4CC3A

Complex of human tuba c-terminal sh3 domain and mena proline-rich peptide - h3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DYNAMIN-BINDING PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 11
structure length 61
sequence length 61
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc3A00
1ZUYA 2O88A 2CUBA 2RMOA 1Z9QA 4LUDA 3VS1A 1M27C 1I0CA 2DLPA 5GJWB 3R6NA 4JZ4A 2HCKA 2KR3A 2RPNA 3RBBB 1YP5A 2GBQA 1YWPA 2K9GA 1HD3A 2H8HA 1NYFA 3EHRA 1PHTA 1QKWA 2E5KA 4AFSC 4OMLA 4GLMA 4ORZA 2DBKA 2A37A 4J9CA 2ABLA 2YUQA 1GCQC 4ZNXA 1NEGA 2EYYA 1UHFA 1W1FA 4Z89A 4JJCA 2KEAA 4DEYA 1UJ0A 1QKXA 1T0HA 3EG1A 2C0IA 2KXCA 1B3QA 2DM1A 1B07A 1GRIA 3VS5A 1IO6A 2L2PA 1SPKA 3EGUA 3PVQA 4CC7A 3REBB 2CH4A 2ENMA 1OOTA 4DEXA 2V1RA 1AEYA 4IIMA 2JS0A 2LJ0A 1W6XA 1T3LA 5IHNA 3VRZA 2CT3A 1RI9A 2KYMA 1WYXA 2CT4A 2V1QA 5HCKA 1JXOA 1AVZC 2JXBA 1KIKA 2DBMA 3M0QA 2DA9A 4OMOA 2KYBA 2OAWA 2YSQA 2EPDA 4Y92A 1GCQA 2DNUA 2MIOA 2KROA 3VS6A 2L3PA 1K4US 4K11A 1K0SA 2B86A 3LH5A 1UECA 4RTYA 2KGTA 1LCKA 4WCIA 2EW3A 2SEMA 1CSKA 1WA7A 1X27A 4RTUA 3IQLA 1X6BA 4F16A 1H3HA 1WFWA 1NYGA 2YDLA 2L3SA 2SRCA 2BZ8A 4OMMA 2DL7A 4J9EA 2D8HA 2PZ1A 2OJ2A 2YUPA 2KT8A 2HEQA 3KFVA 4HVUA 2AK5A 3M0RA 2DF6A 2JT4A 2KXDA 2A28A 2CH4W 2M51A 1T3SA 3GBQA 3PE0A 2F2WA 2DMOA 2VKNA 1RUWA 1BK2A 5FWCA 1AOJA 1M3BA 2J7IA 2NWMA 2K7AA 4LN2A 2X3XD 2EGCA 4JZ3A 2G6FX 3JV3A 2HDAA 2L3QA 3QWXX 1VA7A 2KRSA 3NHNA 1HSQA 1NLOC 1Y57A 2J6KA 1GFDA 1GBQA 2P4RA 4RTZA 2CUDA 4LNPA 4HVWA 1QLYA 3VS7A 1WI7A 1W70A 4AG1C 3VS0A 3VS3A 2VVKA 1V1CA 1OV3A 1SEMA 3M0SA 5IHIA 1HJDA 2DL4A 3SEMA 1NM7A 1AWXA 1ABQA 2O2OA 1MV0B 1VYUA 1ZUKA 4A63B 2JW4A 1AZEA 1PWTA 2ROTA 2DL3A 1VYTA 2YUNA 3EG0A 2RQUA 4Z88A 1G2BA 2YUOA 1E7OA 4LE9A 2EVRA 4EIKA 1ABOA 2QDLA 1JQQA 2K3BA 2DRMA 3REAB 4JJDA 1ZSGA 1I1JA 1WLPB 3U23A 2DYBA 4FSSA 1JXMA 1UJYA 1UFFA 1JU5C 1OEBA 1T0JA 1QWEA 2LJ3A 2OI3A 5I11A 2J6FA 2XMFA 1E6GA 4OMPA 1OPLA 1H8KA 4OMQA 2CREA 4J9FA 1GL5A 2FRWA 1RLPC 1M30A 1JEGA 1SHGA 2D1XA 5FW9A 1AWOA 1E6HA 4M4ZA 3O5ZA 2GGRA 1CKAA 2KBTA 2KNBB 1J3TA 4J9IA 2O9VA 2PTKA 2RN8A 1KJWA 4AFZC 2GNCA 1M8MA 2AZSA 1XOVA 4CC2A 3M0PA 3PVLA 2LMJA 1K0XA 1SRLA 5I22A 1A0NB 4QT7A 3ZL7C 5FWBA 1X2QA 2GTJA 2J6OA 4ESRA 2FG0A 5ECAA 1AZGB 2X3WD 1K76A 4AFUC 2IIMA 1UE9A 1YWOA 1UDLA 2HBWA 2D8JA 1JO8A 2M0YA 4J9BA 1BB9A 2FO0A 3NPFA 2RQVA 2K2MA 2FEIA 2ESWA 3UATA 1KSWA 3VS4A 1K1ZA 1VYVA 3EG3A 2RQWA 1PKSA 2YT6A 1MV3A 1ZBJA 1X2KA 1WIEA 1UHCA 1K9AA 1RLQC 4D8KA 3FJ5A 2JM8A 2K79A 2J05A 4D8DA 3TSWA 3SHWA 2DVJA 1TUCA 3EHQA 5IXFA 1U3OA 2EBPA 5IXBA 4JJBA 1ZLMA 4Z8AA 1QCFA 2LCSA 1NG2A 3H0HA 3EG2A 3NGPA 4KRTA 4F14A 1OPKA 4LUEA 1KFZA 1NLPC 1GCPA 2EKHA 2DL8A 2O31A 4J9DA 2I0NA 4HVVA 2JTEA 4R0KA 2O9SA 2KE9A 4IIOA 3H41A 2EGAA 1SRMA 4CC4B 3THKA 1AWJA 1X43A 2KRMA 4JPBW 2A36A 1G83A 3CQTA 1PRMC 2DJQA 4OMNA 2C0OA 3UA7A 2BZXA 1YN8A 2BZYA 2NUZA 1TUDA 3VRYA 1ARKA 1SSHA 3C0CA 1WXTA 2K6DA 2CDTA 2CSIA 3TSZA 3M0TA 3UA6A 2LQNA 4E6RA 1N5ZA 1WX6A 3A98A 4J9HA 3VS2A 4J9GA 2LJ1A 2EGEA 2ED0A 5L23A 1H92A 2MOXA 1PRLC 5GJVB 4HCKA 3NMZC 2PNIA 4X1VA 1U06A 2DILA 4RTWA 4HXJA 2DL5A 2D0NA 4GBQA 2AKKA 1ZX6A 2FPDA 2ROLA 2VWFA 1NEBA 2ECZA 5IH2A 1M3AA 2GQIA 3I5RA 2ED1A 4CC3A 1Y0MA 2DRKA 1AD5A 2DX1A 2FPFA 2W10A 4RUGA 2JS2A 1WXUA 4F17A 2LNHB 2AKLA 2F2XA 2FPEA 1GFCA 2LX7A 4RTTA 1Z9ZA 2RF0A 1CKBA 3M0UA 2HSPA 5IHKA 2BTTA 2DE0X 2F2VA 1QWFA 2A08A 3TVTA 1X69A 1YCSB 2LP5A 1MUZA 3I5SA 3ULRB 4AG2C 1M3CA 2EYZA 1YNZA 2CSQA 1PKTA 2GTOA 2LQWA 2C0TA 1AWWA 1TG0A 1WDXA 2J06A 2W0ZA 2KRNA 2LZ6B 4AFQC 2L0AA 3RNJA 1UG1A 1UGVA 1SHFA 3QWYA 1I07A 3H0FA 1PNJA 1ZUUA 2EYXA 3H0IA 2EQIA 2AZVA 1U5SA 3UF4A 1X6GA 1FYNA 2MCNA 1UUEA 2RNAA 4RTXA 2FRYA 2KT1A 1BBZA 2RQRA 1UTIA 1FMKA 3I35A 1WXBA 2JM9A 2RQTA 2JMAA 4RTVA 5EC7A 3I9QA 2EYWA 1GBRA 1S1NA 1EFNA 2JMCA 1BU1A
chains in the Genus database with same CATH superfamily
9ATCB 1ZUYA 2O88A 2CUBA 2RMOA 1WHHA 1Z9QA 4N4IA 4PK4A 1U1TA 3ZBDA 2V8JA 2MI6A 3C4SA 1I0CA 5GAMe 2OTJQ 1EX4A 3CC2Q 4EMKA 4PJOE 2KR3A 1VQ9T 1FXXA 2V8IA 3EFOA 4F7UB 4XU2A 1HD3A 1G3YA 2HKNA 1QKWA 1YITQ 3LLRA 1NJIR 4IUQA 2X4XA 2F69A 2WACA 1RAHB 3QXEB 2KEAA 1UJ0A 4C5IA 1NPPA 1D1BA 1T0HA 2C0IA 2DZCA 2CS7A 4J83A 4NL2A 2DM1A 5GAN4 4IUTA 3UWNA 3HRTA 1S72T 3JAME 2L2PA 5CKHA 3RDVA 2YRDA 3GPLA 2CH4A 4PLIA 2EJGA 5KYUA 2RJEA 4IIMA 1M90U 2JS0A 2LJ0A 4A4KA 1T3LA 2CT3A 1RI9A 4LDYA 1WYXA 1VQ7Q 3S3MA 3JCMd 2V1QA 1QVGA 2XK0A 2JXBA 5GAMg 2QA4A 1KIKA 2DBMA 3FDRA 4JRQA 2MK5A 2DA9A 3KBGA 4HCCA 1KHIA 1LJOA 2YWWA 2RHUA 2E4HA 1C1AA 1VQ4Q 5IAYA 1K0SA 4M7DF 4OVAA 2RI3A 2QA4T 4M7DC 2RO0A 2YRCA 4WCIA 1TXQA 4F04B 5GMKm 1Q81R 1H641 1WA7A 1X27A 4HT9A 5LL6S 4PNOA 1D0ZA 1X6BA 4F16A 1H3HA 4M78G 1WFWA 1NYGA 2RH2A 2SRCA 4MDXA 4OMMA 4JJNK 2ZPGB 1Q7YU 3JCMP 2O01E 2PU9B 1OYXA 2QTXA 1RADB 1NJIC 1YHQA 2DF6A 1TOVA 2A28A 2CH4W 2KXDA 1B7TA 5FWCA 3JCMJ 1AOJA 3OY9A 1X6OA 4JS5A 2K7AA 3CMAQ 4LN2A 5GMKh 5DLOA 4ZN3A 3QWXX 2QEXQ 1QCNA 4B6MA 1KQ1A 1Y57A 2J6KA 3F70A 1GBQA 4Q5WA 1VQKQ 3OYIA 2K5FA 5GAOn 3FC3A 2RK1A 1YHQT 5J3BA 4AG1C 3VS0A 1M1KR 2EJFA 1SEMA 4XU3A 2DL4A 4C8QF 1VQ5Q 1AWXA 1B34B 2AT1B 2RJCA 1ABQA 5FRMA 2OAUA 1C0MA 2NUPB 2JW4A 1PWTA 1I4K1 1MGQA 3EG0A 2X51A 2YUOA 4BB7A 4C92F 4C0DC 3JCMe 1JQQA 3LWHA 4ANJA 1M1FA 1FMVA 1UJYA 1D1CA 4EMKB 4OMFB 3EFOB 1UEBA 3OSSC 4M78E 3PT9A 1T0JA 2Y90A 1XJWB 2FB7A 4JRIA 1WHKA 5I11A 2ZAEA 2K3XA 2O4XA 3QJ6A 3P8BB 5GANd 1H8KA 1Q81C 2BUDA 1IXDA 4OMQA 4PLLA 1KC8R 3MEUA 5I2SA 2FRWA 1SHGA 1PG5B 1NJIU 2D1XA 4JRKA 3PIPA 3HRUA 3MP1A 3RESA 4C5EA 5KH6A 4PFPA 1WJSA 1WHMA 1W2BS 3RR6A 1VQ6A 3MO8A 4E7IA 4E7HA 3SD4A 2AZSA 1XOVA 5KYUB 3M0PA 3PVLA 1RI0A 1K0XA 1SRLA 5CQXA 4WTOB 3M54A 5FWBA 2GTJA 3JCMg 2FG0A 1IB8A 4M77C 1KG1A 4M7AC 1UE9A 2LQKA 1UDLA 1BYMA 1JO8A 4B9WA 1M1KC 5GAOl 1VQ6T 3SWNC 4LD9K 2RQVA 4C8QE 2ESWA 1Y96A 1PCXA 3FEOA 4JDSA 4QVZA 3CXCS 3OS5A 2RQWA 4ZGDB 5GAMh 2YHTA 2YT6A 1X2KA 1WIEA 3CCST 1RLQC 3FJ5A 5GAN6 4E7JA 4C92E 3QJYA 2J05A 3TSWA 1KQSP 1OZ3A 3ER0A 1OX8A 5CIUA 2EBPA 5L8RE 2RM4A 4JJBA 2DIQA 5CO7A 3V8JA 3S3OA 3BDUA 3EG2A 3NGPA 1OPKA 1NLPC 2EKHA 5CQYA 2O31A 1KQSA 4E7KA 1I81A 4E7ZA 2X4YA 4FL6A 3THKA 1KC8C 2A36A 2A7YA 1BI0A 1PRMC 2DJQA 2BZXA 2E5QA 3LH0A 2Y4YA 5GANe 3BY7A 1SSHA 3META 2K6DA 3UA6A 3CPWP 1ZHIA 2HD0A 1WX6A 3VS2A 1R0BG 2LJ1A 2EGEA 4BE0A 2KQWA 8AT1B 4XQ3A 3C12A 4BY6B 2BE7D 2X9HA 3NTIA 2DILA 3L2ZA 2FHDA 7AT1B 4HXJA 4MDWA 3HPWA 1M1KU 3OYAA 3CPWA 4J5YA 1NEBA 5IH2A 2XDBA 2GCXA 2ED1A 2DRKA 4OGEA 2ZGWA 2JS2A 2AKLA 4MZTA 1GFCA 2NUTA 3GNGA 3FIFA 1JRIA 1PC0A 1WQ7A 2I2LA 3M0UA 3HKSA 2DVEA 1M4ZA 2FZCB 5FU6C 2MWPA 3PNWC 2BTTA 4OP0A 3OS1A 2F2VA 2VGNA 4J8OA 5GANg 3JB9J 2O4XB 2L3RA 1M9SA 2DTIA 1YNZA 2XICA 3DB4A 5CKEA 3JRZA 2VGMA 3M4GA 2JOYA 1VIEA 1R0CB 2MMPA 4M77D 3I55T 1KC8U 2OTJA 3CC2A 4M7AD 2LZ6B 2R57A 5I2MA 3QWYA 1PNJA 3H0IA 3EGDA 1HYOA 2OTLA 2WSFE 1U5SA 3OYKA 3UF4A 2JVVA 5HK3A 4NL3A 1YI2A 2MF2A 2EQMA 2KT1A 4II1A 2OTJT 1OI1A 3CC2T 1UTIA 3OYEA 5KCHA 1VQOQ 3I35A 1WXBA 1DJ7B 2EYWA 3OYBA 3FLGA 1S1NA 2KK4A 1FX7A 2KSSA 1PM3A 2D0QB 4HA8A 4XU1A 1KD1U 1Y96B 1M27C 2EFIA 3JCMh 5LJ5j 5CCAA 1VQMA 1Q86R 3LWIA 5GJWB 1YI2T 4JZ4A 4MMKA 2RPNA 4B9XA 1UGSB 2E64A 4FU6A 4M75F 1TSFA 3J80E 3OYGA 2K9GA 1VQ7A 4ZTFA 1TS9A 4RMOA 1PHTA 2RB6A 4M75C 2C06A 4E7SA 3G71Q 4GLMA 4ORZA 2QQRA 4J9CA 1VQLA 2WSCE 1GCQC 1NEGA 3DB3A 1IRXA 1TUGB 3JCMV 3QPHA 2RJFA 1JBMA 1YFNA 2YXYA 3KXTA 3R6OA 5KYWA 1GRIA 2ZPEB 3VS5A 1VQ7T 4FT2A 1IO6A 2LTOA 3CEYA 4PJOF 3EGUA 3PVQA 3REBB 3M56A 5GAN7 1K73R 1OOTA 2GF7A 1RAEB 4DEXA 2V1RA 1VQLT 3L2QA 1Q82U 5KE3A 3JB9H 2XI9A 2CP3A 2EQJA 3CCLQ 1QW1A 5HKCA 2P84A 4R56A 3M0QA 3HFOA 2E3IA 3M59A 2DYIA 2DKGA 4OMOA 3X25B 2OAWA 2EPDA 4Y92A 4PFOA 1KK7A 2IVWA 2DNUA 2MIOA 3QYHB 3A8LB 3VS6A 5LJ3j 2DFUA 5CKBA 4VUBA 1ZA2B 4V2SA 3JB9I 1JB0E 2QEXA 1WNLA 1O9SA 2LRQA 2VXFA 1LCKA 1YIJQ 5D7UA 2EW3A 2SEMA 1Q86C 3GIBA 1CSKA 2NUTB 4Y91A 4RTUA 2A3LA 3IQLA 4FT4A 3CBPA 2DL7A 3FRNA 3EG9A 4FW1A 3M57A 4N4GA 3WXMB 2R5AA 1D0YA 2PZ1A 4IKFA 4QQDA 1VQ8Q 2QEXT 1O75A 3VJPA 1T3SA 2F2WA 2DMOA 2PUOB 4C0GA 2WSEE 2J7IA 2NWMA 5FROA 5GANh 1VQ5T 2G6FX 2L3QA 2XDPA 1VA7A 3NHNA 4EMGA 5CR2A 3J81E 4HT8A 1WQWA 1GFDA 4RTZA 4J6XA 4KGVB 4LNPA 1QLYA 4FCYA 1K73C 4M7DA 2VVKA 3EGDB 2LCCA 3JCMc 5LJ5f 3OW2A 3SEMA 1NM7A 1G3SA 4AT1B 2OTLQ 3H8ZA 3TEEA 1WHGA 5HY6A 2O2OA 1MV0B 2Y4XA 1VYUA 1YI2Q 1ZUKA 2K57A 1OZ2A 2ROTA 4F7UE 3A8MB 1HK9A 2K5LA 1GXIE 4Z02A 1E7OA 3REAB 2P0QA 4JJDA 1WLPB 3U23A 4FSSA 2EJ9A 3EFRA 3JB9D 2VYTA 4XK8E 1N6AA 4XTXA 1VQMQ 1JU5C 1OEBA 2CZ7B 1QWEA 2LJ3A 2CKKA 4ZTJA 3ASKA 1VOMA 5DLQE 3L42A 4YTLA 4PFZA 3DLLA 4J9FA 2RHYA 1M30A 3C95A 1I8FA 5GAOm 1VQLQ 5FW9A 2JTMA 3V7RA 2KVQG 1PD0A 2MPXC 4M4ZA 2K2VA 2EQUA 3O5ZA 5GAN2 1JJ2P 3CCMQ 1WJQA 5KYWB 4IUPA 4OF1A 1KJWA 2RI5A 4M78F 4AFZC 5GAN8 5AYFA 3M4YA 2DETA 4MZPA 4CC2A 4LDWA 5LJ3f 2QQSA 3ZL7C 2X35A 1K8AR 1JJ2A 4LDUA 5A2QE 4XTUA 2X3WD 4XTVA 1YJNA 1XQHA 2D8JA 2DZ9A 2OX7A 2M9UA 4LD6A 3VU3C 2K2MA 3V8LA 2FEIA 2RK2A 3VUZA 4JLIA 3VS4A 1V76A 1VYVA 2ZCFB 3GF5A 4O5VA 3QSUA 3JCMb 3LX7A 4BE1A 4M7DG 1ZBJA 2CGHA 2P0PA 4BE2A 4BD3A 4ME7A 5CKFA 2JM8A 4DBFA 3KUFA 2H3JA 2K79A 4CI0C 3OYNA 4D8DA 3QBYA 2M1HA 3ME9A 1M2OA 1TUCA 1VQNQ 5IXFA 2KI7A 2PQWA 3CPFA 3PMTA 1WHJA 3CCRQ 3QKJA 3DKMA 5IXBA 2L5QA 4BUGA 4Z8AA 2LDMA 4KULA 2XU8A 4O6JA 3EG9B 4M77A 2DL8A 3MP8A 4M7AA 2KDSA 4HVVA 4C8QC 2JTEA 1UGQB 3H41A 2E6NA 1SRMA 1IZ6A 1LPLA 1AWJA 3L1AA 1X43A 2KRMA 3SWNA 2EKOA 2HKQB 1OQKA 1G83A 4QVCA 1AHJB 3CC4Q 4OMNA 4ZGJB 1QVGS 3S3NA 3OYDA 2BZYA 2NUZA 4QKUA 3PGGA 4MMLA 3C0CA 1ZBXA 3M0TA 4PJNA 4C92C 2RI2A 3A98A 1D0XA 4A53A 2ED0A 4M7DB 2QK0A 2BKDN 2COZA 1PRLC 4X34A 3NMZC 2PNIA 4X1VA 1MMGA 3AHUA 3RUXA 4RTWA 3QYGB 2DL5A 3J7AF 1K8AC 1XTDA 3C94A 3CMEQ 2JJ9A 3OB9A 4MZMA 1IGQA 4X9CA 3I5RA 1Y0MA 2EWNA 2DXUA 2W10A 4DBHA 4C5HA 2DEQA 2KAFA 3M5AA 2MAMA 2RF0A 2EQKA 2NLUA 1RAGB 2HSPA 3V7SA 3HL8A 5GMKi 1QP2A 2M02A 1N8RR 1ZSZA 2DE0X 4FYYB 3V7CA 3I56A 1VQOA 2QGFB 2RHZA 1X69A 5D6XA 4BACA 1MUZA 3ZFJA 2RJDA 4M7DD 1M3CA 2A0FB 1MMDA 1PKTA 5J26A 2GTOA 2HAXA 2C0TA 2J06A 2W0ZA 4BI4A 4AFQC 3JSCA 1UG1A 3LGFA 3OSVA 3I56T 3BE3A 1VQOT 2ZPFB 1XNIA 1BKBA 4C0DB 2RD1A 3OMGA 2CP2A 3G71A 1YCYA 1FYNA 2RNAA 4M77G 3G4SQ 4Y28E 4RTXA 4M7AG 1QVFP 1BBZA 2G3RA 1IGUA 2RQRA 4DOWA 3Q1JA 2RQTA 3I9QA 2PVDB 3N5BB 4EDUA 2JMCA 1Q81U 1YJNQ 4OGCA 1QCOA 3VS1A 1G5VA 3L2RA 2LC4A 3G71T 3R6NA 4A4EA 4J6YA 5GMKl 1QVFA 2HCKA 5FRNA 3RMQA 1IHVA 1QVPA 1YP5A 2KY9A 3MP6A 1YWPA 4C8QD 2DERA 1KQ2A 3CCLA 4AFSC 1ZSZC 2VUBA 2DBKA 1WHLA 2X4WA 5FU7C 4ZNXA 1RL2A 2AHJB 1W1FA 3CCJA 2JUFA 1UB4A 4JJCA 4DEYA 5LJ5d 3HRSA 3EG1A 1N8RC 4C92D 1B3QA 4XU0A 2H3EB 2HZYA 4KH0B 4M77B 4M7AB 3CCLT 2L8DA 1SPKA 3SWNB 1YIJA 2HMAA 3EGXA 5IHNA 3CCJT 2KYMA 2VASA 4M7AE 2CT4A 5AT1B 2FZGB 5HCKA 1JXOA 2L89A 4A54A 3WVDB 4PKCC 4FYXB 1X01A 2DXBA 1NPRA 4M75A 1VQ8A 3SDZA 3MJXA 3SFMA 3P8HA 2KYBA 2YSQA 1GCQA 1N27A 1YIJT 4FM4B 2FL7A 2L3PA 1K4US 4K11A 1SG5A 1LOJA 1UECA 3M58A 4JLGA 1TWBA 2XIDA 4RTYA 3V8KA 1G3WA 4JRPA 2LNVA 2DTHA 1VQ8T 1H3ZA 4PJOA 1KQSS 2K3YA 2YDLA 2L3SA 2D8HA 5LJ3d 1Y71A 2DD4A 2OJ2A 1ZSZB 2RA2A 2KT8A 2HEQA 3HHTB 3KFVA 2F5KA 4ELYC 1U1SA 2AK5A 3M0RA 3I56Q 2JT4A 4BDYA 3GBQA 3CCVA 2VKNA 3CC7A 1RUWA 1BK2A 3VYHB 1M3BA 4CRIA 4XAXB 3WVEB 1YJ9Q 2B8AA 3H6ZA 2OTLT 4JZ3A 4QVDA 2HDAA 4QW2A 1HSQA 1X75C 3CCUQ 2P0KA 2P4RA 4HCBA 2CUDA 5LJ5e 5KCOA 3RKWA 3VS7A 1WI7A 3CPWS 1W70A 1V29B 1TU0B 4N0AC 1OV3A 3OYCA 1BI3A 1HJDA 3UPUA 4KGZB 3CCVT 3PTAA 3OYYA 2LQ8A 1M90R 4A63B 2DEUA 3RKXA 1VQMT 2DL3A 3FB9A 5FU6B 1VYTA 4ELZC 2YUNA 3OYHA 1Q95G 1UGRB 5GMKj 3BDLA 1G3TA 2RQUA 1MNDA 3MEAA 2COYA 3CCMA 3CCEQ 3E9FA 4LE9A 3HSBA 2EVRA 4EIKA 4KGXB 2QDLA 2K3BA 1IHWA 1ZSGA 2ZZDA 1I1JA 2DYBA 1JXMA 2RHIA 1OU8A 1UFFA 2QXFA 5CVIA 5GAOp 4PJOC 4M75G 3OYLA 2HQEA 2J6FA 1SSFA 2XMFA 3MKDA 3CCMT 2PUKB 3OYFA 2COWA 3PMIA 3JB9G 1WGSA 2QQBA 3QO3A 4F7UF 1GL5A 1RLPC 2JN0A 5IN1A 5FLXE 5LJ5g 1QMCA 1TH7A 3O8VA 3QDFA 1AWOA 1C6VX 3MCAB 2K5IA 3CCJQ 4DOVA 5GAOq 2DPPB 1F1BB 2KBTA 3EFSA 4LDXA 1G8XA 1D1AA 2GQVA 2O9VA 2PTKA 4C5GA 1Q7YR 3HFNA 5LJ3e 4FSXA 3L2UA 3OBYA 2GNCA 1M8MA 1U8RA 1VQNA 4RCCA 3RMSA 2FVUA 2HQXA 1A0NB 4QT7A 4EPCA 2QYZA 3EGXB 3OYMA 3CCRA 2BE9B 4ESRA 2DD5A 5ECAA 1K76A 4AFUC 2M0YA 2VB6A 3NPFA 4M75B 3UATA 1KSWA 3PIOA 1K1ZA 1VQNT 3CBOA 3EG3A 2VXEA 3CC4A 2ZPBB 1M90C 2QG9B 2R58A 1PKSA 2DXTA 2QI2A 3CCRT 1MV3A 3MPUB 5HK0A 4RKUE 4D8KA 4AMCA 3CBMA 1M2VA 3SHWA 1M5Q1 3EHQA 2HL5C 4XTYA 1U3OA 2KMTA 5KYYA 1R77A 4PJOB 2CZ6B 3A1PA 3MHXA 3CC4T 4M78A 1ZLMA 1QCFA 1NG2A 4KRTA 4IURA 5LJ3g 4F14A 2VC8A 4LUEA 1GCPA 5A0LA 3QUIA 5GAMj 2E41A 3CMEA 3CD6Q 2O9SA 2KE9A 2EGAA 4CC4B 5A0DA 2XG8D 4FIBA 1MMNA 3CQTA 4M75D 2CP0A 2C0OA 1WPYA 2E70A 3L2WA 3CCVQ 3CC7Q 3QG1A 3VYGA 1S72A 1WXTA 2RHXA 2CDTA 2CSIA 2LQNA 4PL6A 4E6RA 1N5ZA 4XTZA 3E19A 3CMET 1Q7YC 4J9GA 3P8DA 5L23A 4JS4A 1H92A 2MOXA 5GJVB 1Q86U 4P5NA 1U06A 2QAZA 2LT1A 4RG2A 2D0NA 3QHSA 4GBQA 1QVGP 2E1HA 2ROLA 4PJOD 2E3HA 3QZ9B 4ATOA 2ECZA 2GQIA 2XHCA 2LVMA 4CC3A 1AD5A 2DX1A 2FYKA 4C8QA 4RUGA 3M55A 1WXUA 4N4HA 1D3BA 2LNHB 2F2XA 2FPEA 2QTVA 4TVRA 2LX7A 3VUBA 1YJWQ 1Z9ZA 5GAOr 3JCMX 2DIGA 5CAIA 2LX9A 3G4SA 4L6V5 4ZN1A 4C92A 4M78C 1K73U 3EAEA 1QWFA 2V8KA 5IT9E 1YCSB 2LP5A 3RIRA 1BI2A 1EIFA 3MEWA 2EYZA 5KE2A 4IUVA 4EMKC 2IPOB 3VKIA 1W2BP 3G4ST 1PD1A 2KRNA 3OW2S 4C0FA 1SHFA 1I07A 3H0FA 3GP8A 1MHNA 4ZGEB 5LJ5h 1VQPA 1RACB 4A4GA 4UC4A 1EZZB 2EYXA 4E7LA 2AZVA 2LCLA 1YJNT 2CZ1B 3X20B 1W2BA 2JTFA 2FRYA 5C0MA 4DBQA 2IG0A 4OB2B 4KH1B 3E1SA 1FMKA 5EC7A 1MNEA 4RTVA 2JMAA 4WF2A 3CXCP 1VQPT 1WZOA 2M0OA 5DM7R 4LUDA 2YLBA 4L59A 2CZ0B 2DLPA 4X9DA 1N9SA 1W4SA 3RBBB 3A8HB 5GAMf 2GBQA 3OBWA 3X26B 5M9OA 4HCZA 3PFSA 3OS0A 3CXCA 3VV0A 2H8HA 1D09B 1NYFA 3EHRA 1M2VB 1N9RA 2E5KA 4EMHA 4BI3A 1OU9A 4OMLA 5J39A 2A37A 2ABLA 2YUQA 1VQ9Q 2QASA 2EYYA 1UHFA 5KYYB 3EH1A 2EAYA 4FYWB 4Z89A 4M78B 1QKXA 4C8QG 2EIFA 3RERA 2KXCA 4LDVA 4FW2A 1B07A 1VUBA 3QDRB 5A0GA 2D9TA 4CC7A 1JJ2S 2ENMA 4M7DE 5LJ3h 1AEYA 4C92G 1W6XA 5D6YA 3G1JA 3VRZA 5KYXA 3OYJA 1S72Q 1AVZC 3GNFB 5EG2A 2DTOA 3LW5E 2HL3A 3M9QA 3JCMW 5GAN3 4PJJA 4BDZA 2KROA 2CP5A 3BFMA 2B86A 1YJ9A 4M78D 3LH5A 1QQJA 3M53A 3X24B 4BY6C 1M1GA 2KGTA 4C8QB 3CCUA 4M77F 2E12A 1FWZA 1I5OB 1D3BB 4RCBA 4M7AF 3URGA 3CCSA 2EYQA 1KD1R 4QQ6A 4J7IA 4OB0B 3A8GB 1PSFA 2BZ8A 4J9EA 2DK3A 3INZA 1YJ9T 2QA4Q 4C92B 2HBPA 1K9MR 2YUPA 2X4JA 4PJLA 2P4TA 4HVUA 1I5LA 3E9GA 3CCQA 3CCUT 3CCEA 2M51A 3PE0A 2E10A 4DQ2A 1K8AU 4L5GA 2HQHA 2CP7A 4GLKA 2X3XD 2E6ZA 2EGCA 2Z0WA 3JV3A 5KYNA 2KRSA 1OULA 2VV5A 3UDCA 1NLOC 4HVWA 4KT0E 3G7ZA 3CCQT 3VS3A 1V1CA 4KUIA 2BIVA 3M0SA 3L2VA 3NTHA 5IHIA 1VQPQ 3CCET 2M16A 2MYSA 3NTKA 1KHCA 1RAIB 2K4YA 5I21A 3SB2A 1Q82R 2YLCA 1AZEA 1TTHB 1YHQQ 5GANj 1HXDA 5D6WA 1QP3A 4Z88A 3E2UA 1G2BA 1RABB 3T9NA 1ABOA 2R5MA 4A4HA 2DRMA 2E65A 4C0ZA 4DBRA 4J6WA 8ATCB 1BI1A 3GLXA 5GAN5 2MWOA 3JCMQ 3JCMf 1M8VA 2OI3A 3TQ7P 1PSEA 1ZQ1A 4BI8B 4M77E 3FJPA 3OA6A 1E6GA 4OMPA 1OPLA 4N0AA 2DAQA 1KD1C 2CREA 4NOYA 1JEGA 1BIBA 5CKDA 4GY5A 1E6HA 3LGLA 1K9MC 2GGRA 1CKAA 3TCJA 2KNBB 1J3TA 4J9IA 2RN8A 1SF9A 2ATCB 1VIFA 3G6EA 1ACMB 3I55A 4PJMA 3A8OB 2GFAA 2LMJA 3H9NA 5I22A 2XKOC 3A5ZB 1X2QA 2J6OA 5KYXB 4R55A 3HP9A 2FZKB 1AZGB 2IIMA 1YWOA 2HBWA 4J9BA 3OMCA 4OB1B 2D6FA 1QVFS 3CD6A 3D7SB 1BB9A 2QQAA 2FO0A 2F1LA 3G6ET 1FMWA 4OB3B 1LNXA 1BIAA 5FU7B 1Q82C 1N8RU 4F7UA 3DLMA 3NFCA 2CYZB 1UHCA 1K9AA 2XDDA 1YITA 1VQ6Q 3S6WA 2GFUA 3EH2A 4XTWA 5DY9A 4J7FA 3CD6T 2DVJA 1RAAB 4IUUA 4A4FA 3TREA 2DJZA 4KUDK 2HNIA 1P92A 3OQ5A 3CCSQ 2LCSA 4LXCA 3H0HA 2V26A 3MEVA 3OS2A 1KFZA 1ZA1B 3CC7T 4E2FB 6AT1B 1YITT 4J9DA 2I0NA 4R0KA 1IREB 4IIOA 1BCMA 2ZPHB 3BW1A 4JPBW 3CCQQ 1K9MU 2XD0A 3UA7A 1Y07A 3TU4K 1YN8A 3VRYA 1TUDA 5GMKe 1ARKA 2LT4A 3X28B 4QQGA 1YJWA 4FYVB 3TSZA 3HTRA 5GANf 3LYIA 4J9HA 2ZPIB 3JB9F 1SKUB 5GAMd 4E47A 4HCKA 1VQ4A 1Y7XA 1NE8A 2DO3A 4KBMB 2AKKA 2JNGA 1R8OB 1ZX6A 2FPDA 2QQ9A 2VWFA 1BCOA 1YJWT 1M3AA 4DA4A 2FPFA 1AT1B 1NZ9A 2DXCA 4F17A 1WJRA 2CP6A 4D6WA 3GOXA 2PVOB 1YBYA 4RTTA 4HKEA 4PJOG 2PVGB 1VQ4T 1CKBA 5IHKA 1MMAA 2QGGA 3AT1B 1UGPB 2HSEB 2F5TX 2A08A 3TVTA 3I5SA 4F7UG 3ULRB 4AG2C 3QIIA 3UT1A 4JUVA 2AIRB 2CSQA 3CMAA 2LQWA 1AWWA 1TG0A 1WDXA 1VQKA 2L0AA 4NS5A 3RNJA 1UGVA 1NBEB 2JZ2A 1ZUUA 3RKYA 1VQ5A 2EQIA 2NYSA 4M75E 4RG8A 3G6EQ 1B34A 1X6GA 2MCNA 1UUEA 5C6SA 3CMAT 3I55Q 1RAFB 3ZEHA 2QDYB 1VQ9A 2NUPA 3QZ5B 2YRVA 1OX9A 1VQKT 2JM9A 1LVKA 5CK9A 1GBRA 3OW2P 1EFNA 1BU1A
chains in the Genus database with same CATH topology
1ZUYA 2O88A 2CUBA 2RMOA 1Z9QA 4LUDA 3VS1A 1M27C 1I0CA 2DLPA 5GJWB 3R6NA 4JZ4A 2HCKA 2KR3A 2RPNA 3RBBB 1YP5A 2GBQA 1YWPA 2K9GA 1HD3A 2H8HA 1NYFA 3EHRA 1PHTA 1QKWA 2E5KA 4AFSC 4OMLA 4GLMA 4ORZA 2DBKA 2A37A 4J9CA 2ABLA 2YUQA 1GCQC 4ZNXA 1NEGA 2EYYA 1UHFA 1W1FA 4Z89A 4JJCA 2KEAA 4DEYA 1UJ0A 1QKXA 1T0HA 3EG1A 2C0IA 2KXCA 1B3QA 2DM1A 1B07A 1GRIA 3VS5A 1IO6A 2L2PA 1SPKA 3EGUA 3PVQA 4CC7A 3REBB 2CH4A 2ENMA 1OOTA 4DEXA 2V1RA 1AEYA 4IIMA 2JS0A 2LJ0A 1W6XA 1T3LA 5IHNA 3VRZA 2CT3A 1RI9A 2KYMA 1WYXA 2CT4A 2V1QA 5HCKA 1JXOA 1AVZC 2JXBA 1KIKA 2DBMA 3M0QA 2DA9A 4OMOA 2KYBA 2OAWA 2YSQA 2EPDA 4Y92A 1GCQA 2DNUA 2MIOA 2KROA 3VS6A 2L3PA 1K4US 4K11A 1K0SA 2B86A 3LH5A 1UECA 4RTYA 2KGTA 1LCKA 4WCIA 2EW3A 2SEMA 1CSKA 1WA7A 1X27A 4RTUA 3IQLA 1X6BA 4F16A 1H3HA 1WFWA 1NYGA 2YDLA 2L3SA 2SRCA 2BZ8A 4OMMA 2DL7A 4J9EA 2D8HA 2PZ1A 2OJ2A 2YUPA 2KT8A 2HEQA 3KFVA 4HVUA 2AK5A 3M0RA 2DF6A 2JT4A 2KXDA 2A28A 2CH4W 2M51A 1T3SA 3GBQA 3PE0A 2F2WA 2DMOA 2VKNA 1RUWA 1BK2A 5FWCA 1AOJA 1M3BA 2J7IA 2NWMA 2K7AA 4LN2A 2X3XD 2EGCA 4JZ3A 2G6FX 3JV3A 2HDAA 2L3QA 3QWXX 1VA7A 2KRSA 3NHNA 1HSQA 1NLOC 1Y57A 2J6KA 1GFDA 1GBQA 2P4RA 4RTZA 2CUDA 4LNPA 4HVWA 1QLYA 3VS7A 1WI7A 1W70A 4AG1C 3VS0A 3VS3A 2VVKA 1V1CA 1OV3A 1SEMA 3M0SA 5IHIA 1HJDA 2DL4A 3SEMA 1NM7A 1AWXA 1ABQA 2O2OA 1MV0B 1VYUA 1ZUKA 4A63B 2JW4A 1AZEA 1PWTA 2ROTA 2DL3A 1VYTA 2YUNA 3EG0A 2RQUA 4Z88A 1G2BA 2YUOA 1E7OA 4LE9A 2EVRA 4EIKA 1ABOA 2QDLA 1JQQA 2K3BA 2DRMA 3REAB 4JJDA 1ZSGA 1I1JA 1WLPB 3U23A 2DYBA 4FSSA 1JXMA 1UJYA 1UFFA 1JU5C 1OEBA 1T0JA 1QWEA 2LJ3A 2OI3A 5I11A 2J6FA 2XMFA 1E6GA 4OMPA 1OPLA 1H8KA 4OMQA 2CREA 4J9FA 1GL5A 2FRWA 1RLPC 1M30A 1JEGA 1SHGA 2D1XA 5FW9A 1AWOA 1E6HA 4M4ZA 3O5ZA 2GGRA 1CKAA 2KBTA 2KNBB 1J3TA 4J9IA 2O9VA 2PTKA 2RN8A 1KJWA 4AFZC 2GNCA 1M8MA 2AZSA 1XOVA 4CC2A 3M0PA 3PVLA 2LMJA 1K0XA 1SRLA 5I22A 1A0NB 4QT7A 3ZL7C 5FWBA 1X2QA 2GTJA 2J6OA 4ESRA 2FG0A 5ECAA 1AZGB 2X3WD 1K76A 4AFUC 2IIMA 1UE9A 1YWOA 1UDLA 2HBWA 2D8JA 1JO8A 2M0YA 4J9BA 1BB9A 2FO0A 3NPFA 2RQVA 2K2MA 2FEIA 2ESWA 3UATA 1KSWA 3VS4A 1K1ZA 1VYVA 3EG3A 2RQWA 1PKSA 2YT6A 1MV3A 1ZBJA 1X2KA 1WIEA 1UHCA 1K9AA 1RLQC 4D8KA 3FJ5A 2JM8A 2K79A 2J05A 4D8DA 3TSWA 3SHWA 2DVJA 1TUCA 3EHQA 5IXFA 1U3OA 2EBPA 5IXBA 4JJBA 1ZLMA 4Z8AA 1QCFA 2LCSA 1NG2A 3H0HA 3EG2A 3NGPA 4KRTA 4F14A 1OPKA 4LUEA 1KFZA 1NLPC 1GCPA 2EKHA 2DL8A 2O31A 4J9DA 2I0NA 4HVVA 2JTEA 4R0KA 2O9SA 2KE9A 4IIOA 3H41A 2EGAA 1SRMA 4CC4B 3THKA 1AWJA 1X43A 2KRMA 4JPBW 2A36A 1G83A 3CQTA 1PRMC 2DJQA 4OMNA 2C0OA 3UA7A 2BZXA 1YN8A 2BZYA 2NUZA 1TUDA 3VRYA 1ARKA 1SSHA 3C0CA 1WXTA 2K6DA 2CDTA 2CSIA 3TSZA 3M0TA 3UA6A 2LQNA 4E6RA 1N5ZA 1WX6A 3A98A 4J9HA 3VS2A 4J9GA 2LJ1A 2EGEA 2ED0A 5L23A 1H92A 2MOXA 1PRLC 5GJVB 4HCKA 3NMZC 2PNIA 4X1VA 1U06A 2DILA 4RTWA 4HXJA 2DL5A 2D0NA 4GBQA 2AKKA 1ZX6A 2FPDA 2ROLA 2VWFA 1NEBA 2ECZA 5IH2A 1M3AA 2GQIA 3I5RA 2ED1A 4CC3A 1Y0MA 2DRKA 1AD5A 2DX1A 2FPFA 2W10A 4RUGA 2JS2A 1WXUA 4F17A 2LNHB 2AKLA 2F2XA 2FPEA 1GFCA 2LX7A 4RTTA 1Z9ZA 2RF0A 1CKBA 3M0UA 2HSPA 5IHKA 2BTTA 2DE0X 2F2VA 1QWFA 2A08A 3TVTA 1X69A 1YCSB 2LP5A 1MUZA 3I5SA 3ULRB 4AG2C 1M3CA 2EYZA 1YNZA 2CSQA 1PKTA 2GTOA 2LQWA 2C0TA 1AWWA 1TG0A 1WDXA 2J06A 2W0ZA 2KRNA 2LZ6B 4AFQC 2L0AA 3RNJA 1UG1A 1UGVA 1SHFA 3QWYA 1I07A 3H0FA 1PNJA 1ZUUA 2EYXA 3H0IA 2EQIA 2AZVA 1U5SA 3UF4A 1X6GA 1FYNA 2MCNA 1UUEA 2RNAA 4RTXA 2FRYA 2KT1A 1BBZA 2RQRA 1UTIA 1FMKA 3I35A 1WXBA 2JM9A 2RQTA 2JMAA 4RTVA 5EC7A 3I9QA 2EYWA 1GBRA 1S1NA 1EFNA 2JMCA 1BU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUY A;  2O88 A;  2CUB A;  2RMO A;  1Z9Q A;  4LUD A;  3VS1 A;  1M27 C;  1I0C A;  2DLP A;  5GJW B;  3R6N A;  4JZ4 A;  2HCK A;  2KR3 A;  2RPN A;  3RBB B;  1YP5 A;  2GBQ A;  1YWP A;  2K9G A;  1HD3 A;  2H8H A;  1NYF A;  3EHR A;  1PHT A;  1QKW A;  2E5K A;  4AFS C;  4OML A;  4GLM A;  4ORZ A;  2DBK A;  2A37 A;  4J9C A;  2ABL A;  2YUQ A;  1GCQ C;  4ZNX A;  1NEG A;  2EYY A;  1UHF A;  1W1F A;  4Z89 A;  4JJC A;  2KEA A;  4DEY A;  1UJ0 A;  1QKX A;  1T0H A;  3EG1 A;  2C0I A;  2KXC A;  1B3Q A;  2DM1 A;  1B07 A;  1GRI A;  3VS5 A;  1IO6 A;  2L2P A;  1SPK A;  3EGU A;  3PVQ A;  4CC7 A;  3REB B;  2CH4 A;  2ENM A;  1OOT A;  4DEX A;  2V1R A;  1AEY A;  4IIM A;  2JS0 A;  2LJ0 A;  1W6X A;  1T3L A;  5IHN A;  3VRZ A;  2CT3 A;  1RI9 A;  2KYM A;  1WYX A;  2CT4 A;  2V1Q A;  5HCK A;  1JXO A;  1AVZ C;  2JXB A;  1KIK A;  2DBM A;  3M0Q A;  2DA9 A;  4OMO A;  2KYB A;  2OAW A;  2YSQ A;  2EPD A;  4Y92 A;  1GCQ A;  2DNU A;  2MIO A;  2KRO A;  3VS6 A;  2L3P A;  1K4U S;  4K11 A;  1K0S A;  2B86 A;  3LH5 A;  1UEC A;  4RTY A;  2KGT A;  1LCK A;  4WCI A;  2EW3 A;  2SEM A;  1CSK A;  1WA7 A;  1X27 A;  4RTU A;  3IQL A;  1X6B A;  4F16 A;  1H3H A;  1WFW A;  1NYG A;  2YDL A;  2L3S A;  2SRC A;  2BZ8 A;  4OMM A;  2DL7 A;  4J9E A;  2D8H A;  2PZ1 A;  2OJ2 A;  2YUP A;  2KT8 A;  2HEQ A;  3KFV A;  4HVU A;  2AK5 A;  3M0R A;  2DF6 A;  2JT4 A;  2KXD A;  2A28 A;  2CH4 W;  2M51 A;  1T3S A;  3GBQ A;  3PE0 A;  2F2W A;  2DMO A;  2VKN A;  1RUW A;  1BK2 A;  5FWC A;  1AOJ A;  1M3B A;  2J7I A;  2NWM A;  2K7A A;  4LN2 A;  2X3X D;  2EGC A;  4JZ3 A;  2G6F X;  3JV3 A;  2HDA A;  2L3Q A;  3QWX X;  1VA7 A;  2KRS A;  3NHN A;  1HSQ A;  1NLO C;  1Y57 A;  2J6K A;  1GFD A;  1GBQ A;  2P4R A;  4RTZ A;  2CUD A;  4LNP A;  4HVW A;  1QLY A;  3VS7 A;  1WI7 A;  1W70 A;  4AG1 C;  3VS0 A;  3VS3 A;  2VVK A;  1V1C A;  1OV3 A;  1SEM A;  3M0S A;  5IHI A;  1HJD A;  2DL4 A;  3SEM A;  1NM7 A;  1AWX A;  1ABQ A;  2O2O A;  1MV0 B;  1VYU A;  1ZUK A;  4A63 B;  2JW4 A;  1AZE A;  1PWT A;  2ROT A;  2DL3 A;  1VYT A;  2YUN A;  3EG0 A;  2RQU A;  4Z88 A;  1G2B A;  2YUO A;  1E7O A;  4LE9 A;  2EVR A;  4EIK A;  1ABO A;  2QDL A;  1JQQ A;  2K3B A;  2DRM A;  3REA B;  4JJD A;  1ZSG A;  1I1J A;  1WLP B;  3U23 A;  2DYB A;  4FSS A;  1JXM A;  1UJY A;  1UFF A;  1JU5 C;  1OEB A;  1T0J A;  1QWE A;  2LJ3 A;  2OI3 A;  5I11 A;  2J6F A;  2XMF A;  1E6G A;  4OMP A;  1OPL A;  1H8K A;  4OMQ A;  2CRE A;  4J9F A;  1GL5 A;  2FRW A;  1RLP C;  1M30 A;  1JEG A;  1SHG A;  2D1X A;  5FW9 A;  1AWO A;  1E6H A;  4M4Z A;  3O5Z A;  2GGR A;  1CKA A;  2KBT A;  2KNB B;  1J3T A;  4J9I A;  2O9V A;  2PTK A;  2RN8 A;  1KJW A;  4AFZ C;  2GNC A;  1M8M A;  2AZS A;  1XOV A;  4CC2 A;  3M0P A;  3PVL A;  2LMJ A;  1K0X A;  1SRL A;  5I22 A;  1A0N B;  4QT7 A;  3ZL7 C;  5FWB A;  1X2Q A;  2GTJ A;  2J6O A;  4ESR A;  2FG0 A;  5ECA A;  1AZG B;  2X3W D;  1K76 A;  4AFU C;  2IIM A;  1UE9 A;  1YWO A;  1UDL A;  2HBW A;  2D8J A;  1JO8 A;  2M0Y A;  4J9B A;  1BB9 A;  2FO0 A;  3NPF A;  2RQV A;  2K2M A;  2FEI A;  2ESW A;  3UAT A;  1KSW A;  3VS4 A;  1K1Z A;  1VYV A;  3EG3 A;  2RQW A;  1PKS A;  2YT6 A;  1MV3 A;  1ZBJ A;  1X2K A;  1WIE A;  1UHC A;  1K9A A;  1RLQ C;  4D8K A;  3FJ5 A;  2JM8 A;  2K79 A;  2J05 A;  4D8D A;  3TSW A;  3SHW A;  2DVJ A;  1TUC A;  3EHQ A;  5IXF A;  1U3O A;  2EBP A;  5IXB A;  4JJB A;  1ZLM A;  4Z8A A;  1QCF A;  2LCS A;  1NG2 A;  3H0H A;  3EG2 A;  3NGP A;  4KRT A;  4F14 A;  1OPK A;  4LUE A;  1KFZ A;  1NLP C;  1GCP A;  2EKH A;  2DL8 A;  2O31 A;  4J9D A;  2I0N A;  4HVV A;  2JTE A;  4R0K A;  2O9S A;  2KE9 A;  4IIO A;  3H41 A;  2EGA A;  1SRM A;  4CC4 B;  3THK A;  1AWJ A;  1X43 A;  2KRM A;  4JPB W;  2A36 A;  1G83 A;  3CQT A;  1PRM C;  2DJQ A;  4OMN A;  2C0O A;  3UA7 A;  2BZX A;  1YN8 A;  2BZY A;  2NUZ A;  1TUD A;  3VRY A;  1ARK A;  1SSH A;  3C0C A;  1WXT A;  2K6D A;  2CDT A;  2CSI A;  3TSZ A;  3M0T A;  3UA6 A;  2LQN A;  4E6R A;  1N5Z A;  1WX6 A;  3A98 A;  4J9H A;  3VS2 A;  4J9G A;  2LJ1 A;  2EGE A;  2ED0 A;  5L23 A;  1H92 A;  2MOX A;  1PRL C;  5GJV B;  4HCK A;  3NMZ C;  2PNI A;  4X1V A;  1U06 A;  2DIL A;  4RTW A;  4HXJ A;  2DL5 A;  2D0N A;  4GBQ A;  2AKK A;  1ZX6 A;  2FPD A;  2ROL A;  2VWF A;  1NEB A;  2ECZ A;  5IH2 A;  1M3A A;  2GQI A;  3I5R A;  2ED1 A;  4CC3 A;  1Y0M A;  2DRK A;  1AD5 A;  2DX1 A;  2FPF A;  2W10 A;  4RUG A;  2JS2 A;  1WXU A;  4F17 A;  2LNH B;  2AKL A;  2F2X A;  2FPE A;  1GFC A;  2LX7 A;  4RTT A;  1Z9Z A;  2RF0 A;  1CKB A;  3M0U A;  2HSP A;  5IHK A;  2BTT A;  2DE0 X;  2F2V A;  1QWF A;  2A08 A;  3TVT A;  1X69 A;  1YCS B;  2LP5 A;  1MUZ A;  3I5S A;  3ULR B;  4AG2 C;  1M3C A;  2EYZ A;  1YNZ A;  2CSQ A;  1PKT A;  2GTO A;  2LQW A;  2C0T A;  1AWW A;  1TG0 A;  1WDX A;  2J06 A;  2W0Z A;  2KRN A;  2LZ6 B;  4AFQ C;  2L0A A;  3RNJ A;  1UG1 A;  1UGV A;  1SHF A;  3QWY A;  1I07 A;  3H0F A;  1PNJ A;  1ZUU A;  2EYX A;  3H0I A;  2EQI A;  2AZV A;  1U5S A;  3UF4 A;  1X6G A;  1FYN A;  2MCN A;  1UUE A;  2RNA A;  4RTX A;  2FRY A;  2KT1 A;  1BBZ A;  2RQR A;  1UTI A;  1FMK A;  3I35 A;  1WXB A;  2JM9 A;  2RQT A;  2JMA A;  4RTV A;  5EC7 A;  3I9Q A;  2EYW A;  1GBR A;  1S1N A;  1EFN A;  2JMC A;  1BU1 A; 
#chains in the Genus database with same CATH topology
 9ATC B;  1ZUY A;  2O88 A;  2CUB A;  2RMO A;  1WHH A;  1Z9Q A;  4N4I A;  4PK4 A;  1U1T A;  3ZBD A;  2V8J A;  2MI6 A;  3C4S A;  1I0C A;  5GAM e;  2OTJ Q;  1EX4 A;  3CC2 Q;  4EMK A;  4PJO E;  2KR3 A;  1VQ9 T;  1FXX A;  2V8I A;  3EFO A;  4F7U B;  4XU2 A;  1HD3 A;  1G3Y A;  2HKN A;  1QKW A;  1YIT Q;  3LLR A;  1NJI R;  4IUQ A;  2X4X A;  2F69 A;  2WAC A;  1RAH B;  3QXE B;  2KEA A;  1UJ0 A;  4C5I A;  1NPP A;  1D1B A;  1T0H A;  2C0I A;  2DZC A;  2CS7 A;  4J83 A;  4NL2 A;  2DM1 A;  5GAN 4;  4IUT A;  3UWN A;  3HRT A;  1S72 T;  3JAM E;  2L2P A;  5CKH A;  3RDV A;  2YRD A;  3GPL A;  2CH4 A;  4PLI A;  2EJG A;  5KYU A;  2RJE A;  4IIM A;  1M90 U;  2JS0 A;  2LJ0 A;  4A4K A;  1T3L A;  2CT3 A;  1RI9 A;  4LDY A;  1WYX A;  1VQ7 Q;  3S3M A;  3JCM d;  2V1Q A;  1QVG A;  2XK0 A;  2JXB A;  5GAM g;  2QA4 A;  1KIK A;  2DBM A;  3FDR A;  4JRQ A;  2MK5 A;  2DA9 A;  3KBG A;  4HCC A;  1KHI A;  1LJO A;  2YWW A;  2RHU A;  2E4H A;  1C1A A;  1VQ4 Q;  5IAY A;  1K0S A;  4M7D F;  4OVA A;  2RI3 A;  2QA4 T;  4M7D C;  2RO0 A;  2YRC A;  4WCI A;  1TXQ A;  4F04 B;  5GMK m;  1Q81 R;  1H64 1;  1WA7 A;  1X27 A;  4HT9 A;  5LL6 S;  4PNO A;  1D0Z A;  1X6B A;  4F16 A;  1H3H A;  4M78 G;  1WFW A;  1NYG A;  2RH2 A;  2SRC A;  4MDX A;  4OMM A;  4JJN K;  2ZPG B;  1Q7Y U;  3JCM P;  2O01 E;  2PU9 B;  1OYX A;  2QTX A;  1RAD B;  1NJI C;  1YHQ A;  2DF6 A;  1TOV A;  2A28 A;  2CH4 W;  2KXD A;  1B7T A;  5FWC A;  3JCM J;  1AOJ A;  3OY9 A;  1X6O A;  4JS5 A;  2K7A A;  3CMA Q;  4LN2 A;  5GMK h;  5DLO A;  4ZN3 A;  3QWX X;  2QEX Q;  1QCN A;  4B6M A;  1KQ1 A;  1Y57 A;  2J6K A;  3F70 A;  1GBQ A;  4Q5W A;  1VQK Q;  3OYI A;  2K5F A;  5GAO n;  3FC3 A;  2RK1 A;  1YHQ T;  5J3B A;  4AG1 C;  3VS0 A;  1M1K R;  2EJF A;  1SEM A;  4XU3 A;  2DL4 A;  4C8Q F;  1VQ5 Q;  1AWX A;  1B34 B;  2AT1 B;  2RJC A;  1ABQ A;  5FRM A;  2OAU A;  1C0M A;  2NUP B;  2JW4 A;  1PWT A;  1I4K 1;  1MGQ A;  3EG0 A;  2X51 A;  2YUO A;  4BB7 A;  4C92 F;  4C0D C;  3JCM e;  1JQQ A;  3LWH A;  4ANJ A;  1M1F A;  1FMV A;  1UJY A;  1D1C A;  4EMK B;  4OMF B;  3EFO B;  1UEB A;  3OSS C;  4M78 E;  3PT9 A;  1T0J A;  2Y90 A;  1XJW B;  2FB7 A;  4JRI A;  1WHK A;  5I11 A;  2ZAE A;  2K3X A;  2O4X A;  3QJ6 A;  3P8B B;  5GAN d;  1H8K A;  1Q81 C;  2BUD A;  1IXD A;  4OMQ A;  4PLL A;  1KC8 R;  3MEU A;  5I2S A;  2FRW A;  1SHG A;  1PG5 B;  1NJI U;  2D1X A;  4JRK A;  3PIP A;  3HRU A;  3MP1 A;  3RES A;  4C5E A;  5KH6 A;  4PFP A;  1WJS A;  1WHM A;  1W2B S;  3RR6 A;  1VQ6 A;  3MO8 A;  4E7I A;  4E7H A;  3SD4 A;  2AZS A;  1XOV A;  5KYU B;  3M0P A;  3PVL A;  1RI0 A;  1K0X A;  1SRL A;  5CQX A;  4WTO B;  3M54 A;  5FWB A;  2GTJ A;  3JCM g;  2FG0 A;  1IB8 A;  4M77 C;  1KG1 A;  4M7A C;  1UE9 A;  2LQK A;  1UDL A;  1BYM A;  1JO8 A;  4B9W A;  1M1K C;  5GAO l;  1VQ6 T;  3SWN C;  4LD9 K;  2RQV A;  4C8Q E;  2ESW A;  1Y96 A;  1PCX A;  3FEO A;  4JDS A;  4QVZ A;  3CXC S;  3OS5 A;  2RQW A;  4ZGD B;  5GAM h;  2YHT A;  2YT6 A;  1X2K A;  1WIE A;  3CCS T;  1RLQ C;  3FJ5 A;  5GAN 6;  4E7J A;  4C92 E;  3QJY A;  2J05 A;  3TSW A;  1KQS P;  1OZ3 A;  3ER0 A;  1OX8 A;  5CIU A;  2EBP A;  5L8R E;  2RM4 A;  4JJB A;  2DIQ A;  5CO7 A;  3V8J A;  3S3O A;  3BDU A;  3EG2 A;  3NGP A;  1OPK A;  1NLP C;  2EKH A;  5CQY A;  2O31 A;  1KQS A;  4E7K A;  1I81 A;  4E7Z A;  2X4Y A;  4FL6 A;  3THK A;  1KC8 C;  2A36 A;  2A7Y A;  1BI0 A;  1PRM C;  2DJQ A;  2BZX A;  2E5Q A;  3LH0 A;  2Y4Y A;  5GAN e;  3BY7 A;  1SSH A;  3MET A;  2K6D A;  3UA6 A;  3CPW P;  1ZHI A;  2HD0 A;  1WX6 A;  3VS2 A;  1R0B G;  2LJ1 A;  2EGE A;  4BE0 A;  2KQW A;  8AT1 B;  4XQ3 A;  3C12 A;  4BY6 B;  2BE7 D;  2X9H A;  3NTI A;  2DIL A;  3L2Z A;  2FHD A;  7AT1 B;  4HXJ A;  4MDW A;  3HPW A;  1M1K U;  3OYA A;  3CPW A;  4J5Y A;  1NEB A;  5IH2 A;  2XDB A;  2GCX A;  2ED1 A;  2DRK A;  4OGE A;  2ZGW A;  2JS2 A;  2AKL A;  4MZT A;  1GFC A;  2NUT A;  3GNG A;  3FIF A;  1JRI A;  1PC0 A;  1WQ7 A;  2I2L A;  3M0U A;  3HKS A;  2DVE A;  1M4Z A;  2FZC B;  5FU6 C;  2MWP A;  3PNW C;  2BTT A;  4OP0 A;  3OS1 A;  2F2V A;  2VGN A;  4J8O A;  5GAN g;  3JB9 J;  2O4X B;  2L3R A;  1M9S A;  2DTI A;  1YNZ A;  2XIC A;  3DB4 A;  5CKE A;  3JRZ A;  2VGM A;  3M4G A;  2JOY A;  1VIE A;  1R0C B;  2MMP A;  4M77 D;  3I55 T;  1KC8 U;  2OTJ A;  3CC2 A;  4M7A D;  2LZ6 B;  2R57 A;  5I2M A;  3QWY A;  1PNJ A;  3H0I A;  3EGD A;  1HYO A;  2OTL A;  2WSF E;  1U5S A;  3OYK A;  3UF4 A;  2JVV A;  5HK3 A;  4NL3 A;  1YI2 A;  2MF2 A;  2EQM A;  2KT1 A;  4II1 A;  2OTJ T;  1OI1 A;  3CC2 T;  1UTI A;  3OYE A;  5KCH A;  1VQO Q;  3I35 A;  1WXB A;  1DJ7 B;  2EYW A;  3OYB A;  3FLG A;  1S1N A;  2KK4 A;  1FX7 A;  2KSS A;  1PM3 A;  2D0Q B;  4HA8 A;  4XU1 A;  1KD1 U;  1Y96 B;  1M27 C;  2EFI A;  3JCM h;  5LJ5 j;  5CCA A;  1VQM A;  1Q86 R;  3LWI A;  5GJW B;  1YI2 T;  4JZ4 A;  4MMK A;  2RPN A;  4B9X A;  1UGS B;  2E64 A;  4FU6 A;  4M75 F;  1TSF A;  3J80 E;  3OYG A;  2K9G A;  1VQ7 A;  4ZTF A;  1TS9 A;  4RMO A;  1PHT A;  2RB6 A;  4M75 C;  2C06 A;  4E7S A;  3G71 Q;  4GLM A;  4ORZ A;  2QQR A;  4J9C A;  1VQL A;  2WSC E;  1GCQ C;  1NEG A;  3DB3 A;  1IRX A;  1TUG B;  3JCM V;  3QPH A;  2RJF A;  1JBM A;  1YFN A;  2YXY A;  3KXT A;  3R6O A;  5KYW A;  1GRI A;  2ZPE B;  3VS5 A;  1VQ7 T;  4FT2 A;  1IO6 A;  2LTO A;  3CEY A;  4PJO F;  3EGU A;  3PVQ A;  3REB B;  3M56 A;  5GAN 7;  1K73 R;  1OOT A;  2GF7 A;  1RAE B;  4DEX A;  2V1R A;  1VQL T;  3L2Q A;  1Q82 U;  5KE3 A;  3JB9 H;  2XI9 A;  2CP3 A;  2EQJ A;  3CCL Q;  1QW1 A;  5HKC A;  2P84 A;  4R56 A;  3M0Q A;  3HFO A;  2E3I A;  3M59 A;  2DYI A;  2DKG A;  4OMO A;  3X25 B;  2OAW A;  2EPD A;  4Y92 A;  4PFO A;  1KK7 A;  2IVW A;  2DNU A;  2MIO A;  3QYH B;  3A8L B;  3VS6 A;  5LJ3 j;  2DFU A;  5CKB A;  4VUB A;  1ZA2 B;  4V2S A;  3JB9 I;  1JB0 E;  2QEX A;  1WNL A;  1O9S A;  2LRQ A;  2VXF A;  1LCK A;  1YIJ Q;  5D7U A;  2EW3 A;  2SEM A;  1Q86 C;  3GIB A;  1CSK A;  2NUT B;  4Y91 A;  4RTU A;  2A3L A;  3IQL A;  4FT4 A;  3CBP A;  2DL7 A;  3FRN A;  3EG9 A;  4FW1 A;  3M57 A;  4N4G A;  3WXM B;  2R5A A;  1D0Y A;  2PZ1 A;  4IKF A;  4QQD A;  1VQ8 Q;  2QEX T;  1O75 A;  3VJP A;  1T3S A;  2F2W A;  2DMO A;  2PUO B;  4C0G A;  2WSE E;  2J7I A;  2NWM A;  5FRO A;  5GAN h;  1VQ5 T;  2G6F X;  2L3Q A;  2XDP A;  1VA7 A;  3NHN A;  4EMG A;  5CR2 A;  3J81 E;  4HT8 A;  1WQW A;  1GFD A;  4RTZ A;  4J6X A;  4KGV B;  4LNP A;  1QLY A;  4FCY A;  1K73 C;  4M7D A;  2VVK A;  3EGD B;  2LCC A;  3JCM c;  5LJ5 f;  3OW2 A;  3SEM A;  1NM7 A;  1G3S A;  4AT1 B;  2OTL Q;  3H8Z A;  3TEE A;  1WHG A;  5HY6 A;  2O2O A;  1MV0 B;  2Y4X A;  1VYU A;  1YI2 Q;  1ZUK A;  2K57 A;  1OZ2 A;  2ROT A;  4F7U E;  3A8M B;  1HK9 A;  2K5L A;  1GXI E;  4Z02 A;  1E7O A;  3REA B;  2P0Q A;  4JJD A;  1WLP B;  3U23 A;  4FSS A;  2EJ9 A;  3EFR A;  3JB9 D;  2VYT A;  4XK8 E;  1N6A A;  4XTX A;  1VQM Q;  1JU5 C;  1OEB A;  2CZ7 B;  1QWE A;  2LJ3 A;  2CKK A;  4ZTJ A;  3ASK A;  1VOM A;  5DLQ E;  3L42 A;  4YTL A;  4PFZ A;  3DLL A;  4J9F A;  2RHY A;  1M30 A;  3C95 A;  1I8F A;  5GAO m;  1VQL Q;  5FW9 A;  2JTM A;  3V7R A;  2KVQ G;  1PD0 A;  2MPX C;  4M4Z A;  2K2V A;  2EQU A;  3O5Z A;  5GAN 2;  1JJ2 P;  3CCM Q;  1WJQ A;  5KYW B;  4IUP A;  4OF1 A;  1KJW A;  2RI5 A;  4M78 F;  4AFZ C;  5GAN 8;  5AYF A;  3M4Y A;  2DET A;  4MZP A;  4CC2 A;  4LDW A;  5LJ3 f;  2QQS A;  3ZL7 C;  2X35 A;  1K8A R;  1JJ2 A;  4LDU A;  5A2Q E;  4XTU A;  2X3W D;  4XTV A;  1YJN A;  1XQH A;  2D8J A;  2DZ9 A;  2OX7 A;  2M9U A;  4LD6 A;  3VU3 C;  2K2M A;  3V8L A;  2FEI A;  2RK2 A;  3VUZ A;  4JLI A;  3VS4 A;  1V76 A;  1VYV A;  2ZCF B;  3GF5 A;  4O5V A;  3QSU A;  3JCM b;  3LX7 A;  4BE1 A;  4M7D G;  1ZBJ A;  2CGH A;  2P0P A;  4BE2 A;  4BD3 A;  4ME7 A;  5CKF A;  2JM8 A;  4DBF A;  3KUF A;  2H3J A;  2K79 A;  4CI0 C;  3OYN A;  4D8D A;  3QBY A;  2M1H A;  3ME9 A;  1M2O A;  1TUC A;  1VQN Q;  5IXF A;  2KI7 A;  2PQW A;  3CPF A;  3PMT A;  1WHJ A;  3CCR Q;  3QKJ A;  3DKM A;  5IXB A;  2L5Q A;  4BUG A;  4Z8A A;  2LDM A;  4KUL A;  2XU8 A;  4O6J A;  3EG9 B;  4M77 A;  2DL8 A;  3MP8 A;  4M7A A;  2KDS A;  4HVV A;  4C8Q C;  2JTE A;  1UGQ B;  3H41 A;  2E6N A;  1SRM A;  1IZ6 A;  1LPL A;  1AWJ A;  3L1A A;  1X43 A;  2KRM A;  3SWN A;  2EKO A;  2HKQ B;  1OQK A;  1G83 A;  4QVC A;  1AHJ B;  3CC4 Q;  4OMN A;  4ZGJ B;  1QVG S;  3S3N A;  3OYD A;  2BZY A;  2NUZ A;  4QKU A;  3PGG A;  4MML A;  3C0C A;  1ZBX A;  3M0T A;  4PJN A;  4C92 C;  2RI2 A;  3A98 A;  1D0X A;  4A53 A;  2ED0 A;  4M7D B;  2QK0 A;  2BKD N;  2COZ A;  1PRL C;  4X34 A;  3NMZ C;  2PNI A;  4X1V A;  1MMG A;  3AHU A;  3RUX A;  4RTW A;  3QYG B;  2DL5 A;  3J7A F;  1K8A C;  1XTD A;  3C94 A;  3CME Q;  2JJ9 A;  3OB9 A;  4MZM A;  1IGQ A;  4X9C A;  3I5R A;  1Y0M A;  2EWN A;  2DXU A;  2W10 A;  4DBH A;  4C5H A;  2DEQ A;  2KAF A;  3M5A A;  2MAM A;  2RF0 A;  2EQK A;  2NLU A;  1RAG B;  2HSP A;  3V7S A;  3HL8 A;  5GMK i;  1QP2 A;  2M02 A;  1N8R R;  1ZSZ A;  2DE0 X;  4FYY B;  3V7C A;  3I56 A;  1VQO A;  2QGF B;  2RHZ A;  1X69 A;  5D6X A;  4BAC A;  1MUZ A;  3ZFJ A;  2RJD A;  4M7D D;  1M3C A;  2A0F B;  1MMD A;  1PKT A;  5J26 A;  2GTO A;  2HAX A;  2C0T A;  2J06 A;  2W0Z A;  4BI4 A;  4AFQ C;  3JSC A;  1UG1 A;  3LGF A;  3OSV A;  3I56 T;  3BE3 A;  1VQO T;  2ZPF B;  1XNI A;  1BKB A;  4C0D B;  2RD1 A;  3OMG A;  2CP2 A;  3G71 A;  1YCY A;  1FYN A;  2RNA A;  4M77 G;  3G4S Q;  4Y28 E;  4RTX A;  4M7A G;  1QVF P;  1BBZ A;  2G3R A;  1IGU A;  2RQR A;  4DOW A;  3Q1J A;  2RQT A;  3I9Q A;  2PVD B;  3N5B B;  4EDU A;  2JMC A;  1Q81 U;  1YJN Q;  4OGC A;  1QCO A;  3VS1 A;  1G5V A;  3L2R A;  2LC4 A;  3G71 T;  3R6N A;  4A4E A;  4J6Y A;  5GMK l;  1QVF A;  2HCK A;  5FRN A;  3RMQ A;  1IHV A;  1QVP A;  1YP5 A;  2KY9 A;  3MP6 A;  1YWP A;  4C8Q D;  2DER A;  1KQ2 A;  3CCL A;  4AFS C;  1ZSZ C;  2VUB A;  2DBK A;  1WHL A;  2X4W A;  5FU7 C;  4ZNX A;  1RL2 A;  2AHJ B;  1W1F A;  3CCJ A;  2JUF A;  1UB4 A;  4JJC A;  4DEY A;  5LJ5 d;  3HRS A;  3EG1 A;  1N8R C;  4C92 D;  1B3Q A;  4XU0 A;  2H3E B;  2HZY A;  4KH0 B;  4M77 B;  4M7A B;  3CCL T;  2L8D A;  1SPK A;  3SWN B;  1YIJ A;  2HMA A;  3EGX A;  5IHN A;  3CCJ T;  2KYM A;  2VAS A;  4M7A E;  2CT4 A;  5AT1 B;  2FZG B;  5HCK A;  1JXO A;  2L89 A;  4A54 A;  3WVD B;  4PKC C;  4FYX B;  1X01 A;  2DXB A;  1NPR A;  4M75 A;  1VQ8 A;  3SDZ A;  3MJX A;  3SFM A;  3P8H A;  2KYB A;  2YSQ A;  1GCQ A;  1N27 A;  1YIJ T;  4FM4 B;  2FL7 A;  2L3P A;  1K4U S;  4K11 A;  1SG5 A;  1LOJ A;  1UEC A;  3M58 A;  4JLG A;  1TWB A;  2XID A;  4RTY A;  3V8K A;  1G3W A;  4JRP A;  2LNV A;  2DTH A;  1VQ8 T;  1H3Z A;  4PJO A;  1KQS S;  2K3Y A;  2YDL A;  2L3S A;  2D8H A;  5LJ3 d;  1Y71 A;  2DD4 A;  2OJ2 A;  1ZSZ B;  2RA2 A;  2KT8 A;  2HEQ A;  3HHT B;  3KFV A;  2F5K A;  4ELY C;  1U1S A;  2AK5 A;  3M0R A;  3I56 Q;  2JT4 A;  4BDY A;  3GBQ A;  3CCV A;  2VKN A;  3CC7 A;  1RUW A;  1BK2 A;  3VYH B;  1M3B A;  4CRI A;  4XAX B;  3WVE B;  1YJ9 Q;  2B8A A;  3H6Z A;  2OTL T;  4JZ3 A;  4QVD A;  2HDA A;  4QW2 A;  1HSQ A;  1X75 C;  3CCU Q;  2P0K A;  2P4R A;  4HCB A;  2CUD A;  5LJ5 e;  5KCO A;  3RKW A;  3VS7 A;  1WI7 A;  3CPW S;  1W70 A;  1V29 B;  1TU0 B;  4N0A C;  1OV3 A;  3OYC A;  1BI3 A;  1HJD A;  3UPU A;  4KGZ B;  3CCV T;  3PTA A;  3OYY A;  2LQ8 A;  1M90 R;  4A63 B;  2DEU A;  3RKX A;  1VQM T;  2DL3 A;  3FB9 A;  5FU6 B;  1VYT A;  4ELZ C;  2YUN A;  3OYH A;  1Q95 G;  1UGR B;  5GMK j;  3BDL A;  1G3T A;  2RQU A;  1MND A;  3MEA A;  2COY A;  3CCM A;  3CCE Q;  3E9F A;  4LE9 A;  3HSB A;  2EVR A;  4EIK A;  4KGX B;  2QDL A;  2K3B A;  1IHW A;  1ZSG A;  2ZZD A;  1I1J A;  2DYB A;  1JXM A;  2RHI A;  1OU8 A;  1UFF A;  2QXF A;  5CVI A;  5GAO p;  4PJO C;  4M75 G;  3OYL A;  2HQE A;  2J6F A;  1SSF A;  2XMF A;  3MKD A;  3CCM T;  2PUK B;  3OYF A;  2COW A;  3PMI A;  3JB9 G;  1WGS A;  2QQB A;  3QO3 A;  4F7U F;  1GL5 A;  1RLP C;  2JN0 A;  5IN1 A;  5FLX E;  5LJ5 g;  1QMC A;  1TH7 A;  3O8V A;  3QDF A;  1AWO A;  1C6V X;  3MCA B;  2K5I A;  3CCJ Q;  4DOV A;  5GAO q;  2DPP B;  1F1B B;  2KBT A;  3EFS A;  4LDX A;  1G8X A;  1D1A A;  2GQV A;  2O9V A;  2PTK A;  4C5G A;  1Q7Y R;  3HFN A;  5LJ3 e;  4FSX A;  3L2U A;  3OBY A;  2GNC A;  1M8M A;  1U8R A;  1VQN A;  4RCC A;  3RMS A;  2FVU A;  2HQX A;  1A0N B;  4QT7 A;  4EPC A;  2QYZ A;  3EGX B;  3OYM A;  3CCR A;  2BE9 B;  4ESR A;  2DD5 A;  5ECA A;  1K76 A;  4AFU C;  2M0Y A;  2VB6 A;  3NPF A;  4M75 B;  3UAT A;  1KSW A;  3PIO A;  1K1Z A;  1VQN T;  3CBO A;  3EG3 A;  2VXE A;  3CC4 A;  2ZPB B;  1M90 C;  2QG9 B;  2R58 A;  1PKS A;  2DXT A;  2QI2 A;  3CCR T;  1MV3 A;  3MPU B;  5HK0 A;  4RKU E;  4D8K A;  4AMC A;  3CBM A;  1M2V A;  3SHW A;  1M5Q 1;  3EHQ A;  2HL5 C;  4XTY A;  1U3O A;  2KMT A;  5KYY A;  1R77 A;  4PJO B;  2CZ6 B;  3A1P A;  3MHX A;  3CC4 T;  4M78 A;  1ZLM A;  1QCF A;  1NG2 A;  4KRT A;  4IUR A;  5LJ3 g;  4F14 A;  2VC8 A;  4LUE A;  1GCP A;  5A0L A;  3QUI A;  5GAM j;  2E41 A;  3CME A;  3CD6 Q;  2O9S A;  2KE9 A;  2EGA A;  4CC4 B;  5A0D A;  2XG8 D;  4FIB A;  1MMN A;  3CQT A;  4M75 D;  2CP0 A;  2C0O A;  1WPY A;  2E70 A;  3L2W A;  3CCV Q;  3CC7 Q;  3QG1 A;  3VYG A;  1S72 A;  1WXT A;  2RHX A;  2CDT A;  2CSI A;  2LQN A;  4PL6 A;  4E6R A;  1N5Z A;  4XTZ A;  3E19 A;  3CME T;  1Q7Y C;  4J9G A;  3P8D A;  5L23 A;  4JS4 A;  1H92 A;  2MOX A;  5GJV B;  1Q86 U;  4P5N A;  1U06 A;  2QAZ A;  2LT1 A;  4RG2 A;  2D0N A;  3QHS A;  4GBQ A;  1QVG P;  2E1H A;  2ROL A;  4PJO D;  2E3H A;  3QZ9 B;  4ATO A;  2ECZ A;  2GQI A;  2XHC A;  2LVM A;  4CC3 A;  1AD5 A;  2DX1 A;  2FYK A;  4C8Q A;  4RUG A;  3M55 A;  1WXU A;  4N4H A;  1D3B A;  2LNH B;  2F2X A;  2FPE A;  2QTV A;  4TVR A;  2LX7 A;  3VUB A;  1YJW Q;  1Z9Z A;  5GAO r;  3JCM X;  2DIG A;  5CAI A;  2LX9 A;  3G4S A;  4L6V 5;  4ZN1 A;  4C92 A;  4M78 C;  1K73 U;  3EAE A;  1QWF A;  2V8K A;  5IT9 E;  1YCS B;  2LP5 A;  3RIR A;  1BI2 A;  1EIF A;  3MEW A;  2EYZ A;  5KE2 A;  4IUV A;  4EMK C;  2IPO B;  3VKI A;  1W2B P;  3G4S T;  1PD1 A;  2KRN A;  3OW2 S;  4C0F A;  1SHF A;  1I07 A;  3H0F A;  3GP8 A;  1MHN A;  4ZGE B;  5LJ5 h;  1VQP A;  1RAC B;  4A4G A;  4UC4 A;  1EZZ B;  2EYX A;  4E7L A;  2AZV A;  2LCL A;  1YJN T;  2CZ1 B;  3X20 B;  1W2B A;  2JTF A;  2FRY A;  5C0M A;  4DBQ A;  2IG0 A;  4OB2 B;  4KH1 B;  3E1S A;  1FMK A;  5EC7 A;  1MNE A;  4RTV A;  2JMA A;  4WF2 A;  3CXC P;  1VQP T;  1WZO A;  2M0O A;  5DM7 R;  4LUD A;  2YLB A;  4L59 A;  2CZ0 B;  2DLP A;  4X9D A;  1N9S A;  1W4S A;  3RBB B;  3A8H B;  5GAM f;  2GBQ A;  3OBW A;  3X26 B;  5M9O A;  4HCZ A;  3PFS A;  3OS0 A;  3CXC A;  3VV0 A;  2H8H A;  1D09 B;  1NYF A;  3EHR A;  1M2V B;  1N9R A;  2E5K A;  4EMH A;  4BI3 A;  1OU9 A;  4OML A;  5J39 A;  2A37 A;  2ABL A;  2YUQ A;  1VQ9 Q;  2QAS A;  2EYY A;  1UHF A;  5KYY B;  3EH1 A;  2EAY A;  4FYW B;  4Z89 A;  4M78 B;  1QKX A;  4C8Q G;  2EIF A;  3RER A;  2KXC A;  4LDV A;  4FW2 A;  1B07 A;  1VUB A;  3QDR B;  5A0G A;  2D9T A;  4CC7 A;  1JJ2 S;  2ENM A;  4M7D E;  5LJ3 h;  1AEY A;  4C92 G;  1W6X A;  5D6Y A;  3G1J A;  3VRZ A;  5KYX A;  3OYJ A;  1S72 Q;  1AVZ C;  3GNF B;  5EG2 A;  2DTO A;  3LW5 E;  2HL3 A;  3M9Q A;  3JCM W;  5GAN 3;  4PJJ A;  4BDZ A;  2KRO A;  2CP5 A;  3BFM A;  2B86 A;  1YJ9 A;  4M78 D;  3LH5 A;  1QQJ A;  3M53 A;  3X24 B;  4BY6 C;  1M1G A;  2KGT A;  4C8Q B;  3CCU A;  4M77 F;  2E12 A;  1FWZ A;  1I5O B;  1D3B B;  4RCB A;  4M7A F;  3URG A;  3CCS A;  2EYQ A;  1KD1 R;  4QQ6 A;  4J7I A;  4OB0 B;  3A8G B;  1PSF A;  2BZ8 A;  4J9E A;  2DK3 A;  3INZ A;  1YJ9 T;  2QA4 Q;  4C92 B;  2HBP A;  1K9M R;  2YUP A;  2X4J A;  4PJL A;  2P4T A;  4HVU A;  1I5L A;  3E9G A;  3CCQ A;  3CCU T;  3CCE A;  2M51 A;  3PE0 A;  2E10 A;  4DQ2 A;  1K8A U;  4L5G A;  2HQH A;  2CP7 A;  4GLK A;  2X3X D;  2E6Z A;  2EGC A;  2Z0W A;  3JV3 A;  5KYN A;  2KRS A;  1OUL A;  2VV5 A;  3UDC A;  1NLO C;  4HVW A;  4KT0 E;  3G7Z A;  3CCQ T;  3VS3 A;  1V1C A;  4KUI A;  2BIV A;  3M0S A;  3L2V A;  3NTH A;  5IHI A;  1VQP Q;  3CCE T;  2M16 A;  2MYS A;  3NTK A;  1KHC A;  1RAI B;  2K4Y A;  5I21 A;  3SB2 A;  1Q82 R;  2YLC A;  1AZE A;  1TTH B;  1YHQ Q;  5GAN j;  1HXD A;  5D6W A;  1QP3 A;  4Z88 A;  3E2U A;  1G2B A;  1RAB B;  3T9N A;  1ABO A;  2R5M A;  4A4H A;  2DRM A;  2E65 A;  4C0Z A;  4DBR A;  4J6W A;  8ATC B;  1BI1 A;  3GLX A;  5GAN 5;  2MWO A;  3JCM Q;  3JCM f;  1M8V A;  2OI3 A;  3TQ7 P;  1PSE A;  1ZQ1 A;  4BI8 B;  4M77 E;  3FJP A;  3OA6 A;  1E6G A;  4OMP A;  1OPL A;  4N0A A;  2DAQ A;  1KD1 C;  2CRE A;  4NOY A;  1JEG A;  1BIB A;  5CKD A;  4GY5 A;  1E6H A;  3LGL A;  1K9M C;  2GGR A;  1CKA A;  3TCJ A;  2KNB B;  1J3T A;  4J9I A;  2RN8 A;  1SF9 A;  2ATC B;  1VIF A;  3G6E A;  1ACM B;  3I55 A;  4PJM A;  3A8O B;  2GFA A;  2LMJ A;  3H9N A;  5I22 A;  2XKO C;  3A5Z B;  1X2Q A;  2J6O A;  5KYX B;  4R55 A;  3HP9 A;  2FZK B;  1AZG B;  2IIM A;  1YWO A;  2HBW A;  4J9B A;  3OMC A;  4OB1 B;  2D6F A;  1QVF S;  3CD6 A;  3D7S B;  1BB9 A;  2QQA A;  2FO0 A;  2F1L A;  3G6E T;  1FMW A;  4OB3 B;  1LNX A;  1BIA A;  5FU7 B;  1Q82 C;  1N8R U;  4F7U A;  3DLM A;  3NFC A;  2CYZ B;  1UHC A;  1K9A A;  2XDD A;  1YIT A;  1VQ6 Q;  3S6W A;  2GFU A;  3EH2 A;  4XTW A;  5DY9 A;  4J7F A;  3CD6 T;  2DVJ A;  1RAA B;  4IUU A;  4A4F A;  3TRE A;  2DJZ A;  4KUD K;  2HNI A;  1P92 A;  3OQ5 A;  3CCS Q;  2LCS A;  4LXC A;  3H0H A;  2V26 A;  3MEV A;  3OS2 A;  1KFZ A;  1ZA1 B;  3CC7 T;  4E2F B;  6AT1 B;  1YIT T;  4J9D A;  2I0N A;  4R0K A;  1IRE B;  4IIO A;  1BCM A;  2ZPH B;  3BW1 A;  4JPB W;  3CCQ Q;  1K9M U;  2XD0 A;  3UA7 A;  1Y07 A;  3TU4 K;  1YN8 A;  3VRY A;  1TUD A;  5GMK e;  1ARK A;  2LT4 A;  3X28 B;  4QQG A;  1YJW A;  4FYV B;  3TSZ A;  3HTR A;  5GAN f;  3LYI A;  4J9H A;  2ZPI B;  3JB9 F;  1SKU B;  5GAM d;  4E47 A;  4HCK A;  1VQ4 A;  1Y7X A;  1NE8 A;  2DO3 A;  4KBM B;  2AKK A;  2JNG A;  1R8O B;  1ZX6 A;  2FPD A;  2QQ9 A;  2VWF A;  1BCO A;  1YJW T;  1M3A A;  4DA4 A;  2FPF A;  1AT1 B;  1NZ9 A;  2DXC A;  4F17 A;  1WJR A;  2CP6 A;  4D6W A;  3GOX A;  2PVO B;  1YBY A;  4RTT A;  4HKE A;  4PJO G;  2PVG B;  1VQ4 T;  1CKB A;  5IHK A;  1MMA A;  2QGG A;  3AT1 B;  1UGP B;  2HSE B;  2F5T X;  2A08 A;  3TVT A;  3I5S A;  4F7U G;  3ULR B;  4AG2 C;  3QII A;  3UT1 A;  4JUV A;  2AIR B;  2CSQ A;  3CMA A;  2LQW A;  1AWW A;  1TG0 A;  1WDX A;  1VQK A;  2L0A A;  4NS5 A;  3RNJ A;  1UGV A;  1NBE B;  2JZ2 A;  1ZUU A;  3RKY A;  1VQ5 A;  2EQI A;  2NYS A;  4M75 E;  4RG8 A;  3G6E Q;  1B34 A;  1X6G A;  2MCN A;  1UUE A;  5C6S A;  3CMA T;  3I55 Q;  1RAF B;  3ZEH A;  2QDY B;  1VQ9 A;  2NUP A;  3QZ5 B;  2YRV A;  1OX9 A;  1VQK T;  2JM9 A;  1LVK A;  5CK9 A;  1GBR A;  3OW2 P;  1EFN A;  1BU1 A; 
#chains in the Genus database with same CATH homology
 1ZUY A;  2O88 A;  2CUB A;  2RMO A;  1Z9Q A;  4LUD A;  3VS1 A;  1M27 C;  1I0C A;  2DLP A;  5GJW B;  3R6N A;  4JZ4 A;  2HCK A;  2KR3 A;  2RPN A;  3RBB B;  1YP5 A;  2GBQ A;  1YWP A;  2K9G A;  1HD3 A;  2H8H A;  1NYF A;  3EHR A;  1PHT A;  1QKW A;  2E5K A;  4AFS C;  4OML A;  4GLM A;  4ORZ A;  2DBK A;  2A37 A;  4J9C A;  2ABL A;  2YUQ A;  1GCQ C;  4ZNX A;  1NEG A;  2EYY A;  1UHF A;  1W1F A;  4Z89 A;  4JJC A;  2KEA A;  4DEY A;  1UJ0 A;  1QKX A;  1T0H A;  3EG1 A;  2C0I A;  2KXC A;  1B3Q A;  2DM1 A;  1B07 A;  1GRI A;  3VS5 A;  1IO6 A;  2L2P A;  1SPK A;  3EGU A;  3PVQ A;  4CC7 A;  3REB B;  2CH4 A;  2ENM A;  1OOT A;  4DEX A;  2V1R A;  1AEY A;  4IIM A;  2JS0 A;  2LJ0 A;  1W6X A;  1T3L A;  5IHN A;  3VRZ A;  2CT3 A;  1RI9 A;  2KYM A;  1WYX A;  2CT4 A;  2V1Q A;  5HCK A;  1JXO A;  1AVZ C;  2JXB A;  1KIK A;  2DBM A;  3M0Q A;  2DA9 A;  4OMO A;  2KYB A;  2OAW A;  2YSQ A;  2EPD A;  4Y92 A;  1GCQ A;  2DNU A;  2MIO A;  2KRO A;  3VS6 A;  2L3P A;  1K4U S;  4K11 A;  1K0S A;  2B86 A;  3LH5 A;  1UEC A;  4RTY A;  2KGT A;  1LCK A;  4WCI A;  2EW3 A;  2SEM A;  1CSK A;  1WA7 A;  1X27 A;  4RTU A;  3IQL A;  1X6B A;  4F16 A;  1H3H A;  1WFW A;  1NYG A;  2YDL A;  2L3S A;  2SRC A;  2BZ8 A;  4OMM A;  2DL7 A;  4J9E A;  2D8H A;  2PZ1 A;  2OJ2 A;  2YUP A;  2KT8 A;  2HEQ A;  3KFV A;  4HVU A;  2AK5 A;  3M0R A;  2DF6 A;  2JT4 A;  2KXD A;  2A28 A;  2CH4 W;  2M51 A;  1T3S A;  3GBQ A;  3PE0 A;  2F2W A;  2DMO A;  2VKN A;  1RUW A;  1BK2 A;  5FWC A;  1AOJ A;  1M3B A;  2J7I A;  2NWM A;  2K7A A;  4LN2 A;  2X3X D;  2EGC A;  4JZ3 A;  2G6F X;  3JV3 A;  2HDA A;  2L3Q A;  3QWX X;  1VA7 A;  2KRS A;  3NHN A;  1HSQ A;  1NLO C;  1Y57 A;  2J6K A;  1GFD A;  1GBQ A;  2P4R A;  4RTZ A;  2CUD A;  4LNP A;  4HVW A;  1QLY A;  3VS7 A;  1WI7 A;  1W70 A;  4AG1 C;  3VS0 A;  3VS3 A;  2VVK A;  1V1C A;  1OV3 A;  1SEM A;  3M0S A;  5IHI A;  1HJD A;  2DL4 A;  3SEM A;  1NM7 A;  1AWX A;  1ABQ A;  2O2O A;  1MV0 B;  1VYU A;  1ZUK A;  4A63 B;  2JW4 A;  1AZE A;  1PWT A;  2ROT A;  2DL3 A;  1VYT A;  2YUN A;  3EG0 A;  2RQU A;  4Z88 A;  1G2B A;  2YUO A;  1E7O A;  4LE9 A;  2EVR A;  4EIK A;  1ABO A;  2QDL A;  1JQQ A;  2K3B A;  2DRM A;  3REA B;  4JJD A;  1ZSG A;  1I1J A;  1WLP B;  3U23 A;  2DYB A;  4FSS A;  1JXM A;  1UJY A;  1UFF A;  1JU5 C;  1OEB A;  1T0J A;  1QWE A;  2LJ3 A;  2OI3 A;  5I11 A;  2J6F A;  2XMF A;  1E6G A;  4OMP A;  1OPL A;  1H8K A;  4OMQ A;  2CRE A;  4J9F A;  1GL5 A;  2FRW A;  1RLP C;  1M30 A;  1JEG A;  1SHG A;  2D1X A;  5FW9 A;  1AWO A;  1E6H A;  4M4Z A;  3O5Z A;  2GGR A;  1CKA A;  2KBT A;  2KNB B;  1J3T A;  4J9I A;  2O9V A;  2PTK A;  2RN8 A;  1KJW A;  4AFZ C;  2GNC A;  1M8M A;  2AZS A;  1XOV A;  4CC2 A;  3M0P A;  3PVL A;  2LMJ A;  1K0X A;  1SRL A;  5I22 A;  1A0N B;  4QT7 A;  3ZL7 C;  5FWB A;  1X2Q A;  2GTJ A;  2J6O A;  4ESR A;  2FG0 A;  5ECA A;  1AZG B;  2X3W D;  1K76 A;  4AFU C;  2IIM A;  1UE9 A;  1YWO A;  1UDL A;  2HBW A;  2D8J A;  1JO8 A;  2M0Y A;  4J9B A;  1BB9 A;  2FO0 A;  3NPF A;  2RQV A;  2K2M A;  2FEI A;  2ESW A;  3UAT A;  1KSW A;  3VS4 A;  1K1Z A;  1VYV A;  3EG3 A;  2RQW A;  1PKS A;  2YT6 A;  1MV3 A;  1ZBJ A;  1X2K A;  1WIE A;  1UHC A;  1K9A A;  1RLQ C;  4D8K A;  3FJ5 A;  2JM8 A;  2K79 A;  2J05 A;  4D8D A;  3TSW A;  3SHW A;  2DVJ A;  1TUC A;  3EHQ A;  5IXF A;  1U3O A;  2EBP A;  5IXB A;  4JJB A;  1ZLM A;  4Z8A A;  1QCF A;  2LCS A;  1NG2 A;  3H0H A;  3EG2 A;  3NGP A;  4KRT A;  4F14 A;  1OPK A;  4LUE A;  1KFZ A;  1NLP C;  1GCP A;  2EKH A;  2DL8 A;  2O31 A;  4J9D A;  2I0N A;  4HVV A;  2JTE A;  4R0K A;  2O9S A;  2KE9 A;  4IIO A;  3H41 A;  2EGA A;  1SRM A;  4CC4 B;  3THK A;  1AWJ A;  1X43 A;  2KRM A;  4JPB W;  2A36 A;  1G83 A;  3CQT A;  1PRM C;  2DJQ A;  4OMN A;  2C0O A;  3UA7 A;  2BZX A;  1YN8 A;  2BZY A;  2NUZ A;  1TUD A;  3VRY A;  1ARK A;  1SSH A;  3C0C A;  1WXT A;  2K6D A;  2CDT A;  2CSI A;  3TSZ A;  3M0T A;  3UA6 A;  2LQN A;  4E6R A;  1N5Z A;  1WX6 A;  3A98 A;  4J9H A;  3VS2 A;  4J9G A;  2LJ1 A;  2EGE A;  2ED0 A;  5L23 A;  1H92 A;  2MOX A;  1PRL C;  5GJV B;  4HCK A;  3NMZ C;  2PNI A;  4X1V A;  1U06 A;  2DIL A;  4RTW A;  4HXJ A;  2DL5 A;  2D0N A;  4GBQ A;  2AKK A;  1ZX6 A;  2FPD A;  2ROL A;  2VWF A;  1NEB A;  2ECZ A;  5IH2 A;  1M3A A;  2GQI A;  3I5R A;  2ED1 A;  4CC3 A;  1Y0M A;  2DRK A;  1AD5 A;  2DX1 A;  2FPF A;  2W10 A;  4RUG A;  2JS2 A;  1WXU A;  4F17 A;  2LNH B;  2AKL A;  2F2X A;  2FPE A;  1GFC A;  2LX7 A;  4RTT A;  1Z9Z A;  2RF0 A;  1CKB A;  3M0U A;  2HSP A;  5IHK A;  2BTT A;  2DE0 X;  2F2V A;  1QWF A;  2A08 A;  3TVT A;  1X69 A;  1YCS B;  2LP5 A;  1MUZ A;  3I5S A;  3ULR B;  4AG2 C;  1M3C A;  2EYZ A;  1YNZ A;  2CSQ A;  1PKT A;  2GTO A;  2LQW A;  2C0T A;  1AWW A;  1TG0 A;  1WDX A;  2J06 A;  2W0Z A;  2KRN A;  2LZ6 B;  4AFQ C;  2L0A A;  3RNJ A;  1UG1 A;  1UGV A;  1SHF A;  3QWY A;  1I07 A;  3H0F A;  1PNJ A;  1ZUU A;  2EYX A;  3H0I A;  2EQI A;  2AZV A;  1U5S A;  3UF4 A;  1X6G A;  1FYN A;  2MCN A;  1UUE A;  2RNA A;  4RTX A;  2FRY A;  2KT1 A;  1BBZ A;  2RQR A;  1UTI A;  1FMK A;  3I35 A;  1WXB A;  2JM9 A;  2RQT A;  2JMA A;  4RTV A;  5EC7 A;  3I9Q A;  2EYW A;  1GBR A;  1S1N A;  1EFN A;  2JMC A;  1BU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...