4HVUA

Crystal structure of the t98d c-src-sh3 domain mutant in complex with the high affinity peptide app12
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
TFVALYDYESRTEDDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Atomic resolution structures of the c-Src SH3 domain in complex with two high-affinity peptides from classes I and II.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein/peptide
total genus 12
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hvuA00
4ORZA 2DL3A 2RMOA 2EGEA 4HVWA 3VS5A 4GBQA 1BB9A 3O5ZA 1OOTA 1OPKA 1QKWA 5FW9A 2MIOA 3SEMA 2JS2A 2IIMA 3VS0A 1AVZC 1ZUYA 2L0AA 4OMOA 1GFCA 4R0KA 2F2WA 2YUPA 4EIKA 1GCPA 2DNUA 3EHRA 1OEBA 5I22A 3EG2A 4RTWA 1WXTA 1Y57A 2L3SA 1AWWA 1V1CA 3VS2A 2PTKA 1RUWA 1WLPB 2VKNA 2MOXA 2EGAA 3NMZC 4HVVA 4JZ4A 2GBQA 1Z9QA 3EGUA 4RTVA 2OJ2A 2CT4A 2LMJA 3TVTA 1E6HA 4J9FA 4JPBW 4OMPA 4AFZC 2FRYA 1M3BA 2A37A 2CUDA 1YP5A 1NM7A 2NWMA 1SSHA 2KBTA 1YWOA 3UA6A 2EQIA 2EGCA 2D8JA 5FWBA 2LP5A 1AWJA 1GL5A 2LJ3A 2DL5A 2SRCA 1GBQA 2C0TA 2W10A 3I35A 1K0SA 4D8KA 1HD3A 2FRWA 1T3LA 1BBZA 2RQUA 2ESWA 2CSQA 4Z88A 4F16A 2DL4A 2V1RA 2GNCA 2EYYA 1ZX6A 1WXBA 1VYTA 2JM9A 1JU5C 2DYBA 2GTJA 3ZL7C 2LCSA 1M30A 1ABOA 1PWTA 3PVQA 1GCQC 3EG0A 4RUGA 2EYZA 1GRIA 5IHIA 3M0PA 2KRMA 1K76A 2J6FA 2DM1A 1X27A 2J05A 2O2OA 1UHCA 2OI3A 4LE9A 2D1XA 1QWFA 3THKA 2GGRA 1RI9A 1W1FA 4A63B 4AG2C 3UA7A 3PVLA 2KRNA 5IXFA 2DRMA 2QDLA 2VVKA 2W0ZA 2ED0A 1M3CA 1H3HA 1U3OA 2AZSA 2CREA 2YUOA 3M0UA 3RBBB 3PE0A 3VS3A 1X2QA 3QWYA 3UATA 3LH5A 4J9BA 4AFQC 1TG0A 2A36A 2DL8A 1VYUA 2EW3A 2YSQA 3NHNA 4HCKA 2YDLA 1I0CA 1SPKA 1YN8A 2BZ8A 4QT7A 2RPNA 2JM8A 3GBQA 1X69A 1SRLA 1VA7A 2L3PA 1QCFA 1AZGB 1K1ZA 3VS7A 1SEMA 2CT3A 4J9EA 3CQTA 3U23A 4Z89A 2YT6A 1X6BA 1AD5A 4HVUA 1PRMC 1H92A 2JXBA 3I5SA 1K0XA 2X3WD 1VYVA 2FPFA 2PNIA 3SHWA 1E6GA 2P4RA 2K7AA 2VWFA 1M27C 4RTYA 2F2VA 2CDTA 4JJDA 2A28A 2YUNA 2J7IA 1WDXA 5HCKA 2DRKA 1UG1A 4JJCA 2GQIA 2B86A 2RF0A 1K4US 2CUBA 2DVJA 1M3AA 2BZYA 4RTXA 1AOJA 1OV3A 4FSSA 4JZ3A 1I07A 2X3XD 2HEQA 2K6DA 1AZEA 1B07A 2DILA 2HBWA 1GFDA 2O88A 1GBRA 2EYWA 3M0RA 2LJ0A 1J3TA 1SHFA 1QLYA 1FMKA 1G2BA 1M8MA 2CH4A 1Y0MA 2K2MA 2DLPA 2M51A 4J9IA 4OMMA 1EFNA 2ENMA 1TUCA 1SHGA 1ZBJA 1N5ZA 1CKAA 2L2PA 1NYFA 2O31A 4J9GA 2KT1A 3KFVA 2DBMA 4OMQA 4WCIA 1JO8A 4RTZA 3REBB 2C0IA 2GTOA 4J9CA 1ZSGA 2KR3A 2RQWA 4ESRA 4LN2A 4CC7A 1K9AA 4OMLA 1U5SA 3VRZA 3IQLA 1NLPC 2LQNA 2RNAA 2AK5A 1HJDA 1B3QA 2DX1A 3VS6A 5IXBA 1FYNA 2LX7A 3ULRB 2ABLA 4F17A 3R6NA 1AEYA 4LUDA 1CSKA 2SEMA 1WIEA 1UDLA 3EG3A 5IHNA 1AWXA 2RN8A 2ECZA 4J9DA 2K9GA 2A08A 2EVRA 1UFFA 2ED1A 3TSZA 3REAB 4JJBA 1UJ0A 1PNJA 2G6FX 4KRTA 2JT4A 1G83A 1UE9A 1X6GA 4J9HA 1YNZA 2CH4W 3TSWA 1UTIA 3H41A 1JEGA 4AFSC 2FPDA 1KJWA 2HCKA 4AG1C 1UHFA 4RTUA 5I11A 1YWPA 2J6OA 2DJQA 1MV3A 1MV0B 4AFUC 2KGTA 1SRMA 4LUEA 2YUQA 4K11A 1H8KA 2EKHA 1JQQA 4OMNA 1WFWA 2JS0A 2BZXA 1U06A 2FPEA 1GCQA 1JXMA 2KT8A 2FG0A 4F14A 1KSWA 2M0YA 1NLOC 1QKXA 4CC3A 1ARKA 1NEGA 5L23A 2C0OA 1JXOA 3QWXX 1W6XA 2LQWA 3JV3A 2KE9A 3C0CA 1RLPC 2HDAA 1HSQA 2JMCA 3H0IA 1WI7A 4HXJA 1UGVA 1NG2A 5IHKA 3VRYA 3NPFA 2F2XA 2KROA 2LJ1A 1BK2A 2D0NA 2ROTA 1X43A 1BU1A 4CC2A 2MCNA 1W70A 1CKBA 1PKSA 2J6KA 4IIMA 1ZUKA 2LZ6B 4GLMA 1A0NB 4E6RA 1WYXA 1Z9ZA 2DA9A 1MUZA 2E5KA 3VS1A 1T3SA 4D8DA 5GJWB 1UJYA 2H8HA 3I5RA 1WX6A 1ZLMA 2KXCA 1T0HA 2DMOA 3FJ5A 3H0HA 4RTTA 5EC7A 1NEBA 2LNHB 2FEIA 4LNPA 2DF6A 1IO6A 1WA7A 2V1QA 2RQRA 1PKTA 3NGPA 5IH2A 3H0FA 1KIKA 4X1VA 1UECA 1AWOA 3M0TA 1ABQA 3M0QA 4DEXA 1E7OA 5ECAA 4ZNXA 1QWEA 1YCSB 2EBPA 2DBKA 2DL7A 3UF4A 2O9SA 2RQTA 4CC4B 2O9VA 2KYMA 3I9QA 1XOVA 5GJVB 2L3QA 2HSPA 2RQVA 4Y92A 1UUEA 3EHQA 2K79A 2FO0A 4M4ZA 1X2KA 2KEAA 2AZVA 2ROLA 1OPLA 3M0SA 4IIOA 1ZUUA 1LCKA 1S1NA 2J06A 4Z8AA 2OAWA 1PHTA 3A98A 2I0NA 5FWCA 1PRLC 2KXDA 2K3BA 2JW4A 2KRSA 2BTTA 2NUZA 2AKLA 3VS4A 2EPDA 1T0JA 2XMFA 3RNJA 1NYGA 1TUDA 1KFZA 1I1JA 2JMAA 4DEYA 2KNBB 2D8HA 2CSIA 2DE0X 3EG1A 2JTEA 1WXUA 2KYBA 2EYXA 1RLQC 2AKKA 2PZ1A
chains in the Genus database with same CATH superfamily
1G8XA 4DBHA 3CCRA 4F7UA 4XU1A 3O5ZA 1OQKA 4E7JA 1YJWQ 2MMPA 3MKDA 3C94A 4IUVA 3SEMA 3EGXB 4GLKA 3VS0A 3A5ZB 1ZUYA 4RCCA 2DEUA 2ZGWA 2YUPA 3OYIA 2DNUA 3EHRA 5D6WA 3CD6Q 3CCRQ 2R58A 3X25B 3EG2A 4JRKA 4RTWA 6AT1B 5KYYB 3VV0A 2R57A 1V1CA 2AHJB 2PTKA 3JCMW 1C1AA 2EGAA 4BB7A 4PJOB 3LW5E 2GBQA 3EFRA 5KCHA 4JLGA 3EFOA 1AT1B 3EGUA 4IUPA 4RTVA 2PQWA 2JNGA 2RJDA 4O6JA 4L59A 4JPBW 1VQ9A 3CPWA 1M3BA 2XDBA 2NUTB 1YP5A 1OU9A 1SSHA 2E6NA 2QEXA 4ZTJA 1VQMQ 2FHDA 3LH0A 3DLLA 1WHGA 4M7DC 3G4SA 3CCJA 4KH0B 5GAN6 2D8JA 2D0QB 4C8QB 2EJGA 5GAMd 2SRCA 2P0KA 2YWWA 1VQ9Q 4D8KA 1NZ9A 2FRWA 1TSFA 2QEXQ 3EAEA 2CP3A 3G4SQ 3CCJQ 1VOMA 2CP2A 3CXCP 3X24B 2DXTA 2F69A 5KYWB 3GNFB 2DYBA 4RCBA 2GTJA 3ZL7C 3PVQA 3NTIA 4F7UG 5GAOn 2K5IA 3C12A 4XTYA 3JCMc 3V7RA 1FMWA 3M0PA 1Q82C 4JS5A 2K4YA 3GIBA 3FLGA 2J05A 5GAN8 4BY6C 4NS5A 4N0AA 4OB3B 1VQLQ 4AG2C 4BI8B 1VQ6A 3PVLA 5IXFA 2DRMA 5J3BA 2DXBA 2KY9A 2DAQA 1OZ2A 2AZSA 2MF2A 3PE0A 3RR6A 3PIOA 4BI4A 3UATA 4AFQC 3JCMb 2A36A 3G6EA 1D3BA 2BUDA 4ZGDB 1I0CA 1KC8C 2GFAA 4OVAA 1YN8A 2JM8A 1AHJB 2H3JA 5IN1A 3VS7A 2A0FB 2CT3A 4J9EA 2YT6A 1K8AU 1AD5A 4HCCA 4XQ3A 3G6EQ 3VUZA 2X3WD 2X35A 2PNIA 3FJPA 4FYYB 2P4RA 2VWFA 3CMEA 1XTDA 3OA6A 4RTYA 2CDTA 4M7DB 5I2MA 4JJDA 1WDXA 2DRKA 4JJCA 2GQIA 5CQXA 2B86A 3CPWS 1D1CA 4NL3A 4IKFA 2BZYA 4RTXA 3KXTA 2LCCA 1I07A 4PLLA 3CMEQ 4FU6A 1LJOA 1WQ7A 4X34A 1B07A 5I2SA 1GBRA 1QMCA 1Q81R 4M75C 3OYMA 4XU2A 3H6ZA 1J3TA 5LJ5e 1LPLA 2KQWA 1VQ5T 2CP6A 3EH2A 1Y96B 3VUBA 1NPPA 5FLXE 1TS9A 1WJQA 2DLPA 2MK5A 1KHIA 2FB7A 4RG2A 3UT1A 4C92F 4BE0A 2E3HA 3I55T 5GAOm 1N5ZA 4BI3A 2L2PA 1PSFA 1IGUA 1NYFA 2KT1A 3KFVA 4OMQA 4BY6B 1NJIC 9ATCB 4J9CA 1ZSGA 2RQWA 4ESRA 4L5GA 1K9AA 4BE2A 4XU3A 3IQLA 3HRTA 3LWHA 2X51A 4PFOA 2LQNA 2RNAA 1SSFA 1HJDA 1B3QA 3PTAA 1Q81U 3OBWA 3MO8A 3CCEQ 4KBMB 2OTJT 1FYNA 3ULRB 1WPYA 2LDMA 2RH2A 3R6NA 1MMDA 2SEMA 3CCUT 1WIEA 3EG3A 1Q7YR 5FRMA 1AWXA 1WNLA 3L1AA 1H641 2MAMA 2E64A 3REAB 4PJOF 1N9RA 1UJ0A 1V76A 1Q86U 3JCMf 2JT4A 1G83A 2MWPA 2CH4W 1VQ7T 4KULA 3CCSA 4AFSC 2QQBA 2FPDA 2HCKA 3QJYA 5HKCA 1D0YA 3DKMA 5LJ5h 1JJ2A 4WF2A 5LJ3g 3MCAB 4C8QF 5LJ5j 4JJNK 3OW2A 3GP8A 2VXEA 1VQOT 2YUQA 2D6FA 4LDUA 1H8KA 2RJEA 4LXCA 2JS0A 2VC8A 3CC7Q 2WACA 3QIIA 1KQSS 2QA4T 1GCQA 2K57A 2FG0A 4M77E 2WSEE 3OYNA 1K73U 1VQPT 2C06A 1TU0B 4M75B 4CC3A 1TUGB 3JB9D 1NEGA 2LCLA 1VUBA 2CZ0B 2RHIA 1WGSA 2KE9A 1VQNQ 1RLPC 3CEYA 2JMCA 3VYHB 3H0IA 2HAXA 5CK9A 3JAME 1I5OB 2F2XA 4A4HA 1YCYA 2KROA 2LJ1A 3TCJA 2DFUA 2D0NA 1UB4A 1X43A 4CC2A 1S72T 1V29B 2EQMA 1PKSA 1VQKQ 3SD4A 3OYKA 4XK8E 3M4YA 1ZUKA 3BFMA 2RI2A 3A8OB 2P4TA 3FRNA 3VS1A 3M58A 4QW2A 2G3RA 4RTTA 5KYUA 5EC7A 1I4K1 2LNHB 3VKIA 1WA7A 2EIFA 2RQRA 1PKTA 2LVMA 5IH2A 4QQDA 1KIKA 1PM3A 5GAOl 1AWOA 3M0TA 1B7TA 1JBMA 1W2BP 4IURA 1QWEA 1YI2A 1KD1U 2DBKA 1NE8A 3UF4A 2O9SA 2RQTA 4JLIA 4CC4B 2R5AA 2DZCA 4C92D 3L2ZA 1XOVA 1VQ8A 5GAMg 2RI5A 2K79A 1XJWB 3A1PA 3OQ5A 1M8VA 2LT1A 1BI1A 1YI2Q 1PHTA 2M16A 2WSCE 3CCVT 1QCNA 3C95A 5FWCA 4B6MA 3OS2A 2HMAA 4E7ZA 2JW4A 2L89A 5HK3A 1JJ2S 1WZOA 1NYGA 3HRUA 2FVUA 3OW2S 3TEEA 3CCMT 2KNBB 4PK4A 1M1KR 1WXUA 2EYXA 2RA2A 1OX8A 4FIBA 2E1HA 2DL3A 2V8JA 3E9GA 2EGEA 3VS5A 5GAN5 4QQ6A 1BB9A 2K5LA 2XU8A 2XDPA 3P8HA 1QVFA 2NUPA 4OF1A 1KQ1A 4FCYA 4L6V5 2OTLA 2IIMA 3S3NA 1AVZC 4KUIA 2VXFA 4R0KA 4EIKA 3VU3C 4B9XA 1BI2A 1AWWA 3VS2A 4JRIA 1RUWA 2VKNA 3R6OA 3AHUA 2VUBA 2WSFE 3H8ZA 2CYZB 4ELZC 1YJNT 4KGVB 1E6HA 4F7UE 1N8RU 3G71A 1YIJT 4HA8A 4JRQA 2A37A 3PIPA 3JCMP 4X9DA 2DIQA 2M0OA 2ZPIB 3MP8A 3FC3A 4C0ZA 3FIFA 5FWBA 1WHKA 2DIGA 3QZ5B 2ZZDA 2LJ3A 5CCAA 2KDSA 2DK3A 3FDRA 1ZSZA 3OYHA 3CC2T 1HD3A 4LDYA 5I21A 1T3LA 2VGMA 1BBZA 1LVKA 2DTHA 2CSQA 2HD0A 4Z88A 4C92A 4F16A 2V1RA 4HKEA 3HL8A 1IHWA 1ZX6A 2KVQG 3EFSA 4FYVB 4J6XA 3BDUA 1PWTA 1SF9A 4TVRA 4RUGA 3M59A 4A4KA 4E7KA 1GRIA 2KMTA 4M75F 3EGXA 2DM1A 1X27A 2O2OA 2DZ9A 2NLUA 2IVWA 3S3MA 3THKA 2GGRA 1W1FA 4A63B 3OYAA 4FM4B 1PD0A 5KYYA 2ED0A 2XHCA 4M78B 1RI0A 1SKUB 3M55A 4PJOA 1U3OA 1I8FA 1IHVA 3RBBB 3M5AA 1X2QA 2Y90A 3QWYA 3CD6A 4PFPA 2QDYB 2VV5A 1VYUA 2YSQA 1BYMA 1RADB 2NUTA 4ZGEB 1SPKA 3OBYA 1X69A 3RIRA 1QCFA 1AZGB 3QYGB 1W2BA 3L2QA 1VQ5A 4C8QA 4BACA 2D9TA 3CMAT 2JXBA 5CO7A 3JCMd 1K0XA 3I55A 1FX7A 1YITA 1E6GA 3G7ZA 2COZA 2F2VA 1VQMA 2KI7A 3HKSA 4C92G 1H3ZA 2YUNA 2L3RA 5CKBA 5HCKA 3MJXA 4M7AC 3EG9B 3P8BB 1VQ5Q 1WJSA 2RJFA 2CUBA 2DVJA 4QKUA 1ZA2B 1RAHB 5KYWA 1X6OA 3OS1A 4FSSA 3I55Q 1G5VA 1YITQ 5AT1B 2K6DA 1IREB 3RKWA 2YHTA 1GFDA 2O88A 2EYWA 1QVGS 2YLBA 2LJ0A 1C0MA 1SHFA 1QLYA 2QAZA 1G2BA 2ATCB 2K2MA 3VYGA 1Q82R 5D6XA 1SHGA 1ZBJA 4PL6A 4LD9K 1CKAA 2RK1A 2OTJQ 2E10A 4E7SA 2QQ9A 3OYGA 3DLMA 4PJOG 2DVEA 1TXQA 4J9GA 1VQ7A 3JB9J 1JO8A 3CCUQ 1QVPA 3FEOA 1MNEA 2KR3A 1VQLA 1VQ4A 1D1AA 3CC4T 1UGSB 1RL2A 1NLPC 5CAIA 5CQYA 2MWOA 3VS6A 5IXBA 3OYDA 1VQ7Q 2ABLA 2ZCFB 3CCQT 5GANe 5LJ3e 1FMVA 1AEYA 4C8QG 1Y07A 1K8AR 2O4XB 1Y71A 1LOJA 2QA4A 1F1BB 1VQ4Q 1VIFA 2ECZA 2K9GA 1Q82U 2EVRA 1KG1A 5L8RE 3HP9A 3JRZA 2VASA 4IUUA 1B34B 2E6ZA 3QDFA 2G6FX 4KRTA 4M7DA 1VQOQ 1Y7XA 2I2LA 4J9HA 2OX7A 3TSWA 4PLIA 1UTIA 4MDXA 4ZTFA 2QA4Q 1C6VX 3EGDB 1JEGA 2F1LA 4C0DC 5M9OA 4M75D 4AG1C 4RTUA 5I11A 1D0ZA 1VQPQ 4DOVA 1EX4A 3E9FA 4NOYA 1EZZB 3UPUA 2EQJA 2DXUA 2X4YA 3JCMQ 2DJQA 1K9MC 1MV3A 4M7AB 4NL2A 2RM4A 4AFUC 2KGTA 1SRMA 1KQ2A 5GMKm 2EKHA 4A4GA 3V7CA 1KC8U 4OMNA 3QBYA 4F04B 3KBGA 1Y96A 4JS4A 1JXMA 1G3YA 1ARKA 1S72Q 2HZYA 2PU9B 4BD3A 1W6XA 3JV3A 1BI0A 4FW1A 2JVVA 4E2FB 1YHQT 2HL3A 2MI6A 3OMGA 5CVIA 2IPOB 1WI7A 2ZPFB 4HXJA 1NG2A 5GANh 1VIEA 3NPFA 5LJ3h 1TOVA 2CP5A 3L2RA 1YJWT 2DTIA 4VUBA 5GANj 1BK2A 5LJ3j 3GPLA 2ROTA 5FRNA 3M54A 1W70A 3QSUA 2JTFA 4IIMA 2QTXA 4GLMA 1IXDA 1A0NB 2QG9B 5GAMe 2RHXA 4D8DA 3CCVA 2H8HA 1Q86R 3CCEA 3RMSA 4M7DG 1WX6A 3OYCA 2BE7D 1UGRB 2M9UA 4P5NA 2FEIA 2V1QA 4C5EA 3JB9H 2KK4A 1ABQA 3M0QA 1U8RA 3CCMA 2E41A 3CCVQ 1NJIU 2QASA 2DL7A 5FU7C 2LQKA 4Y91A 2JUFA 3GLXA 2E4HA 1Q95G 4HT8A 3QPHA 4UC4A 2L3QA 4C0DB 2HSPA 5IAYA 3OYJA 2RQVA 2OAUA 1PD1A 3EHQA 2FO0A 4M4ZA 3UDCA 2MYSA 1M2VB 2ROLA 3CCMQ 1K73R 1S1NA 4Z8AA 2BE9B 3A98A 2XI9A 3RMQA 4M75A 3NTHA 2KRSA 4J6YA 2AKLA 4J7IA 1JRIA 3CC7A 5GAN7 3OS5A 2LRQA 2XMFA 4LD6A 1TUDA 3VJPA 2JTMA 4LDVA 1MGQA 2D8HA 2DE0X 3EG1A 1WHHA 3HPWA 2V8IA 1RLQC 3JCMX 4FL6A 1XQHA 1OU8A 3ME9A 3CXCA 4ORZA 5GAMh 1YIJA 1VQNA 2GCXA 1U1SA 1UGQB 1Q7YC 1OOTA 3HRSA 2RJCA 5D6YA 1NPRA 1PCXA 3S6WA 3N5BB 2XK0A 1M4ZA 1OPKA 5FW9A 3QO3A 1YJNQ 2JS2A 1GFCA 5GMKl 4PFZA 1GCPA 1VQKA 5LJ5f 4O5VA 1RAEB 1OEBA 1YIJQ 1WXTA 1VQ6T 1QW1A 4FT2A 1OI1A 2MOXA 1PC0A 5GMKe 3CCLT 1N9SA 2NYSA 4KT0E 2E70A 3A8LB 1Z9QA 2RO0A 3LWIA 1KD1R 1HXDA 2OJ2A 4EMHA 2CT4A 3TVTA 2X4JA 3J7AF 4J9FA 2EJ9A 4EMKC 2Y4XA 3CC2Q 4OMPA 3JCMg 4AFZC 4MMKA 2LTOA 3PNWC 4M77C 3HFNA 3BDLA 1OULA 2M1HA 4QVDA 5FU7B 4Z02A 3PMIA 2QK0A 4M75G 3META 3SWNC 2LP5A 1AWJA 1GL5A 2W10A 3I35A 1K0SA 2L8DA 4KH1B 2DETA 2ESWA 3TQ7P 2RHUA 4OB0B 4ATOA 2DL4A 2GNCA 1O9SA 4RG8A 2EYYA 1TH7A 1VYTA 2JM9A 3HSBA 1JU5C 2QTVA 1G3TA 5A0GA 1M30A 1ABOA 1HYOA 4ZGJB 3F70A 1OYXA 2E3IA 2HQXA 4M7DF 3J80E 1TTHB 2ZPHB 5IHIA 3OYBA 3RESA 2KRMA 1U1TA 2J6FA 1UHCA 2OI3A 1M5Q1 4DQ2A 2D1XA 3CMAA 1BI3A 1DJ7B 3PGGA 4EMKA 5GMKh 3UA7A 1ZA1B 2KRNA 3MEVA 3OSVA 1YJ9T 2QDLA 2VVKA 4LDWA 5GMKj 3M9QA 3DB3A 4C92E 3MP6A 3INZA 3M0UA 3CPWP 1NBEB 2PVGB 3CMAQ 4J9BA 4PJOD 4OGCA 2VGNA 2RHYA 1N8RR 2EW3A 2P0QA 2ZPGB 4M78C 3V7SA 4QT7A 2RPNA 5KH6A 4OB1B 3V8KA 1KHCA 1K1ZA 2FL7A 4XTUA 3U23A 1UEBA 4Z89A 1X6BA 4DBQA 4HVUA 4EMKB 2CKKA 4R55A 1PRMC 1JB0E 3I5SA 1IB8A 3M57A 2PVOB 2F5TX 1VYVA 2XKOC 5C0MA 4C8QD 2K7AA 4M77B 4PJOE 1M90C 1FXXA 5AYFA 4E47A 2HNIA 3OB9A 3SWNB 1M1KC 1OV3A 3CCST 2IG0A 4JZ3A 2HEQA 3OMCA 1AZEA 2DILA 2JZ2A 3SFMA 3RUXA 4C8QE 3I56T 2P84A 3V8LA 1FMKA 2EFIA 1M8MA 4XTWA 2AT1B 4J9IA 4OMMA 4E7HA 2ENMA 1TUCA 5KYXB 4AT1B 4BE1A 4M78A 1QQJA 3E2UA 3NTKA 4KUDK 3OSSC 3CCQQ 4FYWB 4WCIA 4X9CA 5HK0A 2GTOA 3WVEB 2E65A 1WHLA 4BUGA 4CC7A 3OY9A 3LYIA 4OMLA 3OYLA 5GAN3 3VRZA 4EMGA 4FW2A 2HSEB 2AK5A 1MNDA 2JN0A 2LX7A 2ZPBB 2YRCA 4ANJA 4LUDA 1CSKA 4C5GA 1KQSP 2DD4A 1BIAA 5GAN2 1UFFA 1MMNA 3TSZA 4A4EA 4RKUE 4BDYA 1PNJA 1PG5B 1M9SA 4OGEA 4QVCA 3M4GA 3OS0A 2DJZA 1EIFA 1X6GA 1IGQA 3A8GB 3EG9A 1R8OB 1YNZA 3L2VA 1O75A 3S3OA 4LDXA 4FSXA 4M7DD 4C0FA 1QVFS 1UHFA 2FZCB 2J6OA 1R0CB 3SB2A 3J81E 3PMTA 4LUEA 3OYFA 1JQQA 1YHQQ 2E12A 2VYTA 7AT1B 4MZPA 1WFWA 1VQ8T 2QQAA 3O8VA 2X9HA 2XIDA 3LX7A 4QQGA 4MZMA 3JCMV 4M7DE 2M0YA 4GY5A 4M78G 4XTZA 4PJJA 3TREA 2CS7A 2B8AA 1BKBA 1WJRA 2LQWA 3C0CA 4KGXB 2HDAA 4PJNA 2COWA 1HSQA 3T9NA 2EJFA 5IHKA 4CI0C 2OTJA 4D6WA 4N0AC 3CCUA 2DYIA 2K3YA 2J6KA 4F7UB 1M2OA 2O4XA 2FZGB 3EH1A 1WYXA 1Z9ZA 5LJ5d 1MUZA 2YRVA 2E5KA 1M1FA 1T3SA 1GXIE 2K2VA 1B34A 5GJWB 2EQKA 1ZLMA 2OTLT 2DMOA 4EDUA 2YXYA 1NEBA 1OZ3A 3GOXA 4LNPA 1LNXA 3ASKA 3JSCA 1JJ2P 3D7SB 3EGDA 4X1VA 3RKXA 5A0DA 3OW2P 2GF7A 2RD1A 5ECAA 4ZNXA 1PSEA 1YCSB 3EFOB 2EBPA 1VQOA 4M7AA 2O9VA 2MPXC 3H9NA 3I9QA 3G1JA 5GJVB 1KC8R 2Y4YA 4Y92A 2HQEA 2LNVA 4M77F 3G71T 3P8DA 1K9MR 1VQPA 2CZ1B 2EYQA 1YFNA 2KEAA 1WHJA 2AZVA 1OPLA 3M0SA 4IIOA 1ZUUA 2DPPB 2RHZA 2OAWA 2LQ8A 2K3BA 5A2QE 2YLCA 2HL5C 3ZBDA 3E1SA 3V8JA 4PJMA 2DERA 1XNIA 1G3SA 2CP0A 3VS4A 2L5QA 1T0JA 1M1GA 3CCLA 1W2BS 1I1JA 2JMAA 4E7LA 2CGHA 1S72A 2KYBA 2QI2A 2HKQB 2AKKA 3X26B 3JB9I 4Y28E 1X01A 3ER0A 3PT9A 3HFOA 3JB9F 2RMOA 1VQ6Q 2F5KA 4HVWA 4GBQA 1K8AC 3CCLQ 1K9MU 4DBRA 5CIUA 2RB6A 1QKWA 2MIOA 2V26A 3JCMe 2CZ6B 4M75E 2L0AA 1ZHIA 4OMOA 3HTRA 2F2WA 2AIRB 3GF5A 5I22A 3BW1A 1Y57A 2L3SA 1WLPB 4J5YA 1KQSA 3L42A 3NMZC 4HVVA 4JZ4A 2QGFB 1NJIR 5J39A 3DB4A 1WHMA 3QHSA 4M7AG 2LMJA 1IRXA 1D3BB 4FYXB 3M56A 2FRYA 2V8KA 3X20B 3CCRT 3CD6T 2CUDA 4PNOA 4M78F 2CZ7B 1NM7A 2NWMA 2KBTA 1YWOA 1M2VA 3UA6A 1UGPB 2EQIA 1R0BG 2QXFA 2EGCA 2M02A 4ME7A 4DBFA 2COYA 4XTVA 5GANf 5LJ3f 2DL5A 1GBQA 2C0TA 3BE3A 1YJ9A 4OP0A 5HY6A 5D7UA 4XAXB 1P92A 2RQUA 1YITT 4N4GA 1X75C 1VQMT 5KYNA 1WXBA 1Q81C 1HK9A 2DD5A 1YJ9Q 2LCSA 3JCMh 1QVFP 1GCQC 1RABB 3EG0A 1VQ9T 3CPFA 4J8OA 1R77A 4AMCA 8ATCB 2EYZA 2LX9A 5EG2A 2ZAEA 2EWNA 2QEXT 1K76A 2GFUA 3WVDB 3G4ST 2JOYA 1QP3A 3CCJT 2XDDA 3QZ9B 2A7YA 2BKDN 4LE9A 1Q86C 2H3EB 3HHTB 1QWFA 4II1A 1RI9A 5A0LA 2EAYA 4MZTA 2W0ZA 1M3CA 5KE3A 1RACB 1H3HA 2HKNA 4BDZA 1YJNA 2CREA 2VB6A 2YUOA 1QCOA 3VS3A 4F7UF 4M77D 4WTOB 3LH5A 1TG0A 4OB2B 2DL8A 2QQRA 5CKHA 1VQLT 1VQ4T 3NHNA 4HCKA 5GAMj 2YDLA 3UWNA 5GANg 2BZ8A 3BY7A 3GBQA 5FROA 1SRLA 1QVGP 3I56A 4IUQA 1VA7A 3QYHB 3OYEA 2PVDB 1BCMA 2L3PA 3ZFJA 4MDWA 1K73C 1ZBXA 1W4SA 1SEMA 3CQTA 5CKEA 2PUOB 5GAN4 3FB9A 1WQWA 1Q7YU 3CCSQ 1H92A 4MMLA 3CC2A 3QXEB 5CR2A 3RERA 2DTOA 2FPFA 3SHWA 2DKGA 3WXMB 3RDVA 1M27C 3MEUA 1D09B 3A8HB 2A3LA 5GAMf 1FWZA 2A28A 4HCZA 3I56Q 2J7IA 1RAIB 3URGA 1UG1A 3QDRB 1ZQ1A 4A53A 5FU6C 2RF0A 1K4US 2JJ9A 1I5LA 1M3AA 3QUIA 3KUFA 1AOJA 1MHNA 3JCMJ 5CKFA 2BIVA 2DEQA 3G6ET 4C0GA 2X3XD 3A8MB 1G3WA 4PJLA 4XTXA 2HBWA 4E7IA 3MPUB 3M0RA 1RAGB 1YBYA 3CBMA 2DXCA 2HBPA 2CH4A 3QKJA 1Y0MA 4FT4A 2M51A 1EFNA 2RK2A 5DM7R 3CMET 4A4FA 2EKOA 4M7AF 3MHXA 2R5MA 3AT1B 3M53A 2O31A 3NFCA 2DBMA 3LLRA 4RTZA 3REBB 2C0IA 4IUTA 1TWBA 2E5QA 4LN2A 4M78D 1KD1C 4HT9A 8AT1B 1U5SA 3LGFA 4N4IA 4QVZA 5LJ5g 2DX1A 1I81A 4F17A 4PKCC 1N27A 2KAFA 2LT4A 2X4XA 4N4HA 1UDLA 5IHNA 3Q1JA 3LGLA 2RN8A 4J9DA 4RMOA 2A08A 1RAAB 2ED1A 4M78E 4JJBA 4M77A 3ZEHA 4B9WA 3L2WA 2LC4A 5KCOA 4JUVA 1UE9A 1SG5A 1N6AA 5LL6S 3CXCS 3L2UA 3CCET 5KYUB 3SWNA 3MEAA 1VQ8Q 3H41A 1D0XA 1IZ6A 4OMFB 1KJWA 2QQSA 4KGZB 1M90R 1YWPA 4A54A 4V2SA 4HCBA 1MV0B 3CBPA 5FU6B 1MMAA 2EQUA 4K11A 3QG1A 1ZSZC 2BZXA 1U06A 2FPEA 3SDZA 1BCOA 2KT8A 3OYYA 4J83A 2CP7A 4C92C 4F14A 1KSWA 5KYXA 1ACMB 5IT9E 1NLOC 4J6WA 1QKXA 5L23A 2C0OA 3X28B 1JXOA 3QWXX 2HQHA 3CC4A 3CC7T 1M90U 1UGVA 3VRYA 1N8RC 2X4WA 3CBOA 5CKDA 2OTLQ 1M1KU 5C6SA 3CCQA 2XD0A 3MEWA 1BU1A 2MCNA 2QGGA 4C5HA 1CKBA 4ELYC 1QP2A 4XU0A 4DA4A 2LZ6B 5GAOr 4DOWA 3CC4Q 1VQNT 4E6RA 2DA9A 4JRPA 2NUPB 1RAFB 4M77G 4PJOC 4C5IA 3TU4K 1UJYA 3RKYA 3I5RA 2KXCA 1T0HA 3FJ5A 3PFSA 3H0HA 5DLQE 1QVGA 2Z0WA 1VQKT 2DF6A 1IO6A 1MMGA 5GMKi 3G71Q 2FZKB 3NGPA 3H0FA 4R56A 4YTLA 1UECA 5J26A 4Q5WA 4DEXA 1E7OA 3C4SA 4JDSA 1KK7A 5DY9A 4C8QC 1OX9A 2KYMA 3GNGA 4J7FA 1D1BA 4ZN1A 2PUKB 4M7AD 1UUEA 3JB9G 2XG8D 2QYZA 5GANd 5LJ3d 1X2KA 1LCKA 2J06A 2I0NA 1PRLC 2KXDA 5KE2A 2BTTA 2NUZA 5GAOq 4ZN3A 2P0PA 2XICA 1ZSZB 1YHQA 2YRDA 3QJ6A 2ZPEB 2EPDA 2RI3A 3RNJA 4EPCA 4C92B 1BIBA 1KFZA 5DLOA 2O01E 1YJWA 4DEYA 2K5FA 4CRIA 3MP1A 2FYKA 2CSIA 4M7AE 2JTEA 5GAOp 2GQVA 2KSSA 1YI2T 3E19A 2K3XA 2PZ1A 2DO3A
chains in the Genus database with same CATH topology
4ORZA 2DL3A 2RMOA 2EGEA 4HVWA 3VS5A 4GBQA 1BB9A 3O5ZA 1OOTA 1OPKA 1QKWA 5FW9A 2MIOA 3SEMA 2JS2A 2IIMA 3VS0A 1AVZC 1ZUYA 2L0AA 4OMOA 1GFCA 4R0KA 2F2WA 2YUPA 4EIKA 1GCPA 2DNUA 3EHRA 1OEBA 5I22A 3EG2A 4RTWA 1WXTA 1Y57A 2L3SA 1AWWA 1V1CA 3VS2A 2PTKA 1RUWA 1WLPB 2VKNA 2MOXA 2EGAA 3NMZC 4HVVA 4JZ4A 2GBQA 1Z9QA 3EGUA 4RTVA 2OJ2A 2CT4A 2LMJA 3TVTA 1E6HA 4J9FA 4JPBW 4OMPA 4AFZC 2FRYA 1M3BA 2A37A 2CUDA 1YP5A 1NM7A 2NWMA 1SSHA 2KBTA 1YWOA 3UA6A 2EQIA 2EGCA 2D8JA 5FWBA 2LP5A 1AWJA 1GL5A 2LJ3A 2DL5A 2SRCA 1GBQA 2C0TA 2W10A 3I35A 1K0SA 4D8KA 1HD3A 2FRWA 1T3LA 1BBZA 2RQUA 2ESWA 2CSQA 4Z88A 4F16A 2DL4A 2V1RA 2GNCA 2EYYA 1ZX6A 1WXBA 1VYTA 2JM9A 1JU5C 2DYBA 2GTJA 3ZL7C 2LCSA 1M30A 1ABOA 1PWTA 3PVQA 1GCQC 3EG0A 4RUGA 2EYZA 1GRIA 5IHIA 3M0PA 2KRMA 1K76A 2J6FA 2DM1A 1X27A 2J05A 2O2OA 1UHCA 2OI3A 4LE9A 2D1XA 1QWFA 3THKA 2GGRA 1RI9A 1W1FA 4A63B 4AG2C 3UA7A 3PVLA 2KRNA 5IXFA 2DRMA 2QDLA 2VVKA 2W0ZA 2ED0A 1M3CA 1H3HA 1U3OA 2AZSA 2CREA 2YUOA 3M0UA 3RBBB 3PE0A 3VS3A 1X2QA 3QWYA 3UATA 3LH5A 4J9BA 4AFQC 1TG0A 2A36A 2DL8A 1VYUA 2EW3A 2YSQA 3NHNA 4HCKA 2YDLA 1I0CA 1SPKA 1YN8A 2BZ8A 4QT7A 2RPNA 2JM8A 3GBQA 1X69A 1SRLA 1VA7A 2L3PA 1QCFA 1AZGB 1K1ZA 3VS7A 1SEMA 2CT3A 4J9EA 3CQTA 3U23A 4Z89A 2YT6A 1X6BA 1AD5A 4HVUA 1PRMC 1H92A 2JXBA 3I5SA 1K0XA 2X3WD 1VYVA 2FPFA 2PNIA 3SHWA 1E6GA 2P4RA 2K7AA 2VWFA 1M27C 4RTYA 2F2VA 2CDTA 4JJDA 2A28A 2YUNA 2J7IA 1WDXA 5HCKA 2DRKA 1UG1A 4JJCA 2GQIA 2B86A 2RF0A 1K4US 2CUBA 2DVJA 1M3AA 2BZYA 4RTXA 1AOJA 1OV3A 4FSSA 4JZ3A 1I07A 2X3XD 2HEQA 2K6DA 1AZEA 1B07A 2DILA 2HBWA 1GFDA 2O88A 1GBRA 2EYWA 3M0RA 2LJ0A 1J3TA 1SHFA 1QLYA 1FMKA 1G2BA 1M8MA 2CH4A 1Y0MA 2K2MA 2DLPA 2M51A 4J9IA 4OMMA 1EFNA 2ENMA 1TUCA 1SHGA 1ZBJA 1N5ZA 1CKAA 2L2PA 1NYFA 2O31A 4J9GA 2KT1A 3KFVA 2DBMA 4OMQA 4WCIA 1JO8A 4RTZA 3REBB 2C0IA 2GTOA 4J9CA 1ZSGA 2KR3A 2RQWA 4ESRA 4LN2A 4CC7A 1K9AA 4OMLA 1U5SA 3VRZA 3IQLA 1NLPC 2LQNA 2RNAA 2AK5A 1HJDA 1B3QA 2DX1A 3VS6A 5IXBA 1FYNA 2LX7A 3ULRB 2ABLA 4F17A 3R6NA 1AEYA 4LUDA 1CSKA 2SEMA 1WIEA 1UDLA 3EG3A 5IHNA 1AWXA 2RN8A 2ECZA 4J9DA 2K9GA 2A08A 2EVRA 1UFFA 2ED1A 3TSZA 3REAB 4JJBA 1UJ0A 1PNJA 2G6FX 4KRTA 2JT4A 1G83A 1UE9A 1X6GA 4J9HA 1YNZA 2CH4W 3TSWA 1UTIA 3H41A 1JEGA 4AFSC 2FPDA 1KJWA 2HCKA 4AG1C 1UHFA 4RTUA 5I11A 1YWPA 2J6OA 2DJQA 1MV3A 1MV0B 4AFUC 2KGTA 1SRMA 4LUEA 2YUQA 4K11A 1H8KA 2EKHA 1JQQA 4OMNA 1WFWA 2JS0A 2BZXA 1U06A 2FPEA 1GCQA 1JXMA 2KT8A 2FG0A 4F14A 1KSWA 2M0YA 1NLOC 1QKXA 4CC3A 1ARKA 1NEGA 5L23A 2C0OA 1JXOA 3QWXX 1W6XA 2LQWA 3JV3A 2KE9A 3C0CA 1RLPC 2HDAA 1HSQA 2JMCA 3H0IA 1WI7A 4HXJA 1UGVA 1NG2A 5IHKA 3VRYA 3NPFA 2F2XA 2KROA 2LJ1A 1BK2A 2D0NA 2ROTA 1X43A 1BU1A 4CC2A 2MCNA 1W70A 1CKBA 1PKSA 2J6KA 4IIMA 1ZUKA 2LZ6B 4GLMA 1A0NB 4E6RA 1WYXA 1Z9ZA 2DA9A 1MUZA 2E5KA 3VS1A 1T3SA 4D8DA 5GJWB 1UJYA 2H8HA 3I5RA 1WX6A 1ZLMA 2KXCA 1T0HA 2DMOA 3FJ5A 3H0HA 4RTTA 5EC7A 1NEBA 2LNHB 2FEIA 4LNPA 2DF6A 1IO6A 1WA7A 2V1QA 2RQRA 1PKTA 3NGPA 5IH2A 3H0FA 1KIKA 4X1VA 1UECA 1AWOA 3M0TA 1ABQA 3M0QA 4DEXA 1E7OA 5ECAA 4ZNXA 1QWEA 1YCSB 2EBPA 2DBKA 2DL7A 3UF4A 2O9SA 2RQTA 4CC4B 2O9VA 2KYMA 3I9QA 1XOVA 5GJVB 2L3QA 2HSPA 2RQVA 4Y92A 1UUEA 3EHQA 2K79A 2FO0A 4M4ZA 1X2KA 2KEAA 2AZVA 2ROLA 1OPLA 3M0SA 4IIOA 1ZUUA 1LCKA 1S1NA 2J06A 4Z8AA 2OAWA 1PHTA 3A98A 2I0NA 5FWCA 1PRLC 2KXDA 2K3BA 2JW4A 2KRSA 2BTTA 2NUZA 2AKLA 3VS4A 2EPDA 1T0JA 2XMFA 3RNJA 1NYGA 1TUDA 1KFZA 1I1JA 2JMAA 4DEYA 2KNBB 2D8HA 2CSIA 2DE0X 3EG1A 2JTEA 1WXUA 2KYBA 2EYXA 1RLQC 2AKKA 2PZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORZ A;  2DL3 A;  2RMO A;  2EGE A;  4HVW A;  3VS5 A;  4GBQ A;  1BB9 A;  3O5Z A;  1OOT A;  1OPK A;  1QKW A;  5FW9 A;  2MIO A;  3SEM A;  2JS2 A;  2IIM A;  3VS0 A;  1AVZ C;  1ZUY A;  2L0A A;  4OMO A;  1GFC A;  4R0K A;  2F2W A;  2YUP A;  4EIK A;  1GCP A;  2DNU A;  3EHR A;  1OEB A;  5I22 A;  3EG2 A;  4RTW A;  1WXT A;  1Y57 A;  2L3S A;  1AWW A;  1V1C A;  3VS2 A;  2PTK A;  1RUW A;  1WLP B;  2VKN A;  2MOX A;  2EGA A;  3NMZ C;  4HVV A;  4JZ4 A;  2GBQ A;  1Z9Q A;  3EGU A;  4RTV A;  2OJ2 A;  2CT4 A;  2LMJ A;  3TVT A;  1E6H A;  4J9F A;  4JPB W;  4OMP A;  4AFZ C;  2FRY A;  1M3B A;  2A37 A;  2CUD A;  1YP5 A;  1NM7 A;  2NWM A;  1SSH A;  2KBT A;  1YWO A;  3UA6 A;  2EQI A;  2EGC A;  2D8J A;  5FWB A;  2LP5 A;  1AWJ A;  1GL5 A;  2LJ3 A;  2DL5 A;  2SRC A;  1GBQ A;  2C0T A;  2W10 A;  3I35 A;  1K0S A;  4D8K A;  1HD3 A;  2FRW A;  1T3L A;  1BBZ A;  2RQU A;  2ESW A;  2CSQ A;  4Z88 A;  4F16 A;  2DL4 A;  2V1R A;  2GNC A;  2EYY A;  1ZX6 A;  1WXB A;  1VYT A;  2JM9 A;  1JU5 C;  2DYB A;  2GTJ A;  3ZL7 C;  2LCS A;  1M30 A;  1ABO A;  1PWT A;  3PVQ A;  1GCQ C;  3EG0 A;  4RUG A;  2EYZ A;  1GRI A;  5IHI A;  3M0P A;  2KRM A;  1K76 A;  2J6F A;  2DM1 A;  1X27 A;  2J05 A;  2O2O A;  1UHC A;  2OI3 A;  4LE9 A;  2D1X A;  1QWF A;  3THK A;  2GGR A;  1RI9 A;  1W1F A;  4A63 B;  4AG2 C;  3UA7 A;  3PVL A;  2KRN A;  5IXF A;  2DRM A;  2QDL A;  2VVK A;  2W0Z A;  2ED0 A;  1M3C A;  1H3H A;  1U3O A;  2AZS A;  2CRE A;  2YUO A;  3M0U A;  3RBB B;  3PE0 A;  3VS3 A;  1X2Q A;  3QWY A;  3UAT A;  3LH5 A;  4J9B A;  4AFQ C;  1TG0 A;  2A36 A;  2DL8 A;  1VYU A;  2EW3 A;  2YSQ A;  3NHN A;  4HCK A;  2YDL A;  1I0C A;  1SPK A;  1YN8 A;  2BZ8 A;  4QT7 A;  2RPN A;  2JM8 A;  3GBQ A;  1X69 A;  1SRL A;  1VA7 A;  2L3P A;  1QCF A;  1AZG B;  1K1Z A;  3VS7 A;  1SEM A;  2CT3 A;  4J9E A;  3CQT A;  3U23 A;  4Z89 A;  2YT6 A;  1X6B A;  1AD5 A;  4HVU A;  1PRM C;  1H92 A;  2JXB A;  3I5S A;  1K0X A;  2X3W D;  1VYV A;  2FPF A;  2PNI A;  3SHW A;  1E6G A;  2P4R A;  2K7A A;  2VWF A;  1M27 C;  4RTY A;  2F2V A;  2CDT A;  4JJD A;  2A28 A;  2YUN A;  2J7I A;  1WDX A;  5HCK A;  2DRK A;  1UG1 A;  4JJC A;  2GQI A;  2B86 A;  2RF0 A;  1K4U S;  2CUB A;  2DVJ A;  1M3A A;  2BZY A;  4RTX A;  1AOJ A;  1OV3 A;  4FSS A;  4JZ3 A;  1I07 A;  2X3X D;  2HEQ A;  2K6D A;  1AZE A;  1B07 A;  2DIL A;  2HBW A;  1GFD A;  2O88 A;  1GBR A;  2EYW A;  3M0R A;  2LJ0 A;  1J3T A;  1SHF A;  1QLY A;  1FMK A;  1G2B A;  1M8M A;  2CH4 A;  1Y0M A;  2K2M A;  2DLP A;  2M51 A;  4J9I A;  4OMM A;  1EFN A;  2ENM A;  1TUC A;  1SHG A;  1ZBJ A;  1N5Z A;  1CKA A;  2L2P A;  1NYF A;  2O31 A;  4J9G A;  2KT1 A;  3KFV A;  2DBM A;  4OMQ A;  4WCI A;  1JO8 A;  4RTZ A;  3REB B;  2C0I A;  2GTO A;  4J9C A;  1ZSG A;  2KR3 A;  2RQW A;  4ESR A;  4LN2 A;  4CC7 A;  1K9A A;  4OML A;  1U5S A;  3VRZ A;  3IQL A;  1NLP C;  2LQN A;  2RNA A;  2AK5 A;  1HJD A;  1B3Q A;  2DX1 A;  3VS6 A;  5IXB A;  1FYN A;  2LX7 A;  3ULR B;  2ABL A;  4F17 A;  3R6N A;  1AEY A;  4LUD A;  1CSK A;  2SEM A;  1WIE A;  1UDL A;  3EG3 A;  5IHN A;  1AWX A;  2RN8 A;  2ECZ A;  4J9D A;  2K9G A;  2A08 A;  2EVR A;  1UFF A;  2ED1 A;  3TSZ A;  3REA B;  4JJB A;  1UJ0 A;  1PNJ A;  2G6F X;  4KRT A;  2JT4 A;  1G83 A;  1UE9 A;  1X6G A;  4J9H A;  1YNZ A;  2CH4 W;  3TSW A;  1UTI A;  3H41 A;  1JEG A;  4AFS C;  2FPD A;  1KJW A;  2HCK A;  4AG1 C;  1UHF A;  4RTU A;  5I11 A;  1YWP A;  2J6O A;  2DJQ A;  1MV3 A;  1MV0 B;  4AFU C;  2KGT A;  1SRM A;  4LUE A;  2YUQ A;  4K11 A;  1H8K A;  2EKH A;  1JQQ A;  4OMN A;  1WFW A;  2JS0 A;  2BZX A;  1U06 A;  2FPE A;  1GCQ A;  1JXM A;  2KT8 A;  2FG0 A;  4F14 A;  1KSW A;  2M0Y A;  1NLO C;  1QKX A;  4CC3 A;  1ARK A;  1NEG A;  5L23 A;  2C0O A;  1JXO A;  3QWX X;  1W6X A;  2LQW A;  3JV3 A;  2KE9 A;  3C0C A;  1RLP C;  2HDA A;  1HSQ A;  2JMC A;  3H0I A;  1WI7 A;  4HXJ A;  1UGV A;  1NG2 A;  5IHK A;  3VRY A;  3NPF A;  2F2X A;  2KRO A;  2LJ1 A;  1BK2 A;  2D0N A;  2ROT A;  1X43 A;  1BU1 A;  4CC2 A;  2MCN A;  1W70 A;  1CKB A;  1PKS A;  2J6K A;  4IIM A;  1ZUK A;  2LZ6 B;  4GLM A;  1A0N B;  4E6R A;  1WYX A;  1Z9Z A;  2DA9 A;  1MUZ A;  2E5K A;  3VS1 A;  1T3S A;  4D8D A;  5GJW B;  1UJY A;  2H8H A;  3I5R A;  1WX6 A;  1ZLM A;  2KXC A;  1T0H A;  2DMO A;  3FJ5 A;  3H0H A;  4RTT A;  5EC7 A;  1NEB A;  2LNH B;  2FEI A;  4LNP A;  2DF6 A;  1IO6 A;  1WA7 A;  2V1Q A;  2RQR A;  1PKT A;  3NGP A;  5IH2 A;  3H0F A;  1KIK A;  4X1V A;  1UEC A;  1AWO A;  3M0T A;  1ABQ A;  3M0Q A;  4DEX A;  1E7O A;  5ECA A;  4ZNX A;  1QWE A;  1YCS B;  2EBP A;  2DBK A;  2DL7 A;  3UF4 A;  2O9S A;  2RQT A;  4CC4 B;  2O9V A;  2KYM A;  3I9Q A;  1XOV A;  5GJV B;  2L3Q A;  2HSP A;  2RQV A;  4Y92 A;  1UUE A;  3EHQ A;  2K79 A;  2FO0 A;  4M4Z A;  1X2K A;  2KEA A;  2AZV A;  2ROL A;  1OPL A;  3M0S A;  4IIO A;  1ZUU A;  1LCK A;  1S1N A;  2J06 A;  4Z8A A;  2OAW A;  1PHT A;  3A98 A;  2I0N A;  5FWC A;  1PRL C;  2KXD A;  2K3B A;  2JW4 A;  2KRS A;  2BTT A;  2NUZ A;  2AKL A;  3VS4 A;  2EPD A;  1T0J A;  2XMF A;  3RNJ A;  1NYG A;  1TUD A;  1KFZ A;  1I1J A;  2JMA A;  4DEY A;  2KNB B;  2D8H A;  2CSI A;  2DE0 X;  3EG1 A;  2JTE A;  1WXU A;  2KYB A;  2EYX A;  1RLQ C;  2AKK A;  2PZ1 A; 
#chains in the Genus database with same CATH topology
 1G8X A;  4DBH A;  3CCR A;  4F7U A;  4XU1 A;  3O5Z A;  1OQK A;  4E7J A;  1YJW Q;  2MMP A;  3MKD A;  3C94 A;  4IUV A;  3SEM A;  3EGX B;  4GLK A;  3VS0 A;  3A5Z B;  1ZUY A;  4RCC A;  2DEU A;  2ZGW A;  2YUP A;  3OYI A;  2DNU A;  3EHR A;  5D6W A;  3CD6 Q;  3CCR Q;  2R58 A;  3X25 B;  3EG2 A;  4JRK A;  4RTW A;  6AT1 B;  5KYY B;  3VV0 A;  2R57 A;  1V1C A;  2AHJ B;  2PTK A;  3JCM W;  1C1A A;  2EGA A;  4BB7 A;  4PJO B;  3LW5 E;  2GBQ A;  3EFR A;  5KCH A;  4JLG A;  3EFO A;  1AT1 B;  3EGU A;  4IUP A;  4RTV A;  2PQW A;  2JNG A;  2RJD A;  4O6J A;  4L59 A;  4JPB W;  1VQ9 A;  3CPW A;  1M3B A;  2XDB A;  2NUT B;  1YP5 A;  1OU9 A;  1SSH A;  2E6N A;  2QEX A;  4ZTJ A;  1VQM Q;  2FHD A;  3LH0 A;  3DLL A;  1WHG A;  4M7D C;  3G4S A;  3CCJ A;  4KH0 B;  5GAN 6;  2D8J A;  2D0Q B;  4C8Q B;  2EJG A;  5GAM d;  2SRC A;  2P0K A;  2YWW A;  1VQ9 Q;  4D8K A;  1NZ9 A;  2FRW A;  1TSF A;  2QEX Q;  3EAE A;  2CP3 A;  3G4S Q;  3CCJ Q;  1VOM A;  2CP2 A;  3CXC P;  3X24 B;  2DXT A;  2F69 A;  5KYW B;  3GNF B;  2DYB A;  4RCB A;  2GTJ A;  3ZL7 C;  3PVQ A;  3NTI A;  4F7U G;  5GAO n;  2K5I A;  3C12 A;  4XTY A;  3JCM c;  3V7R A;  1FMW A;  3M0P A;  1Q82 C;  4JS5 A;  2K4Y A;  3GIB A;  3FLG A;  2J05 A;  5GAN 8;  4BY6 C;  4NS5 A;  4N0A A;  4OB3 B;  1VQL Q;  4AG2 C;  4BI8 B;  1VQ6 A;  3PVL A;  5IXF A;  2DRM A;  5J3B A;  2DXB A;  2KY9 A;  2DAQ A;  1OZ2 A;  2AZS A;  2MF2 A;  3PE0 A;  3RR6 A;  3PIO A;  4BI4 A;  3UAT A;  4AFQ C;  3JCM b;  2A36 A;  3G6E A;  1D3B A;  2BUD A;  4ZGD B;  1I0C A;  1KC8 C;  2GFA A;  4OVA A;  1YN8 A;  2JM8 A;  1AHJ B;  2H3J A;  5IN1 A;  3VS7 A;  2A0F B;  2CT3 A;  4J9E A;  2YT6 A;  1K8A U;  1AD5 A;  4HCC A;  4XQ3 A;  3G6E Q;  3VUZ A;  2X3W D;  2X35 A;  2PNI A;  3FJP A;  4FYY B;  2P4R A;  2VWF A;  3CME A;  1XTD A;  3OA6 A;  4RTY A;  2CDT A;  4M7D B;  5I2M A;  4JJD A;  1WDX A;  2DRK A;  4JJC A;  2GQI A;  5CQX A;  2B86 A;  3CPW S;  1D1C A;  4NL3 A;  4IKF A;  2BZY A;  4RTX A;  3KXT A;  2LCC A;  1I07 A;  4PLL A;  3CME Q;  4FU6 A;  1LJO A;  1WQ7 A;  4X34 A;  1B07 A;  5I2S A;  1GBR A;  1QMC A;  1Q81 R;  4M75 C;  3OYM A;  4XU2 A;  3H6Z A;  1J3T A;  5LJ5 e;  1LPL A;  2KQW A;  1VQ5 T;  2CP6 A;  3EH2 A;  1Y96 B;  3VUB A;  1NPP A;  5FLX E;  1TS9 A;  1WJQ A;  2DLP A;  2MK5 A;  1KHI A;  2FB7 A;  4RG2 A;  3UT1 A;  4C92 F;  4BE0 A;  2E3H A;  3I55 T;  5GAO m;  1N5Z A;  4BI3 A;  2L2P A;  1PSF A;  1IGU A;  1NYF A;  2KT1 A;  3KFV A;  4OMQ A;  4BY6 B;  1NJI C;  9ATC B;  4J9C A;  1ZSG A;  2RQW A;  4ESR A;  4L5G A;  1K9A A;  4BE2 A;  4XU3 A;  3IQL A;  3HRT A;  3LWH A;  2X51 A;  4PFO A;  2LQN A;  2RNA A;  1SSF A;  1HJD A;  1B3Q A;  3PTA A;  1Q81 U;  3OBW A;  3MO8 A;  3CCE Q;  4KBM B;  2OTJ T;  1FYN A;  3ULR B;  1WPY A;  2LDM A;  2RH2 A;  3R6N A;  1MMD A;  2SEM A;  3CCU T;  1WIE A;  3EG3 A;  1Q7Y R;  5FRM A;  1AWX A;  1WNL A;  3L1A A;  1H64 1;  2MAM A;  2E64 A;  3REA B;  4PJO F;  1N9R A;  1UJ0 A;  1V76 A;  1Q86 U;  3JCM f;  2JT4 A;  1G83 A;  2MWP A;  2CH4 W;  1VQ7 T;  4KUL A;  3CCS A;  4AFS C;  2QQB A;  2FPD A;  2HCK A;  3QJY A;  5HKC A;  1D0Y A;  3DKM A;  5LJ5 h;  1JJ2 A;  4WF2 A;  5LJ3 g;  3MCA B;  4C8Q F;  5LJ5 j;  4JJN K;  3OW2 A;  3GP8 A;  2VXE A;  1VQO T;  2YUQ A;  2D6F A;  4LDU A;  1H8K A;  2RJE A;  4LXC A;  2JS0 A;  2VC8 A;  3CC7 Q;  2WAC A;  3QII A;  1KQS S;  2QA4 T;  1GCQ A;  2K57 A;  2FG0 A;  4M77 E;  2WSE E;  3OYN A;  1K73 U;  1VQP T;  2C06 A;  1TU0 B;  4M75 B;  4CC3 A;  1TUG B;  3JB9 D;  1NEG A;  2LCL A;  1VUB A;  2CZ0 B;  2RHI A;  1WGS A;  2KE9 A;  1VQN Q;  1RLP C;  3CEY A;  2JMC A;  3VYH B;  3H0I A;  2HAX A;  5CK9 A;  3JAM E;  1I5O B;  2F2X A;  4A4H A;  1YCY A;  2KRO A;  2LJ1 A;  3TCJ A;  2DFU A;  2D0N A;  1UB4 A;  1X43 A;  4CC2 A;  1S72 T;  1V29 B;  2EQM A;  1PKS A;  1VQK Q;  3SD4 A;  3OYK A;  4XK8 E;  3M4Y A;  1ZUK A;  3BFM A;  2RI2 A;  3A8O B;  2P4T A;  3FRN A;  3VS1 A;  3M58 A;  4QW2 A;  2G3R A;  4RTT A;  5KYU A;  5EC7 A;  1I4K 1;  2LNH B;  3VKI A;  1WA7 A;  2EIF A;  2RQR A;  1PKT A;  2LVM A;  5IH2 A;  4QQD A;  1KIK A;  1PM3 A;  5GAO l;  1AWO A;  3M0T A;  1B7T A;  1JBM A;  1W2B P;  4IUR A;  1QWE A;  1YI2 A;  1KD1 U;  2DBK A;  1NE8 A;  3UF4 A;  2O9S A;  2RQT A;  4JLI A;  4CC4 B;  2R5A A;  2DZC A;  4C92 D;  3L2Z A;  1XOV A;  1VQ8 A;  5GAM g;  2RI5 A;  2K79 A;  1XJW B;  3A1P A;  3OQ5 A;  1M8V A;  2LT1 A;  1BI1 A;  1YI2 Q;  1PHT A;  2M16 A;  2WSC E;  3CCV T;  1QCN A;  3C95 A;  5FWC A;  4B6M A;  3OS2 A;  2HMA A;  4E7Z A;  2JW4 A;  2L89 A;  5HK3 A;  1JJ2 S;  1WZO A;  1NYG A;  3HRU A;  2FVU A;  3OW2 S;  3TEE A;  3CCM T;  2KNB B;  4PK4 A;  1M1K R;  1WXU A;  2EYX A;  2RA2 A;  1OX8 A;  4FIB A;  2E1H A;  2DL3 A;  2V8J A;  3E9G A;  2EGE A;  3VS5 A;  5GAN 5;  4QQ6 A;  1BB9 A;  2K5L A;  2XU8 A;  2XDP A;  3P8H A;  1QVF A;  2NUP A;  4OF1 A;  1KQ1 A;  4FCY A;  4L6V 5;  2OTL A;  2IIM A;  3S3N A;  1AVZ C;  4KUI A;  2VXF A;  4R0K A;  4EIK A;  3VU3 C;  4B9X A;  1BI2 A;  1AWW A;  3VS2 A;  4JRI A;  1RUW A;  2VKN A;  3R6O A;  3AHU A;  2VUB A;  2WSF E;  3H8Z A;  2CYZ B;  4ELZ C;  1YJN T;  4KGV B;  1E6H A;  4F7U E;  1N8R U;  3G71 A;  1YIJ T;  4HA8 A;  4JRQ A;  2A37 A;  3PIP A;  3JCM P;  4X9D A;  2DIQ A;  2M0O A;  2ZPI B;  3MP8 A;  3FC3 A;  4C0Z A;  3FIF A;  5FWB A;  1WHK A;  2DIG A;  3QZ5 B;  2ZZD A;  2LJ3 A;  5CCA A;  2KDS A;  2DK3 A;  3FDR A;  1ZSZ A;  3OYH A;  3CC2 T;  1HD3 A;  4LDY A;  5I21 A;  1T3L A;  2VGM A;  1BBZ A;  1LVK A;  2DTH A;  2CSQ A;  2HD0 A;  4Z88 A;  4C92 A;  4F16 A;  2V1R A;  4HKE A;  3HL8 A;  1IHW A;  1ZX6 A;  2KVQ G;  3EFS A;  4FYV B;  4J6X A;  3BDU A;  1PWT A;  1SF9 A;  4TVR A;  4RUG A;  3M59 A;  4A4K A;  4E7K A;  1GRI A;  2KMT A;  4M75 F;  3EGX A;  2DM1 A;  1X27 A;  2O2O A;  2DZ9 A;  2NLU A;  2IVW A;  3S3M A;  3THK A;  2GGR A;  1W1F A;  4A63 B;  3OYA A;  4FM4 B;  1PD0 A;  5KYY A;  2ED0 A;  2XHC A;  4M78 B;  1RI0 A;  1SKU B;  3M55 A;  4PJO A;  1U3O A;  1I8F A;  1IHV A;  3RBB B;  3M5A A;  1X2Q A;  2Y90 A;  3QWY A;  3CD6 A;  4PFP A;  2QDY B;  2VV5 A;  1VYU A;  2YSQ A;  1BYM A;  1RAD B;  2NUT A;  4ZGE B;  1SPK A;  3OBY A;  1X69 A;  3RIR A;  1QCF A;  1AZG B;  3QYG B;  1W2B A;  3L2Q A;  1VQ5 A;  4C8Q A;  4BAC A;  2D9T A;  3CMA T;  2JXB A;  5CO7 A;  3JCM d;  1K0X A;  3I55 A;  1FX7 A;  1YIT A;  1E6G A;  3G7Z A;  2COZ A;  2F2V A;  1VQM A;  2KI7 A;  3HKS A;  4C92 G;  1H3Z A;  2YUN A;  2L3R A;  5CKB A;  5HCK A;  3MJX A;  4M7A C;  3EG9 B;  3P8B B;  1VQ5 Q;  1WJS A;  2RJF A;  2CUB A;  2DVJ A;  4QKU A;  1ZA2 B;  1RAH B;  5KYW A;  1X6O A;  3OS1 A;  4FSS A;  3I55 Q;  1G5V A;  1YIT Q;  5AT1 B;  2K6D A;  1IRE B;  3RKW A;  2YHT A;  1GFD A;  2O88 A;  2EYW A;  1QVG S;  2YLB A;  2LJ0 A;  1C0M A;  1SHF A;  1QLY A;  2QAZ A;  1G2B A;  2ATC B;  2K2M A;  3VYG A;  1Q82 R;  5D6X A;  1SHG A;  1ZBJ A;  4PL6 A;  4LD9 K;  1CKA A;  2RK1 A;  2OTJ Q;  2E10 A;  4E7S A;  2QQ9 A;  3OYG A;  3DLM A;  4PJO G;  2DVE A;  1TXQ A;  4J9G A;  1VQ7 A;  3JB9 J;  1JO8 A;  3CCU Q;  1QVP A;  3FEO A;  1MNE A;  2KR3 A;  1VQL A;  1VQ4 A;  1D1A A;  3CC4 T;  1UGS B;  1RL2 A;  1NLP C;  5CAI A;  5CQY A;  2MWO A;  3VS6 A;  5IXB A;  3OYD A;  1VQ7 Q;  2ABL A;  2ZCF B;  3CCQ T;  5GAN e;  5LJ3 e;  1FMV A;  1AEY A;  4C8Q G;  1Y07 A;  1K8A R;  2O4X B;  1Y71 A;  1LOJ A;  2QA4 A;  1F1B B;  1VQ4 Q;  1VIF A;  2ECZ A;  2K9G A;  1Q82 U;  2EVR A;  1KG1 A;  5L8R E;  3HP9 A;  3JRZ A;  2VAS A;  4IUU A;  1B34 B;  2E6Z A;  3QDF A;  2G6F X;  4KRT A;  4M7D A;  1VQO Q;  1Y7X A;  2I2L A;  4J9H A;  2OX7 A;  3TSW A;  4PLI A;  1UTI A;  4MDX A;  4ZTF A;  2QA4 Q;  1C6V X;  3EGD B;  1JEG A;  2F1L A;  4C0D C;  5M9O A;  4M75 D;  4AG1 C;  4RTU A;  5I11 A;  1D0Z A;  1VQP Q;  4DOV A;  1EX4 A;  3E9F A;  4NOY A;  1EZZ B;  3UPU A;  2EQJ A;  2DXU A;  2X4Y A;  3JCM Q;  2DJQ A;  1K9M C;  1MV3 A;  4M7A B;  4NL2 A;  2RM4 A;  4AFU C;  2KGT A;  1SRM A;  1KQ2 A;  5GMK m;  2EKH A;  4A4G A;  3V7C A;  1KC8 U;  4OMN A;  3QBY A;  4F04 B;  3KBG A;  1Y96 A;  4JS4 A;  1JXM A;  1G3Y A;  1ARK A;  1S72 Q;  2HZY A;  2PU9 B;  4BD3 A;  1W6X A;  3JV3 A;  1BI0 A;  4FW1 A;  2JVV A;  4E2F B;  1YHQ T;  2HL3 A;  2MI6 A;  3OMG A;  5CVI A;  2IPO B;  1WI7 A;  2ZPF B;  4HXJ A;  1NG2 A;  5GAN h;  1VIE A;  3NPF A;  5LJ3 h;  1TOV A;  2CP5 A;  3L2R A;  1YJW T;  2DTI A;  4VUB A;  5GAN j;  1BK2 A;  5LJ3 j;  3GPL A;  2ROT A;  5FRN A;  3M54 A;  1W70 A;  3QSU A;  2JTF A;  4IIM A;  2QTX A;  4GLM A;  1IXD A;  1A0N B;  2QG9 B;  5GAM e;  2RHX A;  4D8D A;  3CCV A;  2H8H A;  1Q86 R;  3CCE A;  3RMS A;  4M7D G;  1WX6 A;  3OYC A;  2BE7 D;  1UGR B;  2M9U A;  4P5N A;  2FEI A;  2V1Q A;  4C5E A;  3JB9 H;  2KK4 A;  1ABQ A;  3M0Q A;  1U8R A;  3CCM A;  2E41 A;  3CCV Q;  1NJI U;  2QAS A;  2DL7 A;  5FU7 C;  2LQK A;  4Y91 A;  2JUF A;  3GLX A;  2E4H A;  1Q95 G;  4HT8 A;  3QPH A;  4UC4 A;  2L3Q A;  4C0D B;  2HSP A;  5IAY A;  3OYJ A;  2RQV A;  2OAU A;  1PD1 A;  3EHQ A;  2FO0 A;  4M4Z A;  3UDC A;  2MYS A;  1M2V B;  2ROL A;  3CCM Q;  1K73 R;  1S1N A;  4Z8A A;  2BE9 B;  3A98 A;  2XI9 A;  3RMQ A;  4M75 A;  3NTH A;  2KRS A;  4J6Y A;  2AKL A;  4J7I A;  1JRI A;  3CC7 A;  5GAN 7;  3OS5 A;  2LRQ A;  2XMF A;  4LD6 A;  1TUD A;  3VJP A;  2JTM A;  4LDV A;  1MGQ A;  2D8H A;  2DE0 X;  3EG1 A;  1WHH A;  3HPW A;  2V8I A;  1RLQ C;  3JCM X;  4FL6 A;  1XQH A;  1OU8 A;  3ME9 A;  3CXC A;  4ORZ A;  5GAM h;  1YIJ A;  1VQN A;  2GCX A;  1U1S A;  1UGQ B;  1Q7Y C;  1OOT A;  3HRS A;  2RJC A;  5D6Y A;  1NPR A;  1PCX A;  3S6W A;  3N5B B;  2XK0 A;  1M4Z A;  1OPK A;  5FW9 A;  3QO3 A;  1YJN Q;  2JS2 A;  1GFC A;  5GMK l;  4PFZ A;  1GCP A;  1VQK A;  5LJ5 f;  4O5V A;  1RAE B;  1OEB A;  1YIJ Q;  1WXT A;  1VQ6 T;  1QW1 A;  4FT2 A;  1OI1 A;  2MOX A;  1PC0 A;  5GMK e;  3CCL T;  1N9S A;  2NYS A;  4KT0 E;  2E70 A;  3A8L B;  1Z9Q A;  2RO0 A;  3LWI A;  1KD1 R;  1HXD A;  2OJ2 A;  4EMH A;  2CT4 A;  3TVT A;  2X4J A;  3J7A F;  4J9F A;  2EJ9 A;  4EMK C;  2Y4X A;  3CC2 Q;  4OMP A;  3JCM g;  4AFZ C;  4MMK A;  2LTO A;  3PNW C;  4M77 C;  3HFN A;  3BDL A;  1OUL A;  2M1H A;  4QVD A;  5FU7 B;  4Z02 A;  3PMI A;  2QK0 A;  4M75 G;  3MET A;  3SWN C;  2LP5 A;  1AWJ A;  1GL5 A;  2W10 A;  3I35 A;  1K0S A;  2L8D A;  4KH1 B;  2DET A;  2ESW A;  3TQ7 P;  2RHU A;  4OB0 B;  4ATO A;  2DL4 A;  2GNC A;  1O9S A;  4RG8 A;  2EYY A;  1TH7 A;  1VYT A;  2JM9 A;  3HSB A;  1JU5 C;  2QTV A;  1G3T A;  5A0G A;  1M30 A;  1ABO A;  1HYO A;  4ZGJ B;  3F70 A;  1OYX A;  2E3I A;  2HQX A;  4M7D F;  3J80 E;  1TTH B;  2ZPH B;  5IHI A;  3OYB A;  3RES A;  2KRM A;  1U1T A;  2J6F A;  1UHC A;  2OI3 A;  1M5Q 1;  4DQ2 A;  2D1X A;  3CMA A;  1BI3 A;  1DJ7 B;  3PGG A;  4EMK A;  5GMK h;  3UA7 A;  1ZA1 B;  2KRN A;  3MEV A;  3OSV A;  1YJ9 T;  2QDL A;  2VVK A;  4LDW A;  5GMK j;  3M9Q A;  3DB3 A;  4C92 E;  3MP6 A;  3INZ A;  3M0U A;  3CPW P;  1NBE B;  2PVG B;  3CMA Q;  4J9B A;  4PJO D;  4OGC A;  2VGN A;  2RHY A;  1N8R R;  2EW3 A;  2P0Q A;  2ZPG B;  4M78 C;  3V7S A;  4QT7 A;  2RPN A;  5KH6 A;  4OB1 B;  3V8K A;  1KHC A;  1K1Z A;  2FL7 A;  4XTU A;  3U23 A;  1UEB A;  4Z89 A;  1X6B A;  4DBQ A;  4HVU A;  4EMK B;  2CKK A;  4R55 A;  1PRM C;  1JB0 E;  3I5S A;  1IB8 A;  3M57 A;  2PVO B;  2F5T X;  1VYV A;  2XKO C;  5C0M A;  4C8Q D;  2K7A A;  4M77 B;  4PJO E;  1M90 C;  1FXX A;  5AYF A;  4E47 A;  2HNI A;  3OB9 A;  3SWN B;  1M1K C;  1OV3 A;  3CCS T;  2IG0 A;  4JZ3 A;  2HEQ A;  3OMC A;  1AZE A;  2DIL A;  2JZ2 A;  3SFM A;  3RUX A;  4C8Q E;  3I56 T;  2P84 A;  3V8L A;  1FMK A;  2EFI A;  1M8M A;  4XTW A;  2AT1 B;  4J9I A;  4OMM A;  4E7H A;  2ENM A;  1TUC A;  5KYX B;  4AT1 B;  4BE1 A;  4M78 A;  1QQJ A;  3E2U A;  3NTK A;  4KUD K;  3OSS C;  3CCQ Q;  4FYW B;  4WCI A;  4X9C A;  5HK0 A;  2GTO A;  3WVE B;  2E65 A;  1WHL A;  4BUG A;  4CC7 A;  3OY9 A;  3LYI A;  4OML A;  3OYL A;  5GAN 3;  3VRZ A;  4EMG A;  4FW2 A;  2HSE B;  2AK5 A;  1MND A;  2JN0 A;  2LX7 A;  2ZPB B;  2YRC A;  4ANJ A;  4LUD A;  1CSK A;  4C5G A;  1KQS P;  2DD4 A;  1BIA A;  5GAN 2;  1UFF A;  1MMN A;  3TSZ A;  4A4E A;  4RKU E;  4BDY A;  1PNJ A;  1PG5 B;  1M9S A;  4OGE A;  4QVC A;  3M4G A;  3OS0 A;  2DJZ A;  1EIF A;  1X6G A;  1IGQ A;  3A8G B;  3EG9 A;  1R8O B;  1YNZ A;  3L2V A;  1O75 A;  3S3O A;  4LDX A;  4FSX A;  4M7D D;  4C0F A;  1QVF S;  1UHF A;  2FZC B;  2J6O A;  1R0C B;  3SB2 A;  3J81 E;  3PMT A;  4LUE A;  3OYF A;  1JQQ A;  1YHQ Q;  2E12 A;  2VYT A;  7AT1 B;  4MZP A;  1WFW A;  1VQ8 T;  2QQA A;  3O8V A;  2X9H A;  2XID A;  3LX7 A;  4QQG A;  4MZM A;  3JCM V;  4M7D E;  2M0Y A;  4GY5 A;  4M78 G;  4XTZ A;  4PJJ A;  3TRE A;  2CS7 A;  2B8A A;  1BKB A;  1WJR A;  2LQW A;  3C0C A;  4KGX B;  2HDA A;  4PJN A;  2COW A;  1HSQ A;  3T9N A;  2EJF A;  5IHK A;  4CI0 C;  2OTJ A;  4D6W A;  4N0A C;  3CCU A;  2DYI A;  2K3Y A;  2J6K A;  4F7U B;  1M2O A;  2O4X A;  2FZG B;  3EH1 A;  1WYX A;  1Z9Z A;  5LJ5 d;  1MUZ A;  2YRV A;  2E5K A;  1M1F A;  1T3S A;  1GXI E;  2K2V A;  1B34 A;  5GJW B;  2EQK A;  1ZLM A;  2OTL T;  2DMO A;  4EDU A;  2YXY A;  1NEB A;  1OZ3 A;  3GOX A;  4LNP A;  1LNX A;  3ASK A;  3JSC A;  1JJ2 P;  3D7S B;  3EGD A;  4X1V A;  3RKX A;  5A0D A;  3OW2 P;  2GF7 A;  2RD1 A;  5ECA A;  4ZNX A;  1PSE A;  1YCS B;  3EFO B;  2EBP A;  1VQO A;  4M7A A;  2O9V A;  2MPX C;  3H9N A;  3I9Q A;  3G1J A;  5GJV B;  1KC8 R;  2Y4Y A;  4Y92 A;  2HQE A;  2LNV A;  4M77 F;  3G71 T;  3P8D A;  1K9M R;  1VQP A;  2CZ1 B;  2EYQ A;  1YFN A;  2KEA A;  1WHJ A;  2AZV A;  1OPL A;  3M0S A;  4IIO A;  1ZUU A;  2DPP B;  2RHZ A;  2OAW A;  2LQ8 A;  2K3B A;  5A2Q E;  2YLC A;  2HL5 C;  3ZBD A;  3E1S A;  3V8J A;  4PJM A;  2DER A;  1XNI A;  1G3S A;  2CP0 A;  3VS4 A;  2L5Q A;  1T0J A;  1M1G A;  3CCL A;  1W2B S;  1I1J A;  2JMA A;  4E7L A;  2CGH A;  1S72 A;  2KYB A;  2QI2 A;  2HKQ B;  2AKK A;  3X26 B;  3JB9 I;  4Y28 E;  1X01 A;  3ER0 A;  3PT9 A;  3HFO A;  3JB9 F;  2RMO A;  1VQ6 Q;  2F5K A;  4HVW A;  4GBQ A;  1K8A C;  3CCL Q;  1K9M U;  4DBR A;  5CIU A;  2RB6 A;  1QKW A;  2MIO A;  2V26 A;  3JCM e;  2CZ6 B;  4M75 E;  2L0A A;  1ZHI A;  4OMO A;  3HTR A;  2F2W A;  2AIR B;  3GF5 A;  5I22 A;  3BW1 A;  1Y57 A;  2L3S A;  1WLP B;  4J5Y A;  1KQS A;  3L42 A;  3NMZ C;  4HVV A;  4JZ4 A;  2QGF B;  1NJI R;  5J39 A;  3DB4 A;  1WHM A;  3QHS A;  4M7A G;  2LMJ A;  1IRX A;  1D3B B;  4FYX B;  3M56 A;  2FRY A;  2V8K A;  3X20 B;  3CCR T;  3CD6 T;  2CUD A;  4PNO A;  4M78 F;  2CZ7 B;  1NM7 A;  2NWM A;  2KBT A;  1YWO A;  1M2V A;  3UA6 A;  1UGP B;  2EQI A;  1R0B G;  2QXF A;  2EGC A;  2M02 A;  4ME7 A;  4DBF A;  2COY A;  4XTV A;  5GAN f;  5LJ3 f;  2DL5 A;  1GBQ A;  2C0T A;  3BE3 A;  1YJ9 A;  4OP0 A;  5HY6 A;  5D7U A;  4XAX B;  1P92 A;  2RQU A;  1YIT T;  4N4G A;  1X75 C;  1VQM T;  5KYN A;  1WXB A;  1Q81 C;  1HK9 A;  2DD5 A;  1YJ9 Q;  2LCS A;  3JCM h;  1QVF P;  1GCQ C;  1RAB B;  3EG0 A;  1VQ9 T;  3CPF A;  4J8O A;  1R77 A;  4AMC A;  8ATC B;  2EYZ A;  2LX9 A;  5EG2 A;  2ZAE A;  2EWN A;  2QEX T;  1K76 A;  2GFU A;  3WVD B;  3G4S T;  2JOY A;  1QP3 A;  3CCJ T;  2XDD A;  3QZ9 B;  2A7Y A;  2BKD N;  4LE9 A;  1Q86 C;  2H3E B;  3HHT B;  1QWF A;  4II1 A;  1RI9 A;  5A0L A;  2EAY A;  4MZT A;  2W0Z A;  1M3C A;  5KE3 A;  1RAC B;  1H3H A;  2HKN A;  4BDZ A;  1YJN A;  2CRE A;  2VB6 A;  2YUO A;  1QCO A;  3VS3 A;  4F7U F;  4M77 D;  4WTO B;  3LH5 A;  1TG0 A;  4OB2 B;  2DL8 A;  2QQR A;  5CKH A;  1VQL T;  1VQ4 T;  3NHN A;  4HCK A;  5GAM j;  2YDL A;  3UWN A;  5GAN g;  2BZ8 A;  3BY7 A;  3GBQ A;  5FRO A;  1SRL A;  1QVG P;  3I56 A;  4IUQ A;  1VA7 A;  3QYH B;  3OYE A;  2PVD B;  1BCM A;  2L3P A;  3ZFJ A;  4MDW A;  1K73 C;  1ZBX A;  1W4S A;  1SEM A;  3CQT A;  5CKE A;  2PUO B;  5GAN 4;  3FB9 A;  1WQW A;  1Q7Y U;  3CCS Q;  1H92 A;  4MML A;  3CC2 A;  3QXE B;  5CR2 A;  3RER A;  2DTO A;  2FPF A;  3SHW A;  2DKG A;  3WXM B;  3RDV A;  1M27 C;  3MEU A;  1D09 B;  3A8H B;  2A3L A;  5GAM f;  1FWZ A;  2A28 A;  4HCZ A;  3I56 Q;  2J7I A;  1RAI B;  3URG A;  1UG1 A;  3QDR B;  1ZQ1 A;  4A53 A;  5FU6 C;  2RF0 A;  1K4U S;  2JJ9 A;  1I5L A;  1M3A A;  3QUI A;  3KUF A;  1AOJ A;  1MHN A;  3JCM J;  5CKF A;  2BIV A;  2DEQ A;  3G6E T;  4C0G A;  2X3X D;  3A8M B;  1G3W A;  4PJL A;  4XTX A;  2HBW A;  4E7I A;  3MPU B;  3M0R A;  1RAG B;  1YBY A;  3CBM A;  2DXC A;  2HBP A;  2CH4 A;  3QKJ A;  1Y0M A;  4FT4 A;  2M51 A;  1EFN A;  2RK2 A;  5DM7 R;  3CME T;  4A4F A;  2EKO A;  4M7A F;  3MHX A;  2R5M A;  3AT1 B;  3M53 A;  2O31 A;  3NFC A;  2DBM A;  3LLR A;  4RTZ A;  3REB B;  2C0I A;  4IUT A;  1TWB A;  2E5Q A;  4LN2 A;  4M78 D;  1KD1 C;  4HT9 A;  8AT1 B;  1U5S A;  3LGF A;  4N4I A;  4QVZ A;  5LJ5 g;  2DX1 A;  1I81 A;  4F17 A;  4PKC C;  1N27 A;  2KAF A;  2LT4 A;  2X4X A;  4N4H A;  1UDL A;  5IHN A;  3Q1J A;  3LGL A;  2RN8 A;  4J9D A;  4RMO A;  2A08 A;  1RAA B;  2ED1 A;  4M78 E;  4JJB A;  4M77 A;  3ZEH A;  4B9W A;  3L2W A;  2LC4 A;  5KCO A;  4JUV A;  1UE9 A;  1SG5 A;  1N6A A;  5LL6 S;  3CXC S;  3L2U A;  3CCE T;  5KYU B;  3SWN A;  3MEA A;  1VQ8 Q;  3H41 A;  1D0X A;  1IZ6 A;  4OMF B;  1KJW A;  2QQS A;  4KGZ B;  1M90 R;  1YWP A;  4A54 A;  4V2S A;  4HCB A;  1MV0 B;  3CBP A;  5FU6 B;  1MMA A;  2EQU A;  4K11 A;  3QG1 A;  1ZSZ C;  2BZX A;  1U06 A;  2FPE A;  3SDZ A;  1BCO A;  2KT8 A;  3OYY A;  4J83 A;  2CP7 A;  4C92 C;  4F14 A;  1KSW A;  5KYX A;  1ACM B;  5IT9 E;  1NLO C;  4J6W A;  1QKX A;  5L23 A;  2C0O A;  3X28 B;  1JXO A;  3QWX X;  2HQH A;  3CC4 A;  3CC7 T;  1M90 U;  1UGV A;  3VRY A;  1N8R C;  2X4W A;  3CBO A;  5CKD A;  2OTL Q;  1M1K U;  5C6S A;  3CCQ A;  2XD0 A;  3MEW A;  1BU1 A;  2MCN A;  2QGG A;  4C5H A;  1CKB A;  4ELY C;  1QP2 A;  4XU0 A;  4DA4 A;  2LZ6 B;  5GAO r;  4DOW A;  3CC4 Q;  1VQN T;  4E6R A;  2DA9 A;  4JRP A;  2NUP B;  1RAF B;  4M77 G;  4PJO C;  4C5I A;  3TU4 K;  1UJY A;  3RKY A;  3I5R A;  2KXC A;  1T0H A;  3FJ5 A;  3PFS A;  3H0H A;  5DLQ E;  1QVG A;  2Z0W A;  1VQK T;  2DF6 A;  1IO6 A;  1MMG A;  5GMK i;  3G71 Q;  2FZK B;  3NGP A;  3H0F A;  4R56 A;  4YTL A;  1UEC A;  5J26 A;  4Q5W A;  4DEX A;  1E7O A;  3C4S A;  4JDS A;  1KK7 A;  5DY9 A;  4C8Q C;  1OX9 A;  2KYM A;  3GNG A;  4J7F A;  1D1B A;  4ZN1 A;  2PUK B;  4M7A D;  1UUE A;  3JB9 G;  2XG8 D;  2QYZ A;  5GAN d;  5LJ3 d;  1X2K A;  1LCK A;  2J06 A;  2I0N A;  1PRL C;  2KXD A;  5KE2 A;  2BTT A;  2NUZ A;  5GAO q;  4ZN3 A;  2P0P A;  2XIC A;  1ZSZ B;  1YHQ A;  2YRD A;  3QJ6 A;  2ZPE B;  2EPD A;  2RI3 A;  3RNJ A;  4EPC A;  4C92 B;  1BIB A;  1KFZ A;  5DLO A;  2O01 E;  1YJW A;  4DEY A;  2K5F A;  4CRI A;  3MP1 A;  2FYK A;  2CSI A;  4M7A E;  2JTE A;  5GAO p;  2GQV A;  2KSS A;  1YI2 T;  3E19 A;  2K3X A;  2PZ1 A;  2DO3 A; 
#chains in the Genus database with same CATH homology
 4ORZ A;  2DL3 A;  2RMO A;  2EGE A;  4HVW A;  3VS5 A;  4GBQ A;  1BB9 A;  3O5Z A;  1OOT A;  1OPK A;  1QKW A;  5FW9 A;  2MIO A;  3SEM A;  2JS2 A;  2IIM A;  3VS0 A;  1AVZ C;  1ZUY A;  2L0A A;  4OMO A;  1GFC A;  4R0K A;  2F2W A;  2YUP A;  4EIK A;  1GCP A;  2DNU A;  3EHR A;  1OEB A;  5I22 A;  3EG2 A;  4RTW A;  1WXT A;  1Y57 A;  2L3S A;  1AWW A;  1V1C A;  3VS2 A;  2PTK A;  1RUW A;  1WLP B;  2VKN A;  2MOX A;  2EGA A;  3NMZ C;  4HVV A;  4JZ4 A;  2GBQ A;  1Z9Q A;  3EGU A;  4RTV A;  2OJ2 A;  2CT4 A;  2LMJ A;  3TVT A;  1E6H A;  4J9F A;  4JPB W;  4OMP A;  4AFZ C;  2FRY A;  1M3B A;  2A37 A;  2CUD A;  1YP5 A;  1NM7 A;  2NWM A;  1SSH A;  2KBT A;  1YWO A;  3UA6 A;  2EQI A;  2EGC A;  2D8J A;  5FWB A;  2LP5 A;  1AWJ A;  1GL5 A;  2LJ3 A;  2DL5 A;  2SRC A;  1GBQ A;  2C0T A;  2W10 A;  3I35 A;  1K0S A;  4D8K A;  1HD3 A;  2FRW A;  1T3L A;  1BBZ A;  2RQU A;  2ESW A;  2CSQ A;  4Z88 A;  4F16 A;  2DL4 A;  2V1R A;  2GNC A;  2EYY A;  1ZX6 A;  1WXB A;  1VYT A;  2JM9 A;  1JU5 C;  2DYB A;  2GTJ A;  3ZL7 C;  2LCS A;  1M30 A;  1ABO A;  1PWT A;  3PVQ A;  1GCQ C;  3EG0 A;  4RUG A;  2EYZ A;  1GRI A;  5IHI A;  3M0P A;  2KRM A;  1K76 A;  2J6F A;  2DM1 A;  1X27 A;  2J05 A;  2O2O A;  1UHC A;  2OI3 A;  4LE9 A;  2D1X A;  1QWF A;  3THK A;  2GGR A;  1RI9 A;  1W1F A;  4A63 B;  4AG2 C;  3UA7 A;  3PVL A;  2KRN A;  5IXF A;  2DRM A;  2QDL A;  2VVK A;  2W0Z A;  2ED0 A;  1M3C A;  1H3H A;  1U3O A;  2AZS A;  2CRE A;  2YUO A;  3M0U A;  3RBB B;  3PE0 A;  3VS3 A;  1X2Q A;  3QWY A;  3UAT A;  3LH5 A;  4J9B A;  4AFQ C;  1TG0 A;  2A36 A;  2DL8 A;  1VYU A;  2EW3 A;  2YSQ A;  3NHN A;  4HCK A;  2YDL A;  1I0C A;  1SPK A;  1YN8 A;  2BZ8 A;  4QT7 A;  2RPN A;  2JM8 A;  3GBQ A;  1X69 A;  1SRL A;  1VA7 A;  2L3P A;  1QCF A;  1AZG B;  1K1Z A;  3VS7 A;  1SEM A;  2CT3 A;  4J9E A;  3CQT A;  3U23 A;  4Z89 A;  2YT6 A;  1X6B A;  1AD5 A;  4HVU A;  1PRM C;  1H92 A;  2JXB A;  3I5S A;  1K0X A;  2X3W D;  1VYV A;  2FPF A;  2PNI A;  3SHW A;  1E6G A;  2P4R A;  2K7A A;  2VWF A;  1M27 C;  4RTY A;  2F2V A;  2CDT A;  4JJD A;  2A28 A;  2YUN A;  2J7I A;  1WDX A;  5HCK A;  2DRK A;  1UG1 A;  4JJC A;  2GQI A;  2B86 A;  2RF0 A;  1K4U S;  2CUB A;  2DVJ A;  1M3A A;  2BZY A;  4RTX A;  1AOJ A;  1OV3 A;  4FSS A;  4JZ3 A;  1I07 A;  2X3X D;  2HEQ A;  2K6D A;  1AZE A;  1B07 A;  2DIL A;  2HBW A;  1GFD A;  2O88 A;  1GBR A;  2EYW A;  3M0R A;  2LJ0 A;  1J3T A;  1SHF A;  1QLY A;  1FMK A;  1G2B A;  1M8M A;  2CH4 A;  1Y0M A;  2K2M A;  2DLP A;  2M51 A;  4J9I A;  4OMM A;  1EFN A;  2ENM A;  1TUC A;  1SHG A;  1ZBJ A;  1N5Z A;  1CKA A;  2L2P A;  1NYF A;  2O31 A;  4J9G A;  2KT1 A;  3KFV A;  2DBM A;  4OMQ A;  4WCI A;  1JO8 A;  4RTZ A;  3REB B;  2C0I A;  2GTO A;  4J9C A;  1ZSG A;  2KR3 A;  2RQW A;  4ESR A;  4LN2 A;  4CC7 A;  1K9A A;  4OML A;  1U5S A;  3VRZ A;  3IQL A;  1NLP C;  2LQN A;  2RNA A;  2AK5 A;  1HJD A;  1B3Q A;  2DX1 A;  3VS6 A;  5IXB A;  1FYN A;  2LX7 A;  3ULR B;  2ABL A;  4F17 A;  3R6N A;  1AEY A;  4LUD A;  1CSK A;  2SEM A;  1WIE A;  1UDL A;  3EG3 A;  5IHN A;  1AWX A;  2RN8 A;  2ECZ A;  4J9D A;  2K9G A;  2A08 A;  2EVR A;  1UFF A;  2ED1 A;  3TSZ A;  3REA B;  4JJB A;  1UJ0 A;  1PNJ A;  2G6F X;  4KRT A;  2JT4 A;  1G83 A;  1UE9 A;  1X6G A;  4J9H A;  1YNZ A;  2CH4 W;  3TSW A;  1UTI A;  3H41 A;  1JEG A;  4AFS C;  2FPD A;  1KJW A;  2HCK A;  4AG1 C;  1UHF A;  4RTU A;  5I11 A;  1YWP A;  2J6O A;  2DJQ A;  1MV3 A;  1MV0 B;  4AFU C;  2KGT A;  1SRM A;  4LUE A;  2YUQ A;  4K11 A;  1H8K A;  2EKH A;  1JQQ A;  4OMN A;  1WFW A;  2JS0 A;  2BZX A;  1U06 A;  2FPE A;  1GCQ A;  1JXM A;  2KT8 A;  2FG0 A;  4F14 A;  1KSW A;  2M0Y A;  1NLO C;  1QKX A;  4CC3 A;  1ARK A;  1NEG A;  5L23 A;  2C0O A;  1JXO A;  3QWX X;  1W6X A;  2LQW A;  3JV3 A;  2KE9 A;  3C0C A;  1RLP C;  2HDA A;  1HSQ A;  2JMC A;  3H0I A;  1WI7 A;  4HXJ A;  1UGV A;  1NG2 A;  5IHK A;  3VRY A;  3NPF A;  2F2X A;  2KRO A;  2LJ1 A;  1BK2 A;  2D0N A;  2ROT A;  1X43 A;  1BU1 A;  4CC2 A;  2MCN A;  1W70 A;  1CKB A;  1PKS A;  2J6K A;  4IIM A;  1ZUK A;  2LZ6 B;  4GLM A;  1A0N B;  4E6R A;  1WYX A;  1Z9Z A;  2DA9 A;  1MUZ A;  2E5K A;  3VS1 A;  1T3S A;  4D8D A;  5GJW B;  1UJY A;  2H8H A;  3I5R A;  1WX6 A;  1ZLM A;  2KXC A;  1T0H A;  2DMO A;  3FJ5 A;  3H0H A;  4RTT A;  5EC7 A;  1NEB A;  2LNH B;  2FEI A;  4LNP A;  2DF6 A;  1IO6 A;  1WA7 A;  2V1Q A;  2RQR A;  1PKT A;  3NGP A;  5IH2 A;  3H0F A;  1KIK A;  4X1V A;  1UEC A;  1AWO A;  3M0T A;  1ABQ A;  3M0Q A;  4DEX A;  1E7O A;  5ECA A;  4ZNX A;  1QWE A;  1YCS B;  2EBP A;  2DBK A;  2DL7 A;  3UF4 A;  2O9S A;  2RQT A;  4CC4 B;  2O9V A;  2KYM A;  3I9Q A;  1XOV A;  5GJV B;  2L3Q A;  2HSP A;  2RQV A;  4Y92 A;  1UUE A;  3EHQ A;  2K79 A;  2FO0 A;  4M4Z A;  1X2K A;  2KEA A;  2AZV A;  2ROL A;  1OPL A;  3M0S A;  4IIO A;  1ZUU A;  1LCK A;  1S1N A;  2J06 A;  4Z8A A;  2OAW A;  1PHT A;  3A98 A;  2I0N A;  5FWC A;  1PRL C;  2KXD A;  2K3B A;  2JW4 A;  2KRS A;  2BTT A;  2NUZ A;  2AKL A;  3VS4 A;  2EPD A;  1T0J A;  2XMF A;  3RNJ A;  1NYG A;  1TUD A;  1KFZ A;  1I1J A;  2JMA A;  4DEY A;  2KNB B;  2D8H A;  2CSI A;  2DE0 X;  3EG1 A;  2JTE A;  1WXU A;  2KYB A;  2EYX A;  1RLQ C;  2AKK A;  2PZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...