1VQPQ

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqpQ00
1W2BP 1Q81R 1N8RR 1QVFP 3CXCP 1YJWQ 1VQ8Q 3I55Q 1VQ4Q 1Q7YR 3CC2Q 3G71Q 1JJ2P 1VQ9Q 1M90R 1YI2Q 1K9MR 3OW2P 1Q86R 1VQ7Q 3G6EQ 2OTLQ 3CC7Q 3CCQQ 3CCJQ 1YJ9Q 1VQPQ 2OTJQ 3G4SQ 1YIJQ 1VQLQ 1VQNQ 3CCEQ 1VQMQ 1Q82R 1QVGP 2QA4Q 1K73R 1S72Q 1KC8R 1K8AR 1NJIR 1YHQQ 3CMEQ 3CCMQ 1VQ6Q 3CCSQ 1VQOQ 1M1KR 3I56Q 3CCUQ 3CCRQ 1VQ5Q 1KD1R 3CPWP 1YITQ 2QEXQ 3CCLQ 1VQKQ 3CD6Q 1KQSP 3CCVQ 1YJNQ 3CC4Q 3CMAQ
chains in the Genus database with same CATH superfamily
3MCAB 3THKA 3TSWA 3NTIA 3SEMA 4M7DD 4OMLA 3H41A 1VQ4A 2HSPA 3RR6A 3CBPA 3VS3A 1VOMA 4F14A 2K2MA 2QEXQ 2PUKB 3V8LA 4C0GA 3QHSA 4M78D 3VS7A 1QKWA 1SPKA 1K9MU 2HD0A 2FO0A 2CH4W 3EG0A 4F7UF 3OYJA 1ZA1B 2DD4A 1WNLA 3JCMd 2IPOB 4M7AB 1EIFA 2HQXA 2XDPA 3REAB 4NOYA 5GAN8 1JU5C 4M75A 2DRKA 1YJNA 3OMGA 2QA4T 3CBMA 3H0FA 1MNDA 4FT2A 2GTOA 3I55A 2JMAA 1VA7A 5GAOr 2FEIA 4IUQA 3H0HA 1HJDA 3BFMA 1JRIA 2G6FX 2RQTA 3G71T 1H3HA 3VS0A 3HRTA 3OYCA 2BZXA 1KHIA 2RK1A 2KT8A 1WHJA 1YITQ 2HDAA 1B07A 1QW1A 2LJ3A 4F16A 1YJNT 5KE2A 3CC2Q 2CS7A 3L2UA 2COYA 3SDZA 3ER0A 1K9AA 1V29B 1VQLQ 1I4K1 2D8JA 3PVQA 4JJDA 2CP6A 1M1GA 4KH1B 2E41A 4PJNA 3HSBA 2DBMA 3JSCA 3CC7T 1NEGA 4M7AC 2F2VA 1Q81C 3LWIA 1GFCA 4QW2A 3V8JA 4PFOA 2MI6A 4O6JA 2MIOA 2C0TA 2RN8A 2X51A 3HPWA 1M9SA 5IXBA 4LDYA 3CMET 1ZSZA 1WI7A 3EGXB 2QGFB 2RO0A 2FPFA 4JRQA 4J6WA 2MF2A 5CVIA 2HL5C 1GCQA 1IGUA 4IUVA 4II1A 3R6OA 3OYKA 4BI8B 2X4WA 1PCXA 2AKLA 3HTRA 3L2QA 1M90R 4OMOA 3UA6A 1ZX6A 1VQ4T 5I11A 2KEAA 1UTIA 1RAEB 1TTHB 1GBQA 2CUDA 3CMEQ 3L42A 3UWNA 2DVEA 4PFZA 3FRNA 1NZ9A 4LDWA 2FZGB 3FJPA 1IHWA 4C8QC 4Q5WA 5GMKm 4C92B 5LJ5j 3DLLA 3ASKA 1VQMT 2DIGA 4JRIA 2NUZA 4RMOA 4M7AF 2KDSA 4MDXA 8ATCB 3QSUA 5DLOA 2L5QA 4M77E 4KT0E 4IUUA 1N5ZA 2Y4YA 2CYZB 3PGGA 3CCSA 3I55T 3LX7A 5GANd 2EJFA 4OB2B 1R8OB 3CC7Q 4DBHA 1VQPQ 4Z8AA 4M7DB 2AHJB 2EQMA 2ENMA 1QVPA 2O88A 3JB9F 4N4GA 4RKUE 4IUTA 1DJ7B 4LD6A 3QDRB 2QQBA 3OYEA 1M8VA 2DILA 1T0HA 2LDMA 4OB1B 1YJNQ 2YUQA 3P8DA 1SRMA 5A2QE 2R5AA 2BZYA 4IKFA 4A4GA 2OX7A 4CC3A 3EGDA 1YP5A 1LNXA 2O4XB 4EMKA 3V8KA 3X26B 1G83A 3RBBB 4FSSA 4M78E 5CK9A 5IT9E 3OYDA 3PE0A 1Q7YC 4LUDA 4PJOF 1YITT 5IAYA 1X2QA 5KYYB 2J05A 1OZ3A 2GCXA 2R57A 1K0SA 2HMAA 4CI0C 3RMSA 1NYFA 5GANf 1YCYA 2DYBA 2QEXT 2HL3A 1IRXA 4C92C 4HCBA 1PSEA 2A7YA 3CCRT 4LN2A 1AT1B 1RACB 2MWOA 3OBYA 2JT4A 2D8HA 2H8HA 2DERA 1NPRA 3FDRA 2HBWA 3LYIA 2PZ1A 1F1BB 5LJ3j 4DBFA 4ORZA 2RHUA 3BY7A 1YI2A 4RUGA 4E7JA 3S3NA 1Y57A 2DETA 1K73C 2ZGWA 3GPLA 5D6WA 4BE2A 1K76A 3JCMV 4QQ6A 1K8AR 3GNFB 4ZGJB 2BTTA 1D3BA 2O2OA 1JBMA 2OI3A 3OMCA 2RJCA 1OULA 4MDWA 1FX7A 1N8RR 4RTWA 4E7KA 2GF7A 1YBYA 4PJJA 1QQJA 3V7SA 4WCIA 4FYYB 4C92F 4FW2A 4JRPA 2VKNA 3RNJA 2YLCA 1LPLA 2NUPB 2AIRB 2HKNA 1U1TA 2LQ8A 2KBTA 4EPCA 3I56Q 2QAZA 4M7DG 4L59A 2CGHA 2DA9A 1OX9A 4MZTA 3CXCA 4JRKA 1MMNA 4DOWA 4M75G 1FMVA 1YJ9A 4BE1A 4J6XA 3DLMA 4R56A 5IHNA 4M78A 2M51A 2IIMA 2FRYA 1YWOA 4LDXA 3EHRA 1Q7YR 1P92A 3CMAQ 3JB9G 3NFCA 2PVGB 5KH6A 5LJ5g 1PSFA 3X28B 1T0JA 1NLOC 3MEUA 1Q82U 3PT9A 2KE9A 2EYQA 4BD3A 4XTZA 4LDVA 3SB2A 3KBGA 1W4SA 1NLPC 3CC2A 2E4HA 2EYYA 3CPWS 1G3WA 3CD6T 2Y4XA 4KH0B 3GNGA 1Y07A 2LT4A 2CDTA 1I5OB 3DKMA 1R0CB 1IHVA 1OYXA 3VUBA 4M77G 5CKFA 1SSHA 4JJCA 1UFFA 3JB9I 2HNIA 4BUGA 3OS1A 1RAIB 2DKGA 3KUFA 3A8OB 2FPEA 3CCJT 1N8RU 5FWBA 2J6FA 4JLGA 1VQ7A 4QVCA 4LE9A 4B6MA 1M1KR 2A36A 4CC4B 4M78B 4AFUC 1M1KU 2F69A 4OF1A 1CKAA 4QT7A 1O9SA 3OYBA 1VQOA 2KSSA 4FSXA 1RI9A 2HKQB 5KYNA 3OW2P 1NM7A 2K5IA 1YJ9Q 1WHHA 2GFUA 3QXEB 1PHTA 3M0SA 1BI1A 3N5BB 2RJEA 2ATCB 4IUPA 4OGCA 5FU7C 1PWTA 4M75B 4M77C 4QVDA 2EJ9A 1U3OA 3H6ZA 1VIFA 4M7DE 1YHQT 1YJWQ 4B9WA 3A98A 1H8KA 3OYLA 3GIBA 4ME7A 1MNEA 1TOVA 2AT1B 4Y28E 3DB4A 5FU7B 4JZ4A 4HKEA 3I5SA 1EX4A 5KYXA 1TUCA 4HVUA 3VS1A 3FEOA 1Q86U 5LJ3f 5I21A 1S72T 2K5LA 2BUDA 4KULA 2F1LA 1MHNA 3FLGA 2JTMA 2G3RA 1Q81R 4C8QG 1X6GA 5GAMg 1Q81U 2GFAA 1YHQA 2YUPA 1WHKA 3LGLA 4BI3A 3CCST 3SHWA 5CCAA 2I2LA 5CKDA 1WLPB 1OOTA 3JCMg 1VQNQ 4OMMA 2W10A 4E7LA 2NLUA 4M78C 2K3BA 4M7AD 3MP6A 3C12A 1PD0A 1B3QA 1QWEA 1ZSZB 3REBB 3NGPA 1QP3A 3GP8A 2DZCA 3X20B 1FMKA 2ED1A 2BE7D 1VQKA 4M77D 3M56A 1M2VB 1JJ2S 3CC2T 3G4ST 5CQYA 2XHCA 3ZFJA 1BIAA 2F5TX 4HVWA 3OS5A 4C92E 3M54A 4DEXA 5I22A 1VYTA 1JEGA 4N0AA 4C92A 3E1SA 4PLLA 3CCLQ 1QKXA 3JB9J 3CCLT 2J6OA 1WFWA 3I9QA 2JTFA 5LJ5e 2LJ0A 4CC7A 2A0FB 2WSEE 4X9CA 2LZ6B 3CCJQ 2JN0A 2V1RA 5GAMd 3M9QA 1QVGS 2FHDA 3OY9A 4FYVB 4GBQA 4V2SA 1ZSGA 1VQ6Q 1HK9A 2GNCA 3RUXA 1RAGB 2XK0A 4PJOC 1D09B 2YRVA 5D6XA 1TUDA 2RPNA 3JAME 1BI2A 3QYHB 3GF5A 3G71Q 4PJOD 2XG8D 3OW2A 1XQHA 3JCMh 1SEMA 2DXBA 3CPWA 4OMNA 1MUZA 2E1HA 2FZCB 4A63B 4PLIA 1H92A 3JCMf 4FYXB 5GMKi 2DK3A 4KRTA 2JVVA 2YRCA 5IH2A 2AK5A 2CUBA 2P4RA 2QQ9A 4OMQA 1NJIC 2JNGA 4HA8A 4X34A 2RJFA 2WSCE 4M7DA 1E6HA 5GANg 5GMKe 1C6VX 2RB6A 1UB4A 4GLMA 4M4ZA 1KC8R 1XOVA 2DZ9A 2KXDA 2QASA 2ROTA 1SF9A 2HCKA 4LXCA 2E70A 2DTHA 1U06A 1TUGB 2V26A 2EBPA 4Y91A 2EIFA 3J7AF 1CKBA 2L3QA 1T3LA 3HFNA 1GCQC 3OYHA 3JB9D 1SHGA 2L3PA 4CC2A 4RTUA 5J39A 2NUPA 2GQIA 4FIBA 1WZOA 1UDLA 4EDUA 5KYWA 1BI0A 2DXCA 3CC7A 5LJ5d 4J6YA 4ESRA 3OSSC 2V8JA 1I07A 4VUBA 2K79A 4A4HA 1IO6A 4RTZA 1WJSA 4PJOG 2ZPHB 3G4SA 4BI4A 2EWNA 2C0OA 4EIKA 2DM1A 1K0XA 2LQKA 1BB9A 1HD3A 1TG0A 1VIEA 3NMZC 5CO7A 1Z9ZA 2O31A 1K73R 2X3XD 3MHXA 2QDLA 2FPDA 2ZCFB 1O75A 4HCKA 2YWWA 1Y71A 3C0CA 5KYUA 4A4KA 3P8HA 4J9FA 3SWNB 2DD5A 3JCMc 1K9MR 2OTLQ 2DFUA 1VQ9T 1U5SA 3G4SQ 1K4US 2EGAA 3CD6A 4OB3B 3VYGA 1NYGA 4M7AE 2WSFE 2K4YA 2VVKA 5FRNA 4LD9K 3S3MA 1B34B 4Z88A 3NPFA 2BIVA 2CZ0B 3I5RA 4A54A 2OTJQ 5GAMj 4N4IA 2DRMA 1Q86C 3L2RA 2QEXA 2MK5A 1QWFA 4XU3A 1OU9A 2JM9A 3UA7A 1VQ7T 3A5ZB 2D6FA 4RCBA 2KAFA 1IGQA 1VQNT 2DNUA 1VQPT 5KYXB 4BE0A 4M7DC 5GJWB 2F5KA 2YXYA 3V7CA 4PJOA 2VXEA 1VYVA 4PJLA 2L2PA 3TU4K 1UE9A 1S72Q 3G6EA 2RHXA 4X1VA 3L2WA 2ZAEA 2COZA 1WXTA 2VGNA 2JS2A 2LVMA 4FU6A 4EMGA 3M58A 2RMOA 4GLKA 4HCZA 4OVAA 2YUOA 4RTVA 4C0FA 1X69A 1NJIU 3M0UA 3OW2S 2LCLA 1AZEA 2LC4A 4C8QE 4DOVA 4E6RA 4BACA 2C06A 1KSWA 1K9MC 1C0MA 2CSIA 4ZGDB 3AHUA 1S72A 4P5NA 1M2OA 2AZSA 3UDCA 5GAN5 2JM8A 2M16A 2FRWA 5I2MA 1QCOA 3HKSA 1VQLT 5LJ5f 3QJ6A 1C1AA 4DA4A 3F70A 1Q95G 2DMOA 2GQVA 3OB9A 1KFZA 1AOJA 2MYSA 1W2BS 3CCVT 2DPPB 4C0DC 1ZQ1A 1GL5A 5GAN7 5CAIA 1IREB 3CCUA 1NEBA 1RADB 3CXCS 1VQ9A 3MEAA 1BI3A 4CRIA 1CSKA 1G2BA 2O01E 3M57A 4WF2A 5GANe 4RCCA 5HKCA 2KYBA 1YJWA 2KR3A 2BKDN 1M8MA 1H641 2RHIA 4KUIA 4PKCC 2EAYA 4XQ3A 1M30A 4FM4B 1YITA 3UPUA 4J8OA 2D9TA 5GAMf 5FU6C 2FYKA 3ME9A 1PKSA 2HEQA 2DJZA 4XK8E 2KXCA 1H3ZA 1QMCA 4J7FA 4BDZA 1JXOA 2RI2A 1MV0B 4K11A 3HRUA 3PIOA 1W1FA 1V76A 1WX6A 3TCJA 5M9OA 4OMPA 3CD6Q 1NPPA 3ZL7C 3PMTA 2ABLA 3J80E 2E10A 2NWMA 4C5IA 4ZTJA 1N6AA 2LJ1A 3BW1A 4YTLA 1YI2T 2BZ8A 4J9DA 3WXMB 1KQ2A 3FIFA 1NG2A 3I56A 1WGSA 2B86A 3A8GB 2XDDA 3CCSQ 2QGGA 3G1JA 3MO8A 2VUBA 2XICA 2K6DA 2CSQA 2F2WA 2CZ1B 2K9GA 1WHLA 2DL4A 3LLRA 1AHJB 1VQOT 2XU8A 2R58A 3EGUA 3G7ZA 1VQMQ 3D7SB 2KRMA 1KC8U 1KHCA 4KGZB 2K57A 1FMWA 1UGPB 4M75D 3LW5E 4AFQC 7AT1B 5KCHA 3UT1A 2WACA 2KT1A 5J26A 3H0IA 4FT4A 3QO3A 4M77B 4M75C 1VQLA 3CCQA 1B34A 4MZPA 3X25B 1IB8A 2VV5A 1YNZA 3EG9B 5LJ3d 2L89A 1ZBXA 5LJ5h 4QVZA 1ZBJA 2KROA 4NL2A 5GAN6 5A0LA 1VQ8A 1I0CA 3BDUA 1M1FA 1KD1R 1S1NA 1ZUKA 4KGVB 5C0MA 2PUOB 3CCVQ 3L2VA 1RUWA 1KQSS 4IURA 4ANJA 3GBQA 4HXJA 3JCMP 4F7UE 3JCMQ 2RQWA 2P0QA 4RTXA 1M90C 1OPKA 5CKBA 3M0QA 5HY6A 2DX1A 2Z0WA 1W6XA 3UF4A 1Y7XA 1UECA 4F7UG 1YJWT 1ZUYA 1BCOA 4C8QA 3MEWA 1OX8A 3VV0A 4DBRA 4ATOA 1WHMA 4LUEA 1RABB 2M02A 3M59A 3OYNA 1XNIA 2DF6A 4IIOA 1VQ9Q 1ZA2B 1X2KA 1EFNA 3M5AA 3CC4T 3WVEB 1OPLA 2DBKA 3O5ZA 1VQ6T 2DLPA 1Y96B 2V8IA 3EFRA 2EFIA 5LJ3g 5CKHA 1M27C 2MMPA 2CP3A 1OEBA 3A8LB 3MJXA 2JJ9A 1MMAA 4XTVA 3U23A 4B9XA 4LNPA 1VYUA 1JJ2A 4E7ZA 2DIQA 4QQDA 3QIIA 1YWPA 4EMKB 4BY6C 5CKEA 2DAQA 1E6GA 2A08A 2LTOA 4OB0B 2LMJA 2YDLA 1RL2A 2MPXC 3C4SA 4IIMA 3TEEA 1JXMA 3QZ5B 3I55Q 2LCCA 5GAMe 2F2XA 3CCET 4Z89A 4ZNXA 1PRLC 5DM7R 3PVLA 2EGEA 1WA7A 3CQTA 4PJMA 4BDYA 1UJ0A 3G6ET 2JW4A 2DJQA 2KRSA 2M9UA 3MEVA 1RAAB 3OYFA 2RF0A 1BKBA 4JZ3A 1YIJT 2X4XA 3CCMA 5LL6S 2D0QB 2DYIA 2NYSA 1TH7A 3VJPA 4UC4A 1WJQA 4MMLA 2DL8A 2X4JA 2CT4A 4E7HA 3S6WA 1UUEA 5LJ3h 2KRNA 1VQ8T 5GAOq 1D3BB 3E19A 2CH4A 3OYGA 1M2VA 4HT8A 4HT9A 4MMKA 3LGFA 5GAOn 2EYXA 1GRIA 4JJNK 3CCMT 3QJYA 1EZZB 1N9SA 2HQHA 1FXXA 3KFVA 1TWBA 3E9GA 2YT6A 4D8DA 4RTTA 4E7SA 5GAOm 1QVGA 1YN8A 1M1KC 2J06A 3CPFA 3HP9A 2P0KA 3CCVA 2LX7A 1VQ4Q 4C0ZA 1Y96A 4C5GA 5IXFA 2K2VA 1B7TA 2KY9A 1VQ7Q 2ESWA 3G6EQ 1QCFA 2LP5A 2E64A 3SFMA 2QG9B 5HK3A 2FL7A 2A28A 2NUTA 3EFOB 4FYWB 1I1JA 1VQOQ 1E7OA 3META 1TU0B 4XTYA 4R0KA 5GAOl 2DO3A 2H3EB 4NS5A 1FWZA 3MPUB 1GBRA 4E7IA 5FRMA 3I35A 5HK0A 3M4GA 4JLIA 4BY6B 3TSZA 1UJYA 2RD1A 3VU3C 1IXDA 2KNBB 2PVDB 2QA4Q 1RI0A 2OTJA 4M7AG 5GMKj 5CQXA 3JB9H 2LNHB 5A0GA 1BU1A 4PJOE 1W2BP 2OAWA 1UGRB 5GAOp 2K3YA 1U8RA 3EH2A 1SG5A 2CT3A 2I0NA 2QQRA 4XU2A 1QLYA 4HVVA 1GCPA 1ZUUA 4ELZC 1I81A 3QWYA 5KCOA 4TVRA 1KK7A 1K73U 2OTLA 3J81E 3OS0A 2AKKA 5L23A 3M0RA 4F17A 1MMDA 1VQNA 2LX9A 1W70A 1QVFP 4M75E 1YIJA 2SRCA 2P0PA 1X43A 3EHQA 4C5EA 4M7AA 2O9VA 5D7UA 3UATA 4J5YA 3FB9A 1RAFB 2NUTB 5AYFA 3QBYA 3CBOA 2CP0A 2PTKA 3CPWP 1VQKT 2HQEA 2K3XA 4QQGA 4RG2A 2RHZA 5C6SA 5KYUB 3FC3A 1MMGA 1X75C 1OI1A 1SRLA 2QTXA 1I8FA 2EVRA 1ZHIA 1YIJQ 1YCSB 2DXTA 3P8BB 2KQWA 4QKUA 3ULRB 3CCRA 4M7DF 3EFSA 4ZN1A 1K8AU 2RQRA 1X6OA 2E5KA 3CCUQ 3EGXA 4FW1A 4D8KA 2VGMA 3HFOA 1JO8A 5DY9A 5A0DA 3CCLA 2VB6A 1QCNA 4C5HA 5IHKA 2XIDA 1AZGB 4PK4A 3MKDA 3V7RA 3PNWC 4Y92A 4XTUA 1PC0A 3A1PA 2DL3A 3R6NA 2X4YA 9ATCB 1WXUA 3JV3A 2RNAA 2R5MA 2CZ7B 1LCKA 4J9EA 2JTEA 4R55A 2CKKA 3VRZA 2RQVA 2E3HA 2DEQA 2YSQA 3G71A 3INZA 2VC8A 3CCRQ 4E2FB 1UHFA 2L8DA 2FB7A 1KG1A 5FROA 4ZTFA 2VWFA 2FVUA 4C92D 2L0AA 2DVJA 4XTWA 2KMTA 3TREA 3DB3A 2V8KA 1Q82R 2JUFA 2DL7A 2K7AA 3PMIA 1TSFA 3KXTA 1X6BA 3OA6A 2RH2A 3JCMb 3M53A 2A3LA 2E6NA 2EQJA 3QG1A 2EQIA 4HCCA 1ACMB 2YHTA 3HL8A 1D0ZA 2EYZA 3RKYA 1Q82C 4F04B 3PTAA 3EGDB 3BE3A 2RQUA 2D0NA 2E6ZA 1WIEA 2PNIA 5EC7A 3CMAT 2XKOC 1OQKA 5FU6B 4FCYA 3CMEA 2ZZDA 5FWCA 3URGA 4XU1A 2E12A 2QQAA 2QA4A 2QQSA 2E3IA 3BDLA 1QVFA 5GAN4 4DQ2A 4AFSC 4NL3A 2HBPA 3JCMW 3RKWA 1XJWB 1X27A 5FLXE 3CCEQ 3OBWA 2HAXA 5KYWB 2JZ2A 2J7IA 3HHTB 2ZPEB 1G3YA 3I56T 1SSFA 2M0YA 4X9DA 1BYMA 1KQ1A 2DL5A 3L1AA 3VUZA 1K8AC 4F7UA 1GXIE 4C0DB 3NTKA 5J3BA 3OQ5A 1LVKA 2KK4A 4E47A 4M78F 2ZPGB 5GAN2 2JOYA 2ROLA 4JUVA 5I2SA 1FYNA 1ZSZC 5D6YA 1K1ZA 1PM3A 1WPYA 1WQWA 2O4XA 2IVWA 2VYTA 3M0PA 2MOXA 1X01A 2EJGA 1J3TA 3OYAA 1GFDA 3SWNA 3CCQT 1AWWA 2DTOA 3L2ZA 4XAXB 2ZPIB 3ZBDA 3OYMA 4ZN3A 3OYIA 3OYYA 1WHGA 2EKHA 3OS2A 1OV3A 4RG8A 2A37A 1KQSA 2VXFA 2C0IA 1HXDA 1G8XA 1QP2A 3IQLA 3VRYA 2O9SA 4LDUA 1N27A 4M75F 1G3SA 3EH1A 4J9IA 1WXBA 1ARKA 1KIKA 2LT1A 2V1QA 4A53A 3MP8A 4J9BA 5IHIA 5KYYA 4JPBW 2CZ6B 2RA2A 3VS2A 2MCNA 1M3BA 1VUBA 1VQ8Q 4AG2C 1WDXA 1IZ6A 1YI2Q 2AZVA 2PQWA 4WTOB 2W0ZA 1RLPC 1UEBA 1KD1U 3QWXX 2GBQA 1BCMA 3CC4A 3CMAA 2EYWA 2DXUA 3E9FA 3QPHA 2XDBA 2KYMA 4Z02A 1R0BG 1KD1C 3CCJA 2OTJT 5DLQE 1HYOA 2GGRA 4ZGEB 2OJ2A 4AG1C 1M3CA 2P4TA 3QYGB 3EG3A 1BK2A 4N4HA 4XU0A 1ABQA 5GMKl 2LQWA 4ELYC 2L3RA 4KBMB 3RKXA 4PNOA 3EG9A 2IG0A 3X24B 1NJIR 4F7UB 2OTLT 2ZPBB 3H8ZA 4DBQA 2COWA 3MP1A 3SWNC 5GAMh 3RIRA 1VQKQ 1LOJA 4L5GA 5CR2A 3JCMJ 2H3JA 2PVOB 3CXCP 4L6V5 1VQPA 2CP7A 3AT1B 2DEUA 4A4FA 2XD0A 5GANh 1D1CA 4PL6A 2ZPFB 5GANj 3CCEA 2FG0A 3C95A 3M55A 6AT1B 2ED0A 2VASA 1M3AA 3A8HB 1WYXA 5GJVB 3PIPA 1M90U 2K5FA 3PFSA 1RAHB 3JCMe 1WQ7A 3QUIA 1TS9A 1VQ5T 1MV3A 4XTXA 3E2UA 2M1HA 1Z9QA 4AT1B 2D1XA 1SHFA 5HCKA 3GLXA 2YRDA 2LCSA 3C94A 2E5QA 3VYHB 2FZKB 3SD4A 1MGQA 1AWOA 2M0OA 1AWXA 1UGVA 4M78G 1KQSP 2X3WD 5FW9A 1VQ5A 5IN1A 2QK0A 1D1AA 3CEYA 2ECZA 2RI3A 3RERA 2CP2A 5ECAA 2MAMA 3S3OA 2QI2A 1JB0E 4MZMA 4M77F 5KE3A 1M4ZA 3RESA 2DTIA 4D6WA 3EG2A 1NBEB 1QVFS 1D1BA 4C8QD 3EG1A 2P84A 4GY5A 1UGQB 1JJ2P 3CCUT 3JCMX 3T9NA 3VS5A 1V1CA 2YUNA 2EPDA 1Q7YU 1PKTA 1BBZA 4RTYA 4J7IA 2DE0X 2EKOA 1PD1A 2RHYA 1G5VA 3O8VA 2EW3A 3GOXA 4JS5A 2HSEB 3LWHA 2B8AA 4BB7A 1UGSB 1YHQQ 1VQ6A 2KVQG 3VS4A 1PNJA 1I5LA 1N8RC 1ABOA 4FL6A 4DEYA 2KGTA 4PJOB 4KUDK 2JMCA 3Q1JA 1N9RA 3H9NA 1NE8A 3M4YA 5AT1B 1YJ9T 3JRZA 3VS6A 1VQMA 2E65A 2EQKA 1ZLMA 2KI7A 1U1SA 2SEMA 1AVZC 2EGCA 1T3SA 1AD5A 4C92G 4AMCA 2LQNA 3NHNA 2X9HA 5GMKh 5L8RE 4J83A 2GTJA 4N0AC 4J9GA 1Q86R 1A0NB 2RJDA 1KC8C 2JS0A 3M0TA 2RK2A 5GAN3 4J9HA 2JXBA 4AFZC 1WJRA 4JJBA 3ZEHA 3TQ7P 2MWPA 1VQ5Q 4EMKC 2LRQA 3QDFA 3VKIA 2YLBA 8AT1B 1D0XA 2OAUA 1OZ2A 1KJWA 1AWJA 1RLQC 1QVGP 2CP5A 1G3TA 1PG5B 3WVDB 2QTVA 1XTDA 2RM4A 3LH5A 4OGEA 1D0YA 5CIUA 4KGXB 3RDVA 3CC4Q 2QDYB 3RMQA 4C8QF 5LJ3e 1SKUB 4J9CA 3CCQQ 1OU8A 2QXFA 1YFNA 4OMFB 2X35A 1M5Q1 4A4EA 4PFPA 3OSVA 2EQUA 3CCMQ 2RI5A 1UHCA 4JDSA 1AEYA 3QZ9B 2XI9A 4OP0A 3LH0A 4EMHA 2L3SA 4C8QB 1UG1A 1LJOA 1PRMC 3QKJA 3HRSA 4M77A 3EFOA 3FJ5A 2QYZA 2HZYA 3A8MB 4JS4A 5EG2A 2XMFA 3EAEA 1R77A 1HSQA 2Y90A 1TXQA 1Y0MA 3TVTA 1JQQA 3NTHA 1BIBA 2J6KA 2CREA 2LNVA 4O5VA 2PU9B 1W2BA 2BE9B
chains in the Genus database with same CATH topology
1W2BP 1Q81R 1N8RR 1QVFP 3CXCP 1YJWQ 1VQ8Q 3I55Q 1VQ4Q 1Q7YR 3CC2Q 3G71Q 1JJ2P 1VQ9Q 1M90R 1YI2Q 1K9MR 3OW2P 1Q86R 1VQ7Q 3G6EQ 2OTLQ 3CC7Q 3CCQQ 3CCJQ 1YJ9Q 1VQPQ 2OTJQ 3G4SQ 1YIJQ 1VQLQ 1VQNQ 3CCEQ 1VQMQ 1Q82R 1QVGP 2QA4Q 1K73R 1S72Q 1KC8R 1K8AR 1NJIR 1YHQQ 3CMEQ 3CCMQ 1VQ6Q 3CCSQ 1VQOQ 1M1KR 3I56Q 3CCUQ 3CCRQ 1VQ5Q 1KD1R 3CPWP 1YITQ 2QEXQ 3CCLQ 1VQKQ 3CD6Q 1KQSP 3CCVQ 1YJNQ 3CC4Q 3CMAQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B P;  1Q81 R;  1N8R R;  1QVF P;  3CXC P;  1YJW Q;  1VQ8 Q;  3I55 Q;  1VQ4 Q;  1Q7Y R;  3CC2 Q;  3G71 Q;  1JJ2 P;  1VQ9 Q;  1M90 R;  1YI2 Q;  1K9M R;  3OW2 P;  1Q86 R;  1VQ7 Q;  3G6E Q;  2OTL Q;  3CC7 Q;  3CCQ Q;  3CCJ Q;  1YJ9 Q;  1VQP Q;  2OTJ Q;  3G4S Q;  1YIJ Q;  1VQL Q;  1VQN Q;  3CCE Q;  1VQM Q;  1Q82 R;  1QVG P;  2QA4 Q;  1K73 R;  1S72 Q;  1KC8 R;  1K8A R;  1NJI R;  1YHQ Q;  3CME Q;  3CCM Q;  1VQ6 Q;  3CCS Q;  1VQO Q;  1M1K R;  3I56 Q;  3CCU Q;  3CCR Q;  1VQ5 Q;  1KD1 R;  3CPW P;  1YIT Q;  2QEX Q;  3CCL Q;  1VQK Q;  3CD6 Q;  1KQS P;  3CCV Q;  1YJN Q;  3CC4 Q;  3CMA Q; 
#chains in the Genus database with same CATH topology
 3MCA B;  3THK A;  3TSW A;  3NTI A;  3SEM A;  4M7D D;  4OML A;  3H41 A;  1VQ4 A;  2HSP A;  3RR6 A;  3CBP A;  3VS3 A;  1VOM A;  4F14 A;  2K2M A;  2QEX Q;  2PUK B;  3V8L A;  4C0G A;  3QHS A;  4M78 D;  3VS7 A;  1QKW A;  1SPK A;  1K9M U;  2HD0 A;  2FO0 A;  2CH4 W;  3EG0 A;  4F7U F;  3OYJ A;  1ZA1 B;  2DD4 A;  1WNL A;  3JCM d;  2IPO B;  4M7A B;  1EIF A;  2HQX A;  2XDP A;  3REA B;  4NOY A;  5GAN 8;  1JU5 C;  4M75 A;  2DRK A;  1YJN A;  3OMG A;  2QA4 T;  3CBM A;  3H0F A;  1MND A;  4FT2 A;  2GTO A;  3I55 A;  2JMA A;  1VA7 A;  5GAO r;  2FEI A;  4IUQ A;  3H0H A;  1HJD A;  3BFM A;  1JRI A;  2G6F X;  2RQT A;  3G71 T;  1H3H A;  3VS0 A;  3HRT A;  3OYC A;  2BZX A;  1KHI A;  2RK1 A;  2KT8 A;  1WHJ A;  1YIT Q;  2HDA A;  1B07 A;  1QW1 A;  2LJ3 A;  4F16 A;  1YJN T;  5KE2 A;  3CC2 Q;  2CS7 A;  3L2U A;  2COY A;  3SDZ A;  3ER0 A;  1K9A A;  1V29 B;  1VQL Q;  1I4K 1;  2D8J A;  3PVQ A;  4JJD A;  2CP6 A;  1M1G A;  4KH1 B;  2E41 A;  4PJN A;  3HSB A;  2DBM A;  3JSC A;  3CC7 T;  1NEG A;  4M7A C;  2F2V A;  1Q81 C;  3LWI A;  1GFC A;  4QW2 A;  3V8J A;  4PFO A;  2MI6 A;  4O6J A;  2MIO A;  2C0T A;  2RN8 A;  2X51 A;  3HPW A;  1M9S A;  5IXB A;  4LDY A;  3CME T;  1ZSZ A;  1WI7 A;  3EGX B;  2QGF B;  2RO0 A;  2FPF A;  4JRQ A;  4J6W A;  2MF2 A;  5CVI A;  2HL5 C;  1GCQ A;  1IGU A;  4IUV A;  4II1 A;  3R6O A;  3OYK A;  4BI8 B;  2X4W A;  1PCX A;  2AKL A;  3HTR A;  3L2Q A;  1M90 R;  4OMO A;  3UA6 A;  1ZX6 A;  1VQ4 T;  5I11 A;  2KEA A;  1UTI A;  1RAE B;  1TTH B;  1GBQ A;  2CUD A;  3CME Q;  3L42 A;  3UWN A;  2DVE A;  4PFZ A;  3FRN A;  1NZ9 A;  4LDW A;  2FZG B;  3FJP A;  1IHW A;  4C8Q C;  4Q5W A;  5GMK m;  4C92 B;  5LJ5 j;  3DLL A;  3ASK A;  1VQM T;  2DIG A;  4JRI A;  2NUZ A;  4RMO A;  4M7A F;  2KDS A;  4MDX A;  8ATC B;  3QSU A;  5DLO A;  2L5Q A;  4M77 E;  4KT0 E;  4IUU A;  1N5Z A;  2Y4Y A;  2CYZ B;  3PGG A;  3CCS A;  3I55 T;  3LX7 A;  5GAN d;  2EJF A;  4OB2 B;  1R8O B;  3CC7 Q;  4DBH A;  1VQP Q;  4Z8A A;  4M7D B;  2AHJ B;  2EQM A;  2ENM A;  1QVP A;  2O88 A;  3JB9 F;  4N4G A;  4RKU E;  4IUT A;  1DJ7 B;  4LD6 A;  3QDR B;  2QQB A;  3OYE A;  1M8V A;  2DIL A;  1T0H A;  2LDM A;  4OB1 B;  1YJN Q;  2YUQ A;  3P8D A;  1SRM A;  5A2Q E;  2R5A A;  2BZY A;  4IKF A;  4A4G A;  2OX7 A;  4CC3 A;  3EGD A;  1YP5 A;  1LNX A;  2O4X B;  4EMK A;  3V8K A;  3X26 B;  1G83 A;  3RBB B;  4FSS A;  4M78 E;  5CK9 A;  5IT9 E;  3OYD A;  3PE0 A;  1Q7Y C;  4LUD A;  4PJO F;  1YIT T;  5IAY A;  1X2Q A;  5KYY B;  2J05 A;  1OZ3 A;  2GCX A;  2R57 A;  1K0S A;  2HMA A;  4CI0 C;  3RMS A;  1NYF A;  5GAN f;  1YCY A;  2DYB A;  2QEX T;  2HL3 A;  1IRX A;  4C92 C;  4HCB A;  1PSE A;  2A7Y A;  3CCR T;  4LN2 A;  1AT1 B;  1RAC B;  2MWO A;  3OBY A;  2JT4 A;  2D8H A;  2H8H A;  2DER A;  1NPR A;  3FDR A;  2HBW A;  3LYI A;  2PZ1 A;  1F1B B;  5LJ3 j;  4DBF A;  4ORZ A;  2RHU A;  3BY7 A;  1YI2 A;  4RUG A;  4E7J A;  3S3N A;  1Y57 A;  2DET A;  1K73 C;  2ZGW A;  3GPL A;  5D6W A;  4BE2 A;  1K76 A;  3JCM V;  4QQ6 A;  1K8A R;  3GNF B;  4ZGJ B;  2BTT A;  1D3B A;  2O2O A;  1JBM A;  2OI3 A;  3OMC A;  2RJC A;  1OUL A;  4MDW A;  1FX7 A;  1N8R R;  4RTW A;  4E7K A;  2GF7 A;  1YBY A;  4PJJ A;  1QQJ A;  3V7S A;  4WCI A;  4FYY B;  4C92 F;  4FW2 A;  4JRP A;  2VKN A;  3RNJ A;  2YLC A;  1LPL A;  2NUP B;  2AIR B;  2HKN A;  1U1T A;  2LQ8 A;  2KBT A;  4EPC A;  3I56 Q;  2QAZ A;  4M7D G;  4L59 A;  2CGH A;  2DA9 A;  1OX9 A;  4MZT A;  3CXC A;  4JRK A;  1MMN A;  4DOW A;  4M75 G;  1FMV A;  1YJ9 A;  4BE1 A;  4J6X A;  3DLM A;  4R56 A;  5IHN A;  4M78 A;  2M51 A;  2IIM A;  2FRY A;  1YWO A;  4LDX A;  3EHR A;  1Q7Y R;  1P92 A;  3CMA Q;  3JB9 G;  3NFC A;  2PVG B;  5KH6 A;  5LJ5 g;  1PSF A;  3X28 B;  1T0J A;  1NLO C;  3MEU A;  1Q82 U;  3PT9 A;  2KE9 A;  2EYQ A;  4BD3 A;  4XTZ A;  4LDV A;  3SB2 A;  3KBG A;  1W4S A;  1NLP C;  3CC2 A;  2E4H A;  2EYY A;  3CPW S;  1G3W A;  3CD6 T;  2Y4X A;  4KH0 B;  3GNG A;  1Y07 A;  2LT4 A;  2CDT A;  1I5O B;  3DKM A;  1R0C B;  1IHV A;  1OYX A;  3VUB A;  4M77 G;  5CKF A;  1SSH A;  4JJC A;  1UFF A;  3JB9 I;  2HNI A;  4BUG A;  3OS1 A;  1RAI B;  2DKG A;  3KUF A;  3A8O B;  2FPE A;  3CCJ T;  1N8R U;  5FWB A;  2J6F A;  4JLG A;  1VQ7 A;  4QVC A;  4LE9 A;  4B6M A;  1M1K R;  2A36 A;  4CC4 B;  4M78 B;  4AFU C;  1M1K U;  2F69 A;  4OF1 A;  1CKA A;  4QT7 A;  1O9S A;  3OYB A;  1VQO A;  2KSS A;  4FSX A;  1RI9 A;  2HKQ B;  5KYN A;  3OW2 P;  1NM7 A;  2K5I A;  1YJ9 Q;  1WHH A;  2GFU A;  3QXE B;  1PHT A;  3M0S A;  1BI1 A;  3N5B B;  2RJE A;  2ATC B;  4IUP A;  4OGC A;  5FU7 C;  1PWT A;  4M75 B;  4M77 C;  4QVD A;  2EJ9 A;  1U3O A;  3H6Z A;  1VIF A;  4M7D E;  1YHQ T;  1YJW Q;  4B9W A;  3A98 A;  1H8K A;  3OYL A;  3GIB A;  4ME7 A;  1MNE A;  1TOV A;  2AT1 B;  4Y28 E;  3DB4 A;  5FU7 B;  4JZ4 A;  4HKE A;  3I5S A;  1EX4 A;  5KYX A;  1TUC A;  4HVU A;  3VS1 A;  3FEO A;  1Q86 U;  5LJ3 f;  5I21 A;  1S72 T;  2K5L A;  2BUD A;  4KUL A;  2F1L A;  1MHN A;  3FLG A;  2JTM A;  2G3R A;  1Q81 R;  4C8Q G;  1X6G A;  5GAM g;  1Q81 U;  2GFA A;  1YHQ A;  2YUP A;  1WHK A;  3LGL A;  4BI3 A;  3CCS T;  3SHW A;  5CCA A;  2I2L A;  5CKD A;  1WLP B;  1OOT A;  3JCM g;  1VQN Q;  4OMM A;  2W10 A;  4E7L A;  2NLU A;  4M78 C;  2K3B A;  4M7A D;  3MP6 A;  3C12 A;  1PD0 A;  1B3Q A;  1QWE A;  1ZSZ B;  3REB B;  3NGP A;  1QP3 A;  3GP8 A;  2DZC A;  3X20 B;  1FMK A;  2ED1 A;  2BE7 D;  1VQK A;  4M77 D;  3M56 A;  1M2V B;  1JJ2 S;  3CC2 T;  3G4S T;  5CQY A;  2XHC A;  3ZFJ A;  1BIA A;  2F5T X;  4HVW A;  3OS5 A;  4C92 E;  3M54 A;  4DEX A;  5I22 A;  1VYT A;  1JEG A;  4N0A A;  4C92 A;  3E1S A;  4PLL A;  3CCL Q;  1QKX A;  3JB9 J;  3CCL T;  2J6O A;  1WFW A;  3I9Q A;  2JTF A;  5LJ5 e;  2LJ0 A;  4CC7 A;  2A0F B;  2WSE E;  4X9C A;  2LZ6 B;  3CCJ Q;  2JN0 A;  2V1R A;  5GAM d;  3M9Q A;  1QVG S;  2FHD A;  3OY9 A;  4FYV B;  4GBQ A;  4V2S A;  1ZSG A;  1VQ6 Q;  1HK9 A;  2GNC A;  3RUX A;  1RAG B;  2XK0 A;  4PJO C;  1D09 B;  2YRV A;  5D6X A;  1TUD A;  2RPN A;  3JAM E;  1BI2 A;  3QYH B;  3GF5 A;  3G71 Q;  4PJO D;  2XG8 D;  3OW2 A;  1XQH A;  3JCM h;  1SEM A;  2DXB A;  3CPW A;  4OMN A;  1MUZ A;  2E1H A;  2FZC B;  4A63 B;  4PLI A;  1H92 A;  3JCM f;  4FYX B;  5GMK i;  2DK3 A;  4KRT A;  2JVV A;  2YRC A;  5IH2 A;  2AK5 A;  2CUB A;  2P4R A;  2QQ9 A;  4OMQ A;  1NJI C;  2JNG A;  4HA8 A;  4X34 A;  2RJF A;  2WSC E;  4M7D A;  1E6H A;  5GAN g;  5GMK e;  1C6V X;  2RB6 A;  1UB4 A;  4GLM A;  4M4Z A;  1KC8 R;  1XOV A;  2DZ9 A;  2KXD A;  2QAS A;  2ROT A;  1SF9 A;  2HCK A;  4LXC A;  2E70 A;  2DTH A;  1U06 A;  1TUG B;  2V26 A;  2EBP A;  4Y91 A;  2EIF A;  3J7A F;  1CKB A;  2L3Q A;  1T3L A;  3HFN A;  1GCQ C;  3OYH A;  3JB9 D;  1SHG A;  2L3P A;  4CC2 A;  4RTU A;  5J39 A;  2NUP A;  2GQI A;  4FIB A;  1WZO A;  1UDL A;  4EDU A;  5KYW A;  1BI0 A;  2DXC A;  3CC7 A;  5LJ5 d;  4J6Y A;  4ESR A;  3OSS C;  2V8J A;  1I07 A;  4VUB A;  2K79 A;  4A4H A;  1IO6 A;  4RTZ A;  1WJS A;  4PJO G;  2ZPH B;  3G4S A;  4BI4 A;  2EWN A;  2C0O A;  4EIK A;  2DM1 A;  1K0X A;  2LQK A;  1BB9 A;  1HD3 A;  1TG0 A;  1VIE A;  3NMZ C;  5CO7 A;  1Z9Z A;  2O31 A;  1K73 R;  2X3X D;  3MHX A;  2QDL A;  2FPD A;  2ZCF B;  1O75 A;  4HCK A;  2YWW A;  1Y71 A;  3C0C A;  5KYU A;  4A4K A;  3P8H A;  4J9F A;  3SWN B;  2DD5 A;  3JCM c;  1K9M R;  2OTL Q;  2DFU A;  1VQ9 T;  1U5S A;  3G4S Q;  1K4U S;  2EGA A;  3CD6 A;  4OB3 B;  3VYG A;  1NYG A;  4M7A E;  2WSF E;  2K4Y A;  2VVK A;  5FRN A;  4LD9 K;  3S3M A;  1B34 B;  4Z88 A;  3NPF A;  2BIV A;  2CZ0 B;  3I5R A;  4A54 A;  2OTJ Q;  5GAM j;  4N4I A;  2DRM A;  1Q86 C;  3L2R A;  2QEX A;  2MK5 A;  1QWF A;  4XU3 A;  1OU9 A;  2JM9 A;  3UA7 A;  1VQ7 T;  3A5Z B;  2D6F A;  4RCB A;  2KAF A;  1IGQ A;  1VQN T;  2DNU A;  1VQP T;  5KYX B;  4BE0 A;  4M7D C;  5GJW B;  2F5K A;  2YXY A;  3V7C A;  4PJO A;  2VXE A;  1VYV A;  4PJL A;  2L2P A;  3TU4 K;  1UE9 A;  1S72 Q;  3G6E A;  2RHX A;  4X1V A;  3L2W A;  2ZAE A;  2COZ A;  1WXT A;  2VGN A;  2JS2 A;  2LVM A;  4FU6 A;  4EMG A;  3M58 A;  2RMO A;  4GLK A;  4HCZ A;  4OVA A;  2YUO A;  4RTV A;  4C0F A;  1X69 A;  1NJI U;  3M0U A;  3OW2 S;  2LCL A;  1AZE A;  2LC4 A;  4C8Q E;  4DOV A;  4E6R A;  4BAC A;  2C06 A;  1KSW A;  1K9M C;  1C0M A;  2CSI A;  4ZGD B;  3AHU A;  1S72 A;  4P5N A;  1M2O A;  2AZS A;  3UDC A;  5GAN 5;  2JM8 A;  2M16 A;  2FRW A;  5I2M A;  1QCO A;  3HKS A;  1VQL T;  5LJ5 f;  3QJ6 A;  1C1A A;  4DA4 A;  3F70 A;  1Q95 G;  2DMO A;  2GQV A;  3OB9 A;  1KFZ A;  1AOJ A;  2MYS A;  1W2B S;  3CCV T;  2DPP B;  4C0D C;  1ZQ1 A;  1GL5 A;  5GAN 7;  5CAI A;  1IRE B;  3CCU A;  1NEB A;  1RAD B;  3CXC S;  1VQ9 A;  3MEA A;  1BI3 A;  4CRI A;  1CSK A;  1G2B A;  2O01 E;  3M57 A;  4WF2 A;  5GAN e;  4RCC A;  5HKC A;  2KYB A;  1YJW A;  2KR3 A;  2BKD N;  1M8M A;  1H64 1;  2RHI A;  4KUI A;  4PKC C;  2EAY A;  4XQ3 A;  1M30 A;  4FM4 B;  1YIT A;  3UPU A;  4J8O A;  2D9T A;  5GAM f;  5FU6 C;  2FYK A;  3ME9 A;  1PKS A;  2HEQ A;  2DJZ A;  4XK8 E;  2KXC A;  1H3Z A;  1QMC A;  4J7F A;  4BDZ A;  1JXO A;  2RI2 A;  1MV0 B;  4K11 A;  3HRU A;  3PIO A;  1W1F A;  1V76 A;  1WX6 A;  3TCJ A;  5M9O A;  4OMP A;  3CD6 Q;  1NPP A;  3ZL7 C;  3PMT A;  2ABL A;  3J80 E;  2E10 A;  2NWM A;  4C5I A;  4ZTJ A;  1N6A A;  2LJ1 A;  3BW1 A;  4YTL A;  1YI2 T;  2BZ8 A;  4J9D A;  3WXM B;  1KQ2 A;  3FIF A;  1NG2 A;  3I56 A;  1WGS A;  2B86 A;  3A8G B;  2XDD A;  3CCS Q;  2QGG A;  3G1J A;  3MO8 A;  2VUB A;  2XIC A;  2K6D A;  2CSQ A;  2F2W A;  2CZ1 B;  2K9G A;  1WHL A;  2DL4 A;  3LLR A;  1AHJ B;  1VQO T;  2XU8 A;  2R58 A;  3EGU A;  3G7Z A;  1VQM Q;  3D7S B;  2KRM A;  1KC8 U;  1KHC A;  4KGZ B;  2K57 A;  1FMW A;  1UGP B;  4M75 D;  3LW5 E;  4AFQ C;  7AT1 B;  5KCH A;  3UT1 A;  2WAC A;  2KT1 A;  5J26 A;  3H0I A;  4FT4 A;  3QO3 A;  4M77 B;  4M75 C;  1VQL A;  3CCQ A;  1B34 A;  4MZP A;  3X25 B;  1IB8 A;  2VV5 A;  1YNZ A;  3EG9 B;  5LJ3 d;  2L89 A;  1ZBX A;  5LJ5 h;  4QVZ A;  1ZBJ A;  2KRO A;  4NL2 A;  5GAN 6;  5A0L A;  1VQ8 A;  1I0C A;  3BDU A;  1M1F A;  1KD1 R;  1S1N A;  1ZUK A;  4KGV B;  5C0M A;  2PUO B;  3CCV Q;  3L2V A;  1RUW A;  1KQS S;  4IUR A;  4ANJ A;  3GBQ A;  4HXJ A;  3JCM P;  4F7U E;  3JCM Q;  2RQW A;  2P0Q A;  4RTX A;  1M90 C;  1OPK A;  5CKB A;  3M0Q A;  5HY6 A;  2DX1 A;  2Z0W A;  1W6X A;  3UF4 A;  1Y7X A;  1UEC A;  4F7U G;  1YJW T;  1ZUY A;  1BCO A;  4C8Q A;  3MEW A;  1OX8 A;  3VV0 A;  4DBR A;  4ATO A;  1WHM A;  4LUE A;  1RAB B;  2M02 A;  3M59 A;  3OYN A;  1XNI A;  2DF6 A;  4IIO A;  1VQ9 Q;  1ZA2 B;  1X2K A;  1EFN A;  3M5A A;  3CC4 T;  3WVE B;  1OPL A;  2DBK A;  3O5Z A;  1VQ6 T;  2DLP A;  1Y96 B;  2V8I A;  3EFR A;  2EFI A;  5LJ3 g;  5CKH A;  1M27 C;  2MMP A;  2CP3 A;  1OEB A;  3A8L B;  3MJX A;  2JJ9 A;  1MMA A;  4XTV A;  3U23 A;  4B9X A;  4LNP A;  1VYU A;  1JJ2 A;  4E7Z A;  2DIQ A;  4QQD A;  3QII A;  1YWP A;  4EMK B;  4BY6 C;  5CKE A;  2DAQ A;  1E6G A;  2A08 A;  2LTO A;  4OB0 B;  2LMJ A;  2YDL A;  1RL2 A;  2MPX C;  3C4S A;  4IIM A;  3TEE A;  1JXM A;  3QZ5 B;  3I55 Q;  2LCC A;  5GAM e;  2F2X A;  3CCE T;  4Z89 A;  4ZNX A;  1PRL C;  5DM7 R;  3PVL A;  2EGE A;  1WA7 A;  3CQT A;  4PJM A;  4BDY A;  1UJ0 A;  3G6E T;  2JW4 A;  2DJQ A;  2KRS A;  2M9U A;  3MEV A;  1RAA B;  3OYF A;  2RF0 A;  1BKB A;  4JZ3 A;  1YIJ T;  2X4X A;  3CCM A;  5LL6 S;  2D0Q B;  2DYI A;  2NYS A;  1TH7 A;  3VJP A;  4UC4 A;  1WJQ A;  4MML A;  2DL8 A;  2X4J A;  2CT4 A;  4E7H A;  3S6W A;  1UUE A;  5LJ3 h;  2KRN A;  1VQ8 T;  5GAO q;  1D3B B;  3E19 A;  2CH4 A;  3OYG A;  1M2V A;  4HT8 A;  4HT9 A;  4MMK A;  3LGF A;  5GAO n;  2EYX A;  1GRI A;  4JJN K;  3CCM T;  3QJY A;  1EZZ B;  1N9S A;  2HQH A;  1FXX A;  3KFV A;  1TWB A;  3E9G A;  2YT6 A;  4D8D A;  4RTT A;  4E7S A;  5GAO m;  1QVG A;  1YN8 A;  1M1K C;  2J06 A;  3CPF A;  3HP9 A;  2P0K A;  3CCV A;  2LX7 A;  1VQ4 Q;  4C0Z A;  1Y96 A;  4C5G A;  5IXF A;  2K2V A;  1B7T A;  2KY9 A;  1VQ7 Q;  2ESW A;  3G6E Q;  1QCF A;  2LP5 A;  2E64 A;  3SFM A;  2QG9 B;  5HK3 A;  2FL7 A;  2A28 A;  2NUT A;  3EFO B;  4FYW B;  1I1J A;  1VQO Q;  1E7O A;  3MET A;  1TU0 B;  4XTY A;  4R0K A;  5GAO l;  2DO3 A;  2H3E B;  4NS5 A;  1FWZ A;  3MPU B;  1GBR A;  4E7I A;  5FRM A;  3I35 A;  5HK0 A;  3M4G A;  4JLI A;  4BY6 B;  3TSZ A;  1UJY A;  2RD1 A;  3VU3 C;  1IXD A;  2KNB B;  2PVD B;  2QA4 Q;  1RI0 A;  2OTJ A;  4M7A G;  5GMK j;  5CQX A;  3JB9 H;  2LNH B;  5A0G A;  1BU1 A;  4PJO E;  1W2B P;  2OAW A;  1UGR B;  5GAO p;  2K3Y A;  1U8R A;  3EH2 A;  1SG5 A;  2CT3 A;  2I0N A;  2QQR A;  4XU2 A;  1QLY A;  4HVV A;  1GCP A;  1ZUU A;  4ELZ C;  1I81 A;  3QWY A;  5KCO A;  4TVR A;  1KK7 A;  1K73 U;  2OTL A;  3J81 E;  3OS0 A;  2AKK A;  5L23 A;  3M0R A;  4F17 A;  1MMD A;  1VQN A;  2LX9 A;  1W70 A;  1QVF P;  4M75 E;  1YIJ A;  2SRC A;  2P0P A;  1X43 A;  3EHQ A;  4C5E A;  4M7A A;  2O9V A;  5D7U A;  3UAT A;  4J5Y A;  3FB9 A;  1RAF B;  2NUT B;  5AYF A;  3QBY A;  3CBO A;  2CP0 A;  2PTK A;  3CPW P;  1VQK T;  2HQE A;  2K3X A;  4QQG A;  4RG2 A;  2RHZ A;  5C6S A;  5KYU B;  3FC3 A;  1MMG A;  1X75 C;  1OI1 A;  1SRL A;  2QTX A;  1I8F A;  2EVR A;  1ZHI A;  1YIJ Q;  1YCS B;  2DXT A;  3P8B B;  2KQW A;  4QKU A;  3ULR B;  3CCR A;  4M7D F;  3EFS A;  4ZN1 A;  1K8A U;  2RQR A;  1X6O A;  2E5K A;  3CCU Q;  3EGX A;  4FW1 A;  4D8K A;  2VGM A;  3HFO A;  1JO8 A;  5DY9 A;  5A0D A;  3CCL A;  2VB6 A;  1QCN A;  4C5H A;  5IHK A;  2XID A;  1AZG B;  4PK4 A;  3MKD A;  3V7R A;  3PNW C;  4Y92 A;  4XTU A;  1PC0 A;  3A1P A;  2DL3 A;  3R6N A;  2X4Y A;  9ATC B;  1WXU A;  3JV3 A;  2RNA A;  2R5M A;  2CZ7 B;  1LCK A;  4J9E A;  2JTE A;  4R55 A;  2CKK A;  3VRZ A;  2RQV A;  2E3H A;  2DEQ A;  2YSQ A;  3G71 A;  3INZ A;  2VC8 A;  3CCR Q;  4E2F B;  1UHF A;  2L8D A;  2FB7 A;  1KG1 A;  5FRO A;  4ZTF A;  2VWF A;  2FVU A;  4C92 D;  2L0A A;  2DVJ A;  4XTW A;  2KMT A;  3TRE A;  3DB3 A;  2V8K A;  1Q82 R;  2JUF A;  2DL7 A;  2K7A A;  3PMI A;  1TSF A;  3KXT A;  1X6B A;  3OA6 A;  2RH2 A;  3JCM b;  3M53 A;  2A3L A;  2E6N A;  2EQJ A;  3QG1 A;  2EQI A;  4HCC A;  1ACM B;  2YHT A;  3HL8 A;  1D0Z A;  2EYZ A;  3RKY A;  1Q82 C;  4F04 B;  3PTA A;  3EGD B;  3BE3 A;  2RQU A;  2D0N A;  2E6Z A;  1WIE A;  2PNI A;  5EC7 A;  3CMA T;  2XKO C;  1OQK A;  5FU6 B;  4FCY A;  3CME A;  2ZZD A;  5FWC A;  3URG A;  4XU1 A;  2E12 A;  2QQA A;  2QA4 A;  2QQS A;  2E3I A;  3BDL A;  1QVF A;  5GAN 4;  4DQ2 A;  4AFS C;  4NL3 A;  2HBP A;  3JCM W;  3RKW A;  1XJW B;  1X27 A;  5FLX E;  3CCE Q;  3OBW A;  2HAX A;  5KYW B;  2JZ2 A;  2J7I A;  3HHT B;  2ZPE B;  1G3Y A;  3I56 T;  1SSF A;  2M0Y A;  4X9D A;  1BYM A;  1KQ1 A;  2DL5 A;  3L1A A;  3VUZ A;  1K8A C;  4F7U A;  1GXI E;  4C0D B;  3NTK A;  5J3B A;  3OQ5 A;  1LVK A;  2KK4 A;  4E47 A;  4M78 F;  2ZPG B;  5GAN 2;  2JOY A;  2ROL A;  4JUV A;  5I2S A;  1FYN A;  1ZSZ C;  5D6Y A;  1K1Z A;  1PM3 A;  1WPY A;  1WQW A;  2O4X A;  2IVW A;  2VYT A;  3M0P A;  2MOX A;  1X01 A;  2EJG A;  1J3T A;  3OYA A;  1GFD A;  3SWN A;  3CCQ T;  1AWW A;  2DTO A;  3L2Z A;  4XAX B;  2ZPI B;  3ZBD A;  3OYM A;  4ZN3 A;  3OYI A;  3OYY A;  1WHG A;  2EKH A;  3OS2 A;  1OV3 A;  4RG8 A;  2A37 A;  1KQS A;  2VXF A;  2C0I A;  1HXD A;  1G8X A;  1QP2 A;  3IQL A;  3VRY A;  2O9S A;  4LDU A;  1N27 A;  4M75 F;  1G3S A;  3EH1 A;  4J9I A;  1WXB A;  1ARK A;  1KIK A;  2LT1 A;  2V1Q A;  4A53 A;  3MP8 A;  4J9B A;  5IHI A;  5KYY A;  4JPB W;  2CZ6 B;  2RA2 A;  3VS2 A;  2MCN A;  1M3B A;  1VUB A;  1VQ8 Q;  4AG2 C;  1WDX A;  1IZ6 A;  1YI2 Q;  2AZV A;  2PQW A;  4WTO B;  2W0Z A;  1RLP C;  1UEB A;  1KD1 U;  3QWX X;  2GBQ A;  1BCM A;  3CC4 A;  3CMA A;  2EYW A;  2DXU A;  3E9F A;  3QPH A;  2XDB A;  2KYM A;  4Z02 A;  1R0B G;  1KD1 C;  3CCJ A;  2OTJ T;  5DLQ E;  1HYO A;  2GGR A;  4ZGE B;  2OJ2 A;  4AG1 C;  1M3C A;  2P4T A;  3QYG B;  3EG3 A;  1BK2 A;  4N4H A;  4XU0 A;  1ABQ A;  5GMK l;  2LQW A;  4ELY C;  2L3R A;  4KBM B;  3RKX A;  4PNO A;  3EG9 A;  2IG0 A;  3X24 B;  1NJI R;  4F7U B;  2OTL T;  2ZPB B;  3H8Z A;  4DBQ A;  2COW A;  3MP1 A;  3SWN C;  5GAM h;  3RIR A;  1VQK Q;  1LOJ A;  4L5G A;  5CR2 A;  3JCM J;  2H3J A;  2PVO B;  3CXC P;  4L6V 5;  1VQP A;  2CP7 A;  3AT1 B;  2DEU A;  4A4F A;  2XD0 A;  5GAN h;  1D1C A;  4PL6 A;  2ZPF B;  5GAN j;  3CCE A;  2FG0 A;  3C95 A;  3M55 A;  6AT1 B;  2ED0 A;  2VAS A;  1M3A A;  3A8H B;  1WYX A;  5GJV B;  3PIP A;  1M90 U;  2K5F A;  3PFS A;  1RAH B;  3JCM e;  1WQ7 A;  3QUI A;  1TS9 A;  1VQ5 T;  1MV3 A;  4XTX A;  3E2U A;  2M1H A;  1Z9Q A;  4AT1 B;  2D1X A;  1SHF A;  5HCK A;  3GLX A;  2YRD A;  2LCS A;  3C94 A;  2E5Q A;  3VYH B;  2FZK B;  3SD4 A;  1MGQ A;  1AWO A;  2M0O A;  1AWX A;  1UGV A;  4M78 G;  1KQS P;  2X3W D;  5FW9 A;  1VQ5 A;  5IN1 A;  2QK0 A;  1D1A A;  3CEY A;  2ECZ A;  2RI3 A;  3RER A;  2CP2 A;  5ECA A;  2MAM A;  3S3O A;  2QI2 A;  1JB0 E;  4MZM A;  4M77 F;  5KE3 A;  1M4Z A;  3RES A;  2DTI A;  4D6W A;  3EG2 A;  1NBE B;  1QVF S;  1D1B A;  4C8Q D;  3EG1 A;  2P84 A;  4GY5 A;  1UGQ B;  1JJ2 P;  3CCU T;  3JCM X;  3T9N A;  3VS5 A;  1V1C A;  2YUN A;  2EPD A;  1Q7Y U;  1PKT A;  1BBZ A;  4RTY A;  4J7I A;  2DE0 X;  2EKO A;  1PD1 A;  2RHY A;  1G5V A;  3O8V A;  2EW3 A;  3GOX A;  4JS5 A;  2HSE B;  3LWH A;  2B8A A;  4BB7 A;  1UGS B;  1YHQ Q;  1VQ6 A;  2KVQ G;  3VS4 A;  1PNJ A;  1I5L A;  1N8R C;  1ABO A;  4FL6 A;  4DEY A;  2KGT A;  4PJO B;  4KUD K;  2JMC A;  3Q1J A;  1N9R A;  3H9N A;  1NE8 A;  3M4Y A;  5AT1 B;  1YJ9 T;  3JRZ A;  3VS6 A;  1VQM A;  2E65 A;  2EQK A;  1ZLM A;  2KI7 A;  1U1S A;  2SEM A;  1AVZ C;  2EGC A;  1T3S A;  1AD5 A;  4C92 G;  4AMC A;  2LQN A;  3NHN A;  2X9H A;  5GMK h;  5L8R E;  4J83 A;  2GTJ A;  4N0A C;  4J9G A;  1Q86 R;  1A0N B;  2RJD A;  1KC8 C;  2JS0 A;  3M0T A;  2RK2 A;  5GAN 3;  4J9H A;  2JXB A;  4AFZ C;  1WJR A;  4JJB A;  3ZEH A;  3TQ7 P;  2MWP A;  1VQ5 Q;  4EMK C;  2LRQ A;  3QDF A;  3VKI A;  2YLB A;  8AT1 B;  1D0X A;  2OAU A;  1OZ2 A;  1KJW A;  1AWJ A;  1RLQ C;  1QVG P;  2CP5 A;  1G3T A;  1PG5 B;  3WVD B;  2QTV A;  1XTD A;  2RM4 A;  3LH5 A;  4OGE A;  1D0Y A;  5CIU A;  4KGX B;  3RDV A;  3CC4 Q;  2QDY B;  3RMQ A;  4C8Q F;  5LJ3 e;  1SKU B;  4J9C A;  3CCQ Q;  1OU8 A;  2QXF A;  1YFN A;  4OMF B;  2X35 A;  1M5Q 1;  4A4E A;  4PFP A;  3OSV A;  2EQU A;  3CCM Q;  2RI5 A;  1UHC A;  4JDS A;  1AEY A;  3QZ9 B;  2XI9 A;  4OP0 A;  3LH0 A;  4EMH A;  2L3S A;  4C8Q B;  1UG1 A;  1LJO A;  1PRM C;  3QKJ A;  3HRS A;  4M77 A;  3EFO A;  3FJ5 A;  2QYZ A;  2HZY A;  3A8M B;  4JS4 A;  5EG2 A;  2XMF A;  3EAE A;  1R77 A;  1HSQ A;  2Y90 A;  1TXQ A;  1Y0M A;  3TVT A;  1JQQ A;  3NTH A;  1BIB A;  2J6K A;  2CRE A;  2LNV A;  4O5V A;  2PU9 B;  1W2B A;  2BE9 B; 
#chains in the Genus database with same CATH homology
 1W2B P;  1Q81 R;  1N8R R;  1QVF P;  3CXC P;  1YJW Q;  1VQ8 Q;  3I55 Q;  1VQ4 Q;  1Q7Y R;  3CC2 Q;  3G71 Q;  1JJ2 P;  1VQ9 Q;  1M90 R;  1YI2 Q;  1K9M R;  3OW2 P;  1Q86 R;  1VQ7 Q;  3G6E Q;  2OTL Q;  3CC7 Q;  3CCQ Q;  3CCJ Q;  1YJ9 Q;  1VQP Q;  2OTJ Q;  3G4S Q;  1YIJ Q;  1VQL Q;  1VQN Q;  3CCE Q;  1VQM Q;  1Q82 R;  1QVG P;  2QA4 Q;  1K73 R;  1S72 Q;  1KC8 R;  1K8A R;  1NJI R;  1YHQ Q;  3CME Q;  3CCM Q;  1VQ6 Q;  3CCS Q;  1VQO Q;  1M1K R;  3I56 Q;  3CCU Q;  3CCR Q;  1VQ5 Q;  1KD1 R;  3CPW P;  1YIT Q;  2QEX Q;  3CCL Q;  1VQK Q;  3CD6 Q;  1KQS P;  3CCV Q;  1YJN Q;  3CC4 Q;  3CMA Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...