1VQPQ

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqpQ00
3CCVQ 1KC8R 3CCUQ 1VQ6Q 3I55Q 3CCMQ 1YJ9Q 3CPWP 1VQ8Q 3OW2P 2OTLQ 1M90R 3CCEQ 1YI2Q 3G71Q 1KQSP 1VQOQ 1VQ4Q 1K9MR 1Q86R 1JJ2P 1QVGP 3CD6Q 1VQ5Q 1YITQ 3CCSQ 3CMAQ 1NJIR 1K8AR 1KD1R 1Q81R 1Q82R 1N8RR 3CCRQ 1VQLQ 1QVFP 1VQ7Q 3G6EQ 3CXCP 1W2BP 1VQ9Q 1YJWQ 1K73R 3CMEQ 3G4SQ 3CCQQ 2QEXQ 1S72Q 1VQPQ 1VQKQ 1VQMQ 3CC4Q 1M1KR 2OTJQ 1YIJQ 3CC2Q 2QA4Q 3CC7Q 3CCLQ 1YHQQ 3I56Q 1Q7YR 1VQNQ 3CCJQ 1YJNQ
chains in the Genus database with same CATH superfamily
3CCUQ 2A28A 2DL7A 5GAN6 2K79A 2HD0A 4XTWA 3OS2A 1W6XA 2QK0A 1AWXA 2RMOA 2NLUA 1H3ZA 3A8LB 2YWWA 2RQRA 1UGSB 4A4GA 3L2UA 1K8AC 3S3OA 5GMKi 1MMGA 1YBYA 3PFSA 1ZBXA 1VQNA 4M7AA 3NGPA 2RQWA 3JCMb 4RMOA 4TVRA 1U1TA 3JSCA 1VUBA 3EH1A 3VYHB 1QVFP 3NTKA 3G4SQ 1GRIA 1YFNA 2E41A 4JJDA 3G4ST 2FPFA 1EIFA 2ZGWA 4EDUA 4OVAA 3GPLA 1NE8A 2RM4A 3OYKA 2FYKA 4A4EA 4LD6A 1M90R 2KROA 2NUPB 4C92F 2OTLA 2F2XA 2E4HA 4N4GA 3SHWA 5I11A 2X4JA 2R58A 1WZOA 2RQVA 2EYWA 1OX8A 4CC2A 2YLCA 3TREA 3M57A 3TU4K 1SSHA 4M75F 2MF2A 4F7UG 3H0FA 4JRIA 3L2ZA 4BY6B 2L3SA 5A2QE 2ZPIB 2KI7A 2F2VA 4C0DC 1Q7YC 3OW2P 4C8QC 4XTYA 3DB3A 3GLXA 3TSWA 1IXDA 2FG0A 4D8DA 3MKDA 3FDRA 3RMSA 1X6GA 1S72Q 1WQ7A 1IGUA 5IXFA 1T0HA 4M77C 3M5AA 3M58A 5D6XA 1K73C 3I56Q 2ZAEA 2PVDB 1Q81C 1AD5A 2P0KA 3RERA 1NEBA 2G6FX 1MV3A 1QVFS 3VS6A 4M7DG 5LJ5e 1K9MR 2XDPA 1IHWA 4RCCA 1WQWA 3CEYA 3IQLA 5GMKh 3C4SA 3BFMA 4RTWA 2Y4YA 1VQ9T 4IIMA 3X28B 2RNAA 1AOJA 2GBQA 4XU0A 2YRCA 2RHYA 2AKKA 2HBPA 4L59A 4DEXA 1YCYA 1WJRA 1OULA 2ROTA 3ZBDA 1W2BA 1YJNT 1BI1A 1ZA1B 1W1FA 2Y4XA 4J6XA 2V8KA 1N8RU 3QBYA 2I0NA 3E1SA 4M7AB 2KT8A 1ZQ1A 1D1AA 2MOXA 2LC4A 1YJ9T 2CZ1B 3SB2A 1G5VA 2DTOA 3MP8A 5GMKj 5I2MA 1VQ5T 2EAYA 1OZ3A 3EG2A 2MWOA 3MP1A 3VS2A 2W0ZA 4C8QE 2JJ9A 3OS0A 1UGVA 4HCKA 5CKFA 3UA6A 2WSCE 1GFCA 1VQ4T 2QEXA 3J81E 4OMNA 4E47A 1MNEA 3PMIA 1AWJA 2DA9A 3CC4A 2ENMA 8AT1B 2K7AA 5KYWA 2D1XA 1Z9ZA 2K4YA 2MYSA 4J8OA 4J9DA 1RAEB 3P8HA 1VYVA 4JJNK 3UDCA 2IVWA 4EMKC 2JW4A 2VXEA 2COZA 5FROA 4R55A 4DA4A 1TG0A 2XK0A 4C0ZA 3CPWP 5CVIA 4A53A 2EJGA 4M78C 2CP2A 1YP5A 4BDZA 4QVZA 2Y90A 1N9SA 1Y57A 2VKNA 2EJFA 5CKHA 4QVDA 2F2WA 5KYXB 4IUUA 4PJOG 1K76A 5LJ5f 4ZTFA 1D09B 3S6WA 1TOVA 4PJOD 2EQIA 3EG0A 4II1A 3EGXA 4WTOB 4FIBA 4PJLA 1GFDA 1M4ZA 2OTJA 1TUGB 4XTZA 4PFZA 2CP5A 4R0KA 1Q81U 5FU7C 4HCBA 1QVGA 1QKWA 2QDLA 3EGUA 3MJXA 4E7HA 2KQWA 3GBQA 3UWNA 3C95A 2XKOC 4OMLA 3X24B 1BYMA 2FRWA 2PU9B 3I55Q 4RTVA 2XD0A 3M59A 5CKEA 3I55T 2HDAA 3V8LA 3HFNA 2ATCB 4IUVA 1VQ7Q 2JOYA 4BI4A 2JTEA 3TVTA 2MCNA 2P4RA 2X4YA 3V7CA 1CKAA 2PQWA 1V76A 1GCQC 1QCOA 2RD1A 4RTYA 3VRZA 2ZPFB 1D0ZA 4EMGA 3RESA 3HRUA 4ELYC 2B86A 3F70A 4PJJA 5I2SA 1KHCA 4R56A 1WDXA 3PNWC 4M75E 2PUOB 1TUDA 2QG9B 1XTDA 1Q95G 2RHXA 2ZCFB 5GAMe 3NPFA 5IXBA 1LCKA 3MEVA 1OV3A 5GANe 1RABB 2OX7A 4RTTA 3EHRA 2RI2A 5GAOn 1AVZC 1TXQA 3L1AA 2DBMA 1U8RA 2G3RA 2X35A 2OI3A 2DXBA 1VYTA 2F69A 4RTZA 1JJ2A 3HRSA 2E1HA 3G6EQ 4LDVA 3VU3C 3HPWA 1GCPA 5KYYA 3G1JA 4NS5A 3G6ET 3THKA 2XI9A 1OYXA 1GXIE 3FIFA 4M7DE 4F7UF 4FYXB 1X2KA 4WCIA 2RI5A 2CP0A 4C92G 4JPBW 1UHFA 3A5ZB 1G2BA 4BE2A 4M7DD 3M55A 2L3QA 5GAMd 2FHDA 1WHJA 2KRMA 3FC3A 2HEQA 3M4GA 5KYNA 2PVGB 1RAIB 1K73U 1RACB 1NPPA 2FEIA 4FU6A 3OS5A 2HZYA 4UC4A 1RAGB 3LW5E 1IREB 3P8DA 3OY9A 1SKUB 4RTXA 3CCLQ 4Z8AA 3OYFA 2RQTA 3CMAA 3ULRB 3ZFJA 2RO0A 2QYZA 2JMAA 4DEYA 1Q82R 1ARKA 4HCZA 4F14A 4IKFA 1VQ7A 4MMLA 1G3YA 1G3TA 4J9BA 3CCSA 1VQMQ 4J6YA 2CREA 2JMCA 5I22A 3OYJA 1NLPC 3LYIA 5HCKA 5GANg 4DQ2A 2YSQA 3MCAB 2CDTA 3PE0A 1YIJT 2RA2A 5L23A 1QVGP 4M78G 2V26A 1YJWA 2LTOA 2H3EB 1M2VA 2ABLA 2V1QA 3BE3A 2K2VA 1QCNA 3G7ZA 3HKSA 1KFZA 1Y96B 2ESWA 4JJCA 1SRMA 5A0GA 1RAFB 3TEEA 3OYCA 4OGEA 4E7IA 2FL7A 3EGDA 4M77B 1XOVA 3PVQA 1D3BA 3JCMX 5CR2A 2AKLA 1I8FA 4M75C 4E7ZA 2C0OA 1SG5A 1ZLMA 1QP2A 2XMFA 2RF0A 3EFOB 3OYBA 4V2SA 3TSZA 4XK8E 2LT4A 4C8QF 2F1LA 2HMAA 5D7UA 1QW1A 4DBQA 2DD4A 3J80E 2B8AA 3GF5A 1QP3A 3VJPA 1PWTA 3OYIA 4M77F 3LGLA 4FL6A 2F5TX 4J9GA 3H0IA 1LVKA 4XQ3A 2LQWA 3JCMP 1YJNA 3QZ5B 1V1CA 4OMQA 1VA7A 3PT9A 1NZ9A 2KAFA 3C12A 3A8OB 2VGMA 4QQDA 4A4FA 3FJ5A 3KUFA 1T3LA 2PVOB 1X6OA 1WX6A 4EIKA 2DBKA 1UJYA 3E9FA 1FWZA 4M7DA 1VYUA 2K3YA 1X27A 2AZVA 1VQ7T 2XU8A 4LE9A 2LCSA 2YXYA 3OMCA 3CCLA 1KD1R 2DPPB 2FRYA 2KRNA 1KQSA 2NUTA 3OYLA 1M90U 4JLIA 1FMWA 2O01E 2KR3A 2EFIA 2FO0A 5GAMf 3CCUA 3CCST 4M78E 4M7DC 3QSUA 2BZYA 2KXDA 2QGFB 3GIBA 2J6OA 4LN2A 1JJ2P 4KH0B 3VS4A 4HA8A 4BI3A 1K4US 4OMPA 1Y96A 1K73R 2W10A 1M1KR 2O9SA 4M75B 3VUBA 2RK2A 2JUFA 1VQPT 2V8IA 5GAN7 3PGGA 2OAUA 5FWBA 2CZ7B 1KC8U 4JUVA 4AFUC 2HBWA 1SF9A 4A4HA 2LJ0A 4FW2A 1YHQA 3LX7A 4F04B 3JCMJ 3MEWA 4KT0E 4DBFA 3CPWA 3CC7T 1PHTA 3CD6A 4QVCA 1IHVA 2CH4W 2HKQB 1RLQC 3X25B 2L89A 1X75C 1E6HA 1RI0A 3BDLA 1UDLA 3OYNA 4B9XA 5AT1B 7AT1B 2AT1B 1QVPA 2F5KA 1ABQA 1RUWA 2EQUA 2FPDA 3EGDB 3G71T 3S3NA 3QG1A 1UB4A 4MZMA 1YNZA 1ZBJA 1GL5A 2CUDA 2FVUA 2WSEE 2DIGA 3PVLA 1WHMA 2C0TA 5CKDA 4A63B 1VQ6Q 2X4XA 5IHKA 3A8GB 4FT4A 3RUXA 1MMDA 1O9SA 1UECA 3CCET 2EJ9A 4FSSA 3S3MA 4BACA 5KH6A 1OEBA 1K9MU 3FEOA 4GY5A 4DBRA 4M77D 2O31A 2KXCA 4QQ6A 2LNVA 1U3OA 2ED0A 5HKCA 1VQ9A 1PC0A 3VKIA 2JXBA 4X9DA 3QPHA 4C0GA 2QI2A 1MGQA 4C8QD 2AK5A 2E64A 5DLQE 1ZSGA 1WJSA 4OB0B 3RR6A 2KY9A 4MZPA 3JCMQ 3PIOA 1YN8A 1BBZA 2M1HA 2AZSA 3FB9A 4OMFB 2E6NA 2M02A 1VQOA 1X6BA 1HXDA 1VQ5A 1Y07A 1W70A 2O4XA 1QVFA 4F7UE 1FMVA 1PRLC 1Q82U 1RAHB 1D0XA 1G8XA 3JB9I 1SSFA 1ZA2B 4JRQA 5GAN3 2COWA 3CCRT 5FW9A 2QXFA 2RH2A 2DXTA 2EW3A 1CSKA 1RL2A 4J9CA 4PK4A 1HJDA 2XDDA 2K2MA 4M77A 1RADB 2KEAA 5J3BA 3CC7A 4MMKA 1UTIA 2O9VA 3QYHB 4ZGEB 2K6DA 1K8AU 1BB9A 2LRQA 3CC2A 2DNUA 1U5SA 4PFOA 1OPLA 1B07A 2GNCA 4NL3A 3HFOA 2CYZB 1K0SA 2R5MA 4GLKA 4ESRA 1OI1A 1X43A 3ZEHA 4KUIA 1O75A 2VC8A 3C0CA 1B34A 4D6WA 5M9OA 2E65A 3H41A 5D6WA 3M54A 5GAOq 4JZ4A 1GCQA 1QKXA 1T3SA 3NTHA 1NPRA 5GJWB 2LQNA 5FLXE 3L2QA 2DM1A 3CCRA 5FU6C 1SRLA 1U1SA 2KYBA 2QDYB 2NUPA 9ATCB 4EMHA 1MMAA 1KQSS 1VOMA 2LDMA 2OJ2A 4PJOE 4M78D 1H92A 1Y71A 1VQKQ 1UG1A 3Q1JA 2DVJA 2MMPA 2L3RA 4RCBA 1NJIC 3JCMg 3I5RA 2HSPA 1UEBA 3JB9G 3M0TA 4BB7A 4KULA 2DFUA 4DOVA 4PNOA 2MIOA 3T9NA 1NBEB 1JO8A 4B6MA 3GP8A 1TUCA 2A3LA 4M7DF 2V8JA 4E7LA 3L42A 2QASA 2DL4A 5J26A 4M7AG 4JJBA 2LT1A 4KRTA 5FRNA 3OYAA 2QQRA 2X4WA 1I1JA 3L2RA 3RKXA 2CZ6B 4L6V5 3EG1A 2E10A 5EG2A 3KFVA 3EG3A 1R8OB 3OA6A 2DEQA 4HVWA 1WLPB 4M78B 4ME7A 4FM4B 2K5LA 3CMAT 2ZPBB 5GAN8 1AZGB 3V7RA 2RJCA 2M0YA 3VRYA 3BW1A 2L8DA 2JN0A 3UT1A 3I56A 4N0AA 4AMCA 3WVDB 1OPKA 2DE0X 3RKYA 4OF1A 2HQEA 4OMOA 4Z02A 1HSQA 1PSEA 3OS1A 1M8MA 3CPWS 1SHFA 3X20B 1RLPC 1JB0E 2L5QA 1YIJA 2JNGA 1OQKA 2JTFA 3OYGA 1Z9QA 5CQYA 5C0MA 1M2OA 4B9WA 2YUQA 4Z89A 2CGHA 5EC7A 1TTHB 4F16A 1MV0B 4MZTA 3NHNA 2YUOA 5A0LA 3G71Q 5KCHA 1PKSA 3QDFA 1PM3A 5IAYA 1YI2A 3NMZC 1TH7A 2AHJB 4PJOB 1NYGA 2EYZA 3MEUA 2XDBA 1VQ6T 1WGSA 5GAMg 4J83A 2DVEA 4QT7A 1AEYA 1NLOC 1KD1C 1KQ1A 4M7AC 2CT3A 2L3PA 2R5AA 2KNBB 1YI2Q 1LJOA 4XTXA 1WYXA 4XTVA 1YITQ 4AT1B 2K57A 4NOYA 3I5SA 2O88A 2GTOA 2LP5A 3A8MB 3QO3A 5LJ3g 2LJ1A 2EYQA 1ZSZA 2CP3A 2EVRA 5LJ5h 3JCMc 3QXEB 2QQSA 2EGCA 2RN8A 3CCUT 4EMKA 1LNXA 1B7TA 5GMKe 8ATCB 2CSIA 1WI7A 5ECAA 3QHSA 2KDSA 5J39A 1UUEA 3JCMf 2QTXA 2HKNA 1HYOA 1PD0A 1D1BA 3QYGB 5FU6B 2OTJQ 3M56A 2JZ2A 1BI2A 4VUBA 1AT1B 3QJ6A 3R6NA 1KQ2A 1AWWA 2DX1A 1VQ8Q 3ZL7C 1X01A 5LJ5g 3LWHA 4C8QA 4HVUA 4IUPA 3EAEA 3CMET 3AT1B 2K3XA 2D8HA 4AG2C 5FU7B 1C0MA 3M0SA 4LDWA 3CMEQ 4AFQC 1SHGA 1PD1A 3CD6T 2BE9B 3LH0A 3BDUA 3OYMA 4FYWB 1GBRA 4OGCA 4F17A 1I0CA 4YTLA 2P0QA 2O4XB 4OMMA 2YT6A 5KYWB 1MMNA 3RIRA 4ELZC 2KSSA 4IUQA 4Y91A 2QAZA 3RMQA 2MPXC 4A54A 3INZA 2GFUA 2IIMA 2M51A 2OAWA 2JTMA 4MDWA 1QCFA 1XQHA 1KIKA 5GAN4 1QVGS 1C1AA 5KYUA 2HL3A 2M0OA 4FCYA 4EMKB 1EFNA 4C5EA 1Q86U 4FYYB 4JS5A 3FLGA 2DERA 1M3AA 3CCJT 1QQJA 1BIAA 3I56T 1H3HA 2K5IA 3OBYA 3VUZA 4M78A 2CP7A 2GFAA 2PTKA 2BTTA 2KK4A 3EH2A 1VIEA 1N6AA 3VS5A 3OQ5A 1VQ9Q 2YLBA 3SEMA 3TQ7P 4LD9K 2DXCA 2MWPA 2SEMA 4BE0A 2QGGA 4J5YA 4RG8A 3CCEA 1EZZB 1YJNQ 1VQOT 1WFWA 3HP9A 3JB9H 2GF7A 3HTRA 4AFSC 3JCMh 2HAXA 1VQOQ 3LLRA 3V7SA 1UGPB 2FB7A 3CCSQ 1B3QA 3OW2S 1OU8A 1PRMC 4IURA 4OP0A 3FJPA 1G83A 1AHJB 5CO7A 1R77A 1YWPA 1GBQA 2J06A 1ABOA 2GQIA 3CMEA 3DKMA 4CRIA 2OTLT 3SWNC 1VQNQ 4PFPA 2J6FA 1G3WA 5GANj 2KE9A 4ZGDB 5KYUB 1HK9A 3CC4T 2OTLQ 3P8BB 4Y92A 4C92D 1BCOA 1PKTA 3EFRA 2ZPEB 1WHGA 1SEMA 2DETA 4XU3A 4ORZA 1UHCA 4JDSA 4QKUA 3AHUA 3H6ZA 4LUDA 1U06A 2BZ8A 2DD5A 2BIVA 1BKBA 1KG1A 1M8VA 2EYXA 2RJEA 3CQTA 4M7AE 4F7UB 1VQ6A 1IB8A 1JJ2S 3BY7A 3G4SA 1I07A 4K11A 2GGRA 5GAMh 2SRCA 2X3WD 1Q86R 4LDXA 4M77G 3E19A 5GANh 2COYA 3CBOA 3DLLA 1TU0B 2JM9A 5GAOr 3DLMA 3OSSC 4C5GA 3CXCP 5IHIA 4PJOF 2DF6A 4C8QB 4ZTJA 2H3JA 1BU1A 3E9GA 2NYSA 4BY6C 1S72A 1F1BB 1M3BA 3QDRB 2XICA 1TSFA 4M7AF 3OSVA 4C92E 3GOXA 3CCMQ 2HQXA 4M7DB 3CCMT 3H8ZA 1ZUKA 3GNFB 3PTAA 1WXUA 4Z88A 1IZ6A 2E5KA 3CBPA 2A08A 2BE7D 2M9UA 1TWBA 1M3CA 1ZX6A 3JB9F 3HRTA 4N4HA 1Q86C 2LQ8A 5IHNA 1WHHA 2DZ9A 5L8RE 2VWFA 2E3HA 3CCLT 1OOTA 2LCLA 3SWNB 2FZCB 5DM7R 1FXXA 2QEXT 3X26B 3OYHA 2A37A 2DXUA 2DL5A 5CIUA 1RI9A 2I2LA 1YJ9A 1WPYA 4KBMB 2DJZA 1W4SA 4C5IA 4DBHA 5LJ3d 1T0JA 2CUBA 1N9RA 3MO8A 3CPFA 5KE3A 3EG9B 1VQMT 2QQ9A 4KH1B 3H9NA 2BZXA 4M77E 1HD3A 1C6VX 4EPCA 2NWMA 5GAN2 2X9HA 2KGTA 2A36A 2EBPA 2KMTA 1KC8C 1UGQB 1M1FA 4NL2A 2VGNA 3JV3A 2PZ1A 3M4YA 4PLLA 3VV0A 1K1ZA 3WVEB 2ZPHB 2YUPA 2EWNA 5GJVB 2VASA 4KGVB 2KT1A 3CCVA 2IG0A 3CD6Q 4GBQA 4D8KA 4XU1A 2BKDN 2E6ZA 4C0FA 3G6EA 2EYYA 1M2VB 3JCMe 2RHUA 4J7FA 3CXCS 4N0AC 3HL8A 3M0RA 1VQMA 2K9GA 1P92A 2RJFA 4E2FB 2BUDA 4MDXA 3CCQT 4OB1B 1M1KU 2DO3A 1AZEA 2PNIA 2MAMA 3LGFA 2JVVA 2DILA 6AT1B 1NJIR 1WNLA 2D8JA 3OYYA 3QKJA 1M9SA 1JXMA 1LOJA 1KSWA 1QLYA 3CC2Q 2L2PA 2GQVA 2CH4A 5DLOA 4BE1A 1WXBA 4RTUA 1KD1U 2VYTA 4LUEA 1S72T 3JAME 2KYMA 4LDUA 2HL5C 3JCMd 1TS9A 5HY6A 3JB9J 1BK2A 4KGZB 3DB4A 4BI8B 4M75D 3MP6A 1G3SA 1A0NB 2XHCA 4P5NA 4XU2A 1VQKT 1VQ8A 4J9EA 4BUGA 1R0CB 3TCJA 3I55A 4HXJA 2CSQA 2RPNA 3I9QA 4X34A 1XNIA 2P84A 3NTIA 4RKUE 3CXCA 1ZSZC 2VXFA 4LXCA 4HVVA 1VQPA 5HK0A 2RJDA 4PL6A 4Q5WA 4HT8A 2EQMA 5LJ3j 2YRVA 3SFMA 2DMOA 4JS4A 5FWCA 2QQBA 1YHQQ 2JM8A 5GAN5 2GCXA 3HSBA 2A7YA 5LJ3f 3CCMA 2CZ0B 1VQLA 3FRNA 5GAOl 1R0BG 2DYIA 4C5HA 1Q81R 1IGQA 2YRDA 4HKEA 3CC4Q 5GMKm 1M1KC 2V1RA 2ZZDA 3NFCA 2A0FB 4X9CA 5CK9A 3H0HA 3SDZA 1FMKA 1OZ2A 2J6KA 3CMAQ 1UFFA 4JRKA 5LJ3h 2LNHB 2H8HA 5AYFA 2DTHA 1X2QA 2FZGB 4C92C 3C94A 1EX4A 5LJ5j 3M0QA 4J6WA 2FPEA 1FYNA 4E6RA 3MHXA 1UGRB 3UPUA 1W2BP 4PJOC 3JCMV 1NYFA 2NUZA 4ZN3A 2HCKA 2ED1A 2RB6A 2QA4Q 3CC7Q 2JT4A 4JLGA 5GAOp 4E7SA 4M7AD 2QA4T 3RDVA 3QIIA 1S1NA 4CC7A 3CCQA 4DOWA 4C92B 3EHQA 4ZGJB 1NJIU 1OU9A 1I81A 3VS1A 2P0PA 2LMJA 4HCCA 3J7AF 3E2UA 4KGXB 3CBMA 3MEAA 2ROLA 4PJOA 1KJWA 1VQ4A 2CKKA 3UF4A 2EIFA 3CCVQ 4CC4B 4OB2B 3LWIA 4CI0C 2DAQA 1JEGA 4F7UA 3A1PA 3QUIA 1K8AR 1MNDA 2XIDA 2DEUA 4CC3A 3PIPA 1JXOA 4J7IA 3UATA 3L2WA 4QW2A 3G71A 3O8VA 2E70A 3JCMW 1YITT 1M1GA 2CS7A 2E5QA 5I21A 2RHZA 2RHIA 2VVKA 5GMKl 3QWXX 3PMTA 3CCJA 2L0AA 1VQKA 2LJ3A 3M53A 4IUTA 1WA7A 1K0XA 1YWOA 2CP6A 4O5VA 1WIEA 1D0YA 3OYEA 3SD4A 1PNJA 1VQLQ 2XG8D 1Q7YU 2EQJA 1CKBA 3VS7A 3VYGA 1E7OA 2D6FA 3KBGA 1H8KA 1VQLT 1E6GA 3QWYA 2LZ6B 2C06A 4M4ZA 1QWEA 4L5GA 2D9TA 1ZUYA 1IO6A 4FYVB 4J9HA 2RK1A 1PCXA 2OTJT 4A4KA 1M90C 3R6OA 5CAIA 3OBWA 2VUBA 2M16A 3META 2D0QB 4ZNXA 1D3BB 1I5LA 5LJ5d 2RI3A 2WSFE 1VQ8T 1LPLA 5FRMA 5HK3A 2R57A 1BIBA 4FW1A 4ANJA 1DJ7B 2K3BA 4FSXA 2P4TA 1BCMA 2DZCA 5IT9E 1N27A 2D0NA 2J05A 4PKCC 5A0DA 4C92A 4HT9A 1WHLA 2VV5A 2AIRB 2LVMA 2GTJA 2DRKA 4XAXB 2YDLA 5IH2A 3O5ZA 2LCCA 1Y0MA 2EGAA 5CKBA 1VIFA 5IN1A 1WHKA 2DIQA 1ZHIA 4RG2A 3CCQQ 1VQPQ 4XTUA 1JRIA 2DK3A 2X51A 4J9IA 1KHIA 2DLPA 1Q7YR 4PLIA 3I35A 2IPOB 1Q82C 2KVQG 2VB6A 3M0PA 4M78F 1I5OB 3N5BB 2EGEA 2MI6A 3REAB 2LX9A 3ME9A 1MUZA 3CC2T 1RAAB 1N8RR 4J9FA 5LJ3e 1D1CA 4AFZC 3EG9A 3OW2A 3QZ9B 4C8QG 2YHTA 3EFSA 3CCJQ 2HQHA 1AWOA 2MK5A 2KRSA 3OB9A 4GLMA 2ZPGB 1PSFA 3M0UA 4N4IA 1M5Q1 2LQKA 1XJWB 3MPUB 2K5FA 3SWNA 1B34B 1QMCA 1SPKA 1WJQA 2NUTB 4M75A 5GAOm 3EFOA 4PJNA 3ER0A 5GANf 2QA4A 4PJMA 5GAMj 2YUNA 1K9MC 2DJQA 1QWFA 1YCSB 2E12A 2LX7A 1KC8R 1YITA 2QQAA 2DL8A 4OB3B 2HNIA 3CCEQ 3URGA 3L2VA 1JU5C 3REBB 1M27C 1YHQT 1V29B 2X3XD 4QQGA 2O2OA 3OMGA 3U23A 2EKOA 1JQQA 1BI3A 3A98A 1IRXA 4E7JA 2DKGA 1JBMA 1KK7A 2C0IA 3QJYA 3HHTB 1UE9A 1YJ9Q 5CCAA 3OYDA 2EPDA 1UJ0A 3EGXB 2DRMA 4ATOA 2EQKA 1VQ5Q 1VQNT 1NEGA 1W2BS 4JRPA 3VS3A 5D6YA 4X1VA 2JS2A 2RQUA 1ZSZB 1N8RC 2E3IA 2WACA 1YIJQ 1WXTA 3ASKA 2HSEB 1J3TA 4RUGA 4ZN1A 4M75G 2DYBA 1OX9A 1MHNA 3RBBB 4C0DB 4O6JA 1VQ4Q 2QTVA 3RKWA 4LDYA 5KE2A 2FZKB 3CCRQ 4WF2A 3VS0A 2ECZA 1N5ZA 2DTIA 1ZUUA 3D7SB 4AG1C 5DY9A 1BI0A 4E7KA 3A8HB 5LL6S 1X69A 3KXTA 3RNJA 1ACMB 4Y28E 4FT2A 5KYXA 1Y7XA 2J7IA 3JRZA 1PG5B 3LH5A 2CT4A 3UA7A 2KBTA 3V8JA 4KUDK 1YJWT 1FX7A 1YJWQ 5KCOA 1K9AA 1NG2A 3CCVT 1NM7A 3V8KA 2PUKB 1M30A 2JS0A 1H641 2EKHA 5C6SA 5GANd 1KQSP 1I4K1 5CQXA 4JZ3A 1YI2T 3GNGA 2DL3A 2Z0WA 4IIOA 2QEXQ 3M9QA 4BDYA 3JB9D 4BD3A 4LNPA 5KYYB 3WXMB
chains in the Genus database with same CATH topology
3CCVQ 1KC8R 3CCUQ 1VQ6Q 3I55Q 3CCMQ 1YJ9Q 3CPWP 1VQ8Q 3OW2P 2OTLQ 1M90R 3CCEQ 1YI2Q 3G71Q 1KQSP 1VQOQ 1VQ4Q 1K9MR 1Q86R 1JJ2P 1QVGP 3CD6Q 1VQ5Q 1YITQ 3CCSQ 3CMAQ 1NJIR 1K8AR 1KD1R 1Q81R 1Q82R 1N8RR 3CCRQ 1VQLQ 1QVFP 1VQ7Q 3G6EQ 3CXCP 1W2BP 1VQ9Q 1YJWQ 1K73R 3CMEQ 3G4SQ 3CCQQ 2QEXQ 1S72Q 1VQPQ 1VQKQ 1VQMQ 3CC4Q 1M1KR 2OTJQ 1YIJQ 3CC2Q 2QA4Q 3CC7Q 3CCLQ 1YHQQ 3I56Q 1Q7YR 1VQNQ 3CCJQ 1YJNQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV Q;  1KC8 R;  3CCU Q;  1VQ6 Q;  3I55 Q;  3CCM Q;  1YJ9 Q;  3CPW P;  1VQ8 Q;  3OW2 P;  2OTL Q;  1M90 R;  3CCE Q;  1YI2 Q;  3G71 Q;  1KQS P;  1VQO Q;  1VQ4 Q;  1K9M R;  1Q86 R;  1JJ2 P;  1QVG P;  3CD6 Q;  1VQ5 Q;  1YIT Q;  3CCS Q;  3CMA Q;  1NJI R;  1K8A R;  1KD1 R;  1Q81 R;  1Q82 R;  1N8R R;  3CCR Q;  1VQL Q;  1QVF P;  1VQ7 Q;  3G6E Q;  3CXC P;  1W2B P;  1VQ9 Q;  1YJW Q;  1K73 R;  3CME Q;  3G4S Q;  3CCQ Q;  2QEX Q;  1S72 Q;  1VQP Q;  1VQK Q;  1VQM Q;  3CC4 Q;  1M1K R;  2OTJ Q;  1YIJ Q;  3CC2 Q;  2QA4 Q;  3CC7 Q;  3CCL Q;  1YHQ Q;  3I56 Q;  1Q7Y R;  1VQN Q;  3CCJ Q;  1YJN Q; 
#chains in the Genus database with same CATH topology
 3CCU Q;  2A28 A;  2DL7 A;  5GAN 6;  2K79 A;  2HD0 A;  4XTW A;  3OS2 A;  1W6X A;  2QK0 A;  1AWX A;  2RMO A;  2NLU A;  1H3Z A;  3A8L B;  2YWW A;  2RQR A;  1UGS B;  4A4G A;  3L2U A;  1K8A C;  3S3O A;  5GMK i;  1MMG A;  1YBY A;  3PFS A;  1ZBX A;  1VQN A;  4M7A A;  3NGP A;  2RQW A;  3JCM b;  4RMO A;  4TVR A;  1U1T A;  3JSC A;  1VUB A;  3EH1 A;  3VYH B;  1QVF P;  3NTK A;  3G4S Q;  1GRI A;  1YFN A;  2E41 A;  4JJD A;  3G4S T;  2FPF A;  1EIF A;  2ZGW A;  4EDU A;  4OVA A;  3GPL A;  1NE8 A;  2RM4 A;  3OYK A;  2FYK A;  4A4E A;  4LD6 A;  1M90 R;  2KRO A;  2NUP B;  4C92 F;  2OTL A;  2F2X A;  2E4H A;  4N4G A;  3SHW A;  5I11 A;  2X4J A;  2R58 A;  1WZO A;  2RQV A;  2EYW A;  1OX8 A;  4CC2 A;  2YLC A;  3TRE A;  3M57 A;  3TU4 K;  1SSH A;  4M75 F;  2MF2 A;  4F7U G;  3H0F A;  4JRI A;  3L2Z A;  4BY6 B;  2L3S A;  5A2Q E;  2ZPI B;  2KI7 A;  2F2V A;  4C0D C;  1Q7Y C;  3OW2 P;  4C8Q C;  4XTY A;  3DB3 A;  3GLX A;  3TSW A;  1IXD A;  2FG0 A;  4D8D A;  3MKD A;  3FDR A;  3RMS A;  1X6G A;  1S72 Q;  1WQ7 A;  1IGU A;  5IXF A;  1T0H A;  4M77 C;  3M5A A;  3M58 A;  5D6X A;  1K73 C;  3I56 Q;  2ZAE A;  2PVD B;  1Q81 C;  1AD5 A;  2P0K A;  3RER A;  1NEB A;  2G6F X;  1MV3 A;  1QVF S;  3VS6 A;  4M7D G;  5LJ5 e;  1K9M R;  2XDP A;  1IHW A;  4RCC A;  1WQW A;  3CEY A;  3IQL A;  5GMK h;  3C4S A;  3BFM A;  4RTW A;  2Y4Y A;  1VQ9 T;  4IIM A;  3X28 B;  2RNA A;  1AOJ A;  2GBQ A;  4XU0 A;  2YRC A;  2RHY A;  2AKK A;  2HBP A;  4L59 A;  4DEX A;  1YCY A;  1WJR A;  1OUL A;  2ROT A;  3ZBD A;  1W2B A;  1YJN T;  1BI1 A;  1ZA1 B;  1W1F A;  2Y4X A;  4J6X A;  2V8K A;  1N8R U;  3QBY A;  2I0N A;  3E1S A;  4M7A B;  2KT8 A;  1ZQ1 A;  1D1A A;  2MOX A;  2LC4 A;  1YJ9 T;  2CZ1 B;  3SB2 A;  1G5V A;  2DTO A;  3MP8 A;  5GMK j;  5I2M A;  1VQ5 T;  2EAY A;  1OZ3 A;  3EG2 A;  2MWO A;  3MP1 A;  3VS2 A;  2W0Z A;  4C8Q E;  2JJ9 A;  3OS0 A;  1UGV A;  4HCK A;  5CKF A;  3UA6 A;  2WSC E;  1GFC A;  1VQ4 T;  2QEX A;  3J81 E;  4OMN A;  4E47 A;  1MNE A;  3PMI A;  1AWJ A;  2DA9 A;  3CC4 A;  2ENM A;  8AT1 B;  2K7A A;  5KYW A;  2D1X A;  1Z9Z A;  2K4Y A;  2MYS A;  4J8O A;  4J9D A;  1RAE B;  3P8H A;  1VYV A;  4JJN K;  3UDC A;  2IVW A;  4EMK C;  2JW4 A;  2VXE A;  2COZ A;  5FRO A;  4R55 A;  4DA4 A;  1TG0 A;  2XK0 A;  4C0Z A;  3CPW P;  5CVI A;  4A53 A;  2EJG A;  4M78 C;  2CP2 A;  1YP5 A;  4BDZ A;  4QVZ A;  2Y90 A;  1N9S A;  1Y57 A;  2VKN A;  2EJF A;  5CKH A;  4QVD A;  2F2W A;  5KYX B;  4IUU A;  4PJO G;  1K76 A;  5LJ5 f;  4ZTF A;  1D09 B;  3S6W A;  1TOV A;  4PJO D;  2EQI A;  3EG0 A;  4II1 A;  3EGX A;  4WTO B;  4FIB A;  4PJL A;  1GFD A;  1M4Z A;  2OTJ A;  1TUG B;  4XTZ A;  4PFZ A;  2CP5 A;  4R0K A;  1Q81 U;  5FU7 C;  4HCB A;  1QVG A;  1QKW A;  2QDL A;  3EGU A;  3MJX A;  4E7H A;  2KQW A;  3GBQ A;  3UWN A;  3C95 A;  2XKO C;  4OML A;  3X24 B;  1BYM A;  2FRW A;  2PU9 B;  3I55 Q;  4RTV A;  2XD0 A;  3M59 A;  5CKE A;  3I55 T;  2HDA A;  3V8L A;  3HFN A;  2ATC B;  4IUV A;  1VQ7 Q;  2JOY A;  4BI4 A;  2JTE A;  3TVT A;  2MCN A;  2P4R A;  2X4Y A;  3V7C A;  1CKA A;  2PQW A;  1V76 A;  1GCQ C;  1QCO A;  2RD1 A;  4RTY A;  3VRZ A;  2ZPF B;  1D0Z A;  4EMG A;  3RES A;  3HRU A;  4ELY C;  2B86 A;  3F70 A;  4PJJ A;  5I2S A;  1KHC A;  4R56 A;  1WDX A;  3PNW C;  4M75 E;  2PUO B;  1TUD A;  2QG9 B;  1XTD A;  1Q95 G;  2RHX A;  2ZCF B;  5GAM e;  3NPF A;  5IXB A;  1LCK A;  3MEV A;  1OV3 A;  5GAN e;  1RAB B;  2OX7 A;  4RTT A;  3EHR A;  2RI2 A;  5GAO n;  1AVZ C;  1TXQ A;  3L1A A;  2DBM A;  1U8R A;  2G3R A;  2X35 A;  2OI3 A;  2DXB A;  1VYT A;  2F69 A;  4RTZ A;  1JJ2 A;  3HRS A;  2E1H A;  3G6E Q;  4LDV A;  3VU3 C;  3HPW A;  1GCP A;  5KYY A;  3G1J A;  4NS5 A;  3G6E T;  3THK A;  2XI9 A;  1OYX A;  1GXI E;  3FIF A;  4M7D E;  4F7U F;  4FYX B;  1X2K A;  4WCI A;  2RI5 A;  2CP0 A;  4C92 G;  4JPB W;  1UHF A;  3A5Z B;  1G2B A;  4BE2 A;  4M7D D;  3M55 A;  2L3Q A;  5GAM d;  2FHD A;  1WHJ A;  2KRM A;  3FC3 A;  2HEQ A;  3M4G A;  5KYN A;  2PVG B;  1RAI B;  1K73 U;  1RAC B;  1NPP A;  2FEI A;  4FU6 A;  3OS5 A;  2HZY A;  4UC4 A;  1RAG B;  3LW5 E;  1IRE B;  3P8D A;  3OY9 A;  1SKU B;  4RTX A;  3CCL Q;  4Z8A A;  3OYF A;  2RQT A;  3CMA A;  3ULR B;  3ZFJ A;  2RO0 A;  2QYZ A;  2JMA A;  4DEY A;  1Q82 R;  1ARK A;  4HCZ A;  4F14 A;  4IKF A;  1VQ7 A;  4MML A;  1G3Y A;  1G3T A;  4J9B A;  3CCS A;  1VQM Q;  4J6Y A;  2CRE A;  2JMC A;  5I22 A;  3OYJ A;  1NLP C;  3LYI A;  5HCK A;  5GAN g;  4DQ2 A;  2YSQ A;  3MCA B;  2CDT A;  3PE0 A;  1YIJ T;  2RA2 A;  5L23 A;  1QVG P;  4M78 G;  2V26 A;  1YJW A;  2LTO A;  2H3E B;  1M2V A;  2ABL A;  2V1Q A;  3BE3 A;  2K2V A;  1QCN A;  3G7Z A;  3HKS A;  1KFZ A;  1Y96 B;  2ESW A;  4JJC A;  1SRM A;  5A0G A;  1RAF B;  3TEE A;  3OYC A;  4OGE A;  4E7I A;  2FL7 A;  3EGD A;  4M77 B;  1XOV A;  3PVQ A;  1D3B A;  3JCM X;  5CR2 A;  2AKL A;  1I8F A;  4M75 C;  4E7Z A;  2C0O A;  1SG5 A;  1ZLM A;  1QP2 A;  2XMF A;  2RF0 A;  3EFO B;  3OYB A;  4V2S A;  3TSZ A;  4XK8 E;  2LT4 A;  4C8Q F;  2F1L A;  2HMA A;  5D7U A;  1QW1 A;  4DBQ A;  2DD4 A;  3J80 E;  2B8A A;  3GF5 A;  1QP3 A;  3VJP A;  1PWT A;  3OYI A;  4M77 F;  3LGL A;  4FL6 A;  2F5T X;  4J9G A;  3H0I A;  1LVK A;  4XQ3 A;  2LQW A;  3JCM P;  1YJN A;  3QZ5 B;  1V1C A;  4OMQ A;  1VA7 A;  3PT9 A;  1NZ9 A;  2KAF A;  3C12 A;  3A8O B;  2VGM A;  4QQD A;  4A4F A;  3FJ5 A;  3KUF A;  1T3L A;  2PVO B;  1X6O A;  1WX6 A;  4EIK A;  2DBK A;  1UJY A;  3E9F A;  1FWZ A;  4M7D A;  1VYU A;  2K3Y A;  1X27 A;  2AZV A;  1VQ7 T;  2XU8 A;  4LE9 A;  2LCS A;  2YXY A;  3OMC A;  3CCL A;  1KD1 R;  2DPP B;  2FRY A;  2KRN A;  1KQS A;  2NUT A;  3OYL A;  1M90 U;  4JLI A;  1FMW A;  2O01 E;  2KR3 A;  2EFI A;  2FO0 A;  5GAM f;  3CCU A;  3CCS T;  4M78 E;  4M7D C;  3QSU A;  2BZY A;  2KXD A;  2QGF B;  3GIB A;  2J6O A;  4LN2 A;  1JJ2 P;  4KH0 B;  3VS4 A;  4HA8 A;  4BI3 A;  1K4U S;  4OMP A;  1Y96 A;  1K73 R;  2W10 A;  1M1K R;  2O9S A;  4M75 B;  3VUB A;  2RK2 A;  2JUF A;  1VQP T;  2V8I A;  5GAN 7;  3PGG A;  2OAU A;  5FWB A;  2CZ7 B;  1KC8 U;  4JUV A;  4AFU C;  2HBW A;  1SF9 A;  4A4H A;  2LJ0 A;  4FW2 A;  1YHQ A;  3LX7 A;  4F04 B;  3JCM J;  3MEW A;  4KT0 E;  4DBF A;  3CPW A;  3CC7 T;  1PHT A;  3CD6 A;  4QVC A;  1IHV A;  2CH4 W;  2HKQ B;  1RLQ C;  3X25 B;  2L89 A;  1X75 C;  1E6H A;  1RI0 A;  3BDL A;  1UDL A;  3OYN A;  4B9X A;  5AT1 B;  7AT1 B;  2AT1 B;  1QVP A;  2F5K A;  1ABQ A;  1RUW A;  2EQU A;  2FPD A;  3EGD B;  3G71 T;  3S3N A;  3QG1 A;  1UB4 A;  4MZM A;  1YNZ A;  1ZBJ A;  1GL5 A;  2CUD A;  2FVU A;  2WSE E;  2DIG A;  3PVL A;  1WHM A;  2C0T A;  5CKD A;  4A63 B;  1VQ6 Q;  2X4X A;  5IHK A;  3A8G B;  4FT4 A;  3RUX A;  1MMD A;  1O9S A;  1UEC A;  3CCE T;  2EJ9 A;  4FSS A;  3S3M A;  4BAC A;  5KH6 A;  1OEB A;  1K9M U;  3FEO A;  4GY5 A;  4DBR A;  4M77 D;  2O31 A;  2KXC A;  4QQ6 A;  2LNV A;  1U3O A;  2ED0 A;  5HKC A;  1VQ9 A;  1PC0 A;  3VKI A;  2JXB A;  4X9D A;  3QPH A;  4C0G A;  2QI2 A;  1MGQ A;  4C8Q D;  2AK5 A;  2E64 A;  5DLQ E;  1ZSG A;  1WJS A;  4OB0 B;  3RR6 A;  2KY9 A;  4MZP A;  3JCM Q;  3PIO A;  1YN8 A;  1BBZ A;  2M1H A;  2AZS A;  3FB9 A;  4OMF B;  2E6N A;  2M02 A;  1VQO A;  1X6B A;  1HXD A;  1VQ5 A;  1Y07 A;  1W70 A;  2O4X A;  1QVF A;  4F7U E;  1FMV A;  1PRL C;  1Q82 U;  1RAH B;  1D0X A;  1G8X A;  3JB9 I;  1SSF A;  1ZA2 B;  4JRQ A;  5GAN 3;  2COW A;  3CCR T;  5FW9 A;  2QXF A;  2RH2 A;  2DXT A;  2EW3 A;  1CSK A;  1RL2 A;  4J9C A;  4PK4 A;  1HJD A;  2XDD A;  2K2M A;  4M77 A;  1RAD B;  2KEA A;  5J3B A;  3CC7 A;  4MMK A;  1UTI A;  2O9V A;  3QYH B;  4ZGE B;  2K6D A;  1K8A U;  1BB9 A;  2LRQ A;  3CC2 A;  2DNU A;  1U5S A;  4PFO A;  1OPL A;  1B07 A;  2GNC A;  4NL3 A;  3HFO A;  2CYZ B;  1K0S A;  2R5M A;  4GLK A;  4ESR A;  1OI1 A;  1X43 A;  3ZEH A;  4KUI A;  1O75 A;  2VC8 A;  3C0C A;  1B34 A;  4D6W A;  5M9O A;  2E65 A;  3H41 A;  5D6W A;  3M54 A;  5GAO q;  4JZ4 A;  1GCQ A;  1QKX A;  1T3S A;  3NTH A;  1NPR A;  5GJW B;  2LQN A;  5FLX E;  3L2Q A;  2DM1 A;  3CCR A;  5FU6 C;  1SRL A;  1U1S A;  2KYB A;  2QDY B;  2NUP A;  9ATC B;  4EMH A;  1MMA A;  1KQS S;  1VOM A;  2LDM A;  2OJ2 A;  4PJO E;  4M78 D;  1H92 A;  1Y71 A;  1VQK Q;  1UG1 A;  3Q1J A;  2DVJ A;  2MMP A;  2L3R A;  4RCB A;  1NJI C;  3JCM g;  3I5R A;  2HSP A;  1UEB A;  3JB9 G;  3M0T A;  4BB7 A;  4KUL A;  2DFU A;  4DOV A;  4PNO A;  2MIO A;  3T9N A;  1NBE B;  1JO8 A;  4B6M A;  3GP8 A;  1TUC A;  2A3L A;  4M7D F;  2V8J A;  4E7L A;  3L42 A;  2QAS A;  2DL4 A;  5J26 A;  4M7A G;  4JJB A;  2LT1 A;  4KRT A;  5FRN A;  3OYA A;  2QQR A;  2X4W A;  1I1J A;  3L2R A;  3RKX A;  2CZ6 B;  4L6V 5;  3EG1 A;  2E10 A;  5EG2 A;  3KFV A;  3EG3 A;  1R8O B;  3OA6 A;  2DEQ A;  4HVW A;  1WLP B;  4M78 B;  4ME7 A;  4FM4 B;  2K5L A;  3CMA T;  2ZPB B;  5GAN 8;  1AZG B;  3V7R A;  2RJC A;  2M0Y A;  3VRY A;  3BW1 A;  2L8D A;  2JN0 A;  3UT1 A;  3I56 A;  4N0A A;  4AMC A;  3WVD B;  1OPK A;  2DE0 X;  3RKY A;  4OF1 A;  2HQE A;  4OMO A;  4Z02 A;  1HSQ A;  1PSE A;  3OS1 A;  1M8M A;  3CPW S;  1SHF A;  3X20 B;  1RLP C;  1JB0 E;  2L5Q A;  1YIJ A;  2JNG A;  1OQK A;  2JTF A;  3OYG A;  1Z9Q A;  5CQY A;  5C0M A;  1M2O A;  4B9W A;  2YUQ A;  4Z89 A;  2CGH A;  5EC7 A;  1TTH B;  4F16 A;  1MV0 B;  4MZT A;  3NHN A;  2YUO A;  5A0L A;  3G71 Q;  5KCH A;  1PKS A;  3QDF A;  1PM3 A;  5IAY A;  1YI2 A;  3NMZ C;  1TH7 A;  2AHJ B;  4PJO B;  1NYG A;  2EYZ A;  3MEU A;  2XDB A;  1VQ6 T;  1WGS A;  5GAM g;  4J83 A;  2DVE A;  4QT7 A;  1AEY A;  1NLO C;  1KD1 C;  1KQ1 A;  4M7A C;  2CT3 A;  2L3P A;  2R5A A;  2KNB B;  1YI2 Q;  1LJO A;  4XTX A;  1WYX A;  4XTV A;  1YIT Q;  4AT1 B;  2K57 A;  4NOY A;  3I5S A;  2O88 A;  2GTO A;  2LP5 A;  3A8M B;  3QO3 A;  5LJ3 g;  2LJ1 A;  2EYQ A;  1ZSZ A;  2CP3 A;  2EVR A;  5LJ5 h;  3JCM c;  3QXE B;  2QQS A;  2EGC A;  2RN8 A;  3CCU T;  4EMK A;  1LNX A;  1B7T A;  5GMK e;  8ATC B;  2CSI A;  1WI7 A;  5ECA A;  3QHS A;  2KDS A;  5J39 A;  1UUE A;  3JCM f;  2QTX A;  2HKN A;  1HYO A;  1PD0 A;  1D1B A;  3QYG B;  5FU6 B;  2OTJ Q;  3M56 A;  2JZ2 A;  1BI2 A;  4VUB A;  1AT1 B;  3QJ6 A;  3R6N A;  1KQ2 A;  1AWW A;  2DX1 A;  1VQ8 Q;  3ZL7 C;  1X01 A;  5LJ5 g;  3LWH A;  4C8Q A;  4HVU A;  4IUP A;  3EAE A;  3CME T;  3AT1 B;  2K3X A;  2D8H A;  4AG2 C;  5FU7 B;  1C0M A;  3M0S A;  4LDW A;  3CME Q;  4AFQ C;  1SHG A;  1PD1 A;  3CD6 T;  2BE9 B;  3LH0 A;  3BDU A;  3OYM A;  4FYW B;  1GBR A;  4OGC A;  4F17 A;  1I0C A;  4YTL A;  2P0Q A;  2O4X B;  4OMM A;  2YT6 A;  5KYW B;  1MMN A;  3RIR A;  4ELZ C;  2KSS A;  4IUQ A;  4Y91 A;  2QAZ A;  3RMQ A;  2MPX C;  4A54 A;  3INZ A;  2GFU A;  2IIM A;  2M51 A;  2OAW A;  2JTM A;  4MDW A;  1QCF A;  1XQH A;  1KIK A;  5GAN 4;  1QVG S;  1C1A A;  5KYU A;  2HL3 A;  2M0O A;  4FCY A;  4EMK B;  1EFN A;  4C5E A;  1Q86 U;  4FYY B;  4JS5 A;  3FLG A;  2DER A;  1M3A A;  3CCJ T;  1QQJ A;  1BIA A;  3I56 T;  1H3H A;  2K5I A;  3OBY A;  3VUZ A;  4M78 A;  2CP7 A;  2GFA A;  2PTK A;  2BTT A;  2KK4 A;  3EH2 A;  1VIE A;  1N6A A;  3VS5 A;  3OQ5 A;  1VQ9 Q;  2YLB A;  3SEM A;  3TQ7 P;  4LD9 K;  2DXC A;  2MWP A;  2SEM A;  4BE0 A;  2QGG A;  4J5Y A;  4RG8 A;  3CCE A;  1EZZ B;  1YJN Q;  1VQO T;  1WFW A;  3HP9 A;  3JB9 H;  2GF7 A;  3HTR A;  4AFS C;  3JCM h;  2HAX A;  1VQO Q;  3LLR A;  3V7S A;  1UGP B;  2FB7 A;  3CCS Q;  1B3Q A;  3OW2 S;  1OU8 A;  1PRM C;  4IUR A;  4OP0 A;  3FJP A;  1G83 A;  1AHJ B;  5CO7 A;  1R77 A;  1YWP A;  1GBQ A;  2J06 A;  1ABO A;  2GQI A;  3CME A;  3DKM A;  4CRI A;  2OTL T;  3SWN C;  1VQN Q;  4PFP A;  2J6F A;  1G3W A;  5GAN j;  2KE9 A;  4ZGD B;  5KYU B;  1HK9 A;  3CC4 T;  2OTL Q;  3P8B B;  4Y92 A;  4C92 D;  1BCO A;  1PKT A;  3EFR A;  2ZPE B;  1WHG A;  1SEM A;  2DET A;  4XU3 A;  4ORZ A;  1UHC A;  4JDS A;  4QKU A;  3AHU A;  3H6Z A;  4LUD A;  1U06 A;  2BZ8 A;  2DD5 A;  2BIV A;  1BKB A;  1KG1 A;  1M8V A;  2EYX A;  2RJE A;  3CQT A;  4M7A E;  4F7U B;  1VQ6 A;  1IB8 A;  1JJ2 S;  3BY7 A;  3G4S A;  1I07 A;  4K11 A;  2GGR A;  5GAM h;  2SRC A;  2X3W D;  1Q86 R;  4LDX A;  4M77 G;  3E19 A;  5GAN h;  2COY A;  3CBO A;  3DLL A;  1TU0 B;  2JM9 A;  5GAO r;  3DLM A;  3OSS C;  4C5G A;  3CXC P;  5IHI A;  4PJO F;  2DF6 A;  4C8Q B;  4ZTJ A;  2H3J A;  1BU1 A;  3E9G A;  2NYS A;  4BY6 C;  1S72 A;  1F1B B;  1M3B A;  3QDR B;  2XIC A;  1TSF A;  4M7A F;  3OSV A;  4C92 E;  3GOX A;  3CCM Q;  2HQX A;  4M7D B;  3CCM T;  3H8Z A;  1ZUK A;  3GNF B;  3PTA A;  1WXU A;  4Z88 A;  1IZ6 A;  2E5K A;  3CBP A;  2A08 A;  2BE7 D;  2M9U A;  1TWB A;  1M3C A;  1ZX6 A;  3JB9 F;  3HRT A;  4N4H A;  1Q86 C;  2LQ8 A;  5IHN A;  1WHH A;  2DZ9 A;  5L8R E;  2VWF A;  2E3H A;  3CCL T;  1OOT A;  2LCL A;  3SWN B;  2FZC B;  5DM7 R;  1FXX A;  2QEX T;  3X26 B;  3OYH A;  2A37 A;  2DXU A;  2DL5 A;  5CIU A;  1RI9 A;  2I2L A;  1YJ9 A;  1WPY A;  4KBM B;  2DJZ A;  1W4S A;  4C5I A;  4DBH A;  5LJ3 d;  1T0J A;  2CUB A;  1N9R A;  3MO8 A;  3CPF A;  5KE3 A;  3EG9 B;  1VQM T;  2QQ9 A;  4KH1 B;  3H9N A;  2BZX A;  4M77 E;  1HD3 A;  1C6V X;  4EPC A;  2NWM A;  5GAN 2;  2X9H A;  2KGT A;  2A36 A;  2EBP A;  2KMT A;  1KC8 C;  1UGQ B;  1M1F A;  4NL2 A;  2VGN A;  3JV3 A;  2PZ1 A;  3M4Y A;  4PLL A;  3VV0 A;  1K1Z A;  3WVE B;  2ZPH B;  2YUP A;  2EWN A;  5GJV B;  2VAS A;  4KGV B;  2KT1 A;  3CCV A;  2IG0 A;  3CD6 Q;  4GBQ A;  4D8K A;  4XU1 A;  2BKD N;  2E6Z A;  4C0F A;  3G6E A;  2EYY A;  1M2V B;  3JCM e;  2RHU A;  4J7F A;  3CXC S;  4N0A C;  3HL8 A;  3M0R A;  1VQM A;  2K9G A;  1P92 A;  2RJF A;  4E2F B;  2BUD A;  4MDX A;  3CCQ T;  4OB1 B;  1M1K U;  2DO3 A;  1AZE A;  2PNI A;  2MAM A;  3LGF A;  2JVV A;  2DIL A;  6AT1 B;  1NJI R;  1WNL A;  2D8J A;  3OYY A;  3QKJ A;  1M9S A;  1JXM A;  1LOJ A;  1KSW A;  1QLY A;  3CC2 Q;  2L2P A;  2GQV A;  2CH4 A;  5DLO A;  4BE1 A;  1WXB A;  4RTU A;  1KD1 U;  2VYT A;  4LUE A;  1S72 T;  3JAM E;  2KYM A;  4LDU A;  2HL5 C;  3JCM d;  1TS9 A;  5HY6 A;  3JB9 J;  1BK2 A;  4KGZ B;  3DB4 A;  4BI8 B;  4M75 D;  3MP6 A;  1G3S A;  1A0N B;  2XHC A;  4P5N A;  4XU2 A;  1VQK T;  1VQ8 A;  4J9E A;  4BUG A;  1R0C B;  3TCJ A;  3I55 A;  4HXJ A;  2CSQ A;  2RPN A;  3I9Q A;  4X34 A;  1XNI A;  2P84 A;  3NTI A;  4RKU E;  3CXC A;  1ZSZ C;  2VXF A;  4LXC A;  4HVV A;  1VQP A;  5HK0 A;  2RJD A;  4PL6 A;  4Q5W A;  4HT8 A;  2EQM A;  5LJ3 j;  2YRV A;  3SFM A;  2DMO A;  4JS4 A;  5FWC A;  2QQB A;  1YHQ Q;  2JM8 A;  5GAN 5;  2GCX A;  3HSB A;  2A7Y A;  5LJ3 f;  3CCM A;  2CZ0 B;  1VQL A;  3FRN A;  5GAO l;  1R0B G;  2DYI A;  4C5H A;  1Q81 R;  1IGQ A;  2YRD A;  4HKE A;  3CC4 Q;  5GMK m;  1M1K C;  2V1R A;  2ZZD A;  3NFC A;  2A0F B;  4X9C A;  5CK9 A;  3H0H A;  3SDZ A;  1FMK A;  1OZ2 A;  2J6K A;  3CMA Q;  1UFF A;  4JRK A;  5LJ3 h;  2LNH B;  2H8H A;  5AYF A;  2DTH A;  1X2Q A;  2FZG B;  4C92 C;  3C94 A;  1EX4 A;  5LJ5 j;  3M0Q A;  4J6W A;  2FPE A;  1FYN A;  4E6R A;  3MHX A;  1UGR B;  3UPU A;  1W2B P;  4PJO C;  3JCM V;  1NYF A;  2NUZ A;  4ZN3 A;  2HCK A;  2ED1 A;  2RB6 A;  2QA4 Q;  3CC7 Q;  2JT4 A;  4JLG A;  5GAO p;  4E7S A;  4M7A D;  2QA4 T;  3RDV A;  3QII A;  1S1N A;  4CC7 A;  3CCQ A;  4DOW A;  4C92 B;  3EHQ A;  4ZGJ B;  1NJI U;  1OU9 A;  1I81 A;  3VS1 A;  2P0P A;  2LMJ A;  4HCC A;  3J7A F;  3E2U A;  4KGX B;  3CBM A;  3MEA A;  2ROL A;  4PJO A;  1KJW A;  1VQ4 A;  2CKK A;  3UF4 A;  2EIF A;  3CCV Q;  4CC4 B;  4OB2 B;  3LWI A;  4CI0 C;  2DAQ A;  1JEG A;  4F7U A;  3A1P A;  3QUI A;  1K8A R;  1MND A;  2XID A;  2DEU A;  4CC3 A;  3PIP A;  1JXO A;  4J7I A;  3UAT A;  3L2W A;  4QW2 A;  3G71 A;  3O8V A;  2E70 A;  3JCM W;  1YIT T;  1M1G A;  2CS7 A;  2E5Q A;  5I21 A;  2RHZ A;  2RHI A;  2VVK A;  5GMK l;  3QWX X;  3PMT A;  3CCJ A;  2L0A A;  1VQK A;  2LJ3 A;  3M53 A;  4IUT A;  1WA7 A;  1K0X A;  1YWO A;  2CP6 A;  4O5V A;  1WIE A;  1D0Y A;  3OYE A;  3SD4 A;  1PNJ A;  1VQL Q;  2XG8 D;  1Q7Y U;  2EQJ A;  1CKB A;  3VS7 A;  3VYG A;  1E7O A;  2D6F A;  3KBG A;  1H8K A;  1VQL T;  1E6G A;  3QWY A;  2LZ6 B;  2C06 A;  4M4Z A;  1QWE A;  4L5G A;  2D9T A;  1ZUY A;  1IO6 A;  4FYV B;  4J9H A;  2RK1 A;  1PCX A;  2OTJ T;  4A4K A;  1M90 C;  3R6O A;  5CAI A;  3OBW A;  2VUB A;  2M16 A;  3MET A;  2D0Q B;  4ZNX A;  1D3B B;  1I5L A;  5LJ5 d;  2RI3 A;  2WSF E;  1VQ8 T;  1LPL A;  5FRM A;  5HK3 A;  2R57 A;  1BIB A;  4FW1 A;  4ANJ A;  1DJ7 B;  2K3B A;  4FSX A;  2P4T A;  1BCM A;  2DZC A;  5IT9 E;  1N27 A;  2D0N A;  2J05 A;  4PKC C;  5A0D A;  4C92 A;  4HT9 A;  1WHL A;  2VV5 A;  2AIR B;  2LVM A;  2GTJ A;  2DRK A;  4XAX B;  2YDL A;  5IH2 A;  3O5Z A;  2LCC A;  1Y0M A;  2EGA A;  5CKB A;  1VIF A;  5IN1 A;  1WHK A;  2DIQ A;  1ZHI A;  4RG2 A;  3CCQ Q;  1VQP Q;  4XTU A;  1JRI A;  2DK3 A;  2X51 A;  4J9I A;  1KHI A;  2DLP A;  1Q7Y R;  4PLI A;  3I35 A;  2IPO B;  1Q82 C;  2KVQ G;  2VB6 A;  3M0P A;  4M78 F;  1I5O B;  3N5B B;  2EGE A;  2MI6 A;  3REA B;  2LX9 A;  3ME9 A;  1MUZ A;  3CC2 T;  1RAA B;  1N8R R;  4J9F A;  5LJ3 e;  1D1C A;  4AFZ C;  3EG9 A;  3OW2 A;  3QZ9 B;  4C8Q G;  2YHT A;  3EFS A;  3CCJ Q;  2HQH A;  1AWO A;  2MK5 A;  2KRS A;  3OB9 A;  4GLM A;  2ZPG B;  1PSF A;  3M0U A;  4N4I A;  1M5Q 1;  2LQK A;  1XJW B;  3MPU B;  2K5F A;  3SWN A;  1B34 B;  1QMC A;  1SPK A;  1WJQ A;  2NUT B;  4M75 A;  5GAO m;  3EFO A;  4PJN A;  3ER0 A;  5GAN f;  2QA4 A;  4PJM A;  5GAM j;  2YUN A;  1K9M C;  2DJQ A;  1QWF A;  1YCS B;  2E12 A;  2LX7 A;  1KC8 R;  1YIT A;  2QQA A;  2DL8 A;  4OB3 B;  2HNI A;  3CCE Q;  3URG A;  3L2V A;  1JU5 C;  3REB B;  1M27 C;  1YHQ T;  1V29 B;  2X3X D;  4QQG A;  2O2O A;  3OMG A;  3U23 A;  2EKO A;  1JQQ A;  1BI3 A;  3A98 A;  1IRX A;  4E7J A;  2DKG A;  1JBM A;  1KK7 A;  2C0I A;  3QJY A;  3HHT B;  1UE9 A;  1YJ9 Q;  5CCA A;  3OYD A;  2EPD A;  1UJ0 A;  3EGX B;  2DRM A;  4ATO A;  2EQK A;  1VQ5 Q;  1VQN T;  1NEG A;  1W2B S;  4JRP A;  3VS3 A;  5D6Y A;  4X1V A;  2JS2 A;  2RQU A;  1ZSZ B;  1N8R C;  2E3I A;  2WAC A;  1YIJ Q;  1WXT A;  3ASK A;  2HSE B;  1J3T A;  4RUG A;  4ZN1 A;  4M75 G;  2DYB A;  1OX9 A;  1MHN A;  3RBB B;  4C0D B;  4O6J A;  1VQ4 Q;  2QTV A;  3RKW A;  4LDY A;  5KE2 A;  2FZK B;  3CCR Q;  4WF2 A;  3VS0 A;  2ECZ A;  1N5Z A;  2DTI A;  1ZUU A;  3D7S B;  4AG1 C;  5DY9 A;  1BI0 A;  4E7K A;  3A8H B;  5LL6 S;  1X69 A;  3KXT A;  3RNJ A;  1ACM B;  4Y28 E;  4FT2 A;  5KYX A;  1Y7X A;  2J7I A;  3JRZ A;  1PG5 B;  3LH5 A;  2CT4 A;  3UA7 A;  2KBT A;  3V8J A;  4KUD K;  1YJW T;  1FX7 A;  1YJW Q;  5KCO A;  1K9A A;  1NG2 A;  3CCV T;  1NM7 A;  3V8K A;  2PUK B;  1M30 A;  2JS0 A;  1H64 1;  2EKH A;  5C6S A;  5GAN d;  1KQS P;  1I4K 1;  5CQX A;  4JZ3 A;  1YI2 T;  3GNG A;  2DL3 A;  2Z0W A;  4IIO A;  2QEX Q;  3M9Q A;  4BDY A;  3JB9 D;  4BD3 A;  4LNP A;  5KYY B;  3WXM B; 
#chains in the Genus database with same CATH homology
 3CCV Q;  1KC8 R;  3CCU Q;  1VQ6 Q;  3I55 Q;  3CCM Q;  1YJ9 Q;  3CPW P;  1VQ8 Q;  3OW2 P;  2OTL Q;  1M90 R;  3CCE Q;  1YI2 Q;  3G71 Q;  1KQS P;  1VQO Q;  1VQ4 Q;  1K9M R;  1Q86 R;  1JJ2 P;  1QVG P;  3CD6 Q;  1VQ5 Q;  1YIT Q;  3CCS Q;  3CMA Q;  1NJI R;  1K8A R;  1KD1 R;  1Q81 R;  1Q82 R;  1N8R R;  3CCR Q;  1VQL Q;  1QVF P;  1VQ7 Q;  3G6E Q;  3CXC P;  1W2B P;  1VQ9 Q;  1YJW Q;  1K73 R;  3CME Q;  3G4S Q;  3CCQ Q;  2QEX Q;  1S72 Q;  1VQP Q;  1VQK Q;  1VQM Q;  3CC4 Q;  1M1K R;  2OTJ Q;  1YIJ Q;  3CC2 Q;  2QA4 Q;  3CC7 Q;  3CCL Q;  1YHQ Q;  3I56 Q;  1Q7Y R;  1VQN Q;  3CCJ Q;  1YJN Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...