2CH4W

Complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
139
structure length
139
Chain Sequence
KEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reconstruction of the Chemotaxis Receptor-Kinase Assembly
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/chemotaxis
molecule keywords CHEMOTAXIS PROTEIN CHEA
total genus 19
structure length 139
sequence length 139
chains with identical sequence Y
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ch4W01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2ch4W02
4QT7A 2LX7A 2LZ6B 2EKHA 4J9EA 1BU1A 1S1NA 1VYUA 1OPLA 2DYBA 2E5KA 2JS0A 1KJWA 3SEMA 1QWFA 2D1XA 1YN8A 2KNBB 4DEYA 4RTYA 2JTEA 2KYBA 2KBTA 2JXBA 1TUDA 4RTTA 1KIKA 3EHQA 4A63B 4JJCA 1GRIA 1I1JA 3PVLA 3VS2A 2MCNA 4D8KA 5I22A 2NWMA 2YUNA 3GBQA 3UA6A 2I0NA 2AZSA 1UGVA 1PKSA 3EHRA 1UJ0A 2EGAA 1PNJA 4R0KA 2HCKA 1ZX6A 1VYVA 3VS1A 3R6NA 1PWTA 1M3AA 1WI7A 2YT6A 2JM8A 2GQIA 3M0TA 1ZBJA 1OPKA 1FYNA 1KSWA 2AZVA 2KR3A 2LP5A 2JM9A 1X69A 2RF0A 1K9AA 2PZ1A 3VS5A 2C0TA 4J9CA 1AWOA 2OI3A 3C0CA 2GGRA 1UUEA 4JZ3A 2VKNA 2K9GA 1AOJA 2KE9A 2FPFA 3CQTA 3UATA 1SRMA 2DL8A 1U3OA 2DL5A 1AEYA 2JMAA 1JXOA 1QLYA 1B07A 1SHFA 2A28A 1QKXA 4Z88A 2QDLA 2J6OA 2DRMA 2MOXA 3NMZC 5GJVB 3VS6A 2L0AA 2FRWA 5GJWB 2KT1A 2BZXA 2L2PA 3VS4A 1M30A 4J9DA 3I5SA 2DRKA 1I0CA 1RI9A 3QWXX 2P4RA 3TVTA 1K0SA 1JEGA 1BK2A 1CKBA 2LNHB 4CC3A 1UJYA 2PNIA 2IIMA 1K1ZA 3VS7A 3M0QA 1Z9ZA 5I11A 3M0UA 2K6DA 2YDLA 3I5RA 2K3BA 5FW9A 1EFNA 5HCKA 1UFFA 2ROLA 4CC7A 2CUDA 1UDLA 3PVQA 1VYTA 4LNPA 4ESRA 1NG2A 1RLPC 2V1QA 2KXDA 2EYXA 1E6HA 1MUZA 3UF4A 1Y57A 1ABOA 2B86A 2JMCA 4K11A 2CUBA 2M51A 4D8DA 2ED1A 3EGUA 2DL3A 1FMKA 1GCQC 2L3PA 2KT8A 1SPKA 1MV0B 1V1CA 1H3HA 1BBZA 5IH2A 3H0IA 1JXMA 2DF6A 1IO6A 4CC4B 4HVUA 1NM7A 2ECZA 1WLPB 2KRSA 1CKAA 3H0FA 4OMPA 2J05A 2O31A 2CREA 2A37A 1OV3A 2X3XD 2W0ZA 4OMLA 2BZ8A 4LE9A 1X6GA 2C0OA 1QCFA 1GFCA 2LQNA 1G83A 2J6FA 4KRTA 1WIEA 2EGCA 2X3WD 2HEQA 4AFSC 2DL4A 3PE0A 1G2BA 4LN2A 1ARKA 3REBB 4F14A 4X1VA 2BTTA 1WFWA 2GTOA 2DMOA 2XMFA 5FWBA 1W1FA 5IHKA 2DBKA 1SSHA 1M27C 1BB9A 1GBQA 1XOVA 1YNZA 2HDAA 3TSZA 4J9HA 1VA7A 4AFQC 4J9FA 3M0RA 2A08A 1E7OA 2AKLA 3UA7A 4EIKA 1ZLMA 3H0HA 2FEIA 1YCSB 1NYGA 1A0NB 2LJ3A 2K2MA 1SEMA 2MIOA 5FWCA 1T3LA 2VWFA 4FSSA 2EW3A 1NEBA 3VS3A 1I07A 2K7AA 2RPNA 3NPFA 1NLOC 3ULRB 2NUZA 2KYMA 2AKKA 4OMQA 1J3TA 1N5ZA 1SHGA 1MV3A 1OEBA 2LCSA 1U5SA 2G6FX 2O2OA 3JV3A 2FG0A 3ZL7C 2CH4W 2EYYA 3IQLA 4Y92A 4DEXA 1RUWA 2LJ0A 4RUGA 3KFVA 4J9BA 1TG0A 1Y0MA 1NYFA 4HVVA 4WCIA 1PRLC 4JPBW 5IHIA 3RBBB 3VRZA 2RMOA 1KFZA 2O88A 3VS0A 3THKA 4OMMA 4RTXA 4Z8AA 2CSIA 2KRNA 1X43A 3FJ5A 1HSQA 4OMOA 1WA7A 2KGTA 1UE9A 1AWJA 1YWOA 2RN8A 2ABLA 2O9SA 4RTVA 1ABQA 1LCKA 4IIMA 3M0PA 1K4US 1M3BA 2EGEA 2GTJA 1K76A 1HJDA 1ZUKA 2BZYA 5IXBA 2YUQA 4AFZC 1W70A 4GLMA 2CT4A 2CT3A 1WXTA 2H8HA 1GCPA 2HSPA 3QWYA 1X6BA 1ZUUA 2EQIA 2KXCA 1GCQA 1JQQA 3TSWA 1UECA 2ED0A 3LH5A 1JU5C 2RQWA 5EC7A 2RNAA 2AK5A 3NGPA 4M4ZA 2DX1A 2GBQA 2CH4A 2V1RA 2EBPA 4J9GA 1B3QA 2W10A 2D8JA 1AWWA 1OOTA 2DJQA 4JZ4A 2DE0X 1UHFA 1UTIA 1NLPC 3H41A 4JJBA 2K79A 3A98A 4IIOA 1CSKA 1UHCA 2KROA 1WXBA 1SRLA 2RQVA 2SEMA 1AZGB 3VRYA 1PRMC 1RLQC 2L3QA 1TUCA 1WDXA 1AWXA 2CSQA 2PTKA 4HXJA 2YUPA 1WYXA 2L3SA 4HVWA 4LUDA 1UG1A 4JJDA 1X2KA 1PKTA 1YWPA 4OMNA 2JW4A 5ECAA 3EG0A 1T0HA 1JO8A 2HBWA 3EG1A 2SRCA 2D8HA 4GBQA 2YSQA 1ZUYA 4RTWA 2GNCA 2FO0A 1NEGA 2RQTA 2DL7A 2LQWA 2EVRA 3EG2A 2FPDA 4RTUA 3RNJA 2F2VA 1QWEA 2ESWA 2M0YA 2DLPA 2DILA 2DA9A 4AG2C 4Z89A 2A36A 2D0NA 2F2WA 3EG3A 1YP5A 1U06A 1X27A 2KEAA 1T0JA 1T3SA 2VVKA 1M3CA 1ZSGA 2LJ1A 2OAWA 1GBRA 2CDTA 3U23A 4AG1C 1X2QA 2F2XA 1GFDA 2YUOA 3M0SA 3SHWA 2J6KA 4J9IA 1M8MA 3REAB 1W6XA 3I35A 4F17A 1AVZC 2OJ2A 2KRMA 4E6RA 2EYWA 5IXFA 4ORZA 1WX6A 4AFUC 2DVJA 4F16A 3I9QA 4LUEA 2RQRA 2DBMA 2J7IA 4HCKA 2ENMA 1AZEA 2FRYA 2EPDA 2FPEA 1QKWA 1H92A 1HD3A 2DM1A 1PHTA 2DNUA 1K0XA 1AD5A 2ROTA 3NHNA 2RQUA 5L23A 1GL5A 2EYZA 4ZNXA 2C0IA 1Z9QA 2JT4A 2O9VA 2JS2A 3O5ZA 4RTZA 2J06A 1E6GA 2LMJA 1H8KA 5IHNA 4CC2A 1WXUA
chains in the Genus database with same CATH superfamily
1VIEA 2PNHA 1ZA2B 2JA8B 4GN4B 4RCBA 4C3HH 1PTOC 1PYBA 4GNXC 2UU9Q 1S1NA 4FT4A 5CIUA 1FD7D 3FEOA 1Q90A 3FEWX 4Y7NB 5I2SA 1AZPA 2EYOA 2QAZA 2R7FA 5DEHA 2O5IC 4NP5A 1KJWA 1ENAA 2PQEA 4OVAA 4BE1A 2PQWA 3GPLA 3SEBA 3K5LA 2K04A 4KH0B 2HDMA 5GAN2 3OA6A 3QZ9B 4LDWA 1BI3A 2D1XA 2I5LX 2ATWA 2D9TA 1IBKQ 2M2LA 4MNOA 4A4FA 2JTEA 1IKMA 4N4GA 3S1QH 1JWMD 2JA8H 4QVZA 5ELEA 3M3YH 2KBTA 4EMHA 1STEA 1V8QA 2JXBA 4X62Q 2JA6G 2JN4A 4FO2A 1BR9A 1WFQA 2B2UC 2Z6KC 5LJ5e 2XVSA 4IUUA 5FLMH 1JWSD 4A3FB 1I1JA 1NPRA 5GMKe 4A3JG 1MHWC 1V76A 3OYIA 3H3VC 3V96A 2NWMA 2K01A 5H1SE 5JEAH 3C2PA 3K5MA 1NE3A 2EIFA 1UJ0A 3I72A 2EQKA 1M1KC 4X66Q 1I50H 1PXUA 3M58A 1FYCA 2EPBA 3WOFA 5GAMj 1PCXA 4PJOD 3VS1A 4LFCQ 1WI7A 3EG9B 3HOYG 1M5Q1 2NUPA 2JM8A 2WSCE 3A8KE 4IQZA 4BBSB 2VQFL 3D31A 4H02A 3M0TA 4XTXA 1S4ZA 3A8GB 1K83B 2AUKA 2KEEA 1NMFA 4DR1L 3S24A 5L37A 2ZZDA 1DOLA 1LTAD 1LTGD 2JYOA 2L1BA 2RF0A 2ZPFB 4YY3Q 3MXUA 3U9SA 4IFDI 1K28A 1K9AA 2Z8LA 3LWHA 2EAYA 2L4NA 1IXRA 1PA6A 1G8XA 4J9CA 1W3SA 2O2LD 5FRNA 2Q8IB 4RMFA 2A73B 3PGZA 1N33Q 3S16H 2XHCA 2Z9HA 1BCMA 2WINB 2UUBL 2R5MA 4BB7A 5IT9L 4N4IA 2A6ED 5C6AA 4Y52H 2YRDA 1ASZA 4M75D 3S3MA 4X65Q 4M77F 2CWPA 1U1SA 4FDBA 4BXXG 2FPFA 2D0PA 2CCZA 1SRMA 3CD6Q 3CCSQ 3EQLC 4LF6Q 4LFBQ 3OB9A 4MTNA 5A0GA 2JMAA 1G2TA 1QLYA 3KK7A 3S1MB 2IPOB 2A0FB 2H3EB 2OTJT 4KGZB 2HCCA 1UB4A 1EEID 3MEFA 2XIWA 2QDLA 1U4MA 3PO3G 2EYHA 2EJ9A 2M0OA 4NW2A 3VS6A 1FGBD 3G6JB 2FRWA 4L6V5 5GJWB 1FR3A 1HFNA 2KT1A 3TEEA 3M85A 1IYVA 2D2CC 2R61A 5IYCH 3M56A 3K59A 1KABA 1EFWA 1I5FA 1GXDC 2E3HA 2XDBA 1HJPA 5CV7A 5C0XG 1CKNA 1PLFA 3TVTA 1X32A 3AYHB 4RFBA 1ZQ1A 3QR8A 3TZUA 4DV6Q 1GXIE 1BK2A 2IG0A 2E70A 3EAEA 4GY5A 1V1OA 5LJ5j 4CC3A 2CQOA 1GVPA 2HDLA 3MP8A 5TSSA 3OWEB 2K03A 5GAOq 1QVFA 1IYJB 4A3LG 4WTOB 3HRTA 1UGQB 3TCJA 5GAMh 1K1ZA 3GP7A 4X9CA 3L2VA 3MXPA 3NSWA 5D3DA 3I4MB 1VQCA 1RTOA 2F3IA 1CQFA 3I5RA 4LUOA 4NOYA 1VQ9A 3DHQA 2LT1A 1S40A 3J81L 5CKEA 3EVQA 3J81c 2B2TA 1UFFA 2ROLA 2G9DA 4LF4Q 3AEVA 4J7IA 2PW7A 1YNJC 4XTZA 4A76A 1QWYA 2FHTA 4AT1B 1MD2D 4DQ2A 4KTAA 4FF1A 1NG2A 2ICIA 1J5EQ 2A3LA 4C92C 2V1QA 2KHJA 2X4XA 3OSOA 4MDXA 1VQ9Q 4LDUA 1SNQA 3NTIA 3K58A 2I2LA 4C8QE 2N55A 1DJ7B 2L9HA 3J7A5 3UF4A 4QMGA 2X4WA 3X28B 3OHXC 1HK9A 5CV8A 3EJIA 3FIFA 2K5IA 5FJ8H 1TY2A 2CUBA 4RMOA 1VQ6Q 1IXDA 1GHJA 4JBJA 4D8DA 5HK0A 3BYYB 4NB3A 3CD6T 5LJ5f 3T1HL 3KJPA 1JC7A 2E4HA 1QP2A 1K83H 4XYOA 2L3PA 1GCQC 4ODGA 2KT8A 3CPWA 4UHVA 4APVA 4CDCC 4LDXA 1SPKA 3WDNA 1PHJA 4DR3Q 1BBZA 3PMIA 1T5EA 1R8OB 4CC4B 2Y90A 3G71T 3E9HA 2VC8A 3NE5B 2MWPA 3HSBA 5M5WB 4DV5Q 2QGFB 2J05A 1I4XA 2O31A 2QQRA 3CCVA 4KGXB 2JA5G 2CREA 2LC4A 1S5FD 1B8AA 2W0ZA 2VY3A 2KUMA 3LWUA 3I4LA 1M90U 1K73R 4POGA 3J81i 3I56A 3FC3A 3GD7A 3K81C 2HL5C 4LE9A 1X6GA 1Y14B 3AMUA 2EKOA 2LQNA 3JB9D 3MXNB 4DR6Q 1G83A 2XSCA 3QOJA 5GAOn 2RJEA 1XMOQ 1TH7A 2EGCA 4DR4L 1VQIA 2DL4A 5IGCA 2RB6A 1UE1A 4X3KA 4LN2A 1HZAA 2ATCB 2CVRA 3OY9A 2X35A 4BI8B 4C92A 1OX8A 2K2VA 4QGUA 3LWIA 4MHEA 3DUZA 1OXTA 5FWBA 4FSXA 1I6VC 4M7AB 1RJTA 4HMJA 3H94A 3OS2A 1SSHA 4U673 4LF8Q 3I4MG 3G71A 3NWTA 4BI3A 3MZ5A 3PUWA 2RHSB 4J9HA 3H0GH 1PTOD 1EQQA 3HRSA 3NK9A 2QA4T 1LT4D 2R58A 3M4OB 1EUJA 1B9MA 1QVGS 3QG1A 2GFAA 3CD6A 1PTOF 3HHTB 1H3ZA 1EQTA 1E7OA 2AKLA 4X9DA 2B2WC 2RHQB 3I8ZA 1ZLMA 2EY2A 5M3FH 5IAYA 4M7DF 4XXEA 4Z02A 1KNAA 2RD1A 3LGJA 2K5WA 3GTOH 2I46A 1RKNA 2WSEE 4A53A 1TUGB 2MIOA 4P5NA 1PFMA 4ZUJA 2R7ZB 1KD1C 3A54A 4V190 3OMCA 2YRVA 3JCMV 5T1IA 4F8MA 2KQ3A 2PW5A 4LF9L 2EW3A 3VUZA 4P75A 3OYEA 1SAPA 3L2ZA 4A3KB 4FYWB 3QPHA 3K5OA 5BR8L 4LNQA 3TSSA 1NEBA 2F5TX 1A2UA 3A8IE 3VS3A 1ET9A 4JI3Q 3RMQA 3PIO3 1F2ZA 2B2TC 2JA7G 5M5WH 2VB2X 1XTDA 4LFAL 1PD1A 2AKKA 3KUFA 1PFBA 1VQ9T 1N34L 4MZ9A 1Z9FA 3FKIG 2RQXA 3S2DH 1JMCA 5COYA 1SYDA 1D1KA 2EYYA 1E7ZA 4X3UA 1GJXA 1HA6A 5KYXB 2ALYB 3QDRB 3IQLA 4RWSC 4M7AA 4LUZA 1VQ6T 4DNRB 3T1YL 5ELBA 2KVQG 5A0DA 1I5OB 3I55T 4O42A 3HP9A 1X6OA 4M7AD 3HOWH 2X9HA 3W1BA 3VYHB 1XXGA 1H9SB 2Y4XA 4UP9A 1WJQA 1PRTD 4PQXA 2DTIA 4C92D 1YHQA 3EFRA 1Q82R 4A4KA 1I94L 2CZ0B 3T53B 3RBBB 2KVMA 3VRZA 2Z4HA 3OW2P 1M2VB 1YHBA 1UGPB 4FW2A 3CMEQ 1BKBA 1DZ1A 5GAN3 4RTXA 3JCMf 2KRNA 4QUCA 2J7ZA 4CDDC 3NQIA 2EYQA 3ULJA 1D3BA 3OS5A 4X34A 1HSQA 5CAIA 1QZGA 4OMOA 3OW2A 1WA7A 2FVUA 3CCQA 3M9QA 3CCRQ 5E7NA 4AIMA 5FJ8G 2YTYA 2E12A 2DJFC 1VQOT 1CUKA 3OIQA 4IJHA 2JA6B 3EH2A 4RG1A 1R77A 2MJ8A 2O9SA 3RDVA 1NJIR 3M4YA 4O6JA 1LCKA 2A6HD 3R3OA 3JAME 3GTPB 1OZ3A 4IIMA 3M0PA 3G7ZA 2GVBA 1M3BA 2EGEA 4OB3B 4QKUA 1Y1VB 1U5KA 1HJDA 1B34A 4KGVB 2NN6H 4G7HC 4QIWE 2K52A 3UI2A 3Q24A 1KL9A 1I8FA 4AYBG 4FNFA 5IXBA 2RO0A 2CT4A 4N4HA 5GAN6 1WXTA 4R55A 3OYHA 1YIJA 1STHA 3CP0A 2H8HA 4BY7H 2HIXA 2JOYA 5LMNL 3OSVA 3G6EA 1TS3A 1SE8A 4JCVE 1GCQA 1QNKA 5C0MA 2RCFA 5KYYB 1UECA 2KK4A 5GANg 2CP7A 3A8HB 2MO0A 4EQ5A 1Z7TA 4DR5Q 4EMKC 2FMMA 2ED0A 1W4SA 3T16A 4BY6B 1JU5C 2O01E 4RGNA 2RQWA 5M3MB 2EQUA 1EIFA 2LNVA 3TDQA 5C4XH 3F1ZA 4M4ZA 4EX5A 2LQ8A 1B3QA 1EIGA 3CCUT 2KOLA 2A6EC 5C44H 1G91A 4E7LA 1AWWA 1G6PA 1X3PA 3O13A 1TOVA 1VMPA 1BCPB 4LF5L 4JZ4A 1UHFA 1LPLA 4ZKCB 3WXMB 4M78A 1RIPA 3UT1A 2L3RA 3CCUA 3S3OA 3VYUA 4BUGA 3A5UA 4ZTJA 1M1GA 1I3QB 4DK1A 4C8QC 1SNMA 2Q2HA 3OPOA 3SGIA 4PK4A 5FLXL 1JRIA 1Q86C 2HKNA 5KYXA 2KROA 1M9SA 5EPLA 1WTWA 3PSIA 1XJVA 3VKIA 1Q81C 1UNSA 1BCOA 3TREA 1PRMC 1S3OA 4ZUIA 1T9HA 2EFIA 1SYEA 4K2LA 4KI0A 1AWXA 1JT8A 4HXJA 2LQKA 4DV1L 1WYXA 4ZK9B 3LH0A 2L3SA 4HVWA 2JXMB 2EYJA 4M1UB 2AQ2B 3KDFA 4X3SA 2RDGA 3HGBA 1OI1A 4K5XA 1JWUD 3DMUA 1T0HA 1ZHIA 3OYJA 4DR3L 5GAMd 5KYWB 5ISRA 3T9NA 5E4WC 2RI5A 1TTHB 2KQWA 3NBIA 5LMUQ 4HJ9A 5C6SA 3M54A 2KCMA 5JJZA 2IHFA 2FO0A 1B3AA 2IWHA 4ME3A 1C6VX 2CZ6B 2DL7A 2LQWA 2RI3A 1JJCB 2UU9L 3RNJA 1UGRB 4AMCA 4E7HA 3CAMA 2N3SA 3CHBD 1QUQB 2E74C 5IT9E 3MFYA 1Q82C 4XTCS 4DBFA 1ILQA 4BS9A 5CCAA 5M3MH 5GMKi 1HCZA 1YJNT 1KDCA 4Y91A 2E75C 4K14A 2DA9A 4Z89A 2NZOA 5FRMA 3EG3A 1T5XD 4ZKBB 4IFDJ 3CRLC 3R2IA 4GLVB 3F2BA 2B29A 4JI8Q 5EBDA 1K9MC 2KDSA 1YJNA 3VR6A 2E2HH 4RHRA 4M77C 1JQYD 1PH2A 3DWAA 5A2QE 4JV5L 2LDMA 1E2WA 3NFCA 1T3SA 2VVKA 1E1TA 3JSCA 3STBD 1ZSGA 1DXMA 5GADC 1SE4A 3M7NA 2LJ1A 4JS4A 1L0XB 3IFTA 3I55A 4BDYA 4JK1C 3U23A 5KH6A 4HEDA 1FMVA 2IPKD 3CCET 1CA5A 1GFDA 1N27A 4FT2A 3M0SA 2E65A 4JI7Q 2AUJD 1W6XA 3D4WA 3I35A 4DV3L 2F1MA 1M4VA 5M3MG 1FGUA 2VUMH 2OJ2A 4H7BA 5KIXA 4YIJA 4LFAQ 1II3A 3CMAA 3ND9A 1MSHA 3AFPA 4F16A 3HEJA 3I4NG 5LJ5d 3KUPA 2QXFA 3I9QA 4LUEA 4TKOB 1I4HA 4C3HG 3N5BB 4HCKA 3SR1A 1EYDA 1EY7A 1X75C 4RGTA 2F0UA 3I4OA 1HR0Q 3SK5A 3BZCA 4LF9Q 2YLBA 2FRYA 3DKMA 2EPDA 1I3QH 1KXLA 1H92A 5LL6S 2ASBA 4G7OC 3QBYA 3EH1A 1BCPF 1SRUA 4ZCKA 1I4K1 1A6XA 1FJGQ 4JRIA 1KNEA 3S14H 3F2UA 4XIGS 4JV5Q 2DJZA 2MPXC 1ESRA 3L7ZC 2ROTA 4DNTB 2HAXA 1K8MA 4C3JG 1BI1A 1CQVA 1Z9QA 2K1BA 4TVAB 3O5ZA 3C1EA 4K8IA 2NVXH 3QJ6A 1U4RA 2DXBA 1M90R 2QASA 4RKBA 3EG9A 1CHPD 1TWBA 4M7AE 4R4OA 2F0PA 5GAMg 3CCLT 4C2MB 4JI7L 2QTXA 1N32Q 3JCMg 3GQBA 4QT7A 3G4SQ 3C46A 1SNOA 4J9EA 4GNXA 5BR8Q 2QQAA 1PG5B 4J8OA 2DYBA 4G4KA 1YFNA 1FNUA 2PUKB 1EU4A 2CZ7B 1F2YA 1VQ8A 1D5ZC 2WAQE 1QUQA 3G6EQ 2WP8J 1S5BD 3HRZC 1B70B 3S2HB 4J83A 2EJFA 1YIJT 4A3EB 2AKWB 3CKIB 4Y7NH 1LT6D 2UUBQ 4J15A 1IRXA 3I7FA 1TWAH 3MEUA 2JA7B 1JE4A 2KYBA 1D7QA 2LXJA 4B6MA 1KDBA 1Y8OB 2KCCA 1TUDA 3BDOA 1STYA 1TXQA 4RTTA 5DAUA 2NN6I 2NB0A 1KIKA 2Y0SG 3RLNA 1HNWQ 3EHQA 1TT2A 4JJCA 2JA5H 3PVLA 1K0RA 3FHWA 4D8KA 5I22A 4ANJA 3UDXA 3NWSA 4RKUE 4VUBA 1VQKA 4I7ZC 5EAYA 3CCVT 2EXDA 4CHTB 3K57A 1XNQL 2A69D 1O7LA 1NR4A 4Q0FA 4EMKA 3OYLA 3P7JA 3R2TA 2YHTA 2BE7D 4JI1L 4NXNQ 1PNJA 4R0KA 2MPMA 2HCKA 1ZX6A 1VYVA 3A55A 1HNXQ 2FZKB 4GLKA 4QL5A 2JE6I 1K73C 2GQIA 1TQOA 1ZXTA 2ZPIB 1D3BB 5IYBG 2RDHA 2SDFA 1WTHA 1V29B 1OPKA 2Z0SA 3EGDB 2Q2TA 3M9BA 4CKEA 5FU7B 2XIDA 3VS5A 4E2FB 1LACA 2C0TA 4E7ZA 4JI4L 1AWOA 2OI3A 2L55A 4M75E 3VR5A 1B4OA 1FVIA 3MAQA 1G6ZA 4JZ3A 4OIKA 5LJ3h 1YJNQ 1ENCA 2D9UA 5KYYA 4AQYQ 4FYYB 1AOJA 3CQTA 1WJJA 2DETA 4HCZA 3JC66 3OTOQ 2DL8A 2ZPGB 1U3OA 3H6MA 4X3TA 4B3RL 1N36Q 3IAYA 1OULA 4XTYA 5LJ5h 3E5SA 3U58A 1KHCA 2XI9A 2F4VL 5D7UA 3E1SA 1SHFA 1C9OA 4KJNA 4F87A 4Z88A 3CW2C 3JCMd 4N9TA 3JCMJ 2J6OA 2COYA 7AT1B 5GQOA 1JOKA 2B3GA 3LX0A 4MMKA 3A7AB 1WTVA 4PJOE 3PMFA 2PVDB 3QB3A 1QP3A 4XT1B 2BZXA 3W2DA 1JJ2P 2JN0A 2XDPA 4J9DA 3I5SA 2BIVA 2V8KA 3INZA 2GVAA 3ITPA 1I0CA 4DV2L 4JYAL 2D6FA 3QWXX 3R8BA 2P4RA 1K0SA 1AN8A 4A3GG 2NLUA 1YEZA 2EYMA 2VB6A 5EKIA 5HK3A 4LF4L 4EGVA 1TIID 1O7IA 2IIMA 2E2JH 1MI2A 1DM0B 3VS7A 1TWGB 1SNCA 2K7VA 4OO1G 2Z6KA 1PC0A 1TWAB 3RR5A 2K3BA 1GD7A 1WD0A 1QMCA 4BXXH 4C8QD 5JPMC 1DCZA 5HCKA 1D1AA 2E76C 3KDFB 1EQVA 1U4LA 1HRJA 4JI2L 1CZWA 4O5VA 1SE3A 2CUDA 2VB3X 4DV6L 1HA5A 1SLJA 1IBML 1VYTA 4DA4A 1EY0A 2A69C 3JCMh 3RUZA 1M90C 2NVYH 1Q86R 2BE5D 4I7AA 4PZ6A 2Q2UA 4ESRA 1RLPC 2DYIA 3CCUQ 2MGSA 5AFWA 2V4DA 1HHVA 2KXDA 5J26A 3P1HA 1ICWA 3U50C 1UGSB 3VV0A 3HOUG 5IP7G 2DAQA 2EYXA 3OW2S 4BA2I 1MUZA 1BDOA 4GZYC 1EZZB 2QTVA 5IGFA 4KY7A 3PIOA 1QNUA 2B8GA 2JMCA 3CCJA 2M1HA 3RESA 4OHJA 2DZ9A 2M51A 3L2WA 1PZKD 2QCPX 2QQSA 5KYLA 3EGUA 1LTID 1D09B 1MJCA 5I6YA 5CKDA 4OO1H 3T1YQ 2YRCA 4EPCA 4WF2A 1BNZA 3PT9A 3UDCA 3MHXA 2K4KA 3H0IA 4NKLA 2KHSA 1MMNA 1E1OA 1Q12A 5C4JB 2ECZA 3EFSA 5CK9A 4PKCC 4OMPA 3HZXA 5EKLA 2A37A 4A3EH 4M75B 4A3DB 3E0JA 2E2IH 2A6HC 3D4DA 5IIFA 4OMLA 2N88A 4P71A 1ZYRD 4ZLTF 2YYZA 3GTQB 3BY7A 3SWNB 1EY6A 2BDOA 1XYIA 1G3SA 4NS5A 3CCRT 3RMSA 4KJOA 2P5ZX 3SFMA 3C4SA 3I70A 5FO9B 4OL7A 4KD3A 4BY7B 2XKOC 5GAN8 3NEMA 4IPGA 1IW7D 1ASYA 3ERQA 3PE0A 1G2BA 1BCPC 3L0OA 1K9MR 4HSVA 1ET6A 1EIYB 4UPAA 3SWNA 2VS1A 2XWJB 3JAMi 4A3CH 3CCJT 2XICA 4X1VA 3CBOA 1WFWA 3JB9J 2DMOA 3J7AV 1YI2T 2F0OA 2CKKA 2JZ2A 2LS01 5IHKA 3JCMW 3HOUB 3CEYA 1ONLA 2F0MA 1GM5A 1F9PA 4KD4A 1PD0A 1M27C 2MQHA 2LX9A 4EMKB 2P0PA 4CGYB 2ZJPA 1XOVA 1HQMC 2CP5A 2Y0SE 3VR3A 1XMQQ 3QO2A 4OX9Q 2NUTA 1XNRQ 4HCCA 2PI2A 1VA7A 2MI6A 1CK1A 1CKOA 1KAAA 1Z6HA 4DAVA 2V8IA 4J9FA 4PZ7A 2DVEA 2HSEB 5CGKA 4X62L 1NMGA 4HSPA 3UA7A 3N52A 4EIKA 2F0GA 4YWMA 4C1NK 5CMDA 2P0KA 3GO5A 1YCSB 4ULLA 4MN3A 2JA5B 1RAGB 2LJ3A 1SEMA 3BFMA 4OGQC 3GTJH 4A93G 2K57A 5IP9H 3J80c 2EYLA 4QW2A 1PH8A 2WAQG 1D8LA 2HCIA 4EQPA 3QSUA 1L1OC 1PTOB 3D0FA 3S15H 1CKNB 3TP8A 1P92A 2OTJA 4DUYQ 2R92G 3LGLA 1SYCA 4ALPA 1SN8A 5CBAE 1CZGA 1YJWA 1VQKT 1I07A 1QB5D 3X24B 5LJ3f 3GTQH 1HZBA 1NLOC 1QVGA 3HKZB 1D0XA 1G3WA 5FU7C 2OX7A 1HUMA 5CV4A 4L5SA 2VGMA 3CRKC 3DWPA 3JB9F 3K0YA 5M5YB 1HTPA 1O78A 1MV3A 1OEBA 3PO3H 3LW5E 1U5SA 3K0XA 1WZOA 1LABA 4G7ZC 1DONA 4ZQ3A 2FG0A 3X25B 1F2MA 2QA4Q 4EVOA 1PTOH 1X3QA 4S3SA 4C8QB 3FKIH 4GKKL 1RUWA 2DD4A 1M1KR 1GUSA 1HPCA 1NUCA 4AYBB 5K5PA 4RUGA 4KBMB 4DAYB 3GTLB 3KFVA 1WJSA 4J9BA 1Y0MA 4OMFB 3U9OA 4A93H 1NYFA 3I56Q 1VQ4T 4XU2A 1D2BA 2L15A 2JJQA 5F2DA 1K8OA 3P8DA 1I50B 4B08A 4LDVA 5HGQA 4M77G 1A3TA 4LD9K 5IHIA 2E41A 4DF7A 4F7XA 3WVDB 3S1MH 4JI0L 4KV6A 3DEOA 2MP1A 4JVZA 4N9PA 4XYQA 4BY6C 4Z8AA 3AHUA 4DK0A 3J7AF 2E2DC 1AP0A 1KQ1A 1ZA1B 2BH8A 2NVYB 3I2ZA 4DAPA 4B3ML 1I4PA 1WD1A 1JOQA 3CXCS 1KC8R 1UE9A 4A93B 1KQSS 5JJIA 4FM4B 3RD4A 1YWOA 4R56A 1Y8NB 2RHIA 2JA9A 2ABLA 5M3FG 3PNWC 2MHVA 1VQ7Q 1A3UA 3BU2A 3G7LA 4YCVA 4R4IA 1TY0A 4HIMA 2ZM6Q 2EQJA 1ABQA 2HQEA 4LF6L 1NJIC 4B3SQ 3CC7Q 3PV0A 1NPPA 1G5VA 1Y8PB 4Z9CB 3K5NA 3K80C 3S15B 1K76A 2KY9A 3QYHB 4JOIA 4GKKQ 4J8QA 4K5WA 4RKLA 5LMNW 1S5DD 4C3IH 1UE6A 3ZEHA 3FRNA 1W70A 4MZMA 4JW0A 1NBEB 1X54A 2EQSA 2SOBA 4R9WA 3TBIB 4M78C 1Y7XA 2QG9B 4M7DD 4DV2Q 3DM1A 4NXML 2F0WA 3BZKA 2EQIA 4GKJQ 1KLGD 3ZYYX 4M75F 1RCVD 5C4HA 5CC4A 1EOVA 1IYUA 4KMUC 4B3TQ 3RIRA 4OX9L 4IPHA 1KRSA 2ICEC 5IE8A 1BI0A 2RNAA 2DFUA 4NPSA 1N8RU 3HP3A 5GAN5 2OXPA 4FXKC 3LX7A 1K3BC 1FWZA 4YCWA 1B1ZA 2G5DA 1VQ7T 2LY7A 5IOCA 4DR2Q 2F0KA 2V1RA 2R7ZH 5C4XG 4WFN3 5M9OA 2C9OA 3CCEA 1OO9B 4J9GA 2B2WA 3M57A 2RHUA 3G48A 1J8IA 1FX7A 1RADB 2UUCL 1EOTA 3META 2QKIC 3QIAA 4QF4A 4KH1B 3EFOA 4CKBA 2JUFA 1VQJA 1TR5A 1UTIA 2R92H 3PUYA 5C0XI 1NLPC 1PH4A 1DD2A 1SDFA 4A4IA 3HFOA 1EZ8A 4JJBA 4KUDK 3HOXB 2A8VA 2BKDN 3HKSA 4IIOA 1CSKA 1TWFB 2E6ZA 2CS7A 2YV5A 5IGDA 3ZJYC 1SRLA 3SHLA 4M78F 1VQOQ 3HOUH 5D6WA 1N9SA 4FYDA 2DEUA 2ZAEA 1ZSZA 2KEDA 2JEBI 2AHJB 2CSQA 1MMGA 2YUPA 3OQ5A 1H9MA 3HOVG 1J6QA 5C3EG 3RZOH 3RMHA 3VJPA 1YJ9T 3D6WA 1YWPA 2MF2A 5HY6A 5LJ3e 3CMAQ 2K5DA 3KBXA 3KOJA 5JAVA 3VUBA 5A2QL 1ZSZB 1VQAA 2IT1A 3ONAB 3HOVH 4XQ3A 1W6KA 4LF7L 1HR0W 3CMEA 3EG1A 2BCOA 2QF7A 4R4CA 1PRTC 4DBHA 4GBQA 1CI3M 2V26A 2AT1B 2YSQA 4IPCA 5EKKA 3OYYA 4M77B 5KE2A 2AQ3B 1B7TA 1A8VA 4R1JA 1Y1WH 2GNCA 3I4NB 1MKHA 2L5TA 2MO1A 2ZM6L 4A54A 4GOPC 1EL0A 3MEHA 2UXCL 4FYXB 4C8QF 2K28A 4PJOF 4FL6A 1LNXA 2EJFC 1HNZL 2RK1A 4BD3A 3EFOB 2QYZA 4RTUA 3DWQA 3ASKA 4P73A 3S1RB 1Q1EA 5CR2A 3CC4T 2A7YA 4QVCA 3H0GG 3C3LA 3MKDA 5J3BA 2WIIB 4II1A 5ELNA 1JJ2S 3BVMA 3VDYA 2V8JA 4M75C 2DLPA 1DGSA 1JE5A 4XDXA 1K8GA 3GOXA 4K0KQ 1QQJA 4AG2C 3GTGB 2EQMA 2A36A 2D0NA 1Q82U 2F2WA 4QQ6A 4NXMQ 1STAA 2R7DA 2F0FA 3SK8A 1Q3LA 2UUAL 2R5AA 4XTUA 3CCMA 4IZ8A 4KN4C 3W5OA 2K5LA 2VXEA 1SYBA 1OTCA 1XTCD 2OWOA 1C4QA 3OMGA 4RG8A 2LTOA 2PZWA 5JOBA 5KE3A 3NPPA 1YITQ 3NTHA 3SK4A 1PRTF 4BBRG 1U0LA 3PUVA 2OAWA 2GA4B 1B9NA 2ZGWA 2CKZB 4AG1C 1PYWD 2E10A 4LAAA 4CI0C 1EYGA 3MEVA 1Q95G 4PJOC 2L89A 1R9TB 4J9IA 2ZTDA 4KY5A 3V8JA 5ELOA 1Q7YR 3HOXH 1MHNA 2QEXT 4ORZA 2K5NA 1EU3A 4AFUC 2DVJA 1JBMA 3E0EA 1Y96A 2F0DA 4MZPA 1BUVT 3DB4A 3TMEA 2RQRA 1S72T 2DBMA 6AT1B 3G6ET 1JR0D 3S2DB 1Q86U 1YNND 4J6WA 4G57A 3KF8B 2DD5A 3MEAA 1LV9A 5CV9A 5M5XB 2DNCA 4IUNA 3S17H 2FPEA 1TXYA 2JP1A 4I65A 5DLQE 3HKZE 4MDWA 2DNUA 1VQNQ 4JI8L 1AD5A 2RHZA 2IVWA 5CR3A 5D14A 3W1GA 3M55A 1V1PB 4JJNK 3L9AX 1WJRA 4OB2B 3HOWB 2EYZA 2C0IA 1SYGA 4YTLA 2X6LA 2E1HA 3A0JA 4K0KL 1D6EC 1RL2A 3MEWA 2VUBA 3A8MB 1N8RC 4BY1G 2JTMA 3OS1A 4WRDA 4FXDA 4X64Q 2LMJA 1M1FA 3TU4K 4DV3Q 1RAAB 2AQ1B 3HOXG 3HOVB 2DERA 2O5JC 3S2HH 3CU7A 3H15A 1OU8A 4DU9A 3AT1B 3A74A 2LX7A 2X69A 3EN2A 5IY0A 1GUOA 2F0QA 4DR1Q 3JCMP 5KRUA 2COZA 4HCSA 3PO3B 5D65A 2R57A 2JS0A 3VYTA 3WVEB 4JBMA 1N36L 4A3DG 5FLMG 5FO8B 1WGSA 2QGGA 5AT1B 1D1BA 3G71Q 1BXTA 3HTRA 1QWFA 2Y0SB 5GAOl 2BH2A 3DM3A 1TS2A 2F0JA 3CPFA 3AQQA 2YWWA 2KNBB 5D6XA 4DEYA 3Q23A 2F0LA 1W2BS 2B8FA 3KLSX 4K6DA 1VQMA 2L0CA 2EY1A 1Y07A 2K33A 4RG2A 4GOPA 4RHSA 3J80E 2B8AA 3UDIA 4PJNA 1MSGA 3SWNC 1VQ4A 3FKIB 2ZXRA 1MIUA 1IKLA 1HNZQ 3E2UA 1C48A 2J4XA 4IO9A 2K32A 1S5ED 2Q8TA 4DV5L 1YCYA 2YUNA 3GBQA 5GAMe 3E3XA 1IBKL 4HCEA 1HNXL 1TS5A 4Q5WA 2PPBC 4BBSG 2CP2A 5GMKj 1QCBD 5IT9c 3H3VH 4M7DE 3S1QB 5C3WA 2EJGA 3L2PA 4UP7A 2DEQA 1SE2A 3BZDB 1YNJD 3S1NB 4M78E 5KYUA 4Q5VA 1VQOA 1IHWA 1WNLA 2K50A 2KJXA 3CCQT 2YT6A 1TSFA 1NAPA 4CDFC 5I2XA 2K6AA 3HOYB 4OWTB 3F2DA 5AJ3L 2PNRC 2NWGA 1LVKA 5JVG3 3I4NH 2JM9A 3LNNA 1ML0D 3M4PA 2Z6BA 4K2KA 1KHIA 2PZ1A 5I2MA 1F9RA 1YHQT 2OQ0A 2QA4A 1D5XC 1U1TA 3DB3A 4LXCA 5CV6A 3I4MH 4JRKA 2BA0A 3U4ZA 3X26B 1AT1B 3CC2A 2NUCA 5CKBA 1UUEA 1DJRD 2HNIA 3HOYH 4ZYSA 1MNDA 2VKNA 4UC4A 3A8JE 4A4GA 4GLXA 3MC0B 2KE9A 4ILWA 1NCVA 1X01A 3TQ7P 1BYMA 1AE3A 1AEYA 2DL5A 1NBWA 5KEEA 2UUCQ 3OYGA 1LT5D 2B63G 3V8LA 2EVBA 1C7YA 1F9SA 1Y69U 3KFUA 2OTJQ 4ZRZA 1U8RA 1B07A 1KC8U 1C0AA 2VXFA 1KG1A 4N0AC 2HMAA 2DY7A 1QKXA 2E2HB 1GUTA 4N8FA 4R8IA 5GAMf 2DPPB 3GTKB 4A3BH 4C5HA 2DRMA 3NMZC 5GJVB 2BOSA 2R92B 2L0AA 4B3TL 1YITA 4POFA 3JAML 2E5QA 3J81j 5LL6X 2B2YC 2HZYA 2L2PA 4F7UB 5IWAL 1EWCA 1M30A 2DRKA 4O2DA 4A3KG 3SDZA 2WACA 1RTNA 1RI9A 2M9VA 2NYZD 1R9TH 2K5FA 4R8NA 2JA8G 1BQQT 3S1RH 3TEHB 5E4XA 1JEGA 1VQ8Q 1E2VA 2VZAA 1CKBA 1WTQA 4PFZA 1GUGA 2D62A 2OF1A 1MGSA 4IUVA 1GUWA 5KYUB 4JI5L 2IX1A 1EFID 3VU3C 2VW9A 2PO4A 1Z9ZA 2C35B 5IP7H 1HTLD 3D6CA 2K6DA 2YDLA 3GP8A 1A2TA 2B39A 3M4QA 5IP9G 1XPRA 3CF5A 3A8LB 1F2LA 4JI5Q 1AW7A 3K6OA 2EY6A 1K8AC 1NJIU 1CTMA 1SMYC 2FMCA 4DA2A 4QVDA 5IN1A 2RJDA 1HH2P 1UWVA 4IJLA 1TU0B 1N8RR 5EJWA 5KYIA 3RZOB 1GUNA 4PJMA 4JI0Q 4BY1B 1Y1VH 4HTHA 3NBHB 1TKWB 5BN4A 1EX4A 2CHBD 1Q46A 4C3HB 4M7AG 4OIJA 5GAOp 2YU9H 1E6HA 3PIPA 1KQSA 3EROA 2XNAC 4RCCA 3D8GA 1Y57A 4QQBX 1YHAA 5C44B 3VYSA 1OX9A 1ABOA 2B86A 2ZTEA 4K11A 1FMWA 1E3PA 1H9RA 4L6TB 1L0WA 3JRZA 2VQFQ 4FW1A 1XNIA 4C0GA 5GAEC 2ED1A 3VYGA 2VL6A 2N78A 2EWNA 2F5KA 4HKEA 1RHPA 4IN3A 1F9QA 3URGA 2HQHA 3HOZB 2LMCB 4L63B 2GCXA 5E3FA 5C44G 3Q8DA 3JCMb 3EIVA 1MV0B 1V1CA 1H3HA 2K3XA 4E47A 3E19A 5IH2A 1P16A 2ZTCA 1IO6A 4BI4A 1F1BB 2IJ0A 1WVLA 1TU2B 4PLLA 2RF4A 2RM4A 1SEBD 2FL7A 1YHQQ 4AYBE 1SFOH 2HBPA 4ZTFA 3IKJA 4A3CG 2IX0A 1NTGA 3JAMc 5HGTA 1XX8A 3FLGA 3MP1A 1QOHA 4IPDA 3E9GA 4C92B 2C0OA 1PYSB 1V1PA 3E9IA 4HJ7A 1GFCA 2JTFA 3UWNA 4YY3L 1KK7A 3EBEA 1XPOA 1ZEQX 2J6FA 1NE8A 2Z1CA 4KRTA 1WIEA 2NZ1D 2X3WD 1DOKA 2VUMB 4XU0A 4AFSC 1IBMQ 2CW0D 3D4RA 2F3WA 4DR7L 2B63H 1Q81U 3PTAA 2YTVA 3JCMe 1PH6A 3REBB 3EGDA 1K3RA 1H641 2I5MX 2GTOA 2PVOB 2O4XB 3X20B 1Y96B 1MBYA 1HXDA 4IKFA 5IYBH 2DBKA 3CXCP 1XMOL 2DUDA 1B50A 5ELDA 2EYFA 4V0BA 1GBQA 3J80i 5A0LA 2K4YA 2HDAA 5GAN7 1XNRL 1IL8A 1I4GA 2DZCA 4AFQC 3E9FA 4OB0B 1Y1VG 3EGXB 2PVGB 3M0RA 3CC2Q 4PJOB 2RSNA 4PNYA 2A74C 4OWWB 1PFNA 2A08A 2NBFA 1PMRA 1VDZA 1BF4A 4J1MA 1CSPA 3R93A 4A75A 4V2SA 2FEIA 3IRBA 4DV0Q 2A1AA 1X65A 1A0NB 2CW0C 2HQLA 2KENA 2PQAB 2K2MA 4TVRA 4UAIA 5FWCA 4A3FH 4A3GB 2RJCA 3L3OC 3PCOB 1W6JA 4PMBA 1J9OA 1ILPA 2VWFA 1VQLT 2A19A 2QGQA 2B2YA 1VQMT 2Z4IA 4FSSA 5FOBB 4DR7Q 3CBPA 2OAUA 2VNUD 3M7GA 3PIP3 4UP8A 5BN5A 3OYCA 3NP8A 4K5VA 4L5GA 4NL3A 1AFPA 2EY5A 4HJ5A 4BA1I 1O7ZA 4C8QG 2BE9B 3ZBDA 2RPNA 1YNNC 1PSFA 2RK2A 1QJOA 3NPFA 4L8JA 4QB4A 1BBWA 2CZ1B 1V43A 4A3KH 1WTOA 2KYMA 2JA6H 4DN4M 3UE1A 2QDBA 4OMQA 1J3TA 3J81E 4M7DA 1WQWA 1SHGA 2JEAI 4D6WA 2NZHA 2CP3A 4DK6C 3HOZH 3CCSA 5L8RE 3L2UA 2UXDL 1SROA 2KHIA 3OBYA 3M53A 4E7IA 4B9XA 2EOTA 2JSOA 3AU7A 2F69A 3WOEA 1IZ6A 3JB9I 4Y92A 4DEXA 4NL2A 3NXWA 2RA4A 2LJ0A 4LW1A 3QOLA 5FLXc 1I5LA 5KGUA 1IHVA 2D5DA 2WV6D 1FJGL 3B6YA 3M3YB 5GANj 4UY8C 4HVVA 4WCIA 4DOWA 3FRPB 1PRLC 3DEPA 1YITT 1X3GA 1S5CD 3HRUA 1TS4A 3GV3A 3HL8A 2IHEA 5DNFA 3A8OB 2QEXQ 1FNWA 1M8AA 2E5LQ 3O8VA 2DGYA 3I90A 5GAHC 1HQRD 3M4OH 3K8AA 1FL0A 3THKA 1N34Q 2PU9B 4OMMA 1VQBA 5CORA 3TQYA 3Q6SA 1J5EL 2CSIA 2K5VA 5FROA 3BW1A 1IGQA 2E5LL 1XPUA 3BVGA 2A5HA 1KDAA 2DNEA 3RN2A 3URYA 2JJ9A 2AIRB 5CVIA 2K14A 2KCTA 3CPWP 2LVMA 1Q8KA 2XK0A 3CC4Q 4RGOS 3L42A 3QYGB 4RTVA 2EXZA 4OGCA 3D7SB 1K4US 4Y28E 2GTJA 3Q22A 4F7UE 5C3XA 5CV5A 3PF5A 1PH5A 4FF4A 4XT3B 4HIOA 2FFKB 1ZUKA 1Q8IA 2NYSA 4E7KA 5J1ZA 2K5QA 2EE1A 4DV0L 5FKAC 1JCKB 4GLMA 4JUVA 1EY8A 5KNDA 2L8DA 1WHJA 2HSPA 3SVMA 4A3MG 4DAYA 1X6BA 1ZUUA 5CQYA 1WCMB 3KJOA 3GTKH 4LMQD 4A3BB 2KXCA 3VYRA 2O4XA 1JQQA 2COWA 2WSFE 1B44D 1VQFA 1M8VA 3I73A 3OIPA 2L5QA 3X3MA 2KMTA 1EY9A 5KYNA 5KNBA 2RHXA 3H9NA 1EEFD 2RKSA 3JB9H 4J5YA 4PL6A 2P4TA 2PMZE 4KHPQ 1NNXA 2ZJQA 1MJEA 3S1NH 2UXCQ 3QHSA 3BYTB 3C95A 2DX1A 4A3MH 2GBQA 2CH4A 1EIHA 3MO8A 2EBPA 1RAHB 4M75G 4BE0A 1G51A 3P75A 1HUNA 4NXNL 4JI1Q 4CKCA 3ICEA 2DXCA 2QQ9A 3CCQQ 1JOOA 1OOTA 2PMZB 2DJQA 3KXTA 5DY9A 3CMAT 4M7DG 2DE0X 3UE0A 5JVH3 2CYZB 4HIDA 1E22A 5C4ZA 1WTPA 2LCCA 2M00A 2NTTA 2GF7A 3H41A 5GANe 4DV4Q 2FJ2A 3A98A 3J7ZC 2F03A 1QW1A 1N33L 5GMKm 1DOMA 4RGMA 3I91A 2RQVA 3HKZG 2D0QB 1AZGB 3VRYA 5KYWA 4JLIA 3KYHC 2H4OA 3MCAB 3T56B 4C3JB 1O75A 4JDSA 2DO3A 1RLQC 4BY1H 3RR6A 2L3QA 1SFOB 4PJOG 4LF8L 2HKQB 3H09A 4C1NI 4LUDA 1UG1A 5AJ3Q 1X2KA 1PKTA 1RAIB 2F0VA 5G3LF 1PH7A 4IUQA 1A3VA 4XK8E 5ECAA 1ZBXA 1VMCA 2NUTB 1QZHA 4C2MH 4M7DC 3K7AB 5C0XJ 2QW7A 3S6WA 2OTLA 1JO8A 2HBWA 3QIIA 2D8HA 1EQRA 2ZPEB 1WI5A 4LWCA 4RTWA 5FK9C 1F77A 2G3RA 4A3IH 2RQTA 1NEGA 5CBEE 1PH3A 5K36G 1G2SA 1HZ9A 1DYQA 5HURA 1SYFA 3EG2A 2UXBL 5JEAJ 2FPDA 2IX3A 1L1OA 3TS2A 4X6AH 4QCLA 4N0AA 1BI2A 1N6AA 2M9UA 1X55A 2FYKA 3LGFA 3RLOA 2NVTB 3HFNA 1EZ6A 2A68D 2DN8A 4C0DC 2VUMG 5C5MA 4JOIC 1KIXA 3TRZA 2FINB 4H13C 2ESWA 1VQ7A 2LSSA 4OEMB 5JEAG 2Q2IA 1WHLA 3UPUA 3V7RA 5GANf 2F0HA 3H0GB 1H95A 4DV7Q 3H91A 3PUXA 4DK3C 3G4SA 3JB9G 5KCOA 4QIWB 3FDTA 1WHMA 1U06A 1X27A 4WORA 4M75A 5E1FA 5GMKh 1LOJA 5DM63 1HR0L 2KA7A 4C3IB 1M3CA 2K3YA 3MFGA 5DM73 2QEXA 2B63B 2XD0A 1WCMH 1SG5A 4B3SL 3RKXA 5KNCA 3Q1JA 2CDTA 2H5XA 1ACMB 3F70A 1UE5A 2XDDA 2QILA 3GTJB 2YXYA 4EQNA 2F2XA 5M5YH 3RN5A 1B34B 4X64L 2WB1B 3SHWA 2J6KA 1WCMG 3P8HA 2PZTA 3MXNA 1AHJB 3REAB 1BBXC 4F17A 4B3MQ 1B2TA 4E6RA 1OXSC 2EJGC 3N6RA 3M5AA 4WJWA 1PSEA 2K5HA 1UE7A 1WX6A 3FPUB 4KT0E 3H8ZA 2PI2E 1VQNT 5JJLA 1OYXA 4GOPB 3A1PA 1NR2A 4C0FA 4PMCA 1I6HH 1VQPA 4R4TA 2J7IA 3CCMT 1H9KA 2LCLA 3PF4A 1VQ4Q 2ENMA 4FYVB 2GQVA 4M8AA 1VQKQ 2DKGA 3ULLA 3V7SA 4EQOA 2NN6G 1ZSZC 1QKWA 3U4VA 5C4JH 2EJMA 3MJXA 1S72Q 1EYCA 1PHTA 1RI0A 5GAOm 1K0XA 1VQLA 2JNGA 2IL8A 1TWGH 2NTSA 3GF5A 3TP7A 2DXTA 2F0IA 2F1LA 2G9HD 1SKUB 1X56A 2ZJRA 5K36H 4LUVA 4ZN3A 3OSSC 1LUZA 2JT4A 2O9VA 5GAGC 2JS2A 4RTZA 1TVXA 1SJHD 1VCIA 2HUGA 4ID6A 3L2QA 3GTOB 1E6GA 1WPYA 4J7FA 1H8KA 5EG2A 4KLKA 4CC2A 3JCMQ 1C1AA 2QEJC 1LM0A 1WXUA 3K7AH 4OXPA 4ZAIA 1PV4A 2X4JA 5AYFA 4YCUA 2LZ6B 2EKHA 2H3JA 1GKHA 2AHOB 2RHYA 1BU1A 4DOVA 2XGTA 4KN7C 4ABNA 1VYUA 4BBRB 2MNAA 1OPLA 1U4PA 3C94A 3MVVA 4AH6A 2E5KA 3VA5A 1QCOA 1WHGA 1QVPA 2SNMA 2MWOA 3OOCA 3GTPH 3OTOL 3TS0A 1YJWT 3SEMA 4H44C 4GNXB 4YHHQ 4A3EG 1PZJD 2LKVA 4DV7L 3NELA 4DUZL 1YN8A 1KQSP 4RTYA 3P20A 1QVGP 1A62A 3CXCA 4MZTA 2XN9C 4TSSA 3OYNA 4CRIA 1XJWB 1RODA 4R4QA 5M3FB 3MHBA 4CJ0B 1B7YB 1Z47A 3QXEB 4A63B 1PFSA 1GRIA 4A3JB 4F04B 4A3FG 2JA7H 1M4ZA 4DV4L 2H1EA 4KKTA 3VS2A 2Y4YA 2MCNA 4F7UA 4L59A 4J6HA 1YBYA 3T4AC 3UA6A 3L1AA 4IUTA 1PDQA 1JB0E 2AZSA 2I0NA 1UGVA 2MFIA 1PKSA 3GTLH 3EHRA 2RA2A 5EPJA 4DXGA 3S14B 1YVCA 3IFDA 5IGGA 2BDNA 2EGAA 4X66L 2YLCA 1YJ9Q 3OYFA 4LF7Q 4BE2A 1X9NA 4HA8A 3ZFJA 1W2BA 1E2ZA 3JCMX 5I6WA 3R6NA 1PWTA 1LTSD 2I0QA 1M3AA 4C3JH 5C3EB 2RDFA 5LJ5g 1OXVA 1ZBJA 1FYNA 3QUIA 4FCYA 1KSWA 1PH1A 2AZVA 4WJ4A 2KR3A 4PLIA 4EDUA 2LP5A 1MNEA 1HYOA 5DLOA 1CKMA 4C5IA 1GO3E 3BJUA 1X69A 1EY5A 3EFXD 1OXUA 4TQUS 5EBCA 3LLRA 3R6OA 4P72A 5I9PA 1AZQA 1VF7A 2NVXB 1MGQA 1CT1D 2XRSD 1SNDA 1VQPQ 5I4DA 3C0CA 2GGRA 3CCST 8AT1B 4A3IB 3CCRA 3Q0AA 2VQEL 2E2IB 2XWBB 3NHHA 5C3EH 1I4RA 4DKAC 2K9GA 3F2CA 1SJED 4ATOA 2Z0WA 1X3FA 4IFDG 4CDEC 3UATA 5DM7R 3HOZG 3V05A 1IB8A 4J6XA 1G3YA 2A68C 4BBRH 4JI6Q 5CO7A 5EQ0A 1UUPA 4FP5D 1PRTB 1JXOA 5CKFA 1R4PB 4KULA 1RF2D 2HL3A 2MAMA 2A28A 4QUFA 2L12A 4KHPL 1V9PA 2MOXA 1N32L 3FPPA 3RZDB 1KAWA 4M78D 4XTWA 4JRQA 1Q7YC 2PZUA 4A4HA 1Q1BA 3VS4A 1KC8C 1BIBA 4JYAQ 3H3VI 3V7CA 1HXYD 2OQKA 3FDRA 3OBWA 1I94Q 2AWNA 4N8X1 1L1OB 4E6IA 3QDFA 2R7ZG 4IUPA 2LNHB 2QQBA 2GN5A 1UJYA 3CBMA 4E7JA 2KECA 2PCFB 3CC7T 2F4IA 4XU1A 2PNIA 2PYKA 4DFAA 1WTXA 1IBLL 2VGNA 2CGHA 2DIGA 1STNA 3M0QA 5I11A 1LLRD 4M78G 3M0UA 2ZT9C 3AB9A 1RAFB 1VQHA 1TWHH 4BY7G 5FW9A 4NDXA 5D6YA 4ZGJB 5GANd 5NUCA 3I56T 1EFNA 1YNXA 2B2VC 3X3NA 5I2YA 4JG2A 3A7LA 4CC7A 1GHKA 3CPWS 3SXHA 3PFSA 2YTXA 1UDLA 3PVQA 1L2FA 3GV6A 2FB7A 4BDZA 3HFZB 4LNPA 3BDCA 3K7UC 4WJ3M 2K75A 1K73U 2QI2A 1MMAA 2E8GA 4DNIA 2RSOA 2CP6A 3QWNA 4E7SA 4DBQA 5FU6C 1RABB 3PGGA 4C0DB 5IWAQ 5T1GA 1LTBD 4M78B 2AWOA 3E6ZX 3MXGA 4YWLA 1R0CB 2UXBQ 2L11A 1VIFA 2OT2A 3BE3A 3P8BB 4PNOA 3BVZA 2WB1E 4U68A 1JICA 3OYMA 1Y1WB 1A63A 3QJYA 3EGXA 1M1KU 4FF2A 2DL3A 5LHY1 3RNUA 4K8JA 3OYKA 1FMKA 4C0ZA 1UEBA 3D3RA 1JB3A 4BBSH 4LFBL 3GNGA 1VQEA 2RCNA 1LO5D 4RAUC 1G291 3RZDH 1XNQQ 1JXMA 2DF6A 1ENFA 4HVUA 1OQKA 1WHKA 4PJLA 1NM7A 4PFOA 5GMKl 1YJWQ 2TSSA 4X65L 2UXDQ 1WLPB 2KRSA 1CKAA 3H0FA 3ME9A 4DBRA 1BVSA 1KLUD 5C4XB 3KLRA 4KK7A 3BDUA 5GAN4 1OV3A 3CC7A 2X3XD 5GROA 4DV1Q 1TS9A 1YI2A 4YWKA 4KHZA 2PQAA 1JB7A 1VUBA 1LTTD 2BZ8A 3OW7A 4K6LA 2XU8A 2DTOA 4QQGA 2D0OA 2MYSA 1QCFA 1XQHA 1KTKA 4OONA 3DXJC 3F8TA 2HT1A 2MUYA 4IALA 2DJGC 1N9WA 2WAQB 3KLWA 2HEQA 4OELB 1ZKOA 4PMWA 4LJZC 1U9RA 2JQOA 3SD4A 3UDGA 2CP0A 4FU6A 4F7UG 1RACB 4LFCL 1YI2Q 3NUCA 5J22A 1K8AU 4P74A 3T51B 4A3DH 4LDYA 3CCVQ 1ARKA 4F14A 1IGUA 2BTTA 1YIJQ 2OEOA 4L5QA 2XMFA 4JLGA 1JJGA 1W1FA 4M77E 2MMPA 2P84A 2Q8RE 5EGTA 4ELYC 4XQNA 5IGEA 4DR2L 4C56C 1IW7C 1STGA 1D1IA 4PZ8A 3GTGH 1BB9A 1QG7A 5ELCA 1WYDA 2C5CA 4QJFA 1KD1U 3V2TA 1BOSA 1YNZA 3GDEA 4DR5L 1N9RA 3TSZA 1Q7YU 2RI2A 3CCMQ 1R4QB 1ZYRC 4KKSA 3MA2B 4GN3B 2ZPHB 2GFUA 3CCJQ 1NY4A 4FIBA 1WTRA 2IW3A 3WWVA 2ID0A 3QO3A 3H0HA 1BCPD 1M2OA 2R93B 1NYGA 4J6YA 2K05A 4A3JH 4LF5Q 5C5LA 1WHHA 1PM3A 4ELZC 1A0IA 5G3LD 1ICFB 4YHHL 2J0TD 2HIVA 4A3MB 2NVTH 1VQGA 2QK0A 3T13A 3PMTA 4XAXB 5HKCA 3GIBA 1RD9D 2VYTA 1VQ5Q 2VASA 2EZVA 1VOMA 3S9WA 5KCHA 3CQZH 3HPWA 1VQMQ 1O7YA 3CCLQ 1VQLQ 4M7DB 1RDPD 4HR7B 5C0XH 3HOWG 2DY8A 2OTLQ 2K7AA 4JBKA 3ULRB 3RKWA 4GN5A 2NUZA 4UDUC 4DPGA 4GKJL 1TWCH 2NVQB 3TP6A 4PV1C 4ZGDB 2KCNA 1JORA 4KHVA 5LMNQ 2AMCB 1N5ZA 4FXGC 1TWFH 3LWEA 2LCSA 2G6FX 3CC2T 4JI2Q 1MMDA 2O2OA 3JV3A 3J80L 3ZL7C 2CH4W 4PFPA 2DIQA 1O80A 4DAMA 3GTMH 1QVFS 4KUIA 3OS0A 2FXQA 3BG3A 2R3ZA 3AFQA 3KF6A 2F0TA 2E64A 3NBHA 4HT8A 1TG0A 2RJFA 4L5RC 4C92G 4IOAA 1EY4A 4OF1A 3TP5A 3V8KA 4RCNA 4RA8A 3OYAA 3RLFA 4IFDH 4KY6A 1P8LA 4DGZA 2X6GA 2R6GA 2RH2A 5EPKA 1LJOA 2P0QA 4PJOA 3QZ5B 1IREB 4JPBW 2CFMA 2BE5C 4M77D 5GANh 1KRTA 2RMOA 1KFZA 2O88A 2F3VA 3GTMB 3VS0A 5FLXE 1UEAB 5IYDG 2KSSA 4XQQA 1A15A 1X43A 3FJ5A 2DK3A 5LJ3j 5M5XH 1I81A 2KGTA 2RVLA 2LT4A 4F88A 1AWJA 2CWAA 5CQXA 1QCNA 2HD0A 3CC4A 2RN8A 1GOZA 1SR3A 2XG8D 2N8NA 2C06A 2QDYB 4NMZA 1O9SA 4DUYL 2XRQD 3G1JA 2SEBD 3QKJA 4JRPA 1KQ2A 1EYAA 1M2VA 2X4YA 4JI6L 5LMUL 4GS3A 2VV5A 3I3CA 2FZCB 1JJ2A 4B3RQ 3OYBA 2JK8A 2OCEA 2DXUA 2LRQA 2VQEQ 2BZYA 2YUQA 4AFZC 3ND8A 4ZGEB 4QY7A 2CT3A 4CJ2C 5I9OA 2UUAQ 2PUOB 1GCPA 2F0EA 2HHHQ 3M59A 2B2VA 3QWYA 3FMCA 3PQIA 3BDLA 4QQDA 3MP6A 1PZID 3PUZA 3SK6A 4JC0A 4HAEA 3TSWA 1VQNA 2V1CC 3VR4A 2F52A 4PJJA 1LYLA 3H6ZA 1VF5C 3M4GA 3LH5A 2WKCA 3GNFB 5EC7A 1SSFA 1WQ7A 4PG3A 2AK5A 3NGPA 2E3IA 3VR2A 4A3GH 2E6NA 2VXWA 4O1NA 1Q81R 4HT9A 1CM9A 2EDGA 2HD3A 4OWXB 2ZXPA 2W10A 2D8JA 2E2JB 3A5ZB 1STBA 4RCOA 3PO2G 1I6HB 4OB1B 5ELFA 5LJ3g 1CA6A 4ZN1A 1SMYD 3JCMc 2M02A 1Y71A 4EMGA 1FNVA 1LT3D 1SBBB 4DR4Q 2K79A 4C8QA 5GAOr 3S17B 1E0BA 1UHCA 4JI4Q 3S16B 5IGBA 1WXBA 4ME5A 4RH6A 2SEMA 2F0SA 5D3IB 3DLLA 1SXTA 2EYPA 2FHDA 1XMQL 4C92F 3IL8A 5BN3A 2PTKA 1TUCA 1WDXA 4XU3A 3FB9A 4LD6A 3OYDA 1S72A 1YZ6A 1L0YB 1VQ8T 1H9SA 1QVCA 1NZ9A 4JJDA 1TWHB 2WFWA 4H0LC 4C5GA 3PO2B 5JJKA 4LK1C 1KD1R 3FJPA 2JW4A 4OMNA 4C5EA 2N49A 3KLSA 3VA7A 1AE2A 3HG9A 5A35A 1C0MA 1SNPA 3EG0A 3MPUB 3SB2A 2B2UA 1BIAA 3GLXA 2KBNA 3OWFA 4GLAC 2BA1A 1SMXA 2I5HA 5FO7B 2SRCA 1G8ZD 1WOCA 1Y1WG 3CQZB 4HJ8A 1K9MU 3DLMA 1ZUYA 3CCLA 1FXXA 2LXKA 1VQPT 4IOCA 3C12A 2ENBA 1VQ5A 2MK5A 1VQDA 1OZ2A 1K8AR 2OTLT 1IL2A 2EVRA 4DR6L 4A4EA 2HQXA 2I07B 2LFNA 5IODA 4HCBA 1EWHA 1HNWL 3RKYA 1PVOA 2FZGB 3NTKA 5IYDH 2R93H 2F2VA 9ATCB 1QWEA 1VQ5T 4MIUA 3RERA 5J39A 3A56A 2M0YA 4XQJA 1SF9A 4MMLA 4CJ1B 2DILA 3FP9A 3ULPA 4M7AF 1D5MC 3LYIA 2KI7A 4OGEA 1W2BP 4JBWA 3J7YW 2HHHL 8ATCB 4L5TA 1BBUA 4DUZQ 4O0AA 4KKUA 1YP5A 1I4QA 2KEAA 1UAPA 1G3TA 4BWGB 5I21A 1AEXA 3G4ST 3T1HQ 3KBGA 1T0JA 2WB1G 4HN7A 3PO2H 1LTLA 2XTIA 1H9JA 1X3EA 5IYCG 3NQTA 1PH9A 1E24A 1GBRA 3ER0A 4A3BG 1SSOA 4BACA 3I55Q 3HS0C 2WKDA 1IBLQ 1D0YA 1X2QA 2ZPBB 3NENA 2YUOA 1CSQA 4C3IG 2M16A 1HZCA 2ZXOA 3TZDA 1M8MA 3SE0A 3CMET 1AVZC 1OU9A 1IHZA 5FU6B 2KRMA 4OO1I 2DTHA 1D0ZA 2EYWA 5IXFA 3KF8A 3BS1A 4JS5A 3MTSA 2R93G 1XWEA 5CKHA 1QILA 4OP0A 2NUPB 1YJ9A 1BO0A 1CFMA 4P2CB 4F7UF 5LJ3d 5JPNC 2KAFA 4M7AC 4A3LH 3TN2A 3FVQA 4CBVA 1TWCB 2NVQH 2JVVA 4MTKA 1D1CA 1AZEA 1CHQD 3S3NA 3L2RA 2F4VQ 4A3IG 3UDFA 1HD3A 1NSNS 2DM1A 4HJAA 4TRDA 1C8CA 1RAEB 1LTRD 1QVFP 1OXXK 3STBC 4DXFA 4FF3A 1B53A 4IURA 2ZCFB 4FVMA 4AQYL 4HMIA 3NHNA 3ERSX 3MWYW 2RQUA 5L23A 4ME7A 1GL5A 2IY5B 4XTVA 4ZNXA 2RBMA 2TMPA 2YU9B 2BUDA 1AH9A 2F0NA 4C92E 1R0BG 1ESFA 5CYUA 2ES2A 2CQAA 1EWIA 3CCEQ 2SNSA 2J06A 1VQ6A 1V1QA 3EA6A 3KF6B 3W3AA 2X51A 4M77A 1HFGA 1VS0A 5IHNA 4JI3L 3RUXA 1QE6A 3C1FA 1T3LA 4B9WA 4HIKA
chains in the Genus database with same CATH topology
4QT7A 2LX7A 2LZ6B 2EKHA 4J9EA 1BU1A 1S1NA 1VYUA 1OPLA 2DYBA 2E5KA 2JS0A 1KJWA 3SEMA 1QWFA 2D1XA 1YN8A 2KNBB 4DEYA 4RTYA 2JTEA 2KYBA 2KBTA 2JXBA 1TUDA 4RTTA 1KIKA 3EHQA 4A63B 4JJCA 1GRIA 1I1JA 3PVLA 3VS2A 2MCNA 4D8KA 5I22A 2NWMA 2YUNA 3GBQA 3UA6A 2I0NA 2AZSA 1UGVA 1PKSA 3EHRA 1UJ0A 2EGAA 1PNJA 4R0KA 2HCKA 1ZX6A 1VYVA 3VS1A 3R6NA 1PWTA 1M3AA 1WI7A 2YT6A 2JM8A 2GQIA 3M0TA 1ZBJA 1OPKA 1FYNA 1KSWA 2AZVA 2KR3A 2LP5A 2JM9A 1X69A 2RF0A 1K9AA 2PZ1A 3VS5A 2C0TA 4J9CA 1AWOA 2OI3A 3C0CA 2GGRA 1UUEA 4JZ3A 2VKNA 2K9GA 1AOJA 2KE9A 2FPFA 3CQTA 3UATA 1SRMA 2DL8A 1U3OA 2DL5A 1AEYA 2JMAA 1JXOA 1QLYA 1B07A 1SHFA 2A28A 1QKXA 4Z88A 2QDLA 2J6OA 2DRMA 2MOXA 3NMZC 5GJVB 3VS6A 2L0AA 2FRWA 5GJWB 2KT1A 2BZXA 2L2PA 3VS4A 1M30A 4J9DA 3I5SA 2DRKA 1I0CA 1RI9A 3QWXX 2P4RA 3TVTA 1K0SA 1JEGA 1BK2A 1CKBA 2LNHB 4CC3A 1UJYA 2PNIA 2IIMA 1K1ZA 3VS7A 3M0QA 1Z9ZA 5I11A 3M0UA 2K6DA 2YDLA 3I5RA 2K3BA 5FW9A 1EFNA 5HCKA 1UFFA 2ROLA 4CC7A 2CUDA 1UDLA 3PVQA 1VYTA 4LNPA 4ESRA 1NG2A 1RLPC 2V1QA 2KXDA 2EYXA 1E6HA 1MUZA 3UF4A 1Y57A 1ABOA 2B86A 2JMCA 4K11A 2CUBA 2M51A 4D8DA 2ED1A 3EGUA 2DL3A 1FMKA 1GCQC 2L3PA 2KT8A 1SPKA 1MV0B 1V1CA 1H3HA 1BBZA 5IH2A 3H0IA 1JXMA 2DF6A 1IO6A 4CC4B 4HVUA 1NM7A 2ECZA 1WLPB 2KRSA 1CKAA 3H0FA 4OMPA 2J05A 2O31A 2CREA 2A37A 1OV3A 2X3XD 2W0ZA 4OMLA 2BZ8A 4LE9A 1X6GA 2C0OA 1QCFA 1GFCA 2LQNA 1G83A 2J6FA 4KRTA 1WIEA 2EGCA 2X3WD 2HEQA 4AFSC 2DL4A 3PE0A 1G2BA 4LN2A 1ARKA 3REBB 4F14A 4X1VA 2BTTA 1WFWA 2GTOA 2DMOA 2XMFA 5FWBA 1W1FA 5IHKA 2DBKA 1SSHA 1M27C 1BB9A 1GBQA 1XOVA 1YNZA 2HDAA 3TSZA 4J9HA 1VA7A 4AFQC 4J9FA 3M0RA 2A08A 1E7OA 2AKLA 3UA7A 4EIKA 1ZLMA 3H0HA 2FEIA 1YCSB 1NYGA 1A0NB 2LJ3A 2K2MA 1SEMA 2MIOA 5FWCA 1T3LA 2VWFA 4FSSA 2EW3A 1NEBA 3VS3A 1I07A 2K7AA 2RPNA 3NPFA 1NLOC 3ULRB 2NUZA 2KYMA 2AKKA 4OMQA 1J3TA 1N5ZA 1SHGA 1MV3A 1OEBA 2LCSA 1U5SA 2G6FX 2O2OA 3JV3A 2FG0A 3ZL7C 2CH4W 2EYYA 3IQLA 4Y92A 4DEXA 1RUWA 2LJ0A 4RUGA 3KFVA 4J9BA 1TG0A 1Y0MA 1NYFA 4HVVA 4WCIA 1PRLC 4JPBW 5IHIA 3RBBB 3VRZA 2RMOA 1KFZA 2O88A 3VS0A 3THKA 4OMMA 4RTXA 4Z8AA 2CSIA 2KRNA 1X43A 3FJ5A 1HSQA 4OMOA 1WA7A 2KGTA 1UE9A 1AWJA 1YWOA 2RN8A 2ABLA 2O9SA 4RTVA 1ABQA 1LCKA 4IIMA 3M0PA 1K4US 1M3BA 2EGEA 2GTJA 1K76A 1HJDA 1ZUKA 2BZYA 5IXBA 2YUQA 4AFZC 1W70A 4GLMA 2CT4A 2CT3A 1WXTA 2H8HA 1GCPA 2HSPA 3QWYA 1X6BA 1ZUUA 2EQIA 2KXCA 1GCQA 1JQQA 3TSWA 1UECA 2ED0A 3LH5A 1JU5C 2RQWA 5EC7A 2RNAA 2AK5A 3NGPA 4M4ZA 2DX1A 2GBQA 2CH4A 2V1RA 2EBPA 4J9GA 1B3QA 2W10A 2D8JA 1AWWA 1OOTA 2DJQA 4JZ4A 2DE0X 1UHFA 1UTIA 1NLPC 3H41A 4JJBA 2K79A 3A98A 4IIOA 1CSKA 1UHCA 2KROA 1WXBA 1SRLA 2RQVA 2SEMA 1AZGB 3VRYA 1PRMC 1RLQC 2L3QA 1TUCA 1WDXA 1AWXA 2CSQA 2PTKA 4HXJA 2YUPA 1WYXA 2L3SA 4HVWA 4LUDA 1UG1A 4JJDA 1X2KA 1PKTA 1YWPA 4OMNA 2JW4A 5ECAA 3EG0A 1T0HA 1JO8A 2HBWA 3EG1A 2SRCA 2D8HA 4GBQA 2YSQA 1ZUYA 4RTWA 2GNCA 2FO0A 1NEGA 2RQTA 2DL7A 2LQWA 2EVRA 3EG2A 2FPDA 4RTUA 3RNJA 2F2VA 1QWEA 2ESWA 2M0YA 2DLPA 2DILA 2DA9A 4AG2C 4Z89A 2A36A 2D0NA 2F2WA 3EG3A 1YP5A 1U06A 1X27A 2KEAA 1T0JA 1T3SA 2VVKA 1M3CA 1ZSGA 2LJ1A 2OAWA 1GBRA 2CDTA 3U23A 4AG1C 1X2QA 2F2XA 1GFDA 2YUOA 3M0SA 3SHWA 2J6KA 4J9IA 1M8MA 3REAB 1W6XA 3I35A 4F17A 1AVZC 2OJ2A 2KRMA 4E6RA 2EYWA 5IXFA 4ORZA 1WX6A 4AFUC 2DVJA 4F16A 3I9QA 4LUEA 2RQRA 2DBMA 2J7IA 4HCKA 2ENMA 1AZEA 2FRYA 2EPDA 2FPEA 1QKWA 1H92A 1HD3A 2DM1A 1PHTA 2DNUA 1K0XA 1AD5A 2ROTA 3NHNA 2RQUA 5L23A 1GL5A 2EYZA 4ZNXA 2C0IA 1Z9QA 2JT4A 2O9VA 2JS2A 3O5ZA 4RTZA 2J06A 1E6GA 2LMJA 1H8KA 5IHNA 4CC2A 1WXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QT7 A;  2LX7 A;  2LZ6 B;  2EKH A;  4J9E A;  1BU1 A;  1S1N A;  1VYU A;  1OPL A;  2DYB A;  2E5K A;  2JS0 A;  1KJW A;  3SEM A;  1QWF A;  2D1X A;  1YN8 A;  2KNB B;  4DEY A;  4RTY A;  2JTE A;  2KYB A;  2KBT A;  2JXB A;  1TUD A;  4RTT A;  1KIK A;  3EHQ A;  4A63 B;  4JJC A;  1GRI A;  1I1J A;  3PVL A;  3VS2 A;  2MCN A;  4D8K A;  5I22 A;  2NWM A;  2YUN A;  3GBQ A;  3UA6 A;  2I0N A;  2AZS A;  1UGV A;  1PKS A;  3EHR A;  1UJ0 A;  2EGA A;  1PNJ A;  4R0K A;  2HCK A;  1ZX6 A;  1VYV A;  3VS1 A;  3R6N A;  1PWT A;  1M3A A;  1WI7 A;  2YT6 A;  2JM8 A;  2GQI A;  3M0T A;  1ZBJ A;  1OPK A;  1FYN A;  1KSW A;  2AZV A;  2KR3 A;  2LP5 A;  2JM9 A;  1X69 A;  2RF0 A;  1K9A A;  2PZ1 A;  3VS5 A;  2C0T A;  4J9C A;  1AWO A;  2OI3 A;  3C0C A;  2GGR A;  1UUE A;  4JZ3 A;  2VKN A;  2K9G A;  1AOJ A;  2KE9 A;  2FPF A;  3CQT A;  3UAT A;  1SRM A;  2DL8 A;  1U3O A;  2DL5 A;  1AEY A;  2JMA A;  1JXO A;  1QLY A;  1B07 A;  1SHF A;  2A28 A;  1QKX A;  4Z88 A;  2QDL A;  2J6O A;  2DRM A;  2MOX A;  3NMZ C;  5GJV B;  3VS6 A;  2L0A A;  2FRW A;  5GJW B;  2KT1 A;  2BZX A;  2L2P A;  3VS4 A;  1M30 A;  4J9D A;  3I5S A;  2DRK A;  1I0C A;  1RI9 A;  3QWX X;  2P4R A;  3TVT A;  1K0S A;  1JEG A;  1BK2 A;  1CKB A;  2LNH B;  4CC3 A;  1UJY A;  2PNI A;  2IIM A;  1K1Z A;  3VS7 A;  3M0Q A;  1Z9Z A;  5I11 A;  3M0U A;  2K6D A;  2YDL A;  3I5R A;  2K3B A;  5FW9 A;  1EFN A;  5HCK A;  1UFF A;  2ROL A;  4CC7 A;  2CUD A;  1UDL A;  3PVQ A;  1VYT A;  4LNP A;  4ESR A;  1NG2 A;  1RLP C;  2V1Q A;  2KXD A;  2EYX A;  1E6H A;  1MUZ A;  3UF4 A;  1Y57 A;  1ABO A;  2B86 A;  2JMC A;  4K11 A;  2CUB A;  2M51 A;  4D8D A;  2ED1 A;  3EGU A;  2DL3 A;  1FMK A;  1GCQ C;  2L3P A;  2KT8 A;  1SPK A;  1MV0 B;  1V1C A;  1H3H A;  1BBZ A;  5IH2 A;  3H0I A;  1JXM A;  2DF6 A;  1IO6 A;  4CC4 B;  4HVU A;  1NM7 A;  2ECZ A;  1WLP B;  2KRS A;  1CKA A;  3H0F A;  4OMP A;  2J05 A;  2O31 A;  2CRE A;  2A37 A;  1OV3 A;  2X3X D;  2W0Z A;  4OML A;  2BZ8 A;  4LE9 A;  1X6G A;  2C0O A;  1QCF A;  1GFC A;  2LQN A;  1G83 A;  2J6F A;  4KRT A;  1WIE A;  2EGC A;  2X3W D;  2HEQ A;  4AFS C;  2DL4 A;  3PE0 A;  1G2B A;  4LN2 A;  1ARK A;  3REB B;  4F14 A;  4X1V A;  2BTT A;  1WFW A;  2GTO A;  2DMO A;  2XMF A;  5FWB A;  1W1F A;  5IHK A;  2DBK A;  1SSH A;  1M27 C;  1BB9 A;  1GBQ A;  1XOV A;  1YNZ A;  2HDA A;  3TSZ A;  4J9H A;  1VA7 A;  4AFQ C;  4J9F A;  3M0R A;  2A08 A;  1E7O A;  2AKL A;  3UA7 A;  4EIK A;  1ZLM A;  3H0H A;  2FEI A;  1YCS B;  1NYG A;  1A0N B;  2LJ3 A;  2K2M A;  1SEM A;  2MIO A;  5FWC A;  1T3L A;  2VWF A;  4FSS A;  2EW3 A;  1NEB A;  3VS3 A;  1I07 A;  2K7A A;  2RPN A;  3NPF A;  1NLO C;  3ULR B;  2NUZ A;  2KYM A;  2AKK A;  4OMQ A;  1J3T A;  1N5Z A;  1SHG A;  1MV3 A;  1OEB A;  2LCS A;  1U5S A;  2G6F X;  2O2O A;  3JV3 A;  2FG0 A;  3ZL7 C;  2CH4 W;  2EYY A;  3IQL A;  4Y92 A;  4DEX A;  1RUW A;  2LJ0 A;  4RUG A;  3KFV A;  4J9B A;  1TG0 A;  1Y0M A;  1NYF A;  4HVV A;  4WCI A;  1PRL C;  4JPB W;  5IHI A;  3RBB B;  3VRZ A;  2RMO A;  1KFZ A;  2O88 A;  3VS0 A;  3THK A;  4OMM A;  4RTX A;  4Z8A A;  2CSI A;  2KRN A;  1X43 A;  3FJ5 A;  1HSQ A;  4OMO A;  1WA7 A;  2KGT A;  1UE9 A;  1AWJ A;  1YWO A;  2RN8 A;  2ABL A;  2O9S A;  4RTV A;  1ABQ A;  1LCK A;  4IIM A;  3M0P A;  1K4U S;  1M3B A;  2EGE A;  2GTJ A;  1K76 A;  1HJD A;  1ZUK A;  2BZY A;  5IXB A;  2YUQ A;  4AFZ C;  1W70 A;  4GLM A;  2CT4 A;  2CT3 A;  1WXT A;  2H8H A;  1GCP A;  2HSP A;  3QWY A;  1X6B A;  1ZUU A;  2EQI A;  2KXC A;  1GCQ A;  1JQQ A;  3TSW A;  1UEC A;  2ED0 A;  3LH5 A;  1JU5 C;  2RQW A;  5EC7 A;  2RNA A;  2AK5 A;  3NGP A;  4M4Z A;  2DX1 A;  2GBQ A;  2CH4 A;  2V1R A;  2EBP A;  4J9G A;  1B3Q A;  2W10 A;  2D8J A;  1AWW A;  1OOT A;  2DJQ A;  4JZ4 A;  2DE0 X;  1UHF A;  1UTI A;  1NLP C;  3H41 A;  4JJB A;  2K79 A;  3A98 A;  4IIO A;  1CSK A;  1UHC A;  2KRO A;  1WXB A;  1SRL A;  2RQV A;  2SEM A;  1AZG B;  3VRY A;  1PRM C;  1RLQ C;  2L3Q A;  1TUC A;  1WDX A;  1AWX A;  2CSQ A;  2PTK A;  4HXJ A;  2YUP A;  1WYX A;  2L3S A;  4HVW A;  4LUD A;  1UG1 A;  4JJD A;  1X2K A;  1PKT A;  1YWP A;  4OMN A;  2JW4 A;  5ECA A;  3EG0 A;  1T0H A;  1JO8 A;  2HBW A;  3EG1 A;  2SRC A;  2D8H A;  4GBQ A;  2YSQ A;  1ZUY A;  4RTW A;  2GNC A;  2FO0 A;  1NEG A;  2RQT A;  2DL7 A;  2LQW A;  2EVR A;  3EG2 A;  2FPD A;  4RTU A;  3RNJ A;  2F2V A;  1QWE A;  2ESW A;  2M0Y A;  2DLP A;  2DIL A;  2DA9 A;  4AG2 C;  4Z89 A;  2A36 A;  2D0N A;  2F2W A;  3EG3 A;  1YP5 A;  1U06 A;  1X27 A;  2KEA A;  1T0J A;  1T3S A;  2VVK A;  1M3C A;  1ZSG A;  2LJ1 A;  2OAW A;  1GBR A;  2CDT A;  3U23 A;  4AG1 C;  1X2Q A;  2F2X A;  1GFD A;  2YUO A;  3M0S A;  3SHW A;  2J6K A;  4J9I A;  1M8M A;  3REA B;  1W6X A;  3I35 A;  4F17 A;  1AVZ C;  2OJ2 A;  2KRM A;  4E6R A;  2EYW A;  5IXF A;  4ORZ A;  1WX6 A;  4AFU C;  2DVJ A;  4F16 A;  3I9Q A;  4LUE A;  2RQR A;  2DBM A;  2J7I A;  4HCK A;  2ENM A;  1AZE A;  2FRY A;  2EPD A;  2FPE A;  1QKW A;  1H92 A;  1HD3 A;  2DM1 A;  1PHT A;  2DNU A;  1K0X A;  1AD5 A;  2ROT A;  3NHN A;  2RQU A;  5L23 A;  1GL5 A;  2EYZ A;  4ZNX A;  2C0I A;  1Z9Q A;  2JT4 A;  2O9V A;  2JS2 A;  3O5Z A;  4RTZ A;  2J06 A;  1E6G A;  2LMJ A;  1H8K A;  5IHN A;  4CC2 A;  1WXU A; 
#chains in the Genus database with same CATH topology
 1VIE A;  2PNH A;  1ZA2 B;  2JA8 B;  4GN4 B;  4RCB A;  4C3H H;  1PTO C;  1PYB A;  4GNX C;  2UU9 Q;  1S1N A;  4FT4 A;  5CIU A;  1FD7 D;  3FEO A;  1Q90 A;  3FEW X;  4Y7N B;  5I2S A;  1AZP A;  2EYO A;  2QAZ A;  2R7F A;  5DEH A;  2O5I C;  4NP5 A;  1KJW A;  1ENA A;  2PQE A;  4OVA A;  4BE1 A;  2PQW A;  3GPL A;  3SEB A;  3K5L A;  2K04 A;  4KH0 B;  2HDM A;  5GAN 2;  3OA6 A;  3QZ9 B;  4LDW A;  1BI3 A;  2D1X A;  2I5L X;  2ATW A;  2D9T A;  1IBK Q;  2M2L A;  4MNO A;  4A4F A;  2JTE A;  1IKM A;  4N4G A;  3S1Q H;  1JWM D;  2JA8 H;  4QVZ A;  5ELE A;  3M3Y H;  2KBT A;  4EMH A;  1STE A;  1V8Q A;  2JXB A;  4X62 Q;  2JA6 G;  2JN4 A;  4FO2 A;  1BR9 A;  1WFQ A;  2B2U C;  2Z6K C;  5LJ5 e;  2XVS A;  4IUU A;  5FLM H;  1JWS D;  4A3F B;  1I1J A;  1NPR A;  5GMK e;  4A3J G;  1MHW C;  1V76 A;  3OYI A;  3H3V C;  3V96 A;  2NWM A;  2K01 A;  5H1S E;  5JEA H;  3C2P A;  3K5M A;  1NE3 A;  2EIF A;  1UJ0 A;  3I72 A;  2EQK A;  1M1K C;  4X66 Q;  1I50 H;  1PXU A;  3M58 A;  1FYC A;  2EPB A;  3WOF A;  5GAM j;  1PCX A;  4PJO D;  3VS1 A;  4LFC Q;  1WI7 A;  3EG9 B;  3HOY G;  1M5Q 1;  2NUP A;  2JM8 A;  2WSC E;  3A8K E;  4IQZ A;  4BBS B;  2VQF L;  3D31 A;  4H02 A;  3M0T A;  4XTX A;  1S4Z A;  3A8G B;  1K83 B;  2AUK A;  2KEE A;  1NMF A;  4DR1 L;  3S24 A;  5L37 A;  2ZZD A;  1DOL A;  1LTA D;  1LTG D;  2JYO A;  2L1B A;  2RF0 A;  2ZPF B;  4YY3 Q;  3MXU A;  3U9S A;  4IFD I;  1K28 A;  1K9A A;  2Z8L A;  3LWH A;  2EAY A;  2L4N A;  1IXR A;  1PA6 A;  1G8X A;  4J9C A;  1W3S A;  2O2L D;  5FRN A;  2Q8I B;  4RMF A;  2A73 B;  3PGZ A;  1N33 Q;  3S16 H;  2XHC A;  2Z9H A;  1BCM A;  2WIN B;  2UUB L;  2R5M A;  4BB7 A;  5IT9 L;  4N4I A;  2A6E D;  5C6A A;  4Y52 H;  2YRD A;  1ASZ A;  4M75 D;  3S3M A;  4X65 Q;  4M77 F;  2CWP A;  1U1S A;  4FDB A;  4BXX G;  2FPF A;  2D0P A;  2CCZ A;  1SRM A;  3CD6 Q;  3CCS Q;  3EQL C;  4LF6 Q;  4LFB Q;  3OB9 A;  4MTN A;  5A0G A;  2JMA A;  1G2T A;  1QLY A;  3KK7 A;  3S1M B;  2IPO B;  2A0F B;  2H3E B;  2OTJ T;  4KGZ B;  2HCC A;  1UB4 A;  1EEI D;  3MEF A;  2XIW A;  2QDL A;  1U4M A;  3PO3 G;  2EYH A;  2EJ9 A;  2M0O A;  4NW2 A;  3VS6 A;  1FGB D;  3G6J B;  2FRW A;  4L6V 5;  5GJW B;  1FR3 A;  1HFN A;  2KT1 A;  3TEE A;  3M85 A;  1IYV A;  2D2C C;  2R61 A;  5IYC H;  3M56 A;  3K59 A;  1KAB A;  1EFW A;  1I5F A;  1GXD C;  2E3H A;  2XDB A;  1HJP A;  5CV7 A;  5C0X G;  1CKN A;  1PLF A;  3TVT A;  1X32 A;  3AYH B;  4RFB A;  1ZQ1 A;  3QR8 A;  3TZU A;  4DV6 Q;  1GXI E;  1BK2 A;  2IG0 A;  2E70 A;  3EAE A;  4GY5 A;  1V1O A;  5LJ5 j;  4CC3 A;  2CQO A;  1GVP A;  2HDL A;  3MP8 A;  5TSS A;  3OWE B;  2K03 A;  5GAO q;  1QVF A;  1IYJ B;  4A3L G;  4WTO B;  3HRT A;  1UGQ B;  3TCJ A;  5GAM h;  1K1Z A;  3GP7 A;  4X9C A;  3L2V A;  3MXP A;  3NSW A;  5D3D A;  3I4M B;  1VQC A;  1RTO A;  2F3I A;  1CQF A;  3I5R A;  4LUO A;  4NOY A;  1VQ9 A;  3DHQ A;  2LT1 A;  1S40 A;  3J81 L;  5CKE A;  3EVQ A;  3J81 c;  2B2T A;  1UFF A;  2ROL A;  2G9D A;  4LF4 Q;  3AEV A;  4J7I A;  2PW7 A;  1YNJ C;  4XTZ A;  4A76 A;  1QWY A;  2FHT A;  4AT1 B;  1MD2 D;  4DQ2 A;  4KTA A;  4FF1 A;  1NG2 A;  2ICI A;  1J5E Q;  2A3L A;  4C92 C;  2V1Q A;  2KHJ A;  2X4X A;  3OSO A;  4MDX A;  1VQ9 Q;  4LDU A;  1SNQ A;  3NTI A;  3K58 A;  2I2L A;  4C8Q E;  2N55 A;  1DJ7 B;  2L9H A;  3J7A 5;  3UF4 A;  4QMG A;  2X4W A;  3X28 B;  3OHX C;  1HK9 A;  5CV8 A;  3EJI A;  3FIF A;  2K5I A;  5FJ8 H;  1TY2 A;  2CUB A;  4RMO A;  1VQ6 Q;  1IXD A;  1GHJ A;  4JBJ A;  4D8D A;  5HK0 A;  3BYY B;  4NB3 A;  3CD6 T;  5LJ5 f;  3T1H L;  3KJP A;  1JC7 A;  2E4H A;  1QP2 A;  1K83 H;  4XYO A;  2L3P A;  1GCQ C;  4ODG A;  2KT8 A;  3CPW A;  4UHV A;  4APV A;  4CDC C;  4LDX A;  1SPK A;  3WDN A;  1PHJ A;  4DR3 Q;  1BBZ A;  3PMI A;  1T5E A;  1R8O B;  4CC4 B;  2Y90 A;  3G71 T;  3E9H A;  2VC8 A;  3NE5 B;  2MWP A;  3HSB A;  5M5W B;  4DV5 Q;  2QGF B;  2J05 A;  1I4X A;  2O31 A;  2QQR A;  3CCV A;  4KGX B;  2JA5 G;  2CRE A;  2LC4 A;  1S5F D;  1B8A A;  2W0Z A;  2VY3 A;  2KUM A;  3LWU A;  3I4L A;  1M90 U;  1K73 R;  4POG A;  3J81 i;  3I56 A;  3FC3 A;  3GD7 A;  3K81 C;  2HL5 C;  4LE9 A;  1X6G A;  1Y14 B;  3AMU A;  2EKO A;  2LQN A;  3JB9 D;  3MXN B;  4DR6 Q;  1G83 A;  2XSC A;  3QOJ A;  5GAO n;  2RJE A;  1XMO Q;  1TH7 A;  2EGC A;  4DR4 L;  1VQI A;  2DL4 A;  5IGC A;  2RB6 A;  1UE1 A;  4X3K A;  4LN2 A;  1HZA A;  2ATC B;  2CVR A;  3OY9 A;  2X35 A;  4BI8 B;  4C92 A;  1OX8 A;  2K2V A;  4QGU A;  3LWI A;  4MHE A;  3DUZ A;  1OXT A;  5FWB A;  4FSX A;  1I6V C;  4M7A B;  1RJT A;  4HMJ A;  3H94 A;  3OS2 A;  1SSH A;  4U67 3;  4LF8 Q;  3I4M G;  3G71 A;  3NWT A;  4BI3 A;  3MZ5 A;  3PUW A;  2RHS B;  4J9H A;  3H0G H;  1PTO D;  1EQQ A;  3HRS A;  3NK9 A;  2QA4 T;  1LT4 D;  2R58 A;  3M4O B;  1EUJ A;  1B9M A;  1QVG S;  3QG1 A;  2GFA A;  3CD6 A;  1PTO F;  3HHT B;  1H3Z A;  1EQT A;  1E7O A;  2AKL A;  4X9D A;  2B2W C;  2RHQ B;  3I8Z A;  1ZLM A;  2EY2 A;  5M3F H;  5IAY A;  4M7D F;  4XXE A;  4Z02 A;  1KNA A;  2RD1 A;  3LGJ A;  2K5W A;  3GTO H;  2I46 A;  1RKN A;  2WSE E;  4A53 A;  1TUG B;  2MIO A;  4P5N A;  1PFM A;  4ZUJ A;  2R7Z B;  1KD1 C;  3A54 A;  4V19 0;  3OMC A;  2YRV A;  3JCM V;  5T1I A;  4F8M A;  2KQ3 A;  2PW5 A;  4LF9 L;  2EW3 A;  3VUZ A;  4P75 A;  3OYE A;  1SAP A;  3L2Z A;  4A3K B;  4FYW B;  3QPH A;  3K5O A;  5BR8 L;  4LNQ A;  3TSS A;  1NEB A;  2F5T X;  1A2U A;  3A8I E;  3VS3 A;  1ET9 A;  4JI3 Q;  3RMQ A;  3PIO 3;  1F2Z A;  2B2T C;  2JA7 G;  5M5W H;  2VB2 X;  1XTD A;  4LFA L;  1PD1 A;  2AKK A;  3KUF A;  1PFB A;  1VQ9 T;  1N34 L;  4MZ9 A;  1Z9F A;  3FKI G;  2RQX A;  3S2D H;  1JMC A;  5COY A;  1SYD A;  1D1K A;  2EYY A;  1E7Z A;  4X3U A;  1GJX A;  1HA6 A;  5KYX B;  2ALY B;  3QDR B;  3IQL A;  4RWS C;  4M7A A;  4LUZ A;  1VQ6 T;  4DNR B;  3T1Y L;  5ELB A;  2KVQ G;  5A0D A;  1I5O B;  3I55 T;  4O42 A;  3HP9 A;  1X6O A;  4M7A D;  3HOW H;  2X9H A;  3W1B A;  3VYH B;  1XXG A;  1H9S B;  2Y4X A;  4UP9 A;  1WJQ A;  1PRT D;  4PQX A;  2DTI A;  4C92 D;  1YHQ A;  3EFR A;  1Q82 R;  4A4K A;  1I94 L;  2CZ0 B;  3T53 B;  3RBB B;  2KVM A;  3VRZ A;  2Z4H A;  3OW2 P;  1M2V B;  1YHB A;  1UGP B;  4FW2 A;  3CME Q;  1BKB A;  1DZ1 A;  5GAN 3;  4RTX A;  3JCM f;  2KRN A;  4QUC A;  2J7Z A;  4CDD C;  3NQI A;  2EYQ A;  3ULJ A;  1D3B A;  3OS5 A;  4X34 A;  1HSQ A;  5CAI A;  1QZG A;  4OMO A;  3OW2 A;  1WA7 A;  2FVU A;  3CCQ A;  3M9Q A;  3CCR Q;  5E7N A;  4AIM A;  5FJ8 G;  2YTY A;  2E12 A;  2DJF C;  1VQO T;  1CUK A;  3OIQ A;  4IJH A;  2JA6 B;  3EH2 A;  4RG1 A;  1R77 A;  2MJ8 A;  2O9S A;  3RDV A;  1NJI R;  3M4Y A;  4O6J A;  1LCK A;  2A6H D;  3R3O A;  3JAM E;  3GTP B;  1OZ3 A;  4IIM A;  3M0P A;  3G7Z A;  2GVB A;  1M3B A;  2EGE A;  4OB3 B;  4QKU A;  1Y1V B;  1U5K A;  1HJD A;  1B34 A;  4KGV B;  2NN6 H;  4G7H C;  4QIW E;  2K52 A;  3UI2 A;  3Q24 A;  1KL9 A;  1I8F A;  4AYB G;  4FNF A;  5IXB A;  2RO0 A;  2CT4 A;  4N4H A;  5GAN 6;  1WXT A;  4R55 A;  3OYH A;  1YIJ A;  1STH A;  3CP0 A;  2H8H A;  4BY7 H;  2HIX A;  2JOY A;  5LMN L;  3OSV A;  3G6E A;  1TS3 A;  1SE8 A;  4JCV E;  1GCQ A;  1QNK A;  5C0M A;  2RCF A;  5KYY B;  1UEC A;  2KK4 A;  5GAN g;  2CP7 A;  3A8H B;  2MO0 A;  4EQ5 A;  1Z7T A;  4DR5 Q;  4EMK C;  2FMM A;  2ED0 A;  1W4S A;  3T16 A;  4BY6 B;  1JU5 C;  2O01 E;  4RGN A;  2RQW A;  5M3M B;  2EQU A;  1EIF A;  2LNV A;  3TDQ A;  5C4X H;  3F1Z A;  4M4Z A;  4EX5 A;  2LQ8 A;  1B3Q A;  1EIG A;  3CCU T;  2KOL A;  2A6E C;  5C44 H;  1G91 A;  4E7L A;  1AWW A;  1G6P A;  1X3P A;  3O13 A;  1TOV A;  1VMP A;  1BCP B;  4LF5 L;  4JZ4 A;  1UHF A;  1LPL A;  4ZKC B;  3WXM B;  4M78 A;  1RIP A;  3UT1 A;  2L3R A;  3CCU A;  3S3O A;  3VYU A;  4BUG A;  3A5U A;  4ZTJ A;  1M1G A;  1I3Q B;  4DK1 A;  4C8Q C;  1SNM A;  2Q2H A;  3OPO A;  3SGI A;  4PK4 A;  5FLX L;  1JRI A;  1Q86 C;  2HKN A;  5KYX A;  2KRO A;  1M9S A;  5EPL A;  1WTW A;  3PSI A;  1XJV A;  3VKI A;  1Q81 C;  1UNS A;  1BCO A;  3TRE A;  1PRM C;  1S3O A;  4ZUI A;  1T9H A;  2EFI A;  1SYE A;  4K2L A;  4KI0 A;  1AWX A;  1JT8 A;  4HXJ A;  2LQK A;  4DV1 L;  1WYX A;  4ZK9 B;  3LH0 A;  2L3S A;  4HVW A;  2JXM B;  2EYJ A;  4M1U B;  2AQ2 B;  3KDF A;  4X3S A;  2RDG A;  3HGB A;  1OI1 A;  4K5X A;  1JWU D;  3DMU A;  1T0H A;  1ZHI A;  3OYJ A;  4DR3 L;  5GAM d;  5KYW B;  5ISR A;  3T9N A;  5E4W C;  2RI5 A;  1TTH B;  2KQW A;  3NBI A;  5LMU Q;  4HJ9 A;  5C6S A;  3M54 A;  2KCM A;  5JJZ A;  2IHF A;  2FO0 A;  1B3A A;  2IWH A;  4ME3 A;  1C6V X;  2CZ6 B;  2DL7 A;  2LQW A;  2RI3 A;  1JJC B;  2UU9 L;  3RNJ A;  1UGR B;  4AMC A;  4E7H A;  3CAM A;  2N3S A;  3CHB D;  1QUQ B;  2E74 C;  5IT9 E;  3MFY A;  1Q82 C;  4XTC S;  4DBF A;  1ILQ A;  4BS9 A;  5CCA A;  5M3M H;  5GMK i;  1HCZ A;  1YJN T;  1KDC A;  4Y91 A;  2E75 C;  4K14 A;  2DA9 A;  4Z89 A;  2NZO A;  5FRM A;  3EG3 A;  1T5X D;  4ZKB B;  4IFD J;  3CRL C;  3R2I A;  4GLV B;  3F2B A;  2B29 A;  4JI8 Q;  5EBD A;  1K9M C;  2KDS A;  1YJN A;  3VR6 A;  2E2H H;  4RHR A;  4M77 C;  1JQY D;  1PH2 A;  3DWA A;  5A2Q E;  4JV5 L;  2LDM A;  1E2W A;  3NFC A;  1T3S A;  2VVK A;  1E1T A;  3JSC A;  3STB D;  1ZSG A;  1DXM A;  5GAD C;  1SE4 A;  3M7N A;  2LJ1 A;  4JS4 A;  1L0X B;  3IFT A;  3I55 A;  4BDY A;  4JK1 C;  3U23 A;  5KH6 A;  4HED A;  1FMV A;  2IPK D;  3CCE T;  1CA5 A;  1GFD A;  1N27 A;  4FT2 A;  3M0S A;  2E65 A;  4JI7 Q;  2AUJ D;  1W6X A;  3D4W A;  3I35 A;  4DV3 L;  2F1M A;  1M4V A;  5M3M G;  1FGU A;  2VUM H;  2OJ2 A;  4H7B A;  5KIX A;  4YIJ A;  4LFA Q;  1II3 A;  3CMA A;  3ND9 A;  1MSH A;  3AFP A;  4F16 A;  3HEJ A;  3I4N G;  5LJ5 d;  3KUP A;  2QXF A;  3I9Q A;  4LUE A;  4TKO B;  1I4H A;  4C3H G;  3N5B B;  4HCK A;  3SR1 A;  1EYD A;  1EY7 A;  1X75 C;  4RGT A;  2F0U A;  3I4O A;  1HR0 Q;  3SK5 A;  3BZC A;  4LF9 Q;  2YLB A;  2FRY A;  3DKM A;  2EPD A;  1I3Q H;  1KXL A;  1H92 A;  5LL6 S;  2ASB A;  4G7O C;  3QBY A;  3EH1 A;  1BCP F;  1SRU A;  4ZCK A;  1I4K 1;  1A6X A;  1FJG Q;  4JRI A;  1KNE A;  3S14 H;  3F2U A;  4XIG S;  4JV5 Q;  2DJZ A;  2MPX C;  1ESR A;  3L7Z C;  2ROT A;  4DNT B;  2HAX A;  1K8M A;  4C3J G;  1BI1 A;  1CQV A;  1Z9Q A;  2K1B A;  4TVA B;  3O5Z A;  3C1E A;  4K8I A;  2NVX H;  3QJ6 A;  1U4R A;  2DXB A;  1M90 R;  2QAS A;  4RKB A;  3EG9 A;  1CHP D;  1TWB A;  4M7A E;  4R4O A;  2F0P A;  5GAM g;  3CCL T;  4C2M B;  4JI7 L;  2QTX A;  1N32 Q;  3JCM g;  3GQB A;  4QT7 A;  3G4S Q;  3C46 A;  1SNO A;  4J9E A;  4GNX A;  5BR8 Q;  2QQA A;  1PG5 B;  4J8O A;  2DYB A;  4G4K A;  1YFN A;  1FNU A;  2PUK B;  1EU4 A;  2CZ7 B;  1F2Y A;  1VQ8 A;  1D5Z C;  2WAQ E;  1QUQ A;  3G6E Q;  2WP8 J;  1S5B D;  3HRZ C;  1B70 B;  3S2H B;  4J83 A;  2EJF A;  1YIJ T;  4A3E B;  2AKW B;  3CKI B;  4Y7N H;  1LT6 D;  2UUB Q;  4J15 A;  1IRX A;  3I7F A;  1TWA H;  3MEU A;  2JA7 B;  1JE4 A;  2KYB A;  1D7Q A;  2LXJ A;  4B6M A;  1KDB A;  1Y8O B;  2KCC A;  1TUD A;  3BDO A;  1STY A;  1TXQ A;  4RTT A;  5DAU A;  2NN6 I;  2NB0 A;  1KIK A;  2Y0S G;  3RLN A;  1HNW Q;  3EHQ A;  1TT2 A;  4JJC A;  2JA5 H;  3PVL A;  1K0R A;  3FHW A;  4D8K A;  5I22 A;  4ANJ A;  3UDX A;  3NWS A;  4RKU E;  4VUB A;  1VQK A;  4I7Z C;  5EAY A;  3CCV T;  2EXD A;  4CHT B;  3K57 A;  1XNQ L;  2A69 D;  1O7L A;  1NR4 A;  4Q0F A;  4EMK A;  3OYL A;  3P7J A;  3R2T A;  2YHT A;  2BE7 D;  4JI1 L;  4NXN Q;  1PNJ A;  4R0K A;  2MPM A;  2HCK A;  1ZX6 A;  1VYV A;  3A55 A;  1HNX Q;  2FZK B;  4GLK A;  4QL5 A;  2JE6 I;  1K73 C;  2GQI A;  1TQO A;  1ZXT A;  2ZPI B;  1D3B B;  5IYB G;  2RDH A;  2SDF A;  1WTH A;  1V29 B;  1OPK A;  2Z0S A;  3EGD B;  2Q2T A;  3M9B A;  4CKE A;  5FU7 B;  2XID A;  3VS5 A;  4E2F B;  1LAC A;  2C0T A;  4E7Z A;  4JI4 L;  1AWO A;  2OI3 A;  2L55 A;  4M75 E;  3VR5 A;  1B4O A;  1FVI A;  3MAQ A;  1G6Z A;  4JZ3 A;  4OIK A;  5LJ3 h;  1YJN Q;  1ENC A;  2D9U A;  5KYY A;  4AQY Q;  4FYY B;  1AOJ A;  3CQT A;  1WJJ A;  2DET A;  4HCZ A;  3JC6 6;  3OTO Q;  2DL8 A;  2ZPG B;  1U3O A;  3H6M A;  4X3T A;  4B3R L;  1N36 Q;  3IAY A;  1OUL A;  4XTY A;  5LJ5 h;  3E5S A;  3U58 A;  1KHC A;  2XI9 A;  2F4V L;  5D7U A;  3E1S A;  1SHF A;  1C9O A;  4KJN A;  4F87 A;  4Z88 A;  3CW2 C;  3JCM d;  4N9T A;  3JCM J;  2J6O A;  2COY A;  7AT1 B;  5GQO A;  1JOK A;  2B3G A;  3LX0 A;  4MMK A;  3A7A B;  1WTV A;  4PJO E;  3PMF A;  2PVD B;  3QB3 A;  1QP3 A;  4XT1 B;  2BZX A;  3W2D A;  1JJ2 P;  2JN0 A;  2XDP A;  4J9D A;  3I5S A;  2BIV A;  2V8K A;  3INZ A;  2GVA A;  3ITP A;  1I0C A;  4DV2 L;  4JYA L;  2D6F A;  3QWX X;  3R8B A;  2P4R A;  1K0S A;  1AN8 A;  4A3G G;  2NLU A;  1YEZ A;  2EYM A;  2VB6 A;  5EKI A;  5HK3 A;  4LF4 L;  4EGV A;  1TII D;  1O7I A;  2IIM A;  2E2J H;  1MI2 A;  1DM0 B;  3VS7 A;  1TWG B;  1SNC A;  2K7V A;  4OO1 G;  2Z6K A;  1PC0 A;  1TWA B;  3RR5 A;  2K3B A;  1GD7 A;  1WD0 A;  1QMC A;  4BXX H;  4C8Q D;  5JPM C;  1DCZ A;  5HCK A;  1D1A A;  2E76 C;  3KDF B;  1EQV A;  1U4L A;  1HRJ A;  4JI2 L;  1CZW A;  4O5V A;  1SE3 A;  2CUD A;  2VB3 X;  4DV6 L;  1HA5 A;  1SLJ A;  1IBM L;  1VYT A;  4DA4 A;  1EY0 A;  2A69 C;  3JCM h;  3RUZ A;  1M90 C;  2NVY H;  1Q86 R;  2BE5 D;  4I7A A;  4PZ6 A;  2Q2U A;  4ESR A;  1RLP C;  2DYI A;  3CCU Q;  2MGS A;  5AFW A;  2V4D A;  1HHV A;  2KXD A;  5J26 A;  3P1H A;  1ICW A;  3U50 C;  1UGS B;  3VV0 A;  3HOU G;  5IP7 G;  2DAQ A;  2EYX A;  3OW2 S;  4BA2 I;  1MUZ A;  1BDO A;  4GZY C;  1EZZ B;  2QTV A;  5IGF A;  4KY7 A;  3PIO A;  1QNU A;  2B8G A;  2JMC A;  3CCJ A;  2M1H A;  3RES A;  4OHJ A;  2DZ9 A;  2M51 A;  3L2W A;  1PZK D;  2QCP X;  2QQS A;  5KYL A;  3EGU A;  1LTI D;  1D09 B;  1MJC A;  5I6Y A;  5CKD A;  4OO1 H;  3T1Y Q;  2YRC A;  4EPC A;  4WF2 A;  1BNZ A;  3PT9 A;  3UDC A;  3MHX A;  2K4K A;  3H0I A;  4NKL A;  2KHS A;  1MMN A;  1E1O A;  1Q12 A;  5C4J B;  2ECZ A;  3EFS A;  5CK9 A;  4PKC C;  4OMP A;  3HZX A;  5EKL A;  2A37 A;  4A3E H;  4M75 B;  4A3D B;  3E0J A;  2E2I H;  2A6H C;  3D4D A;  5IIF A;  4OML A;  2N88 A;  4P71 A;  1ZYR D;  4ZLT F;  2YYZ A;  3GTQ B;  3BY7 A;  3SWN B;  1EY6 A;  2BDO A;  1XYI A;  1G3S A;  4NS5 A;  3CCR T;  3RMS A;  4KJO A;  2P5Z X;  3SFM A;  3C4S A;  3I70 A;  5FO9 B;  4OL7 A;  4KD3 A;  4BY7 B;  2XKO C;  5GAN 8;  3NEM A;  4IPG A;  1IW7 D;  1ASY A;  3ERQ A;  3PE0 A;  1G2B A;  1BCP C;  3L0O A;  1K9M R;  4HSV A;  1ET6 A;  1EIY B;  4UPA A;  3SWN A;  2VS1 A;  2XWJ B;  3JAM i;  4A3C H;  3CCJ T;  2XIC A;  4X1V A;  3CBO A;  1WFW A;  3JB9 J;  2DMO A;  3J7A V;  1YI2 T;  2F0O A;  2CKK A;  2JZ2 A;  2LS0 1;  5IHK A;  3JCM W;  3HOU B;  3CEY A;  1ONL A;  2F0M A;  1GM5 A;  1F9P A;  4KD4 A;  1PD0 A;  1M27 C;  2MQH A;  2LX9 A;  4EMK B;  2P0P A;  4CGY B;  2ZJP A;  1XOV A;  1HQM C;  2CP5 A;  2Y0S E;  3VR3 A;  1XMQ Q;  3QO2 A;  4OX9 Q;  2NUT A;  1XNR Q;  4HCC A;  2PI2 A;  1VA7 A;  2MI6 A;  1CK1 A;  1CKO A;  1KAA A;  1Z6H A;  4DAV A;  2V8I A;  4J9F A;  4PZ7 A;  2DVE A;  2HSE B;  5CGK A;  4X62 L;  1NMG A;  4HSP A;  3UA7 A;  3N52 A;  4EIK A;  2F0G A;  4YWM A;  4C1N K;  5CMD A;  2P0K A;  3GO5 A;  1YCS B;  4ULL A;  4MN3 A;  2JA5 B;  1RAG B;  2LJ3 A;  1SEM A;  3BFM A;  4OGQ C;  3GTJ H;  4A93 G;  2K57 A;  5IP9 H;  3J80 c;  2EYL A;  4QW2 A;  1PH8 A;  2WAQ G;  1D8L A;  2HCI A;  4EQP A;  3QSU A;  1L1O C;  1PTO B;  3D0F A;  3S15 H;  1CKN B;  3TP8 A;  1P92 A;  2OTJ A;  4DUY Q;  2R92 G;  3LGL A;  1SYC A;  4ALP A;  1SN8 A;  5CBA E;  1CZG A;  1YJW A;  1VQK T;  1I07 A;  1QB5 D;  3X24 B;  5LJ3 f;  3GTQ H;  1HZB A;  1NLO C;  1QVG A;  3HKZ B;  1D0X A;  1G3W A;  5FU7 C;  2OX7 A;  1HUM A;  5CV4 A;  4L5S A;  2VGM A;  3CRK C;  3DWP A;  3JB9 F;  3K0Y A;  5M5Y B;  1HTP A;  1O78 A;  1MV3 A;  1OEB A;  3PO3 H;  3LW5 E;  1U5S A;  3K0X A;  1WZO A;  1LAB A;  4G7Z C;  1DON A;  4ZQ3 A;  2FG0 A;  3X25 B;  1F2M A;  2QA4 Q;  4EVO A;  1PTO H;  1X3Q A;  4S3S A;  4C8Q B;  3FKI H;  4GKK L;  1RUW A;  2DD4 A;  1M1K R;  1GUS A;  1HPC A;  1NUC A;  4AYB B;  5K5P A;  4RUG A;  4KBM B;  4DAY B;  3GTL B;  3KFV A;  1WJS A;  4J9B A;  1Y0M A;  4OMF B;  3U9O A;  4A93 H;  1NYF A;  3I56 Q;  1VQ4 T;  4XU2 A;  1D2B A;  2L15 A;  2JJQ A;  5F2D A;  1K8O A;  3P8D A;  1I50 B;  4B08 A;  4LDV A;  5HGQ A;  4M77 G;  1A3T A;  4LD9 K;  5IHI A;  2E41 A;  4DF7 A;  4F7X A;  3WVD B;  3S1M H;  4JI0 L;  4KV6 A;  3DEO A;  2MP1 A;  4JVZ A;  4N9P A;  4XYQ A;  4BY6 C;  4Z8A A;  3AHU A;  4DK0 A;  3J7A F;  2E2D C;  1AP0 A;  1KQ1 A;  1ZA1 B;  2BH8 A;  2NVY B;  3I2Z A;  4DAP A;  4B3M L;  1I4P A;  1WD1 A;  1JOQ A;  3CXC S;  1KC8 R;  1UE9 A;  4A93 B;  1KQS S;  5JJI A;  4FM4 B;  3RD4 A;  1YWO A;  4R56 A;  1Y8N B;  2RHI A;  2JA9 A;  2ABL A;  5M3F G;  3PNW C;  2MHV A;  1VQ7 Q;  1A3U A;  3BU2 A;  3G7L A;  4YCV A;  4R4I A;  1TY0 A;  4HIM A;  2ZM6 Q;  2EQJ A;  1ABQ A;  2HQE A;  4LF6 L;  1NJI C;  4B3S Q;  3CC7 Q;  3PV0 A;  1NPP A;  1G5V A;  1Y8P B;  4Z9C B;  3K5N A;  3K80 C;  3S15 B;  1K76 A;  2KY9 A;  3QYH B;  4JOI A;  4GKK Q;  4J8Q A;  4K5W A;  4RKL A;  5LMN W;  1S5D D;  4C3I H;  1UE6 A;  3ZEH A;  3FRN A;  1W70 A;  4MZM A;  4JW0 A;  1NBE B;  1X54 A;  2EQS A;  2SOB A;  4R9W A;  3TBI B;  4M78 C;  1Y7X A;  2QG9 B;  4M7D D;  4DV2 Q;  3DM1 A;  4NXM L;  2F0W A;  3BZK A;  2EQI A;  4GKJ Q;  1KLG D;  3ZYY X;  4M75 F;  1RCV D;  5C4H A;  5CC4 A;  1EOV A;  1IYU A;  4KMU C;  4B3T Q;  3RIR A;  4OX9 L;  4IPH A;  1KRS A;  2ICE C;  5IE8 A;  1BI0 A;  2RNA A;  2DFU A;  4NPS A;  1N8R U;  3HP3 A;  5GAN 5;  2OXP A;  4FXK C;  3LX7 A;  1K3B C;  1FWZ A;  4YCW A;  1B1Z A;  2G5D A;  1VQ7 T;  2LY7 A;  5IOC A;  4DR2 Q;  2F0K A;  2V1R A;  2R7Z H;  5C4X G;  4WFN 3;  5M9O A;  2C9O A;  3CCE A;  1OO9 B;  4J9G A;  2B2W A;  3M57 A;  2RHU A;  3G48 A;  1J8I A;  1FX7 A;  1RAD B;  2UUC L;  1EOT A;  3MET A;  2QKI C;  3QIA A;  4QF4 A;  4KH1 B;  3EFO A;  4CKB A;  2JUF A;  1VQJ A;  1TR5 A;  1UTI A;  2R92 H;  3PUY A;  5C0X I;  1NLP C;  1PH4 A;  1DD2 A;  1SDF A;  4A4I A;  3HFO A;  1EZ8 A;  4JJB A;  4KUD K;  3HOX B;  2A8V A;  2BKD N;  3HKS A;  4IIO A;  1CSK A;  1TWF B;  2E6Z A;  2CS7 A;  2YV5 A;  5IGD A;  3ZJY C;  1SRL A;  3SHL A;  4M78 F;  1VQO Q;  3HOU H;  5D6W A;  1N9S A;  4FYD A;  2DEU A;  2ZAE A;  1ZSZ A;  2KED A;  2JEB I;  2AHJ B;  2CSQ A;  1MMG A;  2YUP A;  3OQ5 A;  1H9M A;  3HOV G;  1J6Q A;  5C3E G;  3RZO H;  3RMH A;  3VJP A;  1YJ9 T;  3D6W A;  1YWP A;  2MF2 A;  5HY6 A;  5LJ3 e;  3CMA Q;  2K5D A;  3KBX A;  3KOJ A;  5JAV A;  3VUB A;  5A2Q L;  1ZSZ B;  1VQA A;  2IT1 A;  3ONA B;  3HOV H;  4XQ3 A;  1W6K A;  4LF7 L;  1HR0 W;  3CME A;  3EG1 A;  2BCO A;  2QF7 A;  4R4C A;  1PRT C;  4DBH A;  4GBQ A;  1CI3 M;  2V26 A;  2AT1 B;  2YSQ A;  4IPC A;  5EKK A;  3OYY A;  4M77 B;  5KE2 A;  2AQ3 B;  1B7T A;  1A8V A;  4R1J A;  1Y1W H;  2GNC A;  3I4N B;  1MKH A;  2L5T A;  2MO1 A;  2ZM6 L;  4A54 A;  4GOP C;  1EL0 A;  3MEH A;  2UXC L;  4FYX B;  4C8Q F;  2K28 A;  4PJO F;  4FL6 A;  1LNX A;  2EJF C;  1HNZ L;  2RK1 A;  4BD3 A;  3EFO B;  2QYZ A;  4RTU A;  3DWQ A;  3ASK A;  4P73 A;  3S1R B;  1Q1E A;  5CR2 A;  3CC4 T;  2A7Y A;  4QVC A;  3H0G G;  3C3L A;  3MKD A;  5J3B A;  2WII B;  4II1 A;  5ELN A;  1JJ2 S;  3BVM A;  3VDY A;  2V8J A;  4M75 C;  2DLP A;  1DGS A;  1JE5 A;  4XDX A;  1K8G A;  3GOX A;  4K0K Q;  1QQJ A;  4AG2 C;  3GTG B;  2EQM A;  2A36 A;  2D0N A;  1Q82 U;  2F2W A;  4QQ6 A;  4NXM Q;  1STA A;  2R7D A;  2F0F A;  3SK8 A;  1Q3L A;  2UUA L;  2R5A A;  4XTU A;  3CCM A;  4IZ8 A;  4KN4 C;  3W5O A;  2K5L A;  2VXE A;  1SYB A;  1OTC A;  1XTC D;  2OWO A;  1C4Q A;  3OMG A;  4RG8 A;  2LTO A;  2PZW A;  5JOB A;  5KE3 A;  3NPP A;  1YIT Q;  3NTH A;  3SK4 A;  1PRT F;  4BBR G;  1U0L A;  3PUV A;  2OAW A;  2GA4 B;  1B9N A;  2ZGW A;  2CKZ B;  4AG1 C;  1PYW D;  2E10 A;  4LAA A;  4CI0 C;  1EYG A;  3MEV A;  1Q95 G;  4PJO C;  2L89 A;  1R9T B;  4J9I A;  2ZTD A;  4KY5 A;  3V8J A;  5ELO A;  1Q7Y R;  3HOX H;  1MHN A;  2QEX T;  4ORZ A;  2K5N A;  1EU3 A;  4AFU C;  2DVJ A;  1JBM A;  3E0E A;  1Y96 A;  2F0D A;  4MZP A;  1BUV T;  3DB4 A;  3TME A;  2RQR A;  1S72 T;  2DBM A;  6AT1 B;  3G6E T;  1JR0 D;  3S2D B;  1Q86 U;  1YNN D;  4J6W A;  4G57 A;  3KF8 B;  2DD5 A;  3MEA A;  1LV9 A;  5CV9 A;  5M5X B;  2DNC A;  4IUN A;  3S17 H;  2FPE A;  1TXY A;  2JP1 A;  4I65 A;  5DLQ E;  3HKZ E;  4MDW A;  2DNU A;  1VQN Q;  4JI8 L;  1AD5 A;  2RHZ A;  2IVW A;  5CR3 A;  5D14 A;  3W1G A;  3M55 A;  1V1P B;  4JJN K;  3L9A X;  1WJR A;  4OB2 B;  3HOW B;  2EYZ A;  2C0I A;  1SYG A;  4YTL A;  2X6L A;  2E1H A;  3A0J A;  4K0K L;  1D6E C;  1RL2 A;  3MEW A;  2VUB A;  3A8M B;  1N8R C;  4BY1 G;  2JTM A;  3OS1 A;  4WRD A;  4FXD A;  4X64 Q;  2LMJ A;  1M1F A;  3TU4 K;  4DV3 Q;  1RAA B;  2AQ1 B;  3HOX G;  3HOV B;  2DER A;  2O5J C;  3S2H H;  3CU7 A;  3H15 A;  1OU8 A;  4DU9 A;  3AT1 B;  3A74 A;  2LX7 A;  2X69 A;  3EN2 A;  5IY0 A;  1GUO A;  2F0Q A;  4DR1 Q;  3JCM P;  5KRU A;  2COZ A;  4HCS A;  3PO3 B;  5D65 A;  2R57 A;  2JS0 A;  3VYT A;  3WVE B;  4JBM A;  1N36 L;  4A3D G;  5FLM G;  5FO8 B;  1WGS A;  2QGG A;  5AT1 B;  1D1B A;  3G71 Q;  1BXT A;  3HTR A;  1QWF A;  2Y0S B;  5GAO l;  2BH2 A;  3DM3 A;  1TS2 A;  2F0J A;  3CPF A;  3AQQ A;  2YWW A;  2KNB B;  5D6X A;  4DEY A;  3Q23 A;  2F0L A;  1W2B S;  2B8F A;  3KLS X;  4K6D A;  1VQM A;  2L0C A;  2EY1 A;  1Y07 A;  2K33 A;  4RG2 A;  4GOP A;  4RHS A;  3J80 E;  2B8A A;  3UDI A;  4PJN A;  1MSG A;  3SWN C;  1VQ4 A;  3FKI B;  2ZXR A;  1MIU A;  1IKL A;  1HNZ Q;  3E2U A;  1C48 A;  2J4X A;  4IO9 A;  2K32 A;  1S5E D;  2Q8T A;  4DV5 L;  1YCY A;  2YUN A;  3GBQ A;  5GAM e;  3E3X A;  1IBK L;  4HCE A;  1HNX L;  1TS5 A;  4Q5W A;  2PPB C;  4BBS G;  2CP2 A;  5GMK j;  1QCB D;  5IT9 c;  3H3V H;  4M7D E;  3S1Q B;  5C3W A;  2EJG A;  3L2P A;  4UP7 A;  2DEQ A;  1SE2 A;  3BZD B;  1YNJ D;  3S1N B;  4M78 E;  5KYU A;  4Q5V A;  1VQO A;  1IHW A;  1WNL A;  2K50 A;  2KJX A;  3CCQ T;  2YT6 A;  1TSF A;  1NAP A;  4CDF C;  5I2X A;  2K6A A;  3HOY B;  4OWT B;  3F2D A;  5AJ3 L;  2PNR C;  2NWG A;  1LVK A;  5JVG 3;  3I4N H;  2JM9 A;  3LNN A;  1ML0 D;  3M4P A;  2Z6B A;  4K2K A;  1KHI A;  2PZ1 A;  5I2M A;  1F9R A;  1YHQ T;  2OQ0 A;  2QA4 A;  1D5X C;  1U1T A;  3DB3 A;  4LXC A;  5CV6 A;  3I4M H;  4JRK A;  2BA0 A;  3U4Z A;  3X26 B;  1AT1 B;  3CC2 A;  2NUC A;  5CKB A;  1UUE A;  1DJR D;  2HNI A;  3HOY H;  4ZYS A;  1MND A;  2VKN A;  4UC4 A;  3A8J E;  4A4G A;  4GLX A;  3MC0 B;  2KE9 A;  4ILW A;  1NCV A;  1X01 A;  3TQ7 P;  1BYM A;  1AE3 A;  1AEY A;  2DL5 A;  1NBW A;  5KEE A;  2UUC Q;  3OYG A;  1LT5 D;  2B63 G;  3V8L A;  2EVB A;  1C7Y A;  1F9S A;  1Y69 U;  3KFU A;  2OTJ Q;  4ZRZ A;  1U8R A;  1B07 A;  1KC8 U;  1C0A A;  2VXF A;  1KG1 A;  4N0A C;  2HMA A;  2DY7 A;  1QKX A;  2E2H B;  1GUT A;  4N8F A;  4R8I A;  5GAM f;  2DPP B;  3GTK B;  4A3B H;  4C5H A;  2DRM A;  3NMZ C;  5GJV B;  2BOS A;  2R92 B;  2L0A A;  4B3T L;  1YIT A;  4POF A;  3JAM L;  2E5Q A;  3J81 j;  5LL6 X;  2B2Y C;  2HZY A;  2L2P A;  4F7U B;  5IWA L;  1EWC A;  1M30 A;  2DRK A;  4O2D A;  4A3K G;  3SDZ A;  2WAC A;  1RTN A;  1RI9 A;  2M9V A;  2NYZ D;  1R9T H;  2K5F A;  4R8N A;  2JA8 G;  1BQQ T;  3S1R H;  3TEH B;  5E4X A;  1JEG A;  1VQ8 Q;  1E2V A;  2VZA A;  1CKB A;  1WTQ A;  4PFZ A;  1GUG A;  2D62 A;  2OF1 A;  1MGS A;  4IUV A;  1GUW A;  5KYU B;  4JI5 L;  2IX1 A;  1EFI D;  3VU3 C;  2VW9 A;  2PO4 A;  1Z9Z A;  2C35 B;  5IP7 H;  1HTL D;  3D6C A;  2K6D A;  2YDL A;  3GP8 A;  1A2T A;  2B39 A;  3M4Q A;  5IP9 G;  1XPR A;  3CF5 A;  3A8L B;  1F2L A;  4JI5 Q;  1AW7 A;  3K6O A;  2EY6 A;  1K8A C;  1NJI U;  1CTM A;  1SMY C;  2FMC A;  4DA2 A;  4QVD A;  5IN1 A;  2RJD A;  1HH2 P;  1UWV A;  4IJL A;  1TU0 B;  1N8R R;  5EJW A;  5KYI A;  3RZO B;  1GUN A;  4PJM A;  4JI0 Q;  4BY1 B;  1Y1V H;  4HTH A;  3NBH B;  1TKW B;  5BN4 A;  1EX4 A;  2CHB D;  1Q46 A;  4C3H B;  4M7A G;  4OIJ A;  5GAO p;  2YU9 H;  1E6H A;  3PIP A;  1KQS A;  3ERO A;  2XNA C;  4RCC A;  3D8G A;  1Y57 A;  4QQB X;  1YHA A;  5C44 B;  3VYS A;  1OX9 A;  1ABO A;  2B86 A;  2ZTE A;  4K11 A;  1FMW A;  1E3P A;  1H9R A;  4L6T B;  1L0W A;  3JRZ A;  2VQF Q;  4FW1 A;  1XNI A;  4C0G A;  5GAE C;  2ED1 A;  3VYG A;  2VL6 A;  2N78 A;  2EWN A;  2F5K A;  4HKE A;  1RHP A;  4IN3 A;  1F9Q A;  3URG A;  2HQH A;  3HOZ B;  2LMC B;  4L63 B;  2GCX A;  5E3F A;  5C44 G;  3Q8D A;  3JCM b;  3EIV A;  1MV0 B;  1V1C A;  1H3H A;  2K3X A;  4E47 A;  3E19 A;  5IH2 A;  1P16 A;  2ZTC A;  1IO6 A;  4BI4 A;  1F1B B;  2IJ0 A;  1WVL A;  1TU2 B;  4PLL A;  2RF4 A;  2RM4 A;  1SEB D;  2FL7 A;  1YHQ Q;  4AYB E;  1SFO H;  2HBP A;  4ZTF A;  3IKJ A;  4A3C G;  2IX0 A;  1NTG A;  3JAM c;  5HGT A;  1XX8 A;  3FLG A;  3MP1 A;  1QOH A;  4IPD A;  3E9G A;  4C92 B;  2C0O A;  1PYS B;  1V1P A;  3E9I A;  4HJ7 A;  1GFC A;  2JTF A;  3UWN A;  4YY3 L;  1KK7 A;  3EBE A;  1XPO A;  1ZEQ X;  2J6F A;  1NE8 A;  2Z1C A;  4KRT A;  1WIE A;  2NZ1 D;  2X3W D;  1DOK A;  2VUM B;  4XU0 A;  4AFS C;  1IBM Q;  2CW0 D;  3D4R A;  2F3W A;  4DR7 L;  2B63 H;  1Q81 U;  3PTA A;  2YTV A;  3JCM e;  1PH6 A;  3REB B;  3EGD A;  1K3R A;  1H64 1;  2I5M X;  2GTO A;  2PVO B;  2O4X B;  3X20 B;  1Y96 B;  1MBY A;  1HXD A;  4IKF A;  5IYB H;  2DBK A;  3CXC P;  1XMO L;  2DUD A;  1B50 A;  5ELD A;  2EYF A;  4V0B A;  1GBQ A;  3J80 i;  5A0L A;  2K4Y A;  2HDA A;  5GAN 7;  1XNR L;  1IL8 A;  1I4G A;  2DZC A;  4AFQ C;  3E9F A;  4OB0 B;  1Y1V G;  3EGX B;  2PVG B;  3M0R A;  3CC2 Q;  4PJO B;  2RSN A;  4PNY A;  2A74 C;  4OWW B;  1PFN A;  2A08 A;  2NBF A;  1PMR A;  1VDZ A;  1BF4 A;  4J1M A;  1CSP A;  3R93 A;  4A75 A;  4V2S A;  2FEI A;  3IRB A;  4DV0 Q;  2A1A A;  1X65 A;  1A0N B;  2CW0 C;  2HQL A;  2KEN A;  2PQA B;  2K2M A;  4TVR A;  4UAI A;  5FWC A;  4A3F H;  4A3G B;  2RJC A;  3L3O C;  3PCO B;  1W6J A;  4PMB A;  1J9O A;  1ILP A;  2VWF A;  1VQL T;  2A19 A;  2QGQ A;  2B2Y A;  1VQM T;  2Z4I A;  4FSS A;  5FOB B;  4DR7 Q;  3CBP A;  2OAU A;  2VNU D;  3M7G A;  3PIP 3;  4UP8 A;  5BN5 A;  3OYC A;  3NP8 A;  4K5V A;  4L5G A;  4NL3 A;  1AFP A;  2EY5 A;  4HJ5 A;  4BA1 I;  1O7Z A;  4C8Q G;  2BE9 B;  3ZBD A;  2RPN A;  1YNN C;  1PSF A;  2RK2 A;  1QJO A;  3NPF A;  4L8J A;  4QB4 A;  1BBW A;  2CZ1 B;  1V43 A;  4A3K H;  1WTO A;  2KYM A;  2JA6 H;  4DN4 M;  3UE1 A;  2QDB A;  4OMQ A;  1J3T A;  3J81 E;  4M7D A;  1WQW A;  1SHG A;  2JEA I;  4D6W A;  2NZH A;  2CP3 A;  4DK6 C;  3HOZ H;  3CCS A;  5L8R E;  3L2U A;  2UXD L;  1SRO A;  2KHI A;  3OBY A;  3M53 A;  4E7I A;  4B9X A;  2EOT A;  2JSO A;  3AU7 A;  2F69 A;  3WOE A;  1IZ6 A;  3JB9 I;  4Y92 A;  4DEX A;  4NL2 A;  3NXW A;  2RA4 A;  2LJ0 A;  4LW1 A;  3QOL A;  5FLX c;  1I5L A;  5KGU A;  1IHV A;  2D5D A;  2WV6 D;  1FJG L;  3B6Y A;  3M3Y B;  5GAN j;  4UY8 C;  4HVV A;  4WCI A;  4DOW A;  3FRP B;  1PRL C;  3DEP A;  1YIT T;  1X3G A;  1S5C D;  3HRU A;  1TS4 A;  3GV3 A;  3HL8 A;  2IHE A;  5DNF A;  3A8O B;  2QEX Q;  1FNW A;  1M8A A;  2E5L Q;  3O8V A;  2DGY A;  3I90 A;  5GAH C;  1HQR D;  3M4O H;  3K8A A;  1FL0 A;  3THK A;  1N34 Q;  2PU9 B;  4OMM A;  1VQB A;  5COR A;  3TQY A;  3Q6S A;  1J5E L;  2CSI A;  2K5V A;  5FRO A;  3BW1 A;  1IGQ A;  2E5L L;  1XPU A;  3BVG A;  2A5H A;  1KDA A;  2DNE A;  3RN2 A;  3URY A;  2JJ9 A;  2AIR B;  5CVI A;  2K14 A;  2KCT A;  3CPW P;  2LVM A;  1Q8K A;  2XK0 A;  3CC4 Q;  4RGO S;  3L42 A;  3QYG B;  4RTV A;  2EXZ A;  4OGC A;  3D7S B;  1K4U S;  4Y28 E;  2GTJ A;  3Q22 A;  4F7U E;  5C3X A;  5CV5 A;  3PF5 A;  1PH5 A;  4FF4 A;  4XT3 B;  4HIO A;  2FFK B;  1ZUK A;  1Q8I A;  2NYS A;  4E7K A;  5J1Z A;  2K5Q A;  2EE1 A;  4DV0 L;  5FKA C;  1JCK B;  4GLM A;  4JUV A;  1EY8 A;  5KND A;  2L8D A;  1WHJ A;  2HSP A;  3SVM A;  4A3M G;  4DAY A;  1X6B A;  1ZUU A;  5CQY A;  1WCM B;  3KJO A;  3GTK H;  4LMQ D;  4A3B B;  2KXC A;  3VYR A;  2O4X A;  1JQQ A;  2COW A;  2WSF E;  1B44 D;  1VQF A;  1M8V A;  3I73 A;  3OIP A;  2L5Q A;  3X3M A;  2KMT A;  1EY9 A;  5KYN A;  5KNB A;  2RHX A;  3H9N A;  1EEF D;  2RKS A;  3JB9 H;  4J5Y A;  4PL6 A;  2P4T A;  2PMZ E;  4KHP Q;  1NNX A;  2ZJQ A;  1MJE A;  3S1N H;  2UXC Q;  3QHS A;  3BYT B;  3C95 A;  2DX1 A;  4A3M H;  2GBQ A;  2CH4 A;  1EIH A;  3MO8 A;  2EBP A;  1RAH B;  4M75 G;  4BE0 A;  1G51 A;  3P75 A;  1HUN A;  4NXN L;  4JI1 Q;  4CKC A;  3ICE A;  2DXC A;  2QQ9 A;  3CCQ Q;  1JOO A;  1OOT A;  2PMZ B;  2DJQ A;  3KXT A;  5DY9 A;  3CMA T;  4M7D G;  2DE0 X;  3UE0 A;  5JVH 3;  2CYZ B;  4HID A;  1E22 A;  5C4Z A;  1WTP A;  2LCC A;  2M00 A;  2NTT A;  2GF7 A;  3H41 A;  5GAN e;  4DV4 Q;  2FJ2 A;  3A98 A;  3J7Z C;  2F03 A;  1QW1 A;  1N33 L;  5GMK m;  1DOM A;  4RGM A;  3I91 A;  2RQV A;  3HKZ G;  2D0Q B;  1AZG B;  3VRY A;  5KYW A;  4JLI A;  3KYH C;  2H4O A;  3MCA B;  3T56 B;  4C3J B;  1O75 A;  4JDS A;  2DO3 A;  1RLQ C;  4BY1 H;  3RR6 A;  2L3Q A;  1SFO B;  4PJO G;  4LF8 L;  2HKQ B;  3H09 A;  4C1N I;  4LUD A;  1UG1 A;  5AJ3 Q;  1X2K A;  1PKT A;  1RAI B;  2F0V A;  5G3L F;  1PH7 A;  4IUQ A;  1A3V A;  4XK8 E;  5ECA A;  1ZBX A;  1VMC A;  2NUT B;  1QZH A;  4C2M H;  4M7D C;  3K7A B;  5C0X J;  2QW7 A;  3S6W A;  2OTL A;  1JO8 A;  2HBW A;  3QII A;  2D8H A;  1EQR A;  2ZPE B;  1WI5 A;  4LWC A;  4RTW A;  5FK9 C;  1F77 A;  2G3R A;  4A3I H;  2RQT A;  1NEG A;  5CBE E;  1PH3 A;  5K36 G;  1G2S A;  1HZ9 A;  1DYQ A;  5HUR A;  1SYF A;  3EG2 A;  2UXB L;  5JEA J;  2FPD A;  2IX3 A;  1L1O A;  3TS2 A;  4X6A H;  4QCL A;  4N0A A;  1BI2 A;  1N6A A;  2M9U A;  1X55 A;  2FYK A;  3LGF A;  3RLO A;  2NVT B;  3HFN A;  1EZ6 A;  2A68 D;  2DN8 A;  4C0D C;  2VUM G;  5C5M A;  4JOI C;  1KIX A;  3TRZ A;  2FIN B;  4H13 C;  2ESW A;  1VQ7 A;  2LSS A;  4OEM B;  5JEA G;  2Q2I A;  1WHL A;  3UPU A;  3V7R A;  5GAN f;  2F0H A;  3H0G B;  1H95 A;  4DV7 Q;  3H91 A;  3PUX A;  4DK3 C;  3G4S A;  3JB9 G;  5KCO A;  4QIW B;  3FDT A;  1WHM A;  1U06 A;  1X27 A;  4WOR A;  4M75 A;  5E1F A;  5GMK h;  1LOJ A;  5DM6 3;  1HR0 L;  2KA7 A;  4C3I B;  1M3C A;  2K3Y A;  3MFG A;  5DM7 3;  2QEX A;  2B63 B;  2XD0 A;  1WCM H;  1SG5 A;  4B3S L;  3RKX A;  5KNC A;  3Q1J A;  2CDT A;  2H5X A;  1ACM B;  3F70 A;  1UE5 A;  2XDD A;  2QIL A;  3GTJ B;  2YXY A;  4EQN A;  2F2X A;  5M5Y H;  3RN5 A;  1B34 B;  4X64 L;  2WB1 B;  3SHW A;  2J6K A;  1WCM G;  3P8H A;  2PZT A;  3MXN A;  1AHJ B;  3REA B;  1BBX C;  4F17 A;  4B3M Q;  1B2T A;  4E6R A;  1OXS C;  2EJG C;  3N6R A;  3M5A A;  4WJW A;  1PSE A;  2K5H A;  1UE7 A;  1WX6 A;  3FPU B;  4KT0 E;  3H8Z A;  2PI2 E;  1VQN T;  5JJL A;  1OYX A;  4GOP B;  3A1P A;  1NR2 A;  4C0F A;  4PMC A;  1I6H H;  1VQP A;  4R4T A;  2J7I A;  3CCM T;  1H9K A;  2LCL A;  3PF4 A;  1VQ4 Q;  2ENM A;  4FYV B;  2GQV A;  4M8A A;  1VQK Q;  2DKG A;  3ULL A;  3V7S A;  4EQO A;  2NN6 G;  1ZSZ C;  1QKW A;  3U4V A;  5C4J H;  2EJM A;  3MJX A;  1S72 Q;  1EYC A;  1PHT A;  1RI0 A;  5GAO m;  1K0X A;  1VQL A;  2JNG A;  2IL8 A;  1TWG H;  2NTS A;  3GF5 A;  3TP7 A;  2DXT A;  2F0I A;  2F1L A;  2G9H D;  1SKU B;  1X56 A;  2ZJR A;  5K36 H;  4LUV A;  4ZN3 A;  3OSS C;  1LUZ A;  2JT4 A;  2O9V A;  5GAG C;  2JS2 A;  4RTZ A;  1TVX A;  1SJH D;  1VCI A;  2HUG A;  4ID6 A;  3L2Q A;  3GTO B;  1E6G A;  1WPY A;  4J7F A;  1H8K A;  5EG2 A;  4KLK A;  4CC2 A;  3JCM Q;  1C1A A;  2QEJ C;  1LM0 A;  1WXU A;  3K7A H;  4OXP A;  4ZAI A;  1PV4 A;  2X4J A;  5AYF A;  4YCU A;  2LZ6 B;  2EKH A;  2H3J A;  1GKH A;  2AHO B;  2RHY A;  1BU1 A;  4DOV A;  2XGT A;  4KN7 C;  4ABN A;  1VYU A;  4BBR B;  2MNA A;  1OPL A;  1U4P A;  3C94 A;  3MVV A;  4AH6 A;  2E5K A;  3VA5 A;  1QCO A;  1WHG A;  1QVP A;  2SNM A;  2MWO A;  3OOC A;  3GTP H;  3OTO L;  3TS0 A;  1YJW T;  3SEM A;  4H44 C;  4GNX B;  4YHH Q;  4A3E G;  1PZJ D;  2LKV A;  4DV7 L;  3NEL A;  4DUZ L;  1YN8 A;  1KQS P;  4RTY A;  3P20 A;  1QVG P;  1A62 A;  3CXC A;  4MZT A;  2XN9 C;  4TSS A;  3OYN A;  4CRI A;  1XJW B;  1ROD A;  4R4Q A;  5M3F B;  3MHB A;  4CJ0 B;  1B7Y B;  1Z47 A;  3QXE B;  4A63 B;  1PFS A;  1GRI A;  4A3J B;  4F04 B;  4A3F G;  2JA7 H;  1M4Z A;  4DV4 L;  2H1E A;  4KKT A;  3VS2 A;  2Y4Y A;  2MCN A;  4F7U A;  4L59 A;  4J6H A;  1YBY A;  3T4A C;  3UA6 A;  3L1A A;  4IUT A;  1PDQ A;  1JB0 E;  2AZS A;  2I0N A;  1UGV A;  2MFI A;  1PKS A;  3GTL H;  3EHR A;  2RA2 A;  5EPJ A;  4DXG A;  3S14 B;  1YVC A;  3IFD A;  5IGG A;  2BDN A;  2EGA A;  4X66 L;  2YLC A;  1YJ9 Q;  3OYF A;  4LF7 Q;  4BE2 A;  1X9N A;  4HA8 A;  3ZFJ A;  1W2B A;  1E2Z A;  3JCM X;  5I6W A;  3R6N A;  1PWT A;  1LTS D;  2I0Q A;  1M3A A;  4C3J H;  5C3E B;  2RDF A;  5LJ5 g;  1OXV A;  1ZBJ A;  1FYN A;  3QUI A;  4FCY A;  1KSW A;  1PH1 A;  2AZV A;  4WJ4 A;  2KR3 A;  4PLI A;  4EDU A;  2LP5 A;  1MNE A;  1HYO A;  5DLO A;  1CKM A;  4C5I A;  1GO3 E;  3BJU A;  1X69 A;  1EY5 A;  3EFX D;  1OXU A;  4TQU S;  5EBC A;  3LLR A;  3R6O A;  4P72 A;  5I9P A;  1AZQ A;  1VF7 A;  2NVX B;  1MGQ A;  1CT1 D;  2XRS D;  1SND A;  1VQP Q;  5I4D A;  3C0C A;  2GGR A;  3CCS T;  8AT1 B;  4A3I B;  3CCR A;  3Q0A A;  2VQE L;  2E2I B;  2XWB B;  3NHH A;  5C3E H;  1I4R A;  4DKA C;  2K9G A;  3F2C A;  1SJE D;  4ATO A;  2Z0W A;  1X3F A;  4IFD G;  4CDE C;  3UAT A;  5DM7 R;  3HOZ G;  3V05 A;  1IB8 A;  4J6X A;  1G3Y A;  2A68 C;  4BBR H;  4JI6 Q;  5CO7 A;  5EQ0 A;  1UUP A;  4FP5 D;  1PRT B;  1JXO A;  5CKF A;  1R4P B;  4KUL A;  1RF2 D;  2HL3 A;  2MAM A;  2A28 A;  4QUF A;  2L12 A;  4KHP L;  1V9P A;  2MOX A;  1N32 L;  3FPP A;  3RZD B;  1KAW A;  4M78 D;  4XTW A;  4JRQ A;  1Q7Y C;  2PZU A;  4A4H A;  1Q1B A;  3VS4 A;  1KC8 C;  1BIB A;  4JYA Q;  3H3V I;  3V7C A;  1HXY D;  2OQK A;  3FDR A;  3OBW A;  1I94 Q;  2AWN A;  4N8X 1;  1L1O B;  4E6I A;  3QDF A;  2R7Z G;  4IUP A;  2LNH B;  2QQB A;  2GN5 A;  1UJY A;  3CBM A;  4E7J A;  2KEC A;  2PCF B;  3CC7 T;  2F4I A;  4XU1 A;  2PNI A;  2PYK A;  4DFA A;  1WTX A;  1IBL L;  2VGN A;  2CGH A;  2DIG A;  1STN A;  3M0Q A;  5I11 A;  1LLR D;  4M78 G;  3M0U A;  2ZT9 C;  3AB9 A;  1RAF B;  1VQH A;  1TWH H;  4BY7 G;  5FW9 A;  4NDX A;  5D6Y A;  4ZGJ B;  5GAN d;  5NUC A;  3I56 T;  1EFN A;  1YNX A;  2B2V C;  3X3N A;  5I2Y A;  4JG2 A;  3A7L A;  4CC7 A;  1GHK A;  3CPW S;  3SXH A;  3PFS A;  2YTX A;  1UDL A;  3PVQ A;  1L2F A;  3GV6 A;  2FB7 A;  4BDZ A;  3HFZ B;  4LNP A;  3BDC A;  3K7U C;  4WJ3 M;  2K75 A;  1K73 U;  2QI2 A;  1MMA A;  2E8G A;  4DNI A;  2RSO A;  2CP6 A;  3QWN A;  4E7S A;  4DBQ A;  5FU6 C;  1RAB B;  3PGG A;  4C0D B;  5IWA Q;  5T1G A;  1LTB D;  4M78 B;  2AWO A;  3E6Z X;  3MXG A;  4YWL A;  1R0C B;  2UXB Q;  2L11 A;  1VIF A;  2OT2 A;  3BE3 A;  3P8B B;  4PNO A;  3BVZ A;  2WB1 E;  4U68 A;  1JIC A;  3OYM A;  1Y1W B;  1A63 A;  3QJY A;  3EGX A;  1M1K U;  4FF2 A;  2DL3 A;  5LHY 1;  3RNU A;  4K8J A;  3OYK A;  1FMK A;  4C0Z A;  1UEB A;  3D3R A;  1JB3 A;  4BBS H;  4LFB L;  3GNG A;  1VQE A;  2RCN A;  1LO5 D;  4RAU C;  1G29 1;  3RZD H;  1XNQ Q;  1JXM A;  2DF6 A;  1ENF A;  4HVU A;  1OQK A;  1WHK A;  4PJL A;  1NM7 A;  4PFO A;  5GMK l;  1YJW Q;  2TSS A;  4X65 L;  2UXD Q;  1WLP B;  2KRS A;  1CKA A;  3H0F A;  3ME9 A;  4DBR A;  1BVS A;  1KLU D;  5C4X B;  3KLR A;  4KK7 A;  3BDU A;  5GAN 4;  1OV3 A;  3CC7 A;  2X3X D;  5GRO A;  4DV1 Q;  1TS9 A;  1YI2 A;  4YWK A;  4KHZ A;  2PQA A;  1JB7 A;  1VUB A;  1LTT D;  2BZ8 A;  3OW7 A;  4K6L A;  2XU8 A;  2DTO A;  4QQG A;  2D0O A;  2MYS A;  1QCF A;  1XQH A;  1KTK A;  4OON A;  3DXJ C;  3F8T A;  2HT1 A;  2MUY A;  4IAL A;  2DJG C;  1N9W A;  2WAQ B;  3KLW A;  2HEQ A;  4OEL B;  1ZKO A;  4PMW A;  4LJZ C;  1U9R A;  2JQO A;  3SD4 A;  3UDG A;  2CP0 A;  4FU6 A;  4F7U G;  1RAC B;  4LFC L;  1YI2 Q;  3NUC A;  5J22 A;  1K8A U;  4P74 A;  3T51 B;  4A3D H;  4LDY A;  3CCV Q;  1ARK A;  4F14 A;  1IGU A;  2BTT A;  1YIJ Q;  2OEO A;  4L5Q A;  2XMF A;  4JLG A;  1JJG A;  1W1F A;  4M77 E;  2MMP A;  2P84 A;  2Q8R E;  5EGT A;  4ELY C;  4XQN A;  5IGE A;  4DR2 L;  4C56 C;  1IW7 C;  1STG A;  1D1I A;  4PZ8 A;  3GTG H;  1BB9 A;  1QG7 A;  5ELC A;  1WYD A;  2C5C A;  4QJF A;  1KD1 U;  3V2T A;  1BOS A;  1YNZ A;  3GDE A;  4DR5 L;  1N9R A;  3TSZ A;  1Q7Y U;  2RI2 A;  3CCM Q;  1R4Q B;  1ZYR C;  4KKS A;  3MA2 B;  4GN3 B;  2ZPH B;  2GFU A;  3CCJ Q;  1NY4 A;  4FIB A;  1WTR A;  2IW3 A;  3WWV A;  2ID0 A;  3QO3 A;  3H0H A;  1BCP D;  1M2O A;  2R93 B;  1NYG A;  4J6Y A;  2K05 A;  4A3J H;  4LF5 Q;  5C5L A;  1WHH A;  1PM3 A;  4ELZ C;  1A0I A;  5G3L D;  1ICF B;  4YHH L;  2J0T D;  2HIV A;  4A3M B;  2NVT H;  1VQG A;  2QK0 A;  3T13 A;  3PMT A;  4XAX B;  5HKC A;  3GIB A;  1RD9 D;  2VYT A;  1VQ5 Q;  2VAS A;  2EZV A;  1VOM A;  3S9W A;  5KCH A;  3CQZ H;  3HPW A;  1VQM Q;  1O7Y A;  3CCL Q;  1VQL Q;  4M7D B;  1RDP D;  4HR7 B;  5C0X H;  3HOW G;  2DY8 A;  2OTL Q;  2K7A A;  4JBK A;  3ULR B;  3RKW A;  4GN5 A;  2NUZ A;  4UDU C;  4DPG A;  4GKJ L;  1TWC H;  2NVQ B;  3TP6 A;  4PV1 C;  4ZGD B;  2KCN A;  1JOR A;  4KHV A;  5LMN Q;  2AMC B;  1N5Z A;  4FXG C;  1TWF H;  3LWE A;  2LCS A;  2G6F X;  3CC2 T;  4JI2 Q;  1MMD A;  2O2O A;  3JV3 A;  3J80 L;  3ZL7 C;  2CH4 W;  4PFP A;  2DIQ A;  1O80 A;  4DAM A;  3GTM H;  1QVF S;  4KUI A;  3OS0 A;  2FXQ A;  3BG3 A;  2R3Z A;  3AFQ A;  3KF6 A;  2F0T A;  2E64 A;  3NBH A;  4HT8 A;  1TG0 A;  2RJF A;  4L5R C;  4C92 G;  4IOA A;  1EY4 A;  4OF1 A;  3TP5 A;  3V8K A;  4RCN A;  4RA8 A;  3OYA A;  3RLF A;  4IFD H;  4KY6 A;  1P8L A;  4DGZ A;  2X6G A;  2R6G A;  2RH2 A;  5EPK A;  1LJO A;  2P0Q A;  4PJO A;  3QZ5 B;  1IRE B;  4JPB W;  2CFM A;  2BE5 C;  4M77 D;  5GAN h;  1KRT A;  2RMO A;  1KFZ A;  2O88 A;  2F3V A;  3GTM B;  3VS0 A;  5FLX E;  1UEA B;  5IYD G;  2KSS A;  4XQQ A;  1A15 A;  1X43 A;  3FJ5 A;  2DK3 A;  5LJ3 j;  5M5X H;  1I81 A;  2KGT A;  2RVL A;  2LT4 A;  4F88 A;  1AWJ A;  2CWA A;  5CQX A;  1QCN A;  2HD0 A;  3CC4 A;  2RN8 A;  1GOZ A;  1SR3 A;  2XG8 D;  2N8N A;  2C06 A;  2QDY B;  4NMZ A;  1O9S A;  4DUY L;  2XRQ D;  3G1J A;  2SEB D;  3QKJ A;  4JRP A;  1KQ2 A;  1EYA A;  1M2V A;  2X4Y A;  4JI6 L;  5LMU L;  4GS3 A;  2VV5 A;  3I3C A;  2FZC B;  1JJ2 A;  4B3R Q;  3OYB A;  2JK8 A;  2OCE A;  2DXU A;  2LRQ A;  2VQE Q;  2BZY A;  2YUQ A;  4AFZ C;  3ND8 A;  4ZGE B;  4QY7 A;  2CT3 A;  4CJ2 C;  5I9O A;  2UUA Q;  2PUO B;  1GCP A;  2F0E A;  2HHH Q;  3M59 A;  2B2V A;  3QWY A;  3FMC A;  3PQI A;  3BDL A;  4QQD A;  3MP6 A;  1PZI D;  3PUZ A;  3SK6 A;  4JC0 A;  4HAE A;  3TSW A;  1VQN A;  2V1C C;  3VR4 A;  2F52 A;  4PJJ A;  1LYL A;  3H6Z A;  1VF5 C;  3M4G A;  3LH5 A;  2WKC A;  3GNF B;  5EC7 A;  1SSF A;  1WQ7 A;  4PG3 A;  2AK5 A;  3NGP A;  2E3I A;  3VR2 A;  4A3G H;  2E6N A;  2VXW A;  4O1N A;  1Q81 R;  4HT9 A;  1CM9 A;  2EDG A;  2HD3 A;  4OWX B;  2ZXP A;  2W10 A;  2D8J A;  2E2J B;  3A5Z B;  1STB A;  4RCO A;  3PO2 G;  1I6H B;  4OB1 B;  5ELF A;  5LJ3 g;  1CA6 A;  4ZN1 A;  1SMY D;  3JCM c;  2M02 A;  1Y71 A;  4EMG A;  1FNV A;  1LT3 D;  1SBB B;  4DR4 Q;  2K79 A;  4C8Q A;  5GAO r;  3S17 B;  1E0B A;  1UHC A;  4JI4 Q;  3S16 B;  5IGB A;  1WXB A;  4ME5 A;  4RH6 A;  2SEM A;  2F0S A;  5D3I B;  3DLL A;  1SXT A;  2EYP A;  2FHD A;  1XMQ L;  4C92 F;  3IL8 A;  5BN3 A;  2PTK A;  1TUC A;  1WDX A;  4XU3 A;  3FB9 A;  4LD6 A;  3OYD A;  1S72 A;  1YZ6 A;  1L0Y B;  1VQ8 T;  1H9S A;  1QVC A;  1NZ9 A;  4JJD A;  1TWH B;  2WFW A;  4H0L C;  4C5G A;  3PO2 B;  5JJK A;  4LK1 C;  1KD1 R;  3FJP A;  2JW4 A;  4OMN A;  4C5E A;  2N49 A;  3KLS A;  3VA7 A;  1AE2 A;  3HG9 A;  5A35 A;  1C0M A;  1SNP A;  3EG0 A;  3MPU B;  3SB2 A;  2B2U A;  1BIA A;  3GLX A;  2KBN A;  3OWF A;  4GLA C;  2BA1 A;  1SMX A;  2I5H A;  5FO7 B;  2SRC A;  1G8Z D;  1WOC A;  1Y1W G;  3CQZ B;  4HJ8 A;  1K9M U;  3DLM A;  1ZUY A;  3CCL A;  1FXX A;  2LXK A;  1VQP T;  4IOC A;  3C12 A;  2ENB A;  1VQ5 A;  2MK5 A;  1VQD A;  1OZ2 A;  1K8A R;  2OTL T;  1IL2 A;  2EVR A;  4DR6 L;  4A4E A;  2HQX A;  2I07 B;  2LFN A;  5IOD A;  4HCB A;  1EWH A;  1HNW L;  3RKY A;  1PVO A;  2FZG B;  3NTK A;  5IYD H;  2R93 H;  2F2V A;  9ATC B;  1QWE A;  1VQ5 T;  4MIU A;  3RER A;  5J39 A;  3A56 A;  2M0Y A;  4XQJ A;  1SF9 A;  4MML A;  4CJ1 B;  2DIL A;  3FP9 A;  3ULP A;  4M7A F;  1D5M C;  3LYI A;  2KI7 A;  4OGE A;  1W2B P;  4JBW A;  3J7Y W;  2HHH L;  8ATC B;  4L5T A;  1BBU A;  4DUZ Q;  4O0A A;  4KKU A;  1YP5 A;  1I4Q A;  2KEA A;  1UAP A;  1G3T A;  4BWG B;  5I21 A;  1AEX A;  3G4S T;  3T1H Q;  3KBG A;  1T0J A;  2WB1 G;  4HN7 A;  3PO2 H;  1LTL A;  2XTI A;  1H9J A;  1X3E A;  5IYC G;  3NQT A;  1PH9 A;  1E24 A;  1GBR A;  3ER0 A;  4A3B G;  1SSO A;  4BAC A;  3I55 Q;  3HS0 C;  2WKD A;  1IBL Q;  1D0Y A;  1X2Q A;  2ZPB B;  3NEN A;  2YUO A;  1CSQ A;  4C3I G;  2M16 A;  1HZC A;  2ZXO A;  3TZD A;  1M8M A;  3SE0 A;  3CME T;  1AVZ C;  1OU9 A;  1IHZ A;  5FU6 B;  2KRM A;  4OO1 I;  2DTH A;  1D0Z A;  2EYW A;  5IXF A;  3KF8 A;  3BS1 A;  4JS5 A;  3MTS A;  2R93 G;  1XWE A;  5CKH A;  1QIL A;  4OP0 A;  2NUP B;  1YJ9 A;  1BO0 A;  1CFM A;  4P2C B;  4F7U F;  5LJ3 d;  5JPN C;  2KAF A;  4M7A C;  4A3L H;  3TN2 A;  3FVQ A;  4CBV A;  1TWC B;  2NVQ H;  2JVV A;  4MTK A;  1D1C A;  1AZE A;  1CHQ D;  3S3N A;  3L2R A;  2F4V Q;  4A3I G;  3UDF A;  1HD3 A;  1NSN S;  2DM1 A;  4HJA A;  4TRD A;  1C8C A;  1RAE B;  1LTR D;  1QVF P;  1OXX K;  3STB C;  4DXF A;  4FF3 A;  1B53 A;  4IUR A;  2ZCF B;  4FVM A;  4AQY L;  4HMI A;  3NHN A;  3ERS X;  3MWY W;  2RQU A;  5L23 A;  4ME7 A;  1GL5 A;  2IY5 B;  4XTV A;  4ZNX A;  2RBM A;  2TMP A;  2YU9 B;  2BUD A;  1AH9 A;  2F0N A;  4C92 E;  1R0B G;  1ESF A;  5CYU A;  2ES2 A;  2CQA A;  1EWI A;  3CCE Q;  2SNS A;  2J06 A;  1VQ6 A;  1V1Q A;  3EA6 A;  3KF6 B;  3W3A A;  2X51 A;  4M77 A;  1HFG A;  1VS0 A;  5IHN A;  4JI3 L;  3RUX A;  1QE6 A;  3C1F A;  1T3L A;  4B9W A;  4HIK A; 
#chains in the Genus database with same CATH homology
 4QT7 A;  2LX7 A;  2LZ6 B;  2EKH A;  4J9E A;  1BU1 A;  1S1N A;  1VYU A;  1OPL A;  2DYB A;  2E5K A;  2JS0 A;  1KJW A;  3SEM A;  1QWF A;  2D1X A;  1YN8 A;  2KNB B;  4DEY A;  4RTY A;  2JTE A;  2KYB A;  2KBT A;  2JXB A;  1TUD A;  4RTT A;  1KIK A;  3EHQ A;  4A63 B;  4JJC A;  1GRI A;  1I1J A;  3PVL A;  3VS2 A;  2MCN A;  4D8K A;  5I22 A;  2NWM A;  2YUN A;  3GBQ A;  3UA6 A;  2I0N A;  2AZS A;  1UGV A;  1PKS A;  3EHR A;  1UJ0 A;  2EGA A;  1PNJ A;  4R0K A;  2HCK A;  1ZX6 A;  1VYV A;  3VS1 A;  3R6N A;  1PWT A;  1M3A A;  1WI7 A;  2YT6 A;  2JM8 A;  2GQI A;  3M0T A;  1ZBJ A;  1OPK A;  1FYN A;  1KSW A;  2AZV A;  2KR3 A;  2LP5 A;  2JM9 A;  1X69 A;  2RF0 A;  1K9A A;  2PZ1 A;  3VS5 A;  2C0T A;  4J9C A;  1AWO A;  2OI3 A;  3C0C A;  2GGR A;  1UUE A;  4JZ3 A;  2VKN A;  2K9G A;  1AOJ A;  2KE9 A;  2FPF A;  3CQT A;  3UAT A;  1SRM A;  2DL8 A;  1U3O A;  2DL5 A;  1AEY A;  2JMA A;  1JXO A;  1QLY A;  1B07 A;  1SHF A;  2A28 A;  1QKX A;  4Z88 A;  2QDL A;  2J6O A;  2DRM A;  2MOX A;  3NMZ C;  5GJV B;  3VS6 A;  2L0A A;  2FRW A;  5GJW B;  2KT1 A;  2BZX A;  2L2P A;  3VS4 A;  1M30 A;  4J9D A;  3I5S A;  2DRK A;  1I0C A;  1RI9 A;  3QWX X;  2P4R A;  3TVT A;  1K0S A;  1JEG A;  1BK2 A;  1CKB A;  2LNH B;  4CC3 A;  1UJY A;  2PNI A;  2IIM A;  1K1Z A;  3VS7 A;  3M0Q A;  1Z9Z A;  5I11 A;  3M0U A;  2K6D A;  2YDL A;  3I5R A;  2K3B A;  5FW9 A;  1EFN A;  5HCK A;  1UFF A;  2ROL A;  4CC7 A;  2CUD A;  1UDL A;  3PVQ A;  1VYT A;  4LNP A;  4ESR A;  1NG2 A;  1RLP C;  2V1Q A;  2KXD A;  2EYX A;  1E6H A;  1MUZ A;  3UF4 A;  1Y57 A;  1ABO A;  2B86 A;  2JMC A;  4K11 A;  2CUB A;  2M51 A;  4D8D A;  2ED1 A;  3EGU A;  2DL3 A;  1FMK A;  1GCQ C;  2L3P A;  2KT8 A;  1SPK A;  1MV0 B;  1V1C A;  1H3H A;  1BBZ A;  5IH2 A;  3H0I A;  1JXM A;  2DF6 A;  1IO6 A;  4CC4 B;  4HVU A;  1NM7 A;  2ECZ A;  1WLP B;  2KRS A;  1CKA A;  3H0F A;  4OMP A;  2J05 A;  2O31 A;  2CRE A;  2A37 A;  1OV3 A;  2X3X D;  2W0Z A;  4OML A;  2BZ8 A;  4LE9 A;  1X6G A;  2C0O A;  1QCF A;  1GFC A;  2LQN A;  1G83 A;  2J6F A;  4KRT A;  1WIE A;  2EGC A;  2X3W D;  2HEQ A;  4AFS C;  2DL4 A;  3PE0 A;  1G2B A;  4LN2 A;  1ARK A;  3REB B;  4F14 A;  4X1V A;  2BTT A;  1WFW A;  2GTO A;  2DMO A;  2XMF A;  5FWB A;  1W1F A;  5IHK A;  2DBK A;  1SSH A;  1M27 C;  1BB9 A;  1GBQ A;  1XOV A;  1YNZ A;  2HDA A;  3TSZ A;  4J9H A;  1VA7 A;  4AFQ C;  4J9F A;  3M0R A;  2A08 A;  1E7O A;  2AKL A;  3UA7 A;  4EIK A;  1ZLM A;  3H0H A;  2FEI A;  1YCS B;  1NYG A;  1A0N B;  2LJ3 A;  2K2M A;  1SEM A;  2MIO A;  5FWC A;  1T3L A;  2VWF A;  4FSS A;  2EW3 A;  1NEB A;  3VS3 A;  1I07 A;  2K7A A;  2RPN A;  3NPF A;  1NLO C;  3ULR B;  2NUZ A;  2KYM A;  2AKK A;  4OMQ A;  1J3T A;  1N5Z A;  1SHG A;  1MV3 A;  1OEB A;  2LCS A;  1U5S A;  2G6F X;  2O2O A;  3JV3 A;  2FG0 A;  3ZL7 C;  2CH4 W;  2EYY A;  3IQL A;  4Y92 A;  4DEX A;  1RUW A;  2LJ0 A;  4RUG A;  3KFV A;  4J9B A;  1TG0 A;  1Y0M A;  1NYF A;  4HVV A;  4WCI A;  1PRL C;  4JPB W;  5IHI A;  3RBB B;  3VRZ A;  2RMO A;  1KFZ A;  2O88 A;  3VS0 A;  3THK A;  4OMM A;  4RTX A;  4Z8A A;  2CSI A;  2KRN A;  1X43 A;  3FJ5 A;  1HSQ A;  4OMO A;  1WA7 A;  2KGT A;  1UE9 A;  1AWJ A;  1YWO A;  2RN8 A;  2ABL A;  2O9S A;  4RTV A;  1ABQ A;  1LCK A;  4IIM A;  3M0P A;  1K4U S;  1M3B A;  2EGE A;  2GTJ A;  1K76 A;  1HJD A;  1ZUK A;  2BZY A;  5IXB A;  2YUQ A;  4AFZ C;  1W70 A;  4GLM A;  2CT4 A;  2CT3 A;  1WXT A;  2H8H A;  1GCP A;  2HSP A;  3QWY A;  1X6B A;  1ZUU A;  2EQI A;  2KXC A;  1GCQ A;  1JQQ A;  3TSW A;  1UEC A;  2ED0 A;  3LH5 A;  1JU5 C;  2RQW A;  5EC7 A;  2RNA A;  2AK5 A;  3NGP A;  4M4Z A;  2DX1 A;  2GBQ A;  2CH4 A;  2V1R A;  2EBP A;  4J9G A;  1B3Q A;  2W10 A;  2D8J A;  1AWW A;  1OOT A;  2DJQ A;  4JZ4 A;  2DE0 X;  1UHF A;  1UTI A;  1NLP C;  3H41 A;  4JJB A;  2K79 A;  3A98 A;  4IIO A;  1CSK A;  1UHC A;  2KRO A;  1WXB A;  1SRL A;  2RQV A;  2SEM A;  1AZG B;  3VRY A;  1PRM C;  1RLQ C;  2L3Q A;  1TUC A;  1WDX A;  1AWX A;  2CSQ A;  2PTK A;  4HXJ A;  2YUP A;  1WYX A;  2L3S A;  4HVW A;  4LUD A;  1UG1 A;  4JJD A;  1X2K A;  1PKT A;  1YWP A;  4OMN A;  2JW4 A;  5ECA A;  3EG0 A;  1T0H A;  1JO8 A;  2HBW A;  3EG1 A;  2SRC A;  2D8H A;  4GBQ A;  2YSQ A;  1ZUY A;  4RTW A;  2GNC A;  2FO0 A;  1NEG A;  2RQT A;  2DL7 A;  2LQW A;  2EVR A;  3EG2 A;  2FPD A;  4RTU A;  3RNJ A;  2F2V A;  1QWE A;  2ESW A;  2M0Y A;  2DLP A;  2DIL A;  2DA9 A;  4AG2 C;  4Z89 A;  2A36 A;  2D0N A;  2F2W A;  3EG3 A;  1YP5 A;  1U06 A;  1X27 A;  2KEA A;  1T0J A;  1T3S A;  2VVK A;  1M3C A;  1ZSG A;  2LJ1 A;  2OAW A;  1GBR A;  2CDT A;  3U23 A;  4AG1 C;  1X2Q A;  2F2X A;  1GFD A;  2YUO A;  3M0S A;  3SHW A;  2J6K A;  4J9I A;  1M8M A;  3REA B;  1W6X A;  3I35 A;  4F17 A;  1AVZ C;  2OJ2 A;  2KRM A;  4E6R A;  2EYW A;  5IXF A;  4ORZ A;  1WX6 A;  4AFU C;  2DVJ A;  4F16 A;  3I9Q A;  4LUE A;  2RQR A;  2DBM A;  2J7I A;  4HCK A;  2ENM A;  1AZE A;  2FRY A;  2EPD A;  2FPE A;  1QKW A;  1H92 A;  1HD3 A;  2DM1 A;  1PHT A;  2DNU A;  1K0X A;  1AD5 A;  2ROT A;  3NHN A;  2RQU A;  5L23 A;  1GL5 A;  2EYZ A;  4ZNX A;  2C0I A;  1Z9Q A;  2JT4 A;  2O9V A;  2JS2 A;  3O5Z A;  4RTZ A;  2J06 A;  1E6G A;  2LMJ A;  1H8K A;  5IHN A;  4CC2 A;  1WXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...