4CC3A

Complex of human tuba c-terminal sh3 domain and mena proline-rich peptide - h3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
b'NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DYNAMIN-BINDING PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 11
structure length 61
sequence length 61
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc3A00
4QT7A 4CC7A 2DMOA 3REBB 2MIOA 2J6KA 1JU5C 1Y57A 2W10A 2HCKA 5I22A 1OEBA 2LMJA 2K6DA 1W6XA 2DVJA 1GFCA 2SEMA 4GLMA 1WFWA 1K1ZA 2GTJA 2RQTA 1SHGA 1MUZA 1CSKA 3VS1A 1WX6A 2OAWA 2KYMA 4J9CA 1U06A 4ZNXA 1EFNA 2FPEA 4E6RA 3H0HA 5HCKA 1PWTA 2FEIA 1TG0A 1M3CA 1ZUUA 2VWFA 1Z9QA 2FPDA 2EBPA 1B3QA 1G2BA 1SRMA 2J06A 2LQNA 1GCPA 2GGRA 1RLPC 2LJ3A 1AVZC 5IXFA 2A28A 4ORZA 3H41A 3VS6A 1U5SA 2YUNA 1I07A 1X2KA 4AG1C 4IIOA 2EYXA 2KRNA 2EGCA 2CSIA 2HSPA 1AWOA 2LNHB 3I9QA 1UJYA 2D8JA 2FRWA 5IH2A 2K2MA 3QWYA 1ZUKA 1HSQA 1UUEA 2I0NA 1M3BA 1H92A 1WIEA 2DRKA 2PTKA 3M0PA 1V1CA 2F2WA 2GTOA 2V1RA 1SPKA 2ED1A 2O9SA 1UHCA 2HEQA 4OMQA 2P4RA 1AOJA 2KRMA 3NHNA 1AZEA 2PZ1A 1IO6A 2AK5A 2ABLA 2RQWA 1Z9ZA 4OMMA 2KT1A 1T0JA 2C0TA 1AEYA 3M0RA 2CT3A 1K0XA 3SEMA 5IXBA 2KROA 2YUQA 1UG1A 2JT4A 4RUGA 4RTWA 1SEMA 4F17A 1RUWA 4LUDA 1BU1A 1HJDA 1NLOC 2AZSA 2RQUA 2O88A 4ESRA 2KRSA 2HBWA 4OMNA 1GL5A 4Y92A 1YCSB 2L2PA 2JS0A 2L3QA 4J9BA 5I11A 3SHWA 2MOXA 4DEXA 2M51A 2ED0A 3EG1A 2EKHA 4F16A 1VYUA 3THKA 3I35A 4JJCA 2AKKA 2L0AA 1TUDA 2EGAA 2L3PA 1KFZA 2JM9A 3EHRA 2EGEA 2A37A 2KR3A 4HVUA 2LJ0A 3TSWA 1E6HA 4IIMA 1GBRA 1J3TA 1NYFA 2GNCA 4J9FA 2LZ6B 2YSQA 2EVRA 3VS2A 1T0HA 1K4US 1X6BA 1X6GA 2DL8A 2XMFA 1X27A 3U23A 2DM1A 1YN8A 2D0NA 4J9IA 2ECZA 1PKTA 4WCIA 2CSQA 2EPDA 3VS4A 1AD5A 1QWFA 4JPBW 2G6FX 2L3SA 4RTUA 2DNUA 2K9GA 2F2XA 2RQVA 1PKSA 2DBKA 1UHFA 3IQLA 3GBQA 4A63B 2CUBA 3VS0A 1MV3A 4HCKA 3EG0A 2O9VA 2EYYA 1ZUYA 1I1JA 1WI7A 2IIMA 5IHKA 2EQIA 1ZSGA 1T3SA 3M0QA 2J05A 3EG3A 3M0UA 2X3XD 4CC3A 4GBQA 4DEYA 4Z88A 2E5KA 1QCFA 2RNAA 3CQTA 2O31A 1WA7A 3PVLA 2DX1A 1E6GA 1RI9A 2M0YA 2DILA 2CT4A 2RQRA 1HD3A 4OMLA 2MCNA 3FJ5A 3VS3A 4LN2A 4D8DA 4X1VA 2LCSA 4J9GA 2FO0A 3H0FA 3RNJA 2BTTA 3VRYA 1JO8A 2DJQA 2EYZA 2A36A 4HXJA 2F2VA 2RPNA 4HVVA 2C0OA 1BK2A 1PHTA 2JMAA 2FRYA 1M3AA 2LP5A 2GQIA 5ECAA 1M27C 3C0CA 1NM7A 1G83A 2PNIA 2J6OA 2DL5A 2HDAA 2JXBA 3LH5A 1FMKA 1ABOA 1WXUA 2KBTA 4AFZC 3I5RA 1B07A 1NEGA 1X69A 2W0ZA 4JZ4A 2K79A 2BZ8A 1I0CA 1PRMC 2JM8A 2DYBA 2VVKA 1N5ZA 3TVTA 2YT6A 1GCQA 4RTXA 1GBQA 4JJBA 2KGTA 1ZLMA 1VYTA 3EHQA 1H3HA 3I5SA 2B86A 2DBMA 4OMPA 1PRLC 3NPFA 1YP5A 2VKNA 2OI3A 1S1NA 2A08A 4FSSA 2KT8A 1A0NB 2J6FA 2KXDA 2YUOA 1X43A 4CC2A 1QLYA 1ZBJA 4AFSC 1NLPC 2CDTA 2RF0A 1XOVA 4RTVA 1OOTA 1JXOA 3TSZA 3VRZA 1YWPA 2X3WD 3M0SA 1WLPB 1K9AA 4JZ3A 4R0KA 1X2QA 2DLPA 1NG2A 1K76A 1UGVA 1U3OA 4Z89A 1WXBA 1CKAA 2YDLA 4KRTA 1M30A 3RBBB 2AZVA 3UA6A 3R6NA 3REAB 3KFVA 1WYXA 3VS5A 1UTIA 2NWMA 4Z8AA 3PE0A 2K3BA 1ZX6A 1UECA 1QKWA 1FYNA 1UE9A 2NUZA 1AWJA 2JS2A 1K0SA 2D8HA 4AFUC 1AZGB 2K7AA 2YUPA 5EC7A 2KNBB 1TUCA 2DL4A 3H0IA 1NYGA 1MV0B 2QDLA 2LJ1A 3O5ZA 5IHNA 4J9EA 1OPKA 2DF6A 1YNZA 5FWCA 2O2OA 1T3LA 2KXCA 3UATA 3UF4A 4CC4B 3JV3A 1UFFA 1SRLA 1W70A 2JTEA 2H8HA 2JMCA 3UA7A 5L23A 1KJWA 4HVWA 5FWBA 2BZXA 2BZYA 2DL3A 4OMOA 1KIKA 1E7OA 4AG2C 1H8KA 1BBZA 4JJDA 1SHFA 4RTZA 1ARKA 4AFQC 1ABQA 2V1QA 1UDLA 1GFDA 4F14A 1RLQC 4D8KA 2LX7A 2GBQA 1OV3A 1BB9A 1Y0MA 2FPFA 2RN8A 5GJWB 1JQQA 1NEBA 2EYWA 1OPLA 3M0TA 2CREA 2FG0A 4EIKA 2D1XA 3ULRB 3A98A 2ROTA 2CUDA 1GRIA 4M4ZA 1VYVA 2ENMA 3QWXX 1QWEA 2AKLA 1VA7A 2LQWA 4K11A 4LE9A 5IHIA 3VS7A 2C0IA 2DE0X 3EGUA 4RTYA 1UJ0A 4J9HA 1WXTA 5FW9A 4LNPA 2CH4W 1M8MA 1LCKA 1YWOA 2RMOA 4RTTA 3ZL7C 1GCQC 1AWXA 2SRCA 1KSWA 3NGPA 2EW3A 2CH4A 2DRMA 2ROLA 2DA9A 2KYBA 4LUEA 1CKBA 2KEAA 3EG2A 3NMZC 1SSHA 2DL7A 3PVQA 4J9DA 2JW4A 1JEGA 5GJVB 1W1FA 2OJ2A 1JXMA 1WDXA 2KE9A 1PNJA 1QKXA 1AWWA 2J7IA 2ESWA
chains in the Genus database with same CATH superfamily
2RD1A 4QT7A 1VQ8T 1U1SA 2DMOA 4FYXB 4L59A 4XTZA 1H3ZA 4PLLA 2DD4A 3P8DA 3BDLA 5KYUB 4FW1A 1WPYA 2SEMA 4GY5A 4M77B 2XG8D 5LJ3e 1KHCA 1CSKA 2OAWA 4J9CA 1EFNA 1EZZB 4C0FA 4A4FA 4E6RA 3CPWS 1IHVA 3JRZA 2NUTA 3BDUA 4M7DF 5GAN8 1M3CA 1TOVA 1ZUUA 3G4ST 4BE2A 4PJOD 3GP8A 8AT1B 1KQ2A 3PIPA 3CXCA 1NPPA 1RLPC 2LJ3A 1AVZC 5IXFA 3OS1A 2A28A 4ZN1A 5FLXE 4M7AA 4LDVA 2E41A 5KCOA 2BIVA 3CCUA 2V8IA 2YUNA 2Z0WA 2DPPB 4AG1C 1HK9A 4IIOA 2HZYA 2EGCA 2OTLQ 1AWOA 4EMHA 3I9QA 2D8JA 1ZBXA 1YIJQ 3QWYA 1Q81C 5GMKl 2I0NA 2VASA 2GTOA 4CRIA 2YWWA 3CPFA 1SPKA 2O9SA 1R0CB 1U8RA 4OMQA 2P4RA 5C6SA 5LL6S 1G3SA 1Q86U 2KRMA 4ELZC 2DYIA 2R5MA 2WSCE 1IO6A 2AK5A 2ABLA 2RQWA 1Z9ZA 1WHGA 2KT1A 3LWIA 3EG9B 5GMKe 4KGVB 3M0RA 1K0XA 3SEMA 4R55A 4XQ3A 1UG1A 3CMEA 4RUGA 2P84A 5GMKj 4C8QD 1HJDA 3H9NA 1NBEB 3V8KA 2KRSA 1OX8A 5DY9A 1Y7XA 5DM7R 2K4YA 4J9BA 2XKOC 2CP0A 4DEXA 5I11A 1VQPT 4B6MA 2ED0A 3JCMh 2E10A 4F16A 3META 4O6JA 5GAOq 4LDXA 1BIBA 1YFNA 4QQ6A 3OYJA 1KFZA 2QAZA 2EGEA 2KR3A 3PTAA 2EKOA 3TQ7P 1GBRA 3D7SB 2X9HA 2XU8A 4BI3A 1J3TA 1V29B 4E7HA 4J9FA 1WHKA 2LZ6B 2YSQA 4QW2A 3HRUA 3VS2A 4E7ZA 4DBFA 2K3XA 3OSVA 2DIGA 4FM4B 2EPDA 2NUTB 1QWFA 1PSEA 2H3EB 2G6FX 3J7AF 4RTUA 2K9GA 3NTHA 3JCMQ 2FZGB 1VQLQ 4NL2A 1MV3A 3MKDA 4M7AB 2O9VA 4E7IA 1ZUYA 3G6ET 1MMAA 3MCAB 4C92G 2HMAA 5EG2A 5IHKA 3L2ZA 4KUDK 2E5QA 3CCET 1JB0E 2VUBA 1YJNQ 2E65A 4KGXB 4Z88A 2E5KA 3JCMV 4BE0A 2DTHA 3JB9J 4HCZA 2EQUA 1WA7A 4BD3A 2PVGB 2RJDA 1M4ZA 1E6GA 2M0YA 2RQRA 3CC7A 2COWA 3FJ5A 4LN2A 4IUUA 2FO0A 4F7UE 4QVZA 3LLRA 5GANd 3JB9H 2H3JA 3M9QA 3OYDA 1WHMA 3VUZA 3DKMA 4C8QB 5D6YA 3M58A 2JMAA 1X01A 5KYNA 4IURA 3X25B 2KMTA 1NM7A 2QASA 3UT1A 1W4SA 3LH5A 2HDAA 2J6OA 3MEWA 1FMKA 1YBYA 1EIFA 1ABOA 4AFZC 4A4HA 1MMNA 4M75E 4BACA 3DB3A 2EQMA 2W0ZA 1X69A 1WHJA 2P0KA 4M78G 4BI8B 1WGSA 1QVFP 2LRQA 5KYYA 3MJXA 1I0CA 1NZ9A 3QSUA 2KAFA 2VGMA 1Q86C 3QPHA 1VIFA 3MP6A 1D0ZA 2KK4A 1XNIA 1VYTA 4LXCA 2B86A 1YP5A 2RK2A 1IRXA 5CQXA 4FSSA 5CKHA 2ATCB 1LNXA 1KD1U 2LT1A 1TTHB 1D3BA 3NFCA 4O5VA 5GAMd 1XOVA 4Z02A 1OOTA 3J81E 3WVDB 5LJ5d 3VRZA 5CO7A 1KC8R 1WLPB 1VQKT 1K9AA 4JZ3A 4MZMA 2OTLT 2O01E 1G3WA 4M75C 1K76A 2QI2A 2K2VA 3JCMe 1C6VX 3R6NA 1WYXA 1ZSZA 2P0PA 2KY9A 4OP0A 2CP7A 2NWMA 2IVWA 5I2SA 2QEXT 3PE0A 3JCMb 5CIUA 2K3BA 3CCJA 1UECA 3M4YA 2NUZA 4M75F 4ZGEB 5A2QE 1N8RR 2JS2A 3CCRA 1K9MR 1AZGB 1QQJA 2MWPA 2DERA 2MF2A 2VYTA 1TUCA 3QDRB 4XK8E 1NYGA 1VQNQ 2LJ1A 1OZ2A 5CKFA 1G5VA 3E9FA 2DF6A 4RMOA 2QQRA 1T3LA 3UATA 3UF4A 4Y91A 1LJOA 4BDYA 2BE7D 4BDZA 1SRLA 1W70A 2JTEA 4KH1B 1QVGP 2AT1B 2BZYA 1KIKA 2F5KA 2RHUA 1H8KA 1IXDA 4XTXA 1OZ3A 3KBGA 1SHFA 1VQLA 3JB9I 1ARKA 1TWBA 3QBYA 2L5QA 3SFMA 1BB9A 1NEBA 2COZA 4EPCA 3M0TA 2FG0A 3VYHB 2D1XA 1W2BP 3A98A 1VIEA 3EFOA 2ENMA 2AKLA 5IHIA 3I56A 3X28B 2DE0X 3OS2A 5KYYB 5FW9A 4WTOB 1M1KC 2CH4W 4C0DB 3OYBA 3HFNA 1LCKA 4R56A 5CCAA 3HRTA 4RTTA 3CCLQ 1BYMA 5J3BA 2WSEE 1CKBA 3VV0A 2KEAA 3PMIA 1R8OB 1WJSA 1RABB 2L3RA 3PVQA 1K73R 4JRIA 5J39A 1VQOQ 5GJVB 2X4JA 2K5FA 1WDXA 4LD9K 1O9SA 3OYNA 1D3BB 5KCHA 1QKXA 3EFRA 3CD6A 2ESWA 4JJNK 3M53A 4CC7A 3CCMQ 4M78E 2QA4A 2J6KA 1UGQB 2DD5A 2QYZA 1Y57A 2HCKA 3R6OA 5KE3A 1YJNT 2WACA 2EFIA 3URGA 4M77C 4GLMA 3LWHA 3JB9D 1M5Q1 1K1ZA 2RQTA 1SHGA 3VS1A 5GAN5 1ZSZB 1WX6A 4DA4A 4JLGA 3FB9A 2PVOB 5HKCA 4J8OA 4PFZA 3X26B 4C92D 2FEIA 2A0FB 5LJ3f 4M77F 2EBPA 3NTKA 1PC0A 1FMVA 4ME7A 2V8JA 5GAMg 2BE9B 4ORZA 2LVMA 1KK7A 4BE1A 5LJ5g 5FU6C 1VQ4A 1BIAA 2JVVA 3CCSQ 2CSIA 3H8ZA 2HSPA 5CK9A 1Q82R 1D0YA 4XU1A 2K2MA 4L5GA 1VQ6Q 2HAXA 3M4GA 1M3BA 2G3RA 2R5AA 4AMCA 3LH0A 1K8AC 1VQ8A 4FCYA 1D1CA 1UHCA 2EAYA 3NHNA 4ANJA 4M78D 3G6EQ 2CP3A 2F1LA 3CMAQ 4OMMA 2DXCA 2YXYA 2VXFA 3OB9A 4M7DE 3EFOB 3CCEQ 5GANh 3ZFJA 1JJ2A 4OGCA 5IXBA 1M90U 4OB2B 3AT1B 1SEMA 4JUVA 3G4SA 4LUDA 3V7CA 3MEVA 2AZSA 3V7SA 2C06A 3HSBA 2RHYA 4ESRA 2O88A 3A8OB 2HBWA 4OMNA 9ATCB 1YCSB 2L2PA 3X24B 2L3QA 2M9UA 4FSXA 3L2VA 1OYXA 3BFMA 2M51A 3EG1A 2EKHA 3V7RA 3C12A 3I35A 4N4GA 2AKKA 2RK1A 4M7AE 2V26A 1ZHIA 3FDRA 4PL6A 1RL2A 2A37A 2P4TA 1VQNT 5KYWA 3VKIA 2ZZDA 2JTMA 4XTVA 2GNCA 4M7DC 2HKNA 4XU0A 4RG8A 1PD0A 5GAMh 3OS5A 3GNGA 2DXBA 1W2BS 1X6BA 1X6GA 2XMFA 3VJPA 4EMGA 4PJOA 5LJ5h 3U23A 2DM1A 2D0NA 2ECZA 1MMDA 1Y96A 2EJ9A 5LJ3j 1YITT 4PLIA 3S6WA 1FWZA 5GMKm 3MPUB 5HY6A 2DVEA 4X9CA 1IHWA 1PKSA 4M7DD 2RM4A 3QJYA 2JOYA 3GBQA 4F7UG 3VS0A 4A4EA 4HCKA 4HKEA 4M7AC 3LYIA 2EYYA 4PJJA 1YHQT 3S3MA 3MEUA 2VC8A 1I1JA 1VQKQ 1N8RU 1ZSGA 1VQPA 1QW1A 3V8LA 3LW5E 2MAMA 3EG3A 4M75G 2CZ0B 2X3XD 4M7AF 3E2UA 4N4HA 2DTOA 4GBQA 4DBHA 2P0QA 3CCLT 2QEXQ 4NOYA 3PVLA 2DX1A 4QVCA 3QHSA 1HD3A 4OMLA 1RAHB 2MCNA 1NJIU 1Y07A 2DEUA 3VS3A 3HFOA 3KXTA 3E9GA 2LCSA 4J9GA 1VQOT 3VRYA 4QKUA 2IG0A 2RJFA 4B9WA 2HQEA 1WJQA 2DIQA 3A5ZB 3MHXA 2A36A 4AT1B 4C8QA 4HXJA 4NL3A 2E6ZA 1BK2A 1PHTA 3P8HA 2CKKA 2RI3A 2GQVA 2FRYA 1M3AA 3CCMT 2LP5A 1NPRA 1TS9A 3C0CA 1G83A 4XTUA 2DL5A 2KBTA 3I5RA 2CZ1B 3S3OA 2NLUA 4C8QF 2HSEB 2JM8A 3S3NA 2DYBA 4JRKA 3TVTA 1YJ9Q 1GBQA 3SB2A 3G6EA 1ZLMA 3EHQA 1UEBA 2DBMA 3CBMA 2VKNA 2OI3A 1KQSA 3CCEA 2A08A 3WXMB 1A0NB 3ZBDA 4CI0C 5GANe 1X43A 5KYWB 4HA8A 2LCLA 4AFSC 2DAQA 1NLPC 1M90C 2B8AA 2RF0A 3MP1A 2X4WA 4RTVA 3RIRA 2BUDA 1JXOA 1K73U 1LPLA 3EH2A 1YWPA 3ZEHA 3I55T 2F5TX 3CCST 4PJOB 4DBQA 1UGSB 4XTWA 3M56A 1B34A 1NG2A 5GMKi 3CC2T 2FL7A 1WXBA 2YDLA 3HP9A 4PJLA 1Y96B 1VQ6T 2DKGA 2DZCA 4P5NA 4JLIA 2AZVA 1SSFA 3G71T 1VQMQ 4Z8AA 4ATOA 3CXCS 3JB9G 1KG1A 1AWJA 3JCMf 1K0SA 3OYAA 1M1FA 4AFUC 2K7AA 5A0GA 1I8FA 3CMAT 3H0IA 4E7LA 1YI2T 1VQ5T 1QP3A 2XK0A 3OSSC 2MWOA 3ME9A 4HT8A 1YNZA 5CKEA 2GF7A 2GFUA 1PD1A 4KGZB 1VQ7Q 1WJRA 3UA7A 4OMFB 5FWBA 2BZXA 5C0MA 2DL3A 1YJWQ 4OMOA 4AG2C 3CBOA 4JJDA 4RTZA 5CVIA 3HHTB 1UDLA 2M02A 1Q82U 1MNDA 4E7SA 3C4SA 2A7YA 4D8KA 2GBQA 2FVUA 1OV3A 1ZQ1A 1VQKA 2OTLA 1RAAB 4EIKA 1YIJA 4Q5WA 3TU4K 3BW1A 4M4ZA 3QWXX 4LE9A 4K11A 3OW2A 2QEXA 3EGUA 4HCCA 2E64A 4ZGJB 4LNPA 1WHLA 2I2LA 4C0DC 1WHHA 1DJ7B 2CGHA 1YWOA 3ZL7C 1AWXA 2SRCA 1KSWA 3NGPA 1NJIC 2EW3A 5GAN4 3CC4Q 2OTJQ 2MI6A 1KQSS 3EG2A 1SSHA 2JN0A 2OJ2A 1VQ9Q 4MZTA 5GAOp 1AWWA 3MO8A 5CR2A 2WSFE 4A54A 2EQKA 1Y71A 3REBB 2QQ9A 2YRDA 2MIOA 4TVRA 4F7UA 3RKYA 4DOVA 3CC7T 1B34B 2LMJA 2DVJA 3RKWA 2HQHA 3SDZA 3MEAA 4IUQA 1MUZA 1ZSZC 3EH1A 2KYMA 1MGQA 5LJ3g 4EMKA 4ELYC 4Y28E 2FPEA 3EGDA 3SWNA 3H0HA 1SKUB 5I21A 2VWFA 1Z9QA 1PM3A 5D6WA 3PT9A 2FPDA 4PJNA 1HYOA 5KYXA 4M75D 1G2BA 1K73C 1GCPA 2XICA 4II1A 4ZN3A 1QVFA 3H41A 4M7DG 3VS6A 4OB3B 3QO3A 2Y4YA 2KQWA 2KRNA 3AHUA 5A0DA 2LNHB 2QG9B 5IH2A 1YITQ 3LGFA 1PSFA 1ZUKA 1FMWA 1HSQA 2RO0A 1H92A 1WIEA 2AIRB 3CCVQ 3M0PA 1V1CA 3RMQA 1YJ9T 3RKXA 1WZOA 1Q86R 2EYQA 4J6WA 3OYCA 2VV5A 3FEOA 2ED1A 3QZ5B 3M55A 1AZEA 4A4GA 2HD0A 1YJNA 4BI4A 3CCQQ 2LTOA 4BY6C 1YHQQ 5GAOr 4M7AG 4J7FA 1IGQA 3OMCA 3OW2S 2CT3A 4M77E 2YLBA 3WVEB 2KROA 2YUQA 2M1HA 2DZ9A 2JUFA 1D0XA 2QK0A 1I4K1 1MHNA 2RQUA 3E19A 2E4HA 3MP8A 2LDMA 1IB8A 2QGFB 2JS0A 4RCCA 2RI2A 1VQMT 3SHWA 2MOXA 2R57A 1Q7YR 2L89A 2QGGA 2FHDA 5D7UA 1H641 1LOJA 4JJCA 4JS5A 2HNIA 3OBWA 1TUDA 2EGAA 2L3PA 3X20B 2DETA 3L2WA 3TSWA 4IIMA 3JSCA 4C5HA 4F7UB 5M9OA 1BKBA 1QVGA 1NYFA 2IPOB 5J26A 4IUPA 2M16A 4C92A 2EVRA 2ZCFB 1NE8A 1VQ7T 1SG5A 2DL8A 4NS5A 1X27A 1TUGB 3VU3C 2E1HA 1YJWT 4LDUA 1X75C 4EMKB 2X51A 5IN1A 1D1AA 1KD1C 3EGDB 4J83A 3SWNB 3CCUQ 1GXIE 5GAN7 2ZAEA 3FLGA 3QIIA 4JPBW 1S72T 2DNUA 5KH6A 2F2XA 1BI3A 2JJ9A 5KYXB 3IQLA 3M59A 3OQ5A 3CPWA 4A63B 5GAOl 2CUBA 4M77D 1UB4A 1G8XA 5GAN6 3I55Q 4ZTFA 4V2SA 3F70A 1T3SA 3CC2Q 1M1KR 5DLQE 5FROA 2PUKB 3M0UA 4PFOA 1UGRB 5GMKh 3FJPA 3G71Q 2CYZB 2XHCA 1LVKA 4M78A 1QCFA 2QQAA 4FT4A 2O31A 3CC4T 1M1GA 5FRMA 2OTJT 1VQNA 1RI9A 2DJZA 2DILA 3QYHB 1G3TA 4D8DA 1OQKA 4XU3A 3RNJA 1QP2A 2BTTA 3OYIA 1VQ9T 1JO8A 1YI2Q 2EYZA 2F2VA 2RPNA 4HVVA 1VQ5Q 2C0OA 4PFPA 3RMSA 1RAFB 2K57A 2GQIA 2YRVA 1M27C 1RADB 1YITA 4KH0B 4N0AA 2CP6A 2JXBA 4B9XA 2RJCA 1Q95G 3CXCP 4PJOE 1R77A 5A0LA 1I5LA 1NEGA 2QXFA 2K79A 2BZ8A 3OYGA 3A8GB 3J80E 2MK5A 2VVKA 1M2VA 1GCQA 2LQ8A 4RTXA 1B7TA 2XD0A 4OMPA 3FC3A 1PRLC 3NPFA 3HKSA 4J7IA 4LD6A 2KT8A 5CQYA 1ZA1B 5GAOn 2J6FA 2KXDA 4CC2A 3OYLA 2RI5A 1QLYA 2LQKA 4JRPA 3L2QA 4FU6A 2CDTA 2ZPFB 3CCLA 2NYSA 4C92B 2LT4A 3TSZA 2X4XA 2JTFA 3HTRA 5GANf 2DXTA 3A8MB 4PJOC 2NUPA 4R0KA 1X2QA 4M7DA 2DLPA 2K3YA 1VQOA 1U3OA 4Z89A 1CKAA 5HK3A 1KC8U 2D9TA 3UDCA 3RBBB 3CCVT 3UA6A 3REAB 3KFVA 3JCMg 1K8AR 1UTIA 3A8LB 3CCMA 4PJOF 4C8QE 1QKWA 1FYNA 4J5YA 5L8RE 2D8HA 2EQJA 2YUPA 5EC7A 3CCQT 1JBMA 2KNBB 4YTLA 1FX7A 2PVDB 2FB7A 2DO3A 4L6V5 1D1BA 1K9MU 2A3LA 3O5ZA 3OA6A 5IHNA 3CC7Q 1IREB 3GF5A 3INZA 5FWCA 4HT9A 1KQSP 3CEYA 2XDBA 2CP5A 4A53A 3GLXA 1C1AA 4JS4A 4M78B 2O4XA 5L23A 5FU6B 5GAMf 4HVWA 1M9SA 5AT1B 1E7OA 5FU7B 1BBZA 2RJEA 5LJ5f 4M7AD 4MDXA 3QYGB 1I81A 4MMLA 3OY9A 3SD4A 4FYVB 3L2RA 4PK4A 1ABQA 4GLKA 2DEQA 1AHJB 2V1QA 3OBYA 2OAUA 2EJGA 1QMCA 1RLQC 2JZ2A 4C8QC 2LX7A 3I55A 1JJ2S 4E7KA 3CCSA 1Y0MA 4WF2A 2QDYB 2EYWA 4X9DA 3UPUA 5AYFA 2ZPEB 1TXQA 3CC2A 1VQ6A 1WQ7A 2ROTA 4FL6A 1GRIA 4MZPA 3G71A 3OMGA 4IUTA 2EIFA 2LQWA 1BCMA 2CS7A 3VS7A 3OYKA 2QTVA 1QCOA 1WXTA 2KI7A 3RERA 5LJ3d 3TEEA 2X4YA 2RMOA 1M2VB 3CCUT 5CKBA 3QXEB 2KVQG 1EX4A 3CMAA 2DRMA 1YI2A 5IAYA 2QTXA 4LUEA 1RI0A 1VQ5A 3TREA 3NMZC 2K5IA 2E12A 4J9DA 1X6OA 2JW4A 5KE2A 4VUBA 1JXMA 1OX9A 1M8VA 3PGGA 7AT1B 4F04B 5GANj 1Q7YU 2HKQB 1VOMA 3CCJQ 1VUBA 3JCMJ 1JU5C 3CCRQ 2W10A 5I22A 2E70A 1OEBA 2NUPB 1Q81R 4M7DB 2K6DA 1W6XA 1GFCA 1HXDA 1WFWA 2GTJA 2ZGWA 3L42A 1U06A 4BB7A 4ZNXA 4ZGDB 4KT0E 3CMET 2VXEA 5HCKA 3OW2P 1I5OB 1TSFA 1PWTA 2FYKA 3QKJA 1TG0A 2K5LA 3FIFA 3RUXA 2F69A 4QQDA 1TU0B 2E3HA 5GAMe 1B3QA 1SRMA 2LQNA 2J06A 2GGRA 5LJ5e 1G3YA 2RB6A 3GNFB 1U5SA 2E6NA 4JRQA 3JCMW 1QCNA 1I07A 4C0ZA 1X2KA 5GAMj 4M77G 3LGLA 2EYXA 2O4XB 1KC8C 4OGEA 2RA2A 2RHZA 5LJ5j 1UJYA 2FRWA 2VB6A 4X34A 1UUEA 2DRKA 2PTKA 2F2WA 1RAIB 2V1RA 3T9NA 1S72Q 1PCXA 3I56Q 1M1KU 2CZ6B 1XTDA 4E7JA 4PJMA 5I2MA 2HEQA 2DTIA 2EJFA 1AOJA 3RR6A 1N8RC 1R0BG 2VGNA 1K9MC 1BI1A 2PZ1A 3ASKA 3C95A 3ER0A 1T0JA 1M90R 2C0TA 1AEYA 3V8JA 3PFSA 2LX9A 3M5AA 4DBRA 2JT4A 4RTWA 2D0QB 1N9RA 1N6AA 2COYA 1RUWA 4F17A 1BU1A 3CD6Q 1NLOC 3O8VA 3DLMA 1RACB 2DFUA 3GOXA 2YHTA 1GL5A 4Y92A 3A8HB 2QA4Q 4KULA 1RAEB 1UGPB 1VYUA 1N27A 3THKA 3HL8A 2L0AA 3JCMP 1TH7A 1F1BB 2JM9A 3EHRA 3BY7A 4HVUA 2LJ0A 5D6XA 1E6HA 2MPXC 1OULA 2HQXA 4OB1B 3GIBA 2XI9A 4XTYA 1YJ9A 2OX7A 2YLCA 2GFAA 3EGXA 1WQWA 1T0HA 1K4US 4FYWB 1FXXA 1IZ6A 4M75A 2KSSA 1YN8A 4J9IA 4EMKC 1U1TA 2PUOB 4F7UF 2PU9B 5FRNA 2RH2A 3SWNC 1YIJT 1PKTA 3QJ6A 4WCIA 2CSQA 2JNGA 3M54A 1VQ4Q 3VS4A 1AD5A 1JRIA 2HL3A 3C94A 1PG5B 2L3SA 4DQ2A 2RQVA 2DBKA 4ZTJA 1UHFA 3QG1A 1Q7YC 1KHIA 4PKCC 1SF9A 3HRSA 2Y90A 3EG0A 1K8AU 2X35A 4RG2A 3FRNA 3QZ9B 2MYSA 4IKFA 1WNLA 4C5GA 1VQ8Q 5CKDA 3P8BB 1WI7A 3G7ZA 2IIMA 2HL5C 1XJWB 1VQMA 5CAIA 2EQIA 3M0QA 2J05A 4PJOG 5DLOA 1OU8A 4CC3A 1ZA2B 3PIOA 4DEYA 4IUVA 6AT1B 2RNAA 3M57A 2XDPA 1NJIR 3CQTA 8ATCB 3KUFA 5HK0A 2CT4A 3RDVA 2ZPIB 2KDSA 3G1JA 4J6YA 3G4SQ 4X1VA 3JCMc 3H0FA 2ZPGB 2DJQA 2YRCA 4D6WA 1VQ7A 2LNVA 4RCBA 4QQGA 3BE3A 2XIDA 5GAN2 4C92E 1YJWA 3VUBA 3DLLA 3CCJT 4EDUA 5ECAA 2PNIA 1P92A 3CCRT 2L8DA 1RAGB 1WXUA 3L1AA 1B07A 3EAEA 4MMKA 4JZ4A 3CPWP 1S72A 1C0MA 1Q82C 2R58A 1PRMC 3JCMd 3LX7A 3OS0A 4LDWA 4OF1A 3TCJA 1N5ZA 2YT6A 4JJBA 5LJ3h 2LCCA 2FZCB 2KGTA 3OYFA 4C0GA 4UC4A 1H3HA 3HPWA 3I5SA 2RHXA 2D6FA 3OYHA 2E3IA 4JDSA 4C8QG 1S1NA 4OB0B 4KUIA 2YUOA 2PQWA 1ZBJA 3GPLA 2QQBA 4MDWA 1BI0A 1VQLT 1OU9A 5GANg 3RESA 5GAOm 4C92C 2EWNA 3EFSA 3EGXB 3CC4A 2DXUA 2OTJA 3JB9F 2X3WD 3M0SA 3QDFA 1D09B 4M75B 2XDDA 5KYUA 1UGVA 1JJ2P 1VQ9A 2FZKB 4KRTA 1V76A 4M77A 1M30A 4BUGA 2LC4A 2Y4XA 1ACMB 4C92F 3VS5A 3I56T 1W2BA 1Q81U 4FW2A 1VQPQ 3OYEA 3UWNA 1ZX6A 3N5BB 4PNOA 2ZPHB 1OI1A 2AHJB 1UE9A 1QVFS 3VYGA 5IT9E 1QVPA 4J6XA 4A4KA 2QQSA 4E2FB 2DL4A 3Q1JA 3JAME 1MV0B 2QDLA 4N4IA 4XU2A 4J9EA 2ZPBB 1OPKA 2V8KA 4QVDA 4FYYB 2O2OA 1AT1B 2MMPA 2KXCA 4CC4B 3JV3A 1UFFA 3L2UA 3CD6T 4M78C 2JMCA 2H8HA 1MMGA 1KJWA 3DB4A 4KBMB 3CMEQ 4LDYA 5FU7C 2CZ7B 2QA4T 2GCXA 2RHIA 2HBPA 4XAXB 4AFQC 3JCMX 1GFDA 4M78F 4F14A 1MNEA 4C5EA 3QUIA 2FPFA 2RN8A 5GJWB 1JQQA 1OPLA 4RKUE 3PNWC 2CREA 3PMTA 3ULRB 4BY6B 4N0AC 2CUDA 1BCOA 3EG9A 3CCVA 1VYVA 3H6ZA 4FIBA 3CBPA 1QWEA 1VA7A 4E47A 2C0IA 2DK3A 4RTYA 1UJ0A 1N9SA 4J9HA 5GAN3 2BKDN 1M8MA 4OVAA 1GCQC 3CCQA 1KD1R 3OYYA 1YHQA 1IGUA 2CH4A 1O75A 1M2OA 2ROLA 2DA9A 2M0OA 2KYBA 1VQ4T 4DOWA 3OYMA 4FT2A 3NTIA 2DL7A 1JEGA 2CP2A 3A1PA 3E1SA 1W1FA 1KQ1A 1QVGS 2KE9A 1PNJA 2J7IA 4C5IA 1BI2A 1YCYA 1XQHA 4HCBA
chains in the Genus database with same CATH topology
4QT7A 4CC7A 2DMOA 3REBB 2MIOA 2J6KA 1JU5C 1Y57A 2W10A 2HCKA 5I22A 1OEBA 2LMJA 2K6DA 1W6XA 2DVJA 1GFCA 2SEMA 4GLMA 1WFWA 1K1ZA 2GTJA 2RQTA 1SHGA 1MUZA 1CSKA 3VS1A 1WX6A 2OAWA 2KYMA 4J9CA 1U06A 4ZNXA 1EFNA 2FPEA 4E6RA 3H0HA 5HCKA 1PWTA 2FEIA 1TG0A 1M3CA 1ZUUA 2VWFA 1Z9QA 2FPDA 2EBPA 1B3QA 1G2BA 1SRMA 2J06A 2LQNA 1GCPA 2GGRA 1RLPC 2LJ3A 1AVZC 5IXFA 2A28A 4ORZA 3H41A 3VS6A 1U5SA 2YUNA 1I07A 1X2KA 4AG1C 4IIOA 2EYXA 2KRNA 2EGCA 2CSIA 2HSPA 1AWOA 2LNHB 3I9QA 1UJYA 2D8JA 2FRWA 5IH2A 2K2MA 3QWYA 1ZUKA 1HSQA 1UUEA 2I0NA 1M3BA 1H92A 1WIEA 2DRKA 2PTKA 3M0PA 1V1CA 2F2WA 2GTOA 2V1RA 1SPKA 2ED1A 2O9SA 1UHCA 2HEQA 4OMQA 2P4RA 1AOJA 2KRMA 3NHNA 1AZEA 2PZ1A 1IO6A 2AK5A 2ABLA 2RQWA 1Z9ZA 4OMMA 2KT1A 1T0JA 2C0TA 1AEYA 3M0RA 2CT3A 1K0XA 3SEMA 5IXBA 2KROA 2YUQA 1UG1A 2JT4A 4RUGA 4RTWA 1SEMA 4F17A 1RUWA 4LUDA 1BU1A 1HJDA 1NLOC 2AZSA 2RQUA 2O88A 4ESRA 2KRSA 2HBWA 4OMNA 1GL5A 4Y92A 1YCSB 2L2PA 2JS0A 2L3QA 4J9BA 5I11A 3SHWA 2MOXA 4DEXA 2M51A 2ED0A 3EG1A 2EKHA 4F16A 1VYUA 3THKA 3I35A 4JJCA 2AKKA 2L0AA 1TUDA 2EGAA 2L3PA 1KFZA 2JM9A 3EHRA 2EGEA 2A37A 2KR3A 4HVUA 2LJ0A 3TSWA 1E6HA 4IIMA 1GBRA 1J3TA 1NYFA 2GNCA 4J9FA 2LZ6B 2YSQA 2EVRA 3VS2A 1T0HA 1K4US 1X6BA 1X6GA 2DL8A 2XMFA 1X27A 3U23A 2DM1A 1YN8A 2D0NA 4J9IA 2ECZA 1PKTA 4WCIA 2CSQA 2EPDA 3VS4A 1AD5A 1QWFA 4JPBW 2G6FX 2L3SA 4RTUA 2DNUA 2K9GA 2F2XA 2RQVA 1PKSA 2DBKA 1UHFA 3IQLA 3GBQA 4A63B 2CUBA 3VS0A 1MV3A 4HCKA 3EG0A 2O9VA 2EYYA 1ZUYA 1I1JA 1WI7A 2IIMA 5IHKA 2EQIA 1ZSGA 1T3SA 3M0QA 2J05A 3EG3A 3M0UA 2X3XD 4CC3A 4GBQA 4DEYA 4Z88A 2E5KA 1QCFA 2RNAA 3CQTA 2O31A 1WA7A 3PVLA 2DX1A 1E6GA 1RI9A 2M0YA 2DILA 2CT4A 2RQRA 1HD3A 4OMLA 2MCNA 3FJ5A 3VS3A 4LN2A 4D8DA 4X1VA 2LCSA 4J9GA 2FO0A 3H0FA 3RNJA 2BTTA 3VRYA 1JO8A 2DJQA 2EYZA 2A36A 4HXJA 2F2VA 2RPNA 4HVVA 2C0OA 1BK2A 1PHTA 2JMAA 2FRYA 1M3AA 2LP5A 2GQIA 5ECAA 1M27C 3C0CA 1NM7A 1G83A 2PNIA 2J6OA 2DL5A 2HDAA 2JXBA 3LH5A 1FMKA 1ABOA 1WXUA 2KBTA 4AFZC 3I5RA 1B07A 1NEGA 1X69A 2W0ZA 4JZ4A 2K79A 2BZ8A 1I0CA 1PRMC 2JM8A 2DYBA 2VVKA 1N5ZA 3TVTA 2YT6A 1GCQA 4RTXA 1GBQA 4JJBA 2KGTA 1ZLMA 1VYTA 3EHQA 1H3HA 3I5SA 2B86A 2DBMA 4OMPA 1PRLC 3NPFA 1YP5A 2VKNA 2OI3A 1S1NA 2A08A 4FSSA 2KT8A 1A0NB 2J6FA 2KXDA 2YUOA 1X43A 4CC2A 1QLYA 1ZBJA 4AFSC 1NLPC 2CDTA 2RF0A 1XOVA 4RTVA 1OOTA 1JXOA 3TSZA 3VRZA 1YWPA 2X3WD 3M0SA 1WLPB 1K9AA 4JZ3A 4R0KA 1X2QA 2DLPA 1NG2A 1K76A 1UGVA 1U3OA 4Z89A 1WXBA 1CKAA 2YDLA 4KRTA 1M30A 3RBBB 2AZVA 3UA6A 3R6NA 3REAB 3KFVA 1WYXA 3VS5A 1UTIA 2NWMA 4Z8AA 3PE0A 2K3BA 1ZX6A 1UECA 1QKWA 1FYNA 1UE9A 2NUZA 1AWJA 2JS2A 1K0SA 2D8HA 4AFUC 1AZGB 2K7AA 2YUPA 5EC7A 2KNBB 1TUCA 2DL4A 3H0IA 1NYGA 1MV0B 2QDLA 2LJ1A 3O5ZA 5IHNA 4J9EA 1OPKA 2DF6A 1YNZA 5FWCA 2O2OA 1T3LA 2KXCA 3UATA 3UF4A 4CC4B 3JV3A 1UFFA 1SRLA 1W70A 2JTEA 2H8HA 2JMCA 3UA7A 5L23A 1KJWA 4HVWA 5FWBA 2BZXA 2BZYA 2DL3A 4OMOA 1KIKA 1E7OA 4AG2C 1H8KA 1BBZA 4JJDA 1SHFA 4RTZA 1ARKA 4AFQC 1ABQA 2V1QA 1UDLA 1GFDA 4F14A 1RLQC 4D8KA 2LX7A 2GBQA 1OV3A 1BB9A 1Y0MA 2FPFA 2RN8A 5GJWB 1JQQA 1NEBA 2EYWA 1OPLA 3M0TA 2CREA 2FG0A 4EIKA 2D1XA 3ULRB 3A98A 2ROTA 2CUDA 1GRIA 4M4ZA 1VYVA 2ENMA 3QWXX 1QWEA 2AKLA 1VA7A 2LQWA 4K11A 4LE9A 5IHIA 3VS7A 2C0IA 2DE0X 3EGUA 4RTYA 1UJ0A 4J9HA 1WXTA 5FW9A 4LNPA 2CH4W 1M8MA 1LCKA 1YWOA 2RMOA 4RTTA 3ZL7C 1GCQC 1AWXA 2SRCA 1KSWA 3NGPA 2EW3A 2CH4A 2DRMA 2ROLA 2DA9A 2KYBA 4LUEA 1CKBA 2KEAA 3EG2A 3NMZC 1SSHA 2DL7A 3PVQA 4J9DA 2JW4A 1JEGA 5GJVB 1W1FA 2OJ2A 1JXMA 1WDXA 2KE9A 1PNJA 1QKXA 1AWWA 2J7IA 2ESWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QT7 A;  4CC7 A;  2DMO A;  3REB B;  2MIO A;  2J6K A;  1JU5 C;  1Y57 A;  2W10 A;  2HCK A;  5I22 A;  1OEB A;  2LMJ A;  2K6D A;  1W6X A;  2DVJ A;  1GFC A;  2SEM A;  4GLM A;  1WFW A;  1K1Z A;  2GTJ A;  2RQT A;  1SHG A;  1MUZ A;  1CSK A;  3VS1 A;  1WX6 A;  2OAW A;  2KYM A;  4J9C A;  1U06 A;  4ZNX A;  1EFN A;  2FPE A;  4E6R A;  3H0H A;  5HCK A;  1PWT A;  2FEI A;  1TG0 A;  1M3C A;  1ZUU A;  2VWF A;  1Z9Q A;  2FPD A;  2EBP A;  1B3Q A;  1G2B A;  1SRM A;  2J06 A;  2LQN A;  1GCP A;  2GGR A;  1RLP C;  2LJ3 A;  1AVZ C;  5IXF A;  2A28 A;  4ORZ A;  3H41 A;  3VS6 A;  1U5S A;  2YUN A;  1I07 A;  1X2K A;  4AG1 C;  4IIO A;  2EYX A;  2KRN A;  2EGC A;  2CSI A;  2HSP A;  1AWO A;  2LNH B;  3I9Q A;  1UJY A;  2D8J A;  2FRW A;  5IH2 A;  2K2M A;  3QWY A;  1ZUK A;  1HSQ A;  1UUE A;  2I0N A;  1M3B A;  1H92 A;  1WIE A;  2DRK A;  2PTK A;  3M0P A;  1V1C A;  2F2W A;  2GTO A;  2V1R A;  1SPK A;  2ED1 A;  2O9S A;  1UHC A;  2HEQ A;  4OMQ A;  2P4R A;  1AOJ A;  2KRM A;  3NHN A;  1AZE A;  2PZ1 A;  1IO6 A;  2AK5 A;  2ABL A;  2RQW A;  1Z9Z A;  4OMM A;  2KT1 A;  1T0J A;  2C0T A;  1AEY A;  3M0R A;  2CT3 A;  1K0X A;  3SEM A;  5IXB A;  2KRO A;  2YUQ A;  1UG1 A;  2JT4 A;  4RUG A;  4RTW A;  1SEM A;  4F17 A;  1RUW A;  4LUD A;  1BU1 A;  1HJD A;  1NLO C;  2AZS A;  2RQU A;  2O88 A;  4ESR A;  2KRS A;  2HBW A;  4OMN A;  1GL5 A;  4Y92 A;  1YCS B;  2L2P A;  2JS0 A;  2L3Q A;  4J9B A;  5I11 A;  3SHW A;  2MOX A;  4DEX A;  2M51 A;  2ED0 A;  3EG1 A;  2EKH A;  4F16 A;  1VYU A;  3THK A;  3I35 A;  4JJC A;  2AKK A;  2L0A A;  1TUD A;  2EGA A;  2L3P A;  1KFZ A;  2JM9 A;  3EHR A;  2EGE A;  2A37 A;  2KR3 A;  4HVU A;  2LJ0 A;  3TSW A;  1E6H A;  4IIM A;  1GBR A;  1J3T A;  1NYF A;  2GNC A;  4J9F A;  2LZ6 B;  2YSQ A;  2EVR A;  3VS2 A;  1T0H A;  1K4U S;  1X6B A;  1X6G A;  2DL8 A;  2XMF A;  1X27 A;  3U23 A;  2DM1 A;  1YN8 A;  2D0N A;  4J9I A;  2ECZ A;  1PKT A;  4WCI A;  2CSQ A;  2EPD A;  3VS4 A;  1AD5 A;  1QWF A;  4JPB W;  2G6F X;  2L3S A;  4RTU A;  2DNU A;  2K9G A;  2F2X A;  2RQV A;  1PKS A;  2DBK A;  1UHF A;  3IQL A;  3GBQ A;  4A63 B;  2CUB A;  3VS0 A;  1MV3 A;  4HCK A;  3EG0 A;  2O9V A;  2EYY A;  1ZUY A;  1I1J A;  1WI7 A;  2IIM A;  5IHK A;  2EQI A;  1ZSG A;  1T3S A;  3M0Q A;  2J05 A;  3EG3 A;  3M0U A;  2X3X D;  4CC3 A;  4GBQ A;  4DEY A;  4Z88 A;  2E5K A;  1QCF A;  2RNA A;  3CQT A;  2O31 A;  1WA7 A;  3PVL A;  2DX1 A;  1E6G A;  1RI9 A;  2M0Y A;  2DIL A;  2CT4 A;  2RQR A;  1HD3 A;  4OML A;  2MCN A;  3FJ5 A;  3VS3 A;  4LN2 A;  4D8D A;  4X1V A;  2LCS A;  4J9G A;  2FO0 A;  3H0F A;  3RNJ A;  2BTT A;  3VRY A;  1JO8 A;  2DJQ A;  2EYZ A;  2A36 A;  4HXJ A;  2F2V A;  2RPN A;  4HVV A;  2C0O A;  1BK2 A;  1PHT A;  2JMA A;  2FRY A;  1M3A A;  2LP5 A;  2GQI A;  5ECA A;  1M27 C;  3C0C A;  1NM7 A;  1G83 A;  2PNI A;  2J6O A;  2DL5 A;  2HDA A;  2JXB A;  3LH5 A;  1FMK A;  1ABO A;  1WXU A;  2KBT A;  4AFZ C;  3I5R A;  1B07 A;  1NEG A;  1X69 A;  2W0Z A;  4JZ4 A;  2K79 A;  2BZ8 A;  1I0C A;  1PRM C;  2JM8 A;  2DYB A;  2VVK A;  1N5Z A;  3TVT A;  2YT6 A;  1GCQ A;  4RTX A;  1GBQ A;  4JJB A;  2KGT A;  1ZLM A;  1VYT A;  3EHQ A;  1H3H A;  3I5S A;  2B86 A;  2DBM A;  4OMP A;  1PRL C;  3NPF A;  1YP5 A;  2VKN A;  2OI3 A;  1S1N A;  2A08 A;  4FSS A;  2KT8 A;  1A0N B;  2J6F A;  2KXD A;  2YUO A;  1X43 A;  4CC2 A;  1QLY A;  1ZBJ A;  4AFS C;  1NLP C;  2CDT A;  2RF0 A;  1XOV A;  4RTV A;  1OOT A;  1JXO A;  3TSZ A;  3VRZ A;  1YWP A;  2X3W D;  3M0S A;  1WLP B;  1K9A A;  4JZ3 A;  4R0K A;  1X2Q A;  2DLP A;  1NG2 A;  1K76 A;  1UGV A;  1U3O A;  4Z89 A;  1WXB A;  1CKA A;  2YDL A;  4KRT A;  1M30 A;  3RBB B;  2AZV A;  3UA6 A;  3R6N A;  3REA B;  3KFV A;  1WYX A;  3VS5 A;  1UTI A;  2NWM A;  4Z8A A;  3PE0 A;  2K3B A;  1ZX6 A;  1UEC A;  1QKW A;  1FYN A;  1UE9 A;  2NUZ A;  1AWJ A;  2JS2 A;  1K0S A;  2D8H A;  4AFU C;  1AZG B;  2K7A A;  2YUP A;  5EC7 A;  2KNB B;  1TUC A;  2DL4 A;  3H0I A;  1NYG A;  1MV0 B;  2QDL A;  2LJ1 A;  3O5Z A;  5IHN A;  4J9E A;  1OPK A;  2DF6 A;  1YNZ A;  5FWC A;  2O2O A;  1T3L A;  2KXC A;  3UAT A;  3UF4 A;  4CC4 B;  3JV3 A;  1UFF A;  1SRL A;  1W70 A;  2JTE A;  2H8H A;  2JMC A;  3UA7 A;  5L23 A;  1KJW A;  4HVW A;  5FWB A;  2BZX A;  2BZY A;  2DL3 A;  4OMO A;  1KIK A;  1E7O A;  4AG2 C;  1H8K A;  1BBZ A;  4JJD A;  1SHF A;  4RTZ A;  1ARK A;  4AFQ C;  1ABQ A;  2V1Q A;  1UDL A;  1GFD A;  4F14 A;  1RLQ C;  4D8K A;  2LX7 A;  2GBQ A;  1OV3 A;  1BB9 A;  1Y0M A;  2FPF A;  2RN8 A;  5GJW B;  1JQQ A;  1NEB A;  2EYW A;  1OPL A;  3M0T A;  2CRE A;  2FG0 A;  4EIK A;  2D1X A;  3ULR B;  3A98 A;  2ROT A;  2CUD A;  1GRI A;  4M4Z A;  1VYV A;  2ENM A;  3QWX X;  1QWE A;  2AKL A;  1VA7 A;  2LQW A;  4K11 A;  4LE9 A;  5IHI A;  3VS7 A;  2C0I A;  2DE0 X;  3EGU A;  4RTY A;  1UJ0 A;  4J9H A;  1WXT A;  5FW9 A;  4LNP A;  2CH4 W;  1M8M A;  1LCK A;  1YWO A;  2RMO A;  4RTT A;  3ZL7 C;  1GCQ C;  1AWX A;  2SRC A;  1KSW A;  3NGP A;  2EW3 A;  2CH4 A;  2DRM A;  2ROL A;  2DA9 A;  2KYB A;  4LUE A;  1CKB A;  2KEA A;  3EG2 A;  3NMZ C;  1SSH A;  2DL7 A;  3PVQ A;  4J9D A;  2JW4 A;  1JEG A;  5GJV B;  1W1F A;  2OJ2 A;  1JXM A;  1WDX A;  2KE9 A;  1PNJ A;  1QKX A;  1AWW A;  2J7I A;  2ESW A; 
#chains in the Genus database with same CATH topology
 2RD1 A;  4QT7 A;  1VQ8 T;  1U1S A;  2DMO A;  4FYX B;  4L59 A;  4XTZ A;  1H3Z A;  4PLL A;  2DD4 A;  3P8D A;  3BDL A;  5KYU B;  4FW1 A;  1WPY A;  2SEM A;  4GY5 A;  4M77 B;  2XG8 D;  5LJ3 e;  1KHC A;  1CSK A;  2OAW A;  4J9C A;  1EFN A;  1EZZ B;  4C0F A;  4A4F A;  4E6R A;  3CPW S;  1IHV A;  3JRZ A;  2NUT A;  3BDU A;  4M7D F;  5GAN 8;  1M3C A;  1TOV A;  1ZUU A;  3G4S T;  4BE2 A;  4PJO D;  3GP8 A;  8AT1 B;  1KQ2 A;  3PIP A;  3CXC A;  1NPP A;  1RLP C;  2LJ3 A;  1AVZ C;  5IXF A;  3OS1 A;  2A28 A;  4ZN1 A;  5FLX E;  4M7A A;  4LDV A;  2E41 A;  5KCO A;  2BIV A;  3CCU A;  2V8I A;  2YUN A;  2Z0W A;  2DPP B;  4AG1 C;  1HK9 A;  4IIO A;  2HZY A;  2EGC A;  2OTL Q;  1AWO A;  4EMH A;  3I9Q A;  2D8J A;  1ZBX A;  1YIJ Q;  3QWY A;  1Q81 C;  5GMK l;  2I0N A;  2VAS A;  2GTO A;  4CRI A;  2YWW A;  3CPF A;  1SPK A;  2O9S A;  1R0C B;  1U8R A;  4OMQ A;  2P4R A;  5C6S A;  5LL6 S;  1G3S A;  1Q86 U;  2KRM A;  4ELZ C;  2DYI A;  2R5M A;  2WSC E;  1IO6 A;  2AK5 A;  2ABL A;  2RQW A;  1Z9Z A;  1WHG A;  2KT1 A;  3LWI A;  3EG9 B;  5GMK e;  4KGV B;  3M0R A;  1K0X A;  3SEM A;  4R55 A;  4XQ3 A;  1UG1 A;  3CME A;  4RUG A;  2P84 A;  5GMK j;  4C8Q D;  1HJD A;  3H9N A;  1NBE B;  3V8K A;  2KRS A;  1OX8 A;  5DY9 A;  1Y7X A;  5DM7 R;  2K4Y A;  4J9B A;  2XKO C;  2CP0 A;  4DEX A;  5I11 A;  1VQP T;  4B6M A;  2ED0 A;  3JCM h;  2E10 A;  4F16 A;  3MET A;  4O6J A;  5GAO q;  4LDX A;  1BIB A;  1YFN A;  4QQ6 A;  3OYJ A;  1KFZ A;  2QAZ A;  2EGE A;  2KR3 A;  3PTA A;  2EKO A;  3TQ7 P;  1GBR A;  3D7S B;  2X9H A;  2XU8 A;  4BI3 A;  1J3T A;  1V29 B;  4E7H A;  4J9F A;  1WHK A;  2LZ6 B;  2YSQ A;  4QW2 A;  3HRU A;  3VS2 A;  4E7Z A;  4DBF A;  2K3X A;  3OSV A;  2DIG A;  4FM4 B;  2EPD A;  2NUT B;  1QWF A;  1PSE A;  2H3E B;  2G6F X;  3J7A F;  4RTU A;  2K9G A;  3NTH A;  3JCM Q;  2FZG B;  1VQL Q;  4NL2 A;  1MV3 A;  3MKD A;  4M7A B;  2O9V A;  4E7I A;  1ZUY A;  3G6E T;  1MMA A;  3MCA B;  4C92 G;  2HMA A;  5EG2 A;  5IHK A;  3L2Z A;  4KUD K;  2E5Q A;  3CCE T;  1JB0 E;  2VUB A;  1YJN Q;  2E65 A;  4KGX B;  4Z88 A;  2E5K A;  3JCM V;  4BE0 A;  2DTH A;  3JB9 J;  4HCZ A;  2EQU A;  1WA7 A;  4BD3 A;  2PVG B;  2RJD A;  1M4Z A;  1E6G A;  2M0Y A;  2RQR A;  3CC7 A;  2COW A;  3FJ5 A;  4LN2 A;  4IUU A;  2FO0 A;  4F7U E;  4QVZ A;  3LLR A;  5GAN d;  3JB9 H;  2H3J A;  3M9Q A;  3OYD A;  1WHM A;  3VUZ A;  3DKM A;  4C8Q B;  5D6Y A;  3M58 A;  2JMA A;  1X01 A;  5KYN A;  4IUR A;  3X25 B;  2KMT A;  1NM7 A;  2QAS A;  3UT1 A;  1W4S A;  3LH5 A;  2HDA A;  2J6O A;  3MEW A;  1FMK A;  1YBY A;  1EIF A;  1ABO A;  4AFZ C;  4A4H A;  1MMN A;  4M75 E;  4BAC A;  3DB3 A;  2EQM A;  2W0Z A;  1X69 A;  1WHJ A;  2P0K A;  4M78 G;  4BI8 B;  1WGS A;  1QVF P;  2LRQ A;  5KYY A;  3MJX A;  1I0C A;  1NZ9 A;  3QSU A;  2KAF A;  2VGM A;  1Q86 C;  3QPH A;  1VIF A;  3MP6 A;  1D0Z A;  2KK4 A;  1XNI A;  1VYT A;  4LXC A;  2B86 A;  1YP5 A;  2RK2 A;  1IRX A;  5CQX A;  4FSS A;  5CKH A;  2ATC B;  1LNX A;  1KD1 U;  2LT1 A;  1TTH B;  1D3B A;  3NFC A;  4O5V A;  5GAM d;  1XOV A;  4Z02 A;  1OOT A;  3J81 E;  3WVD B;  5LJ5 d;  3VRZ A;  5CO7 A;  1KC8 R;  1WLP B;  1VQK T;  1K9A A;  4JZ3 A;  4MZM A;  2OTL T;  2O01 E;  1G3W A;  4M75 C;  1K76 A;  2QI2 A;  2K2V A;  3JCM e;  1C6V X;  3R6N A;  1WYX A;  1ZSZ A;  2P0P A;  2KY9 A;  4OP0 A;  2CP7 A;  2NWM A;  2IVW A;  5I2S A;  2QEX T;  3PE0 A;  3JCM b;  5CIU A;  2K3B A;  3CCJ A;  1UEC A;  3M4Y A;  2NUZ A;  4M75 F;  4ZGE B;  5A2Q E;  1N8R R;  2JS2 A;  3CCR A;  1K9M R;  1AZG B;  1QQJ A;  2MWP A;  2DER A;  2MF2 A;  2VYT A;  1TUC A;  3QDR B;  4XK8 E;  1NYG A;  1VQN Q;  2LJ1 A;  1OZ2 A;  5CKF A;  1G5V A;  3E9F A;  2DF6 A;  4RMO A;  2QQR A;  1T3L A;  3UAT A;  3UF4 A;  4Y91 A;  1LJO A;  4BDY A;  2BE7 D;  4BDZ A;  1SRL A;  1W70 A;  2JTE A;  4KH1 B;  1QVG P;  2AT1 B;  2BZY A;  1KIK A;  2F5K A;  2RHU A;  1H8K A;  1IXD A;  4XTX A;  1OZ3 A;  3KBG A;  1SHF A;  1VQL A;  3JB9 I;  1ARK A;  1TWB A;  3QBY A;  2L5Q A;  3SFM A;  1BB9 A;  1NEB A;  2COZ A;  4EPC A;  3M0T A;  2FG0 A;  3VYH B;  2D1X A;  1W2B P;  3A98 A;  1VIE A;  3EFO A;  2ENM A;  2AKL A;  5IHI A;  3I56 A;  3X28 B;  2DE0 X;  3OS2 A;  5KYY B;  5FW9 A;  4WTO B;  1M1K C;  2CH4 W;  4C0D B;  3OYB A;  3HFN A;  1LCK A;  4R56 A;  5CCA A;  3HRT A;  4RTT A;  3CCL Q;  1BYM A;  5J3B A;  2WSE E;  1CKB A;  3VV0 A;  2KEA A;  3PMI A;  1R8O B;  1WJS A;  1RAB B;  2L3R A;  3PVQ A;  1K73 R;  4JRI A;  5J39 A;  1VQO Q;  5GJV B;  2X4J A;  2K5F A;  1WDX A;  4LD9 K;  1O9S A;  3OYN A;  1D3B B;  5KCH A;  1QKX A;  3EFR A;  3CD6 A;  2ESW A;  4JJN K;  3M53 A;  4CC7 A;  3CCM Q;  4M78 E;  2QA4 A;  2J6K A;  1UGQ B;  2DD5 A;  2QYZ A;  1Y57 A;  2HCK A;  3R6O A;  5KE3 A;  1YJN T;  2WAC A;  2EFI A;  3URG A;  4M77 C;  4GLM A;  3LWH A;  3JB9 D;  1M5Q 1;  1K1Z A;  2RQT A;  1SHG A;  3VS1 A;  5GAN 5;  1ZSZ B;  1WX6 A;  4DA4 A;  4JLG A;  3FB9 A;  2PVO B;  5HKC A;  4J8O A;  4PFZ A;  3X26 B;  4C92 D;  2FEI A;  2A0F B;  5LJ3 f;  4M77 F;  2EBP A;  3NTK A;  1PC0 A;  1FMV A;  4ME7 A;  2V8J A;  5GAM g;  2BE9 B;  4ORZ A;  2LVM A;  1KK7 A;  4BE1 A;  5LJ5 g;  5FU6 C;  1VQ4 A;  1BIA A;  2JVV A;  3CCS Q;  2CSI A;  3H8Z A;  2HSP A;  5CK9 A;  1Q82 R;  1D0Y A;  4XU1 A;  2K2M A;  4L5G A;  1VQ6 Q;  2HAX A;  3M4G A;  1M3B A;  2G3R A;  2R5A A;  4AMC A;  3LH0 A;  1K8A C;  1VQ8 A;  4FCY A;  1D1C A;  1UHC A;  2EAY A;  3NHN A;  4ANJ A;  4M78 D;  3G6E Q;  2CP3 A;  2F1L A;  3CMA Q;  4OMM A;  2DXC A;  2YXY A;  2VXF A;  3OB9 A;  4M7D E;  3EFO B;  3CCE Q;  5GAN h;  3ZFJ A;  1JJ2 A;  4OGC A;  5IXB A;  1M90 U;  4OB2 B;  3AT1 B;  1SEM A;  4JUV A;  3G4S A;  4LUD A;  3V7C A;  3MEV A;  2AZS A;  3V7S A;  2C06 A;  3HSB A;  2RHY A;  4ESR A;  2O88 A;  3A8O B;  2HBW A;  4OMN A;  9ATC B;  1YCS B;  2L2P A;  3X24 B;  2L3Q A;  2M9U A;  4FSX A;  3L2V A;  1OYX A;  3BFM A;  2M51 A;  3EG1 A;  2EKH A;  3V7R A;  3C12 A;  3I35 A;  4N4G A;  2AKK A;  2RK1 A;  4M7A E;  2V26 A;  1ZHI A;  3FDR A;  4PL6 A;  1RL2 A;  2A37 A;  2P4T A;  1VQN T;  5KYW A;  3VKI A;  2ZZD A;  2JTM A;  4XTV A;  2GNC A;  4M7D C;  2HKN A;  4XU0 A;  4RG8 A;  1PD0 A;  5GAM h;  3OS5 A;  3GNG A;  2DXB A;  1W2B S;  1X6B A;  1X6G A;  2XMF A;  3VJP A;  4EMG A;  4PJO A;  5LJ5 h;  3U23 A;  2DM1 A;  2D0N A;  2ECZ A;  1MMD A;  1Y96 A;  2EJ9 A;  5LJ3 j;  1YIT T;  4PLI A;  3S6W A;  1FWZ A;  5GMK m;  3MPU B;  5HY6 A;  2DVE A;  4X9C A;  1IHW A;  1PKS A;  4M7D D;  2RM4 A;  3QJY A;  2JOY A;  3GBQ A;  4F7U G;  3VS0 A;  4A4E A;  4HCK A;  4HKE A;  4M7A C;  3LYI A;  2EYY A;  4PJJ A;  1YHQ T;  3S3M A;  3MEU A;  2VC8 A;  1I1J A;  1VQK Q;  1N8R U;  1ZSG A;  1VQP A;  1QW1 A;  3V8L A;  3LW5 E;  2MAM A;  3EG3 A;  4M75 G;  2CZ0 B;  2X3X D;  4M7A F;  3E2U A;  4N4H A;  2DTO A;  4GBQ A;  4DBH A;  2P0Q A;  3CCL T;  2QEX Q;  4NOY A;  3PVL A;  2DX1 A;  4QVC A;  3QHS A;  1HD3 A;  4OML A;  1RAH B;  2MCN A;  1NJI U;  1Y07 A;  2DEU A;  3VS3 A;  3HFO A;  3KXT A;  3E9G A;  2LCS A;  4J9G A;  1VQO T;  3VRY A;  4QKU A;  2IG0 A;  2RJF A;  4B9W A;  2HQE A;  1WJQ A;  2DIQ A;  3A5Z B;  3MHX A;  2A36 A;  4AT1 B;  4C8Q A;  4HXJ A;  4NL3 A;  2E6Z A;  1BK2 A;  1PHT A;  3P8H A;  2CKK A;  2RI3 A;  2GQV A;  2FRY A;  1M3A A;  3CCM T;  2LP5 A;  1NPR A;  1TS9 A;  3C0C A;  1G83 A;  4XTU A;  2DL5 A;  2KBT A;  3I5R A;  2CZ1 B;  3S3O A;  2NLU A;  4C8Q F;  2HSE B;  2JM8 A;  3S3N A;  2DYB A;  4JRK A;  3TVT A;  1YJ9 Q;  1GBQ A;  3SB2 A;  3G6E A;  1ZLM A;  3EHQ A;  1UEB A;  2DBM A;  3CBM A;  2VKN A;  2OI3 A;  1KQS A;  3CCE A;  2A08 A;  3WXM B;  1A0N B;  3ZBD A;  4CI0 C;  5GAN e;  1X43 A;  5KYW B;  4HA8 A;  2LCL A;  4AFS C;  2DAQ A;  1NLP C;  1M90 C;  2B8A A;  2RF0 A;  3MP1 A;  2X4W A;  4RTV A;  3RIR A;  2BUD A;  1JXO A;  1K73 U;  1LPL A;  3EH2 A;  1YWP A;  3ZEH A;  3I55 T;  2F5T X;  3CCS T;  4PJO B;  4DBQ A;  1UGS B;  4XTW A;  3M56 A;  1B34 A;  1NG2 A;  5GMK i;  3CC2 T;  2FL7 A;  1WXB A;  2YDL A;  3HP9 A;  4PJL A;  1Y96 B;  1VQ6 T;  2DKG A;  2DZC A;  4P5N A;  4JLI A;  2AZV A;  1SSF A;  3G71 T;  1VQM Q;  4Z8A A;  4ATO A;  3CXC S;  3JB9 G;  1KG1 A;  1AWJ A;  3JCM f;  1K0S A;  3OYA A;  1M1F A;  4AFU C;  2K7A A;  5A0G A;  1I8F A;  3CMA T;  3H0I A;  4E7L A;  1YI2 T;  1VQ5 T;  1QP3 A;  2XK0 A;  3OSS C;  2MWO A;  3ME9 A;  4HT8 A;  1YNZ A;  5CKE A;  2GF7 A;  2GFU A;  1PD1 A;  4KGZ B;  1VQ7 Q;  1WJR A;  3UA7 A;  4OMF B;  5FWB A;  2BZX A;  5C0M A;  2DL3 A;  1YJW Q;  4OMO A;  4AG2 C;  3CBO A;  4JJD A;  4RTZ A;  5CVI A;  3HHT B;  1UDL A;  2M02 A;  1Q82 U;  1MND A;  4E7S A;  3C4S A;  2A7Y A;  4D8K A;  2GBQ A;  2FVU A;  1OV3 A;  1ZQ1 A;  1VQK A;  2OTL A;  1RAA B;  4EIK A;  1YIJ A;  4Q5W A;  3TU4 K;  3BW1 A;  4M4Z A;  3QWX X;  4LE9 A;  4K11 A;  3OW2 A;  2QEX A;  3EGU A;  4HCC A;  2E64 A;  4ZGJ B;  4LNP A;  1WHL A;  2I2L A;  4C0D C;  1WHH A;  1DJ7 B;  2CGH A;  1YWO A;  3ZL7 C;  1AWX A;  2SRC A;  1KSW A;  3NGP A;  1NJI C;  2EW3 A;  5GAN 4;  3CC4 Q;  2OTJ Q;  2MI6 A;  1KQS S;  3EG2 A;  1SSH A;  2JN0 A;  2OJ2 A;  1VQ9 Q;  4MZT A;  5GAO p;  1AWW A;  3MO8 A;  5CR2 A;  2WSF E;  4A54 A;  2EQK A;  1Y71 A;  3REB B;  2QQ9 A;  2YRD A;  2MIO A;  4TVR A;  4F7U A;  3RKY A;  4DOV A;  3CC7 T;  1B34 B;  2LMJ A;  2DVJ A;  3RKW A;  2HQH A;  3SDZ A;  3MEA A;  4IUQ A;  1MUZ A;  1ZSZ C;  3EH1 A;  2KYM A;  1MGQ A;  5LJ3 g;  4EMK A;  4ELY C;  4Y28 E;  2FPE A;  3EGD A;  3SWN A;  3H0H A;  1SKU B;  5I21 A;  2VWF A;  1Z9Q A;  1PM3 A;  5D6W A;  3PT9 A;  2FPD A;  4PJN A;  1HYO A;  5KYX A;  4M75 D;  1G2B A;  1K73 C;  1GCP A;  2XIC A;  4II1 A;  4ZN3 A;  1QVF A;  3H41 A;  4M7D G;  3VS6 A;  4OB3 B;  3QO3 A;  2Y4Y A;  2KQW A;  2KRN A;  3AHU A;  5A0D A;  2LNH B;  2QG9 B;  5IH2 A;  1YIT Q;  3LGF A;  1PSF A;  1ZUK A;  1FMW A;  1HSQ A;  2RO0 A;  1H92 A;  1WIE A;  2AIR B;  3CCV Q;  3M0P A;  1V1C A;  3RMQ A;  1YJ9 T;  3RKX A;  1WZO A;  1Q86 R;  2EYQ A;  4J6W A;  3OYC A;  2VV5 A;  3FEO A;  2ED1 A;  3QZ5 B;  3M55 A;  1AZE A;  4A4G A;  2HD0 A;  1YJN A;  4BI4 A;  3CCQ Q;  2LTO A;  4BY6 C;  1YHQ Q;  5GAO r;  4M7A G;  4J7F A;  1IGQ A;  3OMC A;  3OW2 S;  2CT3 A;  4M77 E;  2YLB A;  3WVE B;  2KRO A;  2YUQ A;  2M1H A;  2DZ9 A;  2JUF A;  1D0X A;  2QK0 A;  1I4K 1;  1MHN A;  2RQU A;  3E19 A;  2E4H A;  3MP8 A;  2LDM A;  1IB8 A;  2QGF B;  2JS0 A;  4RCC A;  2RI2 A;  1VQM T;  3SHW A;  2MOX A;  2R57 A;  1Q7Y R;  2L89 A;  2QGG A;  2FHD A;  5D7U A;  1H64 1;  1LOJ A;  4JJC A;  4JS5 A;  2HNI A;  3OBW A;  1TUD A;  2EGA A;  2L3P A;  3X20 B;  2DET A;  3L2W A;  3TSW A;  4IIM A;  3JSC A;  4C5H A;  4F7U B;  5M9O A;  1BKB A;  1QVG A;  1NYF A;  2IPO B;  5J26 A;  4IUP A;  2M16 A;  4C92 A;  2EVR A;  2ZCF B;  1NE8 A;  1VQ7 T;  1SG5 A;  2DL8 A;  4NS5 A;  1X27 A;  1TUG B;  3VU3 C;  2E1H A;  1YJW T;  4LDU A;  1X75 C;  4EMK B;  2X51 A;  5IN1 A;  1D1A A;  1KD1 C;  3EGD B;  4J83 A;  3SWN B;  3CCU Q;  1GXI E;  5GAN 7;  2ZAE A;  3FLG A;  3QII A;  4JPB W;  1S72 T;  2DNU A;  5KH6 A;  2F2X A;  1BI3 A;  2JJ9 A;  5KYX B;  3IQL A;  3M59 A;  3OQ5 A;  3CPW A;  4A63 B;  5GAO l;  2CUB A;  4M77 D;  1UB4 A;  1G8X A;  5GAN 6;  3I55 Q;  4ZTF A;  4V2S A;  3F70 A;  1T3S A;  3CC2 Q;  1M1K R;  5DLQ E;  5FRO A;  2PUK B;  3M0U A;  4PFO A;  1UGR B;  5GMK h;  3FJP A;  3G71 Q;  2CYZ B;  2XHC A;  1LVK A;  4M78 A;  1QCF A;  2QQA A;  4FT4 A;  2O31 A;  3CC4 T;  1M1G A;  5FRM A;  2OTJ T;  1VQN A;  1RI9 A;  2DJZ A;  2DIL A;  3QYH B;  1G3T A;  4D8D A;  1OQK A;  4XU3 A;  3RNJ A;  1QP2 A;  2BTT A;  3OYI A;  1VQ9 T;  1JO8 A;  1YI2 Q;  2EYZ A;  2F2V A;  2RPN A;  4HVV A;  1VQ5 Q;  2C0O A;  4PFP A;  3RMS A;  1RAF B;  2K57 A;  2GQI A;  2YRV A;  1M27 C;  1RAD B;  1YIT A;  4KH0 B;  4N0A A;  2CP6 A;  2JXB A;  4B9X A;  2RJC A;  1Q95 G;  3CXC P;  4PJO E;  1R77 A;  5A0L A;  1I5L A;  1NEG A;  2QXF A;  2K79 A;  2BZ8 A;  3OYG A;  3A8G B;  3J80 E;  2MK5 A;  2VVK A;  1M2V A;  1GCQ A;  2LQ8 A;  4RTX A;  1B7T A;  2XD0 A;  4OMP A;  3FC3 A;  1PRL C;  3NPF A;  3HKS A;  4J7I A;  4LD6 A;  2KT8 A;  5CQY A;  1ZA1 B;  5GAO n;  2J6F A;  2KXD A;  4CC2 A;  3OYL A;  2RI5 A;  1QLY A;  2LQK A;  4JRP A;  3L2Q A;  4FU6 A;  2CDT A;  2ZPF B;  3CCL A;  2NYS A;  4C92 B;  2LT4 A;  3TSZ A;  2X4X A;  2JTF A;  3HTR A;  5GAN f;  2DXT A;  3A8M B;  4PJO C;  2NUP A;  4R0K A;  1X2Q A;  4M7D A;  2DLP A;  2K3Y A;  1VQO A;  1U3O A;  4Z89 A;  1CKA A;  5HK3 A;  1KC8 U;  2D9T A;  3UDC A;  3RBB B;  3CCV T;  3UA6 A;  3REA B;  3KFV A;  3JCM g;  1K8A R;  1UTI A;  3A8L B;  3CCM A;  4PJO F;  4C8Q E;  1QKW A;  1FYN A;  4J5Y A;  5L8R E;  2D8H A;  2EQJ A;  2YUP A;  5EC7 A;  3CCQ T;  1JBM A;  2KNB B;  4YTL A;  1FX7 A;  2PVD B;  2FB7 A;  2DO3 A;  4L6V 5;  1D1B A;  1K9M U;  2A3L A;  3O5Z A;  3OA6 A;  5IHN A;  3CC7 Q;  1IRE B;  3GF5 A;  3INZ A;  5FWC A;  4HT9 A;  1KQS P;  3CEY A;  2XDB A;  2CP5 A;  4A53 A;  3GLX A;  1C1A A;  4JS4 A;  4M78 B;  2O4X A;  5L23 A;  5FU6 B;  5GAM f;  4HVW A;  1M9S A;  5AT1 B;  1E7O A;  5FU7 B;  1BBZ A;  2RJE A;  5LJ5 f;  4M7A D;  4MDX A;  3QYG B;  1I81 A;  4MML A;  3OY9 A;  3SD4 A;  4FYV B;  3L2R A;  4PK4 A;  1ABQ A;  4GLK A;  2DEQ A;  1AHJ B;  2V1Q A;  3OBY A;  2OAU A;  2EJG A;  1QMC A;  1RLQ C;  2JZ2 A;  4C8Q C;  2LX7 A;  3I55 A;  1JJ2 S;  4E7K A;  3CCS A;  1Y0M A;  4WF2 A;  2QDY B;  2EYW A;  4X9D A;  3UPU A;  5AYF A;  2ZPE B;  1TXQ A;  3CC2 A;  1VQ6 A;  1WQ7 A;  2ROT A;  4FL6 A;  1GRI A;  4MZP A;  3G71 A;  3OMG A;  4IUT A;  2EIF A;  2LQW A;  1BCM A;  2CS7 A;  3VS7 A;  3OYK A;  2QTV A;  1QCO A;  1WXT A;  2KI7 A;  3RER A;  5LJ3 d;  3TEE A;  2X4Y A;  2RMO A;  1M2V B;  3CCU T;  5CKB A;  3QXE B;  2KVQ G;  1EX4 A;  3CMA A;  2DRM A;  1YI2 A;  5IAY A;  2QTX A;  4LUE A;  1RI0 A;  1VQ5 A;  3TRE A;  3NMZ C;  2K5I A;  2E12 A;  4J9D A;  1X6O A;  2JW4 A;  5KE2 A;  4VUB A;  1JXM A;  1OX9 A;  1M8V A;  3PGG A;  7AT1 B;  4F04 B;  5GAN j;  1Q7Y U;  2HKQ B;  1VOM A;  3CCJ Q;  1VUB A;  3JCM J;  1JU5 C;  3CCR Q;  2W10 A;  5I22 A;  2E70 A;  1OEB A;  2NUP B;  1Q81 R;  4M7D B;  2K6D A;  1W6X A;  1GFC A;  1HXD A;  1WFW A;  2GTJ A;  2ZGW A;  3L42 A;  1U06 A;  4BB7 A;  4ZNX A;  4ZGD B;  4KT0 E;  3CME T;  2VXE A;  5HCK A;  3OW2 P;  1I5O B;  1TSF A;  1PWT A;  2FYK A;  3QKJ A;  1TG0 A;  2K5L A;  3FIF A;  3RUX A;  2F69 A;  4QQD A;  1TU0 B;  2E3H A;  5GAM e;  1B3Q A;  1SRM A;  2LQN A;  2J06 A;  2GGR A;  5LJ5 e;  1G3Y A;  2RB6 A;  3GNF B;  1U5S A;  2E6N A;  4JRQ A;  3JCM W;  1QCN A;  1I07 A;  4C0Z A;  1X2K A;  5GAM j;  4M77 G;  3LGL A;  2EYX A;  2O4X B;  1KC8 C;  4OGE A;  2RA2 A;  2RHZ A;  5LJ5 j;  1UJY A;  2FRW A;  2VB6 A;  4X34 A;  1UUE A;  2DRK A;  2PTK A;  2F2W A;  1RAI B;  2V1R A;  3T9N A;  1S72 Q;  1PCX A;  3I56 Q;  1M1K U;  2CZ6 B;  1XTD A;  4E7J A;  4PJM A;  5I2M A;  2HEQ A;  2DTI A;  2EJF A;  1AOJ A;  3RR6 A;  1N8R C;  1R0B G;  2VGN A;  1K9M C;  1BI1 A;  2PZ1 A;  3ASK A;  3C95 A;  3ER0 A;  1T0J A;  1M90 R;  2C0T A;  1AEY A;  3V8J A;  3PFS A;  2LX9 A;  3M5A A;  4DBR A;  2JT4 A;  4RTW A;  2D0Q B;  1N9R A;  1N6A A;  2COY A;  1RUW A;  4F17 A;  1BU1 A;  3CD6 Q;  1NLO C;  3O8V A;  3DLM A;  1RAC B;  2DFU A;  3GOX A;  2YHT A;  1GL5 A;  4Y92 A;  3A8H B;  2QA4 Q;  4KUL A;  1RAE B;  1UGP B;  1VYU A;  1N27 A;  3THK A;  3HL8 A;  2L0A A;  3JCM P;  1TH7 A;  1F1B B;  2JM9 A;  3EHR A;  3BY7 A;  4HVU A;  2LJ0 A;  5D6X A;  1E6H A;  2MPX C;  1OUL A;  2HQX A;  4OB1 B;  3GIB A;  2XI9 A;  4XTY A;  1YJ9 A;  2OX7 A;  2YLC A;  2GFA A;  3EGX A;  1WQW A;  1T0H A;  1K4U S;  4FYW B;  1FXX A;  1IZ6 A;  4M75 A;  2KSS A;  1YN8 A;  4J9I A;  4EMK C;  1U1T A;  2PUO B;  4F7U F;  2PU9 B;  5FRN A;  2RH2 A;  3SWN C;  1YIJ T;  1PKT A;  3QJ6 A;  4WCI A;  2CSQ A;  2JNG A;  3M54 A;  1VQ4 Q;  3VS4 A;  1AD5 A;  1JRI A;  2HL3 A;  3C94 A;  1PG5 B;  2L3S A;  4DQ2 A;  2RQV A;  2DBK A;  4ZTJ A;  1UHF A;  3QG1 A;  1Q7Y C;  1KHI A;  4PKC C;  1SF9 A;  3HRS A;  2Y90 A;  3EG0 A;  1K8A U;  2X35 A;  4RG2 A;  3FRN A;  3QZ9 B;  2MYS A;  4IKF A;  1WNL A;  4C5G A;  1VQ8 Q;  5CKD A;  3P8B B;  1WI7 A;  3G7Z A;  2IIM A;  2HL5 C;  1XJW B;  1VQM A;  5CAI A;  2EQI A;  3M0Q A;  2J05 A;  4PJO G;  5DLO A;  1OU8 A;  4CC3 A;  1ZA2 B;  3PIO A;  4DEY A;  4IUV A;  6AT1 B;  2RNA A;  3M57 A;  2XDP A;  1NJI R;  3CQT A;  8ATC B;  3KUF A;  5HK0 A;  2CT4 A;  3RDV A;  2ZPI B;  2KDS A;  3G1J A;  4J6Y A;  3G4S Q;  4X1V A;  3JCM c;  3H0F A;  2ZPG B;  2DJQ A;  2YRC A;  4D6W A;  1VQ7 A;  2LNV A;  4RCB A;  4QQG A;  3BE3 A;  2XID A;  5GAN 2;  4C92 E;  1YJW A;  3VUB A;  3DLL A;  3CCJ T;  4EDU A;  5ECA A;  2PNI A;  1P92 A;  3CCR T;  2L8D A;  1RAG B;  1WXU A;  3L1A A;  1B07 A;  3EAE A;  4MMK A;  4JZ4 A;  3CPW P;  1S72 A;  1C0M A;  1Q82 C;  2R58 A;  1PRM C;  3JCM d;  3LX7 A;  3OS0 A;  4LDW A;  4OF1 A;  3TCJ A;  1N5Z A;  2YT6 A;  4JJB A;  5LJ3 h;  2LCC A;  2FZC B;  2KGT A;  3OYF A;  4C0G A;  4UC4 A;  1H3H A;  3HPW A;  3I5S A;  2RHX A;  2D6F A;  3OYH A;  2E3I A;  4JDS A;  4C8Q G;  1S1N A;  4OB0 B;  4KUI A;  2YUO A;  2PQW A;  1ZBJ A;  3GPL A;  2QQB A;  4MDW A;  1BI0 A;  1VQL T;  1OU9 A;  5GAN g;  3RES A;  5GAO m;  4C92 C;  2EWN A;  3EFS A;  3EGX B;  3CC4 A;  2DXU A;  2OTJ A;  3JB9 F;  2X3W D;  3M0S A;  3QDF A;  1D09 B;  4M75 B;  2XDD A;  5KYU A;  1UGV A;  1JJ2 P;  1VQ9 A;  2FZK B;  4KRT A;  1V76 A;  4M77 A;  1M30 A;  4BUG A;  2LC4 A;  2Y4X A;  1ACM B;  4C92 F;  3VS5 A;  3I56 T;  1W2B A;  1Q81 U;  4FW2 A;  1VQP Q;  3OYE A;  3UWN A;  1ZX6 A;  3N5B B;  4PNO A;  2ZPH B;  1OI1 A;  2AHJ B;  1UE9 A;  1QVF S;  3VYG A;  5IT9 E;  1QVP A;  4J6X A;  4A4K A;  2QQS A;  4E2F B;  2DL4 A;  3Q1J A;  3JAM E;  1MV0 B;  2QDL A;  4N4I A;  4XU2 A;  4J9E A;  2ZPB B;  1OPK A;  2V8K A;  4QVD A;  4FYY B;  2O2O A;  1AT1 B;  2MMP A;  2KXC A;  4CC4 B;  3JV3 A;  1UFF A;  3L2U A;  3CD6 T;  4M78 C;  2JMC A;  2H8H A;  1MMG A;  1KJW A;  3DB4 A;  4KBM B;  3CME Q;  4LDY A;  5FU7 C;  2CZ7 B;  2QA4 T;  2GCX A;  2RHI A;  2HBP A;  4XAX B;  4AFQ C;  3JCM X;  1GFD A;  4M78 F;  4F14 A;  1MNE A;  4C5E A;  3QUI A;  2FPF A;  2RN8 A;  5GJW B;  1JQQ A;  1OPL A;  4RKU E;  3PNW C;  2CRE A;  3PMT A;  3ULR B;  4BY6 B;  4N0A C;  2CUD A;  1BCO A;  3EG9 A;  3CCV A;  1VYV A;  3H6Z A;  4FIB A;  3CBP A;  1QWE A;  1VA7 A;  4E47 A;  2C0I A;  2DK3 A;  4RTY A;  1UJ0 A;  1N9S A;  4J9H A;  5GAN 3;  2BKD N;  1M8M A;  4OVA A;  1GCQ C;  3CCQ A;  1KD1 R;  3OYY A;  1YHQ A;  1IGU A;  2CH4 A;  1O75 A;  1M2O A;  2ROL A;  2DA9 A;  2M0O A;  2KYB A;  1VQ4 T;  4DOW A;  3OYM A;  4FT2 A;  3NTI A;  2DL7 A;  1JEG A;  2CP2 A;  3A1P A;  3E1S A;  1W1F A;  1KQ1 A;  1QVG S;  2KE9 A;  1PNJ A;  2J7I A;  4C5I A;  1BI2 A;  1YCY A;  1XQH A;  4HCB A; 
#chains in the Genus database with same CATH homology
 4QT7 A;  4CC7 A;  2DMO A;  3REB B;  2MIO A;  2J6K A;  1JU5 C;  1Y57 A;  2W10 A;  2HCK A;  5I22 A;  1OEB A;  2LMJ A;  2K6D A;  1W6X A;  2DVJ A;  1GFC A;  2SEM A;  4GLM A;  1WFW A;  1K1Z A;  2GTJ A;  2RQT A;  1SHG A;  1MUZ A;  1CSK A;  3VS1 A;  1WX6 A;  2OAW A;  2KYM A;  4J9C A;  1U06 A;  4ZNX A;  1EFN A;  2FPE A;  4E6R A;  3H0H A;  5HCK A;  1PWT A;  2FEI A;  1TG0 A;  1M3C A;  1ZUU A;  2VWF A;  1Z9Q A;  2FPD A;  2EBP A;  1B3Q A;  1G2B A;  1SRM A;  2J06 A;  2LQN A;  1GCP A;  2GGR A;  1RLP C;  2LJ3 A;  1AVZ C;  5IXF A;  2A28 A;  4ORZ A;  3H41 A;  3VS6 A;  1U5S A;  2YUN A;  1I07 A;  1X2K A;  4AG1 C;  4IIO A;  2EYX A;  2KRN A;  2EGC A;  2CSI A;  2HSP A;  1AWO A;  2LNH B;  3I9Q A;  1UJY A;  2D8J A;  2FRW A;  5IH2 A;  2K2M A;  3QWY A;  1ZUK A;  1HSQ A;  1UUE A;  2I0N A;  1M3B A;  1H92 A;  1WIE A;  2DRK A;  2PTK A;  3M0P A;  1V1C A;  2F2W A;  2GTO A;  2V1R A;  1SPK A;  2ED1 A;  2O9S A;  1UHC A;  2HEQ A;  4OMQ A;  2P4R A;  1AOJ A;  2KRM A;  3NHN A;  1AZE A;  2PZ1 A;  1IO6 A;  2AK5 A;  2ABL A;  2RQW A;  1Z9Z A;  4OMM A;  2KT1 A;  1T0J A;  2C0T A;  1AEY A;  3M0R A;  2CT3 A;  1K0X A;  3SEM A;  5IXB A;  2KRO A;  2YUQ A;  1UG1 A;  2JT4 A;  4RUG A;  4RTW A;  1SEM A;  4F17 A;  1RUW A;  4LUD A;  1BU1 A;  1HJD A;  1NLO C;  2AZS A;  2RQU A;  2O88 A;  4ESR A;  2KRS A;  2HBW A;  4OMN A;  1GL5 A;  4Y92 A;  1YCS B;  2L2P A;  2JS0 A;  2L3Q A;  4J9B A;  5I11 A;  3SHW A;  2MOX A;  4DEX A;  2M51 A;  2ED0 A;  3EG1 A;  2EKH A;  4F16 A;  1VYU A;  3THK A;  3I35 A;  4JJC A;  2AKK A;  2L0A A;  1TUD A;  2EGA A;  2L3P A;  1KFZ A;  2JM9 A;  3EHR A;  2EGE A;  2A37 A;  2KR3 A;  4HVU A;  2LJ0 A;  3TSW A;  1E6H A;  4IIM A;  1GBR A;  1J3T A;  1NYF A;  2GNC A;  4J9F A;  2LZ6 B;  2YSQ A;  2EVR A;  3VS2 A;  1T0H A;  1K4U S;  1X6B A;  1X6G A;  2DL8 A;  2XMF A;  1X27 A;  3U23 A;  2DM1 A;  1YN8 A;  2D0N A;  4J9I A;  2ECZ A;  1PKT A;  4WCI A;  2CSQ A;  2EPD A;  3VS4 A;  1AD5 A;  1QWF A;  4JPB W;  2G6F X;  2L3S A;  4RTU A;  2DNU A;  2K9G A;  2F2X A;  2RQV A;  1PKS A;  2DBK A;  1UHF A;  3IQL A;  3GBQ A;  4A63 B;  2CUB A;  3VS0 A;  1MV3 A;  4HCK A;  3EG0 A;  2O9V A;  2EYY A;  1ZUY A;  1I1J A;  1WI7 A;  2IIM A;  5IHK A;  2EQI A;  1ZSG A;  1T3S A;  3M0Q A;  2J05 A;  3EG3 A;  3M0U A;  2X3X D;  4CC3 A;  4GBQ A;  4DEY A;  4Z88 A;  2E5K A;  1QCF A;  2RNA A;  3CQT A;  2O31 A;  1WA7 A;  3PVL A;  2DX1 A;  1E6G A;  1RI9 A;  2M0Y A;  2DIL A;  2CT4 A;  2RQR A;  1HD3 A;  4OML A;  2MCN A;  3FJ5 A;  3VS3 A;  4LN2 A;  4D8D A;  4X1V A;  2LCS A;  4J9G A;  2FO0 A;  3H0F A;  3RNJ A;  2BTT A;  3VRY A;  1JO8 A;  2DJQ A;  2EYZ A;  2A36 A;  4HXJ A;  2F2V A;  2RPN A;  4HVV A;  2C0O A;  1BK2 A;  1PHT A;  2JMA A;  2FRY A;  1M3A A;  2LP5 A;  2GQI A;  5ECA A;  1M27 C;  3C0C A;  1NM7 A;  1G83 A;  2PNI A;  2J6O A;  2DL5 A;  2HDA A;  2JXB A;  3LH5 A;  1FMK A;  1ABO A;  1WXU A;  2KBT A;  4AFZ C;  3I5R A;  1B07 A;  1NEG A;  1X69 A;  2W0Z A;  4JZ4 A;  2K79 A;  2BZ8 A;  1I0C A;  1PRM C;  2JM8 A;  2DYB A;  2VVK A;  1N5Z A;  3TVT A;  2YT6 A;  1GCQ A;  4RTX A;  1GBQ A;  4JJB A;  2KGT A;  1ZLM A;  1VYT A;  3EHQ A;  1H3H A;  3I5S A;  2B86 A;  2DBM A;  4OMP A;  1PRL C;  3NPF A;  1YP5 A;  2VKN A;  2OI3 A;  1S1N A;  2A08 A;  4FSS A;  2KT8 A;  1A0N B;  2J6F A;  2KXD A;  2YUO A;  1X43 A;  4CC2 A;  1QLY A;  1ZBJ A;  4AFS C;  1NLP C;  2CDT A;  2RF0 A;  1XOV A;  4RTV A;  1OOT A;  1JXO A;  3TSZ A;  3VRZ A;  1YWP A;  2X3W D;  3M0S A;  1WLP B;  1K9A A;  4JZ3 A;  4R0K A;  1X2Q A;  2DLP A;  1NG2 A;  1K76 A;  1UGV A;  1U3O A;  4Z89 A;  1WXB A;  1CKA A;  2YDL A;  4KRT A;  1M30 A;  3RBB B;  2AZV A;  3UA6 A;  3R6N A;  3REA B;  3KFV A;  1WYX A;  3VS5 A;  1UTI A;  2NWM A;  4Z8A A;  3PE0 A;  2K3B A;  1ZX6 A;  1UEC A;  1QKW A;  1FYN A;  1UE9 A;  2NUZ A;  1AWJ A;  2JS2 A;  1K0S A;  2D8H A;  4AFU C;  1AZG B;  2K7A A;  2YUP A;  5EC7 A;  2KNB B;  1TUC A;  2DL4 A;  3H0I A;  1NYG A;  1MV0 B;  2QDL A;  2LJ1 A;  3O5Z A;  5IHN A;  4J9E A;  1OPK A;  2DF6 A;  1YNZ A;  5FWC A;  2O2O A;  1T3L A;  2KXC A;  3UAT A;  3UF4 A;  4CC4 B;  3JV3 A;  1UFF A;  1SRL A;  1W70 A;  2JTE A;  2H8H A;  2JMC A;  3UA7 A;  5L23 A;  1KJW A;  4HVW A;  5FWB A;  2BZX A;  2BZY A;  2DL3 A;  4OMO A;  1KIK A;  1E7O A;  4AG2 C;  1H8K A;  1BBZ A;  4JJD A;  1SHF A;  4RTZ A;  1ARK A;  4AFQ C;  1ABQ A;  2V1Q A;  1UDL A;  1GFD A;  4F14 A;  1RLQ C;  4D8K A;  2LX7 A;  2GBQ A;  1OV3 A;  1BB9 A;  1Y0M A;  2FPF A;  2RN8 A;  5GJW B;  1JQQ A;  1NEB A;  2EYW A;  1OPL A;  3M0T A;  2CRE A;  2FG0 A;  4EIK A;  2D1X A;  3ULR B;  3A98 A;  2ROT A;  2CUD A;  1GRI A;  4M4Z A;  1VYV A;  2ENM A;  3QWX X;  1QWE A;  2AKL A;  1VA7 A;  2LQW A;  4K11 A;  4LE9 A;  5IHI A;  3VS7 A;  2C0I A;  2DE0 X;  3EGU A;  4RTY A;  1UJ0 A;  4J9H A;  1WXT A;  5FW9 A;  4LNP A;  2CH4 W;  1M8M A;  1LCK A;  1YWO A;  2RMO A;  4RTT A;  3ZL7 C;  1GCQ C;  1AWX A;  2SRC A;  1KSW A;  3NGP A;  2EW3 A;  2CH4 A;  2DRM A;  2ROL A;  2DA9 A;  2KYB A;  4LUE A;  1CKB A;  2KEA A;  3EG2 A;  3NMZ C;  1SSH A;  2DL7 A;  3PVQ A;  4J9D A;  2JW4 A;  1JEG A;  5GJV B;  1W1F A;  2OJ2 A;  1JXM A;  1WDX A;  2KE9 A;  1PNJ A;  1QKX A;  1AWW A;  2J7I A;  2ESW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...