2CH4W

Complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
139
structure length
139
Chain Sequence
KEFEVLSFEIDEQALAFDVDNIEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLVDRVLGVLRITENQLDLTNVSDKFGKKSKGLVKTDGRLIIYLDIDKIIEEITV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/chemotaxis
molecule keywords CHEMOTAXIS PROTEIN CHEA
publication title Reconstruction of the Chemotaxis Receptor-Kinase Assembly
pubmed doi rcsb
source organism Thermotoga maritima
total genus 19
structure length 139
sequence length 139
chains with identical sequence Y
ec nomenclature
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01584 CheW CheW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ch4W01
2.40.50.180 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) CheA-289, Domain 4 2ch4W02
1SRMA 1ZX6A 1JEGA 2FPFA 4RTXA 4DEXA 4LE9A 1U3OA 1X6BA 2HSPA 1UJYA 2B86A 2D8HA 1GCPA 2GTOA 2CREA 2DE0X 2AKLA 2O88A 3TSZA 4F14A 2DM1A 1WDXA 2JM9A 2DVJA 2X3WD 3TSWA 1CKAA 1PNJA 3KFVA 2CH4A 2EYYA 4HXJA 4E6RA 2ABLA 2JT4A 4HVUA 1ABOA 1WXUA 4IIMA 2AZSA 3C0CA 2RNAA 2EYXA 4ORZA 2DBKA 2GNCA 1Y0MA 2FPEA 2YUOA 4JJDA 2A36A 2DA9A 2DL7A 4HCKA 2KT8A 2RF0A 2LJ0A 2F2VA 1NLOC 2C0IA 3TVTA 1KJWA 1FMKA 2KRMA 4J9IA 1ZUKA 1BK2A 1AWXA 1JO8A 1ZUYA 1SHFA 2CSQA 2DL4A 1UJ0A 2ROTA 4IIOA 3VS4A 3M0QA 1K0XA 1LCKA 2EBPA 1PKTA 3H0IA 1AEYA 2LZ6B 2RQWA 1RUWA 2JMCA 2MCNA 3SHWA 4J9GA 2KRSA 2A08A 1OV3A 2PZ1A 1ABQA 2JM8A 2RPNA 2L2PA 1MUZA 1AVZC 2J6KA 3EG0A 2LMJA 2CDTA 3QWYA 1JU5C 1I07A 5I11A 2M51A 2FEIA 2ROLA 4OMNA 2LP5A 2VVKA 3NHNA 2CSIA 1M3AA 1XOVA 2V1QA 1BB9A 1NYFA 2BZXA 4K11A 4D8DA 1WXBA 1GRIA 4LUDA 3ZL7C 2C0TA 1QLYA 1GFDA 4J9HA 2O9SA 1MV3A 3M0SA 4ESRA 1HSQA 2G6FX 1JXOA 3PVLA 4CC4B 5IHKA 1K9AA 4RTTA 1A0NB 1NYGA 4AFZC 4F16A 2D8JA 2L3QA 1AWJA 1Y57A 4KRTA 1VA7A 1H3HA 2YDLA 1QWEA 1ZBJA 2DYBA 2DLPA 4OMQA 2H8HA 4R0KA 2F2XA 2DNUA 2X3XD 3SEMA 1OEBA 4CC2A 2AKKA 1H8KA 1N5ZA 1SRLA 2L3SA 4HVWA 3UATA 3CQTA 1ZUUA 1KIKA 1MV0B 2ECZA 2HCKA 1Z9ZA 1KFZA 1YN8A 4Z88A 4AG1C 1VYTA 1TUDA 3EGUA 3M0RA 2OAWA 1UGVA 1ZSGA 1I1JA 1ZLMA 2J05A 2I0NA 2LX7A 3O5ZA 2NUZA 4Y92A 2KRNA 1TG0A 3I9QA 4RTYA 2HDAA 1YP5A 1OPLA 2K7AA 2ED0A 2FRYA 3RNJA 1G2BA 5FWBA 1NM7A 1M30A 1ARKA 1Z9QA 1JQQA 1TUCA 2AK5A 2JS0A 2KYMA 1WX6A 3QWXX 4D8KA 2OJ2A 2LQNA 5IXFA 2ENMA 1K0SA 2K79A 1M3CA 3H41A 3NMZC 2EPDA 2YSQA 1WA7A 4RTUA 1AWOA 4GBQA 2FO0A 3VS5A 1BU1A 1X6GA 5IHIA 2CT3A 1AD5A 1U06A 2KNBB 4J9CA 2CUBA 1E7OA 2A37A 3IQLA 2KXCA 2FRWA 2EW3A 1AZEA 2CT4A 1B3QA 1CKBA 4J9FA 2JW4A 4F17A 1T0HA 4OMMA 5FWCA 1WXTA 2LNHB 1YCSB 3M0UA 1QKXA 1WI7A 1GCQC 2KXDA 2YT6A 2RN8A 1J3TA 2K3BA 1M27C 4AFQC 2FG0A 1I0CA 3RBBB 1PRLC 2K9GA 1GBRA 2BTTA 2C0OA 2DILA 2J7IA 3VRYA 4A63B 4DEYA 2DBMA 2EYWA 3ULRB 2RQUA 1UUEA 1M3BA 1K4US 1SSHA 2L0AA 1OPKA 2GBQA 2J6FA 2RMOA 5IXBA 3JV3A 1HD3A 3EG3A 2RQRA 3PVQA 2GTJA 2CH4W 2P4RA 2DRKA 2GQIA 1YNZA 1UFFA 3I35A 2IIMA 2D1XA 1OOTA 1K76A 1T3LA 2J6OA 3VS3A 1GCQA 1NEGA 3VS7A 2KYBA 1X69A 1JXMA 4HVVA 1NLPC 1U5SA 1W1FA 4LNPA 1RI9A 4CC3A 1K1ZA 1E6HA 1PKSA 2JTEA 4OMPA 2MOXA 1E6GA 2K6DA 2W0ZA 4J9EA 3I5RA 1YWPA 4J9DA 1GFCA 2GGRA 5HCKA 1YWOA 1AZGB 2DJQA 1BBZA 3FJ5A 5I22A 2LCSA 2K2MA 1X27A 2E5KA 1RLQC 2MIOA 1GBQA 4CC7A 2BZ8A 4RTZA 1WIEA 1UDLA 3VS1A 2DRMA 2SEMA 2EYZA 2F2WA 2NWMA 4RTWA 2CUDA 3VS6A 3EG2A 1HJDA 2EQIA 4QT7A 1H92A 4Z8AA 3UA6A 1WLPB 3I5SA 1RLPC 3THKA 2LJ1A 3UF4A 2HEQA 2JS2A 4RTVA 2ESWA 3EG1A 3UA7A 2L3PA 1WYXA 2JMAA 4JZ4A 4EIKA 1M8MA 2ED1A 1PWTA 2BZYA 1UHCA 2EGCA 1W6XA 2DX1A 3A98A 2OI3A 3PE0A 4GLMA 4Z89A 2VKNA 1UECA 1VYVA 1UG1A 3NGPA 1UTIA 2O31A 3M0TA 3M0PA 4RUGA 2RQTA 4JZ3A 2O2OA 1X2KA 2FPDA 2V1RA 4AFSC 2O9VA 2DL8A 4M4ZA 2VWFA 1GL5A 1NEBA 5GJVB 1FYNA 1QKWA 2EKHA 1G83A 2EVRA 5L23A 1SEMA 2KT1A 1PRMC 1SPKA 1EFNA 1KSWA 1X43A 4WCIA 5IH2A 3H0HA 4AFUC 1V1CA 2KGTA 2DF6A 1B07A 4X1VA 5IHNA 2KROA 2M0YA 5FW9A 1S1NA 1QWFA 2KE9A 1X2QA 2XMFA 1CSKA 1VYUA 3H0FA 4JPBW 2EGEA 2W10A 2DMOA 2JXBA 3VRZA 2DL5A 2KBTA 2D0NA 2YUPA 1IO6A 2KR3A 4JJCA 3R6NA 2SRCA 2EGAA 2J06A 5ECAA 2HBWA 3REBB 5EC7A 2LJ3A 2YUQA 3EHQA 3NPFA 2KEAA 3REAB 3EHRA 1SHGA 1WFWA 4LN2A 1T0JA 4ZNXA 4OMLA 1UE9A 3VS2A 5GJWB 3VS0A 2YUNA 1AOJA 2QDLA 4JJBA 3U23A 1W70A 4LUEA 2RQVA 1QCFA 2A28A 3LH5A 2DL3A 2PNIA 3GBQA 2AZVA 2PTKA 1AWWA 4FSSA 1NG2A 4OMOA 4AG2C 1T3SA 4J9BA 2LQWA 1PHTA 1UHFA
chains in the Genus database with same CATH superfamily
3M4QA 2RB6A 1ZX6A 5IODA 1JEGA 2FPFA 1ENAA 3CKIB 2Q8RE 4DR1Q 1MD2D 3TRZA 4FU6A 1E2ZA 1V1OA 2RJEA 1D5XC 4X3UA 3ULJA 2HSPA 4C1NK 3L9AX 1TSFA 2A8VA 3M55A 1AHJB 4DV1Q 3RN5A 2DO3A 3PO3G 2QEXQ 1PG5B 1PRTC 2M9VA 2QAZA 5KYIA 3F2DA 1Z7TA 3TSWA 2CKKA 3DHQA 1CKAA 1J5EQ 1MSHA 1GXDC 4QL5A 3KFVA 1RODA 4JW0A 4MMLA 3ASKA 3ULPA 5M3FH 4X9DA 3INZA 2QYZA 4DK1A 3OYCA 2KDSA 2ABLA 2FXQA 1PH2A 2XDPA 2DUDA 1YNXA 4K5XA 3HOWG 3T51B 1ONLA 4HCCA 4JJNK 1SF9A 5C0MA 4E7SA 5EJWA 5LJ5d 4X3TA 2EYXA 5GAMh 4ORZA 2F3IA 1HNWL 3GNFB 1QG7A 2GNCA 1SE4A 4M7AE 2CW0C 2FPEA 4JJDA 1R0BG 2A36A 3HL8A 2N3SA 4YY3L 2EY6A 2PUOB 3PO3H 4GKJL 1E2WA 3S3MA 1TKWB 3ZJYC 4M75D 2F69A 1TWAB 2KT8A 3BZKA 5FJ8G 4K2KA 2OXPA 2NWGA 3PO3B 4DUZQ 4A4IA 2QQSA 3A7AB 3L0OA 4J9IA 3T1HL 1KIXA 3JB9D 2VUBA 4GY5A 2F52A 3K58A 1R9TB 4KD3A 4GNXA 2DEQA 3WDNA 4DAYB 1UJ0A 5IGEA 3HOWH 1VF7A 3M0QA 4K5WA 1RD9D 4ME7A 1X9NA 4ZCKA 2P0QA 1PKTA 2AQ1B 3QJYA 4OWTB 4EQNA 4EVOA 2LZ6B 3HOWB 2MCNA 2EIFA 4RCOA 2K6AA 1S5DD 3GV6A 3MEWA 1PYBA 3M53A 5EKIA 3S16B 1B1ZA 1AVZC 4CHTB 3TZUA 3J80i 2CDTA 1NE8A 3QWYA 1WHLA 3BG3A 1I07A 4LD9K 2M51A 3S14B 2FEIA 3NSWA 4OMNA 2LP5A 2F1MA 3NHNA 1UE1A 2QASA 2NN6I 2M02A 2QGGA 4QVDA 1I4K1 3QJ6A 1NBWA 1ZYRD 4DK0A 1XOVA 4X64L 4L5GA 2BZXA 1B9MA 1GKHA 5IY0A 1PMRA 1Q12A 3CC4A 2G3RA 4NS5A 1Q86U 1V8QA 1GRIA 1YITT 3KLRA 2C0TA 2OF1A 1TWGH 1QLYA 1R0CB 1EY4A 2CZ7B 5GANg 3CCJA 1DM0B 3QO2A 4ESRA 3QWNA 3A54A 3RUXA 2RI5A 1O9SA 2CGHA 1YCYA 3NK9A 3C3LA 5LJ3d 3TDQA 1A15A 1JXOA 4CC4B 5IHKA 1JCKB 2Z4HA 3DWQA 4HT9A 5IGFA 1PZID 4RTTA 2EOTA 5DY9A 3MO8A 4AFZC 1JJGA 3MEAA 4M77G 1XX8A 4EGVA 3M85A 2E65A 5F2DA 4KRTA 1H3HA 1X54A 2LQ8A 2BDNA 1HFNA 3W2DA 5T1GA 1TS9A 5FROA 1A2UA 2IJ0A 4RHRA 2MMPA 2EJGA 4IOCA 1ZBJA 3VR2A 4JUVA 4QQ6A 5JJIA 4XU0A 5HK0A 2DLPA 1VQ8T 2X35A 4ZKCB 1PH1A 4R0KA 3T1YQ 4C8QC 2XSCA 8ATCB 3D4WA 3PV0A 2R92H 4N0AA 2NVTH 1SYFA 2ZGWA 2RBMA 5KYNA 3S3OA 1JE5A 2N78A 4C3IG 2A69C 3H15A 3MA2B 2HHHQ 1KQ1A 3SEMA 2RHSB 2P0KA 1NJIU 1HNXL 4M77E 3FEOA 5GAHC 1EYGA 3CMEA 4HCZA 4XU3A 4IPHA 4KHZA 3JCMW 2OTLQ 2CZ6B 3I55A 4PJJA 2WINB 3ONAB 1SJED 4G4KA 4EQOA 1N34L 1LTID 4BB7A 3WVEB 1VIEA 1LUZA 1Z6HA 2AHOB 2RA4A 2RCNA 3R8BA 2DY8A 4RA8A 2ECZA 1GHKA 4M77B 2KHSA 1Z9ZA 4POGA 1FGBD 2ZTDA 1I5OB 3N52A 4Z88A 4NKLA 1VYTA 4FDBA 4F88A 3EGUA 4E7ZA 2OAWA 1HQRD 4L5RC 3GTGH 4ILWA 4F7UG 2RHUA 3A8HB 4EDUA 5GMKl 3CD6A 3RDVA 1SLJA 2CYZB 5DLOA 4C3IH 3CMAQ 4ZUJA 3ME9A 2JOYA 2ZJQA 2QDYB 4K8JA 2Q2TA 2WKDA 1TG0A 3S9WA 1J6QA 1CKNA 4LF4Q 2E64A 3DLMA 3I56T 2LNVA 5LMNQ 1YP5A 3MAQA 1K0RA 4LFBL 2ED0A 4M77A 3AHUA 3HP3A 1K73U 1XPOA 4DN4M 5EAYA 3RN2A 4IPDA 4OGQC 3ERSX 1M30A 2IG0A 3JC66 5I2XA 3M4YA 1KRTA 3S1QH 1SXTA 2O5IC 1Z9QA 3OYFA 4F7UE 5HK3A 3J80c 1TUCA 2AK5A 4PJOG 5LJ3f 2X4JA 2EJ9A 1L1OB 2I46A 3CCQQ 3QYGB 1A62A 1K9MC 4FYWB 4J8QA 3P20A 3S1RH 5K5PA 1Z9FA 2F0EA 2Q8IB 3A8IE 2ZZDA 4M7DD 1KHCA 4F7UB 5IXFA 2HMAA 2AUJD 3MXNA 3LWHA 3HKZG 1PH9A 2DY7A 1FD7D 4A3MG 4WF2A 3RR6A 3H41A 4BWGB 3BW1A 3CF5A 1TS3A 3UDGA 4A3KG 1AWOA 5GMKj 4R56A 4PJOE 4JV5L 3OYHA 1S72A 2TSSA 3CCEA 1L1OA 3NTHA 1S5ED 2PO4A 4AYBE 2F0OA 1Q1BA 3M58A 3CCMQ 1RDPD 1OTCA 5IHIA 4FXGC 3BDOA 1U06A 1EY9A 4HTHA 2KNBB 3RLOA 2CUBA 2A37A 2ENBA 2L12A 3VYTA 4F7UA 4DV7Q 1VQOT 2DNEA 3MTSA 5D6XA 4PJOB 3AMUA 1JICA 3S2DB 3IQLA 3OW7A 1QB5D 3HRUA 2B8FA 2HD0A 2JA6G 1Q82C 1X3FA 4LWCA 4L6TB 1N33Q 2CT4A 1B3QA 1WZOA 4LW1A 3NEMA 1M1FA 2G9HD 1C9OA 2LQKA 4LUOA 4Q0FA 4A3MH 3LLRA 1TY0A 1T0HA 3HKZB 5D14A 1K8AC 4J15A 1V76A 4QKUA 1VQPA 2PU9B 3V7SA 3R3OA 1QKXA 4A3KB 2KXDA 2RN8A 4PJOA 4EMKB 2HD3A 2NTTA 5IP9H 4RCBA 1CM9A 6AT1B 3QDFA 4V2SA 1GVPA 2F3WA 1DD2A 1SSFA 2CS7A 3META 1OX8A 5E4XA 2NVXH 1NMGA 1PRLC 1VQNT 4AT1B 1SG5A 1E3PA 2TMPA 3QIAA 5IT9c 5KGUA 2J7IA 3VRYA 4A63B 1MMGA 2NVXB 3G6EQ 1FNVA 2JA6H 1PFNA 2RO0A 2EYWA 1PLFA 3FPUB 2MO0A 2KCMA 1V43A 1XTCD 2K3YA 1K4US 4C3JG 2R57A 5IAYA 4DAPA 1OPKA 2B2WC 3D6CA 2DTOA 1M4VA 5ELBA 2RJFA 1LT3D 4EMKA 2D2CC 1SNOA 5E1FA 3EJIA 4JI3Q 3HOZG 2KJXA 4OWWB 4EPCA 4CJ2C 1NPPA 3EG3A 1R4QB 2E1HA 3E2UA 5GAMg 2OTJA 1BOSA 1BCPC 3DEOA 3W3AA 4LMQD 1ZSZB 3J80E 4ID6A 3FIFA 1L0XB 2DRKA 3ZYYX 5BN4A 2GQIA 5J1ZA 2RK2A 3BDLA 3C46A 3PMIA 2K04A 8AT1B 5FLXL 2D1XA 4DR6L 1N32L 3RESA 2R93H 1T3LA 3X28B 3E6ZX 2DIQA 4C92D 2PZWA 1CQVA 1BBXC 2MNAA 4TSSA 1NEGA 3CBMA 3STBD 2X9HA 1K28A 2KA7A 2E5LQ 2F0MA 4IUNA 2BA1A 4AQYQ 3IAYA 5J39A 3VYRA 5KYXB 1WNLA 5ELOA 1EYDA 2KQWA 3X20B 3H6ZA 2K2VA 3M57A 2F4VL 3V7RA 3CP0A 1ZSZA 3G4SA 2X69A 1EQQA 3E3XA 1Z47A 4C3JB 1PH6A 1WJRA 1R8OB 2MP1A 4M8AA 4BA2I 4ZUIA 3HOZH 2ZPGB 2CP6A 5CO7A 3OWEB 1E6HA 1OYXA 2IWHA 3TP8A 2RHYA 1HR0L 1IW7D 3HOZB 2F0VA 4E7JA 1E6GA 2K6DA 3H8ZA 5HURA 2QI2A 4A75A 1EIHA 1Y69U 3QBYA 4HCSA 2Q8TA 4NW2A 2HQLA 5LL6S 2H1EA 2HCCA 5LJ3j 3A74A 1B44D 3JB9F 5KYXA 3O8VA 5HCKA 4HJ5A 4FF2A 4BXXH 1PRTF 1YWOA 4YIJA 1BBZA 3QZ5B 3J7AV 1VQKQ 2LCSA 2Z4IA 2UXBQ 3CCRA 1X27A 3K7AH 4YHHL 4RH6A 3GTPH 3GLXA 3IRBA 2E2IH 2K05A 4FYXB 1GBQA 5GAN4 4A3EG 2YTXA 1JB3A 5GAN5 5EQ0A 1IYJB 1KDBA 2PPBC 5LMUQ 1RACB 1SNDA 2EQJA 5KE3A 2E74C 5M5YH 5C44G 4J7IA 2SEMA 1ENCA 4DR2Q 3GQBA 1JOOA 2EY5A 3CCLQ 3GTQB 3UA6A 3E9HA 3M4OB 1O7ZA 2EY1A 4CDDC 1WJQA 2V8JA 1Y1WG 1EOVA 2JS2A 3QDRB 5IT9E 1KDAA 3V2TA 2RM4A 4GKKL 3MKDA 1D0YA 1RI0A 1WYXA 1LO5D 2PMZE 3KBGA 2GQVA 4EIKA 2LMCB 3C1FA 1EQTA 4IQZA 1I4GA 1PWTA 2HIVA 4JCVE 1UHCA 3HS0C 3MP1A 1F9QA 4OVAA 1G2SA 1FYCA 2QGQA 2COWA 2EGCA 1JC7A 3A98A 4A3EH 1D09B 2QEJC 3SHLA 2OI3A 1C48A 3CHBD 1MNDA 4X9CA 4DK6C 3OIQA 4JYAL 3EIVA 1E7ZA 2CP2A 1UECA 1TS4A 2IX1A 1STGA 1UG1A 3I4OA 2O31A 1KC8R 3A1PA 3CPWS 1B9NA 3CCUT 2YRVA 1XJWB 2QA4A 5JPNC 5C44B 1HRJA 4DBHA 4GN4B 2JEBI 2L3RA 4GS3A 2FPDA 1VQAA 4NXMQ 5IWAL 5C3WA 2RKSA 2MF2A 1PA6A 5D6YA 5BR8Q 1IHWA 2O9VA 2DL8A 4M4ZA 5DM63 2D6FA 4HAEA 4RHSA 1Y1WB 2P5ZX 3OMGA 1FYNA 1QKWA 4B9XA 1AN8A 1CA6A 2VUMG 5EKLA 2EVRA 1SEMA 4KGVB 2A6EC 4XTYA 1BO0A 1VQ9A 4X65L 4BY6C 1IBML 2VB6A 2EYJA 2EQMA 4KH0B 4ZTFA 5C3EG 1JT8A 2KGTA 4BA1I 1Q81U 2BOSA 2DF6A 5FLMG 4NOYA 4X1VA 1STAA 2M0YA 3JCMh 1S1NA 3OYKA 2XMFA 1QCOA 4M78D 1VYUA 2RSOA 4DNIA 3U9OA 4OB3B 3BVGA 3I7FA 3AT1B 1QNKA 3EBEA 4C3HG 3CPWA 5HGTA 3JCMV 1PM3A 4A4HA 5CR2A 3VR4A 4BY6B 2EGEA 1H9MA 4FXDA 4EX5A 3I4MG 3GO5A 3VRZA 1Q86C 4OWXB 4A3CG 2XI9A 2A19A 4RKLA 3I90A 1D2BA 2QEXA 3PIPA 4JC0A 1KC8U 2A74C 4LF9Q 2CP0A 3OBYA 3JCMX 1ICFB 1I4HA 2DNCA 5GAEC 5ECAA 5HKCA 2HBWA 4UP8A 4RMFA 2VUMB 3KJOA 2YUQA 2K5NA 2C35B 5LL6X 3CBPA 5FU6C 3OYYA 3C94A 4XYOA 5FLMH 4JBMA 4KKTA 5C3EB 1VQ6Q 3JSCA 3URGA 4C8QF 2MPMA 5LJ5g 2RVLA 4N8FA 1JORA 1IRXA 3EH1A 2B2VC 1UE9A 3NTIA 1ESRA 2C9OA 5I9PA 4QJFA 2UXDL 3VS0A 4J7FA 4XXEA 2BE7D 2JNGA 2QDLA 4IJHA 3F8TA 1F2MA 4DR5Q 1W70A 2ZPIB 1CT1D 4ODGA 1VQ5Q 2RQVA 4LJZC 5DM7R 4C3HB 4A3CH 3W1GA 4N4GA 3BZCA 3TEHB 1FR3A 1K3RA 2YXYA 4PMCA 1NTGA 3A0JA 3I4MB 2A1AA 1STEA 1NJIC 4C0FA 1B34B 2PTKA 4GLKA 2CVRA 4FW1A 3I70A 4LF5Q 2B29A 2M0OA 1W2BS 3PUYA 1X65A 3I72A 4PLIA 5GADC 3TS2A 1OXSC 4IURA 1YITQ 4C0DC 2F0LA 1PHTA 3C4SA 1SRMA 3BVZA 4BY1B 4V0BA 2H5XA 3VJPA 4RTXA 3FEWX 4KULA 1XTDA 4XQ3A 4LE9A 4DEXA 3H09A 2KUMA 4KGXB 5C6AA 1WVLA 5GANh 1QWYA 5FKAC 3WXMB 4ZAIA 4C0ZA 3M3YB 1N36Q 1RAFB 4LDVA 2F4IA 3J81j 4LF8L 2GTOA 2CREA 3UE1A 4NMZA 1I8FA 2K32A 2AUKA 4P72A 4HIMA 5GAN8 1B7YB 4IFDH 1CHQD 5JEAH 1IBKL 2JM9A 5GAOq 1M1KR 2DVJA 2X3WD 4PV1C 3EN2A 5EBCA 4C0DB 3CCST 5GMKi 2GVBA 2FYKA 3QB3A 2B2UC 1BI1A 5A35A 3DLLA 1MJEA 3JB9I 1N27A 3L1AA 3UDIA 1GD7A 4E6RA 5H1SE 4TVRA 5KNDA 3H6MA 3CW2C 2RH2A 1ABOA 3ZBDA 4A3JG 5FK9C 1K73C 5AFWA 1EWIA 1C8CA 2EPBA 3C0CA 1XNRQ 1L0WA 3M9QA 1W2BA 3KFUA 2DBKA 4DV5L 1C0AA 4DAVA 3G7LA 1E24A 1O7LA 1EFWA 2FHDA 1EOTA 4CJ1B 5IGDA 1Y96B 4RGNA 5EPJA 1M4ZA 1CKMA 2F2VA 1TS5A 1F2LA 3CPFA 2MHVA 1PTOD 3E9IA 3PGZA 2KRMA 1VQDA 3OYAA 1ZUKA 2C5CA 1JO8A 1C7YA 3S2HB 3CC2Q 1V1PB 3KLWA 4JK1C 2QG9B 2YWWA 1G51A 3PNWC 1ZEQX 2ROTA 3H3VI 3KXTA 1ILPA 1YFNA 2EBPA 4A3JH 4A3GG 4O0AA 4A93G 4JI1Q 2RDHA 3H0IA 2UUAL 2JYOA 1RUWA 2JMCA 3SHWA 1V29B 1M1KU 4A3JB 2KRSA 2DYIA 2A08A 1WD0A 1OV3A 1Y96A 1KLGD 1ABQA 3PIO3 4YTLA 3OTOQ 3I56Q 1XJVA 2CP5A 2UU9Q 2BA0A 1C6VX 4OF1A 3LX0A 4EQ5A 2XDBA 1SMYC 1QP2A 3SFMA 4PJLA 3E0JA 2BE5D 1PFSA 1MUZA 2IL8A 3AU7A 1V1PA 1S40A 4HIDA 4P5NA 1CZWA 3DB3A 5FLXc 2EZVA 2LMJA 2E75C 3DWAA 4XTCS 3S15B 5D3DA 4C56C 5I11A 2KBNA 2OTLA 4C92F 2EYPA 1IGQA 2VVKA 2WP8J 2X4WA 2KQ3A 4DA2A 1DOMA 1H9RA 2LXKA 2V1QA 2DZCA 1PH8A 2OX7A 4A3GH 2XU8A 1MIUA 5COYA 3FKIB 2KAFA 1WXBA 4CKBA 3ZL7C 3J7ZC 4A3GB 1A2TA 4A93B 1GFDA 4J9HA 1GUNA 1MV3A 3M0SA 4HA8A 1EZ8A 5BN3A 2R3ZA 3CEYA 3RZOB 1VQMQ 3CMAA 2ZXRA 3HOUB 1WTQA 2YLCA 2F0JA 3CC4T 4HKEA 3D3RA 4R4IA 3C2PA 3CRLC 1A0NB 1LTSD 3EFRA 3OHXC 4X3KA 4ZLTF 3CCJT 5IGCA 3PSIA 1SYGA 1AWJA 1Y57A 1VA7A 4JI7Q 2H3EB 4MTNA 2JN0A 1BCPF 2FMCA 2YDLA 1VQOQ 5A2QE 2QQAA 1K8MA 4QVZA 2YHTA 2NBFA 1CZGA 3OS1A 3TQYA 3OIPA 2KECA 4J6WA 5C0XH 1S5CD 2XDDA 3PQIA 4PFPA 2ZAEA 2DNUA 3OPOA 3GTOH 3CCQA 2K50A 4AIMA 2CFMA 2NVTB 1AEXA 4OXPA 1XPRA 2V8KA 1GUTA 4FP5D 3E5SA 1H8KA 4HIKA 1SRLA 2L3SA 5DEHA 3JB9G 2PVOB 2F0NA 2EFIA 3CU7A 2I5HA 2ZCFB 3H9NA 1YJWQ 1VQBA 3KF8B 3AQQA 1BUVT 5AJ3Q 4MMKA 4Z9CB 2EYLA 3UATA 3Q8DA 2VQFL 2QXFA 2E4HA 1Q7YU 2B2YC 1KIKA 4M75C 2E5QA 5FU7C 2A0FB 3V05A 4DV7L 4QQBX 3CMET 4KKUA 1KFZA 4B3ML 3CCMA 3M0RA 1AH9A 1C4QA 3M9BA 3RNUA 1ZSGA 1VQLT 4KUIA 1IGUA 1ZLMA 4B3TL 1H641 1KD1R 1HZBA 1XNQL 4DBRA 2PQEA 5I9OA 1G5VA 2HT1A 1MMNA 3RKXA 2KRNA 2LCLA 1VQFA 2NZ1D 4RTYA 1M8VA 1SBBB 3GTLH 1YIJT 2OAUA 4QUFA 4DUYQ 3CD6T 5C5MA 5GAOr 4YCVA 2K7AA 5FLXE 3OYIA 1M9SA 2K52A 5L37A 4R8IA 3S17B 2DTIA 3GTLB 4J8OA 1R77A 1NM7A 3RR5A 2K28A 3JCMg 1ARKA 2NUCA 1PRTB 4LFAL 2DJZA 1A3TA 5M3MG 1OU9A 1JQQA 2GF7A 1TWAH 2LT4A 2KSSA 1WX6A 5GROA 3GTMH 4KT0E 1P92A 3QWXX 4FW2A 4D8KA 1VQ4Q 1HZAA 4A3IB 1BIAA 3H3VC 3GTMB 2LQNA 3L2WA 1ZYRC 3F2BA 1R9TH 3RMQA 4FXKC 3L2VA 3MXPA 2LFNA 3G6EA 1QVFS 3MZ5A 1IZ6A 1M90R 2VXEA 1OXUA 2JN4A 2Z9HA 4M7AC 2EE1A 3F1ZA 4A53A 2EPDA 2YSQA 4RTUA 2JXMB 4Y52H 3ND8A 2R6GA 4XK8E 2ATWA 4EMHA 1UGPB 2NYSA 4RG1A 3SE0A 3TZDA 4DPGA 2P4TA 1BU1A 5NUCA 2ZM6Q 4CRIA 3M56A 4DV3Q 2CT3A 3S16H 4QY7A 4MZ9A 5M3MB 4FM4B 2R5AA 2DEUA 4UC4A 1EY8A 4PMWA 5KCHA 3CPWP 1S72T 1QZGA 2VYTA 1PC0A 3CCET 4DV6L 1D7QA 4K8IA 2QQ9A 2MUYA 5FJ8H 2DD4A 1B50A 1TH7A 1SRUA 3S14H 2DJFC 2KXCA 3KOJA 2FRWA 5D6WA 4DAYA 2QQRA 2EW3A 4QMGA 1XYIA 2YRCA 2VC8A 1W6JA 4MIUA 4F17A 1ZXTA 2K7VA 3LNNA 3QR8A 4XAXB 2ZPEB 4OMMA 2A5HA 4OEMB 1QVFA 2LNHB 5AT1B 1AZPA 3M0UA 4TKOB 1WI7A 1GCQC 4OX9L 4PZ7A 5FRNA 2YLBA 4AFQC 4M7AD 4PNOA 1TS2A 2UXCL 1U9RA 3VYSA 1PXUA 3MHBA 4GLVB 3SK6A 1M90U 1Q81C 2Y0SG 4UP7A 2HQHA 1OXXK 4CKCA 4DXGA 4C8QG 3NBHB 1HNWQ 5HY6A 1VQEA 3ZFJA 3ULRB 2NLUA 5DLQE 2Z6BA 4JI5L 2FMMA 1LTTD 4KJNA 1LNXA 4YY3Q 1VQKA 1SSHA 4GKJQ 4NPSA 2Z0WA 5FO9B 3HEJA 3PGGA 3QXEB 1KRSA 4VUBA 2J6FA 4RCCA 1BBUA 2RMOA 5GANe 4DR7L 1SYBA 4A3LG 3JV3A 1HD3A 4A3DG 3ZEHA 1Q46A 1RF2D 1GO3E 2OT2A 3T1HQ 4QCLA 4J6HA 3PVQA 4JBJA 4KBMB 2Y0SE 1IBLL 1YHQQ 4GZYC 1OQKA 2L5QA 4C8QE 1G2TA 2P4RA 1LTGD 4OB1B 2R7ZB 1FMWA 5GAN6 1UFFA 1MKHA 2RQXA 3JAMi 3CCLA 3N5BB 5C4XG 4WTOB 3M4GA 1K76A 1YJ9Q 2OTJT 3J81i 1Q8KA 1GCQA 1U1SA 3TQ7P 1LV9A 1T5XD 1Y8NB 5GAOm 1RKNA 2Y0SB 3VS7A 4C8QB 4LDUA 2B2TC 2KYBA 3Q24A 2WB1G 2J4XA 4HVVA 2EXZA 3EFXD 2JA8G 5JJKA 1A0IA 4QVCA 1KK7A 2DETA 4B3SL 3MFGA 1U5SA 4LNPA 4M7DC 2K03A 2XKOC 3S24A 4A3LH 3VYHB 1X55A 4A3DH 4UAIA 1K1ZA 3OYLA 2SNSA 5GMKh 3E1SA 2WACA 2VB3X 2ASBA 3L7ZC 2FZGB 3MP8A 3QUIA 1W2BP 2MOXA 2OQKA 4NXNL 4A3DB 3G4ST 1HZ9A 2AQ2B 4Z02A 3PUWA 4X64Q 1PTOF 1RTNA 1SAPA 4J9DA 2O2LD 1XMQL 2E3HA 3A8JE 4C8QA 5JVH3 1H95A 2YU9B 2F0GA 2A7YA 1H9JA 5DM73 3J7A5 1TU0B 4DQ2A 3VKIA 1JJ2P 1IXDA 5C4XB 1FL0A 1YI2Q 2PZTA 3A8OB 3HRTA 4JRIA 3NUCA 1U4PA 2VW9A 2CWAA 4CDEC 1N33L 1KQSS 2JA8H 3MEVA 2MIOA 4QQGA 4OELB 1HNZL 2WB1B 2JA8B 4K14A 2F1LA 1UDLA 2A68D 4DK3C 2UUBL 2DRMA 3SWNC 3CCRT 2JA7B 2NVYB 3NP8A 4PLLA 3JCMb 2F2WA 2M16A 2K5LA 1A3UA 1HJPA 4RTWA 2B2TA 3VS6A 2XGTA 1HYOA 5JEAJ 3V96A 4F04B 2EQIA 1XWEA 4P73A 4Z8AA 4R9WA 5CC4A 3QHSA 5LJ5h 5IGBA 1WLPB 3I91A 2HNIA 3OB9A 4M77D 1AE2A 1CQFA 2M9UA 2AT1B 2HEQA 1Q1EA 2FL7A 3EG1A 2KEDA 3RMSA 2L3PA 2NN6G 4XT1B 2F0SA 2JMAA 3KDFB 1JQYD 3SWNB 3PF4A 2ZT9C 1N8RR 2AWOA 4DF7A 1HNXQ 4KK7A 4IUVA 1E22A 1F9PA 1FNUA 1NE3A 4Q5VA 1OU8A 2PW5A 4DFAA 2HQEA 4MZPA 2LVMA 2QCPX 1XMOQ 2K1BA 3S2DH 1VQJA 1L2FA 1XPUA 1IKMA 3JCMc 4DOVA 1KQSA 2F0QA 4G7OC 1NCVA 4GLMA 4JI3L 4GOPC 1N34Q 2VKNA 3FC3A 3HKZE 4B3MQ 3M7NA 3NGPA 2PI2A 4BBSG 1UTIA 1F1BB 2NUPB 4YWMA 2LC4A 2RQTA 4C92G 3M5AA 4MN3A 2DIGA 4B3RL 1VQ6A 3JRZA 4BE2A 2XN9C 3WOEA 4II1A 3KDFA 3UE0A 2ZTCA 4MNOA 3CXCP 4AFSC 4OHJA 3FB9A 2V4DA 1F77A 1U4LA 4O1NA 1G291 3BVMA 1GJXA 2NN6H 1VQIA 1PD0A 3CCSQ 1NEBA 2QA4T 4A3KH 4JG2A 3JAMc 2D9TA 3RKWA 3QPHA 4LDWA 4GOPB 4TQUS 1VQ5A 3EQLC 2E2DC 2FFKB 4C92C 4LUVA 1G3WA 5L23A 2OQ0A 2RSNA 3EA6A 2F0KA 1UGSB 3M54A 3STBC 2NUPA 4F8MA 1EFNA 1B8AA 1X43A 4PKCC 1I6HH 1HCZA 1LJOA 4KY6A 4LFBQ 4ZGJB 1V1CA 2QQBA 3R2TA 2EYOA 2DJGC 4C5IA 2JVVA 1ILQA 1VS0A 1I6HB 1B07A 5CV4A 4B6MA 2E6NA 1FJGQ 2KROA 3VV0A 1LT4D 4PMBA 2CZ0B 1EZZB 2LSSA 4JI8L 1LTLA 1OX9A 2NYZD 1VQ9T 4BBSB 4H7BA 3H0FA 1N8RU 4V190 2XRSD 1FX7A 2JA5B 4JPBW 1VQ7Q 1EQVA 3K0XA 2EQUA 4C92B 2RHQB 3MWYW 4GOPA 4KH1B 5IGGA 4FNFA 4WJ3M 1IW7C 2PNRC 5LJ3h 3L2UA 2W10A 3K0YA 4PJOD 1SNPA 1IL2A 2BH2A 4QIWB 1YNJD 4C5GA 1R4PB 2MQHA 2UXBL 3HRSA 2MK5A 3U58A 1FWZA 1WTVA 2KR3A 1KL9A 3S1NB 2K5QA 4CKEA 1X6OA 3VA7A 2E8GA 5CV6A 1JRIA 5J26A 2V8IA 4PZ6A 2B63G 4JV5Q 5LMUL 1P16A 2QEXT 1O75A 3C12A 4LK1C 5ELEA 1WFWA 4DR2L 1LTBD 3SEBA 4C92A 3F2CA 1Y71A 1T0JA 3CC7Q 2KVQG 1G6PA 1GOZA 4ZGEB 1WCMG 4LAAA 4LF6L 3TP5A 2NVQH 2PQWA 4C3JH 1BCPB 2G9DA 5M9OA 4DR3L 4EQPA 1YJNQ 5GAMe 1I4PA 3EAEA 1XXGA 1YHBA 4CDFC 5C3XA 5KNBA 2Q2IA 2NVQB 1TXYA 3S6WA 3LH5A 5C0XJ 2KHJA 2DL3A 5GMKm 4J1MA 5IYBG 1SNMA 2E12A 4ZQ3A 4P71A 5JPMC 1RAGB 4M75F 2B2WA 4RWSC 1IHVA 4JBWA 1FXXA 1M1GA 2IT1A 5D65A 4OMOA 1SE3A 1SE8A 3CC2A 1NMFA 1T3SA 3Q23A 2K01A 2GA4B 2B63B 1ICWA 3AB9A 4LF7L 1O7YA 1IKLA 1Q7YC 1PYSB 3TCJA 3BYYB 4H0LC 1T9HA 4UDUC 1X6BA 4JS4A 1S3OA 3B6YA 4KKSA 1BKBA 2B86A 2L9HA 4KTAA 4DR4L 5K36G 2XVSA 3DUZA 4DV0L 1WCMB 3I56A 1SKUB 2O88A 1QVGS 4LXCA 4F14A 4JS5A 3JAME 1LOJA 4G7ZC 2A73B 2PW7A 4L8JA 4R1JA 3CCVQ 5T1IA 1TR5A 4JI2L 3GTQH 3M4OH 1TUGB 4DV4L 1WQ7A 1DJ7B 5I4DA 1I94L 4IFDJ 3NQTA 3HOXG 5JJZA 2ATCB 1JOKA 4X66Q 2JT4A 4M78G 1J8IA 4K2LA 1AW7A 4IUPA 4UPAA 5I2SA 4OGCA 2VS1A 5CKFA 1MI2A 1AFPA 4P74A 2AZSA 4FT2A 4FT4A 1U5KA 3GD7A 2LX9A 3ULLA 3OYDA 1ZA2B 4R4QA 1OO9B 4B08A 1Y0MA 4BD3A 2Q2HA 2FINB 5K36H 4DR6Q 1JJCB 3HPWA 3HP9A 5CAIA 2DL7A 2QF7A 3MXGA 3NPPA 2BKDN 4BE0A 4M78C 4HCKA 1CI3M 5CGKA 1KAWA 4M7AF 2O4XB 1WGSA 2LJ0A 1VQMA 3G71Q 1OI1A 1PFBA 5C44H 5GAN3 3PIP3 1KJWA 3A55A 1AWXA 1BK2A 1ZUYA 1HK9A 4P2CB 1X3GA 1QVGA 3HOVG 1GXIE 3KYHC 2CSQA 2F4VQ 1VF5C 1YEZA 1QUQB 4OIKA 3BY7A 4KGZB 3VS4A 3NE5B 3FHWA 4DNTB 1BDOA 1QCNA 1LCKA 1VQLQ 4I7AA 1Y1WH 3HOXB 3LW5E 3MEUA 1ACMB 1X3PA 3MP6A 3EGXB 3LYIA 4M78B 2EYHA 1AEYA 3GV3A 4G7HC 1HR0Q 2RHXA 2JEAI 2KY9A 2VASA 2EJFC 2FB7A 1L0YB 4J9GA 1EY5A 2O4XA 1IYVA 5HGQA 4OO1I 5CK9A 1YIJQ 4JI0L 1H3ZA 2JM8A 2EQKA 2L89A 5CYUA 7AT1B 3A5UA 2RPNA 2HDLA 3HZXA 3K5LA 1I4QA 5CKDA 1GM5A 2KVMA 3EG0A 1QUQA 3X25B 3LH0A 4XU2A 3LGFA 1D1IA 3MXUA 1JU5C 4YHHQ 2E2HH 1S5BD 3GTKB 3PUZA 1YJWA 3SGIA 3HOVH 4DNRB 3EGXA 1EEID 3L2PA 2F0PA 1Y7XA 2E2HB 3ERQA 1X3EA 1BI0A 2Z8LA 2CSIA 3HOVB 1S4ZA 4LFCL 2NUTB 4GLXA 3LWUA 4D8DA 2N49A 5GANf 3Q0AA 1QZHA 1FMVA 2OTLT 1UWVA 2RK1A 1D0ZA 1PH5A 2SOBA 1X32A 1VQHA 1LABA 5CV9A 2VUMH 4PZ8A 5CQXA 4B9WA 4ZK9B 4LD6A 3RLFA 1E1TA 1AP0A 4GKKQ 2XIDA 3OA6A 3DEPA 3PVLA 5C3EH 3NENA 2SDFA 1JR0D 3NHHA 4BY1G 1N9WA 1NYGA 3VR5A 1WD1A 1STNA 3RLNA 1PH4A 2E70A 2NUTA 3CMAT 3D0FA 2M00A 1EUJA 1JBMA 2IHFA 3G7ZA 3ICEA 5D7UA 1QWEA 1SYDA 4JYAQ 9ATCB 4R55A 4C3HH 5C4ZA 2Y4YA 3L42A 3URYA 2XTIA 3K8AA 2F2XA 2H3JA 3OYJA 1BXTA 1JMCA 1X56A 5CV8A 3I4MH 4BY7G 3PO2B 5FU6B 2SEBD 1VQ4A 1UEBA 1UEAB 3W5OA 1TWCB 2NTSA 4OB2B 4OIJA 4DV2L 2X3XD 1FNWA 2RI3A 4R4CA 4E6IA 5IWAQ 2ZJPA 4IPGA 2VL6A 1K9MR 4L5SA 5CV7A 5LJ5e 3HOYG 3CCQT 2PUKB 5ELCA 1D1BA 4M7DF 4BY1H 2K4KA 4XTXA 3T13A 1K83H 2F0FA 3CQTA 1ZUUA 1Y8PB 2WAQG 4HN7A 5E7NA 3CBOA 2HKQB 3M3YH 4L6V5 4N4HA 4K0KL 3OBWA 1K83B 4OL7A 2KK4A 4X65Q 3J80L 1IBMQ 1PTOC 4X6AH 2YV5A 1SFOH 4E7KA 1M2VB 1UGVA 3S1MB 4MZMA 1SFOB 1DXMA 1B34A 1UE5A 1WHMA 2J05A 2B2VA 3BE3A 2LX7A 3OYNA 1EIYB 4BY7B 2NUZA 4Y92A 3BU2A 3O13A 1J9OA 3VUBA 1CUKA 1ET9A 2WAQE 1VQ8Q 3DXJC 2HDAA 4L5TA 3LGLA 5C4JH 1HA6A 1PTOB 5BN5A 1KQSP 1F2ZA 1WPYA 2FRYA 1G2BA 1Q82R 1DCZA 3HOYB 4GN5A 2IPOB 5C4JB 4A4EA 4HR7B 3I2ZA 1LT6D 2BE5C 1STYA 2HSEB 4JI6L 2WAQB 3GTJB 1K8AR 1KTKA 2CZ1B 2KYMA 1PH7A 2LRQA 4OO1G 1HPCA 2R5MA 1HUNA 1K9MU 2K14A 3K59A 1E0BA 5KYYB 3LGJA 3L2ZA 5LJ3g 4FVMA 5GAMd 1HHVA 1VIFA 2OJ2A 3TP6A 3BFMA 3R6OA 1WJJA 3S2HH 1MBYA 2HZYA 2F3VA 2HBPA 2VGNA 1EIGA 1K0SA 3R93A 5C4HA 2KCCA 4KN4C 2UXDQ 4X62L 4PJMA 3H0GB 4KI0A 4XU1A 4FSXA 5IP7G 1BNZA 2DERA 3FKIG 2WFWA 5M5WB 2DD5A 1CTMA 1SN8A 4GBQA 3MPUB 2C06A 1TY2A 1MMAA 2FO0A 1VQGA 2A6HD 2B2UA 4Y28E 4N9PA 4ME3A 3I4NG 2KI7A 3LX7A 2DK3A 5KYYA 2LCCA 1PH3A 1EIFA 3HOUG 4LNQA 1X6GA 2K75A 4JI4L 4C5HA 4XIGS 2DKGA 3RKYA 1YHQA 2R58A 1AE3A 3D31A 2UUCL 1I50B 3P75A 2EYQA 3S15H 2BUDA 5IT9L 1EY7A 5M5XB 2B3GA 5CMDA 1W6KA 4BI8B 1JOQA 5GANj 1DJRD 1KNAA 3X3MA 1QE6A 4A3FG 2K5IA 1YJ9A 3T9NA 1PHJA 4F7XA 2OWOA 3MCAB 1CKBA 4U673 1RIPA 5E4WC 4LF8Q 1EFID 2VB2X 3TU4K 3VUZA 4J9FA 2JW4A 2RHZA 2F0HA 5IP7H 3FKIH 1V1QA 1IBKQ 5FWCA 4A54A 2IHEA 2V1CC 2SNMA 2AHJB 4A93H 2COYA 1YCSB 4BDZA 3TSSA 2QKIC 3I4NH 3R2IA 3NWTA 1J3TA 3RZOH 4IUTA 2K3BA 2RD1A 4DR1L 1PSEA 4PJNA 4BDYA 1RTOA 3PUVA 4JBKA 3HOUH 2MI6A 3I4NB 1MMDA 5A0DA 2Q2UA 2FG0A 2Y4XA 3QO3A 3FDTA 5ELFA 4DV1L 1PVOA 1D6EC 2L4NA 4ME5A 2IW3A 3K57A 1XQHA 2LY7A 4ZGDB 2NZHA 2RQUA 4ZN1A 4DV5Q 4KHPQ 1M3BA 2IPKD 1JB0E 1J5EL 1VCIA 3K5MA 1HR0W 1YI2A 4A4KA 3FMCA 4A3FB 2L0AA 1GUOA 4ZRZA 5GAN2 1Y14B 1HH2P 1EY0A 2R61A 4PFZA 3AFQA 5GAMf 1QCBD 4C1NI 1ZHIA 4OGEA 2RQRA 1WQWA 3WVDB 1VQKT 1PYWD 2K33A 2NZOA 3L3OC 3LWEA 4IUUA 1C0MA 2CH4W 2VY3A 4L63B 4M75G 3I35A 2IIMA 1IL8A 5C5LA 1OOTA 2K57A 2J6OA 4IOAA 3PT9A 1I5FA 2UUAQ 4K5VA 3SK8A 2QK0A 3D6WA 4DUZL 1WJSA 1MJCA 3PIOA 2F0UA 3U4VA 3CCLT 2AMCB 2D9UA 2XWBB 1QW1A 1WTPA 2I5MX 3SVMA 3TS0A 1Q3LA 3T53B 1ZBXA 2EYMA 2J0TD 5CR3A 1VQNQ 2F0DA 3I55T 4A3IG 2D0PA 2VXFA 1RI9A 4CC3A 2H4OA 4UY8C 3BZDB 3V7CA 3JCMP 2EYFA 3OW2S 2MGSA 3FPPA 1PKSA 4DA4A 5M3FG 2W0ZA 4HIOA 1RAIB 1B7TA 1NPRA 1STHA 3I5RA 1I3QB 3DM3A 1GFCA 1WTHA 1HXDA 2VV5A 2KHIA 4M75B 5FU7B 3S17H 5CV5A 2X4YA 5GAOl 3JB9H 1QNUA 3BYTB 4ABNA 1AZGB 2DJQA 2ZPFB 3FJ5A 1YNND 3PUXA 1M8AA 4D6WA 4FO2A 5E3FA 2K2MA 3SR1A 3VDYA 1RLQC 3CCSA 4QB4A 3JCMJ 1F9RA 2E10A 3OS5A 1QVGP 3QG1A 1I4RA 3TP7A 4CC7A 4J6YA 4A4FA 3IL8A 1EWHA 1SYEA 1H9KA 4GNXC 2D5DA 3A5ZB 5CKHA 3HTRA 1WIEA 3IFDA 4M7AG 5J22A 4A3IH 1RHPA 3KUPA 3UWNA 3J7YW 2JZ2A 2NWMA 1SNQA 5CIUA 2RHIA 1VQCA 2I5LX 2B2YA 5GAOn 4M75A 1KHIA 4QT7A 2LKVA 3G48A 1VDZA 3G6JB 1K8OA 2N8NA 4O42A 3NQIA 3U4ZA 3I73A 1ENFA 3X3NA 3THKA 2LJ1A 5M3FB 4RKUE 3OW2A 4RMOA 1PCXA 3E0EA 3JCMe 4RTVA 3UA7A 4M78F 1VQ7A 4GNXB 3FDRA 5TSSA 4JZ4A 2J7ZA 3H3VH 2ZPBB 3G1JA 2VXWA 2VQEQ 2BZYA 4A76A 1WI5A 1DOKA 4RFBA 5M3MH 2RCFA 1KD1U 2PYKA 3K5NA 1CHPD 1Q86R 3FJPA 3NTKA 4XTWA 4Z89A 1VYVA 3P8DA 2VQFQ 3TEEA 3T1YL 4ANJA 2EVBA 3M0PA 4M7AB 5FRMA 1PRTD 1ZQ1A 1MHNA 2O2OA 1TTHB 3UT1A 2HHHL 3K80C 3CC7A 2V1RA 4NB3A 1SE2A 4JVZA 4KUDK 2DN8A 1U4MA 2COZA 1RJTA 3CQZH 4IN3A 2ID0A 4B3TQ 4XQQA 1VQ6T 3QYHB 1YJNA 3KBXA 2EKHA 3PTAA 1XNQQ 1G83A 1QP3A 3CQZB 4KJOA 4E7LA 2R7ZG 1CFMA 2ZTEA 1II3A 1B53A 2KT1A 1PRMC 2ICEC 1SPKA 3OYBA 5IH2A 4M7AA 4WCIA 2EJGC 4WRDA 1NUCA 4AFUC 1VQPT 2DXCA 1TWBA 2V26A 3ER0A 2CW0D 1WFQA 1VQ5T 5GAMj 5C6SA 3MC0B 1GUGA 3L2QA 4HMJA 4LFAQ 2VGMA 5FW9A 2BCOA 4N0AC 2D62A 1JWSD 3K81C 1NJIR 4HJ7A 5DAUA 1BQQT 3MFYA 4XTUA 4L5QA 3NELA 2FJ2A 1N9SA 4C0GA 1PD1A 5EKKA 3K7UC 3OWFA 1LPLA 2HQXA 5A0GA 4BUGA 2DXTA 4LF4L 3M7GA 5LMNL 2R92G 3OYMA 1WOCA 1MNEA 2IY5B 1DONA 2DMOA 1D5ZC 3RD4A 1G6ZA 2FVUA 2ZJRA 3CCUQ 2EJMA 2YUPA 1IO6A 2R7ZH 4JJCA 1KC8C 1TWGB 4H13C 2J06A 2XK0A 3CCVA 4KMUC 5DNFA 1JWUD 3EHQA 3NBHA 1YVCA 1ZKOA 1I81A 2KEAA 2R7DA 5A0LA 5LJ5f 3REAB 4M7DG 1YBYA 3EHRA 5LHY1 1RABB 3C1EA 2RJCA 2NB0A 3PMTA 3TMEA 4LN2A 4TVAB 2JJQA 1ESFA 3SB2A 2A68C 2O01E 3VS2A 4FF3A 4K6LA 1D0XA 2RJDA 1AZQA 5GJWB 1G3YA 1AOJA 4JJBA 3U23A 1K73R 2B8GA 4BE1A 4HT8A 4DV6Q 2JA7G 1BCOA 4LUEA 1G8XA 2YYZA 3BDCA 1QCFA 2I07B 2A28A 2DXUA 4JDSA 4X34A 4M77C 3V8KA 1Q8IA 1CA5A 5IN1A 2R92B 3CRKC 3Q6SA 2QDBA 1SNCA 3E9GA 4M7DE 3G71A 1A8VA 3SXHA 3RZDH 2GFUA 2YU9H 2XRQD 1XMOL 2JP1A 1OULA 5C4XH 1NG2A 3I4LA 4XQNA 4J83A 5A2QL 1TWFH 3RZDB 5IE8A 2CKZB 4K11A 1CKNB 2LQWA 2WB1E 1HZCA 1UHFA 4JRPA 3A8KE 4LUZA 4OX9Q 1TWFB 1VQLA 3E19A 4M7DB 3KF6B 4I65A 2N55A 2HCIA 1U3OA 2UXCQ 4KLKA 4E7IA 1UJYA 4H02A 3CC2T 2BIVA 2D8HA 2JA7H 1GCPA 4ATOA 2DE0X 3EFOB 2M1HA 2AKLA 3EG9B 2NVYH 3WOFA 2X4XA 3TSZA 1PFMA 1YIJA 1Q90A 2DM1A 1QOHA 2PI2E 1WTXA 3TREA 1WDXA 1ASYA 2JJ9A 3GTGB 4O5VA 1MGQA 2Z6KC 4JI5Q 1UUPA 1PNJA 1SSOA 1K8GA 2CH4A 1L1OC 2JE6I 5I21A 4WJ4A 4J6XA 4C8QD 1G8ZD 4C3IB 2EYYA 4HXJA 3OS0A 1QJOA 4RGOS 3OSVA 3KF6A 4M7DA 4E7HA 1BVSA 4YCWA 4DR7Q 1EZ6A 2A69D 4WORA 4HVUA 2R7FA 1F9SA 2LTOA 3MXNB 1WXUA 4IIMA 4BI3A 4ELYC 3H91A 4ZYSA 2Z0SA 1FJGL 1TWHH 1STBA 2RNAA 1HFGA 4MHEA 3EFOA 3EG9A 5I2YA 1AT1B 1IBLQ 3RERA 1RAEB 2HIXA 5I6YA 4Y7NH 3S1QB 1TWHB 2YUOA 1VOMA 2RDGA 2DA9A 1D1AA 4JLGA 4DU9A 1G3TA 2E41A 1HXYD 4PG3A 4P75A 4HCBA 1FGUA 4AYBG 1B4OA 1C1AA 1Y07A 4Y7NB 3FP9A 2PVGB 2JSOA 2PNHA 2RF0A 1QQJA 1BI3A 1NLOC 2AIRB 2C0IA 1ET6A 3TVTA 3AFPA 4DKAC 5GAGC 1T5EA 1FMKA 1VMPA 3OQ5A 3AYHB 4QUCA 2XIWA 4KN7C 2JA5G 4KHPL 3GF5A 3S1RB 2E6ZA 1SHFA 4PJOC 1CSPA 2DL4A 4B3SQ 1VQMT 1YNJC 1K0XA 4IIOA 3SWNA 1U8RA 2BDOA 2Z6KA 1UB4A 5G3LD 2EY2A 4RGMA 1LTAD 2CP3A 1VUBA 2OEOA 1I5LA 1WHHA 4RG8A 2RQWA 4NDXA 4HJAA 4RCNA 2Z1CA 4NXNQ 3NFCA 5IP9G 4MDWA 4Q5WA 2PZ1A 1M1KC 4AQYL 2E5LL 2MYSA 3OYEA 4I7ZC 3J81c 1XMQQ 1UAPA 4HSPA 1TU2B 2L2PA 1OXTA 1SR3A 4C92E 3FLGA 2J6KA 2KMTA 4DBQA 4EMKC 4AYBB 3FRPB 3AEVA 2P0PA 1KQ2A 3GDEA 4BBSH 3D7SB 1I4XA 2AKWB 3A7LA 3D4DA 4QIWE 2JA5H 1O7IA 3KK7A 2ROLA 4L59A 1YITA 3A8MB 4WJWA 3OOCA 1IXRA 1HNZQ 2KCTA 2MWOA 1M3AA 1LYLA 2GVAA 2UUBQ 4O2DA 1BB9A 1NYFA 2XHCA 4A3MB 3SK5A 3JCMd 5LJ5j 1YJWT 4CDCC 2XNAC 2KCNA 5JOBA 4LUDA 3MVVA 3S1NH 4N8X1 1TOVA 3A8GB 2O9SA 2WSCE 4C2MH 3DWPA 4RAUC 2JQOA 1HSQA 1U4RA 2PCFB 2G6FX 4OMFB 5CKEA 3MJXA 4C2MB 3MEHA 2R93G 4UHVA 3OSOA 2XG8D 3P7JA 1ZSZC 1K9AA 3GP7A 1X3QA 2MO1A 3UI2A 1VQ8A 4WFN3 4ZKBB 1JB7A 1RCVD 3C95A 4F16A 2D8JA 1EX4A 1D1CA 2L3QA 5L8RE 3T4AC 3V8LA 4A3BG 2JA6B 1UE7A 4FL6A 1ASZA 1WHKA 1BCMA 3A8LB 1BI2A 1EWCA 3HGBA 3K6OA 5ELDA 4X66L 2K5VA 3GIBA 2DYBA 1WTOA 2F5TX 4OMQA 3EROA 3BS1A 2H8HA 2DPPB 4JRKA 5FO8B 5JJLA 5EPKA 3T16A 5CBAE 2IX0A 1M2OA 4B3RQ 1NSNS 2RI2A 2FZKB 3EVQA 4K6DA 1OEBA 4CC2A 1SJHD 2E3IA 5KCOA 1FVIA 2HL3A 2AKKA 3QSUA 1N5ZA 4BXXG 3FVQA 5KYUB 2B63H 1MSGA 1VQ4T 4IUQA 1UE6A 1PZJD 2R93B 3QOLA 4APVA 4HSVA 4HVWA 3F2UA 3VYGA 1O78A 1I6VC 4QF4A 4DGZA 1NBEB 5CVIA 3LWIA 4C5EA 4A3BH 2XD0A 1MV0B 2HCKA 3H94A 4BI4A 1K3BC 1WCMH 1YN8A 1KDCA 2G5DA 2WKCA 2I0QA 1HQMC 4DBFA 3CC4Q 4AG1C 3GPLA 3PMFA 2HDMA 2KENA 4XT3B 4NXML 3OW2P 1TUDA 2O5JC 1ZA1B 4FYVB 5GAOp 1SDFA 4NP5A 5BR8L 3CCJQ 3UPUA 1I1JA 4JI8Q 1OZ2A 5GAN7 5KRUA 4ZTJA 1KLUD 1BR9A 2I0NA 5GANd 4PFOA 5KYUA 2YTVA 3O5ZA 1EEFD 3J81E 4HCEA 5IYBH 2Y90A 4E2FB 3X24B 3I9QA 2WV6D 1BCPD 3JCMf 1D3BB 1OPLA 2LS01 1EU3A 3RNJA 3JB9J 1DOLA 5FWBA 2L11A 3DM1A 2DXBA 2QTXA 2AQ3B 4PL6A 3BJUA 1SROA 3UDFA 4ALPA 2WIIB 2ICIA 5EBDA 2MPXC 4H44C 2LDMA 2L8DA 4MTKA 3K7AB 3GTPB 4IFDI 2JS0A 1N6AA 1N32Q 3VU3C 3SK4A 3DB4A 5JVG3 5JAVA 1NAPA 1RADB 4MZTA 4Y91A 4OONA 3QIIA 5M5YB 3OS2A 3PFSA 4ZN3A 4M78E 2K4YA 2KEEA 1D3BA 1QVFP 4TRDA 3CMEQ 1N9RA 4LF6Q 2ENMA 1HTPA 1KG1A 4F87A 4LF9L 2JTMA 3I8ZA 1Q81R 3I55Q 4DR3Q 3HOXH 2M2LA 2K79A 2PQAB 1M3CA 2HAXA 3NXWA 3NMZC 2HL5C 3IKJA 1CKOA 3GOXA 2A3LA 5I6WA 1WA7A 3HRZC 4S3SA 3VR6A 4FIBA 4YWLA 3VS5A 2L0CA 1VQOA 2YTYA 3P1HA 1LACA 1SYCA 4CBVA 3HSBA 1LTRD 3UDXA 2DVEA 4OB0B 2BH8A 1LLRD 1IB8A 1KD1C 1AD5A 5CCAA 4J9CA 1E7OA 3CD6Q 4A3EB 1QILA 5KIXA 5KYLA 2PMZB 4DR5L 5LMNW 4LF7Q 3GTKH 2QGFB 1LT5D 2PQAA 3P8HA 4CI0C 4FF1A 2MWPA 2HUGA 4UP9A 1PSFA 2ZPHB 1AZEA 4DR4Q 1YHQT 1P8LA 3KLSA 5D3IB 4DV0Q 4M78A 5EPLA 4LF5L 4HJ9A 4R4TA 4OP0A 3EH2A 3PO2G 4MDXA 1WXTA 4X3SA 1YJ9T 2LXJA 4JI2Q 1DYQA 3W1BA 4DV4Q 2K5DA 1VQNA 5IIFA 1I94Q 1EYAA 3TBIB 2YT6A 4DOWA 2DGYA 1M27C 4NL3A 2XICA 5EG2A 2WSFE 2N88A 3EGDB 4HEDA 2DFUA 3KUFA 1PV4A 1XNIA 1N36L 5GMKe 1I0CA 3RBBB 1GBRA 2K9GA 2DTHA 1M90C 2BTTA 2C0OA 2DILA 2EJFA 3V8JA 3HFOA 4DEYA 1F2YA 2DBMA 1TQOA 2OCEA 4KY5A 1UUEA 2X6LA 2ES2A 1H9SB 2F5KA 3D8GA 3M4PA 2QILA 4XQJA 3MEFA 1S72Q 2GBQA 1PDQA 1TT2A 2GN5A 3CCEQ 2B39A 3PO2H 3EGDA 5IXBA 3E9FA 1TWCH 1B70B 1W3SA 1YI2T 4JLIA 1NR2A 2GTJA 4IALA 3CAMA 1XNRL 1RL2A 3Q1JA 4LDYA 1KABA 5IYCG 5FOBB 1YNZA 1BYMA 2YRDA 1KNEA 3VS3A 1H9SA 1D8LA 1EYCA 3MHXA 1U0LA 2A6ED 1EL0A 2IX3A 5I2MA 1MGSA 4QGUA 3PF5A 4JRQA 4M77F 2CCZA 4FF4A 1CSQA 4JI0Q 1X69A 3QKJA 1JXMA 2QTVA 2CQOA 1VQPQ 1JWMD 1NLPC 4A4GA 3SD4A 5C0XI 4NL2A 5CQYA 2L55A 3S1MH 4AMCA 4IFDG 1W1FA 3PCOB 4POFA 5JEAG 3WWVA 5ELNA 1YHAA 2K5FA 3QOJA 2E76C 2RDFA 3KLSX 4ELZC 5IYDG 1B3AA 2IVWA 3GNGA 4JI1L 4IJLA 4BY7H 1PZKD 3S3NA 3OSSC 2JTEA 4OMPA 1NNXA 3OY9A 3H0GG 4KHVA 3F70A 3UDCA 1GHJA 3A56A 3HFNA 4AH6A 4DAMA 5IYCH 3OTOL 4J9EA 1YWPA 1PTOH 2A6HC 2UU9L 3CCMT 4LFCQ 2GGRA 3RUZA 5GQOA 1IHZA 3HOYH 1U1TA 5I22A 2B8AA 3OYGA 1RAAB 3QZ9B 3N6RA 3ITPA 1JJ2S 4E47A 2E5KA 2CQAA 1VMCA 4IO9A 3GTJH 5G3LF 1E2VA 1M2VA 2E2IB 2BZ8A 2QW7A 5KEEA 2L1BA 5IOCA 1SEBD 4RTZA 2ZXPA 2VZAA 1Y1VG 2OTJQ 1A3VA 2RA2A 2EKOA 3VS1A 1W4SA 5CBEE 3K5OA 5IYDH 5J3BA 2EYZA 3T56B 4F7UF 3HKSA 2X6GA 2CUDA 4EMGA 1S5FD 3DMUA 3EFSA 3EG2A 1HJDA 4HMIA 1EU4A 1H92A 2L5TA 1YZ6A 3H0GH 4XYQA 4J5YA 1GUWA 4G57A 2AWNA 3I5SA 1RLPC 4IPCA 4XDXA 2EQSA 3L2RA 3UF4A 5M5WH 2EWNA 1BIBA 4LDXA 1MHWC 2ESWA 2WSEE 2VNUD 1LM0A 3NWSA 4RGTA 4DV2Q 2E2JH 4QW2A 3JAML 1G91A 2EXDA 1M8MA 2ED1A 5AYFA 2JA9A 4YCUA 5EGTA 2HKNA 3NBIA 2F03A 1G3SA 3G6ET 3G4SQ 1DGSA 2JUFA 3J81L 1Q95G 2E2JB 4JI7L 1ML0D 1W6XA 2DX1A 5LJ3e 3CCUA 2BE9B 1I50H 4N4IA 3OMCA 4PJOF 1VQ7T 4DXFA 2X51A 1DZ1A 1JJ2A 1Y1VH 4ULLA 5M5XH 1M5Q1 4OO1H 3PE0A 5KE2A 3GP8A 4XTVA 1IREB 4YWKA 1Y1VB 2D0QB 3M0TA 5CKBA 5KYWB 1X75C 2GFAA 1OZ3A 4RUGA 1EY6A 1Q82U 4JZ3A 1GUSA 1OXVA 2K5HA 4K0KQ 4KY7A 4RKBA 1X2KA 3J7AF 3VA5A 5CORA 2MFIA 2ALYB 4PNYA 4QQDA 1WHGA 4U68A 1BF4A 2GCXA 3CCRQ 3CXCS 1K8AU 1HUMA 2VWFA 1GL5A 4BBRG 1KXLA 2EAYA 1TVXA 4JOIC 2P84A 3P8BB 5GJVB 2RF4A 5AJ3L 1UGQB 4XTZA 1WTRA 3M59A 3CC7T 3RIRA 4R8NA 3D4RA 5KYWA 3U9SA 1KSWA 4PK4A 2EDGA 2PZUA 4IKFA 3H0HA 3TN2A 1B2TA 1YJNT 5KNCA 3ND9A 4IZ8A 4FYYB 5IHNA 3KJPA 1NY4A 1WYDA 1QWFA 1X2QA 2K3XA 2KE9A 4A3BB 1CSKA 2DZ9A 4A3FH 2FZCB 4JI6Q 4FCYA 3Q22A 4KD4A 3SDZA 2MJ8A 1JE4A 1N8RC 3JCMQ 4CJ0B 2PVDB 3VR3A 1D1KA 3VYUA 1CK1A 5C0XG 2F0TA 4BBRH 4DUYL 2JXBA 1IYUA 2KOLA 1Q7YR 1UNSA 2K5WA 2DL5A 2KBTA 2D0NA 4M1UB 4BBRB 4GLAC 1HA5A 1WTWA 4X62Q 3CXCA 5ISRA 3R6NA 2SRCA 2EGAA 2CWPA 1YNNC 1LVKA 2FHTA 1SMXA 3REBB 5EC7A 2LJ3A 3NPFA 1BBWA 1UGRB 2JTFA 1QMCA 1EQRA 1V9PA 2JK8A 4JOIA 3U50C 2CHBD 1TIID 3HG9A 2ZXOA 4FYDA 2QA4Q 1SHGA 3IFTA 1SMYD 3I3CA 3HHTB 4ZNXA 3CCVT 4N9TA 1Y8OB 4OMLA 3X26B 1A6XA 1D5MC 1O80A 4HJ8A 4JI4Q 2CP7A 4BS9A 1RAHB 3KF8A 2UUCQ 2D0OA 1KAAA 3DKMA 2YUNA 2XWJB 1NZ9A 4KV6A 4O6JA 2F0IA 4M75E 1TXQA 4R4OA 4CGYB 3BDUA 2MAMA 2PNIA 2VQEL 4BACA 2I2LA 1VQ9Q 1QVCA 5FO7B 3GBQA 2AZVA 1E1OA 3FRNA 3GTOB 1I3QH 4PQXA 2ZM6L 1QVPA 1X01A 1AWWA 4RG2A 5KH6A 2LT1A 1WHJA 4FSSA 2F0WA 2L15A 4DV3L 2DAQA 1NR4A 3HFZB 4AG2C 1A63A 4J9BA 1HTLD 3RMHA 4GN3B 3G71T
chains in the Genus database with same CATH topology
1SRMA 1ZX6A 1JEGA 2FPFA 4RTXA 4DEXA 4LE9A 1U3OA 1X6BA 2HSPA 1UJYA 2B86A 2D8HA 1GCPA 2GTOA 2CREA 2DE0X 2AKLA 2O88A 3TSZA 4F14A 2DM1A 1WDXA 2JM9A 2DVJA 2X3WD 3TSWA 1CKAA 1PNJA 3KFVA 2CH4A 2EYYA 4HXJA 4E6RA 2ABLA 2JT4A 4HVUA 1ABOA 1WXUA 4IIMA 2AZSA 3C0CA 2RNAA 2EYXA 4ORZA 2DBKA 2GNCA 1Y0MA 2FPEA 2YUOA 4JJDA 2A36A 2DA9A 2DL7A 4HCKA 2KT8A 2RF0A 2LJ0A 2F2VA 1NLOC 2C0IA 3TVTA 1KJWA 1FMKA 2KRMA 4J9IA 1ZUKA 1BK2A 1AWXA 1JO8A 1ZUYA 1SHFA 2CSQA 2DL4A 1UJ0A 2ROTA 4IIOA 3VS4A 3M0QA 1K0XA 1LCKA 2EBPA 1PKTA 3H0IA 1AEYA 2LZ6B 2RQWA 1RUWA 2JMCA 2MCNA 3SHWA 4J9GA 2KRSA 2A08A 1OV3A 2PZ1A 1ABQA 2JM8A 2RPNA 2L2PA 1MUZA 1AVZC 2J6KA 3EG0A 2LMJA 2CDTA 3QWYA 1JU5C 1I07A 5I11A 2M51A 2FEIA 2ROLA 4OMNA 2LP5A 2VVKA 3NHNA 2CSIA 1M3AA 1XOVA 2V1QA 1BB9A 1NYFA 2BZXA 4K11A 4D8DA 1WXBA 1GRIA 4LUDA 3ZL7C 2C0TA 1QLYA 1GFDA 4J9HA 2O9SA 1MV3A 3M0SA 4ESRA 1HSQA 2G6FX 1JXOA 3PVLA 4CC4B 5IHKA 1K9AA 4RTTA 1A0NB 1NYGA 4AFZC 4F16A 2D8JA 2L3QA 1AWJA 1Y57A 4KRTA 1VA7A 1H3HA 2YDLA 1QWEA 1ZBJA 2DYBA 2DLPA 4OMQA 2H8HA 4R0KA 2F2XA 2DNUA 2X3XD 3SEMA 1OEBA 4CC2A 2AKKA 1H8KA 1N5ZA 1SRLA 2L3SA 4HVWA 3UATA 3CQTA 1ZUUA 1KIKA 1MV0B 2ECZA 2HCKA 1Z9ZA 1KFZA 1YN8A 4Z88A 4AG1C 1VYTA 1TUDA 3EGUA 3M0RA 2OAWA 1UGVA 1ZSGA 1I1JA 1ZLMA 2J05A 2I0NA 2LX7A 3O5ZA 2NUZA 4Y92A 2KRNA 1TG0A 3I9QA 4RTYA 2HDAA 1YP5A 1OPLA 2K7AA 2ED0A 2FRYA 3RNJA 1G2BA 5FWBA 1NM7A 1M30A 1ARKA 1Z9QA 1JQQA 1TUCA 2AK5A 2JS0A 2KYMA 1WX6A 3QWXX 4D8KA 2OJ2A 2LQNA 5IXFA 2ENMA 1K0SA 2K79A 1M3CA 3H41A 3NMZC 2EPDA 2YSQA 1WA7A 4RTUA 1AWOA 4GBQA 2FO0A 3VS5A 1BU1A 1X6GA 5IHIA 2CT3A 1AD5A 1U06A 2KNBB 4J9CA 2CUBA 1E7OA 2A37A 3IQLA 2KXCA 2FRWA 2EW3A 1AZEA 2CT4A 1B3QA 1CKBA 4J9FA 2JW4A 4F17A 1T0HA 4OMMA 5FWCA 1WXTA 2LNHB 1YCSB 3M0UA 1QKXA 1WI7A 1GCQC 2KXDA 2YT6A 2RN8A 1J3TA 2K3BA 1M27C 4AFQC 2FG0A 1I0CA 3RBBB 1PRLC 2K9GA 1GBRA 2BTTA 2C0OA 2DILA 2J7IA 3VRYA 4A63B 4DEYA 2DBMA 2EYWA 3ULRB 2RQUA 1UUEA 1M3BA 1K4US 1SSHA 2L0AA 1OPKA 2GBQA 2J6FA 2RMOA 5IXBA 3JV3A 1HD3A 3EG3A 2RQRA 3PVQA 2GTJA 2CH4W 2P4RA 2DRKA 2GQIA 1YNZA 1UFFA 3I35A 2IIMA 2D1XA 1OOTA 1K76A 1T3LA 2J6OA 3VS3A 1GCQA 1NEGA 3VS7A 2KYBA 1X69A 1JXMA 4HVVA 1NLPC 1U5SA 1W1FA 4LNPA 1RI9A 4CC3A 1K1ZA 1E6HA 1PKSA 2JTEA 4OMPA 2MOXA 1E6GA 2K6DA 2W0ZA 4J9EA 3I5RA 1YWPA 4J9DA 1GFCA 2GGRA 5HCKA 1YWOA 1AZGB 2DJQA 1BBZA 3FJ5A 5I22A 2LCSA 2K2MA 1X27A 2E5KA 1RLQC 2MIOA 1GBQA 4CC7A 2BZ8A 4RTZA 1WIEA 1UDLA 3VS1A 2DRMA 2SEMA 2EYZA 2F2WA 2NWMA 4RTWA 2CUDA 3VS6A 3EG2A 1HJDA 2EQIA 4QT7A 1H92A 4Z8AA 3UA6A 1WLPB 3I5SA 1RLPC 3THKA 2LJ1A 3UF4A 2HEQA 2JS2A 4RTVA 2ESWA 3EG1A 3UA7A 2L3PA 1WYXA 2JMAA 4JZ4A 4EIKA 1M8MA 2ED1A 1PWTA 2BZYA 1UHCA 2EGCA 1W6XA 2DX1A 3A98A 2OI3A 3PE0A 4GLMA 4Z89A 2VKNA 1UECA 1VYVA 1UG1A 3NGPA 1UTIA 2O31A 3M0TA 3M0PA 4RUGA 2RQTA 4JZ3A 2O2OA 1X2KA 2FPDA 2V1RA 4AFSC 2O9VA 2DL8A 4M4ZA 2VWFA 1GL5A 1NEBA 5GJVB 1FYNA 1QKWA 2EKHA 1G83A 2EVRA 5L23A 1SEMA 2KT1A 1PRMC 1SPKA 1EFNA 1KSWA 1X43A 4WCIA 5IH2A 3H0HA 4AFUC 1V1CA 2KGTA 2DF6A 1B07A 4X1VA 5IHNA 2KROA 2M0YA 5FW9A 1S1NA 1QWFA 2KE9A 1X2QA 2XMFA 1CSKA 1VYUA 3H0FA 4JPBW 2EGEA 2W10A 2DMOA 2JXBA 3VRZA 2DL5A 2KBTA 2D0NA 2YUPA 1IO6A 2KR3A 4JJCA 3R6NA 2SRCA 2EGAA 2J06A 5ECAA 2HBWA 3REBB 5EC7A 2LJ3A 2YUQA 3EHQA 3NPFA 2KEAA 3REAB 3EHRA 1SHGA 1WFWA 4LN2A 1T0JA 4ZNXA 4OMLA 1UE9A 3VS2A 5GJWB 3VS0A 2YUNA 1AOJA 2QDLA 4JJBA 3U23A 1W70A 4LUEA 2RQVA 1QCFA 2A28A 3LH5A 2DL3A 2PNIA 3GBQA 2AZVA 2PTKA 1AWWA 4FSSA 1NG2A 4OMOA 4AG2C 1T3SA 4J9BA 2LQWA 1PHTA 1UHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRM A;  1ZX6 A;  1JEG A;  2FPF A;  4RTX A;  4DEX A;  4LE9 A;  1U3O A;  1X6B A;  2HSP A;  1UJY A;  2B86 A;  2D8H A;  1GCP A;  2GTO A;  2CRE A;  2DE0 X;  2AKL A;  2O88 A;  3TSZ A;  4F14 A;  2DM1 A;  1WDX A;  2JM9 A;  2DVJ A;  2X3W D;  3TSW A;  1CKA A;  1PNJ A;  3KFV A;  2CH4 A;  2EYY A;  4HXJ A;  4E6R A;  2ABL A;  2JT4 A;  4HVU A;  1ABO A;  1WXU A;  4IIM A;  2AZS A;  3C0C A;  2RNA A;  2EYX A;  4ORZ A;  2DBK A;  2GNC A;  1Y0M A;  2FPE A;  2YUO A;  4JJD A;  2A36 A;  2DA9 A;  2DL7 A;  4HCK A;  2KT8 A;  2RF0 A;  2LJ0 A;  2F2V A;  1NLO C;  2C0I A;  3TVT A;  1KJW A;  1FMK A;  2KRM A;  4J9I A;  1ZUK A;  1BK2 A;  1AWX A;  1JO8 A;  1ZUY A;  1SHF A;  2CSQ A;  2DL4 A;  1UJ0 A;  2ROT A;  4IIO A;  3VS4 A;  3M0Q A;  1K0X A;  1LCK A;  2EBP A;  1PKT A;  3H0I A;  1AEY A;  2LZ6 B;  2RQW A;  1RUW A;  2JMC A;  2MCN A;  3SHW A;  4J9G A;  2KRS A;  2A08 A;  1OV3 A;  2PZ1 A;  1ABQ A;  2JM8 A;  2RPN A;  2L2P A;  1MUZ A;  1AVZ C;  2J6K A;  3EG0 A;  2LMJ A;  2CDT A;  3QWY A;  1JU5 C;  1I07 A;  5I11 A;  2M51 A;  2FEI A;  2ROL A;  4OMN A;  2LP5 A;  2VVK A;  3NHN A;  2CSI A;  1M3A A;  1XOV A;  2V1Q A;  1BB9 A;  1NYF A;  2BZX A;  4K11 A;  4D8D A;  1WXB A;  1GRI A;  4LUD A;  3ZL7 C;  2C0T A;  1QLY A;  1GFD A;  4J9H A;  2O9S A;  1MV3 A;  3M0S A;  4ESR A;  1HSQ A;  2G6F X;  1JXO A;  3PVL A;  4CC4 B;  5IHK A;  1K9A A;  4RTT A;  1A0N B;  1NYG A;  4AFZ C;  4F16 A;  2D8J A;  2L3Q A;  1AWJ A;  1Y57 A;  4KRT A;  1VA7 A;  1H3H A;  2YDL A;  1QWE A;  1ZBJ A;  2DYB A;  2DLP A;  4OMQ A;  2H8H A;  4R0K A;  2F2X A;  2DNU A;  2X3X D;  3SEM A;  1OEB A;  4CC2 A;  2AKK A;  1H8K A;  1N5Z A;  1SRL A;  2L3S A;  4HVW A;  3UAT A;  3CQT A;  1ZUU A;  1KIK A;  1MV0 B;  2ECZ A;  2HCK A;  1Z9Z A;  1KFZ A;  1YN8 A;  4Z88 A;  4AG1 C;  1VYT A;  1TUD A;  3EGU A;  3M0R A;  2OAW A;  1UGV A;  1ZSG A;  1I1J A;  1ZLM A;  2J05 A;  2I0N A;  2LX7 A;  3O5Z A;  2NUZ A;  4Y92 A;  2KRN A;  1TG0 A;  3I9Q A;  4RTY A;  2HDA A;  1YP5 A;  1OPL A;  2K7A A;  2ED0 A;  2FRY A;  3RNJ A;  1G2B A;  5FWB A;  1NM7 A;  1M30 A;  1ARK A;  1Z9Q A;  1JQQ A;  1TUC A;  2AK5 A;  2JS0 A;  2KYM A;  1WX6 A;  3QWX X;  4D8K A;  2OJ2 A;  2LQN A;  5IXF A;  2ENM A;  1K0S A;  2K79 A;  1M3C A;  3H41 A;  3NMZ C;  2EPD A;  2YSQ A;  1WA7 A;  4RTU A;  1AWO A;  4GBQ A;  2FO0 A;  3VS5 A;  1BU1 A;  1X6G A;  5IHI A;  2CT3 A;  1AD5 A;  1U06 A;  2KNB B;  4J9C A;  2CUB A;  1E7O A;  2A37 A;  3IQL A;  2KXC A;  2FRW A;  2EW3 A;  1AZE A;  2CT4 A;  1B3Q A;  1CKB A;  4J9F A;  2JW4 A;  4F17 A;  1T0H A;  4OMM A;  5FWC A;  1WXT A;  2LNH B;  1YCS B;  3M0U A;  1QKX A;  1WI7 A;  1GCQ C;  2KXD A;  2YT6 A;  2RN8 A;  1J3T A;  2K3B A;  1M27 C;  4AFQ C;  2FG0 A;  1I0C A;  3RBB B;  1PRL C;  2K9G A;  1GBR A;  2BTT A;  2C0O A;  2DIL A;  2J7I A;  3VRY A;  4A63 B;  4DEY A;  2DBM A;  2EYW A;  3ULR B;  2RQU A;  1UUE A;  1M3B A;  1K4U S;  1SSH A;  2L0A A;  1OPK A;  2GBQ A;  2J6F A;  2RMO A;  5IXB A;  3JV3 A;  1HD3 A;  3EG3 A;  2RQR A;  3PVQ A;  2GTJ A;  2CH4 W;  2P4R A;  2DRK A;  2GQI A;  1YNZ A;  1UFF A;  3I35 A;  2IIM A;  2D1X A;  1OOT A;  1K76 A;  1T3L A;  2J6O A;  3VS3 A;  1GCQ A;  1NEG A;  3VS7 A;  2KYB A;  1X69 A;  1JXM A;  4HVV A;  1NLP C;  1U5S A;  1W1F A;  4LNP A;  1RI9 A;  4CC3 A;  1K1Z A;  1E6H A;  1PKS A;  2JTE A;  4OMP A;  2MOX A;  1E6G A;  2K6D A;  2W0Z A;  4J9E A;  3I5R A;  1YWP A;  4J9D A;  1GFC A;  2GGR A;  5HCK A;  1YWO A;  1AZG B;  2DJQ A;  1BBZ A;  3FJ5 A;  5I22 A;  2LCS A;  2K2M A;  1X27 A;  2E5K A;  1RLQ C;  2MIO A;  1GBQ A;  4CC7 A;  2BZ8 A;  4RTZ A;  1WIE A;  1UDL A;  3VS1 A;  2DRM A;  2SEM A;  2EYZ A;  2F2W A;  2NWM A;  4RTW A;  2CUD A;  3VS6 A;  3EG2 A;  1HJD A;  2EQI A;  4QT7 A;  1H92 A;  4Z8A A;  3UA6 A;  1WLP B;  3I5S A;  1RLP C;  3THK A;  2LJ1 A;  3UF4 A;  2HEQ A;  2JS2 A;  4RTV A;  2ESW A;  3EG1 A;  3UA7 A;  2L3P A;  1WYX A;  2JMA A;  4JZ4 A;  4EIK A;  1M8M A;  2ED1 A;  1PWT A;  2BZY A;  1UHC A;  2EGC A;  1W6X A;  2DX1 A;  3A98 A;  2OI3 A;  3PE0 A;  4GLM A;  4Z89 A;  2VKN A;  1UEC A;  1VYV A;  1UG1 A;  3NGP A;  1UTI A;  2O31 A;  3M0T A;  3M0P A;  4RUG A;  2RQT A;  4JZ3 A;  2O2O A;  1X2K A;  2FPD A;  2V1R A;  4AFS C;  2O9V A;  2DL8 A;  4M4Z A;  2VWF A;  1GL5 A;  1NEB A;  5GJV B;  1FYN A;  1QKW A;  2EKH A;  1G83 A;  2EVR A;  5L23 A;  1SEM A;  2KT1 A;  1PRM C;  1SPK A;  1EFN A;  1KSW A;  1X43 A;  4WCI A;  5IH2 A;  3H0H A;  4AFU C;  1V1C A;  2KGT A;  2DF6 A;  1B07 A;  4X1V A;  5IHN A;  2KRO A;  2M0Y A;  5FW9 A;  1S1N A;  1QWF A;  2KE9 A;  1X2Q A;  2XMF A;  1CSK A;  1VYU A;  3H0F A;  4JPB W;  2EGE A;  2W10 A;  2DMO A;  2JXB A;  3VRZ A;  2DL5 A;  2KBT A;  2D0N A;  2YUP A;  1IO6 A;  2KR3 A;  4JJC A;  3R6N A;  2SRC A;  2EGA A;  2J06 A;  5ECA A;  2HBW A;  3REB B;  5EC7 A;  2LJ3 A;  2YUQ A;  3EHQ A;  3NPF A;  2KEA A;  3REA B;  3EHR A;  1SHG A;  1WFW A;  4LN2 A;  1T0J A;  4ZNX A;  4OML A;  1UE9 A;  3VS2 A;  5GJW B;  3VS0 A;  2YUN A;  1AOJ A;  2QDL A;  4JJB A;  3U23 A;  1W70 A;  4LUE A;  2RQV A;  1QCF A;  2A28 A;  3LH5 A;  2DL3 A;  2PNI A;  3GBQ A;  2AZV A;  2PTK A;  1AWW A;  4FSS A;  1NG2 A;  4OMO A;  4AG2 C;  1T3S A;  4J9B A;  2LQW A;  1PHT A;  1UHF A; 
#chains in the Genus database with same CATH topology
 3M4Q A;  2RB6 A;  1ZX6 A;  5IOD A;  1JEG A;  2FPF A;  1ENA A;  3CKI B;  2Q8R E;  4DR1 Q;  1MD2 D;  3TRZ A;  4FU6 A;  1E2Z A;  1V1O A;  2RJE A;  1D5X C;  4X3U A;  3ULJ A;  2HSP A;  4C1N K;  3L9A X;  1TSF A;  2A8V A;  3M55 A;  1AHJ B;  4DV1 Q;  3RN5 A;  2DO3 A;  3PO3 G;  2QEX Q;  1PG5 B;  1PRT C;  2M9V A;  2QAZ A;  5KYI A;  3F2D A;  1Z7T A;  3TSW A;  2CKK A;  3DHQ A;  1CKA A;  1J5E Q;  1MSH A;  1GXD C;  4QL5 A;  3KFV A;  1ROD A;  4JW0 A;  4MML A;  3ASK A;  3ULP A;  5M3F H;  4X9D A;  3INZ A;  2QYZ A;  4DK1 A;  3OYC A;  2KDS A;  2ABL A;  2FXQ A;  1PH2 A;  2XDP A;  2DUD A;  1YNX A;  4K5X A;  3HOW G;  3T51 B;  1ONL A;  4HCC A;  4JJN K;  1SF9 A;  5C0M A;  4E7S A;  5EJW A;  5LJ5 d;  4X3T A;  2EYX A;  5GAM h;  4ORZ A;  2F3I A;  1HNW L;  3GNF B;  1QG7 A;  2GNC A;  1SE4 A;  4M7A E;  2CW0 C;  2FPE A;  4JJD A;  1R0B G;  2A36 A;  3HL8 A;  2N3S A;  4YY3 L;  2EY6 A;  2PUO B;  3PO3 H;  4GKJ L;  1E2W A;  3S3M A;  1TKW B;  3ZJY C;  4M75 D;  2F69 A;  1TWA B;  2KT8 A;  3BZK A;  5FJ8 G;  4K2K A;  2OXP A;  2NWG A;  3PO3 B;  4DUZ Q;  4A4I A;  2QQS A;  3A7A B;  3L0O A;  4J9I A;  3T1H L;  1KIX A;  3JB9 D;  2VUB A;  4GY5 A;  2F52 A;  3K58 A;  1R9T B;  4KD3 A;  4GNX A;  2DEQ A;  3WDN A;  4DAY B;  1UJ0 A;  5IGE A;  3HOW H;  1VF7 A;  3M0Q A;  4K5W A;  1RD9 D;  4ME7 A;  1X9N A;  4ZCK A;  2P0Q A;  1PKT A;  2AQ1 B;  3QJY A;  4OWT B;  4EQN A;  4EVO A;  2LZ6 B;  3HOW B;  2MCN A;  2EIF A;  4RCO A;  2K6A A;  1S5D D;  3GV6 A;  3MEW A;  1PYB A;  3M53 A;  5EKI A;  3S16 B;  1B1Z A;  1AVZ C;  4CHT B;  3TZU A;  3J80 i;  2CDT A;  1NE8 A;  3QWY A;  1WHL A;  3BG3 A;  1I07 A;  4LD9 K;  2M51 A;  3S14 B;  2FEI A;  3NSW A;  4OMN A;  2LP5 A;  2F1M A;  3NHN A;  1UE1 A;  2QAS A;  2NN6 I;  2M02 A;  2QGG A;  4QVD A;  1I4K 1;  3QJ6 A;  1NBW A;  1ZYR D;  4DK0 A;  1XOV A;  4X64 L;  4L5G A;  2BZX A;  1B9M A;  1GKH A;  5IY0 A;  1PMR A;  1Q12 A;  3CC4 A;  2G3R A;  4NS5 A;  1Q86 U;  1V8Q A;  1GRI A;  1YIT T;  3KLR A;  2C0T A;  2OF1 A;  1TWG H;  1QLY A;  1R0C B;  1EY4 A;  2CZ7 B;  5GAN g;  3CCJ A;  1DM0 B;  3QO2 A;  4ESR A;  3QWN A;  3A54 A;  3RUX A;  2RI5 A;  1O9S A;  2CGH A;  1YCY A;  3NK9 A;  3C3L A;  5LJ3 d;  3TDQ A;  1A15 A;  1JXO A;  4CC4 B;  5IHK A;  1JCK B;  2Z4H A;  3DWQ A;  4HT9 A;  5IGF A;  1PZI D;  4RTT A;  2EOT A;  5DY9 A;  3MO8 A;  4AFZ C;  1JJG A;  3MEA A;  4M77 G;  1XX8 A;  4EGV A;  3M85 A;  2E65 A;  5F2D A;  4KRT A;  1H3H A;  1X54 A;  2LQ8 A;  2BDN A;  1HFN A;  3W2D A;  5T1G A;  1TS9 A;  5FRO A;  1A2U A;  2IJ0 A;  4RHR A;  2MMP A;  2EJG A;  4IOC A;  1ZBJ A;  3VR2 A;  4JUV A;  4QQ6 A;  5JJI A;  4XU0 A;  5HK0 A;  2DLP A;  1VQ8 T;  2X35 A;  4ZKC B;  1PH1 A;  4R0K A;  3T1Y Q;  4C8Q C;  2XSC A;  8ATC B;  3D4W A;  3PV0 A;  2R92 H;  4N0A A;  2NVT H;  1SYF A;  2ZGW A;  2RBM A;  5KYN A;  3S3O A;  1JE5 A;  2N78 A;  4C3I G;  2A69 C;  3H15 A;  3MA2 B;  2HHH Q;  1KQ1 A;  3SEM A;  2RHS B;  2P0K A;  1NJI U;  1HNX L;  4M77 E;  3FEO A;  5GAH C;  1EYG A;  3CME A;  4HCZ A;  4XU3 A;  4IPH A;  4KHZ A;  3JCM W;  2OTL Q;  2CZ6 B;  3I55 A;  4PJJ A;  2WIN B;  3ONA B;  1SJE D;  4G4K A;  4EQO A;  1N34 L;  1LTI D;  4BB7 A;  3WVE B;  1VIE A;  1LUZ A;  1Z6H A;  2AHO B;  2RA4 A;  2RCN A;  3R8B A;  2DY8 A;  4RA8 A;  2ECZ A;  1GHK A;  4M77 B;  2KHS A;  1Z9Z A;  4POG A;  1FGB D;  2ZTD A;  1I5O B;  3N52 A;  4Z88 A;  4NKL A;  1VYT A;  4FDB A;  4F88 A;  3EGU A;  4E7Z A;  2OAW A;  1HQR D;  4L5R C;  3GTG H;  4ILW A;  4F7U G;  2RHU A;  3A8H B;  4EDU A;  5GMK l;  3CD6 A;  3RDV A;  1SLJ A;  2CYZ B;  5DLO A;  4C3I H;  3CMA Q;  4ZUJ A;  3ME9 A;  2JOY A;  2ZJQ A;  2QDY B;  4K8J A;  2Q2T A;  2WKD A;  1TG0 A;  3S9W A;  1J6Q A;  1CKN A;  4LF4 Q;  2E64 A;  3DLM A;  3I56 T;  2LNV A;  5LMN Q;  1YP5 A;  3MAQ A;  1K0R A;  4LFB L;  2ED0 A;  4M77 A;  3AHU A;  3HP3 A;  1K73 U;  1XPO A;  4DN4 M;  5EAY A;  3RN2 A;  4IPD A;  4OGQ C;  3ERS X;  1M30 A;  2IG0 A;  3JC6 6;  5I2X A;  3M4Y A;  1KRT A;  3S1Q H;  1SXT A;  2O5I C;  1Z9Q A;  3OYF A;  4F7U E;  5HK3 A;  3J80 c;  1TUC A;  2AK5 A;  4PJO G;  5LJ3 f;  2X4J A;  2EJ9 A;  1L1O B;  2I46 A;  3CCQ Q;  3QYG B;  1A62 A;  1K9M C;  4FYW B;  4J8Q A;  3P20 A;  3S1R H;  5K5P A;  1Z9F A;  2F0E A;  2Q8I B;  3A8I E;  2ZZD A;  4M7D D;  1KHC A;  4F7U B;  5IXF A;  2HMA A;  2AUJ D;  3MXN A;  3LWH A;  3HKZ G;  1PH9 A;  2DY7 A;  1FD7 D;  4A3M G;  4WF2 A;  3RR6 A;  3H41 A;  4BWG B;  3BW1 A;  3CF5 A;  1TS3 A;  3UDG A;  4A3K G;  1AWO A;  5GMK j;  4R56 A;  4PJO E;  4JV5 L;  3OYH A;  1S72 A;  2TSS A;  3CCE A;  1L1O A;  3NTH A;  1S5E D;  2PO4 A;  4AYB E;  2F0O A;  1Q1B A;  3M58 A;  3CCM Q;  1RDP D;  1OTC A;  5IHI A;  4FXG C;  3BDO A;  1U06 A;  1EY9 A;  4HTH A;  2KNB B;  3RLO A;  2CUB A;  2A37 A;  2ENB A;  2L12 A;  3VYT A;  4F7U A;  4DV7 Q;  1VQO T;  2DNE A;  3MTS A;  5D6X A;  4PJO B;  3AMU A;  1JIC A;  3S2D B;  3IQL A;  3OW7 A;  1QB5 D;  3HRU A;  2B8F A;  2HD0 A;  2JA6 G;  1Q82 C;  1X3F A;  4LWC A;  4L6T B;  1N33 Q;  2CT4 A;  1B3Q A;  1WZO A;  4LW1 A;  3NEM A;  1M1F A;  2G9H D;  1C9O A;  2LQK A;  4LUO A;  4Q0F A;  4A3M H;  3LLR A;  1TY0 A;  1T0H A;  3HKZ B;  5D14 A;  1K8A C;  4J15 A;  1V76 A;  4QKU A;  1VQP A;  2PU9 B;  3V7S A;  3R3O A;  1QKX A;  4A3K B;  2KXD A;  2RN8 A;  4PJO A;  4EMK B;  2HD3 A;  2NTT A;  5IP9 H;  4RCB A;  1CM9 A;  6AT1 B;  3QDF A;  4V2S A;  1GVP A;  2F3W A;  1DD2 A;  1SSF A;  2CS7 A;  3MET A;  1OX8 A;  5E4X A;  2NVX H;  1NMG A;  1PRL C;  1VQN T;  4AT1 B;  1SG5 A;  1E3P A;  2TMP A;  3QIA A;  5IT9 c;  5KGU A;  2J7I A;  3VRY A;  4A63 B;  1MMG A;  2NVX B;  3G6E Q;  1FNV A;  2JA6 H;  1PFN A;  2RO0 A;  2EYW A;  1PLF A;  3FPU B;  2MO0 A;  2KCM A;  1V43 A;  1XTC D;  2K3Y A;  1K4U S;  4C3J G;  2R57 A;  5IAY A;  4DAP A;  1OPK A;  2B2W C;  3D6C A;  2DTO A;  1M4V A;  5ELB A;  2RJF A;  1LT3 D;  4EMK A;  2D2C C;  1SNO A;  5E1F A;  3EJI A;  4JI3 Q;  3HOZ G;  2KJX A;  4OWW B;  4EPC A;  4CJ2 C;  1NPP A;  3EG3 A;  1R4Q B;  2E1H A;  3E2U A;  5GAM g;  2OTJ A;  1BOS A;  1BCP C;  3DEO A;  3W3A A;  4LMQ D;  1ZSZ B;  3J80 E;  4ID6 A;  3FIF A;  1L0X B;  2DRK A;  3ZYY X;  5BN4 A;  2GQI A;  5J1Z A;  2RK2 A;  3BDL A;  3C46 A;  3PMI A;  2K04 A;  8AT1 B;  5FLX L;  2D1X A;  4DR6 L;  1N32 L;  3RES A;  2R93 H;  1T3L A;  3X28 B;  3E6Z X;  2DIQ A;  4C92 D;  2PZW A;  1CQV A;  1BBX C;  2MNA A;  4TSS A;  1NEG A;  3CBM A;  3STB D;  2X9H A;  1K28 A;  2KA7 A;  2E5L Q;  2F0M A;  4IUN A;  2BA1 A;  4AQY Q;  3IAY A;  5J39 A;  3VYR A;  5KYX B;  1WNL A;  5ELO A;  1EYD A;  2KQW A;  3X20 B;  3H6Z A;  2K2V A;  3M57 A;  2F4V L;  3V7R A;  3CP0 A;  1ZSZ A;  3G4S A;  2X69 A;  1EQQ A;  3E3X A;  1Z47 A;  4C3J B;  1PH6 A;  1WJR A;  1R8O B;  2MP1 A;  4M8A A;  4BA2 I;  4ZUI A;  3HOZ H;  2ZPG B;  2CP6 A;  5CO7 A;  3OWE B;  1E6H A;  1OYX A;  2IWH A;  3TP8 A;  2RHY A;  1HR0 L;  1IW7 D;  3HOZ B;  2F0V A;  4E7J A;  1E6G A;  2K6D A;  3H8Z A;  5HUR A;  2QI2 A;  4A75 A;  1EIH A;  1Y69 U;  3QBY A;  4HCS A;  2Q8T A;  4NW2 A;  2HQL A;  5LL6 S;  2H1E A;  2HCC A;  5LJ3 j;  3A74 A;  1B44 D;  3JB9 F;  5KYX A;  3O8V A;  5HCK A;  4HJ5 A;  4FF2 A;  4BXX H;  1PRT F;  1YWO A;  4YIJ A;  1BBZ A;  3QZ5 B;  3J7A V;  1VQK Q;  2LCS A;  2Z4I A;  2UXB Q;  3CCR A;  1X27 A;  3K7A H;  4YHH L;  4RH6 A;  3GTP H;  3GLX A;  3IRB A;  2E2I H;  2K05 A;  4FYX B;  1GBQ A;  5GAN 4;  4A3E G;  2YTX A;  1JB3 A;  5GAN 5;  5EQ0 A;  1IYJ B;  1KDB A;  2PPB C;  5LMU Q;  1RAC B;  1SND A;  2EQJ A;  5KE3 A;  2E74 C;  5M5Y H;  5C44 G;  4J7I A;  2SEM A;  1ENC A;  4DR2 Q;  3GQB A;  1JOO A;  2EY5 A;  3CCL Q;  3GTQ B;  3UA6 A;  3E9H A;  3M4O B;  1O7Z A;  2EY1 A;  4CDD C;  1WJQ A;  2V8J A;  1Y1W G;  1EOV A;  2JS2 A;  3QDR B;  5IT9 E;  1KDA A;  3V2T A;  2RM4 A;  4GKK L;  3MKD A;  1D0Y A;  1RI0 A;  1WYX A;  1LO5 D;  2PMZ E;  3KBG A;  2GQV A;  4EIK A;  2LMC B;  3C1F A;  1EQT A;  4IQZ A;  1I4G A;  1PWT A;  2HIV A;  4JCV E;  1UHC A;  3HS0 C;  3MP1 A;  1F9Q A;  4OVA A;  1G2S A;  1FYC A;  2QGQ A;  2COW A;  2EGC A;  1JC7 A;  3A98 A;  4A3E H;  1D09 B;  2QEJ C;  3SHL A;  2OI3 A;  1C48 A;  3CHB D;  1MND A;  4X9C A;  4DK6 C;  3OIQ A;  4JYA L;  3EIV A;  1E7Z A;  2CP2 A;  1UEC A;  1TS4 A;  2IX1 A;  1STG A;  1UG1 A;  3I4O A;  2O31 A;  1KC8 R;  3A1P A;  3CPW S;  1B9N A;  3CCU T;  2YRV A;  1XJW B;  2QA4 A;  5JPN C;  5C44 B;  1HRJ A;  4DBH A;  4GN4 B;  2JEB I;  2L3R A;  4GS3 A;  2FPD A;  1VQA A;  4NXM Q;  5IWA L;  5C3W A;  2RKS A;  2MF2 A;  1PA6 A;  5D6Y A;  5BR8 Q;  1IHW A;  2O9V A;  2DL8 A;  4M4Z A;  5DM6 3;  2D6F A;  4HAE A;  4RHS A;  1Y1W B;  2P5Z X;  3OMG A;  1FYN A;  1QKW A;  4B9X A;  1AN8 A;  1CA6 A;  2VUM G;  5EKL A;  2EVR A;  1SEM A;  4KGV B;  2A6E C;  4XTY A;  1BO0 A;  1VQ9 A;  4X65 L;  4BY6 C;  1IBM L;  2VB6 A;  2EYJ A;  2EQM A;  4KH0 B;  4ZTF A;  5C3E G;  1JT8 A;  2KGT A;  4BA1 I;  1Q81 U;  2BOS A;  2DF6 A;  5FLM G;  4NOY A;  4X1V A;  1STA A;  2M0Y A;  3JCM h;  1S1N A;  3OYK A;  2XMF A;  1QCO A;  4M78 D;  1VYU A;  2RSO A;  4DNI A;  3U9O A;  4OB3 B;  3BVG A;  3I7F A;  3AT1 B;  1QNK A;  3EBE A;  4C3H G;  3CPW A;  5HGT A;  3JCM V;  1PM3 A;  4A4H A;  5CR2 A;  3VR4 A;  4BY6 B;  2EGE A;  1H9M A;  4FXD A;  4EX5 A;  3I4M G;  3GO5 A;  3VRZ A;  1Q86 C;  4OWX B;  4A3C G;  2XI9 A;  2A19 A;  4RKL A;  3I90 A;  1D2B A;  2QEX A;  3PIP A;  4JC0 A;  1KC8 U;  2A74 C;  4LF9 Q;  2CP0 A;  3OBY A;  3JCM X;  1ICF B;  1I4H A;  2DNC A;  5GAE C;  5ECA A;  5HKC A;  2HBW A;  4UP8 A;  4RMF A;  2VUM B;  3KJO A;  2YUQ A;  2K5N A;  2C35 B;  5LL6 X;  3CBP A;  5FU6 C;  3OYY A;  3C94 A;  4XYO A;  5FLM H;  4JBM A;  4KKT A;  5C3E B;  1VQ6 Q;  3JSC A;  3URG A;  4C8Q F;  2MPM A;  5LJ5 g;  2RVL A;  4N8F A;  1JOR A;  1IRX A;  3EH1 A;  2B2V C;  1UE9 A;  3NTI A;  1ESR A;  2C9O A;  5I9P A;  4QJF A;  2UXD L;  3VS0 A;  4J7F A;  4XXE A;  2BE7 D;  2JNG A;  2QDL A;  4IJH A;  3F8T A;  1F2M A;  4DR5 Q;  1W70 A;  2ZPI B;  1CT1 D;  4ODG A;  1VQ5 Q;  2RQV A;  4LJZ C;  5DM7 R;  4C3H B;  4A3C H;  3W1G A;  4N4G A;  3BZC A;  3TEH B;  1FR3 A;  1K3R A;  2YXY A;  4PMC A;  1NTG A;  3A0J A;  3I4M B;  2A1A A;  1STE A;  1NJI C;  4C0F A;  1B34 B;  2PTK A;  4GLK A;  2CVR A;  4FW1 A;  3I70 A;  4LF5 Q;  2B29 A;  2M0O A;  1W2B S;  3PUY A;  1X65 A;  3I72 A;  4PLI A;  5GAD C;  3TS2 A;  1OXS C;  4IUR A;  1YIT Q;  4C0D C;  2F0L A;  1PHT A;  3C4S A;  1SRM A;  3BVZ A;  4BY1 B;  4V0B A;  2H5X A;  3VJP A;  4RTX A;  3FEW X;  4KUL A;  1XTD A;  4XQ3 A;  4LE9 A;  4DEX A;  3H09 A;  2KUM A;  4KGX B;  5C6A A;  1WVL A;  5GAN h;  1QWY A;  5FKA C;  3WXM B;  4ZAI A;  4C0Z A;  3M3Y B;  1N36 Q;  1RAF B;  4LDV A;  2F4I A;  3J81 j;  4LF8 L;  2GTO A;  2CRE A;  3UE1 A;  4NMZ A;  1I8F A;  2K32 A;  2AUK A;  4P72 A;  4HIM A;  5GAN 8;  1B7Y B;  4IFD H;  1CHQ D;  5JEA H;  1IBK L;  2JM9 A;  5GAO q;  1M1K R;  2DVJ A;  2X3W D;  4PV1 C;  3EN2 A;  5EBC A;  4C0D B;  3CCS T;  5GMK i;  2GVB A;  2FYK A;  3QB3 A;  2B2U C;  1BI1 A;  5A35 A;  3DLL A;  1MJE A;  3JB9 I;  1N27 A;  3L1A A;  3UDI A;  1GD7 A;  4E6R A;  5H1S E;  4TVR A;  5KND A;  3H6M A;  3CW2 C;  2RH2 A;  1ABO A;  3ZBD A;  4A3J G;  5FK9 C;  1K73 C;  5AFW A;  1EWI A;  1C8C A;  2EPB A;  3C0C A;  1XNR Q;  1L0W A;  3M9Q A;  1W2B A;  3KFU A;  2DBK A;  4DV5 L;  1C0A A;  4DAV A;  3G7L A;  1E24 A;  1O7L A;  1EFW A;  2FHD A;  1EOT A;  4CJ1 B;  5IGD A;  1Y96 B;  4RGN A;  5EPJ A;  1M4Z A;  1CKM A;  2F2V A;  1TS5 A;  1F2L A;  3CPF A;  2MHV A;  1PTO D;  3E9I A;  3PGZ A;  2KRM A;  1VQD A;  3OYA A;  1ZUK A;  2C5C A;  1JO8 A;  1C7Y A;  3S2H B;  3CC2 Q;  1V1P B;  3KLW A;  4JK1 C;  2QG9 B;  2YWW A;  1G51 A;  3PNW C;  1ZEQ X;  2ROT A;  3H3V I;  3KXT A;  1ILP A;  1YFN A;  2EBP A;  4A3J H;  4A3G G;  4O0A A;  4A93 G;  4JI1 Q;  2RDH A;  3H0I A;  2UUA L;  2JYO A;  1RUW A;  2JMC A;  3SHW A;  1V29 B;  1M1K U;  4A3J B;  2KRS A;  2DYI A;  2A08 A;  1WD0 A;  1OV3 A;  1Y96 A;  1KLG D;  1ABQ A;  3PIO 3;  4YTL A;  3OTO Q;  3I56 Q;  1XJV A;  2CP5 A;  2UU9 Q;  2BA0 A;  1C6V X;  4OF1 A;  3LX0 A;  4EQ5 A;  2XDB A;  1SMY C;  1QP2 A;  3SFM A;  4PJL A;  3E0J A;  2BE5 D;  1PFS A;  1MUZ A;  2IL8 A;  3AU7 A;  1V1P A;  1S40 A;  4HID A;  4P5N A;  1CZW A;  3DB3 A;  5FLX c;  2EZV A;  2LMJ A;  2E75 C;  3DWA A;  4XTC S;  3S15 B;  5D3D A;  4C56 C;  5I11 A;  2KBN A;  2OTL A;  4C92 F;  2EYP A;  1IGQ A;  2VVK A;  2WP8 J;  2X4W A;  2KQ3 A;  4DA2 A;  1DOM A;  1H9R A;  2LXK A;  2V1Q A;  2DZC A;  1PH8 A;  2OX7 A;  4A3G H;  2XU8 A;  1MIU A;  5COY A;  3FKI B;  2KAF A;  1WXB A;  4CKB A;  3ZL7 C;  3J7Z C;  4A3G B;  1A2T A;  4A93 B;  1GFD A;  4J9H A;  1GUN A;  1MV3 A;  3M0S A;  4HA8 A;  1EZ8 A;  5BN3 A;  2R3Z A;  3CEY A;  3RZO B;  1VQM Q;  3CMA A;  2ZXR A;  3HOU B;  1WTQ A;  2YLC A;  2F0J A;  3CC4 T;  4HKE A;  3D3R A;  4R4I A;  3C2P A;  3CRL C;  1A0N B;  1LTS D;  3EFR A;  3OHX C;  4X3K A;  4ZLT F;  3CCJ T;  5IGC A;  3PSI A;  1SYG A;  1AWJ A;  1Y57 A;  1VA7 A;  4JI7 Q;  2H3E B;  4MTN A;  2JN0 A;  1BCP F;  2FMC A;  2YDL A;  1VQO Q;  5A2Q E;  2QQA A;  1K8M A;  4QVZ A;  2YHT A;  2NBF A;  1CZG A;  3OS1 A;  3TQY A;  3OIP A;  2KEC A;  4J6W A;  5C0X H;  1S5C D;  2XDD A;  3PQI A;  4PFP A;  2ZAE A;  2DNU A;  3OPO A;  3GTO H;  3CCQ A;  2K50 A;  4AIM A;  2CFM A;  2NVT B;  1AEX A;  4OXP A;  1XPR A;  2V8K A;  1GUT A;  4FP5 D;  3E5S A;  1H8K A;  4HIK A;  1SRL A;  2L3S A;  5DEH A;  3JB9 G;  2PVO B;  2F0N A;  2EFI A;  3CU7 A;  2I5H A;  2ZCF B;  3H9N A;  1YJW Q;  1VQB A;  3KF8 B;  3AQQ A;  1BUV T;  5AJ3 Q;  4MMK A;  4Z9C B;  2EYL A;  3UAT A;  3Q8D A;  2VQF L;  2QXF A;  2E4H A;  1Q7Y U;  2B2Y C;  1KIK A;  4M75 C;  2E5Q A;  5FU7 C;  2A0F B;  3V05 A;  4DV7 L;  4QQB X;  3CME T;  4KKU A;  1KFZ A;  4B3M L;  3CCM A;  3M0R A;  1AH9 A;  1C4Q A;  3M9B A;  3RNU A;  1ZSG A;  1VQL T;  4KUI A;  1IGU A;  1ZLM A;  4B3T L;  1H64 1;  1KD1 R;  1HZB A;  1XNQ L;  4DBR A;  2PQE A;  5I9O A;  1G5V A;  2HT1 A;  1MMN A;  3RKX A;  2KRN A;  2LCL A;  1VQF A;  2NZ1 D;  4RTY A;  1M8V A;  1SBB B;  3GTL H;  1YIJ T;  2OAU A;  4QUF A;  4DUY Q;  3CD6 T;  5C5M A;  5GAO r;  4YCV A;  2K7A A;  5FLX E;  3OYI A;  1M9S A;  2K52 A;  5L37 A;  4R8I A;  3S17 B;  2DTI A;  3GTL B;  4J8O A;  1R77 A;  1NM7 A;  3RR5 A;  2K28 A;  3JCM g;  1ARK A;  2NUC A;  1PRT B;  4LFA L;  2DJZ A;  1A3T A;  5M3M G;  1OU9 A;  1JQQ A;  2GF7 A;  1TWA H;  2LT4 A;  2KSS A;  1WX6 A;  5GRO A;  3GTM H;  4KT0 E;  1P92 A;  3QWX X;  4FW2 A;  4D8K A;  1VQ4 Q;  1HZA A;  4A3I B;  1BIA A;  3H3V C;  3GTM B;  2LQN A;  3L2W A;  1ZYR C;  3F2B A;  1R9T H;  3RMQ A;  4FXK C;  3L2V A;  3MXP A;  2LFN A;  3G6E A;  1QVF S;  3MZ5 A;  1IZ6 A;  1M90 R;  2VXE A;  1OXU A;  2JN4 A;  2Z9H A;  4M7A C;  2EE1 A;  3F1Z A;  4A53 A;  2EPD A;  2YSQ A;  4RTU A;  2JXM B;  4Y52 H;  3ND8 A;  2R6G A;  4XK8 E;  2ATW A;  4EMH A;  1UGP B;  2NYS A;  4RG1 A;  3SE0 A;  3TZD A;  4DPG A;  2P4T A;  1BU1 A;  5NUC A;  2ZM6 Q;  4CRI A;  3M56 A;  4DV3 Q;  2CT3 A;  3S16 H;  4QY7 A;  4MZ9 A;  5M3M B;  4FM4 B;  2R5A A;  2DEU A;  4UC4 A;  1EY8 A;  4PMW A;  5KCH A;  3CPW P;  1S72 T;  1QZG A;  2VYT A;  1PC0 A;  3CCE T;  4DV6 L;  1D7Q A;  4K8I A;  2QQ9 A;  2MUY A;  5FJ8 H;  2DD4 A;  1B50 A;  1TH7 A;  1SRU A;  3S14 H;  2DJF C;  2KXC A;  3KOJ A;  2FRW A;  5D6W A;  4DAY A;  2QQR A;  2EW3 A;  4QMG A;  1XYI A;  2YRC A;  2VC8 A;  1W6J A;  4MIU A;  4F17 A;  1ZXT A;  2K7V A;  3LNN A;  3QR8 A;  4XAX B;  2ZPE B;  4OMM A;  2A5H A;  4OEM B;  1QVF A;  2LNH B;  5AT1 B;  1AZP A;  3M0U A;  4TKO B;  1WI7 A;  1GCQ C;  4OX9 L;  4PZ7 A;  5FRN A;  2YLB A;  4AFQ C;  4M7A D;  4PNO A;  1TS2 A;  2UXC L;  1U9R A;  3VYS A;  1PXU A;  3MHB A;  4GLV B;  3SK6 A;  1M90 U;  1Q81 C;  2Y0S G;  4UP7 A;  2HQH A;  1OXX K;  4CKC A;  4DXG A;  4C8Q G;  3NBH B;  1HNW Q;  5HY6 A;  1VQE A;  3ZFJ A;  3ULR B;  2NLU A;  5DLQ E;  2Z6B A;  4JI5 L;  2FMM A;  1LTT D;  4KJN A;  1LNX A;  4YY3 Q;  1VQK A;  1SSH A;  4GKJ Q;  4NPS A;  2Z0W A;  5FO9 B;  3HEJ A;  3PGG A;  3QXE B;  1KRS A;  4VUB A;  2J6F A;  4RCC A;  1BBU A;  2RMO A;  5GAN e;  4DR7 L;  1SYB A;  4A3L G;  3JV3 A;  1HD3 A;  4A3D G;  3ZEH A;  1Q46 A;  1RF2 D;  1GO3 E;  2OT2 A;  3T1H Q;  4QCL A;  4J6H A;  3PVQ A;  4JBJ A;  4KBM B;  2Y0S E;  1IBL L;  1YHQ Q;  4GZY C;  1OQK A;  2L5Q A;  4C8Q E;  1G2T A;  2P4R A;  1LTG D;  4OB1 B;  2R7Z B;  1FMW A;  5GAN 6;  1UFF A;  1MKH A;  2RQX A;  3JAM i;  3CCL A;  3N5B B;  5C4X G;  4WTO B;  3M4G A;  1K76 A;  1YJ9 Q;  2OTJ T;  3J81 i;  1Q8K A;  1GCQ A;  1U1S A;  3TQ7 P;  1LV9 A;  1T5X D;  1Y8N B;  5GAO m;  1RKN A;  2Y0S B;  3VS7 A;  4C8Q B;  4LDU A;  2B2T C;  2KYB A;  3Q24 A;  2WB1 G;  2J4X A;  4HVV A;  2EXZ A;  3EFX D;  2JA8 G;  5JJK A;  1A0I A;  4QVC A;  1KK7 A;  2DET A;  4B3S L;  3MFG A;  1U5S A;  4LNP A;  4M7D C;  2K03 A;  2XKO C;  3S24 A;  4A3L H;  3VYH B;  1X55 A;  4A3D H;  4UAI A;  1K1Z A;  3OYL A;  2SNS A;  5GMK h;  3E1S A;  2WAC A;  2VB3 X;  2ASB A;  3L7Z C;  2FZG B;  3MP8 A;  3QUI A;  1W2B P;  2MOX A;  2OQK A;  4NXN L;  4A3D B;  3G4S T;  1HZ9 A;  2AQ2 B;  4Z02 A;  3PUW A;  4X64 Q;  1PTO F;  1RTN A;  1SAP A;  4J9D A;  2O2L D;  1XMQ L;  2E3H A;  3A8J E;  4C8Q A;  5JVH 3;  1H95 A;  2YU9 B;  2F0G A;  2A7Y A;  1H9J A;  5DM7 3;  3J7A 5;  1TU0 B;  4DQ2 A;  3VKI A;  1JJ2 P;  1IXD A;  5C4X B;  1FL0 A;  1YI2 Q;  2PZT A;  3A8O B;  3HRT A;  4JRI A;  3NUC A;  1U4P A;  2VW9 A;  2CWA A;  4CDE C;  1N33 L;  1KQS S;  2JA8 H;  3MEV A;  2MIO A;  4QQG A;  4OEL B;  1HNZ L;  2WB1 B;  2JA8 B;  4K14 A;  2F1L A;  1UDL A;  2A68 D;  4DK3 C;  2UUB L;  2DRM A;  3SWN C;  3CCR T;  2JA7 B;  2NVY B;  3NP8 A;  4PLL A;  3JCM b;  2F2W A;  2M16 A;  2K5L A;  1A3U A;  1HJP A;  4RTW A;  2B2T A;  3VS6 A;  2XGT A;  1HYO A;  5JEA J;  3V96 A;  4F04 B;  2EQI A;  1XWE A;  4P73 A;  4Z8A A;  4R9W A;  5CC4 A;  3QHS A;  5LJ5 h;  5IGB A;  1WLP B;  3I91 A;  2HNI A;  3OB9 A;  4M77 D;  1AE2 A;  1CQF A;  2M9U A;  2AT1 B;  2HEQ A;  1Q1E A;  2FL7 A;  3EG1 A;  2KED A;  3RMS A;  2L3P A;  2NN6 G;  4XT1 B;  2F0S A;  2JMA A;  3KDF B;  1JQY D;  3SWN B;  3PF4 A;  2ZT9 C;  1N8R R;  2AWO A;  4DF7 A;  1HNX Q;  4KK7 A;  4IUV A;  1E22 A;  1F9P A;  1FNU A;  1NE3 A;  4Q5V A;  1OU8 A;  2PW5 A;  4DFA A;  2HQE A;  4MZP A;  2LVM A;  2QCP X;  1XMO Q;  2K1B A;  3S2D H;  1VQJ A;  1L2F A;  1XPU A;  1IKM A;  3JCM c;  4DOV A;  1KQS A;  2F0Q A;  4G7O C;  1NCV A;  4GLM A;  4JI3 L;  4GOP C;  1N34 Q;  2VKN A;  3FC3 A;  3HKZ E;  4B3M Q;  3M7N A;  3NGP A;  2PI2 A;  4BBS G;  1UTI A;  1F1B B;  2NUP B;  4YWM A;  2LC4 A;  2RQT A;  4C92 G;  3M5A A;  4MN3 A;  2DIG A;  4B3R L;  1VQ6 A;  3JRZ A;  4BE2 A;  2XN9 C;  3WOE A;  4II1 A;  3KDF A;  3UE0 A;  2ZTC A;  4MNO A;  3CXC P;  4AFS C;  4OHJ A;  3FB9 A;  2V4D A;  1F77 A;  1U4L A;  4O1N A;  1G29 1;  3BVM A;  1GJX A;  2NN6 H;  1VQI A;  1PD0 A;  3CCS Q;  1NEB A;  2QA4 T;  4A3K H;  4JG2 A;  3JAM c;  2D9T A;  3RKW A;  3QPH A;  4LDW A;  4GOP B;  4TQU S;  1VQ5 A;  3EQL C;  2E2D C;  2FFK B;  4C92 C;  4LUV A;  1G3W A;  5L23 A;  2OQ0 A;  2RSN A;  3EA6 A;  2F0K A;  1UGS B;  3M54 A;  3STB C;  2NUP A;  4F8M A;  1EFN A;  1B8A A;  1X43 A;  4PKC C;  1I6H H;  1HCZ A;  1LJO A;  4KY6 A;  4LFB Q;  4ZGJ B;  1V1C A;  2QQB A;  3R2T A;  2EYO A;  2DJG C;  4C5I A;  2JVV A;  1ILQ A;  1VS0 A;  1I6H B;  1B07 A;  5CV4 A;  4B6M A;  2E6N A;  1FJG Q;  2KRO A;  3VV0 A;  1LT4 D;  4PMB A;  2CZ0 B;  1EZZ B;  2LSS A;  4JI8 L;  1LTL A;  1OX9 A;  2NYZ D;  1VQ9 T;  4BBS B;  4H7B A;  3H0F A;  1N8R U;  4V19 0;  2XRS D;  1FX7 A;  2JA5 B;  4JPB W;  1VQ7 Q;  1EQV A;  3K0X A;  2EQU A;  4C92 B;  2RHQ B;  3MWY W;  4GOP A;  4KH1 B;  5IGG A;  4FNF A;  4WJ3 M;  1IW7 C;  2PNR C;  5LJ3 h;  3L2U A;  2W10 A;  3K0Y A;  4PJO D;  1SNP A;  1IL2 A;  2BH2 A;  4QIW B;  1YNJ D;  4C5G A;  1R4P B;  2MQH A;  2UXB L;  3HRS A;  2MK5 A;  3U58 A;  1FWZ A;  1WTV A;  2KR3 A;  1KL9 A;  3S1N B;  2K5Q A;  4CKE A;  1X6O A;  3VA7 A;  2E8G A;  5CV6 A;  1JRI A;  5J26 A;  2V8I A;  4PZ6 A;  2B63 G;  4JV5 Q;  5LMU L;  1P16 A;  2QEX T;  1O75 A;  3C12 A;  4LK1 C;  5ELE A;  1WFW A;  4DR2 L;  1LTB D;  3SEB A;  4C92 A;  3F2C A;  1Y71 A;  1T0J A;  3CC7 Q;  2KVQ G;  1G6P A;  1GOZ A;  4ZGE B;  1WCM G;  4LAA A;  4LF6 L;  3TP5 A;  2NVQ H;  2PQW A;  4C3J H;  1BCP B;  2G9D A;  5M9O A;  4DR3 L;  4EQP A;  1YJN Q;  5GAM e;  1I4P A;  3EAE A;  1XXG A;  1YHB A;  4CDF C;  5C3X A;  5KNB A;  2Q2I A;  2NVQ B;  1TXY A;  3S6W A;  3LH5 A;  5C0X J;  2KHJ A;  2DL3 A;  5GMK m;  4J1M A;  5IYB G;  1SNM A;  2E12 A;  4ZQ3 A;  4P71 A;  5JPM C;  1RAG B;  4M75 F;  2B2W A;  4RWS C;  1IHV A;  4JBW A;  1FXX A;  1M1G A;  2IT1 A;  5D65 A;  4OMO A;  1SE3 A;  1SE8 A;  3CC2 A;  1NMF A;  1T3S A;  3Q23 A;  2K01 A;  2GA4 B;  2B63 B;  1ICW A;  3AB9 A;  4LF7 L;  1O7Y A;  1IKL A;  1Q7Y C;  1PYS B;  3TCJ A;  3BYY B;  4H0L C;  1T9H A;  4UDU C;  1X6B A;  4JS4 A;  1S3O A;  3B6Y A;  4KKS A;  1BKB A;  2B86 A;  2L9H A;  4KTA A;  4DR4 L;  5K36 G;  2XVS A;  3DUZ A;  4DV0 L;  1WCM B;  3I56 A;  1SKU B;  2O88 A;  1QVG S;  4LXC A;  4F14 A;  4JS5 A;  3JAM E;  1LOJ A;  4G7Z C;  2A73 B;  2PW7 A;  4L8J A;  4R1J A;  3CCV Q;  5T1I A;  1TR5 A;  4JI2 L;  3GTQ H;  3M4O H;  1TUG B;  4DV4 L;  1WQ7 A;  1DJ7 B;  5I4D A;  1I94 L;  4IFD J;  3NQT A;  3HOX G;  5JJZ A;  2ATC B;  1JOK A;  4X66 Q;  2JT4 A;  4M78 G;  1J8I A;  4K2L A;  1AW7 A;  4IUP A;  4UPA A;  5I2S A;  4OGC A;  2VS1 A;  5CKF A;  1MI2 A;  1AFP A;  4P74 A;  2AZS A;  4FT2 A;  4FT4 A;  1U5K A;  3GD7 A;  2LX9 A;  3ULL A;  3OYD A;  1ZA2 B;  4R4Q A;  1OO9 B;  4B08 A;  1Y0M A;  4BD3 A;  2Q2H A;  2FIN B;  5K36 H;  4DR6 Q;  1JJC B;  3HPW A;  3HP9 A;  5CAI A;  2DL7 A;  2QF7 A;  3MXG A;  3NPP A;  2BKD N;  4BE0 A;  4M78 C;  4HCK A;  1CI3 M;  5CGK A;  1KAW A;  4M7A F;  2O4X B;  1WGS A;  2LJ0 A;  1VQM A;  3G71 Q;  1OI1 A;  1PFB A;  5C44 H;  5GAN 3;  3PIP 3;  1KJW A;  3A55 A;  1AWX A;  1BK2 A;  1ZUY A;  1HK9 A;  4P2C B;  1X3G A;  1QVG A;  3HOV G;  1GXI E;  3KYH C;  2CSQ A;  2F4V Q;  1VF5 C;  1YEZ A;  1QUQ B;  4OIK A;  3BY7 A;  4KGZ B;  3VS4 A;  3NE5 B;  3FHW A;  4DNT B;  1BDO A;  1QCN A;  1LCK A;  1VQL Q;  4I7A A;  1Y1W H;  3HOX B;  3LW5 E;  3MEU A;  1ACM B;  1X3P A;  3MP6 A;  3EGX B;  3LYI A;  4M78 B;  2EYH A;  1AEY A;  3GV3 A;  4G7H C;  1HR0 Q;  2RHX A;  2JEA I;  2KY9 A;  2VAS A;  2EJF C;  2FB7 A;  1L0Y B;  4J9G A;  1EY5 A;  2O4X A;  1IYV A;  5HGQ A;  4OO1 I;  5CK9 A;  1YIJ Q;  4JI0 L;  1H3Z A;  2JM8 A;  2EQK A;  2L89 A;  5CYU A;  7AT1 B;  3A5U A;  2RPN A;  2HDL A;  3HZX A;  3K5L A;  1I4Q A;  5CKD A;  1GM5 A;  2KVM A;  3EG0 A;  1QUQ A;  3X25 B;  3LH0 A;  4XU2 A;  3LGF A;  1D1I A;  3MXU A;  1JU5 C;  4YHH Q;  2E2H H;  1S5B D;  3GTK B;  3PUZ A;  1YJW A;  3SGI A;  3HOV H;  4DNR B;  3EGX A;  1EEI D;  3L2P A;  2F0P A;  1Y7X A;  2E2H B;  3ERQ A;  1X3E A;  1BI0 A;  2Z8L A;  2CSI A;  3HOV B;  1S4Z A;  4LFC L;  2NUT B;  4GLX A;  3LWU A;  4D8D A;  2N49 A;  5GAN f;  3Q0A A;  1QZH A;  1FMV A;  2OTL T;  1UWV A;  2RK1 A;  1D0Z A;  1PH5 A;  2SOB A;  1X32 A;  1VQH A;  1LAB A;  5CV9 A;  2VUM H;  4PZ8 A;  5CQX A;  4B9W A;  4ZK9 B;  4LD6 A;  3RLF A;  1E1T A;  1AP0 A;  4GKK Q;  2XID A;  3OA6 A;  3DEP A;  3PVL A;  5C3E H;  3NEN A;  2SDF A;  1JR0 D;  3NHH A;  4BY1 G;  1N9W A;  1NYG A;  3VR5 A;  1WD1 A;  1STN A;  3RLN A;  1PH4 A;  2E70 A;  2NUT A;  3CMA T;  3D0F A;  2M00 A;  1EUJ A;  1JBM A;  2IHF A;  3G7Z A;  3ICE A;  5D7U A;  1QWE A;  1SYD A;  4JYA Q;  9ATC B;  4R55 A;  4C3H H;  5C4Z A;  2Y4Y A;  3L42 A;  3URY A;  2XTI A;  3K8A A;  2F2X A;  2H3J A;  3OYJ A;  1BXT A;  1JMC A;  1X56 A;  5CV8 A;  3I4M H;  4BY7 G;  3PO2 B;  5FU6 B;  2SEB D;  1VQ4 A;  1UEB A;  1UEA B;  3W5O A;  1TWC B;  2NTS A;  4OB2 B;  4OIJ A;  4DV2 L;  2X3X D;  1FNW A;  2RI3 A;  4R4C A;  4E6I A;  5IWA Q;  2ZJP A;  4IPG A;  2VL6 A;  1K9M R;  4L5S A;  5CV7 A;  5LJ5 e;  3HOY G;  3CCQ T;  2PUK B;  5ELC A;  1D1B A;  4M7D F;  4BY1 H;  2K4K A;  4XTX A;  3T13 A;  1K83 H;  2F0F A;  3CQT A;  1ZUU A;  1Y8P B;  2WAQ G;  4HN7 A;  5E7N A;  3CBO A;  2HKQ B;  3M3Y H;  4L6V 5;  4N4H A;  4K0K L;  3OBW A;  1K83 B;  4OL7 A;  2KK4 A;  4X65 Q;  3J80 L;  1IBM Q;  1PTO C;  4X6A H;  2YV5 A;  1SFO H;  4E7K A;  1M2V B;  1UGV A;  3S1M B;  4MZM A;  1SFO B;  1DXM A;  1B34 A;  1UE5 A;  1WHM A;  2J05 A;  2B2V A;  3BE3 A;  2LX7 A;  3OYN A;  1EIY B;  4BY7 B;  2NUZ A;  4Y92 A;  3BU2 A;  3O13 A;  1J9O A;  3VUB A;  1CUK A;  1ET9 A;  2WAQ E;  1VQ8 Q;  3DXJ C;  2HDA A;  4L5T A;  3LGL A;  5C4J H;  1HA6 A;  1PTO B;  5BN5 A;  1KQS P;  1F2Z A;  1WPY A;  2FRY A;  1G2B A;  1Q82 R;  1DCZ A;  3HOY B;  4GN5 A;  2IPO B;  5C4J B;  4A4E A;  4HR7 B;  3I2Z A;  1LT6 D;  2BE5 C;  1STY A;  2HSE B;  4JI6 L;  2WAQ B;  3GTJ B;  1K8A R;  1KTK A;  2CZ1 B;  2KYM A;  1PH7 A;  2LRQ A;  4OO1 G;  1HPC A;  2R5M A;  1HUN A;  1K9M U;  2K14 A;  3K59 A;  1E0B A;  5KYY B;  3LGJ A;  3L2Z A;  5LJ3 g;  4FVM A;  5GAM d;  1HHV A;  1VIF A;  2OJ2 A;  3TP6 A;  3BFM A;  3R6O A;  1WJJ A;  3S2H H;  1MBY A;  2HZY A;  2F3V A;  2HBP A;  2VGN A;  1EIG A;  1K0S A;  3R93 A;  5C4H A;  2KCC A;  4KN4 C;  2UXD Q;  4X62 L;  4PJM A;  3H0G B;  4KI0 A;  4XU1 A;  4FSX A;  5IP7 G;  1BNZ A;  2DER A;  3FKI G;  2WFW A;  5M5W B;  2DD5 A;  1CTM A;  1SN8 A;  4GBQ A;  3MPU B;  2C06 A;  1TY2 A;  1MMA A;  2FO0 A;  1VQG A;  2A6H D;  2B2U A;  4Y28 E;  4N9P A;  4ME3 A;  3I4N G;  2KI7 A;  3LX7 A;  2DK3 A;  5KYY A;  2LCC A;  1PH3 A;  1EIF A;  3HOU G;  4LNQ A;  1X6G A;  2K75 A;  4JI4 L;  4C5H A;  4XIG S;  2DKG A;  3RKY A;  1YHQ A;  2R58 A;  1AE3 A;  3D31 A;  2UUC L;  1I50 B;  3P75 A;  2EYQ A;  3S15 H;  2BUD A;  5IT9 L;  1EY7 A;  5M5X B;  2B3G A;  5CMD A;  1W6K A;  4BI8 B;  1JOQ A;  5GAN j;  1DJR D;  1KNA A;  3X3M A;  1QE6 A;  4A3F G;  2K5I A;  1YJ9 A;  3T9N A;  1PHJ A;  4F7X A;  2OWO A;  3MCA B;  1CKB A;  4U67 3;  1RIP A;  5E4W C;  4LF8 Q;  1EFI D;  2VB2 X;  3TU4 K;  3VUZ A;  4J9F A;  2JW4 A;  2RHZ A;  2F0H A;  5IP7 H;  3FKI H;  1V1Q A;  1IBK Q;  5FWC A;  4A54 A;  2IHE A;  2V1C C;  2SNM A;  2AHJ B;  4A93 H;  2COY A;  1YCS B;  4BDZ A;  3TSS A;  2QKI C;  3I4N H;  3R2I A;  3NWT A;  1J3T A;  3RZO H;  4IUT A;  2K3B A;  2RD1 A;  4DR1 L;  1PSE A;  4PJN A;  4BDY A;  1RTO A;  3PUV A;  4JBK A;  3HOU H;  2MI6 A;  3I4N B;  1MMD A;  5A0D A;  2Q2U A;  2FG0 A;  2Y4X A;  3QO3 A;  3FDT A;  5ELF A;  4DV1 L;  1PVO A;  1D6E C;  2L4N A;  4ME5 A;  2IW3 A;  3K57 A;  1XQH A;  2LY7 A;  4ZGD B;  2NZH A;  2RQU A;  4ZN1 A;  4DV5 Q;  4KHP Q;  1M3B A;  2IPK D;  1JB0 E;  1J5E L;  1VCI A;  3K5M A;  1HR0 W;  1YI2 A;  4A4K A;  3FMC A;  4A3F B;  2L0A A;  1GUO A;  4ZRZ A;  5GAN 2;  1Y14 B;  1HH2 P;  1EY0 A;  2R61 A;  4PFZ A;  3AFQ A;  5GAM f;  1QCB D;  4C1N I;  1ZHI A;  4OGE A;  2RQR A;  1WQW A;  3WVD B;  1VQK T;  1PYW D;  2K33 A;  2NZO A;  3L3O C;  3LWE A;  4IUU A;  1C0M A;  2CH4 W;  2VY3 A;  4L63 B;  4M75 G;  3I35 A;  2IIM A;  1IL8 A;  5C5L A;  1OOT A;  2K57 A;  2J6O A;  4IOA A;  3PT9 A;  1I5F A;  2UUA Q;  4K5V A;  3SK8 A;  2QK0 A;  3D6W A;  4DUZ L;  1WJS A;  1MJC A;  3PIO A;  2F0U A;  3U4V A;  3CCL T;  2AMC B;  2D9U A;  2XWB B;  1QW1 A;  1WTP A;  2I5M X;  3SVM A;  3TS0 A;  1Q3L A;  3T53 B;  1ZBX A;  2EYM A;  2J0T D;  5CR3 A;  1VQN Q;  2F0D A;  3I55 T;  4A3I G;  2D0P A;  2VXF A;  1RI9 A;  4CC3 A;  2H4O A;  4UY8 C;  3BZD B;  3V7C A;  3JCM P;  2EYF A;  3OW2 S;  2MGS A;  3FPP A;  1PKS A;  4DA4 A;  5M3F G;  2W0Z A;  4HIO A;  1RAI B;  1B7T A;  1NPR A;  1STH A;  3I5R A;  1I3Q B;  3DM3 A;  1GFC A;  1WTH A;  1HXD A;  2VV5 A;  2KHI A;  4M75 B;  5FU7 B;  3S17 H;  5CV5 A;  2X4Y A;  5GAO l;  3JB9 H;  1QNU A;  3BYT B;  4ABN A;  1AZG B;  2DJQ A;  2ZPF B;  3FJ5 A;  1YNN D;  3PUX A;  1M8A A;  4D6W A;  4FO2 A;  5E3F A;  2K2M A;  3SR1 A;  3VDY A;  1RLQ C;  3CCS A;  4QB4 A;  3JCM J;  1F9R A;  2E10 A;  3OS5 A;  1QVG P;  3QG1 A;  1I4R A;  3TP7 A;  4CC7 A;  4J6Y A;  4A4F A;  3IL8 A;  1EWH A;  1SYE A;  1H9K A;  4GNX C;  2D5D A;  3A5Z B;  5CKH A;  3HTR A;  1WIE A;  3IFD A;  4M7A G;  5J22 A;  4A3I H;  1RHP A;  3KUP A;  3UWN A;  3J7Y W;  2JZ2 A;  2NWM A;  1SNQ A;  5CIU A;  2RHI A;  1VQC A;  2I5L X;  2B2Y A;  5GAO n;  4M75 A;  1KHI A;  4QT7 A;  2LKV A;  3G48 A;  1VDZ A;  3G6J B;  1K8O A;  2N8N A;  4O42 A;  3NQI A;  3U4Z A;  3I73 A;  1ENF A;  3X3N A;  3THK A;  2LJ1 A;  5M3F B;  4RKU E;  3OW2 A;  4RMO A;  1PCX A;  3E0E A;  3JCM e;  4RTV A;  3UA7 A;  4M78 F;  1VQ7 A;  4GNX B;  3FDR A;  5TSS A;  4JZ4 A;  2J7Z A;  3H3V H;  2ZPB B;  3G1J A;  2VXW A;  2VQE Q;  2BZY A;  4A76 A;  1WI5 A;  1DOK A;  4RFB A;  5M3M H;  2RCF A;  1KD1 U;  2PYK A;  3K5N A;  1CHP D;  1Q86 R;  3FJP A;  3NTK A;  4XTW A;  4Z89 A;  1VYV A;  3P8D A;  2VQF Q;  3TEE A;  3T1Y L;  4ANJ A;  2EVB A;  3M0P A;  4M7A B;  5FRM A;  1PRT D;  1ZQ1 A;  1MHN A;  2O2O A;  1TTH B;  3UT1 A;  2HHH L;  3K80 C;  3CC7 A;  2V1R A;  4NB3 A;  1SE2 A;  4JVZ A;  4KUD K;  2DN8 A;  1U4M A;  2COZ A;  1RJT A;  3CQZ H;  4IN3 A;  2ID0 A;  4B3T Q;  4XQQ A;  1VQ6 T;  3QYH B;  1YJN A;  3KBX A;  2EKH A;  3PTA A;  1XNQ Q;  1G83 A;  1QP3 A;  3CQZ B;  4KJO A;  4E7L A;  2R7Z G;  1CFM A;  2ZTE A;  1II3 A;  1B53 A;  2KT1 A;  1PRM C;  2ICE C;  1SPK A;  3OYB A;  5IH2 A;  4M7A A;  4WCI A;  2EJG C;  4WRD A;  1NUC A;  4AFU C;  1VQP T;  2DXC A;  1TWB A;  2V26 A;  3ER0 A;  2CW0 D;  1WFQ A;  1VQ5 T;  5GAM j;  5C6S A;  3MC0 B;  1GUG A;  3L2Q A;  4HMJ A;  4LFA Q;  2VGM A;  5FW9 A;  2BCO A;  4N0A C;  2D62 A;  1JWS D;  3K81 C;  1NJI R;  4HJ7 A;  5DAU A;  1BQQ T;  3MFY A;  4XTU A;  4L5Q A;  3NEL A;  2FJ2 A;  1N9S A;  4C0G A;  1PD1 A;  5EKK A;  3K7U C;  3OWF A;  1LPL A;  2HQX A;  5A0G A;  4BUG A;  2DXT A;  4LF4 L;  3M7G A;  5LMN L;  2R92 G;  3OYM A;  1WOC A;  1MNE A;  2IY5 B;  1DON A;  2DMO A;  1D5Z C;  3RD4 A;  1G6Z A;  2FVU A;  2ZJR A;  3CCU Q;  2EJM A;  2YUP A;  1IO6 A;  2R7Z H;  4JJC A;  1KC8 C;  1TWG B;  4H13 C;  2J06 A;  2XK0 A;  3CCV A;  4KMU C;  5DNF A;  1JWU D;  3EHQ A;  3NBH A;  1YVC A;  1ZKO A;  1I81 A;  2KEA A;  2R7D A;  5A0L A;  5LJ5 f;  3REA B;  4M7D G;  1YBY A;  3EHR A;  5LHY 1;  1RAB B;  3C1E A;  2RJC A;  2NB0 A;  3PMT A;  3TME A;  4LN2 A;  4TVA B;  2JJQ A;  1ESF A;  3SB2 A;  2A68 C;  2O01 E;  3VS2 A;  4FF3 A;  4K6L A;  1D0X A;  2RJD A;  1AZQ A;  5GJW B;  1G3Y A;  1AOJ A;  4JJB A;  3U23 A;  1K73 R;  2B8G A;  4BE1 A;  4HT8 A;  4DV6 Q;  2JA7 G;  1BCO A;  4LUE A;  1G8X A;  2YYZ A;  3BDC A;  1QCF A;  2I07 B;  2A28 A;  2DXU A;  4JDS A;  4X34 A;  4M77 C;  3V8K A;  1Q8I A;  1CA5 A;  5IN1 A;  2R92 B;  3CRK C;  3Q6S A;  2QDB A;  1SNC A;  3E9G A;  4M7D E;  3G71 A;  1A8V A;  3SXH A;  3RZD H;  2GFU A;  2YU9 H;  2XRQ D;  1XMO L;  2JP1 A;  1OUL A;  5C4X H;  1NG2 A;  3I4L A;  4XQN A;  4J83 A;  5A2Q L;  1TWF H;  3RZD B;  5IE8 A;  2CKZ B;  4K11 A;  1CKN B;  2LQW A;  2WB1 E;  1HZC A;  1UHF A;  4JRP A;  3A8K E;  4LUZ A;  4OX9 Q;  1TWF B;  1VQL A;  3E19 A;  4M7D B;  3KF6 B;  4I65 A;  2N55 A;  2HCI A;  1U3O A;  2UXC Q;  4KLK A;  4E7I A;  1UJY A;  4H02 A;  3CC2 T;  2BIV A;  2D8H A;  2JA7 H;  1GCP A;  4ATO A;  2DE0 X;  3EFO B;  2M1H A;  2AKL A;  3EG9 B;  2NVY H;  3WOF A;  2X4X A;  3TSZ A;  1PFM A;  1YIJ A;  1Q90 A;  2DM1 A;  1QOH A;  2PI2 E;  1WTX A;  3TRE A;  1WDX A;  1ASY A;  2JJ9 A;  3GTG B;  4O5V A;  1MGQ A;  2Z6K C;  4JI5 Q;  1UUP A;  1PNJ A;  1SSO A;  1K8G A;  2CH4 A;  1L1O C;  2JE6 I;  5I21 A;  4WJ4 A;  4J6X A;  4C8Q D;  1G8Z D;  4C3I B;  2EYY A;  4HXJ A;  3OS0 A;  1QJO A;  4RGO S;  3OSV A;  3KF6 A;  4M7D A;  4E7H A;  1BVS A;  4YCW A;  4DR7 Q;  1EZ6 A;  2A69 D;  4WOR A;  4HVU A;  2R7F A;  1F9S A;  2LTO A;  3MXN B;  1WXU A;  4IIM A;  4BI3 A;  4ELY C;  3H91 A;  4ZYS A;  2Z0S A;  1FJG L;  1TWH H;  1STB A;  2RNA A;  1HFG A;  4MHE A;  3EFO A;  3EG9 A;  5I2Y A;  1AT1 B;  1IBL Q;  3RER A;  1RAE B;  2HIX A;  5I6Y A;  4Y7N H;  3S1Q B;  1TWH B;  2YUO A;  1VOM A;  2RDG A;  2DA9 A;  1D1A A;  4JLG A;  4DU9 A;  1G3T A;  2E41 A;  1HXY D;  4PG3 A;  4P75 A;  4HCB A;  1FGU A;  4AYB G;  1B4O A;  1C1A A;  1Y07 A;  4Y7N B;  3FP9 A;  2PVG B;  2JSO A;  2PNH A;  2RF0 A;  1QQJ A;  1BI3 A;  1NLO C;  2AIR B;  2C0I A;  1ET6 A;  3TVT A;  3AFP A;  4DKA C;  5GAG C;  1T5E A;  1FMK A;  1VMP A;  3OQ5 A;  3AYH B;  4QUC A;  2XIW A;  4KN7 C;  2JA5 G;  4KHP L;  3GF5 A;  3S1R B;  2E6Z A;  1SHF A;  4PJO C;  1CSP A;  2DL4 A;  4B3S Q;  1VQM T;  1YNJ C;  1K0X A;  4IIO A;  3SWN A;  1U8R A;  2BDO A;  2Z6K A;  1UB4 A;  5G3L D;  2EY2 A;  4RGM A;  1LTA D;  2CP3 A;  1VUB A;  2OEO A;  1I5L A;  1WHH A;  4RG8 A;  2RQW A;  4NDX A;  4HJA A;  4RCN A;  2Z1C A;  4NXN Q;  3NFC A;  5IP9 G;  4MDW A;  4Q5W A;  2PZ1 A;  1M1K C;  4AQY L;  2E5L L;  2MYS A;  3OYE A;  4I7Z C;  3J81 c;  1XMQ Q;  1UAP A;  4HSP A;  1TU2 B;  2L2P A;  1OXT A;  1SR3 A;  4C92 E;  3FLG A;  2J6K A;  2KMT A;  4DBQ A;  4EMK C;  4AYB B;  3FRP B;  3AEV A;  2P0P A;  1KQ2 A;  3GDE A;  4BBS H;  3D7S B;  1I4X A;  2AKW B;  3A7L A;  3D4D A;  4QIW E;  2JA5 H;  1O7I A;  3KK7 A;  2ROL A;  4L59 A;  1YIT A;  3A8M B;  4WJW A;  3OOC A;  1IXR A;  1HNZ Q;  2KCT A;  2MWO A;  1M3A A;  1LYL A;  2GVA A;  2UUB Q;  4O2D A;  1BB9 A;  1NYF A;  2XHC A;  4A3M B;  3SK5 A;  3JCM d;  5LJ5 j;  1YJW T;  4CDC C;  2XNA C;  2KCN A;  5JOB A;  4LUD A;  3MVV A;  3S1N H;  4N8X 1;  1TOV A;  3A8G B;  2O9S A;  2WSC E;  4C2M H;  3DWP A;  4RAU C;  2JQO A;  1HSQ A;  1U4R A;  2PCF B;  2G6F X;  4OMF B;  5CKE A;  3MJX A;  4C2M B;  3MEH A;  2R93 G;  4UHV A;  3OSO A;  2XG8 D;  3P7J A;  1ZSZ C;  1K9A A;  3GP7 A;  1X3Q A;  2MO1 A;  3UI2 A;  1VQ8 A;  4WFN 3;  4ZKB B;  1JB7 A;  1RCV D;  3C95 A;  4F16 A;  2D8J A;  1EX4 A;  1D1C A;  2L3Q A;  5L8R E;  3T4A C;  3V8L A;  4A3B G;  2JA6 B;  1UE7 A;  4FL6 A;  1ASZ A;  1WHK A;  1BCM A;  3A8L B;  1BI2 A;  1EWC A;  3HGB A;  3K6O A;  5ELD A;  4X66 L;  2K5V A;  3GIB A;  2DYB A;  1WTO A;  2F5T X;  4OMQ A;  3ERO A;  3BS1 A;  2H8H A;  2DPP B;  4JRK A;  5FO8 B;  5JJL A;  5EPK A;  3T16 A;  5CBA E;  2IX0 A;  1M2O A;  4B3R Q;  1NSN S;  2RI2 A;  2FZK B;  3EVQ A;  4K6D A;  1OEB A;  4CC2 A;  1SJH D;  2E3I A;  5KCO A;  1FVI A;  2HL3 A;  2AKK A;  3QSU A;  1N5Z A;  4BXX G;  3FVQ A;  5KYU B;  2B63 H;  1MSG A;  1VQ4 T;  4IUQ A;  1UE6 A;  1PZJ D;  2R93 B;  3QOL A;  4APV A;  4HSV A;  4HVW A;  3F2U A;  3VYG A;  1O78 A;  1I6V C;  4QF4 A;  4DGZ A;  1NBE B;  5CVI A;  3LWI A;  4C5E A;  4A3B H;  2XD0 A;  1MV0 B;  2HCK A;  3H94 A;  4BI4 A;  1K3B C;  1WCM H;  1YN8 A;  1KDC A;  2G5D A;  2WKC A;  2I0Q A;  1HQM C;  4DBF A;  3CC4 Q;  4AG1 C;  3GPL A;  3PMF A;  2HDM A;  2KEN A;  4XT3 B;  4NXM L;  3OW2 P;  1TUD A;  2O5J C;  1ZA1 B;  4FYV B;  5GAO p;  1SDF A;  4NP5 A;  5BR8 L;  3CCJ Q;  3UPU A;  1I1J A;  4JI8 Q;  1OZ2 A;  5GAN 7;  5KRU A;  4ZTJ A;  1KLU D;  1BR9 A;  2I0N A;  5GAN d;  4PFO A;  5KYU A;  2YTV A;  3O5Z A;  1EEF D;  3J81 E;  4HCE A;  5IYB H;  2Y90 A;  4E2F B;  3X24 B;  3I9Q A;  2WV6 D;  1BCP D;  3JCM f;  1D3B B;  1OPL A;  2LS0 1;  1EU3 A;  3RNJ A;  3JB9 J;  1DOL A;  5FWB A;  2L11 A;  3DM1 A;  2DXB A;  2QTX A;  2AQ3 B;  4PL6 A;  3BJU A;  1SRO A;  3UDF A;  4ALP A;  2WII B;  2ICI A;  5EBD A;  2MPX C;  4H44 C;  2LDM A;  2L8D A;  4MTK A;  3K7A B;  3GTP B;  4IFD I;  2JS0 A;  1N6A A;  1N32 Q;  3VU3 C;  3SK4 A;  3DB4 A;  5JVG 3;  5JAV A;  1NAP A;  1RAD B;  4MZT A;  4Y91 A;  4OON A;  3QII A;  5M5Y B;  3OS2 A;  3PFS A;  4ZN3 A;  4M78 E;  2K4Y A;  2KEE A;  1D3B A;  1QVF P;  4TRD A;  3CME Q;  1N9R A;  4LF6 Q;  2ENM A;  1HTP A;  1KG1 A;  4F87 A;  4LF9 L;  2JTM A;  3I8Z A;  1Q81 R;  3I55 Q;  4DR3 Q;  3HOX H;  2M2L A;  2K79 A;  2PQA B;  1M3C A;  2HAX A;  3NXW A;  3NMZ C;  2HL5 C;  3IKJ A;  1CKO A;  3GOX A;  2A3L A;  5I6W A;  1WA7 A;  3HRZ C;  4S3S A;  3VR6 A;  4FIB A;  4YWL A;  3VS5 A;  2L0C A;  1VQO A;  2YTY A;  3P1H A;  1LAC A;  1SYC A;  4CBV A;  3HSB A;  1LTR D;  3UDX A;  2DVE A;  4OB0 B;  2BH8 A;  1LLR D;  1IB8 A;  1KD1 C;  1AD5 A;  5CCA A;  4J9C A;  1E7O A;  3CD6 Q;  4A3E B;  1QIL A;  5KIX A;  5KYL A;  2PMZ B;  4DR5 L;  5LMN W;  4LF7 Q;  3GTK H;  2QGF B;  1LT5 D;  2PQA A;  3P8H A;  4CI0 C;  4FF1 A;  2MWP A;  2HUG A;  4UP9 A;  1PSF A;  2ZPH B;  1AZE A;  4DR4 Q;  1YHQ T;  1P8L A;  3KLS A;  5D3I B;  4DV0 Q;  4M78 A;  5EPL A;  4LF5 L;  4HJ9 A;  4R4T A;  4OP0 A;  3EH2 A;  3PO2 G;  4MDX A;  1WXT A;  4X3S A;  1YJ9 T;  2LXJ A;  4JI2 Q;  1DYQ A;  3W1B A;  4DV4 Q;  2K5D A;  1VQN A;  5IIF A;  1I94 Q;  1EYA A;  3TBI B;  2YT6 A;  4DOW A;  2DGY A;  1M27 C;  4NL3 A;  2XIC A;  5EG2 A;  2WSF E;  2N88 A;  3EGD B;  4HED A;  2DFU A;  3KUF A;  1PV4 A;  1XNI A;  1N36 L;  5GMK e;  1I0C A;  3RBB B;  1GBR A;  2K9G A;  2DTH A;  1M90 C;  2BTT A;  2C0O A;  2DIL A;  2EJF A;  3V8J A;  3HFO A;  4DEY A;  1F2Y A;  2DBM A;  1TQO A;  2OCE A;  4KY5 A;  1UUE A;  2X6L A;  2ES2 A;  1H9S B;  2F5K A;  3D8G A;  3M4P A;  2QIL A;  4XQJ A;  3MEF A;  1S72 Q;  2GBQ A;  1PDQ A;  1TT2 A;  2GN5 A;  3CCE Q;  2B39 A;  3PO2 H;  3EGD A;  5IXB A;  3E9F A;  1TWC H;  1B70 B;  1W3S A;  1YI2 T;  4JLI A;  1NR2 A;  2GTJ A;  4IAL A;  3CAM A;  1XNR L;  1RL2 A;  3Q1J A;  4LDY A;  1KAB A;  5IYC G;  5FOB B;  1YNZ A;  1BYM A;  2YRD A;  1KNE A;  3VS3 A;  1H9S A;  1D8L A;  1EYC A;  3MHX A;  1U0L A;  2A6E D;  1EL0 A;  2IX3 A;  5I2M A;  1MGS A;  4QGU A;  3PF5 A;  4JRQ A;  4M77 F;  2CCZ A;  4FF4 A;  1CSQ A;  4JI0 Q;  1X69 A;  3QKJ A;  1JXM A;  2QTV A;  2CQO A;  1VQP Q;  1JWM D;  1NLP C;  4A4G A;  3SD4 A;  5C0X I;  4NL2 A;  5CQY A;  2L55 A;  3S1M H;  4AMC A;  4IFD G;  1W1F A;  3PCO B;  4POF A;  5JEA G;  3WWV A;  5ELN A;  1YHA A;  2K5F A;  3QOJ A;  2E76 C;  2RDF A;  3KLS X;  4ELZ C;  5IYD G;  1B3A A;  2IVW A;  3GNG A;  4JI1 L;  4IJL A;  4BY7 H;  1PZK D;  3S3N A;  3OSS C;  2JTE A;  4OMP A;  1NNX A;  3OY9 A;  3H0G G;  4KHV A;  3F70 A;  3UDC A;  1GHJ A;  3A56 A;  3HFN A;  4AH6 A;  4DAM A;  5IYC H;  3OTO L;  4J9E A;  1YWP A;  1PTO H;  2A6H C;  2UU9 L;  3CCM T;  4LFC Q;  2GGR A;  3RUZ A;  5GQO A;  1IHZ A;  3HOY H;  1U1T A;  5I22 A;  2B8A A;  3OYG A;  1RAA B;  3QZ9 B;  3N6R A;  3ITP A;  1JJ2 S;  4E47 A;  2E5K A;  2CQA A;  1VMC A;  4IO9 A;  3GTJ H;  5G3L F;  1E2V A;  1M2V A;  2E2I B;  2BZ8 A;  2QW7 A;  5KEE A;  2L1B A;  5IOC A;  1SEB D;  4RTZ A;  2ZXP A;  2VZA A;  1Y1V G;  2OTJ Q;  1A3V A;  2RA2 A;  2EKO A;  3VS1 A;  1W4S A;  5CBE E;  3K5O A;  5IYD H;  5J3B A;  2EYZ A;  3T56 B;  4F7U F;  3HKS A;  2X6G A;  2CUD A;  4EMG A;  1S5F D;  3DMU A;  3EFS A;  3EG2 A;  1HJD A;  4HMI A;  1EU4 A;  1H92 A;  2L5T A;  1YZ6 A;  3H0G H;  4XYQ A;  4J5Y A;  1GUW A;  4G57 A;  2AWN A;  3I5S A;  1RLP C;  4IPC A;  4XDX A;  2EQS A;  3L2R A;  3UF4 A;  5M5W H;  2EWN A;  1BIB A;  4LDX A;  1MHW C;  2ESW A;  2WSE E;  2VNU D;  1LM0 A;  3NWS A;  4RGT A;  4DV2 Q;  2E2J H;  4QW2 A;  3JAM L;  1G91 A;  2EXD A;  1M8M A;  2ED1 A;  5AYF A;  2JA9 A;  4YCU A;  5EGT A;  2HKN A;  3NBI A;  2F03 A;  1G3S A;  3G6E T;  3G4S Q;  1DGS A;  2JUF A;  3J81 L;  1Q95 G;  2E2J B;  4JI7 L;  1ML0 D;  1W6X A;  2DX1 A;  5LJ3 e;  3CCU A;  2BE9 B;  1I50 H;  4N4I A;  3OMC A;  4PJO F;  1VQ7 T;  4DXF A;  2X51 A;  1DZ1 A;  1JJ2 A;  1Y1V H;  4ULL A;  5M5X H;  1M5Q 1;  4OO1 H;  3PE0 A;  5KE2 A;  3GP8 A;  4XTV A;  1IRE B;  4YWK A;  1Y1V B;  2D0Q B;  3M0T A;  5CKB A;  5KYW B;  1X75 C;  2GFA A;  1OZ3 A;  4RUG A;  1EY6 A;  1Q82 U;  4JZ3 A;  1GUS A;  1OXV A;  2K5H A;  4K0K Q;  4KY7 A;  4RKB A;  1X2K A;  3J7A F;  3VA5 A;  5COR A;  2MFI A;  2ALY B;  4PNY A;  4QQD A;  1WHG A;  4U68 A;  1BF4 A;  2GCX A;  3CCR Q;  3CXC S;  1K8A U;  1HUM A;  2VWF A;  1GL5 A;  4BBR G;  1KXL A;  2EAY A;  1TVX A;  4JOI C;  2P84 A;  3P8B B;  5GJV B;  2RF4 A;  5AJ3 L;  1UGQ B;  4XTZ A;  1WTR A;  3M59 A;  3CC7 T;  3RIR A;  4R8N A;  3D4R A;  5KYW A;  3U9S A;  1KSW A;  4PK4 A;  2EDG A;  2PZU A;  4IKF A;  3H0H A;  3TN2 A;  1B2T A;  1YJN T;  5KNC A;  3ND9 A;  4IZ8 A;  4FYY B;  5IHN A;  3KJP A;  1NY4 A;  1WYD A;  1QWF A;  1X2Q A;  2K3X A;  2KE9 A;  4A3B B;  1CSK A;  2DZ9 A;  4A3F H;  2FZC B;  4JI6 Q;  4FCY A;  3Q22 A;  4KD4 A;  3SDZ A;  2MJ8 A;  1JE4 A;  1N8R C;  3JCM Q;  4CJ0 B;  2PVD B;  3VR3 A;  1D1K A;  3VYU A;  1CK1 A;  5C0X G;  2F0T A;  4BBR H;  4DUY L;  2JXB A;  1IYU A;  2KOL A;  1Q7Y R;  1UNS A;  2K5W A;  2DL5 A;  2KBT A;  2D0N A;  4M1U B;  4BBR B;  4GLA C;  1HA5 A;  1WTW A;  4X62 Q;  3CXC A;  5ISR A;  3R6N A;  2SRC A;  2EGA A;  2CWP A;  1YNN C;  1LVK A;  2FHT A;  1SMX A;  3REB B;  5EC7 A;  2LJ3 A;  3NPF A;  1BBW A;  1UGR B;  2JTF A;  1QMC A;  1EQR A;  1V9P A;  2JK8 A;  4JOI A;  3U50 C;  2CHB D;  1TII D;  3HG9 A;  2ZXO A;  4FYD A;  2QA4 Q;  1SHG A;  3IFT A;  1SMY D;  3I3C A;  3HHT B;  4ZNX A;  3CCV T;  4N9T A;  1Y8O B;  4OML A;  3X26 B;  1A6X A;  1D5M C;  1O80 A;  4HJ8 A;  4JI4 Q;  2CP7 A;  4BS9 A;  1RAH B;  3KF8 A;  2UUC Q;  2D0O A;  1KAA A;  3DKM A;  2YUN A;  2XWJ B;  1NZ9 A;  4KV6 A;  4O6J A;  2F0I A;  4M75 E;  1TXQ A;  4R4O A;  4CGY B;  3BDU A;  2MAM A;  2PNI A;  2VQE L;  4BAC A;  2I2L A;  1VQ9 Q;  1QVC A;  5FO7 B;  3GBQ A;  2AZV A;  1E1O A;  3FRN A;  3GTO B;  1I3Q H;  4PQX A;  2ZM6 L;  1QVP A;  1X01 A;  1AWW A;  4RG2 A;  5KH6 A;  2LT1 A;  1WHJ A;  4FSS A;  2F0W A;  2L15 A;  4DV3 L;  2DAQ A;  1NR4 A;  3HFZ B;  4AG2 C;  1A63 A;  4J9B A;  1HTL D;  3RMH A;  4GN3 B;  3G71 T; 
#chains in the Genus database with same CATH homology
 1SRM A;  1ZX6 A;  1JEG A;  2FPF A;  4RTX A;  4DEX A;  4LE9 A;  1U3O A;  1X6B A;  2HSP A;  1UJY A;  2B86 A;  2D8H A;  1GCP A;  2GTO A;  2CRE A;  2DE0 X;  2AKL A;  2O88 A;  3TSZ A;  4F14 A;  2DM1 A;  1WDX A;  2JM9 A;  2DVJ A;  2X3W D;  3TSW A;  1CKA A;  1PNJ A;  3KFV A;  2CH4 A;  2EYY A;  4HXJ A;  4E6R A;  2ABL A;  2JT4 A;  4HVU A;  1ABO A;  1WXU A;  4IIM A;  2AZS A;  3C0C A;  2RNA A;  2EYX A;  4ORZ A;  2DBK A;  2GNC A;  1Y0M A;  2FPE A;  2YUO A;  4JJD A;  2A36 A;  2DA9 A;  2DL7 A;  4HCK A;  2KT8 A;  2RF0 A;  2LJ0 A;  2F2V A;  1NLO C;  2C0I A;  3TVT A;  1KJW A;  1FMK A;  2KRM A;  4J9I A;  1ZUK A;  1BK2 A;  1AWX A;  1JO8 A;  1ZUY A;  1SHF A;  2CSQ A;  2DL4 A;  1UJ0 A;  2ROT A;  4IIO A;  3VS4 A;  3M0Q A;  1K0X A;  1LCK A;  2EBP A;  1PKT A;  3H0I A;  1AEY A;  2LZ6 B;  2RQW A;  1RUW A;  2JMC A;  2MCN A;  3SHW A;  4J9G A;  2KRS A;  2A08 A;  1OV3 A;  2PZ1 A;  1ABQ A;  2JM8 A;  2RPN A;  2L2P A;  1MUZ A;  1AVZ C;  2J6K A;  3EG0 A;  2LMJ A;  2CDT A;  3QWY A;  1JU5 C;  1I07 A;  5I11 A;  2M51 A;  2FEI A;  2ROL A;  4OMN A;  2LP5 A;  2VVK A;  3NHN A;  2CSI A;  1M3A A;  1XOV A;  2V1Q A;  1BB9 A;  1NYF A;  2BZX A;  4K11 A;  4D8D A;  1WXB A;  1GRI A;  4LUD A;  3ZL7 C;  2C0T A;  1QLY A;  1GFD A;  4J9H A;  2O9S A;  1MV3 A;  3M0S A;  4ESR A;  1HSQ A;  2G6F X;  1JXO A;  3PVL A;  4CC4 B;  5IHK A;  1K9A A;  4RTT A;  1A0N B;  1NYG A;  4AFZ C;  4F16 A;  2D8J A;  2L3Q A;  1AWJ A;  1Y57 A;  4KRT A;  1VA7 A;  1H3H A;  2YDL A;  1QWE A;  1ZBJ A;  2DYB A;  2DLP A;  4OMQ A;  2H8H A;  4R0K A;  2F2X A;  2DNU A;  2X3X D;  3SEM A;  1OEB A;  4CC2 A;  2AKK A;  1H8K A;  1N5Z A;  1SRL A;  2L3S A;  4HVW A;  3UAT A;  3CQT A;  1ZUU A;  1KIK A;  1MV0 B;  2ECZ A;  2HCK A;  1Z9Z A;  1KFZ A;  1YN8 A;  4Z88 A;  4AG1 C;  1VYT A;  1TUD A;  3EGU A;  3M0R A;  2OAW A;  1UGV A;  1ZSG A;  1I1J A;  1ZLM A;  2J05 A;  2I0N A;  2LX7 A;  3O5Z A;  2NUZ A;  4Y92 A;  2KRN A;  1TG0 A;  3I9Q A;  4RTY A;  2HDA A;  1YP5 A;  1OPL A;  2K7A A;  2ED0 A;  2FRY A;  3RNJ A;  1G2B A;  5FWB A;  1NM7 A;  1M30 A;  1ARK A;  1Z9Q A;  1JQQ A;  1TUC A;  2AK5 A;  2JS0 A;  2KYM A;  1WX6 A;  3QWX X;  4D8K A;  2OJ2 A;  2LQN A;  5IXF A;  2ENM A;  1K0S A;  2K79 A;  1M3C A;  3H41 A;  3NMZ C;  2EPD A;  2YSQ A;  1WA7 A;  4RTU A;  1AWO A;  4GBQ A;  2FO0 A;  3VS5 A;  1BU1 A;  1X6G A;  5IHI A;  2CT3 A;  1AD5 A;  1U06 A;  2KNB B;  4J9C A;  2CUB A;  1E7O A;  2A37 A;  3IQL A;  2KXC A;  2FRW A;  2EW3 A;  1AZE A;  2CT4 A;  1B3Q A;  1CKB A;  4J9F A;  2JW4 A;  4F17 A;  1T0H A;  4OMM A;  5FWC A;  1WXT A;  2LNH B;  1YCS B;  3M0U A;  1QKX A;  1WI7 A;  1GCQ C;  2KXD A;  2YT6 A;  2RN8 A;  1J3T A;  2K3B A;  1M27 C;  4AFQ C;  2FG0 A;  1I0C A;  3RBB B;  1PRL C;  2K9G A;  1GBR A;  2BTT A;  2C0O A;  2DIL A;  2J7I A;  3VRY A;  4A63 B;  4DEY A;  2DBM A;  2EYW A;  3ULR B;  2RQU A;  1UUE A;  1M3B A;  1K4U S;  1SSH A;  2L0A A;  1OPK A;  2GBQ A;  2J6F A;  2RMO A;  5IXB A;  3JV3 A;  1HD3 A;  3EG3 A;  2RQR A;  3PVQ A;  2GTJ A;  2CH4 W;  2P4R A;  2DRK A;  2GQI A;  1YNZ A;  1UFF A;  3I35 A;  2IIM A;  2D1X A;  1OOT A;  1K76 A;  1T3L A;  2J6O A;  3VS3 A;  1GCQ A;  1NEG A;  3VS7 A;  2KYB A;  1X69 A;  1JXM A;  4HVV A;  1NLP C;  1U5S A;  1W1F A;  4LNP A;  1RI9 A;  4CC3 A;  1K1Z A;  1E6H A;  1PKS A;  2JTE A;  4OMP A;  2MOX A;  1E6G A;  2K6D A;  2W0Z A;  4J9E A;  3I5R A;  1YWP A;  4J9D A;  1GFC A;  2GGR A;  5HCK A;  1YWO A;  1AZG B;  2DJQ A;  1BBZ A;  3FJ5 A;  5I22 A;  2LCS A;  2K2M A;  1X27 A;  2E5K A;  1RLQ C;  2MIO A;  1GBQ A;  4CC7 A;  2BZ8 A;  4RTZ A;  1WIE A;  1UDL A;  3VS1 A;  2DRM A;  2SEM A;  2EYZ A;  2F2W A;  2NWM A;  4RTW A;  2CUD A;  3VS6 A;  3EG2 A;  1HJD A;  2EQI A;  4QT7 A;  1H92 A;  4Z8A A;  3UA6 A;  1WLP B;  3I5S A;  1RLP C;  3THK A;  2LJ1 A;  3UF4 A;  2HEQ A;  2JS2 A;  4RTV A;  2ESW A;  3EG1 A;  3UA7 A;  2L3P A;  1WYX A;  2JMA A;  4JZ4 A;  4EIK A;  1M8M A;  2ED1 A;  1PWT A;  2BZY A;  1UHC A;  2EGC A;  1W6X A;  2DX1 A;  3A98 A;  2OI3 A;  3PE0 A;  4GLM A;  4Z89 A;  2VKN A;  1UEC A;  1VYV A;  1UG1 A;  3NGP A;  1UTI A;  2O31 A;  3M0T A;  3M0P A;  4RUG A;  2RQT A;  4JZ3 A;  2O2O A;  1X2K A;  2FPD A;  2V1R A;  4AFS C;  2O9V A;  2DL8 A;  4M4Z A;  2VWF A;  1GL5 A;  1NEB A;  5GJV B;  1FYN A;  1QKW A;  2EKH A;  1G83 A;  2EVR A;  5L23 A;  1SEM A;  2KT1 A;  1PRM C;  1SPK A;  1EFN A;  1KSW A;  1X43 A;  4WCI A;  5IH2 A;  3H0H A;  4AFU C;  1V1C A;  2KGT A;  2DF6 A;  1B07 A;  4X1V A;  5IHN A;  2KRO A;  2M0Y A;  5FW9 A;  1S1N A;  1QWF A;  2KE9 A;  1X2Q A;  2XMF A;  1CSK A;  1VYU A;  3H0F A;  4JPB W;  2EGE A;  2W10 A;  2DMO A;  2JXB A;  3VRZ A;  2DL5 A;  2KBT A;  2D0N A;  2YUP A;  1IO6 A;  2KR3 A;  4JJC A;  3R6N A;  2SRC A;  2EGA A;  2J06 A;  5ECA A;  2HBW A;  3REB B;  5EC7 A;  2LJ3 A;  2YUQ A;  3EHQ A;  3NPF A;  2KEA A;  3REA B;  3EHR A;  1SHG A;  1WFW A;  4LN2 A;  1T0J A;  4ZNX A;  4OML A;  1UE9 A;  3VS2 A;  5GJW B;  3VS0 A;  2YUN A;  1AOJ A;  2QDL A;  4JJB A;  3U23 A;  1W70 A;  4LUE A;  2RQV A;  1QCF A;  2A28 A;  3LH5 A;  2DL3 A;  2PNI A;  3GBQ A;  2AZV A;  2PTK A;  1AWW A;  4FSS A;  1NG2 A;  4OMO A;  4AG2 C;  1T3S A;  4J9B A;  2LQW A;  1PHT A;  1UHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...