1JJ2P

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1jj2P00
1K9MR 3G4SQ 3I55Q 3CCUQ 1Q81R 1M1KR 1K73R 1VQ8Q 1W2BP 1JJ2P 3CC2Q 3CPWP 3CCEQ 1Q7YR 3OW2P 3CMAQ 1QVGP 1K8AR 1VQNQ 1M90R 1VQ5Q 3CCVQ 1NJIR 2OTLQ 3I56Q 1N8RR 2OTJQ 1S72Q 1Q86R 3CC4Q 1VQOQ 1YI2Q 3CCQQ 1VQLQ 2QEXQ 3CXCP 3CCJQ 1KD1R 3CCLQ 3G6EQ 1VQ6Q 3CCSQ 1YJWQ 3CD6Q 3CCRQ 3CC7Q 1YIJQ 1KC8R 1Q82R 1YJNQ 1QVFP 2QA4Q 1VQ7Q 1YITQ 3CMEQ 3CCMQ 1VQKQ 1VQPQ 1VQ9Q 3G71Q 1YJ9Q 1VQ4Q 1VQMQ 1KQSP 1YHQQ
chains in the Genus database with same CATH superfamily
2ZZDA 3UF4A 2FVUA 1VQKT 4JLIA 1IREB 4R55A 3S3MA 4XTUA 3R6NA 2EPDA 2KE9A 4ELZC 1T3SA 3URGA 2O9SA 1MGQA 1QCOA 3HFOA 4KGXB 3HSBA 3QHSA 2P0KA 2E65A 1YITA 1UJ0A 2DAQA 2XICA 1XTDA 1UGRB 3OYYA 1WNLA 3FJ5A 3CMAT 2E70A 4BE2A 3J7AF 4QW2A 2FYKA 1PHTA 3M4YA 3L2WA 4AFZC 2Z0WA 2D6FA 2M9UA 5FU7C 5GMKl 3MP8A 3CCMT 4OP0A 1M2VB 4C5IA 2VXFA 2FPDA 2JJ9A 4YTLA 2CUBA 3VS4A 2KRSA 3A8HB 3PE0A 1QCFA 2FO0A 1B34A 1KSWA 4M77G 3ZFJA 4PL6A 5HCKA 1RLQC 3O8VA 4M78C 1IHWA 1K8AC 3E9GA 1QP3A 1Q86C 2C0TA 4J9IA 1D0XA 3QZ5B 4CC4B 1YITT 4HT9A 3CCSA 4M75D 4J9FA 1WQWA 3GNGA 3EGXB 1QVFS 2CH4W 3QJ6A 4FT2A 4MZMA 3VRYA 4PJOA 5CQYA 4D8DA 5GAOq 1YI2T 1T0HA 2LQNA 2JS2A 5GAN5 5EG2A 5J3BA 1BBZA 3CCVT 1Y96A 2QTVA 2KR3A 3VU3C 2HKNA 4A4HA 4C0ZA 5GAOp 4NS5A 1G3TA 3OQ5A 2JT4A 2L3RA 3MEAA 2L89A 1VQ5A 5GJVB 1I4K1 3CPFA 3CMAQ 1Q7YR 2VUBA 3CCET 5EC7A 1DJ7B 4ZGEB 1WHJA 3AHUA 3OW2A 4UC4A 3JCMf 1VIFA 8AT1B 1UEBA 2PZ1A 2YUNA 1PKSA 2ENMA 4M77D 1HYOA 2CP2A 1ZSGA 2GFUA 3VUZA 4ESRA 3PNWC 2EAYA 4IUTA 1UHFA 5GANd 2QASA 3MEUA 2FZKB 2ZPHB 4DEXA 3A8LB 4F7UA 2DTIA 4DEYA 1VQLA 4B9XA 1XNIA 1QQJA 1ABQA 2K79A 1VQ8A 3HRSA 5LJ3g 1ZUYA 2RHYA 1FWZA 3BY7A 1QVGA 5GAOn 5M9OA 2IIMA 2RNAA 3OYIA 3VS3A 1QKWA 4J9CA 1AZEA 4WTOB 3MP6A 2DETA 2DZCA 1NJIU 2YRVA 5HK0A 4F7UF 1FMWA 2LCSA 1PKTA 1UGVA 3SDZA 2LMJA 2JMCA 2A3LA 2KNBB 2JOYA 1FMVA 5GAMd 1K9MC 1YIJT 1UGSB 1RAIB 3MJXA 3QDFA 1BI0A 1M8MA 1S1NA 1J3TA 3PT9A 4CC2A 2WSCE 5LJ3d 4BD3A 5GAOm 4KGZB 4AFUC 1N8RU 3MKDA 1AWJA 2ZPFB 1BCMA 3L2UA 4L59A 2HL3A 3TSWA 1Y96B 2XD0A 5KYYA 3V7SA 2JTEA 1VQ6Q 4BY6B 4C8QB 1AD5A 6AT1B 2DEQA 3HPWA 4LD9K 2I2LA 3SB2A 1OI1A 4XU0A 4AG2C 2O88A 4RG2A 4N4IA 3QG1A 2L3PA 3OYFA 3QBYA 1M5Q1 2PU9B 3ZL7C 3BW1A 1JJ2P 4FSXA 1YCYA 4OMQA 4PLLA 3C12A 1KD1R 1JO8A 2ESWA 2OI3A 1Y71A 5IHIA 4C5GA 2GNCA 2PTKA 1QW1A 2QQ9A 4PJOE 2EQIA 4JLGA 1V76A 1ZUKA 2X3WD 4JZ3A 2YXYA 5KYYB 2XK0A 4M4ZA 2AK5A 5CKFA 2EQUA 2V26A 3I56A 3PVQA 2KDSA 2HKQB 4VUBA 2AIRB 2LQKA 3I55A 4JRPA 2QQSA 4IUUA 2RK1A 3EGDB 2KXCA 1YHQQ 2AZSA 2E5KA 2YUOA 4IIMA 2BE9B 3VS1A 4RMOA 1WHGA 2HDAA 2DJZA 3DLLA 5L8RE 1ZLMA 4OF1A 1D1CA 5D6XA 2LQ8A 1K0XA 1MMDA 5KYXB 1SHFA 1MMAA 3VYGA 1Y7XA 1WI7A 2K2VA 1X75C 2K6DA 1KQSP 1RAAB 1S72T 2O2OA 2NYSA 1A0NB 3CC2T 4C8QG 1MMNA 2EYWA 4KH1B 1K4US 1N9RA 2MMPA 5KE3A 3ULRB 3CCVA 1I07A 1BB9A 2MK5A 1U8RA 1IB8A 4BE1A 4PJOF 4EMKC 1JB0E 4A54A 2PVOB 2DKGA 2RO0A 5LJ3h 2RHZA 1NBEB 1PRMC 2CSQA 3EG9A 2PVDB 2NLUA 3CCJA 2KSSA 2V8IA 5KYUB 1UG1A 2L8DA 4QVCA 2PUOB 3CC7A 3DLMA 1D09B 2DBKA 1VQ8Q 4LDXA 4JZ4A 1M3CA 5FW9A 3G4SA 2M0YA 4ORZA 5FWBA 1KD1C 4KRTA 1RLPC 4ZN3A 1LVKA 1NPPA 2JM8A 3QWYA 4OMLA 1Y57A 1YJNQ 2E12A 4FW2A 1WPYA 1M1KC 2DE0X 1T3LA 4M75F 4AG1C 3GF5A 4P5NA 1UDLA 5IHNA 1WXUA 3KBGA 4X9DA 2OTJT 2RHXA 4QVDA 3JB9I 3E1SA 1X27A 1ZA1B 1VQOA 1B34B 2BZXA 1GRIA 1YIJA 4ZGJB 2A37A 2DIQA 2RHIA 1CSKA 1VA7A 4RCBA 3CC4A 1ARKA 1BIBA 2CP5A 2DX1A 2F1LA 1VQ7T 2HMAA 4J7IA 3OYHA 1ZUUA 4OMNA 1W1FA 1BI3A 2K5FA 1K1ZA 5CIUA 1UGPB 1Q7YC 2RJFA 4E47A 1BKBA 2IG0A 5DY9A 4C0DC 1D1BA 2MYSA 2DTOA 4GLKA 2Y4XA 4ATOA 1NEGA 1UB4A 3UPUA 1O75A 3EG0A 5GAN4 5GANg 3PVLA 4RTXA 1UHCA 2V1QA 4DBFA 1YHQT 4X9CA 3VJPA 1GBRA 4PJNA 1PG5B 1K9AA 3M0TA 3EHRA 4CI0C 2ZPIB 5A0LA 3IQLA 4A4KA 3HL8A 1MMGA 2JMAA 4F7UE 2M51A 1SG5A 3KFVA 4A4FA 3TEEA 4M7DF 4XU2A 2DD5A 1YHQA 4C0DB 2C0IA 2GCXA 4RTYA 2YRDA 3OSSC 1S72Q 2MF2A 2XU8A 2COZA 1EZZB 2KQWA 3QUIA 4ZTFA 1NLPC 2CUDA 1OV3A 2MAMA 5GMKi 3LX7A 4HT8A 5LJ5h 2RQTA 2ZPBB 1V1CA 3E2UA 1VQ4T 1SPKA 5FU6C 2LRQA 1ZX6A 2O4XB 1UJYA 2RJCA 2C0OA 3QXEB 1YCSB 4XTVA 2GFAA 3THKA 1OU9A 4HCZA 1W70A 3CXCA 3DB3A 3PIOA 2JTFA 5KYWA 3OMCA 1TSFA 2DVEA 4C5EA 2LP5A 1C0MA 1WLPB 5CO7A 1K0SA 1MHNA 2AT1B 1KQ2A 2CZ1B 2ZGWA 1QLYA 1VQNT 4M7DG 1R0BG 2FB7A 2HAXA 5FRNA 3CD6A 2QK0A 4N0AA 3UDCA 1WDXA 2HEQA 2FRYA 4M75B 5GAN7 2KT8A 3CCMA 2EIFA 4DA4A 5HY6A 2RI3A 5I2SA 4FU6A 2ECZA 1TUGB 2HD0A 3V7CA 3CCRT 1K76A 1QVFP 2QAZA 1U1TA 2Y90A 1WQ7A 4Y92A 2XIDA 4C92E 3RBBB 3JCMd 3H0HA 2X4JA 3X24B 2J6FA 1X2QA 2L3SA 2LT4A 2WSEE 5J39A 2LC4A 3M0UA 1IRXA 3OBYA 4C92C 5GMKh 1NYGA 1VUBA 1JQQA 1KC8U 3SWNC 2KMTA 4PK4A 1CKBA 4DOVA 5CAIA 4TVRA 5KE2A 1WYXA 4J8OA 3M56A 2CP3A 2QA4Q 1NM7A 5GAN6 3EFRA 3VRZA 1WHMA 2GGRA 3OMGA 5GAOl 3CC2A 4EMKB 4E7HA 1PWTA 3UA6A 3UATA 3I5SA 1KG1A 2J05A 2KT1A 1AWWA 2AHJB 4ZNXA 3OYJA 4RTZA 4JJDA 3TCJA 3RUXA 4FM4B 4BACA 1Q81C 2DXTA 1LOJA 2DJQA 2E1HA 3LYIA 1Q81R 2RJEA 4Z89A 1NJIR 5FRMA 1MV3A 1VQOQ 2WACA 1KK7A 7AT1B 3CCLA 1VYVA 1VQ6A 3NTIA 3VUBA 5D6WA 1YFNA 4PJLA 3LGLA 2QA4A 5FLXE 4KT0E 2HQXA 2LZ6B 1K73R 2G3RA 4FT4A 4ZN1A 3INZA 2WSFE 1TXQA 1U3OA 4L5GA 3JCMg 2P4RA 4BUGA 5C6SA 4JS4A 4KULA 1YN8A 2I0NA 4J9GA 5CR2A 4PJMA 4JRIA 2QA4T 3UA7A 3L2VA 3G71T 1M1GA 2GQIA 2MOXA 1AWXA 3CCUA 1N8RR 1X69A 2OTJA 4JJCA 3VYHB 4C5HA 4OMPA 5LJ5f 3G6EQ 1G3SA 2DNUA 3CQTA 4F7UB 3EFOA 2EJGA 3V7RA 2BKDN 4M78A 1I0CA 3QDRB 1OULA 4RTVA 2DL5A 4ME7A 2K5LA 1VQPA 3NHNA 4MMLA 4EIKA 2KYMA 2LVMA 3OYNA 2L3QA 5GAMh 4RUGA 2D1XA 4LUEA 2QXFA 1AHJB 3VKIA 3OYCA 3OYDA 4BI4A 2FEIA 1GXIE 2D0QB 3JB9F 4IUPA 3HFNA 3JB9J 1W2BS 1Q86U 2EQJA 2MWOA 2OTLA 5A2QE 3ZEHA 2DRKA 4EMHA 2HSPA 1LPLA 4PFOA 4XTXA 5I22A 2VKNA 1RUWA 3QYHB 2W0ZA 3A8MB 4JJBA 3WXMB 1GCPA 1G3YA 1TS9A 4MZPA 4CC7A 2ED1A 1K73C 1VIEA 1WGSA 3M0PA 4XTYA 1TOVA 4HVUA 3CPWP 1TG0A 3I5RA 1YBYA 2CREA 4EDUA 3LH5A 4JS5A 2V8JA 5LJ3j 2KYBA 3A1PA 4PLIA 2DXUA 2HBPA 3GBQA 3MPUB 3MHXA 2F5TX 2QTXA 5CCAA 1JXMA 2A28A 2KRNA 1OPLA 3M0QA 3EH1A 1CKAA 2O01E 1Q95G 1NYFA 4KH0B 4XTWA 4J9BA 2DXCA 2L2PA 4J6WA 4LDWA 5A0GA 1BI1A 4HCCA 3A8OB 4C92G 2K9GA 4LNPA 2CYZB 1TU0B 1FMKA 3V8LA 3MP1A 1SRLA 4XK8E 2HBWA 1OQKA 4LUDA 3OYAA 4OB2B 3ZBDA 1SSFA 2DPPB 3C95A 1VQMQ 3BFMA 2DA9A 4M7AG 1RI9A 4RTTA 3QSUA 1RAHB 4PJJA 1N5ZA 3E9FA 4F16A 1ZHIA 2DO3A 2VXEA 1ZQ1A 3BE3A 3S6WA 1PC0A 1KHCA 5GJWB 4M7DC 5C0MA 2H8HA 4F14A 1M8VA 3QWXX 3EGDA 3MO8A 2D0NA 3MCAB 2O4XA 4BE0A 1D3BA 1I5OB 2K57A 2JS0A 2JVVA 1VQNA 5I11A 3CCUQ 3FLGA 2YUQA 2P0PA 1M4ZA 2RJDA 3QIIA 3CCQA 3DKMA 4Z02A 4RG8A 4M75G 1W6XA 3QKJA 3V8JA 5GAMf 4QQ6A 1NG2A 3P8DA 3LLRA 5IXFA 3OYGA 1MNDA 3JSCA 3META 1X6BA 5GAOr 2GBQA 1QVPA 3OYLA 3JCMc 1K9MR 3I55Q 1K73U 4Y28E 1E6GA 4AFSC 5AT1B 1Q86R 2OJ2A 3VS0A 2K7AA 1GFDA 2DTHA 1VYUA 5HK3A 1OX9A 3SHWA 2ZCFB 3WVDB 3SD4A 2CKKA 2E41A 2ABLA 1XOVA 2FHDA 4OGEA 1QMCA 3C4SA 1VQ7A 4MMKA 2QGFB 4B6MA 2RB6A 4PNOA 4XTZA 1M30A 2EQMA 1BIAA 3G1JA 1XJWB 4E7JA 2AKKA 4PJOB 2EWNA 1VYTA 3SWNA 2VASA 1Q7YU 1I5LA 2K3XA 3JB9H 1V29B 3OYMA 4M78B 4C8QF 2MCNA 1SF9A 5L23A 1X01A 4LE9A 3N5BB 4FIBA 2B86A 2IVWA 2PQWA 3EG3A 2R57A 1WA7A 2YDLA 3VS2A 1C6VX 8ATCB 1EX4A 2VC8A 2FZCB 1PM3A 2DZ9A 3FRNA 1TH7A 1IO6A 4WF2A 2KRMA 5GANj 1WJQA 3M0SA 2KBTA 1ZA2B 2DERA 3P8HA 3OB9A 3M54A 3H9NA 3FJPA 1HK9A 4O6JA 2FPFA 2XKOC 2FPEA 1H8KA 2FZGB 4XU3A 2RQRA 3EFSA 4R0KA 3JB9G 1GFCA 1JEGA 1UGQB 2AKLA 4ELYC 3RKYA 3EH2A 3JCMb 1VQ9Q 2X9HA 2VWFA 3RNJA 2XG8D 5KYXA 1PD0A 1GCQC 3OBWA 2FL7A 2L0AA 3AT1B 4Q5WA 1RACB 3RDVA 1HJDA 1IGQA 4F04B 3E19A 1VQLQ 2GQVA 1G2BA 1N9SA 2EW3A 2QYZA 1Q82R 1VQ7Q 1AT1B 2JXBA 1N27A 2XMFA 2YT6A 2E3IA 5LJ5d 1I8FA 4PJOC 4C8QA 4F17A 2DL4A 3PGGA 3QJYA 2KK4A 1RL2A 2PNIA 2RQUA 1VQOT 1M90C 4ZTJA 4C92D 1QWFA 4C92F 1OZ2A 3EGXA 3JCMQ 1QVFA 3CC2Q 3JCMe 4LDYA 4M78D 1M2OA 4JRKA 4J9DA 3CCQT 1YNZA 1SSHA 2X3XD 2YWWA 4OVAA 3OS5A 2EVRA 5IHKA 2E3HA 2D8JA 5DLQE 3A8GB 4J6XA 3L2QA 2RHUA 1YP5A 2SRCA 1KQSA 3CCEQ 4FYXB 4M7AE 1X2KA 4FYVB 4DBQA 2PUKB 2NUZA 4M75C 5GMKj 1U1SA 2RI5A 3U23A 4J7FA 3I56T 4J6YA 2DM1A 3HRTA 1Z9ZA 3C94A 3OYBA 1ZBXA 2EKHA 5I21A 1W2BA 3EG1A 4II1A 1WJSA 3RERA 3X26B 1YJ9Q 2BUDA 4QT7A 4M77F 4JRQA 4HVVA 4FL6A 2VVKA 1H92A 1QKXA 4BB7A 1X6GA 4MDXA 2HL5C 1SRMA 1SEMA 1IXDA 1JBMA 2YSQA 1YWPA 1JJ2S 2P0QA 4HCBA 2VGNA 2M1HA 2JZ2A 4MZTA 2VGMA 1G3WA 2DF6A 4BDYA 4XU1A 1M3AA 2BIVA 4C8QE 2LNVA 3EAEA 1KQ1A 1G5VA 2DLPA 2Y4YA 4BI8B 1KIKA 3LGFA 1UE9A 1RAEB 3CCLQ 1PD1A 2CSIA 3CCRQ 1YJWT 3H8ZA 3OYEA 1YITQ 3RESA 1VQ9A 1S72A 3NPFA 2MIOA 3GOXA 4NL2A 3G4SQ 3JCMJ 3VS5A 2ROTA 1YI2Q 4M77B 1WHKA 2K2MA 3VV0A 1B07A 4XQ3A 4QQGA 4N0AC 4LDUA 4C8QD 2JW4A 3CCRA 3CCLT 3G7ZA 2ED0A 5GAMg 2RK2A 4N4GA 1PRLC 2EGAA 5LJ3f 2CP0A 5LJ5j 4FW1A 2X4WA 3DB4A 4XAXB 9ATCB 2E6ZA 1WIEA 1ACMB 1XQHA 3NMZC 5D7UA 2HSEB 1RABB 2DRMA 1U5SA 2SEMA 4FYYB 4HVWA 1BYMA 3H6ZA 1YJ9A 2JUFA 2EKOA 2ZAEA 1ZSZB 3CCMQ 4FYWB 1QWEA 2B8AA 3HTRA 4IUQA 3S3OA 1HXDA 2BZ8A 2F2WA 4E7IA 2A7YA 2RD1A 4Z88A 2M16A 2HQEA 2CGHA 1OZ3A 1AVZC 1UECA 4M7AD 1H641 2QQAA 5GANf 4D6WA 2E10A 5D6YA 1M1KU 1E6HA 1D1AA 4PJOD 1VQMA 2DK3A 3JCMV 2EGCA 3REAB 3HKSA 1R0CB 4RKUE 2J6KA 5CKDA 1Y07A 1WHLA 1PNJA 1OU8A 1AZGB 1NEBA 4HA8A 3CCUT 1NLOC 2D9TA 2DL8A 4QVZA 3TREA 5DLOA 5LJ3e 3CC4Q 3KUFA 3CPWA 3LWHA 1I81A 2M02A 1UTIA 4OMMA 1YIJQ 4OGCA 3JCMh 1MNEA 4J83A 2BE7D 5GAMj 3TQ7P 3V8KA 3G71Q 2BTTA 1OPKA 2EYYA 2DXBA 4AMCA 2E64A 1VQ5T 2E5QA 2HCKA 2YRCA 1JJ2A 5LJ5g 2COYA 1TUDA 1Y0MA 4E6RA 2NUPA 1B3QA 2QEXA 1N8RC 3M58A 2F69A 3D7SB 2NWMA 1O9SA 5IN1A 3CXCP 1PSFA 3S3NA 2V8KA 4HKEA 1WX6A 1VQPT 1VQ6T 5KYNA 1K8AU 2VB6A 2X4YA 5KCHA 2P84A 2R5MA 3J80E 1K9MU 2EYXA 4M78F 3GPLA 4EMGA 4M7DE 4JPBW 2EBPA 2X51A 3HP9A 4CC3A 1WXBA 1VQ5Q 3ASKA 4N4HA 1QCNA 2QDYB 1H3HA 3HRUA 4J9HA 2HQHA 1EFNA 3JV3A 4M7DD 2KGTA 3M4GA 4K11A 5GAN2 3GP8A 1R8OB 3JCMW 1W4SA 5LL6S 4IURA 3M53A 2YLCA 4JDSA 1KC8C 4J9EA 2K3BA 2MPXC 3FC3A 2LX9A 3PMIA 3SEMA 1IHVA 4D8KA 2NUTB 1WZOA 1M1FA 3NTHA 5AYFA 1GCQA 1JRIA 1FYNA 2CP7A 2RI2A 3I35A 3X20B 3CEYA 3EFOB 4KUIA 3CBMA 3OSVA 3PMTA 3OW2S 2FG0A 1RAFB 5GAN3 2LX7A 2ZPGB 4DBRA 1SHGA 1OYXA 3TSZA 2HNIA 5IAYA 3BDUA 2LQWA 1KD1U 2LCCA 1F1BB 3JB9D 2EJ9A 1BK2A 1ZSZA 2LJ3A 3M55A 3G6EA 2XDDA 3Q1JA 3A5ZB 4KGVB 4OB1B 4Z8AA 2XDPA 3H0FA 2RN8A 2QGGA 4A4GA 3P8BB 2FRWA 2D8HA 3CC7Q 5FU7B 1OEBA 3PTAA 2LDMA 2COWA 1KHIA 2DL7A 4LN2A 3QYGB 4Y91A 3MEWA 1D0ZA 1I1JA 3O5ZA 2A08A 3G6ET 3CD6T 3FEOA 4R56A 1Q81U 5IH2A 3CC4T 2P4TA 2XDBA 4DBHA 2JN0A 1AOJA 3OY9A 3X28B 4M7AF 1R77A 1M3BA 3FDRA 1PCXA 1VQKA 3OYKA 1B7TA 2QG9B 1WHHA 3QO3A 3BDLA 3CMAA 3L42A 4M77A 1BCOA 3OW2P 3PIPA 3F70A 1X6OA 2CH4A 2LNHB 3OS2A 2RF0A 1D0YA 3CCQQ 2E4HA 4M77C 2K3YA 4E7KA 2DFUA 5CKHA 4DQ2A 2VV5A 2VYTA 1KFZA 3HHTB 1VQPQ 1M27C 1OX8A 1YJNT 1ZBJA 5GANe 2CS7A 4NL3A 4PJOG 4C0GA 1QVGP 2KEAA 2XHCA 4OMOA 1P92A 2EJFA 4LDVA 5CK9A 3EHQA 1G83A 2W10A 4BY6C 4C8QC 4E7SA 2EFIA 1IZ6A 3L2RA 2NUPB 1WFWA 2X35A 1VQ4A 4KUDK 2CZ7B 4GBQA 4WCIA 3CC7T 3X25B 4QQDA 1D3BB 2J06A 3EG2A 4M77E 2EYQA 2HZYA 4PFPA 1AWOA 2CP6A 4ANJA 4L6V5 4IIOA 4C92A 1N6AA 2KAFA 1IGUA 3SFMA 2MWPA 3CD6Q 4M7DB 4RTWA 3RMSA 3ME9A 2EYZA 4QKUA 2O31A 4M7AB 1MUZA 1NPRA 3H41A 1TWBA 4B9WA 3A98A 4M7AA 3SWNB 2V1RA 2A0FB 2QDLA 4F7UG 1UFFA 5HKCA 4M75E 2DILA 3JCMP 3OS0A 3M9QA 4MDWA 3CCJT 5KYUA 4M7AC 2J7IA 4E7ZA 4A53A 4M78E 2A36A 2RPNA 2DL3A 3FIFA 1VQMT 2J6OA 3QPHA 2F5KA 4J5YA 2F2XA 3PFSA 2IPOB 2OTLT 4JUVA 2OAUA 2KROA 5KH6A 2CT3A 1K8AR 1HSQA 3G4ST 4M75A 4E7LA 1JU5C 1U06A 1QVGS 3WVEB 3CCJQ 1KJWA 4E2FB 1FX7A 3M59A 4RCCA 5GMKm 4JJNK 1LNXA 1KQSS 1VOMA 1M2VA 3R6OA 3G71A 4C0FA 1YWOA 5LJ5e 2M0OA 4DOWA 2CZ0B 3JAME 2LJ1A 1M1KR 4OMFB 1VQ8T 1W2BP 3LWIA 2CDTA 2C06A 2JNGA 2OTLQ 2G6FX 4KBMB 2QEXT 1X43A 1RAGB 4HXJA 3CMEA 1OOTA 1LCKA 5GANh 2CZ6B 1YJWA 1GL5A 4EPCA 2DMOA 3I55T 3MEVA 2X4XA 2GF7A 4IKFA 4AFQC 5J26A 2AZVA 3RMQA 3REBB 4X34A 1VQNQ 4AT1B 2LJ0A 3NFCA 2ATCB 2OTJQ 2F2VA 2KI7A 3CBPA 1RI0A 3CPWS 3JRZA 3CBOA 5GAN8 2YHTA 1VQ9T 1GBQA 2PVGB 2OAWA 3UWNA 3NGPA 2O9VA 2DYIA 3EGUA 1UUEA 4X1VA 2RH2A 1ABOA 2OX7A 3FB9A 4M7DA 1AEYA 2GTJA 2NUTA 2KVQG 2LTOA 3NTKA 3CXCS 2QQRA 2CT4A 5GMKe 2K5IA 1NE8A 3OA6A 5IT9E 2XI9A 2DIGA 1JXOA 4RTUA 2KY9A 4O5VA 5ECAA 3J81E 2L5QA 3GIBA 3KXTA 5CVIA 5CKEA 1H3ZA 2R5AA 2RA2A 3I56Q 4EMKA 2QEXQ 1BI2A 4FSSA 2RQWA 4BI3A 3CCSQ 1NZ9A 5FWCA 5IXBA 1LJOA 1YJ9T 3T9NA 3C0CA 1EIFA 4PKCC 4FCYA 2DD4A 1M90U 3L2ZA 5KYWB 1SKUB 4OB3B 5A0DA 4CRIA 4C92B 1T0JA 1Z9QA 2DYBA 3CMET 3EG9B 4GY5A 3I9QA 1KC8R 2ZPEB 3QZ9B 4OB0B 1MV0B 2LCLA 2DVJA 2H3JA 1VQ4Q 2RM4A 4ZGDB 4V2SA 5CKBA 1C1AA 3CCEA 4HCKA 2K4YA 3TU4K 1M90R 3CCVQ 1NJIC 3LW5E 1VQLT 3M5AA 2DEUA 2GTOA 1YJWQ 5CQXA 4A4EA 1ZSZC 1BU1A 2QQBA 3RKWA 3H0IA 1TTHB 4NOYA 3CMEQ 2LT1A 1TUCA 5KCOA 1M9SA 1Q82C 2EQKA 3GNFB 3LH0A 3RR6A 1WJRA 2BZYA 2YUPA 3VS7A 2E6NA 2EGEA 2H3EB 1QP2A 2MI6A 1PSEA 1E7OA 3RKXA 2RQVA 3CCST 4A63B 3TVTA 3OS1A 1VQKQ 2KXDA 3GLXA 5GAMe 1YJNA 5FU6B 2ROLA 1G8XA 2RMOA 1WXTA 2DBMA 5I2MA 2JM9A 1YI2A 3JCMX 4IUVA 4BDZA 1FXXA 3M0RA 4GLMA 4LD6A 2QI2A 5DM7R 2JTMA 3RIRA 3M57A 3ER0A 2YLBA 3UT1A 4M78G 4PFZA 2R58A 5FROA 4LXCA 3VS6A 1Q82U 3L1AA 1HD3A 1RADB
chains in the Genus database with same CATH topology
1K9MR 3G4SQ 3I55Q 3CCUQ 1Q81R 1M1KR 1K73R 1VQ8Q 1W2BP 1JJ2P 3CC2Q 3CPWP 3CCEQ 1Q7YR 3OW2P 3CMAQ 1QVGP 1K8AR 1VQNQ 1M90R 1VQ5Q 3CCVQ 1NJIR 2OTLQ 3I56Q 1N8RR 2OTJQ 1S72Q 1Q86R 3CC4Q 1VQOQ 1YI2Q 3CCQQ 1VQLQ 2QEXQ 3CXCP 3CCJQ 1KD1R 3CCLQ 3G6EQ 1VQ6Q 3CCSQ 1YJWQ 3CD6Q 3CCRQ 3CC7Q 1YIJQ 1KC8R 1Q82R 1YJNQ 1QVFP 2QA4Q 1VQ7Q 1YITQ 3CMEQ 3CCMQ 1VQKQ 1VQPQ 1VQ9Q 3G71Q 1YJ9Q 1VQ4Q 1VQMQ 1KQSP 1YHQQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M R;  3G4S Q;  3I55 Q;  3CCU Q;  1Q81 R;  1M1K R;  1K73 R;  1VQ8 Q;  1W2B P;  1JJ2 P;  3CC2 Q;  3CPW P;  3CCE Q;  1Q7Y R;  3OW2 P;  3CMA Q;  1QVG P;  1K8A R;  1VQN Q;  1M90 R;  1VQ5 Q;  3CCV Q;  1NJI R;  2OTL Q;  3I56 Q;  1N8R R;  2OTJ Q;  1S72 Q;  1Q86 R;  3CC4 Q;  1VQO Q;  1YI2 Q;  3CCQ Q;  1VQL Q;  2QEX Q;  3CXC P;  3CCJ Q;  1KD1 R;  3CCL Q;  3G6E Q;  1VQ6 Q;  3CCS Q;  1YJW Q;  3CD6 Q;  3CCR Q;  3CC7 Q;  1YIJ Q;  1KC8 R;  1Q82 R;  1YJN Q;  1QVF P;  2QA4 Q;  1VQ7 Q;  1YIT Q;  3CME Q;  3CCM Q;  1VQK Q;  1VQP Q;  1VQ9 Q;  3G71 Q;  1YJ9 Q;  1VQ4 Q;  1VQM Q;  1KQS P;  1YHQ Q; 
#chains in the Genus database with same CATH topology
 2ZZD A;  3UF4 A;  2FVU A;  1VQK T;  4JLI A;  1IRE B;  4R55 A;  3S3M A;  4XTU A;  3R6N A;  2EPD A;  2KE9 A;  4ELZ C;  1T3S A;  3URG A;  2O9S A;  1MGQ A;  1QCO A;  3HFO A;  4KGX B;  3HSB A;  3QHS A;  2P0K A;  2E65 A;  1YIT A;  1UJ0 A;  2DAQ A;  2XIC A;  1XTD A;  1UGR B;  3OYY A;  1WNL A;  3FJ5 A;  3CMA T;  2E70 A;  4BE2 A;  3J7A F;  4QW2 A;  2FYK A;  1PHT A;  3M4Y A;  3L2W A;  4AFZ C;  2Z0W A;  2D6F A;  2M9U A;  5FU7 C;  5GMK l;  3MP8 A;  3CCM T;  4OP0 A;  1M2V B;  4C5I A;  2VXF A;  2FPD A;  2JJ9 A;  4YTL A;  2CUB A;  3VS4 A;  2KRS A;  3A8H B;  3PE0 A;  1QCF A;  2FO0 A;  1B34 A;  1KSW A;  4M77 G;  3ZFJ A;  4PL6 A;  5HCK A;  1RLQ C;  3O8V A;  4M78 C;  1IHW A;  1K8A C;  3E9G A;  1QP3 A;  1Q86 C;  2C0T A;  4J9I A;  1D0X A;  3QZ5 B;  4CC4 B;  1YIT T;  4HT9 A;  3CCS A;  4M75 D;  4J9F A;  1WQW A;  3GNG A;  3EGX B;  1QVF S;  2CH4 W;  3QJ6 A;  4FT2 A;  4MZM A;  3VRY A;  4PJO A;  5CQY A;  4D8D A;  5GAO q;  1YI2 T;  1T0H A;  2LQN A;  2JS2 A;  5GAN 5;  5EG2 A;  5J3B A;  1BBZ A;  3CCV T;  1Y96 A;  2QTV A;  2KR3 A;  3VU3 C;  2HKN A;  4A4H A;  4C0Z A;  5GAO p;  4NS5 A;  1G3T A;  3OQ5 A;  2JT4 A;  2L3R A;  3MEA A;  2L89 A;  1VQ5 A;  5GJV B;  1I4K 1;  3CPF A;  3CMA Q;  1Q7Y R;  2VUB A;  3CCE T;  5EC7 A;  1DJ7 B;  4ZGE B;  1WHJ A;  3AHU A;  3OW2 A;  4UC4 A;  3JCM f;  1VIF A;  8AT1 B;  1UEB A;  2PZ1 A;  2YUN A;  1PKS A;  2ENM A;  4M77 D;  1HYO A;  2CP2 A;  1ZSG A;  2GFU A;  3VUZ A;  4ESR A;  3PNW C;  2EAY A;  4IUT A;  1UHF A;  5GAN d;  2QAS A;  3MEU A;  2FZK B;  2ZPH B;  4DEX A;  3A8L B;  4F7U A;  2DTI A;  4DEY A;  1VQL A;  4B9X A;  1XNI A;  1QQJ A;  1ABQ A;  2K79 A;  1VQ8 A;  3HRS A;  5LJ3 g;  1ZUY A;  2RHY A;  1FWZ A;  3BY7 A;  1QVG A;  5GAO n;  5M9O A;  2IIM A;  2RNA A;  3OYI A;  3VS3 A;  1QKW A;  4J9C A;  1AZE A;  4WTO B;  3MP6 A;  2DET A;  2DZC A;  1NJI U;  2YRV A;  5HK0 A;  4F7U F;  1FMW A;  2LCS A;  1PKT A;  1UGV A;  3SDZ A;  2LMJ A;  2JMC A;  2A3L A;  2KNB B;  2JOY A;  1FMV A;  5GAM d;  1K9M C;  1YIJ T;  1UGS B;  1RAI B;  3MJX A;  3QDF A;  1BI0 A;  1M8M A;  1S1N A;  1J3T A;  3PT9 A;  4CC2 A;  2WSC E;  5LJ3 d;  4BD3 A;  5GAO m;  4KGZ B;  4AFU C;  1N8R U;  3MKD A;  1AWJ A;  2ZPF B;  1BCM A;  3L2U A;  4L59 A;  2HL3 A;  3TSW A;  1Y96 B;  2XD0 A;  5KYY A;  3V7S A;  2JTE A;  1VQ6 Q;  4BY6 B;  4C8Q B;  1AD5 A;  6AT1 B;  2DEQ A;  3HPW A;  4LD9 K;  2I2L A;  3SB2 A;  1OI1 A;  4XU0 A;  4AG2 C;  2O88 A;  4RG2 A;  4N4I A;  3QG1 A;  2L3P A;  3OYF A;  3QBY A;  1M5Q 1;  2PU9 B;  3ZL7 C;  3BW1 A;  1JJ2 P;  4FSX A;  1YCY A;  4OMQ A;  4PLL A;  3C12 A;  1KD1 R;  1JO8 A;  2ESW A;  2OI3 A;  1Y71 A;  5IHI A;  4C5G A;  2GNC A;  2PTK A;  1QW1 A;  2QQ9 A;  4PJO E;  2EQI A;  4JLG A;  1V76 A;  1ZUK A;  2X3W D;  4JZ3 A;  2YXY A;  5KYY B;  2XK0 A;  4M4Z A;  2AK5 A;  5CKF A;  2EQU A;  2V26 A;  3I56 A;  3PVQ A;  2KDS A;  2HKQ B;  4VUB A;  2AIR B;  2LQK A;  3I55 A;  4JRP A;  2QQS A;  4IUU A;  2RK1 A;  3EGD B;  2KXC A;  1YHQ Q;  2AZS A;  2E5K A;  2YUO A;  4IIM A;  2BE9 B;  3VS1 A;  4RMO A;  1WHG A;  2HDA A;  2DJZ A;  3DLL A;  5L8R E;  1ZLM A;  4OF1 A;  1D1C A;  5D6X A;  2LQ8 A;  1K0X A;  1MMD A;  5KYX B;  1SHF A;  1MMA A;  3VYG A;  1Y7X A;  1WI7 A;  2K2V A;  1X75 C;  2K6D A;  1KQS P;  1RAA B;  1S72 T;  2O2O A;  2NYS A;  1A0N B;  3CC2 T;  4C8Q G;  1MMN A;  2EYW A;  4KH1 B;  1K4U S;  1N9R A;  2MMP A;  5KE3 A;  3ULR B;  3CCV A;  1I07 A;  1BB9 A;  2MK5 A;  1U8R A;  1IB8 A;  4BE1 A;  4PJO F;  4EMK C;  1JB0 E;  4A54 A;  2PVO B;  2DKG A;  2RO0 A;  5LJ3 h;  2RHZ A;  1NBE B;  1PRM C;  2CSQ A;  3EG9 A;  2PVD B;  2NLU A;  3CCJ A;  2KSS A;  2V8I A;  5KYU B;  1UG1 A;  2L8D A;  4QVC A;  2PUO B;  3CC7 A;  3DLM A;  1D09 B;  2DBK A;  1VQ8 Q;  4LDX A;  4JZ4 A;  1M3C A;  5FW9 A;  3G4S A;  2M0Y A;  4ORZ A;  5FWB A;  1KD1 C;  4KRT A;  1RLP C;  4ZN3 A;  1LVK A;  1NPP A;  2JM8 A;  3QWY A;  4OML A;  1Y57 A;  1YJN Q;  2E12 A;  4FW2 A;  1WPY A;  1M1K C;  2DE0 X;  1T3L A;  4M75 F;  4AG1 C;  3GF5 A;  4P5N A;  1UDL A;  5IHN A;  1WXU A;  3KBG A;  4X9D A;  2OTJ T;  2RHX A;  4QVD A;  3JB9 I;  3E1S A;  1X27 A;  1ZA1 B;  1VQO A;  1B34 B;  2BZX A;  1GRI A;  1YIJ A;  4ZGJ B;  2A37 A;  2DIQ A;  2RHI A;  1CSK A;  1VA7 A;  4RCB A;  3CC4 A;  1ARK A;  1BIB A;  2CP5 A;  2DX1 A;  2F1L A;  1VQ7 T;  2HMA A;  4J7I A;  3OYH A;  1ZUU A;  4OMN A;  1W1F A;  1BI3 A;  2K5F A;  1K1Z A;  5CIU A;  1UGP B;  1Q7Y C;  2RJF A;  4E47 A;  1BKB A;  2IG0 A;  5DY9 A;  4C0D C;  1D1B A;  2MYS A;  2DTO A;  4GLK A;  2Y4X A;  4ATO A;  1NEG A;  1UB4 A;  3UPU A;  1O75 A;  3EG0 A;  5GAN 4;  5GAN g;  3PVL A;  4RTX A;  1UHC A;  2V1Q A;  4DBF A;  1YHQ T;  4X9C A;  3VJP A;  1GBR A;  4PJN A;  1PG5 B;  1K9A A;  3M0T A;  3EHR A;  4CI0 C;  2ZPI B;  5A0L A;  3IQL A;  4A4K A;  3HL8 A;  1MMG A;  2JMA A;  4F7U E;  2M51 A;  1SG5 A;  3KFV A;  4A4F A;  3TEE A;  4M7D F;  4XU2 A;  2DD5 A;  1YHQ A;  4C0D B;  2C0I A;  2GCX A;  4RTY A;  2YRD A;  3OSS C;  1S72 Q;  2MF2 A;  2XU8 A;  2COZ A;  1EZZ B;  2KQW A;  3QUI A;  4ZTF A;  1NLP C;  2CUD A;  1OV3 A;  2MAM A;  5GMK i;  3LX7 A;  4HT8 A;  5LJ5 h;  2RQT A;  2ZPB B;  1V1C A;  3E2U A;  1VQ4 T;  1SPK A;  5FU6 C;  2LRQ A;  1ZX6 A;  2O4X B;  1UJY A;  2RJC A;  2C0O A;  3QXE B;  1YCS B;  4XTV A;  2GFA A;  3THK A;  1OU9 A;  4HCZ A;  1W70 A;  3CXC A;  3DB3 A;  3PIO A;  2JTF A;  5KYW A;  3OMC A;  1TSF A;  2DVE A;  4C5E A;  2LP5 A;  1C0M A;  1WLP B;  5CO7 A;  1K0S A;  1MHN A;  2AT1 B;  1KQ2 A;  2CZ1 B;  2ZGW A;  1QLY A;  1VQN T;  4M7D G;  1R0B G;  2FB7 A;  2HAX A;  5FRN A;  3CD6 A;  2QK0 A;  4N0A A;  3UDC A;  1WDX A;  2HEQ A;  2FRY A;  4M75 B;  5GAN 7;  2KT8 A;  3CCM A;  2EIF A;  4DA4 A;  5HY6 A;  2RI3 A;  5I2S A;  4FU6 A;  2ECZ A;  1TUG B;  2HD0 A;  3V7C A;  3CCR T;  1K76 A;  1QVF P;  2QAZ A;  1U1T A;  2Y90 A;  1WQ7 A;  4Y92 A;  2XID A;  4C92 E;  3RBB B;  3JCM d;  3H0H A;  2X4J A;  3X24 B;  2J6F A;  1X2Q A;  2L3S A;  2LT4 A;  2WSE E;  5J39 A;  2LC4 A;  3M0U A;  1IRX A;  3OBY A;  4C92 C;  5GMK h;  1NYG A;  1VUB A;  1JQQ A;  1KC8 U;  3SWN C;  2KMT A;  4PK4 A;  1CKB A;  4DOV A;  5CAI A;  4TVR A;  5KE2 A;  1WYX A;  4J8O A;  3M56 A;  2CP3 A;  2QA4 Q;  1NM7 A;  5GAN 6;  3EFR A;  3VRZ A;  1WHM A;  2GGR A;  3OMG A;  5GAO l;  3CC2 A;  4EMK B;  4E7H A;  1PWT A;  3UA6 A;  3UAT A;  3I5S A;  1KG1 A;  2J05 A;  2KT1 A;  1AWW A;  2AHJ B;  4ZNX A;  3OYJ A;  4RTZ A;  4JJD A;  3TCJ A;  3RUX A;  4FM4 B;  4BAC A;  1Q81 C;  2DXT A;  1LOJ A;  2DJQ A;  2E1H A;  3LYI A;  1Q81 R;  2RJE A;  4Z89 A;  1NJI R;  5FRM A;  1MV3 A;  1VQO Q;  2WAC A;  1KK7 A;  7AT1 B;  3CCL A;  1VYV A;  1VQ6 A;  3NTI A;  3VUB A;  5D6W A;  1YFN A;  4PJL A;  3LGL A;  2QA4 A;  5FLX E;  4KT0 E;  2HQX A;  2LZ6 B;  1K73 R;  2G3R A;  4FT4 A;  4ZN1 A;  3INZ A;  2WSF E;  1TXQ A;  1U3O A;  4L5G A;  3JCM g;  2P4R A;  4BUG A;  5C6S A;  4JS4 A;  4KUL A;  1YN8 A;  2I0N A;  4J9G A;  5CR2 A;  4PJM A;  4JRI A;  2QA4 T;  3UA7 A;  3L2V A;  3G71 T;  1M1G A;  2GQI A;  2MOX A;  1AWX A;  3CCU A;  1N8R R;  1X69 A;  2OTJ A;  4JJC A;  3VYH B;  4C5H A;  4OMP A;  5LJ5 f;  3G6E Q;  1G3S A;  2DNU A;  3CQT A;  4F7U B;  3EFO A;  2EJG A;  3V7R A;  2BKD N;  4M78 A;  1I0C A;  3QDR B;  1OUL A;  4RTV A;  2DL5 A;  4ME7 A;  2K5L A;  1VQP A;  3NHN A;  4MML A;  4EIK A;  2KYM A;  2LVM A;  3OYN A;  2L3Q A;  5GAM h;  4RUG A;  2D1X A;  4LUE A;  2QXF A;  1AHJ B;  3VKI A;  3OYC A;  3OYD A;  4BI4 A;  2FEI A;  1GXI E;  2D0Q B;  3JB9 F;  4IUP A;  3HFN A;  3JB9 J;  1W2B S;  1Q86 U;  2EQJ A;  2MWO A;  2OTL A;  5A2Q E;  3ZEH A;  2DRK A;  4EMH A;  2HSP A;  1LPL A;  4PFO A;  4XTX A;  5I22 A;  2VKN A;  1RUW A;  3QYH B;  2W0Z A;  3A8M B;  4JJB A;  3WXM B;  1GCP A;  1G3Y A;  1TS9 A;  4MZP A;  4CC7 A;  2ED1 A;  1K73 C;  1VIE A;  1WGS A;  3M0P A;  4XTY A;  1TOV A;  4HVU A;  3CPW P;  1TG0 A;  3I5R A;  1YBY A;  2CRE A;  4EDU A;  3LH5 A;  4JS5 A;  2V8J A;  5LJ3 j;  2KYB A;  3A1P A;  4PLI A;  2DXU A;  2HBP A;  3GBQ A;  3MPU B;  3MHX A;  2F5T X;  2QTX A;  5CCA A;  1JXM A;  2A28 A;  2KRN A;  1OPL A;  3M0Q A;  3EH1 A;  1CKA A;  2O01 E;  1Q95 G;  1NYF A;  4KH0 B;  4XTW A;  4J9B A;  2DXC A;  2L2P A;  4J6W A;  4LDW A;  5A0G A;  1BI1 A;  4HCC A;  3A8O B;  4C92 G;  2K9G A;  4LNP A;  2CYZ B;  1TU0 B;  1FMK A;  3V8L A;  3MP1 A;  1SRL A;  4XK8 E;  2HBW A;  1OQK A;  4LUD A;  3OYA A;  4OB2 B;  3ZBD A;  1SSF A;  2DPP B;  3C95 A;  1VQM Q;  3BFM A;  2DA9 A;  4M7A G;  1RI9 A;  4RTT A;  3QSU A;  1RAH B;  4PJJ A;  1N5Z A;  3E9F A;  4F16 A;  1ZHI A;  2DO3 A;  2VXE A;  1ZQ1 A;  3BE3 A;  3S6W A;  1PC0 A;  1KHC A;  5GJW B;  4M7D C;  5C0M A;  2H8H A;  4F14 A;  1M8V A;  3QWX X;  3EGD A;  3MO8 A;  2D0N A;  3MCA B;  2O4X A;  4BE0 A;  1D3B A;  1I5O B;  2K57 A;  2JS0 A;  2JVV A;  1VQN A;  5I11 A;  3CCU Q;  3FLG A;  2YUQ A;  2P0P A;  1M4Z A;  2RJD A;  3QII A;  3CCQ A;  3DKM A;  4Z02 A;  4RG8 A;  4M75 G;  1W6X A;  3QKJ A;  3V8J A;  5GAM f;  4QQ6 A;  1NG2 A;  3P8D A;  3LLR A;  5IXF A;  3OYG A;  1MND A;  3JSC A;  3MET A;  1X6B A;  5GAO r;  2GBQ A;  1QVP A;  3OYL A;  3JCM c;  1K9M R;  3I55 Q;  1K73 U;  4Y28 E;  1E6G A;  4AFS C;  5AT1 B;  1Q86 R;  2OJ2 A;  3VS0 A;  2K7A A;  1GFD A;  2DTH A;  1VYU A;  5HK3 A;  1OX9 A;  3SHW A;  2ZCF B;  3WVD B;  3SD4 A;  2CKK A;  2E41 A;  2ABL A;  1XOV A;  2FHD A;  4OGE A;  1QMC A;  3C4S A;  1VQ7 A;  4MMK A;  2QGF B;  4B6M A;  2RB6 A;  4PNO A;  4XTZ A;  1M30 A;  2EQM A;  1BIA A;  3G1J A;  1XJW B;  4E7J A;  2AKK A;  4PJO B;  2EWN A;  1VYT A;  3SWN A;  2VAS A;  1Q7Y U;  1I5L A;  2K3X A;  3JB9 H;  1V29 B;  3OYM A;  4M78 B;  4C8Q F;  2MCN A;  1SF9 A;  5L23 A;  1X01 A;  4LE9 A;  3N5B B;  4FIB A;  2B86 A;  2IVW A;  2PQW A;  3EG3 A;  2R57 A;  1WA7 A;  2YDL A;  3VS2 A;  1C6V X;  8ATC B;  1EX4 A;  2VC8 A;  2FZC B;  1PM3 A;  2DZ9 A;  3FRN A;  1TH7 A;  1IO6 A;  4WF2 A;  2KRM A;  5GAN j;  1WJQ A;  3M0S A;  2KBT A;  1ZA2 B;  2DER A;  3P8H A;  3OB9 A;  3M54 A;  3H9N A;  3FJP A;  1HK9 A;  4O6J A;  2FPF A;  2XKO C;  2FPE A;  1H8K A;  2FZG B;  4XU3 A;  2RQR A;  3EFS A;  4R0K A;  3JB9 G;  1GFC A;  1JEG A;  1UGQ B;  2AKL A;  4ELY C;  3RKY A;  3EH2 A;  3JCM b;  1VQ9 Q;  2X9H A;  2VWF A;  3RNJ A;  2XG8 D;  5KYX A;  1PD0 A;  1GCQ C;  3OBW A;  2FL7 A;  2L0A A;  3AT1 B;  4Q5W A;  1RAC B;  3RDV A;  1HJD A;  1IGQ A;  4F04 B;  3E19 A;  1VQL Q;  2GQV A;  1G2B A;  1N9S A;  2EW3 A;  2QYZ A;  1Q82 R;  1VQ7 Q;  1AT1 B;  2JXB A;  1N27 A;  2XMF A;  2YT6 A;  2E3I A;  5LJ5 d;  1I8F A;  4PJO C;  4C8Q A;  4F17 A;  2DL4 A;  3PGG A;  3QJY A;  2KK4 A;  1RL2 A;  2PNI A;  2RQU A;  1VQO T;  1M90 C;  4ZTJ A;  4C92 D;  1QWF A;  4C92 F;  1OZ2 A;  3EGX A;  3JCM Q;  1QVF A;  3CC2 Q;  3JCM e;  4LDY A;  4M78 D;  1M2O A;  4JRK A;  4J9D A;  3CCQ T;  1YNZ A;  1SSH A;  2X3X D;  2YWW A;  4OVA A;  3OS5 A;  2EVR A;  5IHK A;  2E3H A;  2D8J A;  5DLQ E;  3A8G B;  4J6X A;  3L2Q A;  2RHU A;  1YP5 A;  2SRC A;  1KQS A;  3CCE Q;  4FYX B;  4M7A E;  1X2K A;  4FYV B;  4DBQ A;  2PUK B;  2NUZ A;  4M75 C;  5GMK j;  1U1S A;  2RI5 A;  3U23 A;  4J7F A;  3I56 T;  4J6Y A;  2DM1 A;  3HRT A;  1Z9Z A;  3C94 A;  3OYB A;  1ZBX A;  2EKH A;  5I21 A;  1W2B A;  3EG1 A;  4II1 A;  1WJS A;  3RER A;  3X26 B;  1YJ9 Q;  2BUD A;  4QT7 A;  4M77 F;  4JRQ A;  4HVV A;  4FL6 A;  2VVK A;  1H92 A;  1QKX A;  4BB7 A;  1X6G A;  4MDX A;  2HL5 C;  1SRM A;  1SEM A;  1IXD A;  1JBM A;  2YSQ A;  1YWP A;  1JJ2 S;  2P0Q A;  4HCB A;  2VGN A;  2M1H A;  2JZ2 A;  4MZT A;  2VGM A;  1G3W A;  2DF6 A;  4BDY A;  4XU1 A;  1M3A A;  2BIV A;  4C8Q E;  2LNV A;  3EAE A;  1KQ1 A;  1G5V A;  2DLP A;  2Y4Y A;  4BI8 B;  1KIK A;  3LGF A;  1UE9 A;  1RAE B;  3CCL Q;  1PD1 A;  2CSI A;  3CCR Q;  1YJW T;  3H8Z A;  3OYE A;  1YIT Q;  3RES A;  1VQ9 A;  1S72 A;  3NPF A;  2MIO A;  3GOX A;  4NL2 A;  3G4S Q;  3JCM J;  3VS5 A;  2ROT A;  1YI2 Q;  4M77 B;  1WHK A;  2K2M A;  3VV0 A;  1B07 A;  4XQ3 A;  4QQG A;  4N0A C;  4LDU A;  4C8Q D;  2JW4 A;  3CCR A;  3CCL T;  3G7Z A;  2ED0 A;  5GAM g;  2RK2 A;  4N4G A;  1PRL C;  2EGA A;  5LJ3 f;  2CP0 A;  5LJ5 j;  4FW1 A;  2X4W A;  3DB4 A;  4XAX B;  9ATC B;  2E6Z A;  1WIE A;  1ACM B;  1XQH A;  3NMZ C;  5D7U A;  2HSE B;  1RAB B;  2DRM A;  1U5S A;  2SEM A;  4FYY B;  4HVW A;  1BYM A;  3H6Z A;  1YJ9 A;  2JUF A;  2EKO A;  2ZAE A;  1ZSZ B;  3CCM Q;  4FYW B;  1QWE A;  2B8A A;  3HTR A;  4IUQ A;  3S3O A;  1HXD A;  2BZ8 A;  2F2W A;  4E7I A;  2A7Y A;  2RD1 A;  4Z88 A;  2M16 A;  2HQE A;  2CGH A;  1OZ3 A;  1AVZ C;  1UEC A;  4M7A D;  1H64 1;  2QQA A;  5GAN f;  4D6W A;  2E10 A;  5D6Y A;  1M1K U;  1E6H A;  1D1A A;  4PJO D;  1VQM A;  2DK3 A;  3JCM V;  2EGC A;  3REA B;  3HKS A;  1R0C B;  4RKU E;  2J6K A;  5CKD A;  1Y07 A;  1WHL A;  1PNJ A;  1OU8 A;  1AZG B;  1NEB A;  4HA8 A;  3CCU T;  1NLO C;  2D9T A;  2DL8 A;  4QVZ A;  3TRE A;  5DLO A;  5LJ3 e;  3CC4 Q;  3KUF A;  3CPW A;  3LWH A;  1I81 A;  2M02 A;  1UTI A;  4OMM A;  1YIJ Q;  4OGC A;  3JCM h;  1MNE A;  4J83 A;  2BE7 D;  5GAM j;  3TQ7 P;  3V8K A;  3G71 Q;  2BTT A;  1OPK A;  2EYY A;  2DXB A;  4AMC A;  2E64 A;  1VQ5 T;  2E5Q A;  2HCK A;  2YRC A;  1JJ2 A;  5LJ5 g;  2COY A;  1TUD A;  1Y0M A;  4E6R A;  2NUP A;  1B3Q A;  2QEX A;  1N8R C;  3M58 A;  2F69 A;  3D7S B;  2NWM A;  1O9S A;  5IN1 A;  3CXC P;  1PSF A;  3S3N A;  2V8K A;  4HKE A;  1WX6 A;  1VQP T;  1VQ6 T;  5KYN A;  1K8A U;  2VB6 A;  2X4Y A;  5KCH A;  2P84 A;  2R5M A;  3J80 E;  1K9M U;  2EYX A;  4M78 F;  3GPL A;  4EMG A;  4M7D E;  4JPB W;  2EBP A;  2X51 A;  3HP9 A;  4CC3 A;  1WXB A;  1VQ5 Q;  3ASK A;  4N4H A;  1QCN A;  2QDY B;  1H3H A;  3HRU A;  4J9H A;  2HQH A;  1EFN A;  3JV3 A;  4M7D D;  2KGT A;  3M4G A;  4K11 A;  5GAN 2;  3GP8 A;  1R8O B;  3JCM W;  1W4S A;  5LL6 S;  4IUR A;  3M53 A;  2YLC A;  4JDS A;  1KC8 C;  4J9E A;  2K3B A;  2MPX C;  3FC3 A;  2LX9 A;  3PMI A;  3SEM A;  1IHV A;  4D8K A;  2NUT B;  1WZO A;  1M1F A;  3NTH A;  5AYF A;  1GCQ A;  1JRI A;  1FYN A;  2CP7 A;  2RI2 A;  3I35 A;  3X20 B;  3CEY A;  3EFO B;  4KUI A;  3CBM A;  3OSV A;  3PMT A;  3OW2 S;  2FG0 A;  1RAF B;  5GAN 3;  2LX7 A;  2ZPG B;  4DBR A;  1SHG A;  1OYX A;  3TSZ A;  2HNI A;  5IAY A;  3BDU A;  2LQW A;  1KD1 U;  2LCC A;  1F1B B;  3JB9 D;  2EJ9 A;  1BK2 A;  1ZSZ A;  2LJ3 A;  3M55 A;  3G6E A;  2XDD A;  3Q1J A;  3A5Z B;  4KGV B;  4OB1 B;  4Z8A A;  2XDP A;  3H0F A;  2RN8 A;  2QGG A;  4A4G A;  3P8B B;  2FRW A;  2D8H A;  3CC7 Q;  5FU7 B;  1OEB A;  3PTA A;  2LDM A;  2COW A;  1KHI A;  2DL7 A;  4LN2 A;  3QYG B;  4Y91 A;  3MEW A;  1D0Z A;  1I1J A;  3O5Z A;  2A08 A;  3G6E T;  3CD6 T;  3FEO A;  4R56 A;  1Q81 U;  5IH2 A;  3CC4 T;  2P4T A;  2XDB A;  4DBH A;  2JN0 A;  1AOJ A;  3OY9 A;  3X28 B;  4M7A F;  1R77 A;  1M3B A;  3FDR A;  1PCX A;  1VQK A;  3OYK A;  1B7T A;  2QG9 B;  1WHH A;  3QO3 A;  3BDL A;  3CMA A;  3L42 A;  4M77 A;  1BCO A;  3OW2 P;  3PIP A;  3F70 A;  1X6O A;  2CH4 A;  2LNH B;  3OS2 A;  2RF0 A;  1D0Y A;  3CCQ Q;  2E4H A;  4M77 C;  2K3Y A;  4E7K A;  2DFU A;  5CKH A;  4DQ2 A;  2VV5 A;  2VYT A;  1KFZ A;  3HHT B;  1VQP Q;  1M27 C;  1OX8 A;  1YJN T;  1ZBJ A;  5GAN e;  2CS7 A;  4NL3 A;  4PJO G;  4C0G A;  1QVG P;  2KEA A;  2XHC A;  4OMO A;  1P92 A;  2EJF A;  4LDV A;  5CK9 A;  3EHQ A;  1G83 A;  2W10 A;  4BY6 C;  4C8Q C;  4E7S A;  2EFI A;  1IZ6 A;  3L2R A;  2NUP B;  1WFW A;  2X35 A;  1VQ4 A;  4KUD K;  2CZ7 B;  4GBQ A;  4WCI A;  3CC7 T;  3X25 B;  4QQD A;  1D3B B;  2J06 A;  3EG2 A;  4M77 E;  2EYQ A;  2HZY A;  4PFP A;  1AWO A;  2CP6 A;  4ANJ A;  4L6V 5;  4IIO A;  4C92 A;  1N6A A;  2KAF A;  1IGU A;  3SFM A;  2MWP A;  3CD6 Q;  4M7D B;  4RTW A;  3RMS A;  3ME9 A;  2EYZ A;  4QKU A;  2O31 A;  4M7A B;  1MUZ A;  1NPR A;  3H41 A;  1TWB A;  4B9W A;  3A98 A;  4M7A A;  3SWN B;  2V1R A;  2A0F B;  2QDL A;  4F7U G;  1UFF A;  5HKC A;  4M75 E;  2DIL A;  3JCM P;  3OS0 A;  3M9Q A;  4MDW A;  3CCJ T;  5KYU A;  4M7A C;  2J7I A;  4E7Z A;  4A53 A;  4M78 E;  2A36 A;  2RPN A;  2DL3 A;  3FIF A;  1VQM T;  2J6O A;  3QPH A;  2F5K A;  4J5Y A;  2F2X A;  3PFS A;  2IPO B;  2OTL T;  4JUV A;  2OAU A;  2KRO A;  5KH6 A;  2CT3 A;  1K8A R;  1HSQ A;  3G4S T;  4M75 A;  4E7L A;  1JU5 C;  1U06 A;  1QVG S;  3WVE B;  3CCJ Q;  1KJW A;  4E2F B;  1FX7 A;  3M59 A;  4RCC A;  5GMK m;  4JJN K;  1LNX A;  1KQS S;  1VOM A;  1M2V A;  3R6O A;  3G71 A;  4C0F A;  1YWO A;  5LJ5 e;  2M0O A;  4DOW A;  2CZ0 B;  3JAM E;  2LJ1 A;  1M1K R;  4OMF B;  1VQ8 T;  1W2B P;  3LWI A;  2CDT A;  2C06 A;  2JNG A;  2OTL Q;  2G6F X;  4KBM B;  2QEX T;  1X43 A;  1RAG B;  4HXJ A;  3CME A;  1OOT A;  1LCK A;  5GAN h;  2CZ6 B;  1YJW A;  1GL5 A;  4EPC A;  2DMO A;  3I55 T;  3MEV A;  2X4X A;  2GF7 A;  4IKF A;  4AFQ C;  5J26 A;  2AZV A;  3RMQ A;  3REB B;  4X34 A;  1VQN Q;  4AT1 B;  2LJ0 A;  3NFC A;  2ATC B;  2OTJ Q;  2F2V A;  2KI7 A;  3CBP A;  1RI0 A;  3CPW S;  3JRZ A;  3CBO A;  5GAN 8;  2YHT A;  1VQ9 T;  1GBQ A;  2PVG B;  2OAW A;  3UWN A;  3NGP A;  2O9V A;  2DYI A;  3EGU A;  1UUE A;  4X1V A;  2RH2 A;  1ABO A;  2OX7 A;  3FB9 A;  4M7D A;  1AEY A;  2GTJ A;  2NUT A;  2KVQ G;  2LTO A;  3NTK A;  3CXC S;  2QQR A;  2CT4 A;  5GMK e;  2K5I A;  1NE8 A;  3OA6 A;  5IT9 E;  2XI9 A;  2DIG A;  1JXO A;  4RTU A;  2KY9 A;  4O5V A;  5ECA A;  3J81 E;  2L5Q A;  3GIB A;  3KXT A;  5CVI A;  5CKE A;  1H3Z A;  2R5A A;  2RA2 A;  3I56 Q;  4EMK A;  2QEX Q;  1BI2 A;  4FSS A;  2RQW A;  4BI3 A;  3CCS Q;  1NZ9 A;  5FWC A;  5IXB A;  1LJO A;  1YJ9 T;  3T9N A;  3C0C A;  1EIF A;  4PKC C;  4FCY A;  2DD4 A;  1M90 U;  3L2Z A;  5KYW B;  1SKU B;  4OB3 B;  5A0D A;  4CRI A;  4C92 B;  1T0J A;  1Z9Q A;  2DYB A;  3CME T;  3EG9 B;  4GY5 A;  3I9Q A;  1KC8 R;  2ZPE B;  3QZ9 B;  4OB0 B;  1MV0 B;  2LCL A;  2DVJ A;  2H3J A;  1VQ4 Q;  2RM4 A;  4ZGD B;  4V2S A;  5CKB A;  1C1A A;  3CCE A;  4HCK A;  2K4Y A;  3TU4 K;  1M90 R;  3CCV Q;  1NJI C;  3LW5 E;  1VQL T;  3M5A A;  2DEU A;  2GTO A;  1YJW Q;  5CQX A;  4A4E A;  1ZSZ C;  1BU1 A;  2QQB A;  3RKW A;  3H0I A;  1TTH B;  4NOY A;  3CME Q;  2LT1 A;  1TUC A;  5KCO A;  1M9S A;  1Q82 C;  2EQK A;  3GNF B;  3LH0 A;  3RR6 A;  1WJR A;  2BZY A;  2YUP A;  3VS7 A;  2E6N A;  2EGE A;  2H3E B;  1QP2 A;  2MI6 A;  1PSE A;  1E7O A;  3RKX A;  2RQV A;  3CCS T;  4A63 B;  3TVT A;  3OS1 A;  1VQK Q;  2KXD A;  3GLX A;  5GAM e;  1YJN A;  5FU6 B;  2ROL A;  1G8X A;  2RMO A;  1WXT A;  2DBM A;  5I2M A;  2JM9 A;  1YI2 A;  3JCM X;  4IUV A;  4BDZ A;  1FXX A;  3M0R A;  4GLM A;  4LD6 A;  2QI2 A;  5DM7 R;  2JTM A;  3RIR A;  3M57 A;  3ER0 A;  2YLB A;  3UT1 A;  4M78 G;  4PFZ A;  2R58 A;  5FRO A;  4LXC A;  3VS6 A;  1Q82 U;  3L1A A;  1HD3 A;  1RAD B; 
#chains in the Genus database with same CATH homology
 1K9M R;  3G4S Q;  3I55 Q;  3CCU Q;  1Q81 R;  1M1K R;  1K73 R;  1VQ8 Q;  1W2B P;  1JJ2 P;  3CC2 Q;  3CPW P;  3CCE Q;  1Q7Y R;  3OW2 P;  3CMA Q;  1QVG P;  1K8A R;  1VQN Q;  1M90 R;  1VQ5 Q;  3CCV Q;  1NJI R;  2OTL Q;  3I56 Q;  1N8R R;  2OTJ Q;  1S72 Q;  1Q86 R;  3CC4 Q;  1VQO Q;  1YI2 Q;  3CCQ Q;  1VQL Q;  2QEX Q;  3CXC P;  3CCJ Q;  1KD1 R;  3CCL Q;  3G6E Q;  1VQ6 Q;  3CCS Q;  1YJW Q;  3CD6 Q;  3CCR Q;  3CC7 Q;  1YIJ Q;  1KC8 R;  1Q82 R;  1YJN Q;  1QVF P;  2QA4 Q;  1VQ7 Q;  1YIT Q;  3CME Q;  3CCM Q;  1VQK Q;  1VQP Q;  1VQ9 Q;  3G71 Q;  1YJ9 Q;  1VQ4 Q;  1VQM Q;  1KQS P;  1YHQ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...