1VQPQ

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqpQ00
1YJNQ 1M1KR 3CC2Q 3CCJQ 2QA4Q 1NJIR 1K9MR 2QEXQ 3CCSQ 3OW2P 2OTLQ 3CMAQ 1VQ7Q 1W2BP 1KC8R 3I55Q 1VQ6Q 1QVFP 3CMEQ 3CC4Q 1JJ2P 3CCMQ 3CPWP 3CCQQ 1YIJQ 1VQ8Q 1VQLQ 1VQPQ 3CCEQ 3CC7Q 1N8RR 1YJWQ 3CCVQ 3G6EQ 1VQKQ 1YI2Q 3CCLQ 1VQNQ 1Q82R 1VQ5Q 1Q86R 3G4SQ 1Q81R 1S72Q 3I56Q 3CCUQ 1QVGP 2OTJQ 1VQOQ 3CCRQ 3CXCP 1K8AR 1YJ9Q 1VQ9Q 1YHQQ 1M90R 1K73R 1KQSP 1Q7YR 3CD6Q 1VQMQ 3G71Q 1KD1R 1YITQ 1VQ4Q
chains in the Genus database with same CATH superfamily
4XU3A 4XU2A 1MNEA 2YSQA 3VS7A 3CCJA 1AWOA 2A3LA 2D0QB 2NUZA 2RF0A 1JQQA 2JM9A 3QBYA 4AFSC 4KUDK 3L2QA 2LDMA 4OMQA 1WPYA 2EQUA 2HAXA 2EJGA 1C6VX 2GF7A 3OBWA 2W10A 2D1XA 3GLXA 4JRKA 3OYDA 4MDXA 2A36A 5CVIA 1YITQ 1K9MU 2HKQB 2QEXQ 3QWYA 5J3BA 2C0TA 4A53A 6AT1B 3GBQA 2EYWA 3CC4A 5GAN2 1VQ9T 3OSVA 1WNLA 1WQWA 3MP1A 5IH2A 1SRMA 2AK5A 2P0PA 1JJ2S 2JT4A 3M0RA 2JOYA 2X3XD 1CKBA 5GANd 2VWFA 3HHTB 3CCSQ 3N5BB 3HTRA 3UF4A 2C0IA 4CRIA 4RCBA 4L6V5 2JMCA 3G6EA 1Q82U 3HP9A 4HCZA 3JB9F 1RAHB 4PLLA 1N27A 2OTLT 4D6WA 1RUWA 3QZ5B 3OB9A 1UGQB 5LJ3d 3A98A 3L2VA 3OS2A 5CR2A 2YRVA 5DY9A 4F17A 2DZCA 3P8DA 3JCMg 5GAOn 4RKUE 2X51A 2RQUA 2ESWA 1VQNQ 1K0SA 2RI3A 1N8RC 2GQVA 3S3NA 4HKEA 2BE9B 2CP0A 5J39A 3VV0A 2QA4Q 1K4US 4A63B 2EYZA 4C5IA 3Q1JA 3S3MA 1UHFA 3ZL7C 3JAME 2R58A 2RK2A 3EFSA 3M53A 1LJOA 3NFCA 1OZ2A 3RUXA 2FHDA 3QDRB 5GAOl 4AFQC 3UT1A 4KGXB 2DKGA 3QG1A 3VKIA 4C5GA 1VYTA 1YFNA 4C92E 4E2FB 2EWNA 1YJNQ 5CKHA 2KYMA 2HSPA 3PVLA 4FSSA 2FZCB 1JXOA 4M77D 3TQ7P 1VQ7A 1KQSS 1HSQA 1T0JA 2DYBA 2YWWA 3WVEB 4OB1B 3QXEB 4C8QB 2DM1A 2ROTA 3LX7A 4E7IA 3EG2A 2O9VA 2LZ6B 2LNVA 1V76A 1E7OA 1VQMA 4J5YA 3LH5A 1M3BA 4B9WA 1MMNA 1XNIA 1JBMA 3CPWP 2DL4A 3SFMA 3J7AF 2EKHA 4IUUA 1NBEB 1ZQ1A 1QQJA 2KMTA 5GAN3 2E3IA 4LUEA 4M7DD 4LNPA 2ECZA 2EYQA 3L2RA 1M1KU 3FJPA 4F7UE 1JXMA 2VYTA 4JS5A 1AHJB 4GLMA 3QWXX 5KE2A 3CCUT 3J80E 5LJ5g 1PRMC 1UHCA 2LJ3A 4IUPA 4QQ6A 3JB9H 3MP6A 2QXFA 3BDUA 5HY6A 2KRMA 1XOVA 3ZFJA 4JJDA 4MMKA 4NL2A 4PJOG 2DIQA 2KQWA 4HT8A 2ED0A 1W2BP 2CP3A 2RA2A 3M0UA 4E6RA 5GAOp 2KXDA 4FT2A 4PFPA 2DTOA 1KC8C 1O9SA 2E12A 4XU1A 1MNDA 2F2VA 3HFOA 3OBYA 1WXUA 2AKLA 1Y07A 2GCXA 2EGCA 3SD4A 2MIOA 4N0AC 2HMAA 1TUGB 5GAMg 4B6MA 2EBPA 1KD1U 1OV3A 1HJDA 2NWMA 2LQKA 3EH1A 4M78E 2HBPA 4M7AB 5GAN7 4XTZA 4C0GA 4BY6B 1VQ6A 3M0SA 1FYNA 2K5LA 3EGDB 4HCKA 4A4FA 3C95A 4FW2A 1AVZC 1K76A 3REAB 1G3YA 3A1PA 4FT4A 2RHXA 2RI5A 2C0OA 4M75B 4ESRA 1MV3A 4KBMB 2RJEA 3CCEQ 1KQ1A 4RG8A 5FU7B 3CC7A 4GLKA 3DB3A 3OYEA 1QVGA 2LQ8A 1X43A 2OTJA 3CCUA 3EG0A 3PMTA 5KE3A 4R55A 1H8KA 4J7IA 4KT0E 1X75C 2F69A 2CDTA 4IUVA 3V7CA 2J6FA 3P8HA 2QASA 1DJ7B 2KAFA 4J9GA 4KULA 1MMAA 2QQRA 3VS4A 3G4SA 2K3YA 4PJOC 2KI7A 1YJ9A 2WSEE 1SHFA 3G71A 3VUBA 3ZEHA 1YJWT 4DEXA 2CGHA 2I2LA 2AKKA 1OU8A 3JCMe 3LYIA 2QDLA 4MZPA 4E7SA 5GAN5 1N8RU 2FL7A 5KYUB 1B34A 2DL3A 2KNBB 4RTZA 3HSBA 1YI2Q 1WIEA 3BY7A 1VQPA 2QK0A 5FU6C 5KCOA 1QW1A 3H0HA 2DBMA 3GIBA 3A8MB 3FB9A 2DF6A 2EQJA 2XDPA 2HSEB 1SRLA 4PKCC 2K2VA 5CKEA 2SEMA 1AZGB 3OYFA 1VYUA 3EG3A 2CP6A 2DZ9A 3META 3I56T 1LPLA 4FCYA 1OYXA 4PJOD 1YJWQ 2YHTA 2DMOA 4FU6A 2O4XB 2NUPB 3M0QA 1U5SA 3QIIA 4J7FA 3M54A 4OB0B 2PVOB 5GAN4 4BE0A 3I9QA 3JCMX 1EFNA 1PSEA 3SDZA 1NJIU 2IPOB 1K73C 3VS3A 2JN0A 1KG1A 4PJJA 1NYGA 4XQ3A 4BUGA 2CT4A 3EFRA 3FIFA 2E70A 1W70A 2RQRA 4M7DB 2PNIA 3PMIA 1U8RA 3OYCA 3MEAA 2OJ2A 2G6FX 1ZHIA 3MJXA 3SB2A 4QT7A 1VQKA 4C92A 2XI9A 5IHIA 3SWNC 3R6NA 3CBMA 3M0PA 2W0ZA 3QJ6A 3I55T 2GTJA 1BI0A 4ANJA 1YHQA 4KH1B 1PM3A 1NM7A 1Y0MA 3QYGB 2E1HA 5KCHA 2O01E 4HCBA 2O2OA 1PG5B 1R0CB 1KC8R 4JZ4A 5FWBA 1YWPA 2CZ1B 4WTOB 2AZVA 2QTVA 1QVFS 1ZSGA 4M77F 4J6YA 1D0YA 1QKWA 2XDBA 3MEWA 3OYBA 5GAOq 2KRNA 3RKXA 4BB7A 2WSCE 1IREB 4EIKA 1TUDA 4JJNK 3A8OB 3JCMh 3UA7A 4GBQA 4AFZC 4WCIA 4C8QE 4OMOA 3RBBB 4ELYC 1S72T 4BDZA 3ME9A 1MMGA 3VUZA 1GCQC 2P0KA 2FO0A 2ZZDA 4J6XA 4MMLA 1I4K1 2K6DA 2XD0A 2HQHA 2GFUA 1AEYA 1M1GA 2P4TA 2DD5A 3GNGA 5CKDA 3CMAQ 2JW4A 1RAIB 4J8OA 3CPWA 5GAN8 1QVPA 4ZTFA 1HD3A 4D8KA 5FROA 1WJRA 3CCJT 5HCKA 5GAMe 2VXEA 3VS1A 2E5KA 1Q86C 1H92A 3RESA 2PUOB 2LJ1A 2CH4W 1NE8A 2A0FB 2IG0A 3I5SA 4YTLA 4V2SA 1K0XA 1B3QA 3I55A 2YUOA 1ZSZB 2KXCA 2VGNA 4J9BA 3TREA 3JCMf 3PVQA 1NPPA 1O75A 1FX7A 4LD6A 4OMNA 1KSWA 3CXCA 3QYHB 2A08A 1WI7A 5GANg 2MAMA 1QKXA 2OAWA 3CD6Q 1PSFA 3T9NA 3CMET 3E9FA 3CC4T 1W2BA 2ZPEB 1CKAA 1HK9A 2XG8D 3GNFB 4E7ZA 1VQ4A 3M9QA 4Y92A 4M75G 5C6SA 1WHJA 3OYJA 3EH2A 3CCQA 2QTXA 2K79A 4BACA 3NMZC 4ELZC 1I5OB 5LJ3g 4M7AE 5L8RE 5KYNA 1AOJA 3CC2Q 1W6XA 1AWXA 4PNOA 3MKDA 3G6ET 3CCVT 1SKUB 5LJ5h 4ZGDB 1FWZA 3CCMA 1OI1A 3A5ZB 2EKOA 1RACB 4LDUA 1Q81C 1K73R 3TU4K 4M75E 1PNJA 2P84A 5IHNA 3LH0A 3MCAB 1QMCA 1PKTA 3JV3A 1BI1A 1WGSA 3E9GA 2MWOA 2BE7D 3FC3A 1D0ZA 7AT1B 4FYXB 1YWOA 3QDFA 4XAXB 1ZBXA 3BFMA 1HYOA 2DJQA 1QCNA 1Y7XA 4JDSA 4J9DA 3E1SA 1VOMA 1S1NA 3J81E 1NLOC 3UWNA 1W1FA 2RHUA 5KYWA 3M59A 2CH4A 2D8JA 5LJ5j 1QP2A 5GAOr 3LGFA 2EYXA 3CMEA 3SWNA 3RMQA 1TUCA 5LJ5f 1Y57A 1N9SA 1E6GA 3V8KA 1VQ5A 3QSUA 1M8MA 1VQ7T 4OMMA 2D6FA 3UA6A 3EFOB 4EMKB 1RABB 1G2BA 4M75C 3NPFA 1WXBA 3NGPA 5FW9A 1WXTA 2LP5A 3D7SB 3M4GA 3GF5A 3VRYA 1E6HA 5IXBA 3CCVA 2A7YA 3CQTA 1VQMT 3L2ZA 4C0DB 2AT1B 1M2VB 2V1QA 2B86A 1VQ9Q 4PJOF 3G7ZA 5C0MA 4C92G 1PD1A 2LTOA 3OS0A 1GCQA 1YN8A 4PLIA 1TSFA 2VGMA 2JTMA 2OI3A 4J9HA 4O5VA 1Q86R 4Y28E 5A0GA 2E4HA 2EQMA 1VQMQ 1KQ2A 1YITA 4M7DE 2OTLQ 3C12A 2QEXA 1TS9A 3R6OA 4HVVA 5A2QE 1VIEA 4OB2B 2M02A 3P8BB 1X27A 2E6NA 4RTWA 1TOVA 4B9XA 4BE2A 1ZA2B 1ZUKA 2ZAEA 3EG9A 3FRNA 3EGXB 4ME7A 1OPLA 2V8KA 2J6OA 2GTOA 4J9FA 1VUBA 2YUNA 4QVDA 1M90C 2L3SA 2KY9A 2D0NA 3CCSA 3QZ9B 4M4ZA 4KRTA 1IZ6A 3SHWA 1V1CA 2FYKA 3BE3A 1JJ2A 4F7UG 1YCYA 2DPPB 2L3PA 1K9AA 1RAAB 2DVEA 2DAQA 3JCMQ 4IURA 2RM4A 3L42A 2DX1A 2KE9A 2Y4XA 3X25B 1M5Q1 1VQ6T 5L23A 1XTDA 2V8IA 2K2MA 3O8VA 4CC3A 2CYZB 4ZTJA 2GFAA 3L2UA 3OYLA 5D6XA 2MI6A 4FYVB 1BI3A 3E2UA 4KGZB 1WQ7A 1VQNA 2FZGB 2J7IA 2R5MA 1SEMA 1Q81R 1UGSB 2LMJA 5KYYB 2RH2A 5GANe 3X20B 4QQDA 1G3WA 2QQBA 4C92C 1VA7A 2E41A 3TSWA 2M9UA 3CC7T 1JU5C 1RAGB 1UTIA 4RTUA 2QGFB 4M78G 3OYHA 2OTJT 1VQOT 2CS7A 1JRIA 1VQLA 4ZGJB 1WDXA 1SSFA 5GAN6 2EW3A 5LJ3e 1PHTA 2XICA 4E7JA 1WJQA 2KT1A 1WJSA 1YJNA 2FRYA 2COWA 2LC4A 3V8LA 2MCNA 1QWEA 1ACMB 1QVFP 4Z89A 3G4ST 4PJNA 1NZ9A 2K7AA 2DNUA 3MPUB 4OVAA 1UJYA 4PK4A 1YJ9T 4C92D 3G71T 1Q81U 1UECA 4M7AA 1M2OA 3CCUQ 1KQSA 1MMDA 3FDRA 2JUFA 3L1AA 9ATCB 4MDWA 1YIJT 2WACA 3H0IA 1VQPT 1XJWB 3EGDA 3ER0A 4A54A 3UDCA 1JB0E 3FLGA 3GP8A 2DD4A 2NLUA 3E19A 3F70A 2BZXA 1JO8A 4C5EA 5DM7R 2K5IA 1X6OA 1C0MA 4RTTA 4M75A 1WHKA 3NHNA 2RD1A 1UE9A 1RADB 2CT3A 1ZBJA 1Q7YC 3OW2P 1H3ZA 1ZSZC 2AZSA 2QYZA 3EHRA 5IXFA 1VQPQ 2KT8A 1I0CA 2V26A 5GANh 2PZ1A 1LCKA 3OYYA 1BCOA 1UEBA 5GMKe 3RNJA 2H3EB 4CC7A 2PUKB 1VQOA 4FM4B 2YLCA 3OSSC 4M78C 1OX8A 1VQKT 4XK8E 2FB7A 2AHJB 1BB9A 2F5TX 3CEYA 4N4HA 5CIUA 2K9GA 3A8GB 2RHYA 4EMGA 1YHQT 1AD5A 4OMFB 5LJ3h 2RQVA 5EC7A 4A4EA 2K5FA 3X26B 3HPWA 4HXJA 3C4SA 5KYXB 1M90R 3RKWA 1X69A 5KYUA 5CK9A 1UJ0A 3RDVA 4ORZA 2EIFA 1H641 2EPDA 1GRIA 2FPDA 4HA8A 2G3RA 4J6WA 4ZGEB 3TCJA 2F1LA 2EJ9A 2JS2A 3ASKA 2CP2A 5LJ5d 2CUDA 1Y96B 3AHUA 4FL6A 1FXXA 1VQKQ 4J83A 1Z9ZA 1YIJA 2R5AA 1RI0A 5GANj 1VIFA 2Y4YA 4M77B 1TH7A 3CPFA 1QCOA 1KJWA 4E7LA 2H8HA 5GANf 1LNXA 2LT4A 1UGPB 3G1JA 4OMPA 1Q95G 2O4XA 2NUPA 3VS0A 1SSHA 1G8XA 2JMAA 2ZGWA 1MGQA 3CCEA 2L3QA 1ZA1B 2JVVA 5LJ3j 3DB4A 5AYFA 5HK0A 5J26A 1N5ZA 2CKKA 5LJ3f 2KSSA 1VQ8T 3GPLA 1NLPC 1K9MC 4RTVA 1U3OA 2D9TA 4QVCA 1IHVA 5I2SA 4DA4A 5D7UA 3CCRT 4UC4A 1KFZA 2JTFA 4XTVA 3ULRB 2E5QA 4C8QG 5GMKh 4K11A 2LX9A 1M4ZA 5FLXE 4EMKC 3I56Q 1Y71A 1SHGA 3O5ZA 1GFDA 1GBRA 2V8JA 1UG1A 3OA6A 3DLMA 1OPKA 2M1HA 3A8LB 4KGVB 1I1JA 2R57A 3OYKA 3QHSA 1QP3A 3QKJA 2QGGA 3DKMA 3KXTA 2FPFA 5M9OA 3S3OA 4RTYA 3VU3C 3NTHA 2RNAA 1YI2A 1VQ4T 2GQIA 4HVUA 4AG2C 1P92A 1Q82C 2P4RA 4HCCA 2MK5A 2GGRA 3QO3A 3NTKA 3M58A 3CCQT 2HD0A 2ZCFB 4XTXA 2VKNA 3I55Q 2KBTA 1WZOA 2DYIA 2K3BA 4LDWA 3LWIA 5IHKA 3LWHA 1X2KA 1HXDA 1G3SA 3M0TA 2NYSA 1X6BA 5GMKj 3X24B 3MEVA 1FMVA 3PFSA 1D0XA 2X9HA 2QQ9A 3CBPA 4F7UA 4Z88A 4Y91A 1Q7YR 2XK0A 1A0NB 3CCMT 4HT9A 1M3CA 1KC8U 3X28B 1RL2A 4J9CA 5CQYA 1KHIA 5GJWB 3EG1A 1N6AA 4OP0A 2M51A 3OW2S 1AT1B 1VQ8A 2CSQA 1S72Q 8AT1B 1T0HA 1WHGA 5CKFA 2FEIA 1B07A 2DEQA 1ZSZA 3CCRA 3QPHA 3MO8A 1B7TA 1U1SA 4M7AG 3JCMV 3RMSA 3ZBDA 1D3BB 2RJFA 4C8QC 1X6GA 2I0NA 2DILA 4X34A 2O9SA 1LVKA 1R0BG 2CZ6B 3SEMA 2HEQA 3UATA 2VXFA 2HDAA 4M78A 2FRWA 3JCMP 1ZUYA 2E6ZA 4C92F 4A4KA 2DETA 3CCJQ 1QVFA 2E65A 1YNZA 2RJCA 2DVJA 5D6YA 4DBQA 5I21A 1VQ5T 3M57A 2RK1A 2FZKB 4JUVA 3OMCA 3LGLA 3PE0A 4C8QD 1K8AC 4RUGA 2RJDA 2ENMA 4F04B 2JXBA 2K3XA 3CMAA 2NUTB 4LN2A 1D1CA 5DLQE 3CMEQ 3CC4Q 2HCKA 2JTEA 3PIOA 4FIBA 3RERA 1PKSA 2YDLA 1WHHA 3CCLA 3JB9J 2JNGA 1GFCA 4E7HA 4ATOA 1IO6A 2HBWA 4PJOB 2ZPBB 3U23A 2HL5C 2VUBA 1K9MR 2CREA 4E7KA 4F7UF 1BK2A 3VS2A 2A28A 1Z9QA 2YLBA 1GBQA 1EZZB 1NYFA 1K1ZA 3G6EQ 2YRCA 3CCVQ 2PVGB 2X35A 3M56A 3OMGA 2EYYA 1I07A 5GAMh 1YITT 3RIRA 4Q5WA 2DO3A 4M77G 2QEXT 1QVGP 3VRZA 4F14A 5FU6B 1T3SA 4RTXA 4XTWA 1IGQA 4M7AC 2DA9A 2HQXA 3CD6A 4IIMA 4BY6C 1GXIE 3PTAA 1UFFA 1KD1C 2CUBA 2QG9B 2L2PA 2X4YA 2CP5A 1M30A 2JM8A 4KH0B 3EFOA 4EMKA 3OQ5A 4AFUC 4NL3A 1Q82R 3CCST 2MPXC 2HZYA 2RO0A 1BBZA 1FMWA 1TXQA 2HL3A 5IT9E 1K73U 2AIRB 2COZA 3H0FA 2JZ2A 4IUTA 4L5GA 2LJ0A 2RI2A 3CC2A 2HQEA 3BW1A 3JCMc 5CAIA 4M78F 2ZPIB 4X9DA 4R56A 2DTHA 5FU7C 4M7DG 1IGUA 1M2VA 2VC8A 4M77E 4OF1A 5KYWB 4II1A 3QJYA 3JB9I 4M7AD 5GAMj 1NG2A 5DLOA 2LT1A 1PRLC 3HRTA 2LQWA 2DBKA 1ABQA 4IIOA 4P5NA 3FJ5A 1SF9A 3SWNB 4R0KA 3JCMb 2WSFE 5GAMf 4JLGA 4JRPA 1GCPA 4X9CA 3EAEA 1PCXA 1VQ7Q 1VQNT 2M0OA 2EJFA 5GMKi 4JZ3A 5HKCA 4JLIA 3VS6A 4LE9A 3TSZA 5A0DA 4PJLA 2L0AA 4M75D 1TWBA 5IAYA 2Y90A 2QA4T 3OS5A 1U06A 4ZNXA 3IQLA 1XQHA 4DOWA 4KUIA 1TG0A 8ATCB 1BU1A 4PL6A 1D1AA 2PTKA 4XU0A 2K4YA 3REBB 2KK4A 2DE0X 2KEAA 2RMOA 4DBHA 1VQLT 4AT1B 1W4SA 4RG2A 4IKFA 3PT9A 2EFIA 2J6KA 2CP7A 3EGXA 4OGCA 2EQIA 2KDSA 2XMFA 4BD3A 4NS5A 3KFVA 4M77C 3JCMW 1YJNT 2FPEA 5GMKl 2XU8A 4JJBA 3VS5A 2PU9B 4C8QA 1H3HA 3OYNA 5ECAA 2DJZA 4J9EA 1JEGA 2L5QA 4E47A 2GNCA 5D6WA 3QUIA 2COYA 1U1TA 1VQLQ 1RI9A 1Q86U 3PGGA 2IIMA 3KUFA 2RHIA 1K8AR 2RQTA 1VQ9A 4WF2A 2F2WA 4DOVA 1M1KR 4Z8AA 4LDXA 3EG9B 3HRSA 5LL6S 4M7DC 4BDYA 1V29B 1NJIC 1ZX6A 2MWPA 5KYYA 2QDYB 2LQNA 2O88A 2D8HA 3OYIA 1TU0B 4DBRA 5I22A 2OX7A 2BKDN 5I2MA 3THKA 3H6ZA 2LNHB 2YRDA 1MUZA 4ZN3A 1EX4A 2EGAA 2LRQA 2BTTA 2M16A 1X2QA 2DLPA 3VYHB 1IHWA 5CQXA 2RPNA 2QA4A 1OQKA 2OTLA 5FRMA 1VQ6Q 2L3RA 2F2XA 2CZ0B 1OOTA 1PWTA 5CCAA 3MP8A 4JRQA 1K8AU 2VB6A 3URGA 5KH6A 1G83A 1KD1R 2E10A 1QVGS 2KYBA 4JS4A 1OZ3A 1AWWA 1WHMA 1BIBA 2DFUA 4C5HA 5AT1B 4AMCA 3JCMd 2C06A 1F1BB 3CC7Q 5GMKm 1R8OB 3H8ZA 4C0ZA 1D1BA 3LW5E 5FWCA 3JB9G 2VV5A 2OTJQ 1VQOQ 3CXCP 4DQ2A 1IRXA 4QVZA 1J3TA 3JCMJ 5GAOm 2V1RA 1BKBA 3AT1B 4C8QF 4CC2A 4TVRA 4Z02A 4BI8B 2F5KA 3G4SQ 1T3LA 2KR3A 3TVTA 1YP5A 3H41A 1YJ9Q 2KGTA 3G71Q 2XIDA 2DERA 2GBQA 1D09B 1EIFA 1WHLA 2DL7A 3CCET 3VYGA 2P0QA 1YIJQ 2MF2A 2CSIA 2ZPHB 3UPUA 4FYYB 4PJOE 1WLPB 1M3AA 2MOXA 4XTYA 4AG1C 1NPRA 1OULA 2DL5A 1IB8A 1MHNA 2YUPA 1M9SA 1ZLMA 4OB3B 2DL8A 2DRMA 5KYXA 2ABLA 2MMPA 2BZYA 4EMHA 2FVUA 4CC4B 1N8RR 3HRUA 1RAEB 4D8DA 1AZEA 4FSXA 1KK7A 2EQKA 4FW1A 1NEGA 2L8DA 3MEUA 2K57A 1R77A 3HKSA 3M5AA 2X3WD 1I8FA 1Y96A 2OAUA 4EPCA 3L2WA 3EGUA 1YI2T 2IVWA 2MYSA 2BZ8A 3OY9A 4M77A 1BI2A 4DEYA 1C1AA 2A37A 2X4JA 4PJMA 2HNIA 1VYVA 1OU9A 2Z0WA 4M78D 2X4XA 1YHQQ 4A4GA 2LVMA 1M1FA 2QQAA 1FMKA 4PFZA 3TEEA 4M7AF 3HFNA 1NJIR 2BUDA 1KHCA 1NEBA 2JS0A 2KVQG 4X1VA 4GY5A 1ABOA 1IXDA 1UGRB 4PFOA 5A0LA 2QI2A 2PQWA 3EHQA 5GAMd 1M90U 1M27C 3PNWC 2DK3A 4M7DA 1B34B 1RLQC 1ZUUA 4BI4A 4M75F 3JB9D 1BCMA 1QWFA 4MZMA 4QKUA 1UDLA 1I5LA 2VVKA 2RHZA 2QQSA 1RLPC 2LCLA 3CPWS 5I11A 4LDVA 3C0CA 2YT6A 5GJVB 4F16A 4JJCA 1UUEA 2H3JA 4LD9K 2ED1A 2ZPGB 1WX6A 2QAZA 1VQ8Q 2ZPFB 3I35A 1YCSB 3M4YA 4A4HA 4C0DC 2X4WA 1SG5A 1OEBA 2CZ7B 1SPKA 3CCRQ 2RQWA 2DXBA 2JJ9A 4C92B 4RMOA 1WA7A 3C94A 3CXCS 2EAYA 3KBGA 3GOXA 1YBYA 2DRKA 3OYMA 4N4GA 1JJ2P 4IUQA 3OYAA 1W2BS 1G3TA 2XHCA 1GL5A 1UB4A 1YJWA 4ZN1A 1QLYA 4CI0C 3CMAT 5HK3A 4BI3A 3HL8A 2KRSA 3JSCA 3H9NA 1VQ4Q 2LX7A 2E64A 2B8AA 1UGVA 1BYMA 1QCFA 4JPBW 3NTIA 3CCLT 3WXMB 4QQGA 2L89A 5CO7A 5LJ5e 1OX9A 4N0AA 2SRCA 2EVRA 3CCQQ 3OS1A 3FEOA 4LDYA 2VASA 4FYWB 3I56A 3WVDB 1I81A 1D3BA 3S6WA 1M8VA 4VUBA 3V8JA 4XTUA 4EDUA 3V7SA 3RKYA 4M7DF 4F7UB 1TTHB 3CCMQ 1LOJA 2XDDA 3MHXA 3A8HB 3VJPA 1PD0A 3RR6A 3CCLQ 3CD6T 2DTIA 4RCCA 2DXUA 2RB6A 1Q7YU 2KROA 5IN1A 2RN8A 4L59A 2O31A 3PIPA 5FRNA 3BDLA 3DLLA 1X01A 1WYXA 2FG0A 2XKOC 3CC2T 2LCCA 2NUTA 2J06A 4NOYA 2HKNA 1KQSP 1KIKA 3OYGA 1AWJA 3JRZA 1ARKA 2DIGA 2YUQA 2J05A 4N4IA 1CSKA 4BE1A 2M0YA 1M1KC 4HVWA 4M78B 3CBOA 2DXTA 1MV0B 1WFWA 4O6JA 4OMLA 2E3HA 1RAFB 2DXCA 4PJOA 4LXCA 3M55A 1VQ5Q 4DBFA 2ATCB 1S72A 4MZTA 1N9RA 4LUDA 3OW2A 2LCSA 2ROLA 3LLRA 4OGEA 5CKBA 1BIAA 1G5VA 2PVDB 3INZA 4J9IA 3I5RA 2BIVA 1PC0A 4C0FA 4JRIA 3V7RA 2YXYA 2EGEA 4QW2A 2DEUA 5EG2A
chains in the Genus database with same CATH topology
1YJNQ 1M1KR 3CC2Q 3CCJQ 2QA4Q 1NJIR 1K9MR 2QEXQ 3CCSQ 3OW2P 2OTLQ 3CMAQ 1VQ7Q 1W2BP 1KC8R 3I55Q 1VQ6Q 1QVFP 3CMEQ 3CC4Q 1JJ2P 3CCMQ 3CPWP 3CCQQ 1YIJQ 1VQ8Q 1VQLQ 1VQPQ 3CCEQ 3CC7Q 1N8RR 1YJWQ 3CCVQ 3G6EQ 1VQKQ 1YI2Q 3CCLQ 1VQNQ 1Q82R 1VQ5Q 1Q86R 3G4SQ 1Q81R 1S72Q 3I56Q 3CCUQ 1QVGP 2OTJQ 1VQOQ 3CCRQ 3CXCP 1K8AR 1YJ9Q 1VQ9Q 1YHQQ 1M90R 1K73R 1KQSP 1Q7YR 3CD6Q 1VQMQ 3G71Q 1KD1R 1YITQ 1VQ4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN Q;  1M1K R;  3CC2 Q;  3CCJ Q;  2QA4 Q;  1NJI R;  1K9M R;  2QEX Q;  3CCS Q;  3OW2 P;  2OTL Q;  3CMA Q;  1VQ7 Q;  1W2B P;  1KC8 R;  3I55 Q;  1VQ6 Q;  1QVF P;  3CME Q;  3CC4 Q;  1JJ2 P;  3CCM Q;  3CPW P;  3CCQ Q;  1YIJ Q;  1VQ8 Q;  1VQL Q;  1VQP Q;  3CCE Q;  3CC7 Q;  1N8R R;  1YJW Q;  3CCV Q;  3G6E Q;  1VQK Q;  1YI2 Q;  3CCL Q;  1VQN Q;  1Q82 R;  1VQ5 Q;  1Q86 R;  3G4S Q;  1Q81 R;  1S72 Q;  3I56 Q;  3CCU Q;  1QVG P;  2OTJ Q;  1VQO Q;  3CCR Q;  3CXC P;  1K8A R;  1YJ9 Q;  1VQ9 Q;  1YHQ Q;  1M90 R;  1K73 R;  1KQS P;  1Q7Y R;  3CD6 Q;  1VQM Q;  3G71 Q;  1KD1 R;  1YIT Q;  1VQ4 Q; 
#chains in the Genus database with same CATH topology
 4XU3 A;  4XU2 A;  1MNE A;  2YSQ A;  3VS7 A;  3CCJ A;  1AWO A;  2A3L A;  2D0Q B;  2NUZ A;  2RF0 A;  1JQQ A;  2JM9 A;  3QBY A;  4AFS C;  4KUD K;  3L2Q A;  2LDM A;  4OMQ A;  1WPY A;  2EQU A;  2HAX A;  2EJG A;  1C6V X;  2GF7 A;  3OBW A;  2W10 A;  2D1X A;  3GLX A;  4JRK A;  3OYD A;  4MDX A;  2A36 A;  5CVI A;  1YIT Q;  1K9M U;  2HKQ B;  2QEX Q;  3QWY A;  5J3B A;  2C0T A;  4A53 A;  6AT1 B;  3GBQ A;  2EYW A;  3CC4 A;  5GAN 2;  1VQ9 T;  3OSV A;  1WNL A;  1WQW A;  3MP1 A;  5IH2 A;  1SRM A;  2AK5 A;  2P0P A;  1JJ2 S;  2JT4 A;  3M0R A;  2JOY A;  2X3X D;  1CKB A;  5GAN d;  2VWF A;  3HHT B;  3CCS Q;  3N5B B;  3HTR A;  3UF4 A;  2C0I A;  4CRI A;  4RCB A;  4L6V 5;  2JMC A;  3G6E A;  1Q82 U;  3HP9 A;  4HCZ A;  3JB9 F;  1RAH B;  4PLL A;  1N27 A;  2OTL T;  4D6W A;  1RUW A;  3QZ5 B;  3OB9 A;  1UGQ B;  5LJ3 d;  3A98 A;  3L2V A;  3OS2 A;  5CR2 A;  2YRV A;  5DY9 A;  4F17 A;  2DZC A;  3P8D A;  3JCM g;  5GAO n;  4RKU E;  2X51 A;  2RQU A;  2ESW A;  1VQN Q;  1K0S A;  2RI3 A;  1N8R C;  2GQV A;  3S3N A;  4HKE A;  2BE9 B;  2CP0 A;  5J39 A;  3VV0 A;  2QA4 Q;  1K4U S;  4A63 B;  2EYZ A;  4C5I A;  3Q1J A;  3S3M A;  1UHF A;  3ZL7 C;  3JAM E;  2R58 A;  2RK2 A;  3EFS A;  3M53 A;  1LJO A;  3NFC A;  1OZ2 A;  3RUX A;  2FHD A;  3QDR B;  5GAO l;  4AFQ C;  3UT1 A;  4KGX B;  2DKG A;  3QG1 A;  3VKI A;  4C5G A;  1VYT A;  1YFN A;  4C92 E;  4E2F B;  2EWN A;  1YJN Q;  5CKH A;  2KYM A;  2HSP A;  3PVL A;  4FSS A;  2FZC B;  1JXO A;  4M77 D;  3TQ7 P;  1VQ7 A;  1KQS S;  1HSQ A;  1T0J A;  2DYB A;  2YWW A;  3WVE B;  4OB1 B;  3QXE B;  4C8Q B;  2DM1 A;  2ROT A;  3LX7 A;  4E7I A;  3EG2 A;  2O9V A;  2LZ6 B;  2LNV A;  1V76 A;  1E7O A;  1VQM A;  4J5Y A;  3LH5 A;  1M3B A;  4B9W A;  1MMN A;  1XNI A;  1JBM A;  3CPW P;  2DL4 A;  3SFM A;  3J7A F;  2EKH A;  4IUU A;  1NBE B;  1ZQ1 A;  1QQJ A;  2KMT A;  5GAN 3;  2E3I A;  4LUE A;  4M7D D;  4LNP A;  2ECZ A;  2EYQ A;  3L2R A;  1M1K U;  3FJP A;  4F7U E;  1JXM A;  2VYT A;  4JS5 A;  1AHJ B;  4GLM A;  3QWX X;  5KE2 A;  3CCU T;  3J80 E;  5LJ5 g;  1PRM C;  1UHC A;  2LJ3 A;  4IUP A;  4QQ6 A;  3JB9 H;  3MP6 A;  2QXF A;  3BDU A;  5HY6 A;  2KRM A;  1XOV A;  3ZFJ A;  4JJD A;  4MMK A;  4NL2 A;  4PJO G;  2DIQ A;  2KQW A;  4HT8 A;  2ED0 A;  1W2B P;  2CP3 A;  2RA2 A;  3M0U A;  4E6R A;  5GAO p;  2KXD A;  4FT2 A;  4PFP A;  2DTO A;  1KC8 C;  1O9S A;  2E12 A;  4XU1 A;  1MND A;  2F2V A;  3HFO A;  3OBY A;  1WXU A;  2AKL A;  1Y07 A;  2GCX A;  2EGC A;  3SD4 A;  2MIO A;  4N0A C;  2HMA A;  1TUG B;  5GAM g;  4B6M A;  2EBP A;  1KD1 U;  1OV3 A;  1HJD A;  2NWM A;  2LQK A;  3EH1 A;  4M78 E;  2HBP A;  4M7A B;  5GAN 7;  4XTZ A;  4C0G A;  4BY6 B;  1VQ6 A;  3M0S A;  1FYN A;  2K5L A;  3EGD B;  4HCK A;  4A4F A;  3C95 A;  4FW2 A;  1AVZ C;  1K76 A;  3REA B;  1G3Y A;  3A1P A;  4FT4 A;  2RHX A;  2RI5 A;  2C0O A;  4M75 B;  4ESR A;  1MV3 A;  4KBM B;  2RJE A;  3CCE Q;  1KQ1 A;  4RG8 A;  5FU7 B;  3CC7 A;  4GLK A;  3DB3 A;  3OYE A;  1QVG A;  2LQ8 A;  1X43 A;  2OTJ A;  3CCU A;  3EG0 A;  3PMT A;  5KE3 A;  4R55 A;  1H8K A;  4J7I A;  4KT0 E;  1X75 C;  2F69 A;  2CDT A;  4IUV A;  3V7C A;  2J6F A;  3P8H A;  2QAS A;  1DJ7 B;  2KAF A;  4J9G A;  4KUL A;  1MMA A;  2QQR A;  3VS4 A;  3G4S A;  2K3Y A;  4PJO C;  2KI7 A;  1YJ9 A;  2WSE E;  1SHF A;  3G71 A;  3VUB A;  3ZEH A;  1YJW T;  4DEX A;  2CGH A;  2I2L A;  2AKK A;  1OU8 A;  3JCM e;  3LYI A;  2QDL A;  4MZP A;  4E7S A;  5GAN 5;  1N8R U;  2FL7 A;  5KYU B;  1B34 A;  2DL3 A;  2KNB B;  4RTZ A;  3HSB A;  1YI2 Q;  1WIE A;  3BY7 A;  1VQP A;  2QK0 A;  5FU6 C;  5KCO A;  1QW1 A;  3H0H A;  2DBM A;  3GIB A;  3A8M B;  3FB9 A;  2DF6 A;  2EQJ A;  2XDP A;  2HSE B;  1SRL A;  4PKC C;  2K2V A;  5CKE A;  2SEM A;  1AZG B;  3OYF A;  1VYU A;  3EG3 A;  2CP6 A;  2DZ9 A;  3MET A;  3I56 T;  1LPL A;  4FCY A;  1OYX A;  4PJO D;  1YJW Q;  2YHT A;  2DMO A;  4FU6 A;  2O4X B;  2NUP B;  3M0Q A;  1U5S A;  3QII A;  4J7F A;  3M54 A;  4OB0 B;  2PVO B;  5GAN 4;  4BE0 A;  3I9Q A;  3JCM X;  1EFN A;  1PSE A;  3SDZ A;  1NJI U;  2IPO B;  1K73 C;  3VS3 A;  2JN0 A;  1KG1 A;  4PJJ A;  1NYG A;  4XQ3 A;  4BUG A;  2CT4 A;  3EFR A;  3FIF A;  2E70 A;  1W70 A;  2RQR A;  4M7D B;  2PNI A;  3PMI A;  1U8R A;  3OYC A;  3MEA A;  2OJ2 A;  2G6F X;  1ZHI A;  3MJX A;  3SB2 A;  4QT7 A;  1VQK A;  4C92 A;  2XI9 A;  5IHI A;  3SWN C;  3R6N A;  3CBM A;  3M0P A;  2W0Z A;  3QJ6 A;  3I55 T;  2GTJ A;  1BI0 A;  4ANJ A;  1YHQ A;  4KH1 B;  1PM3 A;  1NM7 A;  1Y0M A;  3QYG B;  2E1H A;  5KCH A;  2O01 E;  4HCB A;  2O2O A;  1PG5 B;  1R0C B;  1KC8 R;  4JZ4 A;  5FWB A;  1YWP A;  2CZ1 B;  4WTO B;  2AZV A;  2QTV A;  1QVF S;  1ZSG A;  4M77 F;  4J6Y A;  1D0Y A;  1QKW A;  2XDB A;  3MEW A;  3OYB A;  5GAO q;  2KRN A;  3RKX A;  4BB7 A;  2WSC E;  1IRE B;  4EIK A;  1TUD A;  4JJN K;  3A8O B;  3JCM h;  3UA7 A;  4GBQ A;  4AFZ C;  4WCI A;  4C8Q E;  4OMO A;  3RBB B;  4ELY C;  1S72 T;  4BDZ A;  3ME9 A;  1MMG A;  3VUZ A;  1GCQ C;  2P0K A;  2FO0 A;  2ZZD A;  4J6X A;  4MML A;  1I4K 1;  2K6D A;  2XD0 A;  2HQH A;  2GFU A;  1AEY A;  1M1G A;  2P4T A;  2DD5 A;  3GNG A;  5CKD A;  3CMA Q;  2JW4 A;  1RAI B;  4J8O A;  3CPW A;  5GAN 8;  1QVP A;  4ZTF A;  1HD3 A;  4D8K A;  5FRO A;  1WJR A;  3CCJ T;  5HCK A;  5GAM e;  2VXE A;  3VS1 A;  2E5K A;  1Q86 C;  1H92 A;  3RES A;  2PUO B;  2LJ1 A;  2CH4 W;  1NE8 A;  2A0F B;  2IG0 A;  3I5S A;  4YTL A;  4V2S A;  1K0X A;  1B3Q A;  3I55 A;  2YUO A;  1ZSZ B;  2KXC A;  2VGN A;  4J9B A;  3TRE A;  3JCM f;  3PVQ A;  1NPP A;  1O75 A;  1FX7 A;  4LD6 A;  4OMN A;  1KSW A;  3CXC A;  3QYH B;  2A08 A;  1WI7 A;  5GAN g;  2MAM A;  1QKX A;  2OAW A;  3CD6 Q;  1PSF A;  3T9N A;  3CME T;  3E9F A;  3CC4 T;  1W2B A;  2ZPE B;  1CKA A;  1HK9 A;  2XG8 D;  3GNF B;  4E7Z A;  1VQ4 A;  3M9Q A;  4Y92 A;  4M75 G;  5C6S A;  1WHJ A;  3OYJ A;  3EH2 A;  3CCQ A;  2QTX A;  2K79 A;  4BAC A;  3NMZ C;  4ELZ C;  1I5O B;  5LJ3 g;  4M7A E;  5L8R E;  5KYN A;  1AOJ A;  3CC2 Q;  1W6X A;  1AWX A;  4PNO A;  3MKD A;  3G6E T;  3CCV T;  1SKU B;  5LJ5 h;  4ZGD B;  1FWZ A;  3CCM A;  1OI1 A;  3A5Z B;  2EKO A;  1RAC B;  4LDU A;  1Q81 C;  1K73 R;  3TU4 K;  4M75 E;  1PNJ A;  2P84 A;  5IHN A;  3LH0 A;  3MCA B;  1QMC A;  1PKT A;  3JV3 A;  1BI1 A;  1WGS A;  3E9G A;  2MWO A;  2BE7 D;  3FC3 A;  1D0Z A;  7AT1 B;  4FYX B;  1YWO A;  3QDF A;  4XAX B;  1ZBX A;  3BFM A;  1HYO A;  2DJQ A;  1QCN A;  1Y7X A;  4JDS A;  4J9D A;  3E1S A;  1VOM A;  1S1N A;  3J81 E;  1NLO C;  3UWN A;  1W1F A;  2RHU A;  5KYW A;  3M59 A;  2CH4 A;  2D8J A;  5LJ5 j;  1QP2 A;  5GAO r;  3LGF A;  2EYX A;  3CME A;  3SWN A;  3RMQ A;  1TUC A;  5LJ5 f;  1Y57 A;  1N9S A;  1E6G A;  3V8K A;  1VQ5 A;  3QSU A;  1M8M A;  1VQ7 T;  4OMM A;  2D6F A;  3UA6 A;  3EFO B;  4EMK B;  1RAB B;  1G2B A;  4M75 C;  3NPF A;  1WXB A;  3NGP A;  5FW9 A;  1WXT A;  2LP5 A;  3D7S B;  3M4G A;  3GF5 A;  3VRY A;  1E6H A;  5IXB A;  3CCV A;  2A7Y A;  3CQT A;  1VQM T;  3L2Z A;  4C0D B;  2AT1 B;  1M2V B;  2V1Q A;  2B86 A;  1VQ9 Q;  4PJO F;  3G7Z A;  5C0M A;  4C92 G;  1PD1 A;  2LTO A;  3OS0 A;  1GCQ A;  1YN8 A;  4PLI A;  1TSF A;  2VGM A;  2JTM A;  2OI3 A;  4J9H A;  4O5V A;  1Q86 R;  4Y28 E;  5A0G A;  2E4H A;  2EQM A;  1VQM Q;  1KQ2 A;  1YIT A;  4M7D E;  2OTL Q;  3C12 A;  2QEX A;  1TS9 A;  3R6O A;  4HVV A;  5A2Q E;  1VIE A;  4OB2 B;  2M02 A;  3P8B B;  1X27 A;  2E6N A;  4RTW A;  1TOV A;  4B9X A;  4BE2 A;  1ZA2 B;  1ZUK A;  2ZAE A;  3EG9 A;  3FRN A;  3EGX B;  4ME7 A;  1OPL A;  2V8K A;  2J6O A;  2GTO A;  4J9F A;  1VUB A;  2YUN A;  4QVD A;  1M90 C;  2L3S A;  2KY9 A;  2D0N A;  3CCS A;  3QZ9 B;  4M4Z A;  4KRT A;  1IZ6 A;  3SHW A;  1V1C A;  2FYK A;  3BE3 A;  1JJ2 A;  4F7U G;  1YCY A;  2DPP B;  2L3P A;  1K9A A;  1RAA B;  2DVE A;  2DAQ A;  3JCM Q;  4IUR A;  2RM4 A;  3L42 A;  2DX1 A;  2KE9 A;  2Y4X A;  3X25 B;  1M5Q 1;  1VQ6 T;  5L23 A;  1XTD A;  2V8I A;  2K2M A;  3O8V A;  4CC3 A;  2CYZ B;  4ZTJ A;  2GFA A;  3L2U A;  3OYL A;  5D6X A;  2MI6 A;  4FYV B;  1BI3 A;  3E2U A;  4KGZ B;  1WQ7 A;  1VQN A;  2FZG B;  2J7I A;  2R5M A;  1SEM A;  1Q81 R;  1UGS B;  2LMJ A;  5KYY B;  2RH2 A;  5GAN e;  3X20 B;  4QQD A;  1G3W A;  2QQB A;  4C92 C;  1VA7 A;  2E41 A;  3TSW A;  2M9U A;  3CC7 T;  1JU5 C;  1RAG B;  1UTI A;  4RTU A;  2QGF B;  4M78 G;  3OYH A;  2OTJ T;  1VQO T;  2CS7 A;  1JRI A;  1VQL A;  4ZGJ B;  1WDX A;  1SSF A;  5GAN 6;  2EW3 A;  5LJ3 e;  1PHT A;  2XIC A;  4E7J A;  1WJQ A;  2KT1 A;  1WJS A;  1YJN A;  2FRY A;  2COW A;  2LC4 A;  3V8L A;  2MCN A;  1QWE A;  1ACM B;  1QVF P;  4Z89 A;  3G4S T;  4PJN A;  1NZ9 A;  2K7A A;  2DNU A;  3MPU B;  4OVA A;  1UJY A;  4PK4 A;  1YJ9 T;  4C92 D;  3G71 T;  1Q81 U;  1UEC A;  4M7A A;  1M2O A;  3CCU Q;  1KQS A;  1MMD A;  3FDR A;  2JUF A;  3L1A A;  9ATC B;  4MDW A;  1YIJ T;  2WAC A;  3H0I A;  1VQP T;  1XJW B;  3EGD A;  3ER0 A;  4A54 A;  3UDC A;  1JB0 E;  3FLG A;  3GP8 A;  2DD4 A;  2NLU A;  3E19 A;  3F70 A;  2BZX A;  1JO8 A;  4C5E A;  5DM7 R;  2K5I A;  1X6O A;  1C0M A;  4RTT A;  4M75 A;  1WHK A;  3NHN A;  2RD1 A;  1UE9 A;  1RAD B;  2CT3 A;  1ZBJ A;  1Q7Y C;  3OW2 P;  1H3Z A;  1ZSZ C;  2AZS A;  2QYZ A;  3EHR A;  5IXF A;  1VQP Q;  2KT8 A;  1I0C A;  2V26 A;  5GAN h;  2PZ1 A;  1LCK A;  3OYY A;  1BCO A;  1UEB A;  5GMK e;  3RNJ A;  2H3E B;  4CC7 A;  2PUK B;  1VQO A;  4FM4 B;  2YLC A;  3OSS C;  4M78 C;  1OX8 A;  1VQK T;  4XK8 E;  2FB7 A;  2AHJ B;  1BB9 A;  2F5T X;  3CEY A;  4N4H A;  5CIU A;  2K9G A;  3A8G B;  2RHY A;  4EMG A;  1YHQ T;  1AD5 A;  4OMF B;  5LJ3 h;  2RQV A;  5EC7 A;  4A4E A;  2K5F A;  3X26 B;  3HPW A;  4HXJ A;  3C4S A;  5KYX B;  1M90 R;  3RKW A;  1X69 A;  5KYU A;  5CK9 A;  1UJ0 A;  3RDV A;  4ORZ A;  2EIF A;  1H64 1;  2EPD A;  1GRI A;  2FPD A;  4HA8 A;  2G3R A;  4J6W A;  4ZGE B;  3TCJ A;  2F1L A;  2EJ9 A;  2JS2 A;  3ASK A;  2CP2 A;  5LJ5 d;  2CUD A;  1Y96 B;  3AHU A;  4FL6 A;  1FXX A;  1VQK Q;  4J83 A;  1Z9Z A;  1YIJ A;  2R5A A;  1RI0 A;  5GAN j;  1VIF A;  2Y4Y A;  4M77 B;  1TH7 A;  3CPF A;  1QCO A;  1KJW A;  4E7L A;  2H8H A;  5GAN f;  1LNX A;  2LT4 A;  1UGP B;  3G1J A;  4OMP A;  1Q95 G;  2O4X A;  2NUP A;  3VS0 A;  1SSH A;  1G8X A;  2JMA A;  2ZGW A;  1MGQ A;  3CCE A;  2L3Q A;  1ZA1 B;  2JVV A;  5LJ3 j;  3DB4 A;  5AYF A;  5HK0 A;  5J26 A;  1N5Z A;  2CKK A;  5LJ3 f;  2KSS A;  1VQ8 T;  3GPL A;  1NLP C;  1K9M C;  4RTV A;  1U3O A;  2D9T A;  4QVC A;  1IHV A;  5I2S A;  4DA4 A;  5D7U A;  3CCR T;  4UC4 A;  1KFZ A;  2JTF A;  4XTV A;  3ULR B;  2E5Q A;  4C8Q G;  5GMK h;  4K11 A;  2LX9 A;  1M4Z A;  5FLX E;  4EMK C;  3I56 Q;  1Y71 A;  1SHG A;  3O5Z A;  1GFD A;  1GBR A;  2V8J A;  1UG1 A;  3OA6 A;  3DLM A;  1OPK A;  2M1H A;  3A8L B;  4KGV B;  1I1J A;  2R57 A;  3OYK A;  3QHS A;  1QP3 A;  3QKJ A;  2QGG A;  3DKM A;  3KXT A;  2FPF A;  5M9O A;  3S3O A;  4RTY A;  3VU3 C;  3NTH A;  2RNA A;  1YI2 A;  1VQ4 T;  2GQI A;  4HVU A;  4AG2 C;  1P92 A;  1Q82 C;  2P4R A;  4HCC A;  2MK5 A;  2GGR A;  3QO3 A;  3NTK A;  3M58 A;  3CCQ T;  2HD0 A;  2ZCF B;  4XTX A;  2VKN A;  3I55 Q;  2KBT A;  1WZO A;  2DYI A;  2K3B A;  4LDW A;  3LWI A;  5IHK A;  3LWH A;  1X2K A;  1HXD A;  1G3S A;  3M0T A;  2NYS A;  1X6B A;  5GMK j;  3X24 B;  3MEV A;  1FMV A;  3PFS A;  1D0X A;  2X9H A;  2QQ9 A;  3CBP A;  4F7U A;  4Z88 A;  4Y91 A;  1Q7Y R;  2XK0 A;  1A0N B;  3CCM T;  4HT9 A;  1M3C A;  1KC8 U;  3X28 B;  1RL2 A;  4J9C A;  5CQY A;  1KHI A;  5GJW B;  3EG1 A;  1N6A A;  4OP0 A;  2M51 A;  3OW2 S;  1AT1 B;  1VQ8 A;  2CSQ A;  1S72 Q;  8AT1 B;  1T0H A;  1WHG A;  5CKF A;  2FEI A;  1B07 A;  2DEQ A;  1ZSZ A;  3CCR A;  3QPH A;  3MO8 A;  1B7T A;  1U1S A;  4M7A G;  3JCM V;  3RMS A;  3ZBD A;  1D3B B;  2RJF A;  4C8Q C;  1X6G A;  2I0N A;  2DIL A;  4X34 A;  2O9S A;  1LVK A;  1R0B G;  2CZ6 B;  3SEM A;  2HEQ A;  3UAT A;  2VXF A;  2HDA A;  4M78 A;  2FRW A;  3JCM P;  1ZUY A;  2E6Z A;  4C92 F;  4A4K A;  2DET A;  3CCJ Q;  1QVF A;  2E65 A;  1YNZ A;  2RJC A;  2DVJ A;  5D6Y A;  4DBQ A;  5I21 A;  1VQ5 T;  3M57 A;  2RK1 A;  2FZK B;  4JUV A;  3OMC A;  3LGL A;  3PE0 A;  4C8Q D;  1K8A C;  4RUG A;  2RJD A;  2ENM A;  4F04 B;  2JXB A;  2K3X A;  3CMA A;  2NUT B;  4LN2 A;  1D1C A;  5DLQ E;  3CME Q;  3CC4 Q;  2HCK A;  2JTE A;  3PIO A;  4FIB A;  3RER A;  1PKS A;  2YDL A;  1WHH A;  3CCL A;  3JB9 J;  2JNG A;  1GFC A;  4E7H A;  4ATO A;  1IO6 A;  2HBW A;  4PJO B;  2ZPB B;  3U23 A;  2HL5 C;  2VUB A;  1K9M R;  2CRE A;  4E7K A;  4F7U F;  1BK2 A;  3VS2 A;  2A28 A;  1Z9Q A;  2YLB A;  1GBQ A;  1EZZ B;  1NYF A;  1K1Z A;  3G6E Q;  2YRC A;  3CCV Q;  2PVG B;  2X35 A;  3M56 A;  3OMG A;  2EYY A;  1I07 A;  5GAM h;  1YIT T;  3RIR A;  4Q5W A;  2DO3 A;  4M77 G;  2QEX T;  1QVG P;  3VRZ A;  4F14 A;  5FU6 B;  1T3S A;  4RTX A;  4XTW A;  1IGQ A;  4M7A C;  2DA9 A;  2HQX A;  3CD6 A;  4IIM A;  4BY6 C;  1GXI E;  3PTA A;  1UFF A;  1KD1 C;  2CUB A;  2QG9 B;  2L2P A;  2X4Y A;  2CP5 A;  1M30 A;  2JM8 A;  4KH0 B;  3EFO A;  4EMK A;  3OQ5 A;  4AFU C;  4NL3 A;  1Q82 R;  3CCS T;  2MPX C;  2HZY A;  2RO0 A;  1BBZ A;  1FMW A;  1TXQ A;  2HL3 A;  5IT9 E;  1K73 U;  2AIR B;  2COZ A;  3H0F A;  2JZ2 A;  4IUT A;  4L5G A;  2LJ0 A;  2RI2 A;  3CC2 A;  2HQE A;  3BW1 A;  3JCM c;  5CAI A;  4M78 F;  2ZPI B;  4X9D A;  4R56 A;  2DTH A;  5FU7 C;  4M7D G;  1IGU A;  1M2V A;  2VC8 A;  4M77 E;  4OF1 A;  5KYW B;  4II1 A;  3QJY A;  3JB9 I;  4M7A D;  5GAM j;  1NG2 A;  5DLO A;  2LT1 A;  1PRL C;  3HRT A;  2LQW A;  2DBK A;  1ABQ A;  4IIO A;  4P5N A;  3FJ5 A;  1SF9 A;  3SWN B;  4R0K A;  3JCM b;  2WSF E;  5GAM f;  4JLG A;  4JRP A;  1GCP A;  4X9C A;  3EAE A;  1PCX A;  1VQ7 Q;  1VQN T;  2M0O A;  2EJF A;  5GMK i;  4JZ3 A;  5HKC A;  4JLI A;  3VS6 A;  4LE9 A;  3TSZ A;  5A0D A;  4PJL A;  2L0A A;  4M75 D;  1TWB A;  5IAY A;  2Y90 A;  2QA4 T;  3OS5 A;  1U06 A;  4ZNX A;  3IQL A;  1XQH A;  4DOW A;  4KUI A;  1TG0 A;  8ATC B;  1BU1 A;  4PL6 A;  1D1A A;  2PTK A;  4XU0 A;  2K4Y A;  3REB B;  2KK4 A;  2DE0 X;  2KEA A;  2RMO A;  4DBH A;  1VQL T;  4AT1 B;  1W4S A;  4RG2 A;  4IKF A;  3PT9 A;  2EFI A;  2J6K A;  2CP7 A;  3EGX A;  4OGC A;  2EQI A;  2KDS A;  2XMF A;  4BD3 A;  4NS5 A;  3KFV A;  4M77 C;  3JCM W;  1YJN T;  2FPE A;  5GMK l;  2XU8 A;  4JJB A;  3VS5 A;  2PU9 B;  4C8Q A;  1H3H A;  3OYN A;  5ECA A;  2DJZ A;  4J9E A;  1JEG A;  2L5Q A;  4E47 A;  2GNC A;  5D6W A;  3QUI A;  2COY A;  1U1T A;  1VQL Q;  1RI9 A;  1Q86 U;  3PGG A;  2IIM A;  3KUF A;  2RHI A;  1K8A R;  2RQT A;  1VQ9 A;  4WF2 A;  2F2W A;  4DOV A;  1M1K R;  4Z8A A;  4LDX A;  3EG9 B;  3HRS A;  5LL6 S;  4M7D C;  4BDY A;  1V29 B;  1NJI C;  1ZX6 A;  2MWP A;  5KYY A;  2QDY B;  2LQN A;  2O88 A;  2D8H A;  3OYI A;  1TU0 B;  4DBR A;  5I22 A;  2OX7 A;  2BKD N;  5I2M A;  3THK A;  3H6Z A;  2LNH B;  2YRD A;  1MUZ A;  4ZN3 A;  1EX4 A;  2EGA A;  2LRQ A;  2BTT A;  2M16 A;  1X2Q A;  2DLP A;  3VYH B;  1IHW A;  5CQX A;  2RPN A;  2QA4 A;  1OQK A;  2OTL A;  5FRM A;  1VQ6 Q;  2L3R A;  2F2X A;  2CZ0 B;  1OOT A;  1PWT A;  5CCA A;  3MP8 A;  4JRQ A;  1K8A U;  2VB6 A;  3URG A;  5KH6 A;  1G83 A;  1KD1 R;  2E10 A;  1QVG S;  2KYB A;  4JS4 A;  1OZ3 A;  1AWW A;  1WHM A;  1BIB A;  2DFU A;  4C5H A;  5AT1 B;  4AMC A;  3JCM d;  2C06 A;  1F1B B;  3CC7 Q;  5GMK m;  1R8O B;  3H8Z A;  4C0Z A;  1D1B A;  3LW5 E;  5FWC A;  3JB9 G;  2VV5 A;  2OTJ Q;  1VQO Q;  3CXC P;  4DQ2 A;  1IRX A;  4QVZ A;  1J3T A;  3JCM J;  5GAO m;  2V1R A;  1BKB A;  3AT1 B;  4C8Q F;  4CC2 A;  4TVR A;  4Z02 A;  4BI8 B;  2F5K A;  3G4S Q;  1T3L A;  2KR3 A;  3TVT A;  1YP5 A;  3H41 A;  1YJ9 Q;  2KGT A;  3G71 Q;  2XID A;  2DER A;  2GBQ A;  1D09 B;  1EIF A;  1WHL A;  2DL7 A;  3CCE T;  3VYG A;  2P0Q A;  1YIJ Q;  2MF2 A;  2CSI A;  2ZPH B;  3UPU A;  4FYY B;  4PJO E;  1WLP B;  1M3A A;  2MOX A;  4XTY A;  4AG1 C;  1NPR A;  1OUL A;  2DL5 A;  1IB8 A;  1MHN A;  2YUP A;  1M9S A;  1ZLM A;  4OB3 B;  2DL8 A;  2DRM A;  5KYX A;  2ABL A;  2MMP A;  2BZY A;  4EMH A;  2FVU A;  4CC4 B;  1N8R R;  3HRU A;  1RAE B;  4D8D A;  1AZE A;  4FSX A;  1KK7 A;  2EQK A;  4FW1 A;  1NEG A;  2L8D A;  3MEU A;  2K57 A;  1R77 A;  3HKS A;  3M5A A;  2X3W D;  1I8F A;  1Y96 A;  2OAU A;  4EPC A;  3L2W A;  3EGU A;  1YI2 T;  2IVW A;  2MYS A;  2BZ8 A;  3OY9 A;  4M77 A;  1BI2 A;  4DEY A;  1C1A A;  2A37 A;  2X4J A;  4PJM A;  2HNI A;  1VYV A;  1OU9 A;  2Z0W A;  4M78 D;  2X4X A;  1YHQ Q;  4A4G A;  2LVM A;  1M1F A;  2QQA A;  1FMK A;  4PFZ A;  3TEE A;  4M7A F;  3HFN A;  1NJI R;  2BUD A;  1KHC A;  1NEB A;  2JS0 A;  2KVQ G;  4X1V A;  4GY5 A;  1ABO A;  1IXD A;  1UGR B;  4PFO A;  5A0L A;  2QI2 A;  2PQW A;  3EHQ A;  5GAM d;  1M90 U;  1M27 C;  3PNW C;  2DK3 A;  4M7D A;  1B34 B;  1RLQ C;  1ZUU A;  4BI4 A;  4M75 F;  3JB9 D;  1BCM A;  1QWF A;  4MZM A;  4QKU A;  1UDL A;  1I5L A;  2VVK A;  2RHZ A;  2QQS A;  1RLP C;  2LCL A;  3CPW S;  5I11 A;  4LDV A;  3C0C A;  2YT6 A;  5GJV B;  4F16 A;  4JJC A;  1UUE A;  2H3J A;  4LD9 K;  2ED1 A;  2ZPG B;  1WX6 A;  2QAZ A;  1VQ8 Q;  2ZPF B;  3I35 A;  1YCS B;  3M4Y A;  4A4H A;  4C0D C;  2X4W A;  1SG5 A;  1OEB A;  2CZ7 B;  1SPK A;  3CCR Q;  2RQW A;  2DXB A;  2JJ9 A;  4C92 B;  4RMO A;  1WA7 A;  3C94 A;  3CXC S;  2EAY A;  3KBG A;  3GOX A;  1YBY A;  2DRK A;  3OYM A;  4N4G A;  1JJ2 P;  4IUQ A;  3OYA A;  1W2B S;  1G3T A;  2XHC A;  1GL5 A;  1UB4 A;  1YJW A;  4ZN1 A;  1QLY A;  4CI0 C;  3CMA T;  5HK3 A;  4BI3 A;  3HL8 A;  2KRS A;  3JSC A;  3H9N A;  1VQ4 Q;  2LX7 A;  2E64 A;  2B8A A;  1UGV A;  1BYM A;  1QCF A;  4JPB W;  3NTI A;  3CCL T;  3WXM B;  4QQG A;  2L89 A;  5CO7 A;  5LJ5 e;  1OX9 A;  4N0A A;  2SRC A;  2EVR A;  3CCQ Q;  3OS1 A;  3FEO A;  4LDY A;  2VAS A;  4FYW B;  3I56 A;  3WVD B;  1I81 A;  1D3B A;  3S6W A;  1M8V A;  4VUB A;  3V8J A;  4XTU A;  4EDU A;  3V7S A;  3RKY A;  4M7D F;  4F7U B;  1TTH B;  3CCM Q;  1LOJ A;  2XDD A;  3MHX A;  3A8H B;  3VJP A;  1PD0 A;  3RR6 A;  3CCL Q;  3CD6 T;  2DTI A;  4RCC A;  2DXU A;  2RB6 A;  1Q7Y U;  2KRO A;  5IN1 A;  2RN8 A;  4L59 A;  2O31 A;  3PIP A;  5FRN A;  3BDL A;  3DLL A;  1X01 A;  1WYX A;  2FG0 A;  2XKO C;  3CC2 T;  2LCC A;  2NUT A;  2J06 A;  4NOY A;  2HKN A;  1KQS P;  1KIK A;  3OYG A;  1AWJ A;  3JRZ A;  1ARK A;  2DIG A;  2YUQ A;  2J05 A;  4N4I A;  1CSK A;  4BE1 A;  2M0Y A;  1M1K C;  4HVW A;  4M78 B;  3CBO A;  2DXT A;  1MV0 B;  1WFW A;  4O6J A;  4OML A;  2E3H A;  1RAF B;  2DXC A;  4PJO A;  4LXC A;  3M55 A;  1VQ5 Q;  4DBF A;  2ATC B;  1S72 A;  4MZT A;  1N9R A;  4LUD A;  3OW2 A;  2LCS A;  2ROL A;  3LLR A;  4OGE A;  5CKB A;  1BIA A;  1G5V A;  2PVD B;  3INZ A;  4J9I A;  3I5R A;  2BIV A;  1PC0 A;  4C0F A;  4JRI A;  3V7R A;  2YXY A;  2EGE A;  4QW2 A;  2DEU A;  5EG2 A; 
#chains in the Genus database with same CATH homology
 1YJN Q;  1M1K R;  3CC2 Q;  3CCJ Q;  2QA4 Q;  1NJI R;  1K9M R;  2QEX Q;  3CCS Q;  3OW2 P;  2OTL Q;  3CMA Q;  1VQ7 Q;  1W2B P;  1KC8 R;  3I55 Q;  1VQ6 Q;  1QVF P;  3CME Q;  3CC4 Q;  1JJ2 P;  3CCM Q;  3CPW P;  3CCQ Q;  1YIJ Q;  1VQ8 Q;  1VQL Q;  1VQP Q;  3CCE Q;  3CC7 Q;  1N8R R;  1YJW Q;  3CCV Q;  3G6E Q;  1VQK Q;  1YI2 Q;  3CCL Q;  1VQN Q;  1Q82 R;  1VQ5 Q;  1Q86 R;  3G4S Q;  1Q81 R;  1S72 Q;  3I56 Q;  3CCU Q;  1QVG P;  2OTJ Q;  1VQO Q;  3CCR Q;  3CXC P;  1K8A R;  1YJ9 Q;  1VQ9 Q;  1YHQ Q;  1M90 R;  1K73 R;  1KQS P;  1Q7Y R;  3CD6 Q;  1VQM Q;  3G71 Q;  1KD1 R;  1YIT Q;  1VQ4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...