4CC3A

Complex of human tuba c-terminal sh3 domain and mena proline-rich peptide - h3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords DYNAMIN-BINDING PROTEIN
total genus 11
structure length 61
sequence length 61
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc3A00
3EG3A 1GFCA 4OMPA 1YNZA 1X6GA 1WA7A 2J06A 2EBPA 3THKA 3TSWA 2LJ0A 2JMCA 3M0PA 3VS0A 2LP5A 2HCKA 5IXBA 2EKHA 2EQIA 2DBMA 5GJWB 1UGVA 3EG2A 3M0QA 1BBZA 1I07A 2IIMA 2LJ3A 1GL5A 4J9DA 2CH4A 1YCSB 2D8HA 1NEBA 4F16A 2HBWA 1S1NA 2JS0A 4KRTA 3R6NA 2GQIA 1E6GA 1J3TA 2A36A 3ZL7C 4D8KA 1UE9A 1T0JA 2F2WA 2EGAA 3UATA 1B07A 1KJWA 2ENMA 1U5SA 2O88A 2KRMA 2GNCA 5IHKA 4RTZA 1E7OA 1YWOA 2I0NA 2LNHB 2KNBB 4LUEA 1YWPA 1ZUYA 1WXUA 4HVUA 1RUWA 1GCQC 1NYGA 1UDLA 1RLQC 2DILA 1M27C 2ROTA 2L2PA 1UG1A 2X3WD 2LCSA 1WFWA 1WX6A 1AWOA 2CSIA 2JT4A 1H8KA 2M0YA 1UUEA 1WLPB 1YN8A 3PVLA 1ZUUA 3UF4A 2HEQA 1GFDA 3NPFA 1V1CA 1T0HA 4RUGA 1CSKA 2KEAA 1SSHA 1JU5C 2EYZA 2F2XA 4RTYA 1T3LA 4GBQA 4HXJA 4DEXA 4JJCA 4A63B 1OEBA 4Z89A 3TVTA 2L0AA 1Y0MA 1K9AA 2CH4W 2J6KA 2LZ6B 3ULRB 1SRMA 1TG0A 1I0CA 5I22A 1GCQA 3H0IA 2L3SA 3A98A 4FSSA 2FPFA 2D8JA 4J9HA 2W10A 1A0NB 2E5KA 2GBQA 1PWTA 3NHNA 4JJDA 1GRIA 2YUPA 1PRMC 1NG2A 4EIKA 4LE9A 3M0RA 3UA7A 1OPKA 1AD5A 2B86A 1W1FA 1ZSGA 2D1XA 1W6XA 1SHGA 4OMQA 2LQNA 3TSZA 2J6OA 2K79A 4CC3A 1NLOC 1M3CA 1QCFA 2YUNA 2GTOA 1KSWA 4LN2A 4LNPA 2A28A 4J9FA 2YSQA 1X2QA 3I5RA 4RTWA 5IHIA 2K3BA 2W0ZA 2DJQA 4RTXA 2FEIA 1AOJA 5GJVB 4AG1C 2H8HA 1NLPC 4J9IA 2KR3A 3IQLA 4ORZA 1UHFA 5FW9A 1TUCA 1ABQA 4AFQC 2O9SA 4HVVA 4AFUC 2D0NA 3QWYA 4K11A 1KFZA 1IO6A 3QWXX 2P4RA 1M8MA 1OPLA 5IXFA 2EYXA 1G2BA 2ROLA 4Z8AA 1WYXA 3I9QA 5HCKA 2KXDA 2CUDA 1UHCA 3REAB 4E6RA 2AK5A 5FWCA 1M3BA 2JXBA 2EPDA 1FMKA 2FRYA 1W70A 2J05A 4JZ3A 4J9CA 1EFNA 3PVQA 3RBBB 3VS5A 2DL4A 2KXCA 1JEGA 1UFFA 2V1RA 2SEMA 2YUOA 2LQWA 2EW3A 2RPNA 2O31A 3PE0A 2RNAA 2AZVA 4HVWA 2VVKA 1RI9A 1PKSA 1AZEA 1UJYA 1UTIA 1H3HA 1JXMA 4RTUA 2KRSA 2J6FA 1VYTA 3LH5A 1M3AA 5IH2A 3M0SA 1H92A 2AKKA 2J7IA 4DEYA 2K9GA 3SEMA 2CT4A 4AFSC 2FO0A 2C0OA 1GCPA 4OMNA 1QWEA 2DL5A 2KGTA 1SHFA 3I35A 2RQVA 2EGCA 2BTTA 2O9VA 2DMOA 2JM8A 1ZBJA 2RQTA 2PNIA 1OV3A 1AWJA 1K4US 2RMOA 2C0TA 3EGUA 5EC7A 1X43A 2DYBA 4GLMA 2EVRA 2DNUA 1QKWA 2DA9A 2DL3A 2VWFA 2JM9A 1AEYA 2MIOA 1OOTA 3RNJA 3VS1A 4LUDA 3M0UA 1G83A 1PNJA 2DRKA 4X1VA 1YP5A 2KT1A 2KRNA 3EG0A 2YT6A 3CQTA 2DF6A 2YUQA 1MV3A 2O2OA 1BK2A 2DLPA 2DL7A 2L3PA 1RLPC 4JPBW 4AFZC 2NUZA 4HCKA 3C0CA 4M4ZA 4RTTA 2JS2A 1HSQA 1U06A 2JMAA 5L23A 2PZ1A 1SEMA 1HD3A 1GBQA 1N5ZA 1PRLC 1KIKA 1X27A 4ZNXA 2PTKA 1BB9A 2LX7A 4IIOA 1JO8A 2K2MA 1K0XA 2KYMA 1Z9QA 3VS2A 1E6HA 2SRCA 2KE9A 2V1QA 4D8DA 2BZ8A 1CKAA 2DE0X 2YDLA 2DL8A 2VKNA 2XMFA 3U23A 2ED1A 4IIMA 3KFVA 2L3QA 2F2VA 4CC7A 2EYYA 1K1ZA 1ABOA 1T3SA 2HDAA 1WI7A 2EGEA 1K76A 2FPDA 4F14A 1UECA 4CC2A 1WXBA 3VS3A 4R0KA 2CREA 2DRMA 2DX1A 3VS6A 4QT7A 2OJ2A 4WCIA 1ZLMA 2OI3A 2X3XD 2GGRA 3I5SA 2FG0A 1SRLA 2AKLA 3NGPA 1TUDA 2G6FX 3EHRA 4Z88A 4Y92A 3M0TA 1PHTA 1AZGB 2NWMA 4ESRA 2JW4A 1AWXA 1U3OA 4CC4B 1UJ0A 2CDTA 1VYUA 2FPEA 1ARKA 2RQUA 1QLYA 3VS7A 4JJBA 1NEGA 2DBKA 3O5ZA 1GBRA 2EYWA 3REBB 1XOVA 4RTVA 1X69A 4AG2C 1I1JA 2MCNA 1PKTA 2RF0A 1WXTA 1NM7A 2QDLA 3VRYA 4JZ4A 4F17A 2DVJA 2RN8A 4J9BA 2ECZA 2KYBA 1FYNA 1BU1A 3EG1A 1MV0B 2LJ1A 1AVZC 2RQRA 2MOXA 2K6DA 1K0SA 1QKXA 2OAWA 3EHQA 2K7AA 2KROA 5IHNA 1ZX6A 4J9GA 1WIEA 3H41A 2AZSA 5I11A 2JTEA 2ED0A 5ECAA 4OMOA 1WDXA 2M51A 2GTJA 1HJDA 2DM1A 5FWBA 4OMMA 2CUBA 1B3QA 1X6BA 4OMLA 1LCKA 3SHWA 3VS4A 1Y57A 1QWFA 1ZUKA 1JXOA 3UA6A 2LMJA 3NMZC 2RQWA 2FRWA 1Z9ZA 1X2KA 1M30A 3GBQA 3FJ5A 1JQQA 2KT8A 1NYFA 2BZYA 3VRZA 2C0IA 3H0FA 2BZXA 1VA7A 4J9EA 2HSPA 2A37A 1VYVA 1MUZA 1SPKA 3H0HA 2ESWA 2KBTA 1AWWA 2A08A 1CKBA 2CSQA 2ABLA 2CT3A 3JV3A
chains in the Genus database with same CATH superfamily
1GFCA 2QQRA 3PTAA 4HKEA 4OMPA 1YNZA 3RIRA 2J06A 4PJOB 3G1JA 2K3YA 2LJ0A 3VS0A 3V7SA 2RI3A 4BACA 2EKHA 2DBMA 2AT1B 3EG2A 3CBOA 3RKYA 1VQNT 1GL5A 4J9DA 2CH4A 4PJLA 2CYZB 2HBWA 1S1NA 2JS0A 2CP0A 2MYSA 1YI2A 1P92A 1E6GA 4M7AE 1IRXA 4KUDK 1T0JA 1VQ4T 4PJOE 1B07A 1U5SA 2WSCE 2KRMA 4RTZA 4M7DF 2FZGB 1YJNA 2MAMA 3HFNA 1VQ5T 4C5EA 4MZTA 1K8AU 5CIUA 4DOVA 5GMKl 2RI2A 2M1HA 1VQ9T 3HRUA 1UG1A 2LCSA 1YJ9A 2CSIA 2JT4A 1OZ2A 1GXIE 2EFIA 4OMFB 1D0ZA 3BW1A 4ANJA 3PVLA 1TXQA 2P4TA 3CCSQ 2CZ7B 1VQ4Q 4NOYA 1FWZA 1T0HA 2DD5A 4IUTA 4RUGA 1D09B 4C5HA 1SSHA 1MMNA 4FYYB 3OBYA 4MMLA 2X51A 1OEBA 2A0FB 2RA2A 4Z89A 2E70A 4ZN3A 1X01A 1K9AA 1MNDA 3MHXA 2K5LA 5GAMj 2YRCA 1SRMA 1TG0A 2P0PA 3PMIA 4LDYA 5I22A 2KSSA 3H0IA 3OS2A 4KGZB 1WHLA 2D8JA 2H3EB 2W10A 5KCOA 3EFSA 1H641 3L2VA 4LE9A 1AD5A 2DVEA 3M57A 2B86A 5CCAA 4C8QF 2X4YA 2XDDA 4LDXA 3M56A 4J9FA 2YSQA 3HTRA 3NTKA 2EQJA 2QEXQ 1K8AC 3GP8A 5IHIA 1W4SA 4M75E 3QYGB 2HMAA 2FEIA 1AOJA 3QDRB 5GJVB 3RMQA 2BUDA 4J9IA 2JTMA 4II1A 1UHFA 3CD6T 1ABQA 4HVVA 3QHSA 2K57A 3QWYA 4K11A 2KI7A 3H6ZA 3QWXX 2RJCA 4BDZA 4J6YA 5KYXA 1G2BA 4PLLA 4Z8AA 2ZPHB 5HCKA 1C0MA 2O4XB 3L42A 4X9CA 5KYXB 2CUDA 3JCMf 1VQOQ 4E6RA 2FL7A 1OULA 1M1GA 1UGQB 2JXBA 1WHHA 2FRYA 1W70A 2JNGA 4J9CA 5KYYA 2DKGA 2F1LA 3E2UA 2LVMA 4HT8A 3E19A 2LQWA 2DEQA 1M1KR 4M78E 1VQLA 3LW5E 1RL2A 2EJ9A 2KQWA 1UJYA 3LGLA 2RK1A 4M77C 2CS7A 2AKKA 2J7IA 2P84A 1OYXA 1Q86U 4J6WA 2V8IA 3OS5A 1NPPA 3MPUB 5KH6A 1GCPA 1QWEA 1VQ6A 1M1KU 3OYFA 1VQ4A 2BTTA 2O9VA 4MZPA 2DMOA 5GAOm 1OV3A 4QKUA 2RMOA 2C0TA 2DYBA 5LJ5j 2EVRA 2DNUA 1TWBA 3CCQQ 4JS4A 3FLGA 4QW2A 4R55A 3OW2P 3EGDA 2VWFA 5KYYB 1OOTA 5CO7A 1WHGA 4LUDA 3C95A 2LQKA 4KH0B 4RMOA 1G83A 2OTLQ 1BYMA 1RABB 2DRKA 4X1VA 2CP2A 2KT1A 2KRNA 5FLXE 3LGFA 2HKQB 2O2OA 5GAOr 1C6VX 4ELYC 2DLPA 3CCEQ 2O01E 4QQDA 4EMKC 1KC8R 4HCKA 2DZCA 3V7CA 5GAMg 5FRMA 4C92A 1HSQA 5L8RE 4ZN1A 3JCMg 4IUQA 2ZPEB 2JMAA 4L6V5 1HD3A 1KIKA 3CMAQ 2LX7A 4C8QA 2K2MA 3FDRA 3MEWA 1M5Q1 3E1SA 5D6WA 3META 1TOVA 3EGXA 5HK3A 1Y07A 1PD0A 4MZMA 2BZ8A 1CKAA 2VKNA 2BIVA 3RUXA 2WSFE 3VJPA 2GFAA 3QXEB 2L3QA 3CCLT 2F2VA 4CC7A 1K9MC 3CCJQ 4FYXB 3OMGA 2HDAA 1ABOA 4OGCA 4ZTJA 1WI7A 2EGEA 4F14A 4CC2A 4C0DB 3CC2T 1ZQ1A 2HZYA 4R0KA 2CREA 3OBWA 1OQKA 3OYIA 1EX4A 2DD4A 4EMHA 2CP3A 4OP0A 4PFPA 1OI1A 3DB3A 4JJNK 3OYYA 2FG0A 1SRLA 2LC4A 2G3RA 2KDSA 3TQ7P 3DKMA 3NGPA 2QTVA 4Z88A 3EHRA 4Y92A 1RAGB 3M0TA 1AZGB 1YHQA 4N0AA 5CK9A 1UJ0A 3L2QA 1QVPA 2CDTA 1YI2Q 3CCUT 2RQUA 3VS7A 2LQ8A 4JJBA 1NEGA 2VV5A 4MMKA 3HHTB 1SF9A 2E10A 6AT1B 1XOVA 4RTVA 1X69A 4FT2A 3GNFB 1PKTA 3L2RA 1G8XA 2MF2A 4F17A 4BDYA 1FXXA 3OMCA 1FYNA 1BU1A 5LJ5f 3OSSC 1KK7A 4YTLA 2LJ1A 2X4XA 2HQHA 2MOXA 1SSFA 3BY7A 1S72Q 2CP6A 4KULA 1QQJA 3DB4A 4J9GA 5IHNA 1D3BA 1MMDA 4RCCA 5ECAA 3I55A 4OMOA 3CC2A 5D6YA 1QP2A 3EFOB 3CMEQ 3ASKA 1RAFB 4OMLA 4OGEA 4XU1A 3VS4A 4A53A 2PVDB 3WXMB 1QWFA 1ZUKA 1B34A 3UA6A 4A4GA 2LMJA 3L2ZA 1Z9ZA 5AYFA 3C94A 1X2KA 3UT1A 4DBQA 1NZ9A 4EMGA 3GBQA 1JQQA 1B7TA 3KXTA 3OQ5A 2MK5A 1VA7A 2HSPA 3KBGA 5GANd 2OTJT 4XTZA 2ESWA 2KBTA 2LT4A 1CKBA 3I5SA 2HD0A 4XK8E 3EG3A 4OF1A 5GAMh 1X6GA 1TS9A 2EJFA 1VQ9Q 2EBPA 3N5BB 1RACB 1QVFP 3OYKA 2EQIA 2X4JA 4M75F 3VYGA 1I07A 2IIMA 2HKNA 1BI1A 1YCSB 1NEBA 4F16A 4F7UE 4E7HA 1NJIC 3R6NA 3BE3A 1BKBA 4C8QG 5LJ5e 1J3TA 3WVDB 4D8KA 3INZA 1MGQA 4JRPA 2DERA 4XTVA 2E5QA 1KJWA 2ENMA 3EFRA 2GNCA 5IHKA 3X26B 2I0NA 2E3HA 2KNBB 1YWPA 1ZUYA 4L59A 1RUWA 3H8ZA 1YJNQ 1GCQC 2BKDN 2RM4A 2L89A 1Q7YR 3ZBDA 3GIBA 2ROTA 5IAYA 1YJ9Q 1NJIU 2L2PA 2V8KA 2ZPIB 1K73U 1YN8A 2A3LA 4JLIA 3NPFA 2DXBA 4A54A 1VQ5Q 1Q7YU 1K73R 4QQGA 2VB6A 3ER0A 3CCRA 2DYIA 4DOWA 1O9SA 5KYUA 2CZ6B 4J7FA 1NE8A 2CH4W 2J6KA 4FL6A 5LL6S 3G71T 4ZTFA 5HK0A 2RD1A 2R5MA 1V29B 3V8KA 1GCQA 1G5VA 2E6NA 1D3BB 2ZPBB 3CC4A 4FSSA 3CMAT 2JOYA 4J9HA 4DBRA 2JZ2A 2DXCA 3CCMQ 3M59A 3PNWC 3JCMh 1PWTA 4JJDA 5AT1B 1K9MU 2YUPA 1NG2A 5A0DA 1UEBA 5FU6B 3RDVA 3CCST 4Q5WA 2AIRB 5LJ5h 2D1XA 3JCMV 1W6XA 4OMQA 2Y90A 2LQNA 3PMTA 1KC8U 4CC3A 1PM3A 3UDCA 1NLOC 1M3CA 2RJFA 2YUNA 2GTOA 2H3JA 4MDWA 3CMET 3CC2Q 1EZZB 1X2QA 1Q86C 3FIFA 4HCZA 3I5RA 1RAIB 2DJQA 1VQOT 3JSCA 3FJPA 3X25B 2R58A 3CCMT 1G3SA 2VGNA 2VGMA 3C12A 1TUCA 5FW9A 1M1FA 3G4ST 3CXCS 4FYVB 2D0NA 1WJSA 1IO6A 3VU3C 2LT1A 2P4RA 3EH2A 3UWNA 5IXFA 1O75A 8AT1B 4C8QB 3I9QA 1YJ9T 3RESA 2E4HA 1UHCA 4LD6A 2AK5A 5GAN6 1R77A 3GOXA 1FMKA 3CMAA 4KBMB 3I56T 2MWOA 1KQSS 2X35A 1Q86R 1BI3A 1JEGA 3JB9I 4XTUA 5FU7B 2YUOA 2O31A 3PE0A 2AZVA 5CKDA 1UB4A 2LDMA 1AZEA 1UTIA 3PT9A 4RTUA 1IGQA 2KRSA 1U1SA 4L5GA 2BE9B 3M0SA 4M7AD 4DEYA 3SFMA 2K9GA 5CAIA 3SEMA 4BI3A 4OMNA 4QVCA 1VQOA 2DL5A 3CXCA 5J39A 1SHFA 5C6SA 1WGSA 2RQVA 3CCMA 2COYA 2JM8A 2RK2A 3MEUA 4ZGEB 3FRNA 1HXDA 1VIEA 2EIFA 3D7SB 1BI2A 2KVQG 2FZCB 4M7DD 1YBYA 3NTHA 5GMKh 2DL3A 1AEYA 1M4ZA 1YP5A 5DY9A 4XU3A 1KQSA 1SKUB 3CQTA 2DF6A 3BDLA 2GF7A 1BK2A 4M77E 3PFSA 4AMCA 2L3PA 1EIFA 3EH1A 2D9TA 3CEYA 3CPWP 5GAOl 3RKXA 4KH1B 4GLKA 2IVWA 4RTTA 2JS2A 1U06A 4C0DC 1YIJQ 3S6WA 3LWHA 5L23A 2PZ1A 1N5ZA 3G71A 1QMCA 1X27A 4J8OA 3AHUA 4M75A 2EQUA 1Q81C 1JO8A 1ZHIA 2E64A 1K0XA 4M78F 2KYMA 1E6HA 1X75C 3A8LB 4ELZC 4D8DA 3VUZA 4JRQA 3EG9B 4PJNA 2HQEA 3X28B 2RI5A 1VQKQ 3J7AF 5GANe 4IUVA 3JCMQ 5GAOq 1N27A 1OU9A 2YRDA 8ATCB 3M53A 1K1ZA 3CBPA 1WPYA 2FPDA 1QW1A 2F69A 1KHCA 3JAME 2NUTB 4FW1A 1XNIA 2NLUA 3VS3A 2E12A 2OJ2A 4WCIA 3QIIA 2NUPB 4WTOB 4XTXA 4B9XA 1VQ6T 2X3XD 3QSUA 5GAN2 3OYAA 5FRNA 2AKLA 2VC8A 1S72A 4Y91A 1TUDA 2G6FX 1Y96B 3G71Q 2X9HA 2JW4A 1VYUA 2FPEA 1ARKA 1QLYA 2DBKA 2VASA 5KCHA 5GAMe 2EYWA 3A1PA 3OS0A 1QVGS 2QA4T 3CCVT 4AG2C 1RADB 1XJWB 5CQYA 3HRSA 3QO3A 1NM7A 1KG1A 2XI9A 2DVJA 2QQAA 1D0YA 1VQ8T 4BE0A 4OVAA 4PJMA 2E65A 2AHJB 4KT0E 1QKXA 1XTDA 4J7IA 2COZA 2KROA 5LJ3j 1Q82R 4LD9K 1ZX6A 1WIEA 2AZSA 5FU7C 5I11A 4E7ZA 3J80E 1WDXA 4BB7A 5FWBA 3LWIA 2DTHA 1LOJA 2CUBA 3JB9F 3ZFJA 2Z0WA 5GMKm 1YI2T 3QDFA 1Y57A 5CKHA 2ZAEA 1IZ6A 3EGXB 2JJ9A 1VQ7A 3NMZC 2RQWA 3DLLA 4DA4A 1TTHB 3CC7Q 2DPPB 4E7LA 2KT8A 1NYFA 3GNGA 4E2FB 9ATCB 2P0QA 3H0FA 1SG5A 1WHMA 1BI0A 1KC8C 3RERA 4J6XA 2XK0A 2QK0A 2R5AA 3URGA 2CT3A 3JV3A 3VS5A 1WQ7A 2M0OA 3VKIA 1WA7A 3HFOA 2JMCA 3M0PA 2LP5A 2HCKA 5IXBA 5KYWA 5I2MA 1RAHB 3M0QA 2LJ3A 1PSFA 1OX8A 2D8HA 3M54A 1VQMT 1W2BA 1R0CB 1KHIA 4JDSA 3CCUQ 3QZ5B 2GQIA 2A36A 4J5YA 3ZL7C 3QJ6A 1UE9A 2F2WA 4EMKA 1I8FA 1IHVA 2QAZA 2EGAA 2QTXA 3UATA 2EJGA 2JTFA 1E7OA 5D6XA 1IB8A 3HSBA 4LUEA 2VYTA 4M75B 1WXUA 4HVUA 3BFMA 3MCAB 1JBMA 1NYGA 1UDLA 1RLQC 4OB2B 5HY6A 4FT4A 1TH7A 3M4YA 1WX6A 1AWOA 3MEVA 2I2LA 1PD1A 2GQVA 3A8GB 2M0YA 1UUEA 2CP5A 1VQ6Q 1ZUUA 2EWNA 3OYBA 4XU2A 3CC4T 3OYEA 3EAEA 4M77G 4A4EA 4DBHA 3MEAA 2KEAA 1VQPT 2FHDA 5GAMf 2K5FA 2EYZA 5LJ3g 1T3LA 4GBQA 4JJCA 5LJ3h 4A63B 1UGRB 4M78G 3TVTA 2L0AA 3CCUA 4M7DC 2XG8D 3E9GA 2CZ0B 7AT1B 2OTJQ 3JCMP 3TREA 2L3SA 3A98A 3QBYA 4DBFA 2NYSA 2YRVA 2JVVA 2FPFA 3SDZA 2LRQA 4HT9A 1R0BG 2GBQA 2XHCA 5GAN3 3NHNA 1VQ8Q 2QGGA 4EIKA 3DLMA 3M0RA 2QYZA 4N0AC 5LJ5g 1FX7A 3CCQT 3FEOA 1W1FA 1ZSGA 3F70A 4RG8A 4BE1A 1SHGA 1RAAB 2J6OA 5A2QE 1KSWA 2PQWA 2OTLT 1M90U 3I56Q 1IREB 3OS1A 4HCCA 4F7UA 4A4KA 2W0ZA 3MP1A 5D7UA 1NBEB 1OZ3A 4A4FA 4AG1C 2CP7A 1JRIA 2KR3A 3IQLA 4NS5A 2YHTA 4QQ6A 4TVRA 2FYKA 3FB9A 4AFQC 3CCEA 2O9SA 2E3IA 5A0LA 1MMAA 3CD6A 1KFZA 2XDPA 3MP6A 1JJ2S 4V2SA 1OPLA 4M77F 2EYXA 4HA8A 1D0XA 2EYQA 2HBPA 2YWWA 4PFOA 3PIOA 2EQKA 4M7DE 2KXDA 4D6WA 5LJ3d 2E41A 3REAB 4KUIA 5FWCA 2EPDA 1V76A 1HYOA 1EFNA 3PVQA 2M9UA 5GAOp 1QCOA 2QQ9A 2DL4A 3QJYA 1W2BS 2V1RA 1AHJB 2RNAA 2OAUA 3R6OA 4HVWA 2VVKA 1RI9A 1H3HA 1Q7YC 1JXMA 2J6FA 4PJOC 3LH5A 5IH2A 1TU0B 1VOMA 4M7AC 1ZBXA 2CT4A 3X20B 2IPOB 4BD3A 3I35A 2DFUA 1RAEB 1ZBJA 4N4IA 5J26A 5CR2A 3CBMA 1AWJA 1K4US 3CCET 2DO3A 2GFUA 2XD0A 4O6JA 2HL3A 1YIJA 3VV0A 5KYWB 1QKWA 4EPCA 5GMKj 4PFZA 2JM9A 4ZGDB 4F7UF 1VQPQ 2VXFA 2KY9A 3M0UA 3G6EA 1QVFA 1KD1C 1VQLT 2LX9A 4C8QC 4LDUA 4FM4B 3EG0A 1YITQ 2YT6A 4C92D 3ME9A 3OA6A 3LLRA 2YUQA 1MV3A 1PCXA 1TUGB 1ZSZC 3G4SA 4IKFA 2DIQA 4X9DA 4B9WA 4OB3B 3M58A 4AFZC 4ATOA 2NUZA 3T9NA 3L2WA 3C0CA 4M4ZA 4J83A 1N9SA 3S3NA 5GAN4 1ZSZB 5GAN8 3CCSA 4XTWA 2F5KA 2PTKA 4M78D 2BE7D 1PG5B 2EQMA 1LVKA 3SB2A 1Z9QA 3VS2A 3JCMc 2KE9A 2V1QA 1QVFS 1YHQT 2FB7A 2DL8A 2L3RA 3V8LA 1ZA1B 3KFVA 1YIJT 2QDYB 1YJNT 1T3SA 3QZ9B 4QVDA 3MO8A 1K76A 3SD4A 3A8OB 3O8VA 4VUBA 4RCBA 1HK9A 2DX1A 4OB1B 1WHKA 1ZLMA 1Q95G 3G6ET 4E47A 1BCOA 5IT9E 4FSXA 4HCBA 1G3YA 2GGRA 2QA4A 2R57A 4PJOF 1KQ2A 3I55T 4KGVB 3OW2S 4M7AF 4F7UG 1MHNA 3I56A 2NWMA 1VQKA 3OB9A 2K4YA 4M78C 3QG1A 1N6AA 2QEXA 4CC4B 3Q1JA 3AT1B 1KQSP 3ZEHA 2D0QB 4PNOA 3OYCA 5GANg 3CCLA 1GBRA 4A4HA 5GANh 2QXFA 1M90C 1I1JA 2MCNA 2HNIA 3RR6A 2ATCB 2RF0A 3CC7A 1WXTA 4Z02A 2QDLA 4M77B 4O5VA 1Q82U 1VQ9A 2ECZA 2XDBA 3EG1A 2PU9B 2ZPFB 1VQ7T 2ZZDA 3V8JA 2RQRA 5C0MA 4FYWB 2PVGB 4LDWA 1K0SA 2DJZA 4C92G 2FZKB 4F04B 3L2UA 2JTEA 2RHIA 3SWNC 1HJDA 1AT1B 1LCKA 3SHWA 1FMWA 4E7SA 5GAMd 2LCLA 3CPFA 5GANj 3OW2A 2RH2A 4M7DG 1JXOA 1M2OA 1F1BB 3RMSA 3CCVQ 1XQHA 1M30A 2CZ1B 3OYLA 2RHZA 2YXYA 3VRZA 3P8HA 1VQMA 2BZXA 1BCMA 4Y28E 2OTJA 2D6FA 1QP3A 4J9EA 2A37A 1VYVA 4RG2A 1SPKA 3L1AA 3EGDB 1YFNA 3H0HA 3FC3A 2A08A 5EG2A 2ED1A 1N8RR 5GAN5 1I81A 2COWA 3P8BB 5I21A 4M7AG 2DIGA 1QVGP 1B34B 2RO0A 4BY6C 5CKBA 4PJOG 3THKA 3TSWA 3A8HB 4DQ2A 4PJOD 2C06A 5GJWB 1UGVA 1JJ2P 4IUUA 5J3BA 3CC7T 1BBZA 5DM7R 4JRIA 4WF2A 1K9MR 1QCNA 1WJRA 2YLBA 1NPRA 4F7UB 1Y7XA 2QI2A 4LXCA 2PUOB 1M2VA 4KRTA 3S3OA 1PSEA 1YHQQ 1M1KC 2RHXA 4M75D 2O88A 1YWOA 2XU8A 2LNHB 3UPUA 3C4SA 4EMKB 2QGFB 5LJ3e 2K2VA 1UGPB 1ZA2B 1VQKT 2HAXA 1KD1U 2DILA 1M27C 2HQXA 4JS5A 1D1CA 2X3WD 1WFWA 2MMPA 1H8KA 4C92F 1WLPB 1QVGA 3UF4A 2HEQA 3JCMX 1I5OB 1GFDA 1V1CA 2DZ9A 4EDUA 1CSKA 1YITT 5KE3A 1VUBA 2DAQA 5I2SA 1JU5C 2F2XA 1KD1R 4RTYA 2KK4A 4HXJA 4DEXA 3MJXA 1K73C 3MP8A 1I4K1 1W2BP 3LX7A 1Y0MA 3E9FA 4XAXB 2LZ6B 3ULRB 4FCYA 1BIAA 1I0CA 2A7YA 2NUTA 3EG9A 4JUVA 2ZGWA 4C92C 1WZOA 1A0NB 3JCMW 4X34A 1DJ7B 2E5KA 2HL5C 1LJOA 2XIDA 1GRIA 2P0KA 1PRMC 4P5NA 4FW2A 2GCXA 3HRTA 3UA7A 1OPKA 4NL3A 2CKKA 4C5IA 4PJOA 2LCCA 2L5QA 3TSZA 5IN1A 2K79A 4LNPA 1QCFA 4LN2A 4E7KA 2FVUA 3NTIA 2A28A 1MMGA 3J81E 4ME7A 3CCRT 3CMEA 3EFOA 2E1HA 4RTWA 2K3BA 4C8QE 3OYNA 1I5LA 1WHJA 4RTXA 3G6EQ 5KYNA 5GAOn 2PVOB 2H8HA 4E7JA 1NLPC 4ORZA 5GAN7 4C92E 2DXUA 3OYDA 4AFUC 5LJ5d 3OYJA 1OX9A 4BY6B 3QUIA 2KAFA 1M8MA 1VIFA 3JB9D 2LNVA 1ACMB 3GF5A 2ROLA 2Y4YA 4C0FA 4N4GA 1IGUA 1WYXA 3PIPA 4MDXA 2YLCA 1M3BA 4OB0B 2J05A 4N4HA 4JZ3A 2DXTA 3RBBB 2ZCFB 5GMKi 2QQSA 2KXCA 5HKCA 1UFFA 1K8AR 2SEMA 2K3XA 3H9NA 2EW3A 2RPNA 1D1BA 1VQ7Q 1VQNQ 1PKSA 5LJ3f 4PJJA 1VQMQ 1WQWA 2QASA 3RKWA 3CPWA 1Y71A 1VYTA 1YITA 5CQXA 1C1AA 5FROA 1M3AA 1H92A 3JCMd 3NFCA 3MKDA 2V8JA 4AFSC 2FO0A 2C0OA 2DETA 2KGTA 2EGCA 3A8MB 1JB0E 2RQTA 3P8DA 2PNIA 1YJWQ 3OY9A 3TU4K 3EGUA 5EC7A 3M5AA 4BI8B 1X43A 1X6OA 2DK3A 4M78A 4FIBA 1WNLA 4GLMA 3CCQA 3TEEA 4KGXB 1NJIR 4AT1B 2DA9A 2PUKB 3JCMJ 1VQPA 2DEUA 1BIBA 2VUBA 1D1AA 1Q81R 3JB9H 2OX7A 2L8DA 2MI6A 2MIOA 3LYIA 3RNJA 3KUFA 2OTLA 3VS1A 4RKUE 4LDVA 4C5GA 2EAYA 2LTOA 3X24B 1PNJA 2RJDA 3CCRQ 2B8AA 3HPWA 3CC4Q 3A5ZB 3JCMe 4M7DA 4IUPA 2DTIA 3CCLQ 3JRZA 1FMVA 4C92B 1YJWT 5CKFA 2M16A 5M9OA 1N8RC 2EKOA 2M02A 3GPLA 2DL7A 1RLPC 3TCJA 1LPLA 2NUPA 3G4SQ 2X4WA 2JUFA 1Q81U 4BUGA 4UC4A 5KE2A 4PL6A 3WVEB 4JPBW 1M8VA 2VXEA 1PC0A 2RHUA 3CCJT 2XKOC 4M7DB 1SEMA 1GBQA 1PRLC 4ZNXA 1BB9A 4IIOA 1WJQA 4M78B 1VQ5A 3I55Q 1N8RU 2XICA 3S3MA 2SRCA 4PK4A 4PLIA 4PKCC 1U1TA 4JLGA 1Q82C 2DE0X 2YDLA 5CKEA 1VQLQ 2K5IA 2XMFA 2QG9B 3U23A 3VUBA 2MWPA 4IIMA 3G7ZA 3OYMA 3M4GA 1VQNA 1TSFA 2EYYA 2Y4XA 3CCVA 3OYHA 1UECA 4XTYA 1G3WA 1N9RA 1WXBA 3QPHA 2QEXT 2DRMA 3VS6A 1G3TA 2RB6A 4QT7A 4ZGJB 1ZSZA 4R56A 5GMKe 3VYHB 4NL2A 3HKSA 1LNXA 2OI3A 4M77A 2DTOA 2QA4Q 4XQ3A 1U8RA 2MPXC 2RHYA 4BI4A 3OSVA 4E7IA 1YJWA 2F5TX 3V7RA 2WACA 5KYUB 3CPWS 1S72T 4C8QD 2JN0A 4GY5A 2WSEE 1IHWA 2IG0A 1PHTA 4ESRA 2RJEA 1AWXA 2ZPGB 4BE2A 1YCYA 1U3OA 1IXDA 4JRKA 4B6MA 1R8OB 5FU6C 3M9QA 2QQBA 3LH0A 3O5ZA 3REBB 4CRIA 5CVIA 2KMTA 3HL8A 3QYHB 3VRYA 4JZ4A 1VQ8A 2RN8A 4J9BA 1H3ZA 4M77D 2KYBA 1JJ2A 4CI0C 5DLOA 3OYGA 1KQ1A 1MV0B 4QVZA 1MNEA 1AVZC 3M55A 4FU6A 1M90R 2K6DA 2OAWA 1UGSB 4M75C 1OU8A 3EHQA 4IURA 2K7AA 3JB9J 3JCMb 3CXCP 3H41A 2V26A 4C0ZA 2ED0A 4M7AA 2CGHA 2M51A 2GTJA 2DM1A 3JB9G 4OMMA 1Y96A 1B3QA 1X6BA 5DLQE 5A0GA 2E6ZA 4M75G 3SWNA 1M2VB 2FRWA 3QKJA 1RI0A 3BDUA 3CCJA 3CD6Q 3SWNB 3FJ5A 3PGGA 5GANf 2BZYA 2C0IA 4C0GA 2HSEB 1M9SA 3HP9A 4XU0A 1MUZA 2ABLA 3GLXA 1AWWA 2O4XA 2CSQA 4M7AB
chains in the Genus database with same CATH topology
3EG3A 1GFCA 4OMPA 1YNZA 1X6GA 1WA7A 2J06A 2EBPA 3THKA 3TSWA 2LJ0A 2JMCA 3M0PA 3VS0A 2LP5A 2HCKA 5IXBA 2EKHA 2EQIA 2DBMA 5GJWB 1UGVA 3EG2A 3M0QA 1BBZA 1I07A 2IIMA 2LJ3A 1GL5A 4J9DA 2CH4A 1YCSB 2D8HA 1NEBA 4F16A 2HBWA 1S1NA 2JS0A 4KRTA 3R6NA 2GQIA 1E6GA 1J3TA 2A36A 3ZL7C 4D8KA 1UE9A 1T0JA 2F2WA 2EGAA 3UATA 1B07A 1KJWA 2ENMA 1U5SA 2O88A 2KRMA 2GNCA 5IHKA 4RTZA 1E7OA 1YWOA 2I0NA 2LNHB 2KNBB 4LUEA 1YWPA 1ZUYA 1WXUA 4HVUA 1RUWA 1GCQC 1NYGA 1UDLA 1RLQC 2DILA 1M27C 2ROTA 2L2PA 1UG1A 2X3WD 2LCSA 1WFWA 1WX6A 1AWOA 2CSIA 2JT4A 1H8KA 2M0YA 1UUEA 1WLPB 1YN8A 3PVLA 1ZUUA 3UF4A 2HEQA 1GFDA 3NPFA 1V1CA 1T0HA 4RUGA 1CSKA 2KEAA 1SSHA 1JU5C 2EYZA 2F2XA 4RTYA 1T3LA 4GBQA 4HXJA 4DEXA 4JJCA 4A63B 1OEBA 4Z89A 3TVTA 2L0AA 1Y0MA 1K9AA 2CH4W 2J6KA 2LZ6B 3ULRB 1SRMA 1TG0A 1I0CA 5I22A 1GCQA 3H0IA 2L3SA 3A98A 4FSSA 2FPFA 2D8JA 4J9HA 2W10A 1A0NB 2E5KA 2GBQA 1PWTA 3NHNA 4JJDA 1GRIA 2YUPA 1PRMC 1NG2A 4EIKA 4LE9A 3M0RA 3UA7A 1OPKA 1AD5A 2B86A 1W1FA 1ZSGA 2D1XA 1W6XA 1SHGA 4OMQA 2LQNA 3TSZA 2J6OA 2K79A 4CC3A 1NLOC 1M3CA 1QCFA 2YUNA 2GTOA 1KSWA 4LN2A 4LNPA 2A28A 4J9FA 2YSQA 1X2QA 3I5RA 4RTWA 5IHIA 2K3BA 2W0ZA 2DJQA 4RTXA 2FEIA 1AOJA 5GJVB 4AG1C 2H8HA 1NLPC 4J9IA 2KR3A 3IQLA 4ORZA 1UHFA 5FW9A 1TUCA 1ABQA 4AFQC 2O9SA 4HVVA 4AFUC 2D0NA 3QWYA 4K11A 1KFZA 1IO6A 3QWXX 2P4RA 1M8MA 1OPLA 5IXFA 2EYXA 1G2BA 2ROLA 4Z8AA 1WYXA 3I9QA 5HCKA 2KXDA 2CUDA 1UHCA 3REAB 4E6RA 2AK5A 5FWCA 1M3BA 2JXBA 2EPDA 1FMKA 2FRYA 1W70A 2J05A 4JZ3A 4J9CA 1EFNA 3PVQA 3RBBB 3VS5A 2DL4A 2KXCA 1JEGA 1UFFA 2V1RA 2SEMA 2YUOA 2LQWA 2EW3A 2RPNA 2O31A 3PE0A 2RNAA 2AZVA 4HVWA 2VVKA 1RI9A 1PKSA 1AZEA 1UJYA 1UTIA 1H3HA 1JXMA 4RTUA 2KRSA 2J6FA 1VYTA 3LH5A 1M3AA 5IH2A 3M0SA 1H92A 2AKKA 2J7IA 4DEYA 2K9GA 3SEMA 2CT4A 4AFSC 2FO0A 2C0OA 1GCPA 4OMNA 1QWEA 2DL5A 2KGTA 1SHFA 3I35A 2RQVA 2EGCA 2BTTA 2O9VA 2DMOA 2JM8A 1ZBJA 2RQTA 2PNIA 1OV3A 1AWJA 1K4US 2RMOA 2C0TA 3EGUA 5EC7A 1X43A 2DYBA 4GLMA 2EVRA 2DNUA 1QKWA 2DA9A 2DL3A 2VWFA 2JM9A 1AEYA 2MIOA 1OOTA 3RNJA 3VS1A 4LUDA 3M0UA 1G83A 1PNJA 2DRKA 4X1VA 1YP5A 2KT1A 2KRNA 3EG0A 2YT6A 3CQTA 2DF6A 2YUQA 1MV3A 2O2OA 1BK2A 2DLPA 2DL7A 2L3PA 1RLPC 4JPBW 4AFZC 2NUZA 4HCKA 3C0CA 4M4ZA 4RTTA 2JS2A 1HSQA 1U06A 2JMAA 5L23A 2PZ1A 1SEMA 1HD3A 1GBQA 1N5ZA 1PRLC 1KIKA 1X27A 4ZNXA 2PTKA 1BB9A 2LX7A 4IIOA 1JO8A 2K2MA 1K0XA 2KYMA 1Z9QA 3VS2A 1E6HA 2SRCA 2KE9A 2V1QA 4D8DA 2BZ8A 1CKAA 2DE0X 2YDLA 2DL8A 2VKNA 2XMFA 3U23A 2ED1A 4IIMA 3KFVA 2L3QA 2F2VA 4CC7A 2EYYA 1K1ZA 1ABOA 1T3SA 2HDAA 1WI7A 2EGEA 1K76A 2FPDA 4F14A 1UECA 4CC2A 1WXBA 3VS3A 4R0KA 2CREA 2DRMA 2DX1A 3VS6A 4QT7A 2OJ2A 4WCIA 1ZLMA 2OI3A 2X3XD 2GGRA 3I5SA 2FG0A 1SRLA 2AKLA 3NGPA 1TUDA 2G6FX 3EHRA 4Z88A 4Y92A 3M0TA 1PHTA 1AZGB 2NWMA 4ESRA 2JW4A 1AWXA 1U3OA 4CC4B 1UJ0A 2CDTA 1VYUA 2FPEA 1ARKA 2RQUA 1QLYA 3VS7A 4JJBA 1NEGA 2DBKA 3O5ZA 1GBRA 2EYWA 3REBB 1XOVA 4RTVA 1X69A 4AG2C 1I1JA 2MCNA 1PKTA 2RF0A 1WXTA 1NM7A 2QDLA 3VRYA 4JZ4A 4F17A 2DVJA 2RN8A 4J9BA 2ECZA 2KYBA 1FYNA 1BU1A 3EG1A 1MV0B 2LJ1A 1AVZC 2RQRA 2MOXA 2K6DA 1K0SA 1QKXA 2OAWA 3EHQA 2K7AA 2KROA 5IHNA 1ZX6A 4J9GA 1WIEA 3H41A 2AZSA 5I11A 2JTEA 2ED0A 5ECAA 4OMOA 1WDXA 2M51A 2GTJA 1HJDA 2DM1A 5FWBA 4OMMA 2CUBA 1B3QA 1X6BA 4OMLA 1LCKA 3SHWA 3VS4A 1Y57A 1QWFA 1ZUKA 1JXOA 3UA6A 2LMJA 3NMZC 2RQWA 2FRWA 1Z9ZA 1X2KA 1M30A 3GBQA 3FJ5A 1JQQA 2KT8A 1NYFA 2BZYA 3VRZA 2C0IA 3H0FA 2BZXA 1VA7A 4J9EA 2HSPA 2A37A 1VYVA 1MUZA 1SPKA 3H0HA 2ESWA 2KBTA 1AWWA 2A08A 1CKBA 2CSQA 2ABLA 2CT3A 3JV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG3 A;  1GFC A;  4OMP A;  1YNZ A;  1X6G A;  1WA7 A;  2J06 A;  2EBP A;  3THK A;  3TSW A;  2LJ0 A;  2JMC A;  3M0P A;  3VS0 A;  2LP5 A;  2HCK A;  5IXB A;  2EKH A;  2EQI A;  2DBM A;  5GJW B;  1UGV A;  3EG2 A;  3M0Q A;  1BBZ A;  1I07 A;  2IIM A;  2LJ3 A;  1GL5 A;  4J9D A;  2CH4 A;  1YCS B;  2D8H A;  1NEB A;  4F16 A;  2HBW A;  1S1N A;  2JS0 A;  4KRT A;  3R6N A;  2GQI A;  1E6G A;  1J3T A;  2A36 A;  3ZL7 C;  4D8K A;  1UE9 A;  1T0J A;  2F2W A;  2EGA A;  3UAT A;  1B07 A;  1KJW A;  2ENM A;  1U5S A;  2O88 A;  2KRM A;  2GNC A;  5IHK A;  4RTZ A;  1E7O A;  1YWO A;  2I0N A;  2LNH B;  2KNB B;  4LUE A;  1YWP A;  1ZUY A;  1WXU A;  4HVU A;  1RUW A;  1GCQ C;  1NYG A;  1UDL A;  1RLQ C;  2DIL A;  1M27 C;  2ROT A;  2L2P A;  1UG1 A;  2X3W D;  2LCS A;  1WFW A;  1WX6 A;  1AWO A;  2CSI A;  2JT4 A;  1H8K A;  2M0Y A;  1UUE A;  1WLP B;  1YN8 A;  3PVL A;  1ZUU A;  3UF4 A;  2HEQ A;  1GFD A;  3NPF A;  1V1C A;  1T0H A;  4RUG A;  1CSK A;  2KEA A;  1SSH A;  1JU5 C;  2EYZ A;  2F2X A;  4RTY A;  1T3L A;  4GBQ A;  4HXJ A;  4DEX A;  4JJC A;  4A63 B;  1OEB A;  4Z89 A;  3TVT A;  2L0A A;  1Y0M A;  1K9A A;  2CH4 W;  2J6K A;  2LZ6 B;  3ULR B;  1SRM A;  1TG0 A;  1I0C A;  5I22 A;  1GCQ A;  3H0I A;  2L3S A;  3A98 A;  4FSS A;  2FPF A;  2D8J A;  4J9H A;  2W10 A;  1A0N B;  2E5K A;  2GBQ A;  1PWT A;  3NHN A;  4JJD A;  1GRI A;  2YUP A;  1PRM C;  1NG2 A;  4EIK A;  4LE9 A;  3M0R A;  3UA7 A;  1OPK A;  1AD5 A;  2B86 A;  1W1F A;  1ZSG A;  2D1X A;  1W6X A;  1SHG A;  4OMQ A;  2LQN A;  3TSZ A;  2J6O A;  2K79 A;  4CC3 A;  1NLO C;  1M3C A;  1QCF A;  2YUN A;  2GTO A;  1KSW A;  4LN2 A;  4LNP A;  2A28 A;  4J9F A;  2YSQ A;  1X2Q A;  3I5R A;  4RTW A;  5IHI A;  2K3B A;  2W0Z A;  2DJQ A;  4RTX A;  2FEI A;  1AOJ A;  5GJV B;  4AG1 C;  2H8H A;  1NLP C;  4J9I A;  2KR3 A;  3IQL A;  4ORZ A;  1UHF A;  5FW9 A;  1TUC A;  1ABQ A;  4AFQ C;  2O9S A;  4HVV A;  4AFU C;  2D0N A;  3QWY A;  4K11 A;  1KFZ A;  1IO6 A;  3QWX X;  2P4R A;  1M8M A;  1OPL A;  5IXF A;  2EYX A;  1G2B A;  2ROL A;  4Z8A A;  1WYX A;  3I9Q A;  5HCK A;  2KXD A;  2CUD A;  1UHC A;  3REA B;  4E6R A;  2AK5 A;  5FWC A;  1M3B A;  2JXB A;  2EPD A;  1FMK A;  2FRY A;  1W70 A;  2J05 A;  4JZ3 A;  4J9C A;  1EFN A;  3PVQ A;  3RBB B;  3VS5 A;  2DL4 A;  2KXC A;  1JEG A;  1UFF A;  2V1R A;  2SEM A;  2YUO A;  2LQW A;  2EW3 A;  2RPN A;  2O31 A;  3PE0 A;  2RNA A;  2AZV A;  4HVW A;  2VVK A;  1RI9 A;  1PKS A;  1AZE A;  1UJY A;  1UTI A;  1H3H A;  1JXM A;  4RTU A;  2KRS A;  2J6F A;  1VYT A;  3LH5 A;  1M3A A;  5IH2 A;  3M0S A;  1H92 A;  2AKK A;  2J7I A;  4DEY A;  2K9G A;  3SEM A;  2CT4 A;  4AFS C;  2FO0 A;  2C0O A;  1GCP A;  4OMN A;  1QWE A;  2DL5 A;  2KGT A;  1SHF A;  3I35 A;  2RQV A;  2EGC A;  2BTT A;  2O9V A;  2DMO A;  2JM8 A;  1ZBJ A;  2RQT A;  2PNI A;  1OV3 A;  1AWJ A;  1K4U S;  2RMO A;  2C0T A;  3EGU A;  5EC7 A;  1X43 A;  2DYB A;  4GLM A;  2EVR A;  2DNU A;  1QKW A;  2DA9 A;  2DL3 A;  2VWF A;  2JM9 A;  1AEY A;  2MIO A;  1OOT A;  3RNJ A;  3VS1 A;  4LUD A;  3M0U A;  1G83 A;  1PNJ A;  2DRK A;  4X1V A;  1YP5 A;  2KT1 A;  2KRN A;  3EG0 A;  2YT6 A;  3CQT A;  2DF6 A;  2YUQ A;  1MV3 A;  2O2O A;  1BK2 A;  2DLP A;  2DL7 A;  2L3P A;  1RLP C;  4JPB W;  4AFZ C;  2NUZ A;  4HCK A;  3C0C A;  4M4Z A;  4RTT A;  2JS2 A;  1HSQ A;  1U06 A;  2JMA A;  5L23 A;  2PZ1 A;  1SEM A;  1HD3 A;  1GBQ A;  1N5Z A;  1PRL C;  1KIK A;  1X27 A;  4ZNX A;  2PTK A;  1BB9 A;  2LX7 A;  4IIO A;  1JO8 A;  2K2M A;  1K0X A;  2KYM A;  1Z9Q A;  3VS2 A;  1E6H A;  2SRC A;  2KE9 A;  2V1Q A;  4D8D A;  2BZ8 A;  1CKA A;  2DE0 X;  2YDL A;  2DL8 A;  2VKN A;  2XMF A;  3U23 A;  2ED1 A;  4IIM A;  3KFV A;  2L3Q A;  2F2V A;  4CC7 A;  2EYY A;  1K1Z A;  1ABO A;  1T3S A;  2HDA A;  1WI7 A;  2EGE A;  1K76 A;  2FPD A;  4F14 A;  1UEC A;  4CC2 A;  1WXB A;  3VS3 A;  4R0K A;  2CRE A;  2DRM A;  2DX1 A;  3VS6 A;  4QT7 A;  2OJ2 A;  4WCI A;  1ZLM A;  2OI3 A;  2X3X D;  2GGR A;  3I5S A;  2FG0 A;  1SRL A;  2AKL A;  3NGP A;  1TUD A;  2G6F X;  3EHR A;  4Z88 A;  4Y92 A;  3M0T A;  1PHT A;  1AZG B;  2NWM A;  4ESR A;  2JW4 A;  1AWX A;  1U3O A;  4CC4 B;  1UJ0 A;  2CDT A;  1VYU A;  2FPE A;  1ARK A;  2RQU A;  1QLY A;  3VS7 A;  4JJB A;  1NEG A;  2DBK A;  3O5Z A;  1GBR A;  2EYW A;  3REB B;  1XOV A;  4RTV A;  1X69 A;  4AG2 C;  1I1J A;  2MCN A;  1PKT A;  2RF0 A;  1WXT A;  1NM7 A;  2QDL A;  3VRY A;  4JZ4 A;  4F17 A;  2DVJ A;  2RN8 A;  4J9B A;  2ECZ A;  2KYB A;  1FYN A;  1BU1 A;  3EG1 A;  1MV0 B;  2LJ1 A;  1AVZ C;  2RQR A;  2MOX A;  2K6D A;  1K0S A;  1QKX A;  2OAW A;  3EHQ A;  2K7A A;  2KRO A;  5IHN A;  1ZX6 A;  4J9G A;  1WIE A;  3H41 A;  2AZS A;  5I11 A;  2JTE A;  2ED0 A;  5ECA A;  4OMO A;  1WDX A;  2M51 A;  2GTJ A;  1HJD A;  2DM1 A;  5FWB A;  4OMM A;  2CUB A;  1B3Q A;  1X6B A;  4OML A;  1LCK A;  3SHW A;  3VS4 A;  1Y57 A;  1QWF A;  1ZUK A;  1JXO A;  3UA6 A;  2LMJ A;  3NMZ C;  2RQW A;  2FRW A;  1Z9Z A;  1X2K A;  1M30 A;  3GBQ A;  3FJ5 A;  1JQQ A;  2KT8 A;  1NYF A;  2BZY A;  3VRZ A;  2C0I A;  3H0F A;  2BZX A;  1VA7 A;  4J9E A;  2HSP A;  2A37 A;  1VYV A;  1MUZ A;  1SPK A;  3H0H A;  2ESW A;  2KBT A;  1AWW A;  2A08 A;  1CKB A;  2CSQ A;  2ABL A;  2CT3 A;  3JV3 A; 
#chains in the Genus database with same CATH topology
 1GFC A;  2QQR A;  3PTA A;  4HKE A;  4OMP A;  1YNZ A;  3RIR A;  2J06 A;  4PJO B;  3G1J A;  2K3Y A;  2LJ0 A;  3VS0 A;  3V7S A;  2RI3 A;  4BAC A;  2EKH A;  2DBM A;  2AT1 B;  3EG2 A;  3CBO A;  3RKY A;  1VQN T;  1GL5 A;  4J9D A;  2CH4 A;  4PJL A;  2CYZ B;  2HBW A;  1S1N A;  2JS0 A;  2CP0 A;  2MYS A;  1YI2 A;  1P92 A;  1E6G A;  4M7A E;  1IRX A;  4KUD K;  1T0J A;  1VQ4 T;  4PJO E;  1B07 A;  1U5S A;  2WSC E;  2KRM A;  4RTZ A;  4M7D F;  2FZG B;  1YJN A;  2MAM A;  3HFN A;  1VQ5 T;  4C5E A;  4MZT A;  1K8A U;  5CIU A;  4DOV A;  5GMK l;  2RI2 A;  2M1H A;  1VQ9 T;  3HRU A;  1UG1 A;  2LCS A;  1YJ9 A;  2CSI A;  2JT4 A;  1OZ2 A;  1GXI E;  2EFI A;  4OMF B;  1D0Z A;  3BW1 A;  4ANJ A;  3PVL A;  1TXQ A;  2P4T A;  3CCS Q;  2CZ7 B;  1VQ4 Q;  4NOY A;  1FWZ A;  1T0H A;  2DD5 A;  4IUT A;  4RUG A;  1D09 B;  4C5H A;  1SSH A;  1MMN A;  4FYY B;  3OBY A;  4MML A;  2X51 A;  1OEB A;  2A0F B;  2RA2 A;  4Z89 A;  2E70 A;  4ZN3 A;  1X01 A;  1K9A A;  1MND A;  3MHX A;  2K5L A;  5GAM j;  2YRC A;  1SRM A;  1TG0 A;  2P0P A;  3PMI A;  4LDY A;  5I22 A;  2KSS A;  3H0I A;  3OS2 A;  4KGZ B;  1WHL A;  2D8J A;  2H3E B;  2W10 A;  5KCO A;  3EFS A;  1H64 1;  3L2V A;  4LE9 A;  1AD5 A;  2DVE A;  3M57 A;  2B86 A;  5CCA A;  4C8Q F;  2X4Y A;  2XDD A;  4LDX A;  3M56 A;  4J9F A;  2YSQ A;  3HTR A;  3NTK A;  2EQJ A;  2QEX Q;  1K8A C;  3GP8 A;  5IHI A;  1W4S A;  4M75 E;  3QYG B;  2HMA A;  2FEI A;  1AOJ A;  3QDR B;  5GJV B;  3RMQ A;  2BUD A;  4J9I A;  2JTM A;  4II1 A;  1UHF A;  3CD6 T;  1ABQ A;  4HVV A;  3QHS A;  2K57 A;  3QWY A;  4K11 A;  2KI7 A;  3H6Z A;  3QWX X;  2RJC A;  4BDZ A;  4J6Y A;  5KYX A;  1G2B A;  4PLL A;  4Z8A A;  2ZPH B;  5HCK A;  1C0M A;  2O4X B;  3L42 A;  4X9C A;  5KYX B;  2CUD A;  3JCM f;  1VQO Q;  4E6R A;  2FL7 A;  1OUL A;  1M1G A;  1UGQ B;  2JXB A;  1WHH A;  2FRY A;  1W70 A;  2JNG A;  4J9C A;  5KYY A;  2DKG A;  2F1L A;  3E2U A;  2LVM A;  4HT8 A;  3E19 A;  2LQW A;  2DEQ A;  1M1K R;  4M78 E;  1VQL A;  3LW5 E;  1RL2 A;  2EJ9 A;  2KQW A;  1UJY A;  3LGL A;  2RK1 A;  4M77 C;  2CS7 A;  2AKK A;  2J7I A;  2P84 A;  1OYX A;  1Q86 U;  4J6W A;  2V8I A;  3OS5 A;  1NPP A;  3MPU B;  5KH6 A;  1GCP A;  1QWE A;  1VQ6 A;  1M1K U;  3OYF A;  1VQ4 A;  2BTT A;  2O9V A;  4MZP A;  2DMO A;  5GAO m;  1OV3 A;  4QKU A;  2RMO A;  2C0T A;  2DYB A;  5LJ5 j;  2EVR A;  2DNU A;  1TWB A;  3CCQ Q;  4JS4 A;  3FLG A;  4QW2 A;  4R55 A;  3OW2 P;  3EGD A;  2VWF A;  5KYY B;  1OOT A;  5CO7 A;  1WHG A;  4LUD A;  3C95 A;  2LQK A;  4KH0 B;  4RMO A;  1G83 A;  2OTL Q;  1BYM A;  1RAB B;  2DRK A;  4X1V A;  2CP2 A;  2KT1 A;  2KRN A;  5FLX E;  3LGF A;  2HKQ B;  2O2O A;  5GAO r;  1C6V X;  4ELY C;  2DLP A;  3CCE Q;  2O01 E;  4QQD A;  4EMK C;  1KC8 R;  4HCK A;  2DZC A;  3V7C A;  5GAM g;  5FRM A;  4C92 A;  1HSQ A;  5L8R E;  4ZN1 A;  3JCM g;  4IUQ A;  2ZPE B;  2JMA A;  4L6V 5;  1HD3 A;  1KIK A;  3CMA Q;  2LX7 A;  4C8Q A;  2K2M A;  3FDR A;  3MEW A;  1M5Q 1;  3E1S A;  5D6W A;  3MET A;  1TOV A;  3EGX A;  5HK3 A;  1Y07 A;  1PD0 A;  4MZM A;  2BZ8 A;  1CKA A;  2VKN A;  2BIV A;  3RUX A;  2WSF E;  3VJP A;  2GFA A;  3QXE B;  2L3Q A;  3CCL T;  2F2V A;  4CC7 A;  1K9M C;  3CCJ Q;  4FYX B;  3OMG A;  2HDA A;  1ABO A;  4OGC A;  4ZTJ A;  1WI7 A;  2EGE A;  4F14 A;  4CC2 A;  4C0D B;  3CC2 T;  1ZQ1 A;  2HZY A;  4R0K A;  2CRE A;  3OBW A;  1OQK A;  3OYI A;  1EX4 A;  2DD4 A;  4EMH A;  2CP3 A;  4OP0 A;  4PFP A;  1OI1 A;  3DB3 A;  4JJN K;  3OYY A;  2FG0 A;  1SRL A;  2LC4 A;  2G3R A;  2KDS A;  3TQ7 P;  3DKM A;  3NGP A;  2QTV A;  4Z88 A;  3EHR A;  4Y92 A;  1RAG B;  3M0T A;  1AZG B;  1YHQ A;  4N0A A;  5CK9 A;  1UJ0 A;  3L2Q A;  1QVP A;  2CDT A;  1YI2 Q;  3CCU T;  2RQU A;  3VS7 A;  2LQ8 A;  4JJB A;  1NEG A;  2VV5 A;  4MMK A;  3HHT B;  1SF9 A;  2E10 A;  6AT1 B;  1XOV A;  4RTV A;  1X69 A;  4FT2 A;  3GNF B;  1PKT A;  3L2R A;  1G8X A;  2MF2 A;  4F17 A;  4BDY A;  1FXX A;  3OMC A;  1FYN A;  1BU1 A;  5LJ5 f;  3OSS C;  1KK7 A;  4YTL A;  2LJ1 A;  2X4X A;  2HQH A;  2MOX A;  1SSF A;  3BY7 A;  1S72 Q;  2CP6 A;  4KUL A;  1QQJ A;  3DB4 A;  4J9G A;  5IHN A;  1D3B A;  1MMD A;  4RCC A;  5ECA A;  3I55 A;  4OMO A;  3CC2 A;  5D6Y A;  1QP2 A;  3EFO B;  3CME Q;  3ASK A;  1RAF B;  4OML A;  4OGE A;  4XU1 A;  3VS4 A;  4A53 A;  2PVD B;  3WXM B;  1QWF A;  1ZUK A;  1B34 A;  3UA6 A;  4A4G A;  2LMJ A;  3L2Z A;  1Z9Z A;  5AYF A;  3C94 A;  1X2K A;  3UT1 A;  4DBQ A;  1NZ9 A;  4EMG A;  3GBQ A;  1JQQ A;  1B7T A;  3KXT A;  3OQ5 A;  2MK5 A;  1VA7 A;  2HSP A;  3KBG A;  5GAN d;  2OTJ T;  4XTZ A;  2ESW A;  2KBT A;  2LT4 A;  1CKB A;  3I5S A;  2HD0 A;  4XK8 E;  3EG3 A;  4OF1 A;  5GAM h;  1X6G A;  1TS9 A;  2EJF A;  1VQ9 Q;  2EBP A;  3N5B B;  1RAC B;  1QVF P;  3OYK A;  2EQI A;  2X4J A;  4M75 F;  3VYG A;  1I07 A;  2IIM A;  2HKN A;  1BI1 A;  1YCS B;  1NEB A;  4F16 A;  4F7U E;  4E7H A;  1NJI C;  3R6N A;  3BE3 A;  1BKB A;  4C8Q G;  5LJ5 e;  1J3T A;  3WVD B;  4D8K A;  3INZ A;  1MGQ A;  4JRP A;  2DER A;  4XTV A;  2E5Q A;  1KJW A;  2ENM A;  3EFR A;  2GNC A;  5IHK A;  3X26 B;  2I0N A;  2E3H A;  2KNB B;  1YWP A;  1ZUY A;  4L59 A;  1RUW A;  3H8Z A;  1YJN Q;  1GCQ C;  2BKD N;  2RM4 A;  2L89 A;  1Q7Y R;  3ZBD A;  3GIB A;  2ROT A;  5IAY A;  1YJ9 Q;  1NJI U;  2L2P A;  2V8K A;  2ZPI B;  1K73 U;  1YN8 A;  2A3L A;  4JLI A;  3NPF A;  2DXB A;  4A54 A;  1VQ5 Q;  1Q7Y U;  1K73 R;  4QQG A;  2VB6 A;  3ER0 A;  3CCR A;  2DYI A;  4DOW A;  1O9S A;  5KYU A;  2CZ6 B;  4J7F A;  1NE8 A;  2CH4 W;  2J6K A;  4FL6 A;  5LL6 S;  3G71 T;  4ZTF A;  5HK0 A;  2RD1 A;  2R5M A;  1V29 B;  3V8K A;  1GCQ A;  1G5V A;  2E6N A;  1D3B B;  2ZPB B;  3CC4 A;  4FSS A;  3CMA T;  2JOY A;  4J9H A;  4DBR A;  2JZ2 A;  2DXC A;  3CCM Q;  3M59 A;  3PNW C;  3JCM h;  1PWT A;  4JJD A;  5AT1 B;  1K9M U;  2YUP A;  1NG2 A;  5A0D A;  1UEB A;  5FU6 B;  3RDV A;  3CCS T;  4Q5W A;  2AIR B;  5LJ5 h;  2D1X A;  3JCM V;  1W6X A;  4OMQ A;  2Y90 A;  2LQN A;  3PMT A;  1KC8 U;  4CC3 A;  1PM3 A;  3UDC A;  1NLO C;  1M3C A;  2RJF A;  2YUN A;  2GTO A;  2H3J A;  4MDW A;  3CME T;  3CC2 Q;  1EZZ B;  1X2Q A;  1Q86 C;  3FIF A;  4HCZ A;  3I5R A;  1RAI B;  2DJQ A;  1VQO T;  3JSC A;  3FJP A;  3X25 B;  2R58 A;  3CCM T;  1G3S A;  2VGN A;  2VGM A;  3C12 A;  1TUC A;  5FW9 A;  1M1F A;  3G4S T;  3CXC S;  4FYV B;  2D0N A;  1WJS A;  1IO6 A;  3VU3 C;  2LT1 A;  2P4R A;  3EH2 A;  3UWN A;  5IXF A;  1O75 A;  8AT1 B;  4C8Q B;  3I9Q A;  1YJ9 T;  3RES A;  2E4H A;  1UHC A;  4LD6 A;  2AK5 A;  5GAN 6;  1R77 A;  3GOX A;  1FMK A;  3CMA A;  4KBM B;  3I56 T;  2MWO A;  1KQS S;  2X35 A;  1Q86 R;  1BI3 A;  1JEG A;  3JB9 I;  4XTU A;  5FU7 B;  2YUO A;  2O31 A;  3PE0 A;  2AZV A;  5CKD A;  1UB4 A;  2LDM A;  1AZE A;  1UTI A;  3PT9 A;  4RTU A;  1IGQ A;  2KRS A;  1U1S A;  4L5G A;  2BE9 B;  3M0S A;  4M7A D;  4DEY A;  3SFM A;  2K9G A;  5CAI A;  3SEM A;  4BI3 A;  4OMN A;  4QVC A;  1VQO A;  2DL5 A;  3CXC A;  5J39 A;  1SHF A;  5C6S A;  1WGS A;  2RQV A;  3CCM A;  2COY A;  2JM8 A;  2RK2 A;  3MEU A;  4ZGE B;  3FRN A;  1HXD A;  1VIE A;  2EIF A;  3D7S B;  1BI2 A;  2KVQ G;  2FZC B;  4M7D D;  1YBY A;  3NTH A;  5GMK h;  2DL3 A;  1AEY A;  1M4Z A;  1YP5 A;  5DY9 A;  4XU3 A;  1KQS A;  1SKU B;  3CQT A;  2DF6 A;  3BDL A;  2GF7 A;  1BK2 A;  4M77 E;  3PFS A;  4AMC A;  2L3P A;  1EIF A;  3EH1 A;  2D9T A;  3CEY A;  3CPW P;  5GAO l;  3RKX A;  4KH1 B;  4GLK A;  2IVW A;  4RTT A;  2JS2 A;  1U06 A;  4C0D C;  1YIJ Q;  3S6W A;  3LWH A;  5L23 A;  2PZ1 A;  1N5Z A;  3G71 A;  1QMC A;  1X27 A;  4J8O A;  3AHU A;  4M75 A;  2EQU A;  1Q81 C;  1JO8 A;  1ZHI A;  2E64 A;  1K0X A;  4M78 F;  2KYM A;  1E6H A;  1X75 C;  3A8L B;  4ELZ C;  4D8D A;  3VUZ A;  4JRQ A;  3EG9 B;  4PJN A;  2HQE A;  3X28 B;  2RI5 A;  1VQK Q;  3J7A F;  5GAN e;  4IUV A;  3JCM Q;  5GAO q;  1N27 A;  1OU9 A;  2YRD A;  8ATC B;  3M53 A;  1K1Z A;  3CBP A;  1WPY A;  2FPD A;  1QW1 A;  2F69 A;  1KHC A;  3JAM E;  2NUT B;  4FW1 A;  1XNI A;  2NLU A;  3VS3 A;  2E12 A;  2OJ2 A;  4WCI A;  3QII A;  2NUP B;  4WTO B;  4XTX A;  4B9X A;  1VQ6 T;  2X3X D;  3QSU A;  5GAN 2;  3OYA A;  5FRN A;  2AKL A;  2VC8 A;  1S72 A;  4Y91 A;  1TUD A;  2G6F X;  1Y96 B;  3G71 Q;  2X9H A;  2JW4 A;  1VYU A;  2FPE A;  1ARK A;  1QLY A;  2DBK A;  2VAS A;  5KCH A;  5GAM e;  2EYW A;  3A1P A;  3OS0 A;  1QVG S;  2QA4 T;  3CCV T;  4AG2 C;  1RAD B;  1XJW B;  5CQY A;  3HRS A;  3QO3 A;  1NM7 A;  1KG1 A;  2XI9 A;  2DVJ A;  2QQA A;  1D0Y A;  1VQ8 T;  4BE0 A;  4OVA A;  4PJM A;  2E65 A;  2AHJ B;  4KT0 E;  1QKX A;  1XTD A;  4J7I A;  2COZ A;  2KRO A;  5LJ3 j;  1Q82 R;  4LD9 K;  1ZX6 A;  1WIE A;  2AZS A;  5FU7 C;  5I11 A;  4E7Z A;  3J80 E;  1WDX A;  4BB7 A;  5FWB A;  3LWI A;  2DTH A;  1LOJ A;  2CUB A;  3JB9 F;  3ZFJ A;  2Z0W A;  5GMK m;  1YI2 T;  3QDF A;  1Y57 A;  5CKH A;  2ZAE A;  1IZ6 A;  3EGX B;  2JJ9 A;  1VQ7 A;  3NMZ C;  2RQW A;  3DLL A;  4DA4 A;  1TTH B;  3CC7 Q;  2DPP B;  4E7L A;  2KT8 A;  1NYF A;  3GNG A;  4E2F B;  9ATC B;  2P0Q A;  3H0F A;  1SG5 A;  1WHM A;  1BI0 A;  1KC8 C;  3RER A;  4J6X A;  2XK0 A;  2QK0 A;  2R5A A;  3URG A;  2CT3 A;  3JV3 A;  3VS5 A;  1WQ7 A;  2M0O A;  3VKI A;  1WA7 A;  3HFO A;  2JMC A;  3M0P A;  2LP5 A;  2HCK A;  5IXB A;  5KYW A;  5I2M A;  1RAH B;  3M0Q A;  2LJ3 A;  1PSF A;  1OX8 A;  2D8H A;  3M54 A;  1VQM T;  1W2B A;  1R0C B;  1KHI A;  4JDS A;  3CCU Q;  3QZ5 B;  2GQI A;  2A36 A;  4J5Y A;  3ZL7 C;  3QJ6 A;  1UE9 A;  2F2W A;  4EMK A;  1I8F A;  1IHV A;  2QAZ A;  2EGA A;  2QTX A;  3UAT A;  2EJG A;  2JTF A;  1E7O A;  5D6X A;  1IB8 A;  3HSB A;  4LUE A;  2VYT A;  4M75 B;  1WXU A;  4HVU A;  3BFM A;  3MCA B;  1JBM A;  1NYG A;  1UDL A;  1RLQ C;  4OB2 B;  5HY6 A;  4FT4 A;  1TH7 A;  3M4Y A;  1WX6 A;  1AWO A;  3MEV A;  2I2L A;  1PD1 A;  2GQV A;  3A8G B;  2M0Y A;  1UUE A;  2CP5 A;  1VQ6 Q;  1ZUU A;  2EWN A;  3OYB A;  4XU2 A;  3CC4 T;  3OYE A;  3EAE A;  4M77 G;  4A4E A;  4DBH A;  3MEA A;  2KEA A;  1VQP T;  2FHD A;  5GAM f;  2K5F A;  2EYZ A;  5LJ3 g;  1T3L A;  4GBQ A;  4JJC A;  5LJ3 h;  4A63 B;  1UGR B;  4M78 G;  3TVT A;  2L0A A;  3CCU A;  4M7D C;  2XG8 D;  3E9G A;  2CZ0 B;  7AT1 B;  2OTJ Q;  3JCM P;  3TRE A;  2L3S A;  3A98 A;  3QBY A;  4DBF A;  2NYS A;  2YRV A;  2JVV A;  2FPF A;  3SDZ A;  2LRQ A;  4HT9 A;  1R0B G;  2GBQ A;  2XHC A;  5GAN 3;  3NHN A;  1VQ8 Q;  2QGG A;  4EIK A;  3DLM A;  3M0R A;  2QYZ A;  4N0A C;  5LJ5 g;  1FX7 A;  3CCQ T;  3FEO A;  1W1F A;  1ZSG A;  3F70 A;  4RG8 A;  4BE1 A;  1SHG A;  1RAA B;  2J6O A;  5A2Q E;  1KSW A;  2PQW A;  2OTL T;  1M90 U;  3I56 Q;  1IRE B;  3OS1 A;  4HCC A;  4F7U A;  4A4K A;  2W0Z A;  3MP1 A;  5D7U A;  1NBE B;  1OZ3 A;  4A4F A;  4AG1 C;  2CP7 A;  1JRI A;  2KR3 A;  3IQL A;  4NS5 A;  2YHT A;  4QQ6 A;  4TVR A;  2FYK A;  3FB9 A;  4AFQ C;  3CCE A;  2O9S A;  2E3I A;  5A0L A;  1MMA A;  3CD6 A;  1KFZ A;  2XDP A;  3MP6 A;  1JJ2 S;  4V2S A;  1OPL A;  4M77 F;  2EYX A;  4HA8 A;  1D0X A;  2EYQ A;  2HBP A;  2YWW A;  4PFO A;  3PIO A;  2EQK A;  4M7D E;  2KXD A;  4D6W A;  5LJ3 d;  2E41 A;  3REA B;  4KUI A;  5FWC A;  2EPD A;  1V76 A;  1HYO A;  1EFN A;  3PVQ A;  2M9U A;  5GAO p;  1QCO A;  2QQ9 A;  2DL4 A;  3QJY A;  1W2B S;  2V1R A;  1AHJ B;  2RNA A;  2OAU A;  3R6O A;  4HVW A;  2VVK A;  1RI9 A;  1H3H A;  1Q7Y C;  1JXM A;  2J6F A;  4PJO C;  3LH5 A;  5IH2 A;  1TU0 B;  1VOM A;  4M7A C;  1ZBX A;  2CT4 A;  3X20 B;  2IPO B;  4BD3 A;  3I35 A;  2DFU A;  1RAE B;  1ZBJ A;  4N4I A;  5J26 A;  5CR2 A;  3CBM A;  1AWJ A;  1K4U S;  3CCE T;  2DO3 A;  2GFU A;  2XD0 A;  4O6J A;  2HL3 A;  1YIJ A;  3VV0 A;  5KYW B;  1QKW A;  4EPC A;  5GMK j;  4PFZ A;  2JM9 A;  4ZGD B;  4F7U F;  1VQP Q;  2VXF A;  2KY9 A;  3M0U A;  3G6E A;  1QVF A;  1KD1 C;  1VQL T;  2LX9 A;  4C8Q C;  4LDU A;  4FM4 B;  3EG0 A;  1YIT Q;  2YT6 A;  4C92 D;  3ME9 A;  3OA6 A;  3LLR A;  2YUQ A;  1MV3 A;  1PCX A;  1TUG B;  1ZSZ C;  3G4S A;  4IKF A;  2DIQ A;  4X9D A;  4B9W A;  4OB3 B;  3M58 A;  4AFZ C;  4ATO A;  2NUZ A;  3T9N A;  3L2W A;  3C0C A;  4M4Z A;  4J83 A;  1N9S A;  3S3N A;  5GAN 4;  1ZSZ B;  5GAN 8;  3CCS A;  4XTW A;  2F5K A;  2PTK A;  4M78 D;  2BE7 D;  1PG5 B;  2EQM A;  1LVK A;  3SB2 A;  1Z9Q A;  3VS2 A;  3JCM c;  2KE9 A;  2V1Q A;  1QVF S;  1YHQ T;  2FB7 A;  2DL8 A;  2L3R A;  3V8L A;  1ZA1 B;  3KFV A;  1YIJ T;  2QDY B;  1YJN T;  1T3S A;  3QZ9 B;  4QVD A;  3MO8 A;  1K76 A;  3SD4 A;  3A8O B;  3O8V A;  4VUB A;  4RCB A;  1HK9 A;  2DX1 A;  4OB1 B;  1WHK A;  1ZLM A;  1Q95 G;  3G6E T;  4E47 A;  1BCO A;  5IT9 E;  4FSX A;  4HCB A;  1G3Y A;  2GGR A;  2QA4 A;  2R57 A;  4PJO F;  1KQ2 A;  3I55 T;  4KGV B;  3OW2 S;  4M7A F;  4F7U G;  1MHN A;  3I56 A;  2NWM A;  1VQK A;  3OB9 A;  2K4Y A;  4M78 C;  3QG1 A;  1N6A A;  2QEX A;  4CC4 B;  3Q1J A;  3AT1 B;  1KQS P;  3ZEH A;  2D0Q B;  4PNO A;  3OYC A;  5GAN g;  3CCL A;  1GBR A;  4A4H A;  5GAN h;  2QXF A;  1M90 C;  1I1J A;  2MCN A;  2HNI A;  3RR6 A;  2ATC B;  2RF0 A;  3CC7 A;  1WXT A;  4Z02 A;  2QDL A;  4M77 B;  4O5V A;  1Q82 U;  1VQ9 A;  2ECZ A;  2XDB A;  3EG1 A;  2PU9 B;  2ZPF B;  1VQ7 T;  2ZZD A;  3V8J A;  2RQR A;  5C0M A;  4FYW B;  2PVG B;  4LDW A;  1K0S A;  2DJZ A;  4C92 G;  2FZK B;  4F04 B;  3L2U A;  2JTE A;  2RHI A;  3SWN C;  1HJD A;  1AT1 B;  1LCK A;  3SHW A;  1FMW A;  4E7S A;  5GAM d;  2LCL A;  3CPF A;  5GAN j;  3OW2 A;  2RH2 A;  4M7D G;  1JXO A;  1M2O A;  1F1B B;  3RMS A;  3CCV Q;  1XQH A;  1M30 A;  2CZ1 B;  3OYL A;  2RHZ A;  2YXY A;  3VRZ A;  3P8H A;  1VQM A;  2BZX A;  1BCM A;  4Y28 E;  2OTJ A;  2D6F A;  1QP3 A;  4J9E A;  2A37 A;  1VYV A;  4RG2 A;  1SPK A;  3L1A A;  3EGD B;  1YFN A;  3H0H A;  3FC3 A;  2A08 A;  5EG2 A;  2ED1 A;  1N8R R;  5GAN 5;  1I81 A;  2COW A;  3P8B B;  5I21 A;  4M7A G;  2DIG A;  1QVG P;  1B34 B;  2RO0 A;  4BY6 C;  5CKB A;  4PJO G;  3THK A;  3TSW A;  3A8H B;  4DQ2 A;  4PJO D;  2C06 A;  5GJW B;  1UGV A;  1JJ2 P;  4IUU A;  5J3B A;  3CC7 T;  1BBZ A;  5DM7 R;  4JRI A;  4WF2 A;  1K9M R;  1QCN A;  1WJR A;  2YLB A;  1NPR A;  4F7U B;  1Y7X A;  2QI2 A;  4LXC A;  2PUO B;  1M2V A;  4KRT A;  3S3O A;  1PSE A;  1YHQ Q;  1M1K C;  2RHX A;  4M75 D;  2O88 A;  1YWO A;  2XU8 A;  2LNH B;  3UPU A;  3C4S A;  4EMK B;  2QGF B;  5LJ3 e;  2K2V A;  1UGP B;  1ZA2 B;  1VQK T;  2HAX A;  1KD1 U;  2DIL A;  1M27 C;  2HQX A;  4JS5 A;  1D1C A;  2X3W D;  1WFW A;  2MMP A;  1H8K A;  4C92 F;  1WLP B;  1QVG A;  3UF4 A;  2HEQ A;  3JCM X;  1I5O B;  1GFD A;  1V1C A;  2DZ9 A;  4EDU A;  1CSK A;  1YIT T;  5KE3 A;  1VUB A;  2DAQ A;  5I2S A;  1JU5 C;  2F2X A;  1KD1 R;  4RTY A;  2KK4 A;  4HXJ A;  4DEX A;  3MJX A;  1K73 C;  3MP8 A;  1I4K 1;  1W2B P;  3LX7 A;  1Y0M A;  3E9F A;  4XAX B;  2LZ6 B;  3ULR B;  4FCY A;  1BIA A;  1I0C A;  2A7Y A;  2NUT A;  3EG9 A;  4JUV A;  2ZGW A;  4C92 C;  1WZO A;  1A0N B;  3JCM W;  4X34 A;  1DJ7 B;  2E5K A;  2HL5 C;  1LJO A;  2XID A;  1GRI A;  2P0K A;  1PRM C;  4P5N A;  4FW2 A;  2GCX A;  3HRT A;  3UA7 A;  1OPK A;  4NL3 A;  2CKK A;  4C5I A;  4PJO A;  2LCC A;  2L5Q A;  3TSZ A;  5IN1 A;  2K79 A;  4LNP A;  1QCF A;  4LN2 A;  4E7K A;  2FVU A;  3NTI A;  2A28 A;  1MMG A;  3J81 E;  4ME7 A;  3CCR T;  3CME A;  3EFO A;  2E1H A;  4RTW A;  2K3B A;  4C8Q E;  3OYN A;  1I5L A;  1WHJ A;  4RTX A;  3G6E Q;  5KYN A;  5GAO n;  2PVO B;  2H8H A;  4E7J A;  1NLP C;  4ORZ A;  5GAN 7;  4C92 E;  2DXU A;  3OYD A;  4AFU C;  5LJ5 d;  3OYJ A;  1OX9 A;  4BY6 B;  3QUI A;  2KAF A;  1M8M A;  1VIF A;  3JB9 D;  2LNV A;  1ACM B;  3GF5 A;  2ROL A;  2Y4Y A;  4C0F A;  4N4G A;  1IGU A;  1WYX A;  3PIP A;  4MDX A;  2YLC A;  1M3B A;  4OB0 B;  2J05 A;  4N4H A;  4JZ3 A;  2DXT A;  3RBB B;  2ZCF B;  5GMK i;  2QQS A;  2KXC A;  5HKC A;  1UFF A;  1K8A R;  2SEM A;  2K3X A;  3H9N A;  2EW3 A;  2RPN A;  1D1B A;  1VQ7 Q;  1VQN Q;  1PKS A;  5LJ3 f;  4PJJ A;  1VQM Q;  1WQW A;  2QAS A;  3RKW A;  3CPW A;  1Y71 A;  1VYT A;  1YIT A;  5CQX A;  1C1A A;  5FRO A;  1M3A A;  1H92 A;  3JCM d;  3NFC A;  3MKD A;  2V8J A;  4AFS C;  2FO0 A;  2C0O A;  2DET A;  2KGT A;  2EGC A;  3A8M B;  1JB0 E;  2RQT A;  3P8D A;  2PNI A;  1YJW Q;  3OY9 A;  3TU4 K;  3EGU A;  5EC7 A;  3M5A A;  4BI8 B;  1X43 A;  1X6O A;  2DK3 A;  4M78 A;  4FIB A;  1WNL A;  4GLM A;  3CCQ A;  3TEE A;  4KGX B;  1NJI R;  4AT1 B;  2DA9 A;  2PUK B;  3JCM J;  1VQP A;  2DEU A;  1BIB A;  2VUB A;  1D1A A;  1Q81 R;  3JB9 H;  2OX7 A;  2L8D A;  2MI6 A;  2MIO A;  3LYI A;  3RNJ A;  3KUF A;  2OTL A;  3VS1 A;  4RKU E;  4LDV A;  4C5G A;  2EAY A;  2LTO A;  3X24 B;  1PNJ A;  2RJD A;  3CCR Q;  2B8A A;  3HPW A;  3CC4 Q;  3A5Z B;  3JCM e;  4M7D A;  4IUP A;  2DTI A;  3CCL Q;  3JRZ A;  1FMV A;  4C92 B;  1YJW T;  5CKF A;  2M16 A;  5M9O A;  1N8R C;  2EKO A;  2M02 A;  3GPL A;  2DL7 A;  1RLP C;  3TCJ A;  1LPL A;  2NUP A;  3G4S Q;  2X4W A;  2JUF A;  1Q81 U;  4BUG A;  4UC4 A;  5KE2 A;  4PL6 A;  3WVE B;  4JPB W;  1M8V A;  2VXE A;  1PC0 A;  2RHU A;  3CCJ T;  2XKO C;  4M7D B;  1SEM A;  1GBQ A;  1PRL C;  4ZNX A;  1BB9 A;  4IIO A;  1WJQ A;  4M78 B;  1VQ5 A;  3I55 Q;  1N8R U;  2XIC A;  3S3M A;  2SRC A;  4PK4 A;  4PLI A;  4PKC C;  1U1T A;  4JLG A;  1Q82 C;  2DE0 X;  2YDL A;  5CKE A;  1VQL Q;  2K5I A;  2XMF A;  2QG9 B;  3U23 A;  3VUB A;  2MWP A;  4IIM A;  3G7Z A;  3OYM A;  3M4G A;  1VQN A;  1TSF A;  2EYY A;  2Y4X A;  3CCV A;  3OYH A;  1UEC A;  4XTY A;  1G3W A;  1N9R A;  1WXB A;  3QPH A;  2QEX T;  2DRM A;  3VS6 A;  1G3T A;  2RB6 A;  4QT7 A;  4ZGJ B;  1ZSZ A;  4R56 A;  5GMK e;  3VYH B;  4NL2 A;  3HKS A;  1LNX A;  2OI3 A;  4M77 A;  2DTO A;  2QA4 Q;  4XQ3 A;  1U8R A;  2MPX C;  2RHY A;  4BI4 A;  3OSV A;  4E7I A;  1YJW A;  2F5T X;  3V7R A;  2WAC A;  5KYU B;  3CPW S;  1S72 T;  4C8Q D;  2JN0 A;  4GY5 A;  2WSE E;  1IHW A;  2IG0 A;  1PHT A;  4ESR A;  2RJE A;  1AWX A;  2ZPG B;  4BE2 A;  1YCY A;  1U3O A;  1IXD A;  4JRK A;  4B6M A;  1R8O B;  5FU6 C;  3M9Q A;  2QQB A;  3LH0 A;  3O5Z A;  3REB B;  4CRI A;  5CVI A;  2KMT A;  3HL8 A;  3QYH B;  3VRY A;  4JZ4 A;  1VQ8 A;  2RN8 A;  4J9B A;  1H3Z A;  4M77 D;  2KYB A;  1JJ2 A;  4CI0 C;  5DLO A;  3OYG A;  1KQ1 A;  1MV0 B;  4QVZ A;  1MNE A;  1AVZ C;  3M55 A;  4FU6 A;  1M90 R;  2K6D A;  2OAW A;  1UGS B;  4M75 C;  1OU8 A;  3EHQ A;  4IUR A;  2K7A A;  3JB9 J;  3JCM b;  3CXC P;  3H41 A;  2V26 A;  4C0Z A;  2ED0 A;  4M7A A;  2CGH A;  2M51 A;  2GTJ A;  2DM1 A;  3JB9 G;  4OMM A;  1Y96 A;  1B3Q A;  1X6B A;  5DLQ E;  5A0G A;  2E6Z A;  4M75 G;  3SWN A;  1M2V B;  2FRW A;  3QKJ A;  1RI0 A;  3BDU A;  3CCJ A;  3CD6 Q;  3SWN B;  3FJ5 A;  3PGG A;  5GAN f;  2BZY A;  2C0I A;  4C0G A;  2HSE B;  1M9S A;  3HP9 A;  4XU0 A;  1MUZ A;  2ABL A;  3GLX A;  1AWW A;  2O4X A;  2CSQ A;  4M7A B; 
#chains in the Genus database with same CATH homology
 3EG3 A;  1GFC A;  4OMP A;  1YNZ A;  1X6G A;  1WA7 A;  2J06 A;  2EBP A;  3THK A;  3TSW A;  2LJ0 A;  2JMC A;  3M0P A;  3VS0 A;  2LP5 A;  2HCK A;  5IXB A;  2EKH A;  2EQI A;  2DBM A;  5GJW B;  1UGV A;  3EG2 A;  3M0Q A;  1BBZ A;  1I07 A;  2IIM A;  2LJ3 A;  1GL5 A;  4J9D A;  2CH4 A;  1YCS B;  2D8H A;  1NEB A;  4F16 A;  2HBW A;  1S1N A;  2JS0 A;  4KRT A;  3R6N A;  2GQI A;  1E6G A;  1J3T A;  2A36 A;  3ZL7 C;  4D8K A;  1UE9 A;  1T0J A;  2F2W A;  2EGA A;  3UAT A;  1B07 A;  1KJW A;  2ENM A;  1U5S A;  2O88 A;  2KRM A;  2GNC A;  5IHK A;  4RTZ A;  1E7O A;  1YWO A;  2I0N A;  2LNH B;  2KNB B;  4LUE A;  1YWP A;  1ZUY A;  1WXU A;  4HVU A;  1RUW A;  1GCQ C;  1NYG A;  1UDL A;  1RLQ C;  2DIL A;  1M27 C;  2ROT A;  2L2P A;  1UG1 A;  2X3W D;  2LCS A;  1WFW A;  1WX6 A;  1AWO A;  2CSI A;  2JT4 A;  1H8K A;  2M0Y A;  1UUE A;  1WLP B;  1YN8 A;  3PVL A;  1ZUU A;  3UF4 A;  2HEQ A;  1GFD A;  3NPF A;  1V1C A;  1T0H A;  4RUG A;  1CSK A;  2KEA A;  1SSH A;  1JU5 C;  2EYZ A;  2F2X A;  4RTY A;  1T3L A;  4GBQ A;  4HXJ A;  4DEX A;  4JJC A;  4A63 B;  1OEB A;  4Z89 A;  3TVT A;  2L0A A;  1Y0M A;  1K9A A;  2CH4 W;  2J6K A;  2LZ6 B;  3ULR B;  1SRM A;  1TG0 A;  1I0C A;  5I22 A;  1GCQ A;  3H0I A;  2L3S A;  3A98 A;  4FSS A;  2FPF A;  2D8J A;  4J9H A;  2W10 A;  1A0N B;  2E5K A;  2GBQ A;  1PWT A;  3NHN A;  4JJD A;  1GRI A;  2YUP A;  1PRM C;  1NG2 A;  4EIK A;  4LE9 A;  3M0R A;  3UA7 A;  1OPK A;  1AD5 A;  2B86 A;  1W1F A;  1ZSG A;  2D1X A;  1W6X A;  1SHG A;  4OMQ A;  2LQN A;  3TSZ A;  2J6O A;  2K79 A;  4CC3 A;  1NLO C;  1M3C A;  1QCF A;  2YUN A;  2GTO A;  1KSW A;  4LN2 A;  4LNP A;  2A28 A;  4J9F A;  2YSQ A;  1X2Q A;  3I5R A;  4RTW A;  5IHI A;  2K3B A;  2W0Z A;  2DJQ A;  4RTX A;  2FEI A;  1AOJ A;  5GJV B;  4AG1 C;  2H8H A;  1NLP C;  4J9I A;  2KR3 A;  3IQL A;  4ORZ A;  1UHF A;  5FW9 A;  1TUC A;  1ABQ A;  4AFQ C;  2O9S A;  4HVV A;  4AFU C;  2D0N A;  3QWY A;  4K11 A;  1KFZ A;  1IO6 A;  3QWX X;  2P4R A;  1M8M A;  1OPL A;  5IXF A;  2EYX A;  1G2B A;  2ROL A;  4Z8A A;  1WYX A;  3I9Q A;  5HCK A;  2KXD A;  2CUD A;  1UHC A;  3REA B;  4E6R A;  2AK5 A;  5FWC A;  1M3B A;  2JXB A;  2EPD A;  1FMK A;  2FRY A;  1W70 A;  2J05 A;  4JZ3 A;  4J9C A;  1EFN A;  3PVQ A;  3RBB B;  3VS5 A;  2DL4 A;  2KXC A;  1JEG A;  1UFF A;  2V1R A;  2SEM A;  2YUO A;  2LQW A;  2EW3 A;  2RPN A;  2O31 A;  3PE0 A;  2RNA A;  2AZV A;  4HVW A;  2VVK A;  1RI9 A;  1PKS A;  1AZE A;  1UJY A;  1UTI A;  1H3H A;  1JXM A;  4RTU A;  2KRS A;  2J6F A;  1VYT A;  3LH5 A;  1M3A A;  5IH2 A;  3M0S A;  1H92 A;  2AKK A;  2J7I A;  4DEY A;  2K9G A;  3SEM A;  2CT4 A;  4AFS C;  2FO0 A;  2C0O A;  1GCP A;  4OMN A;  1QWE A;  2DL5 A;  2KGT A;  1SHF A;  3I35 A;  2RQV A;  2EGC A;  2BTT A;  2O9V A;  2DMO A;  2JM8 A;  1ZBJ A;  2RQT A;  2PNI A;  1OV3 A;  1AWJ A;  1K4U S;  2RMO A;  2C0T A;  3EGU A;  5EC7 A;  1X43 A;  2DYB A;  4GLM A;  2EVR A;  2DNU A;  1QKW A;  2DA9 A;  2DL3 A;  2VWF A;  2JM9 A;  1AEY A;  2MIO A;  1OOT A;  3RNJ A;  3VS1 A;  4LUD A;  3M0U A;  1G83 A;  1PNJ A;  2DRK A;  4X1V A;  1YP5 A;  2KT1 A;  2KRN A;  3EG0 A;  2YT6 A;  3CQT A;  2DF6 A;  2YUQ A;  1MV3 A;  2O2O A;  1BK2 A;  2DLP A;  2DL7 A;  2L3P A;  1RLP C;  4JPB W;  4AFZ C;  2NUZ A;  4HCK A;  3C0C A;  4M4Z A;  4RTT A;  2JS2 A;  1HSQ A;  1U06 A;  2JMA A;  5L23 A;  2PZ1 A;  1SEM A;  1HD3 A;  1GBQ A;  1N5Z A;  1PRL C;  1KIK A;  1X27 A;  4ZNX A;  2PTK A;  1BB9 A;  2LX7 A;  4IIO A;  1JO8 A;  2K2M A;  1K0X A;  2KYM A;  1Z9Q A;  3VS2 A;  1E6H A;  2SRC A;  2KE9 A;  2V1Q A;  4D8D A;  2BZ8 A;  1CKA A;  2DE0 X;  2YDL A;  2DL8 A;  2VKN A;  2XMF A;  3U23 A;  2ED1 A;  4IIM A;  3KFV A;  2L3Q A;  2F2V A;  4CC7 A;  2EYY A;  1K1Z A;  1ABO A;  1T3S A;  2HDA A;  1WI7 A;  2EGE A;  1K76 A;  2FPD A;  4F14 A;  1UEC A;  4CC2 A;  1WXB A;  3VS3 A;  4R0K A;  2CRE A;  2DRM A;  2DX1 A;  3VS6 A;  4QT7 A;  2OJ2 A;  4WCI A;  1ZLM A;  2OI3 A;  2X3X D;  2GGR A;  3I5S A;  2FG0 A;  1SRL A;  2AKL A;  3NGP A;  1TUD A;  2G6F X;  3EHR A;  4Z88 A;  4Y92 A;  3M0T A;  1PHT A;  1AZG B;  2NWM A;  4ESR A;  2JW4 A;  1AWX A;  1U3O A;  4CC4 B;  1UJ0 A;  2CDT A;  1VYU A;  2FPE A;  1ARK A;  2RQU A;  1QLY A;  3VS7 A;  4JJB A;  1NEG A;  2DBK A;  3O5Z A;  1GBR A;  2EYW A;  3REB B;  1XOV A;  4RTV A;  1X69 A;  4AG2 C;  1I1J A;  2MCN A;  1PKT A;  2RF0 A;  1WXT A;  1NM7 A;  2QDL A;  3VRY A;  4JZ4 A;  4F17 A;  2DVJ A;  2RN8 A;  4J9B A;  2ECZ A;  2KYB A;  1FYN A;  1BU1 A;  3EG1 A;  1MV0 B;  2LJ1 A;  1AVZ C;  2RQR A;  2MOX A;  2K6D A;  1K0S A;  1QKX A;  2OAW A;  3EHQ A;  2K7A A;  2KRO A;  5IHN A;  1ZX6 A;  4J9G A;  1WIE A;  3H41 A;  2AZS A;  5I11 A;  2JTE A;  2ED0 A;  5ECA A;  4OMO A;  1WDX A;  2M51 A;  2GTJ A;  1HJD A;  2DM1 A;  5FWB A;  4OMM A;  2CUB A;  1B3Q A;  1X6B A;  4OML A;  1LCK A;  3SHW A;  3VS4 A;  1Y57 A;  1QWF A;  1ZUK A;  1JXO A;  3UA6 A;  2LMJ A;  3NMZ C;  2RQW A;  2FRW A;  1Z9Z A;  1X2K A;  1M30 A;  3GBQ A;  3FJ5 A;  1JQQ A;  2KT8 A;  1NYF A;  2BZY A;  3VRZ A;  2C0I A;  3H0F A;  2BZX A;  1VA7 A;  4J9E A;  2HSP A;  2A37 A;  1VYV A;  1MUZ A;  1SPK A;  3H0H A;  2ESW A;  2KBT A;  1AWW A;  2A08 A;  1CKB A;  2CSQ A;  2ABL A;  2CT3 A;  3JV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...