4CC3A

Complex of human tuba c-terminal sh3 domain and mena proline-rich peptide - h3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords DYNAMIN-BINDING PROTEIN
total genus 11
structure length 61
sequence length 61
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc3A00
1K76A 1M27C 1WXBA 2RMOA 1WI7A 2EQIA 4LE9A 3UA7A 2CH4W 1KSWA 4QT7A 2EYZA 3VS6A 2EGEA 1ARKA 1Z9QA 4HVVA 1JXOA 1X69A 4OMLA 4FSSA 4AFUC 1W1FA 2DL4A 2J7IA 3VS3A 2CREA 1NYGA 1ZUYA 1RI9A 1XOVA 1NEBA 1T0HA 2EW3A 2KEAA 4GLMA 3O5ZA 2DNUA 1I1JA 2K9GA 1OPKA 5ECAA 2C0OA 2W0ZA 2O2OA 3GBQA 2ESWA 2MIOA 1W6XA 1OPLA 1E7OA 1M3CA 2JS2A 2MCNA 1KIKA 1YWPA 1X2QA 1VA7A 2FRWA 2GQIA 1KFZA 2DE0X 4OMPA 2FO0A 1WX6A 2JS0A 2FRYA 2LQNA 2CT3A 1YNZA 1MV3A 2ABLA 3TSZA 2F2VA 3EHQA 5HCKA 2CH4A 1UJ0A 1T0JA 1EFNA 1WDXA 2YUQA 2GBQA 1GL5A 1M30A 3H0HA 2EPDA 4J9DA 1GCQC 3THKA 1PKSA 4IIOA 1PRLC 2VKNA 2D8JA 1UHCA 4AFQC 3VS5A 5I11A 2L2PA 2A36A 3H0FA 3IQLA 1Y0MA 1BK2A 3SEMA 2LQWA 2DL3A 2K7AA 4J9GA 1CKAA 2OAWA 1E6HA 3I5RA 4JZ4A 2JT4A 2D8HA 2O9VA 4E6RA 1Y57A 2RQVA 1TG0A 4AFZC 4J9FA 1ZLMA 3ULRB 2KR3A 1E6GA 1X43A 2G6FX 4CC7A 2C0IA 2DILA 3H41A 1BU1A 4DEYA 1GBQA 2KXDA 1PNJA 2DRKA 2M51A 5IHNA 4D8DA 1SPKA 1I07A 2LCSA 2YSQA 2DX1A 1YN8A 1SHGA 3NMZC 4RTZA 4AG1C 2PTKA 3REAB 2CDTA 2VWFA 2D1XA 3SHWA 1MV0B 1M8MA 1OEBA 1GCQA 1S1NA 2CSIA 2KT8A 1RUWA 1YP5A 2LZ6B 4Z8AA 5EC7A 1NM7A 2AKLA 2KROA 2GNCA 1GCPA 2KNBB 2A37A 3M0UA 3M0RA 2JMCA 2OJ2A 5IHIA 2DL5A 2HDAA 4LN2A 3C0CA 4Z89A 2RNAA 2KT1A 2YDLA 2RPNA 1WA7A 4RTWA 1QKWA 1HD3A 4GBQA 2FG0A 2L3QA 2LMJA 2LNHB 1IO6A 4IIMA 5IXFA 2JTEA 1BBZA 3EG3A 2DMOA 3KFVA 1U5SA 2GGRA 1UGVA 1ZUUA 4Y92A 1GFDA 1OV3A 4HVUA 2J6KA 2O88A 1WLPB 2DJQA 2ECZA 2J05A 1NLPC 4JPBW 4WCIA 3NHNA 5GJVB 2O31A 4AFSC 5GJWB 2FEIA 2GTOA 1HSQA 1ABOA 4RTXA 1FMKA 2EYYA 2W10A 2J6FA 1H92A 1ZBJA 2FPDA 1LCKA 2X3XD 3PVLA 4F17A 1SEMA 2LJ3A 2DBMA 4LUDA 1T3SA 1QKXA 4J9IA 1X2KA 2K6DA 2EGCA 1K4US 3FJ5A 1KJWA 1U3OA 4ZNXA 2NWMA 2C0TA 1QWEA 1H3HA 2HEQA 4ORZA 2CUBA 2L3PA 1K0XA 2DYBA 1GBRA 4D8KA 1JU5C 1PKTA 2BZ8A 2FPFA 1VYUA 2K79A 3QWYA 2HSPA 1ZSGA 1UJYA 1ABQA 2PZ1A 2DM1A 4KRTA 1FYNA 1UE9A 4J9EA 1G83A 2F2WA 2RQUA 2DRMA 4RTYA 1U06A 1JO8A 1WFWA 2IIMA 3I9QA 1AD5A 1AOJA 4LNPA 4J9HA 1NG2A 3NPFA 2FPEA 4F16A 1QLYA 3I35A 2O9SA 2KRNA 2CUDA 4RTVA 1I0CA 2SEMA 2YT6A 3UF4A 1TUCA 1ZUKA 2DF6A 2J6OA 2M0YA 2KYBA 3RBBB 3VS0A 2K2MA 4A63B 4JZ3A 2CT4A 5IXBA 1PRMC 1H8KA 1G2BA 1AEYA 2LJ0A 1WYXA 1NEGA 2LJ1A 2A28A 2JM8A 2JMAA 2ROTA 1AZGB 4J9BA 2B86A 2SRCA 2J06A 4HCKA 4JJDA 2HBWA 1K1ZA 2BZYA 2I0NA 3JV3A 2AZVA 1CSKA 2KXCA 3ZL7C 2AK5A 4X1VA 1WXTA 1UTIA 4CC2A 2A08A 3PVQA 3REBB 3RNJA 2XMFA 2LX7A 3U23A 3TVTA 1JQQA 2K3BA 3NGPA 1WIEA 1AVZC 2DA9A 3VS1A 4F14A 2EKHA 2JXBA 1M3AA 1A0NB 3EGUA 2NUZA 4LUEA 1VYVA 3M0PA 2ROLA 4J9CA 1NLOC 2P4RA 5I22A 1AWXA 2JM9A 3M0SA 5IH2A 1K9AA 2L3SA 2KGTA 1RLQC 2F2XA 2KRSA 1K0SA 2V1RA 3EG0A 2KE9A 2RQTA 5FWCA 2AZSA 1V1CA 1PWTA 1AWOA 3VRYA 2KRMA 1AWJA 3LH5A 1JXMA 3VS4A 5IHKA 2DBKA 3VS7A 5L23A 2EVRA 1WXUA 2ENMA 2YUPA 4ESRA 2RQWA 1UFFA 4JJBA 3A98A 3M0QA 2YUNA 1B3QA 1T3LA 2VVKA 3EG2A 2AKKA 2QDLA 4OMOA 2KBTA 2EBPA 1M3BA 2RN8A 1J3TA 1W70A 1SSHA 1SHFA 1BB9A 2EGAA 4R0KA 2DLPA 2ED1A 1YCSB 2PNIA 1VYTA 4OMQA 2MOXA 1B07A 2X3WD 4Z88A 2L0AA 3VS2A 1UECA 2EYWA 3VRZA 2YUOA 1QWFA 2CSQA 5FW9A 2GTJA 1TUDA 4EIKA 1CKBA 4DEXA 3I5SA 1UUEA 1OOTA 2DL7A 4RUGA 3PE0A 1N5ZA 1X6GA 4RTUA 4CC4B 3QWXX 3EHRA 2RF0A 2H8HA 3TSWA 2V1QA 2HCKA 3UATA 4AG2C 4HXJA 1UDLA 1UG1A 2D0NA 1ZX6A 4M4ZA 2RQRA 1SRLA 1HJDA 4JJCA 4OMNA 2DL8A 1GRIA 2EYXA 1QCFA 1RLPC 1PHTA 1NYFA 2OI3A 4OMMA 2ED0A 4K11A 1X27A 1X6BA 4HVWA 4RTTA 3M0TA 1GFCA 3R6NA 1JEGA 2E5KA 2BZXA 1SRMA 2JW4A 2KYMA 1Z9ZA 4CC3A 1UHFA 5FWBA 3H0IA 2LP5A 1AWWA 2BTTA 3EG1A 1MUZA 3CQTA 2DVJA 1AZEA 3UA6A 1YWOA
chains in the Genus database with same CATH superfamily
1M27C 3PIOA 4LE9A 4BE0A 2A7YA 3M58A 3MP6A 2RHXA 5GAN6 4RCCA 2P0KA 2EGEA 1UB4A 2COZA 3CCUA 1TXQA 4FSSA 4XTVA 3OS5A 1XOVA 2MF2A 3G6EA 5I21A 1BI3A 2C0OA 1LVKA 2PVOB 1VQ6Q 1IGUA 1C6VX 1M3CA 2JS2A 2JZ2A 2VXFA 1X2QA 1VA7A 3CCEQ 2FRWA 5GAOr 2DE0X 2FO0A 4ZGDB 1Q7YU 3S3OA 1D3BA 1OZ3A 4M77B 3EFOB 3R6OA 3TSZA 3QDFA 4KGZB 2CH4A 4QQ6A 3GP8A 4PJLA 1EFNA 3TQ7P 4M78F 2DTOA 1VQOQ 4BI4A 5GAOl 3EGXB 3THKA 2YWWA 4M75F 3VS5A 2A36A 2K4YA 3JCMb 2DJZA 1BK2A 3JB9G 3SEMA 3CD6T 1QVFA 2DL3A 5KCOA 2PUOB 2KAFA 3ZFJA 5CK9A 1CKAA 4J83A 1I5LA 4EMHA 4NS5A 3O8VA 3BFMA 1QVFP 3L1AA 3V7RA 3CCSA 2JTMA 4PJOG 4HKEA 1ZLMA 2G6FX 3M4YA 4CC7A 3CPFA 1KG1A 2BKDN 3JSCA 1GBQA 2EJ9A 2DRKA 5IHNA 4D8DA 3CC7A 3DB4A 1SPKA 1IGQA 3CD6A 2RI2A 3OQ5A 4M7DB 3OMCA 1Q81U 3HFOA 1S1NA 1RAEB 1RUWA 1X01A 2CP7A 5GMKh 1YJNQ 1K8AR 1QW1A 3CCVA 3GF5A 2RHYA 5CKBA 1D0XA 1N8RR 1GCPA 5GAMg 2KNBB 4C0DC 3M59A 3M0RA 1NJIC 1IXDA 1TU0B 2JMCA 2KY9A 5GMKi 1Q82R 2JJ9A 2FG0A 2L3QA 1M5Q1 1PCXA 3QO3A 4IIMA 5IXFA 1MGQA 3M54A 2HD0A 1PD0A 3KFVA 1U5SA 3M9QA 1IB8A 1GFDA 4KBMB 1OV3A 1JB0E 4KUDK 1M90C 4PFZA 3RR6A 4LDWA 2E1HA 3X24B 2DIGA 1MMDA 2FL7A 2O31A 2LT1A 4AFSC 1M4ZA 2E6ZA 3QJYA 2GTOA 3BY7A 4MZMA 4LD9K 2VGNA 3ZBDA 1KQSS 3X28B 1ABOA 1WHGA 3OYNA 2V8JA 2O4XA 1H92A 1ZBJA 2Z0WA 2XHCA 1FMVA 1BCMA 4OGEA 1T3SA 4J9IA 3CMET 1X2KA 1FWZA 2EGCA 1V29B 1VQ9A 3FJ5A 3RESA 2DD5A 1U3OA 2RJDA 2NWMA 2C0TA 1QWEA 4MDWA 1K0XA 2DYBA 1GBRA 4D8KA 3QDRB 3CPWS 1PKTA 4BI8B 4MDXA 4M7DG 2F5KA 2K79A 3QWYA 4C5GA 4QQDA 2RB6A 2NUTB 1BI0A 1R0BG 1ABQA 5J26A 4HA8A 4BY6B 5A0GA 5DM7R 3QBYA 3MKDA 4DBRA 4FW1A 1NJIR 1D1CA 2DXCA 4E7HA 3JCMW 1AD5A 2L5QA 1NG2A 3NPFA 3HRTA 4M78A 1D1BA 1QLYA 3M53A 2KRNA 1N9RA 1M1KU 3UF4A 1ZUKA 2DF6A 2P84A 2M0YA 3DLLA 3VS0A 3PMTA 4JZ3A 2CT4A 2RI3A 1AEYA 4M7DA 1NEGA 1Q81R 4M75D 4ZN1A 3WXMB 1VQ8T 2SRCA 3CCLQ 2R5MA 4FYXB 2H3EB 3QYHB 2BZYA 2I0NA 1CSKA 2DD4A 2KXCA 4AT1B 3CCVT 3BW1A 2DAQA 2P0PA 3CCMA 2LNVA 3G71A 2R58A 3CCQA 2I2LA 4E7IA 3OSSC 4JDSA 2KDSA 4F14A 3SDZA 4M78B 3PGGA 5A2QE 2NUZA 3BDLA 2E4HA 3EH2A 2LX9A 1OI1A 1VYVA 2ROLA 1VQPA 2EQKA 4M75A 5I22A 2EQMA 5GMKe 2JM9A 1K9AA 2L3SA 2KGTA 4LD6A 1RLQC 4XAXB 3EG0A 2KE9A 2EQUA 1PD1A 2NUPB 2QAZA 1PWTA 2XDBA 2MPXC 3VRYA 1AWJA 2DFUA 2LT4A 4A4EA 3VS4A 3HFNA 3HRUA 4EMGA 2L89A 3HP9A 2CP3A 4ESRA 2RQWA 5KYYA 1K8AU 5FRMA 5KYXA 4JJBA 4OVAA 2ZPGB 4EPCA 3S3NA 1T3LA 3EG2A 5CQXA 3I55A 2XD0A 2QDLA 5HK0A 3A8OB 1J3TA 2E70A 4B6MA 2DLPA 2PNIA 5GAN5 3P8HA 5LJ3f 4X9CA 4FW2A 4ELYC 1UECA 2CSQA 5FW9A 1VQNT 1WHLA 2DTIA 1CKBA 1KQSA 4DEXA 5GANd 1NBEB 2EAYA 5FU6C 5GAMe 2DZCA 4F7UF 2V1QA 2E64A 2HCKA 4M4ZA 3JB9H 1N8RC 4XK8E 4BB7A 5KYXB 1NZ9A 1YI2T 3M56A 2HQEA 1W2BA 4OMMA 1VQ8Q 4WTOB 5LJ5j 2K2VA 4HVWA 1XTDA 1QP3A 1K9MU 2PVDB 2LTOA 2ZPEB 2DEQA 4C92F 4M7AF 1KQ2A 3PIPA 3FLGA 4C92A 4M7AA 5FWBA 3FEOA 5GAN2 2BTTA 5CKHA 3CQTA 1ZSZB 3CXCA 1VQ9Q 4XTUA 1K76A 1YCYA 3OS2A 4C8QE 4M75E 1Q82U 3UA7A 2LCCA 1KSWA 3OS0A 4QT7A 2RJCA 4FIBA 3VS6A 2R5AA 1VQ5Q 1PG5B 1VQNQ 4C0FA 4NL3A 2YHTA 4AFUC 4HT9A 4XTXA 4OMFB 1RI9A 1NEBA 4M77F 2KEAA 4M77D 3O5ZA 1I1JA 2K9GA 3MJXA 5ECAA 4O5VA 3P8DA 3GBQA 1N9SA 4OP0A 2M9UA 4MZPA 3G4ST 3BE3A 2ZGWA 4J7FA 3PTAA 1OPLA 1E7OA 4XU3A 1I81A 1VQMQ 1KIKA 4EMKC 4FM4B 3NFCA 4OMPA 3JCMV 2FRYA 2ABLA 4E7ZA 1C1AA 2DXBA 3EH1A 5HCKA 5DY9A 2XDDA 1TS9A 1UJ0A 2GFUA 3RERA 4QQGA 4ZGJB 1M9SA 3LX7A 1NPPA 3G6ET 3CCRT 4IIOA 1Q82C 2VKNA 2D8JA 3FJPA 2OTLA 4RG8A 4C0DB 2ZPBB 3H0FA 1Y0MA 1YJWT 3A8MB 5GANj 2LQWA 5J39A 3CCJT 3L2ZA 1I8FA 3LYIA 4JZ4A 3L2RA 3MP8A 3RMSA 3I56A 2O9VA 2X51A 4E6RA 1XNIA 2RQVA 3JCMP 2E10A 3OW2A 3DKMA 1K9MC 1MNEA 5EG2A 3ULRB 2RK1A 1Q7YR 2A3LA 3CC4Q 5D6XA 2QEXA 3SWNA 3HKSA 4UC4A 2M02A 4PJOA 2YSQA 1BYMA 2DX1A 3SFMA 4Q5WA 3REAB 2HKQB 4BDZA 2CDTA 2EWNA 1VQPQ 2D1XA 2MWPA 1OEBA 2E12A 5FRNA 3I55Q 1WGSA 3A1PA 1O75A 4FSXA 1RACB 2P4TA 1VQNA 1RAHB 2GNCA 5CKDA 2A37A 2OJ2A 2DL5A 2HDAA 3CCQQ 2K3YA 3C0CA 1VQ7T 2KT1A 1UGSB 3CEYA 1XJWB 2RPNA 3VKIA 4RTWA 3OYLA 3CC4A 1OZ2A 1LJOA 1TTHB 2LMJA 2LNHB 4FYYB 3L2UA 2CP2A 4NOYA 2CZ0B 5KCHA 1JBMA 3L2VA 3FRNA 3CMAT 4Y92A 1PSEA 4GLKA 4V2SA 3NTHA 4A4FA 2CZ1B 2O88A 2GFAA 2DJQA 2ECZA 3CBMA 1NLPC 3M5AA 3CCUT 2DERA 4ANJA 4WCIA 4E2FB 5GJVB 5GJWB 4J6YA 3KXTA 1VQPT 1BI1A 3JCMc 2V8IA 2MMPA 5CAIA 3FIFA 2FPDA 2IPOB 2NUTA 2ZPIB 3OW2S 2LJ3A 2QA4Q 1QKXA 4DBQA 2K6DA 1MNDA 2DKGA 3KUFA 2GCXA 1R77A 3HRSA 4N4GA 4ELZC 4DA4A 3TEEA 2IG0A 3JCMf 4LDVA 2XDPA 3OA6A 1Q86R 1HYOA 3FC3A 2CUBA 1QVGS 3S6WA 4DOVA 1VQ7Q 5KYNA 3JB9D 4JJNK 1C0MA 2FPFA 2YRDA 1VYUA 2Y90A 2WSFE 3E2UA 1KD1U 3MEWA 3OBWA 2QQBA 2BE9B 2YXYA 4CRIA 1WHKA 3PMIA 1FYNA 1MMGA 2KQWA 2E41A 4J9EA 4PLIA 1KHIA 2RQUA 2WSEE 4Z02A 2L8DA 5CQYA 1JRIA 1U06A 4M78C 1AOJA 2EJFA 2FPEA 3DB3A 4F16A 1UGPB 5GAOn 4F04B 1YFNA 2SEMA 4PJOE 2Y4YA 2J6OA 2K57A 3JCMg 3AT1B 3LGLA 4PJOB 1YITA 3GIBA 1WHHA 2DK3A 1QVPA 1G2BA 1RAGB 2LJ0A 1VQLQ 6AT1B 5I2SA 4X9DA 3OY9A 4C8QB 2LC4A 2B86A 4HCKA 2J06A 4JJDA 5CKEA 3G1JA 2EFIA 3A5ZB 2HSEB 2PQWA 2AZVA 2OTJQ 4L6V5 3E9FA 3J81E 1BCOA 3ZL7C 4JUVA 3CCMT 4EMKA 4OB0B 1UTIA 1S72Q 1YHQQ 4C92D 4M7AD 2A08A 3RNJA 1PM3A 3GNGA 5GAMh 1YJ9Q 4KGVB 1QP2A 2NYSA 3QZ5B 4M77A 1JQQA 1KD1C 2K3BA 1MMNA 3MHXA 2HZYA 3RMQA 2QQ9A 3NGPA 2QQRA 2HL5C 1WIEA 2CP6A 1IHVA 2EKHA 4OF1A 3EGUA 3MPUB 4LUEA 4J9CA 4C5HA 5HKCA 4E47A 2H3JA 3M0SA 5IH2A 1BIBA 2E6NA 2F2XA 2OTLQ 2F1LA 2MI6A 2YRVA 2D0QB 3WVEB 2AZSA 1W2BS 2XU8A 2KRMA 3P8BB 2XI9A 2D6FA 4KGXB 5IHKA 2DETA 1B34A 1EX4A 2DBKA 4C0GA 1PC0A 1WXUA 2ENMA 1LNXA 2YUPA 4LXCA 2XKOC 3UDCA 2QASA 1OYXA 4RKUE 1UFFA 3A98A 1M90U 5GAOm 5C6SA 3EFRA 4KH0B 3EGDA 3PT9A 2AKKA 1YJWA 3LWHA 2RJEA 3G71Q 3CCJA 2EBPA 3A8GB 4II1A 4ZTFA 1WZOA 1OU9A 5LJ3h 3LH0A 3JB9J 2OAUA 1WJQA 1SSHA 1SHFA 4EDUA 1BB9A 4BE2A 2EGAA 4R0KA 4ZTJA 2ATCB 4E7KA 4ZN3A 1ACMB 2LQ8A 2DVEA 3OSVA 2MOXA 2VXEA 2E5QA 2X3WD 3CC2Q 3VS2A 2DYIA 3H8ZA 1VQOA 2YUOA 1QWFA 4NL2A 2GTJA 4M75G 4PJMA 3I5SA 1AHJB 4N0AA 1UUEA 5IAYA 2V26A 4BE1A 3PE0A 1BIAA 2FZGB 2QGFB 1N5ZA 4RTUA 4J5YA 2RF0A 2H8HA 4BACA 3TSWA 4E7LA 5IN1A 4OB3B 1Q81C 4HXJA 1UG1A 2D0NA 1ZX6A 4M7AB 4C92B 1HJDA 4JJCA 1YI2A 2MAMA 4OMNA 1VQ9T 1GRIA 1OULA 1M1FA 2EYXA 1TSFA 1PHTA 4K11A 4VUBA 2Y4XA 1GFCA 2E5KA 2BZXA 3OYBA 5GMKm 4RMOA 2KYMA 2YRCA 5GAN8 5LJ5f 1UHFA 3JCMJ 3CXCS 3EG1A 4E7JA 1MUZA 2KI7A 4M78D 3OYDA 3QJ6A 1WNLA 1OU8A 3UA6A 4FU6A 2MK5A 3CCJQ 1Y07A 1YIJQ 1WXBA 2ZPFB 4PFPA 2EQIA 1Y7XA 2CH4W 1RAAB 5D7UA 1M1GA 1ARKA 1Z9QA 4F7UE 2AHJB 1JXOA 2QTVA 1X69A 4OMLA 1I4K1 3L2WA 3CCMQ 4QVZA 1W1FA 2MYSA 2DL4A 3J80E 2J7IA 3VS3A 2QTXA 1NYGA 3QYGB 1T0HA 1YITQ 2FHDA 1D1AA 2X4XA 4PKCC 4HT8A 1JJ2P 3CMEQ 2PUKB 2ESWA 1W6XA 3CD6Q 2MCNA 1YIJT 2AT1B 3OBYA 4A54A 2GQIA 1KFZA 2NUPA 1UEBA 2JS0A 2LQNA 1YNZA 1MV3A 1BKBA 2QGGA 2QYZA 5LJ5d 3TU4K 2F2VA 2FVUA 1QMCA 4HCBA 2ZZDA 1ZSZC 4QW2A 1R0CB 2K5IA 4JRIA 2CP0A 3CCRA 2GBQA 1GL5A 1M30A 4J9DA 3JCMd 2OX7A 1KD1R 1PKSA 3I56Q 1PRLC 4C8QF 5HK3A 4AFQC 1UHCA 1NPRA 3GPLA 5I11A 2KK4A 3IQLA 4FL6A 5FU7C 4C5IA 4FCYA 3M57A 3MEUA 4M7DF 2IVWA 2K7AA 4J9GA 1UGQB 3CCET 2CYZB 3CPWA 2D8HA 1VQLA 3CBOA 2P0QA 2X9HA 1Y96A 1Y57A 1D0YA 1TG0A 4AFZC 3TREA 4J9FA 5GANf 3G4SQ 4E7SA 4XQ3A 1N27A 3NTKA 1E6GA 5FU6B 5A0DA 3H41A 3MO8A 4DEYA 2KXDA 3MCAB 3CC2T 2HL3A 4C8QC 1QCOA 3V7SA 4IUQA 1K73C 1N8RU 1B34B 2JNGA 1I07A 4M75C 5DLOA 3QKJA 1SHGA 4AG1C 2LVMA 1VQ6A 2VWFA 1MV0B 2DO3A 1GCQA 1S72A 3QUIA 4PNOA 2DXTA 1YP5A 1KHCA 5CR2A 5EC7A 3OYKA 2AKLA 3M0UA 3JB9I 1ZA2B 4TVRA 3VYHB 3HTRA 4DBHA 4B9WA 4Z89A 2XK0A 3VJPA 1WQWA 3JCMX 1WA7A 3ZEHA 4IUVA 5I2MA 2JTEA 1BBZA 2GQVA 1RABB 1Y71A 2DMOA 5KH6A 1UGVA 3JCMh 5LJ3e 4EMKB 2J6KA 2VASA 1WLPB 1K8AC 2J05A 4M7DD 4JPBW 5HY6A 1VUBA 2RJFA 1HSQA 4RTXA 1VQ7A 1FMKA 3RKWA 5GAMf 3FDRA 2J6FA 1R8OB 2VV5A 3CC4T 3CCLT 1LCKA 4F17A 1K9MR 1SEMA 3JRZA 4LUDA 4M78G 4XTYA 1M2OA 1K4US 4OB1B 4ZNXA 3SWNB 5J3BA 4ZGEB 1H3HA 4ORZA 2L3PA 2YLCA 1JU5C 4IUPA 2BZ8A 3JB9F 3CC7Q 4QKUA 3NTIA 3A8LB 2LDMA 1ZSGA 1EIFA 5GMKj 1YI2Q 4MMKA 3CXCP 3QSUA 4LDUA 2DM1A 1KC8R 4KRTA 1UE9A 2VYTA 5CKFA 4PJOF 1I5OB 1H3ZA 3V8JA 1JO8A 1WFWA 1QCNA 2IIMA 3I9QA 1WQ7A 2D9TA 1VQ4Q 2CS7A 2K5FA 4J9HA 4LNPA 1GXIE 1VQOT 2O9SA 2CUDA 1I0CA 2YT6A 4PJJA 1TUCA 5GAOq 4ME7A 2C06A 2ZAEA 3CCST 1SSFA 3RBBB 3ER0A 2K2MA 4A63B 1PRMC 3AHUA 5FLXE 1H8KA 1YJNA 1WYXA 2LJ1A 4XU0A 3PFSA 1M1KC 2LRQA 2ROTA 4J9BA 1D09B 2FYKA 2HBWA 1M1KR 3L2QA 3OYJA 2QQAA 3JV3A 4PL6A 1WPYA 9ATCB 3RUXA 4JLGA 2AK5A 1WXTA 2COWA 3SWNC 3REBB 3PNWC 4HCCA 3EG9A 2LQKA 2NLUA 5KYUA 2X4JA 5KYUB 3TVTA 1W4SA 1ZSZA 5GAMj 3EFSA 4N4IA 3CPWP 4N4HA 1TOVA 2JXBA 1G3SA 4R55A 3CCRQ 5LJ3g 4QVDA 2COYA 3M0PA 3OYEA 4M77E 2BUDA 1AWXA 4KUIA 2K3XA 2RD1A 4XU1A 1SF9A 2CKKA 3OYYA 1ZA1B 3E1SA 1H641 4OGCA 2R57A 1WHJA 3CMAA 1AWOA 3JAME 2JUFA 2EKOA 2YLBA 2RHUA 1JXMA 3RKYA 1M2VB 2EVRA 4J6XA 3LGFA 3RDVA 2AIRB 2ZPHB 2OTLT 3M0QA 1B3QA 2VVKA 1HXDA 3ASKA 3JCMQ 4OMOA 3T9NA 2KBTA 2GF7A 1VQMA 3CC7T 1M3BA 2RO0A 4C8QA 3MEVA 4BI3A 5M9OA 1W70A 2EQJA 1OX8A 3X26B 2ED1A 1OQKA 1RAFB 4Y28E 3N5BB 5CO7A 3URGA 1G3WA 4A53A 4B9XA 1W2BP 2VC8A 5GANh 1NJIU 4ATOA 3SD4A 1TUDA 2G3RA 1M8VA 1NE8A 1OOTA 2EJGA 2RK2A 2QEXT 1JJ2A 1FX7A 1X6GA 5GAOp 2OTJA 3QWXX 1JJ2S 2CZ6B 1YJNT 3CCLA 2E3IA 1RADB 2RQRA 4O6JA 1QCFA 1RI0A 2OI3A 2ED0A 2FZKB 2VB6A 3VUBA 1M2VA 1VQ6T 3R6NA 3EGXA 1VOMA 2K5LA 2X4WA 1SRMA 3CCVQ 1S72T 5DLQE 1Z9ZA 4CC3A 4WF2A 1VIFA 1WJSA 4MZTA 4XTWA 1VQKA 2DVJA 4IUTA 4F7UB 2CGHA 1BI2A 1AZEA 1Q86U 1VIEA 5KE2A 1YWOA 1P92A 1KC8C 1WJRA 3V7CA 2EYQA 1FMWA 3JCMe 2RMOA 1PSFA 3OYCA 1WI7A 2HAXA 2PVGB 2X4YA 1ZBXA 2ZCFB 2EYZA 4C8QD 4FYVB 4HVVA 2DIQA 3S3MA 2JVVA 1YJWQ 1HK9A 3UWNA 2CREA 1FXXA 3DLMA 1ZUYA 4QVCA 4A4HA 2EW3A 2HQXA 1Q7YC 4GLMA 2QA4A 2DNUA 5GMKl 1OPKA 4XTZA 4XU2A 2E3HA 2W0ZA 2O2OA 7AT1B 2MIOA 5LL6S 3FB9A 3E9GA 1YWPA 3INZA 5LJ5h 4M78E 4DQ2A 3LWIA 1WX6A 1X6OA 2CT3A 1G3TA 3TCJA 3META 4X34A 3EHQA 1TH7A 1ZHIA 1G5VA 2FZCB 1T0JA 3A8HB 3C12A 1WDXA 2YUQA 1SKUB 3H0HA 4M7DE 4PJNA 2EPDA 4RG2A 4IURA 3QIIA 1GCQC 3QG1A 3GNFB 2RI5A 1KQSP 3VV0A 1KQ1A 1KC8U 2L2PA 2RM4A 4J8OA 1Q86C 5C0MA 4L5GA 4F7UG 3G6EQ 2OAWA 4N0AC 1E6HA 3I5RA 2JT4A 4FT2A 4PFOA 1N6AA 5LJ3d 4M75B 2LCLA 4DOWA 1VQ5A 1B7TA 3HL8A 1YBYA 1O9SA 3OMGA 5KYYB 1G3YA 3MEAA 2KR3A 1X43A 1XQHA 1VQ4T 2C0IA 2DILA 3ME9A 1BU1A 5CIUA 3CMAQ 3OW2P 3H6ZA 4KH1B 1PNJA 2M51A 1QQJA 3KBGA 1F1BB 2RHIA 1SG5A 5KYWB 3E19A 4C92G 4M7AG 2LCSA 1D0ZA 1YN8A 3NMZC 4RTZA 5A0LA 2PTKA 1VQKT 2XICA 1Y96B 3SHWA 4DBFA 2F5TX 2F69A 1VQLT 4JRQA 1M8MA 2CSIA 2KT8A 3WVDB 3CCQT 1M90R 3C4SA 3RKXA 2QA4T 2LZ6B 4Z8AA 4P5NA 5KYWA 1NM7A 2KROA 2WACA 4C0ZA 2KVQG 2DPPB 5IHIA 3I55T 4LN2A 3VU3C 2RNAA 2YDLA 2DEUA 3SB2A 2M0OA 1UGRB 2X35A 1QKWA 1HD3A 4GBQA 3LLRA 1D3BB 2M1HA 3OYFA 1IO6A 2CZ7B 3OYIA 3X25B 4M77G 3EG3A 1WHMA 2GGRA 4RCBA 1ZUUA 1DJ7B 3M55A 4HVUA 2XG8D 4C5EA 4BUGA 3G7ZA 1QVFS 3NHNA 1VQMT 4JRPA 2FEIA 2O01E 2EYYA 2RA2A 2W10A 2QK0A 4J6WA 3BDUA 5GAMd 2X3XD 3PVLA 1YHQA 2DBMA 2V8KA 3HHTB 4JLIA 1KJWA 3CMEA 4PJOD 2HEQA 3G4SA 4FT4A 4KULA 4F7UA 4BDYA 3HPWA 2OTJT 3V8LA 2HSPA 2QQSA 1KK7A 3UT1A 4D6WA 1UJYA 3GLXA 4L59A 2PZ1A 5LJ5e 2MWOA 3OYHA 4LDXA 4JS5A 1G83A 2F2WA 2M16A 2DRMA 4RTYA 4Y91A 5D6WA 5GAN3 1MHNA 4LDYA 3I35A 1X75C 4RTVA 2B8AA 2CP5A 4R56A 3M4GA 8AT1B 3OYGA 4M7DC 2KSSA 2KYBA 4C92C 4M7AC 2PU9B 4J7IA 3QXEB 5IXBA 4JS4A 3EG9B 3J7AF 2RH2A 2A28A 2DTHA 2JM8A 2HNIA 2JMAA 1IREB 1AZGB 3CC2A 1IHWA 1MMAA 1K1ZA 2QG9B 4X1VA 3QHSA 4CC2A 2JN0A 3PVQA 3X20B 3Q1JA 2XMFA 4AMCA 2LX7A 3U23A 1EZZB 1LOJA 4PLLA 8ATCB 5KE3A 1VQ5T 1TWBA 3QZ9B 3EGDB 1AVZC 2DA9A 3VS1A 5FU7B 5CVIA 1M3AA 1A0NB 2L3RA 3VYGA 4IUUA 3F70A 2DXUA 1NLOC 2P4RA 3CCSQ 2DZ9A 3RIRA 4BY6C 5GAN7 3OB9A 2KRSA 1YHQT 1K0SA 1YIJA 3LW5E 5D6YA 2V1RA 5GANg 2RQTA 3QPHA 5FWCA 3L42A 4M77C 1V1CA 3I56T 3CBPA 2VUBA 3LH5A 1U8RA 4BD3A 1YJ9A 2HQHA 3VS7A 5L23A 5L8RE 4FYWB 5GANe 1ZQ1A 4KT0E 3C95A 2KMTA 2YUNA 4GY5A 1U1TA 5LJ3j 1AT1B 3GOXA 3UPUA 1QVGA 3MP1A 2RN8A 1IZ6A 3HSBA 2O4XB 2BE7D 2RHZA 1YCSB 1QVGP 2QEXQ 2BIVA 5GAN4 1VYTA 2HMAA 3CCEA 4OMQA 4A4GA 1B07A 3OYMA 5IT9E 4Z88A 2L0AA 1YJ9T 1Q95G 1RL2A 2EYWA 2WSCE 3VRZA 3OYAA 4MMLA 2JOYA 4C8QG 4CI0C 1U1SA 1TUGB 3CCUQ 4EIKA 2QDYB 4OB2B 3VUZA 4PK4A 2DL7A 4RUGA 3D7SB 5FROA 4CC4B 3EHRA 1IRXA 4A4KA 3UATA 2JTFA 4AG2C 1UDLA 5AT1B 1VQ4A 2FB7A 4PJOC 1SRLA 1VQ8A 2DL8A 3C94A 1VQKQ 1K73U 2EIFA 1RLPC 5CCAA 1OX9A 4C92E 4M7AE 1NYFA 3V8KA 1G8XA 1X27A 1X6BA 4JRKA 5AYFA 1K73R 1LPLA 3EAEA 4RTTA 3M0TA 2XIDA 2HBPA 1JEGA 1V76A 4IKFA 2JW4A 4HCZA 4YTLA 2QXFA 1RAIB 2E65A 3OS1A 1YITT 2QI2A 3H0IA 2LP5A 3EFOA 1AWWA 3G71T 5LJ5g 3H9NA 2A0FB 2HKNA 2VGMA
chains in the Genus database with same CATH topology
1K76A 1M27C 1WXBA 2RMOA 1WI7A 2EQIA 4LE9A 3UA7A 2CH4W 1KSWA 4QT7A 2EYZA 3VS6A 2EGEA 1ARKA 1Z9QA 4HVVA 1JXOA 1X69A 4OMLA 4FSSA 4AFUC 1W1FA 2DL4A 2J7IA 3VS3A 2CREA 1NYGA 1ZUYA 1RI9A 1XOVA 1NEBA 1T0HA 2EW3A 2KEAA 4GLMA 3O5ZA 2DNUA 1I1JA 2K9GA 1OPKA 5ECAA 2C0OA 2W0ZA 2O2OA 3GBQA 2ESWA 2MIOA 1W6XA 1OPLA 1E7OA 1M3CA 2JS2A 2MCNA 1KIKA 1YWPA 1X2QA 1VA7A 2FRWA 2GQIA 1KFZA 2DE0X 4OMPA 2FO0A 1WX6A 2JS0A 2FRYA 2LQNA 2CT3A 1YNZA 1MV3A 2ABLA 3TSZA 2F2VA 3EHQA 5HCKA 2CH4A 1UJ0A 1T0JA 1EFNA 1WDXA 2YUQA 2GBQA 1GL5A 1M30A 3H0HA 2EPDA 4J9DA 1GCQC 3THKA 1PKSA 4IIOA 1PRLC 2VKNA 2D8JA 1UHCA 4AFQC 3VS5A 5I11A 2L2PA 2A36A 3H0FA 3IQLA 1Y0MA 1BK2A 3SEMA 2LQWA 2DL3A 2K7AA 4J9GA 1CKAA 2OAWA 1E6HA 3I5RA 4JZ4A 2JT4A 2D8HA 2O9VA 4E6RA 1Y57A 2RQVA 1TG0A 4AFZC 4J9FA 1ZLMA 3ULRB 2KR3A 1E6GA 1X43A 2G6FX 4CC7A 2C0IA 2DILA 3H41A 1BU1A 4DEYA 1GBQA 2KXDA 1PNJA 2DRKA 2M51A 5IHNA 4D8DA 1SPKA 1I07A 2LCSA 2YSQA 2DX1A 1YN8A 1SHGA 3NMZC 4RTZA 4AG1C 2PTKA 3REAB 2CDTA 2VWFA 2D1XA 3SHWA 1MV0B 1M8MA 1OEBA 1GCQA 1S1NA 2CSIA 2KT8A 1RUWA 1YP5A 2LZ6B 4Z8AA 5EC7A 1NM7A 2AKLA 2KROA 2GNCA 1GCPA 2KNBB 2A37A 3M0UA 3M0RA 2JMCA 2OJ2A 5IHIA 2DL5A 2HDAA 4LN2A 3C0CA 4Z89A 2RNAA 2KT1A 2YDLA 2RPNA 1WA7A 4RTWA 1QKWA 1HD3A 4GBQA 2FG0A 2L3QA 2LMJA 2LNHB 1IO6A 4IIMA 5IXFA 2JTEA 1BBZA 3EG3A 2DMOA 3KFVA 1U5SA 2GGRA 1UGVA 1ZUUA 4Y92A 1GFDA 1OV3A 4HVUA 2J6KA 2O88A 1WLPB 2DJQA 2ECZA 2J05A 1NLPC 4JPBW 4WCIA 3NHNA 5GJVB 2O31A 4AFSC 5GJWB 2FEIA 2GTOA 1HSQA 1ABOA 4RTXA 1FMKA 2EYYA 2W10A 2J6FA 1H92A 1ZBJA 2FPDA 1LCKA 2X3XD 3PVLA 4F17A 1SEMA 2LJ3A 2DBMA 4LUDA 1T3SA 1QKXA 4J9IA 1X2KA 2K6DA 2EGCA 1K4US 3FJ5A 1KJWA 1U3OA 4ZNXA 2NWMA 2C0TA 1QWEA 1H3HA 2HEQA 4ORZA 2CUBA 2L3PA 1K0XA 2DYBA 1GBRA 4D8KA 1JU5C 1PKTA 2BZ8A 2FPFA 1VYUA 2K79A 3QWYA 2HSPA 1ZSGA 1UJYA 1ABQA 2PZ1A 2DM1A 4KRTA 1FYNA 1UE9A 4J9EA 1G83A 2F2WA 2RQUA 2DRMA 4RTYA 1U06A 1JO8A 1WFWA 2IIMA 3I9QA 1AD5A 1AOJA 4LNPA 4J9HA 1NG2A 3NPFA 2FPEA 4F16A 1QLYA 3I35A 2O9SA 2KRNA 2CUDA 4RTVA 1I0CA 2SEMA 2YT6A 3UF4A 1TUCA 1ZUKA 2DF6A 2J6OA 2M0YA 2KYBA 3RBBB 3VS0A 2K2MA 4A63B 4JZ3A 2CT4A 5IXBA 1PRMC 1H8KA 1G2BA 1AEYA 2LJ0A 1WYXA 1NEGA 2LJ1A 2A28A 2JM8A 2JMAA 2ROTA 1AZGB 4J9BA 2B86A 2SRCA 2J06A 4HCKA 4JJDA 2HBWA 1K1ZA 2BZYA 2I0NA 3JV3A 2AZVA 1CSKA 2KXCA 3ZL7C 2AK5A 4X1VA 1WXTA 1UTIA 4CC2A 2A08A 3PVQA 3REBB 3RNJA 2XMFA 2LX7A 3U23A 3TVTA 1JQQA 2K3BA 3NGPA 1WIEA 1AVZC 2DA9A 3VS1A 4F14A 2EKHA 2JXBA 1M3AA 1A0NB 3EGUA 2NUZA 4LUEA 1VYVA 3M0PA 2ROLA 4J9CA 1NLOC 2P4RA 5I22A 1AWXA 2JM9A 3M0SA 5IH2A 1K9AA 2L3SA 2KGTA 1RLQC 2F2XA 2KRSA 1K0SA 2V1RA 3EG0A 2KE9A 2RQTA 5FWCA 2AZSA 1V1CA 1PWTA 1AWOA 3VRYA 2KRMA 1AWJA 3LH5A 1JXMA 3VS4A 5IHKA 2DBKA 3VS7A 5L23A 2EVRA 1WXUA 2ENMA 2YUPA 4ESRA 2RQWA 1UFFA 4JJBA 3A98A 3M0QA 2YUNA 1B3QA 1T3LA 2VVKA 3EG2A 2AKKA 2QDLA 4OMOA 2KBTA 2EBPA 1M3BA 2RN8A 1J3TA 1W70A 1SSHA 1SHFA 1BB9A 2EGAA 4R0KA 2DLPA 2ED1A 1YCSB 2PNIA 1VYTA 4OMQA 2MOXA 1B07A 2X3WD 4Z88A 2L0AA 3VS2A 1UECA 2EYWA 3VRZA 2YUOA 1QWFA 2CSQA 5FW9A 2GTJA 1TUDA 4EIKA 1CKBA 4DEXA 3I5SA 1UUEA 1OOTA 2DL7A 4RUGA 3PE0A 1N5ZA 1X6GA 4RTUA 4CC4B 3QWXX 3EHRA 2RF0A 2H8HA 3TSWA 2V1QA 2HCKA 3UATA 4AG2C 4HXJA 1UDLA 1UG1A 2D0NA 1ZX6A 4M4ZA 2RQRA 1SRLA 1HJDA 4JJCA 4OMNA 2DL8A 1GRIA 2EYXA 1QCFA 1RLPC 1PHTA 1NYFA 2OI3A 4OMMA 2ED0A 4K11A 1X27A 1X6BA 4HVWA 4RTTA 3M0TA 1GFCA 3R6NA 1JEGA 2E5KA 2BZXA 1SRMA 2JW4A 2KYMA 1Z9ZA 4CC3A 1UHFA 5FWBA 3H0IA 2LP5A 1AWWA 2BTTA 3EG1A 1MUZA 3CQTA 2DVJA 1AZEA 3UA6A 1YWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K76 A;  1M27 C;  1WXB A;  2RMO A;  1WI7 A;  2EQI A;  4LE9 A;  3UA7 A;  2CH4 W;  1KSW A;  4QT7 A;  2EYZ A;  3VS6 A;  2EGE A;  1ARK A;  1Z9Q A;  4HVV A;  1JXO A;  1X69 A;  4OML A;  4FSS A;  4AFU C;  1W1F A;  2DL4 A;  2J7I A;  3VS3 A;  2CRE A;  1NYG A;  1ZUY A;  1RI9 A;  1XOV A;  1NEB A;  1T0H A;  2EW3 A;  2KEA A;  4GLM A;  3O5Z A;  2DNU A;  1I1J A;  2K9G A;  1OPK A;  5ECA A;  2C0O A;  2W0Z A;  2O2O A;  3GBQ A;  2ESW A;  2MIO A;  1W6X A;  1OPL A;  1E7O A;  1M3C A;  2JS2 A;  2MCN A;  1KIK A;  1YWP A;  1X2Q A;  1VA7 A;  2FRW A;  2GQI A;  1KFZ A;  2DE0 X;  4OMP A;  2FO0 A;  1WX6 A;  2JS0 A;  2FRY A;  2LQN A;  2CT3 A;  1YNZ A;  1MV3 A;  2ABL A;  3TSZ A;  2F2V A;  3EHQ A;  5HCK A;  2CH4 A;  1UJ0 A;  1T0J A;  1EFN A;  1WDX A;  2YUQ A;  2GBQ A;  1GL5 A;  1M30 A;  3H0H A;  2EPD A;  4J9D A;  1GCQ C;  3THK A;  1PKS A;  4IIO A;  1PRL C;  2VKN A;  2D8J A;  1UHC A;  4AFQ C;  3VS5 A;  5I11 A;  2L2P A;  2A36 A;  3H0F A;  3IQL A;  1Y0M A;  1BK2 A;  3SEM A;  2LQW A;  2DL3 A;  2K7A A;  4J9G A;  1CKA A;  2OAW A;  1E6H A;  3I5R A;  4JZ4 A;  2JT4 A;  2D8H A;  2O9V A;  4E6R A;  1Y57 A;  2RQV A;  1TG0 A;  4AFZ C;  4J9F A;  1ZLM A;  3ULR B;  2KR3 A;  1E6G A;  1X43 A;  2G6F X;  4CC7 A;  2C0I A;  2DIL A;  3H41 A;  1BU1 A;  4DEY A;  1GBQ A;  2KXD A;  1PNJ A;  2DRK A;  2M51 A;  5IHN A;  4D8D A;  1SPK A;  1I07 A;  2LCS A;  2YSQ A;  2DX1 A;  1YN8 A;  1SHG A;  3NMZ C;  4RTZ A;  4AG1 C;  2PTK A;  3REA B;  2CDT A;  2VWF A;  2D1X A;  3SHW A;  1MV0 B;  1M8M A;  1OEB A;  1GCQ A;  1S1N A;  2CSI A;  2KT8 A;  1RUW A;  1YP5 A;  2LZ6 B;  4Z8A A;  5EC7 A;  1NM7 A;  2AKL A;  2KRO A;  2GNC A;  1GCP A;  2KNB B;  2A37 A;  3M0U A;  3M0R A;  2JMC A;  2OJ2 A;  5IHI A;  2DL5 A;  2HDA A;  4LN2 A;  3C0C A;  4Z89 A;  2RNA A;  2KT1 A;  2YDL A;  2RPN A;  1WA7 A;  4RTW A;  1QKW A;  1HD3 A;  4GBQ A;  2FG0 A;  2L3Q A;  2LMJ A;  2LNH B;  1IO6 A;  4IIM A;  5IXF A;  2JTE A;  1BBZ A;  3EG3 A;  2DMO A;  3KFV A;  1U5S A;  2GGR A;  1UGV A;  1ZUU A;  4Y92 A;  1GFD A;  1OV3 A;  4HVU A;  2J6K A;  2O88 A;  1WLP B;  2DJQ A;  2ECZ A;  2J05 A;  1NLP C;  4JPB W;  4WCI A;  3NHN A;  5GJV B;  2O31 A;  4AFS C;  5GJW B;  2FEI A;  2GTO A;  1HSQ A;  1ABO A;  4RTX A;  1FMK A;  2EYY A;  2W10 A;  2J6F A;  1H92 A;  1ZBJ A;  2FPD A;  1LCK A;  2X3X D;  3PVL A;  4F17 A;  1SEM A;  2LJ3 A;  2DBM A;  4LUD A;  1T3S A;  1QKX A;  4J9I A;  1X2K A;  2K6D A;  2EGC A;  1K4U S;  3FJ5 A;  1KJW A;  1U3O A;  4ZNX A;  2NWM A;  2C0T A;  1QWE A;  1H3H A;  2HEQ A;  4ORZ A;  2CUB A;  2L3P A;  1K0X A;  2DYB A;  1GBR A;  4D8K A;  1JU5 C;  1PKT A;  2BZ8 A;  2FPF A;  1VYU A;  2K79 A;  3QWY A;  2HSP A;  1ZSG A;  1UJY A;  1ABQ A;  2PZ1 A;  2DM1 A;  4KRT A;  1FYN A;  1UE9 A;  4J9E A;  1G83 A;  2F2W A;  2RQU A;  2DRM A;  4RTY A;  1U06 A;  1JO8 A;  1WFW A;  2IIM A;  3I9Q A;  1AD5 A;  1AOJ A;  4LNP A;  4J9H A;  1NG2 A;  3NPF A;  2FPE A;  4F16 A;  1QLY A;  3I35 A;  2O9S A;  2KRN A;  2CUD A;  4RTV A;  1I0C A;  2SEM A;  2YT6 A;  3UF4 A;  1TUC A;  1ZUK A;  2DF6 A;  2J6O A;  2M0Y A;  2KYB A;  3RBB B;  3VS0 A;  2K2M A;  4A63 B;  4JZ3 A;  2CT4 A;  5IXB A;  1PRM C;  1H8K A;  1G2B A;  1AEY A;  2LJ0 A;  1WYX A;  1NEG A;  2LJ1 A;  2A28 A;  2JM8 A;  2JMA A;  2ROT A;  1AZG B;  4J9B A;  2B86 A;  2SRC A;  2J06 A;  4HCK A;  4JJD A;  2HBW A;  1K1Z A;  2BZY A;  2I0N A;  3JV3 A;  2AZV A;  1CSK A;  2KXC A;  3ZL7 C;  2AK5 A;  4X1V A;  1WXT A;  1UTI A;  4CC2 A;  2A08 A;  3PVQ A;  3REB B;  3RNJ A;  2XMF A;  2LX7 A;  3U23 A;  3TVT A;  1JQQ A;  2K3B A;  3NGP A;  1WIE A;  1AVZ C;  2DA9 A;  3VS1 A;  4F14 A;  2EKH A;  2JXB A;  1M3A A;  1A0N B;  3EGU A;  2NUZ A;  4LUE A;  1VYV A;  3M0P A;  2ROL A;  4J9C A;  1NLO C;  2P4R A;  5I22 A;  1AWX A;  2JM9 A;  3M0S A;  5IH2 A;  1K9A A;  2L3S A;  2KGT A;  1RLQ C;  2F2X A;  2KRS A;  1K0S A;  2V1R A;  3EG0 A;  2KE9 A;  2RQT A;  5FWC A;  2AZS A;  1V1C A;  1PWT A;  1AWO A;  3VRY A;  2KRM A;  1AWJ A;  3LH5 A;  1JXM A;  3VS4 A;  5IHK A;  2DBK A;  3VS7 A;  5L23 A;  2EVR A;  1WXU A;  2ENM A;  2YUP A;  4ESR A;  2RQW A;  1UFF A;  4JJB A;  3A98 A;  3M0Q A;  2YUN A;  1B3Q A;  1T3L A;  2VVK A;  3EG2 A;  2AKK A;  2QDL A;  4OMO A;  2KBT A;  2EBP A;  1M3B A;  2RN8 A;  1J3T A;  1W70 A;  1SSH A;  1SHF A;  1BB9 A;  2EGA A;  4R0K A;  2DLP A;  2ED1 A;  1YCS B;  2PNI A;  1VYT A;  4OMQ A;  2MOX A;  1B07 A;  2X3W D;  4Z88 A;  2L0A A;  3VS2 A;  1UEC A;  2EYW A;  3VRZ A;  2YUO A;  1QWF A;  2CSQ A;  5FW9 A;  2GTJ A;  1TUD A;  4EIK A;  1CKB A;  4DEX A;  3I5S A;  1UUE A;  1OOT A;  2DL7 A;  4RUG A;  3PE0 A;  1N5Z A;  1X6G A;  4RTU A;  4CC4 B;  3QWX X;  3EHR A;  2RF0 A;  2H8H A;  3TSW A;  2V1Q A;  2HCK A;  3UAT A;  4AG2 C;  4HXJ A;  1UDL A;  1UG1 A;  2D0N A;  1ZX6 A;  4M4Z A;  2RQR A;  1SRL A;  1HJD A;  4JJC A;  4OMN A;  2DL8 A;  1GRI A;  2EYX A;  1QCF A;  1RLP C;  1PHT A;  1NYF A;  2OI3 A;  4OMM A;  2ED0 A;  4K11 A;  1X27 A;  1X6B A;  4HVW A;  4RTT A;  3M0T A;  1GFC A;  3R6N A;  1JEG A;  2E5K A;  2BZX A;  1SRM A;  2JW4 A;  2KYM A;  1Z9Z A;  4CC3 A;  1UHF A;  5FWB A;  3H0I A;  2LP5 A;  1AWW A;  2BTT A;  3EG1 A;  1MUZ A;  3CQT A;  2DVJ A;  1AZE A;  3UA6 A;  1YWO A; 
#chains in the Genus database with same CATH topology
 1M27 C;  3PIO A;  4LE9 A;  4BE0 A;  2A7Y A;  3M58 A;  3MP6 A;  2RHX A;  5GAN 6;  4RCC A;  2P0K A;  2EGE A;  1UB4 A;  2COZ A;  3CCU A;  1TXQ A;  4FSS A;  4XTV A;  3OS5 A;  1XOV A;  2MF2 A;  3G6E A;  5I21 A;  1BI3 A;  2C0O A;  1LVK A;  2PVO B;  1VQ6 Q;  1IGU A;  1C6V X;  1M3C A;  2JS2 A;  2JZ2 A;  2VXF A;  1X2Q A;  1VA7 A;  3CCE Q;  2FRW A;  5GAO r;  2DE0 X;  2FO0 A;  4ZGD B;  1Q7Y U;  3S3O A;  1D3B A;  1OZ3 A;  4M77 B;  3EFO B;  3R6O A;  3TSZ A;  3QDF A;  4KGZ B;  2CH4 A;  4QQ6 A;  3GP8 A;  4PJL A;  1EFN A;  3TQ7 P;  4M78 F;  2DTO A;  1VQO Q;  4BI4 A;  5GAO l;  3EGX B;  3THK A;  2YWW A;  4M75 F;  3VS5 A;  2A36 A;  2K4Y A;  3JCM b;  2DJZ A;  1BK2 A;  3JB9 G;  3SEM A;  3CD6 T;  1QVF A;  2DL3 A;  5KCO A;  2PUO B;  2KAF A;  3ZFJ A;  5CK9 A;  1CKA A;  4J83 A;  1I5L A;  4EMH A;  4NS5 A;  3O8V A;  3BFM A;  1QVF P;  3L1A A;  3V7R A;  3CCS A;  2JTM A;  4PJO G;  4HKE A;  1ZLM A;  2G6F X;  3M4Y A;  4CC7 A;  3CPF A;  1KG1 A;  2BKD N;  3JSC A;  1GBQ A;  2EJ9 A;  2DRK A;  5IHN A;  4D8D A;  3CC7 A;  3DB4 A;  1SPK A;  1IGQ A;  3CD6 A;  2RI2 A;  3OQ5 A;  4M7D B;  3OMC A;  1Q81 U;  3HFO A;  1S1N A;  1RAE B;  1RUW A;  1X01 A;  2CP7 A;  5GMK h;  1YJN Q;  1K8A R;  1QW1 A;  3CCV A;  3GF5 A;  2RHY A;  5CKB A;  1D0X A;  1N8R R;  1GCP A;  5GAM g;  2KNB B;  4C0D C;  3M59 A;  3M0R A;  1NJI C;  1IXD A;  1TU0 B;  2JMC A;  2KY9 A;  5GMK i;  1Q82 R;  2JJ9 A;  2FG0 A;  2L3Q A;  1M5Q 1;  1PCX A;  3QO3 A;  4IIM A;  5IXF A;  1MGQ A;  3M54 A;  2HD0 A;  1PD0 A;  3KFV A;  1U5S A;  3M9Q A;  1IB8 A;  1GFD A;  4KBM B;  1OV3 A;  1JB0 E;  4KUD K;  1M90 C;  4PFZ A;  3RR6 A;  4LDW A;  2E1H A;  3X24 B;  2DIG A;  1MMD A;  2FL7 A;  2O31 A;  2LT1 A;  4AFS C;  1M4Z A;  2E6Z A;  3QJY A;  2GTO A;  3BY7 A;  4MZM A;  4LD9 K;  2VGN A;  3ZBD A;  1KQS S;  3X28 B;  1ABO A;  1WHG A;  3OYN A;  2V8J A;  2O4X A;  1H92 A;  1ZBJ A;  2Z0W A;  2XHC A;  1FMV A;  1BCM A;  4OGE A;  1T3S A;  4J9I A;  3CME T;  1X2K A;  1FWZ A;  2EGC A;  1V29 B;  1VQ9 A;  3FJ5 A;  3RES A;  2DD5 A;  1U3O A;  2RJD A;  2NWM A;  2C0T A;  1QWE A;  4MDW A;  1K0X A;  2DYB A;  1GBR A;  4D8K A;  3QDR B;  3CPW S;  1PKT A;  4BI8 B;  4MDX A;  4M7D G;  2F5K A;  2K79 A;  3QWY A;  4C5G A;  4QQD A;  2RB6 A;  2NUT B;  1BI0 A;  1R0B G;  1ABQ A;  5J26 A;  4HA8 A;  4BY6 B;  5A0G A;  5DM7 R;  3QBY A;  3MKD A;  4DBR A;  4FW1 A;  1NJI R;  1D1C A;  2DXC A;  4E7H A;  3JCM W;  1AD5 A;  2L5Q A;  1NG2 A;  3NPF A;  3HRT A;  4M78 A;  1D1B A;  1QLY A;  3M53 A;  2KRN A;  1N9R A;  1M1K U;  3UF4 A;  1ZUK A;  2DF6 A;  2P84 A;  2M0Y A;  3DLL A;  3VS0 A;  3PMT A;  4JZ3 A;  2CT4 A;  2RI3 A;  1AEY A;  4M7D A;  1NEG A;  1Q81 R;  4M75 D;  4ZN1 A;  3WXM B;  1VQ8 T;  2SRC A;  3CCL Q;  2R5M A;  4FYX B;  2H3E B;  3QYH B;  2BZY A;  2I0N A;  1CSK A;  2DD4 A;  2KXC A;  4AT1 B;  3CCV T;  3BW1 A;  2DAQ A;  2P0P A;  3CCM A;  2LNV A;  3G71 A;  2R58 A;  3CCQ A;  2I2L A;  4E7I A;  3OSS C;  4JDS A;  2KDS A;  4F14 A;  3SDZ A;  4M78 B;  3PGG A;  5A2Q E;  2NUZ A;  3BDL A;  2E4H A;  3EH2 A;  2LX9 A;  1OI1 A;  1VYV A;  2ROL A;  1VQP A;  2EQK A;  4M75 A;  5I22 A;  2EQM A;  5GMK e;  2JM9 A;  1K9A A;  2L3S A;  2KGT A;  4LD6 A;  1RLQ C;  4XAX B;  3EG0 A;  2KE9 A;  2EQU A;  1PD1 A;  2NUP B;  2QAZ A;  1PWT A;  2XDB A;  2MPX C;  3VRY A;  1AWJ A;  2DFU A;  2LT4 A;  4A4E A;  3VS4 A;  3HFN A;  3HRU A;  4EMG A;  2L89 A;  3HP9 A;  2CP3 A;  4ESR A;  2RQW A;  5KYY A;  1K8A U;  5FRM A;  5KYX A;  4JJB A;  4OVA A;  2ZPG B;  4EPC A;  3S3N A;  1T3L A;  3EG2 A;  5CQX A;  3I55 A;  2XD0 A;  2QDL A;  5HK0 A;  3A8O B;  1J3T A;  2E70 A;  4B6M A;  2DLP A;  2PNI A;  5GAN 5;  3P8H A;  5LJ3 f;  4X9C A;  4FW2 A;  4ELY C;  1UEC A;  2CSQ A;  5FW9 A;  1VQN T;  1WHL A;  2DTI A;  1CKB A;  1KQS A;  4DEX A;  5GAN d;  1NBE B;  2EAY A;  5FU6 C;  5GAM e;  2DZC A;  4F7U F;  2V1Q A;  2E64 A;  2HCK A;  4M4Z A;  3JB9 H;  1N8R C;  4XK8 E;  4BB7 A;  5KYX B;  1NZ9 A;  1YI2 T;  3M56 A;  2HQE A;  1W2B A;  4OMM A;  1VQ8 Q;  4WTO B;  5LJ5 j;  2K2V A;  4HVW A;  1XTD A;  1QP3 A;  1K9M U;  2PVD B;  2LTO A;  2ZPE B;  2DEQ A;  4C92 F;  4M7A F;  1KQ2 A;  3PIP A;  3FLG A;  4C92 A;  4M7A A;  5FWB A;  3FEO A;  5GAN 2;  2BTT A;  5CKH A;  3CQT A;  1ZSZ B;  3CXC A;  1VQ9 Q;  4XTU A;  1K76 A;  1YCY A;  3OS2 A;  4C8Q E;  4M75 E;  1Q82 U;  3UA7 A;  2LCC A;  1KSW A;  3OS0 A;  4QT7 A;  2RJC A;  4FIB A;  3VS6 A;  2R5A A;  1VQ5 Q;  1PG5 B;  1VQN Q;  4C0F A;  4NL3 A;  2YHT A;  4AFU C;  4HT9 A;  4XTX A;  4OMF B;  1RI9 A;  1NEB A;  4M77 F;  2KEA A;  4M77 D;  3O5Z A;  1I1J A;  2K9G A;  3MJX A;  5ECA A;  4O5V A;  3P8D A;  3GBQ A;  1N9S A;  4OP0 A;  2M9U A;  4MZP A;  3G4S T;  3BE3 A;  2ZGW A;  4J7F A;  3PTA A;  1OPL A;  1E7O A;  4XU3 A;  1I81 A;  1VQM Q;  1KIK A;  4EMK C;  4FM4 B;  3NFC A;  4OMP A;  3JCM V;  2FRY A;  2ABL A;  4E7Z A;  1C1A A;  2DXB A;  3EH1 A;  5HCK A;  5DY9 A;  2XDD A;  1TS9 A;  1UJ0 A;  2GFU A;  3RER A;  4QQG A;  4ZGJ B;  1M9S A;  3LX7 A;  1NPP A;  3G6E T;  3CCR T;  4IIO A;  1Q82 C;  2VKN A;  2D8J A;  3FJP A;  2OTL A;  4RG8 A;  4C0D B;  2ZPB B;  3H0F A;  1Y0M A;  1YJW T;  3A8M B;  5GAN j;  2LQW A;  5J39 A;  3CCJ T;  3L2Z A;  1I8F A;  3LYI A;  4JZ4 A;  3L2R A;  3MP8 A;  3RMS A;  3I56 A;  2O9V A;  2X51 A;  4E6R A;  1XNI A;  2RQV A;  3JCM P;  2E10 A;  3OW2 A;  3DKM A;  1K9M C;  1MNE A;  5EG2 A;  3ULR B;  2RK1 A;  1Q7Y R;  2A3L A;  3CC4 Q;  5D6X A;  2QEX A;  3SWN A;  3HKS A;  4UC4 A;  2M02 A;  4PJO A;  2YSQ A;  1BYM A;  2DX1 A;  3SFM A;  4Q5W A;  3REA B;  2HKQ B;  4BDZ A;  2CDT A;  2EWN A;  1VQP Q;  2D1X A;  2MWP A;  1OEB A;  2E12 A;  5FRN A;  3I55 Q;  1WGS A;  3A1P A;  1O75 A;  4FSX A;  1RAC B;  2P4T A;  1VQN A;  1RAH B;  2GNC A;  5CKD A;  2A37 A;  2OJ2 A;  2DL5 A;  2HDA A;  3CCQ Q;  2K3Y A;  3C0C A;  1VQ7 T;  2KT1 A;  1UGS B;  3CEY A;  1XJW B;  2RPN A;  3VKI A;  4RTW A;  3OYL A;  3CC4 A;  1OZ2 A;  1LJO A;  1TTH B;  2LMJ A;  2LNH B;  4FYY B;  3L2U A;  2CP2 A;  4NOY A;  2CZ0 B;  5KCH A;  1JBM A;  3L2V A;  3FRN A;  3CMA T;  4Y92 A;  1PSE A;  4GLK A;  4V2S A;  3NTH A;  4A4F A;  2CZ1 B;  2O88 A;  2GFA A;  2DJQ A;  2ECZ A;  3CBM A;  1NLP C;  3M5A A;  3CCU T;  2DER A;  4ANJ A;  4WCI A;  4E2F B;  5GJV B;  5GJW B;  4J6Y A;  3KXT A;  1VQP T;  1BI1 A;  3JCM c;  2V8I A;  2MMP A;  5CAI A;  3FIF A;  2FPD A;  2IPO B;  2NUT A;  2ZPI B;  3OW2 S;  2LJ3 A;  2QA4 Q;  1QKX A;  4DBQ A;  2K6D A;  1MND A;  2DKG A;  3KUF A;  2GCX A;  1R77 A;  3HRS A;  4N4G A;  4ELZ C;  4DA4 A;  3TEE A;  2IG0 A;  3JCM f;  4LDV A;  2XDP A;  3OA6 A;  1Q86 R;  1HYO A;  3FC3 A;  2CUB A;  1QVG S;  3S6W A;  4DOV A;  1VQ7 Q;  5KYN A;  3JB9 D;  4JJN K;  1C0M A;  2FPF A;  2YRD A;  1VYU A;  2Y90 A;  2WSF E;  3E2U A;  1KD1 U;  3MEW A;  3OBW A;  2QQB A;  2BE9 B;  2YXY A;  4CRI A;  1WHK A;  3PMI A;  1FYN A;  1MMG A;  2KQW A;  2E41 A;  4J9E A;  4PLI A;  1KHI A;  2RQU A;  2WSE E;  4Z02 A;  2L8D A;  5CQY A;  1JRI A;  1U06 A;  4M78 C;  1AOJ A;  2EJF A;  2FPE A;  3DB3 A;  4F16 A;  1UGP B;  5GAO n;  4F04 B;  1YFN A;  2SEM A;  4PJO E;  2Y4Y A;  2J6O A;  2K57 A;  3JCM g;  3AT1 B;  3LGL A;  4PJO B;  1YIT A;  3GIB A;  1WHH A;  2DK3 A;  1QVP A;  1G2B A;  1RAG B;  2LJ0 A;  1VQL Q;  6AT1 B;  5I2S A;  4X9D A;  3OY9 A;  4C8Q B;  2LC4 A;  2B86 A;  4HCK A;  2J06 A;  4JJD A;  5CKE A;  3G1J A;  2EFI A;  3A5Z B;  2HSE B;  2PQW A;  2AZV A;  2OTJ Q;  4L6V 5;  3E9F A;  3J81 E;  1BCO A;  3ZL7 C;  4JUV A;  3CCM T;  4EMK A;  4OB0 B;  1UTI A;  1S72 Q;  1YHQ Q;  4C92 D;  4M7A D;  2A08 A;  3RNJ A;  1PM3 A;  3GNG A;  5GAM h;  1YJ9 Q;  4KGV B;  1QP2 A;  2NYS A;  3QZ5 B;  4M77 A;  1JQQ A;  1KD1 C;  2K3B A;  1MMN A;  3MHX A;  2HZY A;  3RMQ A;  2QQ9 A;  3NGP A;  2QQR A;  2HL5 C;  1WIE A;  2CP6 A;  1IHV A;  2EKH A;  4OF1 A;  3EGU A;  3MPU B;  4LUE A;  4J9C A;  4C5H A;  5HKC A;  4E47 A;  2H3J A;  3M0S A;  5IH2 A;  1BIB A;  2E6N A;  2F2X A;  2OTL Q;  2F1L A;  2MI6 A;  2YRV A;  2D0Q B;  3WVE B;  2AZS A;  1W2B S;  2XU8 A;  2KRM A;  3P8B B;  2XI9 A;  2D6F A;  4KGX B;  5IHK A;  2DET A;  1B34 A;  1EX4 A;  2DBK A;  4C0G A;  1PC0 A;  1WXU A;  2ENM A;  1LNX A;  2YUP A;  4LXC A;  2XKO C;  3UDC A;  2QAS A;  1OYX A;  4RKU E;  1UFF A;  3A98 A;  1M90 U;  5GAO m;  5C6S A;  3EFR A;  4KH0 B;  3EGD A;  3PT9 A;  2AKK A;  1YJW A;  3LWH A;  2RJE A;  3G71 Q;  3CCJ A;  2EBP A;  3A8G B;  4II1 A;  4ZTF A;  1WZO A;  1OU9 A;  5LJ3 h;  3LH0 A;  3JB9 J;  2OAU A;  1WJQ A;  1SSH A;  1SHF A;  4EDU A;  1BB9 A;  4BE2 A;  2EGA A;  4R0K A;  4ZTJ A;  2ATC B;  4E7K A;  4ZN3 A;  1ACM B;  2LQ8 A;  2DVE A;  3OSV A;  2MOX A;  2VXE A;  2E5Q A;  2X3W D;  3CC2 Q;  3VS2 A;  2DYI A;  3H8Z A;  1VQO A;  2YUO A;  1QWF A;  4NL2 A;  2GTJ A;  4M75 G;  4PJM A;  3I5S A;  1AHJ B;  4N0A A;  1UUE A;  5IAY A;  2V26 A;  4BE1 A;  3PE0 A;  1BIA A;  2FZG B;  2QGF B;  1N5Z A;  4RTU A;  4J5Y A;  2RF0 A;  2H8H A;  4BAC A;  3TSW A;  4E7L A;  5IN1 A;  4OB3 B;  1Q81 C;  4HXJ A;  1UG1 A;  2D0N A;  1ZX6 A;  4M7A B;  4C92 B;  1HJD A;  4JJC A;  1YI2 A;  2MAM A;  4OMN A;  1VQ9 T;  1GRI A;  1OUL A;  1M1F A;  2EYX A;  1TSF A;  1PHT A;  4K11 A;  4VUB A;  2Y4X A;  1GFC A;  2E5K A;  2BZX A;  3OYB A;  5GMK m;  4RMO A;  2KYM A;  2YRC A;  5GAN 8;  5LJ5 f;  1UHF A;  3JCM J;  3CXC S;  3EG1 A;  4E7J A;  1MUZ A;  2KI7 A;  4M78 D;  3OYD A;  3QJ6 A;  1WNL A;  1OU8 A;  3UA6 A;  4FU6 A;  2MK5 A;  3CCJ Q;  1Y07 A;  1YIJ Q;  1WXB A;  2ZPF B;  4PFP A;  2EQI A;  1Y7X A;  2CH4 W;  1RAA B;  5D7U A;  1M1G A;  1ARK A;  1Z9Q A;  4F7U E;  2AHJ B;  1JXO A;  2QTV A;  1X69 A;  4OML A;  1I4K 1;  3L2W A;  3CCM Q;  4QVZ A;  1W1F A;  2MYS A;  2DL4 A;  3J80 E;  2J7I A;  3VS3 A;  2QTX A;  1NYG A;  3QYG B;  1T0H A;  1YIT Q;  2FHD A;  1D1A A;  2X4X A;  4PKC C;  4HT8 A;  1JJ2 P;  3CME Q;  2PUK B;  2ESW A;  1W6X A;  3CD6 Q;  2MCN A;  1YIJ T;  2AT1 B;  3OBY A;  4A54 A;  2GQI A;  1KFZ A;  2NUP A;  1UEB A;  2JS0 A;  2LQN A;  1YNZ A;  1MV3 A;  1BKB A;  2QGG A;  2QYZ A;  5LJ5 d;  3TU4 K;  2F2V A;  2FVU A;  1QMC A;  4HCB A;  2ZZD A;  1ZSZ C;  4QW2 A;  1R0C B;  2K5I A;  4JRI A;  2CP0 A;  3CCR A;  2GBQ A;  1GL5 A;  1M30 A;  4J9D A;  3JCM d;  2OX7 A;  1KD1 R;  1PKS A;  3I56 Q;  1PRL C;  4C8Q F;  5HK3 A;  4AFQ C;  1UHC A;  1NPR A;  3GPL A;  5I11 A;  2KK4 A;  3IQL A;  4FL6 A;  5FU7 C;  4C5I A;  4FCY A;  3M57 A;  3MEU A;  4M7D F;  2IVW A;  2K7A A;  4J9G A;  1UGQ B;  3CCE T;  2CYZ B;  3CPW A;  2D8H A;  1VQL A;  3CBO A;  2P0Q A;  2X9H A;  1Y96 A;  1Y57 A;  1D0Y A;  1TG0 A;  4AFZ C;  3TRE A;  4J9F A;  5GAN f;  3G4S Q;  4E7S A;  4XQ3 A;  1N27 A;  3NTK A;  1E6G A;  5FU6 B;  5A0D A;  3H41 A;  3MO8 A;  4DEY A;  2KXD A;  3MCA B;  3CC2 T;  2HL3 A;  4C8Q C;  1QCO A;  3V7S A;  4IUQ A;  1K73 C;  1N8R U;  1B34 B;  2JNG A;  1I07 A;  4M75 C;  5DLO A;  3QKJ A;  1SHG A;  4AG1 C;  2LVM A;  1VQ6 A;  2VWF A;  1MV0 B;  2DO3 A;  1GCQ A;  1S72 A;  3QUI A;  4PNO A;  2DXT A;  1YP5 A;  1KHC A;  5CR2 A;  5EC7 A;  3OYK A;  2AKL A;  3M0U A;  3JB9 I;  1ZA2 B;  4TVR A;  3VYH B;  3HTR A;  4DBH A;  4B9W A;  4Z89 A;  2XK0 A;  3VJP A;  1WQW A;  3JCM X;  1WA7 A;  3ZEH A;  4IUV A;  5I2M A;  2JTE A;  1BBZ A;  2GQV A;  1RAB B;  1Y71 A;  2DMO A;  5KH6 A;  1UGV A;  3JCM h;  5LJ3 e;  4EMK B;  2J6K A;  2VAS A;  1WLP B;  1K8A C;  2J05 A;  4M7D D;  4JPB W;  5HY6 A;  1VUB A;  2RJF A;  1HSQ A;  4RTX A;  1VQ7 A;  1FMK A;  3RKW A;  5GAM f;  3FDR A;  2J6F A;  1R8O B;  2VV5 A;  3CC4 T;  3CCL T;  1LCK A;  4F17 A;  1K9M R;  1SEM A;  3JRZ A;  4LUD A;  4M78 G;  4XTY A;  1M2O A;  1K4U S;  4OB1 B;  4ZNX A;  3SWN B;  5J3B A;  4ZGE B;  1H3H A;  4ORZ A;  2L3P A;  2YLC A;  1JU5 C;  4IUP A;  2BZ8 A;  3JB9 F;  3CC7 Q;  4QKU A;  3NTI A;  3A8L B;  2LDM A;  1ZSG A;  1EIF A;  5GMK j;  1YI2 Q;  4MMK A;  3CXC P;  3QSU A;  4LDU A;  2DM1 A;  1KC8 R;  4KRT A;  1UE9 A;  2VYT A;  5CKF A;  4PJO F;  1I5O B;  1H3Z A;  3V8J A;  1JO8 A;  1WFW A;  1QCN A;  2IIM A;  3I9Q A;  1WQ7 A;  2D9T A;  1VQ4 Q;  2CS7 A;  2K5F A;  4J9H A;  4LNP A;  1GXI E;  1VQO T;  2O9S A;  2CUD A;  1I0C A;  2YT6 A;  4PJJ A;  1TUC A;  5GAO q;  4ME7 A;  2C06 A;  2ZAE A;  3CCS T;  1SSF A;  3RBB B;  3ER0 A;  2K2M A;  4A63 B;  1PRM C;  3AHU A;  5FLX E;  1H8K A;  1YJN A;  1WYX A;  2LJ1 A;  4XU0 A;  3PFS A;  1M1K C;  2LRQ A;  2ROT A;  4J9B A;  1D09 B;  2FYK A;  2HBW A;  1M1K R;  3L2Q A;  3OYJ A;  2QQA A;  3JV3 A;  4PL6 A;  1WPY A;  9ATC B;  3RUX A;  4JLG A;  2AK5 A;  1WXT A;  2COW A;  3SWN C;  3REB B;  3PNW C;  4HCC A;  3EG9 A;  2LQK A;  2NLU A;  5KYU A;  2X4J A;  5KYU B;  3TVT A;  1W4S A;  1ZSZ A;  5GAM j;  3EFS A;  4N4I A;  3CPW P;  4N4H A;  1TOV A;  2JXB A;  1G3S A;  4R55 A;  3CCR Q;  5LJ3 g;  4QVD A;  2COY A;  3M0P A;  3OYE A;  4M77 E;  2BUD A;  1AWX A;  4KUI A;  2K3X A;  2RD1 A;  4XU1 A;  1SF9 A;  2CKK A;  3OYY A;  1ZA1 B;  3E1S A;  1H64 1;  4OGC A;  2R57 A;  1WHJ A;  3CMA A;  1AWO A;  3JAM E;  2JUF A;  2EKO A;  2YLB A;  2RHU A;  1JXM A;  3RKY A;  1M2V B;  2EVR A;  4J6X A;  3LGF A;  3RDV A;  2AIR B;  2ZPH B;  2OTL T;  3M0Q A;  1B3Q A;  2VVK A;  1HXD A;  3ASK A;  3JCM Q;  4OMO A;  3T9N A;  2KBT A;  2GF7 A;  1VQM A;  3CC7 T;  1M3B A;  2RO0 A;  4C8Q A;  3MEV A;  4BI3 A;  5M9O A;  1W70 A;  2EQJ A;  1OX8 A;  3X26 B;  2ED1 A;  1OQK A;  1RAF B;  4Y28 E;  3N5B B;  5CO7 A;  3URG A;  1G3W A;  4A53 A;  4B9X A;  1W2B P;  2VC8 A;  5GAN h;  1NJI U;  4ATO A;  3SD4 A;  1TUD A;  2G3R A;  1M8V A;  1NE8 A;  1OOT A;  2EJG A;  2RK2 A;  2QEX T;  1JJ2 A;  1FX7 A;  1X6G A;  5GAO p;  2OTJ A;  3QWX X;  1JJ2 S;  2CZ6 B;  1YJN T;  3CCL A;  2E3I A;  1RAD B;  2RQR A;  4O6J A;  1QCF A;  1RI0 A;  2OI3 A;  2ED0 A;  2FZK B;  2VB6 A;  3VUB A;  1M2V A;  1VQ6 T;  3R6N A;  3EGX A;  1VOM A;  2K5L A;  2X4W A;  1SRM A;  3CCV Q;  1S72 T;  5DLQ E;  1Z9Z A;  4CC3 A;  4WF2 A;  1VIF A;  1WJS A;  4MZT A;  4XTW A;  1VQK A;  2DVJ A;  4IUT A;  4F7U B;  2CGH A;  1BI2 A;  1AZE A;  1Q86 U;  1VIE A;  5KE2 A;  1YWO A;  1P92 A;  1KC8 C;  1WJR A;  3V7C A;  2EYQ A;  1FMW A;  3JCM e;  2RMO A;  1PSF A;  3OYC A;  1WI7 A;  2HAX A;  2PVG B;  2X4Y A;  1ZBX A;  2ZCF B;  2EYZ A;  4C8Q D;  4FYV B;  4HVV A;  2DIQ A;  3S3M A;  2JVV A;  1YJW Q;  1HK9 A;  3UWN A;  2CRE A;  1FXX A;  3DLM A;  1ZUY A;  4QVC A;  4A4H A;  2EW3 A;  2HQX A;  1Q7Y C;  4GLM A;  2QA4 A;  2DNU A;  5GMK l;  1OPK A;  4XTZ A;  4XU2 A;  2E3H A;  2W0Z A;  2O2O A;  7AT1 B;  2MIO A;  5LL6 S;  3FB9 A;  3E9G A;  1YWP A;  3INZ A;  5LJ5 h;  4M78 E;  4DQ2 A;  3LWI A;  1WX6 A;  1X6O A;  2CT3 A;  1G3T A;  3TCJ A;  3MET A;  4X34 A;  3EHQ A;  1TH7 A;  1ZHI A;  1G5V A;  2FZC B;  1T0J A;  3A8H B;  3C12 A;  1WDX A;  2YUQ A;  1SKU B;  3H0H A;  4M7D E;  4PJN A;  2EPD A;  4RG2 A;  4IUR A;  3QII A;  1GCQ C;  3QG1 A;  3GNF B;  2RI5 A;  1KQS P;  3VV0 A;  1KQ1 A;  1KC8 U;  2L2P A;  2RM4 A;  4J8O A;  1Q86 C;  5C0M A;  4L5G A;  4F7U G;  3G6E Q;  2OAW A;  4N0A C;  1E6H A;  3I5R A;  2JT4 A;  4FT2 A;  4PFO A;  1N6A A;  5LJ3 d;  4M75 B;  2LCL A;  4DOW A;  1VQ5 A;  1B7T A;  3HL8 A;  1YBY A;  1O9S A;  3OMG A;  5KYY B;  1G3Y A;  3MEA A;  2KR3 A;  1X43 A;  1XQH A;  1VQ4 T;  2C0I A;  2DIL A;  3ME9 A;  1BU1 A;  5CIU A;  3CMA Q;  3OW2 P;  3H6Z A;  4KH1 B;  1PNJ A;  2M51 A;  1QQJ A;  3KBG A;  1F1B B;  2RHI A;  1SG5 A;  5KYW B;  3E19 A;  4C92 G;  4M7A G;  2LCS A;  1D0Z A;  1YN8 A;  3NMZ C;  4RTZ A;  5A0L A;  2PTK A;  1VQK T;  2XIC A;  1Y96 B;  3SHW A;  4DBF A;  2F5T X;  2F69 A;  1VQL T;  4JRQ A;  1M8M A;  2CSI A;  2KT8 A;  3WVD B;  3CCQ T;  1M90 R;  3C4S A;  3RKX A;  2QA4 T;  2LZ6 B;  4Z8A A;  4P5N A;  5KYW A;  1NM7 A;  2KRO A;  2WAC A;  4C0Z A;  2KVQ G;  2DPP B;  5IHI A;  3I55 T;  4LN2 A;  3VU3 C;  2RNA A;  2YDL A;  2DEU A;  3SB2 A;  2M0O A;  1UGR B;  2X35 A;  1QKW A;  1HD3 A;  4GBQ A;  3LLR A;  1D3B B;  2M1H A;  3OYF A;  1IO6 A;  2CZ7 B;  3OYI A;  3X25 B;  4M77 G;  3EG3 A;  1WHM A;  2GGR A;  4RCB A;  1ZUU A;  1DJ7 B;  3M55 A;  4HVU A;  2XG8 D;  4C5E A;  4BUG A;  3G7Z A;  1QVF S;  3NHN A;  1VQM T;  4JRP A;  2FEI A;  2O01 E;  2EYY A;  2RA2 A;  2W10 A;  2QK0 A;  4J6W A;  3BDU A;  5GAM d;  2X3X D;  3PVL A;  1YHQ A;  2DBM A;  2V8K A;  3HHT B;  4JLI A;  1KJW A;  3CME A;  4PJO D;  2HEQ A;  3G4S A;  4FT4 A;  4KUL A;  4F7U A;  4BDY A;  3HPW A;  2OTJ T;  3V8L A;  2HSP A;  2QQS A;  1KK7 A;  3UT1 A;  4D6W A;  1UJY A;  3GLX A;  4L59 A;  2PZ1 A;  5LJ5 e;  2MWO A;  3OYH A;  4LDX A;  4JS5 A;  1G83 A;  2F2W A;  2M16 A;  2DRM A;  4RTY A;  4Y91 A;  5D6W A;  5GAN 3;  1MHN A;  4LDY A;  3I35 A;  1X75 C;  4RTV A;  2B8A A;  2CP5 A;  4R56 A;  3M4G A;  8AT1 B;  3OYG A;  4M7D C;  2KSS A;  2KYB A;  4C92 C;  4M7A C;  2PU9 B;  4J7I A;  3QXE B;  5IXB A;  4JS4 A;  3EG9 B;  3J7A F;  2RH2 A;  2A28 A;  2DTH A;  2JM8 A;  2HNI A;  2JMA A;  1IRE B;  1AZG B;  3CC2 A;  1IHW A;  1MMA A;  1K1Z A;  2QG9 B;  4X1V A;  3QHS A;  4CC2 A;  2JN0 A;  3PVQ A;  3X20 B;  3Q1J A;  2XMF A;  4AMC A;  2LX7 A;  3U23 A;  1EZZ B;  1LOJ A;  4PLL A;  8ATC B;  5KE3 A;  1VQ5 T;  1TWB A;  3QZ9 B;  3EGD B;  1AVZ C;  2DA9 A;  3VS1 A;  5FU7 B;  5CVI A;  1M3A A;  1A0N B;  2L3R A;  3VYG A;  4IUU A;  3F70 A;  2DXU A;  1NLO C;  2P4R A;  3CCS Q;  2DZ9 A;  3RIR A;  4BY6 C;  5GAN 7;  3OB9 A;  2KRS A;  1YHQ T;  1K0S A;  1YIJ A;  3LW5 E;  5D6Y A;  2V1R A;  5GAN g;  2RQT A;  3QPH A;  5FWC A;  3L42 A;  4M77 C;  1V1C A;  3I56 T;  3CBP A;  2VUB A;  3LH5 A;  1U8R A;  4BD3 A;  1YJ9 A;  2HQH A;  3VS7 A;  5L23 A;  5L8R E;  4FYW B;  5GAN e;  1ZQ1 A;  4KT0 E;  3C95 A;  2KMT A;  2YUN A;  4GY5 A;  1U1T A;  5LJ3 j;  1AT1 B;  3GOX A;  3UPU A;  1QVG A;  3MP1 A;  2RN8 A;  1IZ6 A;  3HSB A;  2O4X B;  2BE7 D;  2RHZ A;  1YCS B;  1QVG P;  2QEX Q;  2BIV A;  5GAN 4;  1VYT A;  2HMA A;  3CCE A;  4OMQ A;  4A4G A;  1B07 A;  3OYM A;  5IT9 E;  4Z88 A;  2L0A A;  1YJ9 T;  1Q95 G;  1RL2 A;  2EYW A;  2WSC E;  3VRZ A;  3OYA A;  4MML A;  2JOY A;  4C8Q G;  4CI0 C;  1U1S A;  1TUG B;  3CCU Q;  4EIK A;  2QDY B;  4OB2 B;  3VUZ A;  4PK4 A;  2DL7 A;  4RUG A;  3D7S B;  5FRO A;  4CC4 B;  3EHR A;  1IRX A;  4A4K A;  3UAT A;  2JTF A;  4AG2 C;  1UDL A;  5AT1 B;  1VQ4 A;  2FB7 A;  4PJO C;  1SRL A;  1VQ8 A;  2DL8 A;  3C94 A;  1VQK Q;  1K73 U;  2EIF A;  1RLP C;  5CCA A;  1OX9 A;  4C92 E;  4M7A E;  1NYF A;  3V8K A;  1G8X A;  1X27 A;  1X6B A;  4JRK A;  5AYF A;  1K73 R;  1LPL A;  3EAE A;  4RTT A;  3M0T A;  2XID A;  2HBP A;  1JEG A;  1V76 A;  4IKF A;  2JW4 A;  4HCZ A;  4YTL A;  2QXF A;  1RAI B;  2E65 A;  3OS1 A;  1YIT T;  2QI2 A;  3H0I A;  2LP5 A;  3EFO A;  1AWW A;  3G71 T;  5LJ5 g;  3H9N A;  2A0F B;  2HKN A;  2VGM A; 
#chains in the Genus database with same CATH homology
 1K76 A;  1M27 C;  1WXB A;  2RMO A;  1WI7 A;  2EQI A;  4LE9 A;  3UA7 A;  2CH4 W;  1KSW A;  4QT7 A;  2EYZ A;  3VS6 A;  2EGE A;  1ARK A;  1Z9Q A;  4HVV A;  1JXO A;  1X69 A;  4OML A;  4FSS A;  4AFU C;  1W1F A;  2DL4 A;  2J7I A;  3VS3 A;  2CRE A;  1NYG A;  1ZUY A;  1RI9 A;  1XOV A;  1NEB A;  1T0H A;  2EW3 A;  2KEA A;  4GLM A;  3O5Z A;  2DNU A;  1I1J A;  2K9G A;  1OPK A;  5ECA A;  2C0O A;  2W0Z A;  2O2O A;  3GBQ A;  2ESW A;  2MIO A;  1W6X A;  1OPL A;  1E7O A;  1M3C A;  2JS2 A;  2MCN A;  1KIK A;  1YWP A;  1X2Q A;  1VA7 A;  2FRW A;  2GQI A;  1KFZ A;  2DE0 X;  4OMP A;  2FO0 A;  1WX6 A;  2JS0 A;  2FRY A;  2LQN A;  2CT3 A;  1YNZ A;  1MV3 A;  2ABL A;  3TSZ A;  2F2V A;  3EHQ A;  5HCK A;  2CH4 A;  1UJ0 A;  1T0J A;  1EFN A;  1WDX A;  2YUQ A;  2GBQ A;  1GL5 A;  1M30 A;  3H0H A;  2EPD A;  4J9D A;  1GCQ C;  3THK A;  1PKS A;  4IIO A;  1PRL C;  2VKN A;  2D8J A;  1UHC A;  4AFQ C;  3VS5 A;  5I11 A;  2L2P A;  2A36 A;  3H0F A;  3IQL A;  1Y0M A;  1BK2 A;  3SEM A;  2LQW A;  2DL3 A;  2K7A A;  4J9G A;  1CKA A;  2OAW A;  1E6H A;  3I5R A;  4JZ4 A;  2JT4 A;  2D8H A;  2O9V A;  4E6R A;  1Y57 A;  2RQV A;  1TG0 A;  4AFZ C;  4J9F A;  1ZLM A;  3ULR B;  2KR3 A;  1E6G A;  1X43 A;  2G6F X;  4CC7 A;  2C0I A;  2DIL A;  3H41 A;  1BU1 A;  4DEY A;  1GBQ A;  2KXD A;  1PNJ A;  2DRK A;  2M51 A;  5IHN A;  4D8D A;  1SPK A;  1I07 A;  2LCS A;  2YSQ A;  2DX1 A;  1YN8 A;  1SHG A;  3NMZ C;  4RTZ A;  4AG1 C;  2PTK A;  3REA B;  2CDT A;  2VWF A;  2D1X A;  3SHW A;  1MV0 B;  1M8M A;  1OEB A;  1GCQ A;  1S1N A;  2CSI A;  2KT8 A;  1RUW A;  1YP5 A;  2LZ6 B;  4Z8A A;  5EC7 A;  1NM7 A;  2AKL A;  2KRO A;  2GNC A;  1GCP A;  2KNB B;  2A37 A;  3M0U A;  3M0R A;  2JMC A;  2OJ2 A;  5IHI A;  2DL5 A;  2HDA A;  4LN2 A;  3C0C A;  4Z89 A;  2RNA A;  2KT1 A;  2YDL A;  2RPN A;  1WA7 A;  4RTW A;  1QKW A;  1HD3 A;  4GBQ A;  2FG0 A;  2L3Q A;  2LMJ A;  2LNH B;  1IO6 A;  4IIM A;  5IXF A;  2JTE A;  1BBZ A;  3EG3 A;  2DMO A;  3KFV A;  1U5S A;  2GGR A;  1UGV A;  1ZUU A;  4Y92 A;  1GFD A;  1OV3 A;  4HVU A;  2J6K A;  2O88 A;  1WLP B;  2DJQ A;  2ECZ A;  2J05 A;  1NLP C;  4JPB W;  4WCI A;  3NHN A;  5GJV B;  2O31 A;  4AFS C;  5GJW B;  2FEI A;  2GTO A;  1HSQ A;  1ABO A;  4RTX A;  1FMK A;  2EYY A;  2W10 A;  2J6F A;  1H92 A;  1ZBJ A;  2FPD A;  1LCK A;  2X3X D;  3PVL A;  4F17 A;  1SEM A;  2LJ3 A;  2DBM A;  4LUD A;  1T3S A;  1QKX A;  4J9I A;  1X2K A;  2K6D A;  2EGC A;  1K4U S;  3FJ5 A;  1KJW A;  1U3O A;  4ZNX A;  2NWM A;  2C0T A;  1QWE A;  1H3H A;  2HEQ A;  4ORZ A;  2CUB A;  2L3P A;  1K0X A;  2DYB A;  1GBR A;  4D8K A;  1JU5 C;  1PKT A;  2BZ8 A;  2FPF A;  1VYU A;  2K79 A;  3QWY A;  2HSP A;  1ZSG A;  1UJY A;  1ABQ A;  2PZ1 A;  2DM1 A;  4KRT A;  1FYN A;  1UE9 A;  4J9E A;  1G83 A;  2F2W A;  2RQU A;  2DRM A;  4RTY A;  1U06 A;  1JO8 A;  1WFW A;  2IIM A;  3I9Q A;  1AD5 A;  1AOJ A;  4LNP A;  4J9H A;  1NG2 A;  3NPF A;  2FPE A;  4F16 A;  1QLY A;  3I35 A;  2O9S A;  2KRN A;  2CUD A;  4RTV A;  1I0C A;  2SEM A;  2YT6 A;  3UF4 A;  1TUC A;  1ZUK A;  2DF6 A;  2J6O A;  2M0Y A;  2KYB A;  3RBB B;  3VS0 A;  2K2M A;  4A63 B;  4JZ3 A;  2CT4 A;  5IXB A;  1PRM C;  1H8K A;  1G2B A;  1AEY A;  2LJ0 A;  1WYX A;  1NEG A;  2LJ1 A;  2A28 A;  2JM8 A;  2JMA A;  2ROT A;  1AZG B;  4J9B A;  2B86 A;  2SRC A;  2J06 A;  4HCK A;  4JJD A;  2HBW A;  1K1Z A;  2BZY A;  2I0N A;  3JV3 A;  2AZV A;  1CSK A;  2KXC A;  3ZL7 C;  2AK5 A;  4X1V A;  1WXT A;  1UTI A;  4CC2 A;  2A08 A;  3PVQ A;  3REB B;  3RNJ A;  2XMF A;  2LX7 A;  3U23 A;  3TVT A;  1JQQ A;  2K3B A;  3NGP A;  1WIE A;  1AVZ C;  2DA9 A;  3VS1 A;  4F14 A;  2EKH A;  2JXB A;  1M3A A;  1A0N B;  3EGU A;  2NUZ A;  4LUE A;  1VYV A;  3M0P A;  2ROL A;  4J9C A;  1NLO C;  2P4R A;  5I22 A;  1AWX A;  2JM9 A;  3M0S A;  5IH2 A;  1K9A A;  2L3S A;  2KGT A;  1RLQ C;  2F2X A;  2KRS A;  1K0S A;  2V1R A;  3EG0 A;  2KE9 A;  2RQT A;  5FWC A;  2AZS A;  1V1C A;  1PWT A;  1AWO A;  3VRY A;  2KRM A;  1AWJ A;  3LH5 A;  1JXM A;  3VS4 A;  5IHK A;  2DBK A;  3VS7 A;  5L23 A;  2EVR A;  1WXU A;  2ENM A;  2YUP A;  4ESR A;  2RQW A;  1UFF A;  4JJB A;  3A98 A;  3M0Q A;  2YUN A;  1B3Q A;  1T3L A;  2VVK A;  3EG2 A;  2AKK A;  2QDL A;  4OMO A;  2KBT A;  2EBP A;  1M3B A;  2RN8 A;  1J3T A;  1W70 A;  1SSH A;  1SHF A;  1BB9 A;  2EGA A;  4R0K A;  2DLP A;  2ED1 A;  1YCS B;  2PNI A;  1VYT A;  4OMQ A;  2MOX A;  1B07 A;  2X3W D;  4Z88 A;  2L0A A;  3VS2 A;  1UEC A;  2EYW A;  3VRZ A;  2YUO A;  1QWF A;  2CSQ A;  5FW9 A;  2GTJ A;  1TUD A;  4EIK A;  1CKB A;  4DEX A;  3I5S A;  1UUE A;  1OOT A;  2DL7 A;  4RUG A;  3PE0 A;  1N5Z A;  1X6G A;  4RTU A;  4CC4 B;  3QWX X;  3EHR A;  2RF0 A;  2H8H A;  3TSW A;  2V1Q A;  2HCK A;  3UAT A;  4AG2 C;  4HXJ A;  1UDL A;  1UG1 A;  2D0N A;  1ZX6 A;  4M4Z A;  2RQR A;  1SRL A;  1HJD A;  4JJC A;  4OMN A;  2DL8 A;  1GRI A;  2EYX A;  1QCF A;  1RLP C;  1PHT A;  1NYF A;  2OI3 A;  4OMM A;  2ED0 A;  4K11 A;  1X27 A;  1X6B A;  4HVW A;  4RTT A;  3M0T A;  1GFC A;  3R6N A;  1JEG A;  2E5K A;  2BZX A;  1SRM A;  2JW4 A;  2KYM A;  1Z9Z A;  4CC3 A;  1UHF A;  5FWB A;  3H0I A;  2LP5 A;  1AWW A;  2BTT A;  3EG1 A;  1MUZ A;  3CQT A;  2DVJ A;  1AZE A;  3UA6 A;  1YWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...