2CH4W

Complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
139
structure length
139
Chain Sequence
b'KEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEMOTAXIS PROTEIN CHEA
molecule tags Transferase/chemotaxis
source organism Thermotoga maritima
publication title Reconstruction of the Chemotaxis Receptor-Kinase Assembly
pubmed doi rcsb
total genus 19
structure length 139
sequence length 139
chains with identical sequence Y
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ch4W01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2ch4W02
1AWWA 2MIOA 4AG1C 3VRZA 2JW4A 2V1RA 1S1NA 2BZYA 1SHGA 4Z8AA 1WLPB 2FEIA 1UFFA 1BU1A 5ECAA 1SEMA 2F2VA 3M0TA 3TVTA 2JT4A 1WFWA 3SEMA 4RTYA 3EGUA 1CKAA 1H3HA 1QLYA 2CH4W 1FMKA 3JV3A 4J9FA 2L3PA 2K79A 2GBQA 1KFZA 4X1VA 1U06A 2RPNA 4RUGA 2FRYA 4AFSC 4LE9A 2KE9A 1LCKA 1V1CA 2SRCA 2YT6A 2DILA 1PKTA 1NM7A 4FSSA 1AWOA 3NPFA 1RLQC 1VYTA 3VS2A 2AZVA 2C0IA 2K3BA 1JU5C 4JPBW 2J6FA 2D8HA 2DNUA 4Z89A 1YWPA 5HCKA 1Z9ZA 2BTTA 2GQIA 1NEGA 2DF6A 2EYZA 1WXUA 2A28A 1U3OA 1UJYA 1E6GA 1UJ0A 2EGEA 5IH2A 1UHCA 1K9AA 4OMPA 1M3BA 1W6XA 2O88A 3REBB 1WIEA 1AOJA 2V1QA 2KNBB 4RTTA 1NYGA 1X6GA 3M0SA 2KROA 1HD3A 2K6DA 2RQRA 2CT4A 1JQQA 1K0SA 4HVWA 1GCQA 2KRNA 1WA7A 4JJDA 4JZ3A 3VS0A 2H8HA 2KXDA 2GTOA 5IXBA 3SHWA 3VS6A 1VA7A 4AG2C 2J6KA 4GLMA 4RTXA 1ARKA 2EGAA 1UDLA 1QWFA 2DL5A 1BBZA 1PRLC 4HXJA 1E6HA 2J7IA 3ZL7C 4QT7A 2AKKA 2JMAA 1J3TA 1X6BA 2AK5A 1AVZC 1A0NB 1K0XA 1SHFA 2NWMA 2A08A 1AWJA 1TUCA 4RTZA 1X69A 2RNAA 3NHNA 1KIKA 4CC4B 2A37A 1K76A 1KSWA 2CH4A 4LUDA 4RTVA 2O2OA 1MV0B 2KRMA 3VS3A 2EYXA 1I0CA 3NGPA 4OMOA 2KXCA 4J9CA 2MCNA 1Y0MA 1ABOA 1I07A 3M0RA 2ESWA 4DEXA 2HDAA 1VYVA 1IO6A 1W1FA 2KGTA 2W10A 4RTWA 4DEYA 3REAB 4JJCA 2CUDA 2KT8A 3I5RA 1WYXA 1JXMA 2DBKA 5FWBA 1W70A 5IXFA 2LJ1A 2DMOA 2F2WA 3TSWA 2C0OA 3VS7A 3H0IA 3VS1A 4J9EA 1ABQA 2JS2A 4AFQC 4CC7A 3VRYA 3I35A 2W0ZA 2XMFA 1GBQA 1KJWA 2D1XA 3I5SA 2YUPA 4HCKA 2EW3A 3RNJA 2D0NA 2J06A 2ECZA 2ABLA 3C0CA 4CC3A 2DE0X 3EG0A 3EHRA 4WCIA 1I1JA 5GJWB 1NLOC 2BZ8A 2EGCA 1NG2A 3EG3A 4RTUA 2KBTA 5GJVB 3R6NA 2NUZA 1JXOA 3QWXX 2DM1A 1AD5A 1MV3A 1SRLA 1Y57A 2EBPA 2GTJA 3UATA 1ZLMA 2CSIA 2I0NA 3H41A 4Y92A 2RQTA 4J9DA 1VYUA 1X27A 3PVQA 2HSPA 3VS4A 1PWTA 1TUDA 1YWOA 2ROTA 1Z9QA 2OAWA 4CC2A 2YSQA 1OPKA 2K9GA 3UA7A 2DL7A 3EG1A 2LZ6B 2EYWA 4KRTA 1NLPC 1UTIA 1UG1A 2A36A 2RQWA 1B3QA 4ZNXA 1G2BA 1QCFA 2DRKA 2LX7A 3KFVA 1WX6A 4LNPA 1BK2A 2JS0A 2PZ1A 1K4US 3I9QA 1GCPA 2VWFA 1AZGB 2RF0A 5I22A 3EHQA 1X2QA 3VS5A 1X2KA 2LJ3A 2DX1A 2OJ2A 2AZSA 4F14A 2DL8A 2EQIA 5IHKA 1T3LA 1ZBJA 3CQTA 3ULRB 2M51A 1N5ZA 1PKSA 2AKLA 3GBQA 1OPLA 2ED1A 3H0HA 1GCQC 1K1ZA 2HCKA 5EC7A 1HJDA 2JM9A 1ZX6A 2L3QA 1X43A 4OMMA 4ORZA 2EKHA 1M27C 4M4ZA 1HSQA 2K2MA 4F16A 2ENMA 1M8MA 2CDTA 1OEBA 2D8JA 2FPEA 1RI9A 4F17A 1GFCA 2ED0A 1GBRA 2O31A 4OMQA 2LQWA 1YN8A 4J9GA 1SSHA 2SEMA 2GGRA 4D8DA 2KR3A 2RQVA 2DRMA 1BB9A 1H92A 2LJ0A 4JZ4A 1JO8A 2CT3A 2HEQA 2VVKA 3EG2A 1QWEA 1M3CA 1GFDA 1JEGA 2DLPA 2GNCA 2E5KA 1OOTA 1UUEA 4HVUA 3A98A 1UE9A 5FW9A 2DYBA 2CUBA 2LNHB 3O5ZA 2X3XD 4IIOA 2RN8A 1RUWA 5I11A 1RLPC 2O9VA 3LH5A 3M0PA 3RBBB 2FO0A 2JTEA 3TSZA 2KYBA 2LP5A 1ZUKA 4AFZC 1GL5A 1PNJA 2MOXA 2JM8A 3H0FA 1ZUUA 2QDLA 1CKBA 2KT1A 1GRIA 2B86A 3PE0A 1UHFA 3PVLA 5IHNA 1PHTA 1SPKA 4J9BA 4EIKA 2EYYA 1WDXA 1CSKA 3FJ5A 4LN2A 1AEYA 3UA6A 4HVVA 3M0UA 2BZXA 2KRSA 2DBMA 4A63B 1T0JA 2PNIA 4K11A 2IIMA 2CREA 1PRMC 2JMCA 2L0AA 4J9IA 2DA9A 4OMLA 1NEBA 3M0QA 1YP5A 1U5SA 3NMZC 4D8KA 2OI3A 2ROLA 1ZUYA 2VKNA 1T3SA 2RMOA 4ESRA 3U23A 2LQNA 4AFUC 1TG0A 4LUEA 2PTKA 1T0HA 2KEAA 2EPDA 1UGVA 2FG0A 2K7AA 2EVRA 2C0TA 2P4RA 2YUQA 3QWYA 3UF4A 1YCSB 2FPFA 2FPDA 2FRWA 1AWXA 2L2PA 1XOVA 1MUZA 2X3WD 4OMNA 4IIMA 1YNZA 2M0YA 1WXBA 2DL3A 4R0KA 1WXTA 4J9HA 2DVJA 4JJBA 2RQUA 2LCSA 2J05A 2O9SA 1E7OA 1ZSGA 4E6RA 2F2XA 1FYNA 1QKXA 2KYMA 1UECA 3THKA 3IQLA 1WI7A 1M30A 2YUNA 2YUOA 1G83A 2J6OA 1OV3A 1SRMA 5IHIA 5L23A 1M3AA 2DL4A 2YDLA 1AZEA 2LMJA 5FWCA 2HBWA 1EFNA 1QKWA 2DJQA 2L3SA 1NYFA 1H8KA 2G6FX 2JXBA 4GBQA 1B07A 4Z88A 2CSQA
chains in the Genus database with same CATH superfamily
1JICA 1AT1B 2HCIA 5IODA 3EH1A 3JB9I 3PUWA 5I4DA 3VRZA 2V1RA 1M1KC 3DB3A 3CCMA 1SHGA 4C0FA 1DGSA 2UUBL 1IREB 1EYDA 1B7TA 2VYTA 4FYDA 4R4CA 2EJ9A 2LT1A 4J6YA 2B2YC 3TS2A 1J8IA 1QCBD 2X4WA 1EQVA 1K28A 4BBSH 1CKOA 1K9MU 4KN7C 5CVIA 3BDUA 3MP8A 5ECAA 2F2VA 3QPHA 3CMEA 5A0DA 4X9DA 3JSCA 2JT4A 3RUXA 5GAMf 2PNHA 1Q82U 5DM63 3H91A 4AMCA 2DYIA 4DV2Q 3TDQA 4A3MB 1Q86R 3CD6Q 1PRTB 3EJIA 1QLYA 5EG2A 1VQ8Q 3TP7A 1RADB 1GOZA 4M7DF 2L3PA 3URGA 2K79A 4JYAL 2DEUA 2VW9A 2K5IA 3OW7A 1DOLA 4AQYL 1ICFB 5LJ3f 1OTCA 1U06A 2L3RA 1RJTA 2RPNA 2FRYA 4C0DB 4M7DD 2PVDB 4QIWB 1ZA1B 2KE9A 1YJ9Q 1L0YB 3K6OA 2ZJRA 2IW3A 3S1QB 4BUGA 4OB1B 2IPKD 1E0BA 4M7AF 3BVMA 2RJCA 4JI2Q 3S14B 4CI0C 1F9RA 4BI4A 1XMOL 3NPFA 2NWGA 5ELNA 5M3FB 2C0IA 8ATCB 3I56T 1EFWA 2LCCA 3GOXA 1XPRA 1L1OB 2WB1G 1VQ7Q 4A93H 4A3GH 2R93H 3JCMX 1Z9ZA 2CZ6B 1KNAA 5T1GA 3S1RB 2BTTA 2E64A 2COWA 1TU2B 4MDXA 5F2DA 4GN3B 4JV5Q 4KHVA 3GNGA 2A28A 4N9TA 2DD4A 4FNFA 1F9PA 4P2CB 4DR3L 2E2IH 1UJYA 3EQLC 1E6GA 1D0YA 1UJ0A 3LWUA 4JS4A 2F3IA 4O0AA 4OMPA 3V05A 1K73R 1QUQA 1DYQA 1W6XA 1VQMT 4RGMA 3CQZB 1XMOQ 3I4MH 5DEHA 1AOJA 2KNBB 3MVVA 1BI1A 4PFZA 1X6GA 2M9UA 4ID6A 3MCAB 1Q1EA 5CO7A 1SFOH 4I7AA 3CCVQ 2I5LX 2KEEA 1RF2D 2DNCA 3VYGA 4F7UA 5LJ5e 4CHTB 2ID0A 2F0KA 4HTHA 5CKBA 3QUIA 3OYIA 4HVWA 3FDTA 1QG7A 5IT9c 1WTWA 2NUTB 4LWCA 4KHPQ 4QVZA 3MFYA 2GTOA 3SHWA 1BIBA 2E2HH 4WF2A 2BA1A 2G3RA 1I8FA 4AG2C 1IHWA 2B8FA 3ITPA 4A3KH 4GLMA 2A68C 2EGAA 4M75G 5KYIA 4A3FH 1STYA 1GUTA 3BS1A 2PMZB 1QNKA 1PRLC 1E24A 2EJMA 4XTYA 1QQJA 2J7IA 1U8RA 4XT1B 5C0XG 4QT7A 2AKKA 4LW1A 3X20B 5KYYB 4C1NK 1J3TA 3DMUA 4L6TB 3H3VH 2V1CC 2NBFA 2AK5A 2XD0A 1UE6A 1VQCA 2EXZA 4R4OA 2F03A 2BDOA 1K0XA 2E76C 1Q8KA 2NWMA 1PA6A 3NPPA 2XDPA 4QUCA 3U9SA 3X25B 2PQEA 3RMQA 1C0MA 1X69A 2JA6H 1D8LA 3NHNA 4B3SL 2VXFA 1FNUA 4QJFA 1EIGA 4CC4B 1G3TA 3I70A 4RTVA 5FU6B 4MZMA 4E2FB 1PFNA 2Y90A 5IP7G 3S2HB 1HH2P 2ZT9C 4NL2A 2KRMA 3E9HA 2DJFC 3L3OC 3VA7A 1I0CA 1VQ6T 2COZA 1TWAB 1IGQA 4Y52H 2VUBA 1JOOA 4DAPA 2L15A 4RMFA 5D3DA 4J9CA 1Y0MA 1QILA 1J5EQ 2K2VA 3G6ET 4H13C 2VUMG 5C3EG 2ESWA 1R9TH 4DEXA 2OEOA 3HOVH 5GAMg 4QY7A 1MIUA 3S1MH 2RI5A 4BY6B 1TWCB 3I7FA 4M7AD 1W1FA 3VJPA 4RTWA 2W10A 4LDVA 4B3TL 4JJCA 4C3JH 3I91A 3UE0A 5IE8A 3CPWS 3CF5A 2B2UA 3V8LA 4N9PA 5FJ8G 3QDRB 2JOYA 2MMPA 3MHXA 3MXPA 1SMYC 3OWFA 3T56B 1WTQA 2JA5G 2N55A 1HNZL 4R56A 2K33A 1U1SA 4M78B 2F0HA 5CORA 5IXFA 4DR6Q 1VQKT 2RA4A 2PW7A 4R4IA 1YJ9A 4XTUA 3GTGH 4DFAA 3GTJH 3VYTA 2C0OA 2RDHA 4EVOA 3MZ5A 4PL6A 2EY2A 5GAOm 4CC7A 4RGOS 3VRYA 4K2LA 2WAQE 1WVLA 3M4QA 1IB8A 2XMFA 3W1BA 3GV3A 5LJ5j 2E3IA 4RKUE 2JUFA 5GAN5 4BXXH 4FYWB 5IWAQ 2MJ8A 2YUPA 2ZPFB 1RD9D 2WB1B 1NZ9A 4EMKA 4WRDA 5GADC 3KLRA 3N6RA 1EL0A 5E1FA 2AQ1B 4ZCKA 3C0CA 1BYMA 3EBEA 3SK4A 2E75C 3P1HA 5IGFA 1OXVA 2K4KA 3CCUA 1TT2A 3H09A 3QIAA 1R8OB 3EHRA 1PTOC 2Y0SE 2DK3A 4X34A 2CWPA 4POGA 2XGTA 4H02A 2FHTA 1QVPA 5GJWB 3WXMB 2R5MA 1ZKOA 2AKWB 2QDYB 4F88A 3DWAA 4QB4A 2RH2A 4A4KA 3E1SA 5JPNC 3GTOB 5GJVB 3P8DA 1PMRA 3HOZH 1JXOA 3CC7Q 2EYPA 3JCMP 1HA5A 1O7ZA 1SNQA 1BCOA 2MO1A 1SRLA 1Y57A 2EBPA 3M53A 4VUBA 4C56C 3S3MA 6AT1B 2GTJA 5HK0A 3EFOA 2RJFA 4JRPA 4LUOA 2CSIA 1XNRL 1U4PA 4LF8Q 3U4VA 2JJQA 3TREA 3HPWA 5I2XA 3GO5A 1N9WA 2ZPIB 4KHZA 5FRMA 1MSGA 1FMVA 1PZID 3RD4A 2ES2A 1VQ4T 3PVQA 4DXFA 3K0YA 2HSPA 3P20A 3HP9A 1ZBXA 4IUUA 1SE2A 1TUDA 2CKZB 2VY3A 1HR0W 2R6GA 2FB7A 2OAWA 3U58A 5CV6A 3SK8A 4OONA 3GLXA 3RZOH 1SYDA 2QTVA 4HA8A 2F0LA 3R2IA 1KXLA 4L59A 3G71A 3EG1A 1YIJQ 2LZ6B 4KRTA 2HL5C 4JI2L 2XSCA 4AYBE 5D7UA 2HD0A 3W5OA 3WDNA 2L5QA 4LF4L 5I2SA 1O80A 1NPPA 1UG1A 2OF1A 3D4DA 3H15A 4NP5A 2NZ1D 3KF6B 4ZNXA 3C3LA 2F0GA 2GQVA 3HOZB 1G2BA 2DRKA 3T9NA 3X26B 5GAN2 1EZ8A 1NE3A 3VU3C 2PVOB 1WX6A 3CXCP 1LLRD 1JB0E 1YNND 2L12A 3G4SQ 2QF7A 4RHSA 3KOJA 4HJ9A 2PZ1A 2F0QA 5BN3A 4DBHA 1EEFD 1LABA 1L1OA 4OELB 1GUNA 3NBIA 2VWFA 5LHY1 2NVQH 3CU7A 3PUXA 3S15B 4A3DG 3R2TA 5C44G 5KCOA 1PTOF 1H9KA 4N4IA 4JS5A 1X2QA 4L5GA 3RKXA 1LV9A 4LD6A 4C5EA 1OZ2A 2VV5A 2ZM6L 2BKDN 3OYEA 2B63H 3AMUA 1G6PA 2QTXA 2BE5D 3GV6A 3I8ZA 5KYXB 2N3SA 3PO3G 4F14A 4PJMA 1X3EA 5FLXc 1NCVA 4NXNQ 2EQIA 2ICIA 2FVUA 1XJWB 2NUTA 1ZBJA 1QW1A 3CQTA 5IHKA 3CC4A 1E3PA 5C4ZA 1N32Q 2JZ2A 2MAMA 1OO9B 1IL2A 5LJ3g 1PH5A 2ED1A 1EIHA 5EC7A 1FMWA 2M02A 3B6YA 3BDCA 1S72A 5C3EB 2ALYB 3OS5A 3K59A 4DUYQ 4M7DE 2LTOA 2JEBI 1ZX6A 3J80c 1AEXA 3FVQA 3T1YQ 3OBYA 2AUJD 4PJOA 1PZJD 1X43A 3FDRA 3MTSA 2QEXA 2EKHA 1Q86C 5CK9A 2JTFA 2K4YA 5C4XB 4KT0E 3QZ9B 4J6WA 1V8QA 1XMQL 4RCBA 3CMAQ 4FVMA 4C2MH 2E2JB 4P74A 4GLAC 1M9SA 4EDUA 4M78A 5DLQE 3BZDB 3MA2B 4HIMA 5C4JH 4G57A 4PJOB 2FPEA 1RI9A 1J5EL 4JI0Q 4UAIA 4KV6A 2ZTCA 2ED0A 3QBYA 4Q5VA 5JJZA 1TQOA 4KY7A 1VQ9T 2YRDA 4RA8A 3CCQQ 2HKQB 5GMKe 4D8DA 4LF5Q 5IGGA 2DRMA 3PFSA 3L2VA 2ZJQA 5GMKh 4A75A 3CD6A 2E12A 2F0IA 2CT3A 2HEQA 3EG2A 1QWEA 4Z02A 1SMXA 1G6ZA 1VQOA 2F52A 4NXMQ 1W2BS 3LX0A 1OOTA 4DOVA 3TEHB 1MGSA 4YIJA 1HZAA 4DR4Q 2EFIA 5FW9A 1U5KA 2TMPA 3ME9A 1OXXK 2AHOB 2VUMH 2CUBA 1VQJA 4P73A 2OTJT 1MHNA 5CV8A 5IOCA 1RAGB 4OGQC 1H9JA 2VQEL 4WJWA 4M77E 2Z6BA 3O5ZA 2CVRA 3WOFA 5JJIA 1Y96A 4DBFA 1QNUA 3S17H 5I11A 1RLPC 4BBRG 4A3CH 4QW2A 3MAQA 2WAQG 1JB3A 4IPHA 3M9BA 2RF4A 5ELDA 1VQ7A 3J7AV 2C06A 1O7YA 3J80E 5EBDA 1A0IA 1MMAA 3VUBA 2JTEA 3RN5A 1VQLA 3A8KE 4UY8C 1VQNT 1XNQQ 2YLBA 1GL5A 4F7UF 1Q86U 3X3MA 2IVWA 1TS3A 5FO9B 1VMCA 1TH7A 3BY7A 3OYFA 3J7YW 3S1NH 2NLUA 1CKBA 1Q82R 4C0GA 1N33L 4JBKA 5GAEC 2UXDQ 4QF4A 3A7LA 3CCLA 4JBJA 2V8IA 2JA8H 1TWCH 1HZCA 4QVCA 3TMEA 1I6HB 1UGQB 3HOVB 1E2ZA 2KBNA 4KY6A 2P4TA 3GNFB 4JC0A 1CSKA 4M78G 2JJ9A 4OX9Q 3K80C 3UA6A 2EIFA 3OQ5A 2JA8B 4XU3A 3N5BB 4BXXG 2ZCFB 4H7BA 1BBXC 2DZCA 1ZSZC 2PNIA 2G9HD 4M78E 2K6AA 3QB3A 3HOUB 4A54A 2D62A 2IIMA 4D6WA 4FCYA 2FZCB 2FYKA 4A4IA 1YJNQ 3CCJT 2K14A 2L0AA 3FKIH 4ZRZA 3SWNC 1YJNT 2OT2A 3BDLA 4JI3Q 4OXPA 1KQ1A 2G5DA 1EUJA 2R7ZG 1NEBA 2BA0A 4PMWA 2QYZA 1N8RC 3DLMA 2HBPA 5M3MH 5CKFA 4DNIA 5HGQA 2EQSA 2VKNA 2K1BA 3P8HA 4HKEA 3CCSQ 3DWQA 4DF7A 2IT1A 4XAXB 4O2DA 1NMFA 4AFUC 4BY1B 3NWTA 5IYBG 1KHCA 2PTKA 1OX8A 2I5MX 1MNEA 2XDBA 2EPDA 3M4PA 1RODA 4KGXB 3EFXD 3HFZB 4H44C 2VGNA 1FVIA 5D6WA 4RGTA 3UF4A 3SE0A 2FPDA 2HD3A 1BBUA 4JI3L 1AWXA 2PVGB 1SKUB 4LF7Q 3M54A 1VQNQ 4PQXA 1SROA 3TN2A 4YY3Q 3J80i 2WSCE 3OTOL 1WXBA 1UE5A 5EKKA 2OX7A 3MXNA 3SDZA 2HIVA 2K5WA 1PH4A 1CQVA 2TSSA 4F8MA 2DVJA 1RAAB 1R4QB 3OHXC 5GAOl 1JMCA 3M85A 2WKDA 1HR0L 3NBHB 4A3KG 1E7OA 2R7ZB 4ZK9B 2LFNA 2DJZA 1HUNA 3KDFA 1DZ1A 3I4LA 5LL6X 2IG0A 2BCOA 4DV6Q 3OYKA 1UGSB 3IQLA 4F7UE 2YUOA 1D1BA 1PSEA 2EOTA 4ANJA 1G83A 3M4GA 4K0KL 4K5XA 5CBEE 4Q0FA 1FR3A 2JA9A 2D9UA 1LT3D 1MKHA 2K5FA 1Q7YR 1EFNA 1QWYA 3U9OA 1NYFA 3PO2G 3JCMJ 4C8QC 2BDNA 2E74C 4LAAA 4Z88A 3E5SA 3QR8A 3MP1A 2NVYH 2D6FA 2FFKB 4P72A 1M5Q1 2NN6G 1UB4A 4AG1C 3LGJA 4B9XA 2I5HA 5CKHA 3FP9A 2A69D 4PMCA 4LFCL 3D6CA 4RKBA 1OYXA 4A3FG 2HIXA 1G3SA 5HGTA 4KHPL 1PFBA 3HFOA 2A6EC 4TQUS 3PTAA 2RI3A 3HRTA 1YCYA 2FEIA 1HTLD 1SYFA 4WFN3 4R4TA 2YYZA 3M0TA 3T1HL 1PH1A 2QEJC 4XT3B 2E5LL 3AHUA 2YRVA 2D0OA 1C6VX 5GAMh 4C3HG 1RKNA 1CKAA 2K75A 3HOVG 1CQFA 2ICEC 1H3HA 2JA6G 4IJHA 4A3IB 3RLFA 2A5HA 2NTSA 4C92C 4GOPB 2EQKA 2WSFE 4JI5Q 1A63A 4X1VA 4KD3A 4BBRB 1YHBA 4RUGA 3J81i 5FJ8H 2P84A 4AFSC 2CP7A 4LD9K 3JB9G 2JA5H 2A0FB 4XDXA 9ATCB 1HNWL 4MTNA 2OQ0A 2YT6A 4PZ6A 2DILA 4L5QA 2D9TA 2MHVA 1AWOA 1B53A 1RLQC 1MHWC 2EYQA 5EKLA 3Q1JA 4G7ZC 2B63G 2LKVA 5IP7H 3E9GA 4A3DB 2PYKA 3DKMA 1C48A 4DBRA 1VQ9A 3GTPH 1WXUA 3VYRA 2KQ3A 4FF3A 2IJ0A 2WACA 4ELYC 2E3HA 4C92A 4MDWA 5M9OA 3SEBA 4E7JA 3S14H 1GVPA 1I5OB 2RI2A 1KAWA 5A2QL 2XK0A 3ZFJA 1EYGA 4KKUA 1PM3A 1YZ6A 1KTKA 2PQAB 1PCXA 1CM9A 1BIAA 4IJLA 3M0SA 4BY7B 2KROA 3A8LB 3PUVA 4NPSA 3V7SA 3ER0A 3KF8B 3JAMc 4KI0A 2RQRA 3T51B 2IX0A 4OMFB 2PW5A 2CT4A 1ENAA 3A8IE 4L5SA 4K14A 3A8MB 2WSEE 5C5MA 4J6HA 4CJ2C 3F2DA 4HJ5A 1YNJC 1C4QA 2VL6A 1STNA 4KUIA 2E41A 2KRNA 4JZ3A 1W2BP 4DR1L 2BE7D 2LMCB 3UPUA 4Q5WA 4QQBX 5IXBA 3FPPA 1CSPA 1CKMA 2J7ZA 4YWMA 3VS6A 3Q23A 1I94Q 4CRIA 4ZAIA 3A8GB 1ENCA 4LF8L 4HMIA 1K8GA 3IFDA 4KJNA 2DL5A 2N49A 2UU9L 4Z9CB 1HQRD 3RNUA 1NBEB 4ELZC 1WTPA 1ASYA 4DNTB 4DV2L 1ILQA 3NBHA 2YLCA 1E2WA 4XXEA 1ESRA 4JI1Q 5J22A 4JI8Q 1XTCD 1ZEQX 2AUKA 2FZGB 2F3VA 4IPCA 2JMAA 4ZGJB 1Y96B 4FW2A 5M5YH 1BBWA 2NVTH 3DXJC 4WJ3M 1IKMA 1RAIB 1X6OA 5KIXA 1K9MR 3FRPB 3NTIA 3M3YB 3D4RA 2QGGA 3CBMA 4CJ1B 3S2DH 2BUDA 1LO5D 4ZLTF 3O13A 1GM5A 1KIKA 1RHPA 1Z6HA 4DK3C 2UUBQ 3ZEHA 2A69C 2A37A 1XTDA 4AYBB 1LTRD 3ICEA 2O5JC 2LC4A 4HIOA 4R8IA 2SNMA 3Q0AA 1OXTA 2LVMA 3VR3A 2EYXA 1B9MA 4K2KA 4KKTA 4IOAA 2O2LD 1Q95G 3NGPA 3OSVA 1HA6A 2WAQB 1YHQQ 2WIIB 5EPKA 3K7AH 3T4AC 4KBMB 1MI2A 1SJED 1HK9A 4E7LA 1HFGA 5FRNA 1X55A 3GDEA 4FXGC 1ZQ1A 4M77F 4X3TA 2SEBD 4X6AH 1WI5A 1D7QA 4OHJA 4K6DA 3CCRQ 3WOEA 3BYYB 5J3BA 1YITA 4ABNA 2HQLA 3GTGB 1KC8R 4ZUJA 1LVKA 3A5ZB 3RDVA 4I7ZC 3TEEA 5ISRA 5C4JB 4G7HC 1PYWD 1BCMA 1WYXA 4XQQA 1K8AU 4J8QA 1Q7YC 1JXMA 1T5XD 3URYA 5JEAG 3OS2A 2LRQA 1X65A 1TIID 4BY1G 3NELA 2L8DA 5FWBA 1W70A 4C8QE 2DY8A 4A4GA 1OXSC 2JA6B 2QAZA 1M8VA 2DMOA 2F2WA 2Z4HA 1SSFA 3TSWA 2C5CA 4LFAQ 4OEMB 3TQYA 2KY9A 1WJJA 1WHKA 5IYCH 3CP0A 1NNXA 4PFPA 1Q81C 2OXPA 4E7ZA 3GTPB 1JC7A 3K0XA 3KLSA 1YI2Q 4A3EG 3G6EQ 3K7AB 2VUMB 1RTOA 1TWAH 1N36Q 4E7SA 4IFDH 5CKDA 4BE0A 4C3IG 3T1HQ 3OMGA 3CRLC 1KJWA 5GAN6 1T5EA 2MP1A 2IHEA 3RN2A 3C46A 2QGFB 1LTSD 1Y1VB 4FT2A 1GO3E 4BE2A 1PZKD 3K57A 3G7LA 2EW3A 4GNXB 2WV6D 3TP8A 2HQEA 4PJOE 2YU9H 3CMAT 1PHJA 4X64L 2Y0SG 4QQGA 3VKIA 3A8JE 3E2UA 2DE0X 2K57A 1SYGA 3F2UA 1MJCA 1Z7TA 4IN3A 2AQ2B 2A6HC 3EG0A 4WCIA 4DAYA 3I2ZA 5HY6A 4Y7NB 3G71T 1N6AA 4GKKL 3VYUA 4GKJQ 1NLOC 1AW7A 5I2YA 2EGCA 3ASKA 1E22A 1NG2A 1SF9A 2E1HA 3EGXB 1C9OA 2NUZA 3WWVA 4C92F 3QWXX 1I6VC 4KKSA 5KYNA 5GANf 4X66Q 1CHQD 4QIWE 5IYBH 1QZHA 1WHJA 5JOBA 1IZ6A 2OTLQ 2VB6A 2R57A 1P16A 5LJ5f 4C2MB 1ZLMA 4JI4Q 2ZJPA 2F0MA 1PYSB 1M2OA 1K83B 2XDDA 2VS1A 5E7NA 4MZPA 4QCLA 2I07B 3K81C 3PF5A 1JRIA 3OB9A 3RMSA 4LJZC 3FMCA 4PMBA 1WTHA 3H0GB 3F1ZA 2EVBA 2QGQA 2RQXA 5FU7C 4DUYL 4B3TQ 5ELOA 1FL0A 4HJ7A 2CHBD 4XTCS 2EPBA 2K9GA 3V7RA 1T9HA 2LXJA 4AYBG 4A3IG 2E4HA 4OGEA 1JJ2S 1TY2A 5M5WB 2DL7A 4A3GB 4EGVA 2EYWA 2X9HA 1UTIA 1Y7XA 5G3LF 4DV7L 3MEAA 3ERQA 2RDFA 4JI7Q 1HQMC 3STBD 1HNZQ 1EIFA 4M7DG 2F0PA 2HDLA 3HOYG 1QCFA 1EY6A 5CV7A 5IT9E 4RGNA 1MMNA 2LX7A 1JT8A 4X3SA 2MF2A 2X4XA 4JJNK 2B2UC 3TQ7P 3MC0B 2VC8A 1SAPA 2GN5A 4XIGS 1YBYA 2HZYA 4RCCA 3OYGA 3SGIA 1II3A 3AYHB 3AB9A 1AZGB 1KAAA 2RF0A 2K52A 1CA6A 3UWNA 1QVCA 3MXGA 4GNXA 3EHQA 1U4RA 2B8AA 2H5XA 2R93G 2RBMA 1X2KA 1Y71A 3M9QA 5IYCG 2LJ3A 1VQ7T 2FJ2A 1M1KR 5JVH3 2XI9A 2QCPX 1KIXA 4XK8E 3I56Q 2OJ2A 3D7SB 2QDBA 4KULA 2X6LA 3PGZA 4DK1A 1GXDC 2EJGC 1JBMA 3QO3A 2XU8A 1NSNS 4M8AA 4P71A 1XJVA 1WFQA 4RG8A 1CKNA 2M51A 1N5ZA 1PKSA 5M5WH 2Z4IA 3H94A 5GANj 2KVMA 1K9MC 2MQHA 3H6MA 4BY1H 2QI2A 2HCKA 1K1ZA 1VQ8A 4C3HH 4NKLA 3MWYW 1PH6A 3LNNA 1S5ED 1LM0A 4BBRH 3HTRA 1MSHA 5COYA 5EAYA 3GTQH 1M1GA 2FL7A 3HOZG 2X4JA 3S24A 3CCEA 4ORZA 1WCMB 3G48A 1M27C 1EFID 3NUCA 3GF5A 4ZTFA 1XWEA 2MI6A 5L37A 4GLKA 4M4ZA 3CD6T 4X3KA 1HSQA 3LGFA 5G3LD 3TZDA 3RERA 3FKIB 5AJ3Q 4A3LG 5J1ZA 1DONA 2ENMA 2K3YA 1M8MA 1I5LA 3CCMQ 5HURA 5A0GA 3FPUB 4J83A 1K3RA 1YI2A 2CDTA 1CZGA 1OEBA 2Q8TA 5C4XH 4F17A 1S3OA 4K8IA 1DD2A 4PJNA 1BXTA 3KJOA 1PH3A 2O31A 2HL3A 3IRBA 2LQWA 1ZSZA 2NUPA 1YN8A 3RLOA 2R7ZH 2ZGWA 2AQ3B 4XU0A 4EX5A 1AFPA 4DR5Q 4FDBA 1VF7A 2GGRA 2A73B 2KR3A 5IAYA 3NHHA 2KDSA 3OW2P 4N8X1 1H92A 2F0EA 3K58A 2LJ0A 4PLLA 3Q6SA 2FMMA 3TBIB 1HXYD 4PLIA 4LNQA 4A3DH 1Y1WB 1PH9A 4YTLA 2VASA 2VVKA 3V8JA 2P5ZX 1E1OA 3CCUQ 1LJOA 1D5ZC 1B3AA 3P75A 1VQKQ 4DV3Q 3KBXA 2F69A 3QOLA 1XPOA 2DLPA 2GNCA 4UHVA 1WCMG 2VXWA 1UUEA 4HVUA 3NTKA 2ZAEA 1NTGA 2ATCB 4RG2A 2KHJA 1XNRQ 2DYBA 1FGBD 2FZKB 3H0GG 3TS0A 4ZN1A 3META 4DXGA 2YWWA 3EAEA 4V190 2LNHB 4JRKA 3A0JA 3W3AA 4B3RL 5JJLA 4BDYA 3MFGA 2E6ZA 2X3XD 2I0QA 2F0VA 3OA6A 1RUWA 5E4XA 1QMCA 1RACB 3EIVA 4C3JG 2RDGA 1EEID 2DFUA 4BI8B 2LS01 4X9CA 2A7YA 3NFCA 4N8FA 3OY9A 3M0PA 4MHEA 2E70A 1M4VA 5D6XA 3TSZA 1MGQA 2KYBA 1KL9A 1RCVD 2F0UA 2LP5A 4J8OA 3GD7A 3I90A 1UE1A 1XQHA 4Y28E 3S16B 1ZUUA 3FLGA 4N4GA 4DUZL 1O9SA 3HOUH 2QDLA 3RZOB 5NUCA 3M58A 1D0XA 2F4VQ 1GRIA 1K8AR 1STAA 3G71Q 3PVLA 5IHNA 1YIJA 1EY8A 2MUYA 1SPKA 4EIKA 3V2TA 3S9WA 2RO0A 3CKIB 2BE9B 1PRTC 2K03A 1WDXA 3DEOA 1Y69U 2EJGA 4PZ7A 4HIKA 3M4OB 3PQIA 5M3MB 4HVVA 3M0UA 3TCJA 2CYZB 5GANd 4A63B 1UGPB 1XMQQ 5C6AA 4K11A 3CBPA 1WHMA 5IGBA 4GNXC 3LX7A 3I4NH 2ZXPA 1RIPA 2A3LA 4B08A 3PF4A 1DOMA 3BVZA 1H9SB 2HT1A 2N88A 1EQQA 4A76A 4M7DB 4CGYB 1YNJD 3Q22A 2DETA 1JOQA 4EQOA 1U9RA 2EZVA 3KXTA 1D5MC 1SDFA 2K28A 2VB3X 5ELBA 2ROLA 3QXEB 1ZUYA 1TOVA 1BF4A 1PVOA 4U673 5KH6A 2RMOA 1LUZA 3TSSA 4ESRA 1W3SA 5C4XG 1I4RA 3W1GA 2BH8A 5CBAE 3J81j 4HCSA 4LUEA 4IFDI 3Q24A 3CHBD 1L0WA 1KLUD 3LW5E 2ZPBB 4C92B 3D4WA 2K7VA 3DWPA 3CCVT 1HPCA 2FG0A 2K7AA 3CW2C 4DR2L 2EVRA 1VCIA 2P4RA 2YUQA 4LXCA 4PK4A 1YCSB 2FPFA 2V8KA 2M16A 2FRWA 4C8QD 5LJ3e 3HG9A 1OI1A 1QVFP 3FEOA 2CZ0B 1SYEA 1UWVA 1MUZA 1YHAA 1KC8C 1Q3LA 1IBKL 2JVVA 1KRTA 1SNOA 1STEA 1VF5C 1YNZA 2M0YA 4N4HA 3J81E 2CP3A 2RJDA 4ZTJA 1WHGA 3JCMe 2DL3A 5I6WA 1QCNA 3MEWA 5IGDA 3E3XA 3H3VC 1JWSD 2Z1CA 3CMAA 2LQ8A 2O9SA 4IFDJ 1Y1WG 1ZSGA 3GTJB 3I3CA 1YHQT 4E6RA 5FO7B 4N0AA 5KYWA 2F2XA 1FYNA 3ZBDA 3GP8A 2DIQA 3SWNA 1PXUA 5I9PA 3ZYYX 3CCMT 3THKA 5L8RE 1UECA 1WTRA 1WI7A 3JB9H 3QIIA 4EQPA 1QOHA 5E4WC 5FOBB 1SRMA 1FX7A 2J6OA 5IHIA 1AZEA 2Q8RE 5KEEA 1GKHA 5GMKm 1TR5A 4PJOG 3HKZE 3HKZB 1QKWA 4JI4L 1JB7A 1Y1WH 4BBSB 1D2BA 2XKOC 1PC0A 1H8KA 2JXBA 2X4YA 4LDUA 3OYNA 4GBQA 1B07A 1O7IA 1NY4A 4R1JA 2E2HB 1S40A 3UT1A 2DXUA 4ZKBB 4TVRA 3L2QA 1D0ZA 4L8JA 2JNGA 3GTKB 3G4SA 4JK1C 1B1ZA 1FNVA 2MIOA 2QQSA 5D6YA 5GANe 4BA1I 4OX9L 3ND8A 4UPAA 1EZZB 2BZYA 2UXBL 2PO4A 1G8XA 4DR1Q 3J7A5 1SE3A 2LT4A 4CKCA 2AWOA 2QQAA 2K01A 3JCMg 1UFFA 4XU2A 3MEHA 1K73U 1ZA2B 3QZ5B 2IY5B 1BU1A 1RABB 3KDFB 1JE4A 1LTGD 3RLNA 1WFWA 1UEBA 3SEMA 4A3JG 4KLKA 1IYVA 1VQEA 3QOJA 3JAMi 2DIGA 1GUSA 2Q2IA 3EN2A 3PIPA 1U1TA 4OVAA 2M1HA 3JV3A 2LDMA 1VQFA 1ESFA 2HCCA 1PTOH 3E0EA 4DR5L 2UXCL 2GBQA 2LXKA 3DB4A 2HSEB 4UDUC 5GANg 3CBOA 4DV5L 1VQ5A 3FEWX 4RCOA 4FF4A 2HNIA 4HEDA 3L0OA 4N0AC 1LCKA 5CGKA 3KJPA 2SRCA 1DM0B 1MD2D 1A15A 2DXTA 2LX9A 4FSSA 4GLXA 1SSOA 1GJXA 1VYTA 2HHHQ 4IZ8A 2K3BA 3OTOQ 1Y07A 4J6XA 1Z9FA 4M7AB 4JPBW 4P75A 4LF7L 2DGYA 2DNUA 2LNVA 2DUDA 4GS3A 1YWPA 5HCKA 5CV9A 2X35A 3OYCA 5ELEA 2GQIA 2MPXC 2DF6A 5I21A 1W4SA 2CQOA 3FKIG 1IW7D 3BW1A 4JI8L 4A3JB 3I55A 3HZXA 2JE6I 4NOYA 1HCZA 1CK1A 1IYUA 4A3MG 4C92G 2ASBA 1SNPA 2GVAA 3UDXA 2EGEA 3EFOB 4C8QA 1K9AA 3I72A 4UP9A 1Q90A 1VQDA 1STHA 1NE8A 1K83H 1KD1U 2A74C 1I4K1 4ATOA 1ML0D 2NZOA 4FIBA 1VQOQ 1BO0A 2OTLT 3K5NA 3OBWA 1Y8NB 4YCWA 1STGA 2JK8A 1QJOA 2R7DA 2CGHA 5KE3A 3FC3A 4NXNL 1JCKB 4PJLA 5C6SA 5LJ5h 3CC4Q 1HD3A 1AZPA 4X3UA 2CS7A 1JQQA 2R5AA 3M4YA 4AIMA 4B3RQ 1VIEA 4A3CG 2AT1B 3CC2T 1LT5D 2EDGA 1WA7A 4UC4A 1SNDA 4F7UB 1NBWA 3VS0A 2K50A 5BR8Q 1JR0D 1PYBA 4ZKCB 5AT1B 4BA2I 4QKUA 1BDOA 3H3VI 1N27A 1MBYA 1Q12A 2NTTA 3RKWA 1CA5A 2XIDA 2J6KA 3OYHA 1XXGA 4CDCC 4JI6Q 2L11A 1JWUD 1Y1VH 1KD1R 2V8JA 2GVBA 1BBZA 3HOWB 3H9NA 4HXJA 3JCMh 1E6HA 3G7ZA 5KNDA 3IKJA 3ZL7C 3IFTA 1G2SA 4ZGEB 4IUVA 1YI2T 4FXDA 4MZ9A 2H3JA 2P0QA 1HNXQ 3SHLA 3GTMB 4LDWA 1D6EC 1NJIC 4WORA 2IX1A 2B29A 1BNZA 1AVZC 1IL8A 1A0NB 2FINB 2PI2E 4OB0B 3GTLB 4Y91A 4BE1A 1K0RA 1Q8IA 1YFNA 3ULPA 4RTZA 1TUCA 4NMZA 5IP9H 2DJGC 2MGSA 3NSWA 1KK7A 1KQSA 2KCMA 1KDCA 3K5LA 2RHZA 4IQZA 1K76A 2CH4A 4LUDA 1RL2A 5HKCA 1V43A 3OYLA 1A2TA 4C8QF 2O2OA 1EY0A 2F0OA 3AQQA 4NB3A 1IBLQ 1W6JA 4ILWA 1JJGA 4J7FA 3BZCA 4UP8A 4XQNA 4M7DA 3PMFA 4OMOA 2BE5C 4GY5A 4DQ2A 3CCRT 2EYLA 2RHUA 2I46A 4JLIA 2E8GA 2MCNA 4U68A 1I4GA 5GAMd 1I07A 3HP3A 1LTBD 3M0RA 3J81c 2XG8D 2XRSD 2F4VL 1CI3M 1WPYA 3J7ZC 3FHWA 2YRCA 2RB6A 2RHSB 1VYVA 1R0BG 1BI0A 1IO6A 3CC2A 2A19A 5D3IB 4GKJL 3G1JA 3REAB 3PUZA 4O5VA 3JB9J 3HOYH 1H9SA 3A7AB 5J39A 3JCMd 1TWBA 2RSNA 4DNRB 4S3SA 4HT9A 3E6ZX 3F70A 1SNMA 3NP8A 2O01E 3PGGA 2ZZDA 1KG1A 4JG2A 2LCLA 4EQNA 2WFWA 1AE3A 2KJXA 5LMNW 1N34L 1PD0A 1JJ2A 3UDIA 2LJ1A 2RJEA 2A1AA 4JRIA 1N33Q 2YTXA 3HOUG 3GTQB 1WQ7A 4J7IA 3NK9A 4M1UB 5CV4A 2UUCQ 2E2IB 2QQRA 4J9EA 1ABQA 2JS2A 3CXCA 4IOCA 3I55T 3I35A 2W0ZA 5D65A 4EMKC 1Y8PB 4JUVA 1K8AC 4F87A 2XN9C 5C3WA 1C7YA 1GBQA 4DR7Q 1EY4A 3QHSA 1FYCA 1UUPA 4BS9A 3EFSA 2D1XA 1F2MA 3I5SA 1VQPQ 4HCKA 4WTOB 5DNFA 3RNJA 4HSPA 2D0NA 2J06A 2RHIA 1CKNB 4HAEA 5K36G 2RA2A 2ABLA 4A4HA 4CC3A 5CR2A 4HCZA 1MNDA 1IBKQ 1I4HA 1WD0A 2M2LA 3EG9A 3OS1A 1B50A 4PG3A 4KN4C 2R92B 7AT1B 1TWFH 4FT4A 1GUGA 1O78A 5CAIA 1VQ5T 2VXEA 1G3YA 1I50B 2K05A 2BZ8A 3PO2B 4YCVA 2NVTB 4HJAA 4L5RC 3EG3A 2KBTA 3I4NG 4M75B 3D6WA 4JBWA 2SOBA 5GAHC 5AJ3L 1EY5A 1X01A 4M78C 1R0CB 2EWNA 3GIBA 1QVFA 1KABA 1L0XB 2F0DA 4GN5A 1VQBA 4IPDA 4OIKA 1WZOA 3UATA 1B9NA 3T53B 2R7FA 4A3FB 1E1TA 5ELCA 5DAUA 1SEBD 4QUFA 3H41A 3CQZH 5JEAH 1YNNC 3I4MB 1VQNA 1VQIA 4J9DA 1VYUA 3OSOA 5I6YA 2UU9Q 2CP5A 2E6NA 3D0FA 4AH6A 2RD1A 3LYIA 1NJIU 3VS4A 1PWTA 3S1MB 2ROTA 2N8NA 2KK4A 1R9TB 4DBQA 4CC2A 1KNEA 5IYDG 8AT1B 2H1EA 4A3EH 4X65L 2OTJQ 3CCRA 3HS0C 4C3HB 1IBMQ 1OPKA 5LJ3h 2EQUA 2X6GA 3RUZA 3ULJA 2LY7A 3UA7A 4EQ5A 4BI3A 3PCOB 2RVLA 3U50C 2EKOA 1LYLA 2ZM6Q 1NLPC 3EGDA 4II1A 3EFRA 4X64Q 1QVGS 5A0LA 4E7IA 1F9QA 1V1PA 1RI0A 2A6HD 1OULA 1Q1BA 3CXCS 4JOIA 4XQ3A 2CP0A 2RQWA 1OU8A 3JCMf 3DM3A 1B3QA 1AE2A 1SMYD 3VR5A 5IY0A 1IHZA 3QG1A 1H9MA 4M77C 3CCLT 3CCQT 1K73C 4HSVA 1VQ9Q 4LNPA 2QA4T 3A1PA 4LFAL 3L2ZA 3NQIA 5FU7B 5IN1A 1OQKA 2QQ9A 4RMOA 1C0AA 2YHTA 3M57A 2D5DA 3BVGA 1N9RA 5I2MA 2YTYA 1GCPA 5A35A 5AFWA 5EKIA 3OIPA 3RESA 5DM73 5I22A 1RAHB 4B6MA 1GD7A 1KD1C 3VS5A 2PUKB 1PDQA 1EX4A 4HN7A 2VZAA 4ULLA 5D14A 1EY9A 1N9SA 3RZDH 5TSSA 1LT6D 4OF1A 5JEAJ 2AZSA 2KOLA 1TWHH 4PFOA 4DN4M 1PTOD 5EGTA 5EQ0A 1T3LA 2KHIA 5GAGC 3CCVA 3ULRB 2HHHL 1IW7C 2AKLA 2DY7A 2EJFA 3H0HA 4LK1C 3V96A 1HJDA 4LF6L 5KNBA 5IYDH 2B2WA 4A3EB 5LJ3d 3OMCA 1RAFB 1CZWA 3VR2A 1K3BC 1C8CA 1CSQA 4IPGA 3KFUA 4DOWA 3PO3H 5CV5A 3TU4K 3HHTB 4DR3Q 1S72T 3TRZA 2RHXA 1R77A 2RSOA 2DTOA 4DK6C 1V1QA 2F5KA 4F16A 2L9HA 5DLOA 3QDFA 4TVAB 1AP0A 1X75C 1D5XC 3QYHB 2O4XB 4FF1A 1V9PA 2B2WC 1QP3A 2RM4A 2IPOB 3JCMQ 2EJFC 4L63B 2HKNA 1WHHA 1GFCA 2O4XA 1KQSP 1HZ9A 3D3RA 1DJ7B 4C5IA 3A8OB 2Z9HA 1L2FA 4R8NA 2XICA 1BCPB 4OMQA 2Q2HA 3AU7A 4ME5A 4DV0L 5GAN3 3VYHB 3PO3B 5KYUA 4GLVB 1I3QH 4C5HA 5K36H 2MK5A 3HOWG 2PZWA 2SEMA 2KVQG 3EGXA 1NR2A 2JP1A 4X62Q 1Z47A 2RQVA 4XYQA 1BCPF 5FLXL 4GOPC 2NVXH 1BB9A 1WTXA 1NUCA 1YJWQ 4JZ4A 4M75F 1Q81U 1LACA 3I4OA 1JO8A 1G2TA 4RHRA 4C3IB 1SRUA 3SR1A 2KEDA 5M5XH 4M7AC 3E9IA 1Q46A 1GFDA 4FYYB 3SB2A 1JEGA 3S2HH 5LMUQ 2P0KA 2E5KA 3X3NA 1VQLT 1GUOA 4DV7Q 2JSOA 2HDMA 2CP6A 4KH1B 2JA7G 2QK0A 2ATWA 5M3MG 3FB9A 1PH8A 3OYJA 2XVSA 3CCST 1Q7YU 2EY1A 1RTNA 4C0DC 5GAMe 5FKAC 4AT1B 3J7AF 4APVA 2IL8A 2DAQA 2L4NA 5GQOA 1SBBB 2RN8A 1VQ4Q 5FK9C 3A55A 3C94A 1D1AA 3GTMH 5LMNL 2O9VA 2D0PA 3NTHA 3EROA 3J80L 3LH5A 4KUDK 2EYHA 2F0NA 1PRTD 4PJJA 3CCJQ 2CWAA 4YWKA 2FO0A 3JCMW 1YNXA 2N78A 4QQDA 1TVXA 5JJKA 3CCET 4LDXA 1ZUKA 4AFZC 4PJOC 1PNJA 3CC7T 2MOXA 1FNWA 1WHLA 2MYSA 1VQHA 2B2VC 4MNOA 5JVG3 1VIFA 4PNOA 3TP6A 4A3BH 4HCBA 4RG1A 1DXMA 1G291 2KT1A 4XTZA 4JI7L 4RCNA 3UI2A 3ONAB 4OWWB 3PE0A 1RAEB 1UHFA 3EH2A 3RMHA 1V1OA 2UUAL 1PHTA 2EYYA 3MXUA 3H8ZA 1VQMA 3LWIA 5C44B 3FJ5A 1E7ZA 2K5DA 4LMQD 4IUTA 2KRSA 2A68D 4KMUC 3HOXG 4LF9Q 2KECA 3KLWA 3QJ6A 5GAOq 1T0JA 5E3FA 3S1NB 4H0LC 5LJ3j 1SE4A 1R4PB 4A3BB 2DTIA 2NYSA 2RHQB 2EQJA 3VR6A 1LPLA 2O5IC 3IAYA 1P92A 2CREA 3CMEQ 2X69A 1PRMC 2E2JH 4KH0B 3INZA 1L1OC 3OIQA 1XNIA 3RIRA 1E2VA 5BN4A 5C0XI 3HOYB 4OMLA 1ZYRC 2QA4A 2V26A 4YY3L 4ALPA 1LNXA 1X3PA 4FP5D 4D8KA 2OI3A 2D2CC 2PQAA 2QEXT 2XTIA 1ZSZB 2NUPB 3E0JA 4KK7A 3M56A 4C8QB 4IFDG 3V8KA 3KK7A 4WJ4A 2NN6H 4M78D 3U23A 1QUQB 3CPWP 4DV5Q 1TG0A 5CQYA 1BI3A 1UEAB 1YEZA 4IUNA 1T0HA 2KEAA 4L6V5 2F0SA 4DV3L 2R93B 4DPGA 3C4SA 2K3XA 3PT9A 1B44D 4MIUA 4M77B 1CT1D 1S5BD 4DU9A 3AFPA 2C0TA 1VQKA 2F0FA 3QWYA 3L2WA 4CBVA 4DUZQ 4HJ8A 4ZGDB 1JJCB 4E7HA 2L2PA 3PIO3 4K6LA 1CFMA 2X3WD 2Q2UA 2NN6I 4PZ8A 4OMNA 4IIMA 5GMKj 1DOKA 2EYJA 3ERSX 1D1IA 2P0PA 5KYXA 4R0KA 4XQJA 1WXTA 4QQ6A 2OAUA 3M7GA 4M75E 1A8VA 1TWGB 2V4DA 3C1FA 3M3YH 5IIFA 2DERA 4JJBA 5KYLA 2RQUA 3L2RA 5KE2A 3G6JB 4LFCQ 3KBGA 1A3VA 2DO3A 1VQ6Q 4AQYQ 1QKXA 2KYMA 3OYBA 1YHQA 1M4ZA 1N8RR 3L9AX 2QG9B 3N52A 1XPUA 1H95A 1BKBA 1M30A 2YUNA 4K5WA 4JYAQ 2EYOA 3LWHA 4ZQ3A 1OV3A 4JRQA 5L23A 2CW0C 2YDLA 2CP2A 2CZ1B 2LMJA 1LTID 2PMZE 2YV5A 3OWEB 5C0XJ 2AHJB 2QQBA 5IGEA 5M5XB 4R55A 2HBWA 2DZ9A 2M9VA 2DJQA 3X28B 4ODGA 2OCEA 3A74A 2OQKA 3EA6A 1JORA 1G91A 2CSQA 1WQWA 2X51A 1AWWA 1D3BB 3NEMA 2JW4A 4A3JH 2JA7H 5KGUA 3HRSA 1M8AA 1HFNA 2K5HA 1S1NA 1TS4A 1X56A 4F7XA 4DA4A 4Z8AA 4O1NA 4OWTB 3RR5A 1F9SA 1WLPB 1I4PA 1IXDA 4P5NA 3CC7A 2E5QA 1NMGA 2RKSA 4XTXA 4K0KQ 3AT1B 3JAML 2EYFA 1SEMA 3TVTA 4V0BA 2J4XA 3TP5A 1RDPD 3RZDB 3V7CA 1PLFA 4RTYA 3EGUA 1FJGL 4TSSA 3PUYA 4NDXA 1K8OA 1QE6A 1EOVA 1VOMA 2CH4W 4XTVA 1FMKA 2HUGA 5FLMH 3CCJA 4LF5L 4J9FA 1F1BB 1S72Q 3G4ST 4KTAA 4B3ML 3AEVA 2HMAA 4NL3A 5LJ5d 1NAPA 1KFZA 2Q2TA 3OOCA 1EYCA 4JLGA 1KDBA 3CCSA 1PFSA 1UAPA 1BCPC 3L7ZC 3D31A 4LFBQ 1VQGA 3CAMA 5GAN8 3R8BA 4LE9A 1KLGD 3S1RH 3C2PA 1ET6A 5BR8L 1V1CA 4O6JA 3F2BA 1TWHB 5GANh 2B2TC 1S4ZA 1PKTA 2GFAA 1LTTD 2CZ7B 1NM7A 2KENA 2MPMA 5H1SE 1WGSA 5CCAA 3EVQA 4DR2Q 4DR6L 1YIJT 3VS2A 3KUPA 2AZVA 4LUVA 3VDYA 3PMTA 2QASA 1JU5C 4OO1H 2EY6A 1NJIR 2J6FA 2D8HA 1BQQT 2B2YA 4Z89A 3FRNA 1KQSS 2H4OA 1M2VA 2KA7A 2SNSA 2B2VA 1PV4A 1X32A 2FXQA 3HRZC 2JA5B 1NEGA 2KCCA 1VUBA 2NVXB 2DD5A 1ENFA 5IGCA 3OW2S 2EYZA 3ZJYC 2J0TD 3OPOA 4QL5A 1U3OA 4X62L 1HNXL 3MHBA 1EY7A 2YXYA 3HOXB 4HR7B 1OX9A 5IH2A 1UHCA 4F04B 2NYZD 2ZXRA 3OYAA 4LUZA 2IX3A 4IUPA 1M3BA 3CCLQ 1BR9A 2O88A 1A6XA 2MO0A 3L2PA 1F2LA 3REBB 5CC4A 1WIEA 4G4KA 2V1QA 4RTTA 3GP7A 1NYGA 3I56A 2DXBA 3SXHA 1WJSA 2OTJA 1LT4D 3SK6A 2CCZA 1B70B 1SE8A 2K6DA 5FU6C 1TXYA 1CTMA 1UNSA 1Y8OB 5M3FG 2DEQA 1X3FA 2F4IA 1K0SA 1D1CA 2Y0SB 1I50H 1W2BA 2PQWA 2JN0A 4M7AA 1GCQA 4M7AG 2B8GA 3UDCA 2CQAA 2ZTDA 4ME7A 4JJDA 1VQ8T 4DA2A 2RK2A 5EJWA 5C3EH 2XWJB 5K5PA 2H8HA 5LMNQ 3JCMc 2KXDA 3S3OA 3G6EA 2B3GA 2F1MA 2QEXQ 2JYOA 1A62A 2SDFA 3MO8A 4XYOA 1S5CD 1BCPD 3M7NA 1VA7A 2PCFB 1WJRA 3JCMb 4FSXA 4M77G 4ZN3A 4RTXA 2F3WA 2EYMA 4E47A 1ARKA 3SWNB 5HK3A 4MMKA 1AN8A 2L0CA 1UDLA 3QO2A 3J81L 1QWFA 2RK1A 2K32A 4E6IA 5M3FH 4EMKB 3JCMV 3CMET 3TZUA 2KCTA 2MWPA 3VA5A 4NXML 1SLJA 2DNEA 4OB2B 4RAUC 2FHDA 3IL8A 5CMDA 3PIP3 2PU9B 3RR6A 2UXCQ 1X6BA 5GAOr 1K8MA 1TKWB 3S6WA 1SHFA 4Y7NH 1TWFB 3CEYA 4EPCA 4BWGB 3CCQA 4ZYSA 2A08A 1F77A 5CYUA 2ZPHB 1SXTA 3HSBA 2DPPB 1A2UA 3AFQA 1AWJA 3HGBA 2ENBA 4DK0A 2RNAA 4PJOF 4G7OC 3EGDB 2A8VA 5GAMj 4BD3A 4F7UG 4RH6A 1KSWA 2M00A 5EBCA 1B34B 4ZUIA 5JAVA 1HXDA 2ZPGB 3PIOA 1U0LA 2JA8G 1MV0B 1TUGB 3VS3A 4KJOA 3T16A 2Y4YA 3HKZG 4BBSG 3CCEQ 2EY5A 5FLXE 4CJ0B 2COYA 1V1PB 3MJXA 3PNWC 1A3TA 3U4ZA 2VGMA 2KHSA 3NQTA 3ND9A 4MN3A 3OYYA 2KXCA 4M78F 4JV5L 1ABOA 1M90R 1ET9A 1DJRD 5C44H 1EZ6A 4A4EA 3H0GH 4X65Q 1AZQA 2HDAA 1TS2A 2GFUA 1SR3A 3UDFA 2JN4A 3BE3A 2KGTA 4DEYA 2CUDA 2KT8A 1D3BA 2Y4XA 3JAME 2VQFQ 3C1EA 3I5RA 2DBKA 1VQLQ 4CDDC 1N32L 4C1NI 1G5VA 5C0XH 1STBA 2Z0SA 1FXXA 4M7AE 4JVZA 4LDYA 4JDSA 3DEPA 3UE1A 3MPUB 4FYVB 3K5MA 2R58A 1O7LA 4NW2A 1QB5D 3S2DB 3T1YL 1WNLA 2RCFA 1FWZA 1YJWT 4OWXB 4YHHQ 1TXQA 3VS7A 3H0IA 3VS1A 5LJ5g 1QVGA 5CKEA 1HTPA 1I6HH 1TWGH 3F2CA 2K5NA 4AFQC 3DM1A 1NR4A 1CUKA 1PD1A 1X3GA 3DHQA 1IRXA 2AWNA 2WKCA 3ULLA 3R6OA 3S16H 1G8ZD 4JI6L 4FU6A 1B8AA 4X66L 3SFMA 4OP0A 1OXUA 1SNCA 5CQXA 3X24B 2XHCA 1MMGA 4M75C 1YJNA 1VQ4A 3BZKA 1B7YB 2PPBC 2B63B 1HJPA 4C92E 3C12A 1X9NA 1ILPA 4B3MQ 2ECZA 1GXIE 2B2TA 3K8AA 3OYMA 1HUMA 2EAYA 1ASZA 4YHHL 1X3QA 5AYFA 4BY6C 3OW2A 5C0MA 5JPMC 1KQ2A 2LSSA 1I1JA 3LLRA 1EOTA 4CDFC 1JQYD 2OWOA 1GHKA 3MKDA 3CRKC 4ME3A 5KNCA 1P8LA 1AHJB 2DVEA 4RTUA 1HR0Q 1JWMD 2HAXA 3R6NA 4QVDA 1ICWA 4DV4Q 3HRUA 4B3SQ 2VB2X 1OU9A 2DM1A 2LQKA 4MZTA 2JQOA 1AD5A 1MV3A 5FO8B 4J5YA 1VQMQ 1KC8U 2I0NA 5IP9G 1BUVT 4Y92A 4HCCA 2M0OA 2RQTA 2PZUA 3T13A 4A3KB 5GAN4 4M75D 3P8BB 3KF6A 1HZBA 4KGVB 1YITT 2PZTA 1G3WA 1X27A 3QSUA 1Y1VG 2KUMA 4I65A 4DKAC 2UUCL 3CPWA 3GQBA 3M4OH 2ZXOA 1YWOA 1EQRA 1Z9QA 2JA7B 3A8HB 3W2DA 4GOPA 1VS0A 1I3QB 3C95A 1U4MA 2EXDA 3DUZA 3QKJA 1TSFA 1IKLA 2MNAA 1B2TA 4IKFA 4L5TA 2YSQA 3K7UC 1WTVA 3CC2Q 1DCZA 4XU1A 1EU3A 3E19A 2QA4Q 1ZXTA 5I9OA 2KMTA 4O42A 4UP7A 2QKIC 3F8TA 3BU2A 4DV1Q 1G51A 4R4QA 2F0WA 2DTHA 2NZHA 5FLMG 4DR4L 1U4LA 1EWHA 2CFMA 2D0QB 4IUQA 2A36A 4MMLA 5KCHA 5DM7R 3OYDA 1YJ9T 1VQOT 3L1AA 3SVMA 1I4XA 1M1FA 1GUWA 1EWCA 4EMHA 1BVSA 4QMGA 5FROA 3BFMA 3KFVA 5GROA 3HOXH 4A4FA 5CR3A 3GTOH 3BDOA 4OGCA 1MJEA 1BK2A 1QVGP 2JS0A 4C0ZA 1C1AA 2YTVA 1K4US 1F2YA 1ZYRD 3NWSA 2R92H 3I9QA 1EWIA 4JI5L 4IO9A 1AH9A 2GCXA 1F2ZA 2KI7A 3HFNA 2AIRB 4FL6A 4DR7L 4K8JA 4A93B 3KYHC 4NS5A 1SG5A 4OL7A 2KAFA 2Q8IB 1QZGA 3FJPA 5IT9L 3KF8A 4RKLA 3E9FA 4FF2A 1UGRB 1MMDA 2F5TX 3JB9F 3BG3A 5C4HA 2DX1A 2QXFA 4A53A 1KDAA 4JBMA 4BACA 1XNQL 2DL8A 3L2UA 2E10A 3LGLA 1EYAA 3KLSX 1VQ6A 1PFMA 3GBQA 5C5LA 2VNUD 4XTWA 5ELFA 3SK5A 1OPLA 1I5FA 2BIVA 1GCQC 2Z6KA 3S15H 2NVQB 2JM9A 3S3NA 2DN8A 2JTMA 1NPRA 4BB7A 1S5FD 3D8GA 2L3QA 1VQ5Q 1FD7D 1PTOB 1Y14B 4A3IH 4OMMA 4RWSC 5EPLA 4PJOD 3M59A 1PRTF 4R9WA 2K04A 3R93A 3MEVA 2MFIA 1SFOB 4KGZB 5CIUA 2I2LA 2K2MA 3M55A 1XX8A 2R3ZA 4JOIC 2ZTEA 2DXCA 1YVCA 2B39A 1OZ3A 1VDZA 1M90U 1EQTA 1VQPT 2F0TA 4FO2A 4RFBA 2D8JA 1ONLA 1M90C 4C3JB 4C92D 1LOJA 3A54A 1GBRA 1A3UA 1IHVA 1X54A 4J9GA 1IGUA 1SSHA 3WVDB 1TS5A 1V29B 2YU9B 3RKYA 3HL8A 3I55Q 3NE5B 4POFA 2ZPEB 2E2DC 1IBML 4DV6L 4KY5A 4JCVE 1XYIA 1I81A 2VQFL 3DLLA 3OS0A 1B4OA 3VR4A 4J1MA 4TRDA 1M3CA 3MXNB 1WOCA 2WP8J 3MEUA 4M75A 3PSIA 1I94L 2A6ED 4B9WA 1KRSA 4FW1A 4FYXB 1IYJB 3A98A 4LF4Q 1UE9A 2K5VA 2K5QA 4CDEC 4E7KA 3S1QH 2L5TA 4YCUA 3QWNA 4GZYC 5GMKi 1BOSA 1H9RA 2C35B 2R92G 4JI1L 4DAYB 1HRJA 1B34A 4YWLA 2DKGA 2PNRC 1LTLA 4IIOA 2AMCB 4A3BG 1PH2A 1YITQ 3P7JA 1TTHB 2R61A 1H3ZA 3OSSC 4PKCC 1TY0A 1TS9A 3MEFA 2KQWA 4HT8A 2BH2A 3RBBB 2FMCA 2JXMB 3H6ZA 3QYGB 1PG5B 2L89A 4FXKC 1SN8A 4A3LH 4FM4B 4JI0L 5GAN7 3BYTB 1Q81R 2JM8A 3A56A 5LL6S 3H0FA 4C8QG 3FIFA 2C9OA 1SYCA 1W6KA 2Z6KC 1UE7A 2GF7A 2B86A 4LF6Q 3STBC 4DAMA 1D09B 1CHPD 1O75A 4J9BA 1SYBA 4GN4B 4MTKA 3UDGA 4LFBL 1I4QA 4OIJA 4LN2A 1ZHIA 2K5LA 1AEYA 3JB9D 2QW7A 3JC66 2NVYB 3GTKH 2BZXA 2RHYA 2DBMA 4CKBA 3NENA 1JJ2P 4KD4A 1QP2A 1BI2A 1M1KU 5LMUL 4OO1G 3KUFA 3K5OA 2BOSA 2KCNA 5GMKl 4BDZA 5C3XA 1TU0B 4HCEA 3VYSA 2XIWA 1VQPA 2JMCA 3HKSA 3GPLA 1QVFS 1JE5A 2WINB 1N34Q 1IBLL 4J9IA 1SJHD 2DA9A 4C5GA 2G9DA 4TKOB 1FJGQ 5EPJA 3MP6A 1EU4A 3WVEB 5GAOp 1QCOA 3M0QA 1YP5A 3SD4A 2GA4B 4IALA 1IXRA 1LTAD 5T1IA 2CKKA 3PO2H 1U5SA 3NMZC 1HHVA 1N8RU 2JEAI 1ACMB 1M2VB 4DV0Q 4M77D 3S17B 1VQAA 1T3SA 3CPFA 1H641 1FGUA 3BJUA 4JW0A 1PH7A 1WJQA 2LQNA 1S5DD 5M5YB 3NXWA 1Q82C 1YJWA 3LWEA 4OB3B 3LH0A 2F0JA 1HNWQ 2E65A 4DV1L 4A93G 5J26A 1KHIA 4M7DC 1GHJA 2MWOA 1UGVA 3CC4T 2OTLA 4PV1C 3HOWH 2XNAC 3QJYA 4PNYA 5KRUA 4QGUA 2QILA 1N36L 2EE1A 3I73A 5KYYA 3JRZA 3VV0A 1PSFA 1XOVA 3I4NB 4CKEA 4C3IH 5GAOn 2EQMA 2UUAQ 2HQHA 2CW0D 2RCNA 2PI2A 5KYUB 2XRQD 2E5LQ 2VQEQ 3HEJA 1HYOA 4BY7G 1WD1A 3PMIA 3GTLH 2Z0WA 2IHFA 2Z8LA 4J9HA 1WTOA 2WB1E 2XWBB 2L1BA 3R3OA 4LF9L 3I4MG 2F1LA 3EG9B 2J05A 2LCSA 3PV0A 5BN5A 4IURA 3VUZA 3Q8DA 1J6QA 1J9OA 2H3EB 2UXBQ 4GKKQ 4V2SA 2PUOB 4A3MH 2KSSA 3A5UA 2HQXA 2L55A 4M77A 1D1KA 1EIYB 5KYWB 1WYDA 4BY7H 4HIDA 4EMGA 2NUCA 3L42A 1JOKA 4DV4L 4OO1I 1M3AA 2DL4A 5DY9A 1V76A 5FWCA 5IWAL 4J15A 4DAVA 3O8VA 2UXDL 4HMJA 4DGZA 2L3SA 2NB0A 3CCUT 3M5AA 2IWHA 2G6FX 4A3GG 1WCMH 4K5VA 1VMPA 5A2QE
chains in the Genus database with same CATH topology
1AWWA 2MIOA 4AG1C 3VRZA 2JW4A 2V1RA 1S1NA 2BZYA 1SHGA 4Z8AA 1WLPB 2FEIA 1UFFA 1BU1A 5ECAA 1SEMA 2F2VA 3M0TA 3TVTA 2JT4A 1WFWA 3SEMA 4RTYA 3EGUA 1CKAA 1H3HA 1QLYA 2CH4W 1FMKA 3JV3A 4J9FA 2L3PA 2K79A 2GBQA 1KFZA 4X1VA 1U06A 2RPNA 4RUGA 2FRYA 4AFSC 4LE9A 2KE9A 1LCKA 1V1CA 2SRCA 2YT6A 2DILA 1PKTA 1NM7A 4FSSA 1AWOA 3NPFA 1RLQC 1VYTA 3VS2A 2AZVA 2C0IA 2K3BA 1JU5C 4JPBW 2J6FA 2D8HA 2DNUA 4Z89A 1YWPA 5HCKA 1Z9ZA 2BTTA 2GQIA 1NEGA 2DF6A 2EYZA 1WXUA 2A28A 1U3OA 1UJYA 1E6GA 1UJ0A 2EGEA 5IH2A 1UHCA 1K9AA 4OMPA 1M3BA 1W6XA 2O88A 3REBB 1WIEA 1AOJA 2V1QA 2KNBB 4RTTA 1NYGA 1X6GA 3M0SA 2KROA 1HD3A 2K6DA 2RQRA 2CT4A 1JQQA 1K0SA 4HVWA 1GCQA 2KRNA 1WA7A 4JJDA 4JZ3A 3VS0A 2H8HA 2KXDA 2GTOA 5IXBA 3SHWA 3VS6A 1VA7A 4AG2C 2J6KA 4GLMA 4RTXA 1ARKA 2EGAA 1UDLA 1QWFA 2DL5A 1BBZA 1PRLC 4HXJA 1E6HA 2J7IA 3ZL7C 4QT7A 2AKKA 2JMAA 1J3TA 1X6BA 2AK5A 1AVZC 1A0NB 1K0XA 1SHFA 2NWMA 2A08A 1AWJA 1TUCA 4RTZA 1X69A 2RNAA 3NHNA 1KIKA 4CC4B 2A37A 1K76A 1KSWA 2CH4A 4LUDA 4RTVA 2O2OA 1MV0B 2KRMA 3VS3A 2EYXA 1I0CA 3NGPA 4OMOA 2KXCA 4J9CA 2MCNA 1Y0MA 1ABOA 1I07A 3M0RA 2ESWA 4DEXA 2HDAA 1VYVA 1IO6A 1W1FA 2KGTA 2W10A 4RTWA 4DEYA 3REAB 4JJCA 2CUDA 2KT8A 3I5RA 1WYXA 1JXMA 2DBKA 5FWBA 1W70A 5IXFA 2LJ1A 2DMOA 2F2WA 3TSWA 2C0OA 3VS7A 3H0IA 3VS1A 4J9EA 1ABQA 2JS2A 4AFQC 4CC7A 3VRYA 3I35A 2W0ZA 2XMFA 1GBQA 1KJWA 2D1XA 3I5SA 2YUPA 4HCKA 2EW3A 3RNJA 2D0NA 2J06A 2ECZA 2ABLA 3C0CA 4CC3A 2DE0X 3EG0A 3EHRA 4WCIA 1I1JA 5GJWB 1NLOC 2BZ8A 2EGCA 1NG2A 3EG3A 4RTUA 2KBTA 5GJVB 3R6NA 2NUZA 1JXOA 3QWXX 2DM1A 1AD5A 1MV3A 1SRLA 1Y57A 2EBPA 2GTJA 3UATA 1ZLMA 2CSIA 2I0NA 3H41A 4Y92A 2RQTA 4J9DA 1VYUA 1X27A 3PVQA 2HSPA 3VS4A 1PWTA 1TUDA 1YWOA 2ROTA 1Z9QA 2OAWA 4CC2A 2YSQA 1OPKA 2K9GA 3UA7A 2DL7A 3EG1A 2LZ6B 2EYWA 4KRTA 1NLPC 1UTIA 1UG1A 2A36A 2RQWA 1B3QA 4ZNXA 1G2BA 1QCFA 2DRKA 2LX7A 3KFVA 1WX6A 4LNPA 1BK2A 2JS0A 2PZ1A 1K4US 3I9QA 1GCPA 2VWFA 1AZGB 2RF0A 5I22A 3EHQA 1X2QA 3VS5A 1X2KA 2LJ3A 2DX1A 2OJ2A 2AZSA 4F14A 2DL8A 2EQIA 5IHKA 1T3LA 1ZBJA 3CQTA 3ULRB 2M51A 1N5ZA 1PKSA 2AKLA 3GBQA 1OPLA 2ED1A 3H0HA 1GCQC 1K1ZA 2HCKA 5EC7A 1HJDA 2JM9A 1ZX6A 2L3QA 1X43A 4OMMA 4ORZA 2EKHA 1M27C 4M4ZA 1HSQA 2K2MA 4F16A 2ENMA 1M8MA 2CDTA 1OEBA 2D8JA 2FPEA 1RI9A 4F17A 1GFCA 2ED0A 1GBRA 2O31A 4OMQA 2LQWA 1YN8A 4J9GA 1SSHA 2SEMA 2GGRA 4D8DA 2KR3A 2RQVA 2DRMA 1BB9A 1H92A 2LJ0A 4JZ4A 1JO8A 2CT3A 2HEQA 2VVKA 3EG2A 1QWEA 1M3CA 1GFDA 1JEGA 2DLPA 2GNCA 2E5KA 1OOTA 1UUEA 4HVUA 3A98A 1UE9A 5FW9A 2DYBA 2CUBA 2LNHB 3O5ZA 2X3XD 4IIOA 2RN8A 1RUWA 5I11A 1RLPC 2O9VA 3LH5A 3M0PA 3RBBB 2FO0A 2JTEA 3TSZA 2KYBA 2LP5A 1ZUKA 4AFZC 1GL5A 1PNJA 2MOXA 2JM8A 3H0FA 1ZUUA 2QDLA 1CKBA 2KT1A 1GRIA 2B86A 3PE0A 1UHFA 3PVLA 5IHNA 1PHTA 1SPKA 4J9BA 4EIKA 2EYYA 1WDXA 1CSKA 3FJ5A 4LN2A 1AEYA 3UA6A 4HVVA 3M0UA 2BZXA 2KRSA 2DBMA 4A63B 1T0JA 2PNIA 4K11A 2IIMA 2CREA 1PRMC 2JMCA 2L0AA 4J9IA 2DA9A 4OMLA 1NEBA 3M0QA 1YP5A 1U5SA 3NMZC 4D8KA 2OI3A 2ROLA 1ZUYA 2VKNA 1T3SA 2RMOA 4ESRA 3U23A 2LQNA 4AFUC 1TG0A 4LUEA 2PTKA 1T0HA 2KEAA 2EPDA 1UGVA 2FG0A 2K7AA 2EVRA 2C0TA 2P4RA 2YUQA 3QWYA 3UF4A 1YCSB 2FPFA 2FPDA 2FRWA 1AWXA 2L2PA 1XOVA 1MUZA 2X3WD 4OMNA 4IIMA 1YNZA 2M0YA 1WXBA 2DL3A 4R0KA 1WXTA 4J9HA 2DVJA 4JJBA 2RQUA 2LCSA 2J05A 2O9SA 1E7OA 1ZSGA 4E6RA 2F2XA 1FYNA 1QKXA 2KYMA 1UECA 3THKA 3IQLA 1WI7A 1M30A 2YUNA 2YUOA 1G83A 2J6OA 1OV3A 1SRMA 5IHIA 5L23A 1M3AA 2DL4A 2YDLA 1AZEA 2LMJA 5FWCA 2HBWA 1EFNA 1QKWA 2DJQA 2L3SA 1NYFA 1H8KA 2G6FX 2JXBA 4GBQA 1B07A 4Z88A 2CSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWW A;  2MIO A;  4AG1 C;  3VRZ A;  2JW4 A;  2V1R A;  1S1N A;  2BZY A;  1SHG A;  4Z8A A;  1WLP B;  2FEI A;  1UFF A;  1BU1 A;  5ECA A;  1SEM A;  2F2V A;  3M0T A;  3TVT A;  2JT4 A;  1WFW A;  3SEM A;  4RTY A;  3EGU A;  1CKA A;  1H3H A;  1QLY A;  2CH4 W;  1FMK A;  3JV3 A;  4J9F A;  2L3P A;  2K79 A;  2GBQ A;  1KFZ A;  4X1V A;  1U06 A;  2RPN A;  4RUG A;  2FRY A;  4AFS C;  4LE9 A;  2KE9 A;  1LCK A;  1V1C A;  2SRC A;  2YT6 A;  2DIL A;  1PKT A;  1NM7 A;  4FSS A;  1AWO A;  3NPF A;  1RLQ C;  1VYT A;  3VS2 A;  2AZV A;  2C0I A;  2K3B A;  1JU5 C;  4JPB W;  2J6F A;  2D8H A;  2DNU A;  4Z89 A;  1YWP A;  5HCK A;  1Z9Z A;  2BTT A;  2GQI A;  1NEG A;  2DF6 A;  2EYZ A;  1WXU A;  2A28 A;  1U3O A;  1UJY A;  1E6G A;  1UJ0 A;  2EGE A;  5IH2 A;  1UHC A;  1K9A A;  4OMP A;  1M3B A;  1W6X A;  2O88 A;  3REB B;  1WIE A;  1AOJ A;  2V1Q A;  2KNB B;  4RTT A;  1NYG A;  1X6G A;  3M0S A;  2KRO A;  1HD3 A;  2K6D A;  2RQR A;  2CT4 A;  1JQQ A;  1K0S A;  4HVW A;  1GCQ A;  2KRN A;  1WA7 A;  4JJD A;  4JZ3 A;  3VS0 A;  2H8H A;  2KXD A;  2GTO A;  5IXB A;  3SHW A;  3VS6 A;  1VA7 A;  4AG2 C;  2J6K A;  4GLM A;  4RTX A;  1ARK A;  2EGA A;  1UDL A;  1QWF A;  2DL5 A;  1BBZ A;  1PRL C;  4HXJ A;  1E6H A;  2J7I A;  3ZL7 C;  4QT7 A;  2AKK A;  2JMA A;  1J3T A;  1X6B A;  2AK5 A;  1AVZ C;  1A0N B;  1K0X A;  1SHF A;  2NWM A;  2A08 A;  1AWJ A;  1TUC A;  4RTZ A;  1X69 A;  2RNA A;  3NHN A;  1KIK A;  4CC4 B;  2A37 A;  1K76 A;  1KSW A;  2CH4 A;  4LUD A;  4RTV A;  2O2O A;  1MV0 B;  2KRM A;  3VS3 A;  2EYX A;  1I0C A;  3NGP A;  4OMO A;  2KXC A;  4J9C A;  2MCN A;  1Y0M A;  1ABO A;  1I07 A;  3M0R A;  2ESW A;  4DEX A;  2HDA A;  1VYV A;  1IO6 A;  1W1F A;  2KGT A;  2W10 A;  4RTW A;  4DEY A;  3REA B;  4JJC A;  2CUD A;  2KT8 A;  3I5R A;  1WYX A;  1JXM A;  2DBK A;  5FWB A;  1W70 A;  5IXF A;  2LJ1 A;  2DMO A;  2F2W A;  3TSW A;  2C0O A;  3VS7 A;  3H0I A;  3VS1 A;  4J9E A;  1ABQ A;  2JS2 A;  4AFQ C;  4CC7 A;  3VRY A;  3I35 A;  2W0Z A;  2XMF A;  1GBQ A;  1KJW A;  2D1X A;  3I5S A;  2YUP A;  4HCK A;  2EW3 A;  3RNJ A;  2D0N A;  2J06 A;  2ECZ A;  2ABL A;  3C0C A;  4CC3 A;  2DE0 X;  3EG0 A;  3EHR A;  4WCI A;  1I1J A;  5GJW B;  1NLO C;  2BZ8 A;  2EGC A;  1NG2 A;  3EG3 A;  4RTU A;  2KBT A;  5GJV B;  3R6N A;  2NUZ A;  1JXO A;  3QWX X;  2DM1 A;  1AD5 A;  1MV3 A;  1SRL A;  1Y57 A;  2EBP A;  2GTJ A;  3UAT A;  1ZLM A;  2CSI A;  2I0N A;  3H41 A;  4Y92 A;  2RQT A;  4J9D A;  1VYU A;  1X27 A;  3PVQ A;  2HSP A;  3VS4 A;  1PWT A;  1TUD A;  1YWO A;  2ROT A;  1Z9Q A;  2OAW A;  4CC2 A;  2YSQ A;  1OPK A;  2K9G A;  3UA7 A;  2DL7 A;  3EG1 A;  2LZ6 B;  2EYW A;  4KRT A;  1NLP C;  1UTI A;  1UG1 A;  2A36 A;  2RQW A;  1B3Q A;  4ZNX A;  1G2B A;  1QCF A;  2DRK A;  2LX7 A;  3KFV A;  1WX6 A;  4LNP A;  1BK2 A;  2JS0 A;  2PZ1 A;  1K4U S;  3I9Q A;  1GCP A;  2VWF A;  1AZG B;  2RF0 A;  5I22 A;  3EHQ A;  1X2Q A;  3VS5 A;  1X2K A;  2LJ3 A;  2DX1 A;  2OJ2 A;  2AZS A;  4F14 A;  2DL8 A;  2EQI A;  5IHK A;  1T3L A;  1ZBJ A;  3CQT A;  3ULR B;  2M51 A;  1N5Z A;  1PKS A;  2AKL A;  3GBQ A;  1OPL A;  2ED1 A;  3H0H A;  1GCQ C;  1K1Z A;  2HCK A;  5EC7 A;  1HJD A;  2JM9 A;  1ZX6 A;  2L3Q A;  1X43 A;  4OMM A;  4ORZ A;  2EKH A;  1M27 C;  4M4Z A;  1HSQ A;  2K2M A;  4F16 A;  2ENM A;  1M8M A;  2CDT A;  1OEB A;  2D8J A;  2FPE A;  1RI9 A;  4F17 A;  1GFC A;  2ED0 A;  1GBR A;  2O31 A;  4OMQ A;  2LQW A;  1YN8 A;  4J9G A;  1SSH A;  2SEM A;  2GGR A;  4D8D A;  2KR3 A;  2RQV A;  2DRM A;  1BB9 A;  1H92 A;  2LJ0 A;  4JZ4 A;  1JO8 A;  2CT3 A;  2HEQ A;  2VVK A;  3EG2 A;  1QWE A;  1M3C A;  1GFD A;  1JEG A;  2DLP A;  2GNC A;  2E5K A;  1OOT A;  1UUE A;  4HVU A;  3A98 A;  1UE9 A;  5FW9 A;  2DYB A;  2CUB A;  2LNH B;  3O5Z A;  2X3X D;  4IIO A;  2RN8 A;  1RUW A;  5I11 A;  1RLP C;  2O9V A;  3LH5 A;  3M0P A;  3RBB B;  2FO0 A;  2JTE A;  3TSZ A;  2KYB A;  2LP5 A;  1ZUK A;  4AFZ C;  1GL5 A;  1PNJ A;  2MOX A;  2JM8 A;  3H0F A;  1ZUU A;  2QDL A;  1CKB A;  2KT1 A;  1GRI A;  2B86 A;  3PE0 A;  1UHF A;  3PVL A;  5IHN A;  1PHT A;  1SPK A;  4J9B A;  4EIK A;  2EYY A;  1WDX A;  1CSK A;  3FJ5 A;  4LN2 A;  1AEY A;  3UA6 A;  4HVV A;  3M0U A;  2BZX A;  2KRS A;  2DBM A;  4A63 B;  1T0J A;  2PNI A;  4K11 A;  2IIM A;  2CRE A;  1PRM C;  2JMC A;  2L0A A;  4J9I A;  2DA9 A;  4OML A;  1NEB A;  3M0Q A;  1YP5 A;  1U5S A;  3NMZ C;  4D8K A;  2OI3 A;  2ROL A;  1ZUY A;  2VKN A;  1T3S A;  2RMO A;  4ESR A;  3U23 A;  2LQN A;  4AFU C;  1TG0 A;  4LUE A;  2PTK A;  1T0H A;  2KEA A;  2EPD A;  1UGV A;  2FG0 A;  2K7A A;  2EVR A;  2C0T A;  2P4R A;  2YUQ A;  3QWY A;  3UF4 A;  1YCS B;  2FPF A;  2FPD A;  2FRW A;  1AWX A;  2L2P A;  1XOV A;  1MUZ A;  2X3W D;  4OMN A;  4IIM A;  1YNZ A;  2M0Y A;  1WXB A;  2DL3 A;  4R0K A;  1WXT A;  4J9H A;  2DVJ A;  4JJB A;  2RQU A;  2LCS A;  2J05 A;  2O9S A;  1E7O A;  1ZSG A;  4E6R A;  2F2X A;  1FYN A;  1QKX A;  2KYM A;  1UEC A;  3THK A;  3IQL A;  1WI7 A;  1M30 A;  2YUN A;  2YUO A;  1G83 A;  2J6O A;  1OV3 A;  1SRM A;  5IHI A;  5L23 A;  1M3A A;  2DL4 A;  2YDL A;  1AZE A;  2LMJ A;  5FWC A;  2HBW A;  1EFN A;  1QKW A;  2DJQ A;  2L3S A;  1NYF A;  1H8K A;  2G6F X;  2JXB A;  4GBQ A;  1B07 A;  4Z88 A;  2CSQ A; 
#chains in the Genus database with same CATH topology
 1JIC A;  1AT1 B;  2HCI A;  5IOD A;  3EH1 A;  3JB9 I;  3PUW A;  5I4D A;  3VRZ A;  2V1R A;  1M1K C;  3DB3 A;  3CCM A;  1SHG A;  4C0F A;  1DGS A;  2UUB L;  1IRE B;  1EYD A;  1B7T A;  2VYT A;  4FYD A;  4R4C A;  2EJ9 A;  2LT1 A;  4J6Y A;  2B2Y C;  3TS2 A;  1J8I A;  1QCB D;  2X4W A;  1EQV A;  1K28 A;  4BBS H;  1CKO A;  1K9M U;  4KN7 C;  5CVI A;  3BDU A;  3MP8 A;  5ECA A;  2F2V A;  3QPH A;  3CME A;  5A0D A;  4X9D A;  3JSC A;  2JT4 A;  3RUX A;  5GAM f;  2PNH A;  1Q82 U;  5DM6 3;  3H91 A;  4AMC A;  2DYI A;  4DV2 Q;  3TDQ A;  4A3M B;  1Q86 R;  3CD6 Q;  1PRT B;  3EJI A;  1QLY A;  5EG2 A;  1VQ8 Q;  3TP7 A;  1RAD B;  1GOZ A;  4M7D F;  2L3P A;  3URG A;  2K79 A;  4JYA L;  2DEU A;  2VW9 A;  2K5I A;  3OW7 A;  1DOL A;  4AQY L;  1ICF B;  5LJ3 f;  1OTC A;  1U06 A;  2L3R A;  1RJT A;  2RPN A;  2FRY A;  4C0D B;  4M7D D;  2PVD B;  4QIW B;  1ZA1 B;  2KE9 A;  1YJ9 Q;  1L0Y B;  3K6O A;  2ZJR A;  2IW3 A;  3S1Q B;  4BUG A;  4OB1 B;  2IPK D;  1E0B A;  4M7A F;  3BVM A;  2RJC A;  4JI2 Q;  3S14 B;  4CI0 C;  1F9R A;  4BI4 A;  1XMO L;  3NPF A;  2NWG A;  5ELN A;  5M3F B;  2C0I A;  8ATC B;  3I56 T;  1EFW A;  2LCC A;  3GOX A;  1XPR A;  1L1O B;  2WB1 G;  1VQ7 Q;  4A93 H;  4A3G H;  2R93 H;  3JCM X;  1Z9Z A;  2CZ6 B;  1KNA A;  5T1G A;  3S1R B;  2BTT A;  2E64 A;  2COW A;  1TU2 B;  4MDX A;  5F2D A;  4GN3 B;  4JV5 Q;  4KHV A;  3GNG A;  2A28 A;  4N9T A;  2DD4 A;  4FNF A;  1F9P A;  4P2C B;  4DR3 L;  2E2I H;  1UJY A;  3EQL C;  1E6G A;  1D0Y A;  1UJ0 A;  3LWU A;  4JS4 A;  2F3I A;  4O0A A;  4OMP A;  3V05 A;  1K73 R;  1QUQ A;  1DYQ A;  1W6X A;  1VQM T;  4RGM A;  3CQZ B;  1XMO Q;  3I4M H;  5DEH A;  1AOJ A;  2KNB B;  3MVV A;  1BI1 A;  4PFZ A;  1X6G A;  2M9U A;  4ID6 A;  3MCA B;  1Q1E A;  5CO7 A;  1SFO H;  4I7A A;  3CCV Q;  2I5L X;  2KEE A;  1RF2 D;  2DNC A;  3VYG A;  4F7U A;  5LJ5 e;  4CHT B;  2ID0 A;  2F0K A;  4HTH A;  5CKB A;  3QUI A;  3OYI A;  4HVW A;  3FDT A;  1QG7 A;  5IT9 c;  1WTW A;  2NUT B;  4LWC A;  4KHP Q;  4QVZ A;  3MFY A;  2GTO A;  3SHW A;  1BIB A;  2E2H H;  4WF2 A;  2BA1 A;  2G3R A;  1I8F A;  4AG2 C;  1IHW A;  2B8F A;  3ITP A;  4A3K H;  4GLM A;  2A68 C;  2EGA A;  4M75 G;  5KYI A;  4A3F H;  1STY A;  1GUT A;  3BS1 A;  2PMZ B;  1QNK A;  1PRL C;  1E24 A;  2EJM A;  4XTY A;  1QQJ A;  2J7I A;  1U8R A;  4XT1 B;  5C0X G;  4QT7 A;  2AKK A;  4LW1 A;  3X20 B;  5KYY B;  4C1N K;  1J3T A;  3DMU A;  4L6T B;  3H3V H;  2V1C C;  2NBF A;  2AK5 A;  2XD0 A;  1UE6 A;  1VQC A;  2EXZ A;  4R4O A;  2F03 A;  2BDO A;  1K0X A;  2E76 C;  1Q8K A;  2NWM A;  1PA6 A;  3NPP A;  2XDP A;  4QUC A;  3U9S A;  3X25 B;  2PQE A;  3RMQ A;  1C0M A;  1X69 A;  2JA6 H;  1D8L A;  3NHN A;  4B3S L;  2VXF A;  1FNU A;  4QJF A;  1EIG A;  4CC4 B;  1G3T A;  3I70 A;  4RTV A;  5FU6 B;  4MZM A;  4E2F B;  1PFN A;  2Y90 A;  5IP7 G;  3S2H B;  1HH2 P;  2ZT9 C;  4NL2 A;  2KRM A;  3E9H A;  2DJF C;  3L3O C;  3VA7 A;  1I0C A;  1VQ6 T;  2COZ A;  1TWA B;  1IGQ A;  4Y52 H;  2VUB A;  1JOO A;  4DAP A;  2L15 A;  4RMF A;  5D3D A;  4J9C A;  1Y0M A;  1QIL A;  1J5E Q;  2K2V A;  3G6E T;  4H13 C;  2VUM G;  5C3E G;  2ESW A;  1R9T H;  4DEX A;  2OEO A;  3HOV H;  5GAM g;  4QY7 A;  1MIU A;  3S1M H;  2RI5 A;  4BY6 B;  1TWC B;  3I7F A;  4M7A D;  1W1F A;  3VJP A;  4RTW A;  2W10 A;  4LDV A;  4B3T L;  4JJC A;  4C3J H;  3I91 A;  3UE0 A;  5IE8 A;  3CPW S;  3CF5 A;  2B2U A;  3V8L A;  4N9P A;  5FJ8 G;  3QDR B;  2JOY A;  2MMP A;  3MHX A;  3MXP A;  1SMY C;  3OWF A;  3T56 B;  1WTQ A;  2JA5 G;  2N55 A;  1HNZ L;  4R56 A;  2K33 A;  1U1S A;  4M78 B;  2F0H A;  5COR A;  5IXF A;  4DR6 Q;  1VQK T;  2RA4 A;  2PW7 A;  4R4I A;  1YJ9 A;  4XTU A;  3GTG H;  4DFA A;  3GTJ H;  3VYT A;  2C0O A;  2RDH A;  4EVO A;  3MZ5 A;  4PL6 A;  2EY2 A;  5GAO m;  4CC7 A;  4RGO S;  3VRY A;  4K2L A;  2WAQ E;  1WVL A;  3M4Q A;  1IB8 A;  2XMF A;  3W1B A;  3GV3 A;  5LJ5 j;  2E3I A;  4RKU E;  2JUF A;  5GAN 5;  4BXX H;  4FYW B;  5IWA Q;  2MJ8 A;  2YUP A;  2ZPF B;  1RD9 D;  2WB1 B;  1NZ9 A;  4EMK A;  4WRD A;  5GAD C;  3KLR A;  3N6R A;  1EL0 A;  5E1F A;  2AQ1 B;  4ZCK A;  3C0C A;  1BYM A;  3EBE A;  3SK4 A;  2E75 C;  3P1H A;  5IGF A;  1OXV A;  2K4K A;  3CCU A;  1TT2 A;  3H09 A;  3QIA A;  1R8O B;  3EHR A;  1PTO C;  2Y0S E;  2DK3 A;  4X34 A;  2CWP A;  4POG A;  2XGT A;  4H02 A;  2FHT A;  1QVP A;  5GJW B;  3WXM B;  2R5M A;  1ZKO A;  2AKW B;  2QDY B;  4F88 A;  3DWA A;  4QB4 A;  2RH2 A;  4A4K A;  3E1S A;  5JPN C;  3GTO B;  5GJV B;  3P8D A;  1PMR A;  3HOZ H;  1JXO A;  3CC7 Q;  2EYP A;  3JCM P;  1HA5 A;  1O7Z A;  1SNQ A;  1BCO A;  2MO1 A;  1SRL A;  1Y57 A;  2EBP A;  3M53 A;  4VUB A;  4C56 C;  3S3M A;  6AT1 B;  2GTJ A;  5HK0 A;  3EFO A;  2RJF A;  4JRP A;  4LUO A;  2CSI A;  1XNR L;  1U4P A;  4LF8 Q;  3U4V A;  2JJQ A;  3TRE A;  3HPW A;  5I2X A;  3GO5 A;  1N9W A;  2ZPI B;  4KHZ A;  5FRM A;  1MSG A;  1FMV A;  1PZI D;  3RD4 A;  2ES2 A;  1VQ4 T;  3PVQ A;  4DXF A;  3K0Y A;  2HSP A;  3P20 A;  3HP9 A;  1ZBX A;  4IUU A;  1SE2 A;  1TUD A;  2CKZ B;  2VY3 A;  1HR0 W;  2R6G A;  2FB7 A;  2OAW A;  3U58 A;  5CV6 A;  3SK8 A;  4OON A;  3GLX A;  3RZO H;  1SYD A;  2QTV A;  4HA8 A;  2F0L A;  3R2I A;  1KXL A;  4L59 A;  3G71 A;  3EG1 A;  1YIJ Q;  2LZ6 B;  4KRT A;  2HL5 C;  4JI2 L;  2XSC A;  4AYB E;  5D7U A;  2HD0 A;  3W5O A;  3WDN A;  2L5Q A;  4LF4 L;  5I2S A;  1O80 A;  1NPP A;  1UG1 A;  2OF1 A;  3D4D A;  3H15 A;  4NP5 A;  2NZ1 D;  3KF6 B;  4ZNX A;  3C3L A;  2F0G A;  2GQV A;  3HOZ B;  1G2B A;  2DRK A;  3T9N A;  3X26 B;  5GAN 2;  1EZ8 A;  1NE3 A;  3VU3 C;  2PVO B;  1WX6 A;  3CXC P;  1LLR D;  1JB0 E;  1YNN D;  2L12 A;  3G4S Q;  2QF7 A;  4RHS A;  3KOJ A;  4HJ9 A;  2PZ1 A;  2F0Q A;  5BN3 A;  4DBH A;  1EEF D;  1LAB A;  1L1O A;  4OEL B;  1GUN A;  3NBI A;  2VWF A;  5LHY 1;  2NVQ H;  3CU7 A;  3PUX A;  3S15 B;  4A3D G;  3R2T A;  5C44 G;  5KCO A;  1PTO F;  1H9K A;  4N4I A;  4JS5 A;  1X2Q A;  4L5G A;  3RKX A;  1LV9 A;  4LD6 A;  4C5E A;  1OZ2 A;  2VV5 A;  2ZM6 L;  2BKD N;  3OYE A;  2B63 H;  3AMU A;  1G6P A;  2QTX A;  2BE5 D;  3GV6 A;  3I8Z A;  5KYX B;  2N3S A;  3PO3 G;  4F14 A;  4PJM A;  1X3E A;  5FLX c;  1NCV A;  4NXN Q;  2EQI A;  2ICI A;  2FVU A;  1XJW B;  2NUT A;  1ZBJ A;  1QW1 A;  3CQT A;  5IHK A;  3CC4 A;  1E3P A;  5C4Z A;  1N32 Q;  2JZ2 A;  2MAM A;  1OO9 B;  1IL2 A;  5LJ3 g;  1PH5 A;  2ED1 A;  1EIH A;  5EC7 A;  1FMW A;  2M02 A;  3B6Y A;  3BDC A;  1S72 A;  5C3E B;  2ALY B;  3OS5 A;  3K59 A;  4DUY Q;  4M7D E;  2LTO A;  2JEB I;  1ZX6 A;  3J80 c;  1AEX A;  3FVQ A;  3T1Y Q;  3OBY A;  2AUJ D;  4PJO A;  1PZJ D;  1X43 A;  3FDR A;  3MTS A;  2QEX A;  2EKH A;  1Q86 C;  5CK9 A;  2JTF A;  2K4Y A;  5C4X B;  4KT0 E;  3QZ9 B;  4J6W A;  1V8Q A;  1XMQ L;  4RCB A;  3CMA Q;  4FVM A;  4C2M H;  2E2J B;  4P74 A;  4GLA C;  1M9S A;  4EDU A;  4M78 A;  5DLQ E;  3BZD B;  3MA2 B;  4HIM A;  5C4J H;  4G57 A;  4PJO B;  2FPE A;  1RI9 A;  1J5E L;  4JI0 Q;  4UAI A;  4KV6 A;  2ZTC A;  2ED0 A;  3QBY A;  4Q5V A;  5JJZ A;  1TQO A;  4KY7 A;  1VQ9 T;  2YRD A;  4RA8 A;  3CCQ Q;  2HKQ B;  5GMK e;  4D8D A;  4LF5 Q;  5IGG A;  2DRM A;  3PFS A;  3L2V A;  2ZJQ A;  5GMK h;  4A75 A;  3CD6 A;  2E12 A;  2F0I A;  2CT3 A;  2HEQ A;  3EG2 A;  1QWE A;  4Z02 A;  1SMX A;  1G6Z A;  1VQO A;  2F52 A;  4NXM Q;  1W2B S;  3LX0 A;  1OOT A;  4DOV A;  3TEH B;  1MGS A;  4YIJ A;  1HZA A;  4DR4 Q;  2EFI A;  5FW9 A;  1U5K A;  2TMP A;  3ME9 A;  1OXX K;  2AHO B;  2VUM H;  2CUB A;  1VQJ A;  4P73 A;  2OTJ T;  1MHN A;  5CV8 A;  5IOC A;  1RAG B;  4OGQ C;  1H9J A;  2VQE L;  4WJW A;  4M77 E;  2Z6B A;  3O5Z A;  2CVR A;  3WOF A;  5JJI A;  1Y96 A;  4DBF A;  1QNU A;  3S17 H;  5I11 A;  1RLP C;  4BBR G;  4A3C H;  4QW2 A;  3MAQ A;  2WAQ G;  1JB3 A;  4IPH A;  3M9B A;  2RF4 A;  5ELD A;  1VQ7 A;  3J7A V;  2C06 A;  1O7Y A;  3J80 E;  5EBD A;  1A0I A;  1MMA A;  3VUB A;  2JTE A;  3RN5 A;  1VQL A;  3A8K E;  4UY8 C;  1VQN T;  1XNQ Q;  2YLB A;  1GL5 A;  4F7U F;  1Q86 U;  3X3M A;  2IVW A;  1TS3 A;  5FO9 B;  1VMC A;  1TH7 A;  3BY7 A;  3OYF A;  3J7Y W;  3S1N H;  2NLU A;  1CKB A;  1Q82 R;  4C0G A;  1N33 L;  4JBK A;  5GAE C;  2UXD Q;  4QF4 A;  3A7L A;  3CCL A;  4JBJ A;  2V8I A;  2JA8 H;  1TWC H;  1HZC A;  4QVC A;  3TME A;  1I6H B;  1UGQ B;  3HOV B;  1E2Z A;  2KBN A;  4KY6 A;  2P4T A;  3GNF B;  4JC0 A;  1CSK A;  4M78 G;  2JJ9 A;  4OX9 Q;  3K80 C;  3UA6 A;  2EIF A;  3OQ5 A;  2JA8 B;  4XU3 A;  3N5B B;  4BXX G;  2ZCF B;  4H7B A;  1BBX C;  2DZC A;  1ZSZ C;  2PNI A;  2G9H D;  4M78 E;  2K6A A;  3QB3 A;  3HOU B;  4A54 A;  2D62 A;  2IIM A;  4D6W A;  4FCY A;  2FZC B;  2FYK A;  4A4I A;  1YJN Q;  3CCJ T;  2K14 A;  2L0A A;  3FKI H;  4ZRZ A;  3SWN C;  1YJN T;  2OT2 A;  3BDL A;  4JI3 Q;  4OXP A;  1KQ1 A;  2G5D A;  1EUJ A;  2R7Z G;  1NEB A;  2BA0 A;  4PMW A;  2QYZ A;  1N8R C;  3DLM A;  2HBP A;  5M3M H;  5CKF A;  4DNI A;  5HGQ A;  2EQS A;  2VKN A;  2K1B A;  3P8H A;  4HKE A;  3CCS Q;  3DWQ A;  4DF7 A;  2IT1 A;  4XAX B;  4O2D A;  1NMF A;  4AFU C;  4BY1 B;  3NWT A;  5IYB G;  1KHC A;  2PTK A;  1OX8 A;  2I5M X;  1MNE A;  2XDB A;  2EPD A;  3M4P A;  1ROD A;  4KGX B;  3EFX D;  3HFZ B;  4H44 C;  2VGN A;  1FVI A;  5D6W A;  4RGT A;  3UF4 A;  3SE0 A;  2FPD A;  2HD3 A;  1BBU A;  4JI3 L;  1AWX A;  2PVG B;  1SKU B;  4LF7 Q;  3M54 A;  1VQN Q;  4PQX A;  1SRO A;  3TN2 A;  4YY3 Q;  3J80 i;  2WSC E;  3OTO L;  1WXB A;  1UE5 A;  5EKK A;  2OX7 A;  3MXN A;  3SDZ A;  2HIV A;  2K5W A;  1PH4 A;  1CQV A;  2TSS A;  4F8M A;  2DVJ A;  1RAA B;  1R4Q B;  3OHX C;  5GAO l;  1JMC A;  3M85 A;  2WKD A;  1HR0 L;  3NBH B;  4A3K G;  1E7O A;  2R7Z B;  4ZK9 B;  2LFN A;  2DJZ A;  1HUN A;  3KDF A;  1DZ1 A;  3I4L A;  5LL6 X;  2IG0 A;  2BCO A;  4DV6 Q;  3OYK A;  1UGS B;  3IQL A;  4F7U E;  2YUO A;  1D1B A;  1PSE A;  2EOT A;  4ANJ A;  1G83 A;  3M4G A;  4K0K L;  4K5X A;  5CBE E;  4Q0F A;  1FR3 A;  2JA9 A;  2D9U A;  1LT3 D;  1MKH A;  2K5F A;  1Q7Y R;  1EFN A;  1QWY A;  3U9O A;  1NYF A;  3PO2 G;  3JCM J;  4C8Q C;  2BDN A;  2E74 C;  4LAA A;  4Z88 A;  3E5S A;  3QR8 A;  3MP1 A;  2NVY H;  2D6F A;  2FFK B;  4P72 A;  1M5Q 1;  2NN6 G;  1UB4 A;  4AG1 C;  3LGJ A;  4B9X A;  2I5H A;  5CKH A;  3FP9 A;  2A69 D;  4PMC A;  4LFC L;  3D6C A;  4RKB A;  1OYX A;  4A3F G;  2HIX A;  1G3S A;  5HGT A;  4KHP L;  1PFB A;  3HFO A;  2A6E C;  4TQU S;  3PTA A;  2RI3 A;  3HRT A;  1YCY A;  2FEI A;  1HTL D;  1SYF A;  4WFN 3;  4R4T A;  2YYZ A;  3M0T A;  3T1H L;  1PH1 A;  2QEJ C;  4XT3 B;  2E5L L;  3AHU A;  2YRV A;  2D0O A;  1C6V X;  5GAM h;  4C3H G;  1RKN A;  1CKA A;  2K75 A;  3HOV G;  1CQF A;  2ICE C;  1H3H A;  2JA6 G;  4IJH A;  4A3I B;  3RLF A;  2A5H A;  2NTS A;  4C92 C;  4GOP B;  2EQK A;  2WSF E;  4JI5 Q;  1A63 A;  4X1V A;  4KD3 A;  4BBR B;  1YHB A;  4RUG A;  3J81 i;  5FJ8 H;  2P84 A;  4AFS C;  2CP7 A;  4LD9 K;  3JB9 G;  2JA5 H;  2A0F B;  4XDX A;  9ATC B;  1HNW L;  4MTN A;  2OQ0 A;  2YT6 A;  4PZ6 A;  2DIL A;  4L5Q A;  2D9T A;  2MHV A;  1AWO A;  1B53 A;  1RLQ C;  1MHW C;  2EYQ A;  5EKL A;  3Q1J A;  4G7Z C;  2B63 G;  2LKV A;  5IP7 H;  3E9G A;  4A3D B;  2PYK A;  3DKM A;  1C48 A;  4DBR A;  1VQ9 A;  3GTP H;  1WXU A;  3VYR A;  2KQ3 A;  4FF3 A;  2IJ0 A;  2WAC A;  4ELY C;  2E3H A;  4C92 A;  4MDW A;  5M9O A;  3SEB A;  4E7J A;  3S14 H;  1GVP A;  1I5O B;  2RI2 A;  1KAW A;  5A2Q L;  2XK0 A;  3ZFJ A;  1EYG A;  4KKU A;  1PM3 A;  1YZ6 A;  1KTK A;  2PQA B;  1PCX A;  1CM9 A;  1BIA A;  4IJL A;  3M0S A;  4BY7 B;  2KRO A;  3A8L B;  3PUV A;  4NPS A;  3V7S A;  3ER0 A;  3KF8 B;  3JAM c;  4KI0 A;  2RQR A;  3T51 B;  2IX0 A;  4OMF B;  2PW5 A;  2CT4 A;  1ENA A;  3A8I E;  4L5S A;  4K14 A;  3A8M B;  2WSE E;  5C5M A;  4J6H A;  4CJ2 C;  3F2D A;  4HJ5 A;  1YNJ C;  1C4Q A;  2VL6 A;  1STN A;  4KUI A;  2E41 A;  2KRN A;  4JZ3 A;  1W2B P;  4DR1 L;  2BE7 D;  2LMC B;  3UPU A;  4Q5W A;  4QQB X;  5IXB A;  3FPP A;  1CSP A;  1CKM A;  2J7Z A;  4YWM A;  3VS6 A;  3Q23 A;  1I94 Q;  4CRI A;  4ZAI A;  3A8G B;  1ENC A;  4LF8 L;  4HMI A;  1K8G A;  3IFD A;  4KJN A;  2DL5 A;  2N49 A;  2UU9 L;  4Z9C B;  1HQR D;  3RNU A;  1NBE B;  4ELZ C;  1WTP A;  1ASY A;  4DNT B;  4DV2 L;  1ILQ A;  3NBH A;  2YLC A;  1E2W A;  4XXE A;  1ESR A;  4JI1 Q;  5J22 A;  4JI8 Q;  1XTC D;  1ZEQ X;  2AUK A;  2FZG B;  2F3V A;  4IPC A;  2JMA A;  4ZGJ B;  1Y96 B;  4FW2 A;  5M5Y H;  1BBW A;  2NVT H;  3DXJ C;  4WJ3 M;  1IKM A;  1RAI B;  1X6O A;  5KIX A;  1K9M R;  3FRP B;  3NTI A;  3M3Y B;  3D4R A;  2QGG A;  3CBM A;  4CJ1 B;  3S2D H;  2BUD A;  1LO5 D;  4ZLT F;  3O13 A;  1GM5 A;  1KIK A;  1RHP A;  1Z6H A;  4DK3 C;  2UUB Q;  3ZEH A;  2A69 C;  2A37 A;  1XTD A;  4AYB B;  1LTR D;  3ICE A;  2O5J C;  2LC4 A;  4HIO A;  4R8I A;  2SNM A;  3Q0A A;  1OXT A;  2LVM A;  3VR3 A;  2EYX A;  1B9M A;  4K2K A;  4KKT A;  4IOA A;  2O2L D;  1Q95 G;  3NGP A;  3OSV A;  1HA6 A;  2WAQ B;  1YHQ Q;  2WII B;  5EPK A;  3K7A H;  3T4A C;  4KBM B;  1MI2 A;  1SJE D;  1HK9 A;  4E7L A;  1HFG A;  5FRN A;  1X55 A;  3GDE A;  4FXG C;  1ZQ1 A;  4M77 F;  4X3T A;  2SEB D;  4X6A H;  1WI5 A;  1D7Q A;  4OHJ A;  4K6D A;  3CCR Q;  3WOE A;  3BYY B;  5J3B A;  1YIT A;  4ABN A;  2HQL A;  3GTG B;  1KC8 R;  4ZUJ A;  1LVK A;  3A5Z B;  3RDV A;  4I7Z C;  3TEE A;  5ISR A;  5C4J B;  4G7H C;  1PYW D;  1BCM A;  1WYX A;  4XQQ A;  1K8A U;  4J8Q A;  1Q7Y C;  1JXM A;  1T5X D;  3URY A;  5JEA G;  3OS2 A;  2LRQ A;  1X65 A;  1TII D;  4BY1 G;  3NEL A;  2L8D A;  5FWB A;  1W70 A;  4C8Q E;  2DY8 A;  4A4G A;  1OXS C;  2JA6 B;  2QAZ A;  1M8V A;  2DMO A;  2F2W A;  2Z4H A;  1SSF A;  3TSW A;  2C5C A;  4LFA Q;  4OEM B;  3TQY A;  2KY9 A;  1WJJ A;  1WHK A;  5IYC H;  3CP0 A;  1NNX A;  4PFP A;  1Q81 C;  2OXP A;  4E7Z A;  3GTP B;  1JC7 A;  3K0X A;  3KLS A;  1YI2 Q;  4A3E G;  3G6E Q;  3K7A B;  2VUM B;  1RTO A;  1TWA H;  1N36 Q;  4E7S A;  4IFD H;  5CKD A;  4BE0 A;  4C3I G;  3T1H Q;  3OMG A;  3CRL C;  1KJW A;  5GAN 6;  1T5E A;  2MP1 A;  2IHE A;  3RN2 A;  3C46 A;  2QGF B;  1LTS D;  1Y1V B;  4FT2 A;  1GO3 E;  4BE2 A;  1PZK D;  3K57 A;  3G7L A;  2EW3 A;  4GNX B;  2WV6 D;  3TP8 A;  2HQE A;  4PJO E;  2YU9 H;  3CMA T;  1PHJ A;  4X64 L;  2Y0S G;  4QQG A;  3VKI A;  3A8J E;  3E2U A;  2DE0 X;  2K57 A;  1SYG A;  3F2U A;  1MJC A;  1Z7T A;  4IN3 A;  2AQ2 B;  2A6H C;  3EG0 A;  4WCI A;  4DAY A;  3I2Z A;  5HY6 A;  4Y7N B;  3G71 T;  1N6A A;  4GKK L;  3VYU A;  4GKJ Q;  1NLO C;  1AW7 A;  5I2Y A;  2EGC A;  3ASK A;  1E22 A;  1NG2 A;  1SF9 A;  2E1H A;  3EGX B;  1C9O A;  2NUZ A;  3WWV A;  4C92 F;  3QWX X;  1I6V C;  4KKS A;  5KYN A;  5GAN f;  4X66 Q;  1CHQ D;  4QIW E;  5IYB H;  1QZH A;  1WHJ A;  5JOB A;  1IZ6 A;  2OTL Q;  2VB6 A;  2R57 A;  1P16 A;  5LJ5 f;  4C2M B;  1ZLM A;  4JI4 Q;  2ZJP A;  2F0M A;  1PYS B;  1M2O A;  1K83 B;  2XDD A;  2VS1 A;  5E7N A;  4MZP A;  4QCL A;  2I07 B;  3K81 C;  3PF5 A;  1JRI A;  3OB9 A;  3RMS A;  4LJZ C;  3FMC A;  4PMB A;  1WTH A;  3H0G B;  3F1Z A;  2EVB A;  2QGQ A;  2RQX A;  5FU7 C;  4DUY L;  4B3T Q;  5ELO A;  1FL0 A;  4HJ7 A;  2CHB D;  4XTC S;  2EPB A;  2K9G A;  3V7R A;  1T9H A;  2LXJ A;  4AYB G;  4A3I G;  2E4H A;  4OGE A;  1JJ2 S;  1TY2 A;  5M5W B;  2DL7 A;  4A3G B;  4EGV A;  2EYW A;  2X9H A;  1UTI A;  1Y7X A;  5G3L F;  4DV7 L;  3MEA A;  3ERQ A;  2RDF A;  4JI7 Q;  1HQM C;  3STB D;  1HNZ Q;  1EIF A;  4M7D G;  2F0P A;  2HDL A;  3HOY G;  1QCF A;  1EY6 A;  5CV7 A;  5IT9 E;  4RGN A;  1MMN A;  2LX7 A;  1JT8 A;  4X3S A;  2MF2 A;  2X4X A;  4JJN K;  2B2U C;  3TQ7 P;  3MC0 B;  2VC8 A;  1SAP A;  2GN5 A;  4XIG S;  1YBY A;  2HZY A;  4RCC A;  3OYG A;  3SGI A;  1II3 A;  3AYH B;  3AB9 A;  1AZG B;  1KAA A;  2RF0 A;  2K52 A;  1CA6 A;  3UWN A;  1QVC A;  3MXG A;  4GNX A;  3EHQ A;  1U4R A;  2B8A A;  2H5X A;  2R93 G;  2RBM A;  1X2K A;  1Y71 A;  3M9Q A;  5IYC G;  2LJ3 A;  1VQ7 T;  2FJ2 A;  1M1K R;  5JVH 3;  2XI9 A;  2QCP X;  1KIX A;  4XK8 E;  3I56 Q;  2OJ2 A;  3D7S B;  2QDB A;  4KUL A;  2X6L A;  3PGZ A;  4DK1 A;  1GXD C;  2EJG C;  1JBM A;  3QO3 A;  2XU8 A;  1NSN S;  4M8A A;  4P71 A;  1XJV A;  1WFQ A;  4RG8 A;  1CKN A;  2M51 A;  1N5Z A;  1PKS A;  5M5W H;  2Z4I A;  3H94 A;  5GAN j;  2KVM A;  1K9M C;  2MQH A;  3H6M A;  4BY1 H;  2QI2 A;  2HCK A;  1K1Z A;  1VQ8 A;  4C3H H;  4NKL A;  3MWY W;  1PH6 A;  3LNN A;  1S5E D;  1LM0 A;  4BBR H;  3HTR A;  1MSH A;  5COY A;  5EAY A;  3GTQ H;  1M1G A;  2FL7 A;  3HOZ G;  2X4J A;  3S24 A;  3CCE A;  4ORZ A;  1WCM B;  3G48 A;  1M27 C;  1EFI D;  3NUC A;  3GF5 A;  4ZTF A;  1XWE A;  2MI6 A;  5L37 A;  4GLK A;  4M4Z A;  3CD6 T;  4X3K A;  1HSQ A;  3LGF A;  5G3L D;  3TZD A;  3RER A;  3FKI B;  5AJ3 Q;  4A3L G;  5J1Z A;  1DON A;  2ENM A;  2K3Y A;  1M8M A;  1I5L A;  3CCM Q;  5HUR A;  5A0G A;  3FPU B;  4J83 A;  1K3R A;  1YI2 A;  2CDT A;  1CZG A;  1OEB A;  2Q8T A;  5C4X H;  4F17 A;  1S3O A;  4K8I A;  1DD2 A;  4PJN A;  1BXT A;  3KJO A;  1PH3 A;  2O31 A;  2HL3 A;  3IRB A;  2LQW A;  1ZSZ A;  2NUP A;  1YN8 A;  3RLO A;  2R7Z H;  2ZGW A;  2AQ3 B;  4XU0 A;  4EX5 A;  1AFP A;  4DR5 Q;  4FDB A;  1VF7 A;  2GGR A;  2A73 B;  2KR3 A;  5IAY A;  3NHH A;  2KDS A;  3OW2 P;  4N8X 1;  1H92 A;  2F0E A;  3K58 A;  2LJ0 A;  4PLL A;  3Q6S A;  2FMM A;  3TBI B;  1HXY D;  4PLI A;  4LNQ A;  4A3D H;  1Y1W B;  1PH9 A;  4YTL A;  2VAS A;  2VVK A;  3V8J A;  2P5Z X;  1E1O A;  3CCU Q;  1LJO A;  1D5Z C;  1B3A A;  3P75 A;  1VQK Q;  4DV3 Q;  3KBX A;  2F69 A;  3QOL A;  1XPO A;  2DLP A;  2GNC A;  4UHV A;  1WCM G;  2VXW A;  1UUE A;  4HVU A;  3NTK A;  2ZAE A;  1NTG A;  2ATC B;  4RG2 A;  2KHJ A;  1XNR Q;  2DYB A;  1FGB D;  2FZK B;  3H0G G;  3TS0 A;  4ZN1 A;  3MET A;  4DXG A;  2YWW A;  3EAE A;  4V19 0;  2LNH B;  4JRK A;  3A0J A;  3W3A A;  4B3R L;  5JJL A;  4BDY A;  3MFG A;  2E6Z A;  2X3X D;  2I0Q A;  2F0V A;  3OA6 A;  1RUW A;  5E4X A;  1QMC A;  1RAC B;  3EIV A;  4C3J G;  2RDG A;  1EEI D;  2DFU A;  4BI8 B;  2LS0 1;  4X9C A;  2A7Y A;  3NFC A;  4N8F A;  3OY9 A;  3M0P A;  4MHE A;  2E70 A;  1M4V A;  5D6X A;  3TSZ A;  1MGQ A;  2KYB A;  1KL9 A;  1RCV D;  2F0U A;  2LP5 A;  4J8O A;  3GD7 A;  3I90 A;  1UE1 A;  1XQH A;  4Y28 E;  3S16 B;  1ZUU A;  3FLG A;  4N4G A;  4DUZ L;  1O9S A;  3HOU H;  2QDL A;  3RZO B;  5NUC A;  3M58 A;  1D0X A;  2F4V Q;  1GRI A;  1K8A R;  1STA A;  3G71 Q;  3PVL A;  5IHN A;  1YIJ A;  1EY8 A;  2MUY A;  1SPK A;  4EIK A;  3V2T A;  3S9W A;  2RO0 A;  3CKI B;  2BE9 B;  1PRT C;  2K03 A;  1WDX A;  3DEO A;  1Y69 U;  2EJG A;  4PZ7 A;  4HIK A;  3M4O B;  3PQI A;  5M3M B;  4HVV A;  3M0U A;  3TCJ A;  2CYZ B;  5GAN d;  4A63 B;  1UGP B;  1XMQ Q;  5C6A A;  4K11 A;  3CBP A;  1WHM A;  5IGB A;  4GNX C;  3LX7 A;  3I4N H;  2ZXP A;  1RIP A;  2A3L A;  4B08 A;  3PF4 A;  1DOM A;  3BVZ A;  1H9S B;  2HT1 A;  2N88 A;  1EQQ A;  4A76 A;  4M7D B;  4CGY B;  1YNJ D;  3Q22 A;  2DET A;  1JOQ A;  4EQO A;  1U9R A;  2EZV A;  3KXT A;  1D5M C;  1SDF A;  2K28 A;  2VB3 X;  5ELB A;  2ROL A;  3QXE B;  1ZUY A;  1TOV A;  1BF4 A;  1PVO A;  4U67 3;  5KH6 A;  2RMO A;  1LUZ A;  3TSS A;  4ESR A;  1W3S A;  5C4X G;  1I4R A;  3W1G A;  2BH8 A;  5CBA E;  3J81 j;  4HCS A;  4LUE A;  4IFD I;  3Q24 A;  3CHB D;  1L0W A;  1KLU D;  3LW5 E;  2ZPB B;  4C92 B;  3D4W A;  2K7V A;  3DWP A;  3CCV T;  1HPC A;  2FG0 A;  2K7A A;  3CW2 C;  4DR2 L;  2EVR A;  1VCI A;  2P4R A;  2YUQ A;  4LXC A;  4PK4 A;  1YCS B;  2FPF A;  2V8K A;  2M16 A;  2FRW A;  4C8Q D;  5LJ3 e;  3HG9 A;  1OI1 A;  1QVF P;  3FEO A;  2CZ0 B;  1SYE A;  1UWV A;  1MUZ A;  1YHA A;  1KC8 C;  1Q3L A;  1IBK L;  2JVV A;  1KRT A;  1SNO A;  1STE A;  1VF5 C;  1YNZ A;  2M0Y A;  4N4H A;  3J81 E;  2CP3 A;  2RJD A;  4ZTJ A;  1WHG A;  3JCM e;  2DL3 A;  5I6W A;  1QCN A;  3MEW A;  5IGD A;  3E3X A;  3H3V C;  1JWS D;  2Z1C A;  3CMA A;  2LQ8 A;  2O9S A;  4IFD J;  1Y1W G;  1ZSG A;  3GTJ B;  3I3C A;  1YHQ T;  4E6R A;  5FO7 B;  4N0A A;  5KYW A;  2F2X A;  1FYN A;  3ZBD A;  3GP8 A;  2DIQ A;  3SWN A;  1PXU A;  5I9P A;  3ZYY X;  3CCM T;  3THK A;  5L8R E;  1UEC A;  1WTR A;  1WI7 A;  3JB9 H;  3QII A;  4EQP A;  1QOH A;  5E4W C;  5FOB B;  1SRM A;  1FX7 A;  2J6O A;  5IHI A;  1AZE A;  2Q8R E;  5KEE A;  1GKH A;  5GMK m;  1TR5 A;  4PJO G;  3HKZ E;  3HKZ B;  1QKW A;  4JI4 L;  1JB7 A;  1Y1W H;  4BBS B;  1D2B A;  2XKO C;  1PC0 A;  1H8K A;  2JXB A;  2X4Y A;  4LDU A;  3OYN A;  4GBQ A;  1B07 A;  1O7I A;  1NY4 A;  4R1J A;  2E2H B;  1S40 A;  3UT1 A;  2DXU A;  4ZKB B;  4TVR A;  3L2Q A;  1D0Z A;  4L8J A;  2JNG A;  3GTK B;  3G4S A;  4JK1 C;  1B1Z A;  1FNV A;  2MIO A;  2QQS A;  5D6Y A;  5GAN e;  4BA1 I;  4OX9 L;  3ND8 A;  4UPA A;  1EZZ B;  2BZY A;  2UXB L;  2PO4 A;  1G8X A;  4DR1 Q;  3J7A 5;  1SE3 A;  2LT4 A;  4CKC A;  2AWO A;  2QQA A;  2K01 A;  3JCM g;  1UFF A;  4XU2 A;  3MEH A;  1K73 U;  1ZA2 B;  3QZ5 B;  2IY5 B;  1BU1 A;  1RAB B;  3KDF B;  1JE4 A;  1LTG D;  3RLN A;  1WFW A;  1UEB A;  3SEM A;  4A3J G;  4KLK A;  1IYV A;  1VQE A;  3QOJ A;  3JAM i;  2DIG A;  1GUS A;  2Q2I A;  3EN2 A;  3PIP A;  1U1T A;  4OVA A;  2M1H A;  3JV3 A;  2LDM A;  1VQF A;  1ESF A;  2HCC A;  1PTO H;  3E0E A;  4DR5 L;  2UXC L;  2GBQ A;  2LXK A;  3DB4 A;  2HSE B;  4UDU C;  5GAN g;  3CBO A;  4DV5 L;  1VQ5 A;  3FEW X;  4RCO A;  4FF4 A;  2HNI A;  4HED A;  3L0O A;  4N0A C;  1LCK A;  5CGK A;  3KJP A;  2SRC A;  1DM0 B;  1MD2 D;  1A15 A;  2DXT A;  2LX9 A;  4FSS A;  4GLX A;  1SSO A;  1GJX A;  1VYT A;  2HHH Q;  4IZ8 A;  2K3B A;  3OTO Q;  1Y07 A;  4J6X A;  1Z9F A;  4M7A B;  4JPB W;  4P75 A;  4LF7 L;  2DGY A;  2DNU A;  2LNV A;  2DUD A;  4GS3 A;  1YWP A;  5HCK A;  5CV9 A;  2X35 A;  3OYC A;  5ELE A;  2GQI A;  2MPX C;  2DF6 A;  5I21 A;  1W4S A;  2CQO A;  3FKI G;  1IW7 D;  3BW1 A;  4JI8 L;  4A3J B;  3I55 A;  3HZX A;  2JE6 I;  4NOY A;  1HCZ A;  1CK1 A;  1IYU A;  4A3M G;  4C92 G;  2ASB A;  1SNP A;  2GVA A;  3UDX A;  2EGE A;  3EFO B;  4C8Q A;  1K9A A;  3I72 A;  4UP9 A;  1Q90 A;  1VQD A;  1STH A;  1NE8 A;  1K83 H;  1KD1 U;  2A74 C;  1I4K 1;  4ATO A;  1ML0 D;  2NZO A;  4FIB A;  1VQO Q;  1BO0 A;  2OTL T;  3K5N A;  3OBW A;  1Y8N B;  4YCW A;  1STG A;  2JK8 A;  1QJO A;  2R7D A;  2CGH A;  5KE3 A;  3FC3 A;  4NXN L;  1JCK B;  4PJL A;  5C6S A;  5LJ5 h;  3CC4 Q;  1HD3 A;  1AZP A;  4X3U A;  2CS7 A;  1JQQ A;  2R5A A;  3M4Y A;  4AIM A;  4B3R Q;  1VIE A;  4A3C G;  2AT1 B;  3CC2 T;  1LT5 D;  2EDG A;  1WA7 A;  4UC4 A;  1SND A;  4F7U B;  1NBW A;  3VS0 A;  2K50 A;  5BR8 Q;  1JR0 D;  1PYB A;  4ZKC B;  5AT1 B;  4BA2 I;  4QKU A;  1BDO A;  3H3V I;  1N27 A;  1MBY A;  1Q12 A;  2NTT A;  3RKW A;  1CA5 A;  2XID A;  2J6K A;  3OYH A;  1XXG A;  4CDC C;  4JI6 Q;  2L11 A;  1JWU D;  1Y1V H;  1KD1 R;  2V8J A;  2GVB A;  1BBZ A;  3HOW B;  3H9N A;  4HXJ A;  3JCM h;  1E6H A;  3G7Z A;  5KND A;  3IKJ A;  3ZL7 C;  3IFT A;  1G2S A;  4ZGE B;  4IUV A;  1YI2 T;  4FXD A;  4MZ9 A;  2H3J A;  2P0Q A;  1HNX Q;  3SHL A;  3GTM B;  4LDW A;  1D6E C;  1NJI C;  4WOR A;  2IX1 A;  2B29 A;  1BNZ A;  1AVZ C;  1IL8 A;  1A0N B;  2FIN B;  2PI2 E;  4OB0 B;  3GTL B;  4Y91 A;  4BE1 A;  1K0R A;  1Q8I A;  1YFN A;  3ULP A;  4RTZ A;  1TUC A;  4NMZ A;  5IP9 H;  2DJG C;  2MGS A;  3NSW A;  1KK7 A;  1KQS A;  2KCM A;  1KDC A;  3K5L A;  2RHZ A;  4IQZ A;  1K76 A;  2CH4 A;  4LUD A;  1RL2 A;  5HKC A;  1V43 A;  3OYL A;  1A2T A;  4C8Q F;  2O2O A;  1EY0 A;  2F0O A;  3AQQ A;  4NB3 A;  1IBL Q;  1W6J A;  4ILW A;  1JJG A;  4J7F A;  3BZC A;  4UP8 A;  4XQN A;  4M7D A;  3PMF A;  4OMO A;  2BE5 C;  4GY5 A;  4DQ2 A;  3CCR T;  2EYL A;  2RHU A;  2I46 A;  4JLI A;  2E8G A;  2MCN A;  4U68 A;  1I4G A;  5GAM d;  1I07 A;  3HP3 A;  1LTB D;  3M0R A;  3J81 c;  2XG8 D;  2XRS D;  2F4V L;  1CI3 M;  1WPY A;  3J7Z C;  3FHW A;  2YRC A;  2RB6 A;  2RHS B;  1VYV A;  1R0B G;  1BI0 A;  1IO6 A;  3CC2 A;  2A19 A;  5D3I B;  4GKJ L;  3G1J A;  3REA B;  3PUZ A;  4O5V A;  3JB9 J;  3HOY H;  1H9S A;  3A7A B;  5J39 A;  3JCM d;  1TWB A;  2RSN A;  4DNR B;  4S3S A;  4HT9 A;  3E6Z X;  3F70 A;  1SNM A;  3NP8 A;  2O01 E;  3PGG A;  2ZZD A;  1KG1 A;  4JG2 A;  2LCL A;  4EQN A;  2WFW A;  1AE3 A;  2KJX A;  5LMN W;  1N34 L;  1PD0 A;  1JJ2 A;  3UDI A;  2LJ1 A;  2RJE A;  2A1A A;  4JRI A;  1N33 Q;  2YTX A;  3HOU G;  3GTQ B;  1WQ7 A;  4J7I A;  3NK9 A;  4M1U B;  5CV4 A;  2UUC Q;  2E2I B;  2QQR A;  4J9E A;  1ABQ A;  2JS2 A;  3CXC A;  4IOC A;  3I55 T;  3I35 A;  2W0Z A;  5D65 A;  4EMK C;  1Y8P B;  4JUV A;  1K8A C;  4F87 A;  2XN9 C;  5C3W A;  1C7Y A;  1GBQ A;  4DR7 Q;  1EY4 A;  3QHS A;  1FYC A;  1UUP A;  4BS9 A;  3EFS A;  2D1X A;  1F2M A;  3I5S A;  1VQP Q;  4HCK A;  4WTO B;  5DNF A;  3RNJ A;  4HSP A;  2D0N A;  2J06 A;  2RHI A;  1CKN B;  4HAE A;  5K36 G;  2RA2 A;  2ABL A;  4A4H A;  4CC3 A;  5CR2 A;  4HCZ A;  1MND A;  1IBK Q;  1I4H A;  1WD0 A;  2M2L A;  3EG9 A;  3OS1 A;  1B50 A;  4PG3 A;  4KN4 C;  2R92 B;  7AT1 B;  1TWF H;  4FT4 A;  1GUG A;  1O78 A;  5CAI A;  1VQ5 T;  2VXE A;  1G3Y A;  1I50 B;  2K05 A;  2BZ8 A;  3PO2 B;  4YCV A;  2NVT B;  4HJA A;  4L5R C;  3EG3 A;  2KBT A;  3I4N G;  4M75 B;  3D6W A;  4JBW A;  2SOB A;  5GAH C;  5AJ3 L;  1EY5 A;  1X01 A;  4M78 C;  1R0C B;  2EWN A;  3GIB A;  1QVF A;  1KAB A;  1L0X B;  2F0D A;  4GN5 A;  1VQB A;  4IPD A;  4OIK A;  1WZO A;  3UAT A;  1B9N A;  3T53 B;  2R7F A;  4A3F B;  1E1T A;  5ELC A;  5DAU A;  1SEB D;  4QUF A;  3H41 A;  3CQZ H;  5JEA H;  1YNN C;  3I4M B;  1VQN A;  1VQI A;  4J9D A;  1VYU A;  3OSO A;  5I6Y A;  2UU9 Q;  2CP5 A;  2E6N A;  3D0F A;  4AH6 A;  2RD1 A;  3LYI A;  1NJI U;  3VS4 A;  1PWT A;  3S1M B;  2ROT A;  2N8N A;  2KK4 A;  1R9T B;  4DBQ A;  4CC2 A;  1KNE A;  5IYD G;  8AT1 B;  2H1E A;  4A3E H;  4X65 L;  2OTJ Q;  3CCR A;  3HS0 C;  4C3H B;  1IBM Q;  1OPK A;  5LJ3 h;  2EQU A;  2X6G A;  3RUZ A;  3ULJ A;  2LY7 A;  3UA7 A;  4EQ5 A;  4BI3 A;  3PCO B;  2RVL A;  3U50 C;  2EKO A;  1LYL A;  2ZM6 Q;  1NLP C;  3EGD A;  4II1 A;  3EFR A;  4X64 Q;  1QVG S;  5A0L A;  4E7I A;  1F9Q A;  1V1P A;  1RI0 A;  2A6H D;  1OUL A;  1Q1B A;  3CXC S;  4JOI A;  4XQ3 A;  2CP0 A;  2RQW A;  1OU8 A;  3JCM f;  3DM3 A;  1B3Q A;  1AE2 A;  1SMY D;  3VR5 A;  5IY0 A;  1IHZ A;  3QG1 A;  1H9M A;  4M77 C;  3CCL T;  3CCQ T;  1K73 C;  4HSV A;  1VQ9 Q;  4LNP A;  2QA4 T;  3A1P A;  4LFA L;  3L2Z A;  3NQI A;  5FU7 B;  5IN1 A;  1OQK A;  2QQ9 A;  4RMO A;  1C0A A;  2YHT A;  3M57 A;  2D5D A;  3BVG A;  1N9R A;  5I2M A;  2YTY A;  1GCP A;  5A35 A;  5AFW A;  5EKI A;  3OIP A;  3RES A;  5DM7 3;  5I22 A;  1RAH B;  4B6M A;  1GD7 A;  1KD1 C;  3VS5 A;  2PUK B;  1PDQ A;  1EX4 A;  4HN7 A;  2VZA A;  4ULL A;  5D14 A;  1EY9 A;  1N9S A;  3RZD H;  5TSS A;  1LT6 D;  4OF1 A;  5JEA J;  2AZS A;  2KOL A;  1TWH H;  4PFO A;  4DN4 M;  1PTO D;  5EGT A;  5EQ0 A;  1T3L A;  2KHI A;  5GAG C;  3CCV A;  3ULR B;  2HHH L;  1IW7 C;  2AKL A;  2DY7 A;  2EJF A;  3H0H A;  4LK1 C;  3V96 A;  1HJD A;  4LF6 L;  5KNB A;  5IYD H;  2B2W A;  4A3E B;  5LJ3 d;  3OMC A;  1RAF B;  1CZW A;  3VR2 A;  1K3B C;  1C8C A;  1CSQ A;  4IPG A;  3KFU A;  4DOW A;  3PO3 H;  5CV5 A;  3TU4 K;  3HHT B;  4DR3 Q;  1S72 T;  3TRZ A;  2RHX A;  1R77 A;  2RSO A;  2DTO A;  4DK6 C;  1V1Q A;  2F5K A;  4F16 A;  2L9H A;  5DLO A;  3QDF A;  4TVA B;  1AP0 A;  1X75 C;  1D5X C;  3QYH B;  2O4X B;  4FF1 A;  1V9P A;  2B2W C;  1QP3 A;  2RM4 A;  2IPO B;  3JCM Q;  2EJF C;  4L63 B;  2HKN A;  1WHH A;  1GFC A;  2O4X A;  1KQS P;  1HZ9 A;  3D3R A;  1DJ7 B;  4C5I A;  3A8O B;  2Z9H A;  1L2F A;  4R8N A;  2XIC A;  1BCP B;  4OMQ A;  2Q2H A;  3AU7 A;  4ME5 A;  4DV0 L;  5GAN 3;  3VYH B;  3PO3 B;  5KYU A;  4GLV B;  1I3Q H;  4C5H A;  5K36 H;  2MK5 A;  3HOW G;  2PZW A;  2SEM A;  2KVQ G;  3EGX A;  1NR2 A;  2JP1 A;  4X62 Q;  1Z47 A;  2RQV A;  4XYQ A;  1BCP F;  5FLX L;  4GOP C;  2NVX H;  1BB9 A;  1WTX A;  1NUC A;  1YJW Q;  4JZ4 A;  4M75 F;  1Q81 U;  1LAC A;  3I4O A;  1JO8 A;  1G2T A;  4RHR A;  4C3I B;  1SRU A;  3SR1 A;  2KED A;  5M5X H;  4M7A C;  3E9I A;  1Q46 A;  1GFD A;  4FYY B;  3SB2 A;  1JEG A;  3S2H H;  5LMU Q;  2P0K A;  2E5K A;  3X3N A;  1VQL T;  1GUO A;  4DV7 Q;  2JSO A;  2HDM A;  2CP6 A;  4KH1 B;  2JA7 G;  2QK0 A;  2ATW A;  5M3M G;  3FB9 A;  1PH8 A;  3OYJ A;  2XVS A;  3CCS T;  1Q7Y U;  2EY1 A;  1RTN A;  4C0D C;  5GAM e;  5FKA C;  4AT1 B;  3J7A F;  4APV A;  2IL8 A;  2DAQ A;  2L4N A;  5GQO A;  1SBB B;  2RN8 A;  1VQ4 Q;  5FK9 C;  3A55 A;  3C94 A;  1D1A A;  3GTM H;  5LMN L;  2O9V A;  2D0P A;  3NTH A;  3ERO A;  3J80 L;  3LH5 A;  4KUD K;  2EYH A;  2F0N A;  1PRT D;  4PJJ A;  3CCJ Q;  2CWA A;  4YWK A;  2FO0 A;  3JCM W;  1YNX A;  2N78 A;  4QQD A;  1TVX A;  5JJK A;  3CCE T;  4LDX A;  1ZUK A;  4AFZ C;  4PJO C;  1PNJ A;  3CC7 T;  2MOX A;  1FNW A;  1WHL A;  2MYS A;  1VQH A;  2B2V C;  4MNO A;  5JVG 3;  1VIF A;  4PNO A;  3TP6 A;  4A3B H;  4HCB A;  4RG1 A;  1DXM A;  1G29 1;  2KT1 A;  4XTZ A;  4JI7 L;  4RCN A;  3UI2 A;  3ONA B;  4OWW B;  3PE0 A;  1RAE B;  1UHF A;  3EH2 A;  3RMH A;  1V1O A;  2UUA L;  1PHT A;  2EYY A;  3MXU A;  3H8Z A;  1VQM A;  3LWI A;  5C44 B;  3FJ5 A;  1E7Z A;  2K5D A;  4LMQ D;  4IUT A;  2KRS A;  2A68 D;  4KMU C;  3HOX G;  4LF9 Q;  2KEC A;  3KLW A;  3QJ6 A;  5GAO q;  1T0J A;  5E3F A;  3S1N B;  4H0L C;  5LJ3 j;  1SE4 A;  1R4P B;  4A3B B;  2DTI A;  2NYS A;  2RHQ B;  2EQJ A;  3VR6 A;  1LPL A;  2O5I C;  3IAY A;  1P92 A;  2CRE A;  3CME Q;  2X69 A;  1PRM C;  2E2J H;  4KH0 B;  3INZ A;  1L1O C;  3OIQ A;  1XNI A;  3RIR A;  1E2V A;  5BN4 A;  5C0X I;  3HOY B;  4OML A;  1ZYR C;  2QA4 A;  2V26 A;  4YY3 L;  4ALP A;  1LNX A;  1X3P A;  4FP5 D;  4D8K A;  2OI3 A;  2D2C C;  2PQA A;  2QEX T;  2XTI A;  1ZSZ B;  2NUP B;  3E0J A;  4KK7 A;  3M56 A;  4C8Q B;  4IFD G;  3V8K A;  3KK7 A;  4WJ4 A;  2NN6 H;  4M78 D;  3U23 A;  1QUQ B;  3CPW P;  4DV5 Q;  1TG0 A;  5CQY A;  1BI3 A;  1UEA B;  1YEZ A;  4IUN A;  1T0H A;  2KEA A;  4L6V 5;  2F0S A;  4DV3 L;  2R93 B;  4DPG A;  3C4S A;  2K3X A;  3PT9 A;  1B44 D;  4MIU A;  4M77 B;  1CT1 D;  1S5B D;  4DU9 A;  3AFP A;  2C0T A;  1VQK A;  2F0F A;  3QWY A;  3L2W A;  4CBV A;  4DUZ Q;  4HJ8 A;  4ZGD B;  1JJC B;  4E7H A;  2L2P A;  3PIO 3;  4K6L A;  1CFM A;  2X3W D;  2Q2U A;  2NN6 I;  4PZ8 A;  4OMN A;  4IIM A;  5GMK j;  1DOK A;  2EYJ A;  3ERS X;  1D1I A;  2P0P A;  5KYX A;  4R0K A;  4XQJ A;  1WXT A;  4QQ6 A;  2OAU A;  3M7G A;  4M75 E;  1A8V A;  1TWG B;  2V4D A;  3C1F A;  3M3Y H;  5IIF A;  2DER A;  4JJB A;  5KYL A;  2RQU A;  3L2R A;  5KE2 A;  3G6J B;  4LFC Q;  3KBG A;  1A3V A;  2DO3 A;  1VQ6 Q;  4AQY Q;  1QKX A;  2KYM A;  3OYB A;  1YHQ A;  1M4Z A;  1N8R R;  3L9A X;  2QG9 B;  3N52 A;  1XPU A;  1H95 A;  1BKB A;  1M30 A;  2YUN A;  4K5W A;  4JYA Q;  2EYO A;  3LWH A;  4ZQ3 A;  1OV3 A;  4JRQ A;  5L23 A;  2CW0 C;  2YDL A;  2CP2 A;  2CZ1 B;  2LMJ A;  1LTI D;  2PMZ E;  2YV5 A;  3OWE B;  5C0X J;  2AHJ B;  2QQB A;  5IGE A;  5M5X B;  4R55 A;  2HBW A;  2DZ9 A;  2M9V A;  2DJQ A;  3X28 B;  4ODG A;  2OCE A;  3A74 A;  2OQK A;  3EA6 A;  1JOR A;  1G91 A;  2CSQ A;  1WQW A;  2X51 A;  1AWW A;  1D3B B;  3NEM A;  2JW4 A;  4A3J H;  2JA7 H;  5KGU A;  3HRS A;  1M8A A;  1HFN A;  2K5H A;  1S1N A;  1TS4 A;  1X56 A;  4F7X A;  4DA4 A;  4Z8A A;  4O1N A;  4OWT B;  3RR5 A;  1F9S A;  1WLP B;  1I4P A;  1IXD A;  4P5N A;  3CC7 A;  2E5Q A;  1NMG A;  2RKS A;  4XTX A;  4K0K Q;  3AT1 B;  3JAM L;  2EYF A;  1SEM A;  3TVT A;  4V0B A;  2J4X A;  3TP5 A;  1RDP D;  3RZD B;  3V7C A;  1PLF A;  4RTY A;  3EGU A;  1FJG L;  4TSS A;  3PUY A;  4NDX A;  1K8O A;  1QE6 A;  1EOV A;  1VOM A;  2CH4 W;  4XTV A;  1FMK A;  2HUG A;  5FLM H;  3CCJ A;  4LF5 L;  4J9F A;  1F1B B;  1S72 Q;  3G4S T;  4KTA A;  4B3M L;  3AEV A;  2HMA A;  4NL3 A;  5LJ5 d;  1NAP A;  1KFZ A;  2Q2T A;  3OOC A;  1EYC A;  4JLG A;  1KDB A;  3CCS A;  1PFS A;  1UAP A;  1BCP C;  3L7Z C;  3D31 A;  4LFB Q;  1VQG A;  3CAM A;  5GAN 8;  3R8B A;  4LE9 A;  1KLG D;  3S1R H;  3C2P A;  1ET6 A;  5BR8 L;  1V1C A;  4O6J A;  3F2B A;  1TWH B;  5GAN h;  2B2T C;  1S4Z A;  1PKT A;  2GFA A;  1LTT D;  2CZ7 B;  1NM7 A;  2KEN A;  2MPM A;  5H1S E;  1WGS A;  5CCA A;  3EVQ A;  4DR2 Q;  4DR6 L;  1YIJ T;  3VS2 A;  3KUP A;  2AZV A;  4LUV A;  3VDY A;  3PMT A;  2QAS A;  1JU5 C;  4OO1 H;  2EY6 A;  1NJI R;  2J6F A;  2D8H A;  1BQQ T;  2B2Y A;  4Z89 A;  3FRN A;  1KQS S;  2H4O A;  1M2V A;  2KA7 A;  2SNS A;  2B2V A;  1PV4 A;  1X32 A;  2FXQ A;  3HRZ C;  2JA5 B;  1NEG A;  2KCC A;  1VUB A;  2NVX B;  2DD5 A;  1ENF A;  5IGC A;  3OW2 S;  2EYZ A;  3ZJY C;  2J0T D;  3OPO A;  4QL5 A;  1U3O A;  4X62 L;  1HNX L;  3MHB A;  1EY7 A;  2YXY A;  3HOX B;  4HR7 B;  1OX9 A;  5IH2 A;  1UHC A;  4F04 B;  2NYZ D;  2ZXR A;  3OYA A;  4LUZ A;  2IX3 A;  4IUP A;  1M3B A;  3CCL Q;  1BR9 A;  2O88 A;  1A6X A;  2MO0 A;  3L2P A;  1F2L A;  3REB B;  5CC4 A;  1WIE A;  4G4K A;  2V1Q A;  4RTT A;  3GP7 A;  1NYG A;  3I56 A;  2DXB A;  3SXH A;  1WJS A;  2OTJ A;  1LT4 D;  3SK6 A;  2CCZ A;  1B70 B;  1SE8 A;  2K6D A;  5FU6 C;  1TXY A;  1CTM A;  1UNS A;  1Y8O B;  5M3F G;  2DEQ A;  1X3F A;  2F4I A;  1K0S A;  1D1C A;  2Y0S B;  1I50 H;  1W2B A;  2PQW A;  2JN0 A;  4M7A A;  1GCQ A;  4M7A G;  2B8G A;  3UDC A;  2CQA A;  2ZTD A;  4ME7 A;  4JJD A;  1VQ8 T;  4DA2 A;  2RK2 A;  5EJW A;  5C3E H;  2XWJ B;  5K5P A;  2H8H A;  5LMN Q;  3JCM c;  2KXD A;  3S3O A;  3G6E A;  2B3G A;  2F1M A;  2QEX Q;  2JYO A;  1A62 A;  2SDF A;  3MO8 A;  4XYO A;  1S5C D;  1BCP D;  3M7N A;  1VA7 A;  2PCF B;  1WJR A;  3JCM b;  4FSX A;  4M77 G;  4ZN3 A;  4RTX A;  2F3W A;  2EYM A;  4E47 A;  1ARK A;  3SWN B;  5HK3 A;  4MMK A;  1AN8 A;  2L0C A;  1UDL A;  3QO2 A;  3J81 L;  1QWF A;  2RK1 A;  2K32 A;  4E6I A;  5M3F H;  4EMK B;  3JCM V;  3CME T;  3TZU A;  2KCT A;  2MWP A;  3VA5 A;  4NXM L;  1SLJ A;  2DNE A;  4OB2 B;  4RAU C;  2FHD A;  3IL8 A;  5CMD A;  3PIP 3;  2PU9 B;  3RR6 A;  2UXC Q;  1X6B A;  5GAO r;  1K8M A;  1TKW B;  3S6W A;  1SHF A;  4Y7N H;  1TWF B;  3CEY A;  4EPC A;  4BWG B;  3CCQ A;  4ZYS A;  2A08 A;  1F77 A;  5CYU A;  2ZPH B;  1SXT A;  3HSB A;  2DPP B;  1A2U A;  3AFQ A;  1AWJ A;  3HGB A;  2ENB A;  4DK0 A;  2RNA A;  4PJO F;  4G7O C;  3EGD B;  2A8V A;  5GAM j;  4BD3 A;  4F7U G;  4RH6 A;  1KSW A;  2M00 A;  5EBC A;  1B34 B;  4ZUI A;  5JAV A;  1HXD A;  2ZPG B;  3PIO A;  1U0L A;  2JA8 G;  1MV0 B;  1TUG B;  3VS3 A;  4KJO A;  3T16 A;  2Y4Y A;  3HKZ G;  4BBS G;  3CCE Q;  2EY5 A;  5FLX E;  4CJ0 B;  2COY A;  1V1P B;  3MJX A;  3PNW C;  1A3T A;  3U4Z A;  2VGM A;  2KHS A;  3NQT A;  3ND9 A;  4MN3 A;  3OYY A;  2KXC A;  4M78 F;  4JV5 L;  1ABO A;  1M90 R;  1ET9 A;  1DJR D;  5C44 H;  1EZ6 A;  4A4E A;  3H0G H;  4X65 Q;  1AZQ A;  2HDA A;  1TS2 A;  2GFU A;  1SR3 A;  3UDF A;  2JN4 A;  3BE3 A;  2KGT A;  4DEY A;  2CUD A;  2KT8 A;  1D3B A;  2Y4X A;  3JAM E;  2VQF Q;  3C1E A;  3I5R A;  2DBK A;  1VQL Q;  4CDD C;  1N32 L;  4C1N I;  1G5V A;  5C0X H;  1STB A;  2Z0S A;  1FXX A;  4M7A E;  4JVZ A;  4LDY A;  4JDS A;  3DEP A;  3UE1 A;  3MPU B;  4FYV B;  3K5M A;  2R58 A;  1O7L A;  4NW2 A;  1QB5 D;  3S2D B;  3T1Y L;  1WNL A;  2RCF A;  1FWZ A;  1YJW T;  4OWX B;  4YHH Q;  1TXQ A;  3VS7 A;  3H0I A;  3VS1 A;  5LJ5 g;  1QVG A;  5CKE A;  1HTP A;  1I6H H;  1TWG H;  3F2C A;  2K5N A;  4AFQ C;  3DM1 A;  1NR4 A;  1CUK A;  1PD1 A;  1X3G A;  3DHQ A;  1IRX A;  2AWN A;  2WKC A;  3ULL A;  3R6O A;  3S16 H;  1G8Z D;  4JI6 L;  4FU6 A;  1B8A A;  4X66 L;  3SFM A;  4OP0 A;  1OXU A;  1SNC A;  5CQX A;  3X24 B;  2XHC A;  1MMG A;  4M75 C;  1YJN A;  1VQ4 A;  3BZK A;  1B7Y B;  2PPB C;  2B63 B;  1HJP A;  4C92 E;  3C12 A;  1X9N A;  1ILP A;  4B3M Q;  2ECZ A;  1GXI E;  2B2T A;  3K8A A;  3OYM A;  1HUM A;  2EAY A;  1ASZ A;  4YHH L;  1X3Q A;  5AYF A;  4BY6 C;  3OW2 A;  5C0M A;  5JPM C;  1KQ2 A;  2LSS A;  1I1J A;  3LLR A;  1EOT A;  4CDF C;  1JQY D;  2OWO A;  1GHK A;  3MKD A;  3CRK C;  4ME3 A;  5KNC A;  1P8L A;  1AHJ B;  2DVE A;  4RTU A;  1HR0 Q;  1JWM D;  2HAX A;  3R6N A;  4QVD A;  1ICW A;  4DV4 Q;  3HRU A;  4B3S Q;  2VB2 X;  1OU9 A;  2DM1 A;  2LQK A;  4MZT A;  2JQO A;  1AD5 A;  1MV3 A;  5FO8 B;  4J5Y A;  1VQM Q;  1KC8 U;  2I0N A;  5IP9 G;  1BUV T;  4Y92 A;  4HCC A;  2M0O A;  2RQT A;  2PZU A;  3T13 A;  4A3K B;  5GAN 4;  4M75 D;  3P8B B;  3KF6 A;  1HZB A;  4KGV B;  1YIT T;  2PZT A;  1G3W A;  1X27 A;  3QSU A;  1Y1V G;  2KUM A;  4I65 A;  4DKA C;  2UUC L;  3CPW A;  3GQB A;  3M4O H;  2ZXO A;  1YWO A;  1EQR A;  1Z9Q A;  2JA7 B;  3A8H B;  3W2D A;  4GOP A;  1VS0 A;  1I3Q B;  3C95 A;  1U4M A;  2EXD A;  3DUZ A;  3QKJ A;  1TSF A;  1IKL A;  2MNA A;  1B2T A;  4IKF A;  4L5T A;  2YSQ A;  3K7U C;  1WTV A;  3CC2 Q;  1DCZ A;  4XU1 A;  1EU3 A;  3E19 A;  2QA4 Q;  1ZXT A;  5I9O A;  2KMT A;  4O42 A;  4UP7 A;  2QKI C;  3F8T A;  3BU2 A;  4DV1 Q;  1G51 A;  4R4Q A;  2F0W A;  2DTH A;  2NZH A;  5FLM G;  4DR4 L;  1U4L A;  1EWH A;  2CFM A;  2D0Q B;  4IUQ A;  2A36 A;  4MML A;  5KCH A;  5DM7 R;  3OYD A;  1YJ9 T;  1VQO T;  3L1A A;  3SVM A;  1I4X A;  1M1F A;  1GUW A;  1EWC A;  4EMH A;  1BVS A;  4QMG A;  5FRO A;  3BFM A;  3KFV A;  5GRO A;  3HOX H;  4A4F A;  5CR3 A;  3GTO H;  3BDO A;  4OGC A;  1MJE A;  1BK2 A;  1QVG P;  2JS0 A;  4C0Z A;  1C1A A;  2YTV A;  1K4U S;  1F2Y A;  1ZYR D;  3NWS A;  2R92 H;  3I9Q A;  1EWI A;  4JI5 L;  4IO9 A;  1AH9 A;  2GCX A;  1F2Z A;  2KI7 A;  3HFN A;  2AIR B;  4FL6 A;  4DR7 L;  4K8J A;  4A93 B;  3KYH C;  4NS5 A;  1SG5 A;  4OL7 A;  2KAF A;  2Q8I B;  1QZG A;  3FJP A;  5IT9 L;  3KF8 A;  4RKL A;  3E9F A;  4FF2 A;  1UGR B;  1MMD A;  2F5T X;  3JB9 F;  3BG3 A;  5C4H A;  2DX1 A;  2QXF A;  4A53 A;  1KDA A;  4JBM A;  4BAC A;  1XNQ L;  2DL8 A;  3L2U A;  2E10 A;  3LGL A;  1EYA A;  3KLS X;  1VQ6 A;  1PFM A;  3GBQ A;  5C5L A;  2VNU D;  4XTW A;  5ELF A;  3SK5 A;  1OPL A;  1I5F A;  2BIV A;  1GCQ C;  2Z6K A;  3S15 H;  2NVQ B;  2JM9 A;  3S3N A;  2DN8 A;  2JTM A;  1NPR A;  4BB7 A;  1S5F D;  3D8G A;  2L3Q A;  1VQ5 Q;  1FD7 D;  1PTO B;  1Y14 B;  4A3I H;  4OMM A;  4RWS C;  5EPL A;  4PJO D;  3M59 A;  1PRT F;  4R9W A;  2K04 A;  3R93 A;  3MEV A;  2MFI A;  1SFO B;  4KGZ B;  5CIU A;  2I2L A;  2K2M A;  3M55 A;  1XX8 A;  2R3Z A;  4JOI C;  2ZTE A;  2DXC A;  1YVC A;  2B39 A;  1OZ3 A;  1VDZ A;  1M90 U;  1EQT A;  1VQP T;  2F0T A;  4FO2 A;  4RFB A;  2D8J A;  1ONL A;  1M90 C;  4C3J B;  4C92 D;  1LOJ A;  3A54 A;  1GBR A;  1A3U A;  1IHV A;  1X54 A;  4J9G A;  1IGU A;  1SSH A;  3WVD B;  1TS5 A;  1V29 B;  2YU9 B;  3RKY A;  3HL8 A;  3I55 Q;  3NE5 B;  4POF A;  2ZPE B;  2E2D C;  1IBM L;  4DV6 L;  4KY5 A;  4JCV E;  1XYI A;  1I81 A;  2VQF L;  3DLL A;  3OS0 A;  1B4O A;  3VR4 A;  4J1M A;  4TRD A;  1M3C A;  3MXN B;  1WOC A;  2WP8 J;  3MEU A;  4M75 A;  3PSI A;  1I94 L;  2A6E D;  4B9W A;  1KRS A;  4FW1 A;  4FYX B;  1IYJ B;  3A98 A;  4LF4 Q;  1UE9 A;  2K5V A;  2K5Q A;  4CDE C;  4E7K A;  3S1Q H;  2L5T A;  4YCU A;  3QWN A;  4GZY C;  5GMK i;  1BOS A;  1H9R A;  2C35 B;  2R92 G;  4JI1 L;  4DAY B;  1HRJ A;  1B34 A;  4YWL A;  2DKG A;  2PNR C;  1LTL A;  4IIO A;  2AMC B;  4A3B G;  1PH2 A;  1YIT Q;  3P7J A;  1TTH B;  2R61 A;  1H3Z A;  3OSS C;  4PKC C;  1TY0 A;  1TS9 A;  3MEF A;  2KQW A;  4HT8 A;  2BH2 A;  3RBB B;  2FMC A;  2JXM B;  3H6Z A;  3QYG B;  1PG5 B;  2L89 A;  4FXK C;  1SN8 A;  4A3L H;  4FM4 B;  4JI0 L;  5GAN 7;  3BYT B;  1Q81 R;  2JM8 A;  3A56 A;  5LL6 S;  3H0F A;  4C8Q G;  3FIF A;  2C9O A;  1SYC A;  1W6K A;  2Z6K C;  1UE7 A;  2GF7 A;  2B86 A;  4LF6 Q;  3STB C;  4DAM A;  1D09 B;  1CHP D;  1O75 A;  4J9B A;  1SYB A;  4GN4 B;  4MTK A;  3UDG A;  4LFB L;  1I4Q A;  4OIJ A;  4LN2 A;  1ZHI A;  2K5L A;  1AEY A;  3JB9 D;  2QW7 A;  3JC6 6;  2NVY B;  3GTK H;  2BZX A;  2RHY A;  2DBM A;  4CKB A;  3NEN A;  1JJ2 P;  4KD4 A;  1QP2 A;  1BI2 A;  1M1K U;  5LMU L;  4OO1 G;  3KUF A;  3K5O A;  2BOS A;  2KCN A;  5GMK l;  4BDZ A;  5C3X A;  1TU0 B;  4HCE A;  3VYS A;  2XIW A;  1VQP A;  2JMC A;  3HKS A;  3GPL A;  1QVF S;  1JE5 A;  2WIN B;  1N34 Q;  1IBL L;  4J9I A;  1SJH D;  2DA9 A;  4C5G A;  2G9D A;  4TKO B;  1FJG Q;  5EPJ A;  3MP6 A;  1EU4 A;  3WVE B;  5GAO p;  1QCO A;  3M0Q A;  1YP5 A;  3SD4 A;  2GA4 B;  4IAL A;  1IXR A;  1LTA D;  5T1I A;  2CKK A;  3PO2 H;  1U5S A;  3NMZ C;  1HHV A;  1N8R U;  2JEA I;  1ACM B;  1M2V B;  4DV0 Q;  4M77 D;  3S17 B;  1VQA A;  1T3S A;  3CPF A;  1H64 1;  1FGU A;  3BJU A;  4JW0 A;  1PH7 A;  1WJQ A;  2LQN A;  1S5D D;  5M5Y B;  3NXW A;  1Q82 C;  1YJW A;  3LWE A;  4OB3 B;  3LH0 A;  2F0J A;  1HNW Q;  2E65 A;  4DV1 L;  4A93 G;  5J26 A;  1KHI A;  4M7D C;  1GHJ A;  2MWO A;  1UGV A;  3CC4 T;  2OTL A;  4PV1 C;  3HOW H;  2XNA C;  3QJY A;  4PNY A;  5KRU A;  4QGU A;  2QIL A;  1N36 L;  2EE1 A;  3I73 A;  5KYY A;  3JRZ A;  3VV0 A;  1PSF A;  1XOV A;  3I4N B;  4CKE A;  4C3I H;  5GAO n;  2EQM A;  2UUA Q;  2HQH A;  2CW0 D;  2RCN A;  2PI2 A;  5KYU B;  2XRQ D;  2E5L Q;  2VQE Q;  3HEJ A;  1HYO A;  4BY7 G;  1WD1 A;  3PMI A;  3GTL H;  2Z0W A;  2IHF A;  2Z8L A;  4J9H A;  1WTO A;  2WB1 E;  2XWB B;  2L1B A;  3R3O A;  4LF9 L;  3I4M G;  2F1L A;  3EG9 B;  2J05 A;  2LCS A;  3PV0 A;  5BN5 A;  4IUR A;  3VUZ A;  3Q8D A;  1J6Q A;  1J9O A;  2H3E B;  2UXB Q;  4GKK Q;  4V2S A;  2PUO B;  4A3M H;  2KSS A;  3A5U A;  2HQX A;  2L55 A;  4M77 A;  1D1K A;  1EIY B;  5KYW B;  1WYD A;  4BY7 H;  4HID A;  4EMG A;  2NUC A;  3L42 A;  1JOK A;  4DV4 L;  4OO1 I;  1M3A A;  2DL4 A;  5DY9 A;  1V76 A;  5FWC A;  5IWA L;  4J15 A;  4DAV A;  3O8V A;  2UXD L;  4HMJ A;  4DGZ A;  2L3S A;  2NB0 A;  3CCU T;  3M5A A;  2IWH A;  2G6F X;  4A3G G;  1WCM H;  4K5V A;  1VMP A;  5A2Q E; 
#chains in the Genus database with same CATH homology
 1AWW A;  2MIO A;  4AG1 C;  3VRZ A;  2JW4 A;  2V1R A;  1S1N A;  2BZY A;  1SHG A;  4Z8A A;  1WLP B;  2FEI A;  1UFF A;  1BU1 A;  5ECA A;  1SEM A;  2F2V A;  3M0T A;  3TVT A;  2JT4 A;  1WFW A;  3SEM A;  4RTY A;  3EGU A;  1CKA A;  1H3H A;  1QLY A;  2CH4 W;  1FMK A;  3JV3 A;  4J9F A;  2L3P A;  2K79 A;  2GBQ A;  1KFZ A;  4X1V A;  1U06 A;  2RPN A;  4RUG A;  2FRY A;  4AFS C;  4LE9 A;  2KE9 A;  1LCK A;  1V1C A;  2SRC A;  2YT6 A;  2DIL A;  1PKT A;  1NM7 A;  4FSS A;  1AWO A;  3NPF A;  1RLQ C;  1VYT A;  3VS2 A;  2AZV A;  2C0I A;  2K3B A;  1JU5 C;  4JPB W;  2J6F A;  2D8H A;  2DNU A;  4Z89 A;  1YWP A;  5HCK A;  1Z9Z A;  2BTT A;  2GQI A;  1NEG A;  2DF6 A;  2EYZ A;  1WXU A;  2A28 A;  1U3O A;  1UJY A;  1E6G A;  1UJ0 A;  2EGE A;  5IH2 A;  1UHC A;  1K9A A;  4OMP A;  1M3B A;  1W6X A;  2O88 A;  3REB B;  1WIE A;  1AOJ A;  2V1Q A;  2KNB B;  4RTT A;  1NYG A;  1X6G A;  3M0S A;  2KRO A;  1HD3 A;  2K6D A;  2RQR A;  2CT4 A;  1JQQ A;  1K0S A;  4HVW A;  1GCQ A;  2KRN A;  1WA7 A;  4JJD A;  4JZ3 A;  3VS0 A;  2H8H A;  2KXD A;  2GTO A;  5IXB A;  3SHW A;  3VS6 A;  1VA7 A;  4AG2 C;  2J6K A;  4GLM A;  4RTX A;  1ARK A;  2EGA A;  1UDL A;  1QWF A;  2DL5 A;  1BBZ A;  1PRL C;  4HXJ A;  1E6H A;  2J7I A;  3ZL7 C;  4QT7 A;  2AKK A;  2JMA A;  1J3T A;  1X6B A;  2AK5 A;  1AVZ C;  1A0N B;  1K0X A;  1SHF A;  2NWM A;  2A08 A;  1AWJ A;  1TUC A;  4RTZ A;  1X69 A;  2RNA A;  3NHN A;  1KIK A;  4CC4 B;  2A37 A;  1K76 A;  1KSW A;  2CH4 A;  4LUD A;  4RTV A;  2O2O A;  1MV0 B;  2KRM A;  3VS3 A;  2EYX A;  1I0C A;  3NGP A;  4OMO A;  2KXC A;  4J9C A;  2MCN A;  1Y0M A;  1ABO A;  1I07 A;  3M0R A;  2ESW A;  4DEX A;  2HDA A;  1VYV A;  1IO6 A;  1W1F A;  2KGT A;  2W10 A;  4RTW A;  4DEY A;  3REA B;  4JJC A;  2CUD A;  2KT8 A;  3I5R A;  1WYX A;  1JXM A;  2DBK A;  5FWB A;  1W70 A;  5IXF A;  2LJ1 A;  2DMO A;  2F2W A;  3TSW A;  2C0O A;  3VS7 A;  3H0I A;  3VS1 A;  4J9E A;  1ABQ A;  2JS2 A;  4AFQ C;  4CC7 A;  3VRY A;  3I35 A;  2W0Z A;  2XMF A;  1GBQ A;  1KJW A;  2D1X A;  3I5S A;  2YUP A;  4HCK A;  2EW3 A;  3RNJ A;  2D0N A;  2J06 A;  2ECZ A;  2ABL A;  3C0C A;  4CC3 A;  2DE0 X;  3EG0 A;  3EHR A;  4WCI A;  1I1J A;  5GJW B;  1NLO C;  2BZ8 A;  2EGC A;  1NG2 A;  3EG3 A;  4RTU A;  2KBT A;  5GJV B;  3R6N A;  2NUZ A;  1JXO A;  3QWX X;  2DM1 A;  1AD5 A;  1MV3 A;  1SRL A;  1Y57 A;  2EBP A;  2GTJ A;  3UAT A;  1ZLM A;  2CSI A;  2I0N A;  3H41 A;  4Y92 A;  2RQT A;  4J9D A;  1VYU A;  1X27 A;  3PVQ A;  2HSP A;  3VS4 A;  1PWT A;  1TUD A;  1YWO A;  2ROT A;  1Z9Q A;  2OAW A;  4CC2 A;  2YSQ A;  1OPK A;  2K9G A;  3UA7 A;  2DL7 A;  3EG1 A;  2LZ6 B;  2EYW A;  4KRT A;  1NLP C;  1UTI A;  1UG1 A;  2A36 A;  2RQW A;  1B3Q A;  4ZNX A;  1G2B A;  1QCF A;  2DRK A;  2LX7 A;  3KFV A;  1WX6 A;  4LNP A;  1BK2 A;  2JS0 A;  2PZ1 A;  1K4U S;  3I9Q A;  1GCP A;  2VWF A;  1AZG B;  2RF0 A;  5I22 A;  3EHQ A;  1X2Q A;  3VS5 A;  1X2K A;  2LJ3 A;  2DX1 A;  2OJ2 A;  2AZS A;  4F14 A;  2DL8 A;  2EQI A;  5IHK A;  1T3L A;  1ZBJ A;  3CQT A;  3ULR B;  2M51 A;  1N5Z A;  1PKS A;  2AKL A;  3GBQ A;  1OPL A;  2ED1 A;  3H0H A;  1GCQ C;  1K1Z A;  2HCK A;  5EC7 A;  1HJD A;  2JM9 A;  1ZX6 A;  2L3Q A;  1X43 A;  4OMM A;  4ORZ A;  2EKH A;  1M27 C;  4M4Z A;  1HSQ A;  2K2M A;  4F16 A;  2ENM A;  1M8M A;  2CDT A;  1OEB A;  2D8J A;  2FPE A;  1RI9 A;  4F17 A;  1GFC A;  2ED0 A;  1GBR A;  2O31 A;  4OMQ A;  2LQW A;  1YN8 A;  4J9G A;  1SSH A;  2SEM A;  2GGR A;  4D8D A;  2KR3 A;  2RQV A;  2DRM A;  1BB9 A;  1H92 A;  2LJ0 A;  4JZ4 A;  1JO8 A;  2CT3 A;  2HEQ A;  2VVK A;  3EG2 A;  1QWE A;  1M3C A;  1GFD A;  1JEG A;  2DLP A;  2GNC A;  2E5K A;  1OOT A;  1UUE A;  4HVU A;  3A98 A;  1UE9 A;  5FW9 A;  2DYB A;  2CUB A;  2LNH B;  3O5Z A;  2X3X D;  4IIO A;  2RN8 A;  1RUW A;  5I11 A;  1RLP C;  2O9V A;  3LH5 A;  3M0P A;  3RBB B;  2FO0 A;  2JTE A;  3TSZ A;  2KYB A;  2LP5 A;  1ZUK A;  4AFZ C;  1GL5 A;  1PNJ A;  2MOX A;  2JM8 A;  3H0F A;  1ZUU A;  2QDL A;  1CKB A;  2KT1 A;  1GRI A;  2B86 A;  3PE0 A;  1UHF A;  3PVL A;  5IHN A;  1PHT A;  1SPK A;  4J9B A;  4EIK A;  2EYY A;  1WDX A;  1CSK A;  3FJ5 A;  4LN2 A;  1AEY A;  3UA6 A;  4HVV A;  3M0U A;  2BZX A;  2KRS A;  2DBM A;  4A63 B;  1T0J A;  2PNI A;  4K11 A;  2IIM A;  2CRE A;  1PRM C;  2JMC A;  2L0A A;  4J9I A;  2DA9 A;  4OML A;  1NEB A;  3M0Q A;  1YP5 A;  1U5S A;  3NMZ C;  4D8K A;  2OI3 A;  2ROL A;  1ZUY A;  2VKN A;  1T3S A;  2RMO A;  4ESR A;  3U23 A;  2LQN A;  4AFU C;  1TG0 A;  4LUE A;  2PTK A;  1T0H A;  2KEA A;  2EPD A;  1UGV A;  2FG0 A;  2K7A A;  2EVR A;  2C0T A;  2P4R A;  2YUQ A;  3QWY A;  3UF4 A;  1YCS B;  2FPF A;  2FPD A;  2FRW A;  1AWX A;  2L2P A;  1XOV A;  1MUZ A;  2X3W D;  4OMN A;  4IIM A;  1YNZ A;  2M0Y A;  1WXB A;  2DL3 A;  4R0K A;  1WXT A;  4J9H A;  2DVJ A;  4JJB A;  2RQU A;  2LCS A;  2J05 A;  2O9S A;  1E7O A;  1ZSG A;  4E6R A;  2F2X A;  1FYN A;  1QKX A;  2KYM A;  1UEC A;  3THK A;  3IQL A;  1WI7 A;  1M30 A;  2YUN A;  2YUO A;  1G83 A;  2J6O A;  1OV3 A;  1SRM A;  5IHI A;  5L23 A;  1M3A A;  2DL4 A;  2YDL A;  1AZE A;  2LMJ A;  5FWC A;  2HBW A;  1EFN A;  1QKW A;  2DJQ A;  2L3S A;  1NYF A;  1H8K A;  2G6F X;  2JXB A;  4GBQ A;  1B07 A;  4Z88 A;  2CSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...