1VQPQ

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqpQ00
3CCLQ 3CMAQ 3CC4Q 1YIJQ 1VQ5Q 1JJ2P 1VQNQ 1VQ4Q 1K73R 3I55Q 2OTLQ 1YHQQ 2OTJQ 1VQ6Q 1KD1R 1VQKQ 1VQOQ 1YJ9Q 1Q81R 1VQLQ 1NJIR 3CCQQ 1YJWQ 1K9MR 1Q7YR 1YJNQ 3CXCP 3CCJQ 3CCEQ 1QVFP 3CC7Q 1VQ7Q 3G4SQ 1K8AR 1M90R 3CCVQ 3CCMQ 3CMEQ 1KC8R 1Q82R 3CPWP 3CCSQ 1YI2Q 1VQMQ 1KQSP 3G6EQ 1Q86R 1VQ9Q 3I56Q 3OW2P 1S72Q 1YITQ 2QA4Q 3G71Q 1VQPQ 1N8RR 2QEXQ 3CCUQ 1M1KR 3CCRQ 1VQ8Q 3CC2Q 1W2BP 3CD6Q 1QVGP
chains in the Genus database with same CATH superfamily
2KMTA 3CCLQ 4QVCA 2ZPBB 1OX8A 4E7ZA 4QQGA 1K73R 3M4YA 1WNLA 5DY9A 4LD6A 3OYDA 4DBFA 4XAXB 3OYAA 5C6SA 5GAN5 2CZ1B 3A5ZB 3CXCA 4M75E 1YJWT 4M77A 1N9SA 2KXCA 3JCMW 4HCCA 2GTOA 1N27A 1ZSZA 3JCMP 3CPWA 1D09B 4XU1A 4A4FA 4FL6A 1SRLA 2E5KA 2QQRA 2E41A 4GLMA 1WPYA 4C0FA 1MV0B 2EQIA 5LJ5g 4LD9K 4AMCA 1PD0A 2D0NA 4AG1C 1WHLA 2AKKA 1IO6A 1M30A 3PGGA 4J9CA 4ELZC 3AHUA 2RNAA 4J9DA 4JRQA 5LJ5j 3EH2A 1S1NA 1SHGA 1WI7A 4LXCA 1W1FA 3TQ7P 2MK5A 3MEUA 3I55Q 1JJ2A 1WZOA 1M4ZA 2DL5A 2E3HA 3AT1B 2RD1A 2VB6A 4M7DA 3JCMf 2COWA 2JN0A 1U1SA 5IN1A 2ECZA 2DPPB 3G4SQ 1YJNT 3G4SA 5DLQE 4F7UE 2RMOA 1YITQ 2KEAA 2LT1A 4C92A 2KBTA 1PNJA 1VQ8A 3S3MA 3CBOA 3EGDB 3OYJA 2J6KA 1MMGA 4IURA 2KRMA 3P8HA 1ZBXA 4Z89A 5GAN4 7AT1B 2HSPA 2PQWA 4PLIA 2XDPA 4C5GA 4HCBA 1YWOA 5LJ5f 3FRNA 4D8KA 5LJ5d 4NOYA 1KQSS 3OA6A 1FYNA 1VQ7T 1QP2A 2KR3A 1QVFA 3OW2A 4M7AF 4M7AC 5IT9E 4DA4A 5GAOl 5L8RE 2W10A 3M53A 3M54A 2XG8D 1VQKA 3CXCS 4XTWA 2LZ6B 3OS2A 2M16A 3EFOB 5I22A 2BZYA 4AG2C 1WA7A 1WXBA 3CPWS 3CCVQ 4A63B 1VQ9Q 1LOJA 2X51A 4M78A 2NUTA 3L42A 1LPLA 4JJNK 1KHCA 2VUBA 4II1A 1Q81C 3T9NA 4BI8B 3DLLA 2RH2A 1ZUKA 2K7AA 4RMOA 3DB3A 1IHVA 4ZTJA 1KC8C 1GBQA 1VQ6T 5GAMe 3CC7Q 1WX6A 2RI5A 4E7SA 1WQWA 2DNUA 2WACA 1Q82R 1YI2Q 4FT2A 3JRZA 4VUBA 4UC4A 2QG9B 3RKWA 3CCST 3CC2Q 1OV3A 2DTHA 1JJ2S 4N4GA 2DK3A 1T0JA 2DRMA 5CQYA 2CP6A 1MHNA 2EYWA 4FSSA 2X4YA 3INZA 3BE3A 1OYXA 3IQLA 4FCYA 2QGGA 4J6XA 2DL3A 2O4XA 1N6AA 3PIOA 4DBRA 4RTWA 4OMPA 1ZUUA 4TVRA 5GAOm 2HDAA 1X43A 2B8AA 1OX9A 2DTOA 2IPOB 2E5QA 4P5NA 1M1KR 2LC4A 2F2XA 2JS0A 4JRIA 1VQMT 3CD6Q 4LDYA 2QQSA 3KUFA 1UHFA 3OBWA 3KBGA 3CCLT 3BDUA 1KQ2A 5FW9A 1NLPC 3OS1A 2LJ0A 4EMKB 3H9NA 4JLGA 2KNBB 1QVFS 5FU7B 2L8DA 2V26A 3OW2S 1JU5C 4J9IA 1I1JA 1M2VA 4OMMA 1VQPQ 4J7FA 2DYBA 3EG9B 2LQKA 1KIKA 1NJIU 2VYTA 3V8KA 4HT8A 3VS6A 4ZNXA 4M77D 1VQ5T 2DXBA 2CH4A 1WXUA 3C12A 1SHFA 4J83A 2PVGB 1GRIA 2RI2A 1VIFA 2QDYB 2QA4Q 3A8LB 3O8VA 4O5VA 4WCIA 3LH0A 3ZFJA 2P0KA 1B7TA 2E4HA 4CC7A 2KAFA 1ZLMA 1YIJT 4C8QF 4C8QC 2RJEA 3Q1JA 2GQIA 2MMPA 5KE3A 5LJ5h 3CCEQ 4F16A 3V8LA 2EJFA 3LH5A 4QKUA 2OAWA 1Q95G 2JS2A 3JCMb 2OTLT 4M7DD 4JJCA 1YITT 3FLGA 2B86A 1ZA2B 1TOVA 5KYXA 1FMWA 3JV3A 1Z9QA 4C92D 2J7IA 1UFFA 2JUFA 4X1VA 1YBYA 2E64A 3CCMA 2AZVA 4ORZA 2HNIA 4IKFA 1J3TA 3CCRQ 4NL2A 2A36A 3OBYA 2JW4A 1FMKA 1NEGA 1NYGA 1YFNA 2EFIA 4PJOC 2M9UA 2K9GA 2DD5A 2EBPA 3I5RA 1VQOQ 4RTXA 3EAEA 3J81E 1Q7YR 2KROA 3JCMX 4FM4B 2V8KA 1T3SA 3QIIA 4Z88A 1PRLC 4ZGJB 2HSEB 2AIRB 1Q86R 1OU8A 3H0HA 2RJFA 3RIRA 4RTYA 3QG1A 3CMET 1K73C 1VQ9T 1TUDA 1D0ZA 1R0BG 1SEMA 1I0CA 3G6ET 1X2QA 4ZGEB 2JT4A 4FU6A 4CRIA 4AFUC 1K9AA 1BBZA 2HAXA 3EG0A 1T0HA 3UA6A 4BY6B 4ZN3A 1PCXA 4R56A 1VQ4T 4M7AE 4M78D 2VGMA 2R5AA 4OMNA 3FJPA 2K3YA 2K5IA 3P8DA 3MEVA 5GAN2 3CC7T 1YWPA 3QHSA 1D1BA 2JOYA 2XIDA 1W2BP 1F1BB 1Y96B 1Y0MA 2FRYA 1VQNQ 2DXCA 4BDZA 3X28B 2E70A 1YHQQ 3UATA 1H92A 3NFCA 2O9VA 3PT9A 1M2OA 2FEIA 1ACMB 4OP0A 3VU3C 2M1HA 3NTKA 2SRCA 4DEXA 2VC8A 2K3XA 5CIUA 5GAMj 1IXDA 4ATOA 2HQHA 1Y71A 3RBBB 1TSFA 2GNCA 2QAZA 3QDRB 3CD6T 2EIFA 1RAEB 4XU3A 2H8HA 3VYHB 4B9XA 3S6WA 3TSWA 3JAME 1YJ9A 4C0GA 1RAHB 4KUDK 1QVPA 3OB9A 2LP5A 4EDUA 4M75B 3SEMA 8AT1B 1VQPT 2XHCA 1S72T 4C0DC 2E6ZA 2GCXA 3GPLA 3CMAT 5GAMf 2O01E 1RUWA 1PC0A 4KT0E 5IXFA 5GAOn 1N9RA 2QYZA 1U8RA 1PG5B 1EZZB 3BFMA 4E7KA 2YRDA 2CP7A 3SDZA 3QYHB 1Y7XA 2FZKB 4FIBA 2YRCA 4NS5A 1FMVA 1AZGB 1R77A 2ROLA 2HZYA 1XNIA 4KH0B 1O75A 1U5SA 3REAB 1UGQB 3CCQA 2JXBA 1N8RU 2R58A 1H641 1VA7A 2RF0A 1X2KA 4A4EA 4DQ2A 4LNPA 2D1XA 2AZSA 1SRMA 3M0SA 2YSQA 2A0FB 2JTMA 3FC3A 4N4HA 1QLYA 3FDRA 3VS2A 3J7AF 1PWTA 5D6YA 3I35A 2SEMA 2XK0A 2EQKA 2DFUA 2X4JA 4JJDA 1Q82C 1AVZC 1D3BB 3H41A 3MJXA 1X69A 4OGCA 1QP3A 4F7UA 4FW2A 4D6WA 4C8QE 3META 4IIOA 4M4ZA 2BKDN 3CCRT 2MWPA 2DXTA 5IHKA 4XQ3A 4EMHA 3OS0A 2CUBA 1NBEB 1XQHA 3OYLA 1VYVA 1VQOT 4OF1A 1HXDA 1YP5A 4FSXA 1VQLT 2J6OA 1M1KC 3RR6A 2AHJB 4FYVB 2CZ0B 1UTIA 4QQ6A 2YHTA 2EJ9A 2OAUA 3SWNC 3EFRA 3QBYA 4PL6A 3GP8A 4IUQA 1M90U 1B34A 4A53A 5KYUA 2QGFB 2P84A 5KYYB 3DLMA 1M1GA 4BE2A 5KYWA 2ZCFB 2BE7D 4LUDA 3I56Q 1G5VA 6AT1B 1EIFA 2QASA 2A7YA 2LNVA 2CP2A 3CBPA 1K76A 4Z02A 4R55A 3E19A 4M77C 1VQ6A 3PVQA 1CKAA 3MO8A 1RL2A 1YHQT 1ZSZC 3LGLA 3CCJQ 1M8MA 4IUTA 5CQXA 4QQDA 1UG1A 4MDWA 2CZ6B 1VIEA 2QEXQ 3M58A 1ABOA 3EG3A 1XTDA 2EYYA 3H0FA 2MYSA 4PNOA 1IGUA 1W70A 2EKHA 2KRSA 3JCMg 1G83A 1TG0A 2O9SA 3C95A 2DL7A 5CK9A 2QQAA 3A8HB 2NWMA 2RO0A 2XMFA 1GXIE 1QQJA 2CKKA 2DRKA 2J6FA 4RG2A 1AWXA 4OB1B 2QXFA 2FHDA 2DZ9A 4M7DC 2DBMA 4J9BA 3VRYA 3X20B 3JB9F 2ZPHB 4C92C 2LJ1A 5GANe 1AHJB 2AK5A 1NE8A 3HRTA 4LUEA 1B07A 5D6WA 2PZ1A 2QTXA 1KD1U 2L2PA 3PMIA 1VQ5A 4M75D 2RK2A 1Q7YC 3MP1A 3BW1A 4OB3B 2LQWA 4XK8E 2EVRA 2KE9A 1Q86C 1WHHA 4OB0B 1TH7A 3JCMd 2BIVA 3JB9H 3OYCA 2OJ2A 4JS4A 4KBMB 3JB9G 4CC4B 2CP0A 2VASA 3HRUA 3CCUA 2NLUA 1VQ8Q 2EYXA 1V29B 4K11A 5FROA 4C0ZA 4BACA 1BK2A 2LVMA 2KYMA 1YIJA 1ZSGA 3V7RA 4B9WA 2JZ2A 4RCBA 3VS0A 1JO8A 5AT1B 4M78F 4ME7A 4M78C 1JRIA 2HBWA 2JTFA 1RLQC 3THKA 3EGDA 3M0UA 3UPUA 1G3YA 2CT3A 2NUPB 3G71A 3GOXA 2LDMA 5CVIA 1X6BA 2P4TA 2E1HA 3GF5A 4E7IA 1OULA 1VQKQ 1HYOA 3OYKA 1H3HA 1JXOA 3E9FA 4M78G 5GAN3 1NYFA 2L89A 2DEQA 1IGQA 1N5ZA 1RLPC 2LTOA 1I07A 3PE0A 1K0SA 3EFOA 3OYGA 1PHTA 4BB7A 4M7AG 1XOVA 4HKEA 1I4K1 2PVDB 1ZBJA 4QVZA 5IHNA 2OI3A 4ANJA 2Y4YA 1G3SA 1BI2A 3CMEA 5EC7A 4M7AB 1KQSP 3G6EA 1SSHA 1WHJA 2RQRA 2GQVA 4XTUA 4LDWA 3URGA 1Q81U 4AFQC 2K79A 4DBQA 2MCNA 2RK1A 1VQ4A 2LRQA 3QUIA 2HD0A 2MOXA 4JJBA 3HSBA 2L0AA 4LDUA 1KC8U 1HK9A 1RABB 2CGHA 1RAAB 4PJLA 4GLKA 3CXCP 2LQ8A 3DB4A 2E10A 2A08A 5IXBA 2COZA 4AFZC 3CCJT 3I5SA 4L5GA 5GMKe 3CPWP 2ZZDA 1HD3A 1OPLA 1BCMA 1FX7A 2G3RA 5FU7C 1AWJA 4Y92A 5FWCA 2D9TA 1GBRA 1VYTA 3LYIA 1K9MU 1WJRA 3FJ5A 2DF6A 2EKOA 4ZN1A 4O6JA 2OTJA 3ER0A 5GAOr 1BIBA 2DD4A 1QCNA 3VJPA 2V8JA 1LJOA 3MEAA 2HL3A 4V2SA 2RPNA 1C1AA 4RTVA 2H3JA 1YCYA 3VYGA 1FWZA 1NJIC 1BB9A 1VUBA 2QDLA 1JJ2P 4EMKA 2JM9A 2G6FX 3QPHA 1GFCA 1LNXA 2PU9B 2ZPFB 5CO7A 3JCMh 3EHRA 4OMQA 2DVEA 3EG9A 3QDFA 3R6NA 2QK0A 3QJ6A 5CAIA 3LLRA 3OS5A 2F2VA 3HRSA 1S72A 3RDVA 1X75C 3QJYA 4BD3A 4EIKA 2CZ7B 3VKIA 3KFVA 3QXEB 4J7IA 3CMAA 1GCPA 3EHQA 4GY5A 5GANg 3L1AA 2FPFA 1IRXA 1NG2A 3JCMc 4E2FB 3I55T 2X3WD 2BZXA 4IUPA 5LJ3e 2KK4A 1D1AA 2EQMA 2XI9A 4C5EA 1QVFP 3OYYA 1H8KA 3OW2P 4Z8AA 5GANj 4JUVA 3G4ST 2ZPEB 3MP6A 4HA8A 1JBMA 1RADB 2GFUA 3CC4Q 1B3QA 2L3QA 3OQ5A 3CC4A 1QKXA 2NYSA 2CUDA 2ED0A 4J9HA 1M8VA 1E7OA 3TREA 4JDSA 5HCKA 2CREA 2MF2A 3ULRB 3TSZA 3CCMQ 4C8QG 3M59A 4CI0C 4BDYA 2Z0WA 3E1SA 1TS9A 1LCKA 3CBMA 1UEBA 2X4XA 5J26A 3RMSA 1ARKA 3JSCA 2XD0A 3ASKA 4Y91A 4PJOF 3BDLA 4C8QB 3RERA 2K5LA 2NUZA 1BI0A 1KD1R 1AWWA 3VS3A 1SF9A 3A1PA 5GANf 2X9HA 2DZCA 5GAN8 1SG5A 1VQKT 3HHTB 5EG2A 5GANd 3REBB 2VWFA 4E7HA 1YN8A 1K1ZA 4KGXB 4A54A 2DO3A 3KXTA 2DIGA 4M78E 5D7UA 3CCVT 5IHIA 2V8IA 5DLOA 2ZGWA 3HP9A 2L3SA 1NPRA 1PKTA 4PJOG 2BUDA 3SD4A 1EFNA 5GMKi 2VGNA 3SFMA 2D0QB 2K5FA 4XTYA 3RUXA 1K73U 3GNGA 5A0GA 4PJOB 4PJJA 1YI2T 3RKYA 2O88A 1KFZA 1QVGA 2BTTA 3CC2T 3N5BB 5GAMg 1WHGA 1TTHB 5GAOq 3HKSA 3MCAB 1AWOA 1Y96A 2EYQA 2MIOA 5ECAA 3C0CA 2GGRA 3OMCA 5GMKl 4OGEA 2MAMA 4M75C 1M3AA 1OI1A 2CH4W 2DILA 4C5IA 2CDTA 1PD1A 3H0IA 3V8JA 1YJ9Q 3WXMB 1C6VX 4OMLA 1VOMA 1G3TA 1VYUA 2FPEA 3OYIA 3GLXA 1CKBA 2RQUA 4DEYA 1RAFB 4FYYB 1GCQA 2KT1A 3EG2A 5D6XA 5GMKj 1KHIA 3X25B 3CEYA 4MZTA 1YJWA 5A0DA 4QW2A 4M75A 5GAMd 2PUOB 4KGVB 1MMDA 4D8DA 5GAN6 1MNDA 5I21A 2RHIA 2CS7A 2YLBA 1UGSB 5CKHA 2QA4T 2GBQA 1TUCA 4A4KA 5FU6C 2XDDA 3CCQQ 1K9MR 2M0YA 2BZ8A 3QWXX 1WXTA 2DETA 2FYKA 5GMKm 2DKGA 1Z9ZA 3CCET 3A8MB 4C0DB 1QVGS 2CSQA 4R0KA 2DBKA 4F14A 2KY9A 1UE9A 2VVKA 1NJIR 5GANh 1YJNA 4LDXA 4OB2B 3M5AA 2F2WA 4CC2A 4X9DA 5LJ3j 2X35A 4PK4A 1KSWA 2L3PA 2O2OA 2JM8A 3VS1A 2YXYA 1D3BA 2QQBA 2RM4A 3UDCA 4HVWA 1Q82U 1UECA 1AT1B 2YDLA 4J9EA 1VQ7A 4FYWB 3EGXB 4J5YA 5I2SA 2FVUA 3M55A 4Y28E 1QWFA 4QVDA 3L2ZA 1M27C 1GL5A 3H8ZA 3FB9A 1I5LA 1XJWB 1BU1A 1SSFA 4KUIA 2M0OA 1I8FA 3DKMA 5LL6S 3L2RA 4FT4A 5LJ3f 4XTXA 5IAYA 1LVKA 2CP3A 1WHMA 4PJMA 3M9QA 3LW5E 4PJOE 3LWIA 4X9CA 1MV3A 2CSIA 2KGTA 3G7ZA 1QMCA 1H3ZA 3GIBA 2F5TX 5FRMA 1MUZA 2JMAA 1T3LA 5KYYA 5CCAA 3HPWA 2R5MA 4M77F 1VQ6Q 3R6OA 4HCZA 1VQNT 2EGEA 2JVVA 4KH1B 5KYNA 2GTJA 4HT9A 1MMNA 2L3RA 2A3LA 2CT4A 3OYHA 2P0PA 4N0AA 2DIQA 3SWNB 2DERA 3CCSA 5J39A 1WJQA 3PTAA 1UHCA 3L2WA 1ZHIA 2DEUA 1MMAA 1QW1A 3M57A 2RJDA 1K8AU 1BI3A 1M3BA 2FG0A 5KE2A 2Y90A 5GAMh 4M77G 3OYFA 1YJ9T 3A8OB 5FWBA 4BI4A 3F70A 1O9SA 1WHKA 1VQMA 2HKNA 4MMKA 2ABLA 1YNZA 3VS7A 3C4SA 4M7DF 3BY7A 4M77B 3PFSA 1PRMC 2COYA 3CCLA 1R0CB 1ZSZB 2FB7A 3GBQA 3MHXA 2LNHB 1I81A 2CP5A 4XTZA 5C0MA 4C92F 1BKBA 1I5OB 4YTLA 5CR2A 5GMKh 1HSQA 1WLPB 4KGZB 3OYMA 2RB6A 3S3OA 4ZGDB 3MEWA 1KD1C 2DMOA 4RTZA 1VQ5Q 1ZUYA 3V7CA 2YRVA 4JZ4A 4M7DG 3M0TA 2P0QA 4ZTFA 4E47A 2PNIA 3D7SB 4OVAA 3JCMJ 3CCQT 1Y07A 1KG1A 5J3BA 4M7DB 1QKWA 4C92G 3RESA 3CCUQ 1C0MA 2GF7A 2DX1A 1Q7YU 4AT1B 1TWBA 1YIJQ 2RQTA 3I55A 5DM7R 2DE0X 4C92B 3OMGA 1Q86U 3SB2A 1NZ9A 5KCOA 4IUUA 2OTLQ 4JZ3A 2IVWA 2OTLA 2KI7A 1YITA 3G71Q 1D0YA 2KSSA 5AYFA 2KYBA 1RAIB 4BE1A 1NPPA 4PFPA 5KCHA 4RG8A 2MI6A 2E12A 2NUPA 4OMFB 5LJ3h 1JXMA 1BI1A 2DVJA 2D8HA 3RNJA 5A2QE 3J80E 3L2UA 1X6GA 1BIAA 2EGCA 1ZX6A 2F5KA 1N8RR 5CKFA 1X27A 2YWWA 3QWYA 2EQUA 3OY9A 2QQ9A 2RN8A 4M78B 2NUTB 2D8JA 4JRKA 2QTVA 4IUVA 3WVDB 2V1QA 2PVOB 4CC3A 3CCVA 3VUZA 2WSEE 3CMEQ 3G6EQ 1VQ9A 5KH6A 2ZAEA 2KVQG 3I56T 1G2BA 1VQ4Q 4QT7A 2RJCA 4HCKA 2EW3A 1BCOA 4M7AA 4A4HA 1SKUB 1IHWA 2KXDA 1AZEA 3CC7A 2ENMA 4E7JA 4JRPA 2EYZA 1YI2A 4EMKC 1OZ3A 1GFDA 3QSUA 1WJSA 1Y57A 2O4XB 3CC2A 2RHZA 4C5HA 4IIMA 2XDBA 2L5QA 2QEXT 3OSVA 1K9MC 3S3NA 2OTJQ 2YUOA 4RUGA 2LX7A 4JPBW 3JB9I 1SPKA 2K3BA 1YCSB 2X3XD 5CKBA 1M90R 2LMJA 1X6OA 3QYGB 4M77E 2O31A 2AKLA 4J6YA 2WSFE 4HXJA 2GFAA 2RHUA 2E65A 2KRNA 1RACB 2DAQA 3CD6A 3E9GA 2VKNA 2H3EB 1W2BA 1JB0E 5CKEA 3G1JA 1M2VB 4AFSC 2C0TA 4MZPA 2RHYA 3M56A 1JEGA 3MP8A 1AD5A 1EX4A 1X01A 2HEQA 2E6NA 1S72Q 2C0OA 1VQPA 4Q5WA 1V76A 2JNGA 3CMAQ 1OZ2A 1UJYA 1UB4A 4HVVA 8ATCB 4N4IA 2XICA 4M7DE 2VV5A 1UJ0A 1K8AR 2R57A 1UDLA 1UGPB 4ELYC 5M9OA 3LWHA 3NTHA 2QA4A 2FZGB 3EGUA 3M0RA 4DBHA 4C92E 2RQVA 1NEBA 3CCUT 2F69A 1U3OA 4JLIA 3ZEHA 1VQ8T 1QWEA 2A37A 3HTRA 2EAYA 3VV0A 3JB9J 2K2VA 3QZ5B 1HJDA 3CCEA 2ZPIB 1W6XA 2YUPA 1OPKA 5KYXB 2F1LA 2XU8A 1CSKA 1DJ7B 3RKXA 1E6HA 2JTEA 3ZBDA 1WQ7A 2LCLA 3G71T 3H6ZA 2FRWA 1RI0A 1WYXA 1NLOC 1WFWA 2ATCB 4E6RA 3CQTA 3JB9D 4LDVA 3I9QA 2DM1A 3NHNA 5HKCA 1WGSA 4BY6C 2ED1A 2MPXC 2K6DA 3P8BB 1G3WA 1PKSA 4C8QA 1W2BS 2FZCB 3CCRA 1A0NB 2HBPA 2ZPGB 3PMTA 4F04B 3UF4A 2LJ3A 1PSFA 2OX7A 2RI3A 1AEYA 1ZA1B 2K57A 2YUNA 1VQOA 2XKOC 1VQLQ 1VQLA 3EH1A 2A28A 4MMLA 4PFZA 1UGRB 3MKDA 4J9GA 2C0IA 3UT1A 4F17A 5HK3A 4BUGA 2VXFA 1PSEA 1M3CA 1OEBA 3HFNA 5CKDA 4FYXB 5L23A 2FO0A 2CYZB 2DLPA 4RTUA 3VS5A 4XU0A 2C06A 5I2MA 3PNWC 3FIFA 3QZ9B 1GCQC 4PJOA 2AT1B 3OYNA 2PTKA 1ZQ1A 4ESRA 2FL7A 4A4GA 1D0XA 4J9FA 4WTOB 3L2QA 4M7AD 1TUGB 2KDSA 4M75F 2HMAA 1VQNA 3OSSC 1YHQA 2Y4XA 2ROTA 2IG0A 4RTTA 3VRZA 3PVLA 1D1CA 2OTJT 3L2VA 3JCMe 3O5ZA 1MGQA 1MNEA 3C94A 3EFSA 4PFOA 3X26B 2HQXA 4X34A 3MPUB 5IH2A 2EGAA 1WDXA 1OU9A 1K0XA 2PUKB 1TXQA 4FW1A 2E3IA 4L59A 1Q81R 4M75G 3QKJA 4DOVA 3OYEA 1YJWQ 9ATCB 3LGFA 2KT8A 4DOWA 5LJ5e 5GAOp 1G8XA 2V1RA 2HL5C 1KC8R 3ME9A 3CPFA 1UUEA 3GNFB 3ZL7C 1AOJA 3TU4K 4PKCC 1E6GA 2DL4A 2WSCE 3M0QA 2M51A 3WVEB 4HVUA 3M4GA 2EQJA 4F7UF 2JMCA 2DA9A 3EG1A 2I0NA 2LT4A 1IREB 2MWOA 1N8RC 1QCOA 1M5Q1 1NM7A 2J05A 2D6FA 1U06A 3JCMQ 3JCMV 5GAN7 3X24B 1JQQA 5GJVB 2HKQB 4WF2A 2RQWA 2DTIA 3UWNA 5LJ3g 3CC4T 2EJGA 1YJNQ 4F7UG 1ABQA 2P4RA 1RAGB 2YLCA 4BI3A 4J8OA 5HY6A 2I2LA 5GJWB 2ESWA 3QO3A 2DJQA 3VUBA 4RKUE 3CCMT 3M0PA 3HL8A 4F7UB 5HK0A 5FU6B 4EPCA 3A98A 3SHWA 3HFOA 3OYBA 1WIEA 1RI9A 1KQ1A 4PLLA 4EMGA 2EWNA 4XTVA 1VQ7Q 1KJWA 2DJZA 1P92A 4PJNA 2QI2A 1IB8A 4LN2A 2HCKA 1BYMA 1KK7A 2RHXA 1QVGP 2LCCA 1PM3A 2YT6A 4KRTA 2LCSA 2HQEA 2X4WA 5FRNA 1W4SA 4N0AC 1M1FA 3EGXA 1OOTA 3A8GB 1M90C 4C8QD 3NPFA 1UGVA 4L6V5 2LQNA 1M1KU 4E7LA 1OQKA 2DL8A 4NL3A 5LJ3d 2K2MA 1B34B 5A0LA 5KYUB 2IIMA 2YUQA 2EPDA 3U23A 2BE9B 3VS4A 5KYWB 4B6MA 1K4US 3NTIA 3V7SA 4BE0A 4LE9A 1QCFA 3TEEA 2LX9A 4JS5A 4XU2A 4MDXA 3TCJA 4MZMA 3FEOA 3CCSQ 2DXUA 3I56A 1R8OB 5FLXE 4KULA 2M02A 4OMOA 2DYIA 5I11A 3LX7A 3NGPA 2KQWA 4PJOD 4RCCA 2J06A 3TVTA 1U1TA 2FPDA 1V1CA 3SWNA 1K8AC 4J6WA 2JJ9A 1FXXA 3CCJA 2W0ZA 3UA7A 1M9SA 3NMZC 1TU0B 2RA2A 1IZ6A 1VQMQ 3PIPA 2K4YA 1KQSA 2VXEA 2QEXA 3E2UA 4GBQA 3RMQA
chains in the Genus database with same CATH topology
3CCLQ 3CMAQ 3CC4Q 1YIJQ 1VQ5Q 1JJ2P 1VQNQ 1VQ4Q 1K73R 3I55Q 2OTLQ 1YHQQ 2OTJQ 1VQ6Q 1KD1R 1VQKQ 1VQOQ 1YJ9Q 1Q81R 1VQLQ 1NJIR 3CCQQ 1YJWQ 1K9MR 1Q7YR 1YJNQ 3CXCP 3CCJQ 3CCEQ 1QVFP 3CC7Q 1VQ7Q 3G4SQ 1K8AR 1M90R 3CCVQ 3CCMQ 3CMEQ 1KC8R 1Q82R 3CPWP 3CCSQ 1YI2Q 1VQMQ 1KQSP 3G6EQ 1Q86R 1VQ9Q 3I56Q 3OW2P 1S72Q 1YITQ 2QA4Q 3G71Q 1VQPQ 1N8RR 2QEXQ 3CCUQ 1M1KR 3CCRQ 1VQ8Q 3CC2Q 1W2BP 3CD6Q 1QVGP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL Q;  3CMA Q;  3CC4 Q;  1YIJ Q;  1VQ5 Q;  1JJ2 P;  1VQN Q;  1VQ4 Q;  1K73 R;  3I55 Q;  2OTL Q;  1YHQ Q;  2OTJ Q;  1VQ6 Q;  1KD1 R;  1VQK Q;  1VQO Q;  1YJ9 Q;  1Q81 R;  1VQL Q;  1NJI R;  3CCQ Q;  1YJW Q;  1K9M R;  1Q7Y R;  1YJN Q;  3CXC P;  3CCJ Q;  3CCE Q;  1QVF P;  3CC7 Q;  1VQ7 Q;  3G4S Q;  1K8A R;  1M90 R;  3CCV Q;  3CCM Q;  3CME Q;  1KC8 R;  1Q82 R;  3CPW P;  3CCS Q;  1YI2 Q;  1VQM Q;  1KQS P;  3G6E Q;  1Q86 R;  1VQ9 Q;  3I56 Q;  3OW2 P;  1S72 Q;  1YIT Q;  2QA4 Q;  3G71 Q;  1VQP Q;  1N8R R;  2QEX Q;  3CCU Q;  1M1K R;  3CCR Q;  1VQ8 Q;  3CC2 Q;  1W2B P;  3CD6 Q;  1QVG P; 
#chains in the Genus database with same CATH topology
 2KMT A;  3CCL Q;  4QVC A;  2ZPB B;  1OX8 A;  4E7Z A;  4QQG A;  1K73 R;  3M4Y A;  1WNL A;  5DY9 A;  4LD6 A;  3OYD A;  4DBF A;  4XAX B;  3OYA A;  5C6S A;  5GAN 5;  2CZ1 B;  3A5Z B;  3CXC A;  4M75 E;  1YJW T;  4M77 A;  1N9S A;  2KXC A;  3JCM W;  4HCC A;  2GTO A;  1N27 A;  1ZSZ A;  3JCM P;  3CPW A;  1D09 B;  4XU1 A;  4A4F A;  4FL6 A;  1SRL A;  2E5K A;  2QQR A;  2E41 A;  4GLM A;  1WPY A;  4C0F A;  1MV0 B;  2EQI A;  5LJ5 g;  4LD9 K;  4AMC A;  1PD0 A;  2D0N A;  4AG1 C;  1WHL A;  2AKK A;  1IO6 A;  1M30 A;  3PGG A;  4J9C A;  4ELZ C;  3AHU A;  2RNA A;  4J9D A;  4JRQ A;  5LJ5 j;  3EH2 A;  1S1N A;  1SHG A;  1WI7 A;  4LXC A;  1W1F A;  3TQ7 P;  2MK5 A;  3MEU A;  3I55 Q;  1JJ2 A;  1WZO A;  1M4Z A;  2DL5 A;  2E3H A;  3AT1 B;  2RD1 A;  2VB6 A;  4M7D A;  3JCM f;  2COW A;  2JN0 A;  1U1S A;  5IN1 A;  2ECZ A;  2DPP B;  3G4S Q;  1YJN T;  3G4S A;  5DLQ E;  4F7U E;  2RMO A;  1YIT Q;  2KEA A;  2LT1 A;  4C92 A;  2KBT A;  1PNJ A;  1VQ8 A;  3S3M A;  3CBO A;  3EGD B;  3OYJ A;  2J6K A;  1MMG A;  4IUR A;  2KRM A;  3P8H A;  1ZBX A;  4Z89 A;  5GAN 4;  7AT1 B;  2HSP A;  2PQW A;  4PLI A;  2XDP A;  4C5G A;  4HCB A;  1YWO A;  5LJ5 f;  3FRN A;  4D8K A;  5LJ5 d;  4NOY A;  1KQS S;  3OA6 A;  1FYN A;  1VQ7 T;  1QP2 A;  2KR3 A;  1QVF A;  3OW2 A;  4M7A F;  4M7A C;  5IT9 E;  4DA4 A;  5GAO l;  5L8R E;  2W10 A;  3M53 A;  3M54 A;  2XG8 D;  1VQK A;  3CXC S;  4XTW A;  2LZ6 B;  3OS2 A;  2M16 A;  3EFO B;  5I22 A;  2BZY A;  4AG2 C;  1WA7 A;  1WXB A;  3CPW S;  3CCV Q;  4A63 B;  1VQ9 Q;  1LOJ A;  2X51 A;  4M78 A;  2NUT A;  3L42 A;  1LPL A;  4JJN K;  1KHC A;  2VUB A;  4II1 A;  1Q81 C;  3T9N A;  4BI8 B;  3DLL A;  2RH2 A;  1ZUK A;  2K7A A;  4RMO A;  3DB3 A;  1IHV A;  4ZTJ A;  1KC8 C;  1GBQ A;  1VQ6 T;  5GAM e;  3CC7 Q;  1WX6 A;  2RI5 A;  4E7S A;  1WQW A;  2DNU A;  2WAC A;  1Q82 R;  1YI2 Q;  4FT2 A;  3JRZ A;  4VUB A;  4UC4 A;  2QG9 B;  3RKW A;  3CCS T;  3CC2 Q;  1OV3 A;  2DTH A;  1JJ2 S;  4N4G A;  2DK3 A;  1T0J A;  2DRM A;  5CQY A;  2CP6 A;  1MHN A;  2EYW A;  4FSS A;  2X4Y A;  3INZ A;  3BE3 A;  1OYX A;  3IQL A;  4FCY A;  2QGG A;  4J6X A;  2DL3 A;  2O4X A;  1N6A A;  3PIO A;  4DBR A;  4RTW A;  4OMP A;  1ZUU A;  4TVR A;  5GAO m;  2HDA A;  1X43 A;  2B8A A;  1OX9 A;  2DTO A;  2IPO B;  2E5Q A;  4P5N A;  1M1K R;  2LC4 A;  2F2X A;  2JS0 A;  4JRI A;  1VQM T;  3CD6 Q;  4LDY A;  2QQS A;  3KUF A;  1UHF A;  3OBW A;  3KBG A;  3CCL T;  3BDU A;  1KQ2 A;  5FW9 A;  1NLP C;  3OS1 A;  2LJ0 A;  4EMK B;  3H9N A;  4JLG A;  2KNB B;  1QVF S;  5FU7 B;  2L8D A;  2V26 A;  3OW2 S;  1JU5 C;  4J9I A;  1I1J A;  1M2V A;  4OMM A;  1VQP Q;  4J7F A;  2DYB A;  3EG9 B;  2LQK A;  1KIK A;  1NJI U;  2VYT A;  3V8K A;  4HT8 A;  3VS6 A;  4ZNX A;  4M77 D;  1VQ5 T;  2DXB A;  2CH4 A;  1WXU A;  3C12 A;  1SHF A;  4J83 A;  2PVG B;  1GRI A;  2RI2 A;  1VIF A;  2QDY B;  2QA4 Q;  3A8L B;  3O8V A;  4O5V A;  4WCI A;  3LH0 A;  3ZFJ A;  2P0K A;  1B7T A;  2E4H A;  4CC7 A;  2KAF A;  1ZLM A;  1YIJ T;  4C8Q F;  4C8Q C;  2RJE A;  3Q1J A;  2GQI A;  2MMP A;  5KE3 A;  5LJ5 h;  3CCE Q;  4F16 A;  3V8L A;  2EJF A;  3LH5 A;  4QKU A;  2OAW A;  1Q95 G;  2JS2 A;  3JCM b;  2OTL T;  4M7D D;  4JJC A;  1YIT T;  3FLG A;  2B86 A;  1ZA2 B;  1TOV A;  5KYX A;  1FMW A;  3JV3 A;  1Z9Q A;  4C92 D;  2J7I A;  1UFF A;  2JUF A;  4X1V A;  1YBY A;  2E64 A;  3CCM A;  2AZV A;  4ORZ A;  2HNI A;  4IKF A;  1J3T A;  3CCR Q;  4NL2 A;  2A36 A;  3OBY A;  2JW4 A;  1FMK A;  1NEG A;  1NYG A;  1YFN A;  2EFI A;  4PJO C;  2M9U A;  2K9G A;  2DD5 A;  2EBP A;  3I5R A;  1VQO Q;  4RTX A;  3EAE A;  3J81 E;  1Q7Y R;  2KRO A;  3JCM X;  4FM4 B;  2V8K A;  1T3S A;  3QII A;  4Z88 A;  1PRL C;  4ZGJ B;  2HSE B;  2AIR B;  1Q86 R;  1OU8 A;  3H0H A;  2RJF A;  3RIR A;  4RTY A;  3QG1 A;  3CME T;  1K73 C;  1VQ9 T;  1TUD A;  1D0Z A;  1R0B G;  1SEM A;  1I0C A;  3G6E T;  1X2Q A;  4ZGE B;  2JT4 A;  4FU6 A;  4CRI A;  4AFU C;  1K9A A;  1BBZ A;  2HAX A;  3EG0 A;  1T0H A;  3UA6 A;  4BY6 B;  4ZN3 A;  1PCX A;  4R56 A;  1VQ4 T;  4M7A E;  4M78 D;  2VGM A;  2R5A A;  4OMN A;  3FJP A;  2K3Y A;  2K5I A;  3P8D A;  3MEV A;  5GAN 2;  3CC7 T;  1YWP A;  3QHS A;  1D1B A;  2JOY A;  2XID A;  1W2B P;  1F1B B;  1Y96 B;  1Y0M A;  2FRY A;  1VQN Q;  2DXC A;  4BDZ A;  3X28 B;  2E70 A;  1YHQ Q;  3UAT A;  1H92 A;  3NFC A;  2O9V A;  3PT9 A;  1M2O A;  2FEI A;  1ACM B;  4OP0 A;  3VU3 C;  2M1H A;  3NTK A;  2SRC A;  4DEX A;  2VC8 A;  2K3X A;  5CIU A;  5GAM j;  1IXD A;  4ATO A;  2HQH A;  1Y71 A;  3RBB B;  1TSF A;  2GNC A;  2QAZ A;  3QDR B;  3CD6 T;  2EIF A;  1RAE B;  4XU3 A;  2H8H A;  3VYH B;  4B9X A;  3S6W A;  3TSW A;  3JAM E;  1YJ9 A;  4C0G A;  1RAH B;  4KUD K;  1QVP A;  3OB9 A;  2LP5 A;  4EDU A;  4M75 B;  3SEM A;  8AT1 B;  1VQP T;  2XHC A;  1S72 T;  4C0D C;  2E6Z A;  2GCX A;  3GPL A;  3CMA T;  5GAM f;  2O01 E;  1RUW A;  1PC0 A;  4KT0 E;  5IXF A;  5GAO n;  1N9R A;  2QYZ A;  1U8R A;  1PG5 B;  1EZZ B;  3BFM A;  4E7K A;  2YRD A;  2CP7 A;  3SDZ A;  3QYH B;  1Y7X A;  2FZK B;  4FIB A;  2YRC A;  4NS5 A;  1FMV A;  1AZG B;  1R77 A;  2ROL A;  2HZY A;  1XNI A;  4KH0 B;  1O75 A;  1U5S A;  3REA B;  1UGQ B;  3CCQ A;  2JXB A;  1N8R U;  2R58 A;  1H64 1;  1VA7 A;  2RF0 A;  1X2K A;  4A4E A;  4DQ2 A;  4LNP A;  2D1X A;  2AZS A;  1SRM A;  3M0S A;  2YSQ A;  2A0F B;  2JTM A;  3FC3 A;  4N4H A;  1QLY A;  3FDR A;  3VS2 A;  3J7A F;  1PWT A;  5D6Y A;  3I35 A;  2SEM A;  2XK0 A;  2EQK A;  2DFU A;  2X4J A;  4JJD A;  1Q82 C;  1AVZ C;  1D3B B;  3H41 A;  3MJX A;  1X69 A;  4OGC A;  1QP3 A;  4F7U A;  4FW2 A;  4D6W A;  4C8Q E;  3MET A;  4IIO A;  4M4Z A;  2BKD N;  3CCR T;  2MWP A;  2DXT A;  5IHK A;  4XQ3 A;  4EMH A;  3OS0 A;  2CUB A;  1NBE B;  1XQH A;  3OYL A;  1VYV A;  1VQO T;  4OF1 A;  1HXD A;  1YP5 A;  4FSX A;  1VQL T;  2J6O A;  1M1K C;  3RR6 A;  2AHJ B;  4FYV B;  2CZ0 B;  1UTI A;  4QQ6 A;  2YHT A;  2EJ9 A;  2OAU A;  3SWN C;  3EFR A;  3QBY A;  4PL6 A;  3GP8 A;  4IUQ A;  1M90 U;  1B34 A;  4A53 A;  5KYU A;  2QGF B;  2P84 A;  5KYY B;  3DLM A;  1M1G A;  4BE2 A;  5KYW A;  2ZCF B;  2BE7 D;  4LUD A;  3I56 Q;  1G5V A;  6AT1 B;  1EIF A;  2QAS A;  2A7Y A;  2LNV A;  2CP2 A;  3CBP A;  1K76 A;  4Z02 A;  4R55 A;  3E19 A;  4M77 C;  1VQ6 A;  3PVQ A;  1CKA A;  3MO8 A;  1RL2 A;  1YHQ T;  1ZSZ C;  3LGL A;  3CCJ Q;  1M8M A;  4IUT A;  5CQX A;  4QQD A;  1UG1 A;  4MDW A;  2CZ6 B;  1VIE A;  2QEX Q;  3M58 A;  1ABO A;  3EG3 A;  1XTD A;  2EYY A;  3H0F A;  2MYS A;  4PNO A;  1IGU A;  1W70 A;  2EKH A;  2KRS A;  3JCM g;  1G83 A;  1TG0 A;  2O9S A;  3C95 A;  2DL7 A;  5CK9 A;  2QQA A;  3A8H B;  2NWM A;  2RO0 A;  2XMF A;  1GXI E;  1QQJ A;  2CKK A;  2DRK A;  2J6F A;  4RG2 A;  1AWX A;  4OB1 B;  2QXF A;  2FHD A;  2DZ9 A;  4M7D C;  2DBM A;  4J9B A;  3VRY A;  3X20 B;  3JB9 F;  2ZPH B;  4C92 C;  2LJ1 A;  5GAN e;  1AHJ B;  2AK5 A;  1NE8 A;  3HRT A;  4LUE A;  1B07 A;  5D6W A;  2PZ1 A;  2QTX A;  1KD1 U;  2L2P A;  3PMI A;  1VQ5 A;  4M75 D;  2RK2 A;  1Q7Y C;  3MP1 A;  3BW1 A;  4OB3 B;  2LQW A;  4XK8 E;  2EVR A;  2KE9 A;  1Q86 C;  1WHH A;  4OB0 B;  1TH7 A;  3JCM d;  2BIV A;  3JB9 H;  3OYC A;  2OJ2 A;  4JS4 A;  4KBM B;  3JB9 G;  4CC4 B;  2CP0 A;  2VAS A;  3HRU A;  3CCU A;  2NLU A;  1VQ8 Q;  2EYX A;  1V29 B;  4K11 A;  5FRO A;  4C0Z A;  4BAC A;  1BK2 A;  2LVM A;  2KYM A;  1YIJ A;  1ZSG A;  3V7R A;  4B9W A;  2JZ2 A;  4RCB A;  3VS0 A;  1JO8 A;  5AT1 B;  4M78 F;  4ME7 A;  4M78 C;  1JRI A;  2HBW A;  2JTF A;  1RLQ C;  3THK A;  3EGD A;  3M0U A;  3UPU A;  1G3Y A;  2CT3 A;  2NUP B;  3G71 A;  3GOX A;  2LDM A;  5CVI A;  1X6B A;  2P4T A;  2E1H A;  3GF5 A;  4E7I A;  1OUL A;  1VQK Q;  1HYO A;  3OYK A;  1H3H A;  1JXO A;  3E9F A;  4M78 G;  5GAN 3;  1NYF A;  2L89 A;  2DEQ A;  1IGQ A;  1N5Z A;  1RLP C;  2LTO A;  1I07 A;  3PE0 A;  1K0S A;  3EFO A;  3OYG A;  1PHT A;  4BB7 A;  4M7A G;  1XOV A;  4HKE A;  1I4K 1;  2PVD B;  1ZBJ A;  4QVZ A;  5IHN A;  2OI3 A;  4ANJ A;  2Y4Y A;  1G3S A;  1BI2 A;  3CME A;  5EC7 A;  4M7A B;  1KQS P;  3G6E A;  1SSH A;  1WHJ A;  2RQR A;  2GQV A;  4XTU A;  4LDW A;  3URG A;  1Q81 U;  4AFQ C;  2K79 A;  4DBQ A;  2MCN A;  2RK1 A;  1VQ4 A;  2LRQ A;  3QUI A;  2HD0 A;  2MOX A;  4JJB A;  3HSB A;  2L0A A;  4LDU A;  1KC8 U;  1HK9 A;  1RAB B;  2CGH A;  1RAA B;  4PJL A;  4GLK A;  3CXC P;  2LQ8 A;  3DB4 A;  2E10 A;  2A08 A;  5IXB A;  2COZ A;  4AFZ C;  3CCJ T;  3I5S A;  4L5G A;  5GMK e;  3CPW P;  2ZZD A;  1HD3 A;  1OPL A;  1BCM A;  1FX7 A;  2G3R A;  5FU7 C;  1AWJ A;  4Y92 A;  5FWC A;  2D9T A;  1GBR A;  1VYT A;  3LYI A;  1K9M U;  1WJR A;  3FJ5 A;  2DF6 A;  2EKO A;  4ZN1 A;  4O6J A;  2OTJ A;  3ER0 A;  5GAO r;  1BIB A;  2DD4 A;  1QCN A;  3VJP A;  2V8J A;  1LJO A;  3MEA A;  2HL3 A;  4V2S A;  2RPN A;  1C1A A;  4RTV A;  2H3J A;  1YCY A;  3VYG A;  1FWZ A;  1NJI C;  1BB9 A;  1VUB A;  2QDL A;  1JJ2 P;  4EMK A;  2JM9 A;  2G6F X;  3QPH A;  1GFC A;  1LNX A;  2PU9 B;  2ZPF B;  5CO7 A;  3JCM h;  3EHR A;  4OMQ A;  2DVE A;  3EG9 A;  3QDF A;  3R6N A;  2QK0 A;  3QJ6 A;  5CAI A;  3LLR A;  3OS5 A;  2F2V A;  3HRS A;  1S72 A;  3RDV A;  1X75 C;  3QJY A;  4BD3 A;  4EIK A;  2CZ7 B;  3VKI A;  3KFV A;  3QXE B;  4J7I A;  3CMA A;  1GCP A;  3EHQ A;  4GY5 A;  5GAN g;  3L1A A;  2FPF A;  1IRX A;  1NG2 A;  3JCM c;  4E2F B;  3I55 T;  2X3W D;  2BZX A;  4IUP A;  5LJ3 e;  2KK4 A;  1D1A A;  2EQM A;  2XI9 A;  4C5E A;  1QVF P;  3OYY A;  1H8K A;  3OW2 P;  4Z8A A;  5GAN j;  4JUV A;  3G4S T;  2ZPE B;  3MP6 A;  4HA8 A;  1JBM A;  1RAD B;  2GFU A;  3CC4 Q;  1B3Q A;  2L3Q A;  3OQ5 A;  3CC4 A;  1QKX A;  2NYS A;  2CUD A;  2ED0 A;  4J9H A;  1M8V A;  1E7O A;  3TRE A;  4JDS A;  5HCK A;  2CRE A;  2MF2 A;  3ULR B;  3TSZ A;  3CCM Q;  4C8Q G;  3M59 A;  4CI0 C;  4BDY A;  2Z0W A;  3E1S A;  1TS9 A;  1LCK A;  3CBM A;  1UEB A;  2X4X A;  5J26 A;  3RMS A;  1ARK A;  3JSC A;  2XD0 A;  3ASK A;  4Y91 A;  4PJO F;  3BDL A;  4C8Q B;  3RER A;  2K5L A;  2NUZ A;  1BI0 A;  1KD1 R;  1AWW A;  3VS3 A;  1SF9 A;  3A1P A;  5GAN f;  2X9H A;  2DZC A;  5GAN 8;  1SG5 A;  1VQK T;  3HHT B;  5EG2 A;  5GAN d;  3REB B;  2VWF A;  4E7H A;  1YN8 A;  1K1Z A;  4KGX B;  4A54 A;  2DO3 A;  3KXT A;  2DIG A;  4M78 E;  5D7U A;  3CCV T;  5IHI A;  2V8I A;  5DLO A;  2ZGW A;  3HP9 A;  2L3S A;  1NPR A;  1PKT A;  4PJO G;  2BUD A;  3SD4 A;  1EFN A;  5GMK i;  2VGN A;  3SFM A;  2D0Q B;  2K5F A;  4XTY A;  3RUX A;  1K73 U;  3GNG A;  5A0G A;  4PJO B;  4PJJ A;  1YI2 T;  3RKY A;  2O88 A;  1KFZ A;  1QVG A;  2BTT A;  3CC2 T;  3N5B B;  5GAM g;  1WHG A;  1TTH B;  5GAO q;  3HKS A;  3MCA B;  1AWO A;  1Y96 A;  2EYQ A;  2MIO A;  5ECA A;  3C0C A;  2GGR A;  3OMC A;  5GMK l;  4OGE A;  2MAM A;  4M75 C;  1M3A A;  1OI1 A;  2CH4 W;  2DIL A;  4C5I A;  2CDT A;  1PD1 A;  3H0I A;  3V8J A;  1YJ9 Q;  3WXM B;  1C6V X;  4OML A;  1VOM A;  1G3T A;  1VYU A;  2FPE A;  3OYI A;  3GLX A;  1CKB A;  2RQU A;  4DEY A;  1RAF B;  4FYY B;  1GCQ A;  2KT1 A;  3EG2 A;  5D6X A;  5GMK j;  1KHI A;  3X25 B;  3CEY A;  4MZT A;  1YJW A;  5A0D A;  4QW2 A;  4M75 A;  5GAM d;  2PUO B;  4KGV B;  1MMD A;  4D8D A;  5GAN 6;  1MND A;  5I21 A;  2RHI A;  2CS7 A;  2YLB A;  1UGS B;  5CKH A;  2QA4 T;  2GBQ A;  1TUC A;  4A4K A;  5FU6 C;  2XDD A;  3CCQ Q;  1K9M R;  2M0Y A;  2BZ8 A;  3QWX X;  1WXT A;  2DET A;  2FYK A;  5GMK m;  2DKG A;  1Z9Z A;  3CCE T;  3A8M B;  4C0D B;  1QVG S;  2CSQ A;  4R0K A;  2DBK A;  4F14 A;  2KY9 A;  1UE9 A;  2VVK A;  1NJI R;  5GAN h;  1YJN A;  4LDX A;  4OB2 B;  3M5A A;  2F2W A;  4CC2 A;  4X9D A;  5LJ3 j;  2X35 A;  4PK4 A;  1KSW A;  2L3P A;  2O2O A;  2JM8 A;  3VS1 A;  2YXY A;  1D3B A;  2QQB A;  2RM4 A;  3UDC A;  4HVW A;  1Q82 U;  1UEC A;  1AT1 B;  2YDL A;  4J9E A;  1VQ7 A;  4FYW B;  3EGX B;  4J5Y A;  5I2S A;  2FVU A;  3M55 A;  4Y28 E;  1QWF A;  4QVD A;  3L2Z A;  1M27 C;  1GL5 A;  3H8Z A;  3FB9 A;  1I5L A;  1XJW B;  1BU1 A;  1SSF A;  4KUI A;  2M0O A;  1I8F A;  3DKM A;  5LL6 S;  3L2R A;  4FT4 A;  5LJ3 f;  4XTX A;  5IAY A;  1LVK A;  2CP3 A;  1WHM A;  4PJM A;  3M9Q A;  3LW5 E;  4PJO E;  3LWI A;  4X9C A;  1MV3 A;  2CSI A;  2KGT A;  3G7Z A;  1QMC A;  1H3Z A;  3GIB A;  2F5T X;  5FRM A;  1MUZ A;  2JMA A;  1T3L A;  5KYY A;  5CCA A;  3HPW A;  2R5M A;  4M77 F;  1VQ6 Q;  3R6O A;  4HCZ A;  1VQN T;  2EGE A;  2JVV A;  4KH1 B;  5KYN A;  2GTJ A;  4HT9 A;  1MMN A;  2L3R A;  2A3L A;  2CT4 A;  3OYH A;  2P0P A;  4N0A A;  2DIQ A;  3SWN B;  2DER A;  3CCS A;  5J39 A;  1WJQ A;  3PTA A;  1UHC A;  3L2W A;  1ZHI A;  2DEU A;  1MMA A;  1QW1 A;  3M57 A;  2RJD A;  1K8A U;  1BI3 A;  1M3B A;  2FG0 A;  5KE2 A;  2Y90 A;  5GAM h;  4M77 G;  3OYF A;  1YJ9 T;  3A8O B;  5FWB A;  4BI4 A;  3F70 A;  1O9S A;  1WHK A;  1VQM A;  2HKN A;  4MMK A;  2ABL A;  1YNZ A;  3VS7 A;  3C4S A;  4M7D F;  3BY7 A;  4M77 B;  3PFS A;  1PRM C;  2COY A;  3CCL A;  1R0C B;  1ZSZ B;  2FB7 A;  3GBQ A;  3MHX A;  2LNH B;  1I81 A;  2CP5 A;  4XTZ A;  5C0M A;  4C92 F;  1BKB A;  1I5O B;  4YTL A;  5CR2 A;  5GMK h;  1HSQ A;  1WLP B;  4KGZ B;  3OYM A;  2RB6 A;  3S3O A;  4ZGD B;  3MEW A;  1KD1 C;  2DMO A;  4RTZ A;  1VQ5 Q;  1ZUY A;  3V7C A;  2YRV A;  4JZ4 A;  4M7D G;  3M0T A;  2P0Q A;  4ZTF A;  4E47 A;  2PNI A;  3D7S B;  4OVA A;  3JCM J;  3CCQ T;  1Y07 A;  1KG1 A;  5J3B A;  4M7D B;  1QKW A;  4C92 G;  3RES A;  3CCU Q;  1C0M A;  2GF7 A;  2DX1 A;  1Q7Y U;  4AT1 B;  1TWB A;  1YIJ Q;  2RQT A;  3I55 A;  5DM7 R;  2DE0 X;  4C92 B;  3OMG A;  1Q86 U;  3SB2 A;  1NZ9 A;  5KCO A;  4IUU A;  2OTL Q;  4JZ3 A;  2IVW A;  2OTL A;  2KI7 A;  1YIT A;  3G71 Q;  1D0Y A;  2KSS A;  5AYF A;  2KYB A;  1RAI B;  4BE1 A;  1NPP A;  4PFP A;  5KCH A;  4RG8 A;  2MI6 A;  2E12 A;  2NUP A;  4OMF B;  5LJ3 h;  1JXM A;  1BI1 A;  2DVJ A;  2D8H A;  3RNJ A;  5A2Q E;  3J80 E;  3L2U A;  1X6G A;  1BIA A;  2EGC A;  1ZX6 A;  2F5K A;  1N8R R;  5CKF A;  1X27 A;  2YWW A;  3QWY A;  2EQU A;  3OY9 A;  2QQ9 A;  2RN8 A;  4M78 B;  2NUT B;  2D8J A;  4JRK A;  2QTV A;  4IUV A;  3WVD B;  2V1Q A;  2PVO B;  4CC3 A;  3CCV A;  3VUZ A;  2WSE E;  3CME Q;  3G6E Q;  1VQ9 A;  5KH6 A;  2ZAE A;  2KVQ G;  3I56 T;  1G2B A;  1VQ4 Q;  4QT7 A;  2RJC A;  4HCK A;  2EW3 A;  1BCO A;  4M7A A;  4A4H A;  1SKU B;  1IHW A;  2KXD A;  1AZE A;  3CC7 A;  2ENM A;  4E7J A;  4JRP A;  2EYZ A;  1YI2 A;  4EMK C;  1OZ3 A;  1GFD A;  3QSU A;  1WJS A;  1Y57 A;  2O4X B;  3CC2 A;  2RHZ A;  4C5H A;  4IIM A;  2XDB A;  2L5Q A;  2QEX T;  3OSV A;  1K9M C;  3S3N A;  2OTJ Q;  2YUO A;  4RUG A;  2LX7 A;  4JPB W;  3JB9 I;  1SPK A;  2K3B A;  1YCS B;  2X3X D;  5CKB A;  1M90 R;  2LMJ A;  1X6O A;  3QYG B;  4M77 E;  2O31 A;  2AKL A;  4J6Y A;  2WSF E;  4HXJ A;  2GFA A;  2RHU A;  2E65 A;  2KRN A;  1RAC B;  2DAQ A;  3CD6 A;  3E9G A;  2VKN A;  2H3E B;  1W2B A;  1JB0 E;  5CKE A;  3G1J A;  1M2V B;  4AFS C;  2C0T A;  4MZP A;  2RHY A;  3M56 A;  1JEG A;  3MP8 A;  1AD5 A;  1EX4 A;  1X01 A;  2HEQ A;  2E6N A;  1S72 Q;  2C0O A;  1VQP A;  4Q5W A;  1V76 A;  2JNG A;  3CMA Q;  1OZ2 A;  1UJY A;  1UB4 A;  4HVV A;  8ATC B;  4N4I A;  2XIC A;  4M7D E;  2VV5 A;  1UJ0 A;  1K8A R;  2R57 A;  1UDL A;  1UGP B;  4ELY C;  5M9O A;  3LWH A;  3NTH A;  2QA4 A;  2FZG B;  3EGU A;  3M0R A;  4DBH A;  4C92 E;  2RQV A;  1NEB A;  3CCU T;  2F69 A;  1U3O A;  4JLI A;  3ZEH A;  1VQ8 T;  1QWE A;  2A37 A;  3HTR A;  2EAY A;  3VV0 A;  3JB9 J;  2K2V A;  3QZ5 B;  1HJD A;  3CCE A;  2ZPI B;  1W6X A;  2YUP A;  1OPK A;  5KYX B;  2F1L A;  2XU8 A;  1CSK A;  1DJ7 B;  3RKX A;  1E6H A;  2JTE A;  3ZBD A;  1WQ7 A;  2LCL A;  3G71 T;  3H6Z A;  2FRW A;  1RI0 A;  1WYX A;  1NLO C;  1WFW A;  2ATC B;  4E6R A;  3CQT A;  3JB9 D;  4LDV A;  3I9Q A;  2DM1 A;  3NHN A;  5HKC A;  1WGS A;  4BY6 C;  2ED1 A;  2MPX C;  2K6D A;  3P8B B;  1G3W A;  1PKS A;  4C8Q A;  1W2B S;  2FZC B;  3CCR A;  1A0N B;  2HBP A;  2ZPG B;  3PMT A;  4F04 B;  3UF4 A;  2LJ3 A;  1PSF A;  2OX7 A;  2RI3 A;  1AEY A;  1ZA1 B;  2K57 A;  2YUN A;  1VQO A;  2XKO C;  1VQL Q;  1VQL A;  3EH1 A;  2A28 A;  4MML A;  4PFZ A;  1UGR B;  3MKD A;  4J9G A;  2C0I A;  3UT1 A;  4F17 A;  5HK3 A;  4BUG A;  2VXF A;  1PSE A;  1M3C A;  1OEB A;  3HFN A;  5CKD A;  4FYX B;  5L23 A;  2FO0 A;  2CYZ B;  2DLP A;  4RTU A;  3VS5 A;  4XU0 A;  2C06 A;  5I2M A;  3PNW C;  3FIF A;  3QZ9 B;  1GCQ C;  4PJO A;  2AT1 B;  3OYN A;  2PTK A;  1ZQ1 A;  4ESR A;  2FL7 A;  4A4G A;  1D0X A;  4J9F A;  4WTO B;  3L2Q A;  4M7A D;  1TUG B;  2KDS A;  4M75 F;  2HMA A;  1VQN A;  3OSS C;  1YHQ A;  2Y4X A;  2ROT A;  2IG0 A;  4RTT A;  3VRZ A;  3PVL A;  1D1C A;  2OTJ T;  3L2V A;  3JCM e;  3O5Z A;  1MGQ A;  1MNE A;  3C94 A;  3EFS A;  4PFO A;  3X26 B;  2HQX A;  4X34 A;  3MPU B;  5IH2 A;  2EGA A;  1WDX A;  1OU9 A;  1K0X A;  2PUK B;  1TXQ A;  4FW1 A;  2E3I A;  4L59 A;  1Q81 R;  4M75 G;  3QKJ A;  4DOV A;  3OYE A;  1YJW Q;  9ATC B;  3LGF A;  2KT8 A;  4DOW A;  5LJ5 e;  5GAO p;  1G8X A;  2V1R A;  2HL5 C;  1KC8 R;  3ME9 A;  3CPF A;  1UUE A;  3GNF B;  3ZL7 C;  1AOJ A;  3TU4 K;  4PKC C;  1E6G A;  2DL4 A;  2WSC E;  3M0Q A;  2M51 A;  3WVE B;  4HVU A;  3M4G A;  2EQJ A;  4F7U F;  2JMC A;  2DA9 A;  3EG1 A;  2I0N A;  2LT4 A;  1IRE B;  2MWO A;  1N8R C;  1QCO A;  1M5Q 1;  1NM7 A;  2J05 A;  2D6F A;  1U06 A;  3JCM Q;  3JCM V;  5GAN 7;  3X24 B;  1JQQ A;  5GJV B;  2HKQ B;  4WF2 A;  2RQW A;  2DTI A;  3UWN A;  5LJ3 g;  3CC4 T;  2EJG A;  1YJN Q;  4F7U G;  1ABQ A;  2P4R A;  1RAG B;  2YLC A;  4BI3 A;  4J8O A;  5HY6 A;  2I2L A;  5GJW B;  2ESW A;  3QO3 A;  2DJQ A;  3VUB A;  4RKU E;  3CCM T;  3M0P A;  3HL8 A;  4F7U B;  5HK0 A;  5FU6 B;  4EPC A;  3A98 A;  3SHW A;  3HFO A;  3OYB A;  1WIE A;  1RI9 A;  1KQ1 A;  4PLL A;  4EMG A;  2EWN A;  4XTV A;  1VQ7 Q;  1KJW A;  2DJZ A;  1P92 A;  4PJN A;  2QI2 A;  1IB8 A;  4LN2 A;  2HCK A;  1BYM A;  1KK7 A;  2RHX A;  1QVG P;  2LCC A;  1PM3 A;  2YT6 A;  4KRT A;  2LCS A;  2HQE A;  2X4W A;  5FRN A;  1W4S A;  4N0A C;  1M1F A;  3EGX A;  1OOT A;  3A8G B;  1M90 C;  4C8Q D;  3NPF A;  1UGV A;  4L6V 5;  2LQN A;  1M1K U;  4E7L A;  1OQK A;  2DL8 A;  4NL3 A;  5LJ3 d;  2K2M A;  1B34 B;  5A0L A;  5KYU B;  2IIM A;  2YUQ A;  2EPD A;  3U23 A;  2BE9 B;  3VS4 A;  5KYW B;  4B6M A;  1K4U S;  3NTI A;  3V7S A;  4BE0 A;  4LE9 A;  1QCF A;  3TEE A;  2LX9 A;  4JS5 A;  4XU2 A;  4MDX A;  3TCJ A;  4MZM A;  3FEO A;  3CCS Q;  2DXU A;  3I56 A;  1R8O B;  5FLX E;  4KUL A;  2M02 A;  4OMO A;  2DYI A;  5I11 A;  3LX7 A;  3NGP A;  2KQW A;  4PJO D;  4RCC A;  2J06 A;  3TVT A;  1U1T A;  2FPD A;  1V1C A;  3SWN A;  1K8A C;  4J6W A;  2JJ9 A;  1FXX A;  3CCJ A;  2W0Z A;  3UA7 A;  1M9S A;  3NMZ C;  1TU0 B;  2RA2 A;  1IZ6 A;  1VQM Q;  3PIP A;  2K4Y A;  1KQS A;  2VXE A;  2QEX A;  3E2U A;  4GBQ A;  3RMQ A; 
#chains in the Genus database with same CATH homology
 3CCL Q;  3CMA Q;  3CC4 Q;  1YIJ Q;  1VQ5 Q;  1JJ2 P;  1VQN Q;  1VQ4 Q;  1K73 R;  3I55 Q;  2OTL Q;  1YHQ Q;  2OTJ Q;  1VQ6 Q;  1KD1 R;  1VQK Q;  1VQO Q;  1YJ9 Q;  1Q81 R;  1VQL Q;  1NJI R;  3CCQ Q;  1YJW Q;  1K9M R;  1Q7Y R;  1YJN Q;  3CXC P;  3CCJ Q;  3CCE Q;  1QVF P;  3CC7 Q;  1VQ7 Q;  3G4S Q;  1K8A R;  1M90 R;  3CCV Q;  3CCM Q;  3CME Q;  1KC8 R;  1Q82 R;  3CPW P;  3CCS Q;  1YI2 Q;  1VQM Q;  1KQS P;  3G6E Q;  1Q86 R;  1VQ9 Q;  3I56 Q;  3OW2 P;  1S72 Q;  1YIT Q;  2QA4 Q;  3G71 Q;  1VQP Q;  1N8R R;  2QEX Q;  3CCU Q;  1M1K R;  3CCR Q;  1VQ8 Q;  3CC2 Q;  1W2B P;  3CD6 Q;  1QVG P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...