4CC3A

Complex of human tuba c-terminal sh3 domain and mena proline-rich peptide - h3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords DYNAMIN-BINDING PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 61
sequence length 61
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc3A00
1M8MA 1TG0A 1ZUKA 2J05A 1KSWA 1IO6A 4RTWA 1E6HA 1OPKA 4CC3A 2KROA 1BBZA 1GL5A 2KT1A 2EGEA 2L3SA 4LNPA 1NYFA 2ROTA 1NLPC 1Y57A 2B86A 2DBKA 2RQTA 1UHFA 3THKA 3SEMA 1SPKA 2ED0A 2DVJA 2LQNA 1QKWA 1PRLC 3LH5A 1BU1A 1GBQA 1T3SA 2J7IA 2KEAA 2LZ6B 2V1RA 4HVVA 1WXUA 1UJ0A 2K3BA 1ARKA 1WFWA 2GTJA 4Z89A 1WXBA 2VVKA 3EG1A 1X2KA 2HCKA 1ZBJA 4AFZC 2X3WD 1RLPC 5I22A 2KYMA 4OMPA 1UDLA 2W0ZA 2CREA 2FPDA 1BB9A 2DL7A 1X6BA 2YUPA 1UHCA 2YSQA 2F2XA 1JXOA 1HD3A 1K0SA 1PRMC 1WX6A 2YT6A 1W70A 2LCSA 2O9VA 2AKKA 1HJDA 1YN8A 2DM1A 1Z9ZA 3NHNA 4JZ3A 1ZX6A 2EGCA 1AEYA 1ZUYA 2D0NA 4J9EA 1QWFA 4JZ4A 3I9QA 2EGAA 2IIMA 3M0PA 2AK5A 2J6OA 1SEMA 2DA9A 3PVLA 4IIOA 1YCSB 3EG0A 1NG2A 3M0RA 5I11A 5HCKA 5FWBA 1AWOA 1SRLA 1TUDA 2FRWA 1YWOA 4A63B 4J9BA 4WCIA 1QKXA 3C0CA 1GBRA 3UA6A 3VS3A 3PE0A 2NWMA 2CSQA 4F17A 3SHWA 2AZVA 1NEGA 1H8KA 3M0SA 3TSWA 1B07A 2J6FA 4AFSC 1GCPA 2DMOA 2DL5A 1U3OA 4LUDA 2FPFA 3UF4A 1KIKA 1WXTA 2EYXA 2JS0A 4QT7A 3REAB 2ECZA 2L2PA 4HCKA 2KBTA 2YUQA 3EHQA 2EVRA 2K7AA 1K4US 1PWTA 1MV3A 1W1FA 2RPNA 2E5KA 2CUDA 3VS2A 1M27C 1I07A 1PKTA 2K2MA 1GFDA 2O88A 2AZSA 2EYZA 1X43A 1NLOC 2A37A 2ROLA 2MOXA 3EG2A 1JU5C 3VS6A 4CC4B 4AG2C 3A98A 2JM8A 2RN8A 1X69A 1AWWA 2DF6A 2JXBA 2J06A 4J9IA 2M51A 4EIKA 4RTUA 2HEQA 1UJYA 1WLPB 4J9DA 1UFFA 1WYXA 2HDAA 3O5ZA 1SHFA 5IXFA 2KE9A 2KXDA 1U06A 2EKHA 2ED1A 1K0XA 4GBQA 3VS5A 2JMAA 1V1CA 2JTEA 1JQQA 2W10A 1FYNA 4Z88A 2A28A 1ZLMA 1K76A 2L0AA 4DEXA 2PZ1A 1Z9QA 2JMCA 2GGRA 3I5SA 1M3CA 1UUEA 2DE0X 2RQRA 4M4ZA 1YWPA 1HSQA 2DX1A 4RTYA 4DEYA 1M3AA 1E6GA 2F2WA 2RF0A 3VRZA 2BZYA 1U5SA 2KNBB 2CH4W 1UGVA 2KT8A 2O2OA 2EBPA 2RQWA 1KJWA 3ZL7C 1UECA 4LN2A 2K79A 1NYGA 2XMFA 2P4RA 4JJBA 5GJWB 1GFCA 1SSHA 2FPEA 2EYWA 4J9GA 5FWCA 2JS2A 3UATA 4Y92A 2I0NA 1OEBA 2KRNA 2NUZA 2GQIA 3H41A 1AZEA 1CKAA 2LJ1A 4HXJA 3NMZC 2OI3A 1ZUUA 4OMLA 1NEBA 2LP5A 2LQWA 3U23A 3QWXX 2G6FX 1AWXA 3VS1A 2H8HA 2FRYA 2FG0A 2RNAA 4AG1C 2FO0A 3REBB 1AD5A 2KRMA 1X6GA 1JXMA 5GJVB 2BTTA 3CQTA 4HVUA 1BK2A 1VYUA 1CKBA 2CSIA 5EC7A 1VYVA 3IQLA 1OV3A 1K1ZA 1EFNA 2RQVA 1OOTA 1WA7A 3R6NA 1OPLA 2YDLA 2PNIA 2HSPA 3EG3A 2AKLA 4AFUC 4CC2A 4D8KA 2EPDA 2C0IA 2GBQA 2EYYA 1QCFA 2O9SA 4X1VA 1X2QA 2YUOA 3QWYA 4CC7A 1JEGA 2CUBA 3M0UA 3KFVA 1J3TA 5IHIA 2CT4A 2KGTA 4FSSA 2K9GA 1K9AA 3GBQA 2X3XD 4JPBW 4E6RA 3TSZA 1XOVA 2CH4A 2DLPA 3RNJA 2EW3A 4RTTA 2DL3A 1GCQC 1H3HA 2VWFA 2MCNA 2KR3A 2L3PA 4D8DA 1FMKA 4RTZA 1I1JA 3H0FA 4J9CA 2JM9A 1M30A 3M0TA 1H92A 1M3BA 4OMOA 5FW9A 2MIOA 2BZXA 4F14A 2KYBA 2DNUA 3RBBB 4LE9A 4LUEA 1GRIA 1NM7A 3EHRA 1VYTA 2GNCA 1ABOA 2ENMA 2J6KA 2LMJA 2ABLA 2DJQA 3TVTA 4RUGA 2A08A 4GLMA 4JJCA 1TUCA 5ECAA 2D8JA 1ZSGA 1ABQA 1UE9A 2F2VA 2OJ2A 3ULRB 2YUNA 2RQUA 3VRYA 3FJ5A 1N5ZA 3I35A 1X27A 2KRSA 1E7OA 2DRMA 1AOJA 2VKNA 1JO8A 1G83A 4RTXA 4F16A 2LNHB 2CDTA 2DRKA 2FEIA 3NPFA 4R0KA 3VS7A 3UA7A 2LX7A 1UTIA 1G2BA 2JW4A 2DL4A 3NGPA 2DILA 3VS4A 2CT3A 3EGUA 4OMMA 1KFZA 1SRMA 1VA7A 4KRTA 4J9HA 4RTVA 5IH2A 2C0TA 4AFQC 2D8HA 1T3LA 3M0QA 2SEMA 1RUWA 4K11A 2HBWA 4ORZA 2BZ8A 3JV3A 1Y0MA 2D1XA 1SHGA 2PTKA 1UG1A 2DBMA 1B3QA 1A0NB 4HVWA 3H0HA 2DYBA 2L3QA 4ESRA 1S1NA 2EQIA 2ESWA 2K6DA 1GCQA 1MV0B 1I0CA 1AVZC 5IXBA 4Z8AA 1PNJA 1LCKA 1T0JA 2LJ0A 2A36A 2JT4A 4J9FA 2SRCA 2OAWA 1RI9A 3I5RA 1WIEA 1T0HA 1CSKA 1AWJA 5L23A 2RMOA 1PKSA 1YNZA 2M0YA 1PHTA 1WDXA 2GTOA 2V1QA 1QLYA 2O31A 1YP5A 1QWEA 1W6XA 4OMNA 3H0IA 5IHNA 1RLQC 1AZGB 4ZNXA 1WI7A 5IHKA 3VS0A 2LJ3A 4IIMA 4JJDA 1MUZA 2QDLA 2KXCA 2DL8A 2C0OA 3PVQA 4OMQA
chains in the Genus database with same CATH superfamily
2COYA 2O4XB 5LJ3j 4O6JA 1VQMQ 5LJ5d 3CCJT 2EKOA 4A4FA 5GANj 2EGEA 3MPUB 4EMGA 1ACMB 3INZA 1QVFS 8AT1B 1SPKA 1X01A 2DVJA 2LQNA 3JAME 1MMGA 1PG5B 2J7IA 1WJRA 3JCMd 1D3BB 3OYMA 3GIBA 4EMKB 3I55Q 4J7IA 4Z89A 1B34B 1WXBA 2HCKA 1ZBJA 1H3ZA 4OMPA 1UDLA 2E6ZA 3BDUA 2CREA 1Q86C 1X6BA 1QP2A 2QK0A 1UHCA 4QQGA 4AMCA 1HD3A 1PRMC 1AT1B 2YT6A 3CCJQ 3UWNA 1W70A 4ELZC 3G6EA 4B9WA 3NHNA 1ZX6A 1AEYA 3C12A 3AT1B 1Y96B 2AK5A 2J6OA 2DA9A 2JN0A 4IIOA 3A8GB 1YCSB 4OB1B 3EFRA 3OYLA 3V7SA 4OP0A 3CCUQ 1NG2A 2CS7A 2DD5A 5FWBA 1YFNA 2XKOC 3TQ7P 4WCIA 4BUGA 2VASA 3C0CA 5CQYA 3UA6A 2VB6A 2NWMA 2CSQA 4F17A 5CKDA 3VV0A 3JSCA 1D1CA 1I5LA 2V26A 1KC8R 2J6FA 5GMKe 1VQOT 2MK5A 3OMCA 3REAB 2L2PA 2KBTA 1K4US 1W1FA 1W4SA 4PJOE 2CUDA 3FB9A 5CAIA 1PKTA 3LGLA 2O88A 2AZSA 1HXDA 1X43A 1VQKA 3CCET 1WJQA 2A37A 2QXFA 4C0FA 5FRMA 3OY9A 3HFOA 2CKKA 4AG2C 3A98A 3MCAB 2VXFA 1Y07A 1MMNA 1MMAA 3FRNA 4L6V5 5GAOq 3QHSA 4HT8A 4JRKA 3JCMJ 1KG1A 1WLPB 3P8DA 4ANJA 4J9DA 2JOYA 4C0DB 1SHFA 5IXFA 2XHCA 1VQOQ 2X51A 5GMKl 3Q1JA 2E4HA 1K0XA 2A28A 1K73R 3L2UA 1K76A 4C92E 4DEXA 4ELYC 1YITT 4A4GA 2JMCA 2PUKB 1VQNA 4M78D 1VQ4A 4M78C 4RTYA 5M9OA 2C06A 5FROA 1C6VX 5GMKm 2CYZB 2RHIA 1VQ7T 2F5KA 3CPWS 3OYBA 3CCEQ 2YXYA 4ZN1A 1RAFB 2KNBB 1I81A 2CH4W 2COWA 2JJ9A 3A8OB 5FU7C 2EBPA 1SKUB 1UECA 1YI2A 5KYNA 2XMFA 4XTYA 4BE0A 2P4RA 5GJWB 4NS5A 2DTHA 1SSHA 4M7AA 4J9GA 5FWCA 4Y92A 1O9SA 5DM7R 3X26B 3E19A 4WF2A 3X25B 2GQIA 2X4JA 3UDCA 3OYAA 5KYXA 1AZEA 3M4YA 2DETA 1N8RR 2JVVA 1PSEA 4PJOB 1NEBA 2O01E 2L3RA 1DJ7B 4FSXA 3V8KA 2H8HA 2FRYA 3G71A 4DBFA 2RJFA 3JB9F 2QGFB 4M75A 1BI1A 3CMAQ 2AT1B 2K5LA 2LQKA 1VQ7Q 3CCST 1XNIA 2BTTA 4DBHA 4KT0E 3PNWC 3FC3A 4KULA 2WSCE 2XK0A 3OYGA 1I5OB 4IUUA 1CKBA 1QW1A 3IQLA 3WVDB 1WA7A 3G6ET 1OPLA 1WGSA 2YDLA 3KXTA 2BIVA 2HSPA 1BCMA 4AFUC 4BB7A 4CC2A 1Q7YC 4D8KA 2EPDA 1BIBA 2GBQA 4QQ6A 4X1VA 1VQ5A 1ZA1B 4CC7A 2CUBA 1LOJA 3M0UA 2WACA 2CT4A 4LDWA 1M8VA 4D6WA 4BDZA 1K9AA 4M77D 1NPPA 3H6ZA 3TSZA 1XOVA 3LX7A 1M5Q1 1GCQC 3URGA 1H3HA 1NJIR 2KR3A 4E7HA 4PJOC 4XU1A 3E1SA 3M0TA 1M3BA 2BZXA 3G6EQ 1Q86U 3E9GA 2E41A 4HCZA 3JB9G 5GAOp 1LJOA 3LLRA 3MP1A 2L8DA 2X9HA 3QBYA 4OGCA 3S3OA 3CCVA 3SD4A 2K3YA 4JRIA 3CPWP 4LDYA 2A08A 2EIFA 3OYNA 1M2VA 1VQKT 1D09B 4E7LA 2XD0A 4M7AB 4X9CA 3S3MA 5FLXE 4OB3B 1WNLA 2D8JA 1VQ6A 4PJLA 2YLCA 3FEOA 1UE9A 5KYXB 1PSFA 4PJOG 3EH1A 2RQUA 2RHYA 1BCOA 1B7TA 1N5ZA 3FJ5A 4C92C 1AOJA 2VKNA 5GAN8 1YBYA 2LNHB 2RJCA 2CP0A 4IUTA 1PM3A 3MEVA 4M7DD 4HKEA 2DRKA 3NPFA 3VS7A 1BI0A 2EFIA 2FYKA 2JW4A 2XDPA 3DLMA 4VUBA 3EFSA 1QVFA 2CT3A 4OMMA 1KFZA 4PJNA 1VQNT 4J9HA 2DZCA 2VGMA 5AYFA 2HNIA 1VQ4T 4AFQC 1T3LA 5D6YA 3M0QA 5KYUA 2SEMA 4E7SA 3M55A 4M7AF 5GAN4 2QTVA 1VQKQ 1R77A 2LCLA 1ZA2B 1M1KC 3L2RA 1B3QA 3M54A 1A0NB 2IVWA 3QPHA 1BIAA 2DYBA 4ESRA 3LWIA 4JRQA 1YI2T 1I0CA 2NYSA 1PNJA 2P0PA 3CXCS 2XDDA 4FT2A 2LJ0A 1N9RA 2SRCA 1Y7XA 4P5NA 4M75F 4C8QA 2F69A 3EGDB 5L23A 1D1AA 1H641 1VQNQ 4FYWB 1WDXA 2V1QA 5GAOr 3G71T 1QWEA 1W6XA 3CCUA 1IXDA 3H0IA 3RR6A 2QYZA 3HHTB 2E70A 3CC2A 2RA2A 3EFOA 4KH0B 3VS0A 4IIMA 4J5YA 1MUZA 2EWNA 2LNVA 4C8QE 2QDLA 2RM4A 3EH2A 2C0OA 3KBGA 3M9QA 1KQSS 1YI2Q 4PFOA 4OMQA 1TG0A 1YHQT 4JS4A 2VUBA 1MNEA 2J05A 2XIDA 4M7AG 1M2VB 4OB2B 4BE1A 5D6WA 4JS5A 1BBZA 4FCYA 1NYFA 1VQ5T 2ROTA 1Y57A 4XTWA 1UHFA 3FLGA 2ED0A 5DLQE 2QEXA 4HCBA 1M2OA 3JCMc 1BU1A 1GBQA 2KEAA 2LZ6B 3G71Q 2HBPA 4KUDK 3GP8A 1WXUA 5KH6A 1UJ0A 5LJ5f 3GOXA 3QJYA 1UGQB 2VVKA 3EG1A 1U8RA 4V2SA 5I22A 4Q5WA 2KYMA 3FJPA 3UT1A 1V76A 4XTVA 2HZYA 1BB9A 2DL7A 4ZN3A 5GAMd 2EJ9A 2F2XA 1JXOA 1TWBA 3EGXA 3JCMf 3SWNC 3DKMA 2LCSA 2AKKA 2YWWA 1YN8A 3CC7A 3CCQA 4JZ3A 3NFCA 3CCVT 1VQ5Q 5L8RE 2D0NA 2COZA 2OAUA 4J9EA 1QWFA 3I9QA 1LPLA 2IIMA 1RL2A 3V7CA 2RD1A 1FMWA 3PVLA 5KCOA 1Q7YU 1RAGB 4MZMA 2FHDA 1VQ6T 3EG0A 5LJ5j 4C8QB 1P92A 1HK9A 2JZ2A 1AHJB 4LDUA 3CXCP 3CPWA 1SRLA 1TUDA 2DYIA 4OF1A 2FRWA 1TTHB 2MWPA 1YWOA 4A63B 3CBOA 1VUBA 4J9BA 3WXMB 1GBRA 4R56A 3PE0A 4N0AA 4OVAA 1NEGA 1H8KA 4ZTJA 1QMCA 1LVKA 3M5AA 2F5TX 1KHCA 4LUDA 3EFOB 3CCMA 2AHJB 3OYDA 1KIKA 2LT1A 3CCVQ 1OZ2A 1RACB 2VV5A 2ECZA 4HCKA 4MMKA 5GAMh 4E2FB 1YIJA 1MV3A 2RPNA 4PK4A 2E5KA 3VS2A 1M27C 2M02A 4RMOA 4ZGDB 1I07A 1VQ6Q 2EYZA 1KQSP 3FDRA 3QKJA 4HCCA 3RMSA 3RKXA 5D6XA 2MOXA 1JU5C 1V29B 3RESA 1OX8A 4MZTA 4E7JA 3PMTA 4AT1B 3I56A 1PD1A 4EMHA 5A0DA 2BE7D 2DAQA 3QYHB 2DF6A 3DLLA 1Q82C 4J9IA 4EIKA 1Q81R 1VQ9A 2HEQA 4J6YA 5KYYA 2DIQA 2YLBA 3GPLA 1MMDA 2HDAA 3O5ZA 4DBQA 3ASKA 2EKHA 4C8QC 4Z88A 3OBYA 3CCUT 2CP7A 1S72Q 4RG8A 3META 2RH2A 2EQJA 1N9SA 4BE2A 3CC2T 2GGRA 1IRXA 3EG9A 3EGXB 2DE0X 2RQRA 4M4ZA 2QQAA 4DQ2A 2DX1A 4DEYA 1M3AA 1E6GA 2F2WA 3N5BB 1U5SA 4LD6A 5GAOl 1UGVA 2O2OA 3OYEA 1MGQA 1K9MR 4FU6A 2ZGWA 3RIRA 1VOMA 1KJWA 1M1KU 2K79A 4KGZB 3QZ5B 3GNFB 1QCNA 4KGVB 1GFCA 5KYWA 4C8QG 2NLUA 2A7YA 3UATA 5KCHA 2FZCB 2I0NA 5GAOm 1OEBA 2QEXT 1I4K1 1M90R 2NUZA 3FIFA 3OYKA 1D0ZA 3QIIA 4PNOA 3NMZC 4HXJA 3DB4A 3PIOA 2HSEB 5LJ5h 2LQWA 2ZPBB 1FX7A 1AWXA 2JTMA 2YRDA 3VS1A 1OI1A 2RI2A 3CC2Q 2VYTA 5LJ3d 2FO0A 4C5EA 2KRMA 1SF9A 1ZHIA 4Z02A 5GANd 3JRZA 2L5QA 2Y90A 3JCMh 2QA4A 4M77A 2R57A 1Y71A 4ATOA 4LXCA 4XK8E 2CSIA 4QVZA 3CC7T 3QO3A 4EMKC 3CCQT 3OS0A 2PNIA 2AKLA 3M57A 3PT9A 2QEXQ 4N4IA 4DOVA 3MP8A 4ME7A 2EYYA 2P84A 3A5ZB 3HRTA 3CCRA 4IUVA 2KGTA 5KYYB 4FSSA 3GBQA 3JCMV 4JPBW 2QASA 2E64A 3RNJA 3HL8A 2DL3A 1XTDA 3V7RA 2VWFA 2ZPGB 3CXCA 1K8AR 1OQKA 2L3PA 4D8DA 4RTZA 1I1JA 3CCMT 2JM9A 6AT1B 4OMOA 3CC7Q 3CCQQ 1QVGP 1GRIA 4M7DA 3L42A 2CZ6B 2ENMA 4XTUA 2QQSA 1W2BS 3CMAT 4RUGA 1RI0A 2LCCA 3OYIA 2HQEA 5CR2A 4O5VA 1D1BA 5CKFA 3I56T 5I21A 3OS5A 3J7AF 2K3XA 2V8KA 1TSFA 3VRYA 1UGSB 1KQSA 3I35A 1VQ9T 1X27A 2KRSA 2MI6A 2V8IA 1ZBXA 3M59A 3CCMQ 1BYMA 2FEIA 3QJ6A 1G2BA 3NGPA 1X75C 4BI3A 3VS4A 4MDWA 3J81E 3HRUA 1SSFA 3S6WA 1YIJQ 3T9NA 2IPOB 4M77B 2QQBA 5IT9E 2FVUA 5CVIA 5LJ5g 2EQKA 4K11A 1D0YA 4M7AE 4Y28E 2MMPA 2PTKA 3M53A 1UG1A 3RUXA 4C0DC 4L59A 2LTOA 5HK3A 3JCMb 4HVWA 5C0MA 4DOWA 1S1NA 2EQIA 2ESWA 2K6DA 3MEUA 3I56Q 4RCBA 1KC8C 1AVZC 5IXBA 2PVOB 3JCMg 1VQ9Q 1LCKA 3GF5A 2DIGA 2A36A 2JT4A 3JCMQ 3ZFJA 2P4TA 2YRCA 1RI9A 2FZKB 1WIEA 2X4YA 2M1HA 4M75E 1FWZA 3P8HA 3PFSA 2BUDA 4J6WA 4R55A 1AWJA 1Q82U 1G3SA 4M77F 5HK0A 4B9XA 5IN1A 1ZSZA 2GFUA 4F7UA 1I8FA 1YP5A 1VQLA 1NPRA 5IHNA 1RLQC 4DA4A 4ZNXA 1WI7A 2QA4T 2LDMA 4JJDA 5DLOA 2EQUA 2VC8A 4PJOD 2DXTA 4PKCC 1M8MA 2E3HA 1K8AC 1ZUKA 4C5GA 1KK7A 1KSWA 4RTWA 2BE9B 1PC0A 1KHIA 1OPKA 4CC3A 2KROA 5KE3A 3OW2S 1K73C 1IHVA 1W2BP 2B86A 3RKYA 5GAMe 5FU6B 1IB8A 3SEMA 3DB3A 3CCRT 1QKWA 1PRLC 1WZOA 2DPPB 3LH5A 1IGUA 4FYYB 1ZQ1A 2V1RA 3JB9H 3KUFA 1RAEB 1ARKA 1OU9A 2GTJA 5GAN6 5CCAA 4ZGEB 2KQWA 1N6AA 4F04B 5A2QE 4C92D 5KE2A 4M7DF 2QA4Q 2R58A 1TU0B 4AFZC 2X3WD 2HKQB 3NTHA 4M77G 1M9SA 2RI5A 2FPDA 4C5IA 3PMIA 2YUPA 2YSQA 4M75B 4QVCA 1UEBA 2F1LA 3JCMW 1N8RC 4BD3A 2DM1A 1F1BB 1O75A 1Z9ZA 3QDRB 4XTZA 3S3NA 3BFMA 1S72A 1G5VA 3CCLA 4JZ4A 2ZCFB 3M0PA 3CCRQ 1TUGB 4J8OA 2DEQA 2R5AA 3RKWA 5GAMf 2FB7A 1R0BG 2EJFA 5HCKA 3SB2A 1RAAB 3M58A 1OZ3A 2KMTA 4QVDA 5CKHA 1AWOA 4GY5A 5GAN7 4KBMB 3VS3A 1ZSZB 4F7UB 3SHWA 4YTLA 2RJEA 3M0SA 4KH1B 3TSWA 2QQRA 1B07A 3BY7A 2K5FA 1U1SA 4AFSC 4M7AC 1GCPA 4IUQA 2DMOA 1U3OA 5LJ5e 2D9TA 2NUPA 4M7DG 1VIEA 4FM4B 5CIUA 3UF4A 1WXTA 2EYXA 2JS0A 4QT7A 1KQ1A 2YUQA 3EHQA 3V8LA 2EVRA 3MKDA 2A3LA 1RAHB 5D7UA 4BI8B 3LWHA 5C6SA 5GAMj 2RK1A 2K2MA 1GFDA 3LGFA 3JCMe 2E12A 4M75C 1NLOC 1BI3A 4PJMA 2ROLA 1NJIC 3EG2A 3VS6A 4F7UF 3BW1A 4QW2A 2JM8A 1X69A 2ZPHB 3UPUA 3OW2P 1D0XA 2RHUA 4OB0B 2J06A 2M51A 3R6OA 2HQXA 2YHTA 1XJWB 3RERA 2HL3A 2KXDA 1U06A 3VS5A 2JMAA 1V1CA 2JTEA 3JCMX 4RCCA 2W10A 1FYNA 1ZLMA 1VQLT 1RAIB 2QQ9A 2PZ1A 1UGPB 3E9FA 4M75G 3M56A 2ZZDA 2DKGA 3I5SA 1M3CA 1UUEA 2O4XA 1YWPA 2RF0A 2XICA 4EDUA 4ZTFA 2BZYA 4OMFB 3PGGA 5J39A 5KYUB 2KT8A 3GLXA 4TVRA 1G3TA 3RMQA 2V8JA 1BI2A 1NYGA 3OSSC 2OX7A 4JJBA 4IKFA 1G3YA 1Q86R 2FPEA 3QSUA 1KC8U 2JS2A 4HT9A 3H41A 2OI3A 2E5QA 3U23A 4F7UG 2E6NA 1VQLQ 2G6FX 1VQ8Q 1W2BA 3WVEB 2Y4XA 4XU0A 2FG0A 3QXEB 3TEEA 1JRIA 1AD5A 1C1AA 4PLIA 1JXMA 3TU4K 5GJVB 3OB9A 2X35A 4QKUA 1JJ2S 4HVUA 4FYXB 2P0KA 4E7KA 1PCXA 1VYUA 3OYCA 4X9DA 5EC7A 1VYVA 3CEYA 1OV3A 1K1ZA 2DO3A 1OOTA 4E7ZA 1S72T 1K8AU 3CCLT 3J80E 3A8LB 4JLIA 4IURA 1K73U 1WJSA 2RO0A 3KFVA 1J3TA 5IHIA 2LVMA 4M78A 2ZPFB 3A1PA 2PUOB 3CBPA 2CZ1B 2M16A 2KK4A 7AT1B 1YITA 4UC4A 1HYOA 5GAN5 2MCNA 2DFUA 5GAOn 4BY6B 4C8QD 1VQPA 4B6MA 3H8ZA 5FW9A 2MIOA 2KYBA 1RADB 3RBBB 4FT4A 4M78E 4LUEA 1NE8A 3CCLQ 1QVGS 2GF7A 3EHRA 1R8OB 2D6FA 2GNCA 2WSFE 1ABOA 4E7IA 1N8RU 2J6KA 2LMJA 2DJQA 2XI9A 3TVTA 4GLMA 4CRIA 2CP2A 4JJCA 3CD6A 3OYHA 1TUCA 4OGEA 3L2WA 2X4WA 3C95A 2MWOA 2OJ2A 5AT1B 4WTOB 4J7FA 2K4YA 1E7OA 2DRMA 3G4SA 1G83A 4RTXA 2MPXC 4F16A 3A8MB 3CCSA 2CDTA 5LL6S 1YJ9A 4CI0C 3UA7A 2LX7A 3C4SA 3OW2A 4XTXA 2DILA 2LRQA 1VA7A 4KRTA 2C0TA 2D8HA 5GMKi 4RKUE 3V8JA 1KD1R 1WHLA 1WHHA 3QG1A 1UGRB 4ORZA 3JV3A 3QDFA 1Y0MA 2D1XA 1JJ2P 2DBMA 3OBWA 3HSBA 4JJNK 2CP6A 4BY6C 2ATCB 3H0HA 4FIBA 2YRVA 1GCQA 3VJPA 2CZ7B 3MO8A 3QYGB 1T0JA 2KI7A 4PJOA 2RI3A 1NJIU 2OAWA 4M78B 4BI4A 1TS9A 3E2UA 3L1AA 1T0HA 2DXBA 3L2ZA 3G7ZA 3VYHB 1CSKA 4PFPA 2RMOA 5FU7B 3ZEHA 1IHWA 1PKSA 4C0GA 2M0YA 4M77E 3D7SB 1Q7YR 5GAMg 2EJGA 1TOVA 2LX9A 3LYIA 2FZGB 2PVDB 4GLKA 2PQWA 3CPFA 2EQMA 2CP3A 2K5IA 5GAN3 2HAXA 4A4EA 1IZ6A 2DXUA 4PJJA 2DL8A 3PTAA 3PVQA 1Q81C 2QG9B 4C92A 3EG9B 1WQWA 1M1FA 5LJ3h 2XU8A 4N0AC 4HA8A 5J26A 4M78F 1IO6A 5GANh 2HD0A 1E6HA 2D0QB 4C0ZA 1YIJT 2LQ8A 5I2MA 1GL5A 2KT1A 1QVFP 2K57A 2L3SA 4LNPA 1YJNA 1QP3A 1NLPC 2HQHA 2DBKA 1IGQA 3G1JA 2RQTA 3THKA 2GQVA 5CKEA 4XAXB 5KYWB 2K2VA 1T3SA 3O8VA 1JBMA 4HVVA 2K3BA 4PFZA 1BKBA 1WFWA 3JB9I 1M1GA 3MJXA 2PVGB 1K9MC 2PU9B 1WHMA 1X2KA 4JDSA 1FMVA 4M7DE 1RLPC 2AIRB 2RK2A 2RHZA 2W0ZA 1WHGA 2H3JA 1VQPT 4RG2A 2L89A 3RDVA 2DJZA 4FW1A 1K0SA 1WX6A 3VUZA 1M90C 1HJDA 2O9VA 3JB9J 5GAN2 3OYJA 1X6OA 4EPCA 2OTJA 2EGCA 1ZUYA 2EGAA 5FRNA 2RJDA 1SEMA 1KD1C 3CD6T 5GMKj 4M78G 3M0RA 3QZ9B 1YITQ 5I11A 1EZZB 2CP5A 3HPWA 5HKCA 3G4ST 4II1A 1QKXA 1M1KR 4N4GA 3M4GA 1YJ9T 2AZVA 3CC4A 3ER0A 1VQPQ 2HMAA 1N27A 2ZPIB 3JB9D 3L2VA 2QAZA 2XG8D 4A4HA 2DL5A 2FPFA 1YHQA 2DTIA 3CBMA 2JTFA 3CMEA 2LC4A 3X24B 1YJWA 1VQ8A 2VGNA 4C92B 1TXQA 2K7AA 4PJOF 1PWTA 5IAYA 4A4KA 4J83A 2E65A 2KDSA 4NL2A 3CD6Q 2BKDN 2WSEE 3L2QA 5HY6A 4M7DB 1EX4A 1SG5A 3AHUA 1WPYA 3EGDA 4XU3A 1IREB 2E3IA 3X20B 4CC4B 3G4SQ 1JJ2A 4JUVA 1EIFA 4M77C 2RN8A 4F7UE 2Y4YA 1AWWA 3NTIA 3VUBA 3CCSQ 1YJ9Q 2JXBA 3A8HB 1FXXA 3SWNA 4RTUA 2FL7A 3QUIA 1UJYA 5LJ3g 4KGXB 1UFFA 1WYXA 5CO7A 2HKNA 2RB6A 4MZPA 5GANg 2KE9A 3HRSA 4QQDA 3ME9A 2NUTA 2ED1A 4GBQA 3HP9A 1MHNA 1JQQA 4C92F 4JRPA 2QGGA 4J6XA 1G8XA 2L0AA 2M0OA 1XQHA 4MDXA 1Z9QA 2A0FB 2OTLA 3HKSA 3F70A 5CQXA 5A0LA 3BDLA 1G3WA 1HSQA 2Z0WA 3VRZA 3PIPA 1TH7A 3H9NA 4X34A 3SDZA 1GXIE 3TREA 2RHXA 3ZBDA 2DTOA 2RQWA 3ZL7C 4A54A 4LN2A 1QQJA 2G3RA 1YJNT 2ZPEB 1VQMA 2EYWA 1LNXA 2KRNA 1QVGA 1CKAA 2LJ1A 5GMKh 4M7DC 1ZUUA 4OMLA 3VYGA 2H3EB 2LP5A 2B8AA 3QWXX 2MYSA 3VU3C 3GNGA 3OS2A 1OULA 4PL6A 5EG2A 3HFNA 2RNAA 4AG1C 3OMGA 3SFMA 3REBB 3I55A 1X6GA 3MEWA 4E47A 1OYXA 5CKBA 4LDVA 4BACA 1NBEB 2KSSA 5FU6C 3CQTA 4C92G 2KY9A 4M7AD 1BK2A 4XQ3A 3JCMP 2RQVA 1EFNA 3R6NA 2OTJT 1Q81U 1YJNQ 1WHKA 2CGHA 2E10A 3EG3A 3CCJA 4N4HA 1OU8A 2C0IA 4KUIA 4MMLA 1QCFA 2O9SA 3P8BB 1X2QA 2YUOA 5DY9A 3QWYA 1JEGA 4M75D 4FW2A 4NL3A 3SWNB 2E1HA 4NOYA 1VQ4Q 2K9GA 1KQ2A 5J3BA 2X3XD 3OQ5A 2JNGA 4E6RA 3C94A 1UB4A 2NUTB 2CH4A 2DLPA 2EW3A 3CC4T 4RTTA 2KAFA 4C5HA 4FYVB 2HL5C 3MP6A 1K9MU 1FMKA 4PLLA 3H0FA 4J9CA 1M30A 2MF2A 1H92A 2DEUA 2OTJQ 4F14A 2GFAA 2I2LA 3TCJA 3CMET 1Q82R 1M4ZA 2DNUA 2QI2A 3OYYA 1YJWT 4LE9A 1VQ8T 1OX9A 1NM7A 3OYFA 1M90U 1VYTA 1WQ7A 2M9UA 1ZSZC 1QCOA 2DK3A 2ABLA 2EYQA 2QTXA 3HTRA 9ATCB 4L5GA 5A0GA 3LH0A 4BDYA 5ECAA 1R0CB 1ZSGA 1KD1U 1ABQA 4XU2A 5LJ3e 2LT4A 2F2VA 3ULRB 2YUNA 2XDBA 5GANe 3CC4Q 2QDYB 8ATCB 2P0QA 1JO8A 1D3BA 3NTKA 4EMKA 2VXEA 1YHQQ 4R0KA 1B34A 3CMEQ 1UTIA 2DL4A 1MNDA 3OSVA 2DERA 3MEAA 1YJWQ 3EGUA 1VQOA 1RABB 1SRMA 3OA6A 4RTVA 2OTLT 1Q95G 5IH2A 3MHXA 2DZ9A 1RUWA 2DXCA 3BE3A 4DBRA 1U1TA 4IUPA 2HBWA 3LW5E 2BZ8A 2NUPB 1SHGA 1PD0A 2EAYA 2L3QA 1MV0B 3CCEA 2MAMA 1WHJA 1QVPA 1Y96A 2X4XA 1C0MA 4Z8AA 1VQMT 2GCXA 4J9FA 5LJ3f 4LD9K 4FL6A 1YCYA 3I5RA 5GANf 4Y91A 3VKIA 4LDXA 4ZGJB 5CK9A 1YNZA 2OTLQ 1PHTA 1JB0E 2GTOA 1QLYA 2O31A 4OMNA 2DD4A 2DVEA 4A53A 3I55T 2JUFA 2IG0A 5I2SA 1AZGB 5IHKA 3OS1A 1VIFA 2CZ0B 4C8QF 2LJ3A 3X28B 2KVQG 4JLGA 3CMAA 3EAEA 2KXCA 1VQ7A 1NZ9A 2ZAEA 2R5MA
chains in the Genus database with same CATH topology
1M8MA 1TG0A 1ZUKA 2J05A 1KSWA 1IO6A 4RTWA 1E6HA 1OPKA 4CC3A 2KROA 1BBZA 1GL5A 2KT1A 2EGEA 2L3SA 4LNPA 1NYFA 2ROTA 1NLPC 1Y57A 2B86A 2DBKA 2RQTA 1UHFA 3THKA 3SEMA 1SPKA 2ED0A 2DVJA 2LQNA 1QKWA 1PRLC 3LH5A 1BU1A 1GBQA 1T3SA 2J7IA 2KEAA 2LZ6B 2V1RA 4HVVA 1WXUA 1UJ0A 2K3BA 1ARKA 1WFWA 2GTJA 4Z89A 1WXBA 2VVKA 3EG1A 1X2KA 2HCKA 1ZBJA 4AFZC 2X3WD 1RLPC 5I22A 2KYMA 4OMPA 1UDLA 2W0ZA 2CREA 2FPDA 1BB9A 2DL7A 1X6BA 2YUPA 1UHCA 2YSQA 2F2XA 1JXOA 1HD3A 1K0SA 1PRMC 1WX6A 2YT6A 1W70A 2LCSA 2O9VA 2AKKA 1HJDA 1YN8A 2DM1A 1Z9ZA 3NHNA 4JZ3A 1ZX6A 2EGCA 1AEYA 1ZUYA 2D0NA 4J9EA 1QWFA 4JZ4A 3I9QA 2EGAA 2IIMA 3M0PA 2AK5A 2J6OA 1SEMA 2DA9A 3PVLA 4IIOA 1YCSB 3EG0A 1NG2A 3M0RA 5I11A 5HCKA 5FWBA 1AWOA 1SRLA 1TUDA 2FRWA 1YWOA 4A63B 4J9BA 4WCIA 1QKXA 3C0CA 1GBRA 3UA6A 3VS3A 3PE0A 2NWMA 2CSQA 4F17A 3SHWA 2AZVA 1NEGA 1H8KA 3M0SA 3TSWA 1B07A 2J6FA 4AFSC 1GCPA 2DMOA 2DL5A 1U3OA 4LUDA 2FPFA 3UF4A 1KIKA 1WXTA 2EYXA 2JS0A 4QT7A 3REAB 2ECZA 2L2PA 4HCKA 2KBTA 2YUQA 3EHQA 2EVRA 2K7AA 1K4US 1PWTA 1MV3A 1W1FA 2RPNA 2E5KA 2CUDA 3VS2A 1M27C 1I07A 1PKTA 2K2MA 1GFDA 2O88A 2AZSA 2EYZA 1X43A 1NLOC 2A37A 2ROLA 2MOXA 3EG2A 1JU5C 3VS6A 4CC4B 4AG2C 3A98A 2JM8A 2RN8A 1X69A 1AWWA 2DF6A 2JXBA 2J06A 4J9IA 2M51A 4EIKA 4RTUA 2HEQA 1UJYA 1WLPB 4J9DA 1UFFA 1WYXA 2HDAA 3O5ZA 1SHFA 5IXFA 2KE9A 2KXDA 1U06A 2EKHA 2ED1A 1K0XA 4GBQA 3VS5A 2JMAA 1V1CA 2JTEA 1JQQA 2W10A 1FYNA 4Z88A 2A28A 1ZLMA 1K76A 2L0AA 4DEXA 2PZ1A 1Z9QA 2JMCA 2GGRA 3I5SA 1M3CA 1UUEA 2DE0X 2RQRA 4M4ZA 1YWPA 1HSQA 2DX1A 4RTYA 4DEYA 1M3AA 1E6GA 2F2WA 2RF0A 3VRZA 2BZYA 1U5SA 2KNBB 2CH4W 1UGVA 2KT8A 2O2OA 2EBPA 2RQWA 1KJWA 3ZL7C 1UECA 4LN2A 2K79A 1NYGA 2XMFA 2P4RA 4JJBA 5GJWB 1GFCA 1SSHA 2FPEA 2EYWA 4J9GA 5FWCA 2JS2A 3UATA 4Y92A 2I0NA 1OEBA 2KRNA 2NUZA 2GQIA 3H41A 1AZEA 1CKAA 2LJ1A 4HXJA 3NMZC 2OI3A 1ZUUA 4OMLA 1NEBA 2LP5A 2LQWA 3U23A 3QWXX 2G6FX 1AWXA 3VS1A 2H8HA 2FRYA 2FG0A 2RNAA 4AG1C 2FO0A 3REBB 1AD5A 2KRMA 1X6GA 1JXMA 5GJVB 2BTTA 3CQTA 4HVUA 1BK2A 1VYUA 1CKBA 2CSIA 5EC7A 1VYVA 3IQLA 1OV3A 1K1ZA 1EFNA 2RQVA 1OOTA 1WA7A 3R6NA 1OPLA 2YDLA 2PNIA 2HSPA 3EG3A 2AKLA 4AFUC 4CC2A 4D8KA 2EPDA 2C0IA 2GBQA 2EYYA 1QCFA 2O9SA 4X1VA 1X2QA 2YUOA 3QWYA 4CC7A 1JEGA 2CUBA 3M0UA 3KFVA 1J3TA 5IHIA 2CT4A 2KGTA 4FSSA 2K9GA 1K9AA 3GBQA 2X3XD 4JPBW 4E6RA 3TSZA 1XOVA 2CH4A 2DLPA 3RNJA 2EW3A 4RTTA 2DL3A 1GCQC 1H3HA 2VWFA 2MCNA 2KR3A 2L3PA 4D8DA 1FMKA 4RTZA 1I1JA 3H0FA 4J9CA 2JM9A 1M30A 3M0TA 1H92A 1M3BA 4OMOA 5FW9A 2MIOA 2BZXA 4F14A 2KYBA 2DNUA 3RBBB 4LE9A 4LUEA 1GRIA 1NM7A 3EHRA 1VYTA 2GNCA 1ABOA 2ENMA 2J6KA 2LMJA 2ABLA 2DJQA 3TVTA 4RUGA 2A08A 4GLMA 4JJCA 1TUCA 5ECAA 2D8JA 1ZSGA 1ABQA 1UE9A 2F2VA 2OJ2A 3ULRB 2YUNA 2RQUA 3VRYA 3FJ5A 1N5ZA 3I35A 1X27A 2KRSA 1E7OA 2DRMA 1AOJA 2VKNA 1JO8A 1G83A 4RTXA 4F16A 2LNHB 2CDTA 2DRKA 2FEIA 3NPFA 4R0KA 3VS7A 3UA7A 2LX7A 1UTIA 1G2BA 2JW4A 2DL4A 3NGPA 2DILA 3VS4A 2CT3A 3EGUA 4OMMA 1KFZA 1SRMA 1VA7A 4KRTA 4J9HA 4RTVA 5IH2A 2C0TA 4AFQC 2D8HA 1T3LA 3M0QA 2SEMA 1RUWA 4K11A 2HBWA 4ORZA 2BZ8A 3JV3A 1Y0MA 2D1XA 1SHGA 2PTKA 1UG1A 2DBMA 1B3QA 1A0NB 4HVWA 3H0HA 2DYBA 2L3QA 4ESRA 1S1NA 2EQIA 2ESWA 2K6DA 1GCQA 1MV0B 1I0CA 1AVZC 5IXBA 4Z8AA 1PNJA 1LCKA 1T0JA 2LJ0A 2A36A 2JT4A 4J9FA 2SRCA 2OAWA 1RI9A 3I5RA 1WIEA 1T0HA 1CSKA 1AWJA 5L23A 2RMOA 1PKSA 1YNZA 2M0YA 1PHTA 1WDXA 2GTOA 2V1QA 1QLYA 2O31A 1YP5A 1QWEA 1W6XA 4OMNA 3H0IA 5IHNA 1RLQC 1AZGB 4ZNXA 1WI7A 5IHKA 3VS0A 2LJ3A 4IIMA 4JJDA 1MUZA 2QDLA 2KXCA 2DL8A 2C0OA 3PVQA 4OMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8M A;  1TG0 A;  1ZUK A;  2J05 A;  1KSW A;  1IO6 A;  4RTW A;  1E6H A;  1OPK A;  4CC3 A;  2KRO A;  1BBZ A;  1GL5 A;  2KT1 A;  2EGE A;  2L3S A;  4LNP A;  1NYF A;  2ROT A;  1NLP C;  1Y57 A;  2B86 A;  2DBK A;  2RQT A;  1UHF A;  3THK A;  3SEM A;  1SPK A;  2ED0 A;  2DVJ A;  2LQN A;  1QKW A;  1PRL C;  3LH5 A;  1BU1 A;  1GBQ A;  1T3S A;  2J7I A;  2KEA A;  2LZ6 B;  2V1R A;  4HVV A;  1WXU A;  1UJ0 A;  2K3B A;  1ARK A;  1WFW A;  2GTJ A;  4Z89 A;  1WXB A;  2VVK A;  3EG1 A;  1X2K A;  2HCK A;  1ZBJ A;  4AFZ C;  2X3W D;  1RLP C;  5I22 A;  2KYM A;  4OMP A;  1UDL A;  2W0Z A;  2CRE A;  2FPD A;  1BB9 A;  2DL7 A;  1X6B A;  2YUP A;  1UHC A;  2YSQ A;  2F2X A;  1JXO A;  1HD3 A;  1K0S A;  1PRM C;  1WX6 A;  2YT6 A;  1W70 A;  2LCS A;  2O9V A;  2AKK A;  1HJD A;  1YN8 A;  2DM1 A;  1Z9Z A;  3NHN A;  4JZ3 A;  1ZX6 A;  2EGC A;  1AEY A;  1ZUY A;  2D0N A;  4J9E A;  1QWF A;  4JZ4 A;  3I9Q A;  2EGA A;  2IIM A;  3M0P A;  2AK5 A;  2J6O A;  1SEM A;  2DA9 A;  3PVL A;  4IIO A;  1YCS B;  3EG0 A;  1NG2 A;  3M0R A;  5I11 A;  5HCK A;  5FWB A;  1AWO A;  1SRL A;  1TUD A;  2FRW A;  1YWO A;  4A63 B;  4J9B A;  4WCI A;  1QKX A;  3C0C A;  1GBR A;  3UA6 A;  3VS3 A;  3PE0 A;  2NWM A;  2CSQ A;  4F17 A;  3SHW A;  2AZV A;  1NEG A;  1H8K A;  3M0S A;  3TSW A;  1B07 A;  2J6F A;  4AFS C;  1GCP A;  2DMO A;  2DL5 A;  1U3O A;  4LUD A;  2FPF A;  3UF4 A;  1KIK A;  1WXT A;  2EYX A;  2JS0 A;  4QT7 A;  3REA B;  2ECZ A;  2L2P A;  4HCK A;  2KBT A;  2YUQ A;  3EHQ A;  2EVR A;  2K7A A;  1K4U S;  1PWT A;  1MV3 A;  1W1F A;  2RPN A;  2E5K A;  2CUD A;  3VS2 A;  1M27 C;  1I07 A;  1PKT A;  2K2M A;  1GFD A;  2O88 A;  2AZS A;  2EYZ A;  1X43 A;  1NLO C;  2A37 A;  2ROL A;  2MOX A;  3EG2 A;  1JU5 C;  3VS6 A;  4CC4 B;  4AG2 C;  3A98 A;  2JM8 A;  2RN8 A;  1X69 A;  1AWW A;  2DF6 A;  2JXB A;  2J06 A;  4J9I A;  2M51 A;  4EIK A;  4RTU A;  2HEQ A;  1UJY A;  1WLP B;  4J9D A;  1UFF A;  1WYX A;  2HDA A;  3O5Z A;  1SHF A;  5IXF A;  2KE9 A;  2KXD A;  1U06 A;  2EKH A;  2ED1 A;  1K0X A;  4GBQ A;  3VS5 A;  2JMA A;  1V1C A;  2JTE A;  1JQQ A;  2W10 A;  1FYN A;  4Z88 A;  2A28 A;  1ZLM A;  1K76 A;  2L0A A;  4DEX A;  2PZ1 A;  1Z9Q A;  2JMC A;  2GGR A;  3I5S A;  1M3C A;  1UUE A;  2DE0 X;  2RQR A;  4M4Z A;  1YWP A;  1HSQ A;  2DX1 A;  4RTY A;  4DEY A;  1M3A A;  1E6G A;  2F2W A;  2RF0 A;  3VRZ A;  2BZY A;  1U5S A;  2KNB B;  2CH4 W;  1UGV A;  2KT8 A;  2O2O A;  2EBP A;  2RQW A;  1KJW A;  3ZL7 C;  1UEC A;  4LN2 A;  2K79 A;  1NYG A;  2XMF A;  2P4R A;  4JJB A;  5GJW B;  1GFC A;  1SSH A;  2FPE A;  2EYW A;  4J9G A;  5FWC A;  2JS2 A;  3UAT A;  4Y92 A;  2I0N A;  1OEB A;  2KRN A;  2NUZ A;  2GQI A;  3H41 A;  1AZE A;  1CKA A;  2LJ1 A;  4HXJ A;  3NMZ C;  2OI3 A;  1ZUU A;  4OML A;  1NEB A;  2LP5 A;  2LQW A;  3U23 A;  3QWX X;  2G6F X;  1AWX A;  3VS1 A;  2H8H A;  2FRY A;  2FG0 A;  2RNA A;  4AG1 C;  2FO0 A;  3REB B;  1AD5 A;  2KRM A;  1X6G A;  1JXM A;  5GJV B;  2BTT A;  3CQT A;  4HVU A;  1BK2 A;  1VYU A;  1CKB A;  2CSI A;  5EC7 A;  1VYV A;  3IQL A;  1OV3 A;  1K1Z A;  1EFN A;  2RQV A;  1OOT A;  1WA7 A;  3R6N A;  1OPL A;  2YDL A;  2PNI A;  2HSP A;  3EG3 A;  2AKL A;  4AFU C;  4CC2 A;  4D8K A;  2EPD A;  2C0I A;  2GBQ A;  2EYY A;  1QCF A;  2O9S A;  4X1V A;  1X2Q A;  2YUO A;  3QWY A;  4CC7 A;  1JEG A;  2CUB A;  3M0U A;  3KFV A;  1J3T A;  5IHI A;  2CT4 A;  2KGT A;  4FSS A;  2K9G A;  1K9A A;  3GBQ A;  2X3X D;  4JPB W;  4E6R A;  3TSZ A;  1XOV A;  2CH4 A;  2DLP A;  3RNJ A;  2EW3 A;  4RTT A;  2DL3 A;  1GCQ C;  1H3H A;  2VWF A;  2MCN A;  2KR3 A;  2L3P A;  4D8D A;  1FMK A;  4RTZ A;  1I1J A;  3H0F A;  4J9C A;  2JM9 A;  1M30 A;  3M0T A;  1H92 A;  1M3B A;  4OMO A;  5FW9 A;  2MIO A;  2BZX A;  4F14 A;  2KYB A;  2DNU A;  3RBB B;  4LE9 A;  4LUE A;  1GRI A;  1NM7 A;  3EHR A;  1VYT A;  2GNC A;  1ABO A;  2ENM A;  2J6K A;  2LMJ A;  2ABL A;  2DJQ A;  3TVT A;  4RUG A;  2A08 A;  4GLM A;  4JJC A;  1TUC A;  5ECA A;  2D8J A;  1ZSG A;  1ABQ A;  1UE9 A;  2F2V A;  2OJ2 A;  3ULR B;  2YUN A;  2RQU A;  3VRY A;  3FJ5 A;  1N5Z A;  3I35 A;  1X27 A;  2KRS A;  1E7O A;  2DRM A;  1AOJ A;  2VKN A;  1JO8 A;  1G83 A;  4RTX A;  4F16 A;  2LNH B;  2CDT A;  2DRK A;  2FEI A;  3NPF A;  4R0K A;  3VS7 A;  3UA7 A;  2LX7 A;  1UTI A;  1G2B A;  2JW4 A;  2DL4 A;  3NGP A;  2DIL A;  3VS4 A;  2CT3 A;  3EGU A;  4OMM A;  1KFZ A;  1SRM A;  1VA7 A;  4KRT A;  4J9H A;  4RTV A;  5IH2 A;  2C0T A;  4AFQ C;  2D8H A;  1T3L A;  3M0Q A;  2SEM A;  1RUW A;  4K11 A;  2HBW A;  4ORZ A;  2BZ8 A;  3JV3 A;  1Y0M A;  2D1X A;  1SHG A;  2PTK A;  1UG1 A;  2DBM A;  1B3Q A;  1A0N B;  4HVW A;  3H0H A;  2DYB A;  2L3Q A;  4ESR A;  1S1N A;  2EQI A;  2ESW A;  2K6D A;  1GCQ A;  1MV0 B;  1I0C A;  1AVZ C;  5IXB A;  4Z8A A;  1PNJ A;  1LCK A;  1T0J A;  2LJ0 A;  2A36 A;  2JT4 A;  4J9F A;  2SRC A;  2OAW A;  1RI9 A;  3I5R A;  1WIE A;  1T0H A;  1CSK A;  1AWJ A;  5L23 A;  2RMO A;  1PKS A;  1YNZ A;  2M0Y A;  1PHT A;  1WDX A;  2GTO A;  2V1Q A;  1QLY A;  2O31 A;  1YP5 A;  1QWE A;  1W6X A;  4OMN A;  3H0I A;  5IHN A;  1RLQ C;  1AZG B;  4ZNX A;  1WI7 A;  5IHK A;  3VS0 A;  2LJ3 A;  4IIM A;  4JJD A;  1MUZ A;  2QDL A;  2KXC A;  2DL8 A;  2C0O A;  3PVQ A;  4OMQ A; 
#chains in the Genus database with same CATH topology
 2COY A;  2O4X B;  5LJ3 j;  4O6J A;  1VQM Q;  5LJ5 d;  3CCJ T;  2EKO A;  4A4F A;  5GAN j;  2EGE A;  3MPU B;  4EMG A;  1ACM B;  3INZ A;  1QVF S;  8AT1 B;  1SPK A;  1X01 A;  2DVJ A;  2LQN A;  3JAM E;  1MMG A;  1PG5 B;  2J7I A;  1WJR A;  3JCM d;  1D3B B;  3OYM A;  3GIB A;  4EMK B;  3I55 Q;  4J7I A;  4Z89 A;  1B34 B;  1WXB A;  2HCK A;  1ZBJ A;  1H3Z A;  4OMP A;  1UDL A;  2E6Z A;  3BDU A;  2CRE A;  1Q86 C;  1X6B A;  1QP2 A;  2QK0 A;  1UHC A;  4QQG A;  4AMC A;  1HD3 A;  1PRM C;  1AT1 B;  2YT6 A;  3CCJ Q;  3UWN A;  1W70 A;  4ELZ C;  3G6E A;  4B9W A;  3NHN A;  1ZX6 A;  1AEY A;  3C12 A;  3AT1 B;  1Y96 B;  2AK5 A;  2J6O A;  2DA9 A;  2JN0 A;  4IIO A;  3A8G B;  1YCS B;  4OB1 B;  3EFR A;  3OYL A;  3V7S A;  4OP0 A;  3CCU Q;  1NG2 A;  2CS7 A;  2DD5 A;  5FWB A;  1YFN A;  2XKO C;  3TQ7 P;  4WCI A;  4BUG A;  2VAS A;  3C0C A;  5CQY A;  3UA6 A;  2VB6 A;  2NWM A;  2CSQ A;  4F17 A;  5CKD A;  3VV0 A;  3JSC A;  1D1C A;  1I5L A;  2V26 A;  1KC8 R;  2J6F A;  5GMK e;  1VQO T;  2MK5 A;  3OMC A;  3REA B;  2L2P A;  2KBT A;  1K4U S;  1W1F A;  1W4S A;  4PJO E;  2CUD A;  3FB9 A;  5CAI A;  1PKT A;  3LGL A;  2O88 A;  2AZS A;  1HXD A;  1X43 A;  1VQK A;  3CCE T;  1WJQ A;  2A37 A;  2QXF A;  4C0F A;  5FRM A;  3OY9 A;  3HFO A;  2CKK A;  4AG2 C;  3A98 A;  3MCA B;  2VXF A;  1Y07 A;  1MMN A;  1MMA A;  3FRN A;  4L6V 5;  5GAO q;  3QHS A;  4HT8 A;  4JRK A;  3JCM J;  1KG1 A;  1WLP B;  3P8D A;  4ANJ A;  4J9D A;  2JOY A;  4C0D B;  1SHF A;  5IXF A;  2XHC A;  1VQO Q;  2X51 A;  5GMK l;  3Q1J A;  2E4H A;  1K0X A;  2A28 A;  1K73 R;  3L2U A;  1K76 A;  4C92 E;  4DEX A;  4ELY C;  1YIT T;  4A4G A;  2JMC A;  2PUK B;  1VQN A;  4M78 D;  1VQ4 A;  4M78 C;  4RTY A;  5M9O A;  2C06 A;  5FRO A;  1C6V X;  5GMK m;  2CYZ B;  2RHI A;  1VQ7 T;  2F5K A;  3CPW S;  3OYB A;  3CCE Q;  2YXY A;  4ZN1 A;  1RAF B;  2KNB B;  1I81 A;  2CH4 W;  2COW A;  2JJ9 A;  3A8O B;  5FU7 C;  2EBP A;  1SKU B;  1UEC A;  1YI2 A;  5KYN A;  2XMF A;  4XTY A;  4BE0 A;  2P4R A;  5GJW B;  4NS5 A;  2DTH A;  1SSH A;  4M7A A;  4J9G A;  5FWC A;  4Y92 A;  1O9S A;  5DM7 R;  3X26 B;  3E19 A;  4WF2 A;  3X25 B;  2GQI A;  2X4J A;  3UDC A;  3OYA A;  5KYX A;  1AZE A;  3M4Y A;  2DET A;  1N8R R;  2JVV A;  1PSE A;  4PJO B;  1NEB A;  2O01 E;  2L3R A;  1DJ7 B;  4FSX A;  3V8K A;  2H8H A;  2FRY A;  3G71 A;  4DBF A;  2RJF A;  3JB9 F;  2QGF B;  4M75 A;  1BI1 A;  3CMA Q;  2AT1 B;  2K5L A;  2LQK A;  1VQ7 Q;  3CCS T;  1XNI A;  2BTT A;  4DBH A;  4KT0 E;  3PNW C;  3FC3 A;  4KUL A;  2WSC E;  2XK0 A;  3OYG A;  1I5O B;  4IUU A;  1CKB A;  1QW1 A;  3IQL A;  3WVD B;  1WA7 A;  3G6E T;  1OPL A;  1WGS A;  2YDL A;  3KXT A;  2BIV A;  2HSP A;  1BCM A;  4AFU C;  4BB7 A;  4CC2 A;  1Q7Y C;  4D8K A;  2EPD A;  1BIB A;  2GBQ A;  4QQ6 A;  4X1V A;  1VQ5 A;  1ZA1 B;  4CC7 A;  2CUB A;  1LOJ A;  3M0U A;  2WAC A;  2CT4 A;  4LDW A;  1M8V A;  4D6W A;  4BDZ A;  1K9A A;  4M77 D;  1NPP A;  3H6Z A;  3TSZ A;  1XOV A;  3LX7 A;  1M5Q 1;  1GCQ C;  3URG A;  1H3H A;  1NJI R;  2KR3 A;  4E7H A;  4PJO C;  4XU1 A;  3E1S A;  3M0T A;  1M3B A;  2BZX A;  3G6E Q;  1Q86 U;  3E9G A;  2E41 A;  4HCZ A;  3JB9 G;  5GAO p;  1LJO A;  3LLR A;  3MP1 A;  2L8D A;  2X9H A;  3QBY A;  4OGC A;  3S3O A;  3CCV A;  3SD4 A;  2K3Y A;  4JRI A;  3CPW P;  4LDY A;  2A08 A;  2EIF A;  3OYN A;  1M2V A;  1VQK T;  1D09 B;  4E7L A;  2XD0 A;  4M7A B;  4X9C A;  3S3M A;  5FLX E;  4OB3 B;  1WNL A;  2D8J A;  1VQ6 A;  4PJL A;  2YLC A;  3FEO A;  1UE9 A;  5KYX B;  1PSF A;  4PJO G;  3EH1 A;  2RQU A;  2RHY A;  1BCO A;  1B7T A;  1N5Z A;  3FJ5 A;  4C92 C;  1AOJ A;  2VKN A;  5GAN 8;  1YBY A;  2LNH B;  2RJC A;  2CP0 A;  4IUT A;  1PM3 A;  3MEV A;  4M7D D;  4HKE A;  2DRK A;  3NPF A;  3VS7 A;  1BI0 A;  2EFI A;  2FYK A;  2JW4 A;  2XDP A;  3DLM A;  4VUB A;  3EFS A;  1QVF A;  2CT3 A;  4OMM A;  1KFZ A;  4PJN A;  1VQN T;  4J9H A;  2DZC A;  2VGM A;  5AYF A;  2HNI A;  1VQ4 T;  4AFQ C;  1T3L A;  5D6Y A;  3M0Q A;  5KYU A;  2SEM A;  4E7S A;  3M55 A;  4M7A F;  5GAN 4;  2QTV A;  1VQK Q;  1R77 A;  2LCL A;  1ZA2 B;  1M1K C;  3L2R A;  1B3Q A;  3M54 A;  1A0N B;  2IVW A;  3QPH A;  1BIA A;  2DYB A;  4ESR A;  3LWI A;  4JRQ A;  1YI2 T;  1I0C A;  2NYS A;  1PNJ A;  2P0P A;  3CXC S;  2XDD A;  4FT2 A;  2LJ0 A;  1N9R A;  2SRC A;  1Y7X A;  4P5N A;  4M75 F;  4C8Q A;  2F69 A;  3EGD B;  5L23 A;  1D1A A;  1H64 1;  1VQN Q;  4FYW B;  1WDX A;  2V1Q A;  5GAO r;  3G71 T;  1QWE A;  1W6X A;  3CCU A;  1IXD A;  3H0I A;  3RR6 A;  2QYZ A;  3HHT B;  2E70 A;  3CC2 A;  2RA2 A;  3EFO A;  4KH0 B;  3VS0 A;  4IIM A;  4J5Y A;  1MUZ A;  2EWN A;  2LNV A;  4C8Q E;  2QDL A;  2RM4 A;  3EH2 A;  2C0O A;  3KBG A;  3M9Q A;  1KQS S;  1YI2 Q;  4PFO A;  4OMQ A;  1TG0 A;  1YHQ T;  4JS4 A;  2VUB A;  1MNE A;  2J05 A;  2XID A;  4M7A G;  1M2V B;  4OB2 B;  4BE1 A;  5D6W A;  4JS5 A;  1BBZ A;  4FCY A;  1NYF A;  1VQ5 T;  2ROT A;  1Y57 A;  4XTW A;  1UHF A;  3FLG A;  2ED0 A;  5DLQ E;  2QEX A;  4HCB A;  1M2O A;  3JCM c;  1BU1 A;  1GBQ A;  2KEA A;  2LZ6 B;  3G71 Q;  2HBP A;  4KUD K;  3GP8 A;  1WXU A;  5KH6 A;  1UJ0 A;  5LJ5 f;  3GOX A;  3QJY A;  1UGQ B;  2VVK A;  3EG1 A;  1U8R A;  4V2S A;  5I22 A;  4Q5W A;  2KYM A;  3FJP A;  3UT1 A;  1V76 A;  4XTV A;  2HZY A;  1BB9 A;  2DL7 A;  4ZN3 A;  5GAM d;  2EJ9 A;  2F2X A;  1JXO A;  1TWB A;  3EGX A;  3JCM f;  3SWN C;  3DKM A;  2LCS A;  2AKK A;  2YWW A;  1YN8 A;  3CC7 A;  3CCQ A;  4JZ3 A;  3NFC A;  3CCV T;  1VQ5 Q;  5L8R E;  2D0N A;  2COZ A;  2OAU A;  4J9E A;  1QWF A;  3I9Q A;  1LPL A;  2IIM A;  1RL2 A;  3V7C A;  2RD1 A;  1FMW A;  3PVL A;  5KCO A;  1Q7Y U;  1RAG B;  4MZM A;  2FHD A;  1VQ6 T;  3EG0 A;  5LJ5 j;  4C8Q B;  1P92 A;  1HK9 A;  2JZ2 A;  1AHJ B;  4LDU A;  3CXC P;  3CPW A;  1SRL A;  1TUD A;  2DYI A;  4OF1 A;  2FRW A;  1TTH B;  2MWP A;  1YWO A;  4A63 B;  3CBO A;  1VUB A;  4J9B A;  3WXM B;  1GBR A;  4R56 A;  3PE0 A;  4N0A A;  4OVA A;  1NEG A;  1H8K A;  4ZTJ A;  1QMC A;  1LVK A;  3M5A A;  2F5T X;  1KHC A;  4LUD A;  3EFO B;  3CCM A;  2AHJ B;  3OYD A;  1KIK A;  2LT1 A;  3CCV Q;  1OZ2 A;  1RAC B;  2VV5 A;  2ECZ A;  4HCK A;  4MMK A;  5GAM h;  4E2F B;  1YIJ A;  1MV3 A;  2RPN A;  4PK4 A;  2E5K A;  3VS2 A;  1M27 C;  2M02 A;  4RMO A;  4ZGD B;  1I07 A;  1VQ6 Q;  2EYZ A;  1KQS P;  3FDR A;  3QKJ A;  4HCC A;  3RMS A;  3RKX A;  5D6X A;  2MOX A;  1JU5 C;  1V29 B;  3RES A;  1OX8 A;  4MZT A;  4E7J A;  3PMT A;  4AT1 B;  3I56 A;  1PD1 A;  4EMH A;  5A0D A;  2BE7 D;  2DAQ A;  3QYH B;  2DF6 A;  3DLL A;  1Q82 C;  4J9I A;  4EIK A;  1Q81 R;  1VQ9 A;  2HEQ A;  4J6Y A;  5KYY A;  2DIQ A;  2YLB A;  3GPL A;  1MMD A;  2HDA A;  3O5Z A;  4DBQ A;  3ASK A;  2EKH A;  4C8Q C;  4Z88 A;  3OBY A;  3CCU T;  2CP7 A;  1S72 Q;  4RG8 A;  3MET A;  2RH2 A;  2EQJ A;  1N9S A;  4BE2 A;  3CC2 T;  2GGR A;  1IRX A;  3EG9 A;  3EGX B;  2DE0 X;  2RQR A;  4M4Z A;  2QQA A;  4DQ2 A;  2DX1 A;  4DEY A;  1M3A A;  1E6G A;  2F2W A;  3N5B B;  1U5S A;  4LD6 A;  5GAO l;  1UGV A;  2O2O A;  3OYE A;  1MGQ A;  1K9M R;  4FU6 A;  2ZGW A;  3RIR A;  1VOM A;  1KJW A;  1M1K U;  2K79 A;  4KGZ B;  3QZ5 B;  3GNF B;  1QCN A;  4KGV B;  1GFC A;  5KYW A;  4C8Q G;  2NLU A;  2A7Y A;  3UAT A;  5KCH A;  2FZC B;  2I0N A;  5GAO m;  1OEB A;  2QEX T;  1I4K 1;  1M90 R;  2NUZ A;  3FIF A;  3OYK A;  1D0Z A;  3QII A;  4PNO A;  3NMZ C;  4HXJ A;  3DB4 A;  3PIO A;  2HSE B;  5LJ5 h;  2LQW A;  2ZPB B;  1FX7 A;  1AWX A;  2JTM A;  2YRD A;  3VS1 A;  1OI1 A;  2RI2 A;  3CC2 Q;  2VYT A;  5LJ3 d;  2FO0 A;  4C5E A;  2KRM A;  1SF9 A;  1ZHI A;  4Z02 A;  5GAN d;  3JRZ A;  2L5Q A;  2Y90 A;  3JCM h;  2QA4 A;  4M77 A;  2R57 A;  1Y71 A;  4ATO A;  4LXC A;  4XK8 E;  2CSI A;  4QVZ A;  3CC7 T;  3QO3 A;  4EMK C;  3CCQ T;  3OS0 A;  2PNI A;  2AKL A;  3M57 A;  3PT9 A;  2QEX Q;  4N4I A;  4DOV A;  3MP8 A;  4ME7 A;  2EYY A;  2P84 A;  3A5Z B;  3HRT A;  3CCR A;  4IUV A;  2KGT A;  5KYY B;  4FSS A;  3GBQ A;  3JCM V;  4JPB W;  2QAS A;  2E64 A;  3RNJ A;  3HL8 A;  2DL3 A;  1XTD A;  3V7R A;  2VWF A;  2ZPG B;  3CXC A;  1K8A R;  1OQK A;  2L3P A;  4D8D A;  4RTZ A;  1I1J A;  3CCM T;  2JM9 A;  6AT1 B;  4OMO A;  3CC7 Q;  3CCQ Q;  1QVG P;  1GRI A;  4M7D A;  3L42 A;  2CZ6 B;  2ENM A;  4XTU A;  2QQS A;  1W2B S;  3CMA T;  4RUG A;  1RI0 A;  2LCC A;  3OYI A;  2HQE A;  5CR2 A;  4O5V A;  1D1B A;  5CKF A;  3I56 T;  5I21 A;  3OS5 A;  3J7A F;  2K3X A;  2V8K A;  1TSF A;  3VRY A;  1UGS B;  1KQS A;  3I35 A;  1VQ9 T;  1X27 A;  2KRS A;  2MI6 A;  2V8I A;  1ZBX A;  3M59 A;  3CCM Q;  1BYM A;  2FEI A;  3QJ6 A;  1G2B A;  3NGP A;  1X75 C;  4BI3 A;  3VS4 A;  4MDW A;  3J81 E;  3HRU A;  1SSF A;  3S6W A;  1YIJ Q;  3T9N A;  2IPO B;  4M77 B;  2QQB A;  5IT9 E;  2FVU A;  5CVI A;  5LJ5 g;  2EQK A;  4K11 A;  1D0Y A;  4M7A E;  4Y28 E;  2MMP A;  2PTK A;  3M53 A;  1UG1 A;  3RUX A;  4C0D C;  4L59 A;  2LTO A;  5HK3 A;  3JCM b;  4HVW A;  5C0M A;  4DOW A;  1S1N A;  2EQI A;  2ESW A;  2K6D A;  3MEU A;  3I56 Q;  4RCB A;  1KC8 C;  1AVZ C;  5IXB A;  2PVO B;  3JCM g;  1VQ9 Q;  1LCK A;  3GF5 A;  2DIG A;  2A36 A;  2JT4 A;  3JCM Q;  3ZFJ A;  2P4T A;  2YRC A;  1RI9 A;  2FZK B;  1WIE A;  2X4Y A;  2M1H A;  4M75 E;  1FWZ A;  3P8H A;  3PFS A;  2BUD A;  4J6W A;  4R55 A;  1AWJ A;  1Q82 U;  1G3S A;  4M77 F;  5HK0 A;  4B9X A;  5IN1 A;  1ZSZ A;  2GFU A;  4F7U A;  1I8F A;  1YP5 A;  1VQL A;  1NPR A;  5IHN A;  1RLQ C;  4DA4 A;  4ZNX A;  1WI7 A;  2QA4 T;  2LDM A;  4JJD A;  5DLO A;  2EQU A;  2VC8 A;  4PJO D;  2DXT A;  4PKC C;  1M8M A;  2E3H A;  1K8A C;  1ZUK A;  4C5G A;  1KK7 A;  1KSW A;  4RTW A;  2BE9 B;  1PC0 A;  1KHI A;  1OPK A;  4CC3 A;  2KRO A;  5KE3 A;  3OW2 S;  1K73 C;  1IHV A;  1W2B P;  2B86 A;  3RKY A;  5GAM e;  5FU6 B;  1IB8 A;  3SEM A;  3DB3 A;  3CCR T;  1QKW A;  1PRL C;  1WZO A;  2DPP B;  3LH5 A;  1IGU A;  4FYY B;  1ZQ1 A;  2V1R A;  3JB9 H;  3KUF A;  1RAE B;  1ARK A;  1OU9 A;  2GTJ A;  5GAN 6;  5CCA A;  4ZGE B;  2KQW A;  1N6A A;  4F04 B;  5A2Q E;  4C92 D;  5KE2 A;  4M7D F;  2QA4 Q;  2R58 A;  1TU0 B;  4AFZ C;  2X3W D;  2HKQ B;  3NTH A;  4M77 G;  1M9S A;  2RI5 A;  2FPD A;  4C5I A;  3PMI A;  2YUP A;  2YSQ A;  4M75 B;  4QVC A;  1UEB A;  2F1L A;  3JCM W;  1N8R C;  4BD3 A;  2DM1 A;  1F1B B;  1O75 A;  1Z9Z A;  3QDR B;  4XTZ A;  3S3N A;  3BFM A;  1S72 A;  1G5V A;  3CCL A;  4JZ4 A;  2ZCF B;  3M0P A;  3CCR Q;  1TUG B;  4J8O A;  2DEQ A;  2R5A A;  3RKW A;  5GAM f;  2FB7 A;  1R0B G;  2EJF A;  5HCK A;  3SB2 A;  1RAA B;  3M58 A;  1OZ3 A;  2KMT A;  4QVD A;  5CKH A;  1AWO A;  4GY5 A;  5GAN 7;  4KBM B;  3VS3 A;  1ZSZ B;  4F7U B;  3SHW A;  4YTL A;  2RJE A;  3M0S A;  4KH1 B;  3TSW A;  2QQR A;  1B07 A;  3BY7 A;  2K5F A;  1U1S A;  4AFS C;  4M7A C;  1GCP A;  4IUQ A;  2DMO A;  1U3O A;  5LJ5 e;  2D9T A;  2NUP A;  4M7D G;  1VIE A;  4FM4 B;  5CIU A;  3UF4 A;  1WXT A;  2EYX A;  2JS0 A;  4QT7 A;  1KQ1 A;  2YUQ A;  3EHQ A;  3V8L A;  2EVR A;  3MKD A;  2A3L A;  1RAH B;  5D7U A;  4BI8 B;  3LWH A;  5C6S A;  5GAM j;  2RK1 A;  2K2M A;  1GFD A;  3LGF A;  3JCM e;  2E12 A;  4M75 C;  1NLO C;  1BI3 A;  4PJM A;  2ROL A;  1NJI C;  3EG2 A;  3VS6 A;  4F7U F;  3BW1 A;  4QW2 A;  2JM8 A;  1X69 A;  2ZPH B;  3UPU A;  3OW2 P;  1D0X A;  2RHU A;  4OB0 B;  2J06 A;  2M51 A;  3R6O A;  2HQX A;  2YHT A;  1XJW B;  3RER A;  2HL3 A;  2KXD A;  1U06 A;  3VS5 A;  2JMA A;  1V1C A;  2JTE A;  3JCM X;  4RCC A;  2W10 A;  1FYN A;  1ZLM A;  1VQL T;  1RAI B;  2QQ9 A;  2PZ1 A;  1UGP B;  3E9F A;  4M75 G;  3M56 A;  2ZZD A;  2DKG A;  3I5S A;  1M3C A;  1UUE A;  2O4X A;  1YWP A;  2RF0 A;  2XIC A;  4EDU A;  4ZTF A;  2BZY A;  4OMF B;  3PGG A;  5J39 A;  5KYU B;  2KT8 A;  3GLX A;  4TVR A;  1G3T A;  3RMQ A;  2V8J A;  1BI2 A;  1NYG A;  3OSS C;  2OX7 A;  4JJB A;  4IKF A;  1G3Y A;  1Q86 R;  2FPE A;  3QSU A;  1KC8 U;  2JS2 A;  4HT9 A;  3H41 A;  2OI3 A;  2E5Q A;  3U23 A;  4F7U G;  2E6N A;  1VQL Q;  2G6F X;  1VQ8 Q;  1W2B A;  3WVE B;  2Y4X A;  4XU0 A;  2FG0 A;  3QXE B;  3TEE A;  1JRI A;  1AD5 A;  1C1A A;  4PLI A;  1JXM A;  3TU4 K;  5GJV B;  3OB9 A;  2X35 A;  4QKU A;  1JJ2 S;  4HVU A;  4FYX B;  2P0K A;  4E7K A;  1PCX A;  1VYU A;  3OYC A;  4X9D A;  5EC7 A;  1VYV A;  3CEY A;  1OV3 A;  1K1Z A;  2DO3 A;  1OOT A;  4E7Z A;  1S72 T;  1K8A U;  3CCL T;  3J80 E;  3A8L B;  4JLI A;  4IUR A;  1K73 U;  1WJS A;  2RO0 A;  3KFV A;  1J3T A;  5IHI A;  2LVM A;  4M78 A;  2ZPF B;  3A1P A;  2PUO B;  3CBP A;  2CZ1 B;  2M16 A;  2KK4 A;  7AT1 B;  1YIT A;  4UC4 A;  1HYO A;  5GAN 5;  2MCN A;  2DFU A;  5GAO n;  4BY6 B;  4C8Q D;  1VQP A;  4B6M A;  3H8Z A;  5FW9 A;  2MIO A;  2KYB A;  1RAD B;  3RBB B;  4FT4 A;  4M78 E;  4LUE A;  1NE8 A;  3CCL Q;  1QVG S;  2GF7 A;  3EHR A;  1R8O B;  2D6F A;  2GNC A;  2WSF E;  1ABO A;  4E7I A;  1N8R U;  2J6K A;  2LMJ A;  2DJQ A;  2XI9 A;  3TVT A;  4GLM A;  4CRI A;  2CP2 A;  4JJC A;  3CD6 A;  3OYH A;  1TUC A;  4OGE A;  3L2W A;  2X4W A;  3C95 A;  2MWO A;  2OJ2 A;  5AT1 B;  4WTO B;  4J7F A;  2K4Y A;  1E7O A;  2DRM A;  3G4S A;  1G83 A;  4RTX A;  2MPX C;  4F16 A;  3A8M B;  3CCS A;  2CDT A;  5LL6 S;  1YJ9 A;  4CI0 C;  3UA7 A;  2LX7 A;  3C4S A;  3OW2 A;  4XTX A;  2DIL A;  2LRQ A;  1VA7 A;  4KRT A;  2C0T A;  2D8H A;  5GMK i;  4RKU E;  3V8J A;  1KD1 R;  1WHL A;  1WHH A;  3QG1 A;  1UGR B;  4ORZ A;  3JV3 A;  3QDF A;  1Y0M A;  2D1X A;  1JJ2 P;  2DBM A;  3OBW A;  3HSB A;  4JJN K;  2CP6 A;  4BY6 C;  2ATC B;  3H0H A;  4FIB A;  2YRV A;  1GCQ A;  3VJP A;  2CZ7 B;  3MO8 A;  3QYG B;  1T0J A;  2KI7 A;  4PJO A;  2RI3 A;  1NJI U;  2OAW A;  4M78 B;  4BI4 A;  1TS9 A;  3E2U A;  3L1A A;  1T0H A;  2DXB A;  3L2Z A;  3G7Z A;  3VYH B;  1CSK A;  4PFP A;  2RMO A;  5FU7 B;  3ZEH A;  1IHW A;  1PKS A;  4C0G A;  2M0Y A;  4M77 E;  3D7S B;  1Q7Y R;  5GAM g;  2EJG A;  1TOV A;  2LX9 A;  3LYI A;  2FZG B;  2PVD B;  4GLK A;  2PQW A;  3CPF A;  2EQM A;  2CP3 A;  2K5I A;  5GAN 3;  2HAX A;  4A4E A;  1IZ6 A;  2DXU A;  4PJJ A;  2DL8 A;  3PTA A;  3PVQ A;  1Q81 C;  2QG9 B;  4C92 A;  3EG9 B;  1WQW A;  1M1F A;  5LJ3 h;  2XU8 A;  4N0A C;  4HA8 A;  5J26 A;  4M78 F;  1IO6 A;  5GAN h;  2HD0 A;  1E6H A;  2D0Q B;  4C0Z A;  1YIJ T;  2LQ8 A;  5I2M A;  1GL5 A;  2KT1 A;  1QVF P;  2K57 A;  2L3S A;  4LNP A;  1YJN A;  1QP3 A;  1NLP C;  2HQH A;  2DBK A;  1IGQ A;  3G1J A;  2RQT A;  3THK A;  2GQV A;  5CKE A;  4XAX B;  5KYW B;  2K2V A;  1T3S A;  3O8V A;  1JBM A;  4HVV A;  2K3B A;  4PFZ A;  1BKB A;  1WFW A;  3JB9 I;  1M1G A;  3MJX A;  2PVG B;  1K9M C;  2PU9 B;  1WHM A;  1X2K A;  4JDS A;  1FMV A;  4M7D E;  1RLP C;  2AIR B;  2RK2 A;  2RHZ A;  2W0Z A;  1WHG A;  2H3J A;  1VQP T;  4RG2 A;  2L89 A;  3RDV A;  2DJZ A;  4FW1 A;  1K0S A;  1WX6 A;  3VUZ A;  1M90 C;  1HJD A;  2O9V A;  3JB9 J;  5GAN 2;  3OYJ A;  1X6O A;  4EPC A;  2OTJ A;  2EGC A;  1ZUY A;  2EGA A;  5FRN A;  2RJD A;  1SEM A;  1KD1 C;  3CD6 T;  5GMK j;  4M78 G;  3M0R A;  3QZ9 B;  1YIT Q;  5I11 A;  1EZZ B;  2CP5 A;  3HPW A;  5HKC A;  3G4S T;  4II1 A;  1QKX A;  1M1K R;  4N4G A;  3M4G A;  1YJ9 T;  2AZV A;  3CC4 A;  3ER0 A;  1VQP Q;  2HMA A;  1N27 A;  2ZPI B;  3JB9 D;  3L2V A;  2QAZ A;  2XG8 D;  4A4H A;  2DL5 A;  2FPF A;  1YHQ A;  2DTI A;  3CBM A;  2JTF A;  3CME A;  2LC4 A;  3X24 B;  1YJW A;  1VQ8 A;  2VGN A;  4C92 B;  1TXQ A;  2K7A A;  4PJO F;  1PWT A;  5IAY A;  4A4K A;  4J83 A;  2E65 A;  2KDS A;  4NL2 A;  3CD6 Q;  2BKD N;  2WSE E;  3L2Q A;  5HY6 A;  4M7D B;  1EX4 A;  1SG5 A;  3AHU A;  1WPY A;  3EGD A;  4XU3 A;  1IRE B;  2E3I A;  3X20 B;  4CC4 B;  3G4S Q;  1JJ2 A;  4JUV A;  1EIF A;  4M77 C;  2RN8 A;  4F7U E;  2Y4Y A;  1AWW A;  3NTI A;  3VUB A;  3CCS Q;  1YJ9 Q;  2JXB A;  3A8H B;  1FXX A;  3SWN A;  4RTU A;  2FL7 A;  3QUI A;  1UJY A;  5LJ3 g;  4KGX B;  1UFF A;  1WYX A;  5CO7 A;  2HKN A;  2RB6 A;  4MZP A;  5GAN g;  2KE9 A;  3HRS A;  4QQD A;  3ME9 A;  2NUT A;  2ED1 A;  4GBQ A;  3HP9 A;  1MHN A;  1JQQ A;  4C92 F;  4JRP A;  2QGG A;  4J6X A;  1G8X A;  2L0A A;  2M0O A;  1XQH A;  4MDX A;  1Z9Q A;  2A0F B;  2OTL A;  3HKS A;  3F70 A;  5CQX A;  5A0L A;  3BDL A;  1G3W A;  1HSQ A;  2Z0W A;  3VRZ A;  3PIP A;  1TH7 A;  3H9N A;  4X34 A;  3SDZ A;  1GXI E;  3TRE A;  2RHX A;  3ZBD A;  2DTO A;  2RQW A;  3ZL7 C;  4A54 A;  4LN2 A;  1QQJ A;  2G3R A;  1YJN T;  2ZPE B;  1VQM A;  2EYW A;  1LNX A;  2KRN A;  1QVG A;  1CKA A;  2LJ1 A;  5GMK h;  4M7D C;  1ZUU A;  4OML A;  3VYG A;  2H3E B;  2LP5 A;  2B8A A;  3QWX X;  2MYS A;  3VU3 C;  3GNG A;  3OS2 A;  1OUL A;  4PL6 A;  5EG2 A;  3HFN A;  2RNA A;  4AG1 C;  3OMG A;  3SFM A;  3REB B;  3I55 A;  1X6G A;  3MEW A;  4E47 A;  1OYX A;  5CKB A;  4LDV A;  4BAC A;  1NBE B;  2KSS A;  5FU6 C;  3CQT A;  4C92 G;  2KY9 A;  4M7A D;  1BK2 A;  4XQ3 A;  3JCM P;  2RQV A;  1EFN A;  3R6N A;  2OTJ T;  1Q81 U;  1YJN Q;  1WHK A;  2CGH A;  2E10 A;  3EG3 A;  3CCJ A;  4N4H A;  1OU8 A;  2C0I A;  4KUI A;  4MML A;  1QCF A;  2O9S A;  3P8B B;  1X2Q A;  2YUO A;  5DY9 A;  3QWY A;  1JEG A;  4M75 D;  4FW2 A;  4NL3 A;  3SWN B;  2E1H A;  4NOY A;  1VQ4 Q;  2K9G A;  1KQ2 A;  5J3B A;  2X3X D;  3OQ5 A;  2JNG A;  4E6R A;  3C94 A;  1UB4 A;  2NUT B;  2CH4 A;  2DLP A;  2EW3 A;  3CC4 T;  4RTT A;  2KAF A;  4C5H A;  4FYV B;  2HL5 C;  3MP6 A;  1K9M U;  1FMK A;  4PLL A;  3H0F A;  4J9C A;  1M30 A;  2MF2 A;  1H92 A;  2DEU A;  2OTJ Q;  4F14 A;  2GFA A;  2I2L A;  3TCJ A;  3CME T;  1Q82 R;  1M4Z A;  2DNU A;  2QI2 A;  3OYY A;  1YJW T;  4LE9 A;  1VQ8 T;  1OX9 A;  1NM7 A;  3OYF A;  1M90 U;  1VYT A;  1WQ7 A;  2M9U A;  1ZSZ C;  1QCO A;  2DK3 A;  2ABL A;  2EYQ A;  2QTX A;  3HTR A;  9ATC B;  4L5G A;  5A0G A;  3LH0 A;  4BDY A;  5ECA A;  1R0C B;  1ZSG A;  1KD1 U;  1ABQ A;  4XU2 A;  5LJ3 e;  2LT4 A;  2F2V A;  3ULR B;  2YUN A;  2XDB A;  5GAN e;  3CC4 Q;  2QDY B;  8ATC B;  2P0Q A;  1JO8 A;  1D3B A;  3NTK A;  4EMK A;  2VXE A;  1YHQ Q;  4R0K A;  1B34 A;  3CME Q;  1UTI A;  2DL4 A;  1MND A;  3OSV A;  2DER A;  3MEA A;  1YJW Q;  3EGU A;  1VQO A;  1RAB B;  1SRM A;  3OA6 A;  4RTV A;  2OTL T;  1Q95 G;  5IH2 A;  3MHX A;  2DZ9 A;  1RUW A;  2DXC A;  3BE3 A;  4DBR A;  1U1T A;  4IUP A;  2HBW A;  3LW5 E;  2BZ8 A;  2NUP B;  1SHG A;  1PD0 A;  2EAY A;  2L3Q A;  1MV0 B;  3CCE A;  2MAM A;  1WHJ A;  1QVP A;  1Y96 A;  2X4X A;  1C0M A;  4Z8A A;  1VQM T;  2GCX A;  4J9F A;  5LJ3 f;  4LD9 K;  4FL6 A;  1YCY A;  3I5R A;  5GAN f;  4Y91 A;  3VKI A;  4LDX A;  4ZGJ B;  5CK9 A;  1YNZ A;  2OTL Q;  1PHT A;  1JB0 E;  2GTO A;  1QLY A;  2O31 A;  4OMN A;  2DD4 A;  2DVE A;  4A53 A;  3I55 T;  2JUF A;  2IG0 A;  5I2S A;  1AZG B;  5IHK A;  3OS1 A;  1VIF A;  2CZ0 B;  4C8Q F;  2LJ3 A;  3X28 B;  2KVQ G;  4JLG A;  3CMA A;  3EAE A;  2KXC A;  1VQ7 A;  1NZ9 A;  2ZAE A;  2R5M A; 
#chains in the Genus database with same CATH homology
 1M8M A;  1TG0 A;  1ZUK A;  2J05 A;  1KSW A;  1IO6 A;  4RTW A;  1E6H A;  1OPK A;  4CC3 A;  2KRO A;  1BBZ A;  1GL5 A;  2KT1 A;  2EGE A;  2L3S A;  4LNP A;  1NYF A;  2ROT A;  1NLP C;  1Y57 A;  2B86 A;  2DBK A;  2RQT A;  1UHF A;  3THK A;  3SEM A;  1SPK A;  2ED0 A;  2DVJ A;  2LQN A;  1QKW A;  1PRL C;  3LH5 A;  1BU1 A;  1GBQ A;  1T3S A;  2J7I A;  2KEA A;  2LZ6 B;  2V1R A;  4HVV A;  1WXU A;  1UJ0 A;  2K3B A;  1ARK A;  1WFW A;  2GTJ A;  4Z89 A;  1WXB A;  2VVK A;  3EG1 A;  1X2K A;  2HCK A;  1ZBJ A;  4AFZ C;  2X3W D;  1RLP C;  5I22 A;  2KYM A;  4OMP A;  1UDL A;  2W0Z A;  2CRE A;  2FPD A;  1BB9 A;  2DL7 A;  1X6B A;  2YUP A;  1UHC A;  2YSQ A;  2F2X A;  1JXO A;  1HD3 A;  1K0S A;  1PRM C;  1WX6 A;  2YT6 A;  1W70 A;  2LCS A;  2O9V A;  2AKK A;  1HJD A;  1YN8 A;  2DM1 A;  1Z9Z A;  3NHN A;  4JZ3 A;  1ZX6 A;  2EGC A;  1AEY A;  1ZUY A;  2D0N A;  4J9E A;  1QWF A;  4JZ4 A;  3I9Q A;  2EGA A;  2IIM A;  3M0P A;  2AK5 A;  2J6O A;  1SEM A;  2DA9 A;  3PVL A;  4IIO A;  1YCS B;  3EG0 A;  1NG2 A;  3M0R A;  5I11 A;  5HCK A;  5FWB A;  1AWO A;  1SRL A;  1TUD A;  2FRW A;  1YWO A;  4A63 B;  4J9B A;  4WCI A;  1QKX A;  3C0C A;  1GBR A;  3UA6 A;  3VS3 A;  3PE0 A;  2NWM A;  2CSQ A;  4F17 A;  3SHW A;  2AZV A;  1NEG A;  1H8K A;  3M0S A;  3TSW A;  1B07 A;  2J6F A;  4AFS C;  1GCP A;  2DMO A;  2DL5 A;  1U3O A;  4LUD A;  2FPF A;  3UF4 A;  1KIK A;  1WXT A;  2EYX A;  2JS0 A;  4QT7 A;  3REA B;  2ECZ A;  2L2P A;  4HCK A;  2KBT A;  2YUQ A;  3EHQ A;  2EVR A;  2K7A A;  1K4U S;  1PWT A;  1MV3 A;  1W1F A;  2RPN A;  2E5K A;  2CUD A;  3VS2 A;  1M27 C;  1I07 A;  1PKT A;  2K2M A;  1GFD A;  2O88 A;  2AZS A;  2EYZ A;  1X43 A;  1NLO C;  2A37 A;  2ROL A;  2MOX A;  3EG2 A;  1JU5 C;  3VS6 A;  4CC4 B;  4AG2 C;  3A98 A;  2JM8 A;  2RN8 A;  1X69 A;  1AWW A;  2DF6 A;  2JXB A;  2J06 A;  4J9I A;  2M51 A;  4EIK A;  4RTU A;  2HEQ A;  1UJY A;  1WLP B;  4J9D A;  1UFF A;  1WYX A;  2HDA A;  3O5Z A;  1SHF A;  5IXF A;  2KE9 A;  2KXD A;  1U06 A;  2EKH A;  2ED1 A;  1K0X A;  4GBQ A;  3VS5 A;  2JMA A;  1V1C A;  2JTE A;  1JQQ A;  2W10 A;  1FYN A;  4Z88 A;  2A28 A;  1ZLM A;  1K76 A;  2L0A A;  4DEX A;  2PZ1 A;  1Z9Q A;  2JMC A;  2GGR A;  3I5S A;  1M3C A;  1UUE A;  2DE0 X;  2RQR A;  4M4Z A;  1YWP A;  1HSQ A;  2DX1 A;  4RTY A;  4DEY A;  1M3A A;  1E6G A;  2F2W A;  2RF0 A;  3VRZ A;  2BZY A;  1U5S A;  2KNB B;  2CH4 W;  1UGV A;  2KT8 A;  2O2O A;  2EBP A;  2RQW A;  1KJW A;  3ZL7 C;  1UEC A;  4LN2 A;  2K79 A;  1NYG A;  2XMF A;  2P4R A;  4JJB A;  5GJW B;  1GFC A;  1SSH A;  2FPE A;  2EYW A;  4J9G A;  5FWC A;  2JS2 A;  3UAT A;  4Y92 A;  2I0N A;  1OEB A;  2KRN A;  2NUZ A;  2GQI A;  3H41 A;  1AZE A;  1CKA A;  2LJ1 A;  4HXJ A;  3NMZ C;  2OI3 A;  1ZUU A;  4OML A;  1NEB A;  2LP5 A;  2LQW A;  3U23 A;  3QWX X;  2G6F X;  1AWX A;  3VS1 A;  2H8H A;  2FRY A;  2FG0 A;  2RNA A;  4AG1 C;  2FO0 A;  3REB B;  1AD5 A;  2KRM A;  1X6G A;  1JXM A;  5GJV B;  2BTT A;  3CQT A;  4HVU A;  1BK2 A;  1VYU A;  1CKB A;  2CSI A;  5EC7 A;  1VYV A;  3IQL A;  1OV3 A;  1K1Z A;  1EFN A;  2RQV A;  1OOT A;  1WA7 A;  3R6N A;  1OPL A;  2YDL A;  2PNI A;  2HSP A;  3EG3 A;  2AKL A;  4AFU C;  4CC2 A;  4D8K A;  2EPD A;  2C0I A;  2GBQ A;  2EYY A;  1QCF A;  2O9S A;  4X1V A;  1X2Q A;  2YUO A;  3QWY A;  4CC7 A;  1JEG A;  2CUB A;  3M0U A;  3KFV A;  1J3T A;  5IHI A;  2CT4 A;  2KGT A;  4FSS A;  2K9G A;  1K9A A;  3GBQ A;  2X3X D;  4JPB W;  4E6R A;  3TSZ A;  1XOV A;  2CH4 A;  2DLP A;  3RNJ A;  2EW3 A;  4RTT A;  2DL3 A;  1GCQ C;  1H3H A;  2VWF A;  2MCN A;  2KR3 A;  2L3P A;  4D8D A;  1FMK A;  4RTZ A;  1I1J A;  3H0F A;  4J9C A;  2JM9 A;  1M30 A;  3M0T A;  1H92 A;  1M3B A;  4OMO A;  5FW9 A;  2MIO A;  2BZX A;  4F14 A;  2KYB A;  2DNU A;  3RBB B;  4LE9 A;  4LUE A;  1GRI A;  1NM7 A;  3EHR A;  1VYT A;  2GNC A;  1ABO A;  2ENM A;  2J6K A;  2LMJ A;  2ABL A;  2DJQ A;  3TVT A;  4RUG A;  2A08 A;  4GLM A;  4JJC A;  1TUC A;  5ECA A;  2D8J A;  1ZSG A;  1ABQ A;  1UE9 A;  2F2V A;  2OJ2 A;  3ULR B;  2YUN A;  2RQU A;  3VRY A;  3FJ5 A;  1N5Z A;  3I35 A;  1X27 A;  2KRS A;  1E7O A;  2DRM A;  1AOJ A;  2VKN A;  1JO8 A;  1G83 A;  4RTX A;  4F16 A;  2LNH B;  2CDT A;  2DRK A;  2FEI A;  3NPF A;  4R0K A;  3VS7 A;  3UA7 A;  2LX7 A;  1UTI A;  1G2B A;  2JW4 A;  2DL4 A;  3NGP A;  2DIL A;  3VS4 A;  2CT3 A;  3EGU A;  4OMM A;  1KFZ A;  1SRM A;  1VA7 A;  4KRT A;  4J9H A;  4RTV A;  5IH2 A;  2C0T A;  4AFQ C;  2D8H A;  1T3L A;  3M0Q A;  2SEM A;  1RUW A;  4K11 A;  2HBW A;  4ORZ A;  2BZ8 A;  3JV3 A;  1Y0M A;  2D1X A;  1SHG A;  2PTK A;  1UG1 A;  2DBM A;  1B3Q A;  1A0N B;  4HVW A;  3H0H A;  2DYB A;  2L3Q A;  4ESR A;  1S1N A;  2EQI A;  2ESW A;  2K6D A;  1GCQ A;  1MV0 B;  1I0C A;  1AVZ C;  5IXB A;  4Z8A A;  1PNJ A;  1LCK A;  1T0J A;  2LJ0 A;  2A36 A;  2JT4 A;  4J9F A;  2SRC A;  2OAW A;  1RI9 A;  3I5R A;  1WIE A;  1T0H A;  1CSK A;  1AWJ A;  5L23 A;  2RMO A;  1PKS A;  1YNZ A;  2M0Y A;  1PHT A;  1WDX A;  2GTO A;  2V1Q A;  1QLY A;  2O31 A;  1YP5 A;  1QWE A;  1W6X A;  4OMN A;  3H0I A;  5IHN A;  1RLQ C;  1AZG B;  4ZNX A;  1WI7 A;  5IHK A;  3VS0 A;  2LJ3 A;  4IIM A;  4JJD A;  1MUZ A;  2QDL A;  2KXC A;  2DL8 A;  2C0O A;  3PVQ A;  4OMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...