2CH4W

Complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
139
structure length
139
Chain Sequence
KEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reconstruction of the Chemotaxis Receptor-Kinase Assembly
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/chemotaxis
molecule keywords CHEMOTAXIS PROTEIN CHEA
total genus 19
structure length 139
sequence length 139
chains with identical sequence Y
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ch4W01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2ch4W02
2O9SA 2DL3A 3UF4A 1UFFA 3I5RA 4DEXA 3PE0A 2LP5A 2LNHB 4Z89A 2C0OA 4F16A 5GJVB 2EKHA 2K2MA 1UTIA 4LE9A 1T3SA 2LQWA 2D1XA 5IXFA 4A63B 4RTZA 5L23A 2HBWA 5IHNA 2DJQA 1AZGB 1ZX6A 1ZSGA 2W10A 1HSQA 4Y92A 1NYGA 1NEBA 1YN8A 4LUDA 1M3CA 4Z88A 3VRYA 1X27A 1UDLA 2KXDA 2JTEA 1TUDA 1HD3A 4IIMA 1M8MA 1AZEA 1B3QA 1AWOA 4M4ZA 3THKA 2YDLA 1H8KA 1TUCA 1RI9A 1BB9A 2JMCA 2P4RA 4GLMA 1E6HA 1M3AA 2V1QA 4HVUA 2SEMA 2KNBB 5I22A 1NYFA 3M0UA 4JZ3A 1PRLC 2EPDA 3VRZA 1T0HA 2ESWA 1WDXA 2GBQA 1ZUYA 1QWEA 1SSHA 2E5KA 1UHFA 3PVLA 1UG1A 4IIOA 3KFVA 1VA7A 2MCNA 2FO0A 4WCIA 2L3SA 2CSIA 1OPLA 2K9GA 1BK2A 1CKAA 4RTUA 1ZUUA 2NUZA 2XMFA 2LZ6B 1KFZA 2DX1A 1M30A 1WX6A 2AK5A 2FPEA 2O31A 1X2QA 1K9AA 1Y57A 4CC4B 1QKWA 2GQIA 1UHCA 1M3BA 4AG2C 3SEMA 3RBBB 1PWTA 2DBKA 1B07A 2RQUA 1UUEA 2OAWA 4QT7A 2RN8A 1T0JA 1JO8A 3VS2A 3UA6A 2X3WD 1RUWA 3M0TA 1JXOA 2CH4W 1H92A 1FYNA 1YP5A 2DLPA 2QDLA 2VKNA 2F2XA 3VS4A 1BBZA 4RTWA 2L3QA 2ROTA 2EYWA 1I07A 2DF6A 4AFZC 1QWFA 2KRMA 2K79A 2J6FA 3SHWA 2FRYA 1ABOA 1ZBJA 1PHTA 2GTJA 2DRMA 2YSQA 1UJYA 2A08A 2ENMA 3IQLA 1ARKA 1ABQA 4CC2A 1AVZC 1GFDA 2V1RA 2CT4A 3VS3A 1AOJA 2RQRA 1UJ0A 1WYXA 2LJ0A 1K0XA 4D8DA 4D8KA 1VYVA 3TVTA 1ZUKA 2VWFA 1OPKA 2BZ8A 5IH2A 3M0SA 3VS7A 1X6BA 1GRIA 4OMOA 4AFSC 1S1NA 2KT8A 2CDTA 4JJBA 3VS0A 1NEGA 1A0NB 2HSPA 2K7AA 4X1VA 4EIKA 2A36A 2L3PA 2LCSA 2JM8A 2IIMA 1WA7A 4KRTA 2O88A 1Z9ZA 2F2VA 1E6GA 3H0FA 1K76A 1PRMC 2JW4A 3UATA 2A28A 3C0CA 3FJ5A 4JPBW 2FG0A 1K4US 1LCKA 1NM7A 2DNUA 3JV3A 2LJ1A 2CT3A 1X2KA 1I0CA 1BU1A 2W0ZA 1GCQA 2J6OA 1WI7A 4OMMA 4HVVA 2HCKA 2RPNA 1KJWA 2JT4A 1NG2A 3I5SA 1RLQC 5FW9A 1QCFA 2EGCA 5FWCA 3EG1A 1YWPA 2OI3A 2EYXA 2RQVA 3NMZC 2JMAA 2DA9A 3QWYA 5IHIA 4F17A 2ED1A 3M0RA 2KRNA 1U06A 5HCKA 2CSQA 2JS0A 2PZ1A 2EYZA 2CUDA 4RTYA 3GBQA 2JS2A 1SPKA 1T3LA 1V1CA 2LQNA 2NWMA 1AWJA 1J3TA 4HXJA 2MOXA 4JJDA 4J9IA 1OOTA 4HVWA 4OMQA 1AWXA 4J9BA 2YUOA 3EG0A 1YNZA 3TSWA 4LN2A 1W6XA 2YUQA 3ULRB 2FPFA 2EYYA 1K1ZA 3PVQA 1AD5A 2AZSA 4J9DA 5EC7A 2DBMA 4RTVA 2D8HA 2GTOA 4J9FA 2CH4A 1U3OA 4R0KA 1JQQA 4RUGA 2YUPA 1AEYA 2KYMA 2PTKA 1CSKA 4LUEA 4OMNA 2D0NA 3VS6A 2F2WA 2KXCA 3H41A 1ZLMA 2ABLA 2H8HA 3REAB 2GGRA 1W70A 4FSSA 2KEAA 2M0YA 1SRLA 1Z9QA 5FWBA 2ROLA 3TSZA 2K3BA 1NLOC 2DYBA 1SHGA 1H3HA 3RNJA 2HDAA 1NLPC 1K0SA 2KGTA 2KRSA 1GBQA 1SHFA 1X69A 2X3XD 1X6GA 2J06A 2SRCA 4J9HA 3H0HA 4ESRA 1WFWA 3UA7A 2VVKA 2HEQA 1VYUA 2KR3A 2KROA 1SEMA 2EW3A 2ED0A 4HCKA 1W1FA 4JJCA 2EQIA 4F14A 5IHKA 1WLPB 2DL5A 3EG2A 4J9CA 4E6RA 1XOVA 2J7IA 3I35A 1JXMA 1N5ZA 4Z8AA 3EHRA 1MV0B 3I9QA 2AZVA 1MV3A 2RF0A 1WXTA 3U23A 2JM9A 2CUBA 2L2PA 5GJWB 2I0NA 3REBB 2BZYA 2BTTA 1QKXA 3H0IA 2J05A 1E7OA 1MUZA 1U5SA 1G83A 2DMOA 4CC7A 2DL7A 3A98A 1JU5C 2DE0X 2M51A 3ZL7C 1G2BA 1QLYA 4J9EA 2J6KA 4ZNXA 2EVRA 3R6NA 3QWXX 1UGVA 2YUNA 2DILA 1IO6A 1KSWA 5IXBA 2PNIA 2AKKA 1I1JA 2A37A 2LMJA 1UE9A 3M0PA 2JXBA 1X43A 2RQWA 1KIKA 1CKBA 2DM1A 5ECAA 2L0AA 1WXBA 4OMLA 2DVJA 4RTXA 4JZ4A 2ECZA 1FMKA 2MIOA 1GCQC 2FEIA 2KBTA 2DRKA 2RNAA 1OEBA 4OMPA 1PNJA 3O5ZA 4GBQA 2EGAA 4J9GA 1EFNA 2CREA 2RQTA 4LNPA 2LX7A 2GNCA 1HJDA 2EBPA 3EHQA 2EGEA 2O9VA 1VYTA 4CC3A 1PKSA 2K6DA 1GBRA 4AG1C 2DL8A 3NPFA 2OJ2A 1RLPC 3VS1A 2B86A 1TG0A 1UECA 1M27C 4AFUC 4DEYA 2C0TA 2BZXA 2FRWA 1WXUA 2LJ3A 2G6FX 3NHNA 1Y0MA 2O2OA 2KT1A 3M0QA 4RTTA 5I11A 2KYBA 1JEGA 3LH5A 3VS5A 1OV3A 3EGUA 1GFCA 2YT6A 3EG3A 1SRMA 4ORZA 2KE9A 4AFQC 2RMOA 1PKTA 1WIEA 1YCSB 1YWOA 3CQTA 2C0IA 3NGPA 1AWWA 2FPDA 1GCPA 4K11A 2AKLA 2D8JA 1GL5A 2DL4A
chains in the Genus database with same CATH superfamily
3STBD 2DL3A 2K2VA 3L2RA 5CKBA 3GIBA 1UFFA 2PVDB 2F0GA 1PH3A 1KNAA 2NVQB 3ERQA 3MEWA 1NTGA 1IBML 3GTPH 2C0OA 4A3KG 2XNAC 5KRUA 1YHQA 4M77A 1UTIA 3HRTA 1RI0A 2CP0A 1SR3A 2R7ZH 1QMCA 1I4GA 3D0FA 2UUAQ 4DV1Q 2QI2A 2K57A 1HZBA 2B39A 2I5LX 1VQ9Q 2XDBA 1SYBA 5HGQA 4Y7NB 4X65Q 4DAVA 5IXFA 3QR8A 3PUZA 5LMNW 1SYDA 3G6JB 1CI3M 2WAQB 1WPYA 4MNOA 5IHNA 2DJQA 1O7ZA 1ZX6A 3RUXA 2MPXC 3CEYA 5E4WC 4GS3A 1F2ZA 1WTXA 1H9RA 2A7YA 3HTRA 5DAUA 3G71T 4K0KL 4E7KA 4IPDA 1NYGA 5CBEE 3RERA 4F7UG 2ZZDA 1VOMA 3ONAB 5C44H 3W5OA 2MMPA 2EFIA 1RADB 3CC4Q 2OXPA 3LLRA 3M4QA 3G6EQ 4KHZA 2MF2A 5GMKl 1NJIU 1QVFA 4RMFA 3NFCA 1UDLA 2KXDA 2SDFA 5K36G 1HD3A 4IIMA 1TUGB 4C8QF 4DAYA 5I4DA 3AEVA 2F0LA 3BYYB 4ZUIA 2HD0A 5GAOn 2XDDA 1Q7YR 3HOVB 1TUCA 4DN4M 3S1QB 2Q8TA 1FYCA 4BBSB 3QOJA 4X9DA 2RHXA 4N0AA 4EMHA 4EGVA 4DOVA 4PL6A 1OO9B 4TVAB 1EY4A 1YJWA 3QSUA 4GLMA 1JWSD 3CXCP 5D14A 1OXSC 3M57A 4A3FH 1M3AA 1E1TA 3BZCA 3LX7A 2V1QA 1N32Q 1LT6D 3T1HQ 5EPKA 2KNBB 2QQAA 3JCMc 3MXNA 3HOUH 3EFOA 5IODA 3RKWA 1NYFA 2QCPX 3M55A 4N8X1 2DD5A 2KECA 1D1IA 3K57A 1Y96A 2SNMA 3QBYA 3JSCA 5KEEA 4O0AA 4II1A 1QWEA 1SSHA 2VASA 2E5KA 2NZ1D 1UHFA 2CYZB 3HKZG 3PVLA 1ZXTA 1SFOH 3GTLH 2K28A 3T13A 1TWCH 3S15H 2IL8A 2E8GA 3DHQA 2ZPIB 4L5RC 4C0ZA 3F1ZA 4GLAC 2UXBQ 3T9NA 3VDYA 3CMEQ 1ZUUA 4L8JA 1TTHB 1AEXA 2LCCA 3SR1A 2DX1A 4IN3A 4YCWA 2X4XA 5LJ5h 5IGGA 1Q81C 2HT1A 1Y57A 1RTOA 5M3FB 4A93B 1VQ9T 1QP2A 1L1OA 3ZJYC 3VUZA 4DKAC 3L2QA 1M3BA 1ESFA 2M16A 2XSCA 1G6ZA 1FL0A 5C0XI 1PWTA 2EJMA 3KDFA 1XPUA 1KTKA 1UUEA 4L6V5 1U0LA 1WYDA 4XIGS 4K6DA 2OAWA 1VQ8A 3CRLC 5GQOA 1E22A 1U9RA 2PW5A 4FL6A 5CV9A 3K5LA 4ZLTF 2E5QA 2X3WD 2BIVA 1UE6A 1UE7A 3EGXB 2NWGA 1JXOA 5FU7C 3PTAA 1SJED 1KABA 3K0YA 2CH4W 1Z9FA 3FDTA 1I50H 4DV4L 2K5DA 1YP5A 2QDLA 5HY6A 4PQXA 3J7YW 1IXRA 4AYBG 1I4PA 4MHEA 2HHHQ 3E9IA 3GTMH 4RKBA 2L3QA 1M5Q1 1VQ4A 3FKIB 3NWSA 4J6WA 1K3RA 1X9NA 3OYEA 1HXDA 1Y1VG 1R0BG 3J7A5 5DM7R 2SNSA 3GDEA 5COYA 4JI6Q 4FW2A 1EY5A 4DV3L 4YWMA 3U4ZA 1ABOA 1OXVA 4RGMA 1ZBJA 2UU9L 2EY5A 3LYIA 2Q2IA 3BZDB 2DRMA 5G3LF 2YSQA 4DR3L 1WI5A 4GKJL 3S1MH 1PSEA 1UJYA 4ELYC 2QA4T 4RA8A 2EYOA 2B2YC 3INZA 2HZYA 1P16A 2YXYA 4LFCL 2LXJA 4K14A 4TVRA 1TS4A 3PSIA 4A75A 1EYDA 3I7FA 3S3MA 2VQEL 4IURA 4KN4C 1C48A 2UXCQ 1JE5A 1SJHD 1BBXC 3H0GB 3HOWG 1F1BB 1D1CA 1I81A 1CKNA 3VYHB 2L15A 1N8RU 3NBIA 5FLXL 1JJ2P 2KEDA 4JV5L 1F9RA 2CW0C 3GP7A 4DUZL 5FJ8G 2AHOB 4AYBE 2VWFA 1A15A 3PUXA 3R2TA 3H3VI 3VS7A 1G3TA 1HPCA 4ZN1A 4JRQA 2FHDA 1Y1VB 1KHCA 3HSBA 2CZ6B 5DM73 1JORA 5I9OA 2K5LA 1T5XD 4ZTJA 1TS2A 4TKOB 1U5KA 3M4GA 1U8RA 2HSPA 5BN5A 1BNZA 3BFMA 3HOZH 4M7DG 3WOFA 1M1KU 3GTOB 1PG5B 3OYLA 4OB0B 1H641 3CCST 2B29A 3URGA 2HUGA 3EVQA 3ULLA 1PV4A 2H3JA 2YWWA 2O88A 2J7ZA 1MMAA 1PSFA 4A3CH 2F2VA 2WKCA 1UB4A 2B8FA 1X32A 2EQSA 1EIGA 3F70A 5GAOp 3KF8A 4C0FA 2F0QA 4N4IA 3I55T 1VMPA 3I8ZA 3JCMW 1LNXA 2HDMA 1HRJA 4EQNA 1JBMA 3FB9A 2KA7A 2UXDQ 3ZEHA 3ULJA 2K33A 2OTJT 3HHTB 2W0ZA 1TWHH 3I91A 1NR4A 1CT1D 4LAAA 3X3MA 4DAYB 5C6AA 3HOXB 2J6OA 2JA6H 2K5WA 3CCEA 4U673 4ME7A 1N34Q 3BS1A 2VYTA 4EPCA 2F1LA 2QA4A 1K8AC 4HVVA 2RB6A 3PUWA 3NPPA 2RPNA 4DR2Q 1KJWA 4GLXA 5JJKA 3OWEB 3GNFB 2ZXPA 3T56B 1HR0Q 4MTNA 3PNWC 1XPOA 3S1MB 2Z8LA 1GVPA 1M2OA 2ZAEA 2MPMA 1O78A 5KYNA 1H3ZA 3I90A 1M1FA 1TXYA 1VUBA 3BW1A 1BBWA 3NMZC 1Y71A 2DA9A 2E3HA 2LC4A 1IHWA 4F17A 1CHQD 4PZ8A 1UAPA 2ED1A 1D2BA 1LUZA 5IGCA 1FXXA 1SE3A 2F3IA 2KRNA 3CHBD 4POFA 1VQOQ 1BBUA 4KKUA 1EIYB 2JS0A 2KHSA 4C0DC 5HKCA 3N6RA 4HT9A 1EQVA 2DVEA 4XTCS 1PH2A 1SPKA 5EQ0A 3EROA 1T3LA 1SLJA 4BACA 4M78A 2UUBQ 1VQOT 1HR0W 2NWMA 4DV7Q 4LFAQ 3R2IA 2A3LA 4HXJA 4LF8Q 4JJDA 1QVFP 1JR0D 2XD0A 5J22A 3DWQA 1VQDA 1OOTA 3TREA 1VQPT 5FO8B 4OMQA 3GP8A 1D5MC 5I2YA 2Z4IA 1VIEA 4C5GA 3W1BA 3WWVA 1Z7TA 3J80c 4LF9Q 2CZ1B 3EG0A 4RWSC 1VQGA 5A35A 1IREB 2QQSA 2VQFQ 1I6HH 3GTJB 3OB9A 5IIFA 3I56A 1DOKA 2AZSA 2RDHA 4J9DA 5EC7A 4M7DE 1FR3A 1HTPA 4P71A 4YWLA 2D8HA 2K5IA 3EG9B 4PV1C 3JB9I 3RN5A 1QNUA 4LJZC 1QG7A 1XNRL 3M59A 1NZ9A 2E2HB 4R0KA 2R92G 2KUMA 1PRTC 2EIFA 4UC4A 5IP9H 2F0HA 1KIXA 1V1OA 2EOTA 1GUWA 2EE1A 3KJOA 4LUEA 3S1NH 3S16H 1S72Q 1WTPA 2D0NA 3E2UA 1XTDA 2CP3A 2HNIA 2JN0A 2YYZA 4JOIC 5AJ3Q 1STBA 1W70A 2A8VA 3EFRA 3RESA 1Q86C 2FVUA 2QGQA 4KV6A 5GAMg 4DV3Q 3OYNA 3OYIA 4KGZB 3IKJA 3A7LA 2DTIA 2XKOC 5GAN5 2K5QA 1A8VA 2JK8A 1FGUA 2OTLQ 3D6WA 3KBXA 5LJ3g 2F0MA 3L9AX 5FWBA 3LWEA 5IWAL 5IYCG 2VS1A 3VKIA 3H6ZA 1JB0E 1SHGA 3RMSA 4RHSA 5JEAH 4KUDK 1TQOA 1JE4A 2YRDA 1YITA 2F0IA 3L7ZC 4HN7A 1OX9A 5E1FA 1NLPC 2COYA 1SKUB 3AT1B 4FYDA 2DPPB 5GANj 1SHFA 2QEXA 1IKMA 2X3XD 2HIXA 4HJAA 1XJWB 2J06A 3MEFA 2VQFL 2SRCA 4J9HA 1AH9A 3S2HB 1R9TH 1WFWA 2AUKA 1K8GA 2P4TA 3PQIA 5FLXc 3DEOA 5CGKA 3UA7A 1JICA 1SN8A 2V4DA 4JK1C 2K14A 2ZGWA 2KR3A 2KCCA 3G1JA 5IGBA 2K4YA 1HUMA 1SEMA 3QJYA 4LD6A 4F7UE 1M8AA 2K32A 4RGTA 3ND8A 4FO2A 1EQQA 4HJ8A 1W1FA 2DK3A 3JCMQ 4IUQA 2JUFA 4F14A 4R9WA 2MWOA 3G4ST 4E6RA 1W3SA 1VQLQ 1SMXA 2GVAA 3I35A 3HOYG 4E7HA 3I2ZA 3EIVA 3L2VA 4BS9A 4M7AB 3EHRA 1XMOL 1C7YA 2KY9A 3FPUB 1SNMA 2PQEA 3QJ6A 2NVTH 4OWXB 2RF0A 2VB2X 4HIKA 1YIJQ 5C4XH 4C2MH 3OS0A 3S2HH 5J26A 3D6CA 3MPUB 3CC2A 1NMFA 1SF9A 4RKLA 3V8KA 1PRTB 1VQBA 2AWNA 4NXMQ 1E7OA 5FLXE 2L5TA 5GMKe 2NN6I 3W1GA 1VQMT 3TQYA 4CC7A 2DL7A 4N0AC 4BWGB 3OA6A 5IE8A 3ZL7C 1QCNA 4M1UB 2MWPA 2YU9H 2V1CC 4PJOF 5KIXA 4DF7A 1C6VX 3Q6SA 2DILA 4XT3B 5M5XH 5JPMC 2VXEA 2E6ZA 2RDFA 2QDBA 2YTVA 3LWHA 4H44C 2L5QA 4HCBA 2PU9B 1IBKQ 1RAEB 3RNUA 1I1JA 1VQKQ 1N6AA 4GN3B 4FXKC 1BIBA 3H3VC 1CKBA 1M2VA 2GVBA 4N4HA 3CXCS 1YHAA 3VU3C 4R55A 4M77E 1SE2A 4C3IG 1CKMA 2QASA 1HXYD 2DVJA 2BCOA 3Q24A 1TS9A 5IOCA 2F4VQ 1VQ5A 3NWTA 2L0CA 4IFDJ 2E1HA 2PZTA 4B9WA 4LWCA 2FEIA 2F0OA 2X69A 5KH6A 2PW7A 4F7UB 5GMKh 4A3DB 2B2VC 1OX8A 2RNAA 4HAEA 5CQXA 2VGNA 3CCVQ 3JB9F 1P8LA 2KQ3A 3NTKA 4OO1H 4XDXA 2RM4A 2OF1A 2RA4A 5D3IB 1PNJA 5GANd 3OYBA 2H4OA 5EAYA 2EGAA 2NTSA 1PH7A 1LABA 2EY1A 4QVDA 1UE1A 3BDOA 1WTWA 3ICEA 1I4K1 1IHVA 2NTTA 5E4XA 1MI2A 4A54A 4YIJA 4OELB 4DUZQ 4S3SA 4OO1G 1EWCA 1WCMG 5L37A 1Q12A 4IOCA 2ZM6Q 5KYYB 3C94A 3ND9A 4B3ML 2HQXA 3BZKA 4M7AC 1O7IA 4QVCA 1W6JA 3CD6A 4V190 3AB9A 4CC3A 1XYIA 3Q1JA 3BG3A 2X9HA 1GBRA 1CTMA 5GANe 3S17B 4GOPC 3NPFA 4LUOA 4DK6C 1R0CB 1RLPC 3I72A 4ODGA 4J83A 1PH9A 1STGA 4HJ5A 4KUIA 3J7AF 2FXQA 1PFSA 2E75C 2Y4YA 2DFUA 1HQMC 1BF4A 4AFUC 3MXUA 3R8BA 3PMFA 2UU9Q 2JQOA 4A3KB 5GAMh 1KD1R 2Y0SE 5CR3A 3K5OA 2L55A 2KT1A 3M0QA 3TP5A 4EDUA 4HR7B 1RL2A 4M7DD 1VF5C 2CKKA 2FL7A 4JS5A 3VS5A 5JJZA 1OV3A 2XWJB 3FLGA 2ZPHB 3GTQB 1J8IA 2YT6A 4L5TA 4ZTFA 1EU4A 1JMCA 1A2UA 2BA0A 3P7JA 1ZA2B 4XTWA 1B7YB 4G7HC 1WIEA 3KLSX 3IRBA 3R3OA 2JA5B 2LMCB 2IX0A 1FNUA 1MNDA 1LTSD 2V8IA 5GAOq 2R7FA 4E7LA 2X6GA 4GN5A 4FYYB 3CBOA 3NXWA 4JBWA 4OONA 5JEAJ 3QDRB 4KH1B 1OXUA 3BVGA 4NW2A 4GOPA 3Q22A 3H9NA 2AKLA 4XU2A 1H9MA 2D8JA 3SWNC 4N4GA 2DL4A 2NVQH 2LT4A 2O9SA 3I4NG 1PZID 4BY1H 3CQZH 3I5RA 4M77G 4DEXA 1UE5A 3X28B 2LNHB 1PRTD 3VR6A 1DZ1A 2XN9C 2WB1B 4F88A 2P0KA 3V96A 4WF2A 5CV6A 4B3SQ 2K2MA 1FMWA 3MEHA 4JRIA 3W2DA 1MHNA 1ZHIA 4LE9A 1YI2A 2XI9A 5CQYA 3S1RH 5J39A 1T3SA 3CPWS 1NSNS 1IL2A 3CMAT 2BOSA 3M4PA 2LQWA 2RH2A 4C92F 1E7ZA 5A2QE 1EQRA 1GHJA 1LYLA 4DR6Q 1RAHB 4A63B 4GKKQ 3HPWA 4KD4A 4LF7L 2XRSD 2RO0A 3JCMd 5I6WA 2YTYA 1KC8C 1EZZB 4EMKC 3DB4A 1R8OB 1E1OA 2N88A 2XVSA 5E7NA 3J81E 5EBCA 3CCRT 1Q3LA 3G4SQ 2DY8A 3I4LA 4UAIA 4LUDA 2B2WA 1M3CA 2JVVA 4JCVE 4O5VA 1YJNA 2J4XA 1W4SA 3V05A 3V8LA 1VQKA 3CCMA 3SK5A 2COZA 2GN5A 1TUDA 2BA1A 1B53A 2LRQA 2QAZA 1YNNC 3VA7A 1ZQ1A 1S5CD 1KC8U 4PJJA 4QUFA 4JI4L 5GAN3 1B34A 2LVMA 3F2CA 1H8KA 1LACA 1X3QA 2KCMA 4A4FA 1BB9A 1TS5A 3QZ5B 4X3UA 3LW5E 5KNCA 1PC0A 6AT1B 1VQCA 5BN3A 4A3IG 5LJ5g 1LTRD 2PI2A 1EY7A 3JB9J 1MKHA 1E6HA 3TEEA 4JI4Q 5FJ8H 5FK9C 1M1KR 3AYHB 2F0TA 4O42A 3T4AC 5JAVA 4HVUA 1QVGS 5CORA 2E41A 2Q8IB 5I22A 3CCLQ 1R9TB 4K5XA 1E2VA 3CCJT 3F8TA 2EPDA 2HBPA 2VZAA 5IT9L 3BU2A 4L5SA 1WDXA 2GBQA 4MMKA 2BDOA 5CMDA 3EA6A 1D5ZC 1KQSS 1QB5D 4IIOA 1TS3A 2F03A 3HOVG 2FO0A 1WHLA 1FNVA 2CSIA 4C92E 1KG1A 1OPLA 4F7UA 5IYBH 4O6JA 1VQHA 4Z9CB 4DNIA 1H95A 2L89A 2QTXA 4RTUA 3GQBA 4A3BG 2NUZA 3FIFA 2XMFA 1IYJB 2D5DA 3NK9A 2KVQG 1T5EA 3D31A 2XDPA 3PMTA 2RSNA 1K8AR 4TQUS 3SWNB 3L2PA 5C5LA 3GTGB 4XK8E 3OIQA 1TWAB 2QDYB 2Z6KA 4U68A 1BCPC 3RIRA 2CP2A 3MHXA 4OIJA 4N8FA 3PF5A 5EKKA 4A3JB 4LF5L 1CKNB 2ICIA 2GQVA 1BQQT 2Q2TA 1S5FD 1VQEA 2DBKA 4QKUA 4C8QG 5KYYA 5JEAG 2LCLA 1LT4D 1KK7A 4K5WA 2CCZA 4QT7A 3OW7A 5IGEA 1T0JA 1LTTD 1Y07A 3L42A 1PFBA 1JQYD 5ELFA 2HMAA 4J8QA 1YI2Q 3M0TA 4KH0B 4DV6Q 2KAFA 2CQOA 2R7DA 5IGFA 2GF7A 4YCUA 4V0BA 4M78E 4DXFA 2SEBD 4ALPA 1RAIB 4EMKB 4Q5VA 3A8IE 3J81j 2F2XA 2R61A 4RTWA 1VQ4T 2ROTA 1HQRD 1EY0A 1B8AA 2EYWA 1I07A 4BY1B 3JAML 1KNEA 4A93H 3AQQA 4MZMA 2K79A 2C35B 4LFCQ 3SHWA 4OF1A 1Y14B 2V8KA 1DJRD 1EYCA 5GANf 2EJGA 4CGYB 2FRYA 4CDCC 4DV1L 1RKNA 3H3VH 2EYQA 3CMAQ 1QVCA 3OYKA 3UI2A 1I94Q 2F0WA 4ZRZA 4MMLA 3RZDH 4NS5A 3S1QH 4KKSA 1F77A 1PVOA 1LPLA 1LVKA 3RDVA 4FF3A 1ARKA 2CT4A 3A8OB 1A62A 1IW7C 2NYSA 4C3JG 2QEJC 2RQRA 1UJ0A 1SNDA 2LJ0A 4JRKA 1VQ5T 1Q8KA 4QY7A 1K0XA 4QUCA 1G8XA 4IJHA 4FT4A 4XT1B 5KCHA 4MIUA 4OWTB 1ZSZB 1VYVA 2A6HC 2G9HD 3PO3B 1HHVA 2CP7A 3KBGA 1RODA 3KF6A 4OGCA 4BB7A 1OPKA 3FKIG 1UEBA 1GRIA 3OIPA 3GTPB 1WTRA 1N34L 1B9MA 1M1GA 3JB9G 2P0PA 1KQ2A 1L1OC 1WNLA 3CCSQ 2DGYA 1IBMQ 2CDTA 1YJNT 1NEGA 3JCMg 1N33Q 5C4XG 1D7QA 4YY3L 2K7AA 2R3ZA 4IFDG 4EIKA 2JTFA 3ZBDA 3X3NA 2UUBL 2DXCA 2LCSA 3CCRA 1D8LA 5NUCA 3UT1A 3G71A 4M78B 2F0VA 3D4DA 2EY2A 1WA7A 3TU4K 4KRTA 1BI3A 4KJOA 4BXXH 2X6LA 2V8JA 3QG1A 3ASKA 3OMGA 2B2TC 3NBHA 2VUMH 1H9JA 5FRMA 4ILWA 3UATA 4ULLA 1BIAA 1PLFA 3PCOB 4LF6Q 1I8FA 3SB2A 2HDLA 1KAAA 2FG0A 1K4US 1ASYA 1NM7A 3CCVA 3CC7T 5C3XA 1HYOA 2N78A 2LJ1A 4IFDI 1EY8A 4FYWB 4DBQA 1OQKA 1ENFA 2CT3A 1X2KA 1Q82C 1B70B 1TWHB 4JOIA 4JI0Q 4A4KA 5I2SA 3T51B 5C4HA 1GCQA 3CCUQ 1WTHA 4IUTA 4OX9Q 4A93G 3GTQH 1WHKA 1WJRA 2EAYA 5EG2A 3GOXA 2HCKA 1K83B 2KOLA 2IW3A 3QIAA 9ATCB 4M7DB 4K8JA 4RCNA 3TP8A 3VA5A 2H5XA 4DBHA 1I3QB 1HNWQ 1DD2A 2DTHA 5I2XA 3TRZA 4HJ7A 4E2FB 2PQAA 3D8GA 2I07B 4EX5A 1JJCB 1UEAB 4M78F 1X65A 5K36H 3RR6A 4Y52H 2A19A 3K7AB 3DWAA 1Q7YU 4BY7G 2LX9A 4HKEA 3PUVA 3PO2B 1TY0A 1U06A 2A5HA 1U4PA 1VF7A 1WQ7A 3UE1A 5HCKA 3L2WA 1VQPQ 2F0UA 2DTOA 2EYZA 1XMOQ 4P74A 3GBQA 3G7LA 2Q8RE 4KKTA 2XGTA 1C8CA 1HZCA 3LNNA 3OTOQ 1OI1A 1YNND 3D3RA 3HOZB 1HH2P 3I4OA 4H0LC 2LQNA 1HTLD 2AKWB 3NEMA 3O13A 5FKAC 1AWJA 3CC2Q 1Q1BA 2MOXA 2CFMA 4J9IA 4XU0A 2IHFA 3FDRA 2C5CA 1QVFS 1RF2D 4PNOA 1AWXA 4J9BA 1PTOB 4HJ9A 1QWYA 2XIDA 3VR2A 3PO2H 1C0AA 4DXGA 1SAPA 2NN6G 2K04A 3G48A 2E65A 3OOCA 1PH4A 5IYDH 3X24B 1BI1A 3LGFA 4BY7B 2DBMA 3A8JE 1L2FA 4RTVA 3RLFA 4X62L 4A3IH 4HMIA 4C1NI 4DR1L 5KYUB 5AJ3L 2SOBA 3M58A 1ILPA 2CH4A 1B3AA 1AW7A 5LMUL 4GLKA 4X64L 2RA2A 1AEYA 4HSVA 1J5EL 5GAMf 4LF5Q 3NTIA 4OB3B 1A3VA 2NBFA 1A6XA 2PZUA 3S2DH 2F2WA 2MQHA 3H41A 1YNXA 2AQ2B 5M3MH 4M78C 3CCUA 3FEWX 1ZLMA 1LTAD 3M7NA 3EFOB 5DLQE 1H9SB 1EWHA 5IYCH 1KHIA 1QVPA 4RCCA 4DK3C 3TMEA 1FMVA 4P72A 4M78G 5C0XJ 4IZ8A 1DJ7B 4X34A 2B63B 2ZPBB 3PT9A 2CWPA 4AIMA 1FD7D 4TRDA 1EIFA 2QGFB 1Z9QA 3I4NH 3DXJC 2K3BA 1NLOC 3E1SA 2L8DA 1M8VA 1G8ZD 2OTLA 2F3WA 1T9HA 2NUCA 1PRTF 2NVYH 2FZKB 1N27A 2N49A 4UP7A 3VYRA 4Y91A 3G71Q 1ONLA 3K80C 1GO3E 2HDAA 4C1NK 4JI5L 3PIP3 4AH6A 2X4YA 2Y0SG 1GBQA 4RKUE 1X69A 2NUPB 4DOWA 1I5FA 1X6GA 3M3YH 2EYHA 4R4IA 4OO1I 1M9SA 5GMKj 2KK4A 1F2MA 3H0HA 1X3FA 3IFTA 4DPGA 4ESRA 3CCSA 1X01A 2OEOA 1IBLQ 5C5MA 3TS0A 5ELBA 4PFOA 3MZ5A 3K0XA 5ELNA 5FRNA 2BH2A 3F2DA 1VMCA 2HL5C 1OU8A 1RAGB 5FU6B 1DCZA 2CGHA 2HEQA 4R4TA 5FO7B 1VYUA 4A3FB 2KROA 3OW2P 3OSVA 1G5VA 1TWAH 4FP5D 3A74A 4B3TL 4LF4L 5DM63 4WJ4A 4HCKA 1D1BA 3OYHA 4R4CA 4A4HA 2EQIA 3PO2G 2K03A 2DEUA 1SNCA 3OYFA 1WGSA 1NNXA 4DV0Q 4KJNA 1S72T 2AZVA 2MHVA 4BUGA 4ZKCB 4LUZA 4WFN3 1WXTA 4FT2A 4LDYA 1QVGP 2L2PA 2NZHA 2JA7B 2NUTA 4X3TA 4DR4L 5GJWB 3M7GA 3N5BB 1IW7D 1XXGA 2BTTA 3OQ5A 1QKXA 4EQPA 3HOWH 2J05A 2HKNA 3HFZB 4E47A 2CZ7B 2EXZA 5HK3A 2BKDN 4A76A 1D0YA 1MSGA 4RG2A 3LX0A 3GTJH 3TS2A 4IUPA 4QIWE 3VV0A 3TZUA 1M90R 1JU5C 4OVAA 3K7UC 4LF7Q 3U9OA 4DR5Q 3BDCA 2E2IB 2P0QA 4A3JH 4J9EA 4RGOS 3FJPA 2J6KA 2E2DC 2EVRA 1WHGA 3QWXX 3DWPA 4R8NA 4DV5L 1HA5A 1N9SA 1QVGA 1HZAA 4RHRA 5LJ3d 3WDNA 4BBSH 4WJWA 1BCPD 3HOYB 3V7CA 5IXBA 4M78D 3AFPA 1AT1B 3CCET 2AKKA 3S16B 2VQEQ 2JA6G 4QW2A 3JB9D 1N33L 4LDWA 2DY7A 4H02A 2A37A 4JVZA 2KCNA 3R93A 2GCXA 3M0PA 2K52A 2JXBA 1X43A 1II3A 4OXPA 4XQQA 5HGTA 4PKCC 3CPWA 3OSOA 3C4SA 2L0AA 1X6OA 3CC4A 4DR7Q 5ISRA 4DBFA 1A2TA 1WJQA 4JZ4A 4RTXA 2Z6KC 1I94L 3M3YB 3K5NA 4BI8B 1GCQC 2DJZA 3NSWA 4JBKA 3GTKB 4ELZC 3NQTA 5C0XH 1YBYA 1I6HB 2DRKA 2MAMA 1PH6A 1FX7A 4JI5Q 2YRCA 5I21A 3NELA 1CUKA 3AMUA 3M4YA 4JI3L 3O8VA 1TWFH 3O5ZA 5FU6C 4HCZA 4UPAA 1NCVA 3MHBA 1PYBA 1K0RA 1EFNA 3OS1A 1BCPF 1N9WA 2RQTA 3VUBA 5LJ5f 3EFXD 5KYWB 2QQRA 4KLKA 5C0XG 3ULPA 2PMZE 5KNBA 2EZVA 4GKJQ 1YHQQ 3A55A 2LX7A 2R57A 5GMKm 3H09A 2DZ9A 2PUOB 4OHJA 2XIWA 2EGEA 2RHZA 3OYMA 2MJ8A 4DR7L 3CPFA 2ES2A 3PF4A 5L8RE 4C3IB 2E12A 4AQYL 4AG1C 4C8QA 2KMTA 1G2TA 4ZN3A 4L5GA 2OAUA 5M5WB 3VS1A 1Y8NB 2A69D 1CQFA 1K83H 1SE4A 1IB8A 1ICWA 2XK0A 1S4ZA 3U9SA 5JJIA 3BE3A 1WQWA 1VQPA 2ZJPA 3MXNB 4P5NA 4BE1A 1VCIA 5JOBA 1Y1WG 2G6FX 1TIID 3VYTA 1RJTA 3NHNA 2O2OA 2AUJD 2PI2E 4R4OA 4DV6L 5LJ5e 3KFUA 5I11A 1LLRD 1K8OA 2KYBA 2ASBA 2KHJA 3EGUA 4CKEA 2I46A 2M9VA 3HRUA 1QUQA 5GAOm 3G6ET 1B9NA 5M5WH 2KE9A 3V8JA 2F0KA 3NE5B 4A3LH 4OB2B 3EH2A 4IUUA 2RMOA 2F0JA 1PXUA 4FDBA 4QCLA 1PD0A 3CQTA 4MDXA 1DXMA 3LWUA 1AWWA 3M5AA 1KD1U 5EKLA 3H0GH 5M3FG 2FPDA 4QQGA 1BI2A 5IYBG 4JUVA 1IRXA 2M02A 1N8RC 1E24A 1S3OA 1VQ4Q 1Q8IA 4JC0A 2K4KA 5CV5A 3UDGA 1CA6A 3CQZB 3FKIH 2K01A 4A3EH 4PJMA 3GO5A 4E7JA 1SG5A 3LWIA 4Z89A 3RMHA 1U4RA 2I5MX 3DM1A 3RZOB 5GAN2 2EKHA 1BYMA 1TWFB 1LJOA 1RDPD 3OWFA 5KGUA 4XQ3A 4KI0A 1CFMA 3QYGB 5KYXB 2B2TA 4KY6A 3MJXA 2K05A 2CP6A 1C0MA 1BKBA 2D1XA 1KD1C 1RAFB 3CCRQ 1LV9A 1UNSA 2E5LL 4KTAA 3KF8B 4AYBB 2D6FA 4PMCA 4RTZA 5KE3A 5C3WA 2E76C 1XNQL 5GAGC 1V29B 1E3PA 2XRQD 1PCXA 1SNOA 5C44G 1AZGB 1YVCA 2A6EC 2Z4HA 3GTMB 4O2DA 3QKJA 2R5MA 1HSQA 3OS2A 3L1AA 1K9MC 2QK0A 3URYA 4DR6L 4GKKL 4RMOA 5ELDA 4EQOA 1M4ZA 1IZ6A 3CBMA 2XU8A 5CAIA 4BE0A 5A2QL 4JI0L 3CMEA 2A1AA 4Z88A 3VRYA 1STEA 3OBWA 4H13C 4B3SL 5T1GA 5JPNC 1KQSP 1ICFB 1NBWA 1STYA 1BDOA 1RACB 4FXDA 1TH7A 4OL7A 4NKLA 4JI3Q 3RMQA 1IL8A 1Y1WH 1PYSB 1MJCA 5IN1A 4M4ZA 5GAN8 3PIOA 1SMYC 1WCMH 4X65L 3C3LA 1RI9A 1U1TA 4PLIA 4ME5A 2QW7A 4L6TB 2M1HA 1G51A 2JMCA 2WSEE 3HP3A 1LOJA 2LQKA 4V2SA 3RD4A 2P4RA 3SK4A 2KSSA 1RAAB 3CMAA 2HQHA 2LDMA 3RUZA 1QCOA 3QXEB 3A8KE 4CDFC 2F5KA 2SEMA 2R58A 3VJPA 4BY6B 5GMKi 4C8QC 4HCCA 4EMKA 1A3TA 1A0IA 1KC8R 3AFQA 1PFNA 1YHQT 2EYJA 4B3MQ 4JW0A 3CC7Q 4A3DH 3H91A 4JZ3A 3VRZA 1T0HA 3CCUT 1VQKT 2DEQA 3RLOA 2QGGA 1ZUYA 2DAQA 2ZTCA 4MZTA 2RHYA 5I6YA 3HOUG 4ZUJA 2VXFA 1QE6A 1UG1A 4CDEC 3FVQA 1TU0B 5J1ZA 1YNJD 4ID6A 2MCNA 3A54A 2K1BA 2L3SA 2OCEA 4XYQA 3RZDB 3EN2A 1SE8A 2K9GA 1BK2A 2RI5A 3MTSA 4UDUC 1CKAA 3G6EA 4BBRG 1D5XC 1STNA 2D0QB 2CVRA 2WFWA 4M7AF 4AMCA 1EZ6A 4BY1G 5FO9B 1KFZA 2K5VA 3QDFA 1M30A 3I3CA 1CZGA 2O31A 2JOYA 1DOLA 1X2QA 3A8HB 1K9AA 5IT9E 5D6YA 1VQ5Q 2B2UC 4AG2C 3S2DB 4J7FA 3ER0A 1EU3A 4EVOA 2CS7A 3T53B 2KI7A 1ZA1B 2DNCA 4XQNA 4M77B 2EYPA 2OX7A 3A5UA 5KE2A 1RD9D 2E2JB 5CIUA 2BE9B 2IX1A 1D3BB 1JO8A 1VQ9A 1ENAA 4DV4Q 1RUWA 1R4PB 1GUGA 4ANJA 2TMPA 2KQWA 1K73U 2NVYB 1PD1A 2VV5A 3RKYA 4BY7H 3A0JA 1FYNA 5IAYA 3S24A 2DLPA 4IUNA 2F4VL 2VKNA 1G91A 1JT8A 4DU9A 1XMQQ 5IP7G 3SDZA 4OEMB 4QIWB 2QYZA 1NE3A 3VYSA 7AT1B 4M75A 1BXTA 3CCLA 2RJCA 2FINB 1SYFA 3VR3A 5FLMG 3P8BB 4RCBA 2BDNA 4NXML 5LL6X 4LFAL 1U1SA 1E0BA 3OPOA 2XHCA 4XAXB 2N3SA 3FRPB 1VQ7A 3TCJA 2JA8H 3OW2A 2GTJA 2LKVA 5C4XB 4C8QB 1NUCA 3KXTA 2VNUD 1VQMA 2PO4A 2A08A 2NYZD 1Q1EA 1TY2A 2ENMA 1BO0A 1VIFA 5KNDA 1AVZC 3GF5A 4G4KA 3CC2T 3IAYA 2Z0SA 1VQLA 3T1YQ 1FJGL 1MHWC 3CCMQ 3HOXH 1YJWT 4EQ5A 4JI2Q 2RI3A 4D8KA 1YJNQ 1X3GA 1BI0A 3K6OA 1MNEA 1KDAA 2LXKA 4M8AA 4HIDA 2WP8J 1WTQA 3G4SA 1WHHA 2R92B 2BZ8A 5LJ3f 4WJ3M 1UUPA 5GAN6 1V1PA 1LTID 1X6BA 3MO8A 4OMOA 3HOXG 1JCKB 2LQ8A 4AFSC 2A68D 2LY7A 4PK4A 2KHIA 2B8GA 5IY0A 3T1HL 3BVMA 1S1NA 3KLRA 3VS0A 1NAPA 1CSPA 4DV2Q 1KDBA 2DNEA 2G5DA 4J5YA 2QEXQ 3RLNA 3T16A 4HIMA 2MUYA 5GAHC 4B3TQ 2L3PA 1KQ1A 3MEVA 2A74C 2IIMA 2EYMA 1UGRB 4FM4B 4RCOA 1YITQ 4A3BH 3VR5A 3HOUB 5C4JB 3A1PA 1K28A 1O9SA 2JA7G 5M3MG 3H0FA 1K76A 1B1ZA 2GA4B 1C9OA 2DKGA 1WTVA 1IBLL 5LMUQ 2K3XA 3FJ5A 2WB1E 4M75D 3I4MG 1OXXK 2R92H 2RJEA 3PO3G 4CBVA 5KYXA 2ZPGB 2DNUA 2PNRC 1I5OB 1TU2B 2D62A 4C92C 3UDXA 1XX8A 4HSPA 4X62Q 3RN2A 4RGNA 2K7VA 2HQEA 3CCVT 1NJIC 3M4OB 4NPSA 1WI7A 4LXCA 4OMMA 4BI4A 5KYUA 1ET9A 4LFBL 1VQ6Q 4KK7A 4PMBA 3I5SA 1HK9A 3S3OA 5EKIA 4M7AD 5FWCA 2EGCA 2A6ED 1XJVA 1X56A 1SEBD 4K2LA 3DB3A 2M9UA 1QW1A 2QG9B 3EG1A 4FCYA 3JCMh 2MP1A 1LTBD 2OI3A 2RHSB 3A8GB 5EPJA 2RQVA 3QWYA 5IHIA 1I6VC 3I56Q 3ME9A 1H9SA 2VB3X 5AT1B 1YFNA 4J7IA 2RHUA 1VQJA 2DJGC 1D09B 3I4MB 5CV4A 3MFYA 4RTYA 4FIBA 4OP0A 4X64Q 2BE5D 4LF8L 4YWKA 4AQYQ 2O5IC 4ZCKA 2K50A 1V1CA 4KD3A 4J6XA 1SMYD 5CYUA 2PMZB 2Z0WA 3CD6Q 5GAEC 4CRIA 2L9HA 4OGQC 2E6NA 2L3RA 4VUBA 3QOLA 4KMUC 2VGMA 4ZQ3A 4X66L 3M56A 2VUMB 4IPGA 5FU7B 5C3EB 3GLXA 4A3EB 3J81i 1S5BD 3GV3A 4HA8A 1GUNA 3TSWA 2DERA 4LN2A 1BCPB 4P73A 1VQOA 1L0WA 2FPFA 2OTJQ 1WTOA 3A8LB 2EYYA 3PVQA 2CZ0B 1XWEA 1HNZQ 1AD5A 3M85A 2JA7H 1Q81U 3HRZC 1B7TA 4AT1B 4A3GG 3H0GG 3CXCA 3HOWB 1HUNA 1EX4A 2JE6I 1HR0L 2B2YA 3STBC 3HL8A 3QPHA 1F2LA 1KRSA 3IFDA 3W3AA 4IJLA 1N36Q 3KYHC 2YLBA 4LDUA 3S14B 2K6AA 1F2YA 4RUGA 2AHJB 3I56T 4JLIA 2KYMA 2EQKA 1LM0A 4C92B 1YITT 5HK0A 1Y8OB 4FYXB 2KENA 1CSKA 4DV0L 4ME3A 3LGLA 4A3MB 2KCTA 3VS6A 1FWZA 3M9QA 1M2VB 1PTOF 2EY6A 2KXCA 4A4IA 2L12A 1WJSA 2ABLA 1SYCA 2KJXA 2GGRA 4K5VA 4PZ6A 2NLUA 4FSSA 1C4QA 1X3PA 3SEBA 5IP9G 3PV0A 3CCJA 1W2BS 4GOPB 3T1YL 5CK9A 2M0YA 2KVMA 1TSFA 4I7AA 1SRLA 3J80i 3DMUA 2L1BA 4C92D 4BXXG 1IHZA 4QL5A 1TT2A 3MXGA 1EOTA 3JC66 1D1KA 4JI7Q 2ROLA 4DR5L 1VQ6T 4DUYQ 4CI0C 3F2UA 2DYBA 2WACA 1R4QB 1NY4A 5D6XA 3ZFJA 4KGXB 3L0OA 1TOVA 3JCMP 2IG0A 1DONA 1K0SA 1BCMA 2PVOB 2BH8A 4NB3A 3K5MA 3CCQT 4M77F 2F5TX 4UP8A 4RH6A 4E7IA 3JCMX 4OMFB 1VQNQ 4YHHL 3FRNA 4G7ZC 4XTZA 1AZPA 3S6WA 1OYXA 1BVSA 1PTOD 4PJOC 4NL3A 3CCMT 4C5HA 4G57A 2L11A 4QQBX 1YIJA 2RKSA 2FYKA 1B4OA 1HFGA 3P1HA 4R4QA 3EFSA 5CKFA 1ACMB 1X54A 4C3JH 4GNXA 2M2LA 3MC0B 4RG1A 3TZDA 2EQMA 2EW3A 2RSOA 1V1PB 5CO7A 2JNGA 1X55A 1TR5A 4JJCA 1EQTA 1EZ8A 4L59A 1AN8A 3QO2A 5IHKA 5GAMd 2MFIA 4PMWA 3BY7A 2DL5A 3EG2A 3WVEB 1E2ZA 1EY6A 1XOVA 2J7IA 2B3GA 2PNHA 3HG9A 5E3FA 3TP6A 3EBEA 4Z8AA 2XG8D 5DLOA 1CM9A 1RIPA 5DNFA 4NXNL 1B34B 3CC4T 4QF4A 1MV3A 3K58A 3I55A 2QILA 2ZJQA 1MGSA 4RAUC 3U23A 2JM9A 4BE2A 2Y0SB 3MEAA 1FVIA 2EQJA 3J80E 2I5HA 2E4HA 4DR1Q 3HOYH 2I0NA 3JRZA 3REBB 4KT0E 3FHWA 4Y7NH 2JA8G 2BZYA 4LMQD 5LMNQ 2DXTA 1SYGA 2ENBA 4GN4B 1U5SA 1GXDC 1JB7A 1G83A 4ZAIA 1B44D 2DMOA 3JCMf 5BR8Q 2RQXA 3D7SB 4A3DG 2E3IA 3I4NB 4HTHA 1WOCA 3NQIA 4B3RQ 2D9UA 3K81C 3A98A 4R8IA 4JBMA 2VUMG 2DE0X 2M51A 4A3EG 5D3DA 3J7ZC 2CKZB 1QLYA 1D1AA 4NL2A 1SROA 2PQAB 5M3FH 1MGQA 3EGXA 1S5DD 2RK1A 3HRSA 1F9QA 1UGVA 3S3NA 3HFOA 4IFDH 2PVGB 3RKXA 2PNIA 1G3SA 3CU7A 1STAA 3KLSA 1JOQA 5GAMj 4NDXA 4JI6L 2R93G 4DA4A 2LMJA 1UE9A 5EJWA 3J81c 1OZ2A 1PHJA 2A73B 2Y90A 4MZ9A 1J5EQ 3S1NB 4WORA 1WXBA 1S72A 3EJIA 3EGDB 5I9PA 4FVMA 1B2TA 4PJNA 3SXHA 1FMKA 4KGVB 3SK8A 5ELCA 4LDVA 2Y4XA 3QYHB 4M75B 1QUQB 5BR8L 1J9OA 1JOKA 4JYAL 1OEBA 3TSSA 1I4HA 2RI2A 3DKMA 3E0EA 2AIRB 2RVLA 4CHTB 2A0FB 2F69A 1PTOH 5K5PA 4GBQA 4M75F 2JJ9A 3KOJA 1EFWA 1XNIA 3CCQQ 1XNQQ 1FNWA 2ZT9C 2E2HH 4J9GA 4LF9L 4QQ6A 2CREA 3JCMV 3OW2S 2HAXA 4PJOD 3FMCA 4N9TA 3EH1A 4XTVA 2F0DA 5C3EH 2IPOB 5GAOr 3S1RB 4OX9L 5IP7H 1QCBD 3BJUA 4RG8A 4FU6A 1SBBB 3HS0C 1Y69U 3FPPA 2GFAA 1Q46A 5T1IA 4PJOB 2OQKA 3H15A 3CAMA 3EHQA 4Z02A 2B2VA 5FOBB 1N8RR 2JA5G 1PKSA 1EWIA 1HJPA 1LO5D 3TN2A 4HIOA 1JJ2S 4DV2L 2XWBB 2OJ2A 4OB1B 2N8NA 2L4NA 2E5LQ 1PH5A 2B86A 2B63H 4F7XA 1IBKL 1JC7A 4K2KA 4Q5WA 1QP3A 1M27C 4NOYA 4FYVB 2C0TA 4A3FG 2PPBC 1YJWQ 2M0OA 2A6HD 2BE5C 2IHEA 5D6WA 2JYOA 1C1AA 1CA5A 3U58A 4L5QA 4RTTA 2J0TD 1GUSA 1CQVA 3LH5A 2HQLA 2CHBD 2QF7A 4E6IA 2DO3A 1L0YB 4M7AG 3DEPA 4M7DF 3EG3A 1EOVA 1SRMA 4BBRB 2EKOA 3V7RA 4JYAQ 1YJ9T 2R93H 1SNQA 2B2WC 2QA4Q 4MZPA 1G291 3FEOA 2F0PA 4LK1C 3I70A 5KYIA 5C44B 1PKTA 4DAMA 2NUPA 2C0IA 3CCEQ 4FXGC 3BDLA 2WIIB 4OIKA 4QQDA 4K11A 3D4WA 4M77D 4DBRA 4DNTB 3MP8A 1AP0A 3NTHA 2GFUA 4UHVA 1H9KA 4BDZA 1GL5A 2FJ2A 3UF4A 2WAQE 4M75C 2P84A 1J6QA 1EIHA 3UDCA 2O01E 2X4JA 2DETA 3AU7A 1K8AU 3PE0A 2LP5A 4CJ1B 1A63A 1LTLA 1U4MA 2ZJRA 4F16A 3CW2C 5GJVB 3AHUA 1LTGD 4APVA 1JB3A 2KBNA 2HIVA 1PM3A 2E74C 3HEJA 4C0GA 1JRIA 4J6HA 4YTLA 2Z9HA 4I65A 4ZGEB 2RCFA 1Y7XA 1UGSB 2F4IA 5A0LA 2RJDA 4M7AE 5L23A 2HCIA 5GAMe 1NR2A 2HBWA 3KUFA 2JN4A 4ZYSA 1NPRA 4R56A 1ZSGA 1WVLA 2LT1A 2W10A 1AFPA 3M4OH 4A4GA 1ZKOA 3X26B 1EYAA 1JWMD 4Y92A 1KL9A 3KK7A 1KDCA 4H7BA 2HKQB 5EBDA 1NEBA 1AZQA 1QZGA 1YJ9Q 4BI3A 1YN8A 4A53A 3TP7A 2UXDL 2YRVA 3SD4A 1Q82U 5M5XB 3S9WA 5LJ3h 4FNFA 4TSSA 3GTKH 4HCSA 2D9TA 4PLLA 1X27A 2LNVA 1Y1VH 3QWNA 4F87A 4KHPL 3OSSC 2JTEA 3A5ZB 2HL3A 1F9SA 4IO9A 4M75E 2YU9B 2NVTB 1G6PA 1M8MA 2QTVA 1AZEA 3HFNA 1K3BC 1KLUD 1B3QA 3E9GA 3P8HA 4XTUA 4E7SA 3THKA 1AWOA 1HCZA 4B08A 2YDLA 4KY7A 4JI1L 2A69C 2JJQA 3PGGA 5H1SE 3ZYYX 3I73A 1K73R 1JJGA 1M90C 3JCMb 2D0PA 4PJOG 3Q23A 4F04B 2IJ0A 1TWBA 3UE0A 2E10A 1VQLT 4QGUA 1HNXL 2NVXB 5JJLA 1X75C 3OBYA 4A3JG 2D0OA 1XNRQ 2HHHL 4CJ2C 1OZ3A 2JZ2A 4GY5A 1RHPA 1AE2A 1ENCA 1W6KA 2YLCA 3M0UA 1NMGA 2C9OA 3FC3A 2FZGB 2O4XB 4IUVA 4C92A 4F8MA 5A0GA 1PRLC 2HCCA 2CW0D 1EFID 1A3UA 3PMIA 2EQUA 2ESWA 3I55Q 1PMRA 5TSSA 1GM5A 2ZCFB 4XU3A 4C0DB 3R6OA 3MWYW 3HGBA 2A68C 5M3MB 2IT1A 4PJLA 3KFVA 1VA7A 2MGSA 2OQ0A 3HZXA 5KYWA 4WCIA 3GPLA 3CCLT 5JVH3 4GZYC 1VQ8Q 4DFAA 2DXBA 2NVXH 1I50B 3GNGA 2CQAA 3E0JA 3U4VA 2QEXT 5LJ3j 3A7AB 1EEFD 2P5ZX 1YJ9A 2LZ6B 2YV5A 3TDQA 1RABB 3Q8DA 5BN4A 2FPEA 1WX6A 2AK5A 2NUTB 1Q86R 1E2WA 1PZJD 2JA9A 2EVBA 4A3GH 1I4RA 1PFMA 1YEZA 5LJ5d 4CC4B 3P20A 1QKWA 2GQIA 1Q95G 1UHCA 2K5FA 3SGIA 2CWAA 3UDFA 3SEMA 1PYWD 3H8ZA 3RBBB 4IALA 5GANg 1VQNA 8AT1B 2RQUA 1B07A 3EGDA 5CCAA 5CC4A 3MKDA 4P2CB 4YHHQ 4C5IA 1QOHA 2RN8A 2DD4A 2WB1G 3J80L 2RBMA 1IXDA 2HD3A 3VS2A 3UA6A 3HKZB 5EGTA 2EYLA 1HZ9A 4BA1I 1QNKA 4C3JB 1PTOC 3SVMA 3CD6T 1H92A 2KDSA 5CKDA 3EG9A 1P92A 1MD2D 4CJ0B 1HA6A 1FJGQ 1UGPB 5JVG3 4PZ7A 3VS4A 2WAQG 1BBZA 3B6YA 5ELOA 5HURA 3QIIA 3E9FA 3C46A 1IGUA 2JTMA 2WINB 4AFZC 1I4QA 2DF6A 3CRKC 3OS5A 4X3KA 4E7ZA 4ATOA 1QWFA 2KRMA 3UDIA 2FB7A 3S14H 2J6FA 1DM0B 3BDUA 5GADC 4KBMB 4JI8Q 2EJGC 5D65A 3MP1A 3KJPA 1MJEA 3EAEA 5C6SA 4BD3A 1PHTA 5GAN7 1B50A 2V26A 3E3XA 2MO1A 4C5EA 4C3HG 2YHTA 2DJFC 2E64A 3JCMe 3OYGA 1IYUA 4F7UF 2WKDA 2DN8A 1BR9A 3FP9A 4JI8L 5C0MA 4IPHA 2UXBL 2BE7D 3IQLA 2LFNA 1ABQA 4CC2A 1GFDA 1CSQA 1V76A 2V1RA 5DY9A 2EPBA 3K59A 3VS3A 1AOJA 3JAMi 1WYXA 1Y8PB 2LS01 4XYOA 2FZCB 3RR5A 4A3GB 4D8DA 2H1EA 3K8AA 3TQ7P 4DK0A 4BBSG 1AE3A 4FF1A 3KDFB 4A3IB 2JA5H 2JSOA 3TVTA 2ATCB 1ZUKA 2R7ZB 1QJOA 1QQJA 1KAWA 2IPKD 5IH2A 2ZPFB 3OYYA 3M0SA 1CHPD 1UWVA 3VYGA 5KCOA 2RF4A 5IWAQ 3DLLA 2B2UA 4C92G 2RDGA 5CR2A 1ML0D 1YZ6A 1ZBXA 1HNXQ 2KT8A 4WTOB 1Q82R 1MBYA 4HEDA 2VL6A 4JRPA 4JJBA 2H3EB 1A0NB 1ESRA 2VUBA 4JLGA 3OYJA 3C1FA 4HCEA 3LH0A 3CMET 3TEHB 4X1VA 3IL8A 3MXPA 3Q0AA 4MDWA 2A36A 2RJFA 5M5YH 4PJOE 2JM8A 4XU1A 1EEID 1EYGA 1MMGA 1F9PA 2UUAL 2ATWA 1YCYA 1JJ2A 1Z9ZA 1E6GA 3CCQA 1I5LA 1GUOA 3NUCA 1PRMC 2JW4A 2JXMB 5C4ZA 2WSCE 2JP1A 1GJXA 1SSOA 2CP5A 2K3YA 4FSXA 2O5JC 2A28A 3C0CA 4JPBW 2OWOA 2EXDA 1LCKA 3M54A 4X9CA 3C95A 3JV3A 4PFPA 1V9PA 3NHHA 4A3BB 1U4LA 1ZYRD 2OT2A 2R7ZG 1FGBD 1VQ6A 3OY9A 1I0CA 4B9XA 1VQIA 1BU1A 1IKLA 5LMNL 4CKBA 1HNWL 2DUDA 4LD9K 3WOEA 1XTCD 1VDZA 3L3OC 4PJOA 1Z6HA 2PCFB 2EJFA 2F1MA 3E5SA 3A56A 2AMCB 2EYFA 3H6MA 1CK1A 1D0XA 2JT4A 1NG2A 5C3EG 3VYUA 1RLQC 2Q2UA 1D0ZA 4PG3A 5FW9A 1QCFA 4HT8A 2MK5A 1YHBA 4BY6C 1KRTA 1YWPA 2N55A 2ZXOA 2EYXA 2IWHA 2JMAA 2VW9A 2QXFA 3OTOL 4DA2A 1R77A 1SRUA 3M0RA 4DR2L 4LF6L 2ZM6L 2ALYB 4QMGA 4JI7L 2F3VA 2CSQA 2PZ1A 4O1NA 2CUDA 2ICEC 1RTNA 2JS2A 3VR4A 3MEUA 1SDFA 2PZWA 3K7AH 1TVXA 4A3LG 4KHPQ 1Q81R 4A3MG 4LF4Q 4JG2A 4J8OA 1J3TA 2G3RA 1NJIR 2M00A 4HVWA 1M1KC 1TKWB 4C3HB 3PFSA 4MTKA 2IY5B 2D2CC 4ZK9B 4DAPA 5GAOl 1EUJA 5GANh 1JWUD 2YUOA 3X25B 3DUZA 5C4JH 1YNZA 4NXNQ 1W6XA 4D6WA 2YUQA 3ULRB 3META 2O4XA 2B63G 5AFWA 1K1ZA 1I4XA 1XQHA 1V8QA 1ZSZA 3U50C 2MNAA 4JI2L 4M77C 3GTGH 4J15A 3MP6A 1JOOA 1QILA 4GNXB 2GTOA 4J9FA 3ITPA 2R93B 4DK1A 1PDQA 4BBRH 4J6YA 1U3OA 5CKEA 2F52A 2NN6H 1JQQA 1GOZA 4C2MB 1SNPA 4K8IA 5IYDG 1VQMQ 3JAME 2YUPA 2VXWA 3E9HA 3NENA 4N9PA 2G9DA 2PTKA 3PGZA 4C3IH 4OMNA 1YNJC 1VQ7Q 4LUVA 1DGSA 4X66Q 3OYDA 2AQ3B 2WV6D 1MMDA 3JAMc 5AYFA 2C06A 4A3CG 3UPUA 2F0SA 1VQFA 2H8HA 1VS0A 3REAB 2UXCL 1ILQA 5CV7A 4CDDC 3HKSA 2KEAA 3OYAA 3OHXC 1HFNA 3CKIB 2EDGA 3NBHB 4EMGA 1HNZL 2EJ9A 1V43A 5GROA 1VQAA 1LT3D 1UGQB 2I2LA 1GKHA 2F0EA 3L2ZA 3PIPA 2Z1CA 4NP5A 5CBAE 3SHLA 3V7SA 1ZSZC 1GHKA 4DNRB 5DEHA 3V2TA 1SXTA 3TSZA 3N52A 4Q0FA 1XMQL 1S40A 3SK6A 1WZOA 1TWGH 5GAN4 4ZKBB 1N36L 4CKCA 1H3HA 3MFGA 3PO3H 4GLVB 1PH1A 1BOSA 4IKFA 4LDXA 5M9OA 3CCJQ 1WHJA 3RNJA 4K6LA 1L1OB 2FMMA 5F2DA 4PNYA 4XQJA 2KGTA 2LTOA 1O7YA 2KRSA 2ZPEB 1AHJB 2DXUA 4ZGDB 5J3BA 1ET6A 2R6GA 2E2JH 1CKOA 5LL6S 1DYQA 4UY8C 1ASZA 2E2IH 1S5ED 2RHQB 2DZCA 4M7DA 1G2SA 5LJ5j 3C1EA 4A3MH 3TBIB 3E6ZX 3H94A 2F0NA 2QQ9A 2VVKA 2Z6BA 5FLMH 3A8MB 1TWCB 3S15B 4FF2A 4DR3Q 4MN3A 2UUCL 2TSSA 4LW1A 1SFOB 3GTLB 1CZWA 2FHTA 2X51A 2ID0A 2ED0A 4WRDA 1K73C 3E19A 1K9MU 3OMCA 1IGQA 4QVZA 2O2LD 2OTJA 1WLPB 3J7AV 1KLGD 4J9CA 1G3WA 1SSFA 2ZTDA 3MVVA 4XTYA 3KF6B 1PA6A 1JXMA 4J1MA 1N5ZA 1MIUA 4JJNK 1MV0B 3MAQA 3I9QA 1PZKD 2FMCA 1OXTA 3PUYA 1IYVA 1ZEQX 3NP8A 4GNXC 2PQWA 2CUBA 4KN7C 3CC7A 1YI2T 2MO0A 2EJFC 1RCVD 3HOZG 3P75A 2DYIA 2BUDA 4M7DC 1Y96B 3H0IA 3QB3A 3BYTB 3M9BA 1MUZA 1Q86U 3BVZA 4IQZA 2NZOA 4POGA 4JDSA 5LHY1 4A4EA 2VB6A 3CBPA 3HOVH 3X20B 4BA2I 2ZTEA 4QJFA 4C56C 2EWNA 1W2BA 1TWGB 1YIJT 1G2BA 2X35A 3I4MH 5I2MA 1K8MA 4ZNXA 3C2PA 1WD0A 3R6NA 3WVDB 4KULA 2JEBI 3QUIA 2YUNA 2B8AA 5KYLA 3HP9A 4RFBA 4OWWB 1IO6A 1KSWA 1NBEB 1BUVT 4DV7L 1WCMB 1PH8A 1EL0A 3F2BA 3MCAB 2ZXRA 3GD7A 3PIO3 1G3YA 4BDYA 1LT5D 2UUCQ 1BCOA 3WXMB 5FROA 2HSEB 2QQBA 4DV5Q 1N32L 4JS4A 2RQWA 1KIKA 2VY3A 5ECAA 1WHMA 2DM1A 5CVIA 3JCMJ 4LNQA 3JB9H 4LFBQ 1D6EC 2LSSA 2NB0A 4OMLA 3C12A 3DM3A 1GUTA 3ERSX 4X3SA 1W2BP 5ELEA 4DGZA 4FF4A 2ECZA 2PUKB 1O75A 3OYCA 2MIOA 4B3RL 1GD7A 1N9RA 2I0QA 2KEEA 2KBTA 2AQ1B 4L63B 1M4VA 2K5HA 1KXLA 1VQNT 4M7AA 2PYKA 4P75A 4G7OC 3DLMA 1ZYRC 4JBJA 1WFQA 1O7LA 2FFKB 1Y1WB 4OMPA 4DR4Q 4I7ZC 1Z47A 4C8QE 4IPCA 3RZOH 2K75A 3QZ9B 4DUYL 1MSHA 4DQ2A 4X6AH 1OULA 1VQ7T 2MI6A 1D3BA 4LNPA 1X3EA 3S17H 2IVWA 2WSFE 4UP9A 2IX3A 3QHSA 4ZGJB 1V1QA 2JA6B 4K0KQ 1TXQA 2GNCA 1Q90A 4KHVA 4IOAA 2E70A 1OTCA 4Y28E 3KUPA 1NPPA 1HJDA 2XTIA 2EBPA 3G7ZA 2O9VA 5EPLA 2AWOA 1VYTA 3SWNA 3HKZE 2MYSA 4NMZA 2XICA 2K6DA 1SYEA 4PFZA 3CF5A 2Q2HA 2DL8A 1K9MR 1I3QH 4OGEA 5CKHA 3P8DA 5LJ3e 2OTLT 2RCNA 4M75G 1STHA 1L0XB 1TG0A 1UECA 1VQ8T 4QB4A 4C3HH 3CPWP 5IT9c 1WJJA 2QKIC 4XXEA 4B6MA 3UWNA 4DEYA 5A0DA 2BZXA 1GXIE 3EQLC 3J81L 2FRWA 1WXUA 2LJ3A 3GV6A 5IGDA 1Y0MA 4JI1Q 2JEAI 3GTOH 3L2UA 1NE8A 2AT1B 1O80A 4R1JA 1Q7YC 3MA2B 1JEGA 2F0FA 1EY9A 4C8QD 4HMJA 2RHIA 1XPRA 2RD1A 2X4WA 2YTXA 3LGJA 4XTXA 3QO3A 5D7UA 1GFCA 2VC8A 4ORZA 1QZHA 4FW1A 1DOMA 5CV8A 4AFQC 4ABNA 4JV5Q 8ATCB 1OU9A 1M90U 3CP0A 2COWA 3SE0A 1YCSB 1YWOA 3D4RA 1WD1A 3NGPA 3SFMA 2K5NA 2RK2A 4YCVA 2JA8B 5M5YB 1KQSA 2DIGA 1GCPA 5G3LD 4A3KH 4KY5A 3KLWA 2DIQA 3M53A 2R5AA 4YY3Q 1MMNA
chains in the Genus database with same CATH topology
2O9SA 2DL3A 3UF4A 1UFFA 3I5RA 4DEXA 3PE0A 2LP5A 2LNHB 4Z89A 2C0OA 4F16A 5GJVB 2EKHA 2K2MA 1UTIA 4LE9A 1T3SA 2LQWA 2D1XA 5IXFA 4A63B 4RTZA 5L23A 2HBWA 5IHNA 2DJQA 1AZGB 1ZX6A 1ZSGA 2W10A 1HSQA 4Y92A 1NYGA 1NEBA 1YN8A 4LUDA 1M3CA 4Z88A 3VRYA 1X27A 1UDLA 2KXDA 2JTEA 1TUDA 1HD3A 4IIMA 1M8MA 1AZEA 1B3QA 1AWOA 4M4ZA 3THKA 2YDLA 1H8KA 1TUCA 1RI9A 1BB9A 2JMCA 2P4RA 4GLMA 1E6HA 1M3AA 2V1QA 4HVUA 2SEMA 2KNBB 5I22A 1NYFA 3M0UA 4JZ3A 1PRLC 2EPDA 3VRZA 1T0HA 2ESWA 1WDXA 2GBQA 1ZUYA 1QWEA 1SSHA 2E5KA 1UHFA 3PVLA 1UG1A 4IIOA 3KFVA 1VA7A 2MCNA 2FO0A 4WCIA 2L3SA 2CSIA 1OPLA 2K9GA 1BK2A 1CKAA 4RTUA 1ZUUA 2NUZA 2XMFA 2LZ6B 1KFZA 2DX1A 1M30A 1WX6A 2AK5A 2FPEA 2O31A 1X2QA 1K9AA 1Y57A 4CC4B 1QKWA 2GQIA 1UHCA 1M3BA 4AG2C 3SEMA 3RBBB 1PWTA 2DBKA 1B07A 2RQUA 1UUEA 2OAWA 4QT7A 2RN8A 1T0JA 1JO8A 3VS2A 3UA6A 2X3WD 1RUWA 3M0TA 1JXOA 2CH4W 1H92A 1FYNA 1YP5A 2DLPA 2QDLA 2VKNA 2F2XA 3VS4A 1BBZA 4RTWA 2L3QA 2ROTA 2EYWA 1I07A 2DF6A 4AFZC 1QWFA 2KRMA 2K79A 2J6FA 3SHWA 2FRYA 1ABOA 1ZBJA 1PHTA 2GTJA 2DRMA 2YSQA 1UJYA 2A08A 2ENMA 3IQLA 1ARKA 1ABQA 4CC2A 1AVZC 1GFDA 2V1RA 2CT4A 3VS3A 1AOJA 2RQRA 1UJ0A 1WYXA 2LJ0A 1K0XA 4D8DA 4D8KA 1VYVA 3TVTA 1ZUKA 2VWFA 1OPKA 2BZ8A 5IH2A 3M0SA 3VS7A 1X6BA 1GRIA 4OMOA 4AFSC 1S1NA 2KT8A 2CDTA 4JJBA 3VS0A 1NEGA 1A0NB 2HSPA 2K7AA 4X1VA 4EIKA 2A36A 2L3PA 2LCSA 2JM8A 2IIMA 1WA7A 4KRTA 2O88A 1Z9ZA 2F2VA 1E6GA 3H0FA 1K76A 1PRMC 2JW4A 3UATA 2A28A 3C0CA 3FJ5A 4JPBW 2FG0A 1K4US 1LCKA 1NM7A 2DNUA 3JV3A 2LJ1A 2CT3A 1X2KA 1I0CA 1BU1A 2W0ZA 1GCQA 2J6OA 1WI7A 4OMMA 4HVVA 2HCKA 2RPNA 1KJWA 2JT4A 1NG2A 3I5SA 1RLQC 5FW9A 1QCFA 2EGCA 5FWCA 3EG1A 1YWPA 2OI3A 2EYXA 2RQVA 3NMZC 2JMAA 2DA9A 3QWYA 5IHIA 4F17A 2ED1A 3M0RA 2KRNA 1U06A 5HCKA 2CSQA 2JS0A 2PZ1A 2EYZA 2CUDA 4RTYA 3GBQA 2JS2A 1SPKA 1T3LA 1V1CA 2LQNA 2NWMA 1AWJA 1J3TA 4HXJA 2MOXA 4JJDA 4J9IA 1OOTA 4HVWA 4OMQA 1AWXA 4J9BA 2YUOA 3EG0A 1YNZA 3TSWA 4LN2A 1W6XA 2YUQA 3ULRB 2FPFA 2EYYA 1K1ZA 3PVQA 1AD5A 2AZSA 4J9DA 5EC7A 2DBMA 4RTVA 2D8HA 2GTOA 4J9FA 2CH4A 1U3OA 4R0KA 1JQQA 4RUGA 2YUPA 1AEYA 2KYMA 2PTKA 1CSKA 4LUEA 4OMNA 2D0NA 3VS6A 2F2WA 2KXCA 3H41A 1ZLMA 2ABLA 2H8HA 3REAB 2GGRA 1W70A 4FSSA 2KEAA 2M0YA 1SRLA 1Z9QA 5FWBA 2ROLA 3TSZA 2K3BA 1NLOC 2DYBA 1SHGA 1H3HA 3RNJA 2HDAA 1NLPC 1K0SA 2KGTA 2KRSA 1GBQA 1SHFA 1X69A 2X3XD 1X6GA 2J06A 2SRCA 4J9HA 3H0HA 4ESRA 1WFWA 3UA7A 2VVKA 2HEQA 1VYUA 2KR3A 2KROA 1SEMA 2EW3A 2ED0A 4HCKA 1W1FA 4JJCA 2EQIA 4F14A 5IHKA 1WLPB 2DL5A 3EG2A 4J9CA 4E6RA 1XOVA 2J7IA 3I35A 1JXMA 1N5ZA 4Z8AA 3EHRA 1MV0B 3I9QA 2AZVA 1MV3A 2RF0A 1WXTA 3U23A 2JM9A 2CUBA 2L2PA 5GJWB 2I0NA 3REBB 2BZYA 2BTTA 1QKXA 3H0IA 2J05A 1E7OA 1MUZA 1U5SA 1G83A 2DMOA 4CC7A 2DL7A 3A98A 1JU5C 2DE0X 2M51A 3ZL7C 1G2BA 1QLYA 4J9EA 2J6KA 4ZNXA 2EVRA 3R6NA 3QWXX 1UGVA 2YUNA 2DILA 1IO6A 1KSWA 5IXBA 2PNIA 2AKKA 1I1JA 2A37A 2LMJA 1UE9A 3M0PA 2JXBA 1X43A 2RQWA 1KIKA 1CKBA 2DM1A 5ECAA 2L0AA 1WXBA 4OMLA 2DVJA 4RTXA 4JZ4A 2ECZA 1FMKA 2MIOA 1GCQC 2FEIA 2KBTA 2DRKA 2RNAA 1OEBA 4OMPA 1PNJA 3O5ZA 4GBQA 2EGAA 4J9GA 1EFNA 2CREA 2RQTA 4LNPA 2LX7A 2GNCA 1HJDA 2EBPA 3EHQA 2EGEA 2O9VA 1VYTA 4CC3A 1PKSA 2K6DA 1GBRA 4AG1C 2DL8A 3NPFA 2OJ2A 1RLPC 3VS1A 2B86A 1TG0A 1UECA 1M27C 4AFUC 4DEYA 2C0TA 2BZXA 2FRWA 1WXUA 2LJ3A 2G6FX 3NHNA 1Y0MA 2O2OA 2KT1A 3M0QA 4RTTA 5I11A 2KYBA 1JEGA 3LH5A 3VS5A 1OV3A 3EGUA 1GFCA 2YT6A 3EG3A 1SRMA 4ORZA 2KE9A 4AFQC 2RMOA 1PKTA 1WIEA 1YCSB 1YWOA 3CQTA 2C0IA 3NGPA 1AWWA 2FPDA 1GCPA 4K11A 2AKLA 2D8JA 1GL5A 2DL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9S A;  2DL3 A;  3UF4 A;  1UFF A;  3I5R A;  4DEX A;  3PE0 A;  2LP5 A;  2LNH B;  4Z89 A;  2C0O A;  4F16 A;  5GJV B;  2EKH A;  2K2M A;  1UTI A;  4LE9 A;  1T3S A;  2LQW A;  2D1X A;  5IXF A;  4A63 B;  4RTZ A;  5L23 A;  2HBW A;  5IHN A;  2DJQ A;  1AZG B;  1ZX6 A;  1ZSG A;  2W10 A;  1HSQ A;  4Y92 A;  1NYG A;  1NEB A;  1YN8 A;  4LUD A;  1M3C A;  4Z88 A;  3VRY A;  1X27 A;  1UDL A;  2KXD A;  2JTE A;  1TUD A;  1HD3 A;  4IIM A;  1M8M A;  1AZE A;  1B3Q A;  1AWO A;  4M4Z A;  3THK A;  2YDL A;  1H8K A;  1TUC A;  1RI9 A;  1BB9 A;  2JMC A;  2P4R A;  4GLM A;  1E6H A;  1M3A A;  2V1Q A;  4HVU A;  2SEM A;  2KNB B;  5I22 A;  1NYF A;  3M0U A;  4JZ3 A;  1PRL C;  2EPD A;  3VRZ A;  1T0H A;  2ESW A;  1WDX A;  2GBQ A;  1ZUY A;  1QWE A;  1SSH A;  2E5K A;  1UHF A;  3PVL A;  1UG1 A;  4IIO A;  3KFV A;  1VA7 A;  2MCN A;  2FO0 A;  4WCI A;  2L3S A;  2CSI A;  1OPL A;  2K9G A;  1BK2 A;  1CKA A;  4RTU A;  1ZUU A;  2NUZ A;  2XMF A;  2LZ6 B;  1KFZ A;  2DX1 A;  1M30 A;  1WX6 A;  2AK5 A;  2FPE A;  2O31 A;  1X2Q A;  1K9A A;  1Y57 A;  4CC4 B;  1QKW A;  2GQI A;  1UHC A;  1M3B A;  4AG2 C;  3SEM A;  3RBB B;  1PWT A;  2DBK A;  1B07 A;  2RQU A;  1UUE A;  2OAW A;  4QT7 A;  2RN8 A;  1T0J A;  1JO8 A;  3VS2 A;  3UA6 A;  2X3W D;  1RUW A;  3M0T A;  1JXO A;  2CH4 W;  1H92 A;  1FYN A;  1YP5 A;  2DLP A;  2QDL A;  2VKN A;  2F2X A;  3VS4 A;  1BBZ A;  4RTW A;  2L3Q A;  2ROT A;  2EYW A;  1I07 A;  2DF6 A;  4AFZ C;  1QWF A;  2KRM A;  2K79 A;  2J6F A;  3SHW A;  2FRY A;  1ABO A;  1ZBJ A;  1PHT A;  2GTJ A;  2DRM A;  2YSQ A;  1UJY A;  2A08 A;  2ENM A;  3IQL A;  1ARK A;  1ABQ A;  4CC2 A;  1AVZ C;  1GFD A;  2V1R A;  2CT4 A;  3VS3 A;  1AOJ A;  2RQR A;  1UJ0 A;  1WYX A;  2LJ0 A;  1K0X A;  4D8D A;  4D8K A;  1VYV A;  3TVT A;  1ZUK A;  2VWF A;  1OPK A;  2BZ8 A;  5IH2 A;  3M0S A;  3VS7 A;  1X6B A;  1GRI A;  4OMO A;  4AFS C;  1S1N A;  2KT8 A;  2CDT A;  4JJB A;  3VS0 A;  1NEG A;  1A0N B;  2HSP A;  2K7A A;  4X1V A;  4EIK A;  2A36 A;  2L3P A;  2LCS A;  2JM8 A;  2IIM A;  1WA7 A;  4KRT A;  2O88 A;  1Z9Z A;  2F2V A;  1E6G A;  3H0F A;  1K76 A;  1PRM C;  2JW4 A;  3UAT A;  2A28 A;  3C0C A;  3FJ5 A;  4JPB W;  2FG0 A;  1K4U S;  1LCK A;  1NM7 A;  2DNU A;  3JV3 A;  2LJ1 A;  2CT3 A;  1X2K A;  1I0C A;  1BU1 A;  2W0Z A;  1GCQ A;  2J6O A;  1WI7 A;  4OMM A;  4HVV A;  2HCK A;  2RPN A;  1KJW A;  2JT4 A;  1NG2 A;  3I5S A;  1RLQ C;  5FW9 A;  1QCF A;  2EGC A;  5FWC A;  3EG1 A;  1YWP A;  2OI3 A;  2EYX A;  2RQV A;  3NMZ C;  2JMA A;  2DA9 A;  3QWY A;  5IHI A;  4F17 A;  2ED1 A;  3M0R A;  2KRN A;  1U06 A;  5HCK A;  2CSQ A;  2JS0 A;  2PZ1 A;  2EYZ A;  2CUD A;  4RTY A;  3GBQ A;  2JS2 A;  1SPK A;  1T3L A;  1V1C A;  2LQN A;  2NWM A;  1AWJ A;  1J3T A;  4HXJ A;  2MOX A;  4JJD A;  4J9I A;  1OOT A;  4HVW A;  4OMQ A;  1AWX A;  4J9B A;  2YUO A;  3EG0 A;  1YNZ A;  3TSW A;  4LN2 A;  1W6X A;  2YUQ A;  3ULR B;  2FPF A;  2EYY A;  1K1Z A;  3PVQ A;  1AD5 A;  2AZS A;  4J9D A;  5EC7 A;  2DBM A;  4RTV A;  2D8H A;  2GTO A;  4J9F A;  2CH4 A;  1U3O A;  4R0K A;  1JQQ A;  4RUG A;  2YUP A;  1AEY A;  2KYM A;  2PTK A;  1CSK A;  4LUE A;  4OMN A;  2D0N A;  3VS6 A;  2F2W A;  2KXC A;  3H41 A;  1ZLM A;  2ABL A;  2H8H A;  3REA B;  2GGR A;  1W70 A;  4FSS A;  2KEA A;  2M0Y A;  1SRL A;  1Z9Q A;  5FWB A;  2ROL A;  3TSZ A;  2K3B A;  1NLO C;  2DYB A;  1SHG A;  1H3H A;  3RNJ A;  2HDA A;  1NLP C;  1K0S A;  2KGT A;  2KRS A;  1GBQ A;  1SHF A;  1X69 A;  2X3X D;  1X6G A;  2J06 A;  2SRC A;  4J9H A;  3H0H A;  4ESR A;  1WFW A;  3UA7 A;  2VVK A;  2HEQ A;  1VYU A;  2KR3 A;  2KRO A;  1SEM A;  2EW3 A;  2ED0 A;  4HCK A;  1W1F A;  4JJC A;  2EQI A;  4F14 A;  5IHK A;  1WLP B;  2DL5 A;  3EG2 A;  4J9C A;  4E6R A;  1XOV A;  2J7I A;  3I35 A;  1JXM A;  1N5Z A;  4Z8A A;  3EHR A;  1MV0 B;  3I9Q A;  2AZV A;  1MV3 A;  2RF0 A;  1WXT A;  3U23 A;  2JM9 A;  2CUB A;  2L2P A;  5GJW B;  2I0N A;  3REB B;  2BZY A;  2BTT A;  1QKX A;  3H0I A;  2J05 A;  1E7O A;  1MUZ A;  1U5S A;  1G83 A;  2DMO A;  4CC7 A;  2DL7 A;  3A98 A;  1JU5 C;  2DE0 X;  2M51 A;  3ZL7 C;  1G2B A;  1QLY A;  4J9E A;  2J6K A;  4ZNX A;  2EVR A;  3R6N A;  3QWX X;  1UGV A;  2YUN A;  2DIL A;  1IO6 A;  1KSW A;  5IXB A;  2PNI A;  2AKK A;  1I1J A;  2A37 A;  2LMJ A;  1UE9 A;  3M0P A;  2JXB A;  1X43 A;  2RQW A;  1KIK A;  1CKB A;  2DM1 A;  5ECA A;  2L0A A;  1WXB A;  4OML A;  2DVJ A;  4RTX A;  4JZ4 A;  2ECZ A;  1FMK A;  2MIO A;  1GCQ C;  2FEI A;  2KBT A;  2DRK A;  2RNA A;  1OEB A;  4OMP A;  1PNJ A;  3O5Z A;  4GBQ A;  2EGA A;  4J9G A;  1EFN A;  2CRE A;  2RQT A;  4LNP A;  2LX7 A;  2GNC A;  1HJD A;  2EBP A;  3EHQ A;  2EGE A;  2O9V A;  1VYT A;  4CC3 A;  1PKS A;  2K6D A;  1GBR A;  4AG1 C;  2DL8 A;  3NPF A;  2OJ2 A;  1RLP C;  3VS1 A;  2B86 A;  1TG0 A;  1UEC A;  1M27 C;  4AFU C;  4DEY A;  2C0T A;  2BZX A;  2FRW A;  1WXU A;  2LJ3 A;  2G6F X;  3NHN A;  1Y0M A;  2O2O A;  2KT1 A;  3M0Q A;  4RTT A;  5I11 A;  2KYB A;  1JEG A;  3LH5 A;  3VS5 A;  1OV3 A;  3EGU A;  1GFC A;  2YT6 A;  3EG3 A;  1SRM A;  4ORZ A;  2KE9 A;  4AFQ C;  2RMO A;  1PKT A;  1WIE A;  1YCS B;  1YWO A;  3CQT A;  2C0I A;  3NGP A;  1AWW A;  2FPD A;  1GCP A;  4K11 A;  2AKL A;  2D8J A;  1GL5 A;  2DL4 A; 
#chains in the Genus database with same CATH topology
 3STB D;  2DL3 A;  2K2V A;  3L2R A;  5CKB A;  3GIB A;  1UFF A;  2PVD B;  2F0G A;  1PH3 A;  1KNA A;  2NVQ B;  3ERQ A;  3MEW A;  1NTG A;  1IBM L;  3GTP H;  2C0O A;  4A3K G;  2XNA C;  5KRU A;  1YHQ A;  4M77 A;  1UTI A;  3HRT A;  1RI0 A;  2CP0 A;  1SR3 A;  2R7Z H;  1QMC A;  1I4G A;  3D0F A;  2UUA Q;  4DV1 Q;  2QI2 A;  2K57 A;  1HZB A;  2B39 A;  2I5L X;  1VQ9 Q;  2XDB A;  1SYB A;  5HGQ A;  4Y7N B;  4X65 Q;  4DAV A;  5IXF A;  3QR8 A;  3PUZ A;  5LMN W;  1SYD A;  3G6J B;  1CI3 M;  2WAQ B;  1WPY A;  4MNO A;  5IHN A;  2DJQ A;  1O7Z A;  1ZX6 A;  3RUX A;  2MPX C;  3CEY A;  5E4W C;  4GS3 A;  1F2Z A;  1WTX A;  1H9R A;  2A7Y A;  3HTR A;  5DAU A;  3G71 T;  4K0K L;  4E7K A;  4IPD A;  1NYG A;  5CBE E;  3RER A;  4F7U G;  2ZZD A;  1VOM A;  3ONA B;  5C44 H;  3W5O A;  2MMP A;  2EFI A;  1RAD B;  3CC4 Q;  2OXP A;  3LLR A;  3M4Q A;  3G6E Q;  4KHZ A;  2MF2 A;  5GMK l;  1NJI U;  1QVF A;  4RMF A;  3NFC A;  1UDL A;  2KXD A;  2SDF A;  5K36 G;  1HD3 A;  4IIM A;  1TUG B;  4C8Q F;  4DAY A;  5I4D A;  3AEV A;  2F0L A;  3BYY B;  4ZUI A;  2HD0 A;  5GAO n;  2XDD A;  1Q7Y R;  3HOV B;  1TUC A;  4DN4 M;  3S1Q B;  2Q8T A;  1FYC A;  4BBS B;  3QOJ A;  4X9D A;  2RHX A;  4N0A A;  4EMH A;  4EGV A;  4DOV A;  4PL6 A;  1OO9 B;  4TVA B;  1EY4 A;  1YJW A;  3QSU A;  4GLM A;  1JWS D;  3CXC P;  5D14 A;  1OXS C;  3M57 A;  4A3F H;  1M3A A;  1E1T A;  3BZC A;  3LX7 A;  2V1Q A;  1N32 Q;  1LT6 D;  3T1H Q;  5EPK A;  2KNB B;  2QQA A;  3JCM c;  3MXN A;  3HOU H;  3EFO A;  5IOD A;  3RKW A;  1NYF A;  2QCP X;  3M55 A;  4N8X 1;  2DD5 A;  2KEC A;  1D1I A;  3K57 A;  1Y96 A;  2SNM A;  3QBY A;  3JSC A;  5KEE A;  4O0A A;  4II1 A;  1QWE A;  1SSH A;  2VAS A;  2E5K A;  2NZ1 D;  1UHF A;  2CYZ B;  3HKZ G;  3PVL A;  1ZXT A;  1SFO H;  3GTL H;  2K28 A;  3T13 A;  1TWC H;  3S15 H;  2IL8 A;  2E8G A;  3DHQ A;  2ZPI B;  4L5R C;  4C0Z A;  3F1Z A;  4GLA C;  2UXB Q;  3T9N A;  3VDY A;  3CME Q;  1ZUU A;  4L8J A;  1TTH B;  1AEX A;  2LCC A;  3SR1 A;  2DX1 A;  4IN3 A;  4YCW A;  2X4X A;  5LJ5 h;  5IGG A;  1Q81 C;  2HT1 A;  1Y57 A;  1RTO A;  5M3F B;  4A93 B;  1VQ9 T;  1QP2 A;  1L1O A;  3ZJY C;  3VUZ A;  4DKA C;  3L2Q A;  1M3B A;  1ESF A;  2M16 A;  2XSC A;  1G6Z A;  1FL0 A;  5C0X I;  1PWT A;  2EJM A;  3KDF A;  1XPU A;  1KTK A;  1UUE A;  4L6V 5;  1U0L A;  1WYD A;  4XIG S;  4K6D A;  2OAW A;  1VQ8 A;  3CRL C;  5GQO A;  1E22 A;  1U9R A;  2PW5 A;  4FL6 A;  5CV9 A;  3K5L A;  4ZLT F;  2E5Q A;  2X3W D;  2BIV A;  1UE6 A;  1UE7 A;  3EGX B;  2NWG A;  1JXO A;  5FU7 C;  3PTA A;  1SJE D;  1KAB A;  3K0Y A;  2CH4 W;  1Z9F A;  3FDT A;  1I50 H;  4DV4 L;  2K5D A;  1YP5 A;  2QDL A;  5HY6 A;  4PQX A;  3J7Y W;  1IXR A;  4AYB G;  1I4P A;  4MHE A;  2HHH Q;  3E9I A;  3GTM H;  4RKB A;  2L3Q A;  1M5Q 1;  1VQ4 A;  3FKI B;  3NWS A;  4J6W A;  1K3R A;  1X9N A;  3OYE A;  1HXD A;  1Y1V G;  1R0B G;  3J7A 5;  5DM7 R;  2SNS A;  3GDE A;  5COY A;  4JI6 Q;  4FW2 A;  1EY5 A;  4DV3 L;  4YWM A;  3U4Z A;  1ABO A;  1OXV A;  4RGM A;  1ZBJ A;  2UU9 L;  2EY5 A;  3LYI A;  2Q2I A;  3BZD B;  2DRM A;  5G3L F;  2YSQ A;  4DR3 L;  1WI5 A;  4GKJ L;  3S1M H;  1PSE A;  1UJY A;  4ELY C;  2QA4 T;  4RA8 A;  2EYO A;  2B2Y C;  3INZ A;  2HZY A;  1P16 A;  2YXY A;  4LFC L;  2LXJ A;  4K14 A;  4TVR A;  1TS4 A;  3PSI A;  4A75 A;  1EYD A;  3I7F A;  3S3M A;  2VQE L;  4IUR A;  4KN4 C;  1C48 A;  2UXC Q;  1JE5 A;  1SJH D;  1BBX C;  3H0G B;  3HOW G;  1F1B B;  1D1C A;  1I81 A;  1CKN A;  3VYH B;  2L15 A;  1N8R U;  3NBI A;  5FLX L;  1JJ2 P;  2KED A;  4JV5 L;  1F9R A;  2CW0 C;  3GP7 A;  4DUZ L;  5FJ8 G;  2AHO B;  4AYB E;  2VWF A;  1A15 A;  3PUX A;  3R2T A;  3H3V I;  3VS7 A;  1G3T A;  1HPC A;  4ZN1 A;  4JRQ A;  2FHD A;  1Y1V B;  1KHC A;  3HSB A;  2CZ6 B;  5DM7 3;  1JOR A;  5I9O A;  2K5L A;  1T5X D;  4ZTJ A;  1TS2 A;  4TKO B;  1U5K A;  3M4G A;  1U8R A;  2HSP A;  5BN5 A;  1BNZ A;  3BFM A;  3HOZ H;  4M7D G;  3WOF A;  1M1K U;  3GTO B;  1PG5 B;  3OYL A;  4OB0 B;  1H64 1;  3CCS T;  2B29 A;  3URG A;  2HUG A;  3EVQ A;  3ULL A;  1PV4 A;  2H3J A;  2YWW A;  2O88 A;  2J7Z A;  1MMA A;  1PSF A;  4A3C H;  2F2V A;  2WKC A;  1UB4 A;  2B8F A;  1X32 A;  2EQS A;  1EIG A;  3F70 A;  5GAO p;  3KF8 A;  4C0F A;  2F0Q A;  4N4I A;  3I55 T;  1VMP A;  3I8Z A;  3JCM W;  1LNX A;  2HDM A;  1HRJ A;  4EQN A;  1JBM A;  3FB9 A;  2KA7 A;  2UXD Q;  3ZEH A;  3ULJ A;  2K33 A;  2OTJ T;  3HHT B;  2W0Z A;  1TWH H;  3I91 A;  1NR4 A;  1CT1 D;  4LAA A;  3X3M A;  4DAY B;  5C6A A;  3HOX B;  2J6O A;  2JA6 H;  2K5W A;  3CCE A;  4U67 3;  4ME7 A;  1N34 Q;  3BS1 A;  2VYT A;  4EPC A;  2F1L A;  2QA4 A;  1K8A C;  4HVV A;  2RB6 A;  3PUW A;  3NPP A;  2RPN A;  4DR2 Q;  1KJW A;  4GLX A;  5JJK A;  3OWE B;  3GNF B;  2ZXP A;  3T56 B;  1HR0 Q;  4MTN A;  3PNW C;  1XPO A;  3S1M B;  2Z8L A;  1GVP A;  1M2O A;  2ZAE A;  2MPM A;  1O78 A;  5KYN A;  1H3Z A;  3I90 A;  1M1F A;  1TXY A;  1VUB A;  3BW1 A;  1BBW A;  3NMZ C;  1Y71 A;  2DA9 A;  2E3H A;  2LC4 A;  1IHW A;  4F17 A;  1CHQ D;  4PZ8 A;  1UAP A;  2ED1 A;  1D2B A;  1LUZ A;  5IGC A;  1FXX A;  1SE3 A;  2F3I A;  2KRN A;  3CHB D;  4POF A;  1VQO Q;  1BBU A;  4KKU A;  1EIY B;  2JS0 A;  2KHS A;  4C0D C;  5HKC A;  3N6R A;  4HT9 A;  1EQV A;  2DVE A;  4XTC S;  1PH2 A;  1SPK A;  5EQ0 A;  3ERO A;  1T3L A;  1SLJ A;  4BAC A;  4M78 A;  2UUB Q;  1VQO T;  1HR0 W;  2NWM A;  4DV7 Q;  4LFA Q;  3R2I A;  2A3L A;  4HXJ A;  4LF8 Q;  4JJD A;  1QVF P;  1JR0 D;  2XD0 A;  5J22 A;  3DWQ A;  1VQD A;  1OOT A;  3TRE A;  1VQP T;  5FO8 B;  4OMQ A;  3GP8 A;  1D5M C;  5I2Y A;  2Z4I A;  1VIE A;  4C5G A;  3W1B A;  3WWV A;  1Z7T A;  3J80 c;  4LF9 Q;  2CZ1 B;  3EG0 A;  4RWS C;  1VQG A;  5A35 A;  1IRE B;  2QQS A;  2VQF Q;  1I6H H;  3GTJ B;  3OB9 A;  5IIF A;  3I56 A;  1DOK A;  2AZS A;  2RDH A;  4J9D A;  5EC7 A;  4M7D E;  1FR3 A;  1HTP A;  4P71 A;  4YWL A;  2D8H A;  2K5I A;  3EG9 B;  4PV1 C;  3JB9 I;  3RN5 A;  1QNU A;  4LJZ C;  1QG7 A;  1XNR L;  3M59 A;  1NZ9 A;  2E2H B;  4R0K A;  2R92 G;  2KUM A;  1PRT C;  2EIF A;  4UC4 A;  5IP9 H;  2F0H A;  1KIX A;  1V1O A;  2EOT A;  1GUW A;  2EE1 A;  3KJO A;  4LUE A;  3S1N H;  3S16 H;  1S72 Q;  1WTP A;  2D0N A;  3E2U A;  1XTD A;  2CP3 A;  2HNI A;  2JN0 A;  2YYZ A;  4JOI C;  5AJ3 Q;  1STB A;  1W70 A;  2A8V A;  3EFR A;  3RES A;  1Q86 C;  2FVU A;  2QGQ A;  4KV6 A;  5GAM g;  4DV3 Q;  3OYN A;  3OYI A;  4KGZ B;  3IKJ A;  3A7L A;  2DTI A;  2XKO C;  5GAN 5;  2K5Q A;  1A8V A;  2JK8 A;  1FGU A;  2OTL Q;  3D6W A;  3KBX A;  5LJ3 g;  2F0M A;  3L9A X;  5FWB A;  3LWE A;  5IWA L;  5IYC G;  2VS1 A;  3VKI A;  3H6Z A;  1JB0 E;  1SHG A;  3RMS A;  4RHS A;  5JEA H;  4KUD K;  1TQO A;  1JE4 A;  2YRD A;  1YIT A;  2F0I A;  3L7Z C;  4HN7 A;  1OX9 A;  5E1F A;  1NLP C;  2COY A;  1SKU B;  3AT1 B;  4FYD A;  2DPP B;  5GAN j;  1SHF A;  2QEX A;  1IKM A;  2X3X D;  2HIX A;  4HJA A;  1XJW B;  2J06 A;  3MEF A;  2VQF L;  2SRC A;  4J9H A;  1AH9 A;  3S2H B;  1R9T H;  1WFW A;  2AUK A;  1K8G A;  2P4T A;  3PQI A;  5FLX c;  3DEO A;  5CGK A;  3UA7 A;  1JIC A;  1SN8 A;  2V4D A;  4JK1 C;  2K14 A;  2ZGW A;  2KR3 A;  2KCC A;  3G1J A;  5IGB A;  2K4Y A;  1HUM A;  1SEM A;  3QJY A;  4LD6 A;  4F7U E;  1M8A A;  2K32 A;  4RGT A;  3ND8 A;  4FO2 A;  1EQQ A;  4HJ8 A;  1W1F A;  2DK3 A;  3JCM Q;  4IUQ A;  2JUF A;  4F14 A;  4R9W A;  2MWO A;  3G4S T;  4E6R A;  1W3S A;  1VQL Q;  1SMX A;  2GVA A;  3I35 A;  3HOY G;  4E7H A;  3I2Z A;  3EIV A;  3L2V A;  4BS9 A;  4M7A B;  3EHR A;  1XMO L;  1C7Y A;  2KY9 A;  3FPU B;  1SNM A;  2PQE A;  3QJ6 A;  2NVT H;  4OWX B;  2RF0 A;  2VB2 X;  4HIK A;  1YIJ Q;  5C4X H;  4C2M H;  3OS0 A;  3S2H H;  5J26 A;  3D6C A;  3MPU B;  3CC2 A;  1NMF A;  1SF9 A;  4RKL A;  3V8K A;  1PRT B;  1VQB A;  2AWN A;  4NXM Q;  1E7O A;  5FLX E;  2L5T A;  5GMK e;  2NN6 I;  3W1G A;  1VQM T;  3TQY A;  4CC7 A;  2DL7 A;  4N0A C;  4BWG B;  3OA6 A;  5IE8 A;  3ZL7 C;  1QCN A;  4M1U B;  2MWP A;  2YU9 H;  2V1C C;  4PJO F;  5KIX A;  4DF7 A;  1C6V X;  3Q6S A;  2DIL A;  4XT3 B;  5M5X H;  5JPM C;  2VXE A;  2E6Z A;  2RDF A;  2QDB A;  2YTV A;  3LWH A;  4H44 C;  2L5Q A;  4HCB A;  2PU9 B;  1IBK Q;  1RAE B;  3RNU A;  1I1J A;  1VQK Q;  1N6A A;  4GN3 B;  4FXK C;  1BIB A;  3H3V C;  1CKB A;  1M2V A;  2GVB A;  4N4H A;  3CXC S;  1YHA A;  3VU3 C;  4R55 A;  4M77 E;  1SE2 A;  4C3I G;  1CKM A;  2QAS A;  1HXY D;  2DVJ A;  2BCO A;  3Q24 A;  1TS9 A;  5IOC A;  2F4V Q;  1VQ5 A;  3NWT A;  2L0C A;  4IFD J;  2E1H A;  2PZT A;  4B9W A;  4LWC A;  2FEI A;  2F0O A;  2X69 A;  5KH6 A;  2PW7 A;  4F7U B;  5GMK h;  4A3D B;  2B2V C;  1OX8 A;  2RNA A;  4HAE A;  5CQX A;  2VGN A;  3CCV Q;  3JB9 F;  1P8L A;  2KQ3 A;  3NTK A;  4OO1 H;  4XDX A;  2RM4 A;  2OF1 A;  2RA4 A;  5D3I B;  1PNJ A;  5GAN d;  3OYB A;  2H4O A;  5EAY A;  2EGA A;  2NTS A;  1PH7 A;  1LAB A;  2EY1 A;  4QVD A;  1UE1 A;  3BDO A;  1WTW A;  3ICE A;  1I4K 1;  1IHV A;  2NTT A;  5E4X A;  1MI2 A;  4A54 A;  4YIJ A;  4OEL B;  4DUZ Q;  4S3S A;  4OO1 G;  1EWC A;  1WCM G;  5L37 A;  1Q12 A;  4IOC A;  2ZM6 Q;  5KYY B;  3C94 A;  3ND9 A;  4B3M L;  2HQX A;  3BZK A;  4M7A C;  1O7I A;  4QVC A;  1W6J A;  3CD6 A;  4V19 0;  3AB9 A;  4CC3 A;  1XYI A;  3Q1J A;  3BG3 A;  2X9H A;  1GBR A;  1CTM A;  5GAN e;  3S17 B;  4GOP C;  3NPF A;  4LUO A;  4DK6 C;  1R0C B;  1RLP C;  3I72 A;  4ODG A;  4J83 A;  1PH9 A;  1STG A;  4HJ5 A;  4KUI A;  3J7A F;  2FXQ A;  1PFS A;  2E75 C;  2Y4Y A;  2DFU A;  1HQM C;  1BF4 A;  4AFU C;  3MXU A;  3R8B A;  3PMF A;  2UU9 Q;  2JQO A;  4A3K B;  5GAM h;  1KD1 R;  2Y0S E;  5CR3 A;  3K5O A;  2L55 A;  2KT1 A;  3M0Q A;  3TP5 A;  4EDU A;  4HR7 B;  1RL2 A;  4M7D D;  1VF5 C;  2CKK A;  2FL7 A;  4JS5 A;  3VS5 A;  5JJZ A;  1OV3 A;  2XWJ B;  3FLG A;  2ZPH B;  3GTQ B;  1J8I A;  2YT6 A;  4L5T A;  4ZTF A;  1EU4 A;  1JMC A;  1A2U A;  2BA0 A;  3P7J A;  1ZA2 B;  4XTW A;  1B7Y B;  4G7H C;  1WIE A;  3KLS X;  3IRB A;  3R3O A;  2JA5 B;  2LMC B;  2IX0 A;  1FNU A;  1MND A;  1LTS D;  2V8I A;  5GAO q;  2R7F A;  4E7L A;  2X6G A;  4GN5 A;  4FYY B;  3CBO A;  3NXW A;  4JBW A;  4OON A;  5JEA J;  3QDR B;  4KH1 B;  1OXU A;  3BVG A;  4NW2 A;  4GOP A;  3Q22 A;  3H9N A;  2AKL A;  4XU2 A;  1H9M A;  2D8J A;  3SWN C;  4N4G A;  2DL4 A;  2NVQ H;  2LT4 A;  2O9S A;  3I4N G;  1PZI D;  4BY1 H;  3CQZ H;  3I5R A;  4M77 G;  4DEX A;  1UE5 A;  3X28 B;  2LNH B;  1PRT D;  3VR6 A;  1DZ1 A;  2XN9 C;  2WB1 B;  4F88 A;  2P0K A;  3V96 A;  4WF2 A;  5CV6 A;  4B3S Q;  2K2M A;  1FMW A;  3MEH A;  4JRI A;  3W2D A;  1MHN A;  1ZHI A;  4LE9 A;  1YI2 A;  2XI9 A;  5CQY A;  3S1R H;  5J39 A;  1T3S A;  3CPW S;  1NSN S;  1IL2 A;  3CMA T;  2BOS A;  3M4P A;  2LQW A;  2RH2 A;  4C92 F;  1E7Z A;  5A2Q E;  1EQR A;  1GHJ A;  1LYL A;  4DR6 Q;  1RAH B;  4A63 B;  4GKK Q;  3HPW A;  4KD4 A;  4LF7 L;  2XRS D;  2RO0 A;  3JCM d;  5I6W A;  2YTY A;  1KC8 C;  1EZZ B;  4EMK C;  3DB4 A;  1R8O B;  1E1O A;  2N88 A;  2XVS A;  5E7N A;  3J81 E;  5EBC A;  3CCR T;  1Q3L A;  3G4S Q;  2DY8 A;  3I4L A;  4UAI A;  4LUD A;  2B2W A;  1M3C A;  2JVV A;  4JCV E;  4O5V A;  1YJN A;  2J4X A;  1W4S A;  3V05 A;  3V8L A;  1VQK A;  3CCM A;  3SK5 A;  2COZ A;  2GN5 A;  1TUD A;  2BA1 A;  1B53 A;  2LRQ A;  2QAZ A;  1YNN C;  3VA7 A;  1ZQ1 A;  1S5C D;  1KC8 U;  4PJJ A;  4QUF A;  4JI4 L;  5GAN 3;  1B34 A;  2LVM A;  3F2C A;  1H8K A;  1LAC A;  1X3Q A;  2KCM A;  4A4F A;  1BB9 A;  1TS5 A;  3QZ5 B;  4X3U A;  3LW5 E;  5KNC A;  1PC0 A;  6AT1 B;  1VQC A;  5BN3 A;  4A3I G;  5LJ5 g;  1LTR D;  2PI2 A;  1EY7 A;  3JB9 J;  1MKH A;  1E6H A;  3TEE A;  4JI4 Q;  5FJ8 H;  5FK9 C;  1M1K R;  3AYH B;  2F0T A;  4O42 A;  3T4A C;  5JAV A;  4HVU A;  1QVG S;  5COR A;  2E41 A;  2Q8I B;  5I22 A;  3CCL Q;  1R9T B;  4K5X A;  1E2V A;  3CCJ T;  3F8T A;  2EPD A;  2HBP A;  2VZA A;  5IT9 L;  3BU2 A;  4L5S A;  1WDX A;  2GBQ A;  4MMK A;  2BDO A;  5CMD A;  3EA6 A;  1D5Z C;  1KQS S;  1QB5 D;  4IIO A;  1TS3 A;  2F03 A;  3HOV G;  2FO0 A;  1WHL A;  1FNV A;  2CSI A;  4C92 E;  1KG1 A;  1OPL A;  4F7U A;  5IYB H;  4O6J A;  1VQH A;  4Z9C B;  4DNI A;  1H95 A;  2L89 A;  2QTX A;  4RTU A;  3GQB A;  4A3B G;  2NUZ A;  3FIF A;  2XMF A;  1IYJ B;  2D5D A;  3NK9 A;  2KVQ G;  1T5E A;  3D31 A;  2XDP A;  3PMT A;  2RSN A;  1K8A R;  4TQU S;  3SWN B;  3L2P A;  5C5L A;  3GTG B;  4XK8 E;  3OIQ A;  1TWA B;  2QDY B;  2Z6K A;  4U68 A;  1BCP C;  3RIR A;  2CP2 A;  3MHX A;  4OIJ A;  4N8F A;  3PF5 A;  5EKK A;  4A3J B;  4LF5 L;  1CKN B;  2ICI A;  2GQV A;  1BQQ T;  2Q2T A;  1S5F D;  1VQE A;  2DBK A;  4QKU A;  4C8Q G;  5KYY A;  5JEA G;  2LCL A;  1LT4 D;  1KK7 A;  4K5W A;  2CCZ A;  4QT7 A;  3OW7 A;  5IGE A;  1T0J A;  1LTT D;  1Y07 A;  3L42 A;  1PFB A;  1JQY D;  5ELF A;  2HMA A;  4J8Q A;  1YI2 Q;  3M0T A;  4KH0 B;  4DV6 Q;  2KAF A;  2CQO A;  2R7D A;  5IGF A;  2GF7 A;  4YCU A;  4V0B A;  4M78 E;  4DXF A;  2SEB D;  4ALP A;  1RAI B;  4EMK B;  4Q5V A;  3A8I E;  3J81 j;  2F2X A;  2R61 A;  4RTW A;  1VQ4 T;  2ROT A;  1HQR D;  1EY0 A;  1B8A A;  2EYW A;  1I07 A;  4BY1 B;  3JAM L;  1KNE A;  4A93 H;  3AQQ A;  4MZM A;  2K79 A;  2C35 B;  4LFC Q;  3SHW A;  4OF1 A;  1Y14 B;  2V8K A;  1DJR D;  1EYC A;  5GAN f;  2EJG A;  4CGY B;  2FRY A;  4CDC C;  4DV1 L;  1RKN A;  3H3V H;  2EYQ A;  3CMA Q;  1QVC A;  3OYK A;  3UI2 A;  1I94 Q;  2F0W A;  4ZRZ A;  4MML A;  3RZD H;  4NS5 A;  3S1Q H;  4KKS A;  1F77 A;  1PVO A;  1LPL A;  1LVK A;  3RDV A;  4FF3 A;  1ARK A;  2CT4 A;  3A8O B;  1A62 A;  1IW7 C;  2NYS A;  4C3J G;  2QEJ C;  2RQR A;  1UJ0 A;  1SND A;  2LJ0 A;  4JRK A;  1VQ5 T;  1Q8K A;  4QY7 A;  1K0X A;  4QUC A;  1G8X A;  4IJH A;  4FT4 A;  4XT1 B;  5KCH A;  4MIU A;  4OWT B;  1ZSZ B;  1VYV A;  2A6H C;  2G9H D;  3PO3 B;  1HHV A;  2CP7 A;  3KBG A;  1ROD A;  3KF6 A;  4OGC A;  4BB7 A;  1OPK A;  3FKI G;  1UEB A;  1GRI A;  3OIP A;  3GTP B;  1WTR A;  1N34 L;  1B9M A;  1M1G A;  3JB9 G;  2P0P A;  1KQ2 A;  1L1O C;  1WNL A;  3CCS Q;  2DGY A;  1IBM Q;  2CDT A;  1YJN T;  1NEG A;  3JCM g;  1N33 Q;  5C4X G;  1D7Q A;  4YY3 L;  2K7A A;  2R3Z A;  4IFD G;  4EIK A;  2JTF A;  3ZBD A;  3X3N A;  2UUB L;  2DXC A;  2LCS A;  3CCR A;  1D8L A;  5NUC A;  3UT1 A;  3G71 A;  4M78 B;  2F0V A;  3D4D A;  2EY2 A;  1WA7 A;  3TU4 K;  4KRT A;  1BI3 A;  4KJO A;  4BXX H;  2X6L A;  2V8J A;  3QG1 A;  3ASK A;  3OMG A;  2B2T C;  3NBH A;  2VUM H;  1H9J A;  5FRM A;  4ILW A;  3UAT A;  4ULL A;  1BIA A;  1PLF A;  3PCO B;  4LF6 Q;  1I8F A;  3SB2 A;  2HDL A;  1KAA A;  2FG0 A;  1K4U S;  1ASY A;  1NM7 A;  3CCV A;  3CC7 T;  5C3X A;  1HYO A;  2N78 A;  2LJ1 A;  4IFD I;  1EY8 A;  4FYW B;  4DBQ A;  1OQK A;  1ENF A;  2CT3 A;  1X2K A;  1Q82 C;  1B70 B;  1TWH B;  4JOI A;  4JI0 Q;  4A4K A;  5I2S A;  3T51 B;  5C4H A;  1GCQ A;  3CCU Q;  1WTH A;  4IUT A;  4OX9 Q;  4A93 G;  3GTQ H;  1WHK A;  1WJR A;  2EAY A;  5EG2 A;  3GOX A;  2HCK A;  1K83 B;  2KOL A;  2IW3 A;  3QIA A;  9ATC B;  4M7D B;  4K8J A;  4RCN A;  3TP8 A;  3VA5 A;  2H5X A;  4DBH A;  1I3Q B;  1HNW Q;  1DD2 A;  2DTH A;  5I2X A;  3TRZ A;  4HJ7 A;  4E2F B;  2PQA A;  3D8G A;  2I07 B;  4EX5 A;  1JJC B;  1UEA B;  4M78 F;  1X65 A;  5K36 H;  3RR6 A;  4Y52 H;  2A19 A;  3K7A B;  3DWA A;  1Q7Y U;  4BY7 G;  2LX9 A;  4HKE A;  3PUV A;  3PO2 B;  1TY0 A;  1U06 A;  2A5H A;  1U4P A;  1VF7 A;  1WQ7 A;  3UE1 A;  5HCK A;  3L2W A;  1VQP Q;  2F0U A;  2DTO A;  2EYZ A;  1XMO Q;  4P74 A;  3GBQ A;  3G7L A;  2Q8R E;  4KKT A;  2XGT A;  1C8C A;  1HZC A;  3LNN A;  3OTO Q;  1OI1 A;  1YNN D;  3D3R A;  3HOZ B;  1HH2 P;  3I4O A;  4H0L C;  2LQN A;  1HTL D;  2AKW B;  3NEM A;  3O13 A;  5FKA C;  1AWJ A;  3CC2 Q;  1Q1B A;  2MOX A;  2CFM A;  4J9I A;  4XU0 A;  2IHF A;  3FDR A;  2C5C A;  1QVF S;  1RF2 D;  4PNO A;  1AWX A;  4J9B A;  1PTO B;  4HJ9 A;  1QWY A;  2XID A;  3VR2 A;  3PO2 H;  1C0A A;  4DXG A;  1SAP A;  2NN6 G;  2K04 A;  3G48 A;  2E65 A;  3OOC A;  1PH4 A;  5IYD H;  3X24 B;  1BI1 A;  3LGF A;  4BY7 B;  2DBM A;  3A8J E;  1L2F A;  4RTV A;  3RLF A;  4X62 L;  4A3I H;  4HMI A;  4C1N I;  4DR1 L;  5KYU B;  5AJ3 L;  2SOB A;  3M58 A;  1ILP A;  2CH4 A;  1B3A A;  1AW7 A;  5LMU L;  4GLK A;  4X64 L;  2RA2 A;  1AEY A;  4HSV A;  1J5E L;  5GAM f;  4LF5 Q;  3NTI A;  4OB3 B;  1A3V A;  2NBF A;  1A6X A;  2PZU A;  3S2D H;  2F2W A;  2MQH A;  3H41 A;  1YNX A;  2AQ2 B;  5M3M H;  4M78 C;  3CCU A;  3FEW X;  1ZLM A;  1LTA D;  3M7N A;  3EFO B;  5DLQ E;  1H9S B;  1EWH A;  5IYC H;  1KHI A;  1QVP A;  4RCC A;  4DK3 C;  3TME A;  1FMV A;  4P72 A;  4M78 G;  5C0X J;  4IZ8 A;  1DJ7 B;  4X34 A;  2B63 B;  2ZPB B;  3PT9 A;  2CWP A;  4AIM A;  1FD7 D;  4TRD A;  1EIF A;  2QGF B;  1Z9Q A;  3I4N H;  3DXJ C;  2K3B A;  1NLO C;  3E1S A;  2L8D A;  1M8V A;  1G8Z D;  2OTL A;  2F3W A;  1T9H A;  2NUC A;  1PRT F;  2NVY H;  2FZK B;  1N27 A;  2N49 A;  4UP7 A;  3VYR A;  4Y91 A;  3G71 Q;  1ONL A;  3K80 C;  1GO3 E;  2HDA A;  4C1N K;  4JI5 L;  3PIP 3;  4AH6 A;  2X4Y A;  2Y0S G;  1GBQ A;  4RKU E;  1X69 A;  2NUP B;  4DOW A;  1I5F A;  1X6G A;  3M3Y H;  2EYH A;  4R4I A;  4OO1 I;  1M9S A;  5GMK j;  2KK4 A;  1F2M A;  3H0H A;  1X3F A;  3IFT A;  4DPG A;  4ESR A;  3CCS A;  1X01 A;  2OEO A;  1IBL Q;  5C5M A;  3TS0 A;  5ELB A;  4PFO A;  3MZ5 A;  3K0X A;  5ELN A;  5FRN A;  2BH2 A;  3F2D A;  1VMC A;  2HL5 C;  1OU8 A;  1RAG B;  5FU6 B;  1DCZ A;  2CGH A;  2HEQ A;  4R4T A;  5FO7 B;  1VYU A;  4A3F B;  2KRO A;  3OW2 P;  3OSV A;  1G5V A;  1TWA H;  4FP5 D;  3A74 A;  4B3T L;  4LF4 L;  5DM6 3;  4WJ4 A;  4HCK A;  1D1B A;  3OYH A;  4R4C A;  4A4H A;  2EQI A;  3PO2 G;  2K03 A;  2DEU A;  1SNC A;  3OYF A;  1WGS A;  1NNX A;  4DV0 Q;  4KJN A;  1S72 T;  2AZV A;  2MHV A;  4BUG A;  4ZKC B;  4LUZ A;  4WFN 3;  1WXT A;  4FT2 A;  4LDY A;  1QVG P;  2L2P A;  2NZH A;  2JA7 B;  2NUT A;  4X3T A;  4DR4 L;  5GJW B;  3M7G A;  3N5B B;  1IW7 D;  1XXG A;  2BTT A;  3OQ5 A;  1QKX A;  4EQP A;  3HOW H;  2J05 A;  2HKN A;  3HFZ B;  4E47 A;  2CZ7 B;  2EXZ A;  5HK3 A;  2BKD N;  4A76 A;  1D0Y A;  1MSG A;  4RG2 A;  3LX0 A;  3GTJ H;  3TS2 A;  4IUP A;  4QIW E;  3VV0 A;  3TZU A;  1M90 R;  1JU5 C;  4OVA A;  3K7U C;  4LF7 Q;  3U9O A;  4DR5 Q;  3BDC A;  2E2I B;  2P0Q A;  4A3J H;  4J9E A;  4RGO S;  3FJP A;  2J6K A;  2E2D C;  2EVR A;  1WHG A;  3QWX X;  3DWP A;  4R8N A;  4DV5 L;  1HA5 A;  1N9S A;  1QVG A;  1HZA A;  4RHR A;  5LJ3 d;  3WDN A;  4BBS H;  4WJW A;  1BCP D;  3HOY B;  3V7C A;  5IXB A;  4M78 D;  3AFP A;  1AT1 B;  3CCE T;  2AKK A;  3S16 B;  2VQE Q;  2JA6 G;  4QW2 A;  3JB9 D;  1N33 L;  4LDW A;  2DY7 A;  4H02 A;  2A37 A;  4JVZ A;  2KCN A;  3R93 A;  2GCX A;  3M0P A;  2K52 A;  2JXB A;  1X43 A;  1II3 A;  4OXP A;  4XQQ A;  5HGT A;  4PKC C;  3CPW A;  3OSO A;  3C4S A;  2L0A A;  1X6O A;  3CC4 A;  4DR7 Q;  5ISR A;  4DBF A;  1A2T A;  1WJQ A;  4JZ4 A;  4RTX A;  2Z6K C;  1I94 L;  3M3Y B;  3K5N A;  4BI8 B;  1GCQ C;  2DJZ A;  3NSW A;  4JBK A;  3GTK B;  4ELZ C;  3NQT A;  5C0X H;  1YBY A;  1I6H B;  2DRK A;  2MAM A;  1PH6 A;  1FX7 A;  4JI5 Q;  2YRC A;  5I21 A;  3NEL A;  1CUK A;  3AMU A;  3M4Y A;  4JI3 L;  3O8V A;  1TWF H;  3O5Z A;  5FU6 C;  4HCZ A;  4UPA A;  1NCV A;  3MHB A;  1PYB A;  1K0R A;  1EFN A;  3OS1 A;  1BCP F;  1N9W A;  2RQT A;  3VUB A;  5LJ5 f;  3EFX D;  5KYW B;  2QQR A;  4KLK A;  5C0X G;  3ULP A;  2PMZ E;  5KNB A;  2EZV A;  4GKJ Q;  1YHQ Q;  3A55 A;  2LX7 A;  2R57 A;  5GMK m;  3H09 A;  2DZ9 A;  2PUO B;  4OHJ A;  2XIW A;  2EGE A;  2RHZ A;  3OYM A;  2MJ8 A;  4DR7 L;  3CPF A;  2ES2 A;  3PF4 A;  5L8R E;  4C3I B;  2E12 A;  4AQY L;  4AG1 C;  4C8Q A;  2KMT A;  1G2T A;  4ZN3 A;  4L5G A;  2OAU A;  5M5W B;  3VS1 A;  1Y8N B;  2A69 D;  1CQF A;  1K83 H;  1SE4 A;  1IB8 A;  1ICW A;  2XK0 A;  1S4Z A;  3U9S A;  5JJI A;  3BE3 A;  1WQW A;  1VQP A;  2ZJP A;  3MXN B;  4P5N A;  4BE1 A;  1VCI A;  5JOB A;  1Y1W G;  2G6F X;  1TII D;  3VYT A;  1RJT A;  3NHN A;  2O2O A;  2AUJ D;  2PI2 E;  4R4O A;  4DV6 L;  5LJ5 e;  3KFU A;  5I11 A;  1LLR D;  1K8O A;  2KYB A;  2ASB A;  2KHJ A;  3EGU A;  4CKE A;  2I46 A;  2M9V A;  3HRU A;  1QUQ A;  5GAO m;  3G6E T;  1B9N A;  5M5W H;  2KE9 A;  3V8J A;  2F0K A;  3NE5 B;  4A3L H;  4OB2 B;  3EH2 A;  4IUU A;  2RMO A;  2F0J A;  1PXU A;  4FDB A;  4QCL A;  1PD0 A;  3CQT A;  4MDX A;  1DXM A;  3LWU A;  1AWW A;  3M5A A;  1KD1 U;  5EKL A;  3H0G H;  5M3F G;  2FPD A;  4QQG A;  1BI2 A;  5IYB G;  4JUV A;  1IRX A;  2M02 A;  1N8R C;  1E24 A;  1S3O A;  1VQ4 Q;  1Q8I A;  4JC0 A;  2K4K A;  5CV5 A;  3UDG A;  1CA6 A;  3CQZ B;  3FKI H;  2K01 A;  4A3E H;  4PJM A;  3GO5 A;  4E7J A;  1SG5 A;  3LWI A;  4Z89 A;  3RMH A;  1U4R A;  2I5M X;  3DM1 A;  3RZO B;  5GAN 2;  2EKH A;  1BYM A;  1TWF B;  1LJO A;  1RDP D;  3OWF A;  5KGU A;  4XQ3 A;  4KI0 A;  1CFM A;  3QYG B;  5KYX B;  2B2T A;  4KY6 A;  3MJX A;  2K05 A;  2CP6 A;  1C0M A;  1BKB A;  2D1X A;  1KD1 C;  1RAF B;  3CCR Q;  1LV9 A;  1UNS A;  2E5L L;  4KTA A;  3KF8 B;  4AYB B;  2D6F A;  4PMC A;  4RTZ A;  5KE3 A;  5C3W A;  2E76 C;  1XNQ L;  5GAG C;  1V29 B;  1E3P A;  2XRQ D;  1PCX A;  1SNO A;  5C44 G;  1AZG B;  1YVC A;  2A6E C;  2Z4H A;  3GTM B;  4O2D A;  3QKJ A;  2R5M A;  1HSQ A;  3OS2 A;  3L1A A;  1K9M C;  2QK0 A;  3URY A;  4DR6 L;  4GKK L;  4RMO A;  5ELD A;  4EQO A;  1M4Z A;  1IZ6 A;  3CBM A;  2XU8 A;  5CAI A;  4BE0 A;  5A2Q L;  4JI0 L;  3CME A;  2A1A A;  4Z88 A;  3VRY A;  1STE A;  3OBW A;  4H13 C;  4B3S L;  5T1G A;  5JPN C;  1KQS P;  1ICF B;  1NBW A;  1STY A;  1BDO A;  1RAC B;  4FXD A;  1TH7 A;  4OL7 A;  4NKL A;  4JI3 Q;  3RMQ A;  1IL8 A;  1Y1W H;  1PYS B;  1MJC A;  5IN1 A;  4M4Z A;  5GAN 8;  3PIO A;  1SMY C;  1WCM H;  4X65 L;  3C3L A;  1RI9 A;  1U1T A;  4PLI A;  4ME5 A;  2QW7 A;  4L6T B;  2M1H A;  1G51 A;  2JMC A;  2WSE E;  3HP3 A;  1LOJ A;  2LQK A;  4V2S A;  3RD4 A;  2P4R A;  3SK4 A;  2KSS A;  1RAA B;  3CMA A;  2HQH A;  2LDM A;  3RUZ A;  1QCO A;  3QXE B;  3A8K E;  4CDF C;  2F5K A;  2SEM A;  2R58 A;  3VJP A;  4BY6 B;  5GMK i;  4C8Q C;  4HCC A;  4EMK A;  1A3T A;  1A0I A;  1KC8 R;  3AFQ A;  1PFN A;  1YHQ T;  2EYJ A;  4B3M Q;  4JW0 A;  3CC7 Q;  4A3D H;  3H91 A;  4JZ3 A;  3VRZ A;  1T0H A;  3CCU T;  1VQK T;  2DEQ A;  3RLO A;  2QGG A;  1ZUY A;  2DAQ A;  2ZTC A;  4MZT A;  2RHY A;  5I6Y A;  3HOU G;  4ZUJ A;  2VXF A;  1QE6 A;  1UG1 A;  4CDE C;  3FVQ A;  1TU0 B;  5J1Z A;  1YNJ D;  4ID6 A;  2MCN A;  3A54 A;  2K1B A;  2L3S A;  2OCE A;  4XYQ A;  3RZD B;  3EN2 A;  1SE8 A;  2K9G A;  1BK2 A;  2RI5 A;  3MTS A;  4UDU C;  1CKA A;  3G6E A;  4BBR G;  1D5X C;  1STN A;  2D0Q B;  2CVR A;  2WFW A;  4M7A F;  4AMC A;  1EZ6 A;  4BY1 G;  5FO9 B;  1KFZ A;  2K5V A;  3QDF A;  1M30 A;  3I3C A;  1CZG A;  2O31 A;  2JOY A;  1DOL A;  1X2Q A;  3A8H B;  1K9A A;  5IT9 E;  5D6Y A;  1VQ5 Q;  2B2U C;  4AG2 C;  3S2D B;  4J7F A;  3ER0 A;  1EU3 A;  4EVO A;  2CS7 A;  3T53 B;  2KI7 A;  1ZA1 B;  2DNC A;  4XQN A;  4M77 B;  2EYP A;  2OX7 A;  3A5U A;  5KE2 A;  1RD9 D;  2E2J B;  5CIU A;  2BE9 B;  2IX1 A;  1D3B B;  1JO8 A;  1VQ9 A;  1ENA A;  4DV4 Q;  1RUW A;  1R4P B;  1GUG A;  4ANJ A;  2TMP A;  2KQW A;  1K73 U;  2NVY B;  1PD1 A;  2VV5 A;  3RKY A;  4BY7 H;  3A0J A;  1FYN A;  5IAY A;  3S24 A;  2DLP A;  4IUN A;  2F4V L;  2VKN A;  1G91 A;  1JT8 A;  4DU9 A;  1XMQ Q;  5IP7 G;  3SDZ A;  4OEM B;  4QIW B;  2QYZ A;  1NE3 A;  3VYS A;  7AT1 B;  4M75 A;  1BXT A;  3CCL A;  2RJC A;  2FIN B;  1SYF A;  3VR3 A;  5FLM G;  3P8B B;  4RCB A;  2BDN A;  4NXM L;  5LL6 X;  4LFA L;  1U1S A;  1E0B A;  3OPO A;  2XHC A;  4XAX B;  2N3S A;  3FRP B;  1VQ7 A;  3TCJ A;  2JA8 H;  3OW2 A;  2GTJ A;  2LKV A;  5C4X B;  4C8Q B;  1NUC A;  3KXT A;  2VNU D;  1VQM A;  2PO4 A;  2A08 A;  2NYZ D;  1Q1E A;  1TY2 A;  2ENM A;  1BO0 A;  1VIF A;  5KND A;  1AVZ C;  3GF5 A;  4G4K A;  3CC2 T;  3IAY A;  2Z0S A;  1VQL A;  3T1Y Q;  1FJG L;  1MHW C;  3CCM Q;  3HOX H;  1YJW T;  4EQ5 A;  4JI2 Q;  2RI3 A;  4D8K A;  1YJN Q;  1X3G A;  1BI0 A;  3K6O A;  1MNE A;  1KDA A;  2LXK A;  4M8A A;  4HID A;  2WP8 J;  1WTQ A;  3G4S A;  1WHH A;  2R92 B;  2BZ8 A;  5LJ3 f;  4WJ3 M;  1UUP A;  5GAN 6;  1V1P A;  1LTI D;  1X6B A;  3MO8 A;  4OMO A;  3HOX G;  1JCK B;  2LQ8 A;  4AFS C;  2A68 D;  2LY7 A;  4PK4 A;  2KHI A;  2B8G A;  5IY0 A;  3T1H L;  3BVM A;  1S1N A;  3KLR A;  3VS0 A;  1NAP A;  1CSP A;  4DV2 Q;  1KDB A;  2DNE A;  2G5D A;  4J5Y A;  2QEX Q;  3RLN A;  3T16 A;  4HIM A;  2MUY A;  5GAH C;  4B3T Q;  2L3P A;  1KQ1 A;  3MEV A;  2A74 C;  2IIM A;  2EYM A;  1UGR B;  4FM4 B;  4RCO A;  1YIT Q;  4A3B H;  3VR5 A;  3HOU B;  5C4J B;  3A1P A;  1K28 A;  1O9S A;  2JA7 G;  5M3M G;  3H0F A;  1K76 A;  1B1Z A;  2GA4 B;  1C9O A;  2DKG A;  1WTV A;  1IBL L;  5LMU Q;  2K3X A;  3FJ5 A;  2WB1 E;  4M75 D;  3I4M G;  1OXX K;  2R92 H;  2RJE A;  3PO3 G;  4CBV A;  5KYX A;  2ZPG B;  2DNU A;  2PNR C;  1I5O B;  1TU2 B;  2D62 A;  4C92 C;  3UDX A;  1XX8 A;  4HSP A;  4X62 Q;  3RN2 A;  4RGN A;  2K7V A;  2HQE A;  3CCV T;  1NJI C;  3M4O B;  4NPS A;  1WI7 A;  4LXC A;  4OMM A;  4BI4 A;  5KYU A;  1ET9 A;  4LFB L;  1VQ6 Q;  4KK7 A;  4PMB A;  3I5S A;  1HK9 A;  3S3O A;  5EKI A;  4M7A D;  5FWC A;  2EGC A;  2A6E D;  1XJV A;  1X56 A;  1SEB D;  4K2L A;  3DB3 A;  2M9U A;  1QW1 A;  2QG9 B;  3EG1 A;  4FCY A;  3JCM h;  2MP1 A;  1LTB D;  2OI3 A;  2RHS B;  3A8G B;  5EPJ A;  2RQV A;  3QWY A;  5IHI A;  1I6V C;  3I56 Q;  3ME9 A;  1H9S A;  2VB3 X;  5AT1 B;  1YFN A;  4J7I A;  2RHU A;  1VQJ A;  2DJG C;  1D09 B;  3I4M B;  5CV4 A;  3MFY A;  4RTY A;  4FIB A;  4OP0 A;  4X64 Q;  2BE5 D;  4LF8 L;  4YWK A;  4AQY Q;  2O5I C;  4ZCK A;  2K50 A;  1V1C A;  4KD3 A;  4J6X A;  1SMY D;  5CYU A;  2PMZ B;  2Z0W A;  3CD6 Q;  5GAE C;  4CRI A;  2L9H A;  4OGQ C;  2E6N A;  2L3R A;  4VUB A;  3QOL A;  4KMU C;  2VGM A;  4ZQ3 A;  4X66 L;  3M56 A;  2VUM B;  4IPG A;  5FU7 B;  5C3E B;  3GLX A;  4A3E B;  3J81 i;  1S5B D;  3GV3 A;  4HA8 A;  1GUN A;  3TSW A;  2DER A;  4LN2 A;  1BCP B;  4P73 A;  1VQO A;  1L0W A;  2FPF A;  2OTJ Q;  1WTO A;  3A8L B;  2EYY A;  3PVQ A;  2CZ0 B;  1XWE A;  1HNZ Q;  1AD5 A;  3M85 A;  2JA7 H;  1Q81 U;  3HRZ C;  1B7T A;  4AT1 B;  4A3G G;  3H0G G;  3CXC A;  3HOW B;  1HUN A;  1EX4 A;  2JE6 I;  1HR0 L;  2B2Y A;  3STB C;  3HL8 A;  3QPH A;  1F2L A;  1KRS A;  3IFD A;  3W3A A;  4IJL A;  1N36 Q;  3KYH C;  2YLB A;  4LDU A;  3S14 B;  2K6A A;  1F2Y A;  4RUG A;  2AHJ B;  3I56 T;  4JLI A;  2KYM A;  2EQK A;  1LM0 A;  4C92 B;  1YIT T;  5HK0 A;  1Y8O B;  4FYX B;  2KEN A;  1CSK A;  4DV0 L;  4ME3 A;  3LGL A;  4A3M B;  2KCT A;  3VS6 A;  1FWZ A;  3M9Q A;  1M2V B;  1PTO F;  2EY6 A;  2KXC A;  4A4I A;  2L12 A;  1WJS A;  2ABL A;  1SYC A;  2KJX A;  2GGR A;  4K5V A;  4PZ6 A;  2NLU A;  4FSS A;  1C4Q A;  1X3P A;  3SEB A;  5IP9 G;  3PV0 A;  3CCJ A;  1W2B S;  4GOP B;  3T1Y L;  5CK9 A;  2M0Y A;  2KVM A;  1TSF A;  4I7A A;  1SRL A;  3J80 i;  3DMU A;  2L1B A;  4C92 D;  4BXX G;  1IHZ A;  4QL5 A;  1TT2 A;  3MXG A;  1EOT A;  3JC6 6;  1D1K A;  4JI7 Q;  2ROL A;  4DR5 L;  1VQ6 T;  4DUY Q;  4CI0 C;  3F2U A;  2DYB A;  2WAC A;  1R4Q B;  1NY4 A;  5D6X A;  3ZFJ A;  4KGX B;  3L0O A;  1TOV A;  3JCM P;  2IG0 A;  1DON A;  1K0S A;  1BCM A;  2PVO B;  2BH8 A;  4NB3 A;  3K5M A;  3CCQ T;  4M77 F;  2F5T X;  4UP8 A;  4RH6 A;  4E7I A;  3JCM X;  4OMF B;  1VQN Q;  4YHH L;  3FRN A;  4G7Z C;  4XTZ A;  1AZP A;  3S6W A;  1OYX A;  1BVS A;  1PTO D;  4PJO C;  4NL3 A;  3CCM T;  4C5H A;  4G57 A;  2L11 A;  4QQB X;  1YIJ A;  2RKS A;  2FYK A;  1B4O A;  1HFG A;  3P1H A;  4R4Q A;  3EFS A;  5CKF A;  1ACM B;  1X54 A;  4C3J H;  4GNX A;  2M2L A;  3MC0 B;  4RG1 A;  3TZD A;  2EQM A;  2EW3 A;  2RSO A;  1V1P B;  5CO7 A;  2JNG A;  1X55 A;  1TR5 A;  4JJC A;  1EQT A;  1EZ8 A;  4L59 A;  1AN8 A;  3QO2 A;  5IHK A;  5GAM d;  2MFI A;  4PMW A;  3BY7 A;  2DL5 A;  3EG2 A;  3WVE B;  1E2Z A;  1EY6 A;  1XOV A;  2J7I A;  2B3G A;  2PNH A;  3HG9 A;  5E3F A;  3TP6 A;  3EBE A;  4Z8A A;  2XG8 D;  5DLO A;  1CM9 A;  1RIP A;  5DNF A;  4NXN L;  1B34 B;  3CC4 T;  4QF4 A;  1MV3 A;  3K58 A;  3I55 A;  2QIL A;  2ZJQ A;  1MGS A;  4RAU C;  3U23 A;  2JM9 A;  4BE2 A;  2Y0S B;  3MEA A;  1FVI A;  2EQJ A;  3J80 E;  2I5H A;  2E4H A;  4DR1 Q;  3HOY H;  2I0N A;  3JRZ A;  3REB B;  4KT0 E;  3FHW A;  4Y7N H;  2JA8 G;  2BZY A;  4LMQ D;  5LMN Q;  2DXT A;  1SYG A;  2ENB A;  4GN4 B;  1U5S A;  1GXD C;  1JB7 A;  1G83 A;  4ZAI A;  1B44 D;  2DMO A;  3JCM f;  5BR8 Q;  2RQX A;  3D7S B;  4A3D G;  2E3I A;  3I4N B;  4HTH A;  1WOC A;  3NQI A;  4B3R Q;  2D9U A;  3K81 C;  3A98 A;  4R8I A;  4JBM A;  2VUM G;  2DE0 X;  2M51 A;  4A3E G;  5D3D A;  3J7Z C;  2CKZ B;  1QLY A;  1D1A A;  4NL2 A;  1SRO A;  2PQA B;  5M3F H;  1MGQ A;  3EGX A;  1S5D D;  2RK1 A;  3HRS A;  1F9Q A;  1UGV A;  3S3N A;  3HFO A;  4IFD H;  2PVG B;  3RKX A;  2PNI A;  1G3S A;  3CU7 A;  1STA A;  3KLS A;  1JOQ A;  5GAM j;  4NDX A;  4JI6 L;  2R93 G;  4DA4 A;  2LMJ A;  1UE9 A;  5EJW A;  3J81 c;  1OZ2 A;  1PHJ A;  2A73 B;  2Y90 A;  4MZ9 A;  1J5E Q;  3S1N B;  4WOR A;  1WXB A;  1S72 A;  3EJI A;  3EGD B;  5I9P A;  4FVM A;  1B2T A;  4PJN A;  3SXH A;  1FMK A;  4KGV B;  3SK8 A;  5ELC A;  4LDV A;  2Y4X A;  3QYH B;  4M75 B;  1QUQ B;  5BR8 L;  1J9O A;  1JOK A;  4JYA L;  1OEB A;  3TSS A;  1I4H A;  2RI2 A;  3DKM A;  3E0E A;  2AIR B;  2RVL A;  4CHT B;  2A0F B;  2F69 A;  1PTO H;  5K5P A;  4GBQ A;  4M75 F;  2JJ9 A;  3KOJ A;  1EFW A;  1XNI A;  3CCQ Q;  1XNQ Q;  1FNW A;  2ZT9 C;  2E2H H;  4J9G A;  4LF9 L;  4QQ6 A;  2CRE A;  3JCM V;  3OW2 S;  2HAX A;  4PJO D;  3FMC A;  4N9T A;  3EH1 A;  4XTV A;  2F0D A;  5C3E H;  2IPO B;  5GAO r;  3S1R B;  4OX9 L;  5IP7 H;  1QCB D;  3BJU A;  4RG8 A;  4FU6 A;  1SBB B;  3HS0 C;  1Y69 U;  3FPP A;  2GFA A;  1Q46 A;  5T1I A;  4PJO B;  2OQK A;  3H15 A;  3CAM A;  3EHQ A;  4Z02 A;  2B2V A;  5FOB B;  1N8R R;  2JA5 G;  1PKS A;  1EWI A;  1HJP A;  1LO5 D;  3TN2 A;  4HIO A;  1JJ2 S;  4DV2 L;  2XWB B;  2OJ2 A;  4OB1 B;  2N8N A;  2L4N A;  2E5L Q;  1PH5 A;  2B86 A;  2B63 H;  4F7X A;  1IBK L;  1JC7 A;  4K2K A;  4Q5W A;  1QP3 A;  1M27 C;  4NOY A;  4FYV B;  2C0T A;  4A3F G;  2PPB C;  1YJW Q;  2M0O A;  2A6H D;  2BE5 C;  2IHE A;  5D6W A;  2JYO A;  1C1A A;  1CA5 A;  3U58 A;  4L5Q A;  4RTT A;  2J0T D;  1GUS A;  1CQV A;  3LH5 A;  2HQL A;  2CHB D;  2QF7 A;  4E6I A;  2DO3 A;  1L0Y B;  4M7A G;  3DEP A;  4M7D F;  3EG3 A;  1EOV A;  1SRM A;  4BBR B;  2EKO A;  3V7R A;  4JYA Q;  1YJ9 T;  2R93 H;  1SNQ A;  2B2W C;  2QA4 Q;  4MZP A;  1G29 1;  3FEO A;  2F0P A;  4LK1 C;  3I70 A;  5KYI A;  5C44 B;  1PKT A;  4DAM A;  2NUP A;  2C0I A;  3CCE Q;  4FXG C;  3BDL A;  2WII B;  4OIK A;  4QQD A;  4K11 A;  3D4W A;  4M77 D;  4DBR A;  4DNT B;  3MP8 A;  1AP0 A;  3NTH A;  2GFU A;  4UHV A;  1H9K A;  4BDZ A;  1GL5 A;  2FJ2 A;  3UF4 A;  2WAQ E;  4M75 C;  2P84 A;  1J6Q A;  1EIH A;  3UDC A;  2O01 E;  2X4J A;  2DET A;  3AU7 A;  1K8A U;  3PE0 A;  2LP5 A;  4CJ1 B;  1A63 A;  1LTL A;  1U4M A;  2ZJR A;  4F16 A;  3CW2 C;  5GJV B;  3AHU A;  1LTG D;  4APV A;  1JB3 A;  2KBN A;  2HIV A;  1PM3 A;  2E74 C;  3HEJ A;  4C0G A;  1JRI A;  4J6H A;  4YTL A;  2Z9H A;  4I65 A;  4ZGE B;  2RCF A;  1Y7X A;  1UGS B;  2F4I A;  5A0L A;  2RJD A;  4M7A E;  5L23 A;  2HCI A;  5GAM e;  1NR2 A;  2HBW A;  3KUF A;  2JN4 A;  4ZYS A;  1NPR A;  4R56 A;  1ZSG A;  1WVL A;  2LT1 A;  2W10 A;  1AFP A;  3M4O H;  4A4G A;  1ZKO A;  3X26 B;  1EYA A;  1JWM D;  4Y92 A;  1KL9 A;  3KK7 A;  1KDC A;  4H7B A;  2HKQ B;  5EBD A;  1NEB A;  1AZQ A;  1QZG A;  1YJ9 Q;  4BI3 A;  1YN8 A;  4A53 A;  3TP7 A;  2UXD L;  2YRV A;  3SD4 A;  1Q82 U;  5M5X B;  3S9W A;  5LJ3 h;  4FNF A;  4TSS A;  3GTK H;  4HCS A;  2D9T A;  4PLL A;  1X27 A;  2LNV A;  1Y1V H;  3QWN A;  4F87 A;  4KHP L;  3OSS C;  2JTE A;  3A5Z B;  2HL3 A;  1F9S A;  4IO9 A;  4M75 E;  2YU9 B;  2NVT B;  1G6P A;  1M8M A;  2QTV A;  1AZE A;  3HFN A;  1K3B C;  1KLU D;  1B3Q A;  3E9G A;  3P8H A;  4XTU A;  4E7S A;  3THK A;  1AWO A;  1HCZ A;  4B08 A;  2YDL A;  4KY7 A;  4JI1 L;  2A69 C;  2JJQ A;  3PGG A;  5H1S E;  3ZYY X;  3I73 A;  1K73 R;  1JJG A;  1M90 C;  3JCM b;  2D0P A;  4PJO G;  3Q23 A;  4F04 B;  2IJ0 A;  1TWB A;  3UE0 A;  2E10 A;  1VQL T;  4QGU A;  1HNX L;  2NVX B;  5JJL A;  1X75 C;  3OBY A;  4A3J G;  2D0O A;  1XNR Q;  2HHH L;  4CJ2 C;  1OZ3 A;  2JZ2 A;  4GY5 A;  1RHP A;  1AE2 A;  1ENC A;  1W6K A;  2YLC A;  3M0U A;  1NMG A;  2C9O A;  3FC3 A;  2FZG B;  2O4X B;  4IUV A;  4C92 A;  4F8M A;  5A0G A;  1PRL C;  2HCC A;  2CW0 D;  1EFI D;  1A3U A;  3PMI A;  2EQU A;  2ESW A;  3I55 Q;  1PMR A;  5TSS A;  1GM5 A;  2ZCF B;  4XU3 A;  4C0D B;  3R6O A;  3MWY W;  3HGB A;  2A68 C;  5M3M B;  2IT1 A;  4PJL A;  3KFV A;  1VA7 A;  2MGS A;  2OQ0 A;  3HZX A;  5KYW A;  4WCI A;  3GPL A;  3CCL T;  5JVH 3;  4GZY C;  1VQ8 Q;  4DFA A;  2DXB A;  2NVX H;  1I50 B;  3GNG A;  2CQA A;  3E0J A;  3U4V A;  2QEX T;  5LJ3 j;  3A7A B;  1EEF D;  2P5Z X;  1YJ9 A;  2LZ6 B;  2YV5 A;  3TDQ A;  1RAB B;  3Q8D A;  5BN4 A;  2FPE A;  1WX6 A;  2AK5 A;  2NUT B;  1Q86 R;  1E2W A;  1PZJ D;  2JA9 A;  2EVB A;  4A3G H;  1I4R A;  1PFM A;  1YEZ A;  5LJ5 d;  4CC4 B;  3P20 A;  1QKW A;  2GQI A;  1Q95 G;  1UHC A;  2K5F A;  3SGI A;  2CWA A;  3UDF A;  3SEM A;  1PYW D;  3H8Z A;  3RBB B;  4IAL A;  5GAN g;  1VQN A;  8AT1 B;  2RQU A;  1B07 A;  3EGD A;  5CCA A;  5CC4 A;  3MKD A;  4P2C B;  4YHH Q;  4C5I A;  1QOH A;  2RN8 A;  2DD4 A;  2WB1 G;  3J80 L;  2RBM A;  1IXD A;  2HD3 A;  3VS2 A;  3UA6 A;  3HKZ B;  5EGT A;  2EYL A;  1HZ9 A;  4BA1 I;  1QNK A;  4C3J B;  1PTO C;  3SVM A;  3CD6 T;  1H92 A;  2KDS A;  5CKD A;  3EG9 A;  1P92 A;  1MD2 D;  4CJ0 B;  1HA6 A;  1FJG Q;  1UGP B;  5JVG 3;  4PZ7 A;  3VS4 A;  2WAQ G;  1BBZ A;  3B6Y A;  5ELO A;  5HUR A;  3QII A;  3E9F A;  3C46 A;  1IGU A;  2JTM A;  2WIN B;  4AFZ C;  1I4Q A;  2DF6 A;  3CRK C;  3OS5 A;  4X3K A;  4E7Z A;  4ATO A;  1QWF A;  2KRM A;  3UDI A;  2FB7 A;  3S14 H;  2J6F A;  1DM0 B;  3BDU A;  5GAD C;  4KBM B;  4JI8 Q;  2EJG C;  5D65 A;  3MP1 A;  3KJP A;  1MJE A;  3EAE A;  5C6S A;  4BD3 A;  1PHT A;  5GAN 7;  1B50 A;  2V26 A;  3E3X A;  2MO1 A;  4C5E A;  4C3H G;  2YHT A;  2DJF C;  2E64 A;  3JCM e;  3OYG A;  1IYU A;  4F7U F;  2WKD A;  2DN8 A;  1BR9 A;  3FP9 A;  4JI8 L;  5C0M A;  4IPH A;  2UXB L;  2BE7 D;  3IQL A;  2LFN A;  1ABQ A;  4CC2 A;  1GFD A;  1CSQ A;  1V76 A;  2V1R A;  5DY9 A;  2EPB A;  3K59 A;  3VS3 A;  1AOJ A;  3JAM i;  1WYX A;  1Y8P B;  2LS0 1;  4XYO A;  2FZC B;  3RR5 A;  4A3G B;  4D8D A;  2H1E A;  3K8A A;  3TQ7 P;  4DK0 A;  4BBS G;  1AE3 A;  4FF1 A;  3KDF B;  4A3I B;  2JA5 H;  2JSO A;  3TVT A;  2ATC B;  1ZUK A;  2R7Z B;  1QJO A;  1QQJ A;  1KAW A;  2IPK D;  5IH2 A;  2ZPF B;  3OYY A;  3M0S A;  1CHP D;  1UWV A;  3VYG A;  5KCO A;  2RF4 A;  5IWA Q;  3DLL A;  2B2U A;  4C92 G;  2RDG A;  5CR2 A;  1ML0 D;  1YZ6 A;  1ZBX A;  1HNX Q;  2KT8 A;  4WTO B;  1Q82 R;  1MBY A;  4HED A;  2VL6 A;  4JRP A;  4JJB A;  2H3E B;  1A0N B;  1ESR A;  2VUB A;  4JLG A;  3OYJ A;  3C1F A;  4HCE A;  3LH0 A;  3CME T;  3TEH B;  4X1V A;  3IL8 A;  3MXP A;  3Q0A A;  4MDW A;  2A36 A;  2RJF A;  5M5Y H;  4PJO E;  2JM8 A;  4XU1 A;  1EEI D;  1EYG A;  1MMG A;  1F9P A;  2UUA L;  2ATW A;  1YCY A;  1JJ2 A;  1Z9Z A;  1E6G A;  3CCQ A;  1I5L A;  1GUO A;  3NUC A;  1PRM C;  2JW4 A;  2JXM B;  5C4Z A;  2WSC E;  2JP1 A;  1GJX A;  1SSO A;  2CP5 A;  2K3Y A;  4FSX A;  2O5J C;  2A28 A;  3C0C A;  4JPB W;  2OWO A;  2EXD A;  1LCK A;  3M54 A;  4X9C A;  3C95 A;  3JV3 A;  4PFP A;  1V9P A;  3NHH A;  4A3B B;  1U4L A;  1ZYR D;  2OT2 A;  2R7Z G;  1FGB D;  1VQ6 A;  3OY9 A;  1I0C A;  4B9X A;  1VQI A;  1BU1 A;  1IKL A;  5LMN L;  4CKB A;  1HNW L;  2DUD A;  4LD9 K;  3WOE A;  1XTC D;  1VDZ A;  3L3O C;  4PJO A;  1Z6H A;  2PCF B;  2EJF A;  2F1M A;  3E5S A;  3A56 A;  2AMC B;  2EYF A;  3H6M A;  1CK1 A;  1D0X A;  2JT4 A;  1NG2 A;  5C3E G;  3VYU A;  1RLQ C;  2Q2U A;  1D0Z A;  4PG3 A;  5FW9 A;  1QCF A;  4HT8 A;  2MK5 A;  1YHB A;  4BY6 C;  1KRT A;  1YWP A;  2N55 A;  2ZXO A;  2EYX A;  2IWH A;  2JMA A;  2VW9 A;  2QXF A;  3OTO L;  4DA2 A;  1R77 A;  1SRU A;  3M0R A;  4DR2 L;  4LF6 L;  2ZM6 L;  2ALY B;  4QMG A;  4JI7 L;  2F3V A;  2CSQ A;  2PZ1 A;  4O1N A;  2CUD A;  2ICE C;  1RTN A;  2JS2 A;  3VR4 A;  3MEU A;  1SDF A;  2PZW A;  3K7A H;  1TVX A;  4A3L G;  4KHP Q;  1Q81 R;  4A3M G;  4LF4 Q;  4JG2 A;  4J8O A;  1J3T A;  2G3R A;  1NJI R;  2M00 A;  4HVW A;  1M1K C;  1TKW B;  4C3H B;  3PFS A;  4MTK A;  2IY5 B;  2D2C C;  4ZK9 B;  4DAP A;  5GAO l;  1EUJ A;  5GAN h;  1JWU D;  2YUO A;  3X25 B;  3DUZ A;  5C4J H;  1YNZ A;  4NXN Q;  1W6X A;  4D6W A;  2YUQ A;  3ULR B;  3MET A;  2O4X A;  2B63 G;  5AFW A;  1K1Z A;  1I4X A;  1XQH A;  1V8Q A;  1ZSZ A;  3U50 C;  2MNA A;  4JI2 L;  4M77 C;  3GTG H;  4J15 A;  3MP6 A;  1JOO A;  1QIL A;  4GNX B;  2GTO A;  4J9F A;  3ITP A;  2R93 B;  4DK1 A;  1PDQ A;  4BBR H;  4J6Y A;  1U3O A;  5CKE A;  2F52 A;  2NN6 H;  1JQQ A;  1GOZ A;  4C2M B;  1SNP A;  4K8I A;  5IYD G;  1VQM Q;  3JAM E;  2YUP A;  2VXW A;  3E9H A;  3NEN A;  4N9P A;  2G9D A;  2PTK A;  3PGZ A;  4C3I H;  4OMN A;  1YNJ C;  1VQ7 Q;  4LUV A;  1DGS A;  4X66 Q;  3OYD A;  2AQ3 B;  2WV6 D;  1MMD A;  3JAM c;  5AYF A;  2C06 A;  4A3C G;  3UPU A;  2F0S A;  1VQF A;  2H8H A;  1VS0 A;  3REA B;  2UXC L;  1ILQ A;  5CV7 A;  4CDD C;  3HKS A;  2KEA A;  3OYA A;  3OHX C;  1HFN A;  3CKI B;  2EDG A;  3NBH B;  4EMG A;  1HNZ L;  2EJ9 A;  1V43 A;  5GRO A;  1VQA A;  1LT3 D;  1UGQ B;  2I2L A;  1GKH A;  2F0E A;  3L2Z A;  3PIP A;  2Z1C A;  4NP5 A;  5CBA E;  3SHL A;  3V7S A;  1ZSZ C;  1GHK A;  4DNR B;  5DEH A;  3V2T A;  1SXT A;  3TSZ A;  3N52 A;  4Q0F A;  1XMQ L;  1S40 A;  3SK6 A;  1WZO A;  1TWG H;  5GAN 4;  4ZKB B;  1N36 L;  4CKC A;  1H3H A;  3MFG A;  3PO3 H;  4GLV B;  1PH1 A;  1BOS A;  4IKF A;  4LDX A;  5M9O A;  3CCJ Q;  1WHJ A;  3RNJ A;  4K6L A;  1L1O B;  2FMM A;  5F2D A;  4PNY A;  4XQJ A;  2KGT A;  2LTO A;  1O7Y A;  2KRS A;  2ZPE B;  1AHJ B;  2DXU A;  4ZGD B;  5J3B A;  1ET6 A;  2R6G A;  2E2J H;  1CKO A;  5LL6 S;  1DYQ A;  4UY8 C;  1ASZ A;  2E2I H;  1S5E D;  2RHQ B;  2DZC A;  4M7D A;  1G2S A;  5LJ5 j;  3C1E A;  4A3M H;  3TBI B;  3E6Z X;  3H94 A;  2F0N A;  2QQ9 A;  2VVK A;  2Z6B A;  5FLM H;  3A8M B;  1TWC B;  3S15 B;  4FF2 A;  4DR3 Q;  4MN3 A;  2UUC L;  2TSS A;  4LW1 A;  1SFO B;  3GTL B;  1CZW A;  2FHT A;  2X51 A;  2ID0 A;  2ED0 A;  4WRD A;  1K73 C;  3E19 A;  1K9M U;  3OMC A;  1IGQ A;  4QVZ A;  2O2L D;  2OTJ A;  1WLP B;  3J7A V;  1KLG D;  4J9C A;  1G3W A;  1SSF A;  2ZTD A;  3MVV A;  4XTY A;  3KF6 B;  1PA6 A;  1JXM A;  4J1M A;  1N5Z A;  1MIU A;  4JJN K;  1MV0 B;  3MAQ A;  3I9Q A;  1PZK D;  2FMC A;  1OXT A;  3PUY A;  1IYV A;  1ZEQ X;  3NP8 A;  4GNX C;  2PQW A;  2CUB A;  4KN7 C;  3CC7 A;  1YI2 T;  2MO0 A;  2EJF C;  1RCV D;  3HOZ G;  3P75 A;  2DYI A;  2BUD A;  4M7D C;  1Y96 B;  3H0I A;  3QB3 A;  3BYT B;  3M9B A;  1MUZ A;  1Q86 U;  3BVZ A;  4IQZ A;  2NZO A;  4POG A;  4JDS A;  5LHY 1;  4A4E A;  2VB6 A;  3CBP A;  3HOV H;  3X20 B;  4BA2 I;  2ZTE A;  4QJF A;  4C56 C;  2EWN A;  1W2B A;  1TWG B;  1YIJ T;  1G2B A;  2X35 A;  3I4M H;  5I2M A;  1K8M A;  4ZNX A;  3C2P A;  1WD0 A;  3R6N A;  3WVD B;  4KUL A;  2JEB I;  3QUI A;  2YUN A;  2B8A A;  5KYL A;  3HP9 A;  4RFB A;  4OWW B;  1IO6 A;  1KSW A;  1NBE B;  1BUV T;  4DV7 L;  1WCM B;  1PH8 A;  1EL0 A;  3F2B A;  3MCA B;  2ZXR A;  3GD7 A;  3PIO 3;  1G3Y A;  4BDY A;  1LT5 D;  2UUC Q;  1BCO A;  3WXM B;  5FRO A;  2HSE B;  2QQB A;  4DV5 Q;  1N32 L;  4JS4 A;  2RQW A;  1KIK A;  2VY3 A;  5ECA A;  1WHM A;  2DM1 A;  5CVI A;  3JCM J;  4LNQ A;  3JB9 H;  4LFB Q;  1D6E C;  2LSS A;  2NB0 A;  4OML A;  3C12 A;  3DM3 A;  1GUT A;  3ERS X;  4X3S A;  1W2B P;  5ELE A;  4DGZ A;  4FF4 A;  2ECZ A;  2PUK B;  1O75 A;  3OYC A;  2MIO A;  4B3R L;  1GD7 A;  1N9R A;  2I0Q A;  2KEE A;  2KBT A;  2AQ1 B;  4L63 B;  1M4V A;  2K5H A;  1KXL A;  1VQN T;  4M7A A;  2PYK A;  4P75 A;  4G7O C;  3DLM A;  1ZYR C;  4JBJ A;  1WFQ A;  1O7L A;  2FFK B;  1Y1W B;  4OMP A;  4DR4 Q;  4I7Z C;  1Z47 A;  4C8Q E;  4IPC A;  3RZO H;  2K75 A;  3QZ9 B;  4DUY L;  1MSH A;  4DQ2 A;  4X6A H;  1OUL A;  1VQ7 T;  2MI6 A;  1D3B A;  4LNP A;  1X3E A;  3S17 H;  2IVW A;  2WSF E;  4UP9 A;  2IX3 A;  3QHS A;  4ZGJ B;  1V1Q A;  2JA6 B;  4K0K Q;  1TXQ A;  2GNC A;  1Q90 A;  4KHV A;  4IOA A;  2E70 A;  1OTC A;  4Y28 E;  3KUP A;  1NPP A;  1HJD A;  2XTI A;  2EBP A;  3G7Z A;  2O9V A;  5EPL A;  2AWO A;  1VYT A;  3SWN A;  3HKZ E;  2MYS A;  4NMZ A;  2XIC A;  2K6D A;  1SYE A;  4PFZ A;  3CF5 A;  2Q2H A;  2DL8 A;  1K9M R;  1I3Q H;  4OGE A;  5CKH A;  3P8D A;  5LJ3 e;  2OTL T;  2RCN A;  4M75 G;  1STH A;  1L0X B;  1TG0 A;  1UEC A;  1VQ8 T;  4QB4 A;  4C3H H;  3CPW P;  5IT9 c;  1WJJ A;  2QKI C;  4XXE A;  4B6M A;  3UWN A;  4DEY A;  5A0D A;  2BZX A;  1GXI E;  3EQL C;  3J81 L;  2FRW A;  1WXU A;  2LJ3 A;  3GV6 A;  5IGD A;  1Y0M A;  4JI1 Q;  2JEA I;  3GTO H;  3L2U A;  1NE8 A;  2AT1 B;  1O80 A;  4R1J A;  1Q7Y C;  3MA2 B;  1JEG A;  2F0F A;  1EY9 A;  4C8Q D;  4HMJ A;  2RHI A;  1XPR A;  2RD1 A;  2X4W A;  2YTX A;  3LGJ A;  4XTX A;  3QO3 A;  5D7U A;  1GFC A;  2VC8 A;  4ORZ A;  1QZH A;  4FW1 A;  1DOM A;  5CV8 A;  4AFQ C;  4ABN A;  4JV5 Q;  8ATC B;  1OU9 A;  1M90 U;  3CP0 A;  2COW A;  3SE0 A;  1YCS B;  1YWO A;  3D4R A;  1WD1 A;  3NGP A;  3SFM A;  2K5N A;  2RK2 A;  4YCV A;  2JA8 B;  5M5Y B;  1KQS A;  2DIG A;  1GCP A;  5G3L D;  4A3K H;  4KY5 A;  3KLW A;  2DIQ A;  3M53 A;  2R5A A;  4YY3 Q;  1MMN A; 
#chains in the Genus database with same CATH homology
 2O9S A;  2DL3 A;  3UF4 A;  1UFF A;  3I5R A;  4DEX A;  3PE0 A;  2LP5 A;  2LNH B;  4Z89 A;  2C0O A;  4F16 A;  5GJV B;  2EKH A;  2K2M A;  1UTI A;  4LE9 A;  1T3S A;  2LQW A;  2D1X A;  5IXF A;  4A63 B;  4RTZ A;  5L23 A;  2HBW A;  5IHN A;  2DJQ A;  1AZG B;  1ZX6 A;  1ZSG A;  2W10 A;  1HSQ A;  4Y92 A;  1NYG A;  1NEB A;  1YN8 A;  4LUD A;  1M3C A;  4Z88 A;  3VRY A;  1X27 A;  1UDL A;  2KXD A;  2JTE A;  1TUD A;  1HD3 A;  4IIM A;  1M8M A;  1AZE A;  1B3Q A;  1AWO A;  4M4Z A;  3THK A;  2YDL A;  1H8K A;  1TUC A;  1RI9 A;  1BB9 A;  2JMC A;  2P4R A;  4GLM A;  1E6H A;  1M3A A;  2V1Q A;  4HVU A;  2SEM A;  2KNB B;  5I22 A;  1NYF A;  3M0U A;  4JZ3 A;  1PRL C;  2EPD A;  3VRZ A;  1T0H A;  2ESW A;  1WDX A;  2GBQ A;  1ZUY A;  1QWE A;  1SSH A;  2E5K A;  1UHF A;  3PVL A;  1UG1 A;  4IIO A;  3KFV A;  1VA7 A;  2MCN A;  2FO0 A;  4WCI A;  2L3S A;  2CSI A;  1OPL A;  2K9G A;  1BK2 A;  1CKA A;  4RTU A;  1ZUU A;  2NUZ A;  2XMF A;  2LZ6 B;  1KFZ A;  2DX1 A;  1M30 A;  1WX6 A;  2AK5 A;  2FPE A;  2O31 A;  1X2Q A;  1K9A A;  1Y57 A;  4CC4 B;  1QKW A;  2GQI A;  1UHC A;  1M3B A;  4AG2 C;  3SEM A;  3RBB B;  1PWT A;  2DBK A;  1B07 A;  2RQU A;  1UUE A;  2OAW A;  4QT7 A;  2RN8 A;  1T0J A;  1JO8 A;  3VS2 A;  3UA6 A;  2X3W D;  1RUW A;  3M0T A;  1JXO A;  2CH4 W;  1H92 A;  1FYN A;  1YP5 A;  2DLP A;  2QDL A;  2VKN A;  2F2X A;  3VS4 A;  1BBZ A;  4RTW A;  2L3Q A;  2ROT A;  2EYW A;  1I07 A;  2DF6 A;  4AFZ C;  1QWF A;  2KRM A;  2K79 A;  2J6F A;  3SHW A;  2FRY A;  1ABO A;  1ZBJ A;  1PHT A;  2GTJ A;  2DRM A;  2YSQ A;  1UJY A;  2A08 A;  2ENM A;  3IQL A;  1ARK A;  1ABQ A;  4CC2 A;  1AVZ C;  1GFD A;  2V1R A;  2CT4 A;  3VS3 A;  1AOJ A;  2RQR A;  1UJ0 A;  1WYX A;  2LJ0 A;  1K0X A;  4D8D A;  4D8K A;  1VYV A;  3TVT A;  1ZUK A;  2VWF A;  1OPK A;  2BZ8 A;  5IH2 A;  3M0S A;  3VS7 A;  1X6B A;  1GRI A;  4OMO A;  4AFS C;  1S1N A;  2KT8 A;  2CDT A;  4JJB A;  3VS0 A;  1NEG A;  1A0N B;  2HSP A;  2K7A A;  4X1V A;  4EIK A;  2A36 A;  2L3P A;  2LCS A;  2JM8 A;  2IIM A;  1WA7 A;  4KRT A;  2O88 A;  1Z9Z A;  2F2V A;  1E6G A;  3H0F A;  1K76 A;  1PRM C;  2JW4 A;  3UAT A;  2A28 A;  3C0C A;  3FJ5 A;  4JPB W;  2FG0 A;  1K4U S;  1LCK A;  1NM7 A;  2DNU A;  3JV3 A;  2LJ1 A;  2CT3 A;  1X2K A;  1I0C A;  1BU1 A;  2W0Z A;  1GCQ A;  2J6O A;  1WI7 A;  4OMM A;  4HVV A;  2HCK A;  2RPN A;  1KJW A;  2JT4 A;  1NG2 A;  3I5S A;  1RLQ C;  5FW9 A;  1QCF A;  2EGC A;  5FWC A;  3EG1 A;  1YWP A;  2OI3 A;  2EYX A;  2RQV A;  3NMZ C;  2JMA A;  2DA9 A;  3QWY A;  5IHI A;  4F17 A;  2ED1 A;  3M0R A;  2KRN A;  1U06 A;  5HCK A;  2CSQ A;  2JS0 A;  2PZ1 A;  2EYZ A;  2CUD A;  4RTY A;  3GBQ A;  2JS2 A;  1SPK A;  1T3L A;  1V1C A;  2LQN A;  2NWM A;  1AWJ A;  1J3T A;  4HXJ A;  2MOX A;  4JJD A;  4J9I A;  1OOT A;  4HVW A;  4OMQ A;  1AWX A;  4J9B A;  2YUO A;  3EG0 A;  1YNZ A;  3TSW A;  4LN2 A;  1W6X A;  2YUQ A;  3ULR B;  2FPF A;  2EYY A;  1K1Z A;  3PVQ A;  1AD5 A;  2AZS A;  4J9D A;  5EC7 A;  2DBM A;  4RTV A;  2D8H A;  2GTO A;  4J9F A;  2CH4 A;  1U3O A;  4R0K A;  1JQQ A;  4RUG A;  2YUP A;  1AEY A;  2KYM A;  2PTK A;  1CSK A;  4LUE A;  4OMN A;  2D0N A;  3VS6 A;  2F2W A;  2KXC A;  3H41 A;  1ZLM A;  2ABL A;  2H8H A;  3REA B;  2GGR A;  1W70 A;  4FSS A;  2KEA A;  2M0Y A;  1SRL A;  1Z9Q A;  5FWB A;  2ROL A;  3TSZ A;  2K3B A;  1NLO C;  2DYB A;  1SHG A;  1H3H A;  3RNJ A;  2HDA A;  1NLP C;  1K0S A;  2KGT A;  2KRS A;  1GBQ A;  1SHF A;  1X69 A;  2X3X D;  1X6G A;  2J06 A;  2SRC A;  4J9H A;  3H0H A;  4ESR A;  1WFW A;  3UA7 A;  2VVK A;  2HEQ A;  1VYU A;  2KR3 A;  2KRO A;  1SEM A;  2EW3 A;  2ED0 A;  4HCK A;  1W1F A;  4JJC A;  2EQI A;  4F14 A;  5IHK A;  1WLP B;  2DL5 A;  3EG2 A;  4J9C A;  4E6R A;  1XOV A;  2J7I A;  3I35 A;  1JXM A;  1N5Z A;  4Z8A A;  3EHR A;  1MV0 B;  3I9Q A;  2AZV A;  1MV3 A;  2RF0 A;  1WXT A;  3U23 A;  2JM9 A;  2CUB A;  2L2P A;  5GJW B;  2I0N A;  3REB B;  2BZY A;  2BTT A;  1QKX A;  3H0I A;  2J05 A;  1E7O A;  1MUZ A;  1U5S A;  1G83 A;  2DMO A;  4CC7 A;  2DL7 A;  3A98 A;  1JU5 C;  2DE0 X;  2M51 A;  3ZL7 C;  1G2B A;  1QLY A;  4J9E A;  2J6K A;  4ZNX A;  2EVR A;  3R6N A;  3QWX X;  1UGV A;  2YUN A;  2DIL A;  1IO6 A;  1KSW A;  5IXB A;  2PNI A;  2AKK A;  1I1J A;  2A37 A;  2LMJ A;  1UE9 A;  3M0P A;  2JXB A;  1X43 A;  2RQW A;  1KIK A;  1CKB A;  2DM1 A;  5ECA A;  2L0A A;  1WXB A;  4OML A;  2DVJ A;  4RTX A;  4JZ4 A;  2ECZ A;  1FMK A;  2MIO A;  1GCQ C;  2FEI A;  2KBT A;  2DRK A;  2RNA A;  1OEB A;  4OMP A;  1PNJ A;  3O5Z A;  4GBQ A;  2EGA A;  4J9G A;  1EFN A;  2CRE A;  2RQT A;  4LNP A;  2LX7 A;  2GNC A;  1HJD A;  2EBP A;  3EHQ A;  2EGE A;  2O9V A;  1VYT A;  4CC3 A;  1PKS A;  2K6D A;  1GBR A;  4AG1 C;  2DL8 A;  3NPF A;  2OJ2 A;  1RLP C;  3VS1 A;  2B86 A;  1TG0 A;  1UEC A;  1M27 C;  4AFU C;  4DEY A;  2C0T A;  2BZX A;  2FRW A;  1WXU A;  2LJ3 A;  2G6F X;  3NHN A;  1Y0M A;  2O2O A;  2KT1 A;  3M0Q A;  4RTT A;  5I11 A;  2KYB A;  1JEG A;  3LH5 A;  3VS5 A;  1OV3 A;  3EGU A;  1GFC A;  2YT6 A;  3EG3 A;  1SRM A;  4ORZ A;  2KE9 A;  4AFQ C;  2RMO A;  1PKT A;  1WIE A;  1YCS B;  1YWO A;  3CQT A;  2C0I A;  3NGP A;  1AWW A;  2FPD A;  1GCP A;  4K11 A;  2AKL A;  2D8J A;  1GL5 A;  2DL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...