4HVUA

Crystal structure of the t98d c-src-sh3 domain mutant in complex with the high affinity peptide app12
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
TFVALYDYESRTEDDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/peptide
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Atomic resolution structures of the c-Src SH3 domain in complex with two high-affinity peptides from classes I and II.
pubmed doi rcsb
source organism Gallus gallus
total genus 12
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hvuA00
2EBPA 4E6RA 2DL8A 2BTTA 1GL5A 1FMKA 1WA7A 3H0IA 4ZNXA 4GBQA 2FPFA 4OMPA 1ZX6A 2M51A 2X3WD 2LP5A 2BZYA 1UGVA 2EW3A 4AFSC 4J9FA 2DNUA 3PVLA 4ESRA 2RQTA 4D8DA 1WDXA 5GJWB 4RTZA 4LUEA 2B86A 3O5ZA 3ZL7C 1AOJA 1VA7A 2J6FA 1N5ZA 2JM8A 4HVWA 2CDTA 2F2VA 2RNAA 1WXBA 2OJ2A 1M3BA 1JU5C 1WLPB 3GBQA 2EYZA 1GCQA 1ZSGA 2A36A 4JZ4A 1SRMA 1W1FA 2KRSA 2JS0A 2AK5A 2KBTA 2L3QA 1PRLC 4HVUA 1H92A 5I11A 1SHFA 2EYWA 2LJ1A 5HCKA 3VRZA 3VS1A 4AFUC 2ROLA 1BU1A 1K1ZA 2A28A 1WI7A 1NYGA 4Z89A 1QKWA 3EG1A 4R0KA 3PVQA 2KXCA 2LNHB 1W6XA 2DL5A 1ZUKA 1QWEA 1Y0MA 3VS7A 1Y57A 5IHKA 4RTUA 1YP5A 1SRLA 3I5RA 2KGTA 4CC4B 2GTOA 4OMLA 2L0AA 2KXDA 1UJYA 1VYTA 3VRYA 3VS4A 2ROTA 5IXFA 2K3BA 1K4US 2EGAA 1OEBA 5L23A 1UG1A 4J9DA 1G2BA 1NG2A 1AWWA 1MV0B 3I35A 4WCIA 5FWCA 1RI9A 2RF0A 2JS2A 3RNJA 2K7AA 1HJDA 2PTKA 2I0NA 2D0NA 2NUZA 3UATA 4IIOA 1KJWA 3EG3A 1YWPA 2YUPA 1X2KA 2GGRA 2HCKA 2HSPA 2ECZA 3NPFA 1J3TA 3THKA 1TUDA 1JEGA 1JO8A 1ZLMA 2AZVA 4LE9A 2KT1A 2D8JA 2YUQA 3M0QA 2KNBB 4F14A 2RPNA 4AFZC 4JPBW 5FW9A 1KFZA 3NHNA 4RUGA 5I22A 2ED0A 2EVRA 2KT8A 2PZ1A 1OPLA 1U3OA 3EG2A 1K9AA 1B07A 1A0NB 4FSSA 3JV3A 1GRIA 4KRTA 2O9VA 2J06A 1OOTA 1X2QA 4LUDA 1M30A 2J6KA 4QT7A 4X1VA 2MOXA 1WXTA 1WFWA 1X6GA 2IIMA 4RTVA 2YSQA 2K79A 4LN2A 1PNJA 2LZ6B 1AZGB 1UHFA 2JTEA 1VYVA 2HEQA 1X69A 2JM9A 1EFNA 1TG0A 3M0UA 2C0TA 1PHTA 1OPKA 2OAWA 1YNZA 1I07A 2LX7A 2JMAA 1PKTA 4RTWA 1UHCA 1M3AA 1X43A 2EPDA 4OMMA 1SPKA 1LCKA 2G6FX 4A63B 2FRWA 2SEMA 1E7OA 2VKNA 1SSHA 2F2XA 1H8KA 4CC7A 1RUWA 3M0RA 5GJVB 1AVZC 2W0ZA 2O88A 2KYMA 2AZSA 2DILA 1GFDA 1NEGA 2YDLA 5FWBA 3TVTA 4J9HA 2CT3A 1CKBA 1SHGA 1KIKA 3SHWA 1X27A 2EKHA 2O31A 2LCSA 5IHIA 2DX1A 2KROA 1M3CA 2O9SA 3TSZA 4RTYA 3QWYA 3FJ5A 1UFFA 2V1QA 1QKXA 2F2WA 1V1CA 3TSWA 2D8HA 2EQIA 2FEIA 2EYYA 1U06A 2A08A 4RTTA 4IIMA 2CREA 1CKAA 2FG0A 1M27C 5IH2A 5ECAA 3RBBB 1CSKA 2DYBA 2J7IA 4DEXA 1MV3A 2CUBA 1Z9QA 1XOVA 2KE9A 1VYUA 3SEMA 1NLPC 1QLYA 1TUCA 2OI3A 4OMQA 2RN8A 1IO6A 4K11A 1T3LA 1UJ0A 3M0SA 2SRCA 2MIOA 2DBKA 1JXOA 1K76A 2EGCA 3U23A 2JMCA 4AFQC 3PE0A 1WXUA 4HCKA 2CSIA 1OV3A 2NWMA 4F17A 3UA7A 4HVVA 2DRMA 3A98A 2CH4W 3I5SA 1HSQA 4J9BA 3R6NA 2LQNA 3VS3A 2L2PA 2CT4A 1YWOA 1ZUUA 2JT4A 4OMOA 1SEMA 2FPDA 2KRMA 4HXJA 4CC3A 2RQVA 2DL7A 2E5KA 2RMOA 2VWFA 3H0HA 5IXBA 2CSQA 1Z9ZA 3KFVA 2P4RA 3C0CA 1AWXA 3VS0A 1MUZA 4J9CA 2H8HA 2EYXA 2KR3A 3VS6A 1HD3A 3EHRA 1AWJA 1H3HA 3QWXX 1E6HA 2DA9A 2RQWA 2ESWA 1BBZA 1NYFA 1RLPC 4J9GA 2YUOA 2DM1A 4GLMA 1B3QA 4AG2C 4Y92A 3LH5A 2J05A 1GBRA 2AKLA 2J6OA 2QDLA 2BZXA 1PRMC 2C0OA 2DJQA 2DLPA 1JXMA 2ED1A 2FO0A 2GTJA 2W10A 3VS5A 2RQRA 2LJ0A 2L3SA 2AKKA 1X6BA 2DL3A 1T0HA 1UECA 1UE9A 1E6GA 1UUEA 2FRYA 3CQTA 2V1RA 1BK2A 3EG0A 3IQLA 1ABOA 3REAB 1T0JA 1GCQC 1GBQA 3NGPA 1W70A 3UF4A 2BZ8A 2GNCA 2M0YA 4EIKA 2EGEA 4JZ3A 5EC7A 3M0TA 1PWTA 1BB9A 2ABLA 4J9EA 1I1JA 2XMFA 2RQUA 2GBQA 4Z88A 2K6DA 1JQQA 1WYXA 1WIEA 2DL4A 4AG1C 1KSWA 2KRNA 1YCSB 1NEBA 3REBB 2ENMA 2VVKA 1K0XA 4Z8AA 2CH4A 2YUNA 1G83A 2K9GA 3UA6A 1GFCA 1S1NA 1QCFA 1YN8A 2GQIA 2DMOA 4RTXA 3EHQA 4DEYA 2KYBA 2C0IA 1ABQA 4D8KA 2LQWA 1T3SA 2X3XD 4JJDA 2FPEA 2LMJA 4J9IA 2JW4A 4OMNA 3NMZC 2A37A 4F16A 4JJCA 3M0PA 2KEAA 4LNPA 2CUDA 2O2OA 1AD5A 1NM7A 2DVJA 1K0SA 1UTIA 1ZBJA 1ZUYA 1I0CA 2YT6A 3H0FA 2MCNA 1GCPA 3I9QA 4JJBA 1QWFA 2DRKA 2JXBA 3EGUA 2DE0X 1NLOC 2L3PA 4M4ZA 2DBMA 1M8MA 1PKSA 1RLQC 1FYNA 3H41A 1ARKA 2K2MA 4ORZA 3ULRB 1AWOA 1WX6A 1U5SA 2HBWA 5IHNA 1AZEA 2DF6A 2HDAA 2LJ3A 2PNIA 3VS2A 4CC2A 1AEYA 2D1XA 1UDLA
chains in the Genus database with same CATH superfamily
4A4GA 2CP3A 2EBPA 1I5OB 4E6RA 3CXCA 3L42A 2DL8A 3OBWA 1FMKA 3S6WA 8AT1B 2K3XA 3GP8A 5KYYA 1G8XA 1XJWB 4J7IA 2FPFA 4DBHA 4O5VA 1ZX6A 2Y4XA 4PNOA 3AT1B 3QJYA 3CCUQ 4PJOG 4AFSC 2V8KA 2LQ8A 2DNUA 2EJ9A 4J9FA 5KYYB 3OYIA 3OS0A 1FMWA 3QIIA 1HYOA 2O4XA 5GANd 4FW2A 1VA7A 3JCMX 1N5ZA 2RNAA 1I5LA 3UPUA 3HKSA 1JU5C 3JCMW 2P4TA 2I2LA 1TUGB 1KQ1A 4FYVB 2O4XB 1VQLQ 2A36A 3CC4A 3JCMd 3I56T 1SRMA 1W1FA 4X34A 5FRMA 1BCMA 1YITQ 2HQEA 3QZ5B 2EAYA 4ME7A 5GAOr 2FHDA 1X6OA 1N27A 2DYIA 1WQWA 3M59A 3PMIA 2MMPA 2ZPHB 3GNFB 3CMEQ 3QUIA 1K1ZA 2WSFE 3FJPA 1WI7A 2LQKA 1YHQT 1QKWA 4R0KA 2DL5A 1QWEA 3CCEA 1Y07A 3HL8A 4PJLA 1YP5A 4PJOE 1SRLA 2KGTA 3JB9D 1QVFP 5GANg 4PJOA 2OTJQ 2CP2A 2L5QA 4DBFA 5GAOl 2DAQA 3C12A 2IG0A 2ZGWA 4PJOC 2D9TA 3JCMg 4PJOB 1NG2A 3JCMc 1Q86R 3WVEB 2KSSA 3TREA 5CAIA 1EZZB 3MEWA 1Y96A 2QQAA 2ZZDA 4WCIA 3CD6T 1RI9A 2K7AA 3CC7A 4EMGA 3SB2A 5J26A 2C06A 3OW2A 3CCLT 1Y96B 1YJWQ 4IIOA 1KJWA 3EG3A 1YWPA 3M54A 2YUPA 2CZ1B 2ECZA 1J3TA 3THKA 1JO8A 2CKKA 2JVVA 1S72A 3PGGA 2CGHA 2HD0A 2KT8A 2QEXA 3CMAT 1OPLA 2LCLA 1K9AA 5CO7A 2LDMA 2ZPEB 2J06A 4V2SA 1PCXA 4LUDA 3L1AA 4B6MA 1M30A 4ELZC 4X1VA 4OVAA 1V29B 3G6EQ 3CBMA 4LN2A 4FYYB 3OMCA 1AZGB 2QAZA 5I21A 1QVGA 1UGRB 1VYVA 2JM9A 1EFNA 2KVQG 2RJDA 5GANf 3VKIA 2C0TA 2YRVA 1KQSS 4M78A 1OPKA 1PD1A 2YXYA 4II1A 1YI2A 1YNZA 1KK7A 1RAHB 1VQ7T 1K9MC 3JCMf 1M4ZA 2CZ6B 2EPDA 1LCKA 3E2UA 3H8ZA 4A53A 1WHKA 4A4HA 2LNVA 4LXCA 2L89A 1IZ6A 4QQDA 1YBYA 1RUWA 1VQKA 2LTOA 3M0RA 1JJ2P 2W0ZA 1QVPA 1D0YA 2AZSA 2FZKB 2YDLA 2MWPA 2HKQB 2L8DA 2GF7A 3SHWA 3TEEA 1M3CA 3L2WA 2HNIA 4RTYA 3QWYA 1WHHA 1SG5A 1UFFA 2V1QA 1Q82U 3JSCA 3LGFA 4UC4A 3OYDA 4KGZB 4M7DF 2CREA 2FG0A 3I56Q 3P8BB 2RB6A 2QG9B 1CSKA 2DYBA 2RHYA 4CRIA 3L2QA 1K73U 2E6ZA 2P0QA 4XTVA 4OB1B 4M7AA 2QDYB 4C8QD 1AT1B 1XOVA 4ZGDB 3SEMA 1G5VA 4OMQA 4N4GA 1D3BA 1UJ0A 3M0SA 3G4SA 2E12A 2SRCA 3S3NA 2DBKA 1Q81C 3CMEA 2EGCA 3U23A 5GAMh 2CSIA 3M56A 4XQ3A 3QBYA 1NZ9A 1QVFS 2DRMA 4JS4A 4PLIA 2NYSA 3KUFA 3V7SA 1LVKA 3OS5A 4M75D 1KHIA 1JRIA 4MZPA 2WSCE 2E10A 6AT1B 4ZGEB 2CT4A 1YWOA 4R55A 1H3ZA 2GFAA 3M53A 2OTJA 5KYWA 1VQMQ 3MPUB 3VUZA 4J83A 2KRMA 4OGEA 1BIAA 4CC3A 2VWFA 2P4RA 5KYWB 3CCLQ 3OSVA 1KC8U 1M90C 4J9CA 1OULA 2H8HA 3OYGA 3CCRT 1XQHA 3MP1A 2EIFA 1K9MR 3WVDB 1MNEA 1RLPC 4MMKA 2RI5A 4GLMA 4Y92A 3LH5A 2YRDA 2E5QA 2AKLA 4JDSA 3AHUA 5IT9E 2C0OA 2DJQA 3A8GB 2DLPA 3INZA 2G3RA 1JXMA 2GTJA 4KT0E 1KG1A 1I81A 2LJ0A 4FT2A 4QQGA 2L3SA 3I55Q 3G71A 1X6BA 4PJJA 5CCAA 5KE2A 2QA4A 4MDWA 3HRTA 2V1RA 2RHIA 1ABOA 3REAB 1T0JA 4XU3A 4B9XA 2Y90A 3E1SA 2BZ8A 3CEYA 4EIKA 4M7DG 1K8AU 2WSEE 3BY7A 3PTAA 3T9NA 5LJ5e 4JRPA 1I1JA 2MPXC 1JQQA 4JUVA 2D0QB 1D1BA 1WYXA 3REBB 2K9GA 5CQXA 3CPWS 4BE1A 4A4KA 1D1AA 1GFCA 3JB9I 4C0GA 3UT1A 1R8OB 4RTXA 3QXEB 4XTWA 5GAMe 2KMTA 2LQWA 3EG9B 2F1LA 2LCCA 2RJCA 3GF5A 4PJOD 2F5KA 2JW4A 3NMZC 1JJ2S 2QTVA 2CUDA 2A0FB 2O2OA 2NUTA 2D6FA 2DVJA 3J81E 1K0SA 1ZUYA 3LLRA 1WHMA 2YT6A 4M77F 1Q81R 1GCPA 2K5LA 3I9QA 4F04B 4JJBA 1QWFA 2O01E 2MK5A 3CC4Q 3LH0A 3VYGA 2NUTB 2QYZA 1NLOC 5IAYA 4E7IA 4OP0A 4M4ZA 1RL2A 1TH7A 3MKDA 3MHXA 5J3BA 1M8MA 3BE3A 4M7DE 2K3YA 1RLQC 4IUQA 2X4YA 1WX6A 3HFOA 4M7DA 5IHNA 2ZAEA 1YJNT 4FU6A 3VJPA 2VXFA 4CC2A 1RAAB 1AEYA 2D1XA 1PRMC 4HCBA 4M7DC 3OYYA 5J39A 4M7DB 2E70A 3OQ5A 4LDVA 3OS2A 3A8MB 3I56A 3VUBA 4RG8A 2QTXA 1AHJB 3H0IA 1M9SA 2AHJB 2EKOA 2EW3A 4ESRA 2RQTA 1VQ8T 4D8DA 5GJWB 4RTZA 1IREB 1BI0A 4QVDA 1WHLA 3O5ZA 2OTLT 2J6FA 1YHQA 2CDTA 3CBPA 2OX7A 2X9HA 2H3JA 4M78D 4MZMA 2IVWA 2L3RA 2DXUA 3CC7Q 5AYFA 1GCQA 2PU9B 1BCOA 2JS0A 1RAIB 5GAN8 3CCJT 1WNLA 1QCOA 3OB9A 3PT9A 1B7TA 1UGPB 4JLGA 3X26B 3ASKA 4L5GA 3VS1A 1S72Q 4AFUC 2DTHA 2QQSA 4FYWB 3RMQA 1ZBXA 2A28A 1NYGA 1W2BA 5GAOm 2DTIA 2KXCA 2LNHB 2QEXQ 3CD6A 1OX8A 2HAXA 4HA8A 2BE9B 3F70A 3ZBDA 1B34A 2XK0A 5IHKA 1M2OA 4HCZA 2E41A 2XI9A 3CCLA 3I5RA 5FROA 2PUKB 4OMLA 1UJYA 4QVCA 3VS4A 5IXFA 5CKEA 5L8RE 1B34B 3LX7A 3QKJA 2FZGB 1OEBA 5L23A 2H3EB 5I2MA 4Y28E 4JS5A 1K73C 3C4SA 3FDRA 2DZ9A 2XG8D 3M57A 1AWWA 1R0CB 2YLCA 1GXIE 3CMAA 2ZPIB 4WF2A 1YI2Q 4VUBA 5FWCA 2DERA 3E9FA 3NTKA 2JS2A 3RNJA 1P92A 1HJDA 2I0NA 3MCAB 4M7AD 4P5NA 3UATA 1TOVA 4BACA 2E64A 3FC3A 4ZN1A 2AZVA 2YUQA 2D8JA 2HKNA 2PVDB 1QVFA 1YCYA 4E7HA 1VIFA 1KFZA 3OBYA 1JB0E 1JBMA 2EWNA 2E65A 1FMVA 2MAMA 2PZ1A 2XKOC 3LYIA 3Q1JA 1VQ7A 1U3OA 2JTMA 1B07A 2BE7D 3JV3A 2O9VA 4XTXA 3GNGA 4BI3A 4M77E 1WXTA 3QDFA 1FXXA 2WACA 1VQ6T 1RAGB 2YSQA 3TU4K 2K79A 2LVMA 3CCVT 3J80E 1UHFA 1KC8C 2HBPA 1UGSB 1TG0A 3M0UA 1U1SA 1PHTA 4BI8B 4PJMA 5KCOA 3CCST 2OAWA 4MZTA 4M77B 3RKWA 5LJ3d 1MMNA 2LX7A 1NE8A 4RTWA 4KH0B 1VOMA 2PVGB 5GMKl 4A63B 1ACMB 2SEMA 4RCBA 5KYXB 1H8KA 4EPCA 4CC7A 3G4SQ 4F7UF 2JZ2A 1QW1A 1X01A 4DBQA 4C92F 3MP6A 2YLBA 3L2UA 5FWBA 3PFSA 4J9HA 1TXQA 4JLIA 2LT4A 1K8AC 3JB9H 4AMCA 1M2VA 1SHGA 2LCSA 5IHIA 2DX1A 2KROA 1Q82R 2O9SA 3TSZA 2VYTA 1TTHB 3CC2T 4E7KA 1M2VB 2F5TX 4KBMB 1VQ5T 2BUDA 5LJ3g 4A54A 2A08A 3CPWA 4XTUA 1K73R 4CI0C 2MYSA 4TVRA 5GAN4 5FRNA 1X75C 5ECAA 3RBBB 3CCJQ 4XTZA 4LDYA 2COZA 1NPPA 4FIBA 1JJ2A 3MP8A 1Z9QA 1SF9A 3PNWC 2HSEB 3CXCP 2E3IA 1QLYA 1M1KU 2HZYA 1IO6A 2QXFA 1T3LA 3M9QA 3MEVA 3C95A 2MIOA 4ELYC 1JXOA 1K76A 1BI1A 1VQNT 2JMCA 1U1TA 1G3YA 3SD4A 3G71Q 1WXUA 3JRZA 2JUFA 3CCRA 1OV3A 2DK3A 5FU7C 4F17A 5FU7B 1G3WA 1M5Q1 2QA4Q 3G1JA 3DB4A 2CH4W 7AT1B 1HSQA 4JRIA 5LJ5j 3EFOA 2FB7A 3VS3A 2L2PA 1MMAA 2GCXA 5A2QE 4M7DD 1PC0A 1ZUUA 4PJNA 2JT4A 4ATOA 4OMOA 1WPYA 2FPDA 3EFOB 3NFCA 3R6OA 1KC8R 4E7ZA 2RQVA 3H0HA 3L2RA 4PKCC 5GAMj 3C0CA 1AWXA 3VS0A 3L2ZA 5LJ3f 2EYXA 3WXMB 1HD3A 3EHRA 2E3HA 4J6YA 4NL2A 3QWXX 1E6HA 3V8KA 4KH1B 3A8OB 1BI3A 2QGFB 1NYFA 2RJEA 4J9GA 3JCMJ 2X4XA 2DM1A 1B3QA 2J05A 1V76A 2QDLA 1YJ9T 3ER0A 1TU0B 2AKKA 2YHTA 3X24B 1Q7YU 5A0DA 3PIPA 1K8AR 1OX9A 2VGNA 1GBQA 2V26A 5GAOp 1QMCA 5GMKh 5EC7A 1RAEB 3HFNA 3OYKA 1PWTA 4C5IA 1BB9A 2X35A 2ABLA 3HPWA 4JJNK 2GQVA 2QQ9A 4Z88A 3OW2P 4AG1C 1YCSB 1NEBA 1RI0A 2OAUA 2VVKA 4BUGA 2YUNA 4F7UE 2VASA 5KYNA 3FEOA 2K2VA 1QCFA 1YN8A 4C92E 2DMOA 5LJ5h 2RI3A 1ABQA 1VQOT 1T3SA 1VQPT 1MGQA 2FPEA 2LMJA 1YJNA 2RM4A 4OMNA 5AT1B 3H6ZA 4BDYA 1YHQQ 1AD5A 4KUDK 1Y7XA 2KI7A 3OYMA 5M9OA 1SSFA 1I4K1 1MMGA 4LD9K 2P84A 1NJIC 1VIEA 1QVGP 3OY9A 1D1CA 4GLKA 3ME9A 3META 4J5YA 3EFSA 1ARKA 2P0KA 1VQ8A 3GPLA 1AWOA 1U5SA 3QO3A 5LJ5d 2LC4A 2HDAA 2OTLA 3QJ6A 2QQBA 1UB4A 3CCQT 3OYAA 4FT4A 4X9DA 1ZA2B 4XU1A 3A1PA 3CD6Q 2HL5C 1BI2A 4E47A 2K5FA 3SFMA 3RERA 5GAMd 3CCJA 1RACB 4OMPA 2BZYA 4LDWA 1UGVA 2YWWA 2RH2A 3URGA 1OU9A 3PVLA 2DFUA 4LUEA 2B86A 1R77A 1WHGA 1WJQA 1AOJA 1BIBA 1Y71A 3QPHA 5CKBA 4MDXA 2JM8A 4HVWA 3X20B 2F2VA 3CMAQ 1C0MA 3P8HA 5GMKe 2K5IA 3GBQA 1ZSGA 2XU8A 5CK9A 5LJ5g 4J7FA 2KRSA 3OS1A 5EG2A 2L3QA 1KD1U 3HRUA 2PVOB 3HP9A 4EMKA 1H92A 4C8QF 5I11A 2LJ1A 5HCKA 3MEUA 5KCHA 5CIUA 4EMKC 4HT8A 2ROLA 3JCMQ 4EMKB 1VQ9T 5GAMg 4IUTA 4Z89A 3QZ9B 2DEQA 3PVQA 3JCMV 1W6XA 1VQ7Q 1WQ7A 2DVEA 1NPRA 1Y57A 3EG9A 4RTUA 3NTHA 4IKFA 2YRCA 4CC4B 2GTOA 1VQ4T 3VRYA 1VYTA 1G3SA 1K4US 2M16A 4RMOA 5DLOA 1UG1A 2VV5A 2XDPA 1G2BA 4PFPA 3CCMT 3LW5E 1DJ7B 3A5ZB 3E19A 3FB9A 5FLXE 3RKYA 1M1KC 4EDUA 3M58A 2JJ9A 5D7UA 2NUZA 1FWZA 1NJIR 1OQKA 4N4IA 1VQ6A 4FW1A 3S3OA 3CCVA 2RI2A 2GGRA 4IUPA 2HSPA 1R0BG 5LJ5f 5HK0A 3CCUT 1TUDA 3OW2S 1JEGA 3EGXB 1N6AA 1ZLMA 2M9UA 2KT1A 3M0QA 4PL6A 2KNBB 4F14A 2QI2A 1ZSZB 4AFZC 2K4YA 4EMHA 5FW9A 3CCSA 1IXDA 3RDVA 3NHNA 5I22A 2ED0A 2EVRA 1NBEB 4E2FB 3M55A 4C5GA 1QP3A 1F1BB 1O75A 4QW2A 1MNDA 4MMLA 5GAMf 4KRTA 1VQLT 3HTRA 1OOTA 1YITT 1U8RA 2J6KA 4QT7A 4Y91A 3EH2A 3BDUA 2IIMA 2XHCA 4C0DC 4RG2A 4C0DB 1IRXA 3QSUA 1TS9A 1KQSA 2JTEA 1IHWA 2HEQA 1X69A 1D0XA 2QGGA 4ZN3A 5GMKm 3HSBA 1WZOA 1QVGS 1ZA1B 2KY9A 3UDCA 2JNGA 2BKDN 8ATCB 4C8QG 1EX4A 2JMAA 2DJZA 1UHCA 1M3AA 3A8HB 4OMMA 1SPKA 3C94A 2G6FX 2V8JA 3CC2A 2FRWA 3X28B 2K57A 1E7OA 4OB3B 1VQ5A 4X9CA 4QVZA 3VV0A 1TWBA 4PJOF 4J6WA 3OYBA 4DOVA 9ATCB 1Q7YC 4Q5WA 5D6XA 1AVZC 2VC8A 2EQMA 2MI6A 2KYMA 4DQ2A 1GFDA 1NEGA 3CCRQ 3RUXA 2QQRA 2COYA 1Q82C 1X27A 3D7SB 3V7CA 3OYCA 4PFZA 4BI4A 4BE2A 1QKXA 1YJWT 1WJSA 3H9NA 3TSWA 2EQIA 2FEIA 4E7LA 2HQHA 2QASA 2M02A 2JTFA 4M77G 1VQNA 4RTTA 4IIMA 5KYUB 3CBOA 4C8QE 3OYFA 5A0LA 2ZPFB 1UGQB 2CP0A 4LD6A 3OA6A 4HT9A 1WGSA 5GAN7 5HKCA 1MV3A 1BKBA 4BD3A 1OZ3A 1M1KR 3EGDA 2COWA 3KXTA 4BDZA 1VYUA 4C8QC 1NLPC 4C8QB 3G6ET 3FLGA 3RR6A 3EGDB 4AT1B 2XDDA 1N8RU 4NS5A 1YIJT 2CP6A 4FYXB 3MO8A 3UWNA 3VYHB 3DLLA 1C1AA 2NWMA 3V7RA 4M78F 4HVVA 4OGCA 2DD5A 3A98A 3I5SA 4D6WA 4XTYA 4QQ6A 2LQNA 2ZPGB 5GANh 2RD1A 3A8LB 4N4HA 1D09B 4M77A 1YJ9A 4HXJA 4R56A 3JCMh 2E5KA 4NL3A 2CSQA 3ZEHA 4M77C 3DB3A 3VS6A 2LX9A 4LDXA 3JCMb 2ZPBB 5KYXA 2VB6A 4B9WA 1W2BP 2DA9A 2RQWA 1M90U 2XD0A 5LL6S 1YJNQ 2LT1A 3VU3C 2YUOA 2ZCFB 2DIQA 2KQWA 2RJFA 2Z0WA 2PUOB 2ED1A 2FO0A 1KD1C 1Q7YR 2RQRA 2VGMA 2FL7A 2X4JA 2DL3A 3L2VA 1UE9A 1PD0A 1YFNA 1UUEA 3QDRB 3IQLA 2E6NA 1VQOA 1VQPA 1VQ8Q 4M7AF 4RCCA 3OSSC 3UF4A 2M0YA 2EGEA 4JZ3A 3LWHA 2OTLQ 3M5AA 3QHSA 1H641 2RQUA 2K6DA 4N0AA 5GAOn 3SWNA 3EAEA 4BE0A 2DL4A 2KRNA 4PK4A 2XIDA 1K0XA 5D6WA 2CH4A 4N0AC 4OB0B 1G83A 3SWNC 5DM7R 3SWNB 3M4YA 3JCMP 2GQIA 3EHQA 2KYBA 2A3LA 4HKEA 2C0IA 4D8KA 2A37A 2RK1A 4E7SA 4F16A 3CCQA 4JJCA 5GMKj 5CQYA 2M0OA 2JOYA 1VQMT 1NM7A 4M78G 3TCJA 2DXTA 3MEAA 4KULA 1I0CA 5GANe 2MCNA 5GAN2 2DRKA 1RAFB 2CYZB 3KBGA 2JXBA 1WHJA 5GAN6 2DE0X 2L3PA 5LJ3e 1LOJA 1PKSA 4KGVB 3H41A 4BB7A 3JCMe 3OYEA 2K2MA 4ORZA 4OF1A 3ULRB 3GIBA 2DF6A 3V8JA 2LJ3A 2PNIA 1UDLA 1IGUA 1XNIA 1M8VA 2BTTA 1GL5A 1WA7A 5GAOq 3I55T 4GY5A 4ZNXA 4GBQA 2AT1B 2EQKA 2M51A 2X3WD 3PMTA 2LP5A 3S3MA 2CZ7B 2Y4YA 4F7UG 3JB9F 2DKGA 4ZTJA 1WDXA 4M78E 1YIJQ 4PLLA 2RA2A 4C92G 2R58A 1VQ9A 3ZL7C 2XDBA 3O8VA 2M1HA 5A0GA 1WXBA 2OJ2A 1M3BA 1W4SA 1WLPB 2DETA 2EYZA 1KD1R 4M7AG 4JZ4A 4M78C 5C6SA 4M78B 2AK5A 2MWOA 3CPWP 2HMAA 2KBTA 1VQ4A 1VQ6Q 1PRLC 2HQXA 4HVUA 3CCVQ 1PSFA 2RO0A 1SHFA 2EYWA 3VRZA 2HL3A 2VUBA 1SKUB 1UEBA 3CCMA 1BU1A 3CCSQ 3DLMA 3FRNA 5DY9A 2B8AA 3EG1A 1ZUKA 1Y0MA 3VS7A 5D6YA 1G3TA 2JN0A 1W2BS 1D0ZA 5CKHA 3CC4T 2XICA 2L0AA 3HRSA 2KXDA 1Q95G 2ROTA 4A4EA 3CCUA 4F7UA 1I8FA 2K3BA 2EGAA 2KAFA 3LWIA 3J7AF 4C92A 4J9DA 1OZ2A 5HY6A 2DXCA 4M7AE 4F7UB 4DA4A 4L6V5 1MV0B 3I35A 4C92C 1VUBA 4C92B 2RF0A 1Q86U 2QK0A 1VQLA 2PTKA 3CCET 2D0NA 4YTLA 2DZCA 1YITA 1N8RC 3CC2Q 2EQJA 4M7AC 1X2KA 4M7AB 1VQ5Q 2HCKA 4JRQA 3NPFA 4LE9A 4ANJA 1O9SA 2EFIA 1M1FA 2RPNA 2NLUA 4KUIA 4JPBW 4J6XA 2DPPB 2RK2A 1D3BB 3LGLA 1MMDA 4RUGA 4OMFB 4WTOB 2FYKA 4IUUA 1OU8A 3EG2A 1A0NB 2CP7A 1EIFA 4FSSA 1PG5B 3JB9G 3CC7T 1GRIA 5CR2A 3X25B 3QYGB 3CXCS 1X2QA 4J8OA 1RABB 4A4FA 2MOXA 1ZQ1A 3OMGA 1WFWA 1X6GA 4RTVA 1XTDA 1PNJA 2LZ6B 2P0PA 4ZTFA 2EJFA 1VQNQ 4C0FA 4PFOA 1S72T 3QYHB 4M77D 3ZFJA 1BYMA 2DTOA 3P8DA 1I07A 2QEXT 3QG1A 1PKTA 2R57A 1X43A 3RMSA 2LRQA 1OI1A 2FVUA 2DO3A 4DBRA 1YJWA 2VKNA 2KK4A 1SSHA 3DKMA 2FZCB 2A7YA 2F2XA 1PSEA 5KH6A 5GJVB 4KGXB 2R5AA 4Z02A 1TSFA 2O88A 3RIRA 2DILA 1RADB 2E1HA 2CP5A 5GAN5 3TVTA 2CT3A 1YI2T 1CKBA 4DOWA 1KIKA 2BIVA 2EKHA 2O31A 3TQ7P 3E9GA 4BY6C 4BY6B 2GFUA 3FJ5A 4M75F 3G6EA 2NUPA 4FCYA 1PM3A 2F2WA 1V1CA 2D8HA 1N9SA 2EYYA 1IB8A 1U06A 1YIJA 1YJ9Q 1QP2A 4FM4B 5GAN3 1CKAA 1VQKT 1LPLA 1M27C 3MJXA 3NTIA 2NUPB 5IH2A 1HXDA 2J7IA 3HHTB 2ATCB 4DEXA 2CUBA 5KE3A 1IGQA 3OYJA 1KHCA 1C6VX 4C5EA 3EGXA 2KE9A 1ZSZA 4FSXA 1TUCA 2OI3A 1N8RR 2RN8A 4K11A 4C0ZA 5GMKi 1HK9A 3OYNA 1ZSZC 4IUVA 1QCNA 5LJ3h 3PIOA 4AFQC 3PE0A 2DEUA 4HCKA 4L59A 4XU0A 3UA7A 3EH1A 4J9BA 1VQOQ 3R6NA 1VQPQ 2E4HA 3EFRA 4ZGJB 2V8IA 3SDZA 2X4WA 4OB2B 4IURA 1OYXA 2MF2A 3GOXA 1SEMA 1ZHIA 3N5BB 2AIRB 3FIFA 3G4ST 2DL7A 2RMOA 3JAME 3CMET 1LJOA 4FL6A 5CVIA 5IN1A 5IXBA 3CCEQ 2PQWA 1IHVA 1Z9ZA 3KFVA 3OYLA 1MUZA 2KR3A 3BDLA 1M90R 1AWJA 2DD4A 1H3HA 5DLQE 1M1GA 2ESWA 2F69A 1BBZA 4HCCA 4E7JA 2VXEA 3CCQQ 5CKDA 1K9MU 5GANj 4QKUA 4NOYA 4AG2C 1GBRA 2CZ0B 2OTJT 2J6OA 2BZXA 5LJ3j 2W10A 3VS5A 3V8LA 4XU2A 2RHUA 1T0HA 1UECA 1E6GA 2DIGA 2EJGA 2RHZA 2FRYA 3CQTA 4M75G 1BK2A 3EG0A 1KQ2A 2CS7A 1GCQC 4C5HA 1WJRA 3NGPA 1W70A 2GNCA 5CKFA 2DXBA 3M0TA 5KYUA 1VQMA 4J9EA 2RHXA 2XMFA 3G7ZA 2GBQA 1WIEA 1KSWA 4LDUA 5FU6C 2ENMA 5FU6B 4Z8AA 3G71T 3UA6A 4C8QA 5I2SA 1S1NA 2QA4T 4DEYA 3GLXA 3RESA 2X3XD 4JJDA 3RKXA 4J9IA 1LNXA 3BFMA 3M0PA 2KEAA 1VQ9Q 4LNPA 4O6JA 1QQJA 3OYHA 1Q86C 4C92D 1N9RA 1UTIA 1ZBJA 5C0MA 2X51A 3H0FA 3JB9J 4M75E 3I55A 3EGUA 1KQSP 4XK8E 4XAXB 1Q81U 2DBMA 4JRKA 4M75A 2R5MA 1VQ4Q 3CPFA 2IPOB 1FYNA 2EYQA 1NJIU 2HBWA 1AZEA 4RKUE 4M75C 4M75B 3CCMQ 1VQKQ 3VS2A 3BW1A 1MHNA 2EQUA 3M4GA 5HK3A 1FX7A 2KDSA
chains in the Genus database with same CATH topology
2EBPA 4E6RA 2DL8A 2BTTA 1GL5A 1FMKA 1WA7A 3H0IA 4ZNXA 4GBQA 2FPFA 4OMPA 1ZX6A 2M51A 2X3WD 2LP5A 2BZYA 1UGVA 2EW3A 4AFSC 4J9FA 2DNUA 3PVLA 4ESRA 2RQTA 4D8DA 1WDXA 5GJWB 4RTZA 4LUEA 2B86A 3O5ZA 3ZL7C 1AOJA 1VA7A 2J6FA 1N5ZA 2JM8A 4HVWA 2CDTA 2F2VA 2RNAA 1WXBA 2OJ2A 1M3BA 1JU5C 1WLPB 3GBQA 2EYZA 1GCQA 1ZSGA 2A36A 4JZ4A 1SRMA 1W1FA 2KRSA 2JS0A 2AK5A 2KBTA 2L3QA 1PRLC 4HVUA 1H92A 5I11A 1SHFA 2EYWA 2LJ1A 5HCKA 3VRZA 3VS1A 4AFUC 2ROLA 1BU1A 1K1ZA 2A28A 1WI7A 1NYGA 4Z89A 1QKWA 3EG1A 4R0KA 3PVQA 2KXCA 2LNHB 1W6XA 2DL5A 1ZUKA 1QWEA 1Y0MA 3VS7A 1Y57A 5IHKA 4RTUA 1YP5A 1SRLA 3I5RA 2KGTA 4CC4B 2GTOA 4OMLA 2L0AA 2KXDA 1UJYA 1VYTA 3VRYA 3VS4A 2ROTA 5IXFA 2K3BA 1K4US 2EGAA 1OEBA 5L23A 1UG1A 4J9DA 1G2BA 1NG2A 1AWWA 1MV0B 3I35A 4WCIA 5FWCA 1RI9A 2RF0A 2JS2A 3RNJA 2K7AA 1HJDA 2PTKA 2I0NA 2D0NA 2NUZA 3UATA 4IIOA 1KJWA 3EG3A 1YWPA 2YUPA 1X2KA 2GGRA 2HCKA 2HSPA 2ECZA 3NPFA 1J3TA 3THKA 1TUDA 1JEGA 1JO8A 1ZLMA 2AZVA 4LE9A 2KT1A 2D8JA 2YUQA 3M0QA 2KNBB 4F14A 2RPNA 4AFZC 4JPBW 5FW9A 1KFZA 3NHNA 4RUGA 5I22A 2ED0A 2EVRA 2KT8A 2PZ1A 1OPLA 1U3OA 3EG2A 1K9AA 1B07A 1A0NB 4FSSA 3JV3A 1GRIA 4KRTA 2O9VA 2J06A 1OOTA 1X2QA 4LUDA 1M30A 2J6KA 4QT7A 4X1VA 2MOXA 1WXTA 1WFWA 1X6GA 2IIMA 4RTVA 2YSQA 2K79A 4LN2A 1PNJA 2LZ6B 1AZGB 1UHFA 2JTEA 1VYVA 2HEQA 1X69A 2JM9A 1EFNA 1TG0A 3M0UA 2C0TA 1PHTA 1OPKA 2OAWA 1YNZA 1I07A 2LX7A 2JMAA 1PKTA 4RTWA 1UHCA 1M3AA 1X43A 2EPDA 4OMMA 1SPKA 1LCKA 2G6FX 4A63B 2FRWA 2SEMA 1E7OA 2VKNA 1SSHA 2F2XA 1H8KA 4CC7A 1RUWA 3M0RA 5GJVB 1AVZC 2W0ZA 2O88A 2KYMA 2AZSA 2DILA 1GFDA 1NEGA 2YDLA 5FWBA 3TVTA 4J9HA 2CT3A 1CKBA 1SHGA 1KIKA 3SHWA 1X27A 2EKHA 2O31A 2LCSA 5IHIA 2DX1A 2KROA 1M3CA 2O9SA 3TSZA 4RTYA 3QWYA 3FJ5A 1UFFA 2V1QA 1QKXA 2F2WA 1V1CA 3TSWA 2D8HA 2EQIA 2FEIA 2EYYA 1U06A 2A08A 4RTTA 4IIMA 2CREA 1CKAA 2FG0A 1M27C 5IH2A 5ECAA 3RBBB 1CSKA 2DYBA 2J7IA 4DEXA 1MV3A 2CUBA 1Z9QA 1XOVA 2KE9A 1VYUA 3SEMA 1NLPC 1QLYA 1TUCA 2OI3A 4OMQA 2RN8A 1IO6A 4K11A 1T3LA 1UJ0A 3M0SA 2SRCA 2MIOA 2DBKA 1JXOA 1K76A 2EGCA 3U23A 2JMCA 4AFQC 3PE0A 1WXUA 4HCKA 2CSIA 1OV3A 2NWMA 4F17A 3UA7A 4HVVA 2DRMA 3A98A 2CH4W 3I5SA 1HSQA 4J9BA 3R6NA 2LQNA 3VS3A 2L2PA 2CT4A 1YWOA 1ZUUA 2JT4A 4OMOA 1SEMA 2FPDA 2KRMA 4HXJA 4CC3A 2RQVA 2DL7A 2E5KA 2RMOA 2VWFA 3H0HA 5IXBA 2CSQA 1Z9ZA 3KFVA 2P4RA 3C0CA 1AWXA 3VS0A 1MUZA 4J9CA 2H8HA 2EYXA 2KR3A 3VS6A 1HD3A 3EHRA 1AWJA 1H3HA 3QWXX 1E6HA 2DA9A 2RQWA 2ESWA 1BBZA 1NYFA 1RLPC 4J9GA 2YUOA 2DM1A 4GLMA 1B3QA 4AG2C 4Y92A 3LH5A 2J05A 1GBRA 2AKLA 2J6OA 2QDLA 2BZXA 1PRMC 2C0OA 2DJQA 2DLPA 1JXMA 2ED1A 2FO0A 2GTJA 2W10A 3VS5A 2RQRA 2LJ0A 2L3SA 2AKKA 1X6BA 2DL3A 1T0HA 1UECA 1UE9A 1E6GA 1UUEA 2FRYA 3CQTA 2V1RA 1BK2A 3EG0A 3IQLA 1ABOA 3REAB 1T0JA 1GCQC 1GBQA 3NGPA 1W70A 3UF4A 2BZ8A 2GNCA 2M0YA 4EIKA 2EGEA 4JZ3A 5EC7A 3M0TA 1PWTA 1BB9A 2ABLA 4J9EA 1I1JA 2XMFA 2RQUA 2GBQA 4Z88A 2K6DA 1JQQA 1WYXA 1WIEA 2DL4A 4AG1C 1KSWA 2KRNA 1YCSB 1NEBA 3REBB 2ENMA 2VVKA 1K0XA 4Z8AA 2CH4A 2YUNA 1G83A 2K9GA 3UA6A 1GFCA 1S1NA 1QCFA 1YN8A 2GQIA 2DMOA 4RTXA 3EHQA 4DEYA 2KYBA 2C0IA 1ABQA 4D8KA 2LQWA 1T3SA 2X3XD 4JJDA 2FPEA 2LMJA 4J9IA 2JW4A 4OMNA 3NMZC 2A37A 4F16A 4JJCA 3M0PA 2KEAA 4LNPA 2CUDA 2O2OA 1AD5A 1NM7A 2DVJA 1K0SA 1UTIA 1ZBJA 1ZUYA 1I0CA 2YT6A 3H0FA 2MCNA 1GCPA 3I9QA 4JJBA 1QWFA 2DRKA 2JXBA 3EGUA 2DE0X 1NLOC 2L3PA 4M4ZA 2DBMA 1M8MA 1PKSA 1RLQC 1FYNA 3H41A 1ARKA 2K2MA 4ORZA 3ULRB 1AWOA 1WX6A 1U5SA 2HBWA 5IHNA 1AZEA 2DF6A 2HDAA 2LJ3A 2PNIA 3VS2A 4CC2A 1AEYA 2D1XA 1UDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBP A;  4E6R A;  2DL8 A;  2BTT A;  1GL5 A;  1FMK A;  1WA7 A;  3H0I A;  4ZNX A;  4GBQ A;  2FPF A;  4OMP A;  1ZX6 A;  2M51 A;  2X3W D;  2LP5 A;  2BZY A;  1UGV A;  2EW3 A;  4AFS C;  4J9F A;  2DNU A;  3PVL A;  4ESR A;  2RQT A;  4D8D A;  1WDX A;  5GJW B;  4RTZ A;  4LUE A;  2B86 A;  3O5Z A;  3ZL7 C;  1AOJ A;  1VA7 A;  2J6F A;  1N5Z A;  2JM8 A;  4HVW A;  2CDT A;  2F2V A;  2RNA A;  1WXB A;  2OJ2 A;  1M3B A;  1JU5 C;  1WLP B;  3GBQ A;  2EYZ A;  1GCQ A;  1ZSG A;  2A36 A;  4JZ4 A;  1SRM A;  1W1F A;  2KRS A;  2JS0 A;  2AK5 A;  2KBT A;  2L3Q A;  1PRL C;  4HVU A;  1H92 A;  5I11 A;  1SHF A;  2EYW A;  2LJ1 A;  5HCK A;  3VRZ A;  3VS1 A;  4AFU C;  2ROL A;  1BU1 A;  1K1Z A;  2A28 A;  1WI7 A;  1NYG A;  4Z89 A;  1QKW A;  3EG1 A;  4R0K A;  3PVQ A;  2KXC A;  2LNH B;  1W6X A;  2DL5 A;  1ZUK A;  1QWE A;  1Y0M A;  3VS7 A;  1Y57 A;  5IHK A;  4RTU A;  1YP5 A;  1SRL A;  3I5R A;  2KGT A;  4CC4 B;  2GTO A;  4OML A;  2L0A A;  2KXD A;  1UJY A;  1VYT A;  3VRY A;  3VS4 A;  2ROT A;  5IXF A;  2K3B A;  1K4U S;  2EGA A;  1OEB A;  5L23 A;  1UG1 A;  4J9D A;  1G2B A;  1NG2 A;  1AWW A;  1MV0 B;  3I35 A;  4WCI A;  5FWC A;  1RI9 A;  2RF0 A;  2JS2 A;  3RNJ A;  2K7A A;  1HJD A;  2PTK A;  2I0N A;  2D0N A;  2NUZ A;  3UAT A;  4IIO A;  1KJW A;  3EG3 A;  1YWP A;  2YUP A;  1X2K A;  2GGR A;  2HCK A;  2HSP A;  2ECZ A;  3NPF A;  1J3T A;  3THK A;  1TUD A;  1JEG A;  1JO8 A;  1ZLM A;  2AZV A;  4LE9 A;  2KT1 A;  2D8J A;  2YUQ A;  3M0Q A;  2KNB B;  4F14 A;  2RPN A;  4AFZ C;  4JPB W;  5FW9 A;  1KFZ A;  3NHN A;  4RUG A;  5I22 A;  2ED0 A;  2EVR A;  2KT8 A;  2PZ1 A;  1OPL A;  1U3O A;  3EG2 A;  1K9A A;  1B07 A;  1A0N B;  4FSS A;  3JV3 A;  1GRI A;  4KRT A;  2O9V A;  2J06 A;  1OOT A;  1X2Q A;  4LUD A;  1M30 A;  2J6K A;  4QT7 A;  4X1V A;  2MOX A;  1WXT A;  1WFW A;  1X6G A;  2IIM A;  4RTV A;  2YSQ A;  2K79 A;  4LN2 A;  1PNJ A;  2LZ6 B;  1AZG B;  1UHF A;  2JTE A;  1VYV A;  2HEQ A;  1X69 A;  2JM9 A;  1EFN A;  1TG0 A;  3M0U A;  2C0T A;  1PHT A;  1OPK A;  2OAW A;  1YNZ A;  1I07 A;  2LX7 A;  2JMA A;  1PKT A;  4RTW A;  1UHC A;  1M3A A;  1X43 A;  2EPD A;  4OMM A;  1SPK A;  1LCK A;  2G6F X;  4A63 B;  2FRW A;  2SEM A;  1E7O A;  2VKN A;  1SSH A;  2F2X A;  1H8K A;  4CC7 A;  1RUW A;  3M0R A;  5GJV B;  1AVZ C;  2W0Z A;  2O88 A;  2KYM A;  2AZS A;  2DIL A;  1GFD A;  1NEG A;  2YDL A;  5FWB A;  3TVT A;  4J9H A;  2CT3 A;  1CKB A;  1SHG A;  1KIK A;  3SHW A;  1X27 A;  2EKH A;  2O31 A;  2LCS A;  5IHI A;  2DX1 A;  2KRO A;  1M3C A;  2O9S A;  3TSZ A;  4RTY A;  3QWY A;  3FJ5 A;  1UFF A;  2V1Q A;  1QKX A;  2F2W A;  1V1C A;  3TSW A;  2D8H A;  2EQI A;  2FEI A;  2EYY A;  1U06 A;  2A08 A;  4RTT A;  4IIM A;  2CRE A;  1CKA A;  2FG0 A;  1M27 C;  5IH2 A;  5ECA A;  3RBB B;  1CSK A;  2DYB A;  2J7I A;  4DEX A;  1MV3 A;  2CUB A;  1Z9Q A;  1XOV A;  2KE9 A;  1VYU A;  3SEM A;  1NLP C;  1QLY A;  1TUC A;  2OI3 A;  4OMQ A;  2RN8 A;  1IO6 A;  4K11 A;  1T3L A;  1UJ0 A;  3M0S A;  2SRC A;  2MIO A;  2DBK A;  1JXO A;  1K76 A;  2EGC A;  3U23 A;  2JMC A;  4AFQ C;  3PE0 A;  1WXU A;  4HCK A;  2CSI A;  1OV3 A;  2NWM A;  4F17 A;  3UA7 A;  4HVV A;  2DRM A;  3A98 A;  2CH4 W;  3I5S A;  1HSQ A;  4J9B A;  3R6N A;  2LQN A;  3VS3 A;  2L2P A;  2CT4 A;  1YWO A;  1ZUU A;  2JT4 A;  4OMO A;  1SEM A;  2FPD A;  2KRM A;  4HXJ A;  4CC3 A;  2RQV A;  2DL7 A;  2E5K A;  2RMO A;  2VWF A;  3H0H A;  5IXB A;  2CSQ A;  1Z9Z A;  3KFV A;  2P4R A;  3C0C A;  1AWX A;  3VS0 A;  1MUZ A;  4J9C A;  2H8H A;  2EYX A;  2KR3 A;  3VS6 A;  1HD3 A;  3EHR A;  1AWJ A;  1H3H A;  3QWX X;  1E6H A;  2DA9 A;  2RQW A;  2ESW A;  1BBZ A;  1NYF A;  1RLP C;  4J9G A;  2YUO A;  2DM1 A;  4GLM A;  1B3Q A;  4AG2 C;  4Y92 A;  3LH5 A;  2J05 A;  1GBR A;  2AKL A;  2J6O A;  2QDL A;  2BZX A;  1PRM C;  2C0O A;  2DJQ A;  2DLP A;  1JXM A;  2ED1 A;  2FO0 A;  2GTJ A;  2W10 A;  3VS5 A;  2RQR A;  2LJ0 A;  2L3S A;  2AKK A;  1X6B A;  2DL3 A;  1T0H A;  1UEC A;  1UE9 A;  1E6G A;  1UUE A;  2FRY A;  3CQT A;  2V1R A;  1BK2 A;  3EG0 A;  3IQL A;  1ABO A;  3REA B;  1T0J A;  1GCQ C;  1GBQ A;  3NGP A;  1W70 A;  3UF4 A;  2BZ8 A;  2GNC A;  2M0Y A;  4EIK A;  2EGE A;  4JZ3 A;  5EC7 A;  3M0T A;  1PWT A;  1BB9 A;  2ABL A;  4J9E A;  1I1J A;  2XMF A;  2RQU A;  2GBQ A;  4Z88 A;  2K6D A;  1JQQ A;  1WYX A;  1WIE A;  2DL4 A;  4AG1 C;  1KSW A;  2KRN A;  1YCS B;  1NEB A;  3REB B;  2ENM A;  2VVK A;  1K0X A;  4Z8A A;  2CH4 A;  2YUN A;  1G83 A;  2K9G A;  3UA6 A;  1GFC A;  1S1N A;  1QCF A;  1YN8 A;  2GQI A;  2DMO A;  4RTX A;  3EHQ A;  4DEY A;  2KYB A;  2C0I A;  1ABQ A;  4D8K A;  2LQW A;  1T3S A;  2X3X D;  4JJD A;  2FPE A;  2LMJ A;  4J9I A;  2JW4 A;  4OMN A;  3NMZ C;  2A37 A;  4F16 A;  4JJC A;  3M0P A;  2KEA A;  4LNP A;  2CUD A;  2O2O A;  1AD5 A;  1NM7 A;  2DVJ A;  1K0S A;  1UTI A;  1ZBJ A;  1ZUY A;  1I0C A;  2YT6 A;  3H0F A;  2MCN A;  1GCP A;  3I9Q A;  4JJB A;  1QWF A;  2DRK A;  2JXB A;  3EGU A;  2DE0 X;  1NLO C;  2L3P A;  4M4Z A;  2DBM A;  1M8M A;  1PKS A;  1RLQ C;  1FYN A;  3H41 A;  1ARK A;  2K2M A;  4ORZ A;  3ULR B;  1AWO A;  1WX6 A;  1U5S A;  2HBW A;  5IHN A;  1AZE A;  2DF6 A;  2HDA A;  2LJ3 A;  2PNI A;  3VS2 A;  4CC2 A;  1AEY A;  2D1X A;  1UDL A; 
#chains in the Genus database with same CATH topology
 4A4G A;  2CP3 A;  2EBP A;  1I5O B;  4E6R A;  3CXC A;  3L42 A;  2DL8 A;  3OBW A;  1FMK A;  3S6W A;  8AT1 B;  2K3X A;  3GP8 A;  5KYY A;  1G8X A;  1XJW B;  4J7I A;  2FPF A;  4DBH A;  4O5V A;  1ZX6 A;  2Y4X A;  4PNO A;  3AT1 B;  3QJY A;  3CCU Q;  4PJO G;  4AFS C;  2V8K A;  2LQ8 A;  2DNU A;  2EJ9 A;  4J9F A;  5KYY B;  3OYI A;  3OS0 A;  1FMW A;  3QII A;  1HYO A;  2O4X A;  5GAN d;  4FW2 A;  1VA7 A;  3JCM X;  1N5Z A;  2RNA A;  1I5L A;  3UPU A;  3HKS A;  1JU5 C;  3JCM W;  2P4T A;  2I2L A;  1TUG B;  1KQ1 A;  4FYV B;  2O4X B;  1VQL Q;  2A36 A;  3CC4 A;  3JCM d;  3I56 T;  1SRM A;  1W1F A;  4X34 A;  5FRM A;  1BCM A;  1YIT Q;  2HQE A;  3QZ5 B;  2EAY A;  4ME7 A;  5GAO r;  2FHD A;  1X6O A;  1N27 A;  2DYI A;  1WQW A;  3M59 A;  3PMI A;  2MMP A;  2ZPH B;  3GNF B;  3CME Q;  3QUI A;  1K1Z A;  2WSF E;  3FJP A;  1WI7 A;  2LQK A;  1YHQ T;  1QKW A;  4R0K A;  2DL5 A;  1QWE A;  3CCE A;  1Y07 A;  3HL8 A;  4PJL A;  1YP5 A;  4PJO E;  1SRL A;  2KGT A;  3JB9 D;  1QVF P;  5GAN g;  4PJO A;  2OTJ Q;  2CP2 A;  2L5Q A;  4DBF A;  5GAO l;  2DAQ A;  3C12 A;  2IG0 A;  2ZGW A;  4PJO C;  2D9T A;  3JCM g;  4PJO B;  1NG2 A;  3JCM c;  1Q86 R;  3WVE B;  2KSS A;  3TRE A;  5CAI A;  1EZZ B;  3MEW A;  1Y96 A;  2QQA A;  2ZZD A;  4WCI A;  3CD6 T;  1RI9 A;  2K7A A;  3CC7 A;  4EMG A;  3SB2 A;  5J26 A;  2C06 A;  3OW2 A;  3CCL T;  1Y96 B;  1YJW Q;  4IIO A;  1KJW A;  3EG3 A;  1YWP A;  3M54 A;  2YUP A;  2CZ1 B;  2ECZ A;  1J3T A;  3THK A;  1JO8 A;  2CKK A;  2JVV A;  1S72 A;  3PGG A;  2CGH A;  2HD0 A;  2KT8 A;  2QEX A;  3CMA T;  1OPL A;  2LCL A;  1K9A A;  5CO7 A;  2LDM A;  2ZPE B;  2J06 A;  4V2S A;  1PCX A;  4LUD A;  3L1A A;  4B6M A;  1M30 A;  4ELZ C;  4X1V A;  4OVA A;  1V29 B;  3G6E Q;  3CBM A;  4LN2 A;  4FYY B;  3OMC A;  1AZG B;  2QAZ A;  5I21 A;  1QVG A;  1UGR B;  1VYV A;  2JM9 A;  1EFN A;  2KVQ G;  2RJD A;  5GAN f;  3VKI A;  2C0T A;  2YRV A;  1KQS S;  4M78 A;  1OPK A;  1PD1 A;  2YXY A;  4II1 A;  1YI2 A;  1YNZ A;  1KK7 A;  1RAH B;  1VQ7 T;  1K9M C;  3JCM f;  1M4Z A;  2CZ6 B;  2EPD A;  1LCK A;  3E2U A;  3H8Z A;  4A53 A;  1WHK A;  4A4H A;  2LNV A;  4LXC A;  2L89 A;  1IZ6 A;  4QQD A;  1YBY A;  1RUW A;  1VQK A;  2LTO A;  3M0R A;  1JJ2 P;  2W0Z A;  1QVP A;  1D0Y A;  2AZS A;  2FZK B;  2YDL A;  2MWP A;  2HKQ B;  2L8D A;  2GF7 A;  3SHW A;  3TEE A;  1M3C A;  3L2W A;  2HNI A;  4RTY A;  3QWY A;  1WHH A;  1SG5 A;  1UFF A;  2V1Q A;  1Q82 U;  3JSC A;  3LGF A;  4UC4 A;  3OYD A;  4KGZ B;  4M7D F;  2CRE A;  2FG0 A;  3I56 Q;  3P8B B;  2RB6 A;  2QG9 B;  1CSK A;  2DYB A;  2RHY A;  4CRI A;  3L2Q A;  1K73 U;  2E6Z A;  2P0Q A;  4XTV A;  4OB1 B;  4M7A A;  2QDY B;  4C8Q D;  1AT1 B;  1XOV A;  4ZGD B;  3SEM A;  1G5V A;  4OMQ A;  4N4G A;  1D3B A;  1UJ0 A;  3M0S A;  3G4S A;  2E12 A;  2SRC A;  3S3N A;  2DBK A;  1Q81 C;  3CME A;  2EGC A;  3U23 A;  5GAM h;  2CSI A;  3M56 A;  4XQ3 A;  3QBY A;  1NZ9 A;  1QVF S;  2DRM A;  4JS4 A;  4PLI A;  2NYS A;  3KUF A;  3V7S A;  1LVK A;  3OS5 A;  4M75 D;  1KHI A;  1JRI A;  4MZP A;  2WSC E;  2E10 A;  6AT1 B;  4ZGE B;  2CT4 A;  1YWO A;  4R55 A;  1H3Z A;  2GFA A;  3M53 A;  2OTJ A;  5KYW A;  1VQM Q;  3MPU B;  3VUZ A;  4J83 A;  2KRM A;  4OGE A;  1BIA A;  4CC3 A;  2VWF A;  2P4R A;  5KYW B;  3CCL Q;  3OSV A;  1KC8 U;  1M90 C;  4J9C A;  1OUL A;  2H8H A;  3OYG A;  3CCR T;  1XQH A;  3MP1 A;  2EIF A;  1K9M R;  3WVD B;  1MNE A;  1RLP C;  4MMK A;  2RI5 A;  4GLM A;  4Y92 A;  3LH5 A;  2YRD A;  2E5Q A;  2AKL A;  4JDS A;  3AHU A;  5IT9 E;  2C0O A;  2DJQ A;  3A8G B;  2DLP A;  3INZ A;  2G3R A;  1JXM A;  2GTJ A;  4KT0 E;  1KG1 A;  1I81 A;  2LJ0 A;  4FT2 A;  4QQG A;  2L3S A;  3I55 Q;  3G71 A;  1X6B A;  4PJJ A;  5CCA A;  5KE2 A;  2QA4 A;  4MDW A;  3HRT A;  2V1R A;  2RHI A;  1ABO A;  3REA B;  1T0J A;  4XU3 A;  4B9X A;  2Y90 A;  3E1S A;  2BZ8 A;  3CEY A;  4EIK A;  4M7D G;  1K8A U;  2WSE E;  3BY7 A;  3PTA A;  3T9N A;  5LJ5 e;  4JRP A;  1I1J A;  2MPX C;  1JQQ A;  4JUV A;  2D0Q B;  1D1B A;  1WYX A;  3REB B;  2K9G A;  5CQX A;  3CPW S;  4BE1 A;  4A4K A;  1D1A A;  1GFC A;  3JB9 I;  4C0G A;  3UT1 A;  1R8O B;  4RTX A;  3QXE B;  4XTW A;  5GAM e;  2KMT A;  2LQW A;  3EG9 B;  2F1L A;  2LCC A;  2RJC A;  3GF5 A;  4PJO D;  2F5K A;  2JW4 A;  3NMZ C;  1JJ2 S;  2QTV A;  2CUD A;  2A0F B;  2O2O A;  2NUT A;  2D6F A;  2DVJ A;  3J81 E;  1K0S A;  1ZUY A;  3LLR A;  1WHM A;  2YT6 A;  4M77 F;  1Q81 R;  1GCP A;  2K5L A;  3I9Q A;  4F04 B;  4JJB A;  1QWF A;  2O01 E;  2MK5 A;  3CC4 Q;  3LH0 A;  3VYG A;  2NUT B;  2QYZ A;  1NLO C;  5IAY A;  4E7I A;  4OP0 A;  4M4Z A;  1RL2 A;  1TH7 A;  3MKD A;  3MHX A;  5J3B A;  1M8M A;  3BE3 A;  4M7D E;  2K3Y A;  1RLQ C;  4IUQ A;  2X4Y A;  1WX6 A;  3HFO A;  4M7D A;  5IHN A;  2ZAE A;  1YJN T;  4FU6 A;  3VJP A;  2VXF A;  4CC2 A;  1RAA B;  1AEY A;  2D1X A;  1PRM C;  4HCB A;  4M7D C;  3OYY A;  5J39 A;  4M7D B;  2E70 A;  3OQ5 A;  4LDV A;  3OS2 A;  3A8M B;  3I56 A;  3VUB A;  4RG8 A;  2QTX A;  1AHJ B;  3H0I A;  1M9S A;  2AHJ B;  2EKO A;  2EW3 A;  4ESR A;  2RQT A;  1VQ8 T;  4D8D A;  5GJW B;  4RTZ A;  1IRE B;  1BI0 A;  4QVD A;  1WHL A;  3O5Z A;  2OTL T;  2J6F A;  1YHQ A;  2CDT A;  3CBP A;  2OX7 A;  2X9H A;  2H3J A;  4M78 D;  4MZM A;  2IVW A;  2L3R A;  2DXU A;  3CC7 Q;  5AYF A;  1GCQ A;  2PU9 B;  1BCO A;  2JS0 A;  1RAI B;  5GAN 8;  3CCJ T;  1WNL A;  1QCO A;  3OB9 A;  3PT9 A;  1B7T A;  1UGP B;  4JLG A;  3X26 B;  3ASK A;  4L5G A;  3VS1 A;  1S72 Q;  4AFU C;  2DTH A;  2QQS A;  4FYW B;  3RMQ A;  1ZBX A;  2A28 A;  1NYG A;  1W2B A;  5GAO m;  2DTI A;  2KXC A;  2LNH B;  2QEX Q;  3CD6 A;  1OX8 A;  2HAX A;  4HA8 A;  2BE9 B;  3F70 A;  3ZBD A;  1B34 A;  2XK0 A;  5IHK A;  1M2O A;  4HCZ A;  2E41 A;  2XI9 A;  3CCL A;  3I5R A;  5FRO A;  2PUK B;  4OML A;  1UJY A;  4QVC A;  3VS4 A;  5IXF A;  5CKE A;  5L8R E;  1B34 B;  3LX7 A;  3QKJ A;  2FZG B;  1OEB A;  5L23 A;  2H3E B;  5I2M A;  4Y28 E;  4JS5 A;  1K73 C;  3C4S A;  3FDR A;  2DZ9 A;  2XG8 D;  3M57 A;  1AWW A;  1R0C B;  2YLC A;  1GXI E;  3CMA A;  2ZPI B;  4WF2 A;  1YI2 Q;  4VUB A;  5FWC A;  2DER A;  3E9F A;  3NTK A;  2JS2 A;  3RNJ A;  1P92 A;  1HJD A;  2I0N A;  3MCA B;  4M7A D;  4P5N A;  3UAT A;  1TOV A;  4BAC A;  2E64 A;  3FC3 A;  4ZN1 A;  2AZV A;  2YUQ A;  2D8J A;  2HKN A;  2PVD B;  1QVF A;  1YCY A;  4E7H A;  1VIF A;  1KFZ A;  3OBY A;  1JB0 E;  1JBM A;  2EWN A;  2E65 A;  1FMV A;  2MAM A;  2PZ1 A;  2XKO C;  3LYI A;  3Q1J A;  1VQ7 A;  1U3O A;  2JTM A;  1B07 A;  2BE7 D;  3JV3 A;  2O9V A;  4XTX A;  3GNG A;  4BI3 A;  4M77 E;  1WXT A;  3QDF A;  1FXX A;  2WAC A;  1VQ6 T;  1RAG B;  2YSQ A;  3TU4 K;  2K79 A;  2LVM A;  3CCV T;  3J80 E;  1UHF A;  1KC8 C;  2HBP A;  1UGS B;  1TG0 A;  3M0U A;  1U1S A;  1PHT A;  4BI8 B;  4PJM A;  5KCO A;  3CCS T;  2OAW A;  4MZT A;  4M77 B;  3RKW A;  5LJ3 d;  1MMN A;  2LX7 A;  1NE8 A;  4RTW A;  4KH0 B;  1VOM A;  2PVG B;  5GMK l;  4A63 B;  1ACM B;  2SEM A;  4RCB A;  5KYX B;  1H8K A;  4EPC A;  4CC7 A;  3G4S Q;  4F7U F;  2JZ2 A;  1QW1 A;  1X01 A;  4DBQ A;  4C92 F;  3MP6 A;  2YLB A;  3L2U A;  5FWB A;  3PFS A;  4J9H A;  1TXQ A;  4JLI A;  2LT4 A;  1K8A C;  3JB9 H;  4AMC A;  1M2V A;  1SHG A;  2LCS A;  5IHI A;  2DX1 A;  2KRO A;  1Q82 R;  2O9S A;  3TSZ A;  2VYT A;  1TTH B;  3CC2 T;  4E7K A;  1M2V B;  2F5T X;  4KBM B;  1VQ5 T;  2BUD A;  5LJ3 g;  4A54 A;  2A08 A;  3CPW A;  4XTU A;  1K73 R;  4CI0 C;  2MYS A;  4TVR A;  5GAN 4;  5FRN A;  1X75 C;  5ECA A;  3RBB B;  3CCJ Q;  4XTZ A;  4LDY A;  2COZ A;  1NPP A;  4FIB A;  1JJ2 A;  3MP8 A;  1Z9Q A;  1SF9 A;  3PNW C;  2HSE B;  3CXC P;  2E3I A;  1QLY A;  1M1K U;  2HZY A;  1IO6 A;  2QXF A;  1T3L A;  3M9Q A;  3MEV A;  3C95 A;  2MIO A;  4ELY C;  1JXO A;  1K76 A;  1BI1 A;  1VQN T;  2JMC A;  1U1T A;  1G3Y A;  3SD4 A;  3G71 Q;  1WXU A;  3JRZ A;  2JUF A;  3CCR A;  1OV3 A;  2DK3 A;  5FU7 C;  4F17 A;  5FU7 B;  1G3W A;  1M5Q 1;  2QA4 Q;  3G1J A;  3DB4 A;  2CH4 W;  7AT1 B;  1HSQ A;  4JRI A;  5LJ5 j;  3EFO A;  2FB7 A;  3VS3 A;  2L2P A;  1MMA A;  2GCX A;  5A2Q E;  4M7D D;  1PC0 A;  1ZUU A;  4PJN A;  2JT4 A;  4ATO A;  4OMO A;  1WPY A;  2FPD A;  3EFO B;  3NFC A;  3R6O A;  1KC8 R;  4E7Z A;  2RQV A;  3H0H A;  3L2R A;  4PKC C;  5GAM j;  3C0C A;  1AWX A;  3VS0 A;  3L2Z A;  5LJ3 f;  2EYX A;  3WXM B;  1HD3 A;  3EHR A;  2E3H A;  4J6Y A;  4NL2 A;  3QWX X;  1E6H A;  3V8K A;  4KH1 B;  3A8O B;  1BI3 A;  2QGF B;  1NYF A;  2RJE A;  4J9G A;  3JCM J;  2X4X A;  2DM1 A;  1B3Q A;  2J05 A;  1V76 A;  2QDL A;  1YJ9 T;  3ER0 A;  1TU0 B;  2AKK A;  2YHT A;  3X24 B;  1Q7Y U;  5A0D A;  3PIP A;  1K8A R;  1OX9 A;  2VGN A;  1GBQ A;  2V26 A;  5GAO p;  1QMC A;  5GMK h;  5EC7 A;  1RAE B;  3HFN A;  3OYK A;  1PWT A;  4C5I A;  1BB9 A;  2X35 A;  2ABL A;  3HPW A;  4JJN K;  2GQV A;  2QQ9 A;  4Z88 A;  3OW2 P;  4AG1 C;  1YCS B;  1NEB A;  1RI0 A;  2OAU A;  2VVK A;  4BUG A;  2YUN A;  4F7U E;  2VAS A;  5KYN A;  3FEO A;  2K2V A;  1QCF A;  1YN8 A;  4C92 E;  2DMO A;  5LJ5 h;  2RI3 A;  1ABQ A;  1VQO T;  1T3S A;  1VQP T;  1MGQ A;  2FPE A;  2LMJ A;  1YJN A;  2RM4 A;  4OMN A;  5AT1 B;  3H6Z A;  4BDY A;  1YHQ Q;  1AD5 A;  4KUD K;  1Y7X A;  2KI7 A;  3OYM A;  5M9O A;  1SSF A;  1I4K 1;  1MMG A;  4LD9 K;  2P84 A;  1NJI C;  1VIE A;  1QVG P;  3OY9 A;  1D1C A;  4GLK A;  3ME9 A;  3MET A;  4J5Y A;  3EFS A;  1ARK A;  2P0K A;  1VQ8 A;  3GPL A;  1AWO A;  1U5S A;  3QO3 A;  5LJ5 d;  2LC4 A;  2HDA A;  2OTL A;  3QJ6 A;  2QQB A;  1UB4 A;  3CCQ T;  3OYA A;  4FT4 A;  4X9D A;  1ZA2 B;  4XU1 A;  3A1P A;  3CD6 Q;  2HL5 C;  1BI2 A;  4E47 A;  2K5F A;  3SFM A;  3RER A;  5GAM d;  3CCJ A;  1RAC B;  4OMP A;  2BZY A;  4LDW A;  1UGV A;  2YWW A;  2RH2 A;  3URG A;  1OU9 A;  3PVL A;  2DFU A;  4LUE A;  2B86 A;  1R77 A;  1WHG A;  1WJQ A;  1AOJ A;  1BIB A;  1Y71 A;  3QPH A;  5CKB A;  4MDX A;  2JM8 A;  4HVW A;  3X20 B;  2F2V A;  3CMA Q;  1C0M A;  3P8H A;  5GMK e;  2K5I A;  3GBQ A;  1ZSG A;  2XU8 A;  5CK9 A;  5LJ5 g;  4J7F A;  2KRS A;  3OS1 A;  5EG2 A;  2L3Q A;  1KD1 U;  3HRU A;  2PVO B;  3HP9 A;  4EMK A;  1H92 A;  4C8Q F;  5I11 A;  2LJ1 A;  5HCK A;  3MEU A;  5KCH A;  5CIU A;  4EMK C;  4HT8 A;  2ROL A;  3JCM Q;  4EMK B;  1VQ9 T;  5GAM g;  4IUT A;  4Z89 A;  3QZ9 B;  2DEQ A;  3PVQ A;  3JCM V;  1W6X A;  1VQ7 Q;  1WQ7 A;  2DVE A;  1NPR A;  1Y57 A;  3EG9 A;  4RTU A;  3NTH A;  4IKF A;  2YRC A;  4CC4 B;  2GTO A;  1VQ4 T;  3VRY A;  1VYT A;  1G3S A;  1K4U S;  2M16 A;  4RMO A;  5DLO A;  1UG1 A;  2VV5 A;  2XDP A;  1G2B A;  4PFP A;  3CCM T;  3LW5 E;  1DJ7 B;  3A5Z B;  3E19 A;  3FB9 A;  5FLX E;  3RKY A;  1M1K C;  4EDU A;  3M58 A;  2JJ9 A;  5D7U A;  2NUZ A;  1FWZ A;  1NJI R;  1OQK A;  4N4I A;  1VQ6 A;  4FW1 A;  3S3O A;  3CCV A;  2RI2 A;  2GGR A;  4IUP A;  2HSP A;  1R0B G;  5LJ5 f;  5HK0 A;  3CCU T;  1TUD A;  3OW2 S;  1JEG A;  3EGX B;  1N6A A;  1ZLM A;  2M9U A;  2KT1 A;  3M0Q A;  4PL6 A;  2KNB B;  4F14 A;  2QI2 A;  1ZSZ B;  4AFZ C;  2K4Y A;  4EMH A;  5FW9 A;  3CCS A;  1IXD A;  3RDV A;  3NHN A;  5I22 A;  2ED0 A;  2EVR A;  1NBE B;  4E2F B;  3M55 A;  4C5G A;  1QP3 A;  1F1B B;  1O75 A;  4QW2 A;  1MND A;  4MML A;  5GAM f;  4KRT A;  1VQL T;  3HTR A;  1OOT A;  1YIT T;  1U8R A;  2J6K A;  4QT7 A;  4Y91 A;  3EH2 A;  3BDU A;  2IIM A;  2XHC A;  4C0D C;  4RG2 A;  4C0D B;  1IRX A;  3QSU A;  1TS9 A;  1KQS A;  2JTE A;  1IHW A;  2HEQ A;  1X69 A;  1D0X A;  2QGG A;  4ZN3 A;  5GMK m;  3HSB A;  1WZO A;  1QVG S;  1ZA1 B;  2KY9 A;  3UDC A;  2JNG A;  2BKD N;  8ATC B;  4C8Q G;  1EX4 A;  2JMA A;  2DJZ A;  1UHC A;  1M3A A;  3A8H B;  4OMM A;  1SPK A;  3C94 A;  2G6F X;  2V8J A;  3CC2 A;  2FRW A;  3X28 B;  2K57 A;  1E7O A;  4OB3 B;  1VQ5 A;  4X9C A;  4QVZ A;  3VV0 A;  1TWB A;  4PJO F;  4J6W A;  3OYB A;  4DOV A;  9ATC B;  1Q7Y C;  4Q5W A;  5D6X A;  1AVZ C;  2VC8 A;  2EQM A;  2MI6 A;  2KYM A;  4DQ2 A;  1GFD A;  1NEG A;  3CCR Q;  3RUX A;  2QQR A;  2COY A;  1Q82 C;  1X27 A;  3D7S B;  3V7C A;  3OYC A;  4PFZ A;  4BI4 A;  4BE2 A;  1QKX A;  1YJW T;  1WJS A;  3H9N A;  3TSW A;  2EQI A;  2FEI A;  4E7L A;  2HQH A;  2QAS A;  2M02 A;  2JTF A;  4M77 G;  1VQN A;  4RTT A;  4IIM A;  5KYU B;  3CBO A;  4C8Q E;  3OYF A;  5A0L A;  2ZPF B;  1UGQ B;  2CP0 A;  4LD6 A;  3OA6 A;  4HT9 A;  1WGS A;  5GAN 7;  5HKC A;  1MV3 A;  1BKB A;  4BD3 A;  1OZ3 A;  1M1K R;  3EGD A;  2COW A;  3KXT A;  4BDZ A;  1VYU A;  4C8Q C;  1NLP C;  4C8Q B;  3G6E T;  3FLG A;  3RR6 A;  3EGD B;  4AT1 B;  2XDD A;  1N8R U;  4NS5 A;  1YIJ T;  2CP6 A;  4FYX B;  3MO8 A;  3UWN A;  3VYH B;  3DLL A;  1C1A A;  2NWM A;  3V7R A;  4M78 F;  4HVV A;  4OGC A;  2DD5 A;  3A98 A;  3I5S A;  4D6W A;  4XTY A;  4QQ6 A;  2LQN A;  2ZPG B;  5GAN h;  2RD1 A;  3A8L B;  4N4H A;  1D09 B;  4M77 A;  1YJ9 A;  4HXJ A;  4R56 A;  3JCM h;  2E5K A;  4NL3 A;  2CSQ A;  3ZEH A;  4M77 C;  3DB3 A;  3VS6 A;  2LX9 A;  4LDX A;  3JCM b;  2ZPB B;  5KYX A;  2VB6 A;  4B9W A;  1W2B P;  2DA9 A;  2RQW A;  1M90 U;  2XD0 A;  5LL6 S;  1YJN Q;  2LT1 A;  3VU3 C;  2YUO A;  2ZCF B;  2DIQ A;  2KQW A;  2RJF A;  2Z0W A;  2PUO B;  2ED1 A;  2FO0 A;  1KD1 C;  1Q7Y R;  2RQR A;  2VGM A;  2FL7 A;  2X4J A;  2DL3 A;  3L2V A;  1UE9 A;  1PD0 A;  1YFN A;  1UUE A;  3QDR B;  3IQL A;  2E6N A;  1VQO A;  1VQP A;  1VQ8 Q;  4M7A F;  4RCC A;  3OSS C;  3UF4 A;  2M0Y A;  2EGE A;  4JZ3 A;  3LWH A;  2OTL Q;  3M5A A;  3QHS A;  1H64 1;  2RQU A;  2K6D A;  4N0A A;  5GAO n;  3SWN A;  3EAE A;  4BE0 A;  2DL4 A;  2KRN A;  4PK4 A;  2XID A;  1K0X A;  5D6W A;  2CH4 A;  4N0A C;  4OB0 B;  1G83 A;  3SWN C;  5DM7 R;  3SWN B;  3M4Y A;  3JCM P;  2GQI A;  3EHQ A;  2KYB A;  2A3L A;  4HKE A;  2C0I A;  4D8K A;  2A37 A;  2RK1 A;  4E7S A;  4F16 A;  3CCQ A;  4JJC A;  5GMK j;  5CQY A;  2M0O A;  2JOY A;  1VQM T;  1NM7 A;  4M78 G;  3TCJ A;  2DXT A;  3MEA A;  4KUL A;  1I0C A;  5GAN e;  2MCN A;  5GAN 2;  2DRK A;  1RAF B;  2CYZ B;  3KBG A;  2JXB A;  1WHJ A;  5GAN 6;  2DE0 X;  2L3P A;  5LJ3 e;  1LOJ A;  1PKS A;  4KGV B;  3H41 A;  4BB7 A;  3JCM e;  3OYE A;  2K2M A;  4ORZ A;  4OF1 A;  3ULR B;  3GIB A;  2DF6 A;  3V8J A;  2LJ3 A;  2PNI A;  1UDL A;  1IGU A;  1XNI A;  1M8V A;  2BTT A;  1GL5 A;  1WA7 A;  5GAO q;  3I55 T;  4GY5 A;  4ZNX A;  4GBQ A;  2AT1 B;  2EQK A;  2M51 A;  2X3W D;  3PMT A;  2LP5 A;  3S3M A;  2CZ7 B;  2Y4Y A;  4F7U G;  3JB9 F;  2DKG A;  4ZTJ A;  1WDX A;  4M78 E;  1YIJ Q;  4PLL A;  2RA2 A;  4C92 G;  2R58 A;  1VQ9 A;  3ZL7 C;  2XDB A;  3O8V A;  2M1H A;  5A0G A;  1WXB A;  2OJ2 A;  1M3B A;  1W4S A;  1WLP B;  2DET A;  2EYZ A;  1KD1 R;  4M7A G;  4JZ4 A;  4M78 C;  5C6S A;  4M78 B;  2AK5 A;  2MWO A;  3CPW P;  2HMA A;  2KBT A;  1VQ4 A;  1VQ6 Q;  1PRL C;  2HQX A;  4HVU A;  3CCV Q;  1PSF A;  2RO0 A;  1SHF A;  2EYW A;  3VRZ A;  2HL3 A;  2VUB A;  1SKU B;  1UEB A;  3CCM A;  1BU1 A;  3CCS Q;  3DLM A;  3FRN A;  5DY9 A;  2B8A A;  3EG1 A;  1ZUK A;  1Y0M A;  3VS7 A;  5D6Y A;  1G3T A;  2JN0 A;  1W2B S;  1D0Z A;  5CKH A;  3CC4 T;  2XIC A;  2L0A A;  3HRS A;  2KXD A;  1Q95 G;  2ROT A;  4A4E A;  3CCU A;  4F7U A;  1I8F A;  2K3B A;  2EGA A;  2KAF A;  3LWI A;  3J7A F;  4C92 A;  4J9D A;  1OZ2 A;  5HY6 A;  2DXC A;  4M7A E;  4F7U B;  4DA4 A;  4L6V 5;  1MV0 B;  3I35 A;  4C92 C;  1VUB A;  4C92 B;  2RF0 A;  1Q86 U;  2QK0 A;  1VQL A;  2PTK A;  3CCE T;  2D0N A;  4YTL A;  2DZC A;  1YIT A;  1N8R C;  3CC2 Q;  2EQJ A;  4M7A C;  1X2K A;  4M7A B;  1VQ5 Q;  2HCK A;  4JRQ A;  3NPF A;  4LE9 A;  4ANJ A;  1O9S A;  2EFI A;  1M1F A;  2RPN A;  2NLU A;  4KUI A;  4JPB W;  4J6X A;  2DPP B;  2RK2 A;  1D3B B;  3LGL A;  1MMD A;  4RUG A;  4OMF B;  4WTO B;  2FYK A;  4IUU A;  1OU8 A;  3EG2 A;  1A0N B;  2CP7 A;  1EIF A;  4FSS A;  1PG5 B;  3JB9 G;  3CC7 T;  1GRI A;  5CR2 A;  3X25 B;  3QYG B;  3CXC S;  1X2Q A;  4J8O A;  1RAB B;  4A4F A;  2MOX A;  1ZQ1 A;  3OMG A;  1WFW A;  1X6G A;  4RTV A;  1XTD A;  1PNJ A;  2LZ6 B;  2P0P A;  4ZTF A;  2EJF A;  1VQN Q;  4C0F A;  4PFO A;  1S72 T;  3QYH B;  4M77 D;  3ZFJ A;  1BYM A;  2DTO A;  3P8D A;  1I07 A;  2QEX T;  3QG1 A;  1PKT A;  2R57 A;  1X43 A;  3RMS A;  2LRQ A;  1OI1 A;  2FVU A;  2DO3 A;  4DBR A;  1YJW A;  2VKN A;  2KK4 A;  1SSH A;  3DKM A;  2FZC B;  2A7Y A;  2F2X A;  1PSE A;  5KH6 A;  5GJV B;  4KGX B;  2R5A A;  4Z02 A;  1TSF A;  2O88 A;  3RIR A;  2DIL A;  1RAD B;  2E1H A;  2CP5 A;  5GAN 5;  3TVT A;  2CT3 A;  1YI2 T;  1CKB A;  4DOW A;  1KIK A;  2BIV A;  2EKH A;  2O31 A;  3TQ7 P;  3E9G A;  4BY6 C;  4BY6 B;  2GFU A;  3FJ5 A;  4M75 F;  3G6E A;  2NUP A;  4FCY A;  1PM3 A;  2F2W A;  1V1C A;  2D8H A;  1N9S A;  2EYY A;  1IB8 A;  1U06 A;  1YIJ A;  1YJ9 Q;  1QP2 A;  4FM4 B;  5GAN 3;  1CKA A;  1VQK T;  1LPL A;  1M27 C;  3MJX A;  3NTI A;  2NUP B;  5IH2 A;  1HXD A;  2J7I A;  3HHT B;  2ATC B;  4DEX A;  2CUB A;  5KE3 A;  1IGQ A;  3OYJ A;  1KHC A;  1C6V X;  4C5E A;  3EGX A;  2KE9 A;  1ZSZ A;  4FSX A;  1TUC A;  2OI3 A;  1N8R R;  2RN8 A;  4K11 A;  4C0Z A;  5GMK i;  1HK9 A;  3OYN A;  1ZSZ C;  4IUV A;  1QCN A;  5LJ3 h;  3PIO A;  4AFQ C;  3PE0 A;  2DEU A;  4HCK A;  4L59 A;  4XU0 A;  3UA7 A;  3EH1 A;  4J9B A;  1VQO Q;  3R6N A;  1VQP Q;  2E4H A;  3EFR A;  4ZGJ B;  2V8I A;  3SDZ A;  2X4W A;  4OB2 B;  4IUR A;  1OYX A;  2MF2 A;  3GOX A;  1SEM A;  1ZHI A;  3N5B B;  2AIR B;  3FIF A;  3G4S T;  2DL7 A;  2RMO A;  3JAM E;  3CME T;  1LJO A;  4FL6 A;  5CVI A;  5IN1 A;  5IXB A;  3CCE Q;  2PQW A;  1IHV A;  1Z9Z A;  3KFV A;  3OYL A;  1MUZ A;  2KR3 A;  3BDL A;  1M90 R;  1AWJ A;  2DD4 A;  1H3H A;  5DLQ E;  1M1G A;  2ESW A;  2F69 A;  1BBZ A;  4HCC A;  4E7J A;  2VXE A;  3CCQ Q;  5CKD A;  1K9M U;  5GAN j;  4QKU A;  4NOY A;  4AG2 C;  1GBR A;  2CZ0 B;  2OTJ T;  2J6O A;  2BZX A;  5LJ3 j;  2W10 A;  3VS5 A;  3V8L A;  4XU2 A;  2RHU A;  1T0H A;  1UEC A;  1E6G A;  2DIG A;  2EJG A;  2RHZ A;  2FRY A;  3CQT A;  4M75 G;  1BK2 A;  3EG0 A;  1KQ2 A;  2CS7 A;  1GCQ C;  4C5H A;  1WJR A;  3NGP A;  1W70 A;  2GNC A;  5CKF A;  2DXB A;  3M0T A;  5KYU A;  1VQM A;  4J9E A;  2RHX A;  2XMF A;  3G7Z A;  2GBQ A;  1WIE A;  1KSW A;  4LDU A;  5FU6 C;  2ENM A;  5FU6 B;  4Z8A A;  3G71 T;  3UA6 A;  4C8Q A;  5I2S A;  1S1N A;  2QA4 T;  4DEY A;  3GLX A;  3RES A;  2X3X D;  4JJD A;  3RKX A;  4J9I A;  1LNX A;  3BFM A;  3M0P A;  2KEA A;  1VQ9 Q;  4LNP A;  4O6J A;  1QQJ A;  3OYH A;  1Q86 C;  4C92 D;  1N9R A;  1UTI A;  1ZBJ A;  5C0M A;  2X51 A;  3H0F A;  3JB9 J;  4M75 E;  3I55 A;  3EGU A;  1KQS P;  4XK8 E;  4XAX B;  1Q81 U;  2DBM A;  4JRK A;  4M75 A;  2R5M A;  1VQ4 Q;  3CPF A;  2IPO B;  1FYN A;  2EYQ A;  1NJI U;  2HBW A;  1AZE A;  4RKU E;  4M75 C;  4M75 B;  3CCM Q;  1VQK Q;  3VS2 A;  3BW1 A;  1MHN A;  2EQU A;  3M4G A;  5HK3 A;  1FX7 A;  2KDS A; 
#chains in the Genus database with same CATH homology
 2EBP A;  4E6R A;  2DL8 A;  2BTT A;  1GL5 A;  1FMK A;  1WA7 A;  3H0I A;  4ZNX A;  4GBQ A;  2FPF A;  4OMP A;  1ZX6 A;  2M51 A;  2X3W D;  2LP5 A;  2BZY A;  1UGV A;  2EW3 A;  4AFS C;  4J9F A;  2DNU A;  3PVL A;  4ESR A;  2RQT A;  4D8D A;  1WDX A;  5GJW B;  4RTZ A;  4LUE A;  2B86 A;  3O5Z A;  3ZL7 C;  1AOJ A;  1VA7 A;  2J6F A;  1N5Z A;  2JM8 A;  4HVW A;  2CDT A;  2F2V A;  2RNA A;  1WXB A;  2OJ2 A;  1M3B A;  1JU5 C;  1WLP B;  3GBQ A;  2EYZ A;  1GCQ A;  1ZSG A;  2A36 A;  4JZ4 A;  1SRM A;  1W1F A;  2KRS A;  2JS0 A;  2AK5 A;  2KBT A;  2L3Q A;  1PRL C;  4HVU A;  1H92 A;  5I11 A;  1SHF A;  2EYW A;  2LJ1 A;  5HCK A;  3VRZ A;  3VS1 A;  4AFU C;  2ROL A;  1BU1 A;  1K1Z A;  2A28 A;  1WI7 A;  1NYG A;  4Z89 A;  1QKW A;  3EG1 A;  4R0K A;  3PVQ A;  2KXC A;  2LNH B;  1W6X A;  2DL5 A;  1ZUK A;  1QWE A;  1Y0M A;  3VS7 A;  1Y57 A;  5IHK A;  4RTU A;  1YP5 A;  1SRL A;  3I5R A;  2KGT A;  4CC4 B;  2GTO A;  4OML A;  2L0A A;  2KXD A;  1UJY A;  1VYT A;  3VRY A;  3VS4 A;  2ROT A;  5IXF A;  2K3B A;  1K4U S;  2EGA A;  1OEB A;  5L23 A;  1UG1 A;  4J9D A;  1G2B A;  1NG2 A;  1AWW A;  1MV0 B;  3I35 A;  4WCI A;  5FWC A;  1RI9 A;  2RF0 A;  2JS2 A;  3RNJ A;  2K7A A;  1HJD A;  2PTK A;  2I0N A;  2D0N A;  2NUZ A;  3UAT A;  4IIO A;  1KJW A;  3EG3 A;  1YWP A;  2YUP A;  1X2K A;  2GGR A;  2HCK A;  2HSP A;  2ECZ A;  3NPF A;  1J3T A;  3THK A;  1TUD A;  1JEG A;  1JO8 A;  1ZLM A;  2AZV A;  4LE9 A;  2KT1 A;  2D8J A;  2YUQ A;  3M0Q A;  2KNB B;  4F14 A;  2RPN A;  4AFZ C;  4JPB W;  5FW9 A;  1KFZ A;  3NHN A;  4RUG A;  5I22 A;  2ED0 A;  2EVR A;  2KT8 A;  2PZ1 A;  1OPL A;  1U3O A;  3EG2 A;  1K9A A;  1B07 A;  1A0N B;  4FSS A;  3JV3 A;  1GRI A;  4KRT A;  2O9V A;  2J06 A;  1OOT A;  1X2Q A;  4LUD A;  1M30 A;  2J6K A;  4QT7 A;  4X1V A;  2MOX A;  1WXT A;  1WFW A;  1X6G A;  2IIM A;  4RTV A;  2YSQ A;  2K79 A;  4LN2 A;  1PNJ A;  2LZ6 B;  1AZG B;  1UHF A;  2JTE A;  1VYV A;  2HEQ A;  1X69 A;  2JM9 A;  1EFN A;  1TG0 A;  3M0U A;  2C0T A;  1PHT A;  1OPK A;  2OAW A;  1YNZ A;  1I07 A;  2LX7 A;  2JMA A;  1PKT A;  4RTW A;  1UHC A;  1M3A A;  1X43 A;  2EPD A;  4OMM A;  1SPK A;  1LCK A;  2G6F X;  4A63 B;  2FRW A;  2SEM A;  1E7O A;  2VKN A;  1SSH A;  2F2X A;  1H8K A;  4CC7 A;  1RUW A;  3M0R A;  5GJV B;  1AVZ C;  2W0Z A;  2O88 A;  2KYM A;  2AZS A;  2DIL A;  1GFD A;  1NEG A;  2YDL A;  5FWB A;  3TVT A;  4J9H A;  2CT3 A;  1CKB A;  1SHG A;  1KIK A;  3SHW A;  1X27 A;  2EKH A;  2O31 A;  2LCS A;  5IHI A;  2DX1 A;  2KRO A;  1M3C A;  2O9S A;  3TSZ A;  4RTY A;  3QWY A;  3FJ5 A;  1UFF A;  2V1Q A;  1QKX A;  2F2W A;  1V1C A;  3TSW A;  2D8H A;  2EQI A;  2FEI A;  2EYY A;  1U06 A;  2A08 A;  4RTT A;  4IIM A;  2CRE A;  1CKA A;  2FG0 A;  1M27 C;  5IH2 A;  5ECA A;  3RBB B;  1CSK A;  2DYB A;  2J7I A;  4DEX A;  1MV3 A;  2CUB A;  1Z9Q A;  1XOV A;  2KE9 A;  1VYU A;  3SEM A;  1NLP C;  1QLY A;  1TUC A;  2OI3 A;  4OMQ A;  2RN8 A;  1IO6 A;  4K11 A;  1T3L A;  1UJ0 A;  3M0S A;  2SRC A;  2MIO A;  2DBK A;  1JXO A;  1K76 A;  2EGC A;  3U23 A;  2JMC A;  4AFQ C;  3PE0 A;  1WXU A;  4HCK A;  2CSI A;  1OV3 A;  2NWM A;  4F17 A;  3UA7 A;  4HVV A;  2DRM A;  3A98 A;  2CH4 W;  3I5S A;  1HSQ A;  4J9B A;  3R6N A;  2LQN A;  3VS3 A;  2L2P A;  2CT4 A;  1YWO A;  1ZUU A;  2JT4 A;  4OMO A;  1SEM A;  2FPD A;  2KRM A;  4HXJ A;  4CC3 A;  2RQV A;  2DL7 A;  2E5K A;  2RMO A;  2VWF A;  3H0H A;  5IXB A;  2CSQ A;  1Z9Z A;  3KFV A;  2P4R A;  3C0C A;  1AWX A;  3VS0 A;  1MUZ A;  4J9C A;  2H8H A;  2EYX A;  2KR3 A;  3VS6 A;  1HD3 A;  3EHR A;  1AWJ A;  1H3H A;  3QWX X;  1E6H A;  2DA9 A;  2RQW A;  2ESW A;  1BBZ A;  1NYF A;  1RLP C;  4J9G A;  2YUO A;  2DM1 A;  4GLM A;  1B3Q A;  4AG2 C;  4Y92 A;  3LH5 A;  2J05 A;  1GBR A;  2AKL A;  2J6O A;  2QDL A;  2BZX A;  1PRM C;  2C0O A;  2DJQ A;  2DLP A;  1JXM A;  2ED1 A;  2FO0 A;  2GTJ A;  2W10 A;  3VS5 A;  2RQR A;  2LJ0 A;  2L3S A;  2AKK A;  1X6B A;  2DL3 A;  1T0H A;  1UEC A;  1UE9 A;  1E6G A;  1UUE A;  2FRY A;  3CQT A;  2V1R A;  1BK2 A;  3EG0 A;  3IQL A;  1ABO A;  3REA B;  1T0J A;  1GCQ C;  1GBQ A;  3NGP A;  1W70 A;  3UF4 A;  2BZ8 A;  2GNC A;  2M0Y A;  4EIK A;  2EGE A;  4JZ3 A;  5EC7 A;  3M0T A;  1PWT A;  1BB9 A;  2ABL A;  4J9E A;  1I1J A;  2XMF A;  2RQU A;  2GBQ A;  4Z88 A;  2K6D A;  1JQQ A;  1WYX A;  1WIE A;  2DL4 A;  4AG1 C;  1KSW A;  2KRN A;  1YCS B;  1NEB A;  3REB B;  2ENM A;  2VVK A;  1K0X A;  4Z8A A;  2CH4 A;  2YUN A;  1G83 A;  2K9G A;  3UA6 A;  1GFC A;  1S1N A;  1QCF A;  1YN8 A;  2GQI A;  2DMO A;  4RTX A;  3EHQ A;  4DEY A;  2KYB A;  2C0I A;  1ABQ A;  4D8K A;  2LQW A;  1T3S A;  2X3X D;  4JJD A;  2FPE A;  2LMJ A;  4J9I A;  2JW4 A;  4OMN A;  3NMZ C;  2A37 A;  4F16 A;  4JJC A;  3M0P A;  2KEA A;  4LNP A;  2CUD A;  2O2O A;  1AD5 A;  1NM7 A;  2DVJ A;  1K0S A;  1UTI A;  1ZBJ A;  1ZUY A;  1I0C A;  2YT6 A;  3H0F A;  2MCN A;  1GCP A;  3I9Q A;  4JJB A;  1QWF A;  2DRK A;  2JXB A;  3EGU A;  2DE0 X;  1NLO C;  2L3P A;  4M4Z A;  2DBM A;  1M8M A;  1PKS A;  1RLQ C;  1FYN A;  3H41 A;  1ARK A;  2K2M A;  4ORZ A;  3ULR B;  1AWO A;  1WX6 A;  1U5S A;  2HBW A;  5IHN A;  1AZE A;  2DF6 A;  2HDA A;  2LJ3 A;  2PNI A;  3VS2 A;  4CC2 A;  1AEY A;  2D1X A;  1UDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...