4M7DC 1UTIA 4FL6A 1Q82C 3CMAT 2NLUA 2B86A 2CUBA 1WHMA 4EIKA 1N27A 4C92A 3GLXA 1M1KR 4C5GA 2DE0X 4J9BA 1NBEB 2EJ9A 4FYWB 1YI2A 3M55A 1Z9QA 2PVGB 4Y92A 5LJ3f 4J9DA 2LCCA 2VC8A 2ROLA 2KMTA 4EPCA 2CUDA 4GY5A 3VRYA 4PJOA 2JMCA 1I81A 2YRCA 2HQEA 2RQTA 3GF5A 3CXCP 3M4YA 1VQ5Q 4N4HA 5KYYB 5GAOm 2EGCA 4CC2A 4ME7A 1XJWB 2A7YA 2DO3A 4JJCA 2J6KA 5IAYA 4E7JA 1B34B 4FW1A 5GANj 4C8QD 3M57A 2CYZB 5LJ5j 1OYXA 3QZ9B 4ZTFA 5FROA 2J6OA 2HNIA 1ZQ1A 9ATCB 4BB7A 2K3BA 3UA6A 2JUFA 3ZEHA 1R0CB 2A28A 1TUCA 1I5OB 2XICA 4XU1A 2K2MA 4QQ6A 2RI3A 3CCET 1AOJA 4J6YA 4BE2A 3OY9A 3MCAB 1KC8C 4MMLA 3SB2A 2X4JA 3LGFA 2DYIA 2ZGWA 3HKSA 4X9CA 2HQXA 4NS5A 1CKAA 4FCYA 4E7HA 2JJ9A 2QDLA 3C4SA 3UDCA 3J81E 2ATCB 2K9GA 3PIPA 3TSWA 1M3CA 3EG0A 2K5FA 4M78A 2GQVA 1AWWA 3QO3A 2OX7A 2VVKA 3VRZA 4XTVA 3MEVA 2HSEB 5AYFA 1IHWA 2EYZA 2QG9B 1YIJT 1OEBA 3FLGA 4E2FB 1X2QA 2O2OA 4M7AE 3HFOA 4B6MA 1KG1A 3ME9A 2OI3A
chains in the Genus database with same CATH topology
4KBMB 4HT9A 4EMGA 1G5VA 2QXFA 1QW1A 3G6ET 2CGHA 2K5LA 2YHTA 3P8BB 1K73C 4RCBA 2DTHA 1H641 3UWNA 5GAMf 1VQ6A 4XTUA 1D3BB 4LDYA 3OYNA 5DY9A 5GMKe 3CD6T 3A8OB 3CCUT 5IT9E 2OTLA 5GANe 3MP6A 2P4TA 4HCZA 5IN1A 2QI2A 2K4YA 5LJ5e 5J39A 1JB0E 1YJWT 4Q5WA 2DIQA 2IVWA 4L6V5 3QHSA 5GAMh 5CK9A 3V7SA 4C8QB 1K73U 3QUIA 2O01E 4QQGA 3OMCA 1YJ9T 2LQKA 3CEYA 5GMKm 3SFMA 2O4XA 3PGGA 4MZTA 5LJ3d 2JTMA 1LJOA 1MGQA 3QKJA 4ELYC 3JB9H 3PTAA 3GOXA 1VQKA 5CR2A 1VIEA 1Q82U 1YHQA 2YLBA 4LDXA 3UT1A 5D6YA 1I5LA 3LH0A 1VQ9A 1X6OA 5EG2A 4KULA 3X26B 2O4XB 4RCCA 1RL2A 4M7AF 2KQWA 3C94A 3SWNC 1YJNA 3CC4A 2DKGA 4MZMA 1BI1A 2LT4A 3X24B 3CCJT 3ME9A 2JOYA 2R5AA 2LX9A 1B34A 1VQ4T 4M7AG 3O8VA 4LDVA 2CZ0B 5GMKi 2L5QA 2LTOA 4JLIA 1S72T 2OTJT 3CD6A 4N0AA 1HXDA 3CCMT 3CCUA 3R6OA 5D6WA 1U1TA 3CCRT 2OAUA 2MF2A 2DAQA 5CKHA 3RMSA 3M58A 4EMKB 3PMIA 2QA4T 5FU6C 5CKDA 1XNIA 3OMGA 3F70A 4MZPA 2ZPIB 3CCQT 5CKFA 4ZGJB 4YTLA 2XD0A 1VQ5A 4M7AD 3LX7A 2M0OA 2DZ9A 3CCST 4OVAA 2ZPEB 4C8QC 3JCMe 3SD4A 5A0GA 3CCLT 1N6AA 3GNFB 2EYQA 2P0QA 4OB1B 4A4GA 1Y07A 3I55T 1YITT 1KD1C 5DLQE 4PNOA 3OYYA 2AHJB 2FB7A 4LD9K 3RKYA 4IUTA 3PIOA 2X4WA 2VGNA 4HCBA 4N4IA 3NFCA 2X4YA 5GAOp 4J83A 1XTDA 1N9RA 4XQ3A 4OP0A 1K8AC 3OYHA 4BUGA 1VQNT 2QEXA 1UEBA 3X28B 3OYGA 4J6XA 2ZPHB 1YCYA 3CCJA 4LDUA 1VQ4A 2ZPGB 5LJ3j 1S72A 4IUPA 2OTJA 3LGLA 3L2QA 1VQOA 2MMPA 4F7UE 3CCMA 2VV5A 4II1A 3OYEA 5KH6A 3BW1A 2RI2A 2GF7A 4C92G 5DM7R 1K8AU 2OTLT 1WJSA 2RM4A 4HKEA 3NTHA 4ZN1A 3EAEA 3PNWC 4KT0E 1K9MC 1FWZA 2XDDA 3JAME 3J80E 4MMKA 3X20B 3V7CA 4BDZA 3VUZA 4XTWA 4XTXA 3BDLA 4JUVA 4M7DE 2LCLA 5CCAA 3CCSA 5LL6S 2FYKA 3SWNA 4C0ZA 4XTYA 2R57A 3JCMV 1M90C 4C92D 3CCLA 1G3SA 3I55A 2HD0A 2K2VA 2DD5A 3TCJA 2M9UA 2PVOB 4XU2A 2QQRA 1JJ2A 4XTZA 3S3MA 3QBYA 4PJOG 1M1KC 2D6FA 1AHJB 2BIVA 4QW2A 4OF1A 4RG2A 4BDYA 3NTKA 1Q81U 2DD4A 1BIAA 5LJ3g 1YHQT 1M90U 1D3BA 5GAOn 4LD6A 3GPLA 1X75C 3SWNB 4JS5A 1VQ9T 1VQMT 3L1AA 1WGSA 3P8HA 5GAMd 3JCMb 3HSBA 3KBGA 1ZBXA 2JN0A 1VQNA 3X25B 2MAMA 1YJNT 3P8DA 2DIGA 3KUFA 3CC4T 4QQDA 4PJOD 1NZ9A 4IURA 3VU3C 1VQ7A 4C8QA 2DTIA 4Y91A 1Y96A 4M78E 3OSSC 4M75E 4A54A 4JRKA 3EFSA 2E10A 4J7FA 3JCMW 2Y90A 1Y7XA 2RI5A 1JBMA 4P5NA 4FSXA 4F7UF 2KAFA 2L8DA 5FU6B 3OYMA 1QVGA 4HT8A 2E12A 2RJCA 3A5ZB 4J7IA 4JLGA 3RESA 4A53A 1QVFS 1BI0A 4J6WA 4DOWA 1M5Q1 2ZCFB 3OS0A 4M7AB 3HPWA 2EQUA 3RMQA 4F7UG 5GAOq 2YLCA 2XIDA 1BKBA 3HRUA 1Y96B 2E6ZA 1VQ5T 4M7DF 4EMHA 2YRVA 1WJQA 5D6XA 2VXEA 1BYMA 1QVFA 2K3YA 4B9XA 3VYHB 3CCVA 2DPPB 3MHXA 2LDMA 2K5IA 3L42A 4M77G 4M7DG 4ATOA 4XAXB 2V8KA 2XDPA 3C95A 3JCMP 2Y4YA 3QZ5B 5GANf 4FT2A 4QVZA 1WQWA 5LJ5f 4B9WA 2EQKA 4MDXA 4EDUA 2XU8A 3QJYA 4BY6C 5LJ3e 3QIIA 5GMKh 2K3XA 1VQMA 3UPUA 5GANh 2RHIA 4A4FA 3G4ST 3QDRB 3WXMB 4BI4A 4EMKA 3OBWA 4M77D 5LJ5h 4M7DD 4OGEA 2P0PA 2IG0A 4IUVA 2QEXT 5L8RE 2DEQA 2HBPA 3HP9A 3VKIA 4C92E 3L2UA 4M78F 1EIFA 4M75F 3GP8A 2RJFA 2MWPA 3FJPA 4UC4A 3V8LA 4RMOA 3ASKA 2XI9A 1M8VA 3LLRA 1VQOT 3OYDA 4PKCC 3BY7A 1H3ZA 1ZHIA 1OZ2A 2PUKB 3OS5A 3EFRA 4M75G 4HA8A 4M78G 5GAN7 4KUDK 1GXIE 4J5YA 2VXFA 5KE3A 3MEUA 3S3OA 2EJFA 3JB9G 3E9GA 3VV0A 4JJNK 2GFUA 1NJIC 1BIBA 1PSFA 4GLKA 3OYJA 2GFAA 3META 5GAMj 4M7AC 2X4XA 3FEOA 4BI8B 5GAN6 5GAN3 1W2BS 2H3JA 1R8OB 2EAYA 4MDWA 4XK8E 3DLLA 4PJOE 2JNGA 3SDZA 3CPWS 3RKWA 3FIFA 5HK0A 2EJGA 4M75D 4M75C 4M78D 1Q7YC 3KXTA 3OYIA 1I4K1 3JB9D 1VQPA 3H8ZA 1NJIU 4N4GA 4ZN3A 2C06A 2CZ7B 3CBPA 3ER0A 4DA4A 2RJDA 4DOVA 3OB9A 1W2BA 2EKOA 5FU7C 2CKKA 3DLMA 4PLIA 3TU4K 2QQBA 2CZ6B 2RO0A 3CPWA 1Y71A 1MHNA 4OB3B 4KUIA 5A0LA 5C6SA 3OYKA 2GCXA 3A8LB 3MP1A 3G4SA 1KD1U 2KK4A 4D6WA 3RUXA 4C5EA 5GMKj 2E64A 2X35A 5I2SA 2RA2A 2KVQG 2ZPBB 3JCMf 4QVDA 1SSFA 4NOYA 3CMAA 1I8FA 3G7ZA 3V8JA 1VQ7T 3LWIA 4C92F 3URGA 2R58A 5CQXA 1VIFA 1YBYA 3HL8A 3JRZA 4A4KA 5GAMg 1VQ8T 3RERA 2CS7A 3JCMh 1FXXA 1W4SA 3TEEA 2E6NA 2PQWA 2L3RA 2V8JA 3VUBA 4C0DC 3OYCA 3L2WA 1OZ3A 4F7UA 5GAN2 2EFIA 1BI2A 2JZ2A 3BDUA 2JVVA 3JCMX 1Q86C 3MO8A 2LVMA 1IREB 1WPYA 2EWNA 4E7KA 1OI1A 3OA6A 3OS1A 2E41A 3NTIA 2QDYB 2DXCA 3FDRA 3CMET 1QP3A 1JJ2S 2XG8D 2PUOB 3T9NA 4HCCA 3S6WA 1X01A 2G3RA 4M77E 4TVRA 3PFSA 1G3TA 2D0QB 2MWOA 4LDWA 3MEAA 3MEWA 2LRQA 4PJOF 1QVPA 1BI3A 3CC7A 5DLOA 4C92C 3FC3A 4F7UB 3CCVT 3RIRA 1K9MU 1M4ZA 4JRIA 3QJ6A 5GAN4 5KCHA 1KHIA 4JDSA 2ZPFB 5KE2A 3JB9I 3M59A 4J8OA 4BY6B 3PMTA 5C0MA 2RHYA 2KSSA 3E1SA 2BKDN 1KQ1A 2QQAA 3E9FA 3CBOA 4L59A 3OYAA 2VUBA 3N5BB 3OYFA 1UB4A 2E5QA 2WACA 3GNGA 3HRSA 3M53A 3QG1A 4M7DB 1NPRA 2QTXA 3PT9A 3LYIA 1UGSB 5CIUA 3J7AF 1QVGS 4M7AA 2F5TX 5GAN8 1M1KU 4PJOC 4XU0A 5CKEA 3M56A 2RK2A 5KCOA 2QQSA 2P0KA 4XU3A 4L5GA 3Q1JA 1VQ8A 1U1SA 3H6ZA 2RJEA 4M75A 2M1HA 3DB4A 3OSVA 1JRIA 4E47A 5GAMe 1NPPA 2I2LA 4IKFA 3AHUA 3JCMc 3TREA 5CVIA 4FIBA 2WSFE 1QP2A 2XHCA 4Z02A 4CI0C 3INZA 1YI2T 3FRNA 1G3WA 1M1GA 4VUBA 5HY6A 3G71A 1LNXA 3I56A 2FHDA 4C0FA 3CMEA 4PL6A 3QYGB 4O6JA 2L89A 1V29B 4M77F 3C12A 3VYGA 5GANd 4M78B 4M75B 4IUQA 3RKXA 4C8QE 5LJ5d 4JRPA 2B8AA 4NL2A 3ZFJA 2EQJA 1N8RC 3OYLA 3CCEA 1NE8A 3CBMA 1G3YA 4V2SA 3M54A 4BACA 5FU7B 1O9SA 1VQPT 2RD1A 4CRIA 2DK3A 3DB3A 3QYHB 1DJ7B 3OYBA 2PU9B 2VGMA 1VQLA 5FRMA 3OQ5A 4BE1A 4OB2B 3L2RA 1N8RU 4OB0B 3A8MB 2RB6A 5GAOr 4X9DA 3L2ZA 4ZGDB 3QXEB 4M77C 3JCMg 4M7DC 1VUBA 2DJZA 4FL6A 1PSEA 1Q82C 2LC4A 2NLUA 3CMAT 4BI3A 2RHUA 2D9TA 4C0DB 4FM4B 1N27A 2HAXA 3M9QA 4X34A 4C0GA 3GLXA 4RG8A 4C5GA 4C92A 3OS2A 3JB9F 5J26A 3JB9J 2XK0A 3MP8A 3JSCA 3QSUA 2EJ9A 2WSCE 1YI2A 4WF2A 4Y28E 3M55A 2PVGB 2DZCA 5LJ3f 2K57A 1YIJA 3M4GA 2DTOA 5M9OA 4BD3A 2DXTA 2LCCA 1KHCA 2VC8A 3OW2S 2KMTA 4EPCA 4C92B 1WJRA 2EQMA 1RI0A 4PLLA 2PVDB 4C8QF 5LJ3h 3CC2T 4FT4A 2E1HA 3CC7T 4GY5A 2LNVA 3G6EA 4A4EA 4M78C 4PJOA 1I81A 2QQ9A 2MI6A 2HQEA 4FU6A 2E70A 3GF5A 4R55A 5CQYA 1M9SA 4C8QG 3OW2A 4OMFB 3A8GB 3M4YA 3JCMd 4N4HA 1M1FA 1KQSS 3E19A 5GAOm 5A2QE 1YJWA 1IZ6A 4ME7A 2A7YA 1KQ2A 2DO3A 1Q7YU 1N9SA 1UGQB 4ZGEB 1HK9A 5IAYA 4PJOB 5FLXE 4E7JA 1B34B 1LOJA 1XOVA 5GANj 3V7RA 4C8QD 3M57A 1YJ9A 2CYZB 1WQ7A 1KQSA 5LJ5j 1OYXA 3QZ9B 2DXBA 4ZTFA 3JCMQ 5FROA 4JS4A 2R5MA 4IUUA 3WVDB 2HNIA 1ZQ1A 3HRTA 4ELZC 1O75A 2LT1A 4BB7A 3A8HB 3FB9A 5A0DA 2JUFA 3GIBA 3BFMA 3ZEHA 5CAIA 2F69A 2XKOC 3G71T 1UGPB 3I56T 4E7LA 2RHXA 4JRQA 2XICA 2EIFA 4ZTJA 3VJPA 5CKBA 4XU1A 5I2MA 2RH2A 2DXUA 2WSEE 3OBYA 4M77A 5HK3A 5GMKl 3LWHA 4E7IA 2V8IA 3CC2A 4M7DA 3CXCS 4QQ6A 2RI3A 3HHTB 1Q86U 3CCET 5FRNA 3DKMA 5HKCA 2KDSA 4O5VA 1VQ6T 2KY9A 2LQ8A 4J6YA 1XQHA 5GANg 4BE2A 3OY9A 3MCAB 3CCRA 5LJ5g 3LW5E 4MMLA 1KC8C 3SB2A 2X4JA 2QA4A 3LGFA 4R56A 3HKSA 2ZGWA 4X9CA 1VQLT 2FVUA 3CPFA 3CXCA 4M77B 5GAN5 2HQXA 4NS5A 5CO7A 2Y4XA 4EMKC 2JTFA 2VYTA 3CCQA 4E7HA 2DVEA 2E65A 1U8RA 1Q81C 2RK1A 3C4SA 3UDCA 3J81E 1KC8U 2A3LA 3WVEB 3PIPA 3S3NA 5J3BA 1WNLA 3M5AA 1FX7A 2K5FA 3HFNA 4DQ2A 1YITA 4M78A 4N0AC 2GQVA 4A4HA 4C5IA 4BE0A 2F5KA 3V8KA 1VQKT 2CZ1B 2M16A 5GAOl 3QO3A 4C5HA 4NL3A 3QPHA 3ZBDA 4XTVA 3JCMJ 4OGCA 3MEVA 2ZZDA 1UGRB 2RHZA 4QVCA 5AYFA 5I21A 1YIJT 1P92A 2XDBA 3L2VA 3FLGA 1KG1A 4M7AE 4RKUE 3HFOA 2FL7A 1TH7A 2BUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMQ A;  3RMS A; 
#chains in the Genus database with same CATH topology
 3I35 A;  2QXF A;  1QW1 A;  1WIE A;  2CGH A;  2YHT A;  1K73 C;  1H64 1;  3TQ7 P;  1VQ6 A;  5KYN A;  1W6X A;  2KEA A;  5DY9 A;  4GLM A;  3A8O B;  1M3B A;  2P4T A;  1Y57 A;  4HCZ A;  1YJW T;  2DIQ A;  2IVW A;  4DBF A;  4C8Q B;  5IHN A;  2O01 E;  1JU5 C;  2DL5 A;  1YJ9 T;  2AKK A;  2LQK A;  1E6H A;  3SFM A;  4MZT A;  2JTM A;  1MGQ A;  3PVL A;  3JB9 H;  3PTA A;  3GOX A;  1F1B B;  1VQK A;  1LPL A;  4FYY B;  4AFU C;  1WZO A;  1W1F A;  2YLB A;  3RR6 A;  1KSW A;  1I5L A;  3LH0 A;  1X6O A;  4KUL A;  3X26 B;  1RAH B;  5KYY A;  2CP3 A;  5FWB A;  3CC4 A;  3UF4 A;  1C0M A;  1YI2 Q;  3X24 B;  2E3H A;  1B34 A;  1VQ4 T;  2A0F B;  4LDV A;  4Z88 A;  5GMK i;  2LJ0 A;  2LTO A;  4JLI A;  4N0A A;  3CCU A;  1QCF A;  3RMS A;  5CKH A;  2DAQ A;  3M58 A;  3PMI A;  3EG9 A;  3OMG A;  1ZLM A;  2ZPI B;  4JZ3 A;  4M7A D;  3LX7 A;  1JQQ A;  3SD4 A;  1GCP A;  3CCL T;  1N6A A;  1YWP A;  4RTT A;  1SG5 A;  4LD9 K;  4HVW A;  3RKY A;  3PIO A;  2VGN A;  2JM9 A;  1AT1 B;  1Q82 R;  2V1Q A;  2ED1 A;  1WHJ A;  1D09 B;  4IUP A;  2M02 A;  2OTJ A;  3LGL A;  1R77 A;  3L2Q A;  3O5Z A;  3CCM A;  4C92 G;  1JXO A;  1WJS A;  4HKE A;  1K9M C;  2DIL A;  2DLP A;  3X20 B;  4XTX A;  4JUV A;  1C6V X;  3CCS A;  2FYK A;  4XTY A;  2P84 A;  2HD0 A;  2ECZ A;  2PVO B;  4XU2 A;  3VS3 A;  4XTZ A;  1AD5 A;  4PJO G;  4OF1 A;  2QGG A;  5HCK A;  2DD4 A;  1YHQ T;  1M90 U;  1ZSZ C;  1VQ9 T;  2DRK A;  1VQM T;  1ZBX A;  1YJN T;  2MAM A;  2DX1 A;  2FRY A;  2DIG A;  3P8D A;  4QQD A;  4C8Q A;  1OUL A;  2EYX A;  4Y91 A;  4A54 A;  1VA7 A;  3JCM W;  3I56 Q;  1Y7X A;  2RI5 A;  3U23 A;  1JBM A;  5I11 A;  1QMC A;  4HT8 A;  1QVG A;  2E12 A;  4J6W A;  1M5Q 1;  1SHF A;  4M7A B;  3HPW A;  2YLC A;  5KYU A;  2E6Z A;  1VQ6 Q;  2YRV A;  1FMW A;  5D6X A;  2DPP B;  3I5R A;  2W10 A;  2E4H A;  1KC8 R;  3E2U A;  4ATO A;  4E6R A;  3JCM P;  1PC0 A;  1WQW A;  4J9E A;  2JM8 A;  2XU8 A;  5LJ3 e;  3QII A;  5GMK h;  2K3X A;  4DEX A;  2F2W A;  5GAN h;  2RHI A;  4A4F A;  3QDR B;  5LJ5 h;  2JT4 A;  1VQK Q;  1K0S A;  4C92 E;  4M78 F;  4JJB A;  1WI7 A;  4RMO A;  1M8V A;  3LLR A;  1VQO T;  4A63 B;  3BY7 A;  4M78 G;  2BTT A;  4X1V A;  4PJL A;  1IXD A;  2EJF A;  2YXY A;  3E9G A;  3G6E Q;  2GFA A;  5GAN 6;  3CCU Q;  3REB B;  2KYB A;  1K73 R;  4XK8 E;  4PJO E;  4PFZ A;  1B3Q A;  1OOT A;  2EJG A;  3FIF A;  5HK0 A;  2NYS A;  1Q7Y C;  3KXT A;  3OYI A;  2KRO A;  1VQP A;  3EHR A;  4N4G A;  3CBP A;  2EW3 A;  4DA4 A;  1W2B A;  1ZSZ B;  3TU4 K;  3EGU A;  1Y71 A;  4OB3 B;  4KUI A;  4AT1 B;  3OYK A;  2HQH A;  3MP1 A;  4C5E A;  2AZV A;  1UE9 A;  2KVQ G;  3JCM f;  3CMA A;  4NOY A;  1I8F A;  3URG A;  2R58 A;  4F04 B;  1VIF A;  5GAM g;  2L2P A;  4PFP A;  3RER A;  3EGX B;  1WDX A;  4C0D C;  2PQW A;  3RBB B;  2L3R A;  2V8J A;  3OYC A;  2CP0 A;  1X2K A;  1OZ3 A;  4F7U A;  3BDU A;  1M2V A;  2CT4 A;  1Q86 C;  3MO8 A;  1D1C A;  2LVM A;  1IRE B;  2EWN A;  2E41 A;  2PZ1 A;  3NTI A;  1K0X A;  2AIR B;  2PUO B;  2OTJ Q;  3S6W A;  3CCM Q;  1YP5 A;  3MEA A;  3CCR Q;  1QVP A;  4C92 C;  3CCV T;  2OJ2 A;  3QJ6 A;  5KCH A;  2ZPF B;  1IGQ A;  3PMT A;  1J3T A;  3CCS Q;  3E1S A;  2VAS A;  1AZG B;  3N5B B;  2WAC A;  2J06 A;  1NPR A;  1BU1 A;  2YDL A;  1RAC B;  1QVG S;  3J7A F;  1OPK A;  1WHH A;  2KBT A;  4M7A A;  2F5T X;  4PJO C;  2FPD A;  1WYX A;  2E3I A;  2P0K A;  1VQ8 A;  3H6Z A;  4M75 A;  2M1H A;  3OSV A;  1RLP C;  4LN2 A;  2CSI A;  4PJJ A;  4Z02 A;  2KXC A;  5HY6 A;  2FHD A;  3R6N A;  2L89 A;  1V29 B;  1VYT A;  5GAN d;  4D8D A;  5LJ5 d;  2B8A A;  4NL2 A;  3ZFJ A;  1QKW A;  5D7U A;  3OYL A;  1YFN A;  2M51 A;  3CCE A;  1NE8 A;  3CBM A;  1G3Y A;  4V2S A;  4BAC A;  2HBW A;  4CRI A;  3QYH B;  4HVU A;  2YRD A;  1K9M R;  4OB2 B;  4OB0 B;  3A8M B;  3TVT A;  2RB6 A;  4X9D A;  3L2Z A;  4DBQ A;  1PSE A;  4BI3 A;  4C0D B;  3JB9 F;  4AMC A;  2XK0 A;  3JSC A;  3QSU A;  3KFV A;  4Y28 E;  2YUQ A;  2FO0 A;  2K57 A;  1YIJ A;  3M4G A;  5M9O A;  1WHL A;  2DXT A;  1KHC A;  2EQI A;  1GCQ A;  3OW2 S;  1RAF B;  4C92 B;  1WJR A;  1UJ0 A;  1RI0 A;  4PLL A;  1G8X A;  4C8Q F;  2E1H A;  2LNV A;  4A4E A;  4KRT A;  4M78 C;  2EYW A;  1NG2 A;  1R0B G;  5CQY A;  4C8Q G;  1KQS S;  1M1F A;  5A2Q E;  2A36 A;  2O9V A;  1YJW A;  4HCK A;  2H8H A;  4PJO B;  1HK9 A;  1RAG B;  1VQP Q;  2LZ6 B;  4CC3 A;  1WXT A;  1XOV A;  2M0Y A;  3V7R A;  1YJ9 A;  1UEC A;  4JS4 A;  2R5M A;  1JEG A;  3HRT A;  1O75 A;  2CT3 A;  3FB9 A;  2O31 A;  2ED0 A;  2QEX Q;  3CMA Q;  1YWO A;  3G71 T;  1GL5 A;  1UGP B;  2JTE A;  2RHX A;  1UDL A;  2PTK A;  1TU0 B;  1TUG B;  3EG2 A;  2HDA A;  1OU9 A;  1BK2 A;  4ZTJ A;  3VJP A;  2RH2 A;  2JS0 A;  3CC2 A;  3CXC S;  1WX6 A;  3DKM A;  4O5V A;  1X6B A;  2CP5 A;  2VWF A;  1NLO C;  1VQL T;  2FVU A;  3CPF A;  3H0H A;  2JTF A;  2VYT A;  1VOM A;  1AZE A;  4JPB W;  2XMF A;  2RK1 A;  1KC8 U;  3S3N A;  2JMA A;  1YCS B;  2K6D A;  3M5A A;  1FX7 A;  4N0A C;  4A4H A;  1T0J A;  2CZ1 B;  1SSH A;  5GAO l;  4C5H A;  1QQJ A;  4NL3 A;  3ZBD A;  3JCM J;  4OGC A;  2ZZD A;  3HTR A;  2G6F X;  2XDB A;  1P92 A;  3L2V A;  1VQ8 Q;  2FL7 A;  3NGP A;  1TTH B;  1G2B A;  1D1B A;  2K5L A;  2COW A;  2C0I A;  2DTH A;  4RCB A;  3UWN A;  1ZUU A;  2RF0 A;  5GAM f;  4RTZ A;  1OV3 A;  4XTU A;  1Q86 R;  2E5K A;  1D1A A;  2CSQ A;  3MP6 A;  1K73 U;  3QUI A;  1M8M A;  1ZA1 B;  2GTO A;  2O4X A;  3PGG A;  5AT1 B;  1LJO A;  4F16 A;  1K4U S;  1YHQ A;  3UT1 A;  1VQ9 A;  4M7A F;  1B07 A;  3C94 A;  1YJN A;  4R0K A;  2IPO B;  2LX9 A;  4GBQ A;  4M7A G;  1S72 T;  1YIJ Q;  2L5Q A;  3CD6 A;  1HXD A;  1X43 A;  1UHF A;  1U1T A;  1UUE A;  2NUZ A;  3F70 A;  4MZP A;  3CCQ T;  5CKF A;  2SEM A;  3PE0 A;  1X69 A;  2DZ9 A;  4C8Q C;  3JCM e;  2KRM A;  5A0G A;  1M2O A;  4OB1 B;  2HCK A;  1YIT T;  2QAS A;  1KD1 C;  3EG9 B;  1WFW A;  3OYY A;  2FB7 A;  2FG0 A;  2FZG B;  4N4I A;  2EPD A;  2DA9 A;  2X4Y A;  1WHG A;  5IH2 A;  1N9R A;  4OP0 A;  1K8A C;  3OYH A;  1VQN T;  3M0U A;  3OYG A;  2ZPH B;  1YCY A;  3CCJ A;  5LJ3 j;  1PRM C;  1VQO A;  2MMP A;  4F7U E;  2OTL T;  5KH6 A;  3BW1 A;  5DM7 R;  4J9H A;  2P4R A;  1FYN A;  3NTH A;  3CC2 Q;  3EAE A;  1IB8 A;  1PWT A;  4MMK A;  3V7C A;  3VS0 A;  2KRS A;  3BDL A;  1QVF P;  2LCL A;  3SWN A;  1G3S A;  3I55 A;  2K2V A;  2M9U A;  2KT1 A;  2X51 A;  3S3M A;  1T3S A;  1AHJ B;  4QW2 A;  1WHK A;  1Q81 U;  1GFD A;  5GAO n;  4E7S A;  1X75 C;  4JS5 A;  3L1A A;  1KIK A;  2RQR A;  3HSB A;  2BZY A;  1NLP C;  1OX8 A;  4WTO B;  3VU3 C;  1Y96 A;  3OSS C;  4M75 E;  4JRK A;  4J7F A;  4FSX A;  2FZK B;  2L8D A;  1OQK A;  4J7I A;  4ESR A;  1ZA2 B;  4A53 A;  4RTX A;  2ZCF B;  3EG3 A;  2EQU A;  1BKB A;  1VQ5 T;  2DL8 A;  2J7I A;  2K3Y A;  4B9X A;  3VYH B;  3CCV A;  2A08 A;  4QKU A;  3C95 A;  3M0S A;  2Y4Y A;  3QZ5 B;  3CPW P;  3MJX A;  5KYU B;  2QAZ A;  1U5S A;  2HMA A;  3GBQ A;  2KGT A;  1Y0M A;  4BY6 C;  2MIO A;  3WXM B;  2EGE A;  5L23 A;  3OBW A;  1GRI A;  4M77 D;  2PNI A;  2ZAE A;  1KJW A;  5L8R E;  3VKI A;  3VS1 A;  1ZBJ A;  1YHQ Q;  3GP8 A;  2YUN A;  1RAE B;  4UC4 A;  1U3O A;  2DL4 A;  4J9F A;  3V8L A;  5GAN 7;  4KUD K;  4HA8 A;  2HZY A;  3MKD A;  2GFU A;  1BIB A;  3MET A;  4M7A C;  3FEO A;  3CD6 Q;  4BI8 B;  5GAN 3;  1R8O B;  4MDW A;  3SDZ A;  4M75 D;  4M75 C;  4ZN3 A;  2C06 A;  2RJD A;  2C0T A;  2CKK A;  3DLM A;  3EH2 A;  2QQB A;  4RTW A;  1MHN A;  5A0L A;  5C6S A;  2GCX A;  3A8L B;  3G4S A;  2E64 A;  5I2S A;  2RA2 A;  2CH4 A;  1VQ7 T;  4C92 F;  1EX4 A;  2JXB A;  1AEY A;  5CQX A;  4A4K A;  2CS7 A;  2L3Q A;  2E6N A;  3VUB A;  5GAN 2;  2EFI A;  1BI2 A;  2JVV A;  3JCM X;  4E7K A;  2HL5 C;  3CCJ Q;  2DET A;  2QDY B;  1CSK A;  2XG8 D;  4HCC A;  2LJ1 A;  3T9N A;  3PFS A;  1G3T A;  3MEW A;  4PJO F;  3FC3 A;  4F7U B;  1M2V B;  1K9A A;  1KHI A;  5EC7 A;  3M59 A;  4BY6 B;  2RHY A;  2KSS A;  4L59 A;  1KQ1 A;  2E5Q A;  3GNG A;  3M53 A;  3I55 Q;  2QTX A;  3PT9 A;  1GCQ C;  1TOV A;  3LYI A;  7AT1 B;  1UGS B;  1M1K U;  5GAN 8;  5CKE A;  2YSQ A;  1KD1 R;  4L5G A;  1U1S A;  5GAM e;  2FRW A;  3AHU A;  3TRE A;  5CVI A;  1UG1 A;  1YI2 T;  4CI0 C;  3INZ A;  2CRE A;  3FRN A;  4VUB A;  3G71 A;  4AFS C;  4DBR A;  1K8A R;  2FZC B;  3CME A;  4PL6 A;  3QYG B;  2C0O A;  1PHT A;  3VYG A;  3C12 A;  5IHK A;  4M75 B;  4IUQ A;  2F2X A;  1M3A A;  1MMG A;  1N8R C;  1N5Z A;  1E7O A;  1I07 A;  3EGD A;  1O9S A;  1MUZ A;  1C1A A;  2DVJ A;  3DB3 A;  1DJ7 B;  2VGM A;  1VQL A;  5FRM A;  2RNA A;  3L2R A;  5GJW B;  1VUB A;  3VS5 A;  3ZL7 C;  1MMN A;  2RHU A;  3QWX X;  4FM4 B;  2HAX A;  4C0G A;  4RG8 A;  1OU8 A;  5J26 A;  3MP8 A;  2L3S A;  4WF2 A;  3CC4 Q;  6AT1 B;  3REA B;  4BD3 A;  1GBR A;  2EQM A;  4OMN A;  2PVD B;  2D8J A;  5LJ3 h;  4FT4 A;  3CC7 T;  5I22 A;  2J05 A;  1WXU A;  2QQ9 A;  2MI6 A;  2E70 A;  3IQL A;  4R55 A;  1M30 A;  1M9S A;  3OW2 A;  4OMF B;  3A8G B;  1LCK A;  3EHQ A;  3FJ5 A;  3E19 A;  3G1J A;  2CP2 A;  2LNH B;  1KQ2 A;  2X3W D;  2GTJ A;  1LOJ A;  1KQS A;  2HKQ B;  2DXB A;  1TXQ A;  3WVD B;  4IUU A;  4PK4 A;  1GBQ A;  2LT1 A;  3G4S Q;  2AK5 A;  1AVZ C;  1PD1 A;  5CAI A;  1TS9 A;  2IIM A;  2XKO C;  2L3P A;  3I56 T;  4E7L A;  2DEU A;  4JRQ A;  2EIF A;  2V26 A;  3CQT A;  5I2M A;  3LWH A;  5GMK l;  4M77 A;  4E7I A;  2V8I A;  1I1J A;  3HHT B;  1X6G A;  5HKC A;  1VQ6 T;  5GAN g;  1XQH A;  5LJ5 g;  3LW5 E;  4R56 A;  1E6G A;  4KGZ B;  3CXC A;  5GAN 5;  5CO7 A;  4EMK C;  2Y4X A;  3CCQ A;  2DVE A;  2E65 A;  2DYB A;  5ECA A;  1GFC A;  1WNL A;  2NUP A;  5J3B A;  1YIT A;  4DQ2 A;  4OMP A;  4C5I A;  4BE0 A;  2F5K A;  1VQK T;  2EVR A;  2DRM A;  3QPH A;  3QWY A;  3EFO A;  1UGR B;  1V76 A;  2RHZ A;  5I21 A;  1ZX6 A;  2HL3 A;  4CC4 B;  4RKU E;  1MND A;  2BUD A;  2LX7 A;  4KBM B;  4EMG A;  3G6E T;  3G71 Q;  3CME Q;  3OYN A;  2MOX A;  3CCU T;  5IXF A;  2OTL A;  2DER A;  2EBP A;  1TUD A;  4ZNX A;  5IN1 A;  2QI2 A;  2K4Y A;  5J39 A;  3LH5 A;  2QYZ A;  4QQG A;  1UJY A;  2KRN A;  3OMC A;  3CEY A;  4K11 A;  5GMK m;  2SRC A;  4IIO A;  5LJ3 d;  3QKJ A;  4D8K A;  4LE9 A;  1IO6 A;  5CR2 A;  3TSZ A;  1Q82 U;  1UGV A;  5D6Y A;  2KYM A;  2O4X B;  4RCC A;  1RL2 A;  2KQW A;  2DL7 A;  2YWW A;  3SWN C;  1H92 A;  4MZM A;  4LUE A;  2JOY A;  3QDF A;  2CZ0 B;  1YNZ A;  2OTJ T;  1PD0 A;  3CCM T;  3NMZ C;  3CCR T;  3AT1 B;  4EMK B;  3MPU B;  2QA4 T;  5FU6 C;  3I9Q A;  2BE9 B;  4PFO A;  4Z89 A;  4YTL A;  1VQ5 A;  1WXB A;  1X27 A;  2M0O A;  3CCS T;  1N8R R;  2ZPE B;  3GNF B;  2EYQ A;  2P0Q A;  4A4G A;  1Y07 A;  3NHN A;  1IHV A;  5DLQ E;  4PNO A;  2O88 A;  2AHJ B;  4AG1 C;  3SHW A;  3A98 A;  1H8K A;  2X4W A;  2DFU A;  2DF6 A;  4HCB A;  5KYW B;  2LMJ A;  1XTD A;  1PRL C;  4BUG A;  1UEB A;  4J6X A;  4LNP A;  1VQ4 A;  1QVG P;  2X3X D;  3RDV A;  2RQU A;  2VV5 A;  4II1 A;  2AZS A;  1K8A U;  1KK7 A;  2GF7 A;  1ABO A;  3PNW C;  2ENM A;  2XDD A;  3J80 E;  4BDZ A;  1QWF A;  4M7D E;  5CCA A;  1Q7Y R;  5LL6 S;  4C0Z A;  3JCM V;  2R57 A;  1T3L A;  3CCL A;  3TCJ A;  3CCQ Q;  1HD3 A;  3QBY A;  3THK A;  4DBH A;  4RG2 A;  4BDY A;  3NTK A;  1BIA A;  3SWN B;  2J6F A;  1WGS A;  3P8H A;  4CC7 A;  1RI9 A;  1YIT Q;  1MV0 B;  2YUP A;  2KE9 A;  2MYS A;  2JN0 A;  3X25 B;  1RAI B;  2MCN A;  3KUF A;  1NZ9 A;  1VQ7 A;  2DTI A;  1IGU A;  4KGX B;  4P5N A;  4F7U F;  5FU6 B;  2KXD A;  2RJC A;  4LXC A;  3A5Z B;  4JLG A;  1QVF S;  1SPK A;  4DOW A;  4QT7 A;  4F7U G;  3CCE Q;  1D0Y A;  2LQN A;  1PG5 B;  1B7T A;  1Y96 B;  4OML A;  2OTL Q;  2I0N A;  2VXE A;  1ARK A;  1U06 A;  1EZZ B;  2K5I A;  4M77 G;  4PJN A;  1W2B P;  4WCI A;  5GAN f;  2KNB B;  1D0Z A;  3H9N A;  5LJ5 f;  4B9W A;  2EQK A;  1VYU A;  1WLP B;  1Q95 G;  4EDU A;  2DNU A;  1VQM A;  4EMK A;  4M7D D;  4ANJ A;  4OGE A;  2RPN A;  2D0N A;  2QEX T;  2DEQ A;  3HP9 A;  2F1L A;  1EIF A;  4M75 F;  2RJF A;  2MWP A;  3FJP A;  1PM3 A;  3ASK A;  2XI9 A;  1MV3 A;  1H3Z A;  1ZHI A;  2PUK B;  4M75 G;  1GXI E;  1QCN A;  2VXF A;  3PVQ A;  3S3O A;  4JJN K;  3VS2 A;  1NJI C;  2EGA A;  5GAM j;  2X4X A;  2H3J A;  2AKL A;  5KYW A;  2JNG A;  3CPW S;  1JJ2 P;  3RKW A;  3NPF A;  2BE7 D;  1YJW Q;  1IRX A;  4FW2 A;  3JB9 D;  1SF9 A;  4DOV A;  3M0R A;  3OB9 A;  1YJ9 Q;  2CZ6 B;  1RLQ C;  2DMO A;  4E7Z A;  3RUX A;  5GMK j;  1PCX A;  2X35 A;  2ZPB B;  2W0Z A;  4QVD A;  4HXJ A;  2GGR A;  1YBY A;  3HL8 A;  3JRZ A;  1VQ8 T;  5GJV B;  3JCM h;  4M4Z A;  1W4S A;  2RQV A;  1W70 A;  4Z8A A;  1WPY A;  1OI1 A;  3OA6 A;  3OS1 A;  3FDR A;  1VQ4 Q;  1QP3 A;  2FPF A;  4M77 E;  2D0Q B;  2MWO A;  2H3E B;  1BI3 A;  3H0F A;  3CC7 A;  1K9M U;  4JRI A;  5GAN 4;  1EFN A;  1QLY A;  3E9F A;  2BKD N;  4HT9 A;  3M0Q A;  3CBO A;  3OYA A;  1S1N A;  2VUB A;  1UB4 A;  4M7D B;  3QG1 A;  3CCL Q;  2L0A A;  5CIU A;  1M27 C;  1BBZ A;  3M56 A;  5KCO A;  4XU3 A;  8ATC B;  3DB4 A;  1JRI A;  1NPP A;  3C0C A;  4FIB A;  1G3W A;  1HSQ A;  1VQ7 Q;  3I56 A;  4O6J A;  4JRP A;  3M54 A;  1SRL A;  2BZ8 A;  1NYG A;  3OQ5 A;  4BE1 A;  1N8R U;  4DEY A;  2GQI A;  1TSF A;  4M77 C;  3JCM g;  3EGD B;  2DJZ A;  2LC4 A;  2D9T A;  3M9Q A;  4X34 A;  3OS2 A;  1VQ9 Q;  1VQM Q;  3JB9 J;  2WSC E;  1YJN Q;  2DZC A;  4JZ4 A;  5FWC A;  1LVK A;  2DTO A;  2HKN A;  3CC2 T;  4J9C A;  3G6E A;  4KH0 B;  1D0X A;  4IIM A;  5KYX B;  4FU6 A;  1RAB B;  1SKU B;  4HVV A;  3JCM d;  1A0N B;  4OMM A;  1IZ6 A;  1PKT A;  2RMO A;  1ZUK A;  1Q7Y U;  1N9S A;  1UGQ B;  4ZGE B;  4FYX B;  5FLX E;  2BZX A;  1AWJ A;  1WQ7 A;  1ZSG A;  3JCM Q;  2VKN A;  4ELZ C;  2X9H A;  3A8H B;  5A0D A;  3GIB A;  3BFM A;  2F69 A;  2FEI A;  2KR3 A;  2JS2 A;  1ABQ A;  1FMK A;  1ZUY A;  5IXB A;  1VQO Q;  5CKB A;  2DXU A;  2WSE E;  3OBY A;  2DBM A;  5HK3 A;  4M7D A;  1QCO A;  2NUT B;  2LCS A;  1Q86 U;  5FRN A;  2LQW A;  2RN8 A;  2GBQ A;  2KDS A;  2KY9 A;  2LQ8 A;  3EG1 A;  4J9G A;  3CCR A;  2QA4 A;  1NJI R;  3CC7 Q;  4M77 B;  1T0H A;  1U8R A;  1Q81 C;  1Z9Z A;  2A3L A;  3WVE B;  3HFN A;  3V8K A;  2M16 A;  3M0T A;  4QVC A;  2QGF B;  5FW9 A;  2NUP B;  2YT6 A;  1CKB A;  1TH7 A;  2F2V A;  1YN8 A;  2DL3 A;  4J9I A;  4KH1 B;  1G5V A;  3P8B B;  3EFO B;  1D3B B;  4LDY A;  3CD6 T;  5GMK e;  5IT9 E;  1UFF A;  3VS6 A;  5GAN e;  2QTV A;  5LJ5 e;  1JB0 E;  4Q5W A;  4L6V 5;  3QHS A;  5GAM h;  1PKS A;  2O9S A;  3CCV Q;  5CK9 A;  3V7S A;  2ABL A;  1NEB A;  4ELY C;  4OMO A;  1UHC A;  1VIE A;  5KYX A;  4LDX A;  5EG2 A;  2LJ3 A;  1TG0 A;  2DKG A;  1JXM A;  1BI1 A;  2LT4 A;  1FMV A;  1ACM B;  4F17 A;  3CCJ T;  2R5A A;  3O8V A;  1AWX A;  3R6O A;  5D6W A;  2OAU A;  2MF2 A;  3M0P A;  1AWO A;  1NEG A;  2HSP A;  5CKD A;  4KGV B;  1MNE A;  1XNI A;  4ZGJ B;  2XD0 A;  2MK5 A;  4OVA A;  3I55 T;  1TWB A;  4RTV A;  2MPX C;  4JJD A;  1BB9 A;  1KFZ A;  2NUT A;  1RAD B;  4IUT A;  2VB6 A;  1WA7 A;  3VS4 A;  3NFC A;  2ROT A;  5GAO p;  4J83 A;  4AFQ C;  4XQ3 A;  1HJD A;  2OAW A;  4RUG A;  2QEX A;  3X28 B;  4PJM A;  4LDU A;  1K76 A;  2ZPG B;  1S72 A;  1QWE A;  3OYE A;  2RI2 A;  1RUW A;  2RM4 A;  4ZN1 A;  4KT0 E;  2D1X A;  3BE3 A;  3H0I A;  1FWZ A;  3JAM E;  2CP7 A;  3UAT A;  3H41 A;  3VUZ A;  4XTW A;  4F14 A;  1OX9 A;  1VYV A;  1M90 C;  2QA4 Q;  4C92 D;  4FSS A;  2DBK A;  2DD5 A;  1OPL A;  2GNC A;  2QQR A;  1JJ2 A;  1JO8 A;  1HYO A;  1RAA B;  1M1K C;  2D6F A;  2BIV A;  3I5S A;  5LJ3 g;  1D3B A;  4LD6 A;  3GPL A;  5GAM d;  3JCM b;  3KBG A;  1VQN A;  2EKH A;  3CC4 T;  2Z0W A;  4PJO D;  4IUR A;  4RTY A;  4M78 E;  3EFS A;  2E10 A;  2Y90 A;  2V1R A;  2KAF A;  3OYM A;  3RES A;  1V1C A;  1BI0 A;  3OS0 A;  2CH4 W;  3RMQ A;  5GAO q;  4FYV B;  2XID A;  3HRU A;  2DM1 A;  4M7D F;  3D7S B;  4EMH A;  2LP5 A;  1WJQ A;  1BYM A;  1QVF A;  4OMQ A;  2AT1 B;  2COZ A;  1VQL Q;  3MHX A;  2LDM A;  2DJQ A;  3L42 A;  1SHG A;  1PNJ A;  4M7D G;  4XAX B;  1MMA A;  2V8K A;  2XDP A;  4FT2 A;  4QVZ A;  4MDX A;  3QJY A;  3UPU A;  3G4S T;  1Q81 R;  4BI4 A;  2P0P A;  3SEM A;  2IG0 A;  4IUV A;  4AG2 C;  2HBP A;  3L2U A;  4AFZ C;  2CP6 A;  3OYD A;  4PKC C;  2EYY A;  1BCO A;  1OZ2 A;  3OS5 A;  3EFR A;  4J5Y A;  5KE3 A;  3MEU A;  3JB9 G;  3VV0 A;  1K1Z A;  1PSF A;  4GLK A;  3OYJ A;  1ZSZ A;  2KT8 A;  1W2B S;  2EAY A;  3DLL A;  4M78 D;  3EH1 A;  1I4K 1;  3H8Z A;  1NJI U;  2CZ7 B;  2D8H A;  3ER0 A;  2RQW A;  2EKO A;  5FU7 C;  4PLI A;  2RO0 A;  3CPW A;  3EGX A;  1KD1 U;  2KK4 A;  4D6W A;  3A1P A;  1I0C A;  3VS7 A;  1SSF A;  2QK0 A;  3G7Z A;  3V8J A;  3ULR B;  3LWI A;  1FXX A;  1SRM A;  3TEE A;  3L2W A;  2JZ2 A;  2CDT A;  1G83 A;  3CME T;  2DXC A;  1JJ2 S;  1S72 Q;  2HEQ A;  1X01 A;  2G3R A;  4TVR A;  3RNJ A;  4LDW A;  2LRQ A;  5IHI A;  5DLO A;  3RIR A;  1NYF A;  1M4Z A;  2K79 A;  4RTU A;  3UA7 A;  4JDS A;  1QKX A;  5KE2 A;  2K7A A;  3JB9 I;  4J8O A;  4ORZ A;  5C0M A;  2QQA A;  3OYF A;  3HRS A;  3JV3 A;  2COY A;  2NWM A;  2YUO A;  4XU0 A;  2FPE A;  2RK2 A;  1MMD A;  2QQS A;  1SEM A;  3Q1J A;  2RJE A;  4IKF A;  4E47 A;  2I2L A;  3JCM c;  2WSF E;  1QP2 A;  1VQN Q;  2XHC A;  1M1G A;  1LNX A;  1H3H A;  4C0F A;  4M77 F;  4LUD A;  4M78 B;  3RKX A;  4C8Q E;  2KI7 A;  2EQJ A;  1BCM A;  3OW2 P;  8AT1 B;  1VQP T;  5FU7 B;  2RD1 A;  2A37 A;  2DK3 A;  3OYB A;  2PU9 B;  2JW4 A;  5GAO r;  1NM7 A;  1KQS P;  4ZGD B;  2ESW A;  3QXE B;  1M90 R;  4M7D C;  1UTI A;  4FL6 A;  1Q82 C;  3CMA T;  2NLU A;  2B86 A;  2CUB A;  1WHM A;  4EIK A;  1N27 A;  4C92 A;  3GLX A;  1M1K R;  4C5G A;  2DE0 X;  4J9B A;  1NBE B;  2EJ9 A;  4FYW B;  1YI2 A;  3M55 A;  1Z9Q A;  2PVG B;  4Y92 A;  5LJ3 f;  4J9D A;  2LCC A;  2VC8 A;  2ROL A;  2KMT A;  4EPC A;  2CUD A;  4GY5 A;  3VRY A;  4PJO A;  2JMC A;  1I81 A;  2YRC A;  2HQE A;  2RQT A;  3GF5 A;  3CXC P;  3M4Y A;  1VQ5 Q;  4N4H A;  5KYY B;  5GAO m;  2EGC A;  4CC2 A;  4ME7 A;  1XJW B;  2A7Y A;  2DO3 A;  4JJC A;  2J6K A;  5IAY A;  4E7J A;  1B34 B;  4FW1 A;  5GAN j;  4C8Q D;  3M57 A;  2CYZ B;  5LJ5 j;  1OYX A;  3QZ9 B;  4ZTF A;  5FRO A;  2J6O A;  2HNI A;  1ZQ1 A;  9ATC B;  4BB7 A;  2K3B A;  3UA6 A;  2JUF A;  3ZEH A;  1R0C B;  2A28 A;  1TUC A;  1I5O B;  2XIC A;  4XU1 A;  2K2M A;  4QQ6 A;  2RI3 A;  3CCE T;  1AOJ A;  4J6Y A;  4BE2 A;  3OY9 A;  3MCA B;  1KC8 C;  4MML A;  3SB2 A;  2X4J A;  3LGF A;  2DYI A;  2ZGW A;  3HKS A;  4X9C A;  2HQX A;  4NS5 A;  1CKA A;  4FCY A;  4E7H A;  2JJ9 A;  2QDL A;  3C4S A;  3UDC A;  3J81 E;  2ATC B;  2K9G A;  3PIP A;  3TSW A;  1M3C A;  3EG0 A;  2K5F A;  4M78 A;  2GQV A;  1AWW A;  3QO3 A;  2OX7 A;  2VVK A;  3VRZ A;  4XTV A;  3MEV A;  2HSE B;  5AYF A;  1IHW A;  2EYZ A;  2QG9 B;  1YIJ T;  1OEB A;  3FLG A;  4E2F B;  1X2Q A;  2O2O A;  4M7A E;  3HFO A;  4B6M A;  1KG1 A;  3ME9 A;  2OI3 A; 
#chains in the Genus database with same CATH homology
 4KBM B;  4HT9 A;  4EMG A;  1G5V A;  2QXF A;  1QW1 A;  3G6E T;  2CGH A;  2K5L A;  2YHT A;  3P8B B;  1K73 C;  4RCB A;  2DTH A;  1H64 1;  3UWN A;  5GAM f;  1VQ6 A;  4XTU A;  1D3B B;  4LDY A;  3OYN A;  5DY9 A;  5GMK e;  3CD6 T;  3A8O B;  3CCU T;  5IT9 E;  2OTL A;  5GAN e;  3MP6 A;  2P4T A;  4HCZ A;  5IN1 A;  2QI2 A;  2K4Y A;  5LJ5 e;  5J39 A;  1JB0 E;  1YJW T;  4Q5W A;  2DIQ A;  2IVW A;  4L6V 5;  3QHS A;  5GAM h;  5CK9 A;  3V7S A;  4C8Q B;  1K73 U;  3QUI A;  2O01 E;  4QQG A;  3OMC A;  1YJ9 T;  2LQK A;  3CEY A;  5GMK m;  3SFM A;  2O4X A;  3PGG A;  4MZT A;  5LJ3 d;  2JTM A;  1LJO A;  1MGQ A;  3QKJ A;  4ELY C;  3JB9 H;  3PTA A;  3GOX A;  1VQK A;  5CR2 A;  1VIE A;  1Q82 U;  1YHQ A;  2YLB A;  4LDX A;  3UT1 A;  5D6Y A;  1I5L A;  3LH0 A;  1VQ9 A;  1X6O A;  5EG2 A;  4KUL A;  3X26 B;  2O4X B;  4RCC A;  1RL2 A;  4M7A F;  2KQW A;  3C94 A;  3SWN C;  1YJN A;  3CC4 A;  2DKG A;  4MZM A;  1BI1 A;  2LT4 A;  3X24 B;  3CCJ T;  3ME9 A;  2JOY A;  2R5A A;  2LX9 A;  1B34 A;  1VQ4 T;  4M7A G;  3O8V A;  4LDV A;  2CZ0 B;  5GMK i;  2L5Q A;  2LTO A;  4JLI A;  1S72 T;  2OTJ T;  3CD6 A;  4N0A A;  1HXD A;  3CCM T;  3CCU A;  3R6O A;  5D6W A;  1U1T A;  3CCR T;  2OAU A;  2MF2 A;  2DAQ A;  5CKH A;  3RMS A;  3M58 A;  4EMK B;  3PMI A;  2QA4 T;  5FU6 C;  5CKD A;  1XNI A;  3OMG A;  3F70 A;  4MZP A;  2ZPI B;  3CCQ T;  5CKF A;  4ZGJ B;  4YTL A;  2XD0 A;  1VQ5 A;  4M7A D;  3LX7 A;  2M0O A;  2DZ9 A;  3CCS T;  4OVA A;  2ZPE B;  4C8Q C;  3JCM e;  3SD4 A;  5A0G A;  3CCL T;  1N6A A;  3GNF B;  2EYQ A;  2P0Q A;  4OB1 B;  4A4G A;  1Y07 A;  3I55 T;  1YIT T;  1KD1 C;  5DLQ E;  4PNO A;  3OYY A;  2AHJ B;  2FB7 A;  4LD9 K;  3RKY A;  4IUT A;  3PIO A;  2X4W A;  2VGN A;  4HCB A;  4N4I A;  3NFC A;  2X4Y A;  5GAO p;  4J83 A;  1XTD A;  1N9R A;  4XQ3 A;  4OP0 A;  1K8A C;  3OYH A;  4BUG A;  1VQN T;  2QEX A;  1UEB A;  3X28 B;  3OYG A;  4J6X A;  2ZPH B;  1YCY A;  3CCJ A;  4LDU A;  1VQ4 A;  2ZPG B;  5LJ3 j;  1S72 A;  4IUP A;  2OTJ A;  3LGL A;  3L2Q A;  1VQO A;  2MMP A;  4F7U E;  3CCM A;  2VV5 A;  4II1 A;  3OYE A;  5KH6 A;  3BW1 A;  2RI2 A;  2GF7 A;  4C92 G;  5DM7 R;  1K8A U;  2OTL T;  1WJS A;  2RM4 A;  4HKE A;  3NTH A;  4ZN1 A;  3EAE A;  3PNW C;  4KT0 E;  1K9M C;  1FWZ A;  2XDD A;  3JAM E;  3J80 E;  4MMK A;  3X20 B;  3V7C A;  4BDZ A;  3VUZ A;  4XTW A;  4XTX A;  3BDL A;  4JUV A;  4M7D E;  2LCL A;  5CCA A;  3CCS A;  5LL6 S;  2FYK A;  3SWN A;  4C0Z A;  4XTY A;  2R57 A;  3JCM V;  1M90 C;  4C92 D;  3CCL A;  1G3S A;  3I55 A;  2HD0 A;  2K2V A;  2DD5 A;  3TCJ A;  2M9U A;  2PVO B;  4XU2 A;  2QQR A;  1JJ2 A;  4XTZ A;  3S3M A;  3QBY A;  4PJO G;  1M1K C;  2D6F A;  1AHJ B;  2BIV A;  4QW2 A;  4OF1 A;  4RG2 A;  4BDY A;  3NTK A;  1Q81 U;  2DD4 A;  1BIA A;  5LJ3 g;  1YHQ T;  1M90 U;  1D3B A;  5GAO n;  4LD6 A;  3GPL A;  1X75 C;  3SWN B;  4JS5 A;  1VQ9 T;  1VQM T;  3L1A A;  1WGS A;  3P8H A;  5GAM d;  3JCM b;  3HSB A;  3KBG A;  1ZBX A;  2JN0 A;  1VQN A;  3X25 B;  2MAM A;  1YJN T;  3P8D A;  2DIG A;  3KUF A;  3CC4 T;  4QQD A;  4PJO D;  1NZ9 A;  4IUR A;  3VU3 C;  1VQ7 A;  4C8Q A;  2DTI A;  4Y91 A;  1Y96 A;  4M78 E;  3OSS C;  4M75 E;  4A54 A;  4JRK A;  3EFS A;  2E10 A;  4J7F A;  3JCM W;  2Y90 A;  1Y7X A;  2RI5 A;  1JBM A;  4P5N A;  4FSX A;  4F7U F;  2KAF A;  2L8D A;  5FU6 B;  3OYM A;  1QVG A;  4HT8 A;  2E12 A;  2RJC A;  3A5Z B;  4J7I A;  4JLG A;  3RES A;  4A53 A;  1QVF S;  1BI0 A;  4J6W A;  4DOW A;  1M5Q 1;  2ZCF B;  3OS0 A;  4M7A B;  3HPW A;  2EQU A;  3RMQ A;  4F7U G;  5GAO q;  2YLC A;  2XID A;  1BKB A;  3HRU A;  1Y96 B;  2E6Z A;  1VQ5 T;  4M7D F;  4EMH A;  2YRV A;  1WJQ A;  5D6X A;  2VXE A;  1BYM A;  1QVF A;  2K3Y A;  4B9X A;  3VYH B;  3CCV A;  2DPP B;  3MHX A;  2LDM A;  2K5I A;  3L42 A;  4M77 G;  4M7D G;  4ATO A;  4XAX B;  2V8K A;  2XDP A;  3C95 A;  3JCM P;  2Y4Y A;  3QZ5 B;  5GAN f;  4FT2 A;  4QVZ A;  1WQW A;  5LJ5 f;  4B9W A;  2EQK A;  4MDX A;  4EDU A;  2XU8 A;  3QJY A;  4BY6 C;  5LJ3 e;  3QII A;  5GMK h;  2K3X A;  1VQM A;  3UPU A;  5GAN h;  2RHI A;  4A4F A;  3G4S T;  3QDR B;  3WXM B;  4BI4 A;  4EMK A;  3OBW A;  4M77 D;  5LJ5 h;  4M7D D;  4OGE A;  2P0P A;  2IG0 A;  4IUV A;  2QEX T;  5L8R E;  2DEQ A;  2HBP A;  3HP9 A;  3VKI A;  4C92 E;  3L2U A;  4M78 F;  1EIF A;  4M75 F;  3GP8 A;  2RJF A;  2MWP A;  3FJP A;  4UC4 A;  3V8L A;  4RMO A;  3ASK A;  2XI9 A;  1M8V A;  3LLR A;  1VQO T;  3OYD A;  4PKC C;  3BY7 A;  1H3Z A;  1ZHI A;  1OZ2 A;  2PUK B;  3OS5 A;  3EFR A;  4M75 G;  4HA8 A;  4M78 G;  5GAN 7;  4KUD K;  1GXI E;  4J5Y A;  2VXF A;  5KE3 A;  3MEU A;  3S3O A;  2EJF A;  3JB9 G;  3E9G A;  3VV0 A;  4JJN K;  2GFU A;  1NJI C;  1BIB A;  1PSF A;  4GLK A;  3OYJ A;  2GFA A;  3MET A;  5GAM j;  4M7A C;  2X4X A;  3FEO A;  4BI8 B;  5GAN 6;  5GAN 3;  1W2B S;  2H3J A;  1R8O B;  2EAY A;  4MDW A;  4XK8 E;  3DLL A;  4PJO E;  2JNG A;  3SDZ A;  3CPW S;  3RKW A;  3FIF A;  5HK0 A;  2EJG A;  4M75 D;  4M75 C;  4M78 D;  1Q7Y C;  3KXT A;  3OYI A;  1I4K 1;  3JB9 D;  1VQP A;  3H8Z A;  1NJI U;  4N4G A;  4ZN3 A;  2C06 A;  2CZ7 B;  3CBP A;  3ER0 A;  4DA4 A;  2RJD A;  4DOV A;  3OB9 A;  1W2B A;  2EKO A;  5FU7 C;  2CKK A;  3DLM A;  4PLI A;  3TU4 K;  2QQB A;  2CZ6 B;  2RO0 A;  3CPW A;  1Y71 A;  1MHN A;  4OB3 B;  4KUI A;  5A0L A;  5C6S A;  3OYK A;  2GCX A;  3A8L B;  3MP1 A;  3G4S A;  1KD1 U;  2KK4 A;  4D6W A;  3RUX A;  4C5E A;  5GMK j;  2E64 A;  2X35 A;  5I2S A;  2RA2 A;  2KVQ G;  2ZPB B;  3JCM f;  4QVD A;  1SSF A;  4NOY A;  3CMA A;  1I8F A;  3G7Z A;  3V8J A;  1VQ7 T;  3LWI A;  4C92 F;  3URG A;  2R58 A;  5CQX A;  1VIF A;  1YBY A;  3HL8 A;  3JRZ A;  4A4K A;  5GAM g;  1VQ8 T;  3RER A;  2CS7 A;  3JCM h;  1FXX A;  1W4S A;  3TEE A;  2E6N A;  2PQW A;  2L3R A;  2V8J A;  3VUB A;  4C0D C;  3OYC A;  3L2W A;  1OZ3 A;  4F7U A;  5GAN 2;  2EFI A;  1BI2 A;  2JZ2 A;  3BDU A;  2JVV A;  3JCM X;  1Q86 C;  3MO8 A;  2LVM A;  1IRE B;  1WPY A;  2EWN A;  4E7K A;  1OI1 A;  3OA6 A;  3OS1 A;  2E41 A;  3NTI A;  2QDY B;  2DXC A;  3FDR A;  3CME T;  1QP3 A;  1JJ2 S;  2XG8 D;  2PUO B;  3T9N A;  4HCC A;  3S6W A;  1X01 A;  2G3R A;  4M77 E;  4TVR A;  3PFS A;  1G3T A;  2D0Q B;  2MWO A;  4LDW A;  3MEA A;  3MEW A;  2LRQ A;  4PJO F;  1QVP A;  1BI3 A;  3CC7 A;  5DLO A;  4C92 C;  3FC3 A;  4F7U B;  3CCV T;  3RIR A;  1K9M U;  1M4Z A;  4JRI A;  3QJ6 A;  5GAN 4;  5KCH A;  1KHI A;  4JDS A;  2ZPF B;  5KE2 A;  3JB9 I;  3M59 A;  4J8O A;  4BY6 B;  3PMT A;  5C0M A;  2RHY A;  2KSS A;  3E1S A;  2BKD N;  1KQ1 A;  2QQA A;  3E9F A;  3CBO A;  4L59 A;  3OYA A;  2VUB A;  3N5B B;  3OYF A;  1UB4 A;  2E5Q A;  2WAC A;  3GNG A;  3HRS A;  3M53 A;  3QG1 A;  4M7D B;  1NPR A;  2QTX A;  3PT9 A;  3LYI A;  1UGS B;  5CIU A;  3J7A F;  1QVG S;  4M7A A;  2F5T X;  5GAN 8;  1M1K U;  4PJO C;  4XU0 A;  5CKE A;  3M56 A;  2RK2 A;  5KCO A;  2QQS A;  2P0K A;  4XU3 A;  4L5G A;  3Q1J A;  1VQ8 A;  1U1S A;  3H6Z A;  2RJE A;  4M75 A;  2M1H A;  3DB4 A;  3OSV A;  1JRI A;  4E47 A;  5GAM e;  1NPP A;  2I2L A;  4IKF A;  3AHU A;  3JCM c;  3TRE A;  5CVI A;  4FIB A;  2WSF E;  1QP2 A;  2XHC A;  4Z02 A;  4CI0 C;  3INZ A;  1YI2 T;  3FRN A;  1G3W A;  1M1G A;  4VUB A;  5HY6 A;  3G71 A;  1LNX A;  3I56 A;  2FHD A;  4C0F A;  3CME A;  4PL6 A;  3QYG B;  4O6J A;  2L89 A;  1V29 B;  4M77 F;  3C12 A;  3VYG A;  5GAN d;  4M78 B;  4M75 B;  4IUQ A;  3RKX A;  4C8Q E;  5LJ5 d;  4JRP A;  2B8A A;  4NL2 A;  3ZFJ A;  2EQJ A;  1N8R C;  3OYL A;  3CCE A;  1NE8 A;  3CBM A;  1G3Y A;  4V2S A;  3M54 A;  4BAC A;  5FU7 B;  1O9S A;  1VQP T;  2RD1 A;  4CRI A;  2DK3 A;  3DB3 A;  3QYH B;  1DJ7 B;  3OYB A;  2PU9 B;  2VGM A;  1VQL A;  5FRM A;  3OQ5 A;  4BE1 A;  4OB2 B;  3L2R A;  1N8R U;  4OB0 B;  3A8M B;  2RB6 A;  5GAO r;  4X9D A;  3L2Z A;  4ZGD B;  3QXE B;  4M77 C;  3JCM g;  4M7D C;  1VUB A;  2DJZ A;  4FL6 A;  1PSE A;  1Q82 C;  2LC4 A;  2NLU A;  3CMA T;  4BI3 A;  2RHU A;  2D9T A;  4C0D B;  4FM4 B;  1N27 A;  2HAX A;  3M9Q A;  4X34 A;  4C0G A;  3GLX A;  4RG8 A;  4C5G A;  4C92 A;  3OS2 A;  3JB9 F;  5J26 A;  3JB9 J;  2XK0 A;  3MP8 A;  3JSC A;  3QSU A;  2EJ9 A;  2WSC E;  1YI2 A;  4WF2 A;  4Y28 E;  3M55 A;  2PVG B;  2DZC A;  5LJ3 f;  2K57 A;  1YIJ A;  3M4G A;  2DTO A;  5M9O A;  4BD3 A;  2DXT A;  2LCC A;  1KHC A;  2VC8 A;  3OW2 S;  2KMT A;  4EPC A;  4C92 B;  1WJR A;  2EQM A;  1RI0 A;  4PLL A;  2PVD B;  4C8Q F;  5LJ3 h;  3CC2 T;  4FT4 A;  2E1H A;  3CC7 T;  4GY5 A;  2LNV A;  3G6E A;  4A4E A;  4M78 C;  4PJO A;  1I81 A;  2QQ9 A;  2MI6 A;  2HQE A;  4FU6 A;  2E70 A;  3GF5 A;  4R55 A;  5CQY A;  1M9S A;  4C8Q G;  3OW2 A;  4OMF B;  3A8G B;  3M4Y A;  3JCM d;  4N4H A;  1M1F A;  1KQS S;  3E19 A;  5GAO m;  5A2Q E;  1YJW A;  1IZ6 A;  4ME7 A;  2A7Y A;  1KQ2 A;  2DO3 A;  1Q7Y U;  1N9S A;  1UGQ B;  4ZGE B;  1HK9 A;  5IAY A;  4PJO B;  5FLX E;  4E7J A;  1B34 B;  1LOJ A;  1XOV A;  5GAN j;  3V7R A;  4C8Q D;  3M57 A;  1YJ9 A;  2CYZ B;  1WQ7 A;  1KQS A;  5LJ5 j;  1OYX A;  3QZ9 B;  2DXB A;  4ZTF A;  3JCM Q;  5FRO A;  4JS4 A;  2R5M A;  4IUU A;  3WVD B;  2HNI A;  1ZQ1 A;  3HRT A;  4ELZ C;  1O75 A;  2LT1 A;  4BB7 A;  3A8H B;  3FB9 A;  5A0D A;  2JUF A;  3GIB A;  3BFM A;  3ZEH A;  5CAI A;  2F69 A;  2XKO C;  3G71 T;  1UGP B;  3I56 T;  4E7L A;  2RHX A;  4JRQ A;  2XIC A;  2EIF A;  4ZTJ A;  3VJP A;  5CKB A;  4XU1 A;  5I2M A;  2RH2 A;  2DXU A;  2WSE E;  3OBY A;  4M77 A;  5HK3 A;  5GMK l;  3LWH A;  4E7I A;  2V8I A;  3CC2 A;  4M7D A;  3CXC S;  4QQ6 A;  2RI3 A;  3HHT B;  1Q86 U;  3CCE T;  5FRN A;  3DKM A;  5HKC A;  2KDS A;  4O5V A;  1VQ6 T;  2KY9 A;  2LQ8 A;  4J6Y A;  1XQH A;  5GAN g;  4BE2 A;  3OY9 A;  3MCA B;  3CCR A;  5LJ5 g;  3LW5 E;  4MML A;  1KC8 C;  3SB2 A;  2X4J A;  2QA4 A;  3LGF A;  4R56 A;  3HKS A;  2ZGW A;  4X9C A;  1VQL T;  2FVU A;  3CPF A;  3CXC A;  4M77 B;  5GAN 5;  2HQX A;  4NS5 A;  5CO7 A;  2Y4X A;  4EMK C;  2JTF A;  2VYT A;  3CCQ A;  4E7H A;  2DVE A;  2E65 A;  1U8R A;  1Q81 C;  2RK1 A;  3C4S A;  3UDC A;  3J81 E;  1KC8 U;  2A3L A;  3WVE B;  3PIP A;  3S3N A;  5J3B A;  1WNL A;  3M5A A;  1FX7 A;  2K5F A;  3HFN A;  4DQ2 A;  1YIT A;  4M78 A;  4N0A C;  2GQV A;  4A4H A;  4C5I A;  4BE0 A;  2F5K A;  3V8K A;  1VQK T;  2CZ1 B;  2M16 A;  5GAO l;  3QO3 A;  4C5H A;  4NL3 A;  3QPH A;  3ZBD A;  4XTV A;  3JCM J;  4OGC A;  3MEV A;  2ZZD A;  1UGR B;  2RHZ A;  4QVC A;  5AYF A;  5I21 A;  1YIJ T;  1P92 A;  2XDB A;  3L2V A;  3FLG A;  1KG1 A;  4M7A E;  4RKU E;  3HFO A;  2FL7 A;  1TH7 A;  2BUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...