4CC3A

Complex of human tuba c-terminal sh3 domain and mena proline-rich peptide - h3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DYNAMIN-BINDING PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 11
structure length 61
sequence length 61
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc3A00
2EW3A 4JJBA 2OAWA 4RTZA 1GFDA 2DL7A 2CT4A 4ESRA 2EQIA 5IHNA 4LNPA 2GQIA 1T0HA 2D0NA 4E6RA 1AZGB 1X2KA 2HDAA 2LJ3A 1X2QA 1IO6A 1K4US 1NG2A 1SEMA 2JS2A 3I5RA 4D8KA 1AVZC 1JU5C 1JQQA 2FPFA 2CDTA 3EG0A 1WFWA 1JO8A 1JXOA 1U06A 3EG2A 2JMCA 1WXTA 1NYFA 1QLYA 3PVLA 2A37A 1EFNA 2LQNA 1H8KA 4AFSC 2DNUA 4GBQA 1SSHA 2PTKA 3FJ5A 4HVUA 3IQLA 3A98A 2KXDA 1HD3A 2ROTA 2A28A 2AK5A 2DL3A 2DYBA 2CSQA 4Z89A 2KE9A 3R6NA 2M51A 3QWXX 1YWPA 1AWWA 1AWOA 2DX1A 2EGEA 2KYBA 2LJ1A 3REAB 1UDLA 3JV3A 2X3WD 2FRYA 2HSPA 2LZ6B 1AZEA 4LE9A 2ED1A 2DM1A 4JJDA 2K2MA 2VKNA 1Y0MA 2FG0A 3I35A 1Z9ZA 2RMOA 5I11A 2FRWA 1QWEA 5IXFA 3C0CA 2ABLA 2W10A 1JEGA 1GCQA 2KRSA 2YUQA 1UGVA 1NEGA 5I22A 1WA7A 5L23A 1VYUA 4F16A 2LMJA 1RUWA 2J6FA 5IHIA 1K76A 4JPBW 4DEXA 1GCPA 1XOVA 3RNJA 2L3SA 2KBTA 1U5SA 3VS0A 4J9CA 2L3QA 1OV3A 3VS4A 2ROLA 4HVVA 3NMZC 2GNCA 1AOJA 2KRNA 2DJQA 2GTJA 1PRMC 4CC3A 2ECZA 1OOTA 1G83A 2KR3A 1UECA 2CT3A 1NEBA 1W70A 4JZ3A 5IHKA 3VS3A 4A63B 4J9GA 4R0KA 4CC2A 2DILA 2V1QA 4WCIA 5IH2A 1N5ZA 3TSWA 1U3OA 2EVRA 2EGAA 2RQRA 1I1JA 2ENMA 4OMQA 4Z8AA 2HBWA 3RBBB 1A0NB 2EYWA 3M0PA 1E6GA 3CQTA 1ZUUA 3NGPA 2JXBA 1MV3A 2JS0A 1AD5A 1X69A 1VA7A 2M0YA 4HXJA 2GTOA 3GBQA 4OMOA 1JXMA 2DE0X 2L2PA 4M4ZA 1ZUKA 4D8DA 2AKKA 4RUGA 1ZLMA 4F14A 3VRYA 1PKTA 1PWTA 1YCSB 2O31A 4X1VA 2RQWA 1M3AA 1YWOA 1TG0A 2RQUA 2EKHA 2NUZA 3SHWA 3PE0A 1M30A 2O9SA 2VWFA 2CUDA 4FSSA 2GGRA 3KFVA 3M0RA 3NPFA 4OMNA 2RQTA 1AWXA 2RNAA 2DBMA 2C0TA 3TSZA 4J9DA 2K79A 2J05A 2DVJA 5HCKA 3LH5A 2EPDA 2KT8A 1NM7A 3VS2A 2LQWA 1SHGA 2C0OA 1PHTA 4IIOA 1BU1A 3UATA 2IIMA 1CKAA 1FYNA 1H92A 2K7AA 1B3QA 1X6BA 2GBQA 1M8MA 2DRMA 1X27A 2YSQA 4F17A 4LN2A 1CSKA 2MIOA 1PNJA 1LCKA 2DBKA 1W6XA 4JJCA 1T3SA 3REBB 1KFZA 4J9FA 3QWYA 1YP5A 1GL5A 3VS5A 1QKXA 2J6KA 2HEQA 1MUZA 2EGCA 1ZUYA 2DF6A 2FO0A 5EC7A 1KSWA 2BTTA 2EYYA 2K9GA 1ARKA 1ZSGA 3UA6A 2CUBA 1M3CA 1HSQA 2FEIA 2DRKA 2YUOA 1K0XA 2BZ8A 1E7OA 3VS7A 1WXBA 2LNHB 2RF0A 1BB9A 2J6OA 3EG3A 1OPLA 2MOXA 4RTXA 1YNZA 1RI9A 2CSIA 1UUEA 2EYZA 1CKBA 3VS1A 4ZNXA 2QDLA 3M0SA 4HVWA 4RTUA 4J9HA 1GFCA 1QWFA 2B86A 2I0NA 4LUDA 1OPKA 1W1FA 2HCKA 4JZ4A 1K9AA 4DEYA 1M3BA 2DA9A 4J9IA 4AG2C 1NLOC 2SEMA 3UF4A 3VS6A 3TVTA 4AFQC 2JMAA 3UA7A 4Y92A 1PRLC 1G2BA 1GRIA 1WYXA 1X43A 4HCKA 2KGTA 4OMPA 2W0ZA 1S1NA 1UJ0A 2L3PA 2X3XD 3EG1A 4J9EA 1ABQA 2YDLA 1SRLA 2CH4A 5FW9A 2ED0A 2V1RA 1VYVA 2K3BA 1UTIA 3SEMA 4CC4B 2CH4W 2OI3A 1MV0B 5FWCA 2F2VA 1K0SA 2AZSA 3EHQA 2SRCA 1ZX6A 2JM9A 3I9QA 2AZVA 2RPNA 3O5ZA 5GJWB 1QCFA 2DL5A 2YT6A 4OMLA 2NWMA 2F2WA 2KROA 2KRMA 5FWBA 2RQVA 1B07A 1NYGA 3I5SA 3EGUA 5ECAA 1T3LA 1BK2A 2K6DA 3NHNA 4GLMA 4QT7A 5IXBA 2CREA 1UE9A 1WDXA 3M0UA 3EHRA 1ABOA 1K1ZA 2AKLA 2KT1A 3ULRB 4K11A 1M27C 1AWJA 2LP5A 2D8JA 2A36A 1V1CA 1UG1A 3H0IA 1RLQC 3H0FA 1NLPC 3H0HA 2KXCA 1KJWA 1Y57A 1SRMA 1QKWA 2D1XA 3H41A 1OEBA 1UHCA 3PVQA 2D8HA 4AG1C 4IIMA 2JT4A 4AFZC 2JTEA 1T0JA 2E5KA 2YUPA 1Z9QA 4CC7A 2J06A 4OMMA 2JM8A 2O88A 4RTVA 2FPEA 4KRTA 3U23A 2ESWA 3M0TA 1WI7A 3ZL7C 2DMOA 2O9VA 1RLPC 2LJ0A 1E6HA 2A08A 1GCQC 1ZBJA 4RTYA 2BZXA 2JW4A 1PKSA 2L0AA 2EYXA 1WLPB 1VYTA 1WX6A 2F2XA 2H8HA 2PNIA 3VRZA 1X6GA 1TUCA 1SPKA 1HJDA 2J7IA 1SHFA 2FPDA 2YUNA 2RN8A 1AEYA 3M0QA 4J9BA 1UJYA 2VVKA 2G6FX 2KEAA 1YN8A 4RTTA 4LUEA 2DL4A 1FMKA 1BBZA 1WIEA 5GJVB 1UHFA 2XMFA 3THKA 2LX7A 1GBRA 2DL8A 2KNBB 1KIKA 4RTWA 2MCNA 1J3TA 1TUDA 2P4RA 2OJ2A 4EIKA 4AFUC 1I0CA 2BZYA 2LCSA 4ORZA 1GBQA 2O2OA 2PZ1A 1I07A 2EBPA 2C0IA 2KYMA 4Z88A 2DLPA 1H3HA 1WXUA 1UFFA
chains in the Genus database with same CATH superfamily
2EW3A 2OAWA 2DL7A 2CT4A 3RUXA 1VQ7T 5EG2A 4E6RA 1R0BG 1YJ9T 1AZGB 1JBMA 1OX8A 3WVDB 1S72A 2K5FA 2JS2A 4M7DF 4XU2A 3CCRT 4OVAA 3JB9F 1ZSZC 1AVZC 5CAIA 4M7DB 4DBQA 3JB9J 1WJRA 1XTDA 3E9FA 1QLYA 2DPPB 1Q82C 2A37A 1EFNA 2KMTA 1M1KR 1IRXA 1OQKA 2E70A 4J83A 1FMWA 2M02A 1YITQ 4FW2A 4B6MA 3RESA 1HD3A 2E3HA 2GQVA 1QVPA 2DL3A 2QAZA 3X20B 5KYYB 4YTLA 2KYBA 1YHQA 3JV3A 2X3WD 3JAME 5D6YA 1VQ6Q 3ZBDA 2VKNA 2FG0A 3JCMP 1Z9ZA 2PVGB 2RMOA 3BW1A 2XU8A 1ZA1B 3C0CA 1TOVA 1JEGA 4DBFA 2YUQA 1UGVA 5GAN2 2HQXA 4XU1A 1LVKA 2LMJA 1IHWA 1VQKT 3CCET 2EYQA 5FROA 3A1PA 2KBTA 2JNGA 4BACA 2ROLA 4HVVA 3TQ7P 4M7AE 1WJQA 2GNCA 2DKGA 2DJQA 2GTJA 3OYFA 2ECZA 4EMKB 2P0PA 2AT1B 1W70A 5GAMe 4A63B 4RG2A 4CC2A 2V1QA 1N5ZA 1U3OA 3CCSA 2RQRA 3A8OB 4A4GA 1I1JA 2COWA 1WQWA 3RBBB 2BIVA 3META 2ZCFB 4BDZA 4NL2A 5GAN4 3FEOA 1E6GA 2Y90A 4C0GA 3LWIA 2X4JA 3NGPA 1MV3A 4C8QC 1QVGA 2RHXA 1VA7A 1U1TA 3L2QA 1B34B 4M75B 5KYXB 1BIBA 1W2BS 3E1SA 2DE0X 2QXFA 2X4XA 3JCMQ 4Y91A 4RUGA 2QGGA 4X1VA 1M3AA 1VQ8Q 5KYUA 2VGNA 4VUBA 3X26B 1BIAA 3OBWA 5FU7C 2FYKA 4OMNA 3MEWA 4X9DA 5HY6A 1M2VB 4E47A 3CD6A 2HNIA 2K79A 1M90C 2E10A 3RIRA 4F7UB 2EPDA 1M8VA 3CXCP 2LQWA 2IIMA 2G3RA 3PMTA 1H92A 1X6BA 3JB9H 3OYEA 2DETA 2LX9A 1LNXA 4Q5WA 4KH1B 5CK9A 4XTUA 2MWPA 4PFPA 4NOYA 4XQ3A 4DQ2A 2EJ9A 1VQLA 3M55A 2MIOA 1Q7YC 4N0AA 1YITA 1T3SA 3M5AA 4C8QG 4PK4A 5GAN8 4E7ZA 2X4YA 2JN0A 1GL5A 1C1AA 2J6KA 2BE7D 1HYOA 2DF6A 5D7UA 2FO0A 1WJSA 5EC7A 2L3RA 2K9GA 1DJ7B 4C92B 4PFZA 3QHSA 3CEYA 1ZSGA 2GFAA 4EPCA 2EJFA 3CPWP 3CCLT 1C6VX 1VQ6A 2RJEA 1HSQA 2FEIA 1VQPT 2YUOA 4WTOB 4QW2A 2DZCA 2BE9B 3EGXB 1BB9A 3EG3A 1EZZB 2MOXA 4QKUA 4RTXA 1ZSZB 1UUEA 2KK4A 2EYZA 3PNWC 1MNDA 2K3XA 4V2SA 4ZNXA 4ELZC 1TTHB 4RTUA 4IURA 3SWNC 1GFCA 4GLKA 3ZFJA 1QWFA 2QQRA 4LUDA 3PIOA 4JZ4A 1FXXA 2QQ9A 5GAOq 2QA4Q 4P5NA 4J9IA 4AG2C 2H3JA 2QI2A 1S72T 5KE2A 4EMHA 1IXDA 3ASKA 1G2BA 3RMSA 4HCKA 2KGTA 4C8QA 1ABQA 3TEEA 1SRLA 2CH4A 1Q95G 3HL8A 2ED0A 2M9UA 2DXTA 2V1RA 3VU3C 2K57A 2X4WA 1KC8C 4PLLA 2K3BA 4X34A 2ZGWA 1WHMA 2RHIA 3CC7Q 1GXIE 3EH2A 4M7AC 1Y96B 5CR2A 1IHVA 2Z0WA 2RPNA 1YBYA 1JRIA 1OZ3A 2DL5A 2YT6A 4OMLA 2NWMA 2E6ZA 1YHQT 1K73R 4XK8E 2CP2A 1B07A 2F1LA 3I5SA 1BCOA 3GNGA 3I55A 1Q86C 3OYYA 4QT7A 2K6DA 2RJDA 1N6AA 1WDXA 1VQ8A 3S3OA 3EG9B 3EHRA 5LJ3h 3OB9A 1M27C 1VQ4Q 2LP5A 2D8JA 1V1CA 1IZ6A 1PSFA 2YLBA 3DLLA 3MHXA 3J80E 1XQHA 5IAYA 1ZBXA 3H41A 3OYCA 3GLXA 4DBHA 4IIMA 2CGHA 1YCYA 4FSXA 1T0JA 2E5KA 2LRQA 4UC4A 3CXCS 4JJNK 1TU0B 1VQNQ 2O88A 3MP1A 4OB0B 1BI1A 1QCOA 2B8AA 4LD9K 5A2QE 2ZPFB 3M0TA 9ATCB 3TCJA 2O9VA 4M7AG 1E6HA 2A08A 1VQPQ 2MK5A 1GCQC 4DOWA 3CCST 2EYXA 1Q82U 2E41A 5LJ5h 2KI7A 3VRZA 3SWNA 4KUIA 2VGMA 1SPKA 3HFNA 1N9RA 2J7IA 1SHFA 2FPDA 2RO0A 1AEYA 1HK9A 5GAOn 4KULA 2XK0A 3CMEQ 2KEAA 2QQSA 3FIFA 5I21A 3A5ZB 4LUEA 3CPWS 4MZTA 1WIEA 5GJVB 1M9SA 4KUDK 1X75C 1K8AC 2DL8A 1KIKA 4RTWA 2MCNA 2LVMA 2HBPA 4II1A 1TUDA 3M56A 2P4RA 3HFOA 4C0FA 2L5QA 2PZ1A 4M77D 1X01A 2OAUA 2EBPA 2LDMA 3LLRA 1XNIA 2KYMA 3OYHA 4XTXA 1UFFA 1QP3A 2QA4A 2GCXA 5LJ3d 2DXUA 5IHNA 4LNPA 3CD6T 1WZOA 1T0HA 1O9SA 2NUPA 1D0ZA 2HDAA 2V8JA 2ZAEA 4PJOD 4M7AA 1RI0A 2RHUA 3AT1B 1SKUB 1SEMA 1D0YA 3I5RA 4D8KA 1PM3A 1BI2A 1RAGB 4OP0A 4A53A 5KCHA 4B9XA 1YHQQ 1I5LA 1QVGP 5GANh 1NYFA 2QG9B 2Y4XA 1VQLT 3PVLA 4GY5A 3P8BB 2DTIA 3UPUA 2OTLQ 1H8KA 3CC7A 1YITT 4XTWA 2E5QA 1D1AA 4OB1B 2DNUA 4GBQA 5LJ3f 3QBYA 2XICA 4PL6A 4NL3A 4HVUA 3CCMA 3IQLA 3RDVA 2XDPA 2ROTA 1MHNA 1KD1R 3HSBA 5C0MA 5LJ5d 4Z89A 3FDRA 1AWOA 2LJ1A 2EGEA 2ZPHB 1K9MC 1UDLA 1VQ6T 4Z02A 3S6WA 1VQ5Q 2FRYA 2X35A 3J81E 4M78A 2LZ6B 1AZEA 4C5EA 2E1HA 1KK7A 2DM1A 4JJDA 2K2MA 3LWHA 4FT4A 1Y0MA 1ZA2B 2JUFA 4C8QE 4KGXB 1VQ4A 2FZKB 2CP6A 1N9SA 5I11A 3VJPA 2K5LA 2R5AA 3R6OA 4R56A 1GCQA 2KRSA 1QQJA 2I2LA 3EH1A 1TWBA 2FB7A 4F16A 2J6FA 5GAMd 1PSEA 1M1KC 3CCSQ 4M7DA 2XIDA 1XOVA 1U5SA 3L42A 5FU6B 3VS0A 5GMKm 1C0MA 4M77F 3OYGA 2AIRB 1VQNA 5GAN3 2HKNA 3CCVQ 3NMZC 5GAN5 2QQBA 1M90U 1W4SA 1RADB 2EJGA 4CC3A 3CCJQ 1G83A 5HK3A 2CT3A 3OMCA 3QDFA 2LT4A 4JZ3A 4PJOF 3JCMh 1EIFA 1WQ7A 3VS3A 4FIBA 4NS5A 2DILA 5IH2A 2LQ8A 3OS1A 5GANd 4Z8AA 1Q7YU 2HBWA 5GAMf 1U8RA 1A0NB 3L2UA 4PKCC 4LD6A 2CS7A 3CMEA 1ZUUA 1AD5A 4HXJA 5KYWA 4BI8B 4FL6A 3CD6Q 3I55T 4N4GA 2DD5A 1ZUKA 1VQ8T 1OX9A 2VB6A 4BY6B 3OYKA 3VRYA 1PWTA 1YCSB 2DAQA 4XTVA 2RQWA 1YWOA 5CVIA 1KHCA 8AT1B 2DEUA 4N4HA 1TS9A 5GANf 4M75D 2VWFA 1VQ9A 1OI1A 2HAXA 1QCNA 3M0RA 2K3YA 1VQLQ 3VUBA 3NPFA 2RQTA 4QVCA 2RNAA 4DBRA 4EMKA 3TSZA 2QEXQ 4J8OA 4J9DA 2J05A 3X24B 2DVJA 1YI2Q 3LH5A 3SD4A 2KT8A 1NM7A 1VQMQ 1SHGA 2C0OA 2EQJA 2MMPA 1CKAA 1FYNA 2K7AA 3OSSC 5IT9E 3PT9A 1NJIR 1I81A 1M8MA 2E12A 1X27A 1QVGS 2OTLA 5GAOr 4A54A 1CSKA 3VUZA 1PNJA 4QVZA 4N0AC 4J6YA 2YRDA 1KFZA 4J9FA 3QWYA 4IUTA 5LL6S 1B34A 4FCYA 1QKXA 1KC8U 4LXCA 3JCMd 1PD1A 2XG8D 2PVOB 1KSWA 2BTTA 4ELYC 1ARKA 2KSSA 1VQ5A 2CUBA 3ME9A 1MMDA 4J5YA 3QJYA 4E2FB 3MPUB 1E7OA 4BE1A 1WXBA 2RF0A 2EIFA 3EGDA 1YNZA 1RI9A 4OGEA 2CSIA 3TREA 4C92D 1VQOQ 1Q86U 4KGVB 1QMCA 3KUFA 3M0SA 4ATOA 1BI0A 3GPLA 1LOJA 2QA4T 3JCMf 2B86A 2HD0A 1OPKA 2HSEB 2RB6A 2DA9A 4Y28E 1NLOC 2HL5C 3CCVA 4E7KA 2VASA 3MKDA 1GRIA 1WYXA 3CCJA 4M75F 1S1NA 3MP8A 4LDVA 4PJOE 5GMKh 4BB7A 5FW9A 4WF2A 4BI3A 3GIBA 4XTZA 4C5HA 3I55Q 3CC7T 4M78E 4C0ZA 1U1SA 4CC4B 2XI9A 1MGQA 3CCMT 5FWCA 2F2VA 3OYLA 2AZSA 2JVVA 2SRCA 4JRKA 3WVEB 3MEUA 3A8GB 1BCMA 2AZVA 3L2VA 3G4SQ 1QCFA 2QQAA 4F7UF 2F2WA 2KROA 4DA4A 2KRMA 3OYAA 2WSFE 5FWBA 4C0DC 1WGSA 5CKEA 3H6ZA 5CIUA 4M7DE 2RD1A 5ECAA 3OYMA 2MWOA 2GFUA 4PJJA 3NHNA 1NPRA 3OS5A 4ZN1A 2CREA 1Y71A 3CBPA 5LJ3g 1K8AU 1VQ4T 2CZ7B 1ABOA 2QTXA 3QUIA 2P84A 1NZ9A 2NUTA 1RAIB 2KT1A 4K11A 2JTFA 1IB8A 4O5VA 3H0IA 3L1AA 1NLPC 8ATCB 2EAYA 2QEXA 1KJWA 1SRMA 1QKWA 1YI2A 4C92F 1OEBA 1UHCA 3PVQA 3V7CA 2QTVA 2YRCA 4X9CA 3I56Q 2YUPA 1VQMA 1VQNT 5C6SA 3FJPA 2BUDA 5GAOl 2ZPIB 3CCQQ 3CC2Q 4E7IA 5CKBA 2ESWA 4XU0A 1WI7A 2JJ9A 1K73C 1XJWB 1N8RR 1FWZA 1RLPC 1N27A 5GAN6 2BZXA 2L0AA 5LJ5g 1WLPB 2E3IA 4ZGDB 1X6GA 5KYUB 2RA2A 3OY9A 2YUNA 3CMET 3H9NA 2P0KA 2LCCA 5CO7A 4OB2B 5KE3A 1D1CA 2G6FX 2ZPEB 1FMKA 2JOYA 2MF2A 5CCAA 3ER0A 1Q81R 1UHFA 1R0CB 3THKA 1K9MU 1GBRA 3CPFA 5DLQE 1VQOA 4RKUE 4CRIA 1J3TA 3CCUQ 1R77A 1FMVA 4A4HA 2IPOB 3E9GA 2BZYA 3PFSA 3JCMc 1GBQA 2O2OA 3H8ZA 2LNVA 2IVWA 1NBEB 1IGQA 3OYDA 1UGSB 3PGGA 4Z88A 1VQ9T 1H3HA 1WXUA 4RTZA 1GFDA 2EQIA 3EFOB 3JCMX 2GQIA 3P8HA 2D0NA 5L8RE 2LT1A 1UGQB 1X2KA 2LJ3A 1X2QA 1IO6A 3CCMQ 1K4US 2QK0A 3M53A 1M1KU 2DIQA 3FB9A 1KQ2A 1JU5C 1JQQA 2FPFA 2D9TA 1WFWA 1JO8A 1U06A 3EG2A 2OTLT 1QW1A 2E64A 5HKCA 4CI0C 4LDXA 2VUBA 3CMAQ 2RHYA 3M9QA 3NTIA 4F04B 4AFSC 2RM4A 5M9OA 2OX7A 2MAMA 1SSHA 3RERA 5GAOp 2VXFA 2PVDB 3A98A 3G4SA 2KXDA 2P0QA 2D0QB 1ACMB 1V29B 2PUKB 2AK5A 2DYBA 2CSQA 4F7UE 3R6NA 3QWXX 1YWPA 1UEBA 5J3BA 2RI3A 2RK2A 1VQ5T 1D3BA 3REAB 1TSFA 2E4HA 4IKFA 4PJOC 2A0FB 5D6XA 2KVQG 3PTAA 2MYSA 5LJ3j 3M59A 4M78C 4LE9A 3LYIA 4C8QB 3I35A 3QPHA 1QWEA 1AHJB 5IXFA 3UT1A 4A4EA 2CYZB 3QIIA 1WA7A 5I22A 4JS4A 3GP8A 1YJWQ 1RUWA 5IHIA 3I56A 3DB4A 1Y7XA 3URGA 4M7DC 2L3SA 1PC0A 2EQKA 3CCVT 3HKSA 5HK0A 3CCJT 5FU7B 3CCQA 3CC2A 1MMGA 3UWNA 1JJ2A 1AOJA 2F5KA 1KD1C 2DTHA 4ZTJA 1OOTA 4M77G 1VIEA 2FVUA 1KHIA 1UECA 5LJ5j 1G8XA 5CKDA 4PJNA 5IHKA 3JCMJ 1WNLA 3T9NA 1MMNA 3TSWA 2EGAA 4E7HA 4PJOG 4LDWA 5GAMh 5GMKi 5KH6A 4M78G 4MMLA 3M0PA 3CQTA 2O4XA 2JXBA 1VQ9Q 4ZGJB 2OTJA 2AHJB 2M0YA 2DJZA 4KH0B 3CCUA 2F69A 1OZ2A 4D8DA 2AKKA 2M16A 4F14A 2A3LA 2ZPGB 4JRPA 1PKTA 4M7DG 2CZ0B 2EKHA 2NUZA 2RJFA 3JB9G 2O9SA 2CUDA 2GGRA 3KFVA 2QEXT 4M77A 3MJXA 2RK1A 2YWWA 1YI2T 1SSFA 3E19A 4EMKC 3M4GA 3G6EQ 3SWNB 2C06A 1VQMT 2FZCB 3QJ6A 3VS2A 5GANj 2NYSA 1KQSA 4IIOA 1WHHA 4JLGA 1B3QA 4PJOA 2DRMA 4O6JA 4F17A 3QZ5B 3CMAA 1OULA 1RAAB 4FM4B 1PCXA 1LCKA 2F5TX 2DBKA 3PMIA 4JJCA 3O8VA 1VUBA 3OYNA 1RAHB 4IUPA 1YP5A 1HXDA 3VS5A 3N5BB 2HEQA 1MUZA 1WHJA 1EX4A 1ZUYA 2EYYA 3RKXA 3GOXA 1UB4A 1SG5A 4ZGEB 4BD3A 1M3CA 4OB3B 2MPXC 2NUPB 2DRKA 2CP5A 1K0XA 4M7AB 3QYHB 5CQYA 3VS7A 2COYA 4RCBA 1VQOT 3M54A 4OMFB 3HPWA 4L59A 4XU3A 3M58A 1CKBA 5IN1A 3FLGA 1H641 1VOMA 3VS1A 4BI4A 2JZ2A 3LX7A 1NJIC 2R58A 1YJWA 5KYYA 1W1FA 2QASA 4DEYA 4PLIA 3QO3A 1M3BA 2V8IA 2EQUA 1KG1A 4AMCA 3UF4A 3VS6A 1G3SA 3TVTA 4AFQC 1UGRB 2JMAA 3UA7A 4MMKA 2DVEA 1PRLC 1X43A 1RL2A 1WHGA 2O01E 3RKWA 3EFRA 3G1JA 1MMAA 2KAFA 3CBOA 3EAEA 4M75G 1G3YA 4E7JA 3OW2A 5A0LA 4C92C 1K73U 2CZ6B 4B9WA 2DZ9A 1MV0B 1UGPB 4E7SA 1K0SA 3G4ST 1ZX6A 2JM9A 1X6OA 3BE3A 3CC4Q 3OSVA 3O5ZA 1G3TA 5FRNA 1QP2A 2HKQB 3V8LA 3NFCA 4C5IA 2PUOB 3LGLA 5LJ3e 3FRNA 1YJNQ 1I5OB 3EGUA 3PIPA 3V8KA 3WXMB 4F7UG 2CP7A 5IXBA 4RG8A 1UE9A 1P92A 3HTRA 3M0UA 2HMAA 3LH0A 3QYGB 2DXBA 3TU4K 2FHDA 1K1ZA 2QGFB 1AWJA 2A36A 2DFUA 3MEAA 1LJOA 1RLQC 3OMGA 1TXQA 1WHLA 3H0HA 2KXCA 3P8DA 3I56T 3G6EA 1Y57A 4QVDA 3QZ9B 4M75A 2D8HA 5KYXA 2JT4A 3A8LB 1IREB 3OQ5A 2E65A 3NTHA 1Z9QA 3MCAB 3C12A 3CCQT 3CC2T 4C92G 4OMMA 2JM8A 3G7ZA 2FPEA 2DO3A 2V8KA 3U23A 5LJ5e 5KYWB 1D1BA 2DTOA 2YLCA 4RTYA 1QVFP 1MNEA 2CKKA 2JW4A 1PKSA 4HKEA 1OU8A 2ATCB 3QDRB 1M2VA 4LDYA 2X9HA 3QG1A 6AT1B 3L2RA 4KGZB 2PNIA 7AT1B 3BFMA 2PQWA 2CP0A 1HJDA 4F7UA 5J26A 2RN8A 3M0QA 1SF9A 3C4SA 2OTJT 1UJYA 3INZA 1V76A 4RTTA 1Q82R 2L89A 3BY7A 3RR6A 3V8JA 4M77E 2COZA 2DL4A 1M4ZA 2R5MA 2LX7A 4PFOA 1YIJQ 2M0OA 2YXYA 3HRTA 3CCUT 2XKOC 1R8OB 3E2UA 2OJ2A 4AFUC 1I0CA 1JJ2P 2LCSA 4J6XA 3VV0A 1M1GA 1I07A 4AT1B 3SFMA 3VKIA 3M57A 5A0GA 2D6FA 2DLPA 4C92A 2DD4A 2LQKA 3D7SB 4JJBA 3LW5E 4ESRA 1N8RC 4ZN3A 2VXEA 1VQ7Q 3X25B 1OYXA 3EGXA 3G71A 4L5GA 1YJ9Q 1NG2A 5GANe 4BE0A 5GMKj 4JS5A 4IUVA 1ZSZA 4TVRA 3DLMA 3CCRQ 4PJLA 2CDTA 3C95A 3EG0A 1JXOA 3CMAT 2JMCA 1WXTA 4L6V5 1KD1U 2MI6A 5CKHA 2LQNA 2L8DA 4OF1A 3EGDB 1Q81C 2PTKA 3FJ5A 1F1BB 1ZQ1A 3EFSA 3CC4A 5FLXE 2A28A 2DYIA 3LGFA 2A7YA 2CP3A 1PD0A 3HHTB 2KE9A 2M51A 1AWWA 2DX1A 1Y07A 4QQDA 1YJNA 1PG5B 3FC3A 3OBYA 2HSPA 1RAEB 2DK3A 4FU6A 2ED1A 1OU9A 1KQSP 3EFOA 2XDBA 2FRWA 3S3NA 4FT2A 2ABLA 2W10A 1Y96A 2FZGB 1YJWT 1NEGA 5L23A 2HQEA 1VYUA 3UDCA 2VC8A 1K76A 2LCLA 1W2BA 3HRSA 4JPBW 4C5GA 4DEXA 4C8QD 1RACB 1GCPA 4KBMB 4HCCA 3RNJA 2VYTA 3L2ZA 4J9CA 2PU9B 2L3QA 3JB9I 3OS0A 1VQKQ 3CCEQ 1OV3A 3VS4A 4FYVB 2VV5A 5A0DA 3DKMA 3EG9A 1D09B 2KRNA 4FYWB 1PRMC 4MZMA 3JCMe 2EQMA 2OTJQ 4J7FA 3J7AF 2KR3A 3MP6A 4JRIA 1NEBA 2WSEE 3OYJA 4J9GA 4R0KA 1QVFS 3A8MB 2LC4A 4WCIA 1M90R 4PJMA 1M1FA 2EVRA 1JB0E 2ENMA 3JSCA 4OMQA 5GAMg 2NUTB 3C94A 4JLIA 2EYWA 4BUGA 2JS0A 1NE8A 1X69A 3QXEB 2GTOA 1Q7YR 3GBQA 1G5VA 1NPPA 1YIJA 4M75E 1WHKA 4OMOA 4BDYA 3DB3A 1JXMA 2L2PA 4M4ZA 2DEQA 1ZLMA 2K2VA 2O31A 2BKDN 3GF5A 1JJ2S 5GANg 1TG0A 2RQUA 3MEVA 2K5IA 2XHCA 3SDZA 3SHWA 5FU6C 3PE0A 1M30A 4EMGA 4FSSA 4A4FA 2JTMA 3OW2P 1AWXA 4M77C 2DBMA 3G6ET 2Y4YA 3BDUA 1NJIU 2C0TA 1VQ7A 4DOVA 1YJ9A 5HCKA 4A4KA 5GMKl 2XD0A 4HA8A 3KXTA 4IUUA 2ZZDA 4FYYB 1PHTA 1BU1A 3CCRA 3UATA 2QDYB 5D6WA 2GBQA 2IG0A 2GF7A 4C8QF 2YSQA 1QVFA 4LN2A 2M1HA 1W6XA 4BE2A 3REBB 3ZEHA 1I8FA 3HP9A 3JCMb 2RH2A 2EGCA 3X28B 3RMQA 2EKOA 4E7LA 4JRQA 3HRUA 1I4K1 4MDXA 3M4YA 4C92E 1D0XA 4FYXB 3OYIA 3UA6A 1G3WA 3SB2A 4BY6C 1LPLA 2E6NA 3RKYA 5DM7R 2R57A 1KC8R 2YRVA 3CCLQ 2BZ8A 5AYFA 1IGUA 2RI2A 2LNHB 1VIFA 2J6OA 1OPLA 3OS2A 5AT1B 4ME7A 4HCZA 5FRMA 2HL3A 5I2MA 1KQSS 2DERA 4C0DB 2QDLA 4HVWA 4FW1A 4LDUA 5KCOA 3JCMg 4J9HA 5CQXA 3VYHB 2I0NA 4M7AD 2HCKA 3GNFB 5J39A 1K9AA 5GAN7 2EWNA 3QSUA 3OYBA 1Q86R 1KQ1A 3CCEA 1VQKA 2SEMA 3QKJA 3G71T 4N4IA 4Y92A 4HT9A 2EFIA 5GMKe 5GAOm 1S72Q 4OMPA 2W0ZA 1UJ0A 2L3PA 2X3XD 4J9EA 3EG1A 4XAXB 3VYGA 1D3BB 1TUGB 5CKFA 1WPYA 2YDLA 2K4YA 5GAMj 4IUQA 1VYVA 3BDLA 4ZTFA 1UTIA 3SEMA 2CH4W 2OI3A 3CC4T 1BYMA 4QQ6A 3V7SA 3CXCA 1YFNA 3AHUA 3EHQA 2KDSA 3L2WA 2DXCA 4MDWA 3I9QA 5I2SA 5GJWB 2CZ1B 4M78D 1YJNT 1M2OA 3KBGA 4HT8A 2RQVA 4D6WA 1H3ZA 2YHTA 1NYGA 4ANJA 4OGCA 1ZHIA 1T3LA 4GLMA 1BK2A 1O75A 4MZPA 3Q1JA 1TH7A 4PNOA 1AT1B 1FX7A 2AKLA 3ULRB 3JCMW 2H3EB 3F70A 2RJCA 4M7DD 1UG1A 3MO8A 3CPWA 3H0FA 3JB9D 4XTYA 1RABB 3NTKA 5DY9A 2ZPBB 1BKBA 3OW2S 4HCBA 2V26A 1K8AR 1B7TA 2D1XA 2HZYA 3OA6A 1M5Q1 4AG1C 4M75C 4AFZC 2JTEA 4R55A 1N8RU 1BI3A 2QYZA 4CC7A 2O4XB 2J06A 4M7AF 2P4TA 4RTVA 2FL7A 4KRTA 2HQHA 3ZL7C 2DMOA 2KY9A 2LJ0A 4QQGA 4EDUA 1RAFB 1ZBJA 2WACA 4J6WA 4JDSA 2DIGA 4J7IA 1VYTA 1WX6A 3S3MA 2F2XA 5LJ5f 2H8HA 3CBMA 1Q81U 1TUCA 2KQWA 3JRZA 3V7RA 4J9BA 2WSCE 2XDDA 2VVKA 1YN8A 4M77B 2X51A 2RI5A 4RCCA 3CCLA 1BBZA 1YIJT 1W2BP 2XMFA 1VQPA 2RHZA 2KNBB 4RMOA 3G71Q 5KYNA 2NLUA 4JUVA 4M78F 4KT0E 4EIKA 4PJOB 3JCMV 5DLOA 4ORZA 3A8HB 4M78B 2C0IA 2LTOA 1K9MR
chains in the Genus database with same CATH topology
2EW3A 4JJBA 2OAWA 4RTZA 1GFDA 2DL7A 2CT4A 4ESRA 2EQIA 5IHNA 4LNPA 2GQIA 1T0HA 2D0NA 4E6RA 1AZGB 1X2KA 2HDAA 2LJ3A 1X2QA 1IO6A 1K4US 1NG2A 1SEMA 2JS2A 3I5RA 4D8KA 1AVZC 1JU5C 1JQQA 2FPFA 2CDTA 3EG0A 1WFWA 1JO8A 1JXOA 1U06A 3EG2A 2JMCA 1WXTA 1NYFA 1QLYA 3PVLA 2A37A 1EFNA 2LQNA 1H8KA 4AFSC 2DNUA 4GBQA 1SSHA 2PTKA 3FJ5A 4HVUA 3IQLA 3A98A 2KXDA 1HD3A 2ROTA 2A28A 2AK5A 2DL3A 2DYBA 2CSQA 4Z89A 2KE9A 3R6NA 2M51A 3QWXX 1YWPA 1AWWA 1AWOA 2DX1A 2EGEA 2KYBA 2LJ1A 3REAB 1UDLA 3JV3A 2X3WD 2FRYA 2HSPA 2LZ6B 1AZEA 4LE9A 2ED1A 2DM1A 4JJDA 2K2MA 2VKNA 1Y0MA 2FG0A 3I35A 1Z9ZA 2RMOA 5I11A 2FRWA 1QWEA 5IXFA 3C0CA 2ABLA 2W10A 1JEGA 1GCQA 2KRSA 2YUQA 1UGVA 1NEGA 5I22A 1WA7A 5L23A 1VYUA 4F16A 2LMJA 1RUWA 2J6FA 5IHIA 1K76A 4JPBW 4DEXA 1GCPA 1XOVA 3RNJA 2L3SA 2KBTA 1U5SA 3VS0A 4J9CA 2L3QA 1OV3A 3VS4A 2ROLA 4HVVA 3NMZC 2GNCA 1AOJA 2KRNA 2DJQA 2GTJA 1PRMC 4CC3A 2ECZA 1OOTA 1G83A 2KR3A 1UECA 2CT3A 1NEBA 1W70A 4JZ3A 5IHKA 3VS3A 4A63B 4J9GA 4R0KA 4CC2A 2DILA 2V1QA 4WCIA 5IH2A 1N5ZA 3TSWA 1U3OA 2EVRA 2EGAA 2RQRA 1I1JA 2ENMA 4OMQA 4Z8AA 2HBWA 3RBBB 1A0NB 2EYWA 3M0PA 1E6GA 3CQTA 1ZUUA 3NGPA 2JXBA 1MV3A 2JS0A 1AD5A 1X69A 1VA7A 2M0YA 4HXJA 2GTOA 3GBQA 4OMOA 1JXMA 2DE0X 2L2PA 4M4ZA 1ZUKA 4D8DA 2AKKA 4RUGA 1ZLMA 4F14A 3VRYA 1PKTA 1PWTA 1YCSB 2O31A 4X1VA 2RQWA 1M3AA 1YWOA 1TG0A 2RQUA 2EKHA 2NUZA 3SHWA 3PE0A 1M30A 2O9SA 2VWFA 2CUDA 4FSSA 2GGRA 3KFVA 3M0RA 3NPFA 4OMNA 2RQTA 1AWXA 2RNAA 2DBMA 2C0TA 3TSZA 4J9DA 2K79A 2J05A 2DVJA 5HCKA 3LH5A 2EPDA 2KT8A 1NM7A 3VS2A 2LQWA 1SHGA 2C0OA 1PHTA 4IIOA 1BU1A 3UATA 2IIMA 1CKAA 1FYNA 1H92A 2K7AA 1B3QA 1X6BA 2GBQA 1M8MA 2DRMA 1X27A 2YSQA 4F17A 4LN2A 1CSKA 2MIOA 1PNJA 1LCKA 2DBKA 1W6XA 4JJCA 1T3SA 3REBB 1KFZA 4J9FA 3QWYA 1YP5A 1GL5A 3VS5A 1QKXA 2J6KA 2HEQA 1MUZA 2EGCA 1ZUYA 2DF6A 2FO0A 5EC7A 1KSWA 2BTTA 2EYYA 2K9GA 1ARKA 1ZSGA 3UA6A 2CUBA 1M3CA 1HSQA 2FEIA 2DRKA 2YUOA 1K0XA 2BZ8A 1E7OA 3VS7A 1WXBA 2LNHB 2RF0A 1BB9A 2J6OA 3EG3A 1OPLA 2MOXA 4RTXA 1YNZA 1RI9A 2CSIA 1UUEA 2EYZA 1CKBA 3VS1A 4ZNXA 2QDLA 3M0SA 4HVWA 4RTUA 4J9HA 1GFCA 1QWFA 2B86A 2I0NA 4LUDA 1OPKA 1W1FA 2HCKA 4JZ4A 1K9AA 4DEYA 1M3BA 2DA9A 4J9IA 4AG2C 1NLOC 2SEMA 3UF4A 3VS6A 3TVTA 4AFQC 2JMAA 3UA7A 4Y92A 1PRLC 1G2BA 1GRIA 1WYXA 1X43A 4HCKA 2KGTA 4OMPA 2W0ZA 1S1NA 1UJ0A 2L3PA 2X3XD 3EG1A 4J9EA 1ABQA 2YDLA 1SRLA 2CH4A 5FW9A 2ED0A 2V1RA 1VYVA 2K3BA 1UTIA 3SEMA 4CC4B 2CH4W 2OI3A 1MV0B 5FWCA 2F2VA 1K0SA 2AZSA 3EHQA 2SRCA 1ZX6A 2JM9A 3I9QA 2AZVA 2RPNA 3O5ZA 5GJWB 1QCFA 2DL5A 2YT6A 4OMLA 2NWMA 2F2WA 2KROA 2KRMA 5FWBA 2RQVA 1B07A 1NYGA 3I5SA 3EGUA 5ECAA 1T3LA 1BK2A 2K6DA 3NHNA 4GLMA 4QT7A 5IXBA 2CREA 1UE9A 1WDXA 3M0UA 3EHRA 1ABOA 1K1ZA 2AKLA 2KT1A 3ULRB 4K11A 1M27C 1AWJA 2LP5A 2D8JA 2A36A 1V1CA 1UG1A 3H0IA 1RLQC 3H0FA 1NLPC 3H0HA 2KXCA 1KJWA 1Y57A 1SRMA 1QKWA 2D1XA 3H41A 1OEBA 1UHCA 3PVQA 2D8HA 4AG1C 4IIMA 2JT4A 4AFZC 2JTEA 1T0JA 2E5KA 2YUPA 1Z9QA 4CC7A 2J06A 4OMMA 2JM8A 2O88A 4RTVA 2FPEA 4KRTA 3U23A 2ESWA 3M0TA 1WI7A 3ZL7C 2DMOA 2O9VA 1RLPC 2LJ0A 1E6HA 2A08A 1GCQC 1ZBJA 4RTYA 2BZXA 2JW4A 1PKSA 2L0AA 2EYXA 1WLPB 1VYTA 1WX6A 2F2XA 2H8HA 2PNIA 3VRZA 1X6GA 1TUCA 1SPKA 1HJDA 2J7IA 1SHFA 2FPDA 2YUNA 2RN8A 1AEYA 3M0QA 4J9BA 1UJYA 2VVKA 2G6FX 2KEAA 1YN8A 4RTTA 4LUEA 2DL4A 1FMKA 1BBZA 1WIEA 5GJVB 1UHFA 2XMFA 3THKA 2LX7A 1GBRA 2DL8A 2KNBB 1KIKA 4RTWA 2MCNA 1J3TA 1TUDA 2P4RA 2OJ2A 4EIKA 4AFUC 1I0CA 2BZYA 2LCSA 4ORZA 1GBQA 2O2OA 2PZ1A 1I07A 2EBPA 2C0IA 2KYMA 4Z88A 2DLPA 1H3HA 1WXUA 1UFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EW3 A;  4JJB A;  2OAW A;  4RTZ A;  1GFD A;  2DL7 A;  2CT4 A;  4ESR A;  2EQI A;  5IHN A;  4LNP A;  2GQI A;  1T0H A;  2D0N A;  4E6R A;  1AZG B;  1X2K A;  2HDA A;  2LJ3 A;  1X2Q A;  1IO6 A;  1K4U S;  1NG2 A;  1SEM A;  2JS2 A;  3I5R A;  4D8K A;  1AVZ C;  1JU5 C;  1JQQ A;  2FPF A;  2CDT A;  3EG0 A;  1WFW A;  1JO8 A;  1JXO A;  1U06 A;  3EG2 A;  2JMC A;  1WXT A;  1NYF A;  1QLY A;  3PVL A;  2A37 A;  1EFN A;  2LQN A;  1H8K A;  4AFS C;  2DNU A;  4GBQ A;  1SSH A;  2PTK A;  3FJ5 A;  4HVU A;  3IQL A;  3A98 A;  2KXD A;  1HD3 A;  2ROT A;  2A28 A;  2AK5 A;  2DL3 A;  2DYB A;  2CSQ A;  4Z89 A;  2KE9 A;  3R6N A;  2M51 A;  3QWX X;  1YWP A;  1AWW A;  1AWO A;  2DX1 A;  2EGE A;  2KYB A;  2LJ1 A;  3REA B;  1UDL A;  3JV3 A;  2X3W D;  2FRY A;  2HSP A;  2LZ6 B;  1AZE A;  4LE9 A;  2ED1 A;  2DM1 A;  4JJD A;  2K2M A;  2VKN A;  1Y0M A;  2FG0 A;  3I35 A;  1Z9Z A;  2RMO A;  5I11 A;  2FRW A;  1QWE A;  5IXF A;  3C0C A;  2ABL A;  2W10 A;  1JEG A;  1GCQ A;  2KRS A;  2YUQ A;  1UGV A;  1NEG A;  5I22 A;  1WA7 A;  5L23 A;  1VYU A;  4F16 A;  2LMJ A;  1RUW A;  2J6F A;  5IHI A;  1K76 A;  4JPB W;  4DEX A;  1GCP A;  1XOV A;  3RNJ A;  2L3S A;  2KBT A;  1U5S A;  3VS0 A;  4J9C A;  2L3Q A;  1OV3 A;  3VS4 A;  2ROL A;  4HVV A;  3NMZ C;  2GNC A;  1AOJ A;  2KRN A;  2DJQ A;  2GTJ A;  1PRM C;  4CC3 A;  2ECZ A;  1OOT A;  1G83 A;  2KR3 A;  1UEC A;  2CT3 A;  1NEB A;  1W70 A;  4JZ3 A;  5IHK A;  3VS3 A;  4A63 B;  4J9G A;  4R0K A;  4CC2 A;  2DIL A;  2V1Q A;  4WCI A;  5IH2 A;  1N5Z A;  3TSW A;  1U3O A;  2EVR A;  2EGA A;  2RQR A;  1I1J A;  2ENM A;  4OMQ A;  4Z8A A;  2HBW A;  3RBB B;  1A0N B;  2EYW A;  3M0P A;  1E6G A;  3CQT A;  1ZUU A;  3NGP A;  2JXB A;  1MV3 A;  2JS0 A;  1AD5 A;  1X69 A;  1VA7 A;  2M0Y A;  4HXJ A;  2GTO A;  3GBQ A;  4OMO A;  1JXM A;  2DE0 X;  2L2P A;  4M4Z A;  1ZUK A;  4D8D A;  2AKK A;  4RUG A;  1ZLM A;  4F14 A;  3VRY A;  1PKT A;  1PWT A;  1YCS B;  2O31 A;  4X1V A;  2RQW A;  1M3A A;  1YWO A;  1TG0 A;  2RQU A;  2EKH A;  2NUZ A;  3SHW A;  3PE0 A;  1M30 A;  2O9S A;  2VWF A;  2CUD A;  4FSS A;  2GGR A;  3KFV A;  3M0R A;  3NPF A;  4OMN A;  2RQT A;  1AWX A;  2RNA A;  2DBM A;  2C0T A;  3TSZ A;  4J9D A;  2K79 A;  2J05 A;  2DVJ A;  5HCK A;  3LH5 A;  2EPD A;  2KT8 A;  1NM7 A;  3VS2 A;  2LQW A;  1SHG A;  2C0O A;  1PHT A;  4IIO A;  1BU1 A;  3UAT A;  2IIM A;  1CKA A;  1FYN A;  1H92 A;  2K7A A;  1B3Q A;  1X6B A;  2GBQ A;  1M8M A;  2DRM A;  1X27 A;  2YSQ A;  4F17 A;  4LN2 A;  1CSK A;  2MIO A;  1PNJ A;  1LCK A;  2DBK A;  1W6X A;  4JJC A;  1T3S A;  3REB B;  1KFZ A;  4J9F A;  3QWY A;  1YP5 A;  1GL5 A;  3VS5 A;  1QKX A;  2J6K A;  2HEQ A;  1MUZ A;  2EGC A;  1ZUY A;  2DF6 A;  2FO0 A;  5EC7 A;  1KSW A;  2BTT A;  2EYY A;  2K9G A;  1ARK A;  1ZSG A;  3UA6 A;  2CUB A;  1M3C A;  1HSQ A;  2FEI A;  2DRK A;  2YUO A;  1K0X A;  2BZ8 A;  1E7O A;  3VS7 A;  1WXB A;  2LNH B;  2RF0 A;  1BB9 A;  2J6O A;  3EG3 A;  1OPL A;  2MOX A;  4RTX A;  1YNZ A;  1RI9 A;  2CSI A;  1UUE A;  2EYZ A;  1CKB A;  3VS1 A;  4ZNX A;  2QDL A;  3M0S A;  4HVW A;  4RTU A;  4J9H A;  1GFC A;  1QWF A;  2B86 A;  2I0N A;  4LUD A;  1OPK A;  1W1F A;  2HCK A;  4JZ4 A;  1K9A A;  4DEY A;  1M3B A;  2DA9 A;  4J9I A;  4AG2 C;  1NLO C;  2SEM A;  3UF4 A;  3VS6 A;  3TVT A;  4AFQ C;  2JMA A;  3UA7 A;  4Y92 A;  1PRL C;  1G2B A;  1GRI A;  1WYX A;  1X43 A;  4HCK A;  2KGT A;  4OMP A;  2W0Z A;  1S1N A;  1UJ0 A;  2L3P A;  2X3X D;  3EG1 A;  4J9E A;  1ABQ A;  2YDL A;  1SRL A;  2CH4 A;  5FW9 A;  2ED0 A;  2V1R A;  1VYV A;  2K3B A;  1UTI A;  3SEM A;  4CC4 B;  2CH4 W;  2OI3 A;  1MV0 B;  5FWC A;  2F2V A;  1K0S A;  2AZS A;  3EHQ A;  2SRC A;  1ZX6 A;  2JM9 A;  3I9Q A;  2AZV A;  2RPN A;  3O5Z A;  5GJW B;  1QCF A;  2DL5 A;  2YT6 A;  4OML A;  2NWM A;  2F2W A;  2KRO A;  2KRM A;  5FWB A;  2RQV A;  1B07 A;  1NYG A;  3I5S A;  3EGU A;  5ECA A;  1T3L A;  1BK2 A;  2K6D A;  3NHN A;  4GLM A;  4QT7 A;  5IXB A;  2CRE A;  1UE9 A;  1WDX A;  3M0U A;  3EHR A;  1ABO A;  1K1Z A;  2AKL A;  2KT1 A;  3ULR B;  4K11 A;  1M27 C;  1AWJ A;  2LP5 A;  2D8J A;  2A36 A;  1V1C A;  1UG1 A;  3H0I A;  1RLQ C;  3H0F A;  1NLP C;  3H0H A;  2KXC A;  1KJW A;  1Y57 A;  1SRM A;  1QKW A;  2D1X A;  3H41 A;  1OEB A;  1UHC A;  3PVQ A;  2D8H A;  4AG1 C;  4IIM A;  2JT4 A;  4AFZ C;  2JTE A;  1T0J A;  2E5K A;  2YUP A;  1Z9Q A;  4CC7 A;  2J06 A;  4OMM A;  2JM8 A;  2O88 A;  4RTV A;  2FPE A;  4KRT A;  3U23 A;  2ESW A;  3M0T A;  1WI7 A;  3ZL7 C;  2DMO A;  2O9V A;  1RLP C;  2LJ0 A;  1E6H A;  2A08 A;  1GCQ C;  1ZBJ A;  4RTY A;  2BZX A;  2JW4 A;  1PKS A;  2L0A A;  2EYX A;  1WLP B;  1VYT A;  1WX6 A;  2F2X A;  2H8H A;  2PNI A;  3VRZ A;  1X6G A;  1TUC A;  1SPK A;  1HJD A;  2J7I A;  1SHF A;  2FPD A;  2YUN A;  2RN8 A;  1AEY A;  3M0Q A;  4J9B A;  1UJY A;  2VVK A;  2G6F X;  2KEA A;  1YN8 A;  4RTT A;  4LUE A;  2DL4 A;  1FMK A;  1BBZ A;  1WIE A;  5GJV B;  1UHF A;  2XMF A;  3THK A;  2LX7 A;  1GBR A;  2DL8 A;  2KNB B;  1KIK A;  4RTW A;  2MCN A;  1J3T A;  1TUD A;  2P4R A;  2OJ2 A;  4EIK A;  4AFU C;  1I0C A;  2BZY A;  2LCS A;  4ORZ A;  1GBQ A;  2O2O A;  2PZ1 A;  1I07 A;  2EBP A;  2C0I A;  2KYM A;  4Z88 A;  2DLP A;  1H3H A;  1WXU A;  1UFF A; 
#chains in the Genus database with same CATH topology
 2EW3 A;  2OAW A;  2DL7 A;  2CT4 A;  3RUX A;  1VQ7 T;  5EG2 A;  4E6R A;  1R0B G;  1YJ9 T;  1AZG B;  1JBM A;  1OX8 A;  3WVD B;  1S72 A;  2K5F A;  2JS2 A;  4M7D F;  4XU2 A;  3CCR T;  4OVA A;  3JB9 F;  1ZSZ C;  1AVZ C;  5CAI A;  4M7D B;  4DBQ A;  3JB9 J;  1WJR A;  1XTD A;  3E9F A;  1QLY A;  2DPP B;  1Q82 C;  2A37 A;  1EFN A;  2KMT A;  1M1K R;  1IRX A;  1OQK A;  2E70 A;  4J83 A;  1FMW A;  2M02 A;  1YIT Q;  4FW2 A;  4B6M A;  3RES A;  1HD3 A;  2E3H A;  2GQV A;  1QVP A;  2DL3 A;  2QAZ A;  3X20 B;  5KYY B;  4YTL A;  2KYB A;  1YHQ A;  3JV3 A;  2X3W D;  3JAM E;  5D6Y A;  1VQ6 Q;  3ZBD A;  2VKN A;  2FG0 A;  3JCM P;  1Z9Z A;  2PVG B;  2RMO A;  3BW1 A;  2XU8 A;  1ZA1 B;  3C0C A;  1TOV A;  1JEG A;  4DBF A;  2YUQ A;  1UGV A;  5GAN 2;  2HQX A;  4XU1 A;  1LVK A;  2LMJ A;  1IHW A;  1VQK T;  3CCE T;  2EYQ A;  5FRO A;  3A1P A;  2KBT A;  2JNG A;  4BAC A;  2ROL A;  4HVV A;  3TQ7 P;  4M7A E;  1WJQ A;  2GNC A;  2DKG A;  2DJQ A;  2GTJ A;  3OYF A;  2ECZ A;  4EMK B;  2P0P A;  2AT1 B;  1W70 A;  5GAM e;  4A63 B;  4RG2 A;  4CC2 A;  2V1Q A;  1N5Z A;  1U3O A;  3CCS A;  2RQR A;  3A8O B;  4A4G A;  1I1J A;  2COW A;  1WQW A;  3RBB B;  2BIV A;  3MET A;  2ZCF B;  4BDZ A;  4NL2 A;  5GAN 4;  3FEO A;  1E6G A;  2Y90 A;  4C0G A;  3LWI A;  2X4J A;  3NGP A;  1MV3 A;  4C8Q C;  1QVG A;  2RHX A;  1VA7 A;  1U1T A;  3L2Q A;  1B34 B;  4M75 B;  5KYX B;  1BIB A;  1W2B S;  3E1S A;  2DE0 X;  2QXF A;  2X4X A;  3JCM Q;  4Y91 A;  4RUG A;  2QGG A;  4X1V A;  1M3A A;  1VQ8 Q;  5KYU A;  2VGN A;  4VUB A;  3X26 B;  1BIA A;  3OBW A;  5FU7 C;  2FYK A;  4OMN A;  3MEW A;  4X9D A;  5HY6 A;  1M2V B;  4E47 A;  3CD6 A;  2HNI A;  2K79 A;  1M90 C;  2E10 A;  3RIR A;  4F7U B;  2EPD A;  1M8V A;  3CXC P;  2LQW A;  2IIM A;  2G3R A;  3PMT A;  1H92 A;  1X6B A;  3JB9 H;  3OYE A;  2DET A;  2LX9 A;  1LNX A;  4Q5W A;  4KH1 B;  5CK9 A;  4XTU A;  2MWP A;  4PFP A;  4NOY A;  4XQ3 A;  4DQ2 A;  2EJ9 A;  1VQL A;  3M55 A;  2MIO A;  1Q7Y C;  4N0A A;  1YIT A;  1T3S A;  3M5A A;  4C8Q G;  4PK4 A;  5GAN 8;  4E7Z A;  2X4Y A;  2JN0 A;  1GL5 A;  1C1A A;  2J6K A;  2BE7 D;  1HYO A;  2DF6 A;  5D7U A;  2FO0 A;  1WJS A;  5EC7 A;  2L3R A;  2K9G A;  1DJ7 B;  4C92 B;  4PFZ A;  3QHS A;  3CEY A;  1ZSG A;  2GFA A;  4EPC A;  2EJF A;  3CPW P;  3CCL T;  1C6V X;  1VQ6 A;  2RJE A;  1HSQ A;  2FEI A;  1VQP T;  2YUO A;  4WTO B;  4QW2 A;  2DZC A;  2BE9 B;  3EGX B;  1BB9 A;  3EG3 A;  1EZZ B;  2MOX A;  4QKU A;  4RTX A;  1ZSZ B;  1UUE A;  2KK4 A;  2EYZ A;  3PNW C;  1MND A;  2K3X A;  4V2S A;  4ZNX A;  4ELZ C;  1TTH B;  4RTU A;  4IUR A;  3SWN C;  1GFC A;  4GLK A;  3ZFJ A;  1QWF A;  2QQR A;  4LUD A;  3PIO A;  4JZ4 A;  1FXX A;  2QQ9 A;  5GAO q;  2QA4 Q;  4P5N A;  4J9I A;  4AG2 C;  2H3J A;  2QI2 A;  1S72 T;  5KE2 A;  4EMH A;  1IXD A;  3ASK A;  1G2B A;  3RMS A;  4HCK A;  2KGT A;  4C8Q A;  1ABQ A;  3TEE A;  1SRL A;  2CH4 A;  1Q95 G;  3HL8 A;  2ED0 A;  2M9U A;  2DXT A;  2V1R A;  3VU3 C;  2K57 A;  2X4W A;  1KC8 C;  4PLL A;  2K3B A;  4X34 A;  2ZGW A;  1WHM A;  2RHI A;  3CC7 Q;  1GXI E;  3EH2 A;  4M7A C;  1Y96 B;  5CR2 A;  1IHV A;  2Z0W A;  2RPN A;  1YBY A;  1JRI A;  1OZ3 A;  2DL5 A;  2YT6 A;  4OML A;  2NWM A;  2E6Z A;  1YHQ T;  1K73 R;  4XK8 E;  2CP2 A;  1B07 A;  2F1L A;  3I5S A;  1BCO A;  3GNG A;  3I55 A;  1Q86 C;  3OYY A;  4QT7 A;  2K6D A;  2RJD A;  1N6A A;  1WDX A;  1VQ8 A;  3S3O A;  3EG9 B;  3EHR A;  5LJ3 h;  3OB9 A;  1M27 C;  1VQ4 Q;  2LP5 A;  2D8J A;  1V1C A;  1IZ6 A;  1PSF A;  2YLB A;  3DLL A;  3MHX A;  3J80 E;  1XQH A;  5IAY A;  1ZBX A;  3H41 A;  3OYC A;  3GLX A;  4DBH A;  4IIM A;  2CGH A;  1YCY A;  4FSX A;  1T0J A;  2E5K A;  2LRQ A;  4UC4 A;  3CXC S;  4JJN K;  1TU0 B;  1VQN Q;  2O88 A;  3MP1 A;  4OB0 B;  1BI1 A;  1QCO A;  2B8A A;  4LD9 K;  5A2Q E;  2ZPF B;  3M0T A;  9ATC B;  3TCJ A;  2O9V A;  4M7A G;  1E6H A;  2A08 A;  1VQP Q;  2MK5 A;  1GCQ C;  4DOW A;  3CCS T;  2EYX A;  1Q82 U;  2E41 A;  5LJ5 h;  2KI7 A;  3VRZ A;  3SWN A;  4KUI A;  2VGM A;  1SPK A;  3HFN A;  1N9R A;  2J7I A;  1SHF A;  2FPD A;  2RO0 A;  1AEY A;  1HK9 A;  5GAO n;  4KUL A;  2XK0 A;  3CME Q;  2KEA A;  2QQS A;  3FIF A;  5I21 A;  3A5Z B;  4LUE A;  3CPW S;  4MZT A;  1WIE A;  5GJV B;  1M9S A;  4KUD K;  1X75 C;  1K8A C;  2DL8 A;  1KIK A;  4RTW A;  2MCN A;  2LVM A;  2HBP A;  4II1 A;  1TUD A;  3M56 A;  2P4R A;  3HFO A;  4C0F A;  2L5Q A;  2PZ1 A;  4M77 D;  1X01 A;  2OAU A;  2EBP A;  2LDM A;  3LLR A;  1XNI A;  2KYM A;  3OYH A;  4XTX A;  1UFF A;  1QP3 A;  2QA4 A;  2GCX A;  5LJ3 d;  2DXU A;  5IHN A;  4LNP A;  3CD6 T;  1WZO A;  1T0H A;  1O9S A;  2NUP A;  1D0Z A;  2HDA A;  2V8J A;  2ZAE A;  4PJO D;  4M7A A;  1RI0 A;  2RHU A;  3AT1 B;  1SKU B;  1SEM A;  1D0Y A;  3I5R A;  4D8K A;  1PM3 A;  1BI2 A;  1RAG B;  4OP0 A;  4A53 A;  5KCH A;  4B9X A;  1YHQ Q;  1I5L A;  1QVG P;  5GAN h;  1NYF A;  2QG9 B;  2Y4X A;  1VQL T;  3PVL A;  4GY5 A;  3P8B B;  2DTI A;  3UPU A;  2OTL Q;  1H8K A;  3CC7 A;  1YIT T;  4XTW A;  2E5Q A;  1D1A A;  4OB1 B;  2DNU A;  4GBQ A;  5LJ3 f;  3QBY A;  2XIC A;  4PL6 A;  4NL3 A;  4HVU A;  3CCM A;  3IQL A;  3RDV A;  2XDP A;  2ROT A;  1MHN A;  1KD1 R;  3HSB A;  5C0M A;  5LJ5 d;  4Z89 A;  3FDR A;  1AWO A;  2LJ1 A;  2EGE A;  2ZPH B;  1K9M C;  1UDL A;  1VQ6 T;  4Z02 A;  3S6W A;  1VQ5 Q;  2FRY A;  2X35 A;  3J81 E;  4M78 A;  2LZ6 B;  1AZE A;  4C5E A;  2E1H A;  1KK7 A;  2DM1 A;  4JJD A;  2K2M A;  3LWH A;  4FT4 A;  1Y0M A;  1ZA2 B;  2JUF A;  4C8Q E;  4KGX B;  1VQ4 A;  2FZK B;  2CP6 A;  1N9S A;  5I11 A;  3VJP A;  2K5L A;  2R5A A;  3R6O A;  4R56 A;  1GCQ A;  2KRS A;  1QQJ A;  2I2L A;  3EH1 A;  1TWB A;  2FB7 A;  4F16 A;  2J6F A;  5GAM d;  1PSE A;  1M1K C;  3CCS Q;  4M7D A;  2XID A;  1XOV A;  1U5S A;  3L42 A;  5FU6 B;  3VS0 A;  5GMK m;  1C0M A;  4M77 F;  3OYG A;  2AIR B;  1VQN A;  5GAN 3;  2HKN A;  3CCV Q;  3NMZ C;  5GAN 5;  2QQB A;  1M90 U;  1W4S A;  1RAD B;  2EJG A;  4CC3 A;  3CCJ Q;  1G83 A;  5HK3 A;  2CT3 A;  3OMC A;  3QDF A;  2LT4 A;  4JZ3 A;  4PJO F;  3JCM h;  1EIF A;  1WQ7 A;  3VS3 A;  4FIB A;  4NS5 A;  2DIL A;  5IH2 A;  2LQ8 A;  3OS1 A;  5GAN d;  4Z8A A;  1Q7Y U;  2HBW A;  5GAM f;  1U8R A;  1A0N B;  3L2U A;  4PKC C;  4LD6 A;  2CS7 A;  3CME A;  1ZUU A;  1AD5 A;  4HXJ A;  5KYW A;  4BI8 B;  4FL6 A;  3CD6 Q;  3I55 T;  4N4G A;  2DD5 A;  1ZUK A;  1VQ8 T;  1OX9 A;  2VB6 A;  4BY6 B;  3OYK A;  3VRY A;  1PWT A;  1YCS B;  2DAQ A;  4XTV A;  2RQW A;  1YWO A;  5CVI A;  1KHC A;  8AT1 B;  2DEU A;  4N4H A;  1TS9 A;  5GAN f;  4M75 D;  2VWF A;  1VQ9 A;  1OI1 A;  2HAX A;  1QCN A;  3M0R A;  2K3Y A;  1VQL Q;  3VUB A;  3NPF A;  2RQT A;  4QVC A;  2RNA A;  4DBR A;  4EMK A;  3TSZ A;  2QEX Q;  4J8O A;  4J9D A;  2J05 A;  3X24 B;  2DVJ A;  1YI2 Q;  3LH5 A;  3SD4 A;  2KT8 A;  1NM7 A;  1VQM Q;  1SHG A;  2C0O A;  2EQJ A;  2MMP A;  1CKA A;  1FYN A;  2K7A A;  3OSS C;  5IT9 E;  3PT9 A;  1NJI R;  1I81 A;  1M8M A;  2E12 A;  1X27 A;  1QVG S;  2OTL A;  5GAO r;  4A54 A;  1CSK A;  3VUZ A;  1PNJ A;  4QVZ A;  4N0A C;  4J6Y A;  2YRD A;  1KFZ A;  4J9F A;  3QWY A;  4IUT A;  5LL6 S;  1B34 A;  4FCY A;  1QKX A;  1KC8 U;  4LXC A;  3JCM d;  1PD1 A;  2XG8 D;  2PVO B;  1KSW A;  2BTT A;  4ELY C;  1ARK A;  2KSS A;  1VQ5 A;  2CUB A;  3ME9 A;  1MMD A;  4J5Y A;  3QJY A;  4E2F B;  3MPU B;  1E7O A;  4BE1 A;  1WXB A;  2RF0 A;  2EIF A;  3EGD A;  1YNZ A;  1RI9 A;  4OGE A;  2CSI A;  3TRE A;  4C92 D;  1VQO Q;  1Q86 U;  4KGV B;  1QMC A;  3KUF A;  3M0S A;  4ATO A;  1BI0 A;  3GPL A;  1LOJ A;  2QA4 T;  3JCM f;  2B86 A;  2HD0 A;  1OPK A;  2HSE B;  2RB6 A;  2DA9 A;  4Y28 E;  1NLO C;  2HL5 C;  3CCV A;  4E7K A;  2VAS A;  3MKD A;  1GRI A;  1WYX A;  3CCJ A;  4M75 F;  1S1N A;  3MP8 A;  4LDV A;  4PJO E;  5GMK h;  4BB7 A;  5FW9 A;  4WF2 A;  4BI3 A;  3GIB A;  4XTZ A;  4C5H A;  3I55 Q;  3CC7 T;  4M78 E;  4C0Z A;  1U1S A;  4CC4 B;  2XI9 A;  1MGQ A;  3CCM T;  5FWC A;  2F2V A;  3OYL A;  2AZS A;  2JVV A;  2SRC A;  4JRK A;  3WVE B;  3MEU A;  3A8G B;  1BCM A;  2AZV A;  3L2V A;  3G4S Q;  1QCF A;  2QQA A;  4F7U F;  2F2W A;  2KRO A;  4DA4 A;  2KRM A;  3OYA A;  2WSF E;  5FWB A;  4C0D C;  1WGS A;  5CKE A;  3H6Z A;  5CIU A;  4M7D E;  2RD1 A;  5ECA A;  3OYM A;  2MWO A;  2GFU A;  4PJJ A;  3NHN A;  1NPR A;  3OS5 A;  4ZN1 A;  2CRE A;  1Y71 A;  3CBP A;  5LJ3 g;  1K8A U;  1VQ4 T;  2CZ7 B;  1ABO A;  2QTX A;  3QUI A;  2P84 A;  1NZ9 A;  2NUT A;  1RAI B;  2KT1 A;  4K11 A;  2JTF A;  1IB8 A;  4O5V A;  3H0I A;  3L1A A;  1NLP C;  8ATC B;  2EAY A;  2QEX A;  1KJW A;  1SRM A;  1QKW A;  1YI2 A;  4C92 F;  1OEB A;  1UHC A;  3PVQ A;  3V7C A;  2QTV A;  2YRC A;  4X9C A;  3I56 Q;  2YUP A;  1VQM A;  1VQN T;  5C6S A;  3FJP A;  2BUD A;  5GAO l;  2ZPI B;  3CCQ Q;  3CC2 Q;  4E7I A;  5CKB A;  2ESW A;  4XU0 A;  1WI7 A;  2JJ9 A;  1K73 C;  1XJW B;  1N8R R;  1FWZ A;  1RLP C;  1N27 A;  5GAN 6;  2BZX A;  2L0A A;  5LJ5 g;  1WLP B;  2E3I A;  4ZGD B;  1X6G A;  5KYU B;  2RA2 A;  3OY9 A;  2YUN A;  3CME T;  3H9N A;  2P0K A;  2LCC A;  5CO7 A;  4OB2 B;  5KE3 A;  1D1C A;  2G6F X;  2ZPE B;  1FMK A;  2JOY A;  2MF2 A;  5CCA A;  3ER0 A;  1Q81 R;  1UHF A;  1R0C B;  3THK A;  1K9M U;  1GBR A;  3CPF A;  5DLQ E;  1VQO A;  4RKU E;  4CRI A;  1J3T A;  3CCU Q;  1R77 A;  1FMV A;  4A4H A;  2IPO B;  3E9G A;  2BZY A;  3PFS A;  3JCM c;  1GBQ A;  2O2O A;  3H8Z A;  2LNV A;  2IVW A;  1NBE B;  1IGQ A;  3OYD A;  1UGS B;  3PGG A;  4Z88 A;  1VQ9 T;  1H3H A;  1WXU A;  4RTZ A;  1GFD A;  2EQI A;  3EFO B;  3JCM X;  2GQI A;  3P8H A;  2D0N A;  5L8R E;  2LT1 A;  1UGQ B;  1X2K A;  2LJ3 A;  1X2Q A;  1IO6 A;  3CCM Q;  1K4U S;  2QK0 A;  3M53 A;  1M1K U;  2DIQ A;  3FB9 A;  1KQ2 A;  1JU5 C;  1JQQ A;  2FPF A;  2D9T A;  1WFW A;  1JO8 A;  1U06 A;  3EG2 A;  2OTL T;  1QW1 A;  2E64 A;  5HKC A;  4CI0 C;  4LDX A;  2VUB A;  3CMA Q;  2RHY A;  3M9Q A;  3NTI A;  4F04 B;  4AFS C;  2RM4 A;  5M9O A;  2OX7 A;  2MAM A;  1SSH A;  3RER A;  5GAO p;  2VXF A;  2PVD B;  3A98 A;  3G4S A;  2KXD A;  2P0Q A;  2D0Q B;  1ACM B;  1V29 B;  2PUK B;  2AK5 A;  2DYB A;  2CSQ A;  4F7U E;  3R6N A;  3QWX X;  1YWP A;  1UEB A;  5J3B A;  2RI3 A;  2RK2 A;  1VQ5 T;  1D3B A;  3REA B;  1TSF A;  2E4H A;  4IKF A;  4PJO C;  2A0F B;  5D6X A;  2KVQ G;  3PTA A;  2MYS A;  5LJ3 j;  3M59 A;  4M78 C;  4LE9 A;  3LYI A;  4C8Q B;  3I35 A;  3QPH A;  1QWE A;  1AHJ B;  5IXF A;  3UT1 A;  4A4E A;  2CYZ B;  3QII A;  1WA7 A;  5I22 A;  4JS4 A;  3GP8 A;  1YJW Q;  1RUW A;  5IHI A;  3I56 A;  3DB4 A;  1Y7X A;  3URG A;  4M7D C;  2L3S A;  1PC0 A;  2EQK A;  3CCV T;  3HKS A;  5HK0 A;  3CCJ T;  5FU7 B;  3CCQ A;  3CC2 A;  1MMG A;  3UWN A;  1JJ2 A;  1AOJ A;  2F5K A;  1KD1 C;  2DTH A;  4ZTJ A;  1OOT A;  4M77 G;  1VIE A;  2FVU A;  1KHI A;  1UEC A;  5LJ5 j;  1G8X A;  5CKD A;  4PJN A;  5IHK A;  3JCM J;  1WNL A;  3T9N A;  1MMN A;  3TSW A;  2EGA A;  4E7H A;  4PJO G;  4LDW A;  5GAM h;  5GMK i;  5KH6 A;  4M78 G;  4MML A;  3M0P A;  3CQT A;  2O4X A;  2JXB A;  1VQ9 Q;  4ZGJ B;  2OTJ A;  2AHJ B;  2M0Y A;  2DJZ A;  4KH0 B;  3CCU A;  2F69 A;  1OZ2 A;  4D8D A;  2AKK A;  2M16 A;  4F14 A;  2A3L A;  2ZPG B;  4JRP A;  1PKT A;  4M7D G;  2CZ0 B;  2EKH A;  2NUZ A;  2RJF A;  3JB9 G;  2O9S A;  2CUD A;  2GGR A;  3KFV A;  2QEX T;  4M77 A;  3MJX A;  2RK1 A;  2YWW A;  1YI2 T;  1SSF A;  3E19 A;  4EMK C;  3M4G A;  3G6E Q;  3SWN B;  2C06 A;  1VQM T;  2FZC B;  3QJ6 A;  3VS2 A;  5GAN j;  2NYS A;  1KQS A;  4IIO A;  1WHH A;  4JLG A;  1B3Q A;  4PJO A;  2DRM A;  4O6J A;  4F17 A;  3QZ5 B;  3CMA A;  1OUL A;  1RAA B;  4FM4 B;  1PCX A;  1LCK A;  2F5T X;  2DBK A;  3PMI A;  4JJC A;  3O8V A;  1VUB A;  3OYN A;  1RAH B;  4IUP A;  1YP5 A;  1HXD A;  3VS5 A;  3N5B B;  2HEQ A;  1MUZ A;  1WHJ A;  1EX4 A;  1ZUY A;  2EYY A;  3RKX A;  3GOX A;  1UB4 A;  1SG5 A;  4ZGE B;  4BD3 A;  1M3C A;  4OB3 B;  2MPX C;  2NUP B;  2DRK A;  2CP5 A;  1K0X A;  4M7A B;  3QYH B;  5CQY A;  3VS7 A;  2COY A;  4RCB A;  1VQO T;  3M54 A;  4OMF B;  3HPW A;  4L59 A;  4XU3 A;  3M58 A;  1CKB A;  5IN1 A;  3FLG A;  1H64 1;  1VOM A;  3VS1 A;  4BI4 A;  2JZ2 A;  3LX7 A;  1NJI C;  2R58 A;  1YJW A;  5KYY A;  1W1F A;  2QAS A;  4DEY A;  4PLI A;  3QO3 A;  1M3B A;  2V8I A;  2EQU A;  1KG1 A;  4AMC A;  3UF4 A;  3VS6 A;  1G3S A;  3TVT A;  4AFQ C;  1UGR B;  2JMA A;  3UA7 A;  4MMK A;  2DVE A;  1PRL C;  1X43 A;  1RL2 A;  1WHG A;  2O01 E;  3RKW A;  3EFR A;  3G1J A;  1MMA A;  2KAF A;  3CBO A;  3EAE A;  4M75 G;  1G3Y A;  4E7J A;  3OW2 A;  5A0L A;  4C92 C;  1K73 U;  2CZ6 B;  4B9W A;  2DZ9 A;  1MV0 B;  1UGP B;  4E7S A;  1K0S A;  3G4S T;  1ZX6 A;  2JM9 A;  1X6O A;  3BE3 A;  3CC4 Q;  3OSV A;  3O5Z A;  1G3T A;  5FRN A;  1QP2 A;  2HKQ B;  3V8L A;  3NFC A;  4C5I A;  2PUO B;  3LGL A;  5LJ3 e;  3FRN A;  1YJN Q;  1I5O B;  3EGU A;  3PIP A;  3V8K A;  3WXM B;  4F7U G;  2CP7 A;  5IXB A;  4RG8 A;  1UE9 A;  1P92 A;  3HTR A;  3M0U A;  2HMA A;  3LH0 A;  3QYG B;  2DXB A;  3TU4 K;  2FHD A;  1K1Z A;  2QGF B;  1AWJ A;  2A36 A;  2DFU A;  3MEA A;  1LJO A;  1RLQ C;  3OMG A;  1TXQ A;  1WHL A;  3H0H A;  2KXC A;  3P8D A;  3I56 T;  3G6E A;  1Y57 A;  4QVD A;  3QZ9 B;  4M75 A;  2D8H A;  5KYX A;  2JT4 A;  3A8L B;  1IRE B;  3OQ5 A;  2E65 A;  3NTH A;  1Z9Q A;  3MCA B;  3C12 A;  3CCQ T;  3CC2 T;  4C92 G;  4OMM A;  2JM8 A;  3G7Z A;  2FPE A;  2DO3 A;  2V8K A;  3U23 A;  5LJ5 e;  5KYW B;  1D1B A;  2DTO A;  2YLC A;  4RTY A;  1QVF P;  1MNE A;  2CKK A;  2JW4 A;  1PKS A;  4HKE A;  1OU8 A;  2ATC B;  3QDR B;  1M2V A;  4LDY A;  2X9H A;  3QG1 A;  6AT1 B;  3L2R A;  4KGZ B;  2PNI A;  7AT1 B;  3BFM A;  2PQW A;  2CP0 A;  1HJD A;  4F7U A;  5J26 A;  2RN8 A;  3M0Q A;  1SF9 A;  3C4S A;  2OTJ T;  1UJY A;  3INZ A;  1V76 A;  4RTT A;  1Q82 R;  2L89 A;  3BY7 A;  3RR6 A;  3V8J A;  4M77 E;  2COZ A;  2DL4 A;  1M4Z A;  2R5M A;  2LX7 A;  4PFO A;  1YIJ Q;  2M0O A;  2YXY A;  3HRT A;  3CCU T;  2XKO C;  1R8O B;  3E2U A;  2OJ2 A;  4AFU C;  1I0C A;  1JJ2 P;  2LCS A;  4J6X A;  3VV0 A;  1M1G A;  1I07 A;  4AT1 B;  3SFM A;  3VKI A;  3M57 A;  5A0G A;  2D6F A;  2DLP A;  4C92 A;  2DD4 A;  2LQK A;  3D7S B;  4JJB A;  3LW5 E;  4ESR A;  1N8R C;  4ZN3 A;  2VXE A;  1VQ7 Q;  3X25 B;  1OYX A;  3EGX A;  3G71 A;  4L5G A;  1YJ9 Q;  1NG2 A;  5GAN e;  4BE0 A;  5GMK j;  4JS5 A;  4IUV A;  1ZSZ A;  4TVR A;  3DLM A;  3CCR Q;  4PJL A;  2CDT A;  3C95 A;  3EG0 A;  1JXO A;  3CMA T;  2JMC A;  1WXT A;  4L6V 5;  1KD1 U;  2MI6 A;  5CKH A;  2LQN A;  2L8D A;  4OF1 A;  3EGD B;  1Q81 C;  2PTK A;  3FJ5 A;  1F1B B;  1ZQ1 A;  3EFS A;  3CC4 A;  5FLX E;  2A28 A;  2DYI A;  3LGF A;  2A7Y A;  2CP3 A;  1PD0 A;  3HHT B;  2KE9 A;  2M51 A;  1AWW A;  2DX1 A;  1Y07 A;  4QQD A;  1YJN A;  1PG5 B;  3FC3 A;  3OBY A;  2HSP A;  1RAE B;  2DK3 A;  4FU6 A;  2ED1 A;  1OU9 A;  1KQS P;  3EFO A;  2XDB A;  2FRW A;  3S3N A;  4FT2 A;  2ABL A;  2W10 A;  1Y96 A;  2FZG B;  1YJW T;  1NEG A;  5L23 A;  2HQE A;  1VYU A;  3UDC A;  2VC8 A;  1K76 A;  2LCL A;  1W2B A;  3HRS A;  4JPB W;  4C5G A;  4DEX A;  4C8Q D;  1RAC B;  1GCP A;  4KBM B;  4HCC A;  3RNJ A;  2VYT A;  3L2Z A;  4J9C A;  2PU9 B;  2L3Q A;  3JB9 I;  3OS0 A;  1VQK Q;  3CCE Q;  1OV3 A;  3VS4 A;  4FYV B;  2VV5 A;  5A0D A;  3DKM A;  3EG9 A;  1D09 B;  2KRN A;  4FYW B;  1PRM C;  4MZM A;  3JCM e;  2EQM A;  2OTJ Q;  4J7F A;  3J7A F;  2KR3 A;  3MP6 A;  4JRI A;  1NEB A;  2WSE E;  3OYJ A;  4J9G A;  4R0K A;  1QVF S;  3A8M B;  2LC4 A;  4WCI A;  1M90 R;  4PJM A;  1M1F A;  2EVR A;  1JB0 E;  2ENM A;  3JSC A;  4OMQ A;  5GAM g;  2NUT B;  3C94 A;  4JLI A;  2EYW A;  4BUG A;  2JS0 A;  1NE8 A;  1X69 A;  3QXE B;  2GTO A;  1Q7Y R;  3GBQ A;  1G5V A;  1NPP A;  1YIJ A;  4M75 E;  1WHK A;  4OMO A;  4BDY A;  3DB3 A;  1JXM A;  2L2P A;  4M4Z A;  2DEQ A;  1ZLM A;  2K2V A;  2O31 A;  2BKD N;  3GF5 A;  1JJ2 S;  5GAN g;  1TG0 A;  2RQU A;  3MEV A;  2K5I A;  2XHC A;  3SDZ A;  3SHW A;  5FU6 C;  3PE0 A;  1M30 A;  4EMG A;  4FSS A;  4A4F A;  2JTM A;  3OW2 P;  1AWX A;  4M77 C;  2DBM A;  3G6E T;  2Y4Y A;  3BDU A;  1NJI U;  2C0T A;  1VQ7 A;  4DOV A;  1YJ9 A;  5HCK A;  4A4K A;  5GMK l;  2XD0 A;  4HA8 A;  3KXT A;  4IUU A;  2ZZD A;  4FYY B;  1PHT A;  1BU1 A;  3CCR A;  3UAT A;  2QDY B;  5D6W A;  2GBQ A;  2IG0 A;  2GF7 A;  4C8Q F;  2YSQ A;  1QVF A;  4LN2 A;  2M1H A;  1W6X A;  4BE2 A;  3REB B;  3ZEH A;  1I8F A;  3HP9 A;  3JCM b;  2RH2 A;  2EGC A;  3X28 B;  3RMQ A;  2EKO A;  4E7L A;  4JRQ A;  3HRU A;  1I4K 1;  4MDX A;  3M4Y A;  4C92 E;  1D0X A;  4FYX B;  3OYI A;  3UA6 A;  1G3W A;  3SB2 A;  4BY6 C;  1LPL A;  2E6N A;  3RKY A;  5DM7 R;  2R57 A;  1KC8 R;  2YRV A;  3CCL Q;  2BZ8 A;  5AYF A;  1IGU A;  2RI2 A;  2LNH B;  1VIF A;  2J6O A;  1OPL A;  3OS2 A;  5AT1 B;  4ME7 A;  4HCZ A;  5FRM A;  2HL3 A;  5I2M A;  1KQS S;  2DER A;  4C0D B;  2QDL A;  4HVW A;  4FW1 A;  4LDU A;  5KCO A;  3JCM g;  4J9H A;  5CQX A;  3VYH B;  2I0N A;  4M7A D;  2HCK A;  3GNF B;  5J39 A;  1K9A A;  5GAN 7;  2EWN A;  3QSU A;  3OYB A;  1Q86 R;  1KQ1 A;  3CCE A;  1VQK A;  2SEM A;  3QKJ A;  3G71 T;  4N4I A;  4Y92 A;  4HT9 A;  2EFI A;  5GMK e;  5GAO m;  1S72 Q;  4OMP A;  2W0Z A;  1UJ0 A;  2L3P A;  2X3X D;  4J9E A;  3EG1 A;  4XAX B;  3VYG A;  1D3B B;  1TUG B;  5CKF A;  1WPY A;  2YDL A;  2K4Y A;  5GAM j;  4IUQ A;  1VYV A;  3BDL A;  4ZTF A;  1UTI A;  3SEM A;  2CH4 W;  2OI3 A;  3CC4 T;  1BYM A;  4QQ6 A;  3V7S A;  3CXC A;  1YFN A;  3AHU A;  3EHQ A;  2KDS A;  3L2W A;  2DXC A;  4MDW A;  3I9Q A;  5I2S A;  5GJW B;  2CZ1 B;  4M78 D;  1YJN T;  1M2O A;  3KBG A;  4HT8 A;  2RQV A;  4D6W A;  1H3Z A;  2YHT A;  1NYG A;  4ANJ A;  4OGC A;  1ZHI A;  1T3L A;  4GLM A;  1BK2 A;  1O75 A;  4MZP A;  3Q1J A;  1TH7 A;  4PNO A;  1AT1 B;  1FX7 A;  2AKL A;  3ULR B;  3JCM W;  2H3E B;  3F70 A;  2RJC A;  4M7D D;  1UG1 A;  3MO8 A;  3CPW A;  3H0F A;  3JB9 D;  4XTY A;  1RAB B;  3NTK A;  5DY9 A;  2ZPB B;  1BKB A;  3OW2 S;  4HCB A;  2V26 A;  1K8A R;  1B7T A;  2D1X A;  2HZY A;  3OA6 A;  1M5Q 1;  4AG1 C;  4M75 C;  4AFZ C;  2JTE A;  4R55 A;  1N8R U;  1BI3 A;  2QYZ A;  4CC7 A;  2O4X B;  2J06 A;  4M7A F;  2P4T A;  4RTV A;  2FL7 A;  4KRT A;  2HQH A;  3ZL7 C;  2DMO A;  2KY9 A;  2LJ0 A;  4QQG A;  4EDU A;  1RAF B;  1ZBJ A;  2WAC A;  4J6W A;  4JDS A;  2DIG A;  4J7I A;  1VYT A;  1WX6 A;  3S3M A;  2F2X A;  5LJ5 f;  2H8H A;  3CBM A;  1Q81 U;  1TUC A;  2KQW A;  3JRZ A;  3V7R A;  4J9B A;  2WSC E;  2XDD A;  2VVK A;  1YN8 A;  4M77 B;  2X51 A;  2RI5 A;  4RCC A;  3CCL A;  1BBZ A;  1YIJ T;  1W2B P;  2XMF A;  1VQP A;  2RHZ A;  2KNB B;  4RMO A;  3G71 Q;  5KYN A;  2NLU A;  4JUV A;  4M78 F;  4KT0 E;  4EIK A;  4PJO B;  3JCM V;  5DLO A;  4ORZ A;  3A8H B;  4M78 B;  2C0I A;  2LTO A;  1K9M R; 
#chains in the Genus database with same CATH homology
 2EW3 A;  4JJB A;  2OAW A;  4RTZ A;  1GFD A;  2DL7 A;  2CT4 A;  4ESR A;  2EQI A;  5IHN A;  4LNP A;  2GQI A;  1T0H A;  2D0N A;  4E6R A;  1AZG B;  1X2K A;  2HDA A;  2LJ3 A;  1X2Q A;  1IO6 A;  1K4U S;  1NG2 A;  1SEM A;  2JS2 A;  3I5R A;  4D8K A;  1AVZ C;  1JU5 C;  1JQQ A;  2FPF A;  2CDT A;  3EG0 A;  1WFW A;  1JO8 A;  1JXO A;  1U06 A;  3EG2 A;  2JMC A;  1WXT A;  1NYF A;  1QLY A;  3PVL A;  2A37 A;  1EFN A;  2LQN A;  1H8K A;  4AFS C;  2DNU A;  4GBQ A;  1SSH A;  2PTK A;  3FJ5 A;  4HVU A;  3IQL A;  3A98 A;  2KXD A;  1HD3 A;  2ROT A;  2A28 A;  2AK5 A;  2DL3 A;  2DYB A;  2CSQ A;  4Z89 A;  2KE9 A;  3R6N A;  2M51 A;  3QWX X;  1YWP A;  1AWW A;  1AWO A;  2DX1 A;  2EGE A;  2KYB A;  2LJ1 A;  3REA B;  1UDL A;  3JV3 A;  2X3W D;  2FRY A;  2HSP A;  2LZ6 B;  1AZE A;  4LE9 A;  2ED1 A;  2DM1 A;  4JJD A;  2K2M A;  2VKN A;  1Y0M A;  2FG0 A;  3I35 A;  1Z9Z A;  2RMO A;  5I11 A;  2FRW A;  1QWE A;  5IXF A;  3C0C A;  2ABL A;  2W10 A;  1JEG A;  1GCQ A;  2KRS A;  2YUQ A;  1UGV A;  1NEG A;  5I22 A;  1WA7 A;  5L23 A;  1VYU A;  4F16 A;  2LMJ A;  1RUW A;  2J6F A;  5IHI A;  1K76 A;  4JPB W;  4DEX A;  1GCP A;  1XOV A;  3RNJ A;  2L3S A;  2KBT A;  1U5S A;  3VS0 A;  4J9C A;  2L3Q A;  1OV3 A;  3VS4 A;  2ROL A;  4HVV A;  3NMZ C;  2GNC A;  1AOJ A;  2KRN A;  2DJQ A;  2GTJ A;  1PRM C;  4CC3 A;  2ECZ A;  1OOT A;  1G83 A;  2KR3 A;  1UEC A;  2CT3 A;  1NEB A;  1W70 A;  4JZ3 A;  5IHK A;  3VS3 A;  4A63 B;  4J9G A;  4R0K A;  4CC2 A;  2DIL A;  2V1Q A;  4WCI A;  5IH2 A;  1N5Z A;  3TSW A;  1U3O A;  2EVR A;  2EGA A;  2RQR A;  1I1J A;  2ENM A;  4OMQ A;  4Z8A A;  2HBW A;  3RBB B;  1A0N B;  2EYW A;  3M0P A;  1E6G A;  3CQT A;  1ZUU A;  3NGP A;  2JXB A;  1MV3 A;  2JS0 A;  1AD5 A;  1X69 A;  1VA7 A;  2M0Y A;  4HXJ A;  2GTO A;  3GBQ A;  4OMO A;  1JXM A;  2DE0 X;  2L2P A;  4M4Z A;  1ZUK A;  4D8D A;  2AKK A;  4RUG A;  1ZLM A;  4F14 A;  3VRY A;  1PKT A;  1PWT A;  1YCS B;  2O31 A;  4X1V A;  2RQW A;  1M3A A;  1YWO A;  1TG0 A;  2RQU A;  2EKH A;  2NUZ A;  3SHW A;  3PE0 A;  1M30 A;  2O9S A;  2VWF A;  2CUD A;  4FSS A;  2GGR A;  3KFV A;  3M0R A;  3NPF A;  4OMN A;  2RQT A;  1AWX A;  2RNA A;  2DBM A;  2C0T A;  3TSZ A;  4J9D A;  2K79 A;  2J05 A;  2DVJ A;  5HCK A;  3LH5 A;  2EPD A;  2KT8 A;  1NM7 A;  3VS2 A;  2LQW A;  1SHG A;  2C0O A;  1PHT A;  4IIO A;  1BU1 A;  3UAT A;  2IIM A;  1CKA A;  1FYN A;  1H92 A;  2K7A A;  1B3Q A;  1X6B A;  2GBQ A;  1M8M A;  2DRM A;  1X27 A;  2YSQ A;  4F17 A;  4LN2 A;  1CSK A;  2MIO A;  1PNJ A;  1LCK A;  2DBK A;  1W6X A;  4JJC A;  1T3S A;  3REB B;  1KFZ A;  4J9F A;  3QWY A;  1YP5 A;  1GL5 A;  3VS5 A;  1QKX A;  2J6K A;  2HEQ A;  1MUZ A;  2EGC A;  1ZUY A;  2DF6 A;  2FO0 A;  5EC7 A;  1KSW A;  2BTT A;  2EYY A;  2K9G A;  1ARK A;  1ZSG A;  3UA6 A;  2CUB A;  1M3C A;  1HSQ A;  2FEI A;  2DRK A;  2YUO A;  1K0X A;  2BZ8 A;  1E7O A;  3VS7 A;  1WXB A;  2LNH B;  2RF0 A;  1BB9 A;  2J6O A;  3EG3 A;  1OPL A;  2MOX A;  4RTX A;  1YNZ A;  1RI9 A;  2CSI A;  1UUE A;  2EYZ A;  1CKB A;  3VS1 A;  4ZNX A;  2QDL A;  3M0S A;  4HVW A;  4RTU A;  4J9H A;  1GFC A;  1QWF A;  2B86 A;  2I0N A;  4LUD A;  1OPK A;  1W1F A;  2HCK A;  4JZ4 A;  1K9A A;  4DEY A;  1M3B A;  2DA9 A;  4J9I A;  4AG2 C;  1NLO C;  2SEM A;  3UF4 A;  3VS6 A;  3TVT A;  4AFQ C;  2JMA A;  3UA7 A;  4Y92 A;  1PRL C;  1G2B A;  1GRI A;  1WYX A;  1X43 A;  4HCK A;  2KGT A;  4OMP A;  2W0Z A;  1S1N A;  1UJ0 A;  2L3P A;  2X3X D;  3EG1 A;  4J9E A;  1ABQ A;  2YDL A;  1SRL A;  2CH4 A;  5FW9 A;  2ED0 A;  2V1R A;  1VYV A;  2K3B A;  1UTI A;  3SEM A;  4CC4 B;  2CH4 W;  2OI3 A;  1MV0 B;  5FWC A;  2F2V A;  1K0S A;  2AZS A;  3EHQ A;  2SRC A;  1ZX6 A;  2JM9 A;  3I9Q A;  2AZV A;  2RPN A;  3O5Z A;  5GJW B;  1QCF A;  2DL5 A;  2YT6 A;  4OML A;  2NWM A;  2F2W A;  2KRO A;  2KRM A;  5FWB A;  2RQV A;  1B07 A;  1NYG A;  3I5S A;  3EGU A;  5ECA A;  1T3L A;  1BK2 A;  2K6D A;  3NHN A;  4GLM A;  4QT7 A;  5IXB A;  2CRE A;  1UE9 A;  1WDX A;  3M0U A;  3EHR A;  1ABO A;  1K1Z A;  2AKL A;  2KT1 A;  3ULR B;  4K11 A;  1M27 C;  1AWJ A;  2LP5 A;  2D8J A;  2A36 A;  1V1C A;  1UG1 A;  3H0I A;  1RLQ C;  3H0F A;  1NLP C;  3H0H A;  2KXC A;  1KJW A;  1Y57 A;  1SRM A;  1QKW A;  2D1X A;  3H41 A;  1OEB A;  1UHC A;  3PVQ A;  2D8H A;  4AG1 C;  4IIM A;  2JT4 A;  4AFZ C;  2JTE A;  1T0J A;  2E5K A;  2YUP A;  1Z9Q A;  4CC7 A;  2J06 A;  4OMM A;  2JM8 A;  2O88 A;  4RTV A;  2FPE A;  4KRT A;  3U23 A;  2ESW A;  3M0T A;  1WI7 A;  3ZL7 C;  2DMO A;  2O9V A;  1RLP C;  2LJ0 A;  1E6H A;  2A08 A;  1GCQ C;  1ZBJ A;  4RTY A;  2BZX A;  2JW4 A;  1PKS A;  2L0A A;  2EYX A;  1WLP B;  1VYT A;  1WX6 A;  2F2X A;  2H8H A;  2PNI A;  3VRZ A;  1X6G A;  1TUC A;  1SPK A;  1HJD A;  2J7I A;  1SHF A;  2FPD A;  2YUN A;  2RN8 A;  1AEY A;  3M0Q A;  4J9B A;  1UJY A;  2VVK A;  2G6F X;  2KEA A;  1YN8 A;  4RTT A;  4LUE A;  2DL4 A;  1FMK A;  1BBZ A;  1WIE A;  5GJV B;  1UHF A;  2XMF A;  3THK A;  2LX7 A;  1GBR A;  2DL8 A;  2KNB B;  1KIK A;  4RTW A;  2MCN A;  1J3T A;  1TUD A;  2P4R A;  2OJ2 A;  4EIK A;  4AFU C;  1I0C A;  2BZY A;  2LCS A;  4ORZ A;  1GBQ A;  2O2O A;  2PZ1 A;  1I07 A;  2EBP A;  2C0I A;  2KYM A;  4Z88 A;  2DLP A;  1H3H A;  1WXU A;  1UFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...