2CH4W

Complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
139
structure length
139
Chain Sequence
KEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Reconstruction of the Chemotaxis Receptor-Kinase Assembly
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/chemotaxis
total genus 19
structure length 139
sequence length 139
chains with identical sequence Y
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ch4W01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2ch4W02
1B07A 1ZLMA 1NLOC 1WIEA 3LH5A 1U5SA 1WDXA 2O9VA 4J9BA 4CC2A 1X27A 2BZXA 3NPFA 3SHWA 2RMOA 2P4RA 1KFZA 5HCKA 1NYGA 1X2KA 2GTJA 4JZ4A 2W10A 2DF6A 2HSPA 2YDLA 1OV3A 2FG0A 2OJ2A 2DBMA 2AK5A 3VS5A 2GNCA 1HD3A 2L3SA 2JMAA 1FYNA 4D8DA 1SHGA 2HEQA 1UDLA 1NYFA 1YP5A 4J9GA 2V1QA 1NLPC 3C0CA 4M4ZA 5FW9A 1SSHA 4IIOA 3EG1A 2K79A 2HDAA 1PRMC 2GBQA 2JM9A 1W70A 2KBTA 4Z8AA 3NHNA 2JS0A 1EFNA 2VWFA 2EYWA 1I0CA 2LMJA 1TUDA 2AZSA 2ROLA 3UA6A 1NM7A 2KT1A 2C0TA 3PVQA 2MCNA 4RTZA 1J3TA 2PZ1A 2EYYA 2J06A 5IHIA 1RUWA 1CSKA 1UE9A 3VRYA 1AWJA 3ULRB 2DX1A 3M0RA 2L3PA 1WXTA 2QDLA 4JJBA 1T3LA 1WX6A 1I1JA 1Z9QA 4A63B 3ZL7C 3PVLA 1E7OA 5FWCA 1YN8A 2A37A 3VS0A 1WXBA 1RLPC 2BZYA 1UJ0A 2JT4A 4KRTA 2ENMA 4AFUC 2LZ6B 1AEYA 1SHFA 2DRMA 2KEAA 2CSQA 3EGUA 2L3QA 3EHRA 2KT8A 1U06A 2K9GA 4HCKA 2ED1A 3SEMA 2O88A 5I22A 2F2XA 2KXCA 1T0JA 3FJ5A 1PKSA 2NWMA 1X69A 1QKXA 3M0PA 3H0FA 2F2WA 3IQLA 4HVWA 1RLQC 1GCQC 2HCKA 2IIMA 4CC4B 4RTVA 1M30A 3O5ZA 2KXDA 1IO6A 2MOXA 1ZUKA 1FMKA 2NUZA 1T3SA 1GFCA 2B86A 2EPDA 1PNJA 2XMFA 4AG1C 2LP5A 2LQNA 1ABOA 1Y0MA 1KJWA 2KRSA 1OEBA 1NEBA 2CH4W 3EHQA 3QWYA 2JMCA 1ARKA 1ZSGA 5IXBA 2JM8A 1UJYA 3RBBB 1KIKA 1M3CA 2EGCA 5FWBA 4AFZC 1H3HA 1SEMA 5GJWB 2O2OA 4Z89A 2DNUA 4RTUA 2GTOA 3CQTA 1PKTA 1W1FA 2BZ8A 1X6GA 5GJVB 2CT3A 4LUDA 2ED0A 2OAWA 3H0HA 4R0KA 1GBRA 3RNJA 4EIKA 1ABQA 2DVJA 1CKBA 4F16A 2DA9A 4JPBW 1BU1A 1M27C 1VA7A 2W0ZA 5EC7A 1N5ZA 2EYXA 1SPKA 1VYVA 2DMOA 4LNPA 4J9EA 3UA7A 2EKHA 4DEXA 4JJCA 2KE9A 2KYBA 3VS1A 2EW3A 3VS4A 1V1CA 2YUNA 1UHFA 1GCPA 3NMZC 4GBQA 4OMQA 1K0XA 4CC3A 2A08A 4J9HA 1WXUA 1K9AA 2CSIA 4J9CA 4J9FA 1AWWA 1K4US 2C0OA 1BK2A 3NGPA 4JJDA 1UG1A 2RQUA 2LQWA 2DLPA 2FO0A 1UECA 1ZUYA 4HVVA 2M51A 1QCFA 3I5SA 2YUOA 2VKNA 3M0TA 1LCKA 1UFFA 2RQWA 2KROA 1AVZC 4Y92A 2PNIA 1WA7A 2EYZA 2J6OA 2LNHB 4LN2A 2CT4A 1PWTA 2KYMA 3VS2A 3GBQA 1CKAA 4RTYA 2X3WD 3PE0A 4AFQC 2D0NA 4LUEA 1UHCA 2JS2A 3TVTA 2J7IA 2YT6A 1AD5A 1M3BA 2J05A 4K11A 1JXMA 1GRIA 4F14A 2F2VA 1UUEA 2M0YA 3REBB 1Z9ZA 2YUQA 1W6XA 2D1XA 2K3BA 1VYUA 3H41A 2RQRA 1MV3A 2JXBA 2ROTA 1H8KA 2LJ0A 3REAB 3I5RA 5IXFA 1AWXA 1YCSB 1PRLC 1T0HA 2EQIA 1VYTA 1QKWA 1X6BA 3M0QA 2LCSA 1WI7A 2L2PA 2A28A 2G6FX 4AG2C 1MV0B 2EVRA 4ORZA 1GCQA 2ABLA 2RF0A 2EGAA 2FPEA 4JZ3A 1UGVA 1JU5C 3KFVA 2K6DA 3VS7A 2DILA 3A98A 4RTTA 2FRYA 4J9IA 1JEGA 1JQQA 1MUZA 4HVUA 1OPKA 2GGRA 1M8MA 1YWPA 2KGTA 1M3AA 2DL3A 1AZEA 4F17A 2AKLA 3THKA 2D8HA 3H0IA 3TSZA 1A0NB 1E6HA 1ZX6A 5ECAA 2RN8A 2DBKA 3EG0A 2LJ3A 1KSWA 2SRCA 4GLMA 5L23A 1G83A 4AFSC 2VVKA 2J6FA 4RTXA 2CUDA 3I35A 2RPNA 2ECZA 2YUPA 2D8JA 1QWFA 4OMPA 1X2QA 2FPDA 2KR3A 2HBWA 2L0AA 1K0SA 1YWOA 2J6KA 1JO8A 2JW4A 4D8KA 1UTIA 2RQTA 2EBPA 1H92A 1HJDA 1ZUUA 1B3QA 3M0SA 4X1VA 1SRLA 5IH2A 2E5KA 2O9SA 2GQIA 3I9QA 3VS3A 1GL5A 1GBQA 2I0NA 3UATA 2DE0X 4HXJA 2PTKA 1TG0A 2LJ1A 2CUBA 3UF4A 1RI9A 3U23A 2OI3A 2SEMA 3JV3A 2X3XD 2CH4A 4CC7A 1WLPB 2DL8A 2CDTA 3R6NA 4WCIA 2BTTA 2MIOA 2YSQA 1QLYA 1BB9A 4OMNA 2DL4A 2CREA 4FSSA 1AWOA 5IHNA 1HSQA 2KRNA 2K2MA 4OMLA 2K7AA 2AKKA 4ESRA 1I07A 3TSWA 1S1NA 1SRMA 1AZGB 2FEIA 4IIMA 1E6GA 5I11A 1AOJA 2O31A 2DM1A 1BBZA 2KRMA 2FRWA 3VRZA 2DL5A 2H8HA 4Z88A 1YNZA 2JTEA 3EG2A 2FPFA 2AZVA 1NG2A 2LX7A 4RUGA 2RQVA 4OMOA 4E6RA 1Y57A 2V1RA 3VS6A 3QWXX 4J9DA 5IHKA 4OMMA 1WFWA 1K1ZA 1U3OA 2KNBB 1X43A 3M0UA 2C0IA 4ZNXA 4DEYA 2A36A 1G2BA 1TUCA 2DRKA 1NEGA 1ZBJA 1QWEA 2DL7A 1K76A 2ESWA 2RNAA 1JXOA 3EG3A 2EGEA 1PHTA 2DYBA 2DJQA 1GFDA 4RTWA 1OOTA 1WYXA 1OPLA 1XOVA 4LE9A 4QT7A
chains in the Genus database with same CATH superfamily
1NLOC 5CKFA 4UP8A 2Z0WA 4RKBA 2RI3A 1O7IA 4J9BA 4A4GA 3CCRQ 2C9OA 1CHQD 4M77D 4FW2A 1R9TB 2RMOA 2P4RA 1KFZA 2KCTA 5FO7B 4DGZA 4FF4A 1S5ED 1X2KA 2GTJA 2V8KA 4JZ4A 3AFPA 4A3JH 2DYIA 2HSPA 1K9MC 3CQZH 3PV0A 1VQNT 1WTWA 3VS5A 1EY6A 4C92A 2GNCA 1HD3A 1CZWA 2FJ2A 1X9NA 3S15B 4J7IA 1PRTF 3BYYB 3FIFA 4MMKA 2J7ZA 4ZQ3A 3J81E 1M1GA 4M7DF 1BF4A 1UDLA 1EY7A 5I2SA 5LJ5e 5AJ3L 4K0KL 1UUPA 3H09A 2IX1A 1EWCA 5GANg 4KY7A 1XPOA 4JI7L 1SSHA 3EG1A 3NBIA 4HJAA 2K79A 2HDAA 2EYLA 4F7UG 2GBQA 2JM9A 2L8DA 4E7ZA 5I21A 2KY9A 3LH0A 1YJWQ 1CT1D 1YITT 2VWFA 2PVOB 4C8QE 2LMJA 1F2MA 1SNDA 4CKCA 2HL5C 3V05A 2XRSD 5IGGA 1KL9A 3VR4A 4OWTB 3PVQA 3MEVA 1TWGH 5J1ZA 4X65L 3T56B 4BY7G 1JJ2S 2MCNA 4RTZA 3CCJQ 2PZ1A 1J3TA 2EYYA 2Z1CA 3VR6A 2J06A 4HIMA 2Q2UA 1QCNA 2K75A 3X3MA 4DV5L 1U4PA 5IGBA 1XMQL 2IPKD 1G291 1LT4D 3JB9F 4DAPA 4A93H 1HYOA 1STEA 2QG9B 1CSKA 2F0UA 2MJ8A 4JI4Q 5M3FB 2KHSA 2B2UA 3CCLT 5KYUA 2R3ZA 1KAAA 4DBFA 1G2TA 1GXIE 1PFSA 3M4QA 4J6HA 3S2DB 5CQYA 2E74C 1HNXQ 1Q81R 3BVGA 1BCPF 1HK9A 1OTCA 3QZ5B 3GF5A 3KF6A 3I90A 2QTXA 3AT1B 3TQ7P 4HCCA 1X32A 1Z7TA 1JB3A 3EAEA 4M78A 4KD3A 1ML0D 4A4IA 1VMCA 2K4KA 4BB7A 4JI5Q 3V7RA 1ZSZC 1D3BA 1I1JA 1GUGA 2R57A 1IW7D 3ZL7C 5FWCA 5C44H 4WJWA 2LT1A 2RJCA 2O5IC 2NLUA 4KGVB 1VOMA 2YRDA 4WORA 2JT4A 2AT1B 2LZ6B 4IUUA 3G6EA 1X65A 1AEYA 2CVRA 2VW9A 1RAAB 2DRMA 2PUOB 3DHQA 3M57A 1F9QA 3GTKB 2AQ2B 1Y1WG 2G9HD 4IN3A 3RMHA 3LGLA 2L3QA 1C7YA 2KT8A 1WFQA 2E3HA 2OQ0A 1R0CB 2O88A 4OO1G 2E2HB 4XAXB 4X66Q 3HOVH 3HRSA 3FJ5A 1W2BP 1PV4A 4EMKC 5IN1A 3L2UA 5JJZA 4YHHQ 1VQBA 3FPPA 2NUTA 4YWLA 2XVSA 3OWEB 1U1TA 5EBDA 1PH9A 1JB7A 2K52A 2CP3A 3M3YH 3Q6SA 2FHDA 2ZPHB 2RHYA 3AHUA 1BO0A 4UDUC 4F7UB 2XICA 4RTVA 2ENBA 3PUWA 5AYFA 1M30A 4R4TA 4HCBA 3BU2A 1OX8A 3JCMh 2LSSA 3LGJA 1FMKA 1MSHA 2EJMA 2DY7A 4I65A 2NUZA 1PFMA 1T3SA 1QVGS 1GFCA 5FJ8H 3L3OC 1CI3M 4BY7B 2COZA 4JK1C 1NTGA 1K28A 4F04B 5C0XH 5JVH3 2HQXA 3CC7T 1R9TH 2V4DA 2QTVA 2PU9B 2L89A 1O80A 5CBAE 2KRSA 1T5EA 3SEBA 3MWYW 4AQYL 5K36H 1Z47A 1WJQA 2JEBI 1PZKD 3IL8A 2VGMA 4DPGA 4HT9A 2MQHA 1LTLA 1ARKA 5IYCG 3GNFB 1YI2T 2ICEC 3AEVA 4XU1A 5IXBA 1PTOC 2E12A 4KGXB 5M5WB 2FMCA 1V1QA 3S15H 3TU4K 4CDFC 2JM8A 1QCOA 5CKEA 1EZ6A 1SYCA 3OW2A 2LFNA 1M3CA 3MFYA 4K5WA 3OTOQ 1EYGA 4JI6L 4IUTA 3RERA 2A69D 3SWNA 2CP2A 1QVFS 1WOCA 4GN5A 4ZAIA 1ZSZB 3HSBA 2DNUA 2E10A 1CTMA 4LAAA 3KDFB 1IGQA 3QDRB 5GAMe 1YNNC 1DOKA 4L5SA 1X6OA 5IGFA 1PVOA 1ET6A 4KKSA 1SJED 4GKKL 4Q5VA 2TSSA 5GAOq 5IP7G 5M3MB 2X4WA 4LUDA 3K80C 3G6EQ 1TIID 1LTID 5E7NA 4A76A 1YVCA 3RKXA 1JT8A 1GBRA 1PSEA 4EIKA 1Y1WB 4IUNA 4LWCA 5FRNA 3QHSA 2IPOB 2CZ7B 3MEUA 2DVJA 5FU6C 3CCST 1SE4A 2XSCA 1CKBA 3D6WA 4F16A 3MXUA 1EU4A 2DA9A 1K83B 1EZZB 1BU1A 3OOCA 3E9GA 1ICWA 3I4LA 1L1OC 4EMKB 1PD0A 1EOTA 5LJ3e 2PI2E 2BE5D 1N5ZA 1RAFB 3V7CA 2DVEA 3QSUA 1BUVT 5M3FH 1D1BA 2DMOA 3MKDA 4LNPA 1PRTD 2KQ3A 3JAME 3UA7A 1TH7A 2DXUA 3CCRT 3PTAA 4M7DD 1PZJD 3S2DH 4JJCA 2K5LA 2JA6B 3VS1A 3OHXC 4EPCA 3CCVA 4GOPA 4KGZB 1D1CA 3JB9I 2IX3A 5JPNC 3TCJA 4GBQA 4PJOE 1K0XA 2DIQA 2LTOA 2A08A 4RHSA 4C8QD 3CCQT 2AHOB 1K9AA 1Q8KA 1AWWA 4H0LC 4F8MA 3DWAA 2C0OA 1D5XC 3G48A 2O4XB 4JVZA 2FZGB 4JJDA 4DR6L 1C9OA 2RBMA 2PVDB 4FXKC 1FJGQ 2HSEB 2SNMA 3KJPA 2M51A 1QCFA 1WTXA 3I5SA 4M78C 2F0VA 3K7UC 1IBLQ 3GTKH 1AH9A 2WB1B 5I9OA 4PJJA 2OTJT 2QDYB 3TMEA 3FEWX 1GHJA 2JJ9A 1PTOB 3CD6A 2NBFA 2RF4A 1M2VA 5FLXL 3ULPA 2RQWA 4PJLA 2E2HH 1HHVA 2DTOA 4JCVE 3K58A 2EYZA 2QEXA 5J3BA 4BDZA 3GTOB 1RAIB 1R4PB 4ABNA 4DA2A 1XMOQ 1EX4A 1PWTA 4RH6A 2R7FA 1CKAA 2F1MA 1QCBD 2KCMA 4A3GG 1S5CD 4X64L 1M1FA 3VU3C 2A1AA 2MAMA 1QWYA 2EE1A 2PQAA 3U4ZA 2JA5G 1XPUA 4OEMB 1IBML 2FYKA 3TVTA 3ULJA 2J7IA 3GTJB 2YT6A 3DLMA 4DV1Q 1VQIA 3H3VC 1IGUA 3CW2C 3RKWA 4F14A 1DCZA 2E64A 1UUEA 1YIJA 1PDQA 2D1XA 4BY7H 3MHBA 5FU6B 4JYAL 1SMYD 3FPUB 4MZPA 1B3AA 5IE8A 3V7SA 1O7LA 1LT5D 2E41A 2VYTA 2GCXA 1L1OB 2F0GA 2RQRA 3EJIA 1A63A 3UPUA 2JXBA 4DR5Q 1TXYA 4MTNA 4DBRA 1MD2D 3FDRA 3REAB 2K3XA 3BDLA 1QKWA 2YV5A 5D7UA 2VXEA 1C1AA 3A8OB 2N55A 2PVGB 2A28A 1MIUA 3M4PA 3P75A 5M5WH 2I2LA 2RF0A 3G7ZA 2XDBA 4RGMA 2JA7B 2WINB 4NP5A 1JU5C 2RHIA 2IL8A 2K6DA 2PMZE 3FRPB 3CCVQ 1EQRA 4LFCQ 2MK5A 3ERSX 1PYSB 1CHPD 1H9RA 3QOLA 2Z4IA 3DWQA 2H3JA 5CBEE 1ASZA 2GN5A 2A8VA 5GAN7 2CGHA 3THKA 5IT9c 4JI1L 2B2YA 2DD5A 2TMPA 4LF6L 1Q95G 1WHJA 1VS0A 4O42A 3MA2B 3KF6B 2QASA 5M3MH 3S14B 2OXPA 3J80c 4DUYQ 4M78B 3SWNC 5LJ5f 4BD3A 1K8MA 2RSOA 3GV3A 3JCMc 3TBIB 1H9JA 4YCVA 2LCLA 1OU8A 4Q5WA 1Y1WH 1R77A 4J6XA 4DBQA 2VVKA 2B2VC 1OXXK 2ZTCA 1J8IA 1OXVA 3KF8B 1HZ9A 3HOWG 4RTXA 2CUDA 1K83H 4CHTB 3S1QB 4OO1H 3I35A 2M02A 1GD7A 3CD6Q 3ER0A 3I4NB 1Y96B 1HNZL 5GMKm 4NMZA 1SG5A 2JNGA 2QEXQ 4HR7B 2FPDA 4XIGS 4BI4A 1JR0D 2L0AA 2VXWA 1EFWA 7AT1B 2JW4A 2OT2A 2P0PA 2YXYA 2BDNA 2JA6H 4A3GB 4JI4L 1HJDA 2DK3A 3A7LA 2XDPA 3SK5A 5DAUA 3L9AX 1BIBA 4R4IA 2KOLA 2PO4A 4X1VA 4ZGDB 5IH2A 1VQMT 2XWJB 1X75C 1PTOF 5I9PA 3T13A 2NUTB 2O9SA 1GL5A 2DFUA 3STBC 2ASBA 3OYJA 2RH2A 1BXTA 4A4KA 3I91A 2EQSA 2ID0A 2PTKA 2VC8A 3LX7A 4JUVA 1YIJQ 1TWCB 1MSGA 4DOVA 1GUNA 4GOPC 1RL2A 2CW0C 1D0ZA 2YLCA 2JYOA 4K2KA 2CUBA 2EQMA 1N8RC 1VF7A 1YITA 4BE2A 1RI9A 2OI3A 2UU9Q 3E9HA 3GIBA 1PTOH 3MJXA 2DL8A 3JRZA 1RIPA 5IYCH 2DKGA 4NDXA 2IT1A 1H95A 3OYAA 2NN6I 1WJRA 2JK8A 5C5MA 2WV6D 3GTOH 4PLIA 2BTTA 3KXTA 1BIAA 1SKUB 2RVLA 4JI3Q 2XI9A 2ZPBB 2YSQA 5KE2A 1JRIA 1Y71A 4OMFB 5IAYA 1SNOA 2RQXA 4X66L 1X54A 1E0BA 2DL4A 1WJSA 3ULLA 1ZBXA 2QF7A 4A4EA 2RD1A 3EFSA 1Q86R 2MMPA 2WSEE 3A8MB 4YHHL 1ILPA 1XMQQ 1V29B 1WHGA 2EQUA 3UDCA 5C0MA 1EL0A 3QJ6A 3GTJH 3RZOB 2PW5A 4AYBE 3QO2A 3QDFA 3T1YQ 3GO5A 3SWNB 1IXDA 5IP7H 2RA4A 3WDNA 2CZ1B 4XU3A 1KAWA 4JS4A 3GTMB 1SNPA 1C0MA 3HG9A 5CV5A 1FVIA 1XPRA 4C0ZA 4E7SA 1JBMA 2GVAA 1BBZA 1VQLT 2FRWA 4UC4A 1IXRA 2WFWA 4GN3B 3GTQB 2KVMA 2PUKB 2JZ2A 2QQAA 3BZKA 2DL5A 4X3KA 4A3JG 3HOWB 2H8HA 4Z88A 1B1ZA 1YNZA 1TWBA 2A68C 4ZYSA 1MMNA 4OHJA 1S40A 2GFUA 1S5FD 1IB8A 2LX7A 4H13C 4RUGA 4GZYC 5FROA 3PQIA 4A4FA 4OMOA 1BI2A 3QYGB 2BE7D 1KQSP 1Y57A 3SK6A 4X62L 1NJIC 2NZOA 2F5TX 4KTAA 3JCMb 1RKNA 4M78F 2Z6BA 3JB9J 3FRNA 1P16A 2JA7H 1WTRA 5CV9A 4LF7Q 1KLGD 3KLWA 3NSWA 2FL7A 2QCPX 1VQ8T 1U3OA 3NPPA 2B63B 1WCMG 2FFKB 3EH1A 2D6FA 4E6IA 1VQKT 1HTLD 3RD4A 1QNUA 3G1JA 2C0IA 2KVQG 4ZNXA 4M7AA 1DD2A 5CV8A 3K6OA 2KEEA 3MO8A 2BDOA 4B3TQ 2LMCB 5EKIA 2KCNA 4GOPB 4JLGA 1G2BA 4FNFA 2Q8TA 3M55A 3S14H 3S17B 2RCFA 2DETA 5IWAQ 4M77E 2BH2A 2E65A 1HZBA 2KJXA 1E7ZA 1YHAA 1JMCA 2NVQB 1YCYA 1QVCA 1JORA 1K76A 2CZ6B 3R8BA 2F0EA 2RNAA 2DGYA 4DU9A 1JXOA 2K2VA 2EDGA 4TVAB 3A54A 5GAMf 4BE1A 1H641 2EAYA 1YITQ 4LK1C 1DXMA 3KYHC 3S1QH 4WJ4A 1KC8U 2DEQA 2AUJD 4R8IA 1OOTA 4N9TA 1OPLA 3I4NH 5CV4A 3G4SA 4UPAA 3OWFA 2Q8IB 2DAQA 1WIEA 2PQEA 1U5SA 3A8LB 3NQTA 1WDXA 1KD1C 2O9VA 3CC7A 3E2UA 4CC2A 4HJ7A 1KC8R 2F3WA 2EOTA 3DWPA 2BZXA 2ZJPA 5CC4A 4K5VA 4A3GH 1M2VB 1E1TA 3SHWA 1LLRD 1A8VA 2F0JA 2MFIA 3JB9G 1VQAA 2OQKA 3OYDA 1JWUD 3MEAA 1NAPA 3HOZB 3X28B 2K5HA 2W10A 5LJ3f 2WSFE 1YI2A 4ZKBB 3H3VH 2NTSA 3MP1A 2YDLA 2PI2A 2Y0SE 4HMIA 5EG2A 3H15A 3HKZG 2DBMA 1H3ZA 2L3SA 1OQKA 1EYDA 3A8KE 4L6TB 2JMAA 2MYSA 1XJVA 1FYNA 2M0OA 1TXQA 1RACB 5GAEC 1GM5A 1TWCH 1UWVA 4LDYA 3CCVT 3MZ5A 1D5MC 2E5LQ 2EYFA 2JEAI 1NYFA 1W2BA 1QE6A 1IZ6A 5BN4A 1YP5A 2V1QA 1WHHA 1NLPC 4MDWA 4IIOA 4PFPA 1EWIA 2CFMA 3CF5A 3HOVG 1VQJA 1STBA 2X51A 2KBTA 3NHNA 1YEZA 2PYKA 2JS0A 2OAUA 4KULA 1FJGL 3M4OB 4R4CA 1XYIA 4OONA 2N88A 1TUDA 2AZSA 1IBLL 4ZGJB 2DTHA 2ROLA 3UA6A 1M90C 1FNWA 2NUPA 3CCSA 2BH8A 4XTXA 1S3OA 3GP7A 2HKNA 2EIFA 2I5HA 3I4MH 1MNEA 1WCMB 1UEAB 5ELCA 4A3CH 1TTHB 3OSVA 3TP8A 3VA5A 3S1NB 2KI7A 4GN4B 2IW3A 4XTUA 1PTOD 5DM73 1D09B 3Q1JA 5IHIA 3OS2A 2NWGA 4YY3Q 4DR4Q 4A3IB 3OW2S 4EQOA 1XMOL 2QYZA 3J7AF 3HZXA 3RZOH 3CCRA 1M9SA 1A15A 1UE9A 1CZGA 2DY8A 3TS2A 1HRJA 5ELNA 2MWPA 5KYWA 4X3SA 4LNQA 2YRCA 1EQTA 2G9DA 3GTMH 5ISRA 2DX1A 3CXCA 4OF1A 2X6LA 3M0RA 1IREB 3ND8A 4KN4C 5JPMC 2L3PA 3GTQH 5K36G 1WXTA 4RKUE 2UUCQ 3CCQA 3HOWH 4F7XA 3I7FA 2YU9B 4NXNQ 1I81A 2F0NA 4RCCA 2WKDA 2QDLA 1R0BG 4JJBA 1T3LA 4ODGA 1WX6A 4EMGA 2R58A 4IO9A 3G4SQ 3PVLA 1E7OA 4X3UA 5ELFA 1EQQA 1YIJT 3S16B 3NHHA 4FP5D 4DR5L 1X3GA 2E2JB 3A55A 3CC7Q 1HNWQ 1UGPB 4PLLA 3J7AV 4AFUC 2ENMA 1HUMA 4KMUC 3P20A 5GAN3 1Q7YR 5AT1B 2OTJA 3F8TA 4DR1Q 4BWGB 2EQJA 2B63H 5CR2A 3NFCA 2OTLT 2KEAA 3EGUA 2DXCA 3FKIG 3SD4A 1U06A 2K9GA 2PQWA 3CBPA 2ED1A 4M75E 2BIVA 1YI2Q 2WP8J 3N52A 3GTLB 1HH2P 1STNA 4E47A 3HKZB 2HCIA 4OGEA 4AMCA 3NWTA 4JI2Q 4A4HA 4LFCL 2B3GA 2COWA 4LF8Q 1PKSA 2NWMA 2VL6A 1X69A 3S17H 1I5LA 4DV0Q 1QKXA 4H7BA 1VIEA 3M0PA 3H0FA 1M2OA 3JCMP 2F2WA 1Q8IA 4KJNA 1S4ZA 4DNRB 2NVQH 3A74A 3IQLA 2ZAEA 4FIBA 4M7AG 4K8JA 3UDXA 5DEHA 1OI1A 1GCQC 1WHMA 3VR2A 2IIMA 4M7AC 2Q2IA 4CC4B 4DUYL 4JJNK 2K5IA 5C6SA 4UHVA 3PO3G 4ZGEB 3L2ZA 1K73C 1K9MR 2EY1A 1TQOA 3VUBA 4RFBA 1ZUKA 4N9PA 4DUZQ 4XYQA 2QQRA 2K14A 1M1KU 3T16A 1PNJA 5D6XA 3CCSQ 2SEBD 2XMFA 2XWBB 3PMTA 3B6YA 4KK7A 3H3VI 1G3WA 1KDBA 3BG3A 1ACMB 1QG7A 2JSOA 2R92G 3QR8A 1OXSC 3X26B 4HCSA 2KUMA 2X4XA 3NTHA 3HOZH 1HCZA 2ZJQA 2A5HA 4WTOB 1EEFD 1H9SA 1TS5A 1FGUA 3EHQA 3QWYA 4BUGA 3SB2A 3PIPA 4E7IA 3M54A 3L1AA 2V8JA 1G3TA 3RLOA 2QXFA 2X4YA 2RI5A 3L2VA 4APVA 1N9RA 3VYGA 1F1BB 1EYAA 1W6JA 1I6VC 3LWUA 1UJYA 2XIDA 1EUJA 4IOCA 3U9SA 2RHXA 1IRXA 2HQLA 2M9VA 4ILWA 1EU3A 2EYPA 4RGTA 1H3HA 3M7NA 1X3FA 1OX9A 2HCCA 1FL0A 3E0JA 3MEHA 3CCQQ 1UGRB 1SE3A 4BY6C 1N27A 5E3FA 1K8AC 4Z89A 3F2UA 4LW1A 4QJFA 3QZ9B 1I4PA 2AQ1B 1ZHIA 2GTOA 1G8XA 2NVYB 4KLKA 1SYGA 1JQYD 4S3SA 4JI1Q 3CCUA 1PKTA 1W1FA 3E9FA 1KNEA 2NN6G 4YCWA 3V96A 4L5QA 4LF6Q 3M4OH 3I8ZA 1MI2A 2X9HA 5GJVB 4M7DE 2CT3A 3L2QA 2UU9L 4MZMA 2ED0A 2CQAA 5HK0A 2OAWA 3OBWA 2OTJQ 1WCMH 3RNJA 3S6WA 1FNUA 4NW2A 4KHZA 3OYIA 3S1NH 1X55A 2J4XA 3FKIB 4MN3A 4NB3A 3JCMg 1H9KA 2F4IA 2FHTA 3K5LA 4DR2Q 3TN2A 2NYSA 2K5FA 1DOMA 5GAOm 4WJ3M 4A3IH 1M27C 1VA7A 2FMMA 4JI3L 3D4WA 3SFMA 5EC7A 2RJDA 2DNCA 2YTYA 3DM1A 1SPKA 3CC2T 1YJ9A 5IT9E 3URGA 3S3OA 4UY8C 2I0QA 2ZPEB 1KHCA 1KK7A 1EWHA 1NMFA 2F52A 4POFA 1NBWA 4A3FG 1TU0B 4DEXA 4M7AB 3J80E 4P73A 2EW3A 1VQMA 5G3LF 3T1YL 3T53B 3VS4A 1Q81U 2K04A 3NMZC 4OMQA 3DEOA 4CC3A 1STYA 2YU9H 3PO3B 2R6GA 3EQLC 3HHTB 3RUXA 3P8BB 3D8GA 1B34B 2Y4XA 4J9CA 4J9FA 3J81L 1NR4A 3CEYA 1G2SA 1K4US 1BK2A 2JN4A 3I2ZA 5EBCA 2H3EB 2Z6KA 3S16H 1MGQA 5GAOp 1SBBB 2E2JH 1PH6A 4IALA 2DERA 1BCMA 4CBVA 1XWEA 1ZUYA 2P0KA 4XTZA 5I2MA 4HVVA 3JB9H 1TR5A 2R92B 1OU9A 4EMHA 2JA8G 2F3VA 2YUOA 3WVEB 2D5DA 2XN9C 1I6HB 1I4XA 3CRKC 1BR9A 1Y07A 4MZ9A 2N78A 5KNDA 3M0TA 2DJFC 3GP8A 1VQGA 1WI5A 3GTLH 5M3MG 4LF7L 5GMKe 4A3DG 4CI0C 4IQZA 3F2BA 4QW2A 1D5ZC 3PF4A 2PNIA 2P84A 1HPCA 4LN2A 3I3CA 3JCMX 3K5NA 2CT4A 1VQ7T 2G3RA 3F1ZA 4NXMQ 1EFID 3QO3A 2KYMA 4BY6B 1MJCA 1F9RA 2KSSA 1BQQT 2E75C 4B3TL 2IJ0A 2F0WA 5A2QE 1UE5A 4PV1C 3STBD 1QP2A 1U1SA 3PE0A 4AFQC 1SR3A 3M5AA 1LTRD 2DN8A 4IPGA 2UUBQ 3FP9A 3DB3A 3V8LA 4OIJA 5ELDA 1ENCA 2BUDA 2F0IA 5IWAL 1K8GA 4GLAC 3W2DA 3I70A 1AD5A 2WAQE 1N9WA 3CCUQ 1M3BA 4X3TA 2FZCB 3SXHA 2K50A 1JXMA 5IYDH 1VQLA 2F2VA 3S24A 4N8X1 3RZDH 2JA6G 3HL8A 4ZCKA 1V1PA 1JJCB 4DNIA 3J7A5 2K3BA 4M77A 4E7LA 1W6KA 3TDQA 3CPWA 1VQDA 2N49A 4FXDA 1EY5A 4M75D 4X9DA 3WWVA 2ROTA 2CZ0B 1H8KA 4RKLA 1G6ZA 4QUFA 4JI0Q 1YCSB 1PRLC 2EQIA 2LCSA 1X6BA 3OS0A 2NUPB 2VGNA 1QILA 4C3IG 2QKIC 3G4ST 1WI7A 2QGFB 1EIHA 2L2PA 1GUOA 1YJ9Q 4QQGA 2IHEA 2NYZD 4DK6C 4A3FB 1SAPA 2HDMA 1EYCA 2CKKA 1Y14B 4X62Q 1VQ8A 4N8FA 2FPEA 4C5GA 1TVXA 1RD9D 4JZ3A 4DQ2A 1YHBA 4HCZA 2WB1G 1STHA 5COYA 3VS7A 1VQKA 3A98A 2HAXA 1VQMQ 1I4HA 1WTHA 4QB4A 2EJ9A 5FO8B 4TKOB 4L5RC 5KYWB 3PUXA 4LF9Q 2NVYH 4C5EA 2D8HA 5LHY1 3H0IA 5C6AA 2V1CC 2CP6A 2E5LL 4A3BH 1RI0A 9ATCB 3MC0B 1ZX6A 5ECAA 1N6AA 4B3SQ 4KBMB 1VUBA 2RN8A 2DBKA 1UB4A 1ENAA 2QGQA 2LJ3A 3R6OA 2I5LX 1KSWA 2SRCA 3CBOA 1G83A 4C92G 4M7AF 3EROA 3OYCA 3ND9A 2JA8B 4OELB 1SEBD 4C92C 2J6FA 3HFOA 3FKIH 2QW7A 2HHHQ 5CV6A 3KUPA 4A3DB 3HOYG 3HS0C 4CKBA 1Y8PB 1SN8A 4J8QA 1QW1A 2D8JA 1MHWC 2K1BA 4QIWB 4OMPA 1X2QA 4ZTFA 5FRMA 2SDFA 4MHEA 5H1SE 3HTRA 4FDBA 4DV2Q 1K0SA 2D0QB 5CORA 4YY3L 4DR4L 4OGQC 1KQSA 1UTIA 2RQTA 2EBPA 1M8VA 2LDMA 1SXTA 1JOOA 1F77A 4KUIA 5T1GA 2HBPA 4FF3A 6AT1B 3OIPA 3PO3H 2VV5A 1Q82C 1VCIA 4XQQA 2E5KA 2V8IA 4M8AA 2D62A 3I9QA 1LUZA 4IFDI 1R8OB 1CKOA 1GBQA 2E70A 3OW7A 5DM63 4HJ5A 2JA7G 2OCEA 5IODA 4CRIA 1VQLQ 2OEOA 4KN7C 1IL2A 1JJGA 1QUQB 2JTMA 2RSNA 4HJ9A 4NXNL 4KY5A 5KH6A 4QQDA 3D6CA 5C5LA 1RODA 2LJ1A 3HRTA 2R92H 3A8IE 4QVZA 1LYLA 3SK8A 2B2UC 2K6AA 3UWNA 1SE8A 4J5YA 1I6HH 3PIP3 2P0QA 4LUVA 1HNWL 2RA2A 1KG1A 2CH4A 4C3IB 4B6MA 3M53A 1CK1A 4A3MB 1WLPB 4ME3A 4IPCA 4M78G 4JRPA 4DR1L 5M5YB 4E7KA 3M9QA 2HL3A 1KABA 2EYHA 3F2DA 4WCIA 2AQ3B 4JRQA 1KDCA 2YTVA 1VQ8Q 4MTKA 4LUOA 2MIOA 1EQVA 1K0RA 3MFGA 2ES2A 3JB9D 5GANe 1HA6A 4F7UE 1VQKQ 3P8DA 5J39A 4DAYA 2VQEQ 4JI2L 1BB9A 4DOWA 4LF8L 2CREA 4FSSA 1MMGA 4FL6A 2LXKA 4CJ1B 1HSQA 4VUBA 1FMWA 5CV7A 2RK1A 3I4NG 1HFGA 4OMLA 3NK9A 1SYEA 3JAML 5HY6A 2K7AA 4HMJA 4DV0L 3SR1A 4ESRA 1F9SA 1B7YB 1GO3E 2NN6H 2M16A 3TSWA 1BCPD 1LTBD 1ZXTA 1W2BS 4BY1G 3J7YW 1SRMA 4CDCC 3PNWC 2HD3A 1WTQA 4XYOA 1W4SA 4C92B 4UP7A 3VDYA 2EFIA 3J81i 3C46A 3VRZA 4KKUA 5C4XG 3EG9A 2QQBA 4DAVA 2PNRC 2RHSB 4R8NA 1G5VA 1VQFA 5EGTA 3OYHA 1VQ9T 4FYDA 3KUFA 4JBWA 4DUZL 4FYXB 4OB1B 2JTEA 4GLKA 3EG2A 4A3KG 3HOYB 1KIXA 4QMGA 2LNVA 5FLMH 5GAOr 4DF7A 2V1RA 4LJZC 2UXCQ 5EPLA 4A3FH 4ME7A 4IKFA 1A62A 3QWXX 4PZ8A 2O5JC 1LPLA 4OMMA 1PMRA 3JC66 2OTLA 4QCLA 2H1EA 3HOXG 2CS7A 3EH2A 3JSCA 5LJ5d 4OP0A 2EKOA 4XT1B 3UDIA 1ASYA 5I2XA 2KNBB 3W5OA 3LYIA 2XHCA 4RCNA 3M0UA 3NTKA 4WRDA 4YWMA 1OO9B 2F0KA 3V2TA 3CXCS 5D6WA 4DEYA 2JQOA 2M2LA 3HFNA 1ZYRD 3E1SA 3PMFA 4AIMA 3QKJA 2CYZB 1WD0A 1V76A 3I4MG 2UXDQ 4LDXA 4FYYB 1NE8A 1E22A 4U673 2MNAA 3A5ZB 4A3CG 4ALPA 2LRQA 8AT1B 5KYUB 1LTAD 1RTOA 4K5XA 5D14A 4HSPA 1A3TA 1KTKA 1SF9A 4PG3A 3NBHA 1IBKL 2JA8H 1TWHB 3P7JA 3BYTB 3QIAA 1EOVA 5EPKA 2ZM6Q 5KYIA 1E3PA 1PHTA 2DYBA 2DD4A 5D6YA 2HIXA 2V26A 2GVBA 2R5MA 3PUVA 4A3DH 1TSFA 2IVWA 2RO0A 4OVAA 3CCUT 1SFOB 4JV5L 1TY2A 1YHQT 1UE1A 3BDCA 3ONAB 4RGOS 2VB2X 1BKBA 1WVLA 4QT7A 1V1OA 1D3BB 1X3EA 3OIQA 4O0AA 3LH5A 2L12A 2Z4HA 3HEJA 4DR2L 4M7DA 2Q8RE 2PW7A 4QUCA 3LWHA 1X27A 1I4K1 2BOSA 1N32Q 3M58A 1M4ZA 1YZ6A 3NPFA 2X6GA 1PM3A 1PYWD 5HCKA 4J7FA 1NYGA 1YJNT 4A3EG 3MPUB 1N8RR 4C8QA 1HNZQ 4X9CA 1N9SA 1Q46A 2B29A 2DF6A 3D4DA 4IURA 3MP8A 4BY1B 2LX9A 3HOUB 3OYFA 1YJ9T 2FG0A 2QQ9A 2OJ2A 3VV0A 2AK5A 3CHBD 2B63G 2EYQA 5C4XB 4Q0FA 2JVVA 3OYLA 2AHJB 1SHGA 2HEQA 3U9OA 4ZUJA 1V8QA 4J9GA 4Z02A 2LVMA 1H9MA 4NPSA 5FW9A 3C0CA 1CKMA 2XU8A 3R93A 4C1NK 4A3KB 3SGIA 1F2LA 4E7JA 1IW7C 3EBEA 1V1PB 4C3IH 4A3MH 1W70A 1IYUA 3X3NA 4FXGC 5ELEA 1N34Q 1EFNA 1S72A 2EYWA 4KT0E 5M5YH 1I4GA 4XDXA 2BE9B 1O9SA 1RCVD 4C92F 2O2LD 1CQFA 1GOZA 3HOXB 2OTLQ 2C0TA 3PF5A 4KJOA 2UUAQ 5A0LA 1Y8OB 1G3SA 4L59A 3PUZA 4IOAA 5CKBA 2OWOA 1UE6A 1E2ZA 1OXTA 1NJIU 4DAMA 3VR5A 1DOLA 3U58A 4NXML 1B70B 3CC2A 4MDXA 2MHVA 1Q86U 3L2RA 2IY5B 4LF5Q 4CJ0B 3K8AA 1BBWA 2RHZA 2RDFA 3NQIA 4J6WA 1B8AA 1PYBA 4ANJA 2XNAC 4HTHA 2JUFA 3I4MB 1AWJA 5TSSA 3PUYA 1NJIR 3A56A 3CAMA 2UUBL 1VQHA 2RK2A 2JOYA 3K5OA 3ULRB 4DR3Q 5CCAA 5IYBG 1SYDA 3HOZG 4PKCC 1O78A 2BA1A 2Z8LA 1ZKOA 5IY0A 4LFAL 1D0YA 5IGDA 5IIFA 3HOYH 3OS1A 5BN5A 2C06A 1U9RA 2ZXRA 3I73A 3ICEA 5LJ5j 2QEJC 1U8RA 4A63B 3BDUA 4IPHA 1YN8A 1BBUA 3L0OA 2DJGC 2R7ZB 3X25B 3BZDB 1WXBA 1RLPC 2BZYA 1UJ0A 4KRTA 3OW2P 3GD7A 4JI0L 4R4QA 2KQWA 2QDBA 3IKJA 1SHFA 5JJKA 2IHFA 3T1HQ 2P4TA 1G3YA 2EY5A 4A3EB 2DO3A 2CSQA 2L4NA 4OL7A 5LMUL 2E6NA 4IFDJ 2MPXC 3EHRA 4HCKA 1IKLA 1TU2B 1FXXA 5GAMd 1KD1U 2LS01 1MMAA 1XJWB 1Q3LA 4LDUA 3EVQA 5J26A 3ZEHA 1CA6A 3TRZA 2F2XA 4KHPL 1BI3A 4NOYA 1VQ7A 2KXCA 1EY9A 3MEFA 4M78E 4DXFA 3E9IA 3URYA 2DXBA 1E2VA 2CQOA 3PCOB 4LF9L 3JAMi 3HPWA 2A69C 1KD1R 1XNRQ 3FJPA 3GTPB 1D2BA 4XQNA 3C4SA 3PIOA 1VQ6T 3ZJYC 4QY7A 2G5DA 2VNUD 1PD1A 3CPFA 4HVWA 1TWHH 3ERQA 5C3XA 2ZTDA 5IGEA 4A3IG 4J8OA 1ONLA 1R4QB 4B3SL 5C4ZA 2MI6A 5FK9C 3JCMQ 4EVOA 2HD0A 3O5ZA 4B9WA 4JBKA 5LJ3d 1SFOH 3H6MA 1C6VX 2KXDA 2MOXA 2CKZB 1S72Q 3CCET 5CKHA 3DXJC 2VZAA 4CGYB 3QPHA 4QGUA 1WQWA 2HHHL 2HQHA 3MHXA 2A6HC 1KNAA 2B2YC 3CC4T 4D6WA 2WSCE 3QBYA 4AG1C 2B8FA 1QZGA 5CQXA 1PH3A 1ABOA 3BDOA 1Y0MA 1OEBA 3Q24A 1NEBA 2BE5C 4BI8B 3A8JE 1LOJA 4DV2L 1HR0Q 3CC2Q 1EIYB 1FX7A 2VY3A 4BY1H 1U4RA 3OY9A 2QK0A 3K59A 2QILA 3HOUH 2B2TA 4IFDG 2JMCA 1ESRA 4DAYB 5FLXc 4ME5A 2XGTA 4HSVA 2XG8D 1E24A 3L2PA 1M90R 4P72A 2EGCA 5C4XH 1EY0A 5FWBA 4C8QG 4YIJA 4DK0A 5HK3A 4OGCA 4QQ6A 4C8QC 4BDYA 4P71A 4BBRG 4FF2A 2EPBA 4A3KH 5GANd 3KJOA 1NUCA 2K5DA 3S1MB 1MMDA 1CSQA 1BYMA 2PQAB 4NKLA 2D9TA 3CPWS 3R3OA 1WTOA 3LW5E 2EWNA 2BZ8A 5KIXA 4LFBQ 3TZDA 4PJOA 3HOXH 3I55T 1LV9A 2F0SA 2PZTA 4L5GA 3H0HA 3OPOA 4E7HA 2AIRB 4V2SA 3WVDB 3H91A 5E4XA 3KLSX 3M9BA 2NVTB 4JPBW 4HIDA 5IYDG 2RJFA 1KDAA 3CCMT 1JE4A 3AFQA 2W0ZA 1VQ7Q 1GUTA 4ZN3A 1TWFB 2ZPFB 2EYXA 2VQEL 3CRLC 4R55A 2F0QA 2SOBA 4POGA 4DV4Q 4J9EA 5GANf 3ZYYX 2JN0A 4KKTA 2EKHA 3MP6A 3I72A 2KYBA 4F7UA 3NENA 3E19A 1A2TA 2F0LA 1HFNA 2YUNA 5GMKl 4JBJA 1GUSA 3LX0A 4HEDA 1PH2A 3UE1A 1WTVA 4J9HA 1WXUA 4K2LA 2B39A 1QZHA 1D1IA 4QKUA 5FU7C 3QYHB 1YNND 3NGPA 2H5XA 2D0OA 2R7ZH 4C92D 2RQUA 2D0PA 5GAMj 1LT6D 4MIUA 1UEBA 2DLPA 2FO0A 3QB3A 5A35A 1UECA 1QOHA 5FO9B 4NL3A 1K73U 1JJ2P 1FWZA 2QA4T 4A3EH 4P74A 2UXCL 1Q7YU 5LJ5h 3VYUA 5CKDA 4C3HG 4A3BG 2K3YA 2HNIA 2NTTA 3E6ZX 2VKNA 5L8RE 3OMCA 2L3RA 4V190 1KQSS 1UFFA 1K73R 5LMNQ 1AVZC 1TS9A 4DNTB 1LTTD 1BDOA 4LD9K 3LWEA 1G8ZD 3QWNA 1SSOA 2J6OA 3MVVA 3QXEB 1Y1VG 1RABB 3H94A 2UXBL 4LUZA 4C8QB 5KE3A 3VYTA 3GTPH 5LJ3j 2ZZDA 3K0YA 1ZSZA 4XQ3A 4LXCA 4TQUS 3VYRA 1FMVA 3KDFA 3R2IA 5CVIA 1NMGA 4OWXB 4BBRB 5JAVA 2UXDL 2D0NA 2K5VA 1PHJA 5GAN2 4LUEA 4HN7A 1UHCA 4BA2I 1NCVA 1X3PA 3HKSA 1B2TA 4K6LA 3VUZA 2IX0A 5LL6X 4XTVA 3K7AB 2J05A 1ICFB 4FO2A 4K11A 2PZUA 4DN4M 1K9MU 1GRIA 4J1MA 1SNQA 2ZM6L 4XTYA 1Z9ZA 4XU2A 3G71T 1ESFA 3GV6A 2PCFB 1VYUA 1VQ9A 3CP0A 3LNNA 2E2DC 1A2UA 4PQXA 5C3EG 1CA5A 1K3RA 2NUCA 4MMLA 2LXJA 1SROA 3KBXA 4PL6A 1VDZA 2LJ0A 1BVSA 4B08A 3I5RA 4M78D 5IXFA 3RZDB 3QUIA 1T0HA 5BR8Q 3L2WA 1N32L 3T4AC 4ELZC 1KXLA 3V8KA 4GKJQ 5ELOA 3FLGA 2F0TA 4AG2C 1QVPA 4ORZA 4NL2A 5GANj 2CP7A 1J6QA 2F1LA 1XX8A 3BVMA 2EGAA 2CWPA 2CWAA 2L0CA 3ITPA 5IYBH 1I5OB 1KHIA 3F70A 1AN8A 1LTSD 1BBXC 2AWOA 1UGVA 3VYHB 4BBSG 2F5KA 2DILA 3T9NA 4RTTA 1F9PA 2FRYA 3TREA 4J9IA 1LO5D 2EYOA 1QJOA 1JQQA 1MUZA 2DJZA 1OPKA 2VUBA 4HVUA 3W1BA 4E2FB 2GFAA 1M8MA 2KGTA 5FU7B 1M3AA 1AZEA 5D3IB 4OWWB 3S1MH 2AKLA 1Q1BA 2O01E 2B2TC 3TSZA 3OYNA 3A8GB 1EZ8A 4RMFA 1M5Q1 1A0NB 1E6HA 3MXNA 5I2YA 4B3RL 2YHTA 1KQ2A 2MUYA 3I4OA 4J6YA 3AMUA 1PH8A 3EG0A 1QVGP 3DM3A 4GLMA 1II3A 1EIGA 1WZOA 2YRVA 4ZRZA 1N34L 4XK8E 8ATCB 4HCEA 4DFAA 4AFSC 2WAQB 4C3HB 4A3BB 1YFNA 1L2FA 1I50B 4JOIA 1YHQA 2NVTH 3BJUA 5KRUA 1T9HA 2RPNA 1S72T 2K33A 1WPYA 1N33Q 2UUAL 2YUPA 4PJOG 1TWFH 4JV5Q 1CUKA 1QWFA 4PFOA 1Y1VB 4PNYA 2DIGA 2KR3A 4PJOC 3PIO3 2E8GA 1LM0A 2JJQA 2K7VA 3EFXD 2HMAA 2J6KA 1JO8A 2DPPB 5DLOA 4P2CB 3VA7A 4QQBX 4D8KA 1YJNA 4PJNA 2KDSA 4Y52H 5I6YA 3P8HA 1H92A 1LACA 4LF5L 3QIIA 1QVFP 5FLMG 5IOCA 3M0SA 3C95A 3AYHB 3C1EA 1SRLA 2FZKB 4GLXA 4DR3L 3NE5B 1PH5A 4K8IA 2GF7A 2GQIA 4CJ2C 3DKMA 2A73B 3PGGA 2I0NA 1I5FA 2J0TD 1M1KC 4N4GA 2F03A 1YNJC 2DE0X 4FF1A 2R7DA 4HXJA 4X34A 4C8QF 1TG0A 4KY6A 2CP0A 1FNVA 1L1OA 1VQ9Q 5C3EB 3G7LA 1JOKA 1Z9FA 2AMCB 3C1FA 3OYGA 2XRQD 5I6WA 4A53A 4KI0A 3HKZE 1Y69U 1J5EQ 3U23A 3X24B 2X3XD 5GAGC 2E3IA 4CC7A 4IFDH 3L42A 3P1HA 5GAMh 3T1HL 1O7YA 2CDTA 2KA7A 3R6NA 1TWAB 2CHBD 3RLNA 5KNCA 4BBSB 2DUDA 4R4OA 5CK9A 3AQQA 2F0PA 1YBYA 1I3QB 4Y7NB 1G91A 1F2ZA 3S3MA 2L9HA 4BBRH 5EAYA 4HAEA 3WXMB 5IT9L 3SE0A 1O75A 2K2MA 2KRNA 4BACA 1VQ4T 1TKWB 1VQ5T 1XNRL 2GQVA 1G6PA 1S5DD 2A7YA 2ZXOA 3MEWA 4QVDA 4RG2A 5CAIA 2D2CC 4Y28E 3K7AH 5C3WA 2F4VQ 1LJOA 3J80L 5LJ3h 4N0AA 4XTWA 4XTCS 1AZGB 1ZA1B 3A7AB 1E6GA 1TT2A 4OXPA 5I11A 1UAPA 2RJEA 2O31A 2DM1A 3FEOA 2KRMA 2R5AA 1PH7A 4IZ8A 3RR6A 2QQSA 5KYYA 2HDLA 3KF8A 2DZ9A 1N36L 1PH4A 3BZCA 1SSFA 3JCMV 2WIIB 1I94Q 4LFAQ 1C8CA 4L63B 4ZN1A 4QVCA 1YHQQ 2CW0D 1Y96A 4JRIA 1NG2A 4PJOB 1FR3A 5C4HA 3HRUA 4ZKCB 4E6RA 5KEEA 1VMPA 3EN2A 1CM9A 3T51B 4B3ML 2ALYB 5IP9G 4J9DA 4OB0B 1CFMA 1HR0L 4XU0A 3E3XA 2LCCA 1Q81C 1YJNQ 3RDVA 3OSOA 4UAIA 3OYBA 1NPPA 1D6EC 1K1ZA 4A3MG 1HZAA 1QQJA 5FKAC 1X43A 3WOFA 5LMUQ 3BE3A 4ELYC 3L7ZC 5GMKi 5GANh 1OZ2A 1AE2A 2KBNA 4C5HA 4FSXA 3SHLA 4JDSA 4C0GA 2A36A 2VUMG 4KHPQ 1SMXA 3QOJA 5JJLA 4PFZA 1TUCA 1VQ6A 5A2QL 1LABA 2DRKA 3I56A 2F69A 3KLSA 2JA9A 2EY2A 1NE3A 3META 1Q82U 3IFDA 2VQFQ 4C2MB 4V0BA 1VF5C 2ESWA 3EG3A 4C3HH 2K57A 2EGEA 3Q23A 1I50H 4QF4A 4LFBL 4MZTA 3CCEA 1AW7A 2DJQA 1D8LA 1Q82R 1GFDA 1SJHD 3CMAT 2K32A 4RG8A 1GVPA 2A74C 4O1NA 4Z9CB 5JVG3 3OMGA 1U4LA 1RJTA 1WYXA 4TVRA 1XOVA 1WYDA 1Y8NB 2A6EC 1PLFA 2A68D 1PH1A 4C56C 1Y1VH 3CC4A 1B07A 1ZLMA 1LT3D 4M7AE 3S2HB 5GAN4 4MNOA 1M4VA 5F2DA 3EIVA 3CXCP 3BVZA 5KYXA 2JTFA 3EFOA 4ZLTF 4JOIC 4GY5A 1IYJB 4GS3A 2M9UA 4H44C 3CMET 3H9NA 4PJMA 3NWSA 4L8JA 2LY7A 4DR7Q 1RHPA 1KRSA 2E5QA 1NSNS 1RADB 2QGGA 3CKIB 4R9WA 1OV3A 2R93G 5GAN6 4DBHA 1TS4A 2B2VA 4IUPA 4C5IA 5CGKA 3A8HB 4ULLA 4D8DA 3OYMA 4BS9A 5DLQE 1CKNA 1AT1B 5C3EH 2HT1A 2XIWA 3RIRA 4PNOA 2L15A 2PNHA 1NPRA 3HGBA 1GUWA 4M4ZA 2PMZB 4JG2A 3N6RA 3S9WA 2EVBA 4O5VA 1OZ3A 3RLFA 4EQ5A 1PRMC 3M4YA 1L0WA 2LQKA 2AKWB 1QB5D 3TEHB 4ZK9B 4Z8AA 1X56A 2A6HD 2KECA 1I4QA 4FCYA 2F0FA 3U4VA 1N36Q 1RAEB 1I0CA 1TOVA 1VQOA 2ZXPA 3I55A 1UE7A 3NEMA 1TWAH 4KH0B 1NM7A 2F0HA 2KT1A 2RHQB 4LMQD 4AYBG 5FLXE 1Q90A 4BBSH 1RAGB 4GNXA 4Y7NH 3PFSA 1I3QH 5LMNL 2XD0A 2RM4A 5D3DA 3TZUA 1JICA 4L5TA 3EGDA 3V8JA 1V9PA 2KK4A 3CCMA 2Z6KC 1WQ7A 2OX7A 4LDWA 4C1NI 4GLVB 1D1KA 4XT3B 1RUWA 2AWNA 2Z9HA 4PJOF 1DJRD 2VUMB 5KYNA 3H8ZA 3MCAB 1VQEA 3GNGA 5G3LD 4FYWB 3VRYA 1H9SB 5KYLA 1VQ6Q 3DMUA 3I56Q 3OB9A 1JWSD 2EJFA 4I7AA 5E4WC 2HZYA 5DNFA 5GAOl 3KFUA 3JCMe 4M75A 1T5XD 4A3LG 1HQRD 1FGBD 2VB3X 3UI2A 2EJGA 2X35A 2MO0A 3MXNB 2NVXB 3HOUG 4X6AH 1EEID 1AE3A 4G57A 4DV6Q 4JC0A 3EGXA 1ZA2B 2YWWA 3CCEQ 1MBYA 1QNKA 3RNUA 4YTLA 2F0OA 2HUGA 3H6ZA 4N0AC 1Z9QA 4ATOA 3G6JB 2IWHA 1X3QA 5M5XB 1BNZA 4F7UF 4O6JA 3W3AA 3CC4Q 2K5WA 1YJWT 2CP5A 2Y4YA 2A37A 4JRKA 3VS0A 3M59A 2QA4A 2F0MA 2KHJA 5JEAJ 2COYA 5D65A 5BR8L 1ET9A 2M1HA 4OB2B 1BI1A 2ZCFB 4HT8A 2M00A 4JW0A 3D7SB 4DV3L 4GKJL 1F2YA 1A3UA 4M77G 2K4YA 4DV4L 1AEXA 4L6V5 4KHVA 4YWKA 4II1A 5A0GA 1DZ1A 3SEMA 4M77C 3CCJT 5JOBA 2RDGA 5I22A 1TS2A 4IJLA 2R93B 3U50C 1WHKA 1NY4A 1TY0A 3KLRA 5E1FA 3VR3A 1T0JA 2XDDA 2WKCA 2HKQB 2JP1A 4U68A 5GAN5 1XNQQ 1EY4A 3ME9A 3S3NA 2L5QA 1XQHA 2UXBQ 4C2MH 3OSSC 3J80i 5C0XI 2KMTA 3NXWA 3QG1A 4FW1A 3PGZA 1RLQC 1WNLA 4HJ8A 4EQPA 2QI2A 2HCKA 3AU7A 1AZQA 2K01A 3M85A 2ZGWA 1IHVA 3TEEA 2F0DA 4QIWE 3GTGB 1PFNA 2FINB 1U0LA 4P5NA 2AUKA 1ZQ1A 4DV7Q 2ZTEA 4IUQA 1IO6A 3G71A 1ENFA 5J22A 3Q22A 1VQOQ 1PA6A 3X20B 1PC0A 3I55Q 4K6DA 4RGNA 3J81c 5HGQA 4AYBB 3S2HH 3HFZB 2B86A 4DA4A 1HA5A 1AHJB 3MXPA 2QAZA 2EPDA 2Y0SG 4R1JA 3WOEA 2IG0A 2FB7A 1XXGA 1NBEB 4G7ZC 1N33L 2LP5A 3M7GA 5JEAG 3FDTA 2B8AA 2LQNA 3CCMQ 1KJWA 3O8VA 3BFMA 4N4HA 4TSSA 4C3JG 2EZVA 2LT4A 1N8RU 1LNXA 2R7ZG 1JJ2A 2CH4W 4OX9Q 1MNDA 1DM0B 3HP3A 4KH1B 1ZSGA 5CO7A 2L5TA 1IHWA 5FOBB 2C5CA 2RB6A 4G7OC 3K81C 3RBBB 1HZCA 1KIKA 1AFPA 1VQPA 1PZID 4JI8Q 4ZUIA 4AFZC 1TS3A 2MO1A 2ZPGB 1SEMA 3IAYA 3INZA 1IKMA 5GJWB 2K5QA 1J9OA 2O2OA 3RKYA 4RTUA 1SYFA 2GA4B 3CU7A 4M7AD 2EXDA 3RUZA 3CQTA 2E4HA 2DTIA 3C2PA 5KYYB 4IPDA 1UNSA 5ELBA 3C12A 4B9XA 2WB1E 3FHWA 4LF4Q 5IP9H 1U4MA 5KGUA 1C0AA 1X6GA 4B3RQ 3K5MA 4RMOA 1J5EL 1STAA 2QA4Q 3NELA 5GQOA 1GJXA 4UP9A 5CR3A 4C0FA 3RMSA 3D0FA 4R0KA 1XNIA 1ABQA 4M77B 2DNEA 4HA8A 2LKVA 2MWOA 3FC3A 2MPMA 5JJIA 3PO2G 1SE2A 3UE0A 4R56A 2ZPIB 2LQ8A 2JA5B 2Q2HA 2VUMH 2A0FB 1DGSA 5EKLA 2CCZA 1VYVA 4C92E 5NUCA 4PK4A 1VQNA 1ZEQX 2ATWA 4GNXC 2L1BA 3NTIA 4BXXG 2DZCA 3RMQA 1HNXL 1Q1EA 3CPWP 2EYMA 3H0GG 4JS5A 5EPJA 3C3LA 5M9OA 2KE9A 4BE0A 4BA1I 2E6ZA 3LLRA 5AFWA 4A75A 2F4VL 3VKIA 1BI0A 1V1CA 2NVXH 1UHFA 1GCPA 5GROA 4KUDK 4JI5L 2R61A 3EFRA 3K0XA 4KD4A 4AT1B 2CSIA 1SYBA 5M5XH 1OXUA 5AJ3Q 3TSSA 5C4JB 3G71Q 4K0KQ 3UDGA 3Q8DA 3D4RA 3PT9A 4C0DC 2EJFC 4M75G 4JI7Q 1UG1A 1I94L 4KV6A 2BCOA 2LQWA 2Y0SB 4M75C 1E1OA 1SRUA 2EY6A 3GDEA 1EY8A 2EJGC 3TS0A 5T1IA 3G6ET 4FM4B 1QVGA 4C3JB 3M4GA 1AP0A 4PJOD 4BI3A 3TP7A 2HIVA 4Y91A 4X65Q 1LCKA 1GHKA 5KYXB 2KROA 4CDDC 3EFOB 4Y92A 1AZPA 2R93H 1WTPA 1RAHB 1WA7A 1WGSA 2I07B 4DV5Q 1UGSB 3FMCA 2XK0A 2LNHB 2KENA 3CCLA 3TQYA 1FYCA 2E1HA 2B2WA 1D7QA 2RI2A 3IRBA 1VQPQ 3VS2A 3DEPA 3MTSA 3GBQA 5DM7R 3UT1A 1VQ4A 1GKHA 1VQ5A 2C35B 2VB6A 3A0JA 1WJJA 1DONA 4RTYA 2X3WD 3OYEA 4YCUA 5GAOn 1G51A 1KLUD 1WHLA 1YNJD 1B9MA 1O7ZA 4O2DA 2JS2A 1YNXA 3GTGH 4EX5A 1CKNB 1I8FA 2VQFL 2L11A 2A3LA 1QVFA 1NR2A 1HUNA 4HIKA 3OQ5A 1HXYD 3I56T 1CSPA 2YYZA 1WD1A 1IBKQ 4RAUC 2M0YA 3REBB 2YUQA 1W6XA 2OF1A 1PXUA 5DY9A 3SVMA 3TP6A 4XXEA 3H41A 2ZJRA 3RESA 2UUCL 2P5ZX 4RWSC 2RDHA 4FT2A 1MV3A 1C48A 1Q86C 1RF2D 3PO2B 1A6XA 3JCMJ 1AWXA 3JCMW 1VYTA 3M0QA 3GOXA 2H4OA 1HXDA 3EA6A 3HRZC 2PPBC 4GNXB 3CBMA 2D9UA 2K28A 2G6FX 4M1UB 1MV0B 2EVRA 3EGDB 1GCQA 2ABLA 1VQNQ 1L0YB 2MP1A 4PZ6A 4F88A 3OTOL 3RN5A 3DLLA 4IUVA 2NZ1D 1OYXA 3H0GB 4B3MQ 4FU6A 1NZ9A 4A54A 4DR7L 5LJ5g 5GMKj 3KFVA 4A3LH 1M90U 3ZFJA 4M77F 4M7DG 1JEGA 1QP3A 1EIFA 1MHNA 4HKEA 1B44D 1E2WA 1PRTC 2K03A 2GGRA 2Q2TA 1B34A 1YWPA 4M7DC 1XTDA 2ATCB 2DL3A 3E0EA 2YLBA 4F17A 1A3VA 4C0DB 1HR0W 2X4JA 4OO1I 3OYKA 4FVMA 4A93G 3JAMc 3ZBDA 2JXMB 2SNSA 3DUZA 4M75B 2EYJA 5GAN8 2NZHA 1X01A 3EGXB 2WACA 3UDFA 5L23A 3OA6A 3GQBA 2Y90A 4DK3C 1C4QA 2EQKA 3CMAA 1MJEA 1OULA 1HQMC 4ZTJA 1RDPD 3EG9B 3RN2A 1JE5A 2E2IB 1Y7XA 3OS5A 1BOSA 3JCMd 3S1RB 1HTPA 5GAHC 2JA5H 1BCOA 1VQOT 2ECZA 3A1PA 3OBYA 3K57A 3BW1A 5L37A 4AQYQ 5C44G 2HBWA 3CCLQ 4CDEC 1YWOA 2DEUA 5C0XJ 2A19A 4JLIA 2JE6I 5HGTA 1B53A 3CMEA 2I5MX 3ASKA 1VQ4Q 4FT4A 2NB0A 1VQ5Q 1ZUUA 3HP9A 5KCHA 1UGQB 1B3QA 1GXDC 1BCPC 1B9NA 1MKHA 4FYVB 1W3SA 2N8NA 4RHRA 3N5BB 4PMWA 4A3JB 4JI6Q 2E76C 3CQZB 3O13A 3VS3A 3M56A 4OB3B 3R2TA 5C4JH 3UATA 2XTIA 2Z0SA 1IL8A 2XKOC 1STGA 1V43A 3FB9A 1MGSA 2ZT9C 5EQ0A 3E5SA 2ICIA 1Q12A 4DV6L 1HJPA 3JCMf 1KC8C 5KCOA 2FXQA 1D1AA 1ILQA 1SDFA 4QL5A 1JC7A 1IHZA 4RG1A 1PCXA 5JEAH 4GKKQ 1B4OA 3GLXA 4DKAC 1CQVA 2A6ED 4K14A 3PSIA 3UF4A 3NBHB 3W1GA 1QMCA 4C3JH 2SEMA 2HQEA 3JV3A 2VASA 1SMYC 5EJWA 4DXGA 4LDVA 3MAQA 3QJYA 1M8AA 1JOQA 3SDZA 4IJHA 3SK4A 1K8OA 3BS1A 2RHUA 1NNXA 3GPLA 3CD6T 5FJ8G 2VS1A 1PFBA 1PRTB 3Q0AA 4H02A 4J83A 2WAQG 3LWIA 3KBGA 5CIUA 2QEXT 1TWGB 4I7ZC 1KQ1A 2DXTA 4M7DB 2K5NA 1FD7D 1QLYA 4DK1A 5C0XG 2FVUA 4OMNA 4EDUA 2B8GA 1AWOA 2BA0A 1JB0E 3BY7A 5IHNA 3TP5A 1I4RA 1PG5B 2YTXA 2RCNA 1JCKB 3D3RA 1ZYRC 5K5PA 2AKKA 2KHIA 4TRDA 1XNQL 4A93B 1A0IA 1TUGB 4DV1L 1I07A 3F2CA 1S1NA 5HKCA 4F87A 5LMNW 3D31A 3OYYA 4HIOA 2B2WC 1B7TA 2FEIA 4IIMA 2BKDN 3VJPA 1AOJA 2X69A 1K3BC 4WF2A 3C94A 3VYSA 4AH6A 4N4IA 4DV7L 1IYVA 5CYUA 4RCBA 3J81j 5GADC 3CMAQ 1B50A 3PO2H 4DR6Q 2KEDA 2F3IA 2FPFA 1P8LA 2AZVA 4LD6A 2K05A 2N3SA 4PZ7A 1K8AU 2RQVA 2VXFA 1YJWA 3IFTA 4ID6A 3J7ZC 3A5UA 3KOJA 3PMIA 4M75F 5LL6S 5C44B 3VS6A 4CKEA 4BXXH 5CMDA 2MF2A 2KAFA 2PZWA 4RA8A 4EMKA 5IHKA 2KCCA 3H0GH 1K8AR 1P92A 1SNMA 5BN3A 1WFWA 1JWMD 4JBMA 3DB4A 3CMEQ 1BCPB 4G7HC 4OX9L 2RKSA 3CCJA 1Z6HA 4DV3Q 1U5KA 5GAMg 5I4DA 5IGCA 2EXZA 3AB9A 1VQCA 3LGFA 4PMBA 4EQNA 1DJ7B 4PMCA 4EGVA 4JI8L 1RTNA 1QUQA 1S5BD 3HOVB 4X64Q 1SLJA 5GMKh 3FVQA 3NP8A 5M3FG 1IBMQ 1VQPT 1XTCD 4RCOA 1NEGA 4G4KA 4P75A 1ZBJA 2MGSA 5KNBA 3KK7A 1QWEA 2DL7A 1Q7YC 1D0XA 1VIFA 1KRTA 4J15A 2I46A 5HURA 3M3YB 4WFN3 1LTGD 1SNCA 4OIKA 2O4XA 5A0DA 3MXGA 4LF4L 4XQJA 4NS5A 2E2IH 5EKKA 3S1RH 5LJ3g 3RR5A 4JYAQ 2LC4A 2L55A 3NUCA 1LVKA 4RTWA 1DYQA 4LE9A 1PSFA 1L0XB 1M1KR
chains in the Genus database with same CATH topology
1B07A 1ZLMA 1NLOC 1WIEA 3LH5A 1U5SA 1WDXA 2O9VA 4J9BA 4CC2A 1X27A 2BZXA 3NPFA 3SHWA 2RMOA 2P4RA 1KFZA 5HCKA 1NYGA 1X2KA 2GTJA 4JZ4A 2W10A 2DF6A 2HSPA 2YDLA 1OV3A 2FG0A 2OJ2A 2DBMA 2AK5A 3VS5A 2GNCA 1HD3A 2L3SA 2JMAA 1FYNA 4D8DA 1SHGA 2HEQA 1UDLA 1NYFA 1YP5A 4J9GA 2V1QA 1NLPC 3C0CA 4M4ZA 5FW9A 1SSHA 4IIOA 3EG1A 2K79A 2HDAA 1PRMC 2GBQA 2JM9A 1W70A 2KBTA 4Z8AA 3NHNA 2JS0A 1EFNA 2VWFA 2EYWA 1I0CA 2LMJA 1TUDA 2AZSA 2ROLA 3UA6A 1NM7A 2KT1A 2C0TA 3PVQA 2MCNA 4RTZA 1J3TA 2PZ1A 2EYYA 2J06A 5IHIA 1RUWA 1CSKA 1UE9A 3VRYA 1AWJA 3ULRB 2DX1A 3M0RA 2L3PA 1WXTA 2QDLA 4JJBA 1T3LA 1WX6A 1I1JA 1Z9QA 4A63B 3ZL7C 3PVLA 1E7OA 5FWCA 1YN8A 2A37A 3VS0A 1WXBA 1RLPC 2BZYA 1UJ0A 2JT4A 4KRTA 2ENMA 4AFUC 2LZ6B 1AEYA 1SHFA 2DRMA 2KEAA 2CSQA 3EGUA 2L3QA 3EHRA 2KT8A 1U06A 2K9GA 4HCKA 2ED1A 3SEMA 2O88A 5I22A 2F2XA 2KXCA 1T0JA 3FJ5A 1PKSA 2NWMA 1X69A 1QKXA 3M0PA 3H0FA 2F2WA 3IQLA 4HVWA 1RLQC 1GCQC 2HCKA 2IIMA 4CC4B 4RTVA 1M30A 3O5ZA 2KXDA 1IO6A 2MOXA 1ZUKA 1FMKA 2NUZA 1T3SA 1GFCA 2B86A 2EPDA 1PNJA 2XMFA 4AG1C 2LP5A 2LQNA 1ABOA 1Y0MA 1KJWA 2KRSA 1OEBA 1NEBA 2CH4W 3EHQA 3QWYA 2JMCA 1ARKA 1ZSGA 5IXBA 2JM8A 1UJYA 3RBBB 1KIKA 1M3CA 2EGCA 5FWBA 4AFZC 1H3HA 1SEMA 5GJWB 2O2OA 4Z89A 2DNUA 4RTUA 2GTOA 3CQTA 1PKTA 1W1FA 2BZ8A 1X6GA 5GJVB 2CT3A 4LUDA 2ED0A 2OAWA 3H0HA 4R0KA 1GBRA 3RNJA 4EIKA 1ABQA 2DVJA 1CKBA 4F16A 2DA9A 4JPBW 1BU1A 1M27C 1VA7A 2W0ZA 5EC7A 1N5ZA 2EYXA 1SPKA 1VYVA 2DMOA 4LNPA 4J9EA 3UA7A 2EKHA 4DEXA 4JJCA 2KE9A 2KYBA 3VS1A 2EW3A 3VS4A 1V1CA 2YUNA 1UHFA 1GCPA 3NMZC 4GBQA 4OMQA 1K0XA 4CC3A 2A08A 4J9HA 1WXUA 1K9AA 2CSIA 4J9CA 4J9FA 1AWWA 1K4US 2C0OA 1BK2A 3NGPA 4JJDA 1UG1A 2RQUA 2LQWA 2DLPA 2FO0A 1UECA 1ZUYA 4HVVA 2M51A 1QCFA 3I5SA 2YUOA 2VKNA 3M0TA 1LCKA 1UFFA 2RQWA 2KROA 1AVZC 4Y92A 2PNIA 1WA7A 2EYZA 2J6OA 2LNHB 4LN2A 2CT4A 1PWTA 2KYMA 3VS2A 3GBQA 1CKAA 4RTYA 2X3WD 3PE0A 4AFQC 2D0NA 4LUEA 1UHCA 2JS2A 3TVTA 2J7IA 2YT6A 1AD5A 1M3BA 2J05A 4K11A 1JXMA 1GRIA 4F14A 2F2VA 1UUEA 2M0YA 3REBB 1Z9ZA 2YUQA 1W6XA 2D1XA 2K3BA 1VYUA 3H41A 2RQRA 1MV3A 2JXBA 2ROTA 1H8KA 2LJ0A 3REAB 3I5RA 5IXFA 1AWXA 1YCSB 1PRLC 1T0HA 2EQIA 1VYTA 1QKWA 1X6BA 3M0QA 2LCSA 1WI7A 2L2PA 2A28A 2G6FX 4AG2C 1MV0B 2EVRA 4ORZA 1GCQA 2ABLA 2RF0A 2EGAA 2FPEA 4JZ3A 1UGVA 1JU5C 3KFVA 2K6DA 3VS7A 2DILA 3A98A 4RTTA 2FRYA 4J9IA 1JEGA 1JQQA 1MUZA 4HVUA 1OPKA 2GGRA 1M8MA 1YWPA 2KGTA 1M3AA 2DL3A 1AZEA 4F17A 2AKLA 3THKA 2D8HA 3H0IA 3TSZA 1A0NB 1E6HA 1ZX6A 5ECAA 2RN8A 2DBKA 3EG0A 2LJ3A 1KSWA 2SRCA 4GLMA 5L23A 1G83A 4AFSC 2VVKA 2J6FA 4RTXA 2CUDA 3I35A 2RPNA 2ECZA 2YUPA 2D8JA 1QWFA 4OMPA 1X2QA 2FPDA 2KR3A 2HBWA 2L0AA 1K0SA 1YWOA 2J6KA 1JO8A 2JW4A 4D8KA 1UTIA 2RQTA 2EBPA 1H92A 1HJDA 1ZUUA 1B3QA 3M0SA 4X1VA 1SRLA 5IH2A 2E5KA 2O9SA 2GQIA 3I9QA 3VS3A 1GL5A 1GBQA 2I0NA 3UATA 2DE0X 4HXJA 2PTKA 1TG0A 2LJ1A 2CUBA 3UF4A 1RI9A 3U23A 2OI3A 2SEMA 3JV3A 2X3XD 2CH4A 4CC7A 1WLPB 2DL8A 2CDTA 3R6NA 4WCIA 2BTTA 2MIOA 2YSQA 1QLYA 1BB9A 4OMNA 2DL4A 2CREA 4FSSA 1AWOA 5IHNA 1HSQA 2KRNA 2K2MA 4OMLA 2K7AA 2AKKA 4ESRA 1I07A 3TSWA 1S1NA 1SRMA 1AZGB 2FEIA 4IIMA 1E6GA 5I11A 1AOJA 2O31A 2DM1A 1BBZA 2KRMA 2FRWA 3VRZA 2DL5A 2H8HA 4Z88A 1YNZA 2JTEA 3EG2A 2FPFA 2AZVA 1NG2A 2LX7A 4RUGA 2RQVA 4OMOA 4E6RA 1Y57A 2V1RA 3VS6A 3QWXX 4J9DA 5IHKA 4OMMA 1WFWA 1K1ZA 1U3OA 2KNBB 1X43A 3M0UA 2C0IA 4ZNXA 4DEYA 2A36A 1G2BA 1TUCA 2DRKA 1NEGA 1ZBJA 1QWEA 2DL7A 1K76A 2ESWA 2RNAA 1JXOA 3EG3A 2EGEA 1PHTA 2DYBA 2DJQA 1GFDA 4RTWA 1OOTA 1WYXA 1OPLA 1XOVA 4LE9A 4QT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B07 A;  1ZLM A;  1NLO C;  1WIE A;  3LH5 A;  1U5S A;  1WDX A;  2O9V A;  4J9B A;  4CC2 A;  1X27 A;  2BZX A;  3NPF A;  3SHW A;  2RMO A;  2P4R A;  1KFZ A;  5HCK A;  1NYG A;  1X2K A;  2GTJ A;  4JZ4 A;  2W10 A;  2DF6 A;  2HSP A;  2YDL A;  1OV3 A;  2FG0 A;  2OJ2 A;  2DBM A;  2AK5 A;  3VS5 A;  2GNC A;  1HD3 A;  2L3S A;  2JMA A;  1FYN A;  4D8D A;  1SHG A;  2HEQ A;  1UDL A;  1NYF A;  1YP5 A;  4J9G A;  2V1Q A;  1NLP C;  3C0C A;  4M4Z A;  5FW9 A;  1SSH A;  4IIO A;  3EG1 A;  2K79 A;  2HDA A;  1PRM C;  2GBQ A;  2JM9 A;  1W70 A;  2KBT A;  4Z8A A;  3NHN A;  2JS0 A;  1EFN A;  2VWF A;  2EYW A;  1I0C A;  2LMJ A;  1TUD A;  2AZS A;  2ROL A;  3UA6 A;  1NM7 A;  2KT1 A;  2C0T A;  3PVQ A;  2MCN A;  4RTZ A;  1J3T A;  2PZ1 A;  2EYY A;  2J06 A;  5IHI A;  1RUW A;  1CSK A;  1UE9 A;  3VRY A;  1AWJ A;  3ULR B;  2DX1 A;  3M0R A;  2L3P A;  1WXT A;  2QDL A;  4JJB A;  1T3L A;  1WX6 A;  1I1J A;  1Z9Q A;  4A63 B;  3ZL7 C;  3PVL A;  1E7O A;  5FWC A;  1YN8 A;  2A37 A;  3VS0 A;  1WXB A;  1RLP C;  2BZY A;  1UJ0 A;  2JT4 A;  4KRT A;  2ENM A;  4AFU C;  2LZ6 B;  1AEY A;  1SHF A;  2DRM A;  2KEA A;  2CSQ A;  3EGU A;  2L3Q A;  3EHR A;  2KT8 A;  1U06 A;  2K9G A;  4HCK A;  2ED1 A;  3SEM A;  2O88 A;  5I22 A;  2F2X A;  2KXC A;  1T0J A;  3FJ5 A;  1PKS A;  2NWM A;  1X69 A;  1QKX A;  3M0P A;  3H0F A;  2F2W A;  3IQL A;  4HVW A;  1RLQ C;  1GCQ C;  2HCK A;  2IIM A;  4CC4 B;  4RTV A;  1M30 A;  3O5Z A;  2KXD A;  1IO6 A;  2MOX A;  1ZUK A;  1FMK A;  2NUZ A;  1T3S A;  1GFC A;  2B86 A;  2EPD A;  1PNJ A;  2XMF A;  4AG1 C;  2LP5 A;  2LQN A;  1ABO A;  1Y0M A;  1KJW A;  2KRS A;  1OEB A;  1NEB A;  2CH4 W;  3EHQ A;  3QWY A;  2JMC A;  1ARK A;  1ZSG A;  5IXB A;  2JM8 A;  1UJY A;  3RBB B;  1KIK A;  1M3C A;  2EGC A;  5FWB A;  4AFZ C;  1H3H A;  1SEM A;  5GJW B;  2O2O A;  4Z89 A;  2DNU A;  4RTU A;  2GTO A;  3CQT A;  1PKT A;  1W1F A;  2BZ8 A;  1X6G A;  5GJV B;  2CT3 A;  4LUD A;  2ED0 A;  2OAW A;  3H0H A;  4R0K A;  1GBR A;  3RNJ A;  4EIK A;  1ABQ A;  2DVJ A;  1CKB A;  4F16 A;  2DA9 A;  4JPB W;  1BU1 A;  1M27 C;  1VA7 A;  2W0Z A;  5EC7 A;  1N5Z A;  2EYX A;  1SPK A;  1VYV A;  2DMO A;  4LNP A;  4J9E A;  3UA7 A;  2EKH A;  4DEX A;  4JJC A;  2KE9 A;  2KYB A;  3VS1 A;  2EW3 A;  3VS4 A;  1V1C A;  2YUN A;  1UHF A;  1GCP A;  3NMZ C;  4GBQ A;  4OMQ A;  1K0X A;  4CC3 A;  2A08 A;  4J9H A;  1WXU A;  1K9A A;  2CSI A;  4J9C A;  4J9F A;  1AWW A;  1K4U S;  2C0O A;  1BK2 A;  3NGP A;  4JJD A;  1UG1 A;  2RQU A;  2LQW A;  2DLP A;  2FO0 A;  1UEC A;  1ZUY A;  4HVV A;  2M51 A;  1QCF A;  3I5S A;  2YUO A;  2VKN A;  3M0T A;  1LCK A;  1UFF A;  2RQW A;  2KRO A;  1AVZ C;  4Y92 A;  2PNI A;  1WA7 A;  2EYZ A;  2J6O A;  2LNH B;  4LN2 A;  2CT4 A;  1PWT A;  2KYM A;  3VS2 A;  3GBQ A;  1CKA A;  4RTY A;  2X3W D;  3PE0 A;  4AFQ C;  2D0N A;  4LUE A;  1UHC A;  2JS2 A;  3TVT A;  2J7I A;  2YT6 A;  1AD5 A;  1M3B A;  2J05 A;  4K11 A;  1JXM A;  1GRI A;  4F14 A;  2F2V A;  1UUE A;  2M0Y A;  3REB B;  1Z9Z A;  2YUQ A;  1W6X A;  2D1X A;  2K3B A;  1VYU A;  3H41 A;  2RQR A;  1MV3 A;  2JXB A;  2ROT A;  1H8K A;  2LJ0 A;  3REA B;  3I5R A;  5IXF A;  1AWX A;  1YCS B;  1PRL C;  1T0H A;  2EQI A;  1VYT A;  1QKW A;  1X6B A;  3M0Q A;  2LCS A;  1WI7 A;  2L2P A;  2A28 A;  2G6F X;  4AG2 C;  1MV0 B;  2EVR A;  4ORZ A;  1GCQ A;  2ABL A;  2RF0 A;  2EGA A;  2FPE A;  4JZ3 A;  1UGV A;  1JU5 C;  3KFV A;  2K6D A;  3VS7 A;  2DIL A;  3A98 A;  4RTT A;  2FRY A;  4J9I A;  1JEG A;  1JQQ A;  1MUZ A;  4HVU A;  1OPK A;  2GGR A;  1M8M A;  1YWP A;  2KGT A;  1M3A A;  2DL3 A;  1AZE A;  4F17 A;  2AKL A;  3THK A;  2D8H A;  3H0I A;  3TSZ A;  1A0N B;  1E6H A;  1ZX6 A;  5ECA A;  2RN8 A;  2DBK A;  3EG0 A;  2LJ3 A;  1KSW A;  2SRC A;  4GLM A;  5L23 A;  1G83 A;  4AFS C;  2VVK A;  2J6F A;  4RTX A;  2CUD A;  3I35 A;  2RPN A;  2ECZ A;  2YUP A;  2D8J A;  1QWF A;  4OMP A;  1X2Q A;  2FPD A;  2KR3 A;  2HBW A;  2L0A A;  1K0S A;  1YWO A;  2J6K A;  1JO8 A;  2JW4 A;  4D8K A;  1UTI A;  2RQT A;  2EBP A;  1H92 A;  1HJD A;  1ZUU A;  1B3Q A;  3M0S A;  4X1V A;  1SRL A;  5IH2 A;  2E5K A;  2O9S A;  2GQI A;  3I9Q A;  3VS3 A;  1GL5 A;  1GBQ A;  2I0N A;  3UAT A;  2DE0 X;  4HXJ A;  2PTK A;  1TG0 A;  2LJ1 A;  2CUB A;  3UF4 A;  1RI9 A;  3U23 A;  2OI3 A;  2SEM A;  3JV3 A;  2X3X D;  2CH4 A;  4CC7 A;  1WLP B;  2DL8 A;  2CDT A;  3R6N A;  4WCI A;  2BTT A;  2MIO A;  2YSQ A;  1QLY A;  1BB9 A;  4OMN A;  2DL4 A;  2CRE A;  4FSS A;  1AWO A;  5IHN A;  1HSQ A;  2KRN A;  2K2M A;  4OML A;  2K7A A;  2AKK A;  4ESR A;  1I07 A;  3TSW A;  1S1N A;  1SRM A;  1AZG B;  2FEI A;  4IIM A;  1E6G A;  5I11 A;  1AOJ A;  2O31 A;  2DM1 A;  1BBZ A;  2KRM A;  2FRW A;  3VRZ A;  2DL5 A;  2H8H A;  4Z88 A;  1YNZ A;  2JTE A;  3EG2 A;  2FPF A;  2AZV A;  1NG2 A;  2LX7 A;  4RUG A;  2RQV A;  4OMO A;  4E6R A;  1Y57 A;  2V1R A;  3VS6 A;  3QWX X;  4J9D A;  5IHK A;  4OMM A;  1WFW A;  1K1Z A;  1U3O A;  2KNB B;  1X43 A;  3M0U A;  2C0I A;  4ZNX A;  4DEY A;  2A36 A;  1G2B A;  1TUC A;  2DRK A;  1NEG A;  1ZBJ A;  1QWE A;  2DL7 A;  1K76 A;  2ESW A;  2RNA A;  1JXO A;  3EG3 A;  2EGE A;  1PHT A;  2DYB A;  2DJQ A;  1GFD A;  4RTW A;  1OOT A;  1WYX A;  1OPL A;  1XOV A;  4LE9 A;  4QT7 A; 
#chains in the Genus database with same CATH topology
 1NLO C;  5CKF A;  4UP8 A;  2Z0W A;  4RKB A;  2RI3 A;  1O7I A;  4J9B A;  4A4G A;  3CCR Q;  2C9O A;  1CHQ D;  4M77 D;  4FW2 A;  1R9T B;  2RMO A;  2P4R A;  1KFZ A;  2KCT A;  5FO7 B;  4DGZ A;  4FF4 A;  1S5E D;  1X2K A;  2GTJ A;  2V8K A;  4JZ4 A;  3AFP A;  4A3J H;  2DYI A;  2HSP A;  1K9M C;  3CQZ H;  3PV0 A;  1VQN T;  1WTW A;  3VS5 A;  1EY6 A;  4C92 A;  2GNC A;  1HD3 A;  1CZW A;  2FJ2 A;  1X9N A;  3S15 B;  4J7I A;  1PRT F;  3BYY B;  3FIF A;  4MMK A;  2J7Z A;  4ZQ3 A;  3J81 E;  1M1G A;  4M7D F;  1BF4 A;  1UDL A;  1EY7 A;  5I2S A;  5LJ5 e;  5AJ3 L;  4K0K L;  1UUP A;  3H09 A;  2IX1 A;  1EWC A;  5GAN g;  4KY7 A;  1XPO A;  4JI7 L;  1SSH A;  3EG1 A;  3NBI A;  4HJA A;  2K79 A;  2HDA A;  2EYL A;  4F7U G;  2GBQ A;  2JM9 A;  2L8D A;  4E7Z A;  5I21 A;  2KY9 A;  3LH0 A;  1YJW Q;  1CT1 D;  1YIT T;  2VWF A;  2PVO B;  4C8Q E;  2LMJ A;  1F2M A;  1SND A;  4CKC A;  2HL5 C;  3V05 A;  2XRS D;  5IGG A;  1KL9 A;  3VR4 A;  4OWT B;  3PVQ A;  3MEV A;  1TWG H;  5J1Z A;  4X65 L;  3T56 B;  4BY7 G;  1JJ2 S;  2MCN A;  4RTZ A;  3CCJ Q;  2PZ1 A;  1J3T A;  2EYY A;  2Z1C A;  3VR6 A;  2J06 A;  4HIM A;  2Q2U A;  1QCN A;  2K75 A;  3X3M A;  4DV5 L;  1U4P A;  5IGB A;  1XMQ L;  2IPK D;  1G29 1;  1LT4 D;  3JB9 F;  4DAP A;  4A93 H;  1HYO A;  1STE A;  2QG9 B;  1CSK A;  2F0U A;  2MJ8 A;  4JI4 Q;  5M3F B;  2KHS A;  2B2U A;  3CCL T;  5KYU A;  2R3Z A;  1KAA A;  4DBF A;  1G2T A;  1GXI E;  1PFS A;  3M4Q A;  4J6H A;  3S2D B;  5CQY A;  2E74 C;  1HNX Q;  1Q81 R;  3BVG A;  1BCP F;  1HK9 A;  1OTC A;  3QZ5 B;  3GF5 A;  3KF6 A;  3I90 A;  2QTX A;  3AT1 B;  3TQ7 P;  4HCC A;  1X32 A;  1Z7T A;  1JB3 A;  3EAE A;  4M78 A;  4KD3 A;  1ML0 D;  4A4I A;  1VMC A;  2K4K A;  4BB7 A;  4JI5 Q;  3V7R A;  1ZSZ C;  1D3B A;  1I1J A;  1GUG A;  2R57 A;  1IW7 D;  3ZL7 C;  5FWC A;  5C44 H;  4WJW A;  2LT1 A;  2RJC A;  2O5I C;  2NLU A;  4KGV B;  1VOM A;  2YRD A;  4WOR A;  2JT4 A;  2AT1 B;  2LZ6 B;  4IUU A;  3G6E A;  1X65 A;  1AEY A;  2CVR A;  2VW9 A;  1RAA B;  2DRM A;  2PUO B;  3DHQ A;  3M57 A;  1F9Q A;  3GTK B;  2AQ2 B;  1Y1W G;  2G9H D;  4IN3 A;  3RMH A;  3LGL A;  2L3Q A;  1C7Y A;  2KT8 A;  1WFQ A;  2E3H A;  2OQ0 A;  1R0C B;  2O88 A;  4OO1 G;  2E2H B;  4XAX B;  4X66 Q;  3HOV H;  3HRS A;  3FJ5 A;  1W2B P;  1PV4 A;  4EMK C;  5IN1 A;  3L2U A;  5JJZ A;  4YHH Q;  1VQB A;  3FPP A;  2NUT A;  4YWL A;  2XVS A;  3OWE B;  1U1T A;  5EBD A;  1PH9 A;  1JB7 A;  2K52 A;  2CP3 A;  3M3Y H;  3Q6S A;  2FHD A;  2ZPH B;  2RHY A;  3AHU A;  1BO0 A;  4UDU C;  4F7U B;  2XIC A;  4RTV A;  2ENB A;  3PUW A;  5AYF A;  1M30 A;  4R4T A;  4HCB A;  3BU2 A;  1OX8 A;  3JCM h;  2LSS A;  3LGJ A;  1FMK A;  1MSH A;  2EJM A;  2DY7 A;  4I65 A;  2NUZ A;  1PFM A;  1T3S A;  1QVG S;  1GFC A;  5FJ8 H;  3L3O C;  1CI3 M;  4BY7 B;  2COZ A;  4JK1 C;  1NTG A;  1K28 A;  4F04 B;  5C0X H;  5JVH 3;  2HQX A;  3CC7 T;  1R9T H;  2V4D A;  2QTV A;  2PU9 B;  2L89 A;  1O80 A;  5CBA E;  2KRS A;  1T5E A;  3SEB A;  3MWY W;  4AQY L;  5K36 H;  1Z47 A;  1WJQ A;  2JEB I;  1PZK D;  3IL8 A;  2VGM A;  4DPG A;  4HT9 A;  2MQH A;  1LTL A;  1ARK A;  5IYC G;  3GNF B;  1YI2 T;  2ICE C;  3AEV A;  4XU1 A;  5IXB A;  1PTO C;  2E12 A;  4KGX B;  5M5W B;  2FMC A;  1V1Q A;  3S15 H;  3TU4 K;  4CDF C;  2JM8 A;  1QCO A;  5CKE A;  1EZ6 A;  1SYC A;  3OW2 A;  2LFN A;  1M3C A;  3MFY A;  4K5W A;  3OTO Q;  1EYG A;  4JI6 L;  4IUT A;  3RER A;  2A69 D;  3SWN A;  2CP2 A;  1QVF S;  1WOC A;  4GN5 A;  4ZAI A;  1ZSZ B;  3HSB A;  2DNU A;  2E10 A;  1CTM A;  4LAA A;  3KDF B;  1IGQ A;  3QDR B;  5GAM e;  1YNN C;  1DOK A;  4L5S A;  1X6O A;  5IGF A;  1PVO A;  1ET6 A;  4KKS A;  1SJE D;  4GKK L;  4Q5V A;  2TSS A;  5GAO q;  5IP7 G;  5M3M B;  2X4W A;  4LUD A;  3K80 C;  3G6E Q;  1TII D;  1LTI D;  5E7N A;  4A76 A;  1YVC A;  3RKX A;  1JT8 A;  1GBR A;  1PSE A;  4EIK A;  1Y1W B;  4IUN A;  4LWC A;  5FRN A;  3QHS A;  2IPO B;  2CZ7 B;  3MEU A;  2DVJ A;  5FU6 C;  3CCS T;  1SE4 A;  2XSC A;  1CKB A;  3D6W A;  4F16 A;  3MXU A;  1EU4 A;  2DA9 A;  1K83 B;  1EZZ B;  1BU1 A;  3OOC A;  3E9G A;  1ICW A;  3I4L A;  1L1O C;  4EMK B;  1PD0 A;  1EOT A;  5LJ3 e;  2PI2 E;  2BE5 D;  1N5Z A;  1RAF B;  3V7C A;  2DVE A;  3QSU A;  1BUV T;  5M3F H;  1D1B A;  2DMO A;  3MKD A;  4LNP A;  1PRT D;  2KQ3 A;  3JAM E;  3UA7 A;  1TH7 A;  2DXU A;  3CCR T;  3PTA A;  4M7D D;  1PZJ D;  3S2D H;  4JJC A;  2K5L A;  2JA6 B;  3VS1 A;  3OHX C;  4EPC A;  3CCV A;  4GOP A;  4KGZ B;  1D1C A;  3JB9 I;  2IX3 A;  5JPN C;  3TCJ A;  4GBQ A;  4PJO E;  1K0X A;  2DIQ A;  2LTO A;  2A08 A;  4RHS A;  4C8Q D;  3CCQ T;  2AHO B;  1K9A A;  1Q8K A;  1AWW A;  4H0L C;  4F8M A;  3DWA A;  2C0O A;  1D5X C;  3G48 A;  2O4X B;  4JVZ A;  2FZG B;  4JJD A;  4DR6 L;  1C9O A;  2RBM A;  2PVD B;  4FXK C;  1FJG Q;  2HSE B;  2SNM A;  3KJP A;  2M51 A;  1QCF A;  1WTX A;  3I5S A;  4M78 C;  2F0V A;  3K7U C;  1IBL Q;  3GTK H;  1AH9 A;  2WB1 B;  5I9O A;  4PJJ A;  2OTJ T;  2QDY B;  3TME A;  3FEW X;  1GHJ A;  2JJ9 A;  1PTO B;  3CD6 A;  2NBF A;  2RF4 A;  1M2V A;  5FLX L;  3ULP A;  2RQW A;  4PJL A;  2E2H H;  1HHV A;  2DTO A;  4JCV E;  3K58 A;  2EYZ A;  2QEX A;  5J3B A;  4BDZ A;  3GTO B;  1RAI B;  1R4P B;  4ABN A;  4DA2 A;  1XMO Q;  1EX4 A;  1PWT A;  4RH6 A;  2R7F A;  1CKA A;  2F1M A;  1QCB D;  2KCM A;  4A3G G;  1S5C D;  4X64 L;  1M1F A;  3VU3 C;  2A1A A;  2MAM A;  1QWY A;  2EE1 A;  2PQA A;  3U4Z A;  2JA5 G;  1XPU A;  4OEM B;  1IBM L;  2FYK A;  3TVT A;  3ULJ A;  2J7I A;  3GTJ B;  2YT6 A;  3DLM A;  4DV1 Q;  1VQI A;  3H3V C;  1IGU A;  3CW2 C;  3RKW A;  4F14 A;  1DCZ A;  2E64 A;  1UUE A;  1YIJ A;  1PDQ A;  2D1X A;  4BY7 H;  3MHB A;  5FU6 B;  4JYA L;  1SMY D;  3FPU B;  4MZP A;  1B3A A;  5IE8 A;  3V7S A;  1O7L A;  1LT5 D;  2E41 A;  2VYT A;  2GCX A;  1L1O B;  2F0G A;  2RQR A;  3EJI A;  1A63 A;  3UPU A;  2JXB A;  4DR5 Q;  1TXY A;  4MTN A;  4DBR A;  1MD2 D;  3FDR A;  3REA B;  2K3X A;  3BDL A;  1QKW A;  2YV5 A;  5D7U A;  2VXE A;  1C1A A;  3A8O B;  2N55 A;  2PVG B;  2A28 A;  1MIU A;  3M4P A;  3P75 A;  5M5W H;  2I2L A;  2RF0 A;  3G7Z A;  2XDB A;  4RGM A;  2JA7 B;  2WIN B;  4NP5 A;  1JU5 C;  2RHI A;  2IL8 A;  2K6D A;  2PMZ E;  3FRP B;  3CCV Q;  1EQR A;  4LFC Q;  2MK5 A;  3ERS X;  1PYS B;  1CHP D;  1H9R A;  3QOL A;  2Z4I A;  3DWQ A;  2H3J A;  5CBE E;  1ASZ A;  2GN5 A;  2A8V A;  5GAN 7;  2CGH A;  3THK A;  5IT9 c;  4JI1 L;  2B2Y A;  2DD5 A;  2TMP A;  4LF6 L;  1Q95 G;  1WHJ A;  1VS0 A;  4O42 A;  3MA2 B;  3KF6 B;  2QAS A;  5M3M H;  3S14 B;  2OXP A;  3J80 c;  4DUY Q;  4M78 B;  3SWN C;  5LJ5 f;  4BD3 A;  1K8M A;  2RSO A;  3GV3 A;  3JCM c;  3TBI B;  1H9J A;  4YCV A;  2LCL A;  1OU8 A;  4Q5W A;  1Y1W H;  1R77 A;  4J6X A;  4DBQ A;  2VVK A;  2B2V C;  1OXX K;  2ZTC A;  1J8I A;  1OXV A;  3KF8 B;  1HZ9 A;  3HOW G;  4RTX A;  2CUD A;  1K83 H;  4CHT B;  3S1Q B;  4OO1 H;  3I35 A;  2M02 A;  1GD7 A;  3CD6 Q;  3ER0 A;  3I4N B;  1Y96 B;  1HNZ L;  5GMK m;  4NMZ A;  1SG5 A;  2JNG A;  2QEX Q;  4HR7 B;  2FPD A;  4XIG S;  4BI4 A;  1JR0 D;  2L0A A;  2VXW A;  1EFW A;  7AT1 B;  2JW4 A;  2OT2 A;  2P0P A;  2YXY A;  2BDN A;  2JA6 H;  4A3G B;  4JI4 L;  1HJD A;  2DK3 A;  3A7L A;  2XDP A;  3SK5 A;  5DAU A;  3L9A X;  1BIB A;  4R4I A;  2KOL A;  2PO4 A;  4X1V A;  4ZGD B;  5IH2 A;  1VQM T;  2XWJ B;  1X75 C;  1PTO F;  5I9P A;  3T13 A;  2NUT B;  2O9S A;  1GL5 A;  2DFU A;  3STB C;  2ASB A;  3OYJ A;  2RH2 A;  1BXT A;  4A4K A;  3I91 A;  2EQS A;  2ID0 A;  2PTK A;  2VC8 A;  3LX7 A;  4JUV A;  1YIJ Q;  1TWC B;  1MSG A;  4DOV A;  1GUN A;  4GOP C;  1RL2 A;  2CW0 C;  1D0Z A;  2YLC A;  2JYO A;  4K2K A;  2CUB A;  2EQM A;  1N8R C;  1VF7 A;  1YIT A;  4BE2 A;  1RI9 A;  2OI3 A;  2UU9 Q;  3E9H A;  3GIB A;  1PTO H;  3MJX A;  2DL8 A;  3JRZ A;  1RIP A;  5IYC H;  2DKG A;  4NDX A;  2IT1 A;  1H95 A;  3OYA A;  2NN6 I;  1WJR A;  2JK8 A;  5C5M A;  2WV6 D;  3GTO H;  4PLI A;  2BTT A;  3KXT A;  1BIA A;  1SKU B;  2RVL A;  4JI3 Q;  2XI9 A;  2ZPB B;  2YSQ A;  5KE2 A;  1JRI A;  1Y71 A;  4OMF B;  5IAY A;  1SNO A;  2RQX A;  4X66 L;  1X54 A;  1E0B A;  2DL4 A;  1WJS A;  3ULL A;  1ZBX A;  2QF7 A;  4A4E A;  2RD1 A;  3EFS A;  1Q86 R;  2MMP A;  2WSE E;  3A8M B;  4YHH L;  1ILP A;  1XMQ Q;  1V29 B;  1WHG A;  2EQU A;  3UDC A;  5C0M A;  1EL0 A;  3QJ6 A;  3GTJ H;  3RZO B;  2PW5 A;  4AYB E;  3QO2 A;  3QDF A;  3T1Y Q;  3GO5 A;  3SWN B;  1IXD A;  5IP7 H;  2RA4 A;  3WDN A;  2CZ1 B;  4XU3 A;  1KAW A;  4JS4 A;  3GTM B;  1SNP A;  1C0M A;  3HG9 A;  5CV5 A;  1FVI A;  1XPR A;  4C0Z A;  4E7S A;  1JBM A;  2GVA A;  1BBZ A;  1VQL T;  2FRW A;  4UC4 A;  1IXR A;  2WFW A;  4GN3 B;  3GTQ B;  2KVM A;  2PUK B;  2JZ2 A;  2QQA A;  3BZK A;  2DL5 A;  4X3K A;  4A3J G;  3HOW B;  2H8H A;  4Z88 A;  1B1Z A;  1YNZ A;  1TWB A;  2A68 C;  4ZYS A;  1MMN A;  4OHJ A;  1S40 A;  2GFU A;  1S5F D;  1IB8 A;  2LX7 A;  4H13 C;  4RUG A;  4GZY C;  5FRO A;  3PQI A;  4A4F A;  4OMO A;  1BI2 A;  3QYG B;  2BE7 D;  1KQS P;  1Y57 A;  3SK6 A;  4X62 L;  1NJI C;  2NZO A;  2F5T X;  4KTA A;  3JCM b;  1RKN A;  4M78 F;  2Z6B A;  3JB9 J;  3FRN A;  1P16 A;  2JA7 H;  1WTR A;  5CV9 A;  4LF7 Q;  1KLG D;  3KLW A;  3NSW A;  2FL7 A;  2QCP X;  1VQ8 T;  1U3O A;  3NPP A;  2B63 B;  1WCM G;  2FFK B;  3EH1 A;  2D6F A;  4E6I A;  1VQK T;  1HTL D;  3RD4 A;  1QNU A;  3G1J A;  2C0I A;  2KVQ G;  4ZNX A;  4M7A A;  1DD2 A;  5CV8 A;  3K6O A;  2KEE A;  3MO8 A;  2BDO A;  4B3T Q;  2LMC B;  5EKI A;  2KCN A;  4GOP B;  4JLG A;  1G2B A;  4FNF A;  2Q8T A;  3M55 A;  3S14 H;  3S17 B;  2RCF A;  2DET A;  5IWA Q;  4M77 E;  2BH2 A;  2E65 A;  1HZB A;  2KJX A;  1E7Z A;  1YHA A;  1JMC A;  2NVQ B;  1YCY A;  1QVC A;  1JOR A;  1K76 A;  2CZ6 B;  3R8B A;  2F0E A;  2RNA A;  2DGY A;  4DU9 A;  1JXO A;  2K2V A;  2EDG A;  4TVA B;  3A54 A;  5GAM f;  4BE1 A;  1H64 1;  2EAY A;  1YIT Q;  4LK1 C;  1DXM A;  3KYH C;  3S1Q H;  4WJ4 A;  1KC8 U;  2DEQ A;  2AUJ D;  4R8I A;  1OOT A;  4N9T A;  1OPL A;  3I4N H;  5CV4 A;  3G4S A;  4UPA A;  3OWF A;  2Q8I B;  2DAQ A;  1WIE A;  2PQE A;  1U5S A;  3A8L B;  3NQT A;  1WDX A;  1KD1 C;  2O9V A;  3CC7 A;  3E2U A;  4CC2 A;  4HJ7 A;  1KC8 R;  2F3W A;  2EOT A;  3DWP A;  2BZX A;  2ZJP A;  5CC4 A;  4K5V A;  4A3G H;  1M2V B;  1E1T A;  3SHW A;  1LLR D;  1A8V A;  2F0J A;  2MFI A;  3JB9 G;  1VQA A;  2OQK A;  3OYD A;  1JWU D;  3MEA A;  1NAP A;  3HOZ B;  3X28 B;  2K5H A;  2W10 A;  5LJ3 f;  2WSF E;  1YI2 A;  4ZKB B;  3H3V H;  2NTS A;  3MP1 A;  2YDL A;  2PI2 A;  2Y0S E;  4HMI A;  5EG2 A;  3H15 A;  3HKZ G;  2DBM A;  1H3Z A;  2L3S A;  1OQK A;  1EYD A;  3A8K E;  4L6T B;  2JMA A;  2MYS A;  1XJV A;  1FYN A;  2M0O A;  1TXQ A;  1RAC B;  5GAE C;  1GM5 A;  1TWC H;  1UWV A;  4LDY A;  3CCV T;  3MZ5 A;  1D5M C;  2E5L Q;  2EYF A;  2JEA I;  1NYF A;  1W2B A;  1QE6 A;  1IZ6 A;  5BN4 A;  1YP5 A;  2V1Q A;  1WHH A;  1NLP C;  4MDW A;  4IIO A;  4PFP A;  1EWI A;  2CFM A;  3CF5 A;  3HOV G;  1VQJ A;  1STB A;  2X51 A;  2KBT A;  3NHN A;  1YEZ A;  2PYK A;  2JS0 A;  2OAU A;  4KUL A;  1FJG L;  3M4O B;  4R4C A;  1XYI A;  4OON A;  2N88 A;  1TUD A;  2AZS A;  1IBL L;  4ZGJ B;  2DTH A;  2ROL A;  3UA6 A;  1M90 C;  1FNW A;  2NUP A;  3CCS A;  2BH8 A;  4XTX A;  1S3O A;  3GP7 A;  2HKN A;  2EIF A;  2I5H A;  3I4M H;  1MNE A;  1WCM B;  1UEA B;  5ELC A;  4A3C H;  1TTH B;  3OSV A;  3TP8 A;  3VA5 A;  3S1N B;  2KI7 A;  4GN4 B;  2IW3 A;  4XTU A;  1PTO D;  5DM7 3;  1D09 B;  3Q1J A;  5IHI A;  3OS2 A;  2NWG A;  4YY3 Q;  4DR4 Q;  4A3I B;  3OW2 S;  4EQO A;  1XMO L;  2QYZ A;  3J7A F;  3HZX A;  3RZO H;  3CCR A;  1M9S A;  1A15 A;  1UE9 A;  1CZG A;  2DY8 A;  3TS2 A;  1HRJ A;  5ELN A;  2MWP A;  5KYW A;  4X3S A;  4LNQ A;  2YRC A;  1EQT A;  2G9D A;  3GTM H;  5ISR A;  2DX1 A;  3CXC A;  4OF1 A;  2X6L A;  3M0R A;  1IRE B;  3ND8 A;  4KN4 C;  5JPM C;  2L3P A;  3GTQ H;  5K36 G;  1WXT A;  4RKU E;  2UUC Q;  3CCQ A;  3HOW H;  4F7X A;  3I7F A;  2YU9 B;  4NXN Q;  1I81 A;  2F0N A;  4RCC A;  2WKD A;  2QDL A;  1R0B G;  4JJB A;  1T3L A;  4ODG A;  1WX6 A;  4EMG A;  2R58 A;  4IO9 A;  3G4S Q;  3PVL A;  1E7O A;  4X3U A;  5ELF A;  1EQQ A;  1YIJ T;  3S16 B;  3NHH A;  4FP5 D;  4DR5 L;  1X3G A;  2E2J B;  3A55 A;  3CC7 Q;  1HNW Q;  1UGP B;  4PLL A;  3J7A V;  4AFU C;  2ENM A;  1HUM A;  4KMU C;  3P20 A;  5GAN 3;  1Q7Y R;  5AT1 B;  2OTJ A;  3F8T A;  4DR1 Q;  4BWG B;  2EQJ A;  2B63 H;  5CR2 A;  3NFC A;  2OTL T;  2KEA A;  3EGU A;  2DXC A;  3FKI G;  3SD4 A;  1U06 A;  2K9G A;  2PQW A;  3CBP A;  2ED1 A;  4M75 E;  2BIV A;  1YI2 Q;  2WP8 J;  3N52 A;  3GTL B;  1HH2 P;  1STN A;  4E47 A;  3HKZ B;  2HCI A;  4OGE A;  4AMC A;  3NWT A;  4JI2 Q;  4A4H A;  4LFC L;  2B3G A;  2COW A;  4LF8 Q;  1PKS A;  2NWM A;  2VL6 A;  1X69 A;  3S17 H;  1I5L A;  4DV0 Q;  1QKX A;  4H7B A;  1VIE A;  3M0P A;  3H0F A;  1M2O A;  3JCM P;  2F2W A;  1Q8I A;  4KJN A;  1S4Z A;  4DNR B;  2NVQ H;  3A74 A;  3IQL A;  2ZAE A;  4FIB A;  4M7A G;  4K8J A;  3UDX A;  5DEH A;  1OI1 A;  1GCQ C;  1WHM A;  3VR2 A;  2IIM A;  4M7A C;  2Q2I A;  4CC4 B;  4DUY L;  4JJN K;  2K5I A;  5C6S A;  4UHV A;  3PO3 G;  4ZGE B;  3L2Z A;  1K73 C;  1K9M R;  2EY1 A;  1TQO A;  3VUB A;  4RFB A;  1ZUK A;  4N9P A;  4DUZ Q;  4XYQ A;  2QQR A;  2K14 A;  1M1K U;  3T16 A;  1PNJ A;  5D6X A;  3CCS Q;  2SEB D;  2XMF A;  2XWB B;  3PMT A;  3B6Y A;  4KK7 A;  3H3V I;  1G3W A;  1KDB A;  3BG3 A;  1ACM B;  1QG7 A;  2JSO A;  2R92 G;  3QR8 A;  1OXS C;  3X26 B;  4HCS A;  2KUM A;  2X4X A;  3NTH A;  3HOZ H;  1HCZ A;  2ZJQ A;  2A5H A;  4WTO B;  1EEF D;  1H9S A;  1TS5 A;  1FGU A;  3EHQ A;  3QWY A;  4BUG A;  3SB2 A;  3PIP A;  4E7I A;  3M54 A;  3L1A A;  2V8J A;  1G3T A;  3RLO A;  2QXF A;  2X4Y A;  2RI5 A;  3L2V A;  4APV A;  1N9R A;  3VYG A;  1F1B B;  1EYA A;  1W6J A;  1I6V C;  3LWU A;  1UJY A;  2XID A;  1EUJ A;  4IOC A;  3U9S A;  2RHX A;  1IRX A;  2HQL A;  2M9V A;  4ILW A;  1EU3 A;  2EYP A;  4RGT A;  1H3H A;  3M7N A;  1X3F A;  1OX9 A;  2HCC A;  1FL0 A;  3E0J A;  3MEH A;  3CCQ Q;  1UGR B;  1SE3 A;  4BY6 C;  1N27 A;  5E3F A;  1K8A C;  4Z89 A;  3F2U A;  4LW1 A;  4QJF A;  3QZ9 B;  1I4P A;  2AQ1 B;  1ZHI A;  2GTO A;  1G8X A;  2NVY B;  4KLK A;  1SYG A;  1JQY D;  4S3S A;  4JI1 Q;  3CCU A;  1PKT A;  1W1F A;  3E9F A;  1KNE A;  2NN6 G;  4YCW A;  3V96 A;  4L5Q A;  4LF6 Q;  3M4O H;  3I8Z A;  1MI2 A;  2X9H A;  5GJV B;  4M7D E;  2CT3 A;  3L2Q A;  2UU9 L;  4MZM A;  2ED0 A;  2CQA A;  5HK0 A;  2OAW A;  3OBW A;  2OTJ Q;  1WCM H;  3RNJ A;  3S6W A;  1FNU A;  4NW2 A;  4KHZ A;  3OYI A;  3S1N H;  1X55 A;  2J4X A;  3FKI B;  4MN3 A;  4NB3 A;  3JCM g;  1H9K A;  2F4I A;  2FHT A;  3K5L A;  4DR2 Q;  3TN2 A;  2NYS A;  2K5F A;  1DOM A;  5GAO m;  4WJ3 M;  4A3I H;  1M27 C;  1VA7 A;  2FMM A;  4JI3 L;  3D4W A;  3SFM A;  5EC7 A;  2RJD A;  2DNC A;  2YTY A;  3DM1 A;  1SPK A;  3CC2 T;  1YJ9 A;  5IT9 E;  3URG A;  3S3O A;  4UY8 C;  2I0Q A;  2ZPE B;  1KHC A;  1KK7 A;  1EWH A;  1NMF A;  2F52 A;  4POF A;  1NBW A;  4A3F G;  1TU0 B;  4DEX A;  4M7A B;  3J80 E;  4P73 A;  2EW3 A;  1VQM A;  5G3L F;  3T1Y L;  3T53 B;  3VS4 A;  1Q81 U;  2K04 A;  3NMZ C;  4OMQ A;  3DEO A;  4CC3 A;  1STY A;  2YU9 H;  3PO3 B;  2R6G A;  3EQL C;  3HHT B;  3RUX A;  3P8B B;  3D8G A;  1B34 B;  2Y4X A;  4J9C A;  4J9F A;  3J81 L;  1NR4 A;  3CEY A;  1G2S A;  1K4U S;  1BK2 A;  2JN4 A;  3I2Z A;  5EBC A;  2H3E B;  2Z6K A;  3S16 H;  1MGQ A;  5GAO p;  1SBB B;  2E2J H;  1PH6 A;  4IAL A;  2DER A;  1BCM A;  4CBV A;  1XWE A;  1ZUY A;  2P0K A;  4XTZ A;  5I2M A;  4HVV A;  3JB9 H;  1TR5 A;  2R92 B;  1OU9 A;  4EMH A;  2JA8 G;  2F3V A;  2YUO A;  3WVE B;  2D5D A;  2XN9 C;  1I6H B;  1I4X A;  3CRK C;  1BR9 A;  1Y07 A;  4MZ9 A;  2N78 A;  5KND A;  3M0T A;  2DJF C;  3GP8 A;  1VQG A;  1WI5 A;  3GTL H;  5M3M G;  4LF7 L;  5GMK e;  4A3D G;  4CI0 C;  4IQZ A;  3F2B A;  4QW2 A;  1D5Z C;  3PF4 A;  2PNI A;  2P84 A;  1HPC A;  4LN2 A;  3I3C A;  3JCM X;  3K5N A;  2CT4 A;  1VQ7 T;  2G3R A;  3F1Z A;  4NXM Q;  1EFI D;  3QO3 A;  2KYM A;  4BY6 B;  1MJC A;  1F9R A;  2KSS A;  1BQQ T;  2E75 C;  4B3T L;  2IJ0 A;  2F0W A;  5A2Q E;  1UE5 A;  4PV1 C;  3STB D;  1QP2 A;  1U1S A;  3PE0 A;  4AFQ C;  1SR3 A;  3M5A A;  1LTR D;  2DN8 A;  4IPG A;  2UUB Q;  3FP9 A;  3DB3 A;  3V8L A;  4OIJ A;  5ELD A;  1ENC A;  2BUD A;  2F0I A;  5IWA L;  1K8G A;  4GLA C;  3W2D A;  3I70 A;  1AD5 A;  2WAQ E;  1N9W A;  3CCU Q;  1M3B A;  4X3T A;  2FZC B;  3SXH A;  2K50 A;  1JXM A;  5IYD H;  1VQL A;  2F2V A;  3S24 A;  4N8X 1;  3RZD H;  2JA6 G;  3HL8 A;  4ZCK A;  1V1P A;  1JJC B;  4DNI A;  3J7A 5;  2K3B A;  4M77 A;  4E7L A;  1W6K A;  3TDQ A;  3CPW A;  1VQD A;  2N49 A;  4FXD A;  1EY5 A;  4M75 D;  4X9D A;  3WWV A;  2ROT A;  2CZ0 B;  1H8K A;  4RKL A;  1G6Z A;  4QUF A;  4JI0 Q;  1YCS B;  1PRL C;  2EQI A;  2LCS A;  1X6B A;  3OS0 A;  2NUP B;  2VGN A;  1QIL A;  4C3I G;  2QKI C;  3G4S T;  1WI7 A;  2QGF B;  1EIH A;  2L2P A;  1GUO A;  1YJ9 Q;  4QQG A;  2IHE A;  2NYZ D;  4DK6 C;  4A3F B;  1SAP A;  2HDM A;  1EYC A;  2CKK A;  1Y14 B;  4X62 Q;  1VQ8 A;  4N8F A;  2FPE A;  4C5G A;  1TVX A;  1RD9 D;  4JZ3 A;  4DQ2 A;  1YHB A;  4HCZ A;  2WB1 G;  1STH A;  5COY A;  3VS7 A;  1VQK A;  3A98 A;  2HAX A;  1VQM Q;  1I4H A;  1WTH A;  4QB4 A;  2EJ9 A;  5FO8 B;  4TKO B;  4L5R C;  5KYW B;  3PUX A;  4LF9 Q;  2NVY H;  4C5E A;  2D8H A;  5LHY 1;  3H0I A;  5C6A A;  2V1C C;  2CP6 A;  2E5L L;  4A3B H;  1RI0 A;  9ATC B;  3MC0 B;  1ZX6 A;  5ECA A;  1N6A A;  4B3S Q;  4KBM B;  1VUB A;  2RN8 A;  2DBK A;  1UB4 A;  1ENA A;  2QGQ A;  2LJ3 A;  3R6O A;  2I5L X;  1KSW A;  2SRC A;  3CBO A;  1G83 A;  4C92 G;  4M7A F;  3ERO A;  3OYC A;  3ND9 A;  2JA8 B;  4OEL B;  1SEB D;  4C92 C;  2J6F A;  3HFO A;  3FKI H;  2QW7 A;  2HHH Q;  5CV6 A;  3KUP A;  4A3D B;  3HOY G;  3HS0 C;  4CKB A;  1Y8P B;  1SN8 A;  4J8Q A;  1QW1 A;  2D8J A;  1MHW C;  2K1B A;  4QIW B;  4OMP A;  1X2Q A;  4ZTF A;  5FRM A;  2SDF A;  4MHE A;  5H1S E;  3HTR A;  4FDB A;  4DV2 Q;  1K0S A;  2D0Q B;  5COR A;  4YY3 L;  4DR4 L;  4OGQ C;  1KQS A;  1UTI A;  2RQT A;  2EBP A;  1M8V A;  2LDM A;  1SXT A;  1JOO A;  1F77 A;  4KUI A;  5T1G A;  2HBP A;  4FF3 A;  6AT1 B;  3OIP A;  3PO3 H;  2VV5 A;  1Q82 C;  1VCI A;  4XQQ A;  2E5K A;  2V8I A;  4M8A A;  2D62 A;  3I9Q A;  1LUZ A;  4IFD I;  1R8O B;  1CKO A;  1GBQ A;  2E70 A;  3OW7 A;  5DM6 3;  4HJ5 A;  2JA7 G;  2OCE A;  5IOD A;  4CRI A;  1VQL Q;  2OEO A;  4KN7 C;  1IL2 A;  1JJG A;  1QUQ B;  2JTM A;  2RSN A;  4HJ9 A;  4NXN L;  4KY5 A;  5KH6 A;  4QQD A;  3D6C A;  5C5L A;  1ROD A;  2LJ1 A;  3HRT A;  2R92 H;  3A8I E;  4QVZ A;  1LYL A;  3SK8 A;  2B2U C;  2K6A A;  3UWN A;  1SE8 A;  4J5Y A;  1I6H H;  3PIP 3;  2P0Q A;  4LUV A;  1HNW L;  2RA2 A;  1KG1 A;  2CH4 A;  4C3I B;  4B6M A;  3M53 A;  1CK1 A;  4A3M B;  1WLP B;  4ME3 A;  4IPC A;  4M78 G;  4JRP A;  4DR1 L;  5M5Y B;  4E7K A;  3M9Q A;  2HL3 A;  1KAB A;  2EYH A;  3F2D A;  4WCI A;  2AQ3 B;  4JRQ A;  1KDC A;  2YTV A;  1VQ8 Q;  4MTK A;  4LUO A;  2MIO A;  1EQV A;  1K0R A;  3MFG A;  2ES2 A;  3JB9 D;  5GAN e;  1HA6 A;  4F7U E;  1VQK Q;  3P8D A;  5J39 A;  4DAY A;  2VQE Q;  4JI2 L;  1BB9 A;  4DOW A;  4LF8 L;  2CRE A;  4FSS A;  1MMG A;  4FL6 A;  2LXK A;  4CJ1 B;  1HSQ A;  4VUB A;  1FMW A;  5CV7 A;  2RK1 A;  3I4N G;  1HFG A;  4OML A;  3NK9 A;  1SYE A;  3JAM L;  5HY6 A;  2K7A A;  4HMJ A;  4DV0 L;  3SR1 A;  4ESR A;  1F9S A;  1B7Y B;  1GO3 E;  2NN6 H;  2M16 A;  3TSW A;  1BCP D;  1LTB D;  1ZXT A;  1W2B S;  4BY1 G;  3J7Y W;  1SRM A;  4CDC C;  3PNW C;  2HD3 A;  1WTQ A;  4XYO A;  1W4S A;  4C92 B;  4UP7 A;  3VDY A;  2EFI A;  3J81 i;  3C46 A;  3VRZ A;  4KKU A;  5C4X G;  3EG9 A;  2QQB A;  4DAV A;  2PNR C;  2RHS B;  4R8N A;  1G5V A;  1VQF A;  5EGT A;  3OYH A;  1VQ9 T;  4FYD A;  3KUF A;  4JBW A;  4DUZ L;  4FYX B;  4OB1 B;  2JTE A;  4GLK A;  3EG2 A;  4A3K G;  3HOY B;  1KIX A;  4QMG A;  2LNV A;  5FLM H;  5GAO r;  4DF7 A;  2V1R A;  4LJZ C;  2UXC Q;  5EPL A;  4A3F H;  4ME7 A;  4IKF A;  1A62 A;  3QWX X;  4PZ8 A;  2O5J C;  1LPL A;  4OMM A;  1PMR A;  3JC6 6;  2OTL A;  4QCL A;  2H1E A;  3HOX G;  2CS7 A;  3EH2 A;  3JSC A;  5LJ5 d;  4OP0 A;  2EKO A;  4XT1 B;  3UDI A;  1ASY A;  5I2X A;  2KNB B;  3W5O A;  3LYI A;  2XHC A;  4RCN A;  3M0U A;  3NTK A;  4WRD A;  4YWM A;  1OO9 B;  2F0K A;  3V2T A;  3CXC S;  5D6W A;  4DEY A;  2JQO A;  2M2L A;  3HFN A;  1ZYR D;  3E1S A;  3PMF A;  4AIM A;  3QKJ A;  2CYZ B;  1WD0 A;  1V76 A;  3I4M G;  2UXD Q;  4LDX A;  4FYY B;  1NE8 A;  1E22 A;  4U67 3;  2MNA A;  3A5Z B;  4A3C G;  4ALP A;  2LRQ A;  8AT1 B;  5KYU B;  1LTA D;  1RTO A;  4K5X A;  5D14 A;  4HSP A;  1A3T A;  1KTK A;  1SF9 A;  4PG3 A;  3NBH A;  1IBK L;  2JA8 H;  1TWH B;  3P7J A;  3BYT B;  3QIA A;  1EOV A;  5EPK A;  2ZM6 Q;  5KYI A;  1E3P A;  1PHT A;  2DYB A;  2DD4 A;  5D6Y A;  2HIX A;  2V26 A;  2GVB A;  2R5M A;  3PUV A;  4A3D H;  1TSF A;  2IVW A;  2RO0 A;  4OVA A;  3CCU T;  1SFO B;  4JV5 L;  1TY2 A;  1YHQ T;  1UE1 A;  3BDC A;  3ONA B;  4RGO S;  2VB2 X;  1BKB A;  1WVL A;  4QT7 A;  1V1O A;  1D3B B;  1X3E A;  3OIQ A;  4O0A A;  3LH5 A;  2L12 A;  2Z4H A;  3HEJ A;  4DR2 L;  4M7D A;  2Q8R E;  2PW7 A;  4QUC A;  3LWH A;  1X27 A;  1I4K 1;  2BOS A;  1N32 Q;  3M58 A;  1M4Z A;  1YZ6 A;  3NPF A;  2X6G A;  1PM3 A;  1PYW D;  5HCK A;  4J7F A;  1NYG A;  1YJN T;  4A3E G;  3MPU B;  1N8R R;  4C8Q A;  1HNZ Q;  4X9C A;  1N9S A;  1Q46 A;  2B29 A;  2DF6 A;  3D4D A;  4IUR A;  3MP8 A;  4BY1 B;  2LX9 A;  3HOU B;  3OYF A;  1YJ9 T;  2FG0 A;  2QQ9 A;  2OJ2 A;  3VV0 A;  2AK5 A;  3CHB D;  2B63 G;  2EYQ A;  5C4X B;  4Q0F A;  2JVV A;  3OYL A;  2AHJ B;  1SHG A;  2HEQ A;  3U9O A;  4ZUJ A;  1V8Q A;  4J9G A;  4Z02 A;  2LVM A;  1H9M A;  4NPS A;  5FW9 A;  3C0C A;  1CKM A;  2XU8 A;  3R93 A;  4C1N K;  4A3K B;  3SGI A;  1F2L A;  4E7J A;  1IW7 C;  3EBE A;  1V1P B;  4C3I H;  4A3M H;  1W70 A;  1IYU A;  3X3N A;  4FXG C;  5ELE A;  1N34 Q;  1EFN A;  1S72 A;  2EYW A;  4KT0 E;  5M5Y H;  1I4G A;  4XDX A;  2BE9 B;  1O9S A;  1RCV D;  4C92 F;  2O2L D;  1CQF A;  1GOZ A;  3HOX B;  2OTL Q;  2C0T A;  3PF5 A;  4KJO A;  2UUA Q;  5A0L A;  1Y8O B;  1G3S A;  4L59 A;  3PUZ A;  4IOA A;  5CKB A;  2OWO A;  1UE6 A;  1E2Z A;  1OXT A;  1NJI U;  4DAM A;  3VR5 A;  1DOL A;  3U58 A;  4NXM L;  1B70 B;  3CC2 A;  4MDX A;  2MHV A;  1Q86 U;  3L2R A;  2IY5 B;  4LF5 Q;  4CJ0 B;  3K8A A;  1BBW A;  2RHZ A;  2RDF A;  3NQI A;  4J6W A;  1B8A A;  1PYB A;  4ANJ A;  2XNA C;  4HTH A;  2JUF A;  3I4M B;  1AWJ A;  5TSS A;  3PUY A;  1NJI R;  3A56 A;  3CAM A;  2UUB L;  1VQH A;  2RK2 A;  2JOY A;  3K5O A;  3ULR B;  4DR3 Q;  5CCA A;  5IYB G;  1SYD A;  3HOZ G;  4PKC C;  1O78 A;  2BA1 A;  2Z8L A;  1ZKO A;  5IY0 A;  4LFA L;  1D0Y A;  5IGD A;  5IIF A;  3HOY H;  3OS1 A;  5BN5 A;  2C06 A;  1U9R A;  2ZXR A;  3I73 A;  3ICE A;  5LJ5 j;  2QEJ C;  1U8R A;  4A63 B;  3BDU A;  4IPH A;  1YN8 A;  1BBU A;  3L0O A;  2DJG C;  2R7Z B;  3X25 B;  3BZD B;  1WXB A;  1RLP C;  2BZY A;  1UJ0 A;  4KRT A;  3OW2 P;  3GD7 A;  4JI0 L;  4R4Q A;  2KQW A;  2QDB A;  3IKJ A;  1SHF A;  5JJK A;  2IHF A;  3T1H Q;  2P4T A;  1G3Y A;  2EY5 A;  4A3E B;  2DO3 A;  2CSQ A;  2L4N A;  4OL7 A;  5LMU L;  2E6N A;  4IFD J;  2MPX C;  3EHR A;  4HCK A;  1IKL A;  1TU2 B;  1FXX A;  5GAM d;  1KD1 U;  2LS0 1;  1MMA A;  1XJW B;  1Q3L A;  4LDU A;  3EVQ A;  5J26 A;  3ZEH A;  1CA6 A;  3TRZ A;  2F2X A;  4KHP L;  1BI3 A;  4NOY A;  1VQ7 A;  2KXC A;  1EY9 A;  3MEF A;  4M78 E;  4DXF A;  3E9I A;  3URY A;  2DXB A;  1E2V A;  2CQO A;  3PCO B;  4LF9 L;  3JAM i;  3HPW A;  2A69 C;  1KD1 R;  1XNR Q;  3FJP A;  3GTP B;  1D2B A;  4XQN A;  3C4S A;  3PIO A;  1VQ6 T;  3ZJY C;  4QY7 A;  2G5D A;  2VNU D;  1PD1 A;  3CPF A;  4HVW A;  1TWH H;  3ERQ A;  5C3X A;  2ZTD A;  5IGE A;  4A3I G;  4J8O A;  1ONL A;  1R4Q B;  4B3S L;  5C4Z A;  2MI6 A;  5FK9 C;  3JCM Q;  4EVO A;  2HD0 A;  3O5Z A;  4B9W A;  4JBK A;  5LJ3 d;  1SFO H;  3H6M A;  1C6V X;  2KXD A;  2MOX A;  2CKZ B;  1S72 Q;  3CCE T;  5CKH A;  3DXJ C;  2VZA A;  4CGY B;  3QPH A;  4QGU A;  1WQW A;  2HHH L;  2HQH A;  3MHX A;  2A6H C;  1KNA A;  2B2Y C;  3CC4 T;  4D6W A;  2WSC E;  3QBY A;  4AG1 C;  2B8F A;  1QZG A;  5CQX A;  1PH3 A;  1ABO A;  3BDO A;  1Y0M A;  1OEB A;  3Q24 A;  1NEB A;  2BE5 C;  4BI8 B;  3A8J E;  1LOJ A;  4DV2 L;  1HR0 Q;  3CC2 Q;  1EIY B;  1FX7 A;  2VY3 A;  4BY1 H;  1U4R A;  3OY9 A;  2QK0 A;  3K59 A;  2QIL A;  3HOU H;  2B2T A;  4IFD G;  2JMC A;  1ESR A;  4DAY B;  5FLX c;  4ME5 A;  2XGT A;  4HSV A;  2XG8 D;  1E24 A;  3L2P A;  1M90 R;  4P72 A;  2EGC A;  5C4X H;  1EY0 A;  5FWB A;  4C8Q G;  4YIJ A;  4DK0 A;  5HK3 A;  4OGC A;  4QQ6 A;  4C8Q C;  4BDY A;  4P71 A;  4BBR G;  4FF2 A;  2EPB A;  4A3K H;  5GAN d;  3KJO A;  1NUC A;  2K5D A;  3S1M B;  1MMD A;  1CSQ A;  1BYM A;  2PQA B;  4NKL A;  2D9T A;  3CPW S;  3R3O A;  1WTO A;  3LW5 E;  2EWN A;  2BZ8 A;  5KIX A;  4LFB Q;  3TZD A;  4PJO A;  3HOX H;  3I55 T;  1LV9 A;  2F0S A;  2PZT A;  4L5G A;  3H0H A;  3OPO A;  4E7H A;  2AIR B;  4V2S A;  3WVD B;  3H91 A;  5E4X A;  3KLS X;  3M9B A;  2NVT B;  4JPB W;  4HID A;  5IYD G;  2RJF A;  1KDA A;  3CCM T;  1JE4 A;  3AFQ A;  2W0Z A;  1VQ7 Q;  1GUT A;  4ZN3 A;  1TWF B;  2ZPF B;  2EYX A;  2VQE L;  3CRL C;  4R55 A;  2F0Q A;  2SOB A;  4POG A;  4DV4 Q;  4J9E A;  5GAN f;  3ZYY X;  2JN0 A;  4KKT A;  2EKH A;  3MP6 A;  3I72 A;  2KYB A;  4F7U A;  3NEN A;  3E19 A;  1A2T A;  2F0L A;  1HFN A;  2YUN A;  5GMK l;  4JBJ A;  1GUS A;  3LX0 A;  4HED A;  1PH2 A;  3UE1 A;  1WTV A;  4J9H A;  1WXU A;  4K2L A;  2B39 A;  1QZH A;  1D1I A;  4QKU A;  5FU7 C;  3QYH B;  1YNN D;  3NGP A;  2H5X A;  2D0O A;  2R7Z H;  4C92 D;  2RQU A;  2D0P A;  5GAM j;  1LT6 D;  4MIU A;  1UEB A;  2DLP A;  2FO0 A;  3QB3 A;  5A35 A;  1UEC A;  1QOH A;  5FO9 B;  4NL3 A;  1K73 U;  1JJ2 P;  1FWZ A;  2QA4 T;  4A3E H;  4P74 A;  2UXC L;  1Q7Y U;  5LJ5 h;  3VYU A;  5CKD A;  4C3H G;  4A3B G;  2K3Y A;  2HNI A;  2NTT A;  3E6Z X;  2VKN A;  5L8R E;  3OMC A;  2L3R A;  4V19 0;  1KQS S;  1UFF A;  1K73 R;  5LMN Q;  1AVZ C;  1TS9 A;  4DNT B;  1LTT D;  1BDO A;  4LD9 K;  3LWE A;  1G8Z D;  3QWN A;  1SSO A;  2J6O A;  3MVV A;  3QXE B;  1Y1V G;  1RAB B;  3H94 A;  2UXB L;  4LUZ A;  4C8Q B;  5KE3 A;  3VYT A;  3GTP H;  5LJ3 j;  2ZZD A;  3K0Y A;  1ZSZ A;  4XQ3 A;  4LXC A;  4TQU S;  3VYR A;  1FMV A;  3KDF A;  3R2I A;  5CVI A;  1NMG A;  4OWX B;  4BBR B;  5JAV A;  2UXD L;  2D0N A;  2K5V A;  1PHJ A;  5GAN 2;  4LUE A;  4HN7 A;  1UHC A;  4BA2 I;  1NCV A;  1X3P A;  3HKS A;  1B2T A;  4K6L A;  3VUZ A;  2IX0 A;  5LL6 X;  4XTV A;  3K7A B;  2J05 A;  1ICF B;  4FO2 A;  4K11 A;  2PZU A;  4DN4 M;  1K9M U;  1GRI A;  4J1M A;  1SNQ A;  2ZM6 L;  4XTY A;  1Z9Z A;  4XU2 A;  3G71 T;  1ESF A;  3GV6 A;  2PCF B;  1VYU A;  1VQ9 A;  3CP0 A;  3LNN A;  2E2D C;  1A2U A;  4PQX A;  5C3E G;  1CA5 A;  1K3R A;  2NUC A;  4MML A;  2LXJ A;  1SRO A;  3KBX A;  4PL6 A;  1VDZ A;  2LJ0 A;  1BVS A;  4B08 A;  3I5R A;  4M78 D;  5IXF A;  3RZD B;  3QUI A;  1T0H A;  5BR8 Q;  3L2W A;  1N32 L;  3T4A C;  4ELZ C;  1KXL A;  3V8K A;  4GKJ Q;  5ELO A;  3FLG A;  2F0T A;  4AG2 C;  1QVP A;  4ORZ A;  4NL2 A;  5GAN j;  2CP7 A;  1J6Q A;  2F1L A;  1XX8 A;  3BVM A;  2EGA A;  2CWP A;  2CWA A;  2L0C A;  3ITP A;  5IYB H;  1I5O B;  1KHI A;  3F70 A;  1AN8 A;  1LTS D;  1BBX C;  2AWO A;  1UGV A;  3VYH B;  4BBS G;  2F5K A;  2DIL A;  3T9N A;  4RTT A;  1F9P A;  2FRY A;  3TRE A;  4J9I A;  1LO5 D;  2EYO A;  1QJO A;  1JQQ A;  1MUZ A;  2DJZ A;  1OPK A;  2VUB A;  4HVU A;  3W1B A;  4E2F B;  2GFA A;  1M8M A;  2KGT A;  5FU7 B;  1M3A A;  1AZE A;  5D3I B;  4OWW B;  3S1M H;  2AKL A;  1Q1B A;  2O01 E;  2B2T C;  3TSZ A;  3OYN A;  3A8G B;  1EZ8 A;  4RMF A;  1M5Q 1;  1A0N B;  1E6H A;  3MXN A;  5I2Y A;  4B3R L;  2YHT A;  1KQ2 A;  2MUY A;  3I4O A;  4J6Y A;  3AMU A;  1PH8 A;  3EG0 A;  1QVG P;  3DM3 A;  4GLM A;  1II3 A;  1EIG A;  1WZO A;  2YRV A;  4ZRZ A;  1N34 L;  4XK8 E;  8ATC B;  4HCE A;  4DFA A;  4AFS C;  2WAQ B;  4C3H B;  4A3B B;  1YFN A;  1L2F A;  1I50 B;  4JOI A;  1YHQ A;  2NVT H;  3BJU A;  5KRU A;  1T9H A;  2RPN A;  1S72 T;  2K33 A;  1WPY A;  1N33 Q;  2UUA L;  2YUP A;  4PJO G;  1TWF H;  4JV5 Q;  1CUK A;  1QWF A;  4PFO A;  1Y1V B;  4PNY A;  2DIG A;  2KR3 A;  4PJO C;  3PIO 3;  2E8G A;  1LM0 A;  2JJQ A;  2K7V A;  3EFX D;  2HMA A;  2J6K A;  1JO8 A;  2DPP B;  5DLO A;  4P2C B;  3VA7 A;  4QQB X;  4D8K A;  1YJN A;  4PJN A;  2KDS A;  4Y52 H;  5I6Y A;  3P8H A;  1H92 A;  1LAC A;  4LF5 L;  3QII A;  1QVF P;  5FLM G;  5IOC A;  3M0S A;  3C95 A;  3AYH B;  3C1E A;  1SRL A;  2FZK B;  4GLX A;  4DR3 L;  3NE5 B;  1PH5 A;  4K8I A;  2GF7 A;  2GQI A;  4CJ2 C;  3DKM A;  2A73 B;  3PGG A;  2I0N A;  1I5F A;  2J0T D;  1M1K C;  4N4G A;  2F03 A;  1YNJ C;  2DE0 X;  4FF1 A;  2R7D A;  4HXJ A;  4X34 A;  4C8Q F;  1TG0 A;  4KY6 A;  2CP0 A;  1FNV A;  1L1O A;  1VQ9 Q;  5C3E B;  3G7L A;  1JOK A;  1Z9F A;  2AMC B;  3C1F A;  3OYG A;  2XRQ D;  5I6W A;  4A53 A;  4KI0 A;  3HKZ E;  1Y69 U;  1J5E Q;  3U23 A;  3X24 B;  2X3X D;  5GAG C;  2E3I A;  4CC7 A;  4IFD H;  3L42 A;  3P1H A;  5GAM h;  3T1H L;  1O7Y A;  2CDT A;  2KA7 A;  3R6N A;  1TWA B;  2CHB D;  3RLN A;  5KNC A;  4BBS B;  2DUD A;  4R4O A;  5CK9 A;  3AQQ A;  2F0P A;  1YBY A;  1I3Q B;  4Y7N B;  1G91 A;  1F2Z A;  3S3M A;  2L9H A;  4BBR H;  5EAY A;  4HAE A;  3WXM B;  5IT9 L;  3SE0 A;  1O75 A;  2K2M A;  2KRN A;  4BAC A;  1VQ4 T;  1TKW B;  1VQ5 T;  1XNR L;  2GQV A;  1G6P A;  1S5D D;  2A7Y A;  2ZXO A;  3MEW A;  4QVD A;  4RG2 A;  5CAI A;  2D2C C;  4Y28 E;  3K7A H;  5C3W A;  2F4V Q;  1LJO A;  3J80 L;  5LJ3 h;  4N0A A;  4XTW A;  4XTC S;  1AZG B;  1ZA1 B;  3A7A B;  1E6G A;  1TT2 A;  4OXP A;  5I11 A;  1UAP A;  2RJE A;  2O31 A;  2DM1 A;  3FEO A;  2KRM A;  2R5A A;  1PH7 A;  4IZ8 A;  3RR6 A;  2QQS A;  5KYY A;  2HDL A;  3KF8 A;  2DZ9 A;  1N36 L;  1PH4 A;  3BZC A;  1SSF A;  3JCM V;  2WII B;  1I94 Q;  4LFA Q;  1C8C A;  4L63 B;  4ZN1 A;  4QVC A;  1YHQ Q;  2CW0 D;  1Y96 A;  4JRI A;  1NG2 A;  4PJO B;  1FR3 A;  5C4H A;  3HRU A;  4ZKC B;  4E6R A;  5KEE A;  1VMP A;  3EN2 A;  1CM9 A;  3T51 B;  4B3M L;  2ALY B;  5IP9 G;  4J9D A;  4OB0 B;  1CFM A;  1HR0 L;  4XU0 A;  3E3X A;  2LCC A;  1Q81 C;  1YJN Q;  3RDV A;  3OSO A;  4UAI A;  3OYB A;  1NPP A;  1D6E C;  1K1Z A;  4A3M G;  1HZA A;  1QQJ A;  5FKA C;  1X43 A;  3WOF A;  5LMU Q;  3BE3 A;  4ELY C;  3L7Z C;  5GMK i;  5GAN h;  1OZ2 A;  1AE2 A;  2KBN A;  4C5H A;  4FSX A;  3SHL A;  4JDS A;  4C0G A;  2A36 A;  2VUM G;  4KHP Q;  1SMX A;  3QOJ A;  5JJL A;  4PFZ A;  1TUC A;  1VQ6 A;  5A2Q L;  1LAB A;  2DRK A;  3I56 A;  2F69 A;  3KLS A;  2JA9 A;  2EY2 A;  1NE3 A;  3MET A;  1Q82 U;  3IFD A;  2VQF Q;  4C2M B;  4V0B A;  1VF5 C;  2ESW A;  3EG3 A;  4C3H H;  2K57 A;  2EGE A;  3Q23 A;  1I50 H;  4QF4 A;  4LFB L;  4MZT A;  3CCE A;  1AW7 A;  2DJQ A;  1D8L A;  1Q82 R;  1GFD A;  1SJH D;  3CMA T;  2K32 A;  4RG8 A;  1GVP A;  2A74 C;  4O1N A;  4Z9C B;  5JVG 3;  3OMG A;  1U4L A;  1RJT A;  1WYX A;  4TVR A;  1XOV A;  1WYD A;  1Y8N B;  2A6E C;  1PLF A;  2A68 D;  1PH1 A;  4C56 C;  1Y1V H;  3CC4 A;  1B07 A;  1ZLM A;  1LT3 D;  4M7A E;  3S2H B;  5GAN 4;  4MNO A;  1M4V A;  5F2D A;  3EIV A;  3CXC P;  3BVZ A;  5KYX A;  2JTF A;  3EFO A;  4ZLT F;  4JOI C;  4GY5 A;  1IYJ B;  4GS3 A;  2M9U A;  4H44 C;  3CME T;  3H9N A;  4PJM A;  3NWS A;  4L8J A;  2LY7 A;  4DR7 Q;  1RHP A;  1KRS A;  2E5Q A;  1NSN S;  1RAD B;  2QGG A;  3CKI B;  4R9W A;  1OV3 A;  2R93 G;  5GAN 6;  4DBH A;  1TS4 A;  2B2V A;  4IUP A;  4C5I A;  5CGK A;  3A8H B;  4ULL A;  4D8D A;  3OYM A;  4BS9 A;  5DLQ E;  1CKN A;  1AT1 B;  5C3E H;  2HT1 A;  2XIW A;  3RIR A;  4PNO A;  2L15 A;  2PNH A;  1NPR A;  3HGB A;  1GUW A;  4M4Z A;  2PMZ B;  4JG2 A;  3N6R A;  3S9W A;  2EVB A;  4O5V A;  1OZ3 A;  3RLF A;  4EQ5 A;  1PRM C;  3M4Y A;  1L0W A;  2LQK A;  2AKW B;  1QB5 D;  3TEH B;  4ZK9 B;  4Z8A A;  1X56 A;  2A6H D;  2KEC A;  1I4Q A;  4FCY A;  2F0F A;  3U4V A;  1N36 Q;  1RAE B;  1I0C A;  1TOV A;  1VQO A;  2ZXP A;  3I55 A;  1UE7 A;  3NEM A;  1TWA H;  4KH0 B;  1NM7 A;  2F0H A;  2KT1 A;  2RHQ B;  4LMQ D;  4AYB G;  5FLX E;  1Q90 A;  4BBS H;  1RAG B;  4GNX A;  4Y7N H;  3PFS A;  1I3Q H;  5LMN L;  2XD0 A;  2RM4 A;  5D3D A;  3TZU A;  1JIC A;  4L5T A;  3EGD A;  3V8J A;  1V9P A;  2KK4 A;  3CCM A;  2Z6K C;  1WQ7 A;  2OX7 A;  4LDW A;  4C1N I;  4GLV B;  1D1K A;  4XT3 B;  1RUW A;  2AWN A;  2Z9H A;  4PJO F;  1DJR D;  2VUM B;  5KYN A;  3H8Z A;  3MCA B;  1VQE A;  3GNG A;  5G3L D;  4FYW B;  3VRY A;  1H9S B;  5KYL A;  1VQ6 Q;  3DMU A;  3I56 Q;  3OB9 A;  1JWS D;  2EJF A;  4I7A A;  5E4W C;  2HZY A;  5DNF A;  5GAO l;  3KFU A;  3JCM e;  4M75 A;  1T5X D;  4A3L G;  1HQR D;  1FGB D;  2VB3 X;  3UI2 A;  2EJG A;  2X35 A;  2MO0 A;  3MXN B;  2NVX B;  3HOU G;  4X6A H;  1EEI D;  1AE3 A;  4G57 A;  4DV6 Q;  4JC0 A;  3EGX A;  1ZA2 B;  2YWW A;  3CCE Q;  1MBY A;  1QNK A;  3RNU A;  4YTL A;  2F0O A;  2HUG A;  3H6Z A;  4N0A C;  1Z9Q A;  4ATO A;  3G6J B;  2IWH A;  1X3Q A;  5M5X B;  1BNZ A;  4F7U F;  4O6J A;  3W3A A;  3CC4 Q;  2K5W A;  1YJW T;  2CP5 A;  2Y4Y A;  2A37 A;  4JRK A;  3VS0 A;  3M59 A;  2QA4 A;  2F0M A;  2KHJ A;  5JEA J;  2COY A;  5D65 A;  5BR8 L;  1ET9 A;  2M1H A;  4OB2 B;  1BI1 A;  2ZCF B;  4HT8 A;  2M00 A;  4JW0 A;  3D7S B;  4DV3 L;  4GKJ L;  1F2Y A;  1A3U A;  4M77 G;  2K4Y A;  4DV4 L;  1AEX A;  4L6V 5;  4KHV A;  4YWK A;  4II1 A;  5A0G A;  1DZ1 A;  3SEM A;  4M77 C;  3CCJ T;  5JOB A;  2RDG A;  5I22 A;  1TS2 A;  4IJL A;  2R93 B;  3U50 C;  1WHK A;  1NY4 A;  1TY0 A;  3KLR A;  5E1F A;  3VR3 A;  1T0J A;  2XDD A;  2WKC A;  2HKQ B;  2JP1 A;  4U68 A;  5GAN 5;  1XNQ Q;  1EY4 A;  3ME9 A;  3S3N A;  2L5Q A;  1XQH A;  2UXB Q;  4C2M H;  3OSS C;  3J80 i;  5C0X I;  2KMT A;  3NXW A;  3QG1 A;  4FW1 A;  3PGZ A;  1RLQ C;  1WNL A;  4HJ8 A;  4EQP A;  2QI2 A;  2HCK A;  3AU7 A;  1AZQ A;  2K01 A;  3M85 A;  2ZGW A;  1IHV A;  3TEE A;  2F0D A;  4QIW E;  3GTG B;  1PFN A;  2FIN B;  1U0L A;  4P5N A;  2AUK A;  1ZQ1 A;  4DV7 Q;  2ZTE A;  4IUQ A;  1IO6 A;  3G71 A;  1ENF A;  5J22 A;  3Q22 A;  1VQO Q;  1PA6 A;  3X20 B;  1PC0 A;  3I55 Q;  4K6D A;  4RGN A;  3J81 c;  5HGQ A;  4AYB B;  3S2H H;  3HFZ B;  2B86 A;  4DA4 A;  1HA5 A;  1AHJ B;  3MXP A;  2QAZ A;  2EPD A;  2Y0S G;  4R1J A;  3WOE A;  2IG0 A;  2FB7 A;  1XXG A;  1NBE B;  4G7Z C;  1N33 L;  2LP5 A;  3M7G A;  5JEA G;  3FDT A;  2B8A A;  2LQN A;  3CCM Q;  1KJW A;  3O8V A;  3BFM A;  4N4H A;  4TSS A;  4C3J G;  2EZV A;  2LT4 A;  1N8R U;  1LNX A;  2R7Z G;  1JJ2 A;  2CH4 W;  4OX9 Q;  1MND A;  1DM0 B;  3HP3 A;  4KH1 B;  1ZSG A;  5CO7 A;  2L5T A;  1IHW A;  5FOB B;  2C5C A;  2RB6 A;  4G7O C;  3K81 C;  3RBB B;  1HZC A;  1KIK A;  1AFP A;  1VQP A;  1PZI D;  4JI8 Q;  4ZUI A;  4AFZ C;  1TS3 A;  2MO1 A;  2ZPG B;  1SEM A;  3IAY A;  3INZ A;  1IKM A;  5GJW B;  2K5Q A;  1J9O A;  2O2O A;  3RKY A;  4RTU A;  1SYF A;  2GA4 B;  3CU7 A;  4M7A D;  2EXD A;  3RUZ A;  3CQT A;  2E4H A;  2DTI A;  3C2P A;  5KYY B;  4IPD A;  1UNS A;  5ELB A;  3C12 A;  4B9X A;  2WB1 E;  3FHW A;  4LF4 Q;  5IP9 H;  1U4M A;  5KGU A;  1C0A A;  1X6G A;  4B3R Q;  3K5M A;  4RMO A;  1J5E L;  1STA A;  2QA4 Q;  3NEL A;  5GQO A;  1GJX A;  4UP9 A;  5CR3 A;  4C0F A;  3RMS A;  3D0F A;  4R0K A;  1XNI A;  1ABQ A;  4M77 B;  2DNE A;  4HA8 A;  2LKV A;  2MWO A;  3FC3 A;  2MPM A;  5JJI A;  3PO2 G;  1SE2 A;  3UE0 A;  4R56 A;  2ZPI B;  2LQ8 A;  2JA5 B;  2Q2H A;  2VUM H;  2A0F B;  1DGS A;  5EKL A;  2CCZ A;  1VYV A;  4C92 E;  5NUC A;  4PK4 A;  1VQN A;  1ZEQ X;  2ATW A;  4GNX C;  2L1B A;  3NTI A;  4BXX G;  2DZC A;  3RMQ A;  1HNX L;  1Q1E A;  3CPW P;  2EYM A;  3H0G G;  4JS5 A;  5EPJ A;  3C3L A;  5M9O A;  2KE9 A;  4BE0 A;  4BA1 I;  2E6Z A;  3LLR A;  5AFW A;  4A75 A;  2F4V L;  3VKI A;  1BI0 A;  1V1C A;  2NVX H;  1UHF A;  1GCP A;  5GRO A;  4KUD K;  4JI5 L;  2R61 A;  3EFR A;  3K0X A;  4KD4 A;  4AT1 B;  2CSI A;  1SYB A;  5M5X H;  1OXU A;  5AJ3 Q;  3TSS A;  5C4J B;  3G71 Q;  4K0K Q;  3UDG A;  3Q8D A;  3D4R A;  3PT9 A;  4C0D C;  2EJF C;  4M75 G;  4JI7 Q;  1UG1 A;  1I94 L;  4KV6 A;  2BCO A;  2LQW A;  2Y0S B;  4M75 C;  1E1O A;  1SRU A;  2EY6 A;  3GDE A;  1EY8 A;  2EJG C;  3TS0 A;  5T1I A;  3G6E T;  4FM4 B;  1QVG A;  4C3J B;  3M4G A;  1AP0 A;  4PJO D;  4BI3 A;  3TP7 A;  2HIV A;  4Y91 A;  4X65 Q;  1LCK A;  1GHK A;  5KYX B;  2KRO A;  4CDD C;  3EFO B;  4Y92 A;  1AZP A;  2R93 H;  1WTP A;  1RAH B;  1WA7 A;  1WGS A;  2I07 B;  4DV5 Q;  1UGS B;  3FMC A;  2XK0 A;  2LNH B;  2KEN A;  3CCL A;  3TQY A;  1FYC A;  2E1H A;  2B2W A;  1D7Q A;  2RI2 A;  3IRB A;  1VQP Q;  3VS2 A;  3DEP A;  3MTS A;  3GBQ A;  5DM7 R;  3UT1 A;  1VQ4 A;  1GKH A;  1VQ5 A;  2C35 B;  2VB6 A;  3A0J A;  1WJJ A;  1DON A;  4RTY A;  2X3W D;  3OYE A;  4YCU A;  5GAO n;  1G51 A;  1KLU D;  1WHL A;  1YNJ D;  1B9M A;  1O7Z A;  4O2D A;  2JS2 A;  1YNX A;  3GTG H;  4EX5 A;  1CKN B;  1I8F A;  2VQF L;  2L11 A;  2A3L A;  1QVF A;  1NR2 A;  1HUN A;  4HIK A;  3OQ5 A;  1HXY D;  3I56 T;  1CSP A;  2YYZ A;  1WD1 A;  1IBK Q;  4RAU C;  2M0Y A;  3REB B;  2YUQ A;  1W6X A;  2OF1 A;  1PXU A;  5DY9 A;  3SVM A;  3TP6 A;  4XXE A;  3H41 A;  2ZJR A;  3RES A;  2UUC L;  2P5Z X;  4RWS C;  2RDH A;  4FT2 A;  1MV3 A;  1C48 A;  1Q86 C;  1RF2 D;  3PO2 B;  1A6X A;  3JCM J;  1AWX A;  3JCM W;  1VYT A;  3M0Q A;  3GOX A;  2H4O A;  1HXD A;  3EA6 A;  3HRZ C;  2PPB C;  4GNX B;  3CBM A;  2D9U A;  2K28 A;  2G6F X;  4M1U B;  1MV0 B;  2EVR A;  3EGD B;  1GCQ A;  2ABL A;  1VQN Q;  1L0Y B;  2MP1 A;  4PZ6 A;  4F88 A;  3OTO L;  3RN5 A;  3DLL A;  4IUV A;  2NZ1 D;  1OYX A;  3H0G B;  4B3M Q;  4FU6 A;  1NZ9 A;  4A54 A;  4DR7 L;  5LJ5 g;  5GMK j;  3KFV A;  4A3L H;  1M90 U;  3ZFJ A;  4M77 F;  4M7D G;  1JEG A;  1QP3 A;  1EIF A;  1MHN A;  4HKE A;  1B44 D;  1E2W A;  1PRT C;  2K03 A;  2GGR A;  2Q2T A;  1B34 A;  1YWP A;  4M7D C;  1XTD A;  2ATC B;  2DL3 A;  3E0E A;  2YLB A;  4F17 A;  1A3V A;  4C0D B;  1HR0 W;  2X4J A;  4OO1 I;  3OYK A;  4FVM A;  4A93 G;  3JAM c;  3ZBD A;  2JXM B;  2SNS A;  3DUZ A;  4M75 B;  2EYJ A;  5GAN 8;  2NZH A;  1X01 A;  3EGX B;  2WAC A;  3UDF A;  5L23 A;  3OA6 A;  3GQB A;  2Y90 A;  4DK3 C;  1C4Q A;  2EQK A;  3CMA A;  1MJE A;  1OUL A;  1HQM C;  4ZTJ A;  1RDP D;  3EG9 B;  3RN2 A;  1JE5 A;  2E2I B;  1Y7X A;  3OS5 A;  1BOS A;  3JCM d;  3S1R B;  1HTP A;  5GAH C;  2JA5 H;  1BCO A;  1VQO T;  2ECZ A;  3A1P A;  3OBY A;  3K57 A;  3BW1 A;  5L37 A;  4AQY Q;  5C44 G;  2HBW A;  3CCL Q;  4CDE C;  1YWO A;  2DEU A;  5C0X J;  2A19 A;  4JLI A;  2JE6 I;  5HGT A;  1B53 A;  3CME A;  2I5M X;  3ASK A;  1VQ4 Q;  4FT4 A;  2NB0 A;  1VQ5 Q;  1ZUU A;  3HP9 A;  5KCH A;  1UGQ B;  1B3Q A;  1GXD C;  1BCP C;  1B9N A;  1MKH A;  4FYV B;  1W3S A;  2N8N A;  4RHR A;  3N5B B;  4PMW A;  4A3J B;  4JI6 Q;  2E76 C;  3CQZ B;  3O13 A;  3VS3 A;  3M56 A;  4OB3 B;  3R2T A;  5C4J H;  3UAT A;  2XTI A;  2Z0S A;  1IL8 A;  2XKO C;  1STG A;  1V43 A;  3FB9 A;  1MGS A;  2ZT9 C;  5EQ0 A;  3E5S A;  2ICI A;  1Q12 A;  4DV6 L;  1HJP A;  3JCM f;  1KC8 C;  5KCO A;  2FXQ A;  1D1A A;  1ILQ A;  1SDF A;  4QL5 A;  1JC7 A;  1IHZ A;  4RG1 A;  1PCX A;  5JEA H;  4GKK Q;  1B4O A;  3GLX A;  4DKA C;  1CQV A;  2A6E D;  4K14 A;  3PSI A;  3UF4 A;  3NBH B;  3W1G A;  1QMC A;  4C3J H;  2SEM A;  2HQE A;  3JV3 A;  2VAS A;  1SMY C;  5EJW A;  4DXG A;  4LDV A;  3MAQ A;  3QJY A;  1M8A A;  1JOQ A;  3SDZ A;  4IJH A;  3SK4 A;  1K8O A;  3BS1 A;  2RHU A;  1NNX A;  3GPL A;  3CD6 T;  5FJ8 G;  2VS1 A;  1PFB A;  1PRT B;  3Q0A A;  4H02 A;  4J83 A;  2WAQ G;  3LWI A;  3KBG A;  5CIU A;  2QEX T;  1TWG B;  4I7Z C;  1KQ1 A;  2DXT A;  4M7D B;  2K5N A;  1FD7 D;  1QLY A;  4DK1 A;  5C0X G;  2FVU A;  4OMN A;  4EDU A;  2B8G A;  1AWO A;  2BA0 A;  1JB0 E;  3BY7 A;  5IHN A;  3TP5 A;  1I4R A;  1PG5 B;  2YTX A;  2RCN A;  1JCK B;  3D3R A;  1ZYR C;  5K5P A;  2AKK A;  2KHI A;  4TRD A;  1XNQ L;  4A93 B;  1A0I A;  1TUG B;  4DV1 L;  1I07 A;  3F2C A;  1S1N A;  5HKC A;  4F87 A;  5LMN W;  3D31 A;  3OYY A;  4HIO A;  2B2W C;  1B7T A;  2FEI A;  4IIM A;  2BKD N;  3VJP A;  1AOJ A;  2X69 A;  1K3B C;  4WF2 A;  3C94 A;  3VYS A;  4AH6 A;  4N4I A;  4DV7 L;  1IYV A;  5CYU A;  4RCB A;  3J81 j;  5GAD C;  3CMA Q;  1B50 A;  3PO2 H;  4DR6 Q;  2KED A;  2F3I A;  2FPF A;  1P8L A;  2AZV A;  4LD6 A;  2K05 A;  2N3S A;  4PZ7 A;  1K8A U;  2RQV A;  2VXF A;  1YJW A;  3IFT A;  4ID6 A;  3J7Z C;  3A5U A;  3KOJ A;  3PMI A;  4M75 F;  5LL6 S;  5C44 B;  3VS6 A;  4CKE A;  4BXX H;  5CMD A;  2MF2 A;  2KAF A;  2PZW A;  4RA8 A;  4EMK A;  5IHK A;  2KCC A;  3H0G H;  1K8A R;  1P92 A;  1SNM A;  5BN3 A;  1WFW A;  1JWM D;  4JBM A;  3DB4 A;  3CME Q;  1BCP B;  4G7H C;  4OX9 L;  2RKS A;  3CCJ A;  1Z6H A;  4DV3 Q;  1U5K A;  5GAM g;  5I4D A;  5IGC A;  2EXZ A;  3AB9 A;  1VQC A;  3LGF A;  4PMB A;  4EQN A;  1DJ7 B;  4PMC A;  4EGV A;  4JI8 L;  1RTN A;  1QUQ A;  1S5B D;  3HOV B;  4X64 Q;  1SLJ A;  5GMK h;  3FVQ A;  3NP8 A;  5M3F G;  1IBM Q;  1VQP T;  1XTC D;  4RCO A;  1NEG A;  4G4K A;  4P75 A;  1ZBJ A;  2MGS A;  5KNB A;  3KK7 A;  1QWE A;  2DL7 A;  1Q7Y C;  1D0X A;  1VIF A;  1KRT A;  4J15 A;  2I46 A;  5HUR A;  3M3Y B;  4WFN 3;  1LTG D;  1SNC A;  4OIK A;  2O4X A;  5A0D A;  3MXG A;  4LF4 L;  4XQJ A;  4NS5 A;  2E2I H;  5EKK A;  3S1R H;  5LJ3 g;  3RR5 A;  4JYA Q;  2LC4 A;  2L55 A;  3NUC A;  1LVK A;  4RTW A;  1DYQ A;  4LE9 A;  1PSF A;  1L0X B;  1M1K R; 
#chains in the Genus database with same CATH homology
 1B07 A;  1ZLM A;  1NLO C;  1WIE A;  3LH5 A;  1U5S A;  1WDX A;  2O9V A;  4J9B A;  4CC2 A;  1X27 A;  2BZX A;  3NPF A;  3SHW A;  2RMO A;  2P4R A;  1KFZ A;  5HCK A;  1NYG A;  1X2K A;  2GTJ A;  4JZ4 A;  2W10 A;  2DF6 A;  2HSP A;  2YDL A;  1OV3 A;  2FG0 A;  2OJ2 A;  2DBM A;  2AK5 A;  3VS5 A;  2GNC A;  1HD3 A;  2L3S A;  2JMA A;  1FYN A;  4D8D A;  1SHG A;  2HEQ A;  1UDL A;  1NYF A;  1YP5 A;  4J9G A;  2V1Q A;  1NLP C;  3C0C A;  4M4Z A;  5FW9 A;  1SSH A;  4IIO A;  3EG1 A;  2K79 A;  2HDA A;  1PRM C;  2GBQ A;  2JM9 A;  1W70 A;  2KBT A;  4Z8A A;  3NHN A;  2JS0 A;  1EFN A;  2VWF A;  2EYW A;  1I0C A;  2LMJ A;  1TUD A;  2AZS A;  2ROL A;  3UA6 A;  1NM7 A;  2KT1 A;  2C0T A;  3PVQ A;  2MCN A;  4RTZ A;  1J3T A;  2PZ1 A;  2EYY A;  2J06 A;  5IHI A;  1RUW A;  1CSK A;  1UE9 A;  3VRY A;  1AWJ A;  3ULR B;  2DX1 A;  3M0R A;  2L3P A;  1WXT A;  2QDL A;  4JJB A;  1T3L A;  1WX6 A;  1I1J A;  1Z9Q A;  4A63 B;  3ZL7 C;  3PVL A;  1E7O A;  5FWC A;  1YN8 A;  2A37 A;  3VS0 A;  1WXB A;  1RLP C;  2BZY A;  1UJ0 A;  2JT4 A;  4KRT A;  2ENM A;  4AFU C;  2LZ6 B;  1AEY A;  1SHF A;  2DRM A;  2KEA A;  2CSQ A;  3EGU A;  2L3Q A;  3EHR A;  2KT8 A;  1U06 A;  2K9G A;  4HCK A;  2ED1 A;  3SEM A;  2O88 A;  5I22 A;  2F2X A;  2KXC A;  1T0J A;  3FJ5 A;  1PKS A;  2NWM A;  1X69 A;  1QKX A;  3M0P A;  3H0F A;  2F2W A;  3IQL A;  4HVW A;  1RLQ C;  1GCQ C;  2HCK A;  2IIM A;  4CC4 B;  4RTV A;  1M30 A;  3O5Z A;  2KXD A;  1IO6 A;  2MOX A;  1ZUK A;  1FMK A;  2NUZ A;  1T3S A;  1GFC A;  2B86 A;  2EPD A;  1PNJ A;  2XMF A;  4AG1 C;  2LP5 A;  2LQN A;  1ABO A;  1Y0M A;  1KJW A;  2KRS A;  1OEB A;  1NEB A;  2CH4 W;  3EHQ A;  3QWY A;  2JMC A;  1ARK A;  1ZSG A;  5IXB A;  2JM8 A;  1UJY A;  3RBB B;  1KIK A;  1M3C A;  2EGC A;  5FWB A;  4AFZ C;  1H3H A;  1SEM A;  5GJW B;  2O2O A;  4Z89 A;  2DNU A;  4RTU A;  2GTO A;  3CQT A;  1PKT A;  1W1F A;  2BZ8 A;  1X6G A;  5GJV B;  2CT3 A;  4LUD A;  2ED0 A;  2OAW A;  3H0H A;  4R0K A;  1GBR A;  3RNJ A;  4EIK A;  1ABQ A;  2DVJ A;  1CKB A;  4F16 A;  2DA9 A;  4JPB W;  1BU1 A;  1M27 C;  1VA7 A;  2W0Z A;  5EC7 A;  1N5Z A;  2EYX A;  1SPK A;  1VYV A;  2DMO A;  4LNP A;  4J9E A;  3UA7 A;  2EKH A;  4DEX A;  4JJC A;  2KE9 A;  2KYB A;  3VS1 A;  2EW3 A;  3VS4 A;  1V1C A;  2YUN A;  1UHF A;  1GCP A;  3NMZ C;  4GBQ A;  4OMQ A;  1K0X A;  4CC3 A;  2A08 A;  4J9H A;  1WXU A;  1K9A A;  2CSI A;  4J9C A;  4J9F A;  1AWW A;  1K4U S;  2C0O A;  1BK2 A;  3NGP A;  4JJD A;  1UG1 A;  2RQU A;  2LQW A;  2DLP A;  2FO0 A;  1UEC A;  1ZUY A;  4HVV A;  2M51 A;  1QCF A;  3I5S A;  2YUO A;  2VKN A;  3M0T A;  1LCK A;  1UFF A;  2RQW A;  2KRO A;  1AVZ C;  4Y92 A;  2PNI A;  1WA7 A;  2EYZ A;  2J6O A;  2LNH B;  4LN2 A;  2CT4 A;  1PWT A;  2KYM A;  3VS2 A;  3GBQ A;  1CKA A;  4RTY A;  2X3W D;  3PE0 A;  4AFQ C;  2D0N A;  4LUE A;  1UHC A;  2JS2 A;  3TVT A;  2J7I A;  2YT6 A;  1AD5 A;  1M3B A;  2J05 A;  4K11 A;  1JXM A;  1GRI A;  4F14 A;  2F2V A;  1UUE A;  2M0Y A;  3REB B;  1Z9Z A;  2YUQ A;  1W6X A;  2D1X A;  2K3B A;  1VYU A;  3H41 A;  2RQR A;  1MV3 A;  2JXB A;  2ROT A;  1H8K A;  2LJ0 A;  3REA B;  3I5R A;  5IXF A;  1AWX A;  1YCS B;  1PRL C;  1T0H A;  2EQI A;  1VYT A;  1QKW A;  1X6B A;  3M0Q A;  2LCS A;  1WI7 A;  2L2P A;  2A28 A;  2G6F X;  4AG2 C;  1MV0 B;  2EVR A;  4ORZ A;  1GCQ A;  2ABL A;  2RF0 A;  2EGA A;  2FPE A;  4JZ3 A;  1UGV A;  1JU5 C;  3KFV A;  2K6D A;  3VS7 A;  2DIL A;  3A98 A;  4RTT A;  2FRY A;  4J9I A;  1JEG A;  1JQQ A;  1MUZ A;  4HVU A;  1OPK A;  2GGR A;  1M8M A;  1YWP A;  2KGT A;  1M3A A;  2DL3 A;  1AZE A;  4F17 A;  2AKL A;  3THK A;  2D8H A;  3H0I A;  3TSZ A;  1A0N B;  1E6H A;  1ZX6 A;  5ECA A;  2RN8 A;  2DBK A;  3EG0 A;  2LJ3 A;  1KSW A;  2SRC A;  4GLM A;  5L23 A;  1G83 A;  4AFS C;  2VVK A;  2J6F A;  4RTX A;  2CUD A;  3I35 A;  2RPN A;  2ECZ A;  2YUP A;  2D8J A;  1QWF A;  4OMP A;  1X2Q A;  2FPD A;  2KR3 A;  2HBW A;  2L0A A;  1K0S A;  1YWO A;  2J6K A;  1JO8 A;  2JW4 A;  4D8K A;  1UTI A;  2RQT A;  2EBP A;  1H92 A;  1HJD A;  1ZUU A;  1B3Q A;  3M0S A;  4X1V A;  1SRL A;  5IH2 A;  2E5K A;  2O9S A;  2GQI A;  3I9Q A;  3VS3 A;  1GL5 A;  1GBQ A;  2I0N A;  3UAT A;  2DE0 X;  4HXJ A;  2PTK A;  1TG0 A;  2LJ1 A;  2CUB A;  3UF4 A;  1RI9 A;  3U23 A;  2OI3 A;  2SEM A;  3JV3 A;  2X3X D;  2CH4 A;  4CC7 A;  1WLP B;  2DL8 A;  2CDT A;  3R6N A;  4WCI A;  2BTT A;  2MIO A;  2YSQ A;  1QLY A;  1BB9 A;  4OMN A;  2DL4 A;  2CRE A;  4FSS A;  1AWO A;  5IHN A;  1HSQ A;  2KRN A;  2K2M A;  4OML A;  2K7A A;  2AKK A;  4ESR A;  1I07 A;  3TSW A;  1S1N A;  1SRM A;  1AZG B;  2FEI A;  4IIM A;  1E6G A;  5I11 A;  1AOJ A;  2O31 A;  2DM1 A;  1BBZ A;  2KRM A;  2FRW A;  3VRZ A;  2DL5 A;  2H8H A;  4Z88 A;  1YNZ A;  2JTE A;  3EG2 A;  2FPF A;  2AZV A;  1NG2 A;  2LX7 A;  4RUG A;  2RQV A;  4OMO A;  4E6R A;  1Y57 A;  2V1R A;  3VS6 A;  3QWX X;  4J9D A;  5IHK A;  4OMM A;  1WFW A;  1K1Z A;  1U3O A;  2KNB B;  1X43 A;  3M0U A;  2C0I A;  4ZNX A;  4DEY A;  2A36 A;  1G2B A;  1TUC A;  2DRK A;  1NEG A;  1ZBJ A;  1QWE A;  2DL7 A;  1K76 A;  2ESW A;  2RNA A;  1JXO A;  3EG3 A;  2EGE A;  1PHT A;  2DYB A;  2DJQ A;  1GFD A;  4RTW A;  1OOT A;  1WYX A;  1OPL A;  1XOV A;  4LE9 A;  4QT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...