4HVUA

Crystal structure of the t98d c-src-sh3 domain mutant in complex with the high affinity peptide app12
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
TFVALYDYESRTEDDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic resolution structures of the c-Src SH3 domain in complex with two high-affinity peptides from classes I and II.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein/peptide
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 12
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hvuA00
1Y0MA 4OMPA 3JV3A 1AWXA 1CKBA 4J9DA 2LJ0A 4RTVA 1PKTA 4RTZA 1GBQA 2LZ6B 2JM8A 3H0IA 2RQVA 2EBPA 2EVRA 2D8JA 1W1FA 3REBB 5IHNA 2A37A 1X69A 2DL4A 3NMZC 1PWTA 4Z8AA 2F2WA 2YUPA 3C0CA 1AWJA 1NLOC 2JTEA 2J6OA 5FWBA 1BBZA 1QWFA 5IHKA 1G2BA 1GCPA 2DVJA 2O2OA 2YT6A 3VS3A 2VWFA 4ESRA 1W6XA 2F2VA 4OMQA 4ZNXA 2EW3A 1SSHA 2A08A 1M30A 2AKLA 2W10A 2DBKA 3THKA 2EYWA 1K76A 2YSQA 3EHQA 5FW9A 2KT1A 4RTTA 2ROTA 1GBRA 2W0ZA 3KFVA 4J9GA 4IIOA 1HSQA 2SEMA 2J6FA 2D1XA 1K4US 2CUDA 3SHWA 4KRTA 1OEBA 2BZ8A 1WA7A 2LQWA 3EGUA 3VS7A 4HVUA 3REAB 1AVZC 4JZ4A 1E6HA 2DBMA 4ORZA 1YP5A 3I5RA 2J06A 3PE0A 3RNJA 2JMAA 1JEGA 1E6GA 1M27C 2JXBA 3PVQA 2IIMA 4GBQA 2LNHB 1ZBJA 1RLPC 1SRLA 3QWYA 1YN8A 2PTKA 2RF0A 3O5ZA 1AZEA 1VYUA 2JS0A 1UJYA 2LX7A 1K0XA 2K2MA 2HBWA 5GJWB 1S1NA 2C0TA 2LQNA 1GFCA 1JO8A 2V1RA 3LH5A 4J9CA 4J9FA 1MV3A 3VS5A 3M0SA 2DRKA 1WXBA 4HCKA 1KJWA 2K9GA 3UATA 2P4RA 1M3AA 3NGPA 3A98A 2EQIA 1SHGA 1X43A 1SHFA 2EGEA 3I35A 4LUEA 1PRLC 1ZLMA 2ENMA 2MCNA 1SEMA 1AOJA 1KIKA 1G83A 4LUDA 5FWCA 2JMCA 2I0NA 2K7AA 3EG3A 2SRCA 2E5KA 1QKXA 1BU1A 1UGVA 2KE9A 2EGAA 4F14A 2GQIA 2D8HA 2DYBA 1I1JA 3EHRA 3ULRB 4RTUA 2ED1A 4EIKA 2KT8A 2QDLA 2RQUA 2DL3A 1OOTA 2DL8A 1A0NB 1FMKA 1UHFA 2AZSA 4RTWA 1U5SA 4CC2A 1AWOA 1QKWA 4A63B 1WXTA 3UF4A 2LJ3A 1GCQC 3EG1A 2GBQA 1Y57A 1PHTA 4J9IA 2NUZA 2KYMA 3NPFA 1MUZA 2EPDA 1NEGA 2FRYA 4OMLA 2BTTA 4F17A 2DM1A 4WCIA 2DLPA 4Z89A 4J9BA 2BZYA 4D8KA 2HDAA 2KNBB 2L2PA 1OV3A 5GJVB 1LCKA 1U06A 3FJ5A 3ZL7C 2DA9A 2KRMA 1Z9ZA 1Z9QA 1WI7A 2M51A 2LJ1A 3M0RA 4AFQC 2CH4A 3PVLA 1AZGB 3M0PA 2GTJA 5IH2A 3I5SA 1UDLA 2L0AA 1JQQA 2JT4A 3SEMA 1NEBA 5IXFA 1VYVA 2KYBA 2DMOA 2JM9A 1UFFA 1RI9A 1T3SA 4HXJA 4OMMA 2X3WD 1V1CA 1ABQA 1TUDA 3NHNA 1K9AA 1UHCA 1CSKA 1ARKA 1GFDA 2ABLA 2FG0A 2K79A 2HEQA 1PKSA 4E6RA 4HVWA 3GBQA 3UA6A 4R0KA 1AEYA 1E7OA 3IQLA 3U23A 3RBBB 1EFNA 1KSWA 2FRWA 2K3BA 2CSQA 1QWEA 5L23A 2NWMA 1X27A 1ZUKA 2CSIA 2AKKA 5ECAA 1ZX6A 2EGCA 3VS0A 2J6KA 2CDTA 4HVVA 1OPKA 4DEYA 4FSSA 1WIEA 3VRZA 2VKNA 3CQTA 2RMOA 2LCSA 1NG2A 5IHIA 4AFUC 2RQRA 1M8MA 1GCQA 1TG0A 2EKHA 2YUQA 1ZSGA 1B3QA 2C0OA 4M4ZA 5HCKA 4CC3A 4DEXA 1UTIA 2L3SA 2RQWA 1M3CA 4J9EA 5EC7A 3QWXX 4F16A 4D8DA 1K0SA 1BB9A 4AFZC 1UECA 1CKAA 4AG2C 1WLPB 2EYZA 3VS4A 3VS6A 2HSPA 2O9VA 1UUEA 2AK5A 2VVKA 1YWPA 2ECZA 1UJ0A 2KR3A 5IXBA 3H41A 2DE0X 2GGRA 3TSZA 2F2XA 1H8KA 1W70A 4OMNA 4OMOA 1I07A 2ESWA 4RTYA 2FEIA 1QCFA 4JJDA 1YWOA 1H3HA 2G6FX 2GTOA 1VYTA 2KBTA 2ROLA 4RUGA 1WFWA 4JPBW 3M0QA 2RN8A 1ABOA 1SRMA 4AFSC 1ZUUA 2L3PA 3H0FA 2C0IA 3EG0A 4LN2A 1JXOA 2DF6A 2JS2A 2FPDA 2LP5A 1NYGA 4CC7A 2DL5A 1T0JA 2FPEA 4CC4B 2L3QA 1X6GA 2FPFA 2DX1A 1I0CA 1NYFA 2JW4A 2O9SA 3EG2A 1T3LA 2FO0A 1SPKA 3UA7A 2KXCA 2D0NA 1FYNA 2RPNA 2RQTA 1H92A 2DNUA 2DRMA 1X6BA 1N5ZA 2AZVA 4K11A 2YDLA 1GL5A 2CT4A 1T0HA 2O31A 1TUCA 2KEAA 4AG1C 2KXDA 1PNJA 2LMJA 1J3TA 2M0YA 4QT7A 2EYYA 5I11A 1WX6A 2YUNA 1PRMC 1AWWA 1GRIA 3TVTA 2DL7A 1JU5C 4LE9A 2B86A 3M0TA 1VA7A 2A28A 2KRSA 1WXUA 1OPLA 2MIOA 1KFZA 4JJCA 2CUBA 1UG1A 1MV0B 2EYXA 3M0UA 1WYXA 2GNCA 3TSWA 2V1QA 4JZ3A 3VS1A 2KGTA 2XMFA 2CREA 2KROA 2CH4W 3I9QA 2H8HA 1UE9A 3VS2A 4J9HA 2MOXA 5I22A 4Z88A 1U3OA 1RUWA 3R6NA 1BK2A 1YNZA 4Y92A 2J7IA 2PZ1A 2OI3A 2DJQA 1XOVA 1NLPC 2DILA 2RNAA 2OJ2A 2YUOA 2ED0A 2J05A 2CT3A 3H0HA 3VRYA 1AD5A 1WDXA 4X1VA 1QLYA 1NM7A 1M3BA 1JXMA 1RLQC 1K1ZA 2A36A 4IIMA 1X2KA 4RTXA 2K6DA 2O88A 2HCKA 2PNIA 2KRNA 1ZUYA 1IO6A 1X2QA 4LNPA 2X3XD 2BZXA 2OAWA 1HJDA 4GLMA 1HD3A 1YCSB 1B07A 4JJBA
chains in the Genus database with same CATH superfamily
1Y0MA 4OMPA 1EZZB 4M7AE 2QA4T 3OYYA 5GANf 2VASA 1GBQA 2XDDA 1Q81U 4M75E 5A0DA 2BUDA 2JZ2A 1VIEA 1TUGB 5GAN6 1W1FA 1B34A 2G3RA 1I8FA 1X69A 5D7UA 2YUPA 4OB2B 1AWJA 2EJ9A 2FYKA 3S6WA 1NPPA 1QWFA 5IHKA 1SKUB 2DVJA 4A4KA 3VS3A 1OULA 3JB9J 4ESRA 3HPWA 2JNGA 3UDCA 1UB4A 2EW3A 2DBKA 4L5GA 1NZ9A 2YSQA 1UGPB 1MMDA 1WQWA 3EHQA 4RTTA 5GAN3 3CPWS 3BE3A 1GBRA 2W0ZA 3CMAT 2LRQA 3J80E 3ASKA 1FMVA 1EX4A 3S3MA 4RG2A 1KQSS 1K4US 2QGGA 3MP1A 1OEBA 4N4HA 1W4SA 2BZ8A 3OYHA 4DBRA 2RHUA 5A0LA 1VQMT 3F70A 1E6HA 1M9SA 3EFOA 2QQ9A 1YP5A 1SSFA 3PMIA 3CC2T 2DETA 5KYXB 1YITT 5FROA 2J06A 4ZTFA 2EIFA 2MF2A 4C5EA 2QDYB 1S72T 1PSFA 1RLPC 1SRLA 2CZ7B 1I4K1 3WVEB 1VQKA 1MGQA 5GAOn 2K2MA 5GJWB 2DXBA 2C0TA 1VOMA 5GAOq 1JO8A 4J9FA 3FIFA 3PFSA 3M0SA 2HQHA 4C92G 4B9WA 1NJIR 1G3WA 4M7DG 1M1GA 5D6WA 2DVEA 3LGFA 3CEYA 2EGEA 4EDUA 5CKDA 1PRLC 1DJ7B 3X26B 2MCNA 2KY9A 1RI0A 2DERA 5GAN2 2EFIA 4LUDA 5FWCA 2K7AA 2E5KA 4JUVA 1UGVA 1O75A 2EGAA 4F14A 2GQIA 3MKDA 2DYBA 3EHRA 4CI0C 4RTUA 2C06A 1G3YA 2VB6A 2XHCA 1IGQA 2DL8A 2CP6A 4ELZC 1FMKA 3OSSC 3CMEA 2RHZA 5FU7B 2DTIA 1QVPA 3Q1JA 4J9IA 2E6ZA 2F69A 4XTVA 5CR2A 1YJNT 4M77C 1WPYA 1M1KC 2LT1A 5GMKm 5HK0A 4Z89A 3L2QA 2OTLA 2NUPB 2BZYA 4BDYA 1TXQA 5KE3A 4A4GA 5GMKe 2QYZA 1OU9A 2K3YA 3VKIA 2RB6A 3QZ9B 3FJ5A 4A4HA 2AHJB 2KRMA 4QVCA 3M54A 3E2UA 1KQSP 2CH4A 2E65A 4F7UB 3I5SA 4NOYA 3CPWP 5CQYA 3V8JA 2QEXQ 4C92B 2LNVA 4PJOG 1Y07A 1VYVA 2FVUA 4BY6C 5C6SA 1OX8A 1K9MR 3A8MB 1V1CA 1ABQA 1TUDA 4C8QE 3QZ5B 1K9AA 2KMTA 2K79A 1KC8U 3QXEB 2E12A 3UA6A 4R0KA 4BACA 1AEYA 1M90R 3IQLA 2A0FB 3M56A 3QYGB 2MPXC 2WACA 1VQPT 1QWEA 4F7UA 2JTMA 2NWMA 2CS7A 3V7SA 1ZUKA 1ZSZA 2KI7A 2AKKA 5ECAA 2EGCA 2CDTA 1OPKA 2HKNA 8ATCB 4FYYB 5GAN7 2RMOA 4AT1B 5C0MA 2X4JA 2YLCA 1NG2A 5IHIA 1YJWT 2RJEA 3M4GA 2YUQA 1ZSGA 5HCKA 1UTIA 2L3SA 5LJ5h 1EIFA 4IUUA 1LOJA 2VXFA 4F16A 3I56A 2V8KA 8AT1B 4D8DA 5IT9E 4RKUE 1RAIB 4FYXB 1BB9A 2RA2A 3TCJA 1CKAA 3M5AA 1WLPB 2EYZA 1ZSZC 3JCMQ 2O9VA 1UUEA 2LC4A 4MDXA 1QVFA 2DE0X 3J7AF 2E64A 3JCMJ 2GGRA 3OYJA 2L89A 4OMOA 4OMNA 1YHQT 1YWOA 2G6FX 1VYTA 1M5Q1 3HRUA 3NTKA 5KYUA 2ROLA 4RUGA 2RN8A 1W2BS 2E1HA 1SRMA 1Y96A 3RERA 4KGZB 1K8AR 2HAXA 3OY9A 1LVKA 2C0IA 3VUBA 1OU8A 3MCAB 5CO7A 4Z02A 4BD3A 2KDSA 2EKOA 4CC4B 4M7AG 2QXFA 3H9NA 4M7AF 1NYFA 4QW2A 1T3LA 4KUDK 2RI5A 2HD0A 2R5MA 4LXCA 4ME7A 3UA7A 2RQTA 2EQKA 5I2SA 4O5VA 2RJDA 2LQ8A 5GAN8 1BCOA 1BIAA 1VQ8Q 2HL5C 2O31A 2KEAA 4AG1C 3UT1A 1KQ1A 1QP2A 2M0YA 3OYAA 2HL3A 3CCLA 2EYYA 2IG0A 3FJPA 1JBMA 2DD5A 4A54A 3M9QA 3HHTB 3JB9F 2H3EB 1Q7YC 1VA7A 1RADB 3JSCA 3L1AA 3MHXA 2DO3A 3M0UA 1R8OB 1IRXA 1H3ZA 5LJ3e 4MDWA 2XDBA 3CCQQ 2IVWA 2XMFA 2CREA 5LJ5f 2QI2A 1R0CB 3ZFJA 1VQ5T 2XI9A 3G1JA 2XICA 3CC2A 4QQDA 2H8HA 2ZPEB 1X01A 3URGA 3VJPA 1D0ZA 4N0AC 2PZ1A 4N4IA 5LJ3d 4E7HA 3EH1A 1Q86C 2OI3A 1YJ9T 4RCCA 4M77E 3A8OB 5DLQE 2J05A 1XNIA 3G71T 4F04B 4MMKA 1Y7XA 4PL6A 1W2BP 4ZN1A 3CC2Q 4LDUA 4M77D 3OS5A 1YITQ 2K6DA 2E5QA 3META 4L6V5 3C4SA 1BI2A 4J6YA 4LDVA 3WXMB 4HA8A 1YJ9A 2EWNA 2OAWA 4GLMA 3MEAA 5LJ5g 1VQ7T 1BI1A 1MMNA 1AWXA 3JV3A 3V7RA 1U1SA 1YCYA 1ZQ1A 4LDYA 1CKBA 4J9DA 2F1LA 3CCUQ 2JOYA 2KAFA 4IURA 1PKTA 5GAMd 4RTZA 1Q7YU 1JJ2S 4PJJA 3JRZA 5IHNA 3PNWC 1KD1R 2DL4A 3C0CA 3CCVQ 4LD6A 5GAMj 3CCQA 1NBEB 1QVGP 3RKYA 3CMAA 4M75D 2J6OA 3OYKA 1BBZA 2Y4XA 2O2OA 2VWFA 1MMGA 1W6XA 3I55A 3EGDA 2V26A 4ZNXA 2ATCB 1SSHA 5CKFA 2AKLA 2W10A 3CCLT 5IAYA 3A1PA 5GANe 2D6FA 1QVGA 2KT1A 1D0XA 2ZCFB 4J6XA 2QTVA 1TTHB 4WTOB 3KFVA 4LDXA 4J9GA 2O4XB 1IREB 2GFUA 1K73U 2J6FA 2BKDN 2CUDA 3A8GB 4M77A 4HVUA 1WGSA 2DJZA 2R57A 2YXYA 2DBMA 3HFOA 5GAMe 5LJ5d 1VQNQ 1B34B 1N27A 2CP3A 2JMAA 2WSEE 1JEGA 2PU9B 1NPRA 4GLKA 3PVQA 1ZBJA 3JCMW 4XU1A 3QWYA 3M57A 4OVAA 3A5ZB 1FMWA 3O5ZA 1VQ9A 4EMGA 2L3RA 5LJ5e 3UWNA 1VYUA 2P0KA 2HBWA 1GFCA 3LH5A 3OB9A 1QVFS 4M78E 4M75A 5CKHA 4HCKA 3LH0A 4F7UE 2K5IA 2DPPB 1HYOA 1PCXA 2XDPA 3UATA 1M3AA 3NGPA 4J5YA 2EQIA 3LWHA 1NJIC 1IB8A 5GAN4 1ZLMA 4E7SA 2HNIA 2ENMA 3EG9A 1SEMA 5GAOl 4HCBA 1MHNA 3JB9G 3SWNC 2SRCA 1M1FA 2RI3A 4MZTA 2NUTA 5KYXA 2D8HA 5DM7R 3DB4A 1I1JA 3ULRB 4EIKA 2ED1A 5GMKj 1Q82U 2BE9B 2KT8A 2A3LA 1M4ZA 2QDLA 2DL3A 2CGHA 1OOTA 1K8AU 4RG8A 2AZSA 3RUXA 1U5SA 5FU6C 4CC2A 1WXTA 3UF4A 3QG1A 5HY6A 1Y57A 5D6YA 3QO3A 4C0FA 2EPDA 1N9SA 5CKBA 5CIUA 4OMLA 2BTTA 4E7ZA 4WCIA 2BE7D 4C92F 3QDRB 3X25B 3E9GA 2LQKA 3JCMV 2RHXA 2DLPA 3MEUA 4M7DA 4FCYA 1N8RR 4FM4B 1VQLA 2HDAA 2KNBB 3CD6Q 2L2PA 1YI2Q 1OV3A 4PJOA 4PFZA 1WJRA 5GJVB 3FLGA 1QMCA 3ZL7C 4E7JA 1FX7A 1D1AA 2GFAA 2PVGB 3E1SA 1WI7A 1M90U 4M75F 2LJ1A 3MO8A 5DLOA 1K73R 1YHQQ 3G4SA 2FHDA 1AZGB 3M0PA 2GTJA 5IH2A 3HRTA 1JQQA 2HZYA 2HMAA 2PVDB 1UGSB 3SEMA 2P0PA 1M1KU 1VQ6Q 2JM9A 4M7AB 3OS1A 1TS9A 3EFSA 2DAQA 4HXJA 3P8BB 5A0GA 2JJ9A 3RKWA 4EMKB 3CCJT 1CSKA 2BIVA 3G4ST 4C5HA 3MEWA 2QQRA 5KYUB 3GBQA 1UEBA 4R56A 1IHWA 4OF1A 3LGLA 3U23A 3RBBB 2FRWA 1D09B 4M77F 4HKEA 1ZX6A 2ZPIB 1JJ2P 3JCMb 3OA6A 3JCMc 3VS0A 2LX9A 4DOVA 2XU8A 1KG1A 4DEYA 1M2OA 2RO0A 2VKNA 5GAMf 2DYIA 2LCSA 4M7DD 1M8MA 1GCQA 4BUGA 1B3QA 2C0OA 5LJ5j 3LW5E 1M3CA 5EC7A 4HCZA 4PJOD 4M78C 1UECA 3JAME 3OSVA 2X4XA 3RR6A 3VS6A 4M7DC 2HSPA 4KT0E 3CMET 6AT1B 2D0QB 4XTYA 2VVKA 2ZPFB 2JVVA 3GP8A 4M75B 4BE1A 4PKCC 3H41A 2X4WA 2QTXA 2XG8D 4HCCA 2M9UA 2K4YA 1VQ5Q 3BDLA 1H8KA 1JRIA 3G6EA 2OAUA 1K8AC 4F7UG 2DFUA 1QCFA 4JJDA 4II1A 3CXCA 3OYEA 2EYQA 4N0AA 3BW1A 1WFWA 1VQLQ 3M0QA 1Q82R 4O6JA 1VQMQ 1ABOA 3TEEA 5GAN5 2Y4YA 2L3PA 4LD9K 3T9NA 1BI3A 1Q95G 3EG0A 4C0GA 4LN2A 3HRSA 2CZ0B 2FPDA 2RK2A 4FW1A 1D3BA 4C5GA 2FB7A 1T0JA 2FPEA 2MYSA 3CCMT 2FPFA 4J7FA 3GLXA 4XTXA 1SPKA 3CC7Q 2KXCA 2GCXA 2D0NA 4BI3A 4QVDA 2DNUA 4C8QB 1VQ7A 1BI0A 1XTDA 1N5ZA 5LL6S 3JB9H 3CCUT 1BYMA 4OB3B 2CP5A 2K5LA 5I2MA 1WX6A 2OTLQ 3QJ6A 2YUNA 3OYFA 1AWWA 5J3BA 4A4EA 3CC4A 5GMKl 5AYFA 1Y96B 4EMHA 1Q81R 1I5OB 4JJCA 2P4TA 1UG1A 1TH7A 4PFOA 3PGGA 4Y91A 3X20B 3TSWA 2JTFA 2V1QA 4D6WA 3C95A 4M7AA 2KROA 2CH4W 1LPLA 2AT1B 2B8AA 5IN1A 2DZ9A 4BI4A 3M59A 3QHSA 4EMKA 5KCHA 1UE9A 4J9HA 3CCSQ 2MOXA 4Z88A 1U3OA 1YITA 1YJNQ 4KBMB 2RHIA 2EAYA 3GF5A 1XOVA 2DILA 3C12A 2OJ2A 1N8RC 1RAHB 1VIFA 5KYYB 2PQWA 2MWOA 3VRYA 1AD5A 4ZTJA 1NM7A 1M3BA 1RLQC 4FSXA 4KGVB 1VQNT 4JJNK 2A36A 2RD1A 4IIMA 5LJ3f 2ZPBB 3G6ET 1LNXA 1G3SA 2MMPA 2P84A 4IUPA 4RTXA 2O88A 2HCKA 2A7YA 1IO6A 4PJLA 3OBYA 3L2ZA 4PJOE 5J26A 2BZXA 3A8HB 3JB9D 4M7DE 2E4HA 4DBQA 1HD3A 1B07A 1VQOT 2QAZA 2QEXT 4XU0A 3BY7A 2LJ0A 4RTVA 1VQKT 3I55Q 2X51A 2LZ6B 9ATCB 2JM8A 3H0IA 2EBPA 2EVRA 1KQ2A 2D8JA 3REBB 2A37A 2K2VA 3NMZC 1PWTA 3V8LA 4J6WA 1SG5A 1RAEB 3JCMe 1H641 4C8QF 3HSBA 1NLOC 1KC8R 4M7AD 3A8LB 4X9DA 5FWBA 2DKGA 2YT6A 1GCPA 3HP9A 2PVOB 4C0DB 2X35A 2F2VA 4QKUA 4OMQA 3N5BB 2A08A 1M30A 3THKA 2EYWA 1VQ5A 4PJMA 5FW9A 1TU0B 4QQGA 1JJ2A 3QPHA 4IIOA 1HSQA 3WVDB 2D1XA 1VQ4A 4OGCA 5GAMg 3E19A 4F7UF 3EGUA 3KXTA 5GAOm 3OYBA 3REAB 1WHMA 1M1KR 1MNDA 3I56T 3RESA 3JCMh 3I5RA 3O8VA 3H8ZA 3PE0A 3RNJA 5LJ3j 2VUBA 1M27C 2EQJA 2F5KA 2IIMA 1XQHA 2ZAEA 4E47A 2LNHB 5CK9A 1YN8A 2RI2A 2RF0A 3GOXA 3OQ5A 1AHJB 4JRKA 5LJ3h 1C6VX 1UJYA 1K0XA 1BIBA 1WNLA 5LJ3g 2LQNA 3OW2A 2L5QA 3OMGA 3CXCP 2KK4A 4J9CA 2E3HA 4BE2A 4JLGA 5HKCA 1VQ9Q 1WXBA 1VQ6T 3QUIA 4XK8E 3OYCA 3OYNA 1D1CA 2DXCA 1UGQB 2P4RA 3EGXA 1SHGA 4DA4A 4M77G 3CCJQ 4LUEA 2EQMA 1FWZA 3G4SQ 4M77B 2O4XA 2IPOB 4Y28E 1AOJA 1KIKA 1G83A 1PM3A 2JMCA 2I0NA 1M90C 3EG3A 1YIJT 3CCVA 1QKXA 1BU1A 2KE9A 4JRQA 4A4FA 2DZCA 1VQ8T 5D6XA 3HL8A 3CD6A 1IXDA 1R0BG 1A0NB 1UHFA 4PJOC 1IZ6A 1AWOA 1QKWA 4XQ3A 4C0ZA 4A63B 1QP3A 2K3XA 3LX7A 3VV0A 3CCUA 5GMKi 2GBQA 1PHTA 4E2FB 2NUZA 2KYMA 1Q81C 3OW2S 1NEGA 2I2LA 2FRYA 4B6MA 4F17A 3SWNA 1R77A 2DM1A 4C92C 4BE0A 3OYMA 4J9BA 2DIGA 2OX7A 4D8KA 3NFCA 1K9MU 3CMEQ 1HXDA 3V7CA 2RM4A 3PIOA 1WHKA 2HKQB 1U06A 3S3OA 1VQOA 1WHLA 4M78G 1OZ2A 2M51A 4OB1B 3EFRA 4AFQC 4WF2A 4C8QD 1W2BA 3CCET 3PVLA 2RK1A 4PLIA 3QYHB 2LVMA 2L0AA 3MP8A 3G71Q 1VQLT 3S3NA 4NL3A 5IXFA 1U8RA 2DMOA 3UPUA 3CCSA 2M02A 1RI9A 2NUPA 3M58A 3CXCS 4OMMA 3PIPA 4TVRA 5FU6B 3NHNA 4HT8A 1UHCA 1GFDA 2ABLA 1N9RA 1XJWB 1BCMA 3R6OA 4QQ6A 5EG2A 1VQ7Q 1YJWA 3M55A 4ZN3A 3L2UA 1KSWA 5GAMh 3X28B 4YTLA 3CC7T 4M78B 5GMKh 3TQ7P 3FEOA 1WJQA 2FL7A 2OTJQ 3OYDA 3JCMX 1QCOA 3VRZA 5AT1B 1KQSA 4DQ2A 3CQTA 2MWPA 4IUVA 4AFUC 2EKHA 3KBGA 2RJCA 3OBWA 2QQBA 4DEXA 1M2VB 4OMFB 3RDVA 4CRIA 2NYSA 5DY9A 1Q7YR 4AFZC 4AG2C 2VGNA 1V76A 2MK5A 2AK5A 3DLMA 4C8QA 3H6ZA 4UC4A 2CP7A 2KR3A 2YRVA 3QKJA 4A53A 4BY6B 3OYLA 4ELYC 2V8IA 5FU7C 4PFPA 1YBYA 2VYTA 1RACB 3GNGA 3LWIA 2ESWA 2FEIA 4X9CA 1M2VA 2KBTA 5GAOp 5GANj 4JPBW 4ATOA 3HFNA 2LCCA 3JCMP 4JRIA 2HQXA 3EAEA 4PJNA 2XD0A 2QA4A 1ZA2B 4CC7A 1RL2A 2DL5A 3MEVA 3G6EQ 4HT9A 3SD4A 4C92E 1X6GA 5CVIA 2DX1A 1I0CA 3X24B 4ZGDB 3VYGA 2FO0A 1RAGB 4BDZA 1YFNA 1FYNA 1H92A 2CZ6B 2DRMA 4K11A 2YDLA 2KQWA 4XU2A 1WHHA 3I55T 4C5IA 7AT1B 2LMJA 3TU4K 1J3TA 1QCNA 2LT4A 4JRPA 4QT7A 3HTRA 2P0QA 2HSEB 1PRMC 3OS0A 2DTHA 1ZA1B 3PMTA 1KHCA 2A28A 2KRSA 3CC4Q 3L2WA 1OPLA 1KFZA 1V29B 2CUBA 2XIDA 4J8OA 1MV0B 3ZBDA 2DEQA 1WYXA 1IHVA 2GNCA 4C8QC 4JZ3A 2KGTA 3LLRA 3PTAA 4KUIA 2HBPA 3I9QA 3KUFA 3RKXA 3BFMA 1I81A 3VS2A 1TOVA 5I22A 4IUQA 1RUWA 1WQ7A 3R6NA 1C1AA 1BK2A 5KYWA 2VXEA 1YNZA 4XTUA 3CCRQ 4M7DF 3ME9A 3BDUA 2RNAA 1F1BB 2YUOA 3H0HA 4M78F 4KULA 1WHJA 4X1VA 1QLYA 3FDRA 1VQMA 3CCMA 3HKSA 1YHQA 1PSEA 4RCBA 2PNIA 1ZUYA 5FLXE 3DLLA 1X2QA 1HJDA 1VUBA 5KYWB 2H3JA 5CAIA 3EGDB 4IUTA 2V8JA 1WZOA 2CP2A 4FW2A 4C0DC 1WJSA 2M16A 3QBYA 1OI1A 1PC0A 1G3TA 4MZMA 2RQVA 4B9XA 3NTIA 2EJGA 5KH6A 2R58A 2YLBA 4Z8AA 2F2WA 2YWWA 1YJWQ 5FRMA 3J81E 2JTEA 3PT9A 1G2BA 1NJIU 5KYYA 2QQAA 1KHIA 2ZZDA 2LDMA 1YIJQ 3P8HA 3GIBA 1K76A 4DOWA 5KE2A 1VQPA 2RH2A 1RAFB 1RABB 3RMQA 3L2VA 2XKOC 1HK9A 3SFMA 1B7TA 4FU6A 2ROTA 2XK0A 4EPCA 4C92D 3EH2A 3QJYA 4PK4A 4PNOA 2SEMA 2FZKB 2X4YA 1KD1U 5KCOA 3SHWA 4KRTA 2YRDA 1VQ4Q 1WA7A 2LQWA 3VS7A 3ER0A 1AVZC 1KK7A 2PUKB 2E70A 4JZ4A 1RAAB 3QDFA 4ORZA 2NLUA 3VYHB 1E6GA 1VQ6A 1N6AA 4GBQA 2JXBA 1QW1A 2E10A 4PJOF 2ZPHB 3V8KA 3SWNB 2FZCB 2PTKA 3TREA 1AZEA 1K73C 2DK3A 2JS0A 2QA4Q 2LX7A 1VQNA 4XTWA 1S1NA 2V1RA 1MV3A 3VS5A 2DRKA 5A2QE 2WSCE 2E41A 3CC7A 1KJWA 4DBHA 1D1BA 2K9GA 1KD1C 3JB9I 1N8RU 3CCMQ 2X9HA 4BB7A 3A98A 4X34A 4J7IA 1X43A 4V2SA 1SHFA 5GANh 3I35A 4FT2A 3CCJA 4JS5A 3M4YA 1C0MA 2VGMA 4C92A 4JDSA 1O9SA 4M7DB 1PD1A 1OZ3A 1OX9A 4C8QG 3FB9A 4N4GA 5CKEA 1QVFP 2AIRB 2RQUA 2OTJT 2DXTA 4RTWA 3CCQT 2OTLT 3CMAQ 1G5VA 2E3IA 2LJ3A 4E7LA 1GCQC 1LJOA 3EG1A 3P8DA 4NS5A 2M1HA 3FC3A 3LYIA 2COZA 3SB2A 2L8DA 3NPFA 1MUZA 2VV5A 4E7KA 2JN0A 3G71A 4M78A 1TWBA 3EG9B 2EQUA 2QGFB 3CCEA 1YJ9Q 1G8XA 2NUTB 5FRNA 1S72A 4R55A 1S72Q 3AT1B 3CCST 1LCKA 2COYA 4DBFA 5GANg 2DA9A 3DB3A 3C94A 1Z9ZA 1Z9QA 2DTOA 3OYIA 1PG5B 3D7SB 2CKKA 3M0RA 1TSFA 1Q86R 2DXUA 2WSFE 1IGUA 1UDLA 2JUFA 2JT4A 2QQSA 3NTHA 4OGEA 1NEBA 4FIBA 4IKFA 2KYBA 1I5LA 4M75C 4PLLA 2RJFA 4JS4A 3INZA 2K5FA 1UFFA 1T3SA 5M9OA 2X3WD 4LDWA 4PJOB 1ARKA 2FG0A 2HEQA 1PKSA 1VQOQ 2CYZB 3JCMf 4E6RA 4HVWA 3CCVT 1K9MC 1E7OA 2CZ1B 2FZGB 4L59A 1EFNA 4OB0B 4JLIA 2K3BA 2CSQA 1VQKQ 5L23A 1X27A 2CSIA 2J6KA 4HVVA 1WHGA 2GQVA 4M78D 3CCLQ 2R5AA 4FSSA 1WIEA 3QSUA 2QASA 2PUOB 5CQXA 3JCMg 4MMLA 3JCMd 2RQRA 1TG0A 2QK0A 4GY5A 3CPWA 4M4ZA 4CC3A 4FYVB 1X6OA 2RQWA 3VUZA 1YI2A 3QWXX 1K0SA 4Q5WA 5CCAA 3L2RA 4FL6A 3CC4T 1P92A 3VS4A 4ZGEB 1QQJA 4NL2A 1UGRB 1YWPA 2ZPGB 2ECZA 2QG9B 1U1TA 1OYXA 1UJ0A 4M7AC 5IXBA 3OMCA 3M53A 1AT1B 1FXXA 2ZGWA 4J83A 4MZPA 4QVZA 4EMKC 3TSZA 2F2XA 1W70A 1I07A 2VC8A 2DD4A 4RTYA 2K57A 3GPLA 1H3HA 2GTOA 1ZSZB 3VU3C 1ZHIA 3I56Q 4AFSC 1MMAA 5L8RE 4OP0A 3CCRT 1ZUUA 5J39A 4KGXB 1D0YA 2F5TX 3H0FA 1JXOA 3RMSA 2DF6A 2JS2A 2LP5A 1NYGA 5GANd 2EJFA 3MPUB 3QIIA 2L3QA 1YIJA 3OW2P 1MNEA 2JW4A 2O9SA 3EG2A 1VQPQ 1GXIE 4BI8B 2CP0A 3CPFA 2RPNA 3CBOA 4KH0B 3RIRA 3MP6A 1X6BA 3EFOB 1VQ9T 2AZVA 1GL5A 2CT4A 1M8VA 2O01E 3OYGA 4ZGJB 1T0HA 1X75C 1TUCA 3E9FA 2KXDA 1PNJA 2MI6A 2Z0WA 1D3BB 2HQEA 1Q86U 5I11A 2MAMA 4VUBA 3TVTA 1GRIA 2DL7A 1JU5C 4LE9A 2B86A 1PD0A 2D9TA 3FRNA 3M0TA 1WXUA 4ANJA 1KC8C 1SF9A 2MIOA 1NE8A 2E6NA 4E7IA 2YHTA 1Y71A 2EYXA 3SDZA 4RMOA 2KSSA 5KYNA 3VS1A 3L42A 2LTOA 1VQ8A 3G7ZA 2RHYA 3CBMA 2DIQA 3EGXB 3CD6T 4P5NA 1YI2T 2OTJA 3MJXA 4FT4A 2DEUA 4XU3A 4Y92A 2COWA 4XTZA 2J7IA 5HK3A 3CCRA 1Q82C 2LCLA 1OQKA 1ZBXA 2DJQA 2Y90A 3DKMA 1NLPC 1VQ4T 4FYWB 3AHUA 3ZEHA 3OS2A 4M75G 2KVQG 1JB0E 2ED0A 2CT3A 2QEXA 1YJNA 1WDXA 4KH1B 4XAXB 3GNFB 1BKBA 1JXMA 1K1ZA 5GAOr 2YRCA 1X2KA 1QVGS 2KRNA 2M0OA 1ACMB 3CCEQ 2GF7A 4LNPA 4AMCA 2X3XD 3CBPA 1YCSB 4J9EA 5I21A 4JJBA
chains in the Genus database with same CATH topology
1Y0MA 4OMPA 3JV3A 1AWXA 1CKBA 4J9DA 2LJ0A 4RTVA 1PKTA 4RTZA 1GBQA 2LZ6B 2JM8A 3H0IA 2RQVA 2EBPA 2EVRA 2D8JA 1W1FA 3REBB 5IHNA 2A37A 1X69A 2DL4A 3NMZC 1PWTA 4Z8AA 2F2WA 2YUPA 3C0CA 1AWJA 1NLOC 2JTEA 2J6OA 5FWBA 1BBZA 1QWFA 5IHKA 1G2BA 1GCPA 2DVJA 2O2OA 2YT6A 3VS3A 2VWFA 4ESRA 1W6XA 2F2VA 4OMQA 4ZNXA 2EW3A 1SSHA 2A08A 1M30A 2AKLA 2W10A 2DBKA 3THKA 2EYWA 1K76A 2YSQA 3EHQA 5FW9A 2KT1A 4RTTA 2ROTA 1GBRA 2W0ZA 3KFVA 4J9GA 4IIOA 1HSQA 2SEMA 2J6FA 2D1XA 1K4US 2CUDA 3SHWA 4KRTA 1OEBA 2BZ8A 1WA7A 2LQWA 3EGUA 3VS7A 4HVUA 3REAB 1AVZC 4JZ4A 1E6HA 2DBMA 4ORZA 1YP5A 3I5RA 2J06A 3PE0A 3RNJA 2JMAA 1JEGA 1E6GA 1M27C 2JXBA 3PVQA 2IIMA 4GBQA 2LNHB 1ZBJA 1RLPC 1SRLA 3QWYA 1YN8A 2PTKA 2RF0A 3O5ZA 1AZEA 1VYUA 2JS0A 1UJYA 2LX7A 1K0XA 2K2MA 2HBWA 5GJWB 1S1NA 2C0TA 2LQNA 1GFCA 1JO8A 2V1RA 3LH5A 4J9CA 4J9FA 1MV3A 3VS5A 3M0SA 2DRKA 1WXBA 4HCKA 1KJWA 2K9GA 3UATA 2P4RA 1M3AA 3NGPA 3A98A 2EQIA 1SHGA 1X43A 1SHFA 2EGEA 3I35A 4LUEA 1PRLC 1ZLMA 2ENMA 2MCNA 1SEMA 1AOJA 1KIKA 1G83A 4LUDA 5FWCA 2JMCA 2I0NA 2K7AA 3EG3A 2SRCA 2E5KA 1QKXA 1BU1A 1UGVA 2KE9A 2EGAA 4F14A 2GQIA 2D8HA 2DYBA 1I1JA 3EHRA 3ULRB 4RTUA 2ED1A 4EIKA 2KT8A 2QDLA 2RQUA 2DL3A 1OOTA 2DL8A 1A0NB 1FMKA 1UHFA 2AZSA 4RTWA 1U5SA 4CC2A 1AWOA 1QKWA 4A63B 1WXTA 3UF4A 2LJ3A 1GCQC 3EG1A 2GBQA 1Y57A 1PHTA 4J9IA 2NUZA 2KYMA 3NPFA 1MUZA 2EPDA 1NEGA 2FRYA 4OMLA 2BTTA 4F17A 2DM1A 4WCIA 2DLPA 4Z89A 4J9BA 2BZYA 4D8KA 2HDAA 2KNBB 2L2PA 1OV3A 5GJVB 1LCKA 1U06A 3FJ5A 3ZL7C 2DA9A 2KRMA 1Z9ZA 1Z9QA 1WI7A 2M51A 2LJ1A 3M0RA 4AFQC 2CH4A 3PVLA 1AZGB 3M0PA 2GTJA 5IH2A 3I5SA 1UDLA 2L0AA 1JQQA 2JT4A 3SEMA 1NEBA 5IXFA 1VYVA 2KYBA 2DMOA 2JM9A 1UFFA 1RI9A 1T3SA 4HXJA 4OMMA 2X3WD 1V1CA 1ABQA 1TUDA 3NHNA 1K9AA 1UHCA 1CSKA 1ARKA 1GFDA 2ABLA 2FG0A 2K79A 2HEQA 1PKSA 4E6RA 4HVWA 3GBQA 3UA6A 4R0KA 1AEYA 1E7OA 3IQLA 3U23A 3RBBB 1EFNA 1KSWA 2FRWA 2K3BA 2CSQA 1QWEA 5L23A 2NWMA 1X27A 1ZUKA 2CSIA 2AKKA 5ECAA 1ZX6A 2EGCA 3VS0A 2J6KA 2CDTA 4HVVA 1OPKA 4DEYA 4FSSA 1WIEA 3VRZA 2VKNA 3CQTA 2RMOA 2LCSA 1NG2A 5IHIA 4AFUC 2RQRA 1M8MA 1GCQA 1TG0A 2EKHA 2YUQA 1ZSGA 1B3QA 2C0OA 4M4ZA 5HCKA 4CC3A 4DEXA 1UTIA 2L3SA 2RQWA 1M3CA 4J9EA 5EC7A 3QWXX 4F16A 4D8DA 1K0SA 1BB9A 4AFZC 1UECA 1CKAA 4AG2C 1WLPB 2EYZA 3VS4A 3VS6A 2HSPA 2O9VA 1UUEA 2AK5A 2VVKA 1YWPA 2ECZA 1UJ0A 2KR3A 5IXBA 3H41A 2DE0X 2GGRA 3TSZA 2F2XA 1H8KA 1W70A 4OMNA 4OMOA 1I07A 2ESWA 4RTYA 2FEIA 1QCFA 4JJDA 1YWOA 1H3HA 2G6FX 2GTOA 1VYTA 2KBTA 2ROLA 4RUGA 1WFWA 4JPBW 3M0QA 2RN8A 1ABOA 1SRMA 4AFSC 1ZUUA 2L3PA 3H0FA 2C0IA 3EG0A 4LN2A 1JXOA 2DF6A 2JS2A 2FPDA 2LP5A 1NYGA 4CC7A 2DL5A 1T0JA 2FPEA 4CC4B 2L3QA 1X6GA 2FPFA 2DX1A 1I0CA 1NYFA 2JW4A 2O9SA 3EG2A 1T3LA 2FO0A 1SPKA 3UA7A 2KXCA 2D0NA 1FYNA 2RPNA 2RQTA 1H92A 2DNUA 2DRMA 1X6BA 1N5ZA 2AZVA 4K11A 2YDLA 1GL5A 2CT4A 1T0HA 2O31A 1TUCA 2KEAA 4AG1C 2KXDA 1PNJA 2LMJA 1J3TA 2M0YA 4QT7A 2EYYA 5I11A 1WX6A 2YUNA 1PRMC 1AWWA 1GRIA 3TVTA 2DL7A 1JU5C 4LE9A 2B86A 3M0TA 1VA7A 2A28A 2KRSA 1WXUA 1OPLA 2MIOA 1KFZA 4JJCA 2CUBA 1UG1A 1MV0B 2EYXA 3M0UA 1WYXA 2GNCA 3TSWA 2V1QA 4JZ3A 3VS1A 2KGTA 2XMFA 2CREA 2KROA 2CH4W 3I9QA 2H8HA 1UE9A 3VS2A 4J9HA 2MOXA 5I22A 4Z88A 1U3OA 1RUWA 3R6NA 1BK2A 1YNZA 4Y92A 2J7IA 2PZ1A 2OI3A 2DJQA 1XOVA 1NLPC 2DILA 2RNAA 2OJ2A 2YUOA 2ED0A 2J05A 2CT3A 3H0HA 3VRYA 1AD5A 1WDXA 4X1VA 1QLYA 1NM7A 1M3BA 1JXMA 1RLQC 1K1ZA 2A36A 4IIMA 1X2KA 4RTXA 2K6DA 2O88A 2HCKA 2PNIA 2KRNA 1ZUYA 1IO6A 1X2QA 4LNPA 2X3XD 2BZXA 2OAWA 1HJDA 4GLMA 1HD3A 1YCSB 1B07A 4JJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0M A;  4OMP A;  3JV3 A;  1AWX A;  1CKB A;  4J9D A;  2LJ0 A;  4RTV A;  1PKT A;  4RTZ A;  1GBQ A;  2LZ6 B;  2JM8 A;  3H0I A;  2RQV A;  2EBP A;  2EVR A;  2D8J A;  1W1F A;  3REB B;  5IHN A;  2A37 A;  1X69 A;  2DL4 A;  3NMZ C;  1PWT A;  4Z8A A;  2F2W A;  2YUP A;  3C0C A;  1AWJ A;  1NLO C;  2JTE A;  2J6O A;  5FWB A;  1BBZ A;  1QWF A;  5IHK A;  1G2B A;  1GCP A;  2DVJ A;  2O2O A;  2YT6 A;  3VS3 A;  2VWF A;  4ESR A;  1W6X A;  2F2V A;  4OMQ A;  4ZNX A;  2EW3 A;  1SSH A;  2A08 A;  1M30 A;  2AKL A;  2W10 A;  2DBK A;  3THK A;  2EYW A;  1K76 A;  2YSQ A;  3EHQ A;  5FW9 A;  2KT1 A;  4RTT A;  2ROT A;  1GBR A;  2W0Z A;  3KFV A;  4J9G A;  4IIO A;  1HSQ A;  2SEM A;  2J6F A;  2D1X A;  1K4U S;  2CUD A;  3SHW A;  4KRT A;  1OEB A;  2BZ8 A;  1WA7 A;  2LQW A;  3EGU A;  3VS7 A;  4HVU A;  3REA B;  1AVZ C;  4JZ4 A;  1E6H A;  2DBM A;  4ORZ A;  1YP5 A;  3I5R A;  2J06 A;  3PE0 A;  3RNJ A;  2JMA A;  1JEG A;  1E6G A;  1M27 C;  2JXB A;  3PVQ A;  2IIM A;  4GBQ A;  2LNH B;  1ZBJ A;  1RLP C;  1SRL A;  3QWY A;  1YN8 A;  2PTK A;  2RF0 A;  3O5Z A;  1AZE A;  1VYU A;  2JS0 A;  1UJY A;  2LX7 A;  1K0X A;  2K2M A;  2HBW A;  5GJW B;  1S1N A;  2C0T A;  2LQN A;  1GFC A;  1JO8 A;  2V1R A;  3LH5 A;  4J9C A;  4J9F A;  1MV3 A;  3VS5 A;  3M0S A;  2DRK A;  1WXB A;  4HCK A;  1KJW A;  2K9G A;  3UAT A;  2P4R A;  1M3A A;  3NGP A;  3A98 A;  2EQI A;  1SHG A;  1X43 A;  1SHF A;  2EGE A;  3I35 A;  4LUE A;  1PRL C;  1ZLM A;  2ENM A;  2MCN A;  1SEM A;  1AOJ A;  1KIK A;  1G83 A;  4LUD A;  5FWC A;  2JMC A;  2I0N A;  2K7A A;  3EG3 A;  2SRC A;  2E5K A;  1QKX A;  1BU1 A;  1UGV A;  2KE9 A;  2EGA A;  4F14 A;  2GQI A;  2D8H A;  2DYB A;  1I1J A;  3EHR A;  3ULR B;  4RTU A;  2ED1 A;  4EIK A;  2KT8 A;  2QDL A;  2RQU A;  2DL3 A;  1OOT A;  2DL8 A;  1A0N B;  1FMK A;  1UHF A;  2AZS A;  4RTW A;  1U5S A;  4CC2 A;  1AWO A;  1QKW A;  4A63 B;  1WXT A;  3UF4 A;  2LJ3 A;  1GCQ C;  3EG1 A;  2GBQ A;  1Y57 A;  1PHT A;  4J9I A;  2NUZ A;  2KYM A;  3NPF A;  1MUZ A;  2EPD A;  1NEG A;  2FRY A;  4OML A;  2BTT A;  4F17 A;  2DM1 A;  4WCI A;  2DLP A;  4Z89 A;  4J9B A;  2BZY A;  4D8K A;  2HDA A;  2KNB B;  2L2P A;  1OV3 A;  5GJV B;  1LCK A;  1U06 A;  3FJ5 A;  3ZL7 C;  2DA9 A;  2KRM A;  1Z9Z A;  1Z9Q A;  1WI7 A;  2M51 A;  2LJ1 A;  3M0R A;  4AFQ C;  2CH4 A;  3PVL A;  1AZG B;  3M0P A;  2GTJ A;  5IH2 A;  3I5S A;  1UDL A;  2L0A A;  1JQQ A;  2JT4 A;  3SEM A;  1NEB A;  5IXF A;  1VYV A;  2KYB A;  2DMO A;  2JM9 A;  1UFF A;  1RI9 A;  1T3S A;  4HXJ A;  4OMM A;  2X3W D;  1V1C A;  1ABQ A;  1TUD A;  3NHN A;  1K9A A;  1UHC A;  1CSK A;  1ARK A;  1GFD A;  2ABL A;  2FG0 A;  2K79 A;  2HEQ A;  1PKS A;  4E6R A;  4HVW A;  3GBQ A;  3UA6 A;  4R0K A;  1AEY A;  1E7O A;  3IQL A;  3U23 A;  3RBB B;  1EFN A;  1KSW A;  2FRW A;  2K3B A;  2CSQ A;  1QWE A;  5L23 A;  2NWM A;  1X27 A;  1ZUK A;  2CSI A;  2AKK A;  5ECA A;  1ZX6 A;  2EGC A;  3VS0 A;  2J6K A;  2CDT A;  4HVV A;  1OPK A;  4DEY A;  4FSS A;  1WIE A;  3VRZ A;  2VKN A;  3CQT A;  2RMO A;  2LCS A;  1NG2 A;  5IHI A;  4AFU C;  2RQR A;  1M8M A;  1GCQ A;  1TG0 A;  2EKH A;  2YUQ A;  1ZSG A;  1B3Q A;  2C0O A;  4M4Z A;  5HCK A;  4CC3 A;  4DEX A;  1UTI A;  2L3S A;  2RQW A;  1M3C A;  4J9E A;  5EC7 A;  3QWX X;  4F16 A;  4D8D A;  1K0S A;  1BB9 A;  4AFZ C;  1UEC A;  1CKA A;  4AG2 C;  1WLP B;  2EYZ A;  3VS4 A;  3VS6 A;  2HSP A;  2O9V A;  1UUE A;  2AK5 A;  2VVK A;  1YWP A;  2ECZ A;  1UJ0 A;  2KR3 A;  5IXB A;  3H41 A;  2DE0 X;  2GGR A;  3TSZ A;  2F2X A;  1H8K A;  1W70 A;  4OMN A;  4OMO A;  1I07 A;  2ESW A;  4RTY A;  2FEI A;  1QCF A;  4JJD A;  1YWO A;  1H3H A;  2G6F X;  2GTO A;  1VYT A;  2KBT A;  2ROL A;  4RUG A;  1WFW A;  4JPB W;  3M0Q A;  2RN8 A;  1ABO A;  1SRM A;  4AFS C;  1ZUU A;  2L3P A;  3H0F A;  2C0I A;  3EG0 A;  4LN2 A;  1JXO A;  2DF6 A;  2JS2 A;  2FPD A;  2LP5 A;  1NYG A;  4CC7 A;  2DL5 A;  1T0J A;  2FPE A;  4CC4 B;  2L3Q A;  1X6G A;  2FPF A;  2DX1 A;  1I0C A;  1NYF A;  2JW4 A;  2O9S A;  3EG2 A;  1T3L A;  2FO0 A;  1SPK A;  3UA7 A;  2KXC A;  2D0N A;  1FYN A;  2RPN A;  2RQT A;  1H92 A;  2DNU A;  2DRM A;  1X6B A;  1N5Z A;  2AZV A;  4K11 A;  2YDL A;  1GL5 A;  2CT4 A;  1T0H A;  2O31 A;  1TUC A;  2KEA A;  4AG1 C;  2KXD A;  1PNJ A;  2LMJ A;  1J3T A;  2M0Y A;  4QT7 A;  2EYY A;  5I11 A;  1WX6 A;  2YUN A;  1PRM C;  1AWW A;  1GRI A;  3TVT A;  2DL7 A;  1JU5 C;  4LE9 A;  2B86 A;  3M0T A;  1VA7 A;  2A28 A;  2KRS A;  1WXU A;  1OPL A;  2MIO A;  1KFZ A;  4JJC A;  2CUB A;  1UG1 A;  1MV0 B;  2EYX A;  3M0U A;  1WYX A;  2GNC A;  3TSW A;  2V1Q A;  4JZ3 A;  3VS1 A;  2KGT A;  2XMF A;  2CRE A;  2KRO A;  2CH4 W;  3I9Q A;  2H8H A;  1UE9 A;  3VS2 A;  4J9H A;  2MOX A;  5I22 A;  4Z88 A;  1U3O A;  1RUW A;  3R6N A;  1BK2 A;  1YNZ A;  4Y92 A;  2J7I A;  2PZ1 A;  2OI3 A;  2DJQ A;  1XOV A;  1NLP C;  2DIL A;  2RNA A;  2OJ2 A;  2YUO A;  2ED0 A;  2J05 A;  2CT3 A;  3H0H A;  3VRY A;  1AD5 A;  1WDX A;  4X1V A;  1QLY A;  1NM7 A;  1M3B A;  1JXM A;  1RLQ C;  1K1Z A;  2A36 A;  4IIM A;  1X2K A;  4RTX A;  2K6D A;  2O88 A;  2HCK A;  2PNI A;  2KRN A;  1ZUY A;  1IO6 A;  1X2Q A;  4LNP A;  2X3X D;  2BZX A;  2OAW A;  1HJD A;  4GLM A;  1HD3 A;  1YCS B;  1B07 A;  4JJB A; 
#chains in the Genus database with same CATH topology
 1Y0M A;  4OMP A;  1EZZ B;  4M7A E;  2QA4 T;  3OYY A;  5GAN f;  2VAS A;  1GBQ A;  2XDD A;  1Q81 U;  4M75 E;  5A0D A;  2BUD A;  2JZ2 A;  1VIE A;  1TUG B;  5GAN 6;  1W1F A;  1B34 A;  2G3R A;  1I8F A;  1X69 A;  5D7U A;  2YUP A;  4OB2 B;  1AWJ A;  2EJ9 A;  2FYK A;  3S6W A;  1NPP A;  1QWF A;  5IHK A;  1SKU B;  2DVJ A;  4A4K A;  3VS3 A;  1OUL A;  3JB9 J;  4ESR A;  3HPW A;  2JNG A;  3UDC A;  1UB4 A;  2EW3 A;  2DBK A;  4L5G A;  1NZ9 A;  2YSQ A;  1UGP B;  1MMD A;  1WQW A;  3EHQ A;  4RTT A;  5GAN 3;  3CPW S;  3BE3 A;  1GBR A;  2W0Z A;  3CMA T;  2LRQ A;  3J80 E;  3ASK A;  1FMV A;  1EX4 A;  3S3M A;  4RG2 A;  1KQS S;  1K4U S;  2QGG A;  3MP1 A;  1OEB A;  4N4H A;  1W4S A;  2BZ8 A;  3OYH A;  4DBR A;  2RHU A;  5A0L A;  1VQM T;  3F70 A;  1E6H A;  1M9S A;  3EFO A;  2QQ9 A;  1YP5 A;  1SSF A;  3PMI A;  3CC2 T;  2DET A;  5KYX B;  1YIT T;  5FRO A;  2J06 A;  4ZTF A;  2EIF A;  2MF2 A;  4C5E A;  2QDY B;  1S72 T;  1PSF A;  1RLP C;  1SRL A;  2CZ7 B;  1I4K 1;  3WVE B;  1VQK A;  1MGQ A;  5GAO n;  2K2M A;  5GJW B;  2DXB A;  2C0T A;  1VOM A;  5GAO q;  1JO8 A;  4J9F A;  3FIF A;  3PFS A;  3M0S A;  2HQH A;  4C92 G;  4B9W A;  1NJI R;  1G3W A;  4M7D G;  1M1G A;  5D6W A;  2DVE A;  3LGF A;  3CEY A;  2EGE A;  4EDU A;  5CKD A;  1PRL C;  1DJ7 B;  3X26 B;  2MCN A;  2KY9 A;  1RI0 A;  2DER A;  5GAN 2;  2EFI A;  4LUD A;  5FWC A;  2K7A A;  2E5K A;  4JUV A;  1UGV A;  1O75 A;  2EGA A;  4F14 A;  2GQI A;  3MKD A;  2DYB A;  3EHR A;  4CI0 C;  4RTU A;  2C06 A;  1G3Y A;  2VB6 A;  2XHC A;  1IGQ A;  2DL8 A;  2CP6 A;  4ELZ C;  1FMK A;  3OSS C;  3CME A;  2RHZ A;  5FU7 B;  2DTI A;  1QVP A;  3Q1J A;  4J9I A;  2E6Z A;  2F69 A;  4XTV A;  5CR2 A;  1YJN T;  4M77 C;  1WPY A;  1M1K C;  2LT1 A;  5GMK m;  5HK0 A;  4Z89 A;  3L2Q A;  2OTL A;  2NUP B;  2BZY A;  4BDY A;  1TXQ A;  5KE3 A;  4A4G A;  5GMK e;  2QYZ A;  1OU9 A;  2K3Y A;  3VKI A;  2RB6 A;  3QZ9 B;  3FJ5 A;  4A4H A;  2AHJ B;  2KRM A;  4QVC A;  3M54 A;  3E2U A;  1KQS P;  2CH4 A;  2E65 A;  4F7U B;  3I5S A;  4NOY A;  3CPW P;  5CQY A;  3V8J A;  2QEX Q;  4C92 B;  2LNV A;  4PJO G;  1Y07 A;  1VYV A;  2FVU A;  4BY6 C;  5C6S A;  1OX8 A;  1K9M R;  3A8M B;  1V1C A;  1ABQ A;  1TUD A;  4C8Q E;  3QZ5 B;  1K9A A;  2KMT A;  2K79 A;  1KC8 U;  3QXE B;  2E12 A;  3UA6 A;  4R0K A;  4BAC A;  1AEY A;  1M90 R;  3IQL A;  2A0F B;  3M56 A;  3QYG B;  2MPX C;  2WAC A;  1VQP T;  1QWE A;  4F7U A;  2JTM A;  2NWM A;  2CS7 A;  3V7S A;  1ZUK A;  1ZSZ A;  2KI7 A;  2AKK A;  5ECA A;  2EGC A;  2CDT A;  1OPK A;  2HKN A;  8ATC B;  4FYY B;  5GAN 7;  2RMO A;  4AT1 B;  5C0M A;  2X4J A;  2YLC A;  1NG2 A;  5IHI A;  1YJW T;  2RJE A;  3M4G A;  2YUQ A;  1ZSG A;  5HCK A;  1UTI A;  2L3S A;  5LJ5 h;  1EIF A;  4IUU A;  1LOJ A;  2VXF A;  4F16 A;  3I56 A;  2V8K A;  8AT1 B;  4D8D A;  5IT9 E;  4RKU E;  1RAI B;  4FYX B;  1BB9 A;  2RA2 A;  3TCJ A;  1CKA A;  3M5A A;  1WLP B;  2EYZ A;  1ZSZ C;  3JCM Q;  2O9V A;  1UUE A;  2LC4 A;  4MDX A;  1QVF A;  2DE0 X;  3J7A F;  2E64 A;  3JCM J;  2GGR A;  3OYJ A;  2L89 A;  4OMO A;  4OMN A;  1YHQ T;  1YWO A;  2G6F X;  1VYT A;  1M5Q 1;  3HRU A;  3NTK A;  5KYU A;  2ROL A;  4RUG A;  2RN8 A;  1W2B S;  2E1H A;  1SRM A;  1Y96 A;  3RER A;  4KGZ B;  1K8A R;  2HAX A;  3OY9 A;  1LVK A;  2C0I A;  3VUB A;  1OU8 A;  3MCA B;  5CO7 A;  4Z02 A;  4BD3 A;  2KDS A;  2EKO A;  4CC4 B;  4M7A G;  2QXF A;  3H9N A;  4M7A F;  1NYF A;  4QW2 A;  1T3L A;  4KUD K;  2RI5 A;  2HD0 A;  2R5M A;  4LXC A;  4ME7 A;  3UA7 A;  2RQT A;  2EQK A;  5I2S A;  4O5V A;  2RJD A;  2LQ8 A;  5GAN 8;  1BCO A;  1BIA A;  1VQ8 Q;  2HL5 C;  2O31 A;  2KEA A;  4AG1 C;  3UT1 A;  1KQ1 A;  1QP2 A;  2M0Y A;  3OYA A;  2HL3 A;  3CCL A;  2EYY A;  2IG0 A;  3FJP A;  1JBM A;  2DD5 A;  4A54 A;  3M9Q A;  3HHT B;  3JB9 F;  2H3E B;  1Q7Y C;  1VA7 A;  1RAD B;  3JSC A;  3L1A A;  3MHX A;  2DO3 A;  3M0U A;  1R8O B;  1IRX A;  1H3Z A;  5LJ3 e;  4MDW A;  2XDB A;  3CCQ Q;  2IVW A;  2XMF A;  2CRE A;  5LJ5 f;  2QI2 A;  1R0C B;  3ZFJ A;  1VQ5 T;  2XI9 A;  3G1J A;  2XIC A;  3CC2 A;  4QQD A;  2H8H A;  2ZPE B;  1X01 A;  3URG A;  3VJP A;  1D0Z A;  4N0A C;  2PZ1 A;  4N4I A;  5LJ3 d;  4E7H A;  3EH1 A;  1Q86 C;  2OI3 A;  1YJ9 T;  4RCC A;  4M77 E;  3A8O B;  5DLQ E;  2J05 A;  1XNI A;  3G71 T;  4F04 B;  4MMK A;  1Y7X A;  4PL6 A;  1W2B P;  4ZN1 A;  3CC2 Q;  4LDU A;  4M77 D;  3OS5 A;  1YIT Q;  2K6D A;  2E5Q A;  3MET A;  4L6V 5;  3C4S A;  1BI2 A;  4J6Y A;  4LDV A;  3WXM B;  4HA8 A;  1YJ9 A;  2EWN A;  2OAW A;  4GLM A;  3MEA A;  5LJ5 g;  1VQ7 T;  1BI1 A;  1MMN A;  1AWX A;  3JV3 A;  3V7R A;  1U1S A;  1YCY A;  1ZQ1 A;  4LDY A;  1CKB A;  4J9D A;  2F1L A;  3CCU Q;  2JOY A;  2KAF A;  4IUR A;  1PKT A;  5GAM d;  4RTZ A;  1Q7Y U;  1JJ2 S;  4PJJ A;  3JRZ A;  5IHN A;  3PNW C;  1KD1 R;  2DL4 A;  3C0C A;  3CCV Q;  4LD6 A;  5GAM j;  3CCQ A;  1NBE B;  1QVG P;  3RKY A;  3CMA A;  4M75 D;  2J6O A;  3OYK A;  1BBZ A;  2Y4X A;  2O2O A;  2VWF A;  1MMG A;  1W6X A;  3I55 A;  3EGD A;  2V26 A;  4ZNX A;  2ATC B;  1SSH A;  5CKF A;  2AKL A;  2W10 A;  3CCL T;  5IAY A;  3A1P A;  5GAN e;  2D6F A;  1QVG A;  2KT1 A;  1D0X A;  2ZCF B;  4J6X A;  2QTV A;  1TTH B;  4WTO B;  3KFV A;  4LDX A;  4J9G A;  2O4X B;  1IRE B;  2GFU A;  1K73 U;  2J6F A;  2BKD N;  2CUD A;  3A8G B;  4M77 A;  4HVU A;  1WGS A;  2DJZ A;  2R57 A;  2YXY A;  2DBM A;  3HFO A;  5GAM e;  5LJ5 d;  1VQN Q;  1B34 B;  1N27 A;  2CP3 A;  2JMA A;  2WSE E;  1JEG A;  2PU9 B;  1NPR A;  4GLK A;  3PVQ A;  1ZBJ A;  3JCM W;  4XU1 A;  3QWY A;  3M57 A;  4OVA A;  3A5Z B;  1FMW A;  3O5Z A;  1VQ9 A;  4EMG A;  2L3R A;  5LJ5 e;  3UWN A;  1VYU A;  2P0K A;  2HBW A;  1GFC A;  3LH5 A;  3OB9 A;  1QVF S;  4M78 E;  4M75 A;  5CKH A;  4HCK A;  3LH0 A;  4F7U E;  2K5I A;  2DPP B;  1HYO A;  1PCX A;  2XDP A;  3UAT A;  1M3A A;  3NGP A;  4J5Y A;  2EQI A;  3LWH A;  1NJI C;  1IB8 A;  5GAN 4;  1ZLM A;  4E7S A;  2HNI A;  2ENM A;  3EG9 A;  1SEM A;  5GAO l;  4HCB A;  1MHN A;  3JB9 G;  3SWN C;  2SRC A;  1M1F A;  2RI3 A;  4MZT A;  2NUT A;  5KYX A;  2D8H A;  5DM7 R;  3DB4 A;  1I1J A;  3ULR B;  4EIK A;  2ED1 A;  5GMK j;  1Q82 U;  2BE9 B;  2KT8 A;  2A3L A;  1M4Z A;  2QDL A;  2DL3 A;  2CGH A;  1OOT A;  1K8A U;  4RG8 A;  2AZS A;  3RUX A;  1U5S A;  5FU6 C;  4CC2 A;  1WXT A;  3UF4 A;  3QG1 A;  5HY6 A;  1Y57 A;  5D6Y A;  3QO3 A;  4C0F A;  2EPD A;  1N9S A;  5CKB A;  5CIU A;  4OML A;  2BTT A;  4E7Z A;  4WCI A;  2BE7 D;  4C92 F;  3QDR B;  3X25 B;  3E9G A;  2LQK A;  3JCM V;  2RHX A;  2DLP A;  3MEU A;  4M7D A;  4FCY A;  1N8R R;  4FM4 B;  1VQL A;  2HDA A;  2KNB B;  3CD6 Q;  2L2P A;  1YI2 Q;  1OV3 A;  4PJO A;  4PFZ A;  1WJR A;  5GJV B;  3FLG A;  1QMC A;  3ZL7 C;  4E7J A;  1FX7 A;  1D1A A;  2GFA A;  2PVG B;  3E1S A;  1WI7 A;  1M90 U;  4M75 F;  2LJ1 A;  3MO8 A;  5DLO A;  1K73 R;  1YHQ Q;  3G4S A;  2FHD A;  1AZG B;  3M0P A;  2GTJ A;  5IH2 A;  3HRT A;  1JQQ A;  2HZY A;  2HMA A;  2PVD B;  1UGS B;  3SEM A;  2P0P A;  1M1K U;  1VQ6 Q;  2JM9 A;  4M7A B;  3OS1 A;  1TS9 A;  3EFS A;  2DAQ A;  4HXJ A;  3P8B B;  5A0G A;  2JJ9 A;  3RKW A;  4EMK B;  3CCJ T;  1CSK A;  2BIV A;  3G4S T;  4C5H A;  3MEW A;  2QQR A;  5KYU B;  3GBQ A;  1UEB A;  4R56 A;  1IHW A;  4OF1 A;  3LGL A;  3U23 A;  3RBB B;  2FRW A;  1D09 B;  4M77 F;  4HKE A;  1ZX6 A;  2ZPI B;  1JJ2 P;  3JCM b;  3OA6 A;  3JCM c;  3VS0 A;  2LX9 A;  4DOV A;  2XU8 A;  1KG1 A;  4DEY A;  1M2O A;  2RO0 A;  2VKN A;  5GAM f;  2DYI A;  2LCS A;  4M7D D;  1M8M A;  1GCQ A;  4BUG A;  1B3Q A;  2C0O A;  5LJ5 j;  3LW5 E;  1M3C A;  5EC7 A;  4HCZ A;  4PJO D;  4M78 C;  1UEC A;  3JAM E;  3OSV A;  2X4X A;  3RR6 A;  3VS6 A;  4M7D C;  2HSP A;  4KT0 E;  3CME T;  6AT1 B;  2D0Q B;  4XTY A;  2VVK A;  2ZPF B;  2JVV A;  3GP8 A;  4M75 B;  4BE1 A;  4PKC C;  3H41 A;  2X4W A;  2QTX A;  2XG8 D;  4HCC A;  2M9U A;  2K4Y A;  1VQ5 Q;  3BDL A;  1H8K A;  1JRI A;  3G6E A;  2OAU A;  1K8A C;  4F7U G;  2DFU A;  1QCF A;  4JJD A;  4II1 A;  3CXC A;  3OYE A;  2EYQ A;  4N0A A;  3BW1 A;  1WFW A;  1VQL Q;  3M0Q A;  1Q82 R;  4O6J A;  1VQM Q;  1ABO A;  3TEE A;  5GAN 5;  2Y4Y A;  2L3P A;  4LD9 K;  3T9N A;  1BI3 A;  1Q95 G;  3EG0 A;  4C0G A;  4LN2 A;  3HRS A;  2CZ0 B;  2FPD A;  2RK2 A;  4FW1 A;  1D3B A;  4C5G A;  2FB7 A;  1T0J A;  2FPE A;  2MYS A;  3CCM T;  2FPF A;  4J7F A;  3GLX A;  4XTX A;  1SPK A;  3CC7 Q;  2KXC A;  2GCX A;  2D0N A;  4BI3 A;  4QVD A;  2DNU A;  4C8Q B;  1VQ7 A;  1BI0 A;  1XTD A;  1N5Z A;  5LL6 S;  3JB9 H;  3CCU T;  1BYM A;  4OB3 B;  2CP5 A;  2K5L A;  5I2M A;  1WX6 A;  2OTL Q;  3QJ6 A;  2YUN A;  3OYF A;  1AWW A;  5J3B A;  4A4E A;  3CC4 A;  5GMK l;  5AYF A;  1Y96 B;  4EMH A;  1Q81 R;  1I5O B;  4JJC A;  2P4T A;  1UG1 A;  1TH7 A;  4PFO A;  3PGG A;  4Y91 A;  3X20 B;  3TSW A;  2JTF A;  2V1Q A;  4D6W A;  3C95 A;  4M7A A;  2KRO A;  2CH4 W;  1LPL A;  2AT1 B;  2B8A A;  5IN1 A;  2DZ9 A;  4BI4 A;  3M59 A;  3QHS A;  4EMK A;  5KCH A;  1UE9 A;  4J9H A;  3CCS Q;  2MOX A;  4Z88 A;  1U3O A;  1YIT A;  1YJN Q;  4KBM B;  2RHI A;  2EAY A;  3GF5 A;  1XOV A;  2DIL A;  3C12 A;  2OJ2 A;  1N8R C;  1RAH B;  1VIF A;  5KYY B;  2PQW A;  2MWO A;  3VRY A;  1AD5 A;  4ZTJ A;  1NM7 A;  1M3B A;  1RLQ C;  4FSX A;  4KGV B;  1VQN T;  4JJN K;  2A36 A;  2RD1 A;  4IIM A;  5LJ3 f;  2ZPB B;  3G6E T;  1LNX A;  1G3S A;  2MMP A;  2P84 A;  4IUP A;  4RTX A;  2O88 A;  2HCK A;  2A7Y A;  1IO6 A;  4PJL A;  3OBY A;  3L2Z A;  4PJO E;  5J26 A;  2BZX A;  3A8H B;  3JB9 D;  4M7D E;  2E4H A;  4DBQ A;  1HD3 A;  1B07 A;  1VQO T;  2QAZ A;  2QEX T;  4XU0 A;  3BY7 A;  2LJ0 A;  4RTV A;  1VQK T;  3I55 Q;  2X51 A;  2LZ6 B;  9ATC B;  2JM8 A;  3H0I A;  2EBP A;  2EVR A;  1KQ2 A;  2D8J A;  3REB B;  2A37 A;  2K2V A;  3NMZ C;  1PWT A;  3V8L A;  4J6W A;  1SG5 A;  1RAE B;  3JCM e;  1H64 1;  4C8Q F;  3HSB A;  1NLO C;  1KC8 R;  4M7A D;  3A8L B;  4X9D A;  5FWB A;  2DKG A;  2YT6 A;  1GCP A;  3HP9 A;  2PVO B;  4C0D B;  2X35 A;  2F2V A;  4QKU A;  4OMQ A;  3N5B B;  2A08 A;  1M30 A;  3THK A;  2EYW A;  1VQ5 A;  4PJM A;  5FW9 A;  1TU0 B;  4QQG A;  1JJ2 A;  3QPH A;  4IIO A;  1HSQ A;  3WVD B;  2D1X A;  1VQ4 A;  4OGC A;  5GAM g;  3E19 A;  4F7U F;  3EGU A;  3KXT A;  5GAO m;  3OYB A;  3REA B;  1WHM A;  1M1K R;  1MND A;  3I56 T;  3RES A;  3JCM h;  3I5R A;  3O8V A;  3H8Z A;  3PE0 A;  3RNJ A;  5LJ3 j;  2VUB A;  1M27 C;  2EQJ A;  2F5K A;  2IIM A;  1XQH A;  2ZAE A;  4E47 A;  2LNH B;  5CK9 A;  1YN8 A;  2RI2 A;  2RF0 A;  3GOX A;  3OQ5 A;  1AHJ B;  4JRK A;  5LJ3 h;  1C6V X;  1UJY A;  1K0X A;  1BIB A;  1WNL A;  5LJ3 g;  2LQN A;  3OW2 A;  2L5Q A;  3OMG A;  3CXC P;  2KK4 A;  4J9C A;  2E3H A;  4BE2 A;  4JLG A;  5HKC A;  1VQ9 Q;  1WXB A;  1VQ6 T;  3QUI A;  4XK8 E;  3OYC A;  3OYN A;  1D1C A;  2DXC A;  1UGQ B;  2P4R A;  3EGX A;  1SHG A;  4DA4 A;  4M77 G;  3CCJ Q;  4LUE A;  2EQM A;  1FWZ A;  3G4S Q;  4M77 B;  2O4X A;  2IPO B;  4Y28 E;  1AOJ A;  1KIK A;  1G83 A;  1PM3 A;  2JMC A;  2I0N A;  1M90 C;  3EG3 A;  1YIJ T;  3CCV A;  1QKX A;  1BU1 A;  2KE9 A;  4JRQ A;  4A4F A;  2DZC A;  1VQ8 T;  5D6X A;  3HL8 A;  3CD6 A;  1IXD A;  1R0B G;  1A0N B;  1UHF A;  4PJO C;  1IZ6 A;  1AWO A;  1QKW A;  4XQ3 A;  4C0Z A;  4A63 B;  1QP3 A;  2K3X A;  3LX7 A;  3VV0 A;  3CCU A;  5GMK i;  2GBQ A;  1PHT A;  4E2F B;  2NUZ A;  2KYM A;  1Q81 C;  3OW2 S;  1NEG A;  2I2L A;  2FRY A;  4B6M A;  4F17 A;  3SWN A;  1R77 A;  2DM1 A;  4C92 C;  4BE0 A;  3OYM A;  4J9B A;  2DIG A;  2OX7 A;  4D8K A;  3NFC A;  1K9M U;  3CME Q;  1HXD A;  3V7C A;  2RM4 A;  3PIO A;  1WHK A;  2HKQ B;  1U06 A;  3S3O A;  1VQO A;  1WHL A;  4M78 G;  1OZ2 A;  2M51 A;  4OB1 B;  3EFR A;  4AFQ C;  4WF2 A;  4C8Q D;  1W2B A;  3CCE T;  3PVL A;  2RK1 A;  4PLI A;  3QYH B;  2LVM A;  2L0A A;  3MP8 A;  3G71 Q;  1VQL T;  3S3N A;  4NL3 A;  5IXF A;  1U8R A;  2DMO A;  3UPU A;  3CCS A;  2M02 A;  1RI9 A;  2NUP A;  3M58 A;  3CXC S;  4OMM A;  3PIP A;  4TVR A;  5FU6 B;  3NHN A;  4HT8 A;  1UHC A;  1GFD A;  2ABL A;  1N9R A;  1XJW B;  1BCM A;  3R6O A;  4QQ6 A;  5EG2 A;  1VQ7 Q;  1YJW A;  3M55 A;  4ZN3 A;  3L2U A;  1KSW A;  5GAM h;  3X28 B;  4YTL A;  3CC7 T;  4M78 B;  5GMK h;  3TQ7 P;  3FEO A;  1WJQ A;  2FL7 A;  2OTJ Q;  3OYD A;  3JCM X;  1QCO A;  3VRZ A;  5AT1 B;  1KQS A;  4DQ2 A;  3CQT A;  2MWP A;  4IUV A;  4AFU C;  2EKH A;  3KBG A;  2RJC A;  3OBW A;  2QQB A;  4DEX A;  1M2V B;  4OMF B;  3RDV A;  4CRI A;  2NYS A;  5DY9 A;  1Q7Y R;  4AFZ C;  4AG2 C;  2VGN A;  1V76 A;  2MK5 A;  2AK5 A;  3DLM A;  4C8Q A;  3H6Z A;  4UC4 A;  2CP7 A;  2KR3 A;  2YRV A;  3QKJ A;  4A53 A;  4BY6 B;  3OYL A;  4ELY C;  2V8I A;  5FU7 C;  4PFP A;  1YBY A;  2VYT A;  1RAC B;  3GNG A;  3LWI A;  2ESW A;  2FEI A;  4X9C A;  1M2V A;  2KBT A;  5GAO p;  5GAN j;  4JPB W;  4ATO A;  3HFN A;  2LCC A;  3JCM P;  4JRI A;  2HQX A;  3EAE A;  4PJN A;  2XD0 A;  2QA4 A;  1ZA2 B;  4CC7 A;  1RL2 A;  2DL5 A;  3MEV A;  3G6E Q;  4HT9 A;  3SD4 A;  4C92 E;  1X6G A;  5CVI A;  2DX1 A;  1I0C A;  3X24 B;  4ZGD B;  3VYG A;  2FO0 A;  1RAG B;  4BDZ A;  1YFN A;  1FYN A;  1H92 A;  2CZ6 B;  2DRM A;  4K11 A;  2YDL A;  2KQW A;  4XU2 A;  1WHH A;  3I55 T;  4C5I A;  7AT1 B;  2LMJ A;  3TU4 K;  1J3T A;  1QCN A;  2LT4 A;  4JRP A;  4QT7 A;  3HTR A;  2P0Q A;  2HSE B;  1PRM C;  3OS0 A;  2DTH A;  1ZA1 B;  3PMT A;  1KHC A;  2A28 A;  2KRS A;  3CC4 Q;  3L2W A;  1OPL A;  1KFZ A;  1V29 B;  2CUB A;  2XID A;  4J8O A;  1MV0 B;  3ZBD A;  2DEQ A;  1WYX A;  1IHV A;  2GNC A;  4C8Q C;  4JZ3 A;  2KGT A;  3LLR A;  3PTA A;  4KUI A;  2HBP A;  3I9Q A;  3KUF A;  3RKX A;  3BFM A;  1I81 A;  3VS2 A;  1TOV A;  5I22 A;  4IUQ A;  1RUW A;  1WQ7 A;  3R6N A;  1C1A A;  1BK2 A;  5KYW A;  2VXE A;  1YNZ A;  4XTU A;  3CCR Q;  4M7D F;  3ME9 A;  3BDU A;  2RNA A;  1F1B B;  2YUO A;  3H0H A;  4M78 F;  4KUL A;  1WHJ A;  4X1V A;  1QLY A;  3FDR A;  1VQM A;  3CCM A;  3HKS A;  1YHQ A;  1PSE A;  4RCB A;  2PNI A;  1ZUY A;  5FLX E;  3DLL A;  1X2Q A;  1HJD A;  1VUB A;  5KYW B;  2H3J A;  5CAI A;  3EGD B;  4IUT A;  2V8J A;  1WZO A;  2CP2 A;  4FW2 A;  4C0D C;  1WJS A;  2M16 A;  3QBY A;  1OI1 A;  1PC0 A;  1G3T A;  4MZM A;  2RQV A;  4B9X A;  3NTI A;  2EJG A;  5KH6 A;  2R58 A;  2YLB A;  4Z8A A;  2F2W A;  2YWW A;  1YJW Q;  5FRM A;  3J81 E;  2JTE A;  3PT9 A;  1G2B A;  1NJI U;  5KYY A;  2QQA A;  1KHI A;  2ZZD A;  2LDM A;  1YIJ Q;  3P8H A;  3GIB A;  1K76 A;  4DOW A;  5KE2 A;  1VQP A;  2RH2 A;  1RAF B;  1RAB B;  3RMQ A;  3L2V A;  2XKO C;  1HK9 A;  3SFM A;  1B7T A;  4FU6 A;  2ROT A;  2XK0 A;  4EPC A;  4C92 D;  3EH2 A;  3QJY A;  4PK4 A;  4PNO A;  2SEM A;  2FZK B;  2X4Y A;  1KD1 U;  5KCO A;  3SHW A;  4KRT A;  2YRD A;  1VQ4 Q;  1WA7 A;  2LQW A;  3VS7 A;  3ER0 A;  1AVZ C;  1KK7 A;  2PUK B;  2E70 A;  4JZ4 A;  1RAA B;  3QDF A;  4ORZ A;  2NLU A;  3VYH B;  1E6G A;  1VQ6 A;  1N6A A;  4GBQ A;  2JXB A;  1QW1 A;  2E10 A;  4PJO F;  2ZPH B;  3V8K A;  3SWN B;  2FZC B;  2PTK A;  3TRE A;  1AZE A;  1K73 C;  2DK3 A;  2JS0 A;  2QA4 Q;  2LX7 A;  1VQN A;  4XTW A;  1S1N A;  2V1R A;  1MV3 A;  3VS5 A;  2DRK A;  5A2Q E;  2WSC E;  2E41 A;  3CC7 A;  1KJW A;  4DBH A;  1D1B A;  2K9G A;  1KD1 C;  3JB9 I;  1N8R U;  3CCM Q;  2X9H A;  4BB7 A;  3A98 A;  4X34 A;  4J7I A;  1X43 A;  4V2S A;  1SHF A;  5GAN h;  3I35 A;  4FT2 A;  3CCJ A;  4JS5 A;  3M4Y A;  1C0M A;  2VGM A;  4C92 A;  4JDS A;  1O9S A;  4M7D B;  1PD1 A;  1OZ3 A;  1OX9 A;  4C8Q G;  3FB9 A;  4N4G A;  5CKE A;  1QVF P;  2AIR B;  2RQU A;  2OTJ T;  2DXT A;  4RTW A;  3CCQ T;  2OTL T;  3CMA Q;  1G5V A;  2E3I A;  2LJ3 A;  4E7L A;  1GCQ C;  1LJO A;  3EG1 A;  3P8D A;  4NS5 A;  2M1H A;  3FC3 A;  3LYI A;  2COZ A;  3SB2 A;  2L8D A;  3NPF A;  1MUZ A;  2VV5 A;  4E7K A;  2JN0 A;  3G71 A;  4M78 A;  1TWB A;  3EG9 B;  2EQU A;  2QGF B;  3CCE A;  1YJ9 Q;  1G8X A;  2NUT B;  5FRN A;  1S72 A;  4R55 A;  1S72 Q;  3AT1 B;  3CCS T;  1LCK A;  2COY A;  4DBF A;  5GAN g;  2DA9 A;  3DB3 A;  3C94 A;  1Z9Z A;  1Z9Q A;  2DTO A;  3OYI A;  1PG5 B;  3D7S B;  2CKK A;  3M0R A;  1TSF A;  1Q86 R;  2DXU A;  2WSF E;  1IGU A;  1UDL A;  2JUF A;  2JT4 A;  2QQS A;  3NTH A;  4OGE A;  1NEB A;  4FIB A;  4IKF A;  2KYB A;  1I5L A;  4M75 C;  4PLL A;  2RJF A;  4JS4 A;  3INZ A;  2K5F A;  1UFF A;  1T3S A;  5M9O A;  2X3W D;  4LDW A;  4PJO B;  1ARK A;  2FG0 A;  2HEQ A;  1PKS A;  1VQO Q;  2CYZ B;  3JCM f;  4E6R A;  4HVW A;  3CCV T;  1K9M C;  1E7O A;  2CZ1 B;  2FZG B;  4L59 A;  1EFN A;  4OB0 B;  4JLI A;  2K3B A;  2CSQ A;  1VQK Q;  5L23 A;  1X27 A;  2CSI A;  2J6K A;  4HVV A;  1WHG A;  2GQV A;  4M78 D;  3CCL Q;  2R5A A;  4FSS A;  1WIE A;  3QSU A;  2QAS A;  2PUO B;  5CQX A;  3JCM g;  4MML A;  3JCM d;  2RQR A;  1TG0 A;  2QK0 A;  4GY5 A;  3CPW A;  4M4Z A;  4CC3 A;  4FYV B;  1X6O A;  2RQW A;  3VUZ A;  1YI2 A;  3QWX X;  1K0S A;  4Q5W A;  5CCA A;  3L2R A;  4FL6 A;  3CC4 T;  1P92 A;  3VS4 A;  4ZGE B;  1QQJ A;  4NL2 A;  1UGR B;  1YWP A;  2ZPG B;  2ECZ A;  2QG9 B;  1U1T A;  1OYX A;  1UJ0 A;  4M7A C;  5IXB A;  3OMC A;  3M53 A;  1AT1 B;  1FXX A;  2ZGW A;  4J83 A;  4MZP A;  4QVZ A;  4EMK C;  3TSZ A;  2F2X A;  1W70 A;  1I07 A;  2VC8 A;  2DD4 A;  4RTY A;  2K57 A;  3GPL A;  1H3H A;  2GTO A;  1ZSZ B;  3VU3 C;  1ZHI A;  3I56 Q;  4AFS C;  1MMA A;  5L8R E;  4OP0 A;  3CCR T;  1ZUU A;  5J39 A;  4KGX B;  1D0Y A;  2F5T X;  3H0F A;  1JXO A;  3RMS A;  2DF6 A;  2JS2 A;  2LP5 A;  1NYG A;  5GAN d;  2EJF A;  3MPU B;  3QII A;  2L3Q A;  1YIJ A;  3OW2 P;  1MNE A;  2JW4 A;  2O9S A;  3EG2 A;  1VQP Q;  1GXI E;  4BI8 B;  2CP0 A;  3CPF A;  2RPN A;  3CBO A;  4KH0 B;  3RIR A;  3MP6 A;  1X6B A;  3EFO B;  1VQ9 T;  2AZV A;  1GL5 A;  2CT4 A;  1M8V A;  2O01 E;  3OYG A;  4ZGJ B;  1T0H A;  1X75 C;  1TUC A;  3E9F A;  2KXD A;  1PNJ A;  2MI6 A;  2Z0W A;  1D3B B;  2HQE A;  1Q86 U;  5I11 A;  2MAM A;  4VUB A;  3TVT A;  1GRI A;  2DL7 A;  1JU5 C;  4LE9 A;  2B86 A;  1PD0 A;  2D9T A;  3FRN A;  3M0T A;  1WXU A;  4ANJ A;  1KC8 C;  1SF9 A;  2MIO A;  1NE8 A;  2E6N A;  4E7I A;  2YHT A;  1Y71 A;  2EYX A;  3SDZ A;  4RMO A;  2KSS A;  5KYN A;  3VS1 A;  3L42 A;  2LTO A;  1VQ8 A;  3G7Z A;  2RHY A;  3CBM A;  2DIQ A;  3EGX B;  3CD6 T;  4P5N A;  1YI2 T;  2OTJ A;  3MJX A;  4FT4 A;  2DEU A;  4XU3 A;  4Y92 A;  2COW A;  4XTZ A;  2J7I A;  5HK3 A;  3CCR A;  1Q82 C;  2LCL A;  1OQK A;  1ZBX A;  2DJQ A;  2Y90 A;  3DKM A;  1NLP C;  1VQ4 T;  4FYW B;  3AHU A;  3ZEH A;  3OS2 A;  4M75 G;  2KVQ G;  1JB0 E;  2ED0 A;  2CT3 A;  2QEX A;  1YJN A;  1WDX A;  4KH1 B;  4XAX B;  3GNF B;  1BKB A;  1JXM A;  1K1Z A;  5GAO r;  2YRC A;  1X2K A;  1QVG S;  2KRN A;  2M0O A;  1ACM B;  3CCE Q;  2GF7 A;  4LNP A;  4AMC A;  2X3X D;  3CBP A;  1YCS B;  4J9E A;  5I21 A;  4JJB A; 
#chains in the Genus database with same CATH homology
 1Y0M A;  4OMP A;  3JV3 A;  1AWX A;  1CKB A;  4J9D A;  2LJ0 A;  4RTV A;  1PKT A;  4RTZ A;  1GBQ A;  2LZ6 B;  2JM8 A;  3H0I A;  2RQV A;  2EBP A;  2EVR A;  2D8J A;  1W1F A;  3REB B;  5IHN A;  2A37 A;  1X69 A;  2DL4 A;  3NMZ C;  1PWT A;  4Z8A A;  2F2W A;  2YUP A;  3C0C A;  1AWJ A;  1NLO C;  2JTE A;  2J6O A;  5FWB A;  1BBZ A;  1QWF A;  5IHK A;  1G2B A;  1GCP A;  2DVJ A;  2O2O A;  2YT6 A;  3VS3 A;  2VWF A;  4ESR A;  1W6X A;  2F2V A;  4OMQ A;  4ZNX A;  2EW3 A;  1SSH A;  2A08 A;  1M30 A;  2AKL A;  2W10 A;  2DBK A;  3THK A;  2EYW A;  1K76 A;  2YSQ A;  3EHQ A;  5FW9 A;  2KT1 A;  4RTT A;  2ROT A;  1GBR A;  2W0Z A;  3KFV A;  4J9G A;  4IIO A;  1HSQ A;  2SEM A;  2J6F A;  2D1X A;  1K4U S;  2CUD A;  3SHW A;  4KRT A;  1OEB A;  2BZ8 A;  1WA7 A;  2LQW A;  3EGU A;  3VS7 A;  4HVU A;  3REA B;  1AVZ C;  4JZ4 A;  1E6H A;  2DBM A;  4ORZ A;  1YP5 A;  3I5R A;  2J06 A;  3PE0 A;  3RNJ A;  2JMA A;  1JEG A;  1E6G A;  1M27 C;  2JXB A;  3PVQ A;  2IIM A;  4GBQ A;  2LNH B;  1ZBJ A;  1RLP C;  1SRL A;  3QWY A;  1YN8 A;  2PTK A;  2RF0 A;  3O5Z A;  1AZE A;  1VYU A;  2JS0 A;  1UJY A;  2LX7 A;  1K0X A;  2K2M A;  2HBW A;  5GJW B;  1S1N A;  2C0T A;  2LQN A;  1GFC A;  1JO8 A;  2V1R A;  3LH5 A;  4J9C A;  4J9F A;  1MV3 A;  3VS5 A;  3M0S A;  2DRK A;  1WXB A;  4HCK A;  1KJW A;  2K9G A;  3UAT A;  2P4R A;  1M3A A;  3NGP A;  3A98 A;  2EQI A;  1SHG A;  1X43 A;  1SHF A;  2EGE A;  3I35 A;  4LUE A;  1PRL C;  1ZLM A;  2ENM A;  2MCN A;  1SEM A;  1AOJ A;  1KIK A;  1G83 A;  4LUD A;  5FWC A;  2JMC A;  2I0N A;  2K7A A;  3EG3 A;  2SRC A;  2E5K A;  1QKX A;  1BU1 A;  1UGV A;  2KE9 A;  2EGA A;  4F14 A;  2GQI A;  2D8H A;  2DYB A;  1I1J A;  3EHR A;  3ULR B;  4RTU A;  2ED1 A;  4EIK A;  2KT8 A;  2QDL A;  2RQU A;  2DL3 A;  1OOT A;  2DL8 A;  1A0N B;  1FMK A;  1UHF A;  2AZS A;  4RTW A;  1U5S A;  4CC2 A;  1AWO A;  1QKW A;  4A63 B;  1WXT A;  3UF4 A;  2LJ3 A;  1GCQ C;  3EG1 A;  2GBQ A;  1Y57 A;  1PHT A;  4J9I A;  2NUZ A;  2KYM A;  3NPF A;  1MUZ A;  2EPD A;  1NEG A;  2FRY A;  4OML A;  2BTT A;  4F17 A;  2DM1 A;  4WCI A;  2DLP A;  4Z89 A;  4J9B A;  2BZY A;  4D8K A;  2HDA A;  2KNB B;  2L2P A;  1OV3 A;  5GJV B;  1LCK A;  1U06 A;  3FJ5 A;  3ZL7 C;  2DA9 A;  2KRM A;  1Z9Z A;  1Z9Q A;  1WI7 A;  2M51 A;  2LJ1 A;  3M0R A;  4AFQ C;  2CH4 A;  3PVL A;  1AZG B;  3M0P A;  2GTJ A;  5IH2 A;  3I5S A;  1UDL A;  2L0A A;  1JQQ A;  2JT4 A;  3SEM A;  1NEB A;  5IXF A;  1VYV A;  2KYB A;  2DMO A;  2JM9 A;  1UFF A;  1RI9 A;  1T3S A;  4HXJ A;  4OMM A;  2X3W D;  1V1C A;  1ABQ A;  1TUD A;  3NHN A;  1K9A A;  1UHC A;  1CSK A;  1ARK A;  1GFD A;  2ABL A;  2FG0 A;  2K79 A;  2HEQ A;  1PKS A;  4E6R A;  4HVW A;  3GBQ A;  3UA6 A;  4R0K A;  1AEY A;  1E7O A;  3IQL A;  3U23 A;  3RBB B;  1EFN A;  1KSW A;  2FRW A;  2K3B A;  2CSQ A;  1QWE A;  5L23 A;  2NWM A;  1X27 A;  1ZUK A;  2CSI A;  2AKK A;  5ECA A;  1ZX6 A;  2EGC A;  3VS0 A;  2J6K A;  2CDT A;  4HVV A;  1OPK A;  4DEY A;  4FSS A;  1WIE A;  3VRZ A;  2VKN A;  3CQT A;  2RMO A;  2LCS A;  1NG2 A;  5IHI A;  4AFU C;  2RQR A;  1M8M A;  1GCQ A;  1TG0 A;  2EKH A;  2YUQ A;  1ZSG A;  1B3Q A;  2C0O A;  4M4Z A;  5HCK A;  4CC3 A;  4DEX A;  1UTI A;  2L3S A;  2RQW A;  1M3C A;  4J9E A;  5EC7 A;  3QWX X;  4F16 A;  4D8D A;  1K0S A;  1BB9 A;  4AFZ C;  1UEC A;  1CKA A;  4AG2 C;  1WLP B;  2EYZ A;  3VS4 A;  3VS6 A;  2HSP A;  2O9V A;  1UUE A;  2AK5 A;  2VVK A;  1YWP A;  2ECZ A;  1UJ0 A;  2KR3 A;  5IXB A;  3H41 A;  2DE0 X;  2GGR A;  3TSZ A;  2F2X A;  1H8K A;  1W70 A;  4OMN A;  4OMO A;  1I07 A;  2ESW A;  4RTY A;  2FEI A;  1QCF A;  4JJD A;  1YWO A;  1H3H A;  2G6F X;  2GTO A;  1VYT A;  2KBT A;  2ROL A;  4RUG A;  1WFW A;  4JPB W;  3M0Q A;  2RN8 A;  1ABO A;  1SRM A;  4AFS C;  1ZUU A;  2L3P A;  3H0F A;  2C0I A;  3EG0 A;  4LN2 A;  1JXO A;  2DF6 A;  2JS2 A;  2FPD A;  2LP5 A;  1NYG A;  4CC7 A;  2DL5 A;  1T0J A;  2FPE A;  4CC4 B;  2L3Q A;  1X6G A;  2FPF A;  2DX1 A;  1I0C A;  1NYF A;  2JW4 A;  2O9S A;  3EG2 A;  1T3L A;  2FO0 A;  1SPK A;  3UA7 A;  2KXC A;  2D0N A;  1FYN A;  2RPN A;  2RQT A;  1H92 A;  2DNU A;  2DRM A;  1X6B A;  1N5Z A;  2AZV A;  4K11 A;  2YDL A;  1GL5 A;  2CT4 A;  1T0H A;  2O31 A;  1TUC A;  2KEA A;  4AG1 C;  2KXD A;  1PNJ A;  2LMJ A;  1J3T A;  2M0Y A;  4QT7 A;  2EYY A;  5I11 A;  1WX6 A;  2YUN A;  1PRM C;  1AWW A;  1GRI A;  3TVT A;  2DL7 A;  1JU5 C;  4LE9 A;  2B86 A;  3M0T A;  1VA7 A;  2A28 A;  2KRS A;  1WXU A;  1OPL A;  2MIO A;  1KFZ A;  4JJC A;  2CUB A;  1UG1 A;  1MV0 B;  2EYX A;  3M0U A;  1WYX A;  2GNC A;  3TSW A;  2V1Q A;  4JZ3 A;  3VS1 A;  2KGT A;  2XMF A;  2CRE A;  2KRO A;  2CH4 W;  3I9Q A;  2H8H A;  1UE9 A;  3VS2 A;  4J9H A;  2MOX A;  5I22 A;  4Z88 A;  1U3O A;  1RUW A;  3R6N A;  1BK2 A;  1YNZ A;  4Y92 A;  2J7I A;  2PZ1 A;  2OI3 A;  2DJQ A;  1XOV A;  1NLP C;  2DIL A;  2RNA A;  2OJ2 A;  2YUO A;  2ED0 A;  2J05 A;  2CT3 A;  3H0H A;  3VRY A;  1AD5 A;  1WDX A;  4X1V A;  1QLY A;  1NM7 A;  1M3B A;  1JXM A;  1RLQ C;  1K1Z A;  2A36 A;  4IIM A;  1X2K A;  4RTX A;  2K6D A;  2O88 A;  2HCK A;  2PNI A;  2KRN A;  1ZUY A;  1IO6 A;  1X2Q A;  4LNP A;  2X3X D;  2BZX A;  2OAW A;  1HJD A;  4GLM A;  1HD3 A;  1YCS B;  1B07 A;  4JJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...