1JJ2P

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1jj2P00
1W2BP 2OTJQ 3CXCP 1VQMQ 1VQOQ 1K73R 3CCJQ 1VQ5Q 3I55Q 1Q81R 2OTLQ 3CPWP 1Q7YR 1KD1R 3CC2Q 1YJ9Q 1VQLQ 1VQ8Q 3CMAQ 2QEXQ 2QA4Q 3OW2P 1QVGP 1KQSP 1S72Q 3G4SQ 3I56Q 3CCUQ 1VQ9Q 1K8AR 1YI2Q 1NJIR 1YJNQ 3CCVQ 1VQ4Q 1VQKQ 1N8RR 3CCRQ 3CD6Q 1VQ7Q 3G71Q 1YHQQ 1YITQ 1VQ6Q 1JJ2P 3CCSQ 3CCQQ 1YJWQ 1Q86R 1Q82R 3CCLQ 1QVFP 1VQNQ 1KC8R 1M1KR 3CMEQ 3CC7Q 3CC4Q 1YIJQ 1K9MR 3CCEQ 3CCMQ 1M90R 3G6EQ 1VQPQ
chains in the Genus database with same CATH superfamily
3OQ5A 1M2OA 4KH0B 1Q82U 2L2PA 1TUCA 1ZLMA 4M77E 1O75A 3QJ6A 4FYXB 1FYNA 3G4SA 2CZ0B 2F2VA 1KD1C 2DIGA 2LVMA 4DQ2A 1W2BS 5GAOr 4TVRA 2LCCA 3OYMA 1QQJA 2MF2A 5GAOl 2MAMA 3GNFB 5CCAA 1JXMA 1RI9A 2RD1A 4PJOC 4M7AG 2KT1A 4ZN3A 4M7AF 2CP2A 4C8QD 2RI3A 1YIJT 2NUTA 4OMOA 2DD5A 2ATCB 3BDUA 2JTEA 3PGGA 5DLOA 5C0MA 9ATCB 1YNZA 1WPYA 4JLIA 5FRNA 2MK5A 4NS5A 3GBQA 3G71T 2DX1A 3M5AA 1VQPQ 2P4RA 3MPUB 1TTHB 2KI7A 1VQ8A 1LCKA 1T3SA 5GANd 1ABOA 4BI3A 3BDLA 3I5SA 1QWEA 3M59A 2DK3A 2Y90A 1I81A 1PD1A 2PZ1A 4ATOA 4PLLA 4M78C 5A2QE 1YITT 1QMCA 2RNAA 2KK4A 1QCNA 3CEYA 4MZMA 1S72A 1P92A 4O5VA 1EIFA 1I1JA 1VQ9Q 4E7ZA 2OTLT 1QVGA 5GMKj 3EG3A 4OMFB 4YTLA 5FU7C 4HKEA 3FJ5A 5EG2A 5GAMd 1WHMA 2JS0A 2FZCB 2ED1A 1OULA 2DMOA 3VS3A 2E3IA 1PC0A 3CCJQ 2XMFA 1TXQA 5GAN8 4MDWA 2D0NA 2BUDA 3UWNA 3EGUA 2ESWA 4M4ZA 3TQ7P 5GANh 3CCVQ 2A08A 3NGPA 3R6NA 1YCYA 3V7SA 5GAOn 4C5HA 2HQXA 4C0GA 1QLYA 4IIOA 3PTAA 2OTJA 2F69A 2LX7A 1VQ5Q 1KJWA 4C5IA 1G3SA 1UGSB 2A37A 1WJQA 2CT3A 1VIFA 1W70A 1XTDA 1UGVA 3X24B 2C0OA 4J5YA 5GAMh 5LJ3e 2EYZA 3CBPA 1VQOA 3LX7A 2CH4W 1M9SA 2ZPFB 3CCET 1RABB 1RLQC 1H641 3I56A 1N9SA 2GNCA 1WLPB 2A28A 1MNDA 3MEUA 3I55T 2ROTA 2EVRA 8ATCB 1VQKA 1IO6A 1OX9A 2O9VA 2CUBA 3JB9J 1YI2T 3EGDA 2HSEB 1U06A 1V29B 1YHQT 4RG2A 2OAUA 3CC2Q 4XAXB 2K5LA 2FL7A 4PFPA 4HVWA 3GOXA 1M90C 1DJ7B 1D1BA 3FIFA 1VQLQ 2M51A 2DPPB 2QI2A 2CZ6B 2L3SA 4M75B 3JCMX 3M58A 2COYA 1YBYA 1M1GA 4HCBA 4JUVA 2KGTA 4IURA 3HPWA 4BUGA 4M7DA 1OU8A 2RHYA 2HL5C 2PVOB 3H9NA 4M78A 5HKCA 5LJ5j 5KYYA 5GANf 2DKGA 3OY9A 1VQNT 3M55A 1WI7A 2CREA 4D8DA 3RDVA 3OW2P 1WNLA 1U1SA 2CP3A 3DLMA 2O4XA 3SEMA 2O4XB 2QEXT 4QW2A 5GANg 1X2QA 3E9GA 1UGQB 2HAXA 4AFZC 1X6BA 4IUQA 4PKCC 3DLLA 2CSQA 1Q81R 2ABLA 4J83A 5EC7A 2YRVA 3M9QA 1MV0B 3JCMP 1WQWA 2E6NA 3OW2A 2O2OA 3CD6A 3QO3A 2VUBA 1ZQ1A 1YJWA 2P0QA 1OEBA 4HCKA 2VC8A 4BE2A 3OYJA 1T0JA 1OPLA 5CKFA 4OMMA 5GAMg 3QJYA 3OSSC 3ZEHA 4FYVB 1ZSGA 1YJ9Q 4WTOB 4OB3B 1D0ZA 1W2BA 3QDRB 2YUQA 4FM4B 1UB4A 1NJIR 1R77A 2COZA 2CDTA 4PJJA 2EJFA 5GMKm 3F70A 3X28B 1PSFA 3LW5E 4M7DD 1X75C 4FT2A 4NL2A 4C92C 3A8MB 4M78D 3P8HA 2RK2A 2WSFE 3CCLT 3MKDA 4JZ4A 3OYDA 1JBMA 3NTHA 4EIKA 2ZAEA 3CMAQ 2OAWA 5GAOp 1UDLA 1UGRB 4HCCA 3KFVA 1X01A 4KGZB 4J9EA 1I8FA 5L23A 1Q86R 1SRLA 2M16A 5CVIA 4KH1B 1UUEA 1IREB 3JB9H 4M75G 5KYWA 2RQVA 4M75F 1G8XA 1M4ZA 1VQMQ 3JRZA 1MUZA 2X3WD 4RKUE 3CMET 1NBEB 4XQ3A 1WXBA 5FU6C 4J9DA 2ECZA 4M7AC 1QKWA 2RHUA 1UGPB 4JJCA 3MEVA 4J9CA 2VGNA 1QVPA 1PRLC 3EG9A 2DF6A 2DXUA 3EG9B 3EHQA 4J7IA 4ELZC 3A98A 3OYIA 2L5QA 4F04B 2DEQA 4FYWB 4HXJA 3G4ST 4HVVA 2JNGA 3OS5A 2DEUA 2ROLA 1M90R 4E47A 4A4KA 2YLBA 3REAB 1YWPA 4C8QC 2E1HA 1G83A 3HKSA 5GMKe 3H0FA 2P0KA 2X3XD 1XJWB 1QCOA 2OI3A 1N6AA 2ZGWA 1VQ6A 3HSBA 5IXFA 3CCUT 4PNOA 4AG2C 2RHIA 1SF9A 3TVTA 2EQUA 3J81E 2DXBA 5IN1A 4KT0E 1YIJQ 3G6EA 1D1CA 3QYHB 3UA6A 5LJ3d 2V8IA 1UHCA 1H8KA 1K0SA 1D3BA 1KQSP 1FMKA 4Y92A 2K3XA 4F14A 2ZPIB 1ZSZB 3FRNA 4MDXA 4XTUA 3G71Q 4BY6C 4M77A 4BE0A 1LVKA 4M77B 3OYFA 2I0NA 2QYZA 3S6WA 4A63B 1HK9A 4J8OA 3FB9A 3OB9A 4C92A 2JVVA 2EQJA 4E7LA 1KC8U 2K79A 4E7JA 2P0PA 2QA4A 2CSIA 1RAIB 1WHGA 4PL6A 3H6ZA 5ECAA 1KQSA 1V76A 1K0XA 1QKXA 1YITQ 1C6VX 1K8AU 5KYXB 1K9MR 3NPFA 2LRQA 2G3RA 3Q1JA 2OTLQ 1VIEA 4PJNA 2PNIA 4DEXA 3URGA 3CCMT 2NWMA 4LD6A 4M7AA 2KQWA 1SKUB 5KYNA 3MP6A 1WQ7A 2DZ9A 1VQPA 2QDLA 3MEAA 4HT9A 1SEMA 4PJLA 2X35A 2QK0A 4JPBW 2MPXC 1NZ9A 2FRWA 4KULA 3ASKA 1X6OA 1UG1A 4M77D 5LJ5e 2FEIA 3HL8A 4Z88A 1KFZA 1CKAA 3FLGA 4CC7A 2YRCA 3OSVA 4C92D 5GAN7 4QKUA 1JXOA 1WHJA 5D6YA 2MCNA 2LCLA 2NUPB 2GBQA 3C12A 3RMQA 3OYHA 2VVKA 3I56T 1UHFA 1HXDA 2CS7A 1VQKT 4J6XA 3UA7A 3CCEQ 4J9IA 1VYTA 3DKMA 1I5LA 3CCJA 4A4HA 3I55Q 2RJCA 3GP8A 3CPWP 3L1AA 2DBMA 3EFOA 1NG2A 3EFSA 1YI2Q 3CCVA 3A1PA 4J9FA 1AD5A 1RAFB 1Z9QA 3VYHB 4M7AD 2W0ZA 3LYIA 1YHQQ 4C0DB 3ZL7C 1RI0A 4J6WA 3OW2S 2F5TX 4KUDK 3HRSA 7AT1B 2JOYA 1M8VA 1WXTA 2M0YA 4E7HA 2ZPGB 3REBB 5LJ3g 2IVWA 5CO7A 3CPWA 2GFAA 1SPKA 1G3TA 1YJNA 1UE9A 4A53A 2ENMA 3X25B 1NLOC 1VOMA 2EJGA 2JZ2A 5I22A 3JAME 4KRTA 1RAHB 2RJDA 3PNWC 1VQNQ 4B6MA 3M0PA 4N4GA 1W6XA 3MP8A 3PIPA 2IPOB 4A54A 1C1AA 2FPDA 2QEXQ 5GAN5 1GXIE 2O9SA 2RI2A 2E5QA 1ARKA 1JRIA 5KYUA 5GMKi 2WACA 5KYUB 1Q95G 3LH0A 3VS0A 2LC4A 4RTVA 5A0GA 1JB0E 2H3EB 3VS6A 1YJWT 2R57A 3CC2A 1IXDA 5GMKl 4JJDA 4B9XA 4M75C 1T3LA 1OU9A 3QWYA 2GF7A 5CIUA 2EWNA 4M7DC 5J39A 3KUFA 2JXBA 5AYFA 5IH2A 3V8JA 3S3NA 5KCHA 3EG0A 1J3TA 2IIMA 4OP0A 3EHRA 3U23A 3QZ9B 4DBFA 2DXCA 1WDXA 2GTOA 3FJPA 4ZGDB 3N5BB 1WXUA 5LL6S 1N8RR 2VXEA 2JUFA 3VS4A 2D8JA 2DL8A 3VJPA 2E65A 4A4GA 1VA7A 3CCLQ 4UC4A 4B9WA 2VXFA 5HY6A 2FVUA 3RKXA 1E7OA 4OB1B 1AWWA 1RACB 4II1A 5D6WA 2K3BA 3PT9A 1IHWA 3FDRA 3VRYA 2M9UA 3TCJA 2RQRA 1NM7A 3JCMe 2LQ8A 2AKLA 4Y91A 1N9RA 5GANj 1KSWA 2Y4YA 4GLKA 3LH5A 2MIOA 2RK1A 1KIKA 3TSZA 4J9HA 3CMEQ 3UATA 3EAEA 1UJ0A 5GJVB 8AT1B 1Y96B 1ZUYA 4ANJA 4PK4A 2K3YA 1TS9A 2PVGB 4HVUA 3SWNB 1PD0A 2AKKA 3JB9I 3OYCA 1M2VA 1K1ZA 2MWPA 2X9HA 1K9AA 1M2VB 4GLMA 4PFZA 1NEBA 2KVQG 1N5ZA 1VYUA 2RJEA 3L42A 5D6XA 5IAYA 5GAMj 3C94A 3FC3A 1FMVA 2JT4A 2J6FA 3CBMA 3G4SQ 4RTXA 2NLUA 2FB7A 2EBPA 1BK2A 2GTJA 2V8KA 4BDYA 2ZPEB 3M56A 2DL4A 3META 2DL5A 4N4HA 1KQSS 1D1AA 1NYGA 3DB4A 2KBTA 3CCST 2CUDA 3CBOA 3EG2A 2FZGB 2M1HA 2J6KA 1KD1R 1PRMC 1B34A 3H0IA 3QXEB 2YHTA 3VUBA 3CCUQ 1B34B 2PU9B 3QKJA 2V26A 1R0CB 4M75A 2X51A 2KYBA 2XU8A 3E19A 1Q7YU 2L3QA 3VKIA 3L2ZA 1WJSA 1R8OB 1RUWA 4XTYA 5AT1B 2HL3A 1KC8C 3CCQT 2FZKB 2LJ3A 1YN8A 1BKBA 2AT1B 2NYSA 2K4YA 3X26B 2B8AA 4P5NA 2H8HA 5DM7R 1K8AC 2QA4T 2SEMA 2J7IA 4R55A 1QVFP 2EGCA 3H41A 4EDUA 2B86A 1VQ4T 4LDYA 5FWBA 2LDMA 5J26A 4XTZA 4NOYA 2QGFB 4XTXA 2F2XA 3OYBA 2R5MA 3CC7T 2QTVA 3DB3A 3RIRA 2HMAA 2LJ0A 5IHIA 2I2LA 4RUGA 4XTVA 2VV5A 2EYQA 5GAMf 4JS5A 1X27A 4ELYC 2QQAA 2IG0A 1A0NB 4FSSA 3CCMQ 1QVFA 1BBZA 2Z0WA 2L3RA 2R58A 4JZ3A 2RH2A 1ZSZC 2GFUA 2QASA 3V8KA 1IRXA 3RBBB 4M75D 1ZBXA 2DVJA 4M77C 3G71A 2BZXA 4ZTFA 3R6OA 4BI4A 3GLXA 1OOTA 2RO0A 2VASA 3RKWA 2L0AA 3EGXA 3MJXA 3EGXB 3TREA 2O88A 2F5KA 2DERA 2CYZB 4A4FA 1W4SA 2LP5A 4QT7A 2RJFA 3CCRA 1Q81U 4PJOG 1Z9ZA 2PVDB 1YITA 3H0HA 4PJOF 3E2UA 3CPWS 5M9OA 2LMJA 4OMPA 3QPHA 4ESRA 1U5SA 5CR2A 2CP0A 2LT4A 2DIQA 3ME9A 2K7AA 2OTLA 4ZGJB 1HSQA 4IUUA 4EMHA 1N27A 3RERA 3I56Q 4E7KA 3LLRA 1VUBA 3H8ZA 4Q5WA 1VQKQ 4QVDA 1D0YA 2AHJB 5I2SA 1X43A 3SB2A 4PJOE 3PE0A 1UJYA 1NJIU 4NL3A 2HKQB 2KXCA 1Q82C 1LPLA 4Z8AA 1FWZA 2A3LA 2MMPA 4Y28E 2HEQA 2KXDA 5IXBA 4MZTA 1KQ1A 4LUDA 3HRTA 3QWXX 3RNJA 3OYEA 5HCKA 3JCMd 2DRKA 4L5GA 2X4JA 2D9TA 1KK7A 4Z02A 3J7AF 2RB6A 4E7SA 3LGLA 1YJNT 4IIMA 1G3WA 1XOVA 2E4HA 1IB8A 1BI2A 3PMIA 3VRZA 1Q86U 3PFSA 2ED0A 2BIVA 5GAN3 2K2VA 3L2UA 4M7DE 4JRKA 3A5ZB 4QVCA 5HK0A 4M78E 3E1SA 4Z89A 1YWOA 4LE9A 1M3CA 3HFOA 4V2SA 1WGSA 1PWTA 3JCMc 3CCEA 3CC4A 1S1NA 2ZPBB 4OF1A 4FCYA 2HKNA 2P84A 5GANe 3V8LA 1YI2A 2DNUA 1MHNA 1ZSZA 4C0DC 1VQ8T 2RF0A 3JCMh 1VQ7A 2X4YA 1YJWQ 1WX6A 2D8HA 2J6OA 4QQ6A 1U3OA 4GBQA 1W1FA 2AZSA 3WVEB 1Y57A 2E64A 2EIFA 2QQBA 1B7TA 2YRDA 4RTZA 1WHLA 1OQKA 2QG9B 2VB6A 2BTTA 2LQWA 1M90U 3M0SA 3HFNA 3MCAB 1F1BB 2L8DA 5J3BA 3UDCA 1KHCA 1PKSA 2HQEA 4RG8A 1S72T 2LTOA 3KBGA 1AWOA 5GAMe 4LDXA 2KRSA 2WSEE 1GBQA 5KYXA 3WXMB 5CKHA 5FRMA 3OYGA 2FG0A 2EYXA 2A7YA 1WZOA 1KHIA 2QEXA 2DD4A 5LJ3h 2EJ9A 2XG8D 4DBHA 1FMWA 2JM9A 3RKYA 1M27C 2DL3A 2DA9A 2FPFA 4LDWA 4JRIA 4RTWA 2DFUA 3MHXA 1WIEA 4OMNA 4OGCA 1SSHA 1MGQA 3M0UA 5GAN2 3VS1A 3QHSA 4ZNXA 3SDZA 4FT4A 4E6RA 3OA6A 1M1FA 3JCMW 3CXCP 3E9FA 4FL6A 3KXTA 2YUOA 2E6ZA 1RAAB 4J9BA 1H3HA 2Y4XA 4JDSA 1WFWA 2OTJT 1AT1B 1M8MA 4OGEA 2JTFA 4C0ZA 4CC4B 3M54A 4DOVA 2DE0X 1UTIA 4EMKB 3OYAA 5DLQE 1Y7XA 1OPKA 1MMNA 1OZ3A 2QAZA 1MNEA 2NUPA 1K9MU 4DBRA 4RMOA 1TSFA 1VQ9A 4IUTA 2KNBB 1VQOT 3HRUA 1G5VA 2FRYA 1MMGA 1Y71A 1NYFA 2MI6A 1Q82R 3CCLA 3JCMg 4C5GA 1LNXA 2DLPA 1M3AA 2HD0A 4D8KA 1PNJA 2XICA 1ZX6A 1Q7YC 3OMCA 1WA7A 1U8RA 2MWOA 1YCSB 2KAFA 3P8BB 5GJWB 1ABQA 3EFRA 3CCSQ 2CH4A 4IKFA 3A8LB 2P4TA 1SSFA 3CMEA 5LJ3f 1RLPC 3JB9G 1JQQA 4K11A 3JB9F 1AZEA 3INZA 4L59A 4PFOA 1VQ5A 1AOJA 4X34A 3SWNC 3C0CA 1QVFS 4F7UG 1K76A 4RTUA 3SD4A 3I9QA 4F7UF 1RL2A 1CSKA 4C92F 1K73U 3OYYA 1AEYA 1ZBJA 3CCQQ 4LDUA 3M0RA 4BY6B 3O5ZA 1H3ZA 3T9NA 2V1RA 3BE3A 4FW2A 2E10A 1CKBA 2QA4Q 1M1KU 4HCZA 2YWWA 3VV0A 2DXTA 4F7UE 3PIOA 1VQ4Q 4QVZA 4C92E 2E3HA 2EKOA 4DBQA 5DY9A 1JJ2P 2LT1A 2DJZA 1AWJA 3JCMJ 3CD6T 3CC7Q 4J7FA 3WVDB 2J05A 3BFMA 3GPLA 2YT6A 2BKDN 3PVQA 1VQLA 2DYBA 2YDLA 2CZ7B 2NUTB 1M3BA 3FEOA 3QYGB 3CCUA 2BE9B 4QQDA 1BU1A 1OX8A 3O8VA 1BIAA 3J80E 2JS2A 3C4SA 1TWBA 2M0OA 1JJ2A 2LQNA 4LXCA 4OB2B 4IUPA 3JCMV 5GAN6 4FYYB 3PVLA 1PG5B 4M7AE 2GGRA 2KDSA 3HHTB 2XK0A 1QVGP 2DO3A 1Q81C 1NEGA 2E70A 2RI5A 2JMCA 3BY7A 4C8QG 2KE9A 4BACA 1GCQC 1NE8A 2K57A 2BE7D 2XI9A 4C8QF 2XIDA 1BYMA 2H3JA 3IQLA 3CCRT 1E6HA 1TH7A 2DILA 2DAQA 2PUOB 1AZGB 2OJ2A 2KY9A 5I2MA 2K2MA 2RMOA 2RA2A 2LNHB 1TOVA 1BI1A 3THKA 2BZYA 2FHDA 2PTKA 2SRCA 6AT1B 1U1TA 1JEGA 5GMKh 1I5OB 4N0AA 5FW9A 1NJIC 4C5EA 2CZ1B 2KEAA 1GFDA 3RESA 4AG1C 2EW3A 2HNIA 2QDYB 4C8QE 1I4K1 3CQTA 3CCMA 2K6DA 3EG1A 1Y96A 1EZZB 1JU5C 1YJ9A 1QP2A 3SWNA 2ZPHB 1BB9A 4RCBA 3C95A 4ZTJA 3OYLA 1NPPA 5CAIA 2GQVA 4MMKA 2JMAA 4ZN1A 4R56A 3QBYA 1MMDA 2DZCA 3CPFA 1XQHA 1Q86C 1N8RU 2LZ6B 1BI3A 4AMCA 1Q7YR 2QXFA 4JLGA 3CMAA 1YJNQ 3QUIA 5CKDA 2KR3A 4ORZA 1EFNA 1UEBA 5LJ5d 3M0QA 1BCOA 3I35A 1VQ6T 4JJBA 2CP5A 2DTHA 3VS5A 1VQMA 4PJOA 1LOJA 4EMGA 4PJOB 1Y07A 3CC4T 5KCOA 3OMGA 3G6ET 5KE2A 4BB7A 1B3QA 2YXYA 4AT1B 1IZ6A 3I5RA 4CRIA 3L2WA 5C6SA 3EGDB 1VQ7T 1OZ2A 3S3OA 5KH6A 3RUXA 3M4YA 1X6GA 3LWIA 1VQ8Q 3M4GA 2KT8A 2JJ9A 1BCMA 1X69A 2EYWA 5L8RE 2EPDA 3L2VA 4CC2A 1QWFA 3G1JA 4BD3A 2COWA 2FPEA 5A0LA 1E6GA 1FX7A 2AIRB 4M7DB 2DYIA 3UT1A 2DRMA 1GCQA 5LJ5h 4M78B 4RTTA 5KYYB 4FSXA 3UF4A 2E41A 1S72Q 2K5FA 5CQXA 2VWFA 4A4EA 1T0HA 4MMLA 3TEEA 1KD1U 1EX4A 2ZCFB 4CI0C 3CXCS 2FO0A 3VU3C 4XU2A 3D7SB 4J9GA 5FU7B 1IGUA 3OYKA 2EQIA 1YIJA 2XDPA 2K9GA 2C06A 1HYOA 1W2BP 4PJOD 5GAOm 4PLIA 4OB0B 2HBWA 1VQPT 2QTXA 4MZPA 4VUBA 1GL5A 2AZVA 2X4XA 3NMZC 4FU6A 2BZ8A 2LX9A 2KMTA 1IHVA 2RM4A 1ACMB 2DVEA 1OI1A 2RPNA 2VGMA 1NPRA 2RQWA 4HT8A 5CKBA 5GAN4 4CC3A 4FW1A 2OTJQ 3ZBDA 1K9MC 2QQSA 1PSEA 3QDFA 4BI8B 5FROA 1RAEB 4E7IA 1GFCA 2DETA 1I0CA 2PUKB 5GAOq 4J6YA 2L3PA 2C0TA 4LD9K 3QSUA 2QQ9A 3RMSA 2ZZDA 3VUZA 3HP9A 1SHGA 1VQ9T 2XD0A 1BIBA 4GY5A 4C0FA 2LNVA 4WF2A 1OYXA 3QG1A 3NHNA 4DA4A 4WCIA 3JSCA 2JN0A 2EGEA 4HA8A 2M02A 4F17A 4LN2A 4OVAA 2CP6A 4DEYA 1VQOQ 2OX7A 2LQKA 3BW1A 3V7RA 1MMAA 1YFNA 5FWCA 5IHNA 3CCJT 4OMQA 2E12A 5LJ5f 3X20B 2CP7A 1TG0A 1K4US 3G7ZA 3TSWA 1GCPA 3CCVT 3L2QA 3OS1A 4PJMA 5KYWB 1QW1A 5FLXE 2EFIA 2D1XA 2DTIA 2DM1A 3AT1B 5LJ5g 2WSCE 4ZGEB 1KG1A 3OS2A 2DBKA 3LGFA 4M7DG 2CT4A 1K73C 4M7DF 1VQ5T 4M78G 2HQHA 4M78F 2R5AA 2HCKA 2V8JA 1HJDA 4KGVB 2DTOA 4E2FB 2HBPA 4EMKC 2GQIA 2JTMA 4M75E 2RHXA 4XK8E 1M1KC 1SG5A 1JJ2S 1XNIA 2D6FA 3PMTA 4L6V5 2XKOC 3MEWA 2MYSA 4JS4A 2YUNA 2NUZA 3VYGA 4JJNK 1SRMA 4EPCA 4ME7A 1WHHA 1R0BG 3A8GB 2F2WA 2XDBA 4N4IA 1D0XA 3RR6A 2EAYA 1KC8R 1TUGB 2EKHA 2CGHA 2RQTA 2L89A 2D0QB 2MOXA 5I21A 3I55A 2G6FX 4JRPA 3GF5A 3NTKA 1ZUKA 4QQGA 3NFCA 2XDDA 2YSQA 3LWHA 1K8AR 1M5Q1 1OV3A 3CC2T 1VQLT 3CD6Q 5IHKA 1QP3A 3CCSA 4AFQC 1YHQA 1I07A 1QVGS 3S3MA 2LCSA 2EQMA 2A36A 2YLCA 5IT9E 2XHCA 4LDVA 3UPUA 1O9SA 1HD3A 3L2RA 1D3BB 2E5KA 2K5IA 1GRIA 3M57A 3JCMb 3OYNA 2FYKA 2EQKA 3M53A 3CCQA 3JCMQ 4IUVA 1PHTA 2CKKA 2DJQA 1VQNA 1TUDA 4R0KA 3MO8A 4F7UA 4XU3A 1D09B 4F7UB 2V1QA 4C92B 1FXXA 2J06A 3OBWA 1G2BA 1ZA1B 4BE1A 2VKNA 3SHWA 5LJ3j 1VQ4A 2KYMA 4LNPA 5CK9A 3VS2A 3CCRQ 2KRNA 4X1VA 2W10A 1H92A 4LUEA 1SHFA 3SFMA 3MP1A 1Y0MA 3CC7A 4JRQA 3GIBA 2EYYA 1MV3A 1UFFA 3QIIA 4KUIA 1RADB 3ER0A 2DL7A 2JW4A 1ZHIA 5FU6B 5D7UA 2O31A 1YJ9T 1QCFA 4M7AB 1NLPC 1VYVA 1WHKA 2JM8A 3A8HB 2C0IA 2QQRA 1N8RC 2F1LA 4AFUC 3QZ5B 4EMKA 2GCXA 4KGXB 5KE3A 1BI0A 2QGGA 5CQYA 3GNGA 2KROA 1PCXA 4KBMB 1B07A 1M30A 3OBYA 3JCMf 4XU1A 1KQ2A 1X2KA 3V7CA 3CXCA 1IGQA 1PKTA 3JB9D 3TU4K 1AWXA 4X9DA 3OS0A 1JO8A 3CMAT 4OMLA 1AHJB 1GBRA 4O6JA 4XU0A 1ZA2B 4RTYA 1WJRA 4D6WA 2HZYA 1PM3A 3A8OB 3JV3A 2KRMA 1K73R 1LJOA 5CKEA 2RN8A 3EH1A 4C8QA 2O01E 5I11A 4C8QB 4BDZA 1UECA 4N0AC 2LJ1A 1VQMT 1WYXA 5A0DA 3EH2A 2X4WA 3AHUA 1YP5A 1VQ6Q 2YUPA 1V1CA 1ZUUA 1TU0B 1RAGB 2HDAA 3VS7A 2VYTA 1M1KR 2EGAA 2RHZA 3CC4Q 2KSSA 2PQWA 3G6EQ 3NTIA 3HTRA 1AVZC 3M0TA 2HSPA 4FIBA 2A0FB 1C0MA 4M77G 4F16A 4M77F 3EFOB 3ZFJA 4XTWA 4C92G 4AFSC 4RCCA 1VQ7Q 4DOWA 1G3YA 2RQUA 3P8DA 2AK5A 3ULRB 4X9CA 5HK3A
chains in the Genus database with same CATH topology
1W2BP 2OTJQ 3CXCP 1VQMQ 1VQOQ 1K73R 3CCJQ 1VQ5Q 3I55Q 1Q81R 2OTLQ 3CPWP 1Q7YR 1KD1R 3CC2Q 1YJ9Q 1VQLQ 1VQ8Q 3CMAQ 2QEXQ 2QA4Q 3OW2P 1QVGP 1KQSP 1S72Q 3G4SQ 3I56Q 3CCUQ 1VQ9Q 1K8AR 1YI2Q 1NJIR 1YJNQ 3CCVQ 1VQ4Q 1VQKQ 1N8RR 3CCRQ 3CD6Q 1VQ7Q 3G71Q 1YHQQ 1YITQ 1VQ6Q 1JJ2P 3CCSQ 3CCQQ 1YJWQ 1Q86R 1Q82R 3CCLQ 1QVFP 1VQNQ 1KC8R 1M1KR 3CMEQ 3CC7Q 3CC4Q 1YIJQ 1K9MR 3CCEQ 3CCMQ 1M90R 3G6EQ 1VQPQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B P;  2OTJ Q;  3CXC P;  1VQM Q;  1VQO Q;  1K73 R;  3CCJ Q;  1VQ5 Q;  3I55 Q;  1Q81 R;  2OTL Q;  3CPW P;  1Q7Y R;  1KD1 R;  3CC2 Q;  1YJ9 Q;  1VQL Q;  1VQ8 Q;  3CMA Q;  2QEX Q;  2QA4 Q;  3OW2 P;  1QVG P;  1KQS P;  1S72 Q;  3G4S Q;  3I56 Q;  3CCU Q;  1VQ9 Q;  1K8A R;  1YI2 Q;  1NJI R;  1YJN Q;  3CCV Q;  1VQ4 Q;  1VQK Q;  1N8R R;  3CCR Q;  3CD6 Q;  1VQ7 Q;  3G71 Q;  1YHQ Q;  1YIT Q;  1VQ6 Q;  1JJ2 P;  3CCS Q;  3CCQ Q;  1YJW Q;  1Q86 R;  1Q82 R;  3CCL Q;  1QVF P;  1VQN Q;  1KC8 R;  1M1K R;  3CME Q;  3CC7 Q;  3CC4 Q;  1YIJ Q;  1K9M R;  3CCE Q;  3CCM Q;  1M90 R;  3G6E Q;  1VQP Q; 
#chains in the Genus database with same CATH topology
 3OQ5 A;  1M2O A;  4KH0 B;  1Q82 U;  2L2P A;  1TUC A;  1ZLM A;  4M77 E;  1O75 A;  3QJ6 A;  4FYX B;  1FYN A;  3G4S A;  2CZ0 B;  2F2V A;  1KD1 C;  2DIG A;  2LVM A;  4DQ2 A;  1W2B S;  5GAO r;  4TVR A;  2LCC A;  3OYM A;  1QQJ A;  2MF2 A;  5GAO l;  2MAM A;  3GNF B;  5CCA A;  1JXM A;  1RI9 A;  2RD1 A;  4PJO C;  4M7A G;  2KT1 A;  4ZN3 A;  4M7A F;  2CP2 A;  4C8Q D;  2RI3 A;  1YIJ T;  2NUT A;  4OMO A;  2DD5 A;  2ATC B;  3BDU A;  2JTE A;  3PGG A;  5DLO A;  5C0M A;  9ATC B;  1YNZ A;  1WPY A;  4JLI A;  5FRN A;  2MK5 A;  4NS5 A;  3GBQ A;  3G71 T;  2DX1 A;  3M5A A;  1VQP Q;  2P4R A;  3MPU B;  1TTH B;  2KI7 A;  1VQ8 A;  1LCK A;  1T3S A;  5GAN d;  1ABO A;  4BI3 A;  3BDL A;  3I5S A;  1QWE A;  3M59 A;  2DK3 A;  2Y90 A;  1I81 A;  1PD1 A;  2PZ1 A;  4ATO A;  4PLL A;  4M78 C;  5A2Q E;  1YIT T;  1QMC A;  2RNA A;  2KK4 A;  1QCN A;  3CEY A;  4MZM A;  1S72 A;  1P92 A;  4O5V A;  1EIF A;  1I1J A;  1VQ9 Q;  4E7Z A;  2OTL T;  1QVG A;  5GMK j;  3EG3 A;  4OMF B;  4YTL A;  5FU7 C;  4HKE A;  3FJ5 A;  5EG2 A;  5GAM d;  1WHM A;  2JS0 A;  2FZC B;  2ED1 A;  1OUL A;  2DMO A;  3VS3 A;  2E3I A;  1PC0 A;  3CCJ Q;  2XMF A;  1TXQ A;  5GAN 8;  4MDW A;  2D0N A;  2BUD A;  3UWN A;  3EGU A;  2ESW A;  4M4Z A;  3TQ7 P;  5GAN h;  3CCV Q;  2A08 A;  3NGP A;  3R6N A;  1YCY A;  3V7S A;  5GAO n;  4C5H A;  2HQX A;  4C0G A;  1QLY A;  4IIO A;  3PTA A;  2OTJ A;  2F69 A;  2LX7 A;  1VQ5 Q;  1KJW A;  4C5I A;  1G3S A;  1UGS B;  2A37 A;  1WJQ A;  2CT3 A;  1VIF A;  1W70 A;  1XTD A;  1UGV A;  3X24 B;  2C0O A;  4J5Y A;  5GAM h;  5LJ3 e;  2EYZ A;  3CBP A;  1VQO A;  3LX7 A;  2CH4 W;  1M9S A;  2ZPF B;  3CCE T;  1RAB B;  1RLQ C;  1H64 1;  3I56 A;  1N9S A;  2GNC A;  1WLP B;  2A28 A;  1MND A;  3MEU A;  3I55 T;  2ROT A;  2EVR A;  8ATC B;  1VQK A;  1IO6 A;  1OX9 A;  2O9V A;  2CUB A;  3JB9 J;  1YI2 T;  3EGD A;  2HSE B;  1U06 A;  1V29 B;  1YHQ T;  4RG2 A;  2OAU A;  3CC2 Q;  4XAX B;  2K5L A;  2FL7 A;  4PFP A;  4HVW A;  3GOX A;  1M90 C;  1DJ7 B;  1D1B A;  3FIF A;  1VQL Q;  2M51 A;  2DPP B;  2QI2 A;  2CZ6 B;  2L3S A;  4M75 B;  3JCM X;  3M58 A;  2COY A;  1YBY A;  1M1G A;  4HCB A;  4JUV A;  2KGT A;  4IUR A;  3HPW A;  4BUG A;  4M7D A;  1OU8 A;  2RHY A;  2HL5 C;  2PVO B;  3H9N A;  4M78 A;  5HKC A;  5LJ5 j;  5KYY A;  5GAN f;  2DKG A;  3OY9 A;  1VQN T;  3M55 A;  1WI7 A;  2CRE A;  4D8D A;  3RDV A;  3OW2 P;  1WNL A;  1U1S A;  2CP3 A;  3DLM A;  2O4X A;  3SEM A;  2O4X B;  2QEX T;  4QW2 A;  5GAN g;  1X2Q A;  3E9G A;  1UGQ B;  2HAX A;  4AFZ C;  1X6B A;  4IUQ A;  4PKC C;  3DLL A;  2CSQ A;  1Q81 R;  2ABL A;  4J83 A;  5EC7 A;  2YRV A;  3M9Q A;  1MV0 B;  3JCM P;  1WQW A;  2E6N A;  3OW2 A;  2O2O A;  3CD6 A;  3QO3 A;  2VUB A;  1ZQ1 A;  1YJW A;  2P0Q A;  1OEB A;  4HCK A;  2VC8 A;  4BE2 A;  3OYJ A;  1T0J A;  1OPL A;  5CKF A;  4OMM A;  5GAM g;  3QJY A;  3OSS C;  3ZEH A;  4FYV B;  1ZSG A;  1YJ9 Q;  4WTO B;  4OB3 B;  1D0Z A;  1W2B A;  3QDR B;  2YUQ A;  4FM4 B;  1UB4 A;  1NJI R;  1R77 A;  2COZ A;  2CDT A;  4PJJ A;  2EJF A;  5GMK m;  3F70 A;  3X28 B;  1PSF A;  3LW5 E;  4M7D D;  1X75 C;  4FT2 A;  4NL2 A;  4C92 C;  3A8M B;  4M78 D;  3P8H A;  2RK2 A;  2WSF E;  3CCL T;  3MKD A;  4JZ4 A;  3OYD A;  1JBM A;  3NTH A;  4EIK A;  2ZAE A;  3CMA Q;  2OAW A;  5GAO p;  1UDL A;  1UGR B;  4HCC A;  3KFV A;  1X01 A;  4KGZ B;  4J9E A;  1I8F A;  5L23 A;  1Q86 R;  1SRL A;  2M16 A;  5CVI A;  4KH1 B;  1UUE A;  1IRE B;  3JB9 H;  4M75 G;  5KYW A;  2RQV A;  4M75 F;  1G8X A;  1M4Z A;  1VQM Q;  3JRZ A;  1MUZ A;  2X3W D;  4RKU E;  3CME T;  1NBE B;  4XQ3 A;  1WXB A;  5FU6 C;  4J9D A;  2ECZ A;  4M7A C;  1QKW A;  2RHU A;  1UGP B;  4JJC A;  3MEV A;  4J9C A;  2VGN A;  1QVP A;  1PRL C;  3EG9 A;  2DF6 A;  2DXU A;  3EG9 B;  3EHQ A;  4J7I A;  4ELZ C;  3A98 A;  3OYI A;  2L5Q A;  4F04 B;  2DEQ A;  4FYW B;  4HXJ A;  3G4S T;  4HVV A;  2JNG A;  3OS5 A;  2DEU A;  2ROL A;  1M90 R;  4E47 A;  4A4K A;  2YLB A;  3REA B;  1YWP A;  4C8Q C;  2E1H A;  1G83 A;  3HKS A;  5GMK e;  3H0F A;  2P0K A;  2X3X D;  1XJW B;  1QCO A;  2OI3 A;  1N6A A;  2ZGW A;  1VQ6 A;  3HSB A;  5IXF A;  3CCU T;  4PNO A;  4AG2 C;  2RHI A;  1SF9 A;  3TVT A;  2EQU A;  3J81 E;  2DXB A;  5IN1 A;  4KT0 E;  1YIJ Q;  3G6E A;  1D1C A;  3QYH B;  3UA6 A;  5LJ3 d;  2V8I A;  1UHC A;  1H8K A;  1K0S A;  1D3B A;  1KQS P;  1FMK A;  4Y92 A;  2K3X A;  4F14 A;  2ZPI B;  1ZSZ B;  3FRN A;  4MDX A;  4XTU A;  3G71 Q;  4BY6 C;  4M77 A;  4BE0 A;  1LVK A;  4M77 B;  3OYF A;  2I0N A;  2QYZ A;  3S6W A;  4A63 B;  1HK9 A;  4J8O A;  3FB9 A;  3OB9 A;  4C92 A;  2JVV A;  2EQJ A;  4E7L A;  1KC8 U;  2K79 A;  4E7J A;  2P0P A;  2QA4 A;  2CSI A;  1RAI B;  1WHG A;  4PL6 A;  3H6Z A;  5ECA A;  1KQS A;  1V76 A;  1K0X A;  1QKX A;  1YIT Q;  1C6V X;  1K8A U;  5KYX B;  1K9M R;  3NPF A;  2LRQ A;  2G3R A;  3Q1J A;  2OTL Q;  1VIE A;  4PJN A;  2PNI A;  4DEX A;  3URG A;  3CCM T;  2NWM A;  4LD6 A;  4M7A A;  2KQW A;  1SKU B;  5KYN A;  3MP6 A;  1WQ7 A;  2DZ9 A;  1VQP A;  2QDL A;  3MEA A;  4HT9 A;  1SEM A;  4PJL A;  2X35 A;  2QK0 A;  4JPB W;  2MPX C;  1NZ9 A;  2FRW A;  4KUL A;  3ASK A;  1X6O A;  1UG1 A;  4M77 D;  5LJ5 e;  2FEI A;  3HL8 A;  4Z88 A;  1KFZ A;  1CKA A;  3FLG A;  4CC7 A;  2YRC A;  3OSV A;  4C92 D;  5GAN 7;  4QKU A;  1JXO A;  1WHJ A;  5D6Y A;  2MCN A;  2LCL A;  2NUP B;  2GBQ A;  3C12 A;  3RMQ A;  3OYH A;  2VVK A;  3I56 T;  1UHF A;  1HXD A;  2CS7 A;  1VQK T;  4J6X A;  3UA7 A;  3CCE Q;  4J9I A;  1VYT A;  3DKM A;  1I5L A;  3CCJ A;  4A4H A;  3I55 Q;  2RJC A;  3GP8 A;  3CPW P;  3L1A A;  2DBM A;  3EFO A;  1NG2 A;  3EFS A;  1YI2 Q;  3CCV A;  3A1P A;  4J9F A;  1AD5 A;  1RAF B;  1Z9Q A;  3VYH B;  4M7A D;  2W0Z A;  3LYI A;  1YHQ Q;  4C0D B;  3ZL7 C;  1RI0 A;  4J6W A;  3OW2 S;  2F5T X;  4KUD K;  3HRS A;  7AT1 B;  2JOY A;  1M8V A;  1WXT A;  2M0Y A;  4E7H A;  2ZPG B;  3REB B;  5LJ3 g;  2IVW A;  5CO7 A;  3CPW A;  2GFA A;  1SPK A;  1G3T A;  1YJN A;  1UE9 A;  4A53 A;  2ENM A;  3X25 B;  1NLO C;  1VOM A;  2EJG A;  2JZ2 A;  5I22 A;  3JAM E;  4KRT A;  1RAH B;  2RJD A;  3PNW C;  1VQN Q;  4B6M A;  3M0P A;  4N4G A;  1W6X A;  3MP8 A;  3PIP A;  2IPO B;  4A54 A;  1C1A A;  2FPD A;  2QEX Q;  5GAN 5;  1GXI E;  2O9S A;  2RI2 A;  2E5Q A;  1ARK A;  1JRI A;  5KYU A;  5GMK i;  2WAC A;  5KYU B;  1Q95 G;  3LH0 A;  3VS0 A;  2LC4 A;  4RTV A;  5A0G A;  1JB0 E;  2H3E B;  3VS6 A;  1YJW T;  2R57 A;  3CC2 A;  1IXD A;  5GMK l;  4JJD A;  4B9X A;  4M75 C;  1T3L A;  1OU9 A;  3QWY A;  2GF7 A;  5CIU A;  2EWN A;  4M7D C;  5J39 A;  3KUF A;  2JXB A;  5AYF A;  5IH2 A;  3V8J A;  3S3N A;  5KCH A;  3EG0 A;  1J3T A;  2IIM A;  4OP0 A;  3EHR A;  3U23 A;  3QZ9 B;  4DBF A;  2DXC A;  1WDX A;  2GTO A;  3FJP A;  4ZGD B;  3N5B B;  1WXU A;  5LL6 S;  1N8R R;  2VXE A;  2JUF A;  3VS4 A;  2D8J A;  2DL8 A;  3VJP A;  2E65 A;  4A4G A;  1VA7 A;  3CCL Q;  4UC4 A;  4B9W A;  2VXF A;  5HY6 A;  2FVU A;  3RKX A;  1E7O A;  4OB1 B;  1AWW A;  1RAC B;  4II1 A;  5D6W A;  2K3B A;  3PT9 A;  1IHW A;  3FDR A;  3VRY A;  2M9U A;  3TCJ A;  2RQR A;  1NM7 A;  3JCM e;  2LQ8 A;  2AKL A;  4Y91 A;  1N9R A;  5GAN j;  1KSW A;  2Y4Y A;  4GLK A;  3LH5 A;  2MIO A;  2RK1 A;  1KIK A;  3TSZ A;  4J9H A;  3CME Q;  3UAT A;  3EAE A;  1UJ0 A;  5GJV B;  8AT1 B;  1Y96 B;  1ZUY A;  4ANJ A;  4PK4 A;  2K3Y A;  1TS9 A;  2PVG B;  4HVU A;  3SWN B;  1PD0 A;  2AKK A;  3JB9 I;  3OYC A;  1M2V A;  1K1Z A;  2MWP A;  2X9H A;  1K9A A;  1M2V B;  4GLM A;  4PFZ A;  1NEB A;  2KVQ G;  1N5Z A;  1VYU A;  2RJE A;  3L42 A;  5D6X A;  5IAY A;  5GAM j;  3C94 A;  3FC3 A;  1FMV A;  2JT4 A;  2J6F A;  3CBM A;  3G4S Q;  4RTX A;  2NLU A;  2FB7 A;  2EBP A;  1BK2 A;  2GTJ A;  2V8K A;  4BDY A;  2ZPE B;  3M56 A;  2DL4 A;  3MET A;  2DL5 A;  4N4H A;  1KQS S;  1D1A A;  1NYG A;  3DB4 A;  2KBT A;  3CCS T;  2CUD A;  3CBO A;  3EG2 A;  2FZG B;  2M1H A;  2J6K A;  1KD1 R;  1PRM C;  1B34 A;  3H0I A;  3QXE B;  2YHT A;  3VUB A;  3CCU Q;  1B34 B;  2PU9 B;  3QKJ A;  2V26 A;  1R0C B;  4M75 A;  2X51 A;  2KYB A;  2XU8 A;  3E19 A;  1Q7Y U;  2L3Q A;  3VKI A;  3L2Z A;  1WJS A;  1R8O B;  1RUW A;  4XTY A;  5AT1 B;  2HL3 A;  1KC8 C;  3CCQ T;  2FZK B;  2LJ3 A;  1YN8 A;  1BKB A;  2AT1 B;  2NYS A;  2K4Y A;  3X26 B;  2B8A A;  4P5N A;  2H8H A;  5DM7 R;  1K8A C;  2QA4 T;  2SEM A;  2J7I A;  4R55 A;  1QVF P;  2EGC A;  3H41 A;  4EDU A;  2B86 A;  1VQ4 T;  4LDY A;  5FWB A;  2LDM A;  5J26 A;  4XTZ A;  4NOY A;  2QGF B;  4XTX A;  2F2X A;  3OYB A;  2R5M A;  3CC7 T;  2QTV A;  3DB3 A;  3RIR A;  2HMA A;  2LJ0 A;  5IHI A;  2I2L A;  4RUG A;  4XTV A;  2VV5 A;  2EYQ A;  5GAM f;  4JS5 A;  1X27 A;  4ELY C;  2QQA A;  2IG0 A;  1A0N B;  4FSS A;  3CCM Q;  1QVF A;  1BBZ A;  2Z0W A;  2L3R A;  2R58 A;  4JZ3 A;  2RH2 A;  1ZSZ C;  2GFU A;  2QAS A;  3V8K A;  1IRX A;  3RBB B;  4M75 D;  1ZBX A;  2DVJ A;  4M77 C;  3G71 A;  2BZX A;  4ZTF A;  3R6O A;  4BI4 A;  3GLX A;  1OOT A;  2RO0 A;  2VAS A;  3RKW A;  2L0A A;  3EGX A;  3MJX A;  3EGX B;  3TRE A;  2O88 A;  2F5K A;  2DER A;  2CYZ B;  4A4F A;  1W4S A;  2LP5 A;  4QT7 A;  2RJF A;  3CCR A;  1Q81 U;  4PJO G;  1Z9Z A;  2PVD B;  1YIT A;  3H0H A;  4PJO F;  3E2U A;  3CPW S;  5M9O A;  2LMJ A;  4OMP A;  3QPH A;  4ESR A;  1U5S A;  5CR2 A;  2CP0 A;  2LT4 A;  2DIQ A;  3ME9 A;  2K7A A;  2OTL A;  4ZGJ B;  1HSQ A;  4IUU A;  4EMH A;  1N27 A;  3RER A;  3I56 Q;  4E7K A;  3LLR A;  1VUB A;  3H8Z A;  4Q5W A;  1VQK Q;  4QVD A;  1D0Y A;  2AHJ B;  5I2S A;  1X43 A;  3SB2 A;  4PJO E;  3PE0 A;  1UJY A;  1NJI U;  4NL3 A;  2HKQ B;  2KXC A;  1Q82 C;  1LPL A;  4Z8A A;  1FWZ A;  2A3L A;  2MMP A;  4Y28 E;  2HEQ A;  2KXD A;  5IXB A;  4MZT A;  1KQ1 A;  4LUD A;  3HRT A;  3QWX X;  3RNJ A;  3OYE A;  5HCK A;  3JCM d;  2DRK A;  4L5G A;  2X4J A;  2D9T A;  1KK7 A;  4Z02 A;  3J7A F;  2RB6 A;  4E7S A;  3LGL A;  1YJN T;  4IIM A;  1G3W A;  1XOV A;  2E4H A;  1IB8 A;  1BI2 A;  3PMI A;  3VRZ A;  1Q86 U;  3PFS A;  2ED0 A;  2BIV A;  5GAN 3;  2K2V A;  3L2U A;  4M7D E;  4JRK A;  3A5Z B;  4QVC A;  5HK0 A;  4M78 E;  3E1S A;  4Z89 A;  1YWO A;  4LE9 A;  1M3C A;  3HFO A;  4V2S A;  1WGS A;  1PWT A;  3JCM c;  3CCE A;  3CC4 A;  1S1N A;  2ZPB B;  4OF1 A;  4FCY A;  2HKN A;  2P84 A;  5GAN e;  3V8L A;  1YI2 A;  2DNU A;  1MHN A;  1ZSZ A;  4C0D C;  1VQ8 T;  2RF0 A;  3JCM h;  1VQ7 A;  2X4Y A;  1YJW Q;  1WX6 A;  2D8H A;  2J6O A;  4QQ6 A;  1U3O A;  4GBQ A;  1W1F A;  2AZS A;  3WVE B;  1Y57 A;  2E64 A;  2EIF A;  2QQB A;  1B7T A;  2YRD A;  4RTZ A;  1WHL A;  1OQK A;  2QG9 B;  2VB6 A;  2BTT A;  2LQW A;  1M90 U;  3M0S A;  3HFN A;  3MCA B;  1F1B B;  2L8D A;  5J3B A;  3UDC A;  1KHC A;  1PKS A;  2HQE A;  4RG8 A;  1S72 T;  2LTO A;  3KBG A;  1AWO A;  5GAM e;  4LDX A;  2KRS A;  2WSE E;  1GBQ A;  5KYX A;  3WXM B;  5CKH A;  5FRM A;  3OYG A;  2FG0 A;  2EYX A;  2A7Y A;  1WZO A;  1KHI A;  2QEX A;  2DD4 A;  5LJ3 h;  2EJ9 A;  2XG8 D;  4DBH A;  1FMW A;  2JM9 A;  3RKY A;  1M27 C;  2DL3 A;  2DA9 A;  2FPF A;  4LDW A;  4JRI A;  4RTW A;  2DFU A;  3MHX A;  1WIE A;  4OMN A;  4OGC A;  1SSH A;  1MGQ A;  3M0U A;  5GAN 2;  3VS1 A;  3QHS A;  4ZNX A;  3SDZ A;  4FT4 A;  4E6R A;  3OA6 A;  1M1F A;  3JCM W;  3CXC P;  3E9F A;  4FL6 A;  3KXT A;  2YUO A;  2E6Z A;  1RAA B;  4J9B A;  1H3H A;  2Y4X A;  4JDS A;  1WFW A;  2OTJ T;  1AT1 B;  1M8M A;  4OGE A;  2JTF A;  4C0Z A;  4CC4 B;  3M54 A;  4DOV A;  2DE0 X;  1UTI A;  4EMK B;  3OYA A;  5DLQ E;  1Y7X A;  1OPK A;  1MMN A;  1OZ3 A;  2QAZ A;  1MNE A;  2NUP A;  1K9M U;  4DBR A;  4RMO A;  1TSF A;  1VQ9 A;  4IUT A;  2KNB B;  1VQO T;  3HRU A;  1G5V A;  2FRY A;  1MMG A;  1Y71 A;  1NYF A;  2MI6 A;  1Q82 R;  3CCL A;  3JCM g;  4C5G A;  1LNX A;  2DLP A;  1M3A A;  2HD0 A;  4D8K A;  1PNJ A;  2XIC A;  1ZX6 A;  1Q7Y C;  3OMC A;  1WA7 A;  1U8R A;  2MWO A;  1YCS B;  2KAF A;  3P8B B;  5GJW B;  1ABQ A;  3EFR A;  3CCS Q;  2CH4 A;  4IKF A;  3A8L B;  2P4T A;  1SSF A;  3CME A;  5LJ3 f;  1RLP C;  3JB9 G;  1JQQ A;  4K11 A;  3JB9 F;  1AZE A;  3INZ A;  4L59 A;  4PFO A;  1VQ5 A;  1AOJ A;  4X34 A;  3SWN C;  3C0C A;  1QVF S;  4F7U G;  1K76 A;  4RTU A;  3SD4 A;  3I9Q A;  4F7U F;  1RL2 A;  1CSK A;  4C92 F;  1K73 U;  3OYY A;  1AEY A;  1ZBJ A;  3CCQ Q;  4LDU A;  3M0R A;  4BY6 B;  3O5Z A;  1H3Z A;  3T9N A;  2V1R A;  3BE3 A;  4FW2 A;  2E10 A;  1CKB A;  2QA4 Q;  1M1K U;  4HCZ A;  2YWW A;  3VV0 A;  2DXT A;  4F7U E;  3PIO A;  1VQ4 Q;  4QVZ A;  4C92 E;  2E3H A;  2EKO A;  4DBQ A;  5DY9 A;  1JJ2 P;  2LT1 A;  2DJZ A;  1AWJ A;  3JCM J;  3CD6 T;  3CC7 Q;  4J7F A;  3WVD B;  2J05 A;  3BFM A;  3GPL A;  2YT6 A;  2BKD N;  3PVQ A;  1VQL A;  2DYB A;  2YDL A;  2CZ7 B;  2NUT B;  1M3B A;  3FEO A;  3QYG B;  3CCU A;  2BE9 B;  4QQD A;  1BU1 A;  1OX8 A;  3O8V A;  1BIA A;  3J80 E;  2JS2 A;  3C4S A;  1TWB A;  2M0O A;  1JJ2 A;  2LQN A;  4LXC A;  4OB2 B;  4IUP A;  3JCM V;  5GAN 6;  4FYY B;  3PVL A;  1PG5 B;  4M7A E;  2GGR A;  2KDS A;  3HHT B;  2XK0 A;  1QVG P;  2DO3 A;  1Q81 C;  1NEG A;  2E70 A;  2RI5 A;  2JMC A;  3BY7 A;  4C8Q G;  2KE9 A;  4BAC A;  1GCQ C;  1NE8 A;  2K57 A;  2BE7 D;  2XI9 A;  4C8Q F;  2XID A;  1BYM A;  2H3J A;  3IQL A;  3CCR T;  1E6H A;  1TH7 A;  2DIL A;  2DAQ A;  2PUO B;  1AZG B;  2OJ2 A;  2KY9 A;  5I2M A;  2K2M A;  2RMO A;  2RA2 A;  2LNH B;  1TOV A;  1BI1 A;  3THK A;  2BZY A;  2FHD A;  2PTK A;  2SRC A;  6AT1 B;  1U1T A;  1JEG A;  5GMK h;  1I5O B;  4N0A A;  5FW9 A;  1NJI C;  4C5E A;  2CZ1 B;  2KEA A;  1GFD A;  3RES A;  4AG1 C;  2EW3 A;  2HNI A;  2QDY B;  4C8Q E;  1I4K 1;  3CQT A;  3CCM A;  2K6D A;  3EG1 A;  1Y96 A;  1EZZ B;  1JU5 C;  1YJ9 A;  1QP2 A;  3SWN A;  2ZPH B;  1BB9 A;  4RCB A;  3C95 A;  4ZTJ A;  3OYL A;  1NPP A;  5CAI A;  2GQV A;  4MMK A;  2JMA A;  4ZN1 A;  4R56 A;  3QBY A;  1MMD A;  2DZC A;  3CPF A;  1XQH A;  1Q86 C;  1N8R U;  2LZ6 B;  1BI3 A;  4AMC A;  1Q7Y R;  2QXF A;  4JLG A;  3CMA A;  1YJN Q;  3QUI A;  5CKD A;  2KR3 A;  4ORZ A;  1EFN A;  1UEB A;  5LJ5 d;  3M0Q A;  1BCO A;  3I35 A;  1VQ6 T;  4JJB A;  2CP5 A;  2DTH A;  3VS5 A;  1VQM A;  4PJO A;  1LOJ A;  4EMG A;  4PJO B;  1Y07 A;  3CC4 T;  5KCO A;  3OMG A;  3G6E T;  5KE2 A;  4BB7 A;  1B3Q A;  2YXY A;  4AT1 B;  1IZ6 A;  3I5R A;  4CRI A;  3L2W A;  5C6S A;  3EGD B;  1VQ7 T;  1OZ2 A;  3S3O A;  5KH6 A;  3RUX A;  3M4Y A;  1X6G A;  3LWI A;  1VQ8 Q;  3M4G A;  2KT8 A;  2JJ9 A;  1BCM A;  1X69 A;  2EYW A;  5L8R E;  2EPD A;  3L2V A;  4CC2 A;  1QWF A;  3G1J A;  4BD3 A;  2COW A;  2FPE A;  5A0L A;  1E6G A;  1FX7 A;  2AIR B;  4M7D B;  2DYI A;  3UT1 A;  2DRM A;  1GCQ A;  5LJ5 h;  4M78 B;  4RTT A;  5KYY B;  4FSX A;  3UF4 A;  2E41 A;  1S72 Q;  2K5F A;  5CQX A;  2VWF A;  4A4E A;  1T0H A;  4MML A;  3TEE A;  1KD1 U;  1EX4 A;  2ZCF B;  4CI0 C;  3CXC S;  2FO0 A;  3VU3 C;  4XU2 A;  3D7S B;  4J9G A;  5FU7 B;  1IGU A;  3OYK A;  2EQI A;  1YIJ A;  2XDP A;  2K9G A;  2C06 A;  1HYO A;  1W2B P;  4PJO D;  5GAO m;  4PLI A;  4OB0 B;  2HBW A;  1VQP T;  2QTX A;  4MZP A;  4VUB A;  1GL5 A;  2AZV A;  2X4X A;  3NMZ C;  4FU6 A;  2BZ8 A;  2LX9 A;  2KMT A;  1IHV A;  2RM4 A;  1ACM B;  2DVE A;  1OI1 A;  2RPN A;  2VGM A;  1NPR A;  2RQW A;  4HT8 A;  5CKB A;  5GAN 4;  4CC3 A;  4FW1 A;  2OTJ Q;  3ZBD A;  1K9M C;  2QQS A;  1PSE A;  3QDF A;  4BI8 B;  5FRO A;  1RAE B;  4E7I A;  1GFC A;  2DET A;  1I0C A;  2PUK B;  5GAO q;  4J6Y A;  2L3P A;  2C0T A;  4LD9 K;  3QSU A;  2QQ9 A;  3RMS A;  2ZZD A;  3VUZ A;  3HP9 A;  1SHG A;  1VQ9 T;  2XD0 A;  1BIB A;  4GY5 A;  4C0F A;  2LNV A;  4WF2 A;  1OYX A;  3QG1 A;  3NHN A;  4DA4 A;  4WCI A;  3JSC A;  2JN0 A;  2EGE A;  4HA8 A;  2M02 A;  4F17 A;  4LN2 A;  4OVA A;  2CP6 A;  4DEY A;  1VQO Q;  2OX7 A;  2LQK A;  3BW1 A;  3V7R A;  1MMA A;  1YFN A;  5FWC A;  5IHN A;  3CCJ T;  4OMQ A;  2E12 A;  5LJ5 f;  3X20 B;  2CP7 A;  1TG0 A;  1K4U S;  3G7Z A;  3TSW A;  1GCP A;  3CCV T;  3L2Q A;  3OS1 A;  4PJM A;  5KYW B;  1QW1 A;  5FLX E;  2EFI A;  2D1X A;  2DTI A;  2DM1 A;  3AT1 B;  5LJ5 g;  2WSC E;  4ZGE B;  1KG1 A;  3OS2 A;  2DBK A;  3LGF A;  4M7D G;  2CT4 A;  1K73 C;  4M7D F;  1VQ5 T;  4M78 G;  2HQH A;  4M78 F;  2R5A A;  2HCK A;  2V8J A;  1HJD A;  4KGV B;  2DTO A;  4E2F B;  2HBP A;  4EMK C;  2GQI A;  2JTM A;  4M75 E;  2RHX A;  4XK8 E;  1M1K C;  1SG5 A;  1JJ2 S;  1XNI A;  2D6F A;  3PMT A;  4L6V 5;  2XKO C;  3MEW A;  2MYS A;  4JS4 A;  2YUN A;  2NUZ A;  3VYG A;  4JJN K;  1SRM A;  4EPC A;  4ME7 A;  1WHH A;  1R0B G;  3A8G B;  2F2W A;  2XDB A;  4N4I A;  1D0X A;  3RR6 A;  2EAY A;  1KC8 R;  1TUG B;  2EKH A;  2CGH A;  2RQT A;  2L89 A;  2D0Q B;  2MOX A;  5I21 A;  3I55 A;  2G6F X;  4JRP A;  3GF5 A;  3NTK A;  1ZUK A;  4QQG A;  3NFC A;  2XDD A;  2YSQ A;  3LWH A;  1K8A R;  1M5Q 1;  1OV3 A;  3CC2 T;  1VQL T;  3CD6 Q;  5IHK A;  1QP3 A;  3CCS A;  4AFQ C;  1YHQ A;  1I07 A;  1QVG S;  3S3M A;  2LCS A;  2EQM A;  2A36 A;  2YLC A;  5IT9 E;  2XHC A;  4LDV A;  3UPU A;  1O9S A;  1HD3 A;  3L2R A;  1D3B B;  2E5K A;  2K5I A;  1GRI A;  3M57 A;  3JCM b;  3OYN A;  2FYK A;  2EQK A;  3M53 A;  3CCQ A;  3JCM Q;  4IUV A;  1PHT A;  2CKK A;  2DJQ A;  1VQN A;  1TUD A;  4R0K A;  3MO8 A;  4F7U A;  4XU3 A;  1D09 B;  4F7U B;  2V1Q A;  4C92 B;  1FXX A;  2J06 A;  3OBW A;  1G2B A;  1ZA1 B;  4BE1 A;  2VKN A;  3SHW A;  5LJ3 j;  1VQ4 A;  2KYM A;  4LNP A;  5CK9 A;  3VS2 A;  3CCR Q;  2KRN A;  4X1V A;  2W10 A;  1H92 A;  4LUE A;  1SHF A;  3SFM A;  3MP1 A;  1Y0M A;  3CC7 A;  4JRQ A;  3GIB A;  2EYY A;  1MV3 A;  1UFF A;  3QII A;  4KUI A;  1RAD B;  3ER0 A;  2DL7 A;  2JW4 A;  1ZHI A;  5FU6 B;  5D7U A;  2O31 A;  1YJ9 T;  1QCF A;  4M7A B;  1NLP C;  1VYV A;  1WHK A;  2JM8 A;  3A8H B;  2C0I A;  2QQR A;  1N8R C;  2F1L A;  4AFU C;  3QZ5 B;  4EMK A;  2GCX A;  4KGX B;  5KE3 A;  1BI0 A;  2QGG A;  5CQY A;  3GNG A;  2KRO A;  1PCX A;  4KBM B;  1B07 A;  1M30 A;  3OBY A;  3JCM f;  4XU1 A;  1KQ2 A;  1X2K A;  3V7C A;  3CXC A;  1IGQ A;  1PKT A;  3JB9 D;  3TU4 K;  1AWX A;  4X9D A;  3OS0 A;  1JO8 A;  3CMA T;  4OML A;  1AHJ B;  1GBR A;  4O6J A;  4XU0 A;  1ZA2 B;  4RTY A;  1WJR A;  4D6W A;  2HZY A;  1PM3 A;  3A8O B;  3JV3 A;  2KRM A;  1K73 R;  1LJO A;  5CKE A;  2RN8 A;  3EH1 A;  4C8Q A;  2O01 E;  5I11 A;  4C8Q B;  4BDZ A;  1UEC A;  4N0A C;  2LJ1 A;  1VQM T;  1WYX A;  5A0D A;  3EH2 A;  2X4W A;  3AHU A;  1YP5 A;  1VQ6 Q;  2YUP A;  1V1C A;  1ZUU A;  1TU0 B;  1RAG B;  2HDA A;  3VS7 A;  2VYT A;  1M1K R;  2EGA A;  2RHZ A;  3CC4 Q;  2KSS A;  2PQW A;  3G6E Q;  3NTI A;  3HTR A;  1AVZ C;  3M0T A;  2HSP A;  4FIB A;  2A0F B;  1C0M A;  4M77 G;  4F16 A;  4M77 F;  3EFO B;  3ZFJ A;  4XTW A;  4C92 G;  4AFS C;  4RCC A;  1VQ7 Q;  4DOW A;  1G3Y A;  2RQU A;  3P8D A;  2AK5 A;  3ULR B;  4X9C A;  5HK3 A; 
#chains in the Genus database with same CATH homology
 1W2B P;  2OTJ Q;  3CXC P;  1VQM Q;  1VQO Q;  1K73 R;  3CCJ Q;  1VQ5 Q;  3I55 Q;  1Q81 R;  2OTL Q;  3CPW P;  1Q7Y R;  1KD1 R;  3CC2 Q;  1YJ9 Q;  1VQL Q;  1VQ8 Q;  3CMA Q;  2QEX Q;  2QA4 Q;  3OW2 P;  1QVG P;  1KQS P;  1S72 Q;  3G4S Q;  3I56 Q;  3CCU Q;  1VQ9 Q;  1K8A R;  1YI2 Q;  1NJI R;  1YJN Q;  3CCV Q;  1VQ4 Q;  1VQK Q;  1N8R R;  3CCR Q;  3CD6 Q;  1VQ7 Q;  3G71 Q;  1YHQ Q;  1YIT Q;  1VQ6 Q;  1JJ2 P;  3CCS Q;  3CCQ Q;  1YJW Q;  1Q86 R;  1Q82 R;  3CCL Q;  1QVF P;  1VQN Q;  1KC8 R;  1M1K R;  3CME Q;  3CC7 Q;  3CC4 Q;  1YIJ Q;  1K9M R;  3CCE Q;  3CCM Q;  1M90 R;  3G6E Q;  1VQP Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...