2CH4W

Complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
139
structure length
139
Chain Sequence
b'KEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Reconstruction of the Chemotaxis Receptor-Kinase Assembly
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/chemotaxis
total genus 19
structure length 139
sequence length 139
chains with identical sequence Y
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ch4W01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2ch4W02
1ZSGA 1I1JA 3KFVA 5L23A 1X43A 2H8HA 3ZL7C 4E6RA 1VA7A 5IXFA 3VS2A 1ZLMA 2F2VA 1M3CA 4Z89A 2YSQA 4LE9A 3M0RA 4GLMA 2VKNA 3I5RA 2SRCA 3I9QA 2RNAA 1K4US 1MV0B 1K1ZA 1Y0MA 1VYUA 1AVZC 4AG1C 1RI9A 3GBQA 1H3HA 1CKBA 4RTWA 3SEMA 4F14A 2EYWA 4OMPA 5IHNA 1K0XA 2KRSA 1UG1A 1RUWA 1QWEA 2BTTA 5EC7A 2KRNA 2O9VA 4AFQC 2EGAA 3M0QA 1OPKA 4RTZA 1G83A 1Z9ZA 3CQTA 4A63B 4GBQA 2PNIA 2CUBA 4K11A 4J9FA 3VS5A 1V1CA 2L2PA 2CREA 2F2WA 3NGPA 2YDLA 4DEYA 2RQVA 3M0SA 1T0JA 1QCFA 4FSSA 4CC2A 5IH2A 1GCQA 1GL5A 1RLPC 1W1FA 2ENMA 3JV3A 3QWXX 1AD5A 1PKTA 3I35A 2BZXA 3VS6A 5GJWB 2DL3A 3QWYA 2L3QA 2DRMA 1GBRA 2L3PA 1YWPA 2D8JA 2DLPA 1FMKA 2J6FA 1M30A 1W6XA 4J9BA 3H0FA 4HVUA 1QLYA 1GFDA 1ABQA 2ED0A 2JT4A 1GCPA 1U06A 2KXCA 1FYNA 5IXBA 3VS7A 2ED1A 4HCKA 2ESWA 3M0UA 2LCSA 1YCSB 2VVKA 2DNUA 3EG1A 1HJDA 4RTXA 1AWOA 1SSHA 2IIMA 2KT1A 1J3TA 1LCKA 5IHKA 4ZNXA 2M51A 2D8HA 2KYBA 2K3BA 5IHIA 1X27A 2RN8A 4R0KA 2CUDA 1OPLA 2JMCA 2J05A 1BK2A 1K9AA 3VS3A 4RUGA 3EG0A 2YUNA 1OV3A 3C0CA 4OMQA 1UJ0A 1QKXA 4X1VA 2X3WD 1G2BA 3FJ5A 4AG2C 4J9DA 1WFWA 1BB9A 2W10A 2FPFA 1M27C 1TG0A 2K2MA 4DEXA 1H8KA 1KIKA 2E5KA 4OMLA 3H0IA 1ZX6A 2GQIA 3A98A 2P4RA 3O5ZA 1ZUUA 1Z9QA 2JTEA 1AWXA 4RTTA 1QWFA 1JXMA 4ESRA 2K6DA 4HVWA 1AOJA 2RF0A 2MIOA 2GNCA 1GCQC 2EPDA 2PTKA 2RMOA 4IIOA 4JJDA 2O31A 2A36A 1WXTA 1SHFA 5FW9A 1NYGA 1X6BA 3UF4A 2PZ1A 2O2OA 2YUPA 4RTYA 1AZEA 2JM9A 3EGUA 3PE0A 3LH5A 2NWMA 1HD3A 1PNJA 1HSQA 1QKWA 4KRTA 1UDLA 3TVTA 3H41A 2CH4A 1UTIA 2L3SA 1JXOA 1GRIA 2LJ3A 4RTUA 2MOXA 1NEGA 3M0PA 3TSZA 4Z8AA 1UUEA 3EG2A 1AWJA 1X69A 2YT6A 2J6OA 4LUEA 3IQLA 5GJVB 2EW3A 2CDTA 2DBMA 1ABOA 3U23A 2HDAA 2AZSA 1M8MA 2MCNA 2C0IA 2EQIA 2YUQA 2K79A 4J9CA 2C0OA 4D8DA 2AZVA 1H92A 2NUZA 3R6NA 2KRMA 1ZBJA 2FRWA 2O88A 3NHNA 1PKSA 3I5SA 2F2XA 2DM1A 2FRYA 2BZYA 2JW4A 1MUZA 2KROA 4AFZC 1IO6A 2DE0X 2B86A 3NMZC 2KE9A 2O9SA 2RQTA 1Y57A 2CT4A 2V1RA 2K7AA 1W70A 2LMJA 1CKAA 2KEAA 1VYVA 4F17A 1UJYA 1BBZA 1MV3A 1E6GA 4J9EA 1KSWA 1WA7A 2W0ZA 3RNJA 1SHGA 2RQWA 5FWBA 1SPKA 2DX1A 2SEMA 1SEMA 2J06A 1GBQA 2GGRA 2K9GA 2AK5A 1OOTA 1U3OA 4HXJA 4LN2A 1PWTA 2J7IA 4JJBA 4AFSC 2M0YA 2AKKA 1WI7A 4EIKA 3NPFA 1AEYA 4JPBW 3UA6A 1K0SA 2FPEA 1UFFA 2KT8A 5I22A 2EGCA 4HVVA 2ABLA 1T3SA 2KYMA 3UATA 1VYTA 4F16A 2FG0A 2RPNA 3EG3A 2DBKA 2FO0A 2J6KA 2LNHB 2GTOA 2EVRA 1PRMC 2DRKA 3THKA 1BU1A 1M3AA 1TUCA 1KFZA 4OMNA 2DILA 3REBB 4CC7A 2LZ6B 1PRLC 2ROLA 3REAB 1YNZA 1E6HA 1NEBA 4QT7A 2CSIA 1SRLA 2EGEA 2LJ1A 2VWFA 1WLPB 1JO8A 1YN8A 2A28A 1UHCA 1WDXA 1OEBA 2QDLA 1I0CA 2JM8A 1YP5A 2HSPA 4JJCA 2RQUA 2JS2A 5HCKA 1ARKA 4OMMA 2CH4W 2V1QA 2LQWA 2DF6A 2D0NA 1AWWA 4JZ3A 3EHRA 1GFCA 3H0HA 1AZGB 1EFNA 1CSKA 2LP5A 2GTJA 2ROTA 2CT3A 1NYFA 1A0NB 1K76A 2DJQA 2EYYA 4Y92A 2D1XA 2KR3A 2DVJA 1E7OA 2ECZA 1XOVA 5I11A 2KGTA 2HBWA 2KXDA 2BZ8A 2HEQA 4WCIA 2G6FX 2JMAA 1WXBA 2DL7A 2YUOA 1M3BA 1PHTA 4LNPA 4RTVA 3VS4A 1UGVA 1X2QA 1JEGA 2DYBA 3UA7A 2OI3A 2LX7A 3VRZA 4AFUC 2KBTA 3PVLA 2A08A 2A37A 2DL4A 2GBQA 2OAWA 4CC3A 2FEIA 4J9IA 3TSWA 4CC4B 1X2KA 2AKLA 2DMOA 3VRYA 1I07A 1T3LA 1SRMA 3VS1A 1RLQC 4Z88A 2FPDA 4LUDA 2KNBB 4ORZA 3EHQA 1YWOA 2EBPA 2RQRA 1WIEA 2DL8A 3RBBB 1ZUKA 2EKHA 2CSQA 1WYXA 4JZ4A 1T0HA 1UHFA 1ZUYA 5ECAA 3M0TA 4OMOA 3SHWA 2L0AA 1B07A 4J9HA 2I0NA 4IIMA 3PVQA 1NLOC 1KJWA 1U5SA 1N5ZA 1NG2A 3ULRB 2OJ2A 4D8KA 5FWCA 1TUDA 1WX6A 2EYXA 2LQNA 1JQQA 1X6GA 1UECA 2JXBA 1NLPC 1UE9A 2X3XD 3VS0A 4M4ZA 2C0TA 2HCKA 2DL5A 1NM7A 1WXUA 2XMFA 4J9GA 1JU5C 2DA9A 1S1NA 1B3QA 2LJ0A 2JS0A 2EYZA
chains in the Genus database with same CATH superfamily
1UE6A 4C1NI 1SJHD 3K59A 5L23A 1X43A 4E6RA 2BE5C 4LF9L 1W2BP 2B8GA 5EGTA 2GQVA 2EJMA 3K5LA 3T1YL 3VS2A 3EGXA 4A53A 4Z89A 2YSQA 4B3TQ 1G6ZA 2RA4A 4M7DD 4RG1A 5ELBA 1WTRA 4BBSB 2K4YA 5C6SA 2SRCA 3UE0A 2Z4IA 4K6DA 3I90A 1MD2D 3IL8A 2OTJA 1W3SA 1YIJT 3V2TA 3P8DA 1C7YA 3OBWA 1MJCA 1Y69U 4QJFA 4RG2A 2FZCB 5KYLA 4LFAL 1WCMH 4JBWA 2H1EA 4BE1A 2L5QA 4PQXA 4P2CB 4QL5A 2MP1A 5GAGC 3HOZH 3BZCA 3VU3C 1Q82U 1VS0A 2XSCA 4P5NA 4N9PA 1U1TA 4XTCS 1O7ZA 5IHNA 4IUQA 1N32Q 2KEDA 2NN6H 5C4ZA 2CP6A 3GTPB 3ZBDA 4LJZC 3C94A 3EG9B 1RUWA 5EC7A 4O6JA 1XJWB 3G48A 4CBVA 2EGAA 1IYVA 4O2DA 3EG9A 4IFDH 2QK0A 3CQTA 2RO0A 4M77G 1NE3A 1SMYD 4GBQA 2L0CA 2PNIA 4A3FG 1C0MA 2WSCE 2F0NA 4PZ6A 2XIDA 1FNVA 3SVMA 4J9FA 2SNMA 4JI3L 3VS5A 2AQ1B 5DY9A 1M1FA 4A3MG 2QXFA 4LF5Q 1J6QA 1RIPA 1NTGA 2EYJA 4PMCA 1E1TA 1CKNB 4E7HA 3M0SA 2QW7A 1JE5A 1OYXA 3KUFA 1QCFA 5C6AA 3OYKA 5J1ZA 3TU4K 3KBGA 1VIFA 1VQ5A 4XTUA 1HTLD 1XPRA 1CKNA 3OYEA 3JV3A 1D6EC 1EWHA 2M9VA 1SSOA 3ULJA 2CGHA 3R2TA 5DAUA 2VZAA 4R8IA 2E41A 3J81E 2QI2A 1D8LA 3ZJYC 3VS6A 3PUVA 4C92D 1IHZA 2L3QA 2DRMA 1B8AA 3D6WA 3OSSC 1PM3A 5CQYA 2L3PA 2E10A 3OW2S 3PUYA 4YHHQ 4GKKL 4K0KQ 3MP8A 1DZ1A 5C4JH 4Y28E 1SJED 2KQ3A 4ZKCB 3CRKC 1S5BD 1YI2T 2JA6B 1PTOH 4M77C 5GMKh 2D9UA 3VS7A 3CMEA 5CC4A 2ESWA 4N4GA 1PD1A 3MFYA 1C6VX 4JLIA 1TSFA 1HTPA 3OPOA 1FMVA 1BNZA 4KUIA 2CVRA 3M59A 3UWNA 3RKWA 1J3TA 4MZ9A 2K1BA 4EQNA 1C8CA 1KQSA 5DNFA 3EFSA 1NR2A 3I91A 4ID6A 4XQJA 1B34B 2K3BA 5LMNL 5TSSA 3URGA 2V8IA 2RN8A 4R0KA 2K03A 4ME5A 2CUDA 1B34A 2WP8J 4OGQC 3NK9A 5KGUA 1MIUA 2KVMA 2J05A 4HAEA 1YJNT 4EQ5A 3MEAA 2G3RA 5GAOq 1B7YB 3HZXA 2ZJQA 2PVOB 1CM9A 1D09B 1EZZB 2X4YA 5C3EB 4BACA 1VQ4T 1TWBA 1RTOA 2DY7A 2XIWA 3NBHB 3JAML 4EPCA 4ILWA 4N8FA 4C3JH 2YUNA 4NOYA 2FZKB 4C0GA 1K28A 1PFNA 3TZDA 4OMQA 1N27A 2LT4A 1QKXA 3E0JA 2K4KA 3NBHA 1VQ5Q 3CCEQ 3WVEB 2X3WD 4LF8L 3L2ZA 4AG2C 4J9DA 2ZJRA 1VQPT 1TR5A 1BCPC 4PFZA 1EQQA 4ALPA 3QIIA 2P0KA 4XQ3A 1TG0A 3JAME 4J1MA 2F4VQ 4M75E 4X9CA 1F9PA 4OX9L 3H0IA 2X6LA 2PI2E 1HZCA 1ZX6A 3H0GH 4C5EA 1HNXL 2YRCA 2EQSA 3RN2A 2DTOA 2D2CC 2JTEA 4LDUA 1M90C 5M3FG 2FL7A 3PF5A 2BIVA 4DR3L 3F8TA 1UEAB 4UP7A 4IO9A 3O13A 5IGGA 2A0FB 3CCVQ 5CORA 4L63B 4XQNA 4LF9Q 2BH2A 2I2LA 2MIOA 3CMEQ 1Z6HA 1GCQC 4ZGEB 3PO3H 2KSSA 2LRQA 2R7ZH 2PTKA 3OYFA 5JVH3 2DO3A 2RMOA 2XWJB 3RLNA 2C5CA 3DB3A 1MNDA 1WNLA 3LX0A 4OHJA 3PFSA 4POFA 2F69A 2PZUA 3PGGA 2DJGC 4A75A 1SHFA 1CKOA 4IKFA 1X6BA 3M9QA 2K2VA 4ZGDB 1GO3E 4QUFA 4JW0A 2RJEA 3ERSX 2RHYA 5NUCA 4RTYA 2J0TD 1YIJQ 9ATCB 3OA6A 1AZEA 3MHXA 3L2QA 4BI8B 1LTGD 1A62A 1WD1A 3EGUA 2KA7A 3L2VA 3LGJA 1AHJB 2GA4B 1YI2A 4A3EG 3JCMc 1PV4A 3HRUA 1PNJA 3GTOB 1AE3A 1ACMB 1MMGA 2CH4A 2J7ZA 2EYHA 1E7ZA 2LTOA 3A8HB 1L0XB 5M3FB 3CCMA 4QUCA 5JPMC 1DD2A 1QB5D 2HQHA 1TXQA 1TY0A 2GN5A 2WB1E 4F87A 1VIEA 1TTHB 4DR1Q 1FJGQ 1PH9A 4HKEA 1ENCA 1NUCA 3M5AA 1QVGA 4EMGA 3GP7A 5IP7G 1D1BA 1NEGA 3TSZA 3KLSA 4JI3Q 4M75B 2CHBD 1JT8A 4JRKA 1YJNA 1PG5B 5I4DA 3BVZA 1L0YB 3BFMA 4M75A 1HZ9A 1UWVA 3IQLA 5GJVB 2RVLA 1VQ4A 2L1BA 3H3VC 3KUPA 3VKIA 3I4MB 2HDAA 4LK1C 2LQ8A 1NE8A 1JMCA 2AUKA 2DTIA 3S1QH 2KY9A 2Z6KA 2JNGA 4YTLA 2C0IA 5J22A 2PZWA 4DV5L 2DIGA 1B50A 1GOZA 1VQPA 1KRTA 2N78A 4A3DH 4A93G 3DXJC 4OP0A 3G6ET 3Q0AA 4JVZA 4GKKQ 2EJGA 3PUWA 2ALYB 3CC4T 3GV6A 3MTSA 3WOFA 3RMQA 2KRMA 1ZBJA 2O4XA 1O80A 4DNRB 1L0WA 3NHNA 2QEXT 1N9SA 4RG8A 1VQ7T 1TQOA 1LACA 4RWSC 5FO7B 3VYRA 4O42A 5FJ8H 3FMCA 3K8AA 3P75A 1YI2Q 2UUBL 3UDGA 2FRYA 1PH4A 2BZYA 5T1IA 3KJPA 4H13C 2KROA 5EPJA 4AFZC 2A74C 2DJFC 2C9OA 4DAVA 4PJOF 2DXUA 1H9SB 1O78A 1NJIU 3HEJA 1YEZA 1PH1A 2WB1B 2RQTA 5M3MB 1E1OA 5I6WA 1XMQQ 1H9SA 5GAN5 4F7UG 5C44G 5L8RE 1BI0A 3GF5A 3OSVA 3H91A 2LT1A 2XN9C 1VQIA 2B8AA 3IRBA 3FRNA 1YJNQ 3BS1A 4J7IA 4PJJA 3T13A 1WA7A 4DGZA 2UXBL 1SHGA 4NS5A 2RQWA 3JCMV 1LTBD 1S5FD 2EYFA 1VQ4Q 4QB4A 3VDYA 2SEMA 1SFOB 1EWCA 3F2UA 3MEWA 1ZXTA 3RR5A 3SHLA 3HOZG 5KYXB 2CW0D 1G91A 5IGEA 2PNRC 1QMCA 3NBIA 2K9GA 2NN6G 1R8OB 1I6VC 2RB6A 1CHQD 1VQPQ 1NMGA 4PJLA 2JXMB 4CKBA 1RAIB 2HCIA 1VCIA 1I5OB 4NXML 1WHGA 5KYXA 4OX9Q 1M9SA 1PWTA 2L3RA 3JSCA 3ONAB 3Q6SA 3S1MH 2DPPB 5FLMH 3K5NA 3X20B 1WI7A 2VB6A 2B2TC 4FXKC 5CO7A 4IFDG 4C56C 1X32A 3R8BA 1N36Q 4A3FB 2K5QA 3EROA 3GTQH 1AEYA 3SK4A 4LD9K 2F0JA 4KMUC 1LV9A 2CCZA 1UFFA 3J81i 4EMKC 3QYHB 1ZYRC 3I72A 2YV5A 4DA2A 4HVVA 2ABLA 3M56A 2BA0A 1LYLA 1TWGB 5JOBA 3H6ZA 5ELCA 2E5LL 1VYTA 3NQIA 1I4HA 1TWHH 4DV3L 1ASZA 5LMUL 4G7HC 2X6GA 2DBKA 1I5LA 3CPWS 5EKIA 3G6EA 1E2VA 2VQEQ 2GCXA 1IGUA 4M78B 1IL2A 2XD0A 4C5IA 1IBKL 3V8LA 1ET6A 3E6ZX 2DJZA 4L8JA 5E4XA 1M8VA 2D0PA 3HOUB 4M78A 4B08A 5LJ3e 1VQ7A 4M7AC 4Z9CB 4QMGA 3H6MA 2E2HB 2LZ6B 2LSSA 1HK9A 2ROLA 5CKFA 2HQXA 2K14A 1UE7A 1SBBB 2EJFC 1B2TA 3MP6A 2CZ6B 2A7YA 4RKLA 2WKDA 2Y4XA 3TP7A 3HOYH 3OYAA 5J39A 1UAPA 5IOCA 1PRTB 5C4XG 1ILPA 2RI3A 5GAMd 3E9GA 4C3IB 3F2BA 2N55A 2R92B 2JM8A 2Z9HA 1TT2A 4B3RL 3OSOA 1H3ZA 5M5YH 3K58A 1PSFA 2Y4YA 5HCKA 3CCST 2LCCA 3I3CA 1MMDA 2JA7B 3HP3A 2LQWA 2D0QB 4HJ5A 2DYIA 1MGQA 2G5DA 2D0NA 1PYWD 2XVSA 4QQGA 3H0HA 1AZGB 3C95A 3E9FA 3HRZC 4XT1B 4M75D 3Q22A 1QWYA 4FF1A 3DKMA 1Q81U 4OB1B 2K5VA 4R1JA 2UU9L 1B1ZA 3Q1JA 1STGA 3JAMi 5GAMh 1F77A 4WORA 5IGCA 1L2FA 3OOCA 1A0NB 3HKZB 4DV5Q 2X51A 1IBLL 5E1FA 3AU7A 3VR4A 2EYYA 4DKAC 5CQXA 1PYBA 4DR6L 3CXCS 4C3JG 1PC0A 1BCMA 2E3IA 1II3A 1PXUA 1NZ9A 2NVYH 2NTSA 2F3VA 3SEBA 1XMOL 1XOVA 1SG5A 1U0LA 3ERQA 3V7RA 5M9OA 3G6EQ 3V05A 4DK1A 1BBWA 1K73C 5JEAJ 4C3HH 2BZ8A 2QGQA 3CC4Q 1Q7YR 3JCMW 2CQAA 3ND9A 1FGBD 1LTLA 4JI8L 3OYJA 1CK1A 2A68D 3SWNC 3ULPA 2ES2A 4KY5A 2QEXQ 2CQOA 1VQ7Q 3S1NH 1XYIA 2UUBQ 1EY6A 3H0GG 3OYMA 2WAQE 2VXEA 3PO2B 4HJ8A 4LW1A 1M3BA 3CAMA 1AZPA 4C8QG 4OWWB 2TSSA 3S3MA 3S17H 4UAIA 3JCMJ 1I8FA 3VJPA 2FB7A 3L42A 1N8RC 3EA6A 3VA7A 4OO1I 3L0OA 2DYBA 2PVGB 3G6JB 5DLQE 4LF4L 2EAYA 4KY7A 4AFUC 2Q8TA 2KBTA 3FKIH 2DZCA 3PO3G 4EX5A 2R7ZG 2NZOA 3TEEA 2XU8A 2EY1A 3OW2P 2VS1A 3UT1A 1VQMT 1LTRD 4M75F 3I4NB 4CC3A 5FU6C 3UPUA 1K8AR 2KI7A 2RK1A 1HUNA 5GMKi 2L55A 2AKLA 2PMZE 2GFAA 1JJGA 1A15A 2R58A 3L3OC 1SRMA 4XIGS 4EDUA 1RLQC 1NY4A 4OIJA 1RF2D 3I55T 1XWEA 1VQEA 4V2SA 1KHIA 4LUDA 1XPUA 3EHQA 3AEVA 4M7DC 2CKZB 1KQSP 5CMDA 5LJ5f 2CYZB 2QQAA 2EKHA 4P73A 5ECAA 1UHFA 3CCSA 1QE6A 5EBDA 3RMHA 1DOMA 1NJIR 1I94Q 2CP5A 4WJ3M 4JI0L 1HNZL 1Q82C 3HPWA 3OYCA 1X75C 2L0AA 3MCAB 4XXEA 4EVOA 3RZDH 1IZ6A 4ODGA 4JI2L 2QYZA 2I0NA 1TUGB 2PUOB 5GAMg 3RESA 3CD6T 1HA5A 4GNXB 4ZN1A 2PQAB 1EL0A 1KJWA 3T53B 2OJ2A 4XTWA 4C8QE 5FWCA 1WVLA 3U4VA 5DM73 4GNXA 3SK5A 2VUMB 1X3GA 2PQAA 1TUDA 2WAQB 1XNRL 2EYXA 2LQNA 4FVMA 1JQQA 1X6GA 3QDRB 1UECA 2K5IA 2B2WC 3OTOL 4JI6L 4A3JB 3KYHC 4PMBA 2WV6D 3TZUA 5KNDA 2HHHL 4IZ8A 3MXGA 3VS0A 2C0TA 2DL5A 1H9RA 1SMYC 1VQGA 3NUCA 1NM7A 1D5ZC 5D3IB 4J9GA 1S72T 8AT1B 1M1KR 1JU5C 4AT1B 3R93A 4DK6C 1AEXA 4BBRH 3EJIA 1EY0A 4A3DG 4M78D 4NW2A 1R9TB 1SF9A 2KCCA 2BZXA 1LVKA 1UGRB 5FU7C 1ZSGA 3T1HL 4GLXA 1OXUA 3BVMA 2COWA 5KCOA 2LKVA 1ZLMA 2F2VA 2PMZB 3RZOB 4A3KH 2I5HA 4IUVA 1QQJA 1E2ZA 2AHOB 5FJ8G 1IREB 3LWIA 1VQOA 3SD4A 2B2YC 4GS3A 4XU3A 2QQ9A 2E76C 4GLMA 2VKNA 3GO5A 2NVTH 1ZA2B 4X34A 4K8JA 5C5LA 2HMAA 4C92C 5CBEE 1BO0A 2MPMA 2JN0A 3A8KE 3E5SA 1K1ZA 1Y0MA 1YBYA 1UEBA 3M53A 1PRTD 1M2OA 2D62A 3F2CA 1EFWA 5K36H 2HDLA 2FINB 2Z0SA 3CCSQ 2ZM6L 3KLWA 2F0PA 3CHBD 1VQMA 4LFCL 1CKBA 2O01E 4E2FB 4HIMA 1KRSA 1R0BG 1EYGA 3SEMA 2EYWA 3MWYW 1K0XA 3NPPA 4FT2A 2M00A 5M5WH 3A55A 2F03A 1JB0E 1QWEA 3S3NA 2ZGWA 3I55A 1Q86U 2KRNA 4CJ0B 4AFQC 5CKHA 2O5JC 1ZQ1A 2X35A 2GVAA 4JBKA 1I6HB 1WTWA 5M3FH 2X9HA 1A6XA 3J81j 3HOWB 1Q8KA 3UI2A 2RBMA 1K83H 4A4EA 2MWPA 1V29B 5ISRA 1WD0A 2LQKA 2MYSA 2GVBA 1LTTD 1C1AA 4QIWE 3NGPA 2YDLA 2DAQA 2RQVA 4DEYA 2B8FA 1QP2A 1VOMA 4CC2A 3CD6A 4JS5A 4BY1B 5IH2A 1XNQL 4L6V5 3GTKH 2FZGB 3J7AF 2DTHA 3QOLA 4C5HA 5FLMG 4OXPA 3H3VH 2EQMA 2YRDA 4FU6A 2K3XA 1EU4A 2C35B 2WKCA 4DNIA 5IWAL 1WTOA 1PKTA 3JB9I 1Q81R 2ZTDA 2VASA 4N4IA 3U9SA 2NVQH 4BY6B 1N34Q 5GJWB 2DL3A 3QWYA 4E7JA 2FFKB 5HK3A 1PRTF 1YWPA 3R2IA 1RADB 2AWOA 4A3EH 3HOVH 2DLPA 5GMKj 3DMUA 3S2HH 2J6FA 2JZ2A 4QQ6A 2H3EB 5LJ5d 1IXRA 3H0FA 3OS5A 2Z4HA 4HVUA 1QLYA 2YHTA 3HHTB 1OXXK 1TWFH 4DV2L 1ABQA 5E4WC 4K2LA 3T16A 2Q2UA 2KXCA 4Y7NH 1VQMQ 5IXBA 2MMPA 1TWCH 2IPOB 4V190 5EKLA 1YCSB 2VVKA 2NUCA 1O7YA 3EG1A 4MNOA 1HJDA 4RTXA 2F0SA 3FDTA 4F7XA 3AMUA 2H3JA 1VQBA 5IP7H 4DR7L 1DJ7B 1VDZA 3QBYA 2A19A 3FJPA 1XTDA 3I55Q 2V8JA 1OZ2A 5ELNA 1Y14B 3SGIA 3J81c 3I8ZA 4DV7L 5LJ5h 3S3OA 2KYBA 1Q8IA 3PUXA 2PU9B 3MA2B 2CKKA 3HOYG 5IHIA 2H5XA 1X27A 1UB4A 5JPNC 1HNZQ 2JMCA 4B3SL 4DA4A 3MVVA 1BK2A 4YCUA 4O0AA 2YLCA 2P84A 4F7UF 1YNXA 4JI2Q 4YY3L 4IJLA 3JB9D 3MO8A 5D6YA 2PO4A 1HNWQ 2F0EA 3CD6Q 2EJ9A 2RDFA 4PJNA 1TWAB 2DUDA 3OYBA 4X1VA 2RDGA 1GKHA 5AJ3Q 2KVQG 5LL6S 4DUYQ 2F5TX 3OHXC 1HYOA 1NR4A 2RSNA 3M4PA 4KK7A 2W10A 1S40A 1M2VB 1E2WA 2K2MA 3EH2A 1KIKA 1TY2A 2E5KA 2DFUA 1OXVA 4A4KA 4QW2A 4DU9A 4AYBE 1LTAD 1IKLA 2XICA 1M2VA 1RI0A 4NP5A 3O5ZA 2NUPB 2WFWA 1Z9QA 3R6OA 2LVMA 1GHJA 1F2ZA 1AWXA 1UGSB 1S72Q 1WJQA 5GAN6 1U8RA 1KAAA 5CGKA 3FRPB 5H1SE 5JEAH 4DV1L 2B3GA 1QWFA 5GMKe 3J80E 1JXMA 1Y1WB 4ESRA 2NUPA 4XK8E 2K6DA 1SN8A 2RCFA 3T1HQ 1MMNA 2RF0A 2QQRA 2I5MX 4E7LA 4C3HG 4POGA 1EEFD 1FNUA 4IIOA 2A36A 1I3QH 1OU9A 1U4MA 5CV5A 3S14B 5C44H 4JBJA 1EY4A 4IUPA 1A3UA 1YNNC 1K8AC 1N33L 2B63B 1ILQA 6AT1B 5EG2A 5GAOr 1X3PA 3JAMc 3RLOA 3UF4A 2O2OA 2YUPA 3VV0A 3CPWP 1SNDA 1HXDA 4RGMA 2K50A 4E6IA 1KL9A 4LF6L 1HHVA 1HR0Q 2ZM6Q 3HGBA 3PE0A 4I7ZC 4PNYA 3X3NA 1Z9FA 4C1NK 3JB9F 5I2YA 3S16H 3S2DH 2RI5A 3LH5A 2ZTEA 2NWMA 3GNGA 2QASA 2MAMA 1VQ9T 2F52A 3FKIG 1QKWA 4ZN3A 1SYFA 2VGNA 2SDFA 3TVTA 3H41A 5CV9A 2HD3A 1UTIA 1D0XA 5CVIA 4A4IA 1OQKA 5LJ5g 1NJIC 2F0HA 1BF4A 4PJOB 2NYZD 2KECA 4FCYA 3KDFB 4P72A 4OB0B 1GRIA 2LJ3A 4Z02A 2MK5A 1QVCA 4NKLA 1RCVD 4PJOA 3EN2A 5IY0A 2LC4A 3HSBA 1JWUD 3MEVA 4OWXB 3HP9A 2FVUA 4MZMA 4CKCA 3J7YW 4R8NA 4N4HA 1UUEA 4JI5Q 2XDDA 3KLRA 4AYBB 4DOVA 1AWJA 3U9OA 4R55A 1WHHA 3FHWA 2UXCL 3B6YA 4LUEA 3A7AB 3K7UC 1WHKA 2RDHA 4DAPA 1XNQQ 1L1OB 1M8MA 2HKNA 1SROA 1XPOA 1WJSA 2L89A 2MPXC 3CKIB 3CCEA 2NBFA 2NVXH 2QF7A 1RAHB 5FRNA 2MCNA 4BY7B 4L5QA 2EQIA 2YUQA 2K79A 3JCMP 4J9CA 1EIGA 1L1OA 2E2JB 2C0OA 2L11A 2IL8A 4KGZB 4D8DA 1EZ8A 1AFPA 2CW0C 1TVXA 3HOXB 1GXDC 1Q86R 1YFNA 1JOKA 1Y1VH 4M8AA 1G8ZD 1XX8A 4XT3B 2WACA 5HK0A 3UDIA 4PNOA 3X26B 3CXCP 4A4HA 4A3IB 2NUZA 2EY2A 3GTMH 4JDSA 2RJFA 1BI3A 2YWWA 5T1GA 4X62L 2CZ0B 4LAAA 2F3WA 5BN3A 4NXNQ 2BA1A 3CCVA 1SYEA 3IAYA 1PLFA 3KBXA 5C4XH 1I4GA 2Z0WA 1WPYA 3A8GB 4ZTFA 2IWHA 4BBRG 1PH8A 2A6ED 2R93B 1QP3A 4UP9A 4K5VA 3M7GA 1KQSS 4GY5A 1W4SA 3G1JA 3M54A 4M77E 4C8QF 3AFQA 3LW5E 2X4XA 2B86A 1VQNT 4DV7Q 3QPHA 2MGSA 2O9SA 2ZPHB 5GADC 2BOSA 1Y57A 2CT4A 3VR2A 3DEPA 4PLLA 1YIJA 4RFBA 5EBCA 2V1RA 4A3KG 3NFCA 2DIQA 1JB7A 5GAN2 3GTLB 3DM1A 4IJHA 2LMJA 1O7LA 3TRZA 3CCJT 3WXMB 1KAWA 2AMCB 4YCWA 4R4IA 5CV6A 4YY3Q 1GM5A 4LFBL 3M57A 1VQ9A 1CT1D 1BBZA 1PFMA 2JA8B 1X6OA 4J9EA 1MMAA 3FP9A 1TU2B 2IHEA 5K36G 1G8XA 4KH1B 2FMCA 1PA6A 2NTTA 5CCAA 1SPKA 2DX1A 5GAOn 1DXMA 2EVBA 3M55A 4DR4L 2M1HA 1TH7A 2J06A 2RK2A 4DF7A 2A69C 2EYOA 4OMFB 2JTFA 4L5SA 1OOTA 2KUMA 5JVG3 1G6PA 1U3OA 2OQ0A 2J7IA 3JRZA 4JJBA 2JN4A 5CKBA 1OZ3A 5CR2A 2AKKA 3ME9A 3OQ5A 4J8QA 4YCVA 4RHRA 1Q81C 2QDBA 3ITPA 2WIIB 2F3IA 4FW2A 3INZA 4J83A 1CUKA 3CQZB 3TS0A 5I22A 1RDPD 2Y0SG 4M75C 4X3UA 3M4QA 2IX1A 4F04B 2E8GA 4HCBA 3S15B 4C0FA 2KYMA 5G3LD 4ULLA 3T1YQ 2JSOA 2DNEA 5IGBA 2FG0A 1Y8PB 1A2UA 1A63A 3SDZA 1YJWT 2Z6KC 1WTXA 3EG3A 4ME3A 4RGOS 1WFQA 2Q2TA 3M3YH 5CK9A 4DBRA 1D1IA 1NBWA 3RLFA 3AHUA 2J6KA 1U1SA 4M77B 5KH6A 3F2DA 1QCBD 2EQKA 2LNHB 3QJ6A 1K9MU 3C4SA 2G9HD 2R7DA 1XXGA 2EJGC 2ICEC 2YTYA 3OYYA 1BU1A 2N88A 1R0CB 4LFAQ 1M3AA 1TUCA 3I70A 1KFZA 3NENA 4DNTB 4A3MB 2OEOA 2JUFA 1I81A 4GKJL 4V0BA 4DFAA 4FDBA 1SAPA 2OQKA 4LF7L 3REAB 1GHKA 3HOVG 1NNXA 1CQVA 1E6HA 1Y7XA 1VQ9Q 2PZTA 4HT8A 2CZ1B 3OBYA 3M4OB 1SRUA 1S5ED 2CSIA 2K04A 1E3PA 1PH2A 2EGEA 2LJ1A 2I07B 1LO5D 4MZPA 3TSSA 2QTXA 4A3BB 1JO8A 4WJ4A 1QVGS 2OXPA 5C0XJ 3V8KA 3CP0A 1VQNA 1TKWB 1JWSD 1YP5A 4PJOD 3DWPA 2HSPA 4JJCA 2RQUA 4JV5L 1Q7YU 3QJYA 4OMMA 2CH4W 2EE1A 4A3GB 3JCMd 3TS2A 4JRIA 2X4WA 5BR8L 2LNVA 4LDWA 2VY3A 5GAMj 1AWWA 2VNUD 2CP7A 1KG1A 1IRXA 3S6WA 2GTJA 1IB8A 2PI2A 5G3LF 1KD1R 5M5XH 3GLXA 1X9NA 4GOPB 1NYFA 5GROA 1SEBD 2JA5H 3AB9A 5GAMf 1CFMA 3IKJA 4ZYSA 2CP0A 1QUQB 2DJQA 4BE2A 4JUVA 4GOPA 2D1XA 1SLJA 1E7OA 3IFTA 4J5YA 4Y91A 2ECZA 3FPUB 1QUQA 4LUOA 3J80i 5JAVA 5I11A 1ENAA 1K8AU 1VQKT 1ET9A 1U4LA 4CGYB 4FF2A 1EUJA 2G6FX 5HURA 4GN5A 3MKDA 2RD1A 3VYHB 2BKDN 4F88A 1SMXA 3J7AV 2OF1A 1YHAA 4QVDA 2PNHA 2DL7A 2YUOA 3MPUB 3T51B 3BZKA 4KJNA 2E2IB 1VMPA 4HMIA 2B2VA 4LNPA 1FR3A 4KBMB 2B2UA 3GTJB 4H0LC 1G2SA 5JEAG 1X2QA 2KK4A 3KFUA 2M02A 2MI6A 3LGLA 4KH0B 5A0GA 1YJWA 5BN4A 2MJ8A 4HCZA 2L9HA 3EIVA 2OI3A 2LX7A 1QOHA 2RJCA 3K7AH 5C4HA 5CBAE 3S1RH 4UY8C 5LMNQ 3G7ZA 1VQNQ 1KC8R 1CZWA 2R5MA 1JB3A 2IX0A 5J26A 4J6HA 3EQLC 2VQFQ 3A5ZB 1U4RA 2P5ZX 1DJRD 4KN4C 1GUTA 4J8OA 2OAWA 3K81C 4BWGB 1RAAB 4M78C 1DM0B 3I4OA 3TSWA 3CCJQ 2TMPA 3LYIA 4C0DB 4IALA 2VB2X 2AIRB 5GAMe 3NEMA 4L5RC 1K8GA 2E6ZA 4KD3A 4OONA 3HS0C 2K52A 2YTVA 2FPDA 2KNBB 2P0PA 2B29A 4HSVA 1PH6A 4LF8Q 1TU0B 2EBPA 1I4RA 4M7AG 4NL3A 2XK0A 1WIEA 4MDXA 3S24A 1M1KU 2KQWA 1U9RA 4R4QA 2QEJC 5I9OA 2CSQA 1ZUYA 1YITT 1B9NA 2OCEA 3M0TA 1SYDA 3URYA 3SHWA 1PRTC 3X25B 5IT9L 1QG7A 3QOJA 2Q8IB 1HNXQ 2XG8D 4CDFC 4J9HA 1IYUA 3FC3A 2ZTCA 5L37A 4C2MB 3KJOA 4HIDA 4DR3Q 1C4QA 3GQBA 3PVQA 4A3EB 1GD7A 4B3ML 3S2HB 1JJ2A 4J7FA 3ULRB 3VUZA 2RHIA 1Q86C 1WGSA 1B9MA 2AWNA 3VA5A 5GAHC 1IHWA 1CTMA 2LXKA 5IT9E 2KDSA 3JCMg 2E1HA 2YXYA 3LX7A 4ZTJA 1K3RA 4RMFA 2UXDL 3G71T 1EWIA 5I21A 4RHSA 3A54A 3OYNA 2FJ2A 2JXBA 4IOAA 4FXDA 4BA2I 1YJWQ 2X3XD 3GD7A 2IX3A 5KNBA 4KUDK 4F7UE 2XMFA 1WXUA 3OWFA 3UDXA 3GTPH 4FSXA 3CC4A 3A8OB 5E3FA 1VQKA 4FF4A 4M77D 4Q5VA 1S1NA 3H15A 2QEXA 2D9TA 1EQVA 2LJ0A 1V76A 3F70A 3K0XA 4LF7Q 2JS0A 1Y1VG 2EYZA 1X01A 1W2BA 3PIP3 3KFVA 5GANf 2H8HA 1H95A 2SOBA 4ZRZA 1SYGA 3G4ST 1BQQT 1QJOA 2KMTA 4NDXA 4BUGA 4M7AE 2MNAA 1C0AA 4LE9A 2UUCL 3EFXD 1G2TA 3MP1A 2FHDA 3X28B 1VF5C 1PH7A 4JOIA 4A93B 3I9QA 2RNAA 1ICFB 3NELA 1X55A 1MV0B 2BDNA 3JC66 4P75A 1AVZC 1XNIA 2F0UA 2VQFL 3FIFA 1HFGA 3VUBA 1K9MR 4PFPA 5IYCH 4LDYA 1STYA 4F14A 4LXCA 5C3XA 1IW7D 3I56T 2KRSA 1SYBA 3WWVA 3TQYA 5KE3A 2BTTA 3BY7A 5KYYB 4ANJA 3A8MB 1JE4A 3QDFA 4FP5D 1PCXA 3A74A 3K6OA 2R5AA 1CQFA 1OPKA 4ZKBB 1MJEA 3NQTA 3H8ZA 5KYYA 1IBML 3L2PA 2SEBD 2I0QA 2JA6H 3RMSA 4A63B 1EYDA 2CUBA 3CW2C 5IN1A 1V9PA 1LPLA 4K11A 1YITA 3PTAA 4M77F 2ENBA 3KK7A 3BDOA 2KHSA 5ELEA 2LY7A 1UGQB 2EFIA 2L2PA 2CREA 3BDUA 4F7UB 4OB3B 5GAOp 3PQIA 5CV8A 5A2QL 4PLIA 4C5GA 3LH0A 1VQKQ 2EY5A 4RA8A 3K0YA 4FSSA 3CMAT 4MMKA 4F7UA 4QKUA 4M7DG 1J5EL 1GL5A 2B63H 2BE7D 2K57A 1E22A 3H3VI 2DZ9A 1YCYA 2ENMA 4ATOA 1WCMB 3QWXX 4LDXA 1GXIE 1AD5A 4DPGA 5A2QE 3I35A 4JS4A 3G71A 3M85A 4GNXC 2DVEA 3HFNA 1CKMA 3N5BB 3STBC 2KCMA 5DM7R 3HOZB 1K0RA 5C3EH 2K6AA 2ATCB 1CZGA 2ZZDA 4D6WA 4KGXB 1FMKA 1HPCA 2A6HD 2XGTA 2E70A 2DEUA 1FNWA 1W6XA 4J9BA 1A3VA 1J9OA 4ZUIA 2K28A 1FMWA 4JLGA 1GFDA 1NAPA 2FHTA 2K75A 3S9WA 3PUZA 2RCNA 3CC7T 2K5DA 3VR5A 4HCKA 2LCSA 1KNAA 5LJ3d 4M1UB 2OAUA 5GAN3 1EFID 2UXBQ 5A0DA 5LJ5j 3BU2A 1SSHA 3G4SA 4BB7A 1ZSZB 2KT1A 4QCLA 4J6YA 2PQEA 3CCLT 2QQSA 4ZNXA 3UDCA 2M51A 3PIO3 4UPAA 5KCHA 3LWEA 1ZSZA 3MEFA 1F9SA 5C0XH 4NXMQ 1EY7A 3QYGB 2IVWA 1WTPA 2E4HA 2E75C 2GFUA 3D4RA 1FD7D 4DV6L 3JCMX 1YHBA 3BVGA 1YITQ 1K9AA 1EX4A 1D7QA 2QILA 3EFOB 2M2LA 4ME7A 3VS3A 4RUGA 1STEA 4G57A 4Q0FA 4B3MQ 7AT1B 2IG0A 2JA9A 4APVA 4CI0C 4C92G 3I56A 5C4JB 3EFOA 3RKXA 1IKMA 2E5LQ 4BDYA 5GANd 2K7VA 2PPBC 4DR5L 2UXDQ 1JCKB 1VQAA 3L2UA 3VYUA 4DV3Q 3FJ5A 3SFMA 1NSNS 1OULA 5LMUQ 1BB9A 1BKBA 1PTOB 2KHJA 1BOSA 3G71Q 4PJMA 4JRPA 1OX9A 1M27C 1Y07A 2CP2A 4DEXA 1I4XA 2MFIA 2YU9H 3A8LB 1BI1A 1EQRA 4NB3A 2ZPEB 4AQYL 2LXJA 4C0ZA 2JA5G 3A98A 4N0AA 2P4RA 1C48A 3C1FA 3HFZB 4GN3B 2PVDB 1IBKQ 1PFSA 4PL6A 2XNAC 1F1BB 1BUVT 1OX8A 3GOXA 2L8DA 4N8X1 5GANh 4DV4L 1BBXC 4HVWA 1XTCD 2DERA 3KF8B 4ZGJB 4TKOB 5GMKl 3JB9J 2GNCA 4BS9A 2CZ7B 1KK7A 2EY6A 1Y71A 3KF8A 4JJDA 2O31A 1B53A 1S4ZA 3G4SQ 1HQRD 2HKQB 1WXTA 2NYSA 1VQFA 3QB3A 4JG2A 5IODA 2UUCQ 5LJ5e 4PK4A 5FW9A 1SNMA 4C3JB 3I4MH 3ZEHA 1NYGA 2E12A 3R3OA 4G7ZC 4B3RQ 3WDNA 2PZ1A 3OYGA 2YYZA 4X3TA 4TRDA 4S3SA 5EJWA 4BY6C 2F0WA 3GDEA 3BW1A 5CV7A 4GLKA 4HCSA 4X3SA 3SK6A 2XWBB 5JJZA 3CC7A 1HD3A 3MXUA 4KRTA 3KF6B 4TQUS 1UDLA 4XU1A 5KYWB 3J80c 2NN6I 1OI1A 4DBFA 3H0GB 2UU9Q 4HIKA 2L3SA 2PYKA 1PVOA 1JOOA 4K8IA 4U68A 3I56Q 1X65A 3A8IE 3KF6A 5KYWA 1YVCA 4JI4L 2HCCA 2A6EC 4C8QB 2HAXA 4BE0A 1TXYA 3CCLA 1IBLQ 1XJVA 3RDVA 1AT1B 1JQYD 1WOCA 3GTGH 4IFDI 4WFN3 2IJ0A 4DR6Q 2DXTA 1B4OA 4C8QA 3QR8A 5LJ3g 1QVGP 1XMOQ 2EQUA 3PO3B 4GLVB 2EXDA 2R7ZB 1PHJA 1D2BA 3TMEA 1MSGA 3FDRA 4FYDA 4DBQA 2DXCA 3RERA 4IUUA 4JI8Q 2J6OA 3P7JA 2EW3A 3MFGA 1J5EQ 1N32L 3U23A 1ABOA 5M3MH 5D6XA 1R4QB 2CWAA 2NZHA 3CMAQ 1PZID 4JCVE 3M9BA 4MDWA 5CKEA 4XYOA 3TP6A 4RCOA 1JBMA 3QG1A 2VYTA 4BBSG 2F0VA 1QILA 1QNUA 2JYOA 4A54A 5J3BA 3DLMA 4EMHA 3QUIA 1IYJB 5CV4A 4LF4Q 3T56B 5FOBB 2RHQB 1H92A 5IGDA 2E6NA 3JCMb 4GN4B 1BIBA 1NPRA 3R6NA 3L7ZC 3J7ZC 2K5WA 4LF5L 3QWNA 1S72A 4DBHA 1RAGB 2YRVA 5GANg 2O88A 3W5OA 1SFOH 8ATCB 3C2PA 3TBIB 2RHSB 4KHVA 1PKSA 1CHPD 2F2XA 5KNCA 1F2MA 1T5XD 3CC7Q 2XHCA 2OX7A 2DN8A 1WJJA 1M90R 2JW4A 2LMCB 1ZEQX 4RKUE 1ENFA 1Q95G 4MMLA 3K5OA 2AQ3B 3W1GA 3D3RA 1IL8A 1F9RA 1SE4A 1IO6A 3BDCA 1WHMA 1K9MC 4A3FH 2COYA 4DXFA 3NMZC 2OTJT 4YHHL 3CCLQ 3AYHB 5FK9C 4K0KL 1EIFA 5I2MA 3S1QB 3FVQA 1GUGA 1TWGH 1X3EA 4VUBA 3QSUA 3OW7A 4JI0Q 1CKAA 3AQQA 2HZYA 4A3DB 4F17A 5ELFA 1UJYA 3OS2A 4AMCA 1MV3A 1G3TA 5I9PA 1KSWA 4UC4A 2R6GA 3RNJA 4CKEA 1X56A 4QIWB 3E9HA 2ZXRA 3J7A5 2V4DA 1HR0W 3GNFB 1PDQA 2UUAL 1J8IA 1K8OA 2EIFA 1SEMA 4J6XA 5GAOl 5IYCG 1XNRQ 1SE2A 5KEEA 5KRUA 4MZTA 3FEOA 4Q5WA 1GBQA 1QCNA 1Q7YC 2GGRA 3OTOQ 1WQ7A 2E2HH 4JI6Q 2HHHQ 2AUJD 4M7AF 4HXJA 1FXXA 3KXTA 4AFSC 4AH6A 4PJOC 2M0YA 2RM4A 1PTOD 2RQXA 2ZXOA 3D8GA 3I73A 1SE3A 4HN7A 2EZVA 3M7NA 2L15A 2QA4T 3BJUA 5CYUA 3RIRA 3NPFA 1WQWA 2JA6G 4QVCA 5KYNA 1K0SA 3A7LA 3SR1A 3V96A 4C3IH 2KT8A 1JWMD 1HA6A 2R92H 2XDPA 5JJIA 4FYVB 2R93G 3O8VA 4OEMB 5KYUB 1M1GA 4F16A 1MSHA 3CBOA 4UDUC 2KOLA 1EOVA 4YIJA 3CCUT 3TP8A 2J4XA 1ZKOA 3QZ9B 3W3AA 4JBMA 5IP9G 5KYUA 5DLOA 3ND8A 2ATWA 1L1OC 2LDMA 4KD4A 4UP8A 2F4VL 4X65L 2ZPIB 1YHQT 1YJ9T 1PYSB 3C1EA 2EVRA 2DRKA 3THKA 4FW1A 4PKCC 5EQ0A 3CU7A 2D5DA 5KE2A 4OMNA 4HSPA 3REBB 4CC7A 3DUZA 5C3EG 1CA6A 4LFCQ 1QZHA 1KD1U 1VQ6T 1YNZA 1WTVA 3PIOA 5CR3A 4E47A 3S1MB 4QT7A 2F0TA 1PZJD 1LJOA 1FX7A 2EXZA 1N9WA 4X6AH 2F0FA 4JI4Q 2QAZA 2VXFA 4QVZA 1FL0A 3GTQB 4JC0A 1YN8A 1STHA 1UHCA 4RGTA 1WDXA 2LX9A 2QDLA 1I0CA 1I4QA 3I7FA 2F4IA 3D4WA 1I4K1 1PTOF 2I5LX 4C8QD 1RAFB 2X69A 1HCZA 3CEYA 1ARKA 4NPSA 1GUWA 3PO2H 3KDFA 2CWPA 2V1QA 2G9DA 3OY9A 5BN5A 1TWHB 3DLLA 3ULLA 4E7SA 4JZ3A 3EHRA 5LL6X 4KN7C 1EFNA 3OYLA 2PQWA 1LT3D 3CRLC 3NTKA 5C0XG 1PZKD 5EAYA 2K5LA 1Q46A 2K5FA 1SNOA 2RKSA 4N9TA 3P8HA 1RODA 2CT3A 1EYCA 1Y96B 2MO0A 5IWAQ 2ZJPA 1M1KC 4R4CA 1UE1A 4JJNK 4DR1L 1FJGL 3RR6A 4DAYB 3I4NH 4Y92A 4BD3A 4JK1C 5F2DA 1KC8U 3HL8A 1Y96A 3I2ZA 3JCMf 3D7SB 2RHZA 3N52A 4DAYA 4L59A 5FLXL 3CF5A 3BDLA 4CRIA 3HOYB 3J81L 2QA4A 4WCIA 2Z6BA 3BZDB 4MIUA 3BE3A 1FVIA 4DV2Q 2F1MA 1MBYA 1QVPA 1WXBA 3CCRT 5M5YB 2KCNA 5FLXE 1UUPA 1QW1A 4M7DF 4A3BG 2XRSD 4B6MA 4O5VA 4JI1L 4MHEA 4RTVA 3CCUA 3JB9H 1UGVA 5AYFA 2FXQA 4DR7Q 4MTNA 1V8QA 4PZ7A 3UDFA 2XRQD 1EY5A 3UA7A 3OIQA 1Q1EA 2HQLA 3SE0A 4A3GG 3C12A 2HL5C 2XDBA 1YHQA 3OW2A 1YJ9A 2DD4A 3PVLA 2OTJQ 1SR3A 4M75G 1AW7A 2PW7A 2A37A 4G7OC 2K5NA 1K3BC 2VUMH 2Q8RE 2K5HA 4PMWA 4B3SQ 1B44D 2QGGA 3BYTB 5HGQA 2EYPA 4IPGA 4A3JH 2DEQA 1VQ6A 2FMMA 2NVYB 3I4MG 2DMOA 1AZQA 3VRYA 3PMFA 1T3LA 3CCMT 3VS1A 1VF7A 2A3LA 5AT1B 1GUOA 1PMRA 4HMJA 4C3HB 2UUAQ 4DXGA 3OS0A 4IURA 1FGUA 3TN2A 3EFRA 2A1AA 2YLBA 4AIMA 1LT4D 4ORZA 3VYSA 3HRSA 1SKUB 1YWOA 4HA8A 3JCMe 1DOKA 3N6RA 4ZK9B 5KYIA 2DD5A 1SYCA 1R9TH 3S1NB 2RQRA 2E3HA 4XTZA 1Z7TA 3RBBB 2JE6I 2JOYA 4HCEA 4JZ4A 4DR2L 1XMQL 1EZ6A 2YTXA 1DCZA 3RZOH 1HH2P 3S17B 2L4NA 1D3BB 4KKTA 1QVFS 1GJXA 4IIMA 2JJQA 2QA4Q 2NUTB 1CI3M 4DV1Q 1OTCA 2F0OA 1FWZA 5IIFA 1NLOC 3OYDA 1D3BA 1QVFA 3FKIB 4D8KA 5HKCA 4CHTB 3RUXA 2NUTA 1IW7C 1EOTA 4C92F 1YNJD 4XDXA 3CCUQ 2PCFB 4X64L 3NTIA 1NLPC 2WB1G 5M3MG 4KI0A 2X4JA 1BDOA 4X65Q 4M4ZA 4K6LA 4GOPC 1N33Q 4OGCA 3TQ7P 3NP8A 2N3SA 4KHPL 4NMZA 3A56A 2KENA 3A8JE 2SNSA 4LF6Q 1YHQQ 1YJ9Q 4B9WA 1N36L 1I50H 4M77A 2RF4A 4FO2A 1B3QA 5DM63 2K33A 3DHQA 3RN5A 3LLRA 1C9OA 1A3TA 1I6HH 5IE8A 1I1JA 2A68C 1WHJA 3CCRA 4PZ8A 3ZL7C 1K73R 2VXWA 1VA7A 5IXFA 1VQ6Q 2QCPX 4X66L 3HOWH 3Q24A 3META 1VQ8T 4KTAA 4Y52H 2BE9B 5E7NA 1M3CA 3ER0A 5IT9c 3RZDB 3W1BA 2B2VC 1PFBA 3M0RA 2BUDA 2B2UC 2DNCA 4EQOA 4R56A 4XTXA 3I5RA 3L2RA 4XTVA 3QO2A 5D65A 5FRMA 1K4US 3RUZA 2VQEL 1QZGA 3K57A 4WF2A 3MEUA 2EQJA 4BY1H 3OMGA 1KABA 2HD0A 1VYUA 2JTMA 3DB4A 1I5FA 2F0DA 3X3MA 3K80C 2LFNA 2A6HC 4AG1C 2E2DC 1WZOA 2ID0A 1RI9A 3GBQA 1N8RR 2PUKB 3RNUA 5DEHA 1B7TA 2P0QA 2HNIA 4RTWA 1H3HA 4I65A 4MTKA 4OO1G 2YU9B 3CCJA 3NTHA 3IFDA 2Y0SE 2UXCQ 4OMPA 1NPPA 4MN3A 1MGSA 5LMNW 1LOJA 1KQ1A 1BCPB 4JI7L 1UG1A 2JEBI 2RA2A 4HCCA 1A8VA 4RH6A 2Q2HA 4BBRB 3E1SA 3A5UA 2O9VA 1ZBXA 3M0QA 4C0DC 1AN8A 1MKHA 2ZT9C 1WYDA 1BR9A 4RTZA 1D5MC 3I4LA 4IN3A 1HJPA 1G83A 1Z9ZA 5EPKA 3JCMh 3G7LA 4M78G 2MF2A 4A3CH 4WJWA 4RAUC 2EYLA 2Q2IA 1OXSC 5I2XA 4A3KB 1RTNA 1V1CA 3HOUG 3E19A 4X64Q 2F2WA 4ZQ3A 4X62Q 2NVTB 1LT5D 3DWAA 3TREA 1T0JA 2BE5D 4KHZA 2K05A 2Z1CA 3SXHA 4TVRA 1GCQA 1RLPC 1G5VA 1LTID 4XAXB 3OS1A 3PNWC 1Q82R 2F0MA 3WOEA 1DOLA 1W1FA 3LWHA 3CCRQ 3U4ZA 5EPLA 4JI1Q 4OL7A 1YNND 4OIKA 5GMKm 2IHFA 3RKYA 1TS3A 4C3IG 4DAMA 2R92G 2O4XB 4H44C 1GBRA 4ZUJA 2D8JA 2JA7G 5M5WB 3QHSA 4OF1A 1M30A 2D0OA 1TWAH 5K5PA 3NE5B 2O5IC 3FLGA 3GTGB 2ED0A 4JRQA 2JT4A 2M9UA 1GCPA 1U06A 2P4TA 1FYNA 4FT4A 1EU3A 5C5MA 3T4AC 4LFBQ 2ED1A 2F0KA 3M0UA 3F1ZA 1HZBA 3AFPA 2DNUA 3PMTA 2QDYB 3SB2A 1K83B 2Y0SB 4L6TB 2ZPGB 4J15A 1AWOA 1QCOA 1VQ8A 1S5CD 1U4PA 3D0FA 3HKZG 3KLSX 2IIMA 4O1NA 4DR4Q 4XTYA 1Y8NB 3CCMQ 1V43A 4K2KA 4K5XA 1LCKA 5IHKA 4KLKA 2E64A 4M78E 3PV0A 1RAEB 4UHVA 3C3LA 3T9NA 5LJ3j 2D8HA 2MO1A 3P20A 1Y1WH 3GTKB 3DEOA 5C0XI 2AT1B 3L9AX 1H9MA 1UE5A 2H4OA 2R61A 2CS7A 1V1OA 4JOIC 4DR2Q 4BXXH 5CAIA 3A0JA 4ZLTF 1HQMC 4DK0A 1EQTA 2N8NA 2R7FA 1OPLA 4X3KA 3DM3A 2NVQB 1NMFA 1CSQA 3S14H 3M4GA 5LJ3f 2JEAI 1JJ2S 2RSOA 4BBSH 4LUZA 3EG0A 1STAA 1R4PB 3PO2G 3HOVB 1O7IA 2A5HA 1WCMG 2NWGA 1OV3A 4IOCA 1VQLT 1PH5A 1LUZA 3C0CA 4R4TA 3K5MA 5I2SA 1UJ0A 1KQ2A 3D4DA 1TWFB 1T9HA 1G2BA 1VMCA 1X54A 3DWQA 3TCJA 1K8MA 1LABA 1WFWA 4CDCC 3VR3A 4Y7NB 1F9QA 1TWCB 3VYTA 2FPFA 3GP8A 2M16A 3AT1B 1H8KA 1BIAA 1X3FA 5ELDA 1RD9D 5JJKA 4OMLA 1AP0A 1I94L 5GANj 4KHPQ 1KLGD 2IPKD 2GQIA 2E5QA 1TIID 4KGVB 3TEHB 1PH3A 4HJ7A 4OB2B 4OGEA 1ZUUA 1KLUD 4LDVA 1RACB 1IHVA 3MHBA 4RTTA 3I4NG 2VB3X 5GAN4 4ELYC 2DGYA 1O75A 3P1HA 1W2BS 4K14A 2CFMA 4GKJQ 1MHNA 1SNQA 1KDBA 1AOJA 3HKZE 2XTIA 3KOJA 3TDQA 1BVSA 1YZ6A 4X66Q 3ICEA 3UE1A 2EPDA 3TP5A 2VV5A 1XQHA 1RKNA 4FYYB 2NB0A 1JRIA 4DN4M 1EIYB 1GUNA 1VQ8Q 3SK8A 1BXTA 3VR6A 1BCOA 3U50C 5CIUA 2HL3A 1IXDA 1SDFA 4RCCA 4WTOB 1W6JA 3CPWA 3P8BB 4JV5Q 2PW5A 1TS5A 1ONLA 3V8JA 3JB9G 2KJXA 2JM9A 4QY7A 5BR8Q 4CDEC 4BY7H 3OMCA 4DOWA 3H94A 1MNEA 2E2JH 1WI5A 5FO9B 1HSQA 4OELB 2BDOA 4KKUA 4LD6A 2HDMA 1D5XC 3HOXH 4JI7Q 1KHCA 2D6FA 2VUMG 2AHJB 1D1AA 2WAQG 4A3IH 1KXLA 2A69D 1BCPD 2AQ2B 1SSFA 4NL2A 2K32A 2NZ1D 4A3JG 1JXOA 4DV0L 1P92A 2HIVA 1RHPA 3PT9A 2RI2A 4RTUA 5GAOm 1A2TA 2COZA 1ICWA 2MOXA 4A3LH 2IW3A 1ZSZC 2EKOA 2B2TA 4FIBA 4EMKB 3M0PA 1TS9A 4E7IA 3MZ5A 4ZCKA 2R93H 2DETA 1DONA 4Z8AA 1I3QB 1D0YA 3EG2A 3HFOA 5C44B 1X69A 3GIBA 4EMKA 2LS01 2YT6A 4CJ1B 3RD4A 4FNFA 5GANe 1M90U 1E0BA 5IP9H 2CDTA 2DBMA 4RMOA 2AZSA 1S3OA 2Y90A 3PSIA 1VQLA 1LT6D 1VQDA 1KDCA 2I46A 3GTLH 4P71A 3HRTA 3NHHA 3PF4A 3S16B 1HRJA 2N49A 3S2DB 2QKIC 2IT1A 5IYBH 5GAN8 1P16A 2JQOA 1CSPA 4M7AB 2JA8H 3QZ5B 4J6WA 1EY8A 1HXYD 3EVQA 3CXCA 4FL6A 2AZVA 3Q23A 1M5Q1 1HZAA 1ZA1B 3CPFA 4FYXB 4M7AA 2OWOA 1G3WA 1PTOC 2FRWA 3H9NA 4QGUA 2R57A 3V7SA 4N0AC 5IAYA 3CC2T 4BA1I 3VYGA 3I5SA 2O2LD 2EJFA 4FXGC 4DK3C 2DM1A 3A1PA 3H09A 4K5WA 4L5TA 2Z8LA 1MUZA 1BCPF 1W6KA 4QF4A 5JJLA 4DQ2A 1VQOT 4IPCA 2WINB 3M58A 3QKJA 1N34L 1G3YA 1M8AA 2EYMA 2DE0X 2HSEB 2RH2A 2KE9A 3CQZH 4G4KA 3WVDB 1VUBA 2EYQA 3L2WA 4KY6A 3HOWG 4QQDA 2NVXB 3E2UA 3S15H 2A73B 4KT0E 2K7AA 1W70A 1ML0D 3LWUA 1KD1C 2KEEA 1JORA 2OTLT 5FROA 1G291 1Q90A 4HIOA 3ZYYX 2KEAA 5LJ3h 1HUMA 1LTSD 1VYVA 4M7DE 2HBPA 2JJ9A 2MHVA 4BY1G 1MHWC 3NXWA 1E6GA 4JYAL 2W0ZA 1Y1VB 4LUVA 4A4FA 2F5KA 3NWTA 1OU8A 2KCTA 1EY9A 2DY8A 5COYA 4U673 5FWBA 4X9DA 3GTMB 4KKSA 4IFDJ 1VQLQ 3W2DA 5D14A 1VQCA 1T5EA 3JCMQ 4A3MH 2JVVA 5A0LA 4HJ9A 2HIXA 4II1A 1STBA 2F0LA 4RCNA 2A8VA 5C4XB 2AK5A 1BYMA 1RABB 2JP1A 3PCOB 3SWNB 2EWNA 5D6WA 1F2YA 4LN2A 4ABNA 3OB9A 1WTHA 1WHLA 1DGSA 3GTOH 1HFNA 2RJDA 4C8QC 2QGFB 3M4OH 2E74C 1V1PB 5IYDH 4EIKA 3SWNA 1ESFA 4A76A 2EOTA 4A3BH 4LWCA 1V1QA 4JPBW 3UA6A 3OYHA 2FPEA 4IPHA 2NLUA 4A3CG 1EEID 4YWKA 1V1PA 2F0GA 3CBPA 1HNWL 2EGCA 1H641 2XI9A 3CMAA 1QVFP 1T3SA 1STNA 3MXNB 4RGNA 3UATA 3EGDB 4I7AA 5FKAC 3HKSA 4EGVA 5AJ3L 4DUYL 4A3GH 1KC8C 1IGQA 4R9WA 4TSSA 3MXNA 4HJAA 2RPNA 1Q12A 1TOVA 3EGDA 3HTRA 2FO0A 1JICA 1N6AA 4H02A 1VQHA 5FU6B 1B70B 1H9JA 2L5TA 2GTOA 3CCQT 3MC0B 1PRMC 2VGMA 1BI2A 2RHXA 2F0IA 4ELZC 2DILA 1D1CA 3CC2A 1AE2A 2ZXPA 3PGZA 1KIXA 2KAFA 2M0OA 2ZPFB 1RJTA 1PRLC 5EKKA 1Y8OB 5I6YA 4C92E 1F2LA 1KTKA 4DUZL 1NEBA 2B39A 4M7DB 4B9XA 3NWSA 3ZFJA 3EH1A 1SRLA 4WRDA 5AFWA 2QQBA 5GAN7 3V7CA 2EDGA 4CJ2C 2VWFA 4B3TL 3E0EA 2K3YA 1WLPB 4M7DA 1JJCB 4GZYC 3QIAA 2A28A 3FEWX 4DV0Q 1OEBA 2CP3A 3D6CA 1IBMQ 4YWMA 1CA5A 1B3AA 3FPPA 2JS2A 4BXXG 3E9IA 4IQZA 4ZAIA 2V1CC 1GVPA 1QNKA 2VW9A 1HR0L 2DF6A 2E2IH 4XQQA 2WSEE 2HUGA 3GTJH 3M4YA 2OTLA 2KHIA 4XU0A 1M4VA 1Y1WG 1GFCA 3M3YB 1ZYRD 4OWTB 1CSKA 1NBEB 2LP5A 3QXEB 4KULA 3MJXA 1X3QA 5FO8B 4IUNA 4H7BA 5D7UA 2DXBA 2ROTA 4XYQA 4A4GA 5HGTA 1TS4A 1I50B 3CBMA 3GV3A 2B2WA 1WTQA 5HY6A 4IPDA 1K76A 4BI4A 5C0MA 2KR3A 2B63G 2DVJA 2QG9B 1R77A 2F0QA 3Q8DA 5CKDA 1FYCA 5GQOA 5FU7B 4M78F 3BYYB 2KGTA 2HBWA 2KXDA 3PIPA 1SXTA 4M7AD 4YWLA 4HR7B 4JI5L 1PD0A 2MWOA 2HEQA 4CDDC 3X24B 1KNEA 5IYDG 1Q3LA 2JMAA 2V26A 4PFOA 2HT1A 3CC2Q 3OIPA 5A35A 3NSWA 5IGFA 1JOQA 1GUSA 3EAEA 4C92B 1NCVA 1LLRD 1PHTA 2B2YA 5GAEC 4PJOG 3VS4A 1LM0A 2VC8A 1JEGA 4LNQA 2FYKA 1YNJC 5C3WA 2K01A 4C92A 3D31A 4E7KA 4KV6A 1VQOQ 2MQHA 3U58A 4C2MH 4OO1H 3VRZA 2WSFE 1OXTA 5M5XB 4FYWB 2VL6A 3CCQA 3MXPA 4EQPA 2A08A 2DL4A 2JA5B 2GBQA 4IUTA 4FM4B 4AYBG 4KJOA 4NXNL 4XU2A 4R4OA 4DV6Q 2AKWB 4P74A 5KIXA 3LNNA 2OTLQ 2FEIA 4J9IA 1ASYA 4JYAQ 4CC4B 1X2KA 2C06A 2R3ZA 1JC7A 1P8LA 1I07A 2MUYA 3OWEB 1D0ZA 3FB9A 1I4PA 2DKGA 2QTVA 2VUBA 4TVAB 5FLXc 4BY7G 1N9RA 4Z88A 4DR5Q 2V8KA 1SE8A 4BI3A 1G51A 1MI2A 1SNPA 4PG3A 1BBUA 3MEHA 2GF7A 3MAQA 3L1AA 2ICIA 4FF3A 3HOUH 1S5DD 3HOXG 4QQBX 4GLAC 1DYQA 1OO9B 2DL8A 4LMQD 4HT9A 2EPBA 2XKOC 1ZUKA 1WYXA 1E24A 1T0HA 1SNCA 4A3IG 2RHUA 4L5GA 4AQYQ 4OMOA 2BH8A 3GPLA 3HG9A 5ELOA 4OVAA 2IY5B 3C46A 1B07A 3BG3A 4HEDA 1U5KA 1ZHIA 1RL2A 2LCLA 4F8MA 3OYIA 1K73U 1G3SA 1UNSA 4A3LG 2L12A 5LHY1 3K7AB 3S1RB 4A93H 1Q1BA 1U5SA 1N5ZA 1NG2A 2ZPBB 1VQ5T 4PJOE 1LNXA 4DV4Q 3CCET 1JJ2P 2BCOA 2JK8A 3STBD 2JA7H 1D1KA 1WX6A 2F1LA 2OT2A 3E3XA 3EBEA 2E65A 1EIHA 1UGPB 4PV1C 2ZCFB 3PMIA 4BDZA 3J80L 4E7ZA 1UE9A 4RKBA 2HQEA 1M4ZA 1JR0D 1KDAA 1WJRA 3LGFA 2HCKA 3QO3A 1N8RU 1VQJA 5D3DA 2ASBA 1PSEA 1TS2A 2DA9A 2ZAEA 1ESRA 2KBNA 1O9SA 4RCBA 3CCQQ 1Z47A 2DK3A 1H9KA 5IYBG 1EYAA 3CCVT 4HTHA 1AH9A 2JA8G 3ASKA 1A0IA 3EGXB 3CMET 4DUZQ
chains in the Genus database with same CATH topology
1ZSGA 1I1JA 3KFVA 5L23A 1X43A 2H8HA 3ZL7C 4E6RA 1VA7A 5IXFA 3VS2A 1ZLMA 2F2VA 1M3CA 4Z89A 2YSQA 4LE9A 3M0RA 4GLMA 2VKNA 3I5RA 2SRCA 3I9QA 2RNAA 1K4US 1MV0B 1K1ZA 1Y0MA 1VYUA 1AVZC 4AG1C 1RI9A 3GBQA 1H3HA 1CKBA 4RTWA 3SEMA 4F14A 2EYWA 4OMPA 5IHNA 1K0XA 2KRSA 1UG1A 1RUWA 1QWEA 2BTTA 5EC7A 2KRNA 2O9VA 4AFQC 2EGAA 3M0QA 1OPKA 4RTZA 1G83A 1Z9ZA 3CQTA 4A63B 4GBQA 2PNIA 2CUBA 4K11A 4J9FA 3VS5A 1V1CA 2L2PA 2CREA 2F2WA 3NGPA 2YDLA 4DEYA 2RQVA 3M0SA 1T0JA 1QCFA 4FSSA 4CC2A 5IH2A 1GCQA 1GL5A 1RLPC 1W1FA 2ENMA 3JV3A 3QWXX 1AD5A 1PKTA 3I35A 2BZXA 3VS6A 5GJWB 2DL3A 3QWYA 2L3QA 2DRMA 1GBRA 2L3PA 1YWPA 2D8JA 2DLPA 1FMKA 2J6FA 1M30A 1W6XA 4J9BA 3H0FA 4HVUA 1QLYA 1GFDA 1ABQA 2ED0A 2JT4A 1GCPA 1U06A 2KXCA 1FYNA 5IXBA 3VS7A 2ED1A 4HCKA 2ESWA 3M0UA 2LCSA 1YCSB 2VVKA 2DNUA 3EG1A 1HJDA 4RTXA 1AWOA 1SSHA 2IIMA 2KT1A 1J3TA 1LCKA 5IHKA 4ZNXA 2M51A 2D8HA 2KYBA 2K3BA 5IHIA 1X27A 2RN8A 4R0KA 2CUDA 1OPLA 2JMCA 2J05A 1BK2A 1K9AA 3VS3A 4RUGA 3EG0A 2YUNA 1OV3A 3C0CA 4OMQA 1UJ0A 1QKXA 4X1VA 2X3WD 1G2BA 3FJ5A 4AG2C 4J9DA 1WFWA 1BB9A 2W10A 2FPFA 1M27C 1TG0A 2K2MA 4DEXA 1H8KA 1KIKA 2E5KA 4OMLA 3H0IA 1ZX6A 2GQIA 3A98A 2P4RA 3O5ZA 1ZUUA 1Z9QA 2JTEA 1AWXA 4RTTA 1QWFA 1JXMA 4ESRA 2K6DA 4HVWA 1AOJA 2RF0A 2MIOA 2GNCA 1GCQC 2EPDA 2PTKA 2RMOA 4IIOA 4JJDA 2O31A 2A36A 1WXTA 1SHFA 5FW9A 1NYGA 1X6BA 3UF4A 2PZ1A 2O2OA 2YUPA 4RTYA 1AZEA 2JM9A 3EGUA 3PE0A 3LH5A 2NWMA 1HD3A 1PNJA 1HSQA 1QKWA 4KRTA 1UDLA 3TVTA 3H41A 2CH4A 1UTIA 2L3SA 1JXOA 1GRIA 2LJ3A 4RTUA 2MOXA 1NEGA 3M0PA 3TSZA 4Z8AA 1UUEA 3EG2A 1AWJA 1X69A 2YT6A 2J6OA 4LUEA 3IQLA 5GJVB 2EW3A 2CDTA 2DBMA 1ABOA 3U23A 2HDAA 2AZSA 1M8MA 2MCNA 2C0IA 2EQIA 2YUQA 2K79A 4J9CA 2C0OA 4D8DA 2AZVA 1H92A 2NUZA 3R6NA 2KRMA 1ZBJA 2FRWA 2O88A 3NHNA 1PKSA 3I5SA 2F2XA 2DM1A 2FRYA 2BZYA 2JW4A 1MUZA 2KROA 4AFZC 1IO6A 2DE0X 2B86A 3NMZC 2KE9A 2O9SA 2RQTA 1Y57A 2CT4A 2V1RA 2K7AA 1W70A 2LMJA 1CKAA 2KEAA 1VYVA 4F17A 1UJYA 1BBZA 1MV3A 1E6GA 4J9EA 1KSWA 1WA7A 2W0ZA 3RNJA 1SHGA 2RQWA 5FWBA 1SPKA 2DX1A 2SEMA 1SEMA 2J06A 1GBQA 2GGRA 2K9GA 2AK5A 1OOTA 1U3OA 4HXJA 4LN2A 1PWTA 2J7IA 4JJBA 4AFSC 2M0YA 2AKKA 1WI7A 4EIKA 3NPFA 1AEYA 4JPBW 3UA6A 1K0SA 2FPEA 1UFFA 2KT8A 5I22A 2EGCA 4HVVA 2ABLA 1T3SA 2KYMA 3UATA 1VYTA 4F16A 2FG0A 2RPNA 3EG3A 2DBKA 2FO0A 2J6KA 2LNHB 2GTOA 2EVRA 1PRMC 2DRKA 3THKA 1BU1A 1M3AA 1TUCA 1KFZA 4OMNA 2DILA 3REBB 4CC7A 2LZ6B 1PRLC 2ROLA 3REAB 1YNZA 1E6HA 1NEBA 4QT7A 2CSIA 1SRLA 2EGEA 2LJ1A 2VWFA 1WLPB 1JO8A 1YN8A 2A28A 1UHCA 1WDXA 1OEBA 2QDLA 1I0CA 2JM8A 1YP5A 2HSPA 4JJCA 2RQUA 2JS2A 5HCKA 1ARKA 4OMMA 2CH4W 2V1QA 2LQWA 2DF6A 2D0NA 1AWWA 4JZ3A 3EHRA 1GFCA 3H0HA 1AZGB 1EFNA 1CSKA 2LP5A 2GTJA 2ROTA 2CT3A 1NYFA 1A0NB 1K76A 2DJQA 2EYYA 4Y92A 2D1XA 2KR3A 2DVJA 1E7OA 2ECZA 1XOVA 5I11A 2KGTA 2HBWA 2KXDA 2BZ8A 2HEQA 4WCIA 2G6FX 2JMAA 1WXBA 2DL7A 2YUOA 1M3BA 1PHTA 4LNPA 4RTVA 3VS4A 1UGVA 1X2QA 1JEGA 2DYBA 3UA7A 2OI3A 2LX7A 3VRZA 4AFUC 2KBTA 3PVLA 2A08A 2A37A 2DL4A 2GBQA 2OAWA 4CC3A 2FEIA 4J9IA 3TSWA 4CC4B 1X2KA 2AKLA 2DMOA 3VRYA 1I07A 1T3LA 1SRMA 3VS1A 1RLQC 4Z88A 2FPDA 4LUDA 2KNBB 4ORZA 3EHQA 1YWOA 2EBPA 2RQRA 1WIEA 2DL8A 3RBBB 1ZUKA 2EKHA 2CSQA 1WYXA 4JZ4A 1T0HA 1UHFA 1ZUYA 5ECAA 3M0TA 4OMOA 3SHWA 2L0AA 1B07A 4J9HA 2I0NA 4IIMA 3PVQA 1NLOC 1KJWA 1U5SA 1N5ZA 1NG2A 3ULRB 2OJ2A 4D8KA 5FWCA 1TUDA 1WX6A 2EYXA 2LQNA 1JQQA 1X6GA 1UECA 2JXBA 1NLPC 1UE9A 2X3XD 3VS0A 4M4ZA 2C0TA 2HCKA 2DL5A 1NM7A 1WXUA 2XMFA 4J9GA 1JU5C 2DA9A 1S1NA 1B3QA 2LJ0A 2JS0A 2EYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSG A;  1I1J A;  3KFV A;  5L23 A;  1X43 A;  2H8H A;  3ZL7 C;  4E6R A;  1VA7 A;  5IXF A;  3VS2 A;  1ZLM A;  2F2V A;  1M3C A;  4Z89 A;  2YSQ A;  4LE9 A;  3M0R A;  4GLM A;  2VKN A;  3I5R A;  2SRC A;  3I9Q A;  2RNA A;  1K4U S;  1MV0 B;  1K1Z A;  1Y0M A;  1VYU A;  1AVZ C;  4AG1 C;  1RI9 A;  3GBQ A;  1H3H A;  1CKB A;  4RTW A;  3SEM A;  4F14 A;  2EYW A;  4OMP A;  5IHN A;  1K0X A;  2KRS A;  1UG1 A;  1RUW A;  1QWE A;  2BTT A;  5EC7 A;  2KRN A;  2O9V A;  4AFQ C;  2EGA A;  3M0Q A;  1OPK A;  4RTZ A;  1G83 A;  1Z9Z A;  3CQT A;  4A63 B;  4GBQ A;  2PNI A;  2CUB A;  4K11 A;  4J9F A;  3VS5 A;  1V1C A;  2L2P A;  2CRE A;  2F2W A;  3NGP A;  2YDL A;  4DEY A;  2RQV A;  3M0S A;  1T0J A;  1QCF A;  4FSS A;  4CC2 A;  5IH2 A;  1GCQ A;  1GL5 A;  1RLP C;  1W1F A;  2ENM A;  3JV3 A;  3QWX X;  1AD5 A;  1PKT A;  3I35 A;  2BZX A;  3VS6 A;  5GJW B;  2DL3 A;  3QWY A;  2L3Q A;  2DRM A;  1GBR A;  2L3P A;  1YWP A;  2D8J A;  2DLP A;  1FMK A;  2J6F A;  1M30 A;  1W6X A;  4J9B A;  3H0F A;  4HVU A;  1QLY A;  1GFD A;  1ABQ A;  2ED0 A;  2JT4 A;  1GCP A;  1U06 A;  2KXC A;  1FYN A;  5IXB A;  3VS7 A;  2ED1 A;  4HCK A;  2ESW A;  3M0U A;  2LCS A;  1YCS B;  2VVK A;  2DNU A;  3EG1 A;  1HJD A;  4RTX A;  1AWO A;  1SSH A;  2IIM A;  2KT1 A;  1J3T A;  1LCK A;  5IHK A;  4ZNX A;  2M51 A;  2D8H A;  2KYB A;  2K3B A;  5IHI A;  1X27 A;  2RN8 A;  4R0K A;  2CUD A;  1OPL A;  2JMC A;  2J05 A;  1BK2 A;  1K9A A;  3VS3 A;  4RUG A;  3EG0 A;  2YUN A;  1OV3 A;  3C0C A;  4OMQ A;  1UJ0 A;  1QKX A;  4X1V A;  2X3W D;  1G2B A;  3FJ5 A;  4AG2 C;  4J9D A;  1WFW A;  1BB9 A;  2W10 A;  2FPF A;  1M27 C;  1TG0 A;  2K2M A;  4DEX A;  1H8K A;  1KIK A;  2E5K A;  4OML A;  3H0I A;  1ZX6 A;  2GQI A;  3A98 A;  2P4R A;  3O5Z A;  1ZUU A;  1Z9Q A;  2JTE A;  1AWX A;  4RTT A;  1QWF A;  1JXM A;  4ESR A;  2K6D A;  4HVW A;  1AOJ A;  2RF0 A;  2MIO A;  2GNC A;  1GCQ C;  2EPD A;  2PTK A;  2RMO A;  4IIO A;  4JJD A;  2O31 A;  2A36 A;  1WXT A;  1SHF A;  5FW9 A;  1NYG A;  1X6B A;  3UF4 A;  2PZ1 A;  2O2O A;  2YUP A;  4RTY A;  1AZE A;  2JM9 A;  3EGU A;  3PE0 A;  3LH5 A;  2NWM A;  1HD3 A;  1PNJ A;  1HSQ A;  1QKW A;  4KRT A;  1UDL A;  3TVT A;  3H41 A;  2CH4 A;  1UTI A;  2L3S A;  1JXO A;  1GRI A;  2LJ3 A;  4RTU A;  2MOX A;  1NEG A;  3M0P A;  3TSZ A;  4Z8A A;  1UUE A;  3EG2 A;  1AWJ A;  1X69 A;  2YT6 A;  2J6O A;  4LUE A;  3IQL A;  5GJV B;  2EW3 A;  2CDT A;  2DBM A;  1ABO A;  3U23 A;  2HDA A;  2AZS A;  1M8M A;  2MCN A;  2C0I A;  2EQI A;  2YUQ A;  2K79 A;  4J9C A;  2C0O A;  4D8D A;  2AZV A;  1H92 A;  2NUZ A;  3R6N A;  2KRM A;  1ZBJ A;  2FRW A;  2O88 A;  3NHN A;  1PKS A;  3I5S A;  2F2X A;  2DM1 A;  2FRY A;  2BZY A;  2JW4 A;  1MUZ A;  2KRO A;  4AFZ C;  1IO6 A;  2DE0 X;  2B86 A;  3NMZ C;  2KE9 A;  2O9S A;  2RQT A;  1Y57 A;  2CT4 A;  2V1R A;  2K7A A;  1W70 A;  2LMJ A;  1CKA A;  2KEA A;  1VYV A;  4F17 A;  1UJY A;  1BBZ A;  1MV3 A;  1E6G A;  4J9E A;  1KSW A;  1WA7 A;  2W0Z A;  3RNJ A;  1SHG A;  2RQW A;  5FWB A;  1SPK A;  2DX1 A;  2SEM A;  1SEM A;  2J06 A;  1GBQ A;  2GGR A;  2K9G A;  2AK5 A;  1OOT A;  1U3O A;  4HXJ A;  4LN2 A;  1PWT A;  2J7I A;  4JJB A;  4AFS C;  2M0Y A;  2AKK A;  1WI7 A;  4EIK A;  3NPF A;  1AEY A;  4JPB W;  3UA6 A;  1K0S A;  2FPE A;  1UFF A;  2KT8 A;  5I22 A;  2EGC A;  4HVV A;  2ABL A;  1T3S A;  2KYM A;  3UAT A;  1VYT A;  4F16 A;  2FG0 A;  2RPN A;  3EG3 A;  2DBK A;  2FO0 A;  2J6K A;  2LNH B;  2GTO A;  2EVR A;  1PRM C;  2DRK A;  3THK A;  1BU1 A;  1M3A A;  1TUC A;  1KFZ A;  4OMN A;  2DIL A;  3REB B;  4CC7 A;  2LZ6 B;  1PRL C;  2ROL A;  3REA B;  1YNZ A;  1E6H A;  1NEB A;  4QT7 A;  2CSI A;  1SRL A;  2EGE A;  2LJ1 A;  2VWF A;  1WLP B;  1JO8 A;  1YN8 A;  2A28 A;  1UHC A;  1WDX A;  1OEB A;  2QDL A;  1I0C A;  2JM8 A;  1YP5 A;  2HSP A;  4JJC A;  2RQU A;  2JS2 A;  5HCK A;  1ARK A;  4OMM A;  2CH4 W;  2V1Q A;  2LQW A;  2DF6 A;  2D0N A;  1AWW A;  4JZ3 A;  3EHR A;  1GFC A;  3H0H A;  1AZG B;  1EFN A;  1CSK A;  2LP5 A;  2GTJ A;  2ROT A;  2CT3 A;  1NYF A;  1A0N B;  1K76 A;  2DJQ A;  2EYY A;  4Y92 A;  2D1X A;  2KR3 A;  2DVJ A;  1E7O A;  2ECZ A;  1XOV A;  5I11 A;  2KGT A;  2HBW A;  2KXD A;  2BZ8 A;  2HEQ A;  4WCI A;  2G6F X;  2JMA A;  1WXB A;  2DL7 A;  2YUO A;  1M3B A;  1PHT A;  4LNP A;  4RTV A;  3VS4 A;  1UGV A;  1X2Q A;  1JEG A;  2DYB A;  3UA7 A;  2OI3 A;  2LX7 A;  3VRZ A;  4AFU C;  2KBT A;  3PVL A;  2A08 A;  2A37 A;  2DL4 A;  2GBQ A;  2OAW A;  4CC3 A;  2FEI A;  4J9I A;  3TSW A;  4CC4 B;  1X2K A;  2AKL A;  2DMO A;  3VRY A;  1I07 A;  1T3L A;  1SRM A;  3VS1 A;  1RLQ C;  4Z88 A;  2FPD A;  4LUD A;  2KNB B;  4ORZ A;  3EHQ A;  1YWO A;  2EBP A;  2RQR A;  1WIE A;  2DL8 A;  3RBB B;  1ZUK A;  2EKH A;  2CSQ A;  1WYX A;  4JZ4 A;  1T0H A;  1UHF A;  1ZUY A;  5ECA A;  3M0T A;  4OMO A;  3SHW A;  2L0A A;  1B07 A;  4J9H A;  2I0N A;  4IIM A;  3PVQ A;  1NLO C;  1KJW A;  1U5S A;  1N5Z A;  1NG2 A;  3ULR B;  2OJ2 A;  4D8K A;  5FWC A;  1TUD A;  1WX6 A;  2EYX A;  2LQN A;  1JQQ A;  1X6G A;  1UEC A;  2JXB A;  1NLP C;  1UE9 A;  2X3X D;  3VS0 A;  4M4Z A;  2C0T A;  2HCK A;  2DL5 A;  1NM7 A;  1WXU A;  2XMF A;  4J9G A;  1JU5 C;  2DA9 A;  1S1N A;  1B3Q A;  2LJ0 A;  2JS0 A;  2EYZ A; 
#chains in the Genus database with same CATH topology
 1UE6 A;  4C1N I;  1SJH D;  3K59 A;  5L23 A;  1X43 A;  4E6R A;  2BE5 C;  4LF9 L;  1W2B P;  2B8G A;  5EGT A;  2GQV A;  2EJM A;  3K5L A;  3T1Y L;  3VS2 A;  3EGX A;  4A53 A;  4Z89 A;  2YSQ A;  4B3T Q;  1G6Z A;  2RA4 A;  4M7D D;  4RG1 A;  5ELB A;  1WTR A;  4BBS B;  2K4Y A;  5C6S A;  2SRC A;  3UE0 A;  2Z4I A;  4K6D A;  3I90 A;  1MD2 D;  3IL8 A;  2OTJ A;  1W3S A;  1YIJ T;  3V2T A;  3P8D A;  1C7Y A;  3OBW A;  1MJC A;  1Y69 U;  4QJF A;  4RG2 A;  2FZC B;  5KYL A;  4LFA L;  1WCM H;  4JBW A;  2H1E A;  4BE1 A;  2L5Q A;  4PQX A;  4P2C B;  4QL5 A;  2MP1 A;  5GAG C;  3HOZ H;  3BZC A;  3VU3 C;  1Q82 U;  1VS0 A;  2XSC A;  4P5N A;  4N9P A;  1U1T A;  4XTC S;  1O7Z A;  5IHN A;  4IUQ A;  1N32 Q;  2KED A;  2NN6 H;  5C4Z A;  2CP6 A;  3GTP B;  3ZBD A;  4LJZ C;  3C94 A;  3EG9 B;  1RUW A;  5EC7 A;  4O6J A;  1XJW B;  3G48 A;  4CBV A;  2EGA A;  1IYV A;  4O2D A;  3EG9 A;  4IFD H;  2QK0 A;  3CQT A;  2RO0 A;  4M77 G;  1NE3 A;  1SMY D;  4GBQ A;  2L0C A;  2PNI A;  4A3F G;  1C0M A;  2WSC E;  2F0N A;  4PZ6 A;  2XID A;  1FNV A;  3SVM A;  4J9F A;  2SNM A;  4JI3 L;  3VS5 A;  2AQ1 B;  5DY9 A;  1M1F A;  4A3M G;  2QXF A;  4LF5 Q;  1J6Q A;  1RIP A;  1NTG A;  2EYJ A;  4PMC A;  1E1T A;  1CKN B;  4E7H A;  3M0S A;  2QW7 A;  1JE5 A;  1OYX A;  3KUF A;  1QCF A;  5C6A A;  3OYK A;  5J1Z A;  3TU4 K;  3KBG A;  1VIF A;  1VQ5 A;  4XTU A;  1HTL D;  1XPR A;  1CKN A;  3OYE A;  3JV3 A;  1D6E C;  1EWH A;  2M9V A;  1SSO A;  3ULJ A;  2CGH A;  3R2T A;  5DAU A;  2VZA A;  4R8I A;  2E41 A;  3J81 E;  2QI2 A;  1D8L A;  3ZJY C;  3VS6 A;  3PUV A;  4C92 D;  1IHZ A;  2L3Q A;  2DRM A;  1B8A A;  3D6W A;  3OSS C;  1PM3 A;  5CQY A;  2L3P A;  2E10 A;  3OW2 S;  3PUY A;  4YHH Q;  4GKK L;  4K0K Q;  3MP8 A;  1DZ1 A;  5C4J H;  4Y28 E;  1SJE D;  2KQ3 A;  4ZKC B;  3CRK C;  1S5B D;  1YI2 T;  2JA6 B;  1PTO H;  4M77 C;  5GMK h;  2D9U A;  3VS7 A;  3CME A;  5CC4 A;  2ESW A;  4N4G A;  1PD1 A;  3MFY A;  1C6V X;  4JLI A;  1TSF A;  1HTP A;  3OPO A;  1FMV A;  1BNZ A;  4KUI A;  2CVR A;  3M59 A;  3UWN A;  3RKW A;  1J3T A;  4MZ9 A;  2K1B A;  4EQN A;  1C8C A;  1KQS A;  5DNF A;  3EFS A;  1NR2 A;  3I91 A;  4ID6 A;  4XQJ A;  1B34 B;  2K3B A;  5LMN L;  5TSS A;  3URG A;  2V8I A;  2RN8 A;  4R0K A;  2K03 A;  4ME5 A;  2CUD A;  1B34 A;  2WP8 J;  4OGQ C;  3NK9 A;  5KGU A;  1MIU A;  2KVM A;  2J05 A;  4HAE A;  1YJN T;  4EQ5 A;  3MEA A;  2G3R A;  5GAO q;  1B7Y B;  3HZX A;  2ZJQ A;  2PVO B;  1CM9 A;  1D09 B;  1EZZ B;  2X4Y A;  5C3E B;  4BAC A;  1VQ4 T;  1TWB A;  1RTO A;  2DY7 A;  2XIW A;  3NBH B;  3JAM L;  4EPC A;  4ILW A;  4N8F A;  4C3J H;  2YUN A;  4NOY A;  2FZK B;  4C0G A;  1K28 A;  1PFN A;  3TZD A;  4OMQ A;  1N27 A;  2LT4 A;  1QKX A;  3E0J A;  2K4K A;  3NBH A;  1VQ5 Q;  3CCE Q;  3WVE B;  2X3W D;  4LF8 L;  3L2Z A;  4AG2 C;  4J9D A;  2ZJR A;  1VQP T;  1TR5 A;  1BCP C;  4PFZ A;  1EQQ A;  4ALP A;  3QII A;  2P0K A;  4XQ3 A;  1TG0 A;  3JAM E;  4J1M A;  2F4V Q;  4M75 E;  4X9C A;  1F9P A;  4OX9 L;  3H0I A;  2X6L A;  2PI2 E;  1HZC A;  1ZX6 A;  3H0G H;  4C5E A;  1HNX L;  2YRC A;  2EQS A;  3RN2 A;  2DTO A;  2D2C C;  2JTE A;  4LDU A;  1M90 C;  5M3F G;  2FL7 A;  3PF5 A;  2BIV A;  4DR3 L;  3F8T A;  1UEA B;  4UP7 A;  4IO9 A;  3O13 A;  5IGG A;  2A0F B;  3CCV Q;  5COR A;  4L63 B;  4XQN A;  4LF9 Q;  2BH2 A;  2I2L A;  2MIO A;  3CME Q;  1Z6H A;  1GCQ C;  4ZGE B;  3PO3 H;  2KSS A;  2LRQ A;  2R7Z H;  2PTK A;  3OYF A;  5JVH 3;  2DO3 A;  2RMO A;  2XWJ B;  3RLN A;  2C5C A;  3DB3 A;  1MND A;  1WNL A;  3LX0 A;  4OHJ A;  3PFS A;  4POF A;  2F69 A;  2PZU A;  3PGG A;  2DJG C;  4A75 A;  1SHF A;  1CKO A;  4IKF A;  1X6B A;  3M9Q A;  2K2V A;  4ZGD B;  1GO3 E;  4QUF A;  4JW0 A;  2RJE A;  3ERS X;  2RHY A;  5NUC A;  4RTY A;  2J0T D;  1YIJ Q;  9ATC B;  3OA6 A;  1AZE A;  3MHX A;  3L2Q A;  4BI8 B;  1LTG D;  1A62 A;  1WD1 A;  3EGU A;  2KA7 A;  3L2V A;  3LGJ A;  1AHJ B;  2GA4 B;  1YI2 A;  4A3E G;  3JCM c;  1PV4 A;  3HRU A;  1PNJ A;  3GTO B;  1AE3 A;  1ACM B;  1MMG A;  2CH4 A;  2J7Z A;  2EYH A;  1E7Z A;  2LTO A;  3A8H B;  1L0X B;  5M3F B;  3CCM A;  4QUC A;  5JPM C;  1DD2 A;  1QB5 D;  2HQH A;  1TXQ A;  1TY0 A;  2GN5 A;  2WB1 E;  4F87 A;  1VIE A;  1TTH B;  4DR1 Q;  1FJG Q;  1PH9 A;  4HKE A;  1ENC A;  1NUC A;  3M5A A;  1QVG A;  4EMG A;  3GP7 A;  5IP7 G;  1D1B A;  1NEG A;  3TSZ A;  3KLS A;  4JI3 Q;  4M75 B;  2CHB D;  1JT8 A;  4JRK A;  1YJN A;  1PG5 B;  5I4D A;  3BVZ A;  1L0Y B;  3BFM A;  4M75 A;  1HZ9 A;  1UWV A;  3IQL A;  5GJV B;  2RVL A;  1VQ4 A;  2L1B A;  3H3V C;  3KUP A;  3VKI A;  3I4M B;  2HDA A;  4LK1 C;  2LQ8 A;  1NE8 A;  1JMC A;  2AUK A;  2DTI A;  3S1Q H;  2KY9 A;  2Z6K A;  2JNG A;  4YTL A;  2C0I A;  5J22 A;  2PZW A;  4DV5 L;  2DIG A;  1B50 A;  1GOZ A;  1VQP A;  1KRT A;  2N78 A;  4A3D H;  4A93 G;  3DXJ C;  4OP0 A;  3G6E T;  3Q0A A;  4JVZ A;  4GKK Q;  2EJG A;  3PUW A;  2ALY B;  3CC4 T;  3GV6 A;  3MTS A;  3WOF A;  3RMQ A;  2KRM A;  1ZBJ A;  2O4X A;  1O80 A;  4DNR B;  1L0W A;  3NHN A;  2QEX T;  1N9S A;  4RG8 A;  1VQ7 T;  1TQO A;  1LAC A;  4RWS C;  5FO7 B;  3VYR A;  4O42 A;  5FJ8 H;  3FMC A;  3K8A A;  3P75 A;  1YI2 Q;  2UUB L;  3UDG A;  2FRY A;  1PH4 A;  2BZY A;  5T1I A;  3KJP A;  4H13 C;  2KRO A;  5EPJ A;  4AFZ C;  2A74 C;  2DJF C;  2C9O A;  4DAV A;  4PJO F;  2DXU A;  1H9S B;  1O78 A;  1NJI U;  3HEJ A;  1YEZ A;  1PH1 A;  2WB1 B;  2RQT A;  5M3M B;  1E1O A;  5I6W A;  1XMQ Q;  1H9S A;  5GAN 5;  4F7U G;  5C44 G;  5L8R E;  1BI0 A;  3GF5 A;  3OSV A;  3H91 A;  2LT1 A;  2XN9 C;  1VQI A;  2B8A A;  3IRB A;  3FRN A;  1YJN Q;  3BS1 A;  4J7I A;  4PJJ A;  3T13 A;  1WA7 A;  4DGZ A;  2UXB L;  1SHG A;  4NS5 A;  2RQW A;  3JCM V;  1LTB D;  1S5F D;  2EYF A;  1VQ4 Q;  4QB4 A;  3VDY A;  2SEM A;  1SFO B;  1EWC A;  3F2U A;  3MEW A;  1ZXT A;  3RR5 A;  3SHL A;  3HOZ G;  5KYX B;  2CW0 D;  1G91 A;  5IGE A;  2PNR C;  1QMC A;  3NBI A;  2K9G A;  2NN6 G;  1R8O B;  1I6V C;  2RB6 A;  1CHQ D;  1VQP Q;  1NMG A;  4PJL A;  2JXM B;  4CKB A;  1RAI B;  2HCI A;  1VCI A;  1I5O B;  4NXM L;  1WHG A;  5KYX A;  4OX9 Q;  1M9S A;  1PWT A;  2L3R A;  3JSC A;  3ONA B;  3Q6S A;  3S1M H;  2DPP B;  5FLM H;  3K5N A;  3X20 B;  1WI7 A;  2VB6 A;  2B2T C;  4FXK C;  5CO7 A;  4IFD G;  4C56 C;  1X32 A;  3R8B A;  1N36 Q;  4A3F B;  2K5Q A;  3ERO A;  3GTQ H;  1AEY A;  3SK4 A;  4LD9 K;  2F0J A;  4KMU C;  1LV9 A;  2CCZ A;  1UFF A;  3J81 i;  4EMK C;  3QYH B;  1ZYR C;  3I72 A;  2YV5 A;  4DA2 A;  4HVV A;  2ABL A;  3M56 A;  2BA0 A;  1LYL A;  1TWG B;  5JOB A;  3H6Z A;  5ELC A;  2E5L L;  1VYT A;  3NQI A;  1I4H A;  1TWH H;  4DV3 L;  1ASZ A;  5LMU L;  4G7H C;  2X6G A;  2DBK A;  1I5L A;  3CPW S;  5EKI A;  3G6E A;  1E2V A;  2VQE Q;  2GCX A;  1IGU A;  4M78 B;  1IL2 A;  2XD0 A;  4C5I A;  1IBK L;  3V8L A;  1ET6 A;  3E6Z X;  2DJZ A;  4L8J A;  5E4X A;  1M8V A;  2D0P A;  3HOU B;  4M78 A;  4B08 A;  5LJ3 e;  1VQ7 A;  4M7A C;  4Z9C B;  4QMG A;  3H6M A;  2E2H B;  2LZ6 B;  2LSS A;  1HK9 A;  2ROL A;  5CKF A;  2HQX A;  2K14 A;  1UE7 A;  1SBB B;  2EJF C;  1B2T A;  3MP6 A;  2CZ6 B;  2A7Y A;  4RKL A;  2WKD A;  2Y4X A;  3TP7 A;  3HOY H;  3OYA A;  5J39 A;  1UAP A;  5IOC A;  1PRT B;  5C4X G;  1ILP A;  2RI3 A;  5GAM d;  3E9G A;  4C3I B;  3F2B A;  2N55 A;  2R92 B;  2JM8 A;  2Z9H A;  1TT2 A;  4B3R L;  3OSO A;  1H3Z A;  5M5Y H;  3K58 A;  1PSF A;  2Y4Y A;  5HCK A;  3CCS T;  2LCC A;  3I3C A;  1MMD A;  2JA7 B;  3HP3 A;  2LQW A;  2D0Q B;  4HJ5 A;  2DYI A;  1MGQ A;  2G5D A;  2D0N A;  1PYW D;  2XVS A;  4QQG A;  3H0H A;  1AZG B;  3C95 A;  3E9F A;  3HRZ C;  4XT1 B;  4M75 D;  3Q22 A;  1QWY A;  4FF1 A;  3DKM A;  1Q81 U;  4OB1 B;  2K5V A;  4R1J A;  2UU9 L;  1B1Z A;  3Q1J A;  1STG A;  3JAM i;  5GAM h;  1F77 A;  4WOR A;  5IGC A;  1L2F A;  3OOC A;  1A0N B;  3HKZ B;  4DV5 Q;  2X51 A;  1IBL L;  5E1F A;  3AU7 A;  3VR4 A;  2EYY A;  4DKA C;  5CQX A;  1PYB A;  4DR6 L;  3CXC S;  4C3J G;  1PC0 A;  1BCM A;  2E3I A;  1II3 A;  1PXU A;  1NZ9 A;  2NVY H;  2NTS A;  2F3V A;  3SEB A;  1XMO L;  1XOV A;  1SG5 A;  1U0L A;  3ERQ A;  3V7R A;  5M9O A;  3G6E Q;  3V05 A;  4DK1 A;  1BBW A;  1K73 C;  5JEA J;  4C3H H;  2BZ8 A;  2QGQ A;  3CC4 Q;  1Q7Y R;  3JCM W;  2CQA A;  3ND9 A;  1FGB D;  1LTL A;  4JI8 L;  3OYJ A;  1CK1 A;  2A68 D;  3SWN C;  3ULP A;  2ES2 A;  4KY5 A;  2QEX Q;  2CQO A;  1VQ7 Q;  3S1N H;  1XYI A;  2UUB Q;  1EY6 A;  3H0G G;  3OYM A;  2WAQ E;  2VXE A;  3PO2 B;  4HJ8 A;  4LW1 A;  1M3B A;  3CAM A;  1AZP A;  4C8Q G;  4OWW B;  2TSS A;  3S3M A;  3S17 H;  4UAI A;  3JCM J;  1I8F A;  3VJP A;  2FB7 A;  3L42 A;  1N8R C;  3EA6 A;  3VA7 A;  4OO1 I;  3L0O A;  2DYB A;  2PVG B;  3G6J B;  5DLQ E;  4LF4 L;  2EAY A;  4KY7 A;  4AFU C;  2Q8T A;  2KBT A;  3FKI H;  2DZC A;  3PO3 G;  4EX5 A;  2R7Z G;  2NZO A;  3TEE A;  2XU8 A;  2EY1 A;  3OW2 P;  2VS1 A;  3UT1 A;  1VQM T;  1LTR D;  4M75 F;  3I4N B;  4CC3 A;  5FU6 C;  3UPU A;  1K8A R;  2KI7 A;  2RK1 A;  1HUN A;  5GMK i;  2L55 A;  2AKL A;  2PMZ E;  2GFA A;  1JJG A;  1A15 A;  2R58 A;  3L3O C;  1SRM A;  4XIG S;  4EDU A;  1RLQ C;  1NY4 A;  4OIJ A;  1RF2 D;  3I55 T;  1XWE A;  1VQE A;  4V2S A;  1KHI A;  4LUD A;  1XPU A;  3EHQ A;  3AEV A;  4M7D C;  2CKZ B;  1KQS P;  5CMD A;  5LJ5 f;  2CYZ B;  2QQA A;  2EKH A;  4P73 A;  5ECA A;  1UHF A;  3CCS A;  1QE6 A;  5EBD A;  3RMH A;  1DOM A;  1NJI R;  1I94 Q;  2CP5 A;  4WJ3 M;  4JI0 L;  1HNZ L;  1Q82 C;  3HPW A;  3OYC A;  1X75 C;  2L0A A;  3MCA B;  4XXE A;  4EVO A;  3RZD H;  1IZ6 A;  4ODG A;  4JI2 L;  2QYZ A;  2I0N A;  1TUG B;  2PUO B;  5GAM g;  3RES A;  3CD6 T;  1HA5 A;  4GNX B;  4ZN1 A;  2PQA B;  1EL0 A;  1KJW A;  3T53 B;  2OJ2 A;  4XTW A;  4C8Q E;  5FWC A;  1WVL A;  3U4V A;  5DM7 3;  4GNX A;  3SK5 A;  2VUM B;  1X3G A;  2PQA A;  1TUD A;  2WAQ B;  1XNR L;  2EYX A;  2LQN A;  4FVM A;  1JQQ A;  1X6G A;  3QDR B;  1UEC A;  2K5I A;  2B2W C;  3OTO L;  4JI6 L;  4A3J B;  3KYH C;  4PMB A;  2WV6 D;  3TZU A;  5KND A;  2HHH L;  4IZ8 A;  3MXG A;  3VS0 A;  2C0T A;  2DL5 A;  1H9R A;  1SMY C;  1VQG A;  3NUC A;  1NM7 A;  1D5Z C;  5D3I B;  4J9G A;  1S72 T;  8AT1 B;  1M1K R;  1JU5 C;  4AT1 B;  3R93 A;  4DK6 C;  1AEX A;  4BBR H;  3EJI A;  1EY0 A;  4A3D G;  4M78 D;  4NW2 A;  1R9T B;  1SF9 A;  2KCC A;  2BZX A;  1LVK A;  1UGR B;  5FU7 C;  1ZSG A;  3T1H L;  4GLX A;  1OXU A;  3BVM A;  2COW A;  5KCO A;  2LKV A;  1ZLM A;  2F2V A;  2PMZ B;  3RZO B;  4A3K H;  2I5H A;  4IUV A;  1QQJ A;  1E2Z A;  2AHO B;  5FJ8 G;  1IRE B;  3LWI A;  1VQO A;  3SD4 A;  2B2Y C;  4GS3 A;  4XU3 A;  2QQ9 A;  2E76 C;  4GLM A;  2VKN A;  3GO5 A;  2NVT H;  1ZA2 B;  4X34 A;  4K8J A;  5C5L A;  2HMA A;  4C92 C;  5CBE E;  1BO0 A;  2MPM A;  2JN0 A;  3A8K E;  3E5S A;  1K1Z A;  1Y0M A;  1YBY A;  1UEB A;  3M53 A;  1PRT D;  1M2O A;  2D62 A;  3F2C A;  1EFW A;  5K36 H;  2HDL A;  2FIN B;  2Z0S A;  3CCS Q;  2ZM6 L;  3KLW A;  2F0P A;  3CHB D;  1VQM A;  4LFC L;  1CKB A;  2O01 E;  4E2F B;  4HIM A;  1KRS A;  1R0B G;  1EYG A;  3SEM A;  2EYW A;  3MWY W;  1K0X A;  3NPP A;  4FT2 A;  2M00 A;  5M5W H;  3A55 A;  2F03 A;  1JB0 E;  1QWE A;  3S3N A;  2ZGW A;  3I55 A;  1Q86 U;  2KRN A;  4CJ0 B;  4AFQ C;  5CKH A;  2O5J C;  1ZQ1 A;  2X35 A;  2GVA A;  4JBK A;  1I6H B;  1WTW A;  5M3F H;  2X9H A;  1A6X A;  3J81 j;  3HOW B;  1Q8K A;  3UI2 A;  2RBM A;  1K83 H;  4A4E A;  2MWP A;  1V29 B;  5ISR A;  1WD0 A;  2LQK A;  2MYS A;  2GVB A;  1LTT D;  1C1A A;  4QIW E;  3NGP A;  2YDL A;  2DAQ A;  2RQV A;  4DEY A;  2B8F A;  1QP2 A;  1VOM A;  4CC2 A;  3CD6 A;  4JS5 A;  4BY1 B;  5IH2 A;  1XNQ L;  4L6V 5;  3GTK H;  2FZG B;  3J7A F;  2DTH A;  3QOL A;  4C5H A;  5FLM G;  4OXP A;  3H3V H;  2EQM A;  2YRD A;  4FU6 A;  2K3X A;  1EU4 A;  2C35 B;  2WKC A;  4DNI A;  5IWA L;  1WTO A;  1PKT A;  3JB9 I;  1Q81 R;  2ZTD A;  2VAS A;  4N4I A;  3U9S A;  2NVQ H;  4BY6 B;  1N34 Q;  5GJW B;  2DL3 A;  3QWY A;  4E7J A;  2FFK B;  5HK3 A;  1PRT F;  1YWP A;  3R2I A;  1RAD B;  2AWO A;  4A3E H;  3HOV H;  2DLP A;  5GMK j;  3DMU A;  3S2H H;  2J6F A;  2JZ2 A;  4QQ6 A;  2H3E B;  5LJ5 d;  1IXR A;  3H0F A;  3OS5 A;  2Z4H A;  4HVU A;  1QLY A;  2YHT A;  3HHT B;  1OXX K;  1TWF H;  4DV2 L;  1ABQ A;  5E4W C;  4K2L A;  3T16 A;  2Q2U A;  2KXC A;  4Y7N H;  1VQM Q;  5IXB A;  2MMP A;  1TWC H;  2IPO B;  4V19 0;  5EKL A;  1YCS B;  2VVK A;  2NUC A;  1O7Y A;  3EG1 A;  4MNO A;  1HJD A;  4RTX A;  2F0S A;  3FDT A;  4F7X A;  3AMU A;  2H3J A;  1VQB A;  5IP7 H;  4DR7 L;  1DJ7 B;  1VDZ A;  3QBY A;  2A19 A;  3FJP A;  1XTD A;  3I55 Q;  2V8J A;  1OZ2 A;  5ELN A;  1Y14 B;  3SGI A;  3J81 c;  3I8Z A;  4DV7 L;  5LJ5 h;  3S3O A;  2KYB A;  1Q8I A;  3PUX A;  2PU9 B;  3MA2 B;  2CKK A;  3HOY G;  5IHI A;  2H5X A;  1X27 A;  1UB4 A;  5JPN C;  1HNZ Q;  2JMC A;  4B3S L;  4DA4 A;  3MVV A;  1BK2 A;  4YCU A;  4O0A A;  2YLC A;  2P84 A;  4F7U F;  1YNX A;  4JI2 Q;  4YY3 L;  4IJL A;  3JB9 D;  3MO8 A;  5D6Y A;  2PO4 A;  1HNW Q;  2F0E A;  3CD6 Q;  2EJ9 A;  2RDF A;  4PJN A;  1TWA B;  2DUD A;  3OYB A;  4X1V A;  2RDG A;  1GKH A;  5AJ3 Q;  2KVQ G;  5LL6 S;  4DUY Q;  2F5T X;  3OHX C;  1HYO A;  1NR4 A;  2RSN A;  3M4P A;  4KK7 A;  2W10 A;  1S40 A;  1M2V B;  1E2W A;  2K2M A;  3EH2 A;  1KIK A;  1TY2 A;  2E5K A;  2DFU A;  1OXV A;  4A4K A;  4QW2 A;  4DU9 A;  4AYB E;  1LTA D;  1IKL A;  2XIC A;  1M2V A;  1RI0 A;  4NP5 A;  3O5Z A;  2NUP B;  2WFW A;  1Z9Q A;  3R6O A;  2LVM A;  1GHJ A;  1F2Z A;  1AWX A;  1UGS B;  1S72 Q;  1WJQ A;  5GAN 6;  1U8R A;  1KAA A;  5CGK A;  3FRP B;  5H1S E;  5JEA H;  4DV1 L;  2B3G A;  1QWF A;  5GMK e;  3J80 E;  1JXM A;  1Y1W B;  4ESR A;  2NUP A;  4XK8 E;  2K6D A;  1SN8 A;  2RCF A;  3T1H Q;  1MMN A;  2RF0 A;  2QQR A;  2I5M X;  4E7L A;  4C3H G;  4POG A;  1EEF D;  1FNU A;  4IIO A;  2A36 A;  1I3Q H;  1OU9 A;  1U4M A;  5CV5 A;  3S14 B;  5C44 H;  4JBJ A;  1EY4 A;  4IUP A;  1A3U A;  1YNN C;  1K8A C;  1N33 L;  2B63 B;  1ILQ A;  6AT1 B;  5EG2 A;  5GAO r;  1X3P A;  3JAM c;  3RLO A;  3UF4 A;  2O2O A;  2YUP A;  3VV0 A;  3CPW P;  1SND A;  1HXD A;  4RGM A;  2K50 A;  4E6I A;  1KL9 A;  4LF6 L;  1HHV A;  1HR0 Q;  2ZM6 Q;  3HGB A;  3PE0 A;  4I7Z C;  4PNY A;  3X3N A;  1Z9F A;  4C1N K;  3JB9 F;  5I2Y A;  3S16 H;  3S2D H;  2RI5 A;  3LH5 A;  2ZTE A;  2NWM A;  3GNG A;  2QAS A;  2MAM A;  1VQ9 T;  2F52 A;  3FKI G;  1QKW A;  4ZN3 A;  1SYF A;  2VGN A;  2SDF A;  3TVT A;  3H41 A;  5CV9 A;  2HD3 A;  1UTI A;  1D0X A;  5CVI A;  4A4I A;  1OQK A;  5LJ5 g;  1NJI C;  2F0H A;  1BF4 A;  4PJO B;  2NYZ D;  2KEC A;  4FCY A;  3KDF B;  4P72 A;  4OB0 B;  1GRI A;  2LJ3 A;  4Z02 A;  2MK5 A;  1QVC A;  4NKL A;  1RCV D;  4PJO A;  3EN2 A;  5IY0 A;  2LC4 A;  3HSB A;  1JWU D;  3MEV A;  4OWX B;  3HP9 A;  2FVU A;  4MZM A;  4CKC A;  3J7Y W;  4R8N A;  4N4H A;  1UUE A;  4JI5 Q;  2XDD A;  3KLR A;  4AYB B;  4DOV A;  1AWJ A;  3U9O A;  4R55 A;  1WHH A;  3FHW A;  2UXC L;  3B6Y A;  4LUE A;  3A7A B;  3K7U C;  1WHK A;  2RDH A;  4DAP A;  1XNQ Q;  1L1O B;  1M8M A;  2HKN A;  1SRO A;  1XPO A;  1WJS A;  2L89 A;  2MPX C;  3CKI B;  3CCE A;  2NBF A;  2NVX H;  2QF7 A;  1RAH B;  5FRN A;  2MCN A;  4BY7 B;  4L5Q A;  2EQI A;  2YUQ A;  2K79 A;  3JCM P;  4J9C A;  1EIG A;  1L1O A;  2E2J B;  2C0O A;  2L11 A;  2IL8 A;  4KGZ B;  4D8D A;  1EZ8 A;  1AFP A;  2CW0 C;  1TVX A;  3HOX B;  1GXD C;  1Q86 R;  1YFN A;  1JOK A;  1Y1V H;  4M8A A;  1G8Z D;  1XX8 A;  4XT3 B;  2WAC A;  5HK0 A;  3UDI A;  4PNO A;  3X26 B;  3CXC P;  4A4H A;  4A3I B;  2NUZ A;  2EY2 A;  3GTM H;  4JDS A;  2RJF A;  1BI3 A;  2YWW A;  5T1G A;  4X62 L;  2CZ0 B;  4LAA A;  2F3W A;  5BN3 A;  4NXN Q;  2BA1 A;  3CCV A;  1SYE A;  3IAY A;  1PLF A;  3KBX A;  5C4X H;  1I4G A;  2Z0W A;  1WPY A;  3A8G B;  4ZTF A;  2IWH A;  4BBR G;  1PH8 A;  2A6E D;  2R93 B;  1QP3 A;  4UP9 A;  4K5V A;  3M7G A;  1KQS S;  4GY5 A;  1W4S A;  3G1J A;  3M54 A;  4M77 E;  4C8Q F;  3AFQ A;  3LW5 E;  2X4X A;  2B86 A;  1VQN T;  4DV7 Q;  3QPH A;  2MGS A;  2O9S A;  2ZPH B;  5GAD C;  2BOS A;  1Y57 A;  2CT4 A;  3VR2 A;  3DEP A;  4PLL A;  1YIJ A;  4RFB A;  5EBC A;  2V1R A;  4A3K G;  3NFC A;  2DIQ A;  1JB7 A;  5GAN 2;  3GTL B;  3DM1 A;  4IJH A;  2LMJ A;  1O7L A;  3TRZ A;  3CCJ T;  3WXM B;  1KAW A;  2AMC B;  4YCW A;  4R4I A;  5CV6 A;  4YY3 Q;  1GM5 A;  4LFB L;  3M57 A;  1VQ9 A;  1CT1 D;  1BBZ A;  1PFM A;  2JA8 B;  1X6O A;  4J9E A;  1MMA A;  3FP9 A;  1TU2 B;  2IHE A;  5K36 G;  1G8X A;  4KH1 B;  2FMC A;  1PA6 A;  2NTT A;  5CCA A;  1SPK A;  2DX1 A;  5GAO n;  1DXM A;  2EVB A;  3M55 A;  4DR4 L;  2M1H A;  1TH7 A;  2J06 A;  2RK2 A;  4DF7 A;  2A69 C;  2EYO A;  4OMF B;  2JTF A;  4L5S A;  1OOT A;  2KUM A;  5JVG 3;  1G6P A;  1U3O A;  2OQ0 A;  2J7I A;  3JRZ A;  4JJB A;  2JN4 A;  5CKB A;  1OZ3 A;  5CR2 A;  2AKK A;  3ME9 A;  3OQ5 A;  4J8Q A;  4YCV A;  4RHR A;  1Q81 C;  2QDB A;  3ITP A;  2WII B;  2F3I A;  4FW2 A;  3INZ A;  4J83 A;  1CUK A;  3CQZ B;  3TS0 A;  5I22 A;  1RDP D;  2Y0S G;  4M75 C;  4X3U A;  3M4Q A;  2IX1 A;  4F04 B;  2E8G A;  4HCB A;  3S15 B;  4C0F A;  2KYM A;  5G3L D;  4ULL A;  3T1Y Q;  2JSO A;  2DNE A;  5IGB A;  2FG0 A;  1Y8P B;  1A2U A;  1A63 A;  3SDZ A;  1YJW T;  2Z6K C;  1WTX A;  3EG3 A;  4ME3 A;  4RGO S;  1WFQ A;  2Q2T A;  3M3Y H;  5CK9 A;  4DBR A;  1D1I A;  1NBW A;  3RLF A;  3AHU A;  2J6K A;  1U1S A;  4M77 B;  5KH6 A;  3F2D A;  1QCB D;  2EQK A;  2LNH B;  3QJ6 A;  1K9M U;  3C4S A;  2G9H D;  2R7D A;  1XXG A;  2EJG C;  2ICE C;  2YTY A;  3OYY A;  1BU1 A;  2N88 A;  1R0C B;  4LFA Q;  1M3A A;  1TUC A;  3I70 A;  1KFZ A;  3NEN A;  4DNT B;  4A3M B;  2OEO A;  2JUF A;  1I81 A;  4GKJ L;  4V0B A;  4DFA A;  4FDB A;  1SAP A;  2OQK A;  4LF7 L;  3REA B;  1GHK A;  3HOV G;  1NNX A;  1CQV A;  1E6H A;  1Y7X A;  1VQ9 Q;  2PZT A;  4HT8 A;  2CZ1 B;  3OBY A;  3M4O B;  1SRU A;  1S5E D;  2CSI A;  2K04 A;  1E3P A;  1PH2 A;  2EGE A;  2LJ1 A;  2I07 B;  1LO5 D;  4MZP A;  3TSS A;  2QTX A;  4A3B B;  1JO8 A;  4WJ4 A;  1QVG S;  2OXP A;  5C0X J;  3V8K A;  3CP0 A;  1VQN A;  1TKW B;  1JWS D;  1YP5 A;  4PJO D;  3DWP A;  2HSP A;  4JJC A;  2RQU A;  4JV5 L;  1Q7Y U;  3QJY A;  4OMM A;  2CH4 W;  2EE1 A;  4A3G B;  3JCM d;  3TS2 A;  4JRI A;  2X4W A;  5BR8 L;  2LNV A;  4LDW A;  2VY3 A;  5GAM j;  1AWW A;  2VNU D;  2CP7 A;  1KG1 A;  1IRX A;  3S6W A;  2GTJ A;  1IB8 A;  2PI2 A;  5G3L F;  1KD1 R;  5M5X H;  3GLX A;  1X9N A;  4GOP B;  1NYF A;  5GRO A;  1SEB D;  2JA5 H;  3AB9 A;  5GAM f;  1CFM A;  3IKJ A;  4ZYS A;  2CP0 A;  1QUQ B;  2DJQ A;  4BE2 A;  4JUV A;  4GOP A;  2D1X A;  1SLJ A;  1E7O A;  3IFT A;  4J5Y A;  4Y91 A;  2ECZ A;  3FPU B;  1QUQ A;  4LUO A;  3J80 i;  5JAV A;  5I11 A;  1ENA A;  1K8A U;  1VQK T;  1ET9 A;  1U4L A;  4CGY B;  4FF2 A;  1EUJ A;  2G6F X;  5HUR A;  4GN5 A;  3MKD A;  2RD1 A;  3VYH B;  2BKD N;  4F88 A;  1SMX A;  3J7A V;  2OF1 A;  1YHA A;  4QVD A;  2PNH A;  2DL7 A;  2YUO A;  3MPU B;  3T51 B;  3BZK A;  4KJN A;  2E2I B;  1VMP A;  4HMI A;  2B2V A;  4LNP A;  1FR3 A;  4KBM B;  2B2U A;  3GTJ B;  4H0L C;  1G2S A;  5JEA G;  1X2Q A;  2KK4 A;  3KFU A;  2M02 A;  2MI6 A;  3LGL A;  4KH0 B;  5A0G A;  1YJW A;  5BN4 A;  2MJ8 A;  4HCZ A;  2L9H A;  3EIV A;  2OI3 A;  2LX7 A;  1QOH A;  2RJC A;  3K7A H;  5C4H A;  5CBA E;  3S1R H;  4UY8 C;  5LMN Q;  3G7Z A;  1VQN Q;  1KC8 R;  1CZW A;  2R5M A;  1JB3 A;  2IX0 A;  5J26 A;  4J6H A;  3EQL C;  2VQF Q;  3A5Z B;  1U4R A;  2P5Z X;  1DJR D;  4KN4 C;  1GUT A;  4J8O A;  2OAW A;  3K81 C;  4BWG B;  1RAA B;  4M78 C;  1DM0 B;  3I4O A;  3TSW A;  3CCJ Q;  2TMP A;  3LYI A;  4C0D B;  4IAL A;  2VB2 X;  2AIR B;  5GAM e;  3NEM A;  4L5R C;  1K8G A;  2E6Z A;  4KD3 A;  4OON A;  3HS0 C;  2K52 A;  2YTV A;  2FPD A;  2KNB B;  2P0P A;  2B29 A;  4HSV A;  1PH6 A;  4LF8 Q;  1TU0 B;  2EBP A;  1I4R A;  4M7A G;  4NL3 A;  2XK0 A;  1WIE A;  4MDX A;  3S24 A;  1M1K U;  2KQW A;  1U9R A;  4R4Q A;  2QEJ C;  5I9O A;  2CSQ A;  1ZUY A;  1YIT T;  1B9N A;  2OCE A;  3M0T A;  1SYD A;  3URY A;  3SHW A;  1PRT C;  3X25 B;  5IT9 L;  1QG7 A;  3QOJ A;  2Q8I B;  1HNX Q;  2XG8 D;  4CDF C;  4J9H A;  1IYU A;  3FC3 A;  2ZTC A;  5L37 A;  4C2M B;  3KJO A;  4HID A;  4DR3 Q;  1C4Q A;  3GQB A;  3PVQ A;  4A3E B;  1GD7 A;  4B3M L;  3S2H B;  1JJ2 A;  4J7F A;  3ULR B;  3VUZ A;  2RHI A;  1Q86 C;  1WGS A;  1B9M A;  2AWN A;  3VA5 A;  5GAH C;  1IHW A;  1CTM A;  2LXK A;  5IT9 E;  2KDS A;  3JCM g;  2E1H A;  2YXY A;  3LX7 A;  4ZTJ A;  1K3R A;  4RMF A;  2UXD L;  3G71 T;  1EWI A;  5I21 A;  4RHS A;  3A54 A;  3OYN A;  2FJ2 A;  2JXB A;  4IOA A;  4FXD A;  4BA2 I;  1YJW Q;  2X3X D;  3GD7 A;  2IX3 A;  5KNB A;  4KUD K;  4F7U E;  2XMF A;  1WXU A;  3OWF A;  3UDX A;  3GTP H;  4FSX A;  3CC4 A;  3A8O B;  5E3F A;  1VQK A;  4FF4 A;  4M77 D;  4Q5V A;  1S1N A;  3H15 A;  2QEX A;  2D9T A;  1EQV A;  2LJ0 A;  1V76 A;  3F70 A;  3K0X A;  4LF7 Q;  2JS0 A;  1Y1V G;  2EYZ A;  1X01 A;  1W2B A;  3PIP 3;  3KFV A;  5GAN f;  2H8H A;  1H95 A;  2SOB A;  4ZRZ A;  1SYG A;  3G4S T;  1BQQ T;  1QJO A;  2KMT A;  4NDX A;  4BUG A;  4M7A E;  2MNA A;  1C0A A;  4LE9 A;  2UUC L;  3EFX D;  1G2T A;  3MP1 A;  2FHD A;  3X28 B;  1VF5 C;  1PH7 A;  4JOI A;  4A93 B;  3I9Q A;  2RNA A;  1ICF B;  3NEL A;  1X55 A;  1MV0 B;  2BDN A;  3JC6 6;  4P75 A;  1AVZ C;  1XNI A;  2F0U A;  2VQF L;  3FIF A;  1HFG A;  3VUB A;  1K9M R;  4PFP A;  5IYC H;  4LDY A;  1STY A;  4F14 A;  4LXC A;  5C3X A;  1IW7 D;  3I56 T;  2KRS A;  1SYB A;  3WWV A;  3TQY A;  5KE3 A;  2BTT A;  3BY7 A;  5KYY B;  4ANJ A;  3A8M B;  1JE4 A;  3QDF A;  4FP5 D;  1PCX A;  3A74 A;  3K6O A;  2R5A A;  1CQF A;  1OPK A;  4ZKB B;  1MJE A;  3NQT A;  3H8Z A;  5KYY A;  1IBM L;  3L2P A;  2SEB D;  2I0Q A;  2JA6 H;  3RMS A;  4A63 B;  1EYD A;  2CUB A;  3CW2 C;  5IN1 A;  1V9P A;  1LPL A;  4K11 A;  1YIT A;  3PTA A;  4M77 F;  2ENB A;  3KK7 A;  3BDO A;  2KHS A;  5ELE A;  2LY7 A;  1UGQ B;  2EFI A;  2L2P A;  2CRE A;  3BDU A;  4F7U B;  4OB3 B;  5GAO p;  3PQI A;  5CV8 A;  5A2Q L;  4PLI A;  4C5G A;  3LH0 A;  1VQK Q;  2EY5 A;  4RA8 A;  3K0Y A;  4FSS A;  3CMA T;  4MMK A;  4F7U A;  4QKU A;  4M7D G;  1J5E L;  1GL5 A;  2B63 H;  2BE7 D;  2K57 A;  1E22 A;  3H3V I;  2DZ9 A;  1YCY A;  2ENM A;  4ATO A;  1WCM B;  3QWX X;  4LDX A;  1GXI E;  1AD5 A;  4DPG A;  5A2Q E;  3I35 A;  4JS4 A;  3G71 A;  3M85 A;  4GNX C;  2DVE A;  3HFN A;  1CKM A;  3N5B B;  3STB C;  2KCM A;  5DM7 R;  3HOZ B;  1K0R A;  5C3E H;  2K6A A;  2ATC B;  1CZG A;  2ZZD A;  4D6W A;  4KGX B;  1FMK A;  1HPC A;  2A6H D;  2XGT A;  2E70 A;  2DEU A;  1FNW A;  1W6X A;  4J9B A;  1A3V A;  1J9O A;  4ZUI A;  2K28 A;  1FMW A;  4JLG A;  1GFD A;  1NAP A;  2FHT A;  2K75 A;  3S9W A;  3PUZ A;  2RCN A;  3CC7 T;  2K5D A;  3VR5 A;  4HCK A;  2LCS A;  1KNA A;  5LJ3 d;  4M1U B;  2OAU A;  5GAN 3;  1EFI D;  2UXB Q;  5A0D A;  5LJ5 j;  3BU2 A;  1SSH A;  3G4S A;  4BB7 A;  1ZSZ B;  2KT1 A;  4QCL A;  4J6Y A;  2PQE A;  3CCL T;  2QQS A;  4ZNX A;  3UDC A;  2M51 A;  3PIO 3;  4UPA A;  5KCH A;  3LWE A;  1ZSZ A;  3MEF A;  1F9S A;  5C0X H;  4NXM Q;  1EY7 A;  3QYG B;  2IVW A;  1WTP A;  2E4H A;  2E75 C;  2GFU A;  3D4R A;  1FD7 D;  4DV6 L;  3JCM X;  1YHB A;  3BVG A;  1YIT Q;  1K9A A;  1EX4 A;  1D7Q A;  2QIL A;  3EFO B;  2M2L A;  4ME7 A;  3VS3 A;  4RUG A;  1STE A;  4G57 A;  4Q0F A;  4B3M Q;  7AT1 B;  2IG0 A;  2JA9 A;  4APV A;  4CI0 C;  4C92 G;  3I56 A;  5C4J B;  3EFO A;  3RKX A;  1IKM A;  2E5L Q;  4BDY A;  5GAN d;  2K7V A;  2PPB C;  4DR5 L;  2UXD Q;  1JCK B;  1VQA A;  3L2U A;  3VYU A;  4DV3 Q;  3FJ5 A;  3SFM A;  1NSN S;  1OUL A;  5LMU Q;  1BB9 A;  1BKB A;  1PTO B;  2KHJ A;  1BOS A;  3G71 Q;  4PJM A;  4JRP A;  1OX9 A;  1M27 C;  1Y07 A;  2CP2 A;  4DEX A;  1I4X A;  2MFI A;  2YU9 H;  3A8L B;  1BI1 A;  1EQR A;  4NB3 A;  2ZPE B;  4AQY L;  2LXJ A;  4C0Z A;  2JA5 G;  3A98 A;  4N0A A;  2P4R A;  1C48 A;  3C1F A;  3HFZ B;  4GN3 B;  2PVD B;  1IBK Q;  1PFS A;  4PL6 A;  2XNA C;  1F1B B;  1BUV T;  1OX8 A;  3GOX A;  2L8D A;  4N8X 1;  5GAN h;  4DV4 L;  1BBX C;  4HVW A;  1XTC D;  2DER A;  3KF8 B;  4ZGJ B;  4TKO B;  5GMK l;  3JB9 J;  2GNC A;  4BS9 A;  2CZ7 B;  1KK7 A;  2EY6 A;  1Y71 A;  3KF8 A;  4JJD A;  2O31 A;  1B53 A;  1S4Z A;  3G4S Q;  1HQR D;  2HKQ B;  1WXT A;  2NYS A;  1VQF A;  3QB3 A;  4JG2 A;  5IOD A;  2UUC Q;  5LJ5 e;  4PK4 A;  5FW9 A;  1SNM A;  4C3J B;  3I4M H;  3ZEH A;  1NYG A;  2E12 A;  3R3O A;  4G7Z C;  4B3R Q;  3WDN A;  2PZ1 A;  3OYG A;  2YYZ A;  4X3T A;  4TRD A;  4S3S A;  5EJW A;  4BY6 C;  2F0W A;  3GDE A;  3BW1 A;  5CV7 A;  4GLK A;  4HCS A;  4X3S A;  3SK6 A;  2XWB B;  5JJZ A;  3CC7 A;  1HD3 A;  3MXU A;  4KRT A;  3KF6 B;  4TQU S;  1UDL A;  4XU1 A;  5KYW B;  3J80 c;  2NN6 I;  1OI1 A;  4DBF A;  3H0G B;  2UU9 Q;  4HIK A;  2L3S A;  2PYK A;  1PVO A;  1JOO A;  4K8I A;  4U68 A;  3I56 Q;  1X65 A;  3A8I E;  3KF6 A;  5KYW A;  1YVC A;  4JI4 L;  2HCC A;  2A6E C;  4C8Q B;  2HAX A;  4BE0 A;  1TXY A;  3CCL A;  1IBL Q;  1XJV A;  3RDV A;  1AT1 B;  1JQY D;  1WOC A;  3GTG H;  4IFD I;  4WFN 3;  2IJ0 A;  4DR6 Q;  2DXT A;  1B4O A;  4C8Q A;  3QR8 A;  5LJ3 g;  1QVG P;  1XMO Q;  2EQU A;  3PO3 B;  4GLV B;  2EXD A;  2R7Z B;  1PHJ A;  1D2B A;  3TME A;  1MSG A;  3FDR A;  4FYD A;  4DBQ A;  2DXC A;  3RER A;  4IUU A;  4JI8 Q;  2J6O A;  3P7J A;  2EW3 A;  3MFG A;  1J5E Q;  1N32 L;  3U23 A;  1ABO A;  5M3M H;  5D6X A;  1R4Q B;  2CWA A;  2NZH A;  3CMA Q;  1PZI D;  4JCV E;  3M9B A;  4MDW A;  5CKE A;  4XYO A;  3TP6 A;  4RCO A;  1JBM A;  3QG1 A;  2VYT A;  4BBS G;  2F0V A;  1QIL A;  1QNU A;  2JYO A;  4A54 A;  5J3B A;  3DLM A;  4EMH A;  3QUI A;  1IYJ B;  5CV4 A;  4LF4 Q;  3T56 B;  5FOB B;  2RHQ B;  1H92 A;  5IGD A;  2E6N A;  3JCM b;  4GN4 B;  1BIB A;  1NPR A;  3R6N A;  3L7Z C;  3J7Z C;  2K5W A;  4LF5 L;  3QWN A;  1S72 A;  4DBH A;  1RAG B;  2YRV A;  5GAN g;  2O88 A;  3W5O A;  1SFO H;  8ATC B;  3C2P A;  3TBI B;  2RHS B;  4KHV A;  1PKS A;  1CHP D;  2F2X A;  5KNC A;  1F2M A;  1T5X D;  3CC7 Q;  2XHC A;  2OX7 A;  2DN8 A;  1WJJ A;  1M90 R;  2JW4 A;  2LMC B;  1ZEQ X;  4RKU E;  1ENF A;  1Q95 G;  4MML A;  3K5O A;  2AQ3 B;  3W1G A;  3D3R A;  1IL8 A;  1F9R A;  1SE4 A;  1IO6 A;  3BDC A;  1WHM A;  1K9M C;  4A3F H;  2COY A;  4DXF A;  3NMZ C;  2OTJ T;  4YHH L;  3CCL Q;  3AYH B;  5FK9 C;  4K0K L;  1EIF A;  5I2M A;  3S1Q B;  3FVQ A;  1GUG A;  1TWG H;  1X3E A;  4VUB A;  3QSU A;  3OW7 A;  4JI0 Q;  1CKA A;  3AQQ A;  2HZY A;  4A3D B;  4F17 A;  5ELF A;  1UJY A;  3OS2 A;  4AMC A;  1MV3 A;  1G3T A;  5I9P A;  1KSW A;  4UC4 A;  2R6G A;  3RNJ A;  4CKE A;  1X56 A;  4QIW B;  3E9H A;  2ZXR A;  3J7A 5;  2V4D A;  1HR0 W;  3GNF B;  1PDQ A;  2UUA L;  1J8I A;  1K8O A;  2EIF A;  1SEM A;  4J6X A;  5GAO l;  5IYC G;  1XNR Q;  1SE2 A;  5KEE A;  5KRU A;  4MZT A;  3FEO A;  4Q5W A;  1GBQ A;  1QCN A;  1Q7Y C;  2GGR A;  3OTO Q;  1WQ7 A;  2E2H H;  4JI6 Q;  2HHH Q;  2AUJ D;  4M7A F;  4HXJ A;  1FXX A;  3KXT A;  4AFS C;  4AH6 A;  4PJO C;  2M0Y A;  2RM4 A;  1PTO D;  2RQX A;  2ZXO A;  3D8G A;  3I73 A;  1SE3 A;  4HN7 A;  2EZV A;  3M7N A;  2L15 A;  2QA4 T;  3BJU A;  5CYU A;  3RIR A;  3NPF A;  1WQW A;  2JA6 G;  4QVC A;  5KYN A;  1K0S A;  3A7L A;  3SR1 A;  3V96 A;  4C3I H;  2KT8 A;  1JWM D;  1HA6 A;  2R92 H;  2XDP A;  5JJI A;  4FYV B;  2R93 G;  3O8V A;  4OEM B;  5KYU B;  1M1G A;  4F16 A;  1MSH A;  3CBO A;  4UDU C;  2KOL A;  1EOV A;  4YIJ A;  3CCU T;  3TP8 A;  2J4X A;  1ZKO A;  3QZ9 B;  3W3A A;  4JBM A;  5IP9 G;  5KYU A;  5DLO A;  3ND8 A;  2ATW A;  1L1O C;  2LDM A;  4KD4 A;  4UP8 A;  2F4V L;  4X65 L;  2ZPI B;  1YHQ T;  1YJ9 T;  1PYS B;  3C1E A;  2EVR A;  2DRK A;  3THK A;  4FW1 A;  4PKC C;  5EQ0 A;  3CU7 A;  2D5D A;  5KE2 A;  4OMN A;  4HSP A;  3REB B;  4CC7 A;  3DUZ A;  5C3E G;  1CA6 A;  4LFC Q;  1QZH A;  1KD1 U;  1VQ6 T;  1YNZ A;  1WTV A;  3PIO A;  5CR3 A;  4E47 A;  3S1M B;  4QT7 A;  2F0T A;  1PZJ D;  1LJO A;  1FX7 A;  2EXZ A;  1N9W A;  4X6A H;  2F0F A;  4JI4 Q;  2QAZ A;  2VXF A;  4QVZ A;  1FL0 A;  3GTQ B;  4JC0 A;  1YN8 A;  1STH A;  1UHC A;  4RGT A;  1WDX A;  2LX9 A;  2QDL A;  1I0C A;  1I4Q A;  3I7F A;  2F4I A;  3D4W A;  1I4K 1;  1PTO F;  2I5L X;  4C8Q D;  1RAF B;  2X69 A;  1HCZ A;  3CEY A;  1ARK A;  4NPS A;  1GUW A;  3PO2 H;  3KDF A;  2CWP A;  2V1Q A;  2G9D A;  3OY9 A;  5BN5 A;  1TWH B;  3DLL A;  3ULL A;  4E7S A;  4JZ3 A;  3EHR A;  5LL6 X;  4KN7 C;  1EFN A;  3OYL A;  2PQW A;  1LT3 D;  3CRL C;  3NTK A;  5C0X G;  1PZK D;  5EAY A;  2K5L A;  1Q46 A;  2K5F A;  1SNO A;  2RKS A;  4N9T A;  3P8H A;  1ROD A;  2CT3 A;  1EYC A;  1Y96 B;  2MO0 A;  5IWA Q;  2ZJP A;  1M1K C;  4R4C A;  1UE1 A;  4JJN K;  4DR1 L;  1FJG L;  3RR6 A;  4DAY B;  3I4N H;  4Y92 A;  4BD3 A;  4JK1 C;  5F2D A;  1KC8 U;  3HL8 A;  1Y96 A;  3I2Z A;  3JCM f;  3D7S B;  2RHZ A;  3N52 A;  4DAY A;  4L59 A;  5FLX L;  3CF5 A;  3BDL A;  4CRI A;  3HOY B;  3J81 L;  2QA4 A;  4WCI A;  2Z6B A;  3BZD B;  4MIU A;  3BE3 A;  1FVI A;  4DV2 Q;  2F1M A;  1MBY A;  1QVP A;  1WXB A;  3CCR T;  5M5Y B;  2KCN A;  5FLX E;  1UUP A;  1QW1 A;  4M7D F;  4A3B G;  2XRS D;  4B6M A;  4O5V A;  4JI1 L;  4MHE A;  4RTV A;  3CCU A;  3JB9 H;  1UGV A;  5AYF A;  2FXQ A;  4DR7 Q;  4MTN A;  1V8Q A;  4PZ7 A;  3UDF A;  2XRQ D;  1EY5 A;  3UA7 A;  3OIQ A;  1Q1E A;  2HQL A;  3SE0 A;  4A3G G;  3C12 A;  2HL5 C;  2XDB A;  1YHQ A;  3OW2 A;  1YJ9 A;  2DD4 A;  3PVL A;  2OTJ Q;  1SR3 A;  4M75 G;  1AW7 A;  2PW7 A;  2A37 A;  4G7O C;  2K5N A;  1K3B C;  2VUM H;  2Q8R E;  2K5H A;  4PMW A;  4B3S Q;  1B44 D;  2QGG A;  3BYT B;  5HGQ A;  2EYP A;  4IPG A;  4A3J H;  2DEQ A;  1VQ6 A;  2FMM A;  2NVY B;  3I4M G;  2DMO A;  1AZQ A;  3VRY A;  3PMF A;  1T3L A;  3CCM T;  3VS1 A;  1VF7 A;  2A3L A;  5AT1 B;  1GUO A;  1PMR A;  4HMJ A;  4C3H B;  2UUA Q;  4DXG A;  3OS0 A;  4IUR A;  1FGU A;  3TN2 A;  3EFR A;  2A1A A;  2YLB A;  4AIM A;  1LT4 D;  4ORZ A;  3VYS A;  3HRS A;  1SKU B;  1YWO A;  4HA8 A;  3JCM e;  1DOK A;  3N6R A;  4ZK9 B;  5KYI A;  2DD5 A;  1SYC A;  1R9T H;  3S1N B;  2RQR A;  2E3H A;  4XTZ A;  1Z7T A;  3RBB B;  2JE6 I;  2JOY A;  4HCE A;  4JZ4 A;  4DR2 L;  1XMQ L;  1EZ6 A;  2YTX A;  1DCZ A;  3RZO H;  1HH2 P;  3S17 B;  2L4N A;  1D3B B;  4KKT A;  1QVF S;  1GJX A;  4IIM A;  2JJQ A;  2QA4 Q;  2NUT B;  1CI3 M;  4DV1 Q;  1OTC A;  2F0O A;  1FWZ A;  5IIF A;  1NLO C;  3OYD A;  1D3B A;  1QVF A;  3FKI B;  4D8K A;  5HKC A;  4CHT B;  3RUX A;  2NUT A;  1IW7 C;  1EOT A;  4C92 F;  1YNJ D;  4XDX A;  3CCU Q;  2PCF B;  4X64 L;  3NTI A;  1NLP C;  2WB1 G;  5M3M G;  4KI0 A;  2X4J A;  1BDO A;  4X65 Q;  4M4Z A;  4K6L A;  4GOP C;  1N33 Q;  4OGC A;  3TQ7 P;  3NP8 A;  2N3S A;  4KHP L;  4NMZ A;  3A56 A;  2KEN A;  3A8J E;  2SNS A;  4LF6 Q;  1YHQ Q;  1YJ9 Q;  4B9W A;  1N36 L;  1I50 H;  4M77 A;  2RF4 A;  4FO2 A;  1B3Q A;  5DM6 3;  2K33 A;  3DHQ A;  3RN5 A;  3LLR A;  1C9O A;  1A3T A;  1I6H H;  5IE8 A;  1I1J A;  2A68 C;  1WHJ A;  3CCR A;  4PZ8 A;  3ZL7 C;  1K73 R;  2VXW A;  1VA7 A;  5IXF A;  1VQ6 Q;  2QCP X;  4X66 L;  3HOW H;  3Q24 A;  3MET A;  1VQ8 T;  4KTA A;  4Y52 H;  2BE9 B;  5E7N A;  1M3C A;  3ER0 A;  5IT9 c;  3RZD B;  3W1B A;  2B2V C;  1PFB A;  3M0R A;  2BUD A;  2B2U C;  2DNC A;  4EQO A;  4R56 A;  4XTX A;  3I5R A;  3L2R A;  4XTV A;  3QO2 A;  5D65 A;  5FRM A;  1K4U S;  3RUZ A;  2VQE L;  1QZG A;  3K57 A;  4WF2 A;  3MEU A;  2EQJ A;  4BY1 H;  3OMG A;  1KAB A;  2HD0 A;  1VYU A;  2JTM A;  3DB4 A;  1I5F A;  2F0D A;  3X3M A;  3K80 C;  2LFN A;  2A6H C;  4AG1 C;  2E2D C;  1WZO A;  2ID0 A;  1RI9 A;  3GBQ A;  1N8R R;  2PUK B;  3RNU A;  5DEH A;  1B7T A;  2P0Q A;  2HNI A;  4RTW A;  1H3H A;  4I65 A;  4MTK A;  4OO1 G;  2YU9 B;  3CCJ A;  3NTH A;  3IFD A;  2Y0S E;  2UXC Q;  4OMP A;  1NPP A;  4MN3 A;  1MGS A;  5LMN W;  1LOJ A;  1KQ1 A;  1BCP B;  4JI7 L;  1UG1 A;  2JEB I;  2RA2 A;  4HCC A;  1A8V A;  4RH6 A;  2Q2H A;  4BBR B;  3E1S A;  3A5U A;  2O9V A;  1ZBX A;  3M0Q A;  4C0D C;  1AN8 A;  1MKH A;  2ZT9 C;  1WYD A;  1BR9 A;  4RTZ A;  1D5M C;  3I4L A;  4IN3 A;  1HJP A;  1G83 A;  1Z9Z A;  5EPK A;  3JCM h;  3G7L A;  4M78 G;  2MF2 A;  4A3C H;  4WJW A;  4RAU C;  2EYL A;  2Q2I A;  1OXS C;  5I2X A;  4A3K B;  1RTN A;  1V1C A;  3HOU G;  3E19 A;  4X64 Q;  2F2W A;  4ZQ3 A;  4X62 Q;  2NVT B;  1LT5 D;  3DWA A;  3TRE A;  1T0J A;  2BE5 D;  4KHZ A;  2K05 A;  2Z1C A;  3SXH A;  4TVR A;  1GCQ A;  1RLP C;  1G5V A;  1LTI D;  4XAX B;  3OS1 A;  3PNW C;  1Q82 R;  2F0M A;  3WOE A;  1DOL A;  1W1F A;  3LWH A;  3CCR Q;  3U4Z A;  5EPL A;  4JI1 Q;  4OL7 A;  1YNN D;  4OIK A;  5GMK m;  2IHF A;  3RKY A;  1TS3 A;  4C3I G;  4DAM A;  2R92 G;  2O4X B;  4H44 C;  1GBR A;  4ZUJ A;  2D8J A;  2JA7 G;  5M5W B;  3QHS A;  4OF1 A;  1M30 A;  2D0O A;  1TWA H;  5K5P A;  3NE5 B;  2O5I C;  3FLG A;  3GTG B;  2ED0 A;  4JRQ A;  2JT4 A;  2M9U A;  1GCP A;  1U06 A;  2P4T A;  1FYN A;  4FT4 A;  1EU3 A;  5C5M A;  3T4A C;  4LFB Q;  2ED1 A;  2F0K A;  3M0U A;  3F1Z A;  1HZB A;  3AFP A;  2DNU A;  3PMT A;  2QDY B;  3SB2 A;  1K83 B;  2Y0S B;  4L6T B;  2ZPG B;  4J15 A;  1AWO A;  1QCO A;  1VQ8 A;  1S5C D;  1U4P A;  3D0F A;  3HKZ G;  3KLS X;  2IIM A;  4O1N A;  4DR4 Q;  4XTY A;  1Y8N B;  3CCM Q;  1V43 A;  4K2K A;  4K5X A;  1LCK A;  5IHK A;  4KLK A;  2E64 A;  4M78 E;  3PV0 A;  1RAE B;  4UHV A;  3C3L A;  3T9N A;  5LJ3 j;  2D8H A;  2MO1 A;  3P20 A;  1Y1W H;  3GTK B;  3DEO A;  5C0X I;  2AT1 B;  3L9A X;  1H9M A;  1UE5 A;  2H4O A;  2R61 A;  2CS7 A;  1V1O A;  4JOI C;  4DR2 Q;  4BXX H;  5CAI A;  3A0J A;  4ZLT F;  1HQM C;  4DK0 A;  1EQT A;  2N8N A;  2R7F A;  1OPL A;  4X3K A;  3DM3 A;  2NVQ B;  1NMF A;  1CSQ A;  3S14 H;  3M4G A;  5LJ3 f;  2JEA I;  1JJ2 S;  2RSO A;  4BBS H;  4LUZ A;  3EG0 A;  1STA A;  1R4P B;  3PO2 G;  3HOV B;  1O7I A;  2A5H A;  1WCM G;  2NWG A;  1OV3 A;  4IOC A;  1VQL T;  1PH5 A;  1LUZ A;  3C0C A;  4R4T A;  3K5M A;  5I2S A;  1UJ0 A;  1KQ2 A;  3D4D A;  1TWF B;  1T9H A;  1G2B A;  1VMC A;  1X54 A;  3DWQ A;  3TCJ A;  1K8M A;  1LAB A;  1WFW A;  4CDC C;  3VR3 A;  4Y7N B;  1F9Q A;  1TWC B;  3VYT A;  2FPF A;  3GP8 A;  2M16 A;  3AT1 B;  1H8K A;  1BIA A;  1X3F A;  5ELD A;  1RD9 D;  5JJK A;  4OML A;  1AP0 A;  1I94 L;  5GAN j;  4KHP Q;  1KLG D;  2IPK D;  2GQI A;  2E5Q A;  1TII D;  4KGV B;  3TEH B;  1PH3 A;  4HJ7 A;  4OB2 B;  4OGE A;  1ZUU A;  1KLU D;  4LDV A;  1RAC B;  1IHV A;  3MHB A;  4RTT A;  3I4N G;  2VB3 X;  5GAN 4;  4ELY C;  2DGY A;  1O75 A;  3P1H A;  1W2B S;  4K14 A;  2CFM A;  4GKJ Q;  1MHN A;  1SNQ A;  1KDB A;  1AOJ A;  3HKZ E;  2XTI A;  3KOJ A;  3TDQ A;  1BVS A;  1YZ6 A;  4X66 Q;  3ICE A;  3UE1 A;  2EPD A;  3TP5 A;  2VV5 A;  1XQH A;  1RKN A;  4FYY B;  2NB0 A;  1JRI A;  4DN4 M;  1EIY B;  1GUN A;  1VQ8 Q;  3SK8 A;  1BXT A;  3VR6 A;  1BCO A;  3U50 C;  5CIU A;  2HL3 A;  1IXD A;  1SDF A;  4RCC A;  4WTO B;  1W6J A;  3CPW A;  3P8B B;  4JV5 Q;  2PW5 A;  1TS5 A;  1ONL A;  3V8J A;  3JB9 G;  2KJX A;  2JM9 A;  4QY7 A;  5BR8 Q;  4CDE C;  4BY7 H;  3OMC A;  4DOW A;  3H94 A;  1MNE A;  2E2J H;  1WI5 A;  5FO9 B;  1HSQ A;  4OEL B;  2BDO A;  4KKU A;  4LD6 A;  2HDM A;  1D5X C;  3HOX H;  4JI7 Q;  1KHC A;  2D6F A;  2VUM G;  2AHJ B;  1D1A A;  2WAQ G;  4A3I H;  1KXL A;  2A69 D;  1BCP D;  2AQ2 B;  1SSF A;  4NL2 A;  2K32 A;  2NZ1 D;  4A3J G;  1JXO A;  4DV0 L;  1P92 A;  2HIV A;  1RHP A;  3PT9 A;  2RI2 A;  4RTU A;  5GAO m;  1A2T A;  2COZ A;  1ICW A;  2MOX A;  4A3L H;  2IW3 A;  1ZSZ C;  2EKO A;  2B2T A;  4FIB A;  4EMK B;  3M0P A;  1TS9 A;  4E7I A;  3MZ5 A;  4ZCK A;  2R93 H;  2DET A;  1DON A;  4Z8A A;  1I3Q B;  1D0Y A;  3EG2 A;  3HFO A;  5C44 B;  1X69 A;  3GIB A;  4EMK A;  2LS0 1;  2YT6 A;  4CJ1 B;  3RD4 A;  4FNF A;  5GAN e;  1M90 U;  1E0B A;  5IP9 H;  2CDT A;  2DBM A;  4RMO A;  2AZS A;  1S3O A;  2Y90 A;  3PSI A;  1VQL A;  1LT6 D;  1VQD A;  1KDC A;  2I46 A;  3GTL H;  4P71 A;  3HRT A;  3NHH A;  3PF4 A;  3S16 B;  1HRJ A;  2N49 A;  3S2D B;  2QKI C;  2IT1 A;  5IYB H;  5GAN 8;  1P16 A;  2JQO A;  1CSP A;  4M7A B;  2JA8 H;  3QZ5 B;  4J6W A;  1EY8 A;  1HXY D;  3EVQ A;  3CXC A;  4FL6 A;  2AZV A;  3Q23 A;  1M5Q 1;  1HZA A;  1ZA1 B;  3CPF A;  4FYX B;  4M7A A;  2OWO A;  1G3W A;  1PTO C;  2FRW A;  3H9N A;  4QGU A;  2R57 A;  3V7S A;  4N0A C;  5IAY A;  3CC2 T;  4BA1 I;  3VYG A;  3I5S A;  2O2L D;  2EJF A;  4FXG C;  4DK3 C;  2DM1 A;  3A1P A;  3H09 A;  4K5W A;  4L5T A;  2Z8L A;  1MUZ A;  1BCP F;  1W6K A;  4QF4 A;  5JJL A;  4DQ2 A;  1VQO T;  4IPC A;  2WIN B;  3M58 A;  3QKJ A;  1N34 L;  1G3Y A;  1M8A A;  2EYM A;  2DE0 X;  2HSE B;  2RH2 A;  2KE9 A;  3CQZ H;  4G4K A;  3WVD B;  1VUB A;  2EYQ A;  3L2W A;  4KY6 A;  3HOW G;  4QQD A;  2NVX B;  3E2U A;  3S15 H;  2A73 B;  4KT0 E;  2K7A A;  1W70 A;  1ML0 D;  3LWU A;  1KD1 C;  2KEE A;  1JOR A;  2OTL T;  5FRO A;  1G29 1;  1Q90 A;  4HIO A;  3ZYY X;  2KEA A;  5LJ3 h;  1HUM A;  1LTS D;  1VYV A;  4M7D E;  2HBP A;  2JJ9 A;  2MHV A;  4BY1 G;  1MHW C;  3NXW A;  1E6G A;  4JYA L;  2W0Z A;  1Y1V B;  4LUV A;  4A4F A;  2F5K A;  3NWT A;  1OU8 A;  2KCT A;  1EY9 A;  2DY8 A;  5COY A;  4U67 3;  5FWB A;  4X9D A;  3GTM B;  4KKS A;  4IFD J;  1VQL Q;  3W2D A;  5D14 A;  1VQC A;  1T5E A;  3JCM Q;  4A3M H;  2JVV A;  5A0L A;  4HJ9 A;  2HIX A;  4II1 A;  1STB A;  2F0L A;  4RCN A;  2A8V A;  5C4X B;  2AK5 A;  1BYM A;  1RAB B;  2JP1 A;  3PCO B;  3SWN B;  2EWN A;  5D6W A;  1F2Y A;  4LN2 A;  4ABN A;  3OB9 A;  1WTH A;  1WHL A;  1DGS A;  3GTO H;  1HFN A;  2RJD A;  4C8Q C;  2QGF B;  3M4O H;  2E74 C;  1V1P B;  5IYD H;  4EIK A;  3SWN A;  1ESF A;  4A76 A;  2EOT A;  4A3B H;  4LWC A;  1V1Q A;  4JPB W;  3UA6 A;  3OYH A;  2FPE A;  4IPH A;  2NLU A;  4A3C G;  1EEI D;  4YWK A;  1V1P A;  2F0G A;  3CBP A;  1HNW L;  2EGC A;  1H64 1;  2XI9 A;  3CMA A;  1QVF P;  1T3S A;  1STN A;  3MXN B;  4RGN A;  3UAT A;  3EGD B;  4I7A A;  5FKA C;  3HKS A;  4EGV A;  5AJ3 L;  4DUY L;  4A3G H;  1KC8 C;  1IGQ A;  4R9W A;  4TSS A;  3MXN A;  4HJA A;  2RPN A;  1Q12 A;  1TOV A;  3EGD A;  3HTR A;  2FO0 A;  1JIC A;  1N6A A;  4H02 A;  1VQH A;  5FU6 B;  1B70 B;  1H9J A;  2L5T A;  2GTO A;  3CCQ T;  3MC0 B;  1PRM C;  2VGM A;  1BI2 A;  2RHX A;  2F0I A;  4ELZ C;  2DIL A;  1D1C A;  3CC2 A;  1AE2 A;  2ZXP A;  3PGZ A;  1KIX A;  2KAF A;  2M0O A;  2ZPF B;  1RJT A;  1PRL C;  5EKK A;  1Y8O B;  5I6Y A;  4C92 E;  1F2L A;  1KTK A;  4DUZ L;  1NEB A;  2B39 A;  4M7D B;  4B9X A;  3NWS A;  3ZFJ A;  3EH1 A;  1SRL A;  4WRD A;  5AFW A;  2QQB A;  5GAN 7;  3V7C A;  2EDG A;  4CJ2 C;  2VWF A;  4B3T L;  3E0E A;  2K3Y A;  1WLP B;  4M7D A;  1JJC B;  4GZY C;  3QIA A;  2A28 A;  3FEW X;  4DV0 Q;  1OEB A;  2CP3 A;  3D6C A;  1IBM Q;  4YWM A;  1CA5 A;  1B3A A;  3FPP A;  2JS2 A;  4BXX G;  3E9I A;  4IQZ A;  4ZAI A;  2V1C C;  1GVP A;  1QNK A;  2VW9 A;  1HR0 L;  2DF6 A;  2E2I H;  4XQQ A;  2WSE E;  2HUG A;  3GTJ H;  3M4Y A;  2OTL A;  2KHI A;  4XU0 A;  1M4V A;  1Y1W G;  1GFC A;  3M3Y B;  1ZYR D;  4OWT B;  1CSK A;  1NBE B;  2LP5 A;  3QXE B;  4KUL A;  3MJX A;  1X3Q A;  5FO8 B;  4IUN A;  4H7B A;  5D7U A;  2DXB A;  2ROT A;  4XYQ A;  4A4G A;  5HGT A;  1TS4 A;  1I50 B;  3CBM A;  3GV3 A;  2B2W A;  1WTQ A;  5HY6 A;  4IPD A;  1K76 A;  4BI4 A;  5C0M A;  2KR3 A;  2B63 G;  2DVJ A;  2QG9 B;  1R77 A;  2F0Q A;  3Q8D A;  5CKD A;  1FYC A;  5GQO A;  5FU7 B;  4M78 F;  3BYY B;  2KGT A;  2HBW A;  2KXD A;  3PIP A;  1SXT A;  4M7A D;  4YWL A;  4HR7 B;  4JI5 L;  1PD0 A;  2MWO A;  2HEQ A;  4CDD C;  3X24 B;  1KNE A;  5IYD G;  1Q3L A;  2JMA A;  2V26 A;  4PFO A;  2HT1 A;  3CC2 Q;  3OIP A;  5A35 A;  3NSW A;  5IGF A;  1JOQ A;  1GUS A;  3EAE A;  4C92 B;  1NCV A;  1LLR D;  1PHT A;  2B2Y A;  5GAE C;  4PJO G;  3VS4 A;  1LM0 A;  2VC8 A;  1JEG A;  4LNQ A;  2FYK A;  1YNJ C;  5C3W A;  2K01 A;  4C92 A;  3D31 A;  4E7K A;  4KV6 A;  1VQO Q;  2MQH A;  3U58 A;  4C2M H;  4OO1 H;  3VRZ A;  2WSF E;  1OXT A;  5M5X B;  4FYW B;  2VL6 A;  3CCQ A;  3MXP A;  4EQP A;  2A08 A;  2DL4 A;  2JA5 B;  2GBQ A;  4IUT A;  4FM4 B;  4AYB G;  4KJO A;  4NXN L;  4XU2 A;  4R4O A;  4DV6 Q;  2AKW B;  4P74 A;  5KIX A;  3LNN A;  2OTL Q;  2FEI A;  4J9I A;  1ASY A;  4JYA Q;  4CC4 B;  1X2K A;  2C06 A;  2R3Z A;  1JC7 A;  1P8L A;  1I07 A;  2MUY A;  3OWE B;  1D0Z A;  3FB9 A;  1I4P A;  2DKG A;  2QTV A;  2VUB A;  4TVA B;  5FLX c;  4BY7 G;  1N9R A;  4Z88 A;  4DR5 Q;  2V8K A;  1SE8 A;  4BI3 A;  1G51 A;  1MI2 A;  1SNP A;  4PG3 A;  1BBU A;  3MEH A;  2GF7 A;  3MAQ A;  3L1A A;  2ICI A;  4FF3 A;  3HOU H;  1S5D D;  3HOX G;  4QQB X;  4GLA C;  1DYQ A;  1OO9 B;  2DL8 A;  4LMQ D;  4HT9 A;  2EPB A;  2XKO C;  1ZUK A;  1WYX A;  1E24 A;  1T0H A;  1SNC A;  4A3I G;  2RHU A;  4L5G A;  4AQY Q;  4OMO A;  2BH8 A;  3GPL A;  3HG9 A;  5ELO A;  4OVA A;  2IY5 B;  3C46 A;  1B07 A;  3BG3 A;  4HED A;  1U5K A;  1ZHI A;  1RL2 A;  2LCL A;  4F8M A;  3OYI A;  1K73 U;  1G3S A;  1UNS A;  4A3L G;  2L12 A;  5LHY 1;  3K7A B;  3S1R B;  4A93 H;  1Q1B A;  1U5S A;  1N5Z A;  1NG2 A;  2ZPB B;  1VQ5 T;  4PJO E;  1LNX A;  4DV4 Q;  3CCE T;  1JJ2 P;  2BCO A;  2JK8 A;  3STB D;  2JA7 H;  1D1K A;  1WX6 A;  2F1L A;  2OT2 A;  3E3X A;  3EBE A;  2E65 A;  1EIH A;  1UGP B;  4PV1 C;  2ZCF B;  3PMI A;  4BDZ A;  3J80 L;  4E7Z A;  1UE9 A;  4RKB A;  2HQE A;  1M4Z A;  1JR0 D;  1KDA A;  1WJR A;  3LGF A;  2HCK A;  3QO3 A;  1N8R U;  1VQJ A;  5D3D A;  2ASB A;  1PSE A;  1TS2 A;  2DA9 A;  2ZAE A;  1ESR A;  2KBN A;  1O9S A;  4RCB A;  3CCQ Q;  1Z47 A;  2DK3 A;  1H9K A;  5IYB G;  1EYA A;  3CCV T;  4HTH A;  1AH9 A;  2JA8 G;  3ASK A;  1A0I A;  3EGX B;  3CME T;  4DUZ Q; 
#chains in the Genus database with same CATH homology
 1ZSG A;  1I1J A;  3KFV A;  5L23 A;  1X43 A;  2H8H A;  3ZL7 C;  4E6R A;  1VA7 A;  5IXF A;  3VS2 A;  1ZLM A;  2F2V A;  1M3C A;  4Z89 A;  2YSQ A;  4LE9 A;  3M0R A;  4GLM A;  2VKN A;  3I5R A;  2SRC A;  3I9Q A;  2RNA A;  1K4U S;  1MV0 B;  1K1Z A;  1Y0M A;  1VYU A;  1AVZ C;  4AG1 C;  1RI9 A;  3GBQ A;  1H3H A;  1CKB A;  4RTW A;  3SEM A;  4F14 A;  2EYW A;  4OMP A;  5IHN A;  1K0X A;  2KRS A;  1UG1 A;  1RUW A;  1QWE A;  2BTT A;  5EC7 A;  2KRN A;  2O9V A;  4AFQ C;  2EGA A;  3M0Q A;  1OPK A;  4RTZ A;  1G83 A;  1Z9Z A;  3CQT A;  4A63 B;  4GBQ A;  2PNI A;  2CUB A;  4K11 A;  4J9F A;  3VS5 A;  1V1C A;  2L2P A;  2CRE A;  2F2W A;  3NGP A;  2YDL A;  4DEY A;  2RQV A;  3M0S A;  1T0J A;  1QCF A;  4FSS A;  4CC2 A;  5IH2 A;  1GCQ A;  1GL5 A;  1RLP C;  1W1F A;  2ENM A;  3JV3 A;  3QWX X;  1AD5 A;  1PKT A;  3I35 A;  2BZX A;  3VS6 A;  5GJW B;  2DL3 A;  3QWY A;  2L3Q A;  2DRM A;  1GBR A;  2L3P A;  1YWP A;  2D8J A;  2DLP A;  1FMK A;  2J6F A;  1M30 A;  1W6X A;  4J9B A;  3H0F A;  4HVU A;  1QLY A;  1GFD A;  1ABQ A;  2ED0 A;  2JT4 A;  1GCP A;  1U06 A;  2KXC A;  1FYN A;  5IXB A;  3VS7 A;  2ED1 A;  4HCK A;  2ESW A;  3M0U A;  2LCS A;  1YCS B;  2VVK A;  2DNU A;  3EG1 A;  1HJD A;  4RTX A;  1AWO A;  1SSH A;  2IIM A;  2KT1 A;  1J3T A;  1LCK A;  5IHK A;  4ZNX A;  2M51 A;  2D8H A;  2KYB A;  2K3B A;  5IHI A;  1X27 A;  2RN8 A;  4R0K A;  2CUD A;  1OPL A;  2JMC A;  2J05 A;  1BK2 A;  1K9A A;  3VS3 A;  4RUG A;  3EG0 A;  2YUN A;  1OV3 A;  3C0C A;  4OMQ A;  1UJ0 A;  1QKX A;  4X1V A;  2X3W D;  1G2B A;  3FJ5 A;  4AG2 C;  4J9D A;  1WFW A;  1BB9 A;  2W10 A;  2FPF A;  1M27 C;  1TG0 A;  2K2M A;  4DEX A;  1H8K A;  1KIK A;  2E5K A;  4OML A;  3H0I A;  1ZX6 A;  2GQI A;  3A98 A;  2P4R A;  3O5Z A;  1ZUU A;  1Z9Q A;  2JTE A;  1AWX A;  4RTT A;  1QWF A;  1JXM A;  4ESR A;  2K6D A;  4HVW A;  1AOJ A;  2RF0 A;  2MIO A;  2GNC A;  1GCQ C;  2EPD A;  2PTK A;  2RMO A;  4IIO A;  4JJD A;  2O31 A;  2A36 A;  1WXT A;  1SHF A;  5FW9 A;  1NYG A;  1X6B A;  3UF4 A;  2PZ1 A;  2O2O A;  2YUP A;  4RTY A;  1AZE A;  2JM9 A;  3EGU A;  3PE0 A;  3LH5 A;  2NWM A;  1HD3 A;  1PNJ A;  1HSQ A;  1QKW A;  4KRT A;  1UDL A;  3TVT A;  3H41 A;  2CH4 A;  1UTI A;  2L3S A;  1JXO A;  1GRI A;  2LJ3 A;  4RTU A;  2MOX A;  1NEG A;  3M0P A;  3TSZ A;  4Z8A A;  1UUE A;  3EG2 A;  1AWJ A;  1X69 A;  2YT6 A;  2J6O A;  4LUE A;  3IQL A;  5GJV B;  2EW3 A;  2CDT A;  2DBM A;  1ABO A;  3U23 A;  2HDA A;  2AZS A;  1M8M A;  2MCN A;  2C0I A;  2EQI A;  2YUQ A;  2K79 A;  4J9C A;  2C0O A;  4D8D A;  2AZV A;  1H92 A;  2NUZ A;  3R6N A;  2KRM A;  1ZBJ A;  2FRW A;  2O88 A;  3NHN A;  1PKS A;  3I5S A;  2F2X A;  2DM1 A;  2FRY A;  2BZY A;  2JW4 A;  1MUZ A;  2KRO A;  4AFZ C;  1IO6 A;  2DE0 X;  2B86 A;  3NMZ C;  2KE9 A;  2O9S A;  2RQT A;  1Y57 A;  2CT4 A;  2V1R A;  2K7A A;  1W70 A;  2LMJ A;  1CKA A;  2KEA A;  1VYV A;  4F17 A;  1UJY A;  1BBZ A;  1MV3 A;  1E6G A;  4J9E A;  1KSW A;  1WA7 A;  2W0Z A;  3RNJ A;  1SHG A;  2RQW A;  5FWB A;  1SPK A;  2DX1 A;  2SEM A;  1SEM A;  2J06 A;  1GBQ A;  2GGR A;  2K9G A;  2AK5 A;  1OOT A;  1U3O A;  4HXJ A;  4LN2 A;  1PWT A;  2J7I A;  4JJB A;  4AFS C;  2M0Y A;  2AKK A;  1WI7 A;  4EIK A;  3NPF A;  1AEY A;  4JPB W;  3UA6 A;  1K0S A;  2FPE A;  1UFF A;  2KT8 A;  5I22 A;  2EGC A;  4HVV A;  2ABL A;  1T3S A;  2KYM A;  3UAT A;  1VYT A;  4F16 A;  2FG0 A;  2RPN A;  3EG3 A;  2DBK A;  2FO0 A;  2J6K A;  2LNH B;  2GTO A;  2EVR A;  1PRM C;  2DRK A;  3THK A;  1BU1 A;  1M3A A;  1TUC A;  1KFZ A;  4OMN A;  2DIL A;  3REB B;  4CC7 A;  2LZ6 B;  1PRL C;  2ROL A;  3REA B;  1YNZ A;  1E6H A;  1NEB A;  4QT7 A;  2CSI A;  1SRL A;  2EGE A;  2LJ1 A;  2VWF A;  1WLP B;  1JO8 A;  1YN8 A;  2A28 A;  1UHC A;  1WDX A;  1OEB A;  2QDL A;  1I0C A;  2JM8 A;  1YP5 A;  2HSP A;  4JJC A;  2RQU A;  2JS2 A;  5HCK A;  1ARK A;  4OMM A;  2CH4 W;  2V1Q A;  2LQW A;  2DF6 A;  2D0N A;  1AWW A;  4JZ3 A;  3EHR A;  1GFC A;  3H0H A;  1AZG B;  1EFN A;  1CSK A;  2LP5 A;  2GTJ A;  2ROT A;  2CT3 A;  1NYF A;  1A0N B;  1K76 A;  2DJQ A;  2EYY A;  4Y92 A;  2D1X A;  2KR3 A;  2DVJ A;  1E7O A;  2ECZ A;  1XOV A;  5I11 A;  2KGT A;  2HBW A;  2KXD A;  2BZ8 A;  2HEQ A;  4WCI A;  2G6F X;  2JMA A;  1WXB A;  2DL7 A;  2YUO A;  1M3B A;  1PHT A;  4LNP A;  4RTV A;  3VS4 A;  1UGV A;  1X2Q A;  1JEG A;  2DYB A;  3UA7 A;  2OI3 A;  2LX7 A;  3VRZ A;  4AFU C;  2KBT A;  3PVL A;  2A08 A;  2A37 A;  2DL4 A;  2GBQ A;  2OAW A;  4CC3 A;  2FEI A;  4J9I A;  3TSW A;  4CC4 B;  1X2K A;  2AKL A;  2DMO A;  3VRY A;  1I07 A;  1T3L A;  1SRM A;  3VS1 A;  1RLQ C;  4Z88 A;  2FPD A;  4LUD A;  2KNB B;  4ORZ A;  3EHQ A;  1YWO A;  2EBP A;  2RQR A;  1WIE A;  2DL8 A;  3RBB B;  1ZUK A;  2EKH A;  2CSQ A;  1WYX A;  4JZ4 A;  1T0H A;  1UHF A;  1ZUY A;  5ECA A;  3M0T A;  4OMO A;  3SHW A;  2L0A A;  1B07 A;  4J9H A;  2I0N A;  4IIM A;  3PVQ A;  1NLO C;  1KJW A;  1U5S A;  1N5Z A;  1NG2 A;  3ULR B;  2OJ2 A;  4D8K A;  5FWC A;  1TUD A;  1WX6 A;  2EYX A;  2LQN A;  1JQQ A;  1X6G A;  1UEC A;  2JXB A;  1NLP C;  1UE9 A;  2X3X D;  3VS0 A;  4M4Z A;  2C0T A;  2HCK A;  2DL5 A;  1NM7 A;  1WXU A;  2XMF A;  4J9G A;  1JU5 C;  2DA9 A;  1S1N A;  1B3Q A;  2LJ0 A;  2JS0 A;  2EYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...