4AFUC

Human chymase - fynomer complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
b'LFVALYDYQADRWTDLSFHKGEKFQILDASPPGDWWEARSLTTGETGYIPSNYVAPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 10
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afuC00
2YT6A 2CREA 2ED1A 5I11A 2DA9A 3VS6A 3EG3A 1WA7A 2CSIA 5IXBA 3H0HA 5HCKA 2JM9A 1H3HA 1WIEA 3I9QA 2KYMA 5EC7A 2LNHB 2YUOA 2MIOA 1S1NA 1GFDA 1JO8A 3M0PA 3TSWA 2J05A 3EG0A 4D8DA 2EGEA 2O9SA 4HVUA 1PRMC 2JW4A 5IHKA 4KRTA 2O88A 4E6RA 1NYFA 2ECZA 1PWTA 2NWMA 2VWFA 2J7IA 2K2MA 2G6FX 2JS2A 1I0CA 2YUQA 1CKAA 3JV3A 4RTZA 2KT8A 3PVLA 1I1JA 4Y92A 2EYWA 2M0YA 1WXBA 2X3WD 2X3XD 1KJWA 2CT4A 5I22A 4IIOA 2DE0X 1FYNA 1PRLC 4J9GA 4HXJA 1RLQC 1T3SA 1KIKA 2KT1A 2DBMA 4AFZC 4J9FA 2EQIA 1GCQC 2YUNA 2GGRA 2CUBA 2FPDA 1H8KA 2DMOA 3TSZA 3C0CA 1K9AA 3NMZC 2DM1A 3UATA 1Z9ZA 4DEYA 3VRZA 4J9EA 1W6XA 2CT3A 2EBPA 3ZL7C 5L23A 3TVTA 2A28A 1SEMA 2DL7A 4OMNA 1M3CA 2CH4W 2LP5A 3I5SA 2RQVA 3I35A 3M0TA 2RF0A 4JJDA 4AFUC 1Z9QA 2EKHA 2H8HA 2KXCA 1YCSB 1V1CA 1EFNA 3U23A 4Z89A 1KSWA 1BB9A 3EG1A 4ORZA 3RBBB 1X43A 1ARKA 2LJ0A 1UECA 2DBKA 3M0UA 2A08A 2LQNA 1K1ZA 4JZ3A 2LQWA 1GFCA 1UJYA 2KEAA 1WX6A 2EGAA 4RUGA 1UHCA 4AG2C 2D0NA 2K79A 3H0IA 2K9GA 1QLYA 2GBQA 2LZ6B 2JTEA 2C0OA 4ZNXA 1BU1A 2KRMA 3M0QA 2PTKA 1ZX6A 4OMQA 4X1VA 2L3QA 3QWXX 2AZSA 1X6GA 1M27C 4OMMA 2B86A 1AVZC 1QWEA 1ZLMA 4F17A 1U3OA 1T3LA 2DL8A 1SSHA 2JM8A 2D8HA 2HSPA 2RQRA 1G83A 4HVVA 1Y0MA 1GCQA 1G2BA 2F2VA 2HCKA 3EHRA 4LN2A 3KFVA 1MV0B 2KE9A 1UJ0A 2OAWA 2EYZA 3UA6A 1UDLA 1YWOA 2YUPA 3LH5A 1NLOC 1ABOA 2P4RA 3SHWA 3M0RA 1RLPC 3UF4A 4CC2A 1UGVA 2AKKA 2K3BA 1T0HA 3EGUA 2GTOA 1AZGB 1FMKA 4Z8AA 2J6OA 4J9BA 2O2OA 2E5KA 2RPNA 4JZ4A 2VVKA 4Z88A 2JMAA 2BZ8A 4WCIA 3IQLA 2L0AA 3R6NA 4LE9A 1QKWA 4LUEA 2J06A 1NM7A 1UHFA 1ZUKA 5IH2A 2DRKA 2J6KA 2LJ3A 2HDAA 1SRLA 4GLMA 4R0KA 4LUDA 1GBRA 1M3BA 2SEMA 1B07A 2PZ1A 1OPLA 2XMFA 1ZUUA 1HJDA 4AG1C 4AFQC 2O9VA 1JXMA 2DL4A 1E7OA 1UFFA 1KFZA 2ABLA 4J9CA 1WFWA 2FEIA 3A98A 2FG0A 5IXFA 2CDTA 2YSQA 1XOVA 1NYGA 4RTUA 2KROA 2MOXA 2ROTA 2DL3A 2DYBA 1M30A 2W0ZA 3O5ZA 2L3SA 1CKBA 2AZVA 2FRYA 4DEXA 1JU5C 1RI9A 2I0NA 2L3PA 2C0IA 4F16A 4M4ZA 1QKXA 2K7AA 1K4US 3EG2A 3NPFA 2C0TA 2ROLA 3I5RA 1VYVA 2DRMA 2GTJA 5GJWB 1AZEA 4OMPA 2J6FA 1AWJA 2ESWA 4CC3A 2BZXA 4LNPA 4HCKA 2DX1A 2M51A 1WXUA 2JT4A 1I07A 2LMJA 4ESRA 1SRMA 4J9DA 1OPKA 4RTXA 4AFSC 1WYXA 3VS1A 3H0FA 1NG2A 4HVWA 1ZSGA 1JXOA 1E6HA 2DJQA 3REBB 1OOTA 4JJBA 2LX7A 1X2QA 5ECAA 1VYUA 4F14A 1YWPA 1TUCA 2ED0A 3ULRB 1AWWA 3RNJA 2RQWA 2PNIA 2V1RA 4FSSA 1ZUYA 1CSKA 3PVQA 1ABQA 2EW3A 2MCNA 3QWYA 1GBQA 1UE9A 2JXBA 1VYTA 3SEMA 2A37A 1YP5A 4JJCA 1RUWA 5FW9A 4JPBW 2RN8A 4RTYA 4IIMA 3M0SA 4CC7A 2EVRA 5FWCA 2KR3A 2SRCA 4QT7A 4J9IA 1W1FA 1M8MA 1N5ZA 4GBQA 1HSQA 1MV3A 5FWBA 1YNZA 4D8KA 2BTTA 2GQIA 2RQUA 3VS4A 2DF6A 2V1QA 2KYBA 1QWFA 4RTWA 1PNJA 3UA7A 2OJ2A 4K11A 2D1XA 1YN8A 1AWXA 2LJ1A 1SHGA 1WI7A 3H41A 2HBWA 1A0NB 1GL5A 4OMOA 2RQTA 3VS3A 2DNUA 4EIKA 1K0XA 1Y57A 3NHNA 3THKA 2F2WA 1OEBA 3CQTA 2A36A 3EHQA 3PE0A 1MUZA 3REAB 1BBZA 1BK2A 1SHFA 1T0JA 1TUDA 1X27A 2AKLA 1AWOA 4RTVA 1E6GA 5IHIA 3VS5A 1WDXA 2DILA 2VKNA 2OI3A 1AOJA 1OV3A 2BZYA 2ENMA 1ZBJA 2YDLA 1H92A 3VS0A 2DLPA 2K6DA 1QCFA 1SPKA 2EYXA 1PKTA 2CSQA 1NLPC 2FRWA 1X2KA 2FPFA 4OMLA 2FO0A 1JQQA 1J3TA 1M3AA 5GJVB 4A63B 2JS0A 1NEGA 2F2XA 1U5SA 2EYYA 3NGPA 2CH4A 1AD5A 2KRNA 1TG0A 1B3QA 2IIMA 2RNAA 2KRSA 2L2PA 1NEBA 1W70A 2KBTA 2QDLA 2LCSA 2O31A 1PKSA 2KXDA 1JEGA 4RTTA 2EPDA 4J9HA 2NUZA 1HD3A 2FPEA 2D8JA 3GBQA 1UG1A 2KGTA 2DL5A 2AK5A 1VA7A 1X6BA 2HEQA 1K76A 2GNCA 1U06A 3FJ5A 1GRIA 1GCPA 1IO6A 4CC4B 1X69A 3VRYA 2JMCA 1WXTA 1UUEA 2EGCA 1K0SA 1AEYA 3VS2A 2W10A 3VS7A 1WLPB 1UTIA 5IHNA 2KNBB 1LCKA 2CUDA 2RMOA 2DVJA 1PHTA
chains in the Genus database with same CATH superfamily
3A1PA 5I11A 1LOJA 3EG3A 2DYIA 4ZN1A 4M78D 5EC7A 1WHHA 2LNHB 4HT8A 4PJOE 1GFDA 1JO8A 3M0PA 1YITT 3EG9B 4M7DF 1YJNQ 1KQ2A 2EGEA 2E12A 2DPPB 2GF7A 4M77E 3HFOA 1WJQA 2XG8D 2VGMA 5GAOn 4NL3A 2RJDA 2AT1B 4ELYC 5GMKm 4JRPA 2JS2A 1VQLA 1CKAA 4RTZA 2KT8A 3EH2A 3PVLA 4PJOC 1YI2Q 2EYWA 2X3XD 1AHJB 1M2VB 5KYUB 3G7ZA 1PRLC 4J9GA 1RLQC 2D0QB 2M0OA 1T3SA 4M77C 3V7RA 2FYKA 2LVMA 3LW5E 1QCNA 2ZCFB 4ZGDB 1IHVA 2FPDA 1H8KA 3PT9A 4BI4A 1NJIC 2PVGB 3C0CA 1K9AA 2DM1A 5FU6C 3DLLA 1YITA 4L5GA 3G71T 1MNEA 2EBPA 2JOYA 4PJOB 3TVTA 3JCMX 2CH4W 5CKHA 4J5YA 2NUPA 3CCJA 3M0TA 4JJDA 2EKHA 5GAN2 3QDRB 4DBQA 2YRCA 4M77B 2GCXA 1QVGS 1QMCA 3VYGA 3OYCA 1VQPQ 3RBBB 1X43A 2AHJB 2FB7A 1Q82U 1KHIA 4KUIA 2LTOA 4C0GA 4A4GA 4C5EA 2LQWA 1GFCA 2KEAA 4B6MA 3OYLA 8AT1B 1UHCA 1BCMA 3BFMA 1OULA 2LRQA 2JZ2A 5GAMg 1B7TA 2EAYA 2LZ6B 4MZPA 3L2VA 3GNGA 4OMQA 3M57A 3MEVA 1W4SA 2AZSA 5HK0A 1YCYA 1AVZC 1QWEA 2QTXA 4RCBA 3CCSA 1U3OA 2RHZA 3G6ET 1SSHA 4J7IA 1OX8A 3X25B 2RQRA 2CKKA 1B34B 1Y0MA 1YJ9T 4QQDA 1OI1A 4C92D 2H3JA 1D0XA 3KFVA 1KD1C 2Y4YA 2OAWA 4XTYA 4IUPA 2QDYB 1UDLA 3LH5A 5GAMf 3MP6A 1O75A 5GANg 3UF4A 1I4K1 1VQMT 2D6FA 4C5GA 4KBMB 4F7UA 1AZGB 2RHIA 2DZCA 1VQOQ 4E7JA 2O2OA 4JZ4A 1YHQT 2VVKA 2BZ8A 1SG5A 3IQLA 1YIJT 4EPCA 2DO3A 3G6EA 1QVFS 4LUEA 4HCBA 2KMTA 1WHLA 2VXEA 5KE2A 1NJIU 3CPWS 2DJZA 1Y7XA 2RHYA 4JRKA 3J81E 7AT1B 5FRNA 1K8AR 3EGXB 4FT4A 1Q81U 2HDAA 3OSVA 1SRLA 4R0KA 3CCQQ 3CCVA 1GBRA 1B07A 3BW1A 1OPLA 4VUBA 1HYOA 2XDBA 4AFQC 2E70A 1VQMA 5GANf 3J80E 3P8DA 1D1CA 4LDVA 3GLXA 1OZ3A 1WFWA 3MEWA 2FEIA 1YHQA 5LJ3e 3EG9A 5IXFA 1JRIA 3O8VA 3RERA 4QQ6A 1YIJA 5GAMd 1VQNQ 4RTUA 2KROA 2MOXA 5L8RE 1W2BS 2FRYA 5CKEA 1JU5C 1RI9A 2I0NA 5DLQE 3A8MB 4PJOF 4MZTA 3EG2A 3NPFA 5GAOl 3INZA 2XHCA 2V8JA 2DXTA 1M2VA 5KYUA 1VYVA 4M77F 2Z0WA 5HK3A 2DIGA 3GIBA 4CC3A 3CC7A 1KHCA 2YLCA 2EQJA 2YWWA 1I07A 4J6YA 2OTLA 4ESRA 1GXIE 1SRMA 4RTXA 3SWNC 1KD1U 5J3BA 2DTOA 1RI0A 4PJOA 1Y07A 3VS1A 1D1AA 1NG2A 3CMET 5GANd 1WHGA 3DLMA 1E6HA 4M7AE 4M77A 3REBB 2VB6A 3JCMb 3QDFA 1YBYA 4HA8A 3EFOB 2JTFA 4XTVA 1TUCA 3RNJA 2RQWA 1YJWQ 3CPWP 3SWNB 2EWNA 1ABQA 3QJ6A 2X4WA 4PL6A 1X6OA 5AYFA 3OW2S 2JXBA 2ZPFB 4M7AC 1VYTA 1VUBA 1RUWA 1BIBA 3JB9G 2EJFA 3R6OA 2EVRA 2F1LA 3CMEA 4JUVA 2RI5A 4PFZA 3JB9I 3TU4K 2QA4T 3OYAA 2RQUA 3VS4A 3CCMQ 4M7AB 1UGSB 4FIBA 2DD4A 4OGEA 1NJIR 1B34A 3JRZA 2HQEA 1LPLA 4N4IA 4DBRA 2CGHA 1V29B 3L1AA 2PVOB 4MDWA 3BE3A 2ZPHB 2OJ2A 4K11A 3H41A 1GL5A 4OMOA 2RQTA 1QVPA 4HCCA 1QP2A 1UGRB 1MMNA 2P4TA 2F2WA 1OEBA 4EMHA 3QG1A 3LLRA 3CQTA 4DQ2A 1G3YA 1Q7YC 1PSEA 3REAB 2KDSA 1BK2A 4FU6A 3VYHB 1TUDA 2RHUA 5IHIA 3RIRA 3VS5A 4PLLA 2ZPIB 3EGXA 1MMGA 4EMKB 1H641 3G4SQ 1OV3A 2ENMA 2YDLA 5KYWA 1VQPA 5FRMA 1PKTA 1NLPC 3RDVA 4OMLA 1Q86U 3I55Q 2JS0A 2VC8A 1NEGA 3NGPA 3FEOA 3Q1JA 1TG0A 3LGFA 2WSCE 2IIMA 4FYXB 4KULA 2L2PA 1VQKT 2BKDN 2JN0A 2RM4A 4J9HA 3NTHA 2D8JA 2GFAA 2KGTA 4PFOA 3L2WA 1VA7A 3EAEA 4DOVA 1U06A 1M90U 2ZPGB 2K4YA 3FJ5A 1GCPA 4CC4B 4JRIA 3CD6Q 4M78B 4A4HA 2JMCA 1R8OB 2Y90A 1FMWA 5HKCA 1K0SA 1LVKA 2XICA 1BYMA 2W10A 1WLPB 3X26B 5GAMe 1UTIA 1LCKA 2IPOB 2LT4A 4MZMA 8ATCB 1IGQA 5FU7B 3X20B 2MK5A 5GMKi 1KG1A 4HCZA 2ED1A 2X51A 3VS6A 2CSIA 3EFRA 3CXCP 2D9TA 3CC4T 1R0CB 1VQOA 1H3ZA 2MWOA 4Y28E 4C8QG 4KGZB 4FW1A 1S1NA 4XQ3A 3CCEQ 4A4EA 3EFOA 1DJ7B 2DZ9A 4RG8A 2XKOC 2O88A 3SWNA 1I8FA 1BI3A 4M7AF 4C8QD 2K2MA 2G6FX 2QG9B 3CCQA 4E7SA 4XU0A 2DEQA 1I1JA 2HSEB 5GANe 2X3WD 3J7AF 2DE0X 2LCCA 4LDWA 1PCXA 1KIKA 5GAMj 4C0ZA 2FHDA 2XK0A 4F7UE 2KT1A 2DXUA 1WQ7A 1OQKA 2DBMA 3QIIA 2YUNA 4BD3A 1S72T 4C92E 1IRXA 1SF9A 1Z9ZA 3HL8A 4M7AA 4J9EA 2FZGB 3QKJA 5L23A 2DL7A 3C12A 2RQVA 2GFUA 2RF0A 1R0BG 5D6WA 1BKBA 1YCSB 2QGFB 3EG1A 4J6WA 4C92C 4D6WA 5CKFA 3M0UA 1YJWT 1TU0B 3OSSC 2QGGA 3CCUT 2OTJQ 1QW1A 1BIAA 3L2ZA 2QEXQ 4RUGA 2D0NA 3CPFA 3HKSA 2K79A 4BDYA 5GANj 3H0IA 4ANJA 2ATCB 1S72A 2JTEA 2MI6A 2K5LA 2HZYA 3PNWC 2HKQB 4IURA 4ME7A 1ZX6A 4M75G 2EJGA 2L3QA 4E2FB 3UWNA 2QQRA 4C92B 1M27C 3HHTB 1IZ6A 3HP9A 4GY5A 4EMKA 4PJLA 5FLXE 1N9RA 1TWBA 1ZLMA 3JCMW 2JM8A 1D0YA 3RUXA 1FXXA 1YJWA 1M4ZA 4HVVA 2E10A 1GCQA 2QI2A 4OB1B 2F2VA 1MV0B 3DB3A 1VQ9Q 1YWOA 2P4RA 3SHWA 4QKUA 1ZA2B 2AKKA 2K3BA 2LX9A 3EGUA 9ATCB 1FMKA 1TXQA 2J6OA 3E2UA 5GAN8 1ACMB 3ZBDA 3VUZA 4C0FA 2JMAA 2DXBA 3CCJT 3CCMA 2CS7A 2L0AA 1Q7YR 2HBPA 4M78A 4M7DG 2JNGA 3M56A 1QKWA 4PK4A 2M16A 4OB3B 1UHFA 5IAYA 4RKUE 5A0GA 1K8AU 4WTOB 2X9HA 2J6KA 2H3EB 2COYA 4GLMA 2SEMA 3M54A 2PZ1A 4LDXA 5EG2A 4E7LA 1KC8C 4JDSA 2CP0A 4M7DD 1HJDA 5FROA 2X4JA 2O9VA 1KQSP 2DEUA 3TEEA 2NLUA 1E7OA 3VJPA 2ABLA 3PMIA 4R55A 1PSFA 2FG0A 1MHNA 2EKOA 2V26A 2KY9A 4OB2B 2ZAEA 2DL3A 4P5NA 3CCST 2L3SA 2C0IA 2R5MA 3LWHA 3HTRA 2ZPBB 4C5IA 2DRMA 4JJNK 4JRQA 2GTJA 3OYDA 2VUBA 5GJWB 3LGLA 2EQKA 1AWJA 4HCKA 2DX1A 2RK2A 1VIFA 3DB4A 4BY6C 3HRSA 1M8VA 2RHXA 4DOWA 1JJ2A 1WYXA 4X9DA 1NBEB 4N4GA 1VOMA 2WSEE 3H0FA 3S3OA 4ZGJB 2E1HA 4F7UF 2CP5A 4RG2A 2DJQA 4XU3A 1FWZA 4C92F 1X2QA 3CD6A 4BY6B 2HL5C 5KH6A 1TS9A 1TUGB 2JVVA 4NOYA 1XNIA 3CCVT 2PNIA 2QQ9A 3UT1A 4B9WA 2EW3A 2DD5A 4RMOA 3QWYA 1GBQA 2R58A 3FB9A 1TSFA 5FW9A 2WSFE 4RTYA 3L2UA 3EFSA 1RAGB 3M0SA 3OYNA 1NPRA 3CCLQ 4C92A 1RL2A 2IG0A 4J9IA 4BACA 1M8MA 1VQ4T 4BI8B 2XDPA 2BTTA 3E9GA 2GQIA 2DKGA 3CC2Q 3HRUA 3SB2A 2V1QA 2BE7D 1QWFA 2VV5A 3GF5A 4A53A 1VQ6Q 2QK0A 3I56Q 4RTWA 5KYWB 1QVGP 3FRNA 2CP2A 2RJFA 1X75C 2EJ9A 2D1XA 3UDCA 3M4GA 1AWXA 2LJ1A 3CC7T 1Y57A 1SKUB 1WJRA 3THKA 3CCRQ 1U1SA 1VQ5Q 3MEAA 4PNOA 3LX7A 2OTLT 3WVDB 3H6ZA 3TCJA 4GLKA 3D7SB 3E9FA 3QYGB 1VQ4A 1MUZA 4KH1B 1RAFB 1BBZA 1G5VA 2FVUA 2MMPA 2RJCA 4CRIA 3SFMA 1AWOA 4RTVA 1K9MR 3M55A 1WDXA 3JCMh 3RMSA 3CMAQ 2E64A 1M1KC 3CEYA 4PJOG 3OYIA 3OYYA 3NTKA 4C0DC 2FRWA 1X2KA 3ASKA 2OTJA 4M77G 4WF2A 1JQQA 1K73C 3JAME 2QEXA 2EYYA 1VQ7Q 1B3QA 2Y4XA 2HKNA 1RABB 2KRSA 5CKDA 4KUDK 2R57A 3M5AA 2CYZB 1EX4A 4XTWA 1PKSA 4KGXB 2KXDA 2EPDA 4BUGA 2NUZA 5J26A 4C0DB 2HQHA 2FPEA 1YJNT 1WHKA 2DL5A 2HEQA 1QVFP 2GQVA 1D3BA 2B8AA 3VUBA 3JB9J 4LXCA 1VQ8Q 1IO6A 1I5LA 2CP3A 3MJXA 4NL2A 3UPUA 1YI2T 4BI3A 2O4XB 1UUEA 1NE8A 3VS7A 4FYYB 3PTAA 1VQ9A 3MP1A 3G1JA 4BE2A 5GAOm 3META 3PIOA 2NUTB 4XTZA 5GAN5 2YT6A 2CREA 1G3WA 1WA7A 5IXBA 1H3HA 1KC8R 2KYMA 3OMCA 1ZSZC 3GNFB 2PQWA 1YJNA 2YUOA 1R77A 2RK1A 3JB9D 1BI1A 3TSWA 1W2BP 3EG0A 4D8DA 4HVUA 1PRMC 3QYHB 2JW4A 5KE3A 2FL7A 4MDXA 3WVEB 2ECZA 1YI2A 3BY7A 1VQPT 4XTXA 5LJ5h 1UGQB 2VWFA 2HAXA 5GAOp 3AT1B 1I0CA 3JV3A 5CAIA 2LQ8A 1ZSZB 2RO0A 4EMKC 4HT9A 2M0YA 1BI2A 1VQLQ 1FX7A 3QPHA 4HXJA 2A0FB 1I5OB 3PFSA 4KGVB 3HPWA 3M53A 4AFZC 4X34A 2EQIA 1GCQC 4DA4A 2GGRA 5D6XA 2QTVA 3RKXA 2DMOA 3NMZC 3P8BB 5D6YA 3S3NA 2PVDB 3ZL7C 4M78E 4XU1A 4KT0E 4A4FA 2A28A 4OMNA 4Z02A 2LP5A 2MYSA 3HFNA 4AFUC 1YITQ 2KAFA 1D09B 3OBYA 2H8HA 1WQWA 5DM7R 3U23A 1EFNA 4Z89A 1KSWA 5I2MA 1BB9A 3VKIA 2RJEA 4ORZA 2L3RA 2LJ0A 2WACA 1ARKA 2DERA 2MF2A 5AT1B 2A08A 3MHXA 4FSXA 3RESA 3H8ZA 3OW2P 1NZ9A 4M78C 2KK4A 1UJYA 4MMKA 4AG2C 4ELZC 2EQMA 2K9GA 1D0ZA 1QLYA 4XTUA 1VQOT 1EZZB 2C0OA 3OYMA 4E7ZA 2RH2A 1BU1A 2COZA 5FU7C 1VIEA 1ZBXA 4X1VA 5CQXA 1BI0A 3QWXX 1N9SA 1JJ2S 3X24B 3G71Q 3FLGA 2DTHA 2K5IA 4LD9K 1WNLA 1T3LA 3VU3C 5I21A 2DL8A 4OMFB 2XIDA 5CQYA 2D8HA 2XDDA 4ZTJA 2HSPA 3CCQT 1U1TA 5GAN3 1G83A 1G2BA 1N8RC 2HQXA 2HCKA 3EHRA 3MO8A 2KE9A 1UJ0A 3LWIA 2PUOB 3A5ZB 2EYZA 3UA6A 2YUPA 1NLOC 1ABOA 3E1SA 4FL6A 1UGVA 5J39A 2GTOA 5KYXB 2LC4A 4Z8AA 3FC3A 1VQNT 2E5KA 3MCAB 3V8JA 4RCCA 2BIVA 1Q7YU 4WCIA 3CC2A 4M7DB 4LE9A 4OVAA 2J06A 1VQ6A 2O4XA 3CPWA 4JS5A 2RA2A 2RB6A 2IVWA 4M7AG 3G6EQ 1M1KR 1N27A 3OS2A 4ATOA 1M3BA 2NUTA 2QXFA 2CZ1B 1YJ9Q 2EIFA 2QQAA 3CCRA 1UEBA 1VQ5A 1ZUUA 6AT1B 5CKBA 2NYSA 4AG1C 4BE0A 1JXMA 1UFFA 4X9CA 1K73R 2FZCB 4XU2A 1VQNA 4J9CA 2HNIA 4JLIA 1VQMQ 5A0DA 3MKDA 4MMLA 2CDTA 2YSQA 1XOVA 2C06A 3QO3A 3LYIA 2ROTA 1YHQQ 1M30A 2W0ZA 2EYQA 3O5ZA 2LNVA 1CKBA 2AZVA 4DEXA 4QQGA 3JCMc 1YIJQ 2L3PA 1M1GA 4FT2A 1QKXA 2K7AA 1ZSZA 3AHUA 2DETA 1MGQA 1PG5B 1JBMA 3RMQA 2YRDA 3OYBA 2HL3A 4OB0B 4IUTA 1AZEA 2J6FA 4LNPA 1K9MC 5C0MA 2LMJA 2QQBA 2YXYA 4J9DA 4AFSC 5A2QE 3SDZA 1XQHA 4HVWA 3CCMT 1JXOA 5GMKl 5CR2A 2OX7A 2E4HA 4EDUA 4PJNA 1VQ8A 4JJBA 4M75D 4BDZA 1Q82C 4N0AC 4F14A 2I2LA 4M78F 1YWPA 2ED0A 3ULRB 3OB9A 4DBHA 2A3LA 3KXTA 4IKFA 1ZUYA 1CSKA 1PD0A 2CZ6B 1C0MA 2QQSA 3OYJA 1UE9A 3SEMA 3OYHA 3EGDA 1EIFA 2RN8A 3OS1A 1JB0E 3QZ5B 3QUIA 5DLOA 1RAHB 1TH7A 3JSCA 5HY6A 4CC7A 5FWCA 4QT7A 1W1FA 4FM4B 4J83A 1MV3A 5FWBA 4D8KA 1M2OA 3JCMg 3CMEQ 3OS0A 3G4ST 2F5TX 2QAZA 1BCOA 1TTHB 2HMAA 4O5VA 3UA7A 4AMCA 3I55T 5GAOq 1OYXA 3ME9A 1SHGA 4EMGA 2HBWA 4IUQA 1A0NB 5LL6S 1QCOA 2DNUA 4EIKA 3CXCA 4JS4A 5KYXA 2VASA 1XTDA 2E3IA 3EHQA 2DVEA 3NTIA 4NS5A 4M7DA 4PLIA 2P0PA 3QZ9B 5KYYB 1K9MU 1SHFA 1IGUA 2VGNA 1T0JA 3JCMf 2AKLA 2A7YA 3G4SA 2RI2A 4B9XA 3OBWA 5GMKh 1YFNA 4FYWB 5LJ3h 2QA4Q 3CD6T 2VKNA 1D3BB 1Q81C 3OYFA 2OI3A 1AOJA 1ZBJA 2RD1A 3OYGA 3VS0A 3I55A 2DLPA 3URGA 1SPKA 2EYXA 3M58A 2DIQA 4J6XA 3QSUA 2FPFA 2K57A 2FO0A 4E7IA 4A63B 1V76A 2K3YA 5KCHA 1AD5A 1X01A 2KRNA 1N8RR 3VV0A 5FU6B 2PUKB 1O9SA 3RKWA 2RNAA 1W70A 3CCET 4OP0A 1JEGA 3GBQA 4F7UG 1UG1A 4PKCC 3G71A 2AK5A 4QVDA 1K76A 2GNCA 1MMDA 4C92G 1GRIA 5LJ5g 3VRYA 4IUVA 1WXTA 2KI7A 3JCMd 2XD0A 3VS2A 5GAOr 5IHNA 1OU9A 3RR6A 2KNBB 2CUDA 1PHTA 3CBOA 3RKYA 5D7UA 3CBMA 1RAIB 1RAAB 2DA9A 2L5QA 4E47A 1QP3A 1KC8U 3H0HA 5HCKA 2EFIA 2JM9A 1WIEA 2CP6A 3I9QA 3OYKA 3CCEA 3P8HA 1VQKQ 1PM3A 2MIOA 3JCMQ 3GOXA 1RADB 2J05A 1IHWA 2O9SA 3LH0A 5IN1A 3QHSA 5IHKA 4KRTA 2X35A 5LJ5f 4E6RA 1NYFA 1PWTA 2NWMA 2J7IA 2OTJT 2YUQA 4Y92A 1Y96B 4R56A 2QEXT 1YJ9A 1WXBA 4J7FA 1KJWA 2CT4A 5I22A 4IIOA 3WXMB 2LDMA 1N6AA 1FYNA 5CVIA 3OYEA 4XK8E 2F69A 4N0AA 3MEUA 4IUUA 3GPLA 2DXCA 4J9FA 4Q5WA 1WJSA 2CUBA 3TSZA 2O01E 4QVZA 3UATA 4DEYA 3CC4Q 3C95A 3VRZA 4ZGEB 2F5KA 1W6XA 3TREA 3V8KA 5GMKe 2CT3A 2QYZA 3M59A 5C6SA 1SEMA 1M3CA 3I5SA 3A8LB 3I35A 3OS5A 1UB4A 1G8XA 1Z9QA 2DAQA 2M9UA 4HKEA 2KXCA 1V1CA 2K3XA 1UECA 1RACB 2DBKA 1VQ9T 2KSSA 2LQNA 4OGCA 2P0KA 1K1ZA 2DK3A 4JZ3A 5A0LA 1Q82R 4F04B 1KQSA 5CIUA 4PJOD 5LJ5d 3C4SA 1WX6A 2EGAA 4C8QE 2EQUA 3E19A 3PMTA 2GBQA 5KYYA 4M77D 4ZNXA 2KRMA 3M0QA 2PTKA 3NFCA 4ZTFA 2YHTA 1OU8A 2E3HA 1RAEB 3JCMP 1S72Q 1X6GA 4OMMA 2B86A 4PJJA 4BE1A 4C8QC 4CI0C 4F17A 4PFPA 5GMKj 5LJ3j 1Q86C 4TVRA 4BB7A 4PJMA 3ZEHA 4LN2A 2LT1A 3N5BB 1UGPB 2ZPEB 3CCUQ 3JB9F 4C8QB 3M0RA 1RLPC 4CC2A 3JCMV 5GAMh 2ZGWA 4A54A 1MNDA 1T0HA 1WHJA 4J9BA 2YLBA 4ZN3A 2RPNA 4Z88A 1M90C 1IB8A 4L59A 5DY9A 2XU8A 3R6NA 3ER0A 1NM7A 3M9QA 1ZQ1A 1ZUKA 3EH1A 2ZZDA 5IH2A 1M1KU 2DRKA 3FDRA 2BE9B 3HRTA 2V8KA 2LJ3A 5I2SA 3MPUB 4LUDA 1Q81R 2E6ZA 1IREB 2CP7A 5GAN6 1D1BA 2XMFA 2CZ0B 4M75E 3PIPA 3C94A 1K73U 2DL4A 4A4KA 5GANh 4QVCA 3CXCS 4YTLA 4E7HA 1KFZA 3L2RA 4N4HA 2RI3A 3JCMe 3A98A 3QXEB 2OAUA 2DTIA 2MAMA 1NYGA 1ZHIA 2DYBA 2QA4A 2X4YA 2LCLA 1QVGA 4M75C 5CCAA 3CCJQ 3MP8A 4F16A 4M4ZA 1K4US 1KK7A 1Y96A 2C0TA 2ROLA 3I5RA 2PU9B 2X4XA 1TOVA 3S3MA 4OMPA 2ESWA 2BZXA 1FMVA 3KUFA 3L2QA 1M1FA 2M51A 1WXUA 3EGDB 3JCMJ 4AT1B 2JT4A 3CCLT 4M75B 1U8RA 1OPKA 1LJOA 4M7DE 5CK9A 1KD1R 2K5FA 2MWPA 4II1A 3CC2T 1Q95G 1ZSGA 2KQWA 3TQ7P 1VQ6T 3I56T 1OOTA 3A8GB 2LX7A 3CCSQ 5ECAA 1M5Q1 1VYUA 2VXFA 1WGSA 2BUDA 4M7DC 1AWWA 2HD0A 4Y91A 2V1RA 4FSSA 4DBFA 3FIFA 2JJ9A 2FZKB 3PVQA 4L6V5 1PC0A 2MCNA 3CCRT 1VQ5T 3QBYA 2R5AA 3HSBA 2A37A 1YP5A 4JJCA 3CCLA 4JPBW 2E65A 4UC4A 2KVQG 4JLGA 4IIMA 3OMGA 1OZ2A 1NPPA 1WHMA 4O6JA 3F70A 2KR3A 2SRCA 1VQKA 5KCOA 4C8QF 1N5ZA 1QQJA 1QVFA 2AIRB 2M1HA 4GBQA 1HSQA 1YNZA 5IT9E 3ZFJA 3CMAT 2P84A 3DKMA 5LJ5e 1SSFA 5LJ3g 3I56A 3H9NA 4V2SA 2DF6A 1AT1B 2KYBA 1XJWB 4FYVB 1PNJA 3JB9H 1ZA1B 2NUPB 4XAXB 5M9OA 4QW2A 2JUFA 2K2VA 1YN8A 3CBPA 3OY9A 2E5QA 3CCVQ 1WI7A 5KYNA 1C6VX 4C8QA 2V8IA 3VS3A 1VQ7T 1K0XA 1G3SA 3NHNA 2YRVA 4M7AD 2LQKA 1M9SA 2A36A 1WZOA 3PE0A 3X28B 2DFUA 4FCYA 1W2BA 3CC4A 4KH0B 2L89A 3CMAA 5GAN7 2CZ7B 4J8OA 4LDUA 1JJ2P 1C1AA 1WPYA 3FJPA 1X27A 5LJ3f 3BDLA 1VQ4Q 1E6GA 1HK9A 1VQ8T 2DILA 1LNXA 1K8AC 3S6WA 3A8OB 1PD1A 2BZYA 5LJ5j 1H92A 2COWA 1Y71A 2K6DA 4LDYA 4LD6A 1QCFA 2L8DA 2CSQA 3OA6A 1HXDA 1VQ7A 1J3TA 2XI9A 1M3AA 5GJVB 1Q86R 2VYTA 2F2XA 1U5SA 1N8RU 2CH4A 3CC7Q 3L42A 5CO7A 3GP8A 3SD4A 4C5HA 2E6NA 1KQ1A 2M02A 1KQSS 1OX9A 4FW2A 2G3RA 2OTLQ 1NEBA 2QDLA 2KBTA 3PGGA 2LCSA 2O31A 4OF1A 1P92A 4M75F 4RTTA 2P0QA 1HD3A 4F7UB 3BDUA 1X6BA 3QJYA 1G3TA 3V7CA 1M90R 3V7SA 2MPXC 1X69A 1F1BB 4E7KA 1MMAA 4M78G 5GAN4 3OQ5A 3OW2A 1IXDA 3KBGA 2QASA 5LJ3d 2EGCA 2JTMA 3A8HB 1I81A 1AEYA 3T9NA 3M4YA 1VQLT 4M75A 3CCUA 2RMOA 2DVJA 3V8LA 2E41A
chains in the Genus database with same CATH topology
2YT6A 2CREA 2ED1A 5I11A 2DA9A 3VS6A 3EG3A 1WA7A 2CSIA 5IXBA 3H0HA 5HCKA 2JM9A 1H3HA 1WIEA 3I9QA 2KYMA 5EC7A 2LNHB 2YUOA 2MIOA 1S1NA 1GFDA 1JO8A 3M0PA 3TSWA 2J05A 3EG0A 4D8DA 2EGEA 2O9SA 4HVUA 1PRMC 2JW4A 5IHKA 4KRTA 2O88A 4E6RA 1NYFA 2ECZA 1PWTA 2NWMA 2VWFA 2J7IA 2K2MA 2G6FX 2JS2A 1I0CA 2YUQA 1CKAA 3JV3A 4RTZA 2KT8A 3PVLA 1I1JA 4Y92A 2EYWA 2M0YA 1WXBA 2X3WD 2X3XD 1KJWA 2CT4A 5I22A 4IIOA 2DE0X 1FYNA 1PRLC 4J9GA 4HXJA 1RLQC 1T3SA 1KIKA 2KT1A 2DBMA 4AFZC 4J9FA 2EQIA 1GCQC 2YUNA 2GGRA 2CUBA 2FPDA 1H8KA 2DMOA 3TSZA 3C0CA 1K9AA 3NMZC 2DM1A 3UATA 1Z9ZA 4DEYA 3VRZA 4J9EA 1W6XA 2CT3A 2EBPA 3ZL7C 5L23A 3TVTA 2A28A 1SEMA 2DL7A 4OMNA 1M3CA 2CH4W 2LP5A 3I5SA 2RQVA 3I35A 3M0TA 2RF0A 4JJDA 4AFUC 1Z9QA 2EKHA 2H8HA 2KXCA 1YCSB 1V1CA 1EFNA 3U23A 4Z89A 1KSWA 1BB9A 3EG1A 4ORZA 3RBBB 1X43A 1ARKA 2LJ0A 1UECA 2DBKA 3M0UA 2A08A 2LQNA 1K1ZA 4JZ3A 2LQWA 1GFCA 1UJYA 2KEAA 1WX6A 2EGAA 4RUGA 1UHCA 4AG2C 2D0NA 2K79A 3H0IA 2K9GA 1QLYA 2GBQA 2LZ6B 2JTEA 2C0OA 4ZNXA 1BU1A 2KRMA 3M0QA 2PTKA 1ZX6A 4OMQA 4X1VA 2L3QA 3QWXX 2AZSA 1X6GA 1M27C 4OMMA 2B86A 1AVZC 1QWEA 1ZLMA 4F17A 1U3OA 1T3LA 2DL8A 1SSHA 2JM8A 2D8HA 2HSPA 2RQRA 1G83A 4HVVA 1Y0MA 1GCQA 1G2BA 2F2VA 2HCKA 3EHRA 4LN2A 3KFVA 1MV0B 2KE9A 1UJ0A 2OAWA 2EYZA 3UA6A 1UDLA 1YWOA 2YUPA 3LH5A 1NLOC 1ABOA 2P4RA 3SHWA 3M0RA 1RLPC 3UF4A 4CC2A 1UGVA 2AKKA 2K3BA 1T0HA 3EGUA 2GTOA 1AZGB 1FMKA 4Z8AA 2J6OA 4J9BA 2O2OA 2E5KA 2RPNA 4JZ4A 2VVKA 4Z88A 2JMAA 2BZ8A 4WCIA 3IQLA 2L0AA 3R6NA 4LE9A 1QKWA 4LUEA 2J06A 1NM7A 1UHFA 1ZUKA 5IH2A 2DRKA 2J6KA 2LJ3A 2HDAA 1SRLA 4GLMA 4R0KA 4LUDA 1GBRA 1M3BA 2SEMA 1B07A 2PZ1A 1OPLA 2XMFA 1ZUUA 1HJDA 4AG1C 4AFQC 2O9VA 1JXMA 2DL4A 1E7OA 1UFFA 1KFZA 2ABLA 4J9CA 1WFWA 2FEIA 3A98A 2FG0A 5IXFA 2CDTA 2YSQA 1XOVA 1NYGA 4RTUA 2KROA 2MOXA 2ROTA 2DL3A 2DYBA 1M30A 2W0ZA 3O5ZA 2L3SA 1CKBA 2AZVA 2FRYA 4DEXA 1JU5C 1RI9A 2I0NA 2L3PA 2C0IA 4F16A 4M4ZA 1QKXA 2K7AA 1K4US 3EG2A 3NPFA 2C0TA 2ROLA 3I5RA 1VYVA 2DRMA 2GTJA 5GJWB 1AZEA 4OMPA 2J6FA 1AWJA 2ESWA 4CC3A 2BZXA 4LNPA 4HCKA 2DX1A 2M51A 1WXUA 2JT4A 1I07A 2LMJA 4ESRA 1SRMA 4J9DA 1OPKA 4RTXA 4AFSC 1WYXA 3VS1A 3H0FA 1NG2A 4HVWA 1ZSGA 1JXOA 1E6HA 2DJQA 3REBB 1OOTA 4JJBA 2LX7A 1X2QA 5ECAA 1VYUA 4F14A 1YWPA 1TUCA 2ED0A 3ULRB 1AWWA 3RNJA 2RQWA 2PNIA 2V1RA 4FSSA 1ZUYA 1CSKA 3PVQA 1ABQA 2EW3A 2MCNA 3QWYA 1GBQA 1UE9A 2JXBA 1VYTA 3SEMA 2A37A 1YP5A 4JJCA 1RUWA 5FW9A 4JPBW 2RN8A 4RTYA 4IIMA 3M0SA 4CC7A 2EVRA 5FWCA 2KR3A 2SRCA 4QT7A 4J9IA 1W1FA 1M8MA 1N5ZA 4GBQA 1HSQA 1MV3A 5FWBA 1YNZA 4D8KA 2BTTA 2GQIA 2RQUA 3VS4A 2DF6A 2V1QA 2KYBA 1QWFA 4RTWA 1PNJA 3UA7A 2OJ2A 4K11A 2D1XA 1YN8A 1AWXA 2LJ1A 1SHGA 1WI7A 3H41A 2HBWA 1A0NB 1GL5A 4OMOA 2RQTA 3VS3A 2DNUA 4EIKA 1K0XA 1Y57A 3NHNA 3THKA 2F2WA 1OEBA 3CQTA 2A36A 3EHQA 3PE0A 1MUZA 3REAB 1BBZA 1BK2A 1SHFA 1T0JA 1TUDA 1X27A 2AKLA 1AWOA 4RTVA 1E6GA 5IHIA 3VS5A 1WDXA 2DILA 2VKNA 2OI3A 1AOJA 1OV3A 2BZYA 2ENMA 1ZBJA 2YDLA 1H92A 3VS0A 2DLPA 2K6DA 1QCFA 1SPKA 2EYXA 1PKTA 2CSQA 1NLPC 2FRWA 1X2KA 2FPFA 4OMLA 2FO0A 1JQQA 1J3TA 1M3AA 5GJVB 4A63B 2JS0A 1NEGA 2F2XA 1U5SA 2EYYA 3NGPA 2CH4A 1AD5A 2KRNA 1TG0A 1B3QA 2IIMA 2RNAA 2KRSA 2L2PA 1NEBA 1W70A 2KBTA 2QDLA 2LCSA 2O31A 1PKSA 2KXDA 1JEGA 4RTTA 2EPDA 4J9HA 2NUZA 1HD3A 2FPEA 2D8JA 3GBQA 1UG1A 2KGTA 2DL5A 2AK5A 1VA7A 1X6BA 2HEQA 1K76A 2GNCA 1U06A 3FJ5A 1GRIA 1GCPA 1IO6A 4CC4B 1X69A 3VRYA 2JMCA 1WXTA 1UUEA 2EGCA 1K0SA 1AEYA 3VS2A 2W10A 3VS7A 1WLPB 1UTIA 5IHNA 2KNBB 1LCKA 2CUDA 2RMOA 2DVJA 1PHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT6 A;  2CRE A;  2ED1 A;  5I11 A;  2DA9 A;  3VS6 A;  3EG3 A;  1WA7 A;  2CSI A;  5IXB A;  3H0H A;  5HCK A;  2JM9 A;  1H3H A;  1WIE A;  3I9Q A;  2KYM A;  5EC7 A;  2LNH B;  2YUO A;  2MIO A;  1S1N A;  1GFD A;  1JO8 A;  3M0P A;  3TSW A;  2J05 A;  3EG0 A;  4D8D A;  2EGE A;  2O9S A;  4HVU A;  1PRM C;  2JW4 A;  5IHK A;  4KRT A;  2O88 A;  4E6R A;  1NYF A;  2ECZ A;  1PWT A;  2NWM A;  2VWF A;  2J7I A;  2K2M A;  2G6F X;  2JS2 A;  1I0C A;  2YUQ A;  1CKA A;  3JV3 A;  4RTZ A;  2KT8 A;  3PVL A;  1I1J A;  4Y92 A;  2EYW A;  2M0Y A;  1WXB A;  2X3W D;  2X3X D;  1KJW A;  2CT4 A;  5I22 A;  4IIO A;  2DE0 X;  1FYN A;  1PRL C;  4J9G A;  4HXJ A;  1RLQ C;  1T3S A;  1KIK A;  2KT1 A;  2DBM A;  4AFZ C;  4J9F A;  2EQI A;  1GCQ C;  2YUN A;  2GGR A;  2CUB A;  2FPD A;  1H8K A;  2DMO A;  3TSZ A;  3C0C A;  1K9A A;  3NMZ C;  2DM1 A;  3UAT A;  1Z9Z A;  4DEY A;  3VRZ A;  4J9E A;  1W6X A;  2CT3 A;  2EBP A;  3ZL7 C;  5L23 A;  3TVT A;  2A28 A;  1SEM A;  2DL7 A;  4OMN A;  1M3C A;  2CH4 W;  2LP5 A;  3I5S A;  2RQV A;  3I35 A;  3M0T A;  2RF0 A;  4JJD A;  4AFU C;  1Z9Q A;  2EKH A;  2H8H A;  2KXC A;  1YCS B;  1V1C A;  1EFN A;  3U23 A;  4Z89 A;  1KSW A;  1BB9 A;  3EG1 A;  4ORZ A;  3RBB B;  1X43 A;  1ARK A;  2LJ0 A;  1UEC A;  2DBK A;  3M0U A;  2A08 A;  2LQN A;  1K1Z A;  4JZ3 A;  2LQW A;  1GFC A;  1UJY A;  2KEA A;  1WX6 A;  2EGA A;  4RUG A;  1UHC A;  4AG2 C;  2D0N A;  2K79 A;  3H0I A;  2K9G A;  1QLY A;  2GBQ A;  2LZ6 B;  2JTE A;  2C0O A;  4ZNX A;  1BU1 A;  2KRM A;  3M0Q A;  2PTK A;  1ZX6 A;  4OMQ A;  4X1V A;  2L3Q A;  3QWX X;  2AZS A;  1X6G A;  1M27 C;  4OMM A;  2B86 A;  1AVZ C;  1QWE A;  1ZLM A;  4F17 A;  1U3O A;  1T3L A;  2DL8 A;  1SSH A;  2JM8 A;  2D8H A;  2HSP A;  2RQR A;  1G83 A;  4HVV A;  1Y0M A;  1GCQ A;  1G2B A;  2F2V A;  2HCK A;  3EHR A;  4LN2 A;  3KFV A;  1MV0 B;  2KE9 A;  1UJ0 A;  2OAW A;  2EYZ A;  3UA6 A;  1UDL A;  1YWO A;  2YUP A;  3LH5 A;  1NLO C;  1ABO A;  2P4R A;  3SHW A;  3M0R A;  1RLP C;  3UF4 A;  4CC2 A;  1UGV A;  2AKK A;  2K3B A;  1T0H A;  3EGU A;  2GTO A;  1AZG B;  1FMK A;  4Z8A A;  2J6O A;  4J9B A;  2O2O A;  2E5K A;  2RPN A;  4JZ4 A;  2VVK A;  4Z88 A;  2JMA A;  2BZ8 A;  4WCI A;  3IQL A;  2L0A A;  3R6N A;  4LE9 A;  1QKW A;  4LUE A;  2J06 A;  1NM7 A;  1UHF A;  1ZUK A;  5IH2 A;  2DRK A;  2J6K A;  2LJ3 A;  2HDA A;  1SRL A;  4GLM A;  4R0K A;  4LUD A;  1GBR A;  1M3B A;  2SEM A;  1B07 A;  2PZ1 A;  1OPL A;  2XMF A;  1ZUU A;  1HJD A;  4AG1 C;  4AFQ C;  2O9V A;  1JXM A;  2DL4 A;  1E7O A;  1UFF A;  1KFZ A;  2ABL A;  4J9C A;  1WFW A;  2FEI A;  3A98 A;  2FG0 A;  5IXF A;  2CDT A;  2YSQ A;  1XOV A;  1NYG A;  4RTU A;  2KRO A;  2MOX A;  2ROT A;  2DL3 A;  2DYB A;  1M30 A;  2W0Z A;  3O5Z A;  2L3S A;  1CKB A;  2AZV A;  2FRY A;  4DEX A;  1JU5 C;  1RI9 A;  2I0N A;  2L3P A;  2C0I A;  4F16 A;  4M4Z A;  1QKX A;  2K7A A;  1K4U S;  3EG2 A;  3NPF A;  2C0T A;  2ROL A;  3I5R A;  1VYV A;  2DRM A;  2GTJ A;  5GJW B;  1AZE A;  4OMP A;  2J6F A;  1AWJ A;  2ESW A;  4CC3 A;  2BZX A;  4LNP A;  4HCK A;  2DX1 A;  2M51 A;  1WXU A;  2JT4 A;  1I07 A;  2LMJ A;  4ESR A;  1SRM A;  4J9D A;  1OPK A;  4RTX A;  4AFS C;  1WYX A;  3VS1 A;  3H0F A;  1NG2 A;  4HVW A;  1ZSG A;  1JXO A;  1E6H A;  2DJQ A;  3REB B;  1OOT A;  4JJB A;  2LX7 A;  1X2Q A;  5ECA A;  1VYU A;  4F14 A;  1YWP A;  1TUC A;  2ED0 A;  3ULR B;  1AWW A;  3RNJ A;  2RQW A;  2PNI A;  2V1R A;  4FSS A;  1ZUY A;  1CSK A;  3PVQ A;  1ABQ A;  2EW3 A;  2MCN A;  3QWY A;  1GBQ A;  1UE9 A;  2JXB A;  1VYT A;  3SEM A;  2A37 A;  1YP5 A;  4JJC A;  1RUW A;  5FW9 A;  4JPB W;  2RN8 A;  4RTY A;  4IIM A;  3M0S A;  4CC7 A;  2EVR A;  5FWC A;  2KR3 A;  2SRC A;  4QT7 A;  4J9I A;  1W1F A;  1M8M A;  1N5Z A;  4GBQ A;  1HSQ A;  1MV3 A;  5FWB A;  1YNZ A;  4D8K A;  2BTT A;  2GQI A;  2RQU A;  3VS4 A;  2DF6 A;  2V1Q A;  2KYB A;  1QWF A;  4RTW A;  1PNJ A;  3UA7 A;  2OJ2 A;  4K11 A;  2D1X A;  1YN8 A;  1AWX A;  2LJ1 A;  1SHG A;  1WI7 A;  3H41 A;  2HBW A;  1A0N B;  1GL5 A;  4OMO A;  2RQT A;  3VS3 A;  2DNU A;  4EIK A;  1K0X A;  1Y57 A;  3NHN A;  3THK A;  2F2W A;  1OEB A;  3CQT A;  2A36 A;  3EHQ A;  3PE0 A;  1MUZ A;  3REA B;  1BBZ A;  1BK2 A;  1SHF A;  1T0J A;  1TUD A;  1X27 A;  2AKL A;  1AWO A;  4RTV A;  1E6G A;  5IHI A;  3VS5 A;  1WDX A;  2DIL A;  2VKN A;  2OI3 A;  1AOJ A;  1OV3 A;  2BZY A;  2ENM A;  1ZBJ A;  2YDL A;  1H92 A;  3VS0 A;  2DLP A;  2K6D A;  1QCF A;  1SPK A;  2EYX A;  1PKT A;  2CSQ A;  1NLP C;  2FRW A;  1X2K A;  2FPF A;  4OML A;  2FO0 A;  1JQQ A;  1J3T A;  1M3A A;  5GJV B;  4A63 B;  2JS0 A;  1NEG A;  2F2X A;  1U5S A;  2EYY A;  3NGP A;  2CH4 A;  1AD5 A;  2KRN A;  1TG0 A;  1B3Q A;  2IIM A;  2RNA A;  2KRS A;  2L2P A;  1NEB A;  1W70 A;  2KBT A;  2QDL A;  2LCS A;  2O31 A;  1PKS A;  2KXD A;  1JEG A;  4RTT A;  2EPD A;  4J9H A;  2NUZ A;  1HD3 A;  2FPE A;  2D8J A;  3GBQ A;  1UG1 A;  2KGT A;  2DL5 A;  2AK5 A;  1VA7 A;  1X6B A;  2HEQ A;  1K76 A;  2GNC A;  1U06 A;  3FJ5 A;  1GRI A;  1GCP A;  1IO6 A;  4CC4 B;  1X69 A;  3VRY A;  2JMC A;  1WXT A;  1UUE A;  2EGC A;  1K0S A;  1AEY A;  3VS2 A;  2W10 A;  3VS7 A;  1WLP B;  1UTI A;  5IHN A;  2KNB B;  1LCK A;  2CUD A;  2RMO A;  2DVJ A;  1PHT A; 
#chains in the Genus database with same CATH topology
 3A1P A;  5I11 A;  1LOJ A;  3EG3 A;  2DYI A;  4ZN1 A;  4M78 D;  5EC7 A;  1WHH A;  2LNH B;  4HT8 A;  4PJO E;  1GFD A;  1JO8 A;  3M0P A;  1YIT T;  3EG9 B;  4M7D F;  1YJN Q;  1KQ2 A;  2EGE A;  2E12 A;  2DPP B;  2GF7 A;  4M77 E;  3HFO A;  1WJQ A;  2XG8 D;  2VGM A;  5GAO n;  4NL3 A;  2RJD A;  2AT1 B;  4ELY C;  5GMK m;  4JRP A;  2JS2 A;  1VQL A;  1CKA A;  4RTZ A;  2KT8 A;  3EH2 A;  3PVL A;  4PJO C;  1YI2 Q;  2EYW A;  2X3X D;  1AHJ B;  1M2V B;  5KYU B;  3G7Z A;  1PRL C;  4J9G A;  1RLQ C;  2D0Q B;  2M0O A;  1T3S A;  4M77 C;  3V7R A;  2FYK A;  2LVM A;  3LW5 E;  1QCN A;  2ZCF B;  4ZGD B;  1IHV A;  2FPD A;  1H8K A;  3PT9 A;  4BI4 A;  1NJI C;  2PVG B;  3C0C A;  1K9A A;  2DM1 A;  5FU6 C;  3DLL A;  1YIT A;  4L5G A;  3G71 T;  1MNE A;  2EBP A;  2JOY A;  4PJO B;  3TVT A;  3JCM X;  2CH4 W;  5CKH A;  4J5Y A;  2NUP A;  3CCJ A;  3M0T A;  4JJD A;  2EKH A;  5GAN 2;  3QDR B;  4DBQ A;  2YRC A;  4M77 B;  2GCX A;  1QVG S;  1QMC A;  3VYG A;  3OYC A;  1VQP Q;  3RBB B;  1X43 A;  2AHJ B;  2FB7 A;  1Q82 U;  1KHI A;  4KUI A;  2LTO A;  4C0G A;  4A4G A;  4C5E A;  2LQW A;  1GFC A;  2KEA A;  4B6M A;  3OYL A;  8AT1 B;  1UHC A;  1BCM A;  3BFM A;  1OUL A;  2LRQ A;  2JZ2 A;  5GAM g;  1B7T A;  2EAY A;  2LZ6 B;  4MZP A;  3L2V A;  3GNG A;  4OMQ A;  3M57 A;  3MEV A;  1W4S A;  2AZS A;  5HK0 A;  1YCY A;  1AVZ C;  1QWE A;  2QTX A;  4RCB A;  3CCS A;  1U3O A;  2RHZ A;  3G6E T;  1SSH A;  4J7I A;  1OX8 A;  3X25 B;  2RQR A;  2CKK A;  1B34 B;  1Y0M A;  1YJ9 T;  4QQD A;  1OI1 A;  4C92 D;  2H3J A;  1D0X A;  3KFV A;  1KD1 C;  2Y4Y A;  2OAW A;  4XTY A;  4IUP A;  2QDY B;  1UDL A;  3LH5 A;  5GAM f;  3MP6 A;  1O75 A;  5GAN g;  3UF4 A;  1I4K 1;  1VQM T;  2D6F A;  4C5G A;  4KBM B;  4F7U A;  1AZG B;  2RHI A;  2DZC A;  1VQO Q;  4E7J A;  2O2O A;  4JZ4 A;  1YHQ T;  2VVK A;  2BZ8 A;  1SG5 A;  3IQL A;  1YIJ T;  4EPC A;  2DO3 A;  3G6E A;  1QVF S;  4LUE A;  4HCB A;  2KMT A;  1WHL A;  2VXE A;  5KE2 A;  1NJI U;  3CPW S;  2DJZ A;  1Y7X A;  2RHY A;  4JRK A;  3J81 E;  7AT1 B;  5FRN A;  1K8A R;  3EGX B;  4FT4 A;  1Q81 U;  2HDA A;  3OSV A;  1SRL A;  4R0K A;  3CCQ Q;  3CCV A;  1GBR A;  1B07 A;  3BW1 A;  1OPL A;  4VUB A;  1HYO A;  2XDB A;  4AFQ C;  2E70 A;  1VQM A;  5GAN f;  3J80 E;  3P8D A;  1D1C A;  4LDV A;  3GLX A;  1OZ3 A;  1WFW A;  3MEW A;  2FEI A;  1YHQ A;  5LJ3 e;  3EG9 A;  5IXF A;  1JRI A;  3O8V A;  3RER A;  4QQ6 A;  1YIJ A;  5GAM d;  1VQN Q;  4RTU A;  2KRO A;  2MOX A;  5L8R E;  1W2B S;  2FRY A;  5CKE A;  1JU5 C;  1RI9 A;  2I0N A;  5DLQ E;  3A8M B;  4PJO F;  4MZT A;  3EG2 A;  3NPF A;  5GAO l;  3INZ A;  2XHC A;  2V8J A;  2DXT A;  1M2V A;  5KYU A;  1VYV A;  4M77 F;  2Z0W A;  5HK3 A;  2DIG A;  3GIB A;  4CC3 A;  3CC7 A;  1KHC A;  2YLC A;  2EQJ A;  2YWW A;  1I07 A;  4J6Y A;  2OTL A;  4ESR A;  1GXI E;  1SRM A;  4RTX A;  3SWN C;  1KD1 U;  5J3B A;  2DTO A;  1RI0 A;  4PJO A;  1Y07 A;  3VS1 A;  1D1A A;  1NG2 A;  3CME T;  5GAN d;  1WHG A;  3DLM A;  1E6H A;  4M7A E;  4M77 A;  3REB B;  2VB6 A;  3JCM b;  3QDF A;  1YBY A;  4HA8 A;  3EFO B;  2JTF A;  4XTV A;  1TUC A;  3RNJ A;  2RQW A;  1YJW Q;  3CPW P;  3SWN B;  2EWN A;  1ABQ A;  3QJ6 A;  2X4W A;  4PL6 A;  1X6O A;  5AYF A;  3OW2 S;  2JXB A;  2ZPF B;  4M7A C;  1VYT A;  1VUB A;  1RUW A;  1BIB A;  3JB9 G;  2EJF A;  3R6O A;  2EVR A;  2F1L A;  3CME A;  4JUV A;  2RI5 A;  4PFZ A;  3JB9 I;  3TU4 K;  2QA4 T;  3OYA A;  2RQU A;  3VS4 A;  3CCM Q;  4M7A B;  1UGS B;  4FIB A;  2DD4 A;  4OGE A;  1NJI R;  1B34 A;  3JRZ A;  2HQE A;  1LPL A;  4N4I A;  4DBR A;  2CGH A;  1V29 B;  3L1A A;  2PVO B;  4MDW A;  3BE3 A;  2ZPH B;  2OJ2 A;  4K11 A;  3H41 A;  1GL5 A;  4OMO A;  2RQT A;  1QVP A;  4HCC A;  1QP2 A;  1UGR B;  1MMN A;  2P4T A;  2F2W A;  1OEB A;  4EMH A;  3QG1 A;  3LLR A;  3CQT A;  4DQ2 A;  1G3Y A;  1Q7Y C;  1PSE A;  3REA B;  2KDS A;  1BK2 A;  4FU6 A;  3VYH B;  1TUD A;  2RHU A;  5IHI A;  3RIR A;  3VS5 A;  4PLL A;  2ZPI B;  3EGX A;  1MMG A;  4EMK B;  1H64 1;  3G4S Q;  1OV3 A;  2ENM A;  2YDL A;  5KYW A;  1VQP A;  5FRM A;  1PKT A;  1NLP C;  3RDV A;  4OML A;  1Q86 U;  3I55 Q;  2JS0 A;  2VC8 A;  1NEG A;  3NGP A;  3FEO A;  3Q1J A;  1TG0 A;  3LGF A;  2WSC E;  2IIM A;  4FYX B;  4KUL A;  2L2P A;  1VQK T;  2BKD N;  2JN0 A;  2RM4 A;  4J9H A;  3NTH A;  2D8J A;  2GFA A;  2KGT A;  4PFO A;  3L2W A;  1VA7 A;  3EAE A;  4DOV A;  1U06 A;  1M90 U;  2ZPG B;  2K4Y A;  3FJ5 A;  1GCP A;  4CC4 B;  4JRI A;  3CD6 Q;  4M78 B;  4A4H A;  2JMC A;  1R8O B;  2Y90 A;  1FMW A;  5HKC A;  1K0S A;  1LVK A;  2XIC A;  1BYM A;  2W10 A;  1WLP B;  3X26 B;  5GAM e;  1UTI A;  1LCK A;  2IPO B;  2LT4 A;  4MZM A;  8ATC B;  1IGQ A;  5FU7 B;  3X20 B;  2MK5 A;  5GMK i;  1KG1 A;  4HCZ A;  2ED1 A;  2X51 A;  3VS6 A;  2CSI A;  3EFR A;  3CXC P;  2D9T A;  3CC4 T;  1R0C B;  1VQO A;  1H3Z A;  2MWO A;  4Y28 E;  4C8Q G;  4KGZ B;  4FW1 A;  1S1N A;  4XQ3 A;  3CCE Q;  4A4E A;  3EFO A;  1DJ7 B;  2DZ9 A;  4RG8 A;  2XKO C;  2O88 A;  3SWN A;  1I8F A;  1BI3 A;  4M7A F;  4C8Q D;  2K2M A;  2G6F X;  2QG9 B;  3CCQ A;  4E7S A;  4XU0 A;  2DEQ A;  1I1J A;  2HSE B;  5GAN e;  2X3W D;  3J7A F;  2DE0 X;  2LCC A;  4LDW A;  1PCX A;  1KIK A;  5GAM j;  4C0Z A;  2FHD A;  2XK0 A;  4F7U E;  2KT1 A;  2DXU A;  1WQ7 A;  1OQK A;  2DBM A;  3QII A;  2YUN A;  4BD3 A;  1S72 T;  4C92 E;  1IRX A;  1SF9 A;  1Z9Z A;  3HL8 A;  4M7A A;  4J9E A;  2FZG B;  3QKJ A;  5L23 A;  2DL7 A;  3C12 A;  2RQV A;  2GFU A;  2RF0 A;  1R0B G;  5D6W A;  1BKB A;  1YCS B;  2QGF B;  3EG1 A;  4J6W A;  4C92 C;  4D6W A;  5CKF A;  3M0U A;  1YJW T;  1TU0 B;  3OSS C;  2QGG A;  3CCU T;  2OTJ Q;  1QW1 A;  1BIA A;  3L2Z A;  2QEX Q;  4RUG A;  2D0N A;  3CPF A;  3HKS A;  2K79 A;  4BDY A;  5GAN j;  3H0I A;  4ANJ A;  2ATC B;  1S72 A;  2JTE A;  2MI6 A;  2K5L A;  2HZY A;  3PNW C;  2HKQ B;  4IUR A;  4ME7 A;  1ZX6 A;  4M75 G;  2EJG A;  2L3Q A;  4E2F B;  3UWN A;  2QQR A;  4C92 B;  1M27 C;  3HHT B;  1IZ6 A;  3HP9 A;  4GY5 A;  4EMK A;  4PJL A;  5FLX E;  1N9R A;  1TWB A;  1ZLM A;  3JCM W;  2JM8 A;  1D0Y A;  3RUX A;  1FXX A;  1YJW A;  1M4Z A;  4HVV A;  2E10 A;  1GCQ A;  2QI2 A;  4OB1 B;  2F2V A;  1MV0 B;  3DB3 A;  1VQ9 Q;  1YWO A;  2P4R A;  3SHW A;  4QKU A;  1ZA2 B;  2AKK A;  2K3B A;  2LX9 A;  3EGU A;  9ATC B;  1FMK A;  1TXQ A;  2J6O A;  3E2U A;  5GAN 8;  1ACM B;  3ZBD A;  3VUZ A;  4C0F A;  2JMA A;  2DXB A;  3CCJ T;  3CCM A;  2CS7 A;  2L0A A;  1Q7Y R;  2HBP A;  4M78 A;  4M7D G;  2JNG A;  3M56 A;  1QKW A;  4PK4 A;  2M16 A;  4OB3 B;  1UHF A;  5IAY A;  4RKU E;  5A0G A;  1K8A U;  4WTO B;  2X9H A;  2J6K A;  2H3E B;  2COY A;  4GLM A;  2SEM A;  3M54 A;  2PZ1 A;  4LDX A;  5EG2 A;  4E7L A;  1KC8 C;  4JDS A;  2CP0 A;  4M7D D;  1HJD A;  5FRO A;  2X4J A;  2O9V A;  1KQS P;  2DEU A;  3TEE A;  2NLU A;  1E7O A;  3VJP A;  2ABL A;  3PMI A;  4R55 A;  1PSF A;  2FG0 A;  1MHN A;  2EKO A;  2V26 A;  2KY9 A;  4OB2 B;  2ZAE A;  2DL3 A;  4P5N A;  3CCS T;  2L3S A;  2C0I A;  2R5M A;  3LWH A;  3HTR A;  2ZPB B;  4C5I A;  2DRM A;  4JJN K;  4JRQ A;  2GTJ A;  3OYD A;  2VUB A;  5GJW B;  3LGL A;  2EQK A;  1AWJ A;  4HCK A;  2DX1 A;  2RK2 A;  1VIF A;  3DB4 A;  4BY6 C;  3HRS A;  1M8V A;  2RHX A;  4DOW A;  1JJ2 A;  1WYX A;  4X9D A;  1NBE B;  4N4G A;  1VOM A;  2WSE E;  3H0F A;  3S3O A;  4ZGJ B;  2E1H A;  4F7U F;  2CP5 A;  4RG2 A;  2DJQ A;  4XU3 A;  1FWZ A;  4C92 F;  1X2Q A;  3CD6 A;  4BY6 B;  2HL5 C;  5KH6 A;  1TS9 A;  1TUG B;  2JVV A;  4NOY A;  1XNI A;  3CCV T;  2PNI A;  2QQ9 A;  3UT1 A;  4B9W A;  2EW3 A;  2DD5 A;  4RMO A;  3QWY A;  1GBQ A;  2R58 A;  3FB9 A;  1TSF A;  5FW9 A;  2WSF E;  4RTY A;  3L2U A;  3EFS A;  1RAG B;  3M0S A;  3OYN A;  1NPR A;  3CCL Q;  4C92 A;  1RL2 A;  2IG0 A;  4J9I A;  4BAC A;  1M8M A;  1VQ4 T;  4BI8 B;  2XDP A;  2BTT A;  3E9G A;  2GQI A;  2DKG A;  3CC2 Q;  3HRU A;  3SB2 A;  2V1Q A;  2BE7 D;  1QWF A;  2VV5 A;  3GF5 A;  4A53 A;  1VQ6 Q;  2QK0 A;  3I56 Q;  4RTW A;  5KYW B;  1QVG P;  3FRN A;  2CP2 A;  2RJF A;  1X75 C;  2EJ9 A;  2D1X A;  3UDC A;  3M4G A;  1AWX A;  2LJ1 A;  3CC7 T;  1Y57 A;  1SKU B;  1WJR A;  3THK A;  3CCR Q;  1U1S A;  1VQ5 Q;  3MEA A;  4PNO A;  3LX7 A;  2OTL T;  3WVD B;  3H6Z A;  3TCJ A;  4GLK A;  3D7S B;  3E9F A;  3QYG B;  1VQ4 A;  1MUZ A;  4KH1 B;  1RAF B;  1BBZ A;  1G5V A;  2FVU A;  2MMP A;  2RJC A;  4CRI A;  3SFM A;  1AWO A;  4RTV A;  1K9M R;  3M55 A;  1WDX A;  3JCM h;  3RMS A;  3CMA Q;  2E64 A;  1M1K C;  3CEY A;  4PJO G;  3OYI A;  3OYY A;  3NTK A;  4C0D C;  2FRW A;  1X2K A;  3ASK A;  2OTJ A;  4M77 G;  4WF2 A;  1JQQ A;  1K73 C;  3JAM E;  2QEX A;  2EYY A;  1VQ7 Q;  1B3Q A;  2Y4X A;  2HKN A;  1RAB B;  2KRS A;  5CKD A;  4KUD K;  2R57 A;  3M5A A;  2CYZ B;  1EX4 A;  4XTW A;  1PKS A;  4KGX B;  2KXD A;  2EPD A;  4BUG A;  2NUZ A;  5J26 A;  4C0D B;  2HQH A;  2FPE A;  1YJN T;  1WHK A;  2DL5 A;  2HEQ A;  1QVF P;  2GQV A;  1D3B A;  2B8A A;  3VUB A;  3JB9 J;  4LXC A;  1VQ8 Q;  1IO6 A;  1I5L A;  2CP3 A;  3MJX A;  4NL2 A;  3UPU A;  1YI2 T;  4BI3 A;  2O4X B;  1UUE A;  1NE8 A;  3VS7 A;  4FYY B;  3PTA A;  1VQ9 A;  3MP1 A;  3G1J A;  4BE2 A;  5GAO m;  3MET A;  3PIO A;  2NUT B;  4XTZ A;  5GAN 5;  2YT6 A;  2CRE A;  1G3W A;  1WA7 A;  5IXB A;  1H3H A;  1KC8 R;  2KYM A;  3OMC A;  1ZSZ C;  3GNF B;  2PQW A;  1YJN A;  2YUO A;  1R77 A;  2RK1 A;  3JB9 D;  1BI1 A;  3TSW A;  1W2B P;  3EG0 A;  4D8D A;  4HVU A;  1PRM C;  3QYH B;  2JW4 A;  5KE3 A;  2FL7 A;  4MDX A;  3WVE B;  2ECZ A;  1YI2 A;  3BY7 A;  1VQP T;  4XTX A;  5LJ5 h;  1UGQ B;  2VWF A;  2HAX A;  5GAO p;  3AT1 B;  1I0C A;  3JV3 A;  5CAI A;  2LQ8 A;  1ZSZ B;  2RO0 A;  4EMK C;  4HT9 A;  2M0Y A;  1BI2 A;  1VQL Q;  1FX7 A;  3QPH A;  4HXJ A;  2A0F B;  1I5O B;  3PFS A;  4KGV B;  3HPW A;  3M53 A;  4AFZ C;  4X34 A;  2EQI A;  1GCQ C;  4DA4 A;  2GGR A;  5D6X A;  2QTV A;  3RKX A;  2DMO A;  3NMZ C;  3P8B B;  5D6Y A;  3S3N A;  2PVD B;  3ZL7 C;  4M78 E;  4XU1 A;  4KT0 E;  4A4F A;  2A28 A;  4OMN A;  4Z02 A;  2LP5 A;  2MYS A;  3HFN A;  4AFU C;  1YIT Q;  2KAF A;  1D09 B;  3OBY A;  2H8H A;  1WQW A;  5DM7 R;  3U23 A;  1EFN A;  4Z89 A;  1KSW A;  5I2M A;  1BB9 A;  3VKI A;  2RJE A;  4ORZ A;  2L3R A;  2LJ0 A;  2WAC A;  1ARK A;  2DER A;  2MF2 A;  5AT1 B;  2A08 A;  3MHX A;  4FSX A;  3RES A;  3H8Z A;  3OW2 P;  1NZ9 A;  4M78 C;  2KK4 A;  1UJY A;  4MMK A;  4AG2 C;  4ELZ C;  2EQM A;  2K9G A;  1D0Z A;  1QLY A;  4XTU A;  1VQO T;  1EZZ B;  2C0O A;  3OYM A;  4E7Z A;  2RH2 A;  1BU1 A;  2COZ A;  5FU7 C;  1VIE A;  1ZBX A;  4X1V A;  5CQX A;  1BI0 A;  3QWX X;  1N9S A;  1JJ2 S;  3X24 B;  3G71 Q;  3FLG A;  2DTH A;  2K5I A;  4LD9 K;  1WNL A;  1T3L A;  3VU3 C;  5I21 A;  2DL8 A;  4OMF B;  2XID A;  5CQY A;  2D8H A;  2XDD A;  4ZTJ A;  2HSP A;  3CCQ T;  1U1T A;  5GAN 3;  1G83 A;  1G2B A;  1N8R C;  2HQX A;  2HCK A;  3EHR A;  3MO8 A;  2KE9 A;  1UJ0 A;  3LWI A;  2PUO B;  3A5Z B;  2EYZ A;  3UA6 A;  2YUP A;  1NLO C;  1ABO A;  3E1S A;  4FL6 A;  1UGV A;  5J39 A;  2GTO A;  5KYX B;  2LC4 A;  4Z8A A;  3FC3 A;  1VQN T;  2E5K A;  3MCA B;  3V8J A;  4RCC A;  2BIV A;  1Q7Y U;  4WCI A;  3CC2 A;  4M7D B;  4LE9 A;  4OVA A;  2J06 A;  1VQ6 A;  2O4X A;  3CPW A;  4JS5 A;  2RA2 A;  2RB6 A;  2IVW A;  4M7A G;  3G6E Q;  1M1K R;  1N27 A;  3OS2 A;  4ATO A;  1M3B A;  2NUT A;  2QXF A;  2CZ1 B;  1YJ9 Q;  2EIF A;  2QQA A;  3CCR A;  1UEB A;  1VQ5 A;  1ZUU A;  6AT1 B;  5CKB A;  2NYS A;  4AG1 C;  4BE0 A;  1JXM A;  1UFF A;  4X9C A;  1K73 R;  2FZC B;  4XU2 A;  1VQN A;  4J9C A;  2HNI A;  4JLI A;  1VQM Q;  5A0D A;  3MKD A;  4MML A;  2CDT A;  2YSQ A;  1XOV A;  2C06 A;  3QO3 A;  3LYI A;  2ROT A;  1YHQ Q;  1M30 A;  2W0Z A;  2EYQ A;  3O5Z A;  2LNV A;  1CKB A;  2AZV A;  4DEX A;  4QQG A;  3JCM c;  1YIJ Q;  2L3P A;  1M1G A;  4FT2 A;  1QKX A;  2K7A A;  1ZSZ A;  3AHU A;  2DET A;  1MGQ A;  1PG5 B;  1JBM A;  3RMQ A;  2YRD A;  3OYB A;  2HL3 A;  4OB0 B;  4IUT A;  1AZE A;  2J6F A;  4LNP A;  1K9M C;  5C0M A;  2LMJ A;  2QQB A;  2YXY A;  4J9D A;  4AFS C;  5A2Q E;  3SDZ A;  1XQH A;  4HVW A;  3CCM T;  1JXO A;  5GMK l;  5CR2 A;  2OX7 A;  2E4H A;  4EDU A;  4PJN A;  1VQ8 A;  4JJB A;  4M75 D;  4BDZ A;  1Q82 C;  4N0A C;  4F14 A;  2I2L A;  4M78 F;  1YWP A;  2ED0 A;  3ULR B;  3OB9 A;  4DBH A;  2A3L A;  3KXT A;  4IKF A;  1ZUY A;  1CSK A;  1PD0 A;  2CZ6 B;  1C0M A;  2QQS A;  3OYJ A;  1UE9 A;  3SEM A;  3OYH A;  3EGD A;  1EIF A;  2RN8 A;  3OS1 A;  1JB0 E;  3QZ5 B;  3QUI A;  5DLO A;  1RAH B;  1TH7 A;  3JSC A;  5HY6 A;  4CC7 A;  5FWC A;  4QT7 A;  1W1F A;  4FM4 B;  4J83 A;  1MV3 A;  5FWB A;  4D8K A;  1M2O A;  3JCM g;  3CME Q;  3OS0 A;  3G4S T;  2F5T X;  2QAZ A;  1BCO A;  1TTH B;  2HMA A;  4O5V A;  3UA7 A;  4AMC A;  3I55 T;  5GAO q;  1OYX A;  3ME9 A;  1SHG A;  4EMG A;  2HBW A;  4IUQ A;  1A0N B;  5LL6 S;  1QCO A;  2DNU A;  4EIK A;  3CXC A;  4JS4 A;  5KYX A;  2VAS A;  1XTD A;  2E3I A;  3EHQ A;  2DVE A;  3NTI A;  4NS5 A;  4M7D A;  4PLI A;  2P0P A;  3QZ9 B;  5KYY B;  1K9M U;  1SHF A;  1IGU A;  2VGN A;  1T0J A;  3JCM f;  2AKL A;  2A7Y A;  3G4S A;  2RI2 A;  4B9X A;  3OBW A;  5GMK h;  1YFN A;  4FYW B;  5LJ3 h;  2QA4 Q;  3CD6 T;  2VKN A;  1D3B B;  1Q81 C;  3OYF A;  2OI3 A;  1AOJ A;  1ZBJ A;  2RD1 A;  3OYG A;  3VS0 A;  3I55 A;  2DLP A;  3URG A;  1SPK A;  2EYX A;  3M58 A;  2DIQ A;  4J6X A;  3QSU A;  2FPF A;  2K57 A;  2FO0 A;  4E7I A;  4A63 B;  1V76 A;  2K3Y A;  5KCH A;  1AD5 A;  1X01 A;  2KRN A;  1N8R R;  3VV0 A;  5FU6 B;  2PUK B;  1O9S A;  3RKW A;  2RNA A;  1W70 A;  3CCE T;  4OP0 A;  1JEG A;  3GBQ A;  4F7U G;  1UG1 A;  4PKC C;  3G71 A;  2AK5 A;  4QVD A;  1K76 A;  2GNC A;  1MMD A;  4C92 G;  1GRI A;  5LJ5 g;  3VRY A;  4IUV A;  1WXT A;  2KI7 A;  3JCM d;  2XD0 A;  3VS2 A;  5GAO r;  5IHN A;  1OU9 A;  3RR6 A;  2KNB B;  2CUD A;  1PHT A;  3CBO A;  3RKY A;  5D7U A;  3CBM A;  1RAI B;  1RAA B;  2DA9 A;  2L5Q A;  4E47 A;  1QP3 A;  1KC8 U;  3H0H A;  5HCK A;  2EFI A;  2JM9 A;  1WIE A;  2CP6 A;  3I9Q A;  3OYK A;  3CCE A;  3P8H A;  1VQK Q;  1PM3 A;  2MIO A;  3JCM Q;  3GOX A;  1RAD B;  2J05 A;  1IHW A;  2O9S A;  3LH0 A;  5IN1 A;  3QHS A;  5IHK A;  4KRT A;  2X35 A;  5LJ5 f;  4E6R A;  1NYF A;  1PWT A;  2NWM A;  2J7I A;  2OTJ T;  2YUQ A;  4Y92 A;  1Y96 B;  4R56 A;  2QEX T;  1YJ9 A;  1WXB A;  4J7F A;  1KJW A;  2CT4 A;  5I22 A;  4IIO A;  3WXM B;  2LDM A;  1N6A A;  1FYN A;  5CVI A;  3OYE A;  4XK8 E;  2F69 A;  4N0A A;  3MEU A;  4IUU A;  3GPL A;  2DXC A;  4J9F A;  4Q5W A;  1WJS A;  2CUB A;  3TSZ A;  2O01 E;  4QVZ A;  3UAT A;  4DEY A;  3CC4 Q;  3C95 A;  3VRZ A;  4ZGE B;  2F5K A;  1W6X A;  3TRE A;  3V8K A;  5GMK e;  2CT3 A;  2QYZ A;  3M59 A;  5C6S A;  1SEM A;  1M3C A;  3I5S A;  3A8L B;  3I35 A;  3OS5 A;  1UB4 A;  1G8X A;  1Z9Q A;  2DAQ A;  2M9U A;  4HKE A;  2KXC A;  1V1C A;  2K3X A;  1UEC A;  1RAC B;  2DBK A;  1VQ9 T;  2KSS A;  2LQN A;  4OGC A;  2P0K A;  1K1Z A;  2DK3 A;  4JZ3 A;  5A0L A;  1Q82 R;  4F04 B;  1KQS A;  5CIU A;  4PJO D;  5LJ5 d;  3C4S A;  1WX6 A;  2EGA A;  4C8Q E;  2EQU A;  3E19 A;  3PMT A;  2GBQ A;  5KYY A;  4M77 D;  4ZNX A;  2KRM A;  3M0Q A;  2PTK A;  3NFC A;  4ZTF A;  2YHT A;  1OU8 A;  2E3H A;  1RAE B;  3JCM P;  1S72 Q;  1X6G A;  4OMM A;  2B86 A;  4PJJ A;  4BE1 A;  4C8Q C;  4CI0 C;  4F17 A;  4PFP A;  5GMK j;  5LJ3 j;  1Q86 C;  4TVR A;  4BB7 A;  4PJM A;  3ZEH A;  4LN2 A;  2LT1 A;  3N5B B;  1UGP B;  2ZPE B;  3CCU Q;  3JB9 F;  4C8Q B;  3M0R A;  1RLP C;  4CC2 A;  3JCM V;  5GAM h;  2ZGW A;  4A54 A;  1MND A;  1T0H A;  1WHJ A;  4J9B A;  2YLB A;  4ZN3 A;  2RPN A;  4Z88 A;  1M90 C;  1IB8 A;  4L59 A;  5DY9 A;  2XU8 A;  3R6N A;  3ER0 A;  1NM7 A;  3M9Q A;  1ZQ1 A;  1ZUK A;  3EH1 A;  2ZZD A;  5IH2 A;  1M1K U;  2DRK A;  3FDR A;  2BE9 B;  3HRT A;  2V8K A;  2LJ3 A;  5I2S A;  3MPU B;  4LUD A;  1Q81 R;  2E6Z A;  1IRE B;  2CP7 A;  5GAN 6;  1D1B A;  2XMF A;  2CZ0 B;  4M75 E;  3PIP A;  3C94 A;  1K73 U;  2DL4 A;  4A4K A;  5GAN h;  4QVC A;  3CXC S;  4YTL A;  4E7H A;  1KFZ A;  3L2R A;  4N4H A;  2RI3 A;  3JCM e;  3A98 A;  3QXE B;  2OAU A;  2DTI A;  2MAM A;  1NYG A;  1ZHI A;  2DYB A;  2QA4 A;  2X4Y A;  2LCL A;  1QVG A;  4M75 C;  5CCA A;  3CCJ Q;  3MP8 A;  4F16 A;  4M4Z A;  1K4U S;  1KK7 A;  1Y96 A;  2C0T A;  2ROL A;  3I5R A;  2PU9 B;  2X4X A;  1TOV A;  3S3M A;  4OMP A;  2ESW A;  2BZX A;  1FMV A;  3KUF A;  3L2Q A;  1M1F A;  2M51 A;  1WXU A;  3EGD B;  3JCM J;  4AT1 B;  2JT4 A;  3CCL T;  4M75 B;  1U8R A;  1OPK A;  1LJO A;  4M7D E;  5CK9 A;  1KD1 R;  2K5F A;  2MWP A;  4II1 A;  3CC2 T;  1Q95 G;  1ZSG A;  2KQW A;  3TQ7 P;  1VQ6 T;  3I56 T;  1OOT A;  3A8G B;  2LX7 A;  3CCS Q;  5ECA A;  1M5Q 1;  1VYU A;  2VXF A;  1WGS A;  2BUD A;  4M7D C;  1AWW A;  2HD0 A;  4Y91 A;  2V1R A;  4FSS A;  4DBF A;  3FIF A;  2JJ9 A;  2FZK B;  3PVQ A;  4L6V 5;  1PC0 A;  2MCN A;  3CCR T;  1VQ5 T;  3QBY A;  2R5A A;  3HSB A;  2A37 A;  1YP5 A;  4JJC A;  3CCL A;  4JPB W;  2E65 A;  4UC4 A;  2KVQ G;  4JLG A;  4IIM A;  3OMG A;  1OZ2 A;  1NPP A;  1WHM A;  4O6J A;  3F70 A;  2KR3 A;  2SRC A;  1VQK A;  5KCO A;  4C8Q F;  1N5Z A;  1QQJ A;  1QVF A;  2AIR B;  2M1H A;  4GBQ A;  1HSQ A;  1YNZ A;  5IT9 E;  3ZFJ A;  3CMA T;  2P84 A;  3DKM A;  5LJ5 e;  1SSF A;  5LJ3 g;  3I56 A;  3H9N A;  4V2S A;  2DF6 A;  1AT1 B;  2KYB A;  1XJW B;  4FYV B;  1PNJ A;  3JB9 H;  1ZA1 B;  2NUP B;  4XAX B;  5M9O A;  4QW2 A;  2JUF A;  2K2V A;  1YN8 A;  3CBP A;  3OY9 A;  2E5Q A;  3CCV Q;  1WI7 A;  5KYN A;  1C6V X;  4C8Q A;  2V8I A;  3VS3 A;  1VQ7 T;  1K0X A;  1G3S A;  3NHN A;  2YRV A;  4M7A D;  2LQK A;  1M9S A;  2A36 A;  1WZO A;  3PE0 A;  3X28 B;  2DFU A;  4FCY A;  1W2B A;  3CC4 A;  4KH0 B;  2L89 A;  3CMA A;  5GAN 7;  2CZ7 B;  4J8O A;  4LDU A;  1JJ2 P;  1C1A A;  1WPY A;  3FJP A;  1X27 A;  5LJ3 f;  3BDL A;  1VQ4 Q;  1E6G A;  1HK9 A;  1VQ8 T;  2DIL A;  1LNX A;  1K8A C;  3S6W A;  3A8O B;  1PD1 A;  2BZY A;  5LJ5 j;  1H92 A;  2COW A;  1Y71 A;  2K6D A;  4LDY A;  4LD6 A;  1QCF A;  2L8D A;  2CSQ A;  3OA6 A;  1HXD A;  1VQ7 A;  1J3T A;  2XI9 A;  1M3A A;  5GJV B;  1Q86 R;  2VYT A;  2F2X A;  1U5S A;  1N8R U;  2CH4 A;  3CC7 Q;  3L42 A;  5CO7 A;  3GP8 A;  3SD4 A;  4C5H A;  2E6N A;  1KQ1 A;  2M02 A;  1KQS S;  1OX9 A;  4FW2 A;  2G3R A;  2OTL Q;  1NEB A;  2QDL A;  2KBT A;  3PGG A;  2LCS A;  2O31 A;  4OF1 A;  1P92 A;  4M75 F;  4RTT A;  2P0Q A;  1HD3 A;  4F7U B;  3BDU A;  1X6B A;  3QJY A;  1G3T A;  3V7C A;  1M90 R;  3V7S A;  2MPX C;  1X69 A;  1F1B B;  4E7K A;  1MMA A;  4M78 G;  5GAN 4;  3OQ5 A;  3OW2 A;  1IXD A;  3KBG A;  2QAS A;  5LJ3 d;  2EGC A;  2JTM A;  3A8H B;  1I81 A;  1AEY A;  3T9N A;  3M4Y A;  1VQL T;  4M75 A;  3CCU A;  2RMO A;  2DVJ A;  3V8L A;  2E41 A; 
#chains in the Genus database with same CATH homology
 2YT6 A;  2CRE A;  2ED1 A;  5I11 A;  2DA9 A;  3VS6 A;  3EG3 A;  1WA7 A;  2CSI A;  5IXB A;  3H0H A;  5HCK A;  2JM9 A;  1H3H A;  1WIE A;  3I9Q A;  2KYM A;  5EC7 A;  2LNH B;  2YUO A;  2MIO A;  1S1N A;  1GFD A;  1JO8 A;  3M0P A;  3TSW A;  2J05 A;  3EG0 A;  4D8D A;  2EGE A;  2O9S A;  4HVU A;  1PRM C;  2JW4 A;  5IHK A;  4KRT A;  2O88 A;  4E6R A;  1NYF A;  2ECZ A;  1PWT A;  2NWM A;  2VWF A;  2J7I A;  2K2M A;  2G6F X;  2JS2 A;  1I0C A;  2YUQ A;  1CKA A;  3JV3 A;  4RTZ A;  2KT8 A;  3PVL A;  1I1J A;  4Y92 A;  2EYW A;  2M0Y A;  1WXB A;  2X3W D;  2X3X D;  1KJW A;  2CT4 A;  5I22 A;  4IIO A;  2DE0 X;  1FYN A;  1PRL C;  4J9G A;  4HXJ A;  1RLQ C;  1T3S A;  1KIK A;  2KT1 A;  2DBM A;  4AFZ C;  4J9F A;  2EQI A;  1GCQ C;  2YUN A;  2GGR A;  2CUB A;  2FPD A;  1H8K A;  2DMO A;  3TSZ A;  3C0C A;  1K9A A;  3NMZ C;  2DM1 A;  3UAT A;  1Z9Z A;  4DEY A;  3VRZ A;  4J9E A;  1W6X A;  2CT3 A;  2EBP A;  3ZL7 C;  5L23 A;  3TVT A;  2A28 A;  1SEM A;  2DL7 A;  4OMN A;  1M3C A;  2CH4 W;  2LP5 A;  3I5S A;  2RQV A;  3I35 A;  3M0T A;  2RF0 A;  4JJD A;  4AFU C;  1Z9Q A;  2EKH A;  2H8H A;  2KXC A;  1YCS B;  1V1C A;  1EFN A;  3U23 A;  4Z89 A;  1KSW A;  1BB9 A;  3EG1 A;  4ORZ A;  3RBB B;  1X43 A;  1ARK A;  2LJ0 A;  1UEC A;  2DBK A;  3M0U A;  2A08 A;  2LQN A;  1K1Z A;  4JZ3 A;  2LQW A;  1GFC A;  1UJY A;  2KEA A;  1WX6 A;  2EGA A;  4RUG A;  1UHC A;  4AG2 C;  2D0N A;  2K79 A;  3H0I A;  2K9G A;  1QLY A;  2GBQ A;  2LZ6 B;  2JTE A;  2C0O A;  4ZNX A;  1BU1 A;  2KRM A;  3M0Q A;  2PTK A;  1ZX6 A;  4OMQ A;  4X1V A;  2L3Q A;  3QWX X;  2AZS A;  1X6G A;  1M27 C;  4OMM A;  2B86 A;  1AVZ C;  1QWE A;  1ZLM A;  4F17 A;  1U3O A;  1T3L A;  2DL8 A;  1SSH A;  2JM8 A;  2D8H A;  2HSP A;  2RQR A;  1G83 A;  4HVV A;  1Y0M A;  1GCQ A;  1G2B A;  2F2V A;  2HCK A;  3EHR A;  4LN2 A;  3KFV A;  1MV0 B;  2KE9 A;  1UJ0 A;  2OAW A;  2EYZ A;  3UA6 A;  1UDL A;  1YWO A;  2YUP A;  3LH5 A;  1NLO C;  1ABO A;  2P4R A;  3SHW A;  3M0R A;  1RLP C;  3UF4 A;  4CC2 A;  1UGV A;  2AKK A;  2K3B A;  1T0H A;  3EGU A;  2GTO A;  1AZG B;  1FMK A;  4Z8A A;  2J6O A;  4J9B A;  2O2O A;  2E5K A;  2RPN A;  4JZ4 A;  2VVK A;  4Z88 A;  2JMA A;  2BZ8 A;  4WCI A;  3IQL A;  2L0A A;  3R6N A;  4LE9 A;  1QKW A;  4LUE A;  2J06 A;  1NM7 A;  1UHF A;  1ZUK A;  5IH2 A;  2DRK A;  2J6K A;  2LJ3 A;  2HDA A;  1SRL A;  4GLM A;  4R0K A;  4LUD A;  1GBR A;  1M3B A;  2SEM A;  1B07 A;  2PZ1 A;  1OPL A;  2XMF A;  1ZUU A;  1HJD A;  4AG1 C;  4AFQ C;  2O9V A;  1JXM A;  2DL4 A;  1E7O A;  1UFF A;  1KFZ A;  2ABL A;  4J9C A;  1WFW A;  2FEI A;  3A98 A;  2FG0 A;  5IXF A;  2CDT A;  2YSQ A;  1XOV A;  1NYG A;  4RTU A;  2KRO A;  2MOX A;  2ROT A;  2DL3 A;  2DYB A;  1M30 A;  2W0Z A;  3O5Z A;  2L3S A;  1CKB A;  2AZV A;  2FRY A;  4DEX A;  1JU5 C;  1RI9 A;  2I0N A;  2L3P A;  2C0I A;  4F16 A;  4M4Z A;  1QKX A;  2K7A A;  1K4U S;  3EG2 A;  3NPF A;  2C0T A;  2ROL A;  3I5R A;  1VYV A;  2DRM A;  2GTJ A;  5GJW B;  1AZE A;  4OMP A;  2J6F A;  1AWJ A;  2ESW A;  4CC3 A;  2BZX A;  4LNP A;  4HCK A;  2DX1 A;  2M51 A;  1WXU A;  2JT4 A;  1I07 A;  2LMJ A;  4ESR A;  1SRM A;  4J9D A;  1OPK A;  4RTX A;  4AFS C;  1WYX A;  3VS1 A;  3H0F A;  1NG2 A;  4HVW A;  1ZSG A;  1JXO A;  1E6H A;  2DJQ A;  3REB B;  1OOT A;  4JJB A;  2LX7 A;  1X2Q A;  5ECA A;  1VYU A;  4F14 A;  1YWP A;  1TUC A;  2ED0 A;  3ULR B;  1AWW A;  3RNJ A;  2RQW A;  2PNI A;  2V1R A;  4FSS A;  1ZUY A;  1CSK A;  3PVQ A;  1ABQ A;  2EW3 A;  2MCN A;  3QWY A;  1GBQ A;  1UE9 A;  2JXB A;  1VYT A;  3SEM A;  2A37 A;  1YP5 A;  4JJC A;  1RUW A;  5FW9 A;  4JPB W;  2RN8 A;  4RTY A;  4IIM A;  3M0S A;  4CC7 A;  2EVR A;  5FWC A;  2KR3 A;  2SRC A;  4QT7 A;  4J9I A;  1W1F A;  1M8M A;  1N5Z A;  4GBQ A;  1HSQ A;  1MV3 A;  5FWB A;  1YNZ A;  4D8K A;  2BTT A;  2GQI A;  2RQU A;  3VS4 A;  2DF6 A;  2V1Q A;  2KYB A;  1QWF A;  4RTW A;  1PNJ A;  3UA7 A;  2OJ2 A;  4K11 A;  2D1X A;  1YN8 A;  1AWX A;  2LJ1 A;  1SHG A;  1WI7 A;  3H41 A;  2HBW A;  1A0N B;  1GL5 A;  4OMO A;  2RQT A;  3VS3 A;  2DNU A;  4EIK A;  1K0X A;  1Y57 A;  3NHN A;  3THK A;  2F2W A;  1OEB A;  3CQT A;  2A36 A;  3EHQ A;  3PE0 A;  1MUZ A;  3REA B;  1BBZ A;  1BK2 A;  1SHF A;  1T0J A;  1TUD A;  1X27 A;  2AKL A;  1AWO A;  4RTV A;  1E6G A;  5IHI A;  3VS5 A;  1WDX A;  2DIL A;  2VKN A;  2OI3 A;  1AOJ A;  1OV3 A;  2BZY A;  2ENM A;  1ZBJ A;  2YDL A;  1H92 A;  3VS0 A;  2DLP A;  2K6D A;  1QCF A;  1SPK A;  2EYX A;  1PKT A;  2CSQ A;  1NLP C;  2FRW A;  1X2K A;  2FPF A;  4OML A;  2FO0 A;  1JQQ A;  1J3T A;  1M3A A;  5GJV B;  4A63 B;  2JS0 A;  1NEG A;  2F2X A;  1U5S A;  2EYY A;  3NGP A;  2CH4 A;  1AD5 A;  2KRN A;  1TG0 A;  1B3Q A;  2IIM A;  2RNA A;  2KRS A;  2L2P A;  1NEB A;  1W70 A;  2KBT A;  2QDL A;  2LCS A;  2O31 A;  1PKS A;  2KXD A;  1JEG A;  4RTT A;  2EPD A;  4J9H A;  2NUZ A;  1HD3 A;  2FPE A;  2D8J A;  3GBQ A;  1UG1 A;  2KGT A;  2DL5 A;  2AK5 A;  1VA7 A;  1X6B A;  2HEQ A;  1K76 A;  2GNC A;  1U06 A;  3FJ5 A;  1GRI A;  1GCP A;  1IO6 A;  4CC4 B;  1X69 A;  3VRY A;  2JMC A;  1WXT A;  1UUE A;  2EGC A;  1K0S A;  1AEY A;  3VS2 A;  2W10 A;  3VS7 A;  1WLP B;  1UTI A;  5IHN A;  2KNB B;  1LCK A;  2CUD A;  2RMO A;  2DVJ A;  1PHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...