4AFUC

Human chymase - fynomer complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
LFVALYDYQADRWTDLSFHKGEKFQILDASPPGDWWEARSLTTGETGYIPSNYVAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afuC00
3KFVA 2YSQA 1I07A 2EYZA 4DEYA 1JU5C 2K79A 1GRIA 2YDLA 2KNBB 2FRWA 2GGRA 2LMJA 2MOXA 2L3SA 1M3AA 2CT3A 5IXBA 1UE9A 2A08A 1YWOA 4HVUA 1AWWA 2JM9A 4FSSA 2BZYA 2RQRA 4JZ3A 2CREA 1UJ0A 1UUEA 1H92A 1W1FA 3IQLA 4JJCA 4HXJA 2GTOA 1AWJA 4CC7A 2LP5A 2ECZA 2KT8A 1NLPC 3PVLA 2PTKA 1SHFA 3VRYA 2KR3A 5L23A 4E6RA 1IO6A 2RF0A 1GBQA 2FG0A 1AOJA 1X43A 3VS5A 1RLQC 1SRLA 3H0HA 2EW3A 2KYMA 4LUEA 1WIEA 2V1RA 1FYNA 5GJWB 1CSKA 2JT4A 2EVRA 1I0CA 3ULRB 1BBZA 2KBTA 5HCKA 1T3SA 4KRTA 2DE0X 3QWXX 1K9AA 2LJ0A 1PKTA 1TUCA 2LQWA 2J05A 3EG0A 4LUDA 1LCKA 2O9VA 1RI9A 3H0IA 1A0NB 1E7OA 1JXOA 3H0FA 4RTUA 3M0UA 1WX6A 1B07A 3VS0A 2LZ6B 2DL3A 2DNUA 2YUOA 4AFZC 1E6GA 2LNHB 3I35A 2DMOA 1VYUA 1OEBA 2AK5A 2JXBA 3M0TA 4M4ZA 2LX7A 1GBRA 3GBQA 2SEMA 2O88A 1RLPC 1UTIA 3EHQA 2EPDA 2K3BA 2KT1A 3EG1A 1KIKA 1AWOA 2FO0A 2G6FX 2RQUA 4D8DA 1PRMC 2RN8A 5IH2A 2DX1A 1M27C 3VS7A 2DL4A 5IHKA 1S1NA 3QWYA 1QWFA 2AKKA 3SEMA 4AFSC 4AFQC 2D1XA 2A37A 1WYXA 4RUGA 4GBQA 1T0JA 1ARKA 4J9GA 1GL5A 3C0CA 3VS1A 3THKA 4X1VA 1K0XA 5FW9A 1X27A 2L3PA 4IIOA 3TSZA 2I0NA 3UA7A 1ZX6A 4ESRA 1WA7A 3UA6A 4AG1C 1WI7A 4F14A 3PVQA 1WXBA 1KSWA 2PNIA 1YN8A 3H41A 1NG2A 1CKBA 1GCQA 2YUPA 1WXTA 1YWPA 1UJYA 2EGAA 2AZSA 2MCNA 2CH4A 1T0HA 1UDLA 1MV0B 4DEXA 1K4US 1ZUKA 1JEGA 3M0QA 4J9HA 3SHWA 2F2WA 2O31A 2B86A 1GFDA 2X3WD 1ZBJA 2K6DA 2J06A 3NHNA 1UFFA 2VVKA 1T3LA 2HEQA 1QCFA 3VS2A 3A98A 3TSWA 2EBPA 2JS0A 1G2BA 2DBMA 1PHTA 4ZNXA 2KE9A 2F2VA 3UF4A 2FPEA 2LJ3A 5I11A 1VYVA 1Z9ZA 2CT4A 1Y57A 2IIMA 2DL5A 1M8MA 2RQWA 5IHIA 4RTXA 1PRLC 1M3BA 5FWBA 2OI3A 1JXMA 1OPKA 3TVTA 1SSHA 2HDAA 2EGCA 3EG3A 1I1JA 2CH4W 5IHNA 2KROA 3O5ZA 1SHGA 1AD5A 1M30A 1HSQA 1Y0MA 2PZ1A 2BZXA 2OJ2A 1UG1A 2ESWA 2KEAA 2X3XD 1NM7A 1ZUYA 1AZEA 3EHRA 2ABLA 2CUDA 2YUNA 4AG2C 1K1ZA 4RTWA 2GNCA 3ZL7C 1SRMA 1ABOA 2F2XA 2JM8A 1YNZA 4J9DA 1OOTA 1Z9QA 2J6OA 2GTJA 3CQTA 2NWMA 2C0IA 2JMCA 1QKWA 2KXDA 2EYYA 1VA7A 4OMLA 5ECAA 1U06A 2LJ1A 2J6KA 2SRCA 4F16A 1NYFA 2KYBA 1H8KA 1G83A 2DF6A 2L0AA 1HJDA 4CC3A 2DRKA 1K76A 2J6FA 2ROLA 2KRMA 1X6BA 5EC7A 1X69A 2JMAA 2C0TA 1X2QA 1BB9A 1M3CA 4LNPA 3I5RA 1E6HA 2ED1A 2EYWA 3JV3A 1HD3A 2DILA 4CC2A 4JJBA 4J9FA 1TUDA 1FMKA 4HVWA 1U3OA 3I5SA 2BZ8A 2VKNA 4J9IA 1AWXA 2D0NA 2K7AA 2V1QA 2DA9A 2RPNA 4K11A 5GJVB 1ZLMA 4QT7A 2AZVA 2FRYA 2EQIA 1ZUUA 2HBWA 4OMPA 2LQNA 1ZSGA 2RQTA 3VRZA 1CKAA 2KXCA 2O2OA 4JZ4A 2CDTA 3RBBB 2EGEA 2D8JA 2M0YA 1AVZC 1N5ZA 1UHCA 4RTYA 1WXUA 4A63B 1K0SA 2A28A 2L2PA 1QWEA 2P4RA 4ORZA 3UATA 3M0SA 3M0RA 1TG0A 4CC4B 2DJQA 1QLYA 1X6GA 1SPKA 4AFUC 1PNJA 3PE0A 4OMNA 2ED0A 5I22A 1XOVA 1W70A 3NPFA 1H3HA 1GCPA 3EGUA 4RTTA 2FPDA 2D8HA 2DVJA 1OPLA 2DLPA 4EIKA 4Z89A 2JW4A 2EKHA 2RQVA 2K2MA 5FWCA 1SEMA 3LH5A 2DM1A 3VS4A 4Z8AA 1EFNA 2DBKA 2DL7A 4GLMA 1BU1A 2HCKA 1AZGB 1UGVA 1YP5A 2ENMA 1NEGA 2NUZA 1PKSA 1OV3A 2O9SA 3I9QA 2XMFA 2YUQA 2EYXA 2E5KA 2KGTA 2LCSA 2C0OA 2KRSA 1B3QA 3RNJA 4RTVA 1MV3A 2VWFA 1KJWA 3R6NA 4Y92A 2JTEA 5IXFA 2K9GA 2DL8A 4HCKA 3VS3A 2QDLA 3M0PA 1YCSB 2L3QA 2HSPA 1JQQA 3EG2A 2RNAA 1GFCA 1WLPB 4RTZA 2OAWA 1RUWA 2FPFA 3REAB 4OMMA 1MUZA 2AKLA 1W6XA 2YT6A 2H8HA 4Z88A 1WFWA 1JO8A 2W0ZA 4J9EA 2CUBA 3FJ5A 3NGPA 4WCIA 2J7IA 3U23A 4LN2A 4F17A 4JPBW 1NEBA 1UECA 1AEYA 1WDXA 1VYTA 1BK2A 1X2KA 1NYGA 2GQIA 4JJDA 1J3TA 4D8KA 2DRMA 4OMOA 4J9BA 3VS6A 2FEIA 4IIMA 1V1CA 2CSIA 2ROTA 2CSQA 1PWTA 3REBB 1KFZA 4HVVA 1QKXA 1ABQA 1NLOC 2DYBA 2RMOA 2A36A 4LE9A 1U5SA 4OMQA 2JS2A 2KRNA 4R0KA 2M51A 2BTTA 3NMZC 1UHFA 2GBQA 1GCQC 4J9CA 2MIOA 2W10A
chains in the Genus database with same CATH superfamily
3KFVA 3VYHB 1I07A 4FYXB 1GRIA 2FVUA 3SD4A 5GAOq 3M4GA 2MOXA 2L3SA 1YJWA 3EGXA 2WSCE 1M3AA 5CKDA 2PUOB 2E70A 3X20B 4PNOA 3CBMA 2HSEB 1VQMQ 4QW2A 2JM9A 4FSSA 1UJ0A 3I55Q 3C95A 4UC4A 1W1FA 4JJCA 2RK2A 1AWJA 4CC7A 2LP5A 5KYWB 2PTKA 1MNDA 2DETA 1RAHB 5GANd 3OYJA 1GBQA 3I56Q 1G8XA 2FG0A 3DB3A 4FYWB 1PM3A 1SRLA 5KYYB 2KYMA 3LWIA 2ATCB 1FYNA 4OF1A 2M1HA 4PLIA 1VQKA 2HL3A 4XTXA 3URGA 2K2VA 3OSSC 2NUTB 3OYLA 2VB6A 3G6ET 2VASA 5LJ5h 1G3WA 2VXFA 4BD3A 3H8ZA 4HT8A 1VQOT 3S3MA 3MJXA 5GAN7 2O9VA 1RI9A 4M75A 1YITT 4M75D 5LJ5j 3SWNB 4M77B 5J39A 3G71T 4M7DE 2LZ6B 2DL3A 1Q7YR 2OTJT 2DMOA 2FZGB 1VQ4A 4HT9A 3CPFA 2BUDA 4FSXA 4BDZA 1VQNQ 2M02A 2KSSA 2ZPBB 1KIKA 2G6FX 4IUVA 1LPLA 5IH2A 2ZPGB 4RCCA 1WHLA 3VS7A 2DL4A 3SDZA 4DOVA 3QWYA 1NJIC 2IG0A 1OX9A 4Y91A 2D1XA 3J80E 3OYGA 5CQXA 3DLLA 4GBQA 1T0JA 2MF2A 3EGXB 3C0CA 4ELYC 3THKA 1TH7A 2L3RA 2CP2A 3QHSA 5D6WA 2L3PA 4ZGJB 3EGDA 3UPUA 2COZA 3UA7A 2LT1A 5KE3A 4F14A 5LJ5d 1WXBA 4M78E 2RJEA 2CP0A 3CPWS 4JLIA 2PNIA 5FU6C 1F1BB 2V8KA 2YUPA 3DB4A 2PU9B 4LDYA 1UEBA 1K9MU 3CD6Q 2EGAA 2QI2A 1T0HA 3LWHA 2QAZA 1BYMA 4QQDA 5CR2A 4J9HA 1N9RA 2PQWA 2IVWA 2HAXA 2K6DA 4MDXA 1UFFA 2VVKA 3CCVA 3VS2A 1Y96A 4ZNXA 1M1KR 2F2VA 2FPEA 3CCMT 3EFOA 4QQGA 3OYDA 4EMGA 2F1LA 1TXQA 2E5QA 1VQ6A 1Y57A 4J7IA 5FROA 2DL5A 4FU6A 3L2WA 4ZTFA 2EKOA 1PRLC 1LOJA 3G4ST 1M2OA 4C0FA 1M3BA 3TU4K 2OI3A 4XU3A 4E47A 2M0OA 1K73R 2DXBA 2HDAA 1RAAB 1S72Q 1O9SA 5IHNA 5DLQE 3OYEA 1YJNA 2KROA 1KQSA 2CP3A 1B34A 1KC8R 4XU0A 1HSQA 4OB2B 2HQHA 1WHJA 2LQKA 5GAMd 2ESWA 3CMAA 2RHXA 3C12A 3AHUA 8AT1B 4C8QA 4C92B 3ZL7C 2GNCA 1SRMA 4C8QD 2CZ6B 2F2XA 3V7CA 4J5YA 1YNZA 1ZHIA 1VQ8A 2J6OA 2GTJA 5GAN8 3JCMe 2C0IA 2PVOB 1IRXA 5I2SA 1K73U 1YHQA 3EGDB 2L0AA 3WXMB 2DRKA 2J6FA 3C4SA 2YRVA 5CKEA 2XDBA 1M3CA 4LNPA 1EZZB 3I5RA 2ED1A 3JV3A 4J6XA 1NZ9A 5CQYA 1YJWQ 2VV5A 4J6WA 7AT1B 1D0ZA 3GOXA 2YWWA 1FMKA 4HVWA 2O4XA 4EMHA 3UWNA 1KD1U 1NBEB 3OYHA 2K5LA 2DA9A 4K11A 3LYIA 1ZA1B 2AZVA 4M77F 2QTVA 3CCUQ 5KH6A 2FRYA 5C0MA 1Y96B 1QCOA 1WJQA 1M90U 4Y28E 2ZPIB 2LT4A 3RKYA 3EFOB 2X4JA 3J81E 4LD9K 2EFIA 3O8VA 4JZ4A 2CDTA 2OTLT 2K5FA 3QG1A 4BI4A 3S3NA 2M0YA 5CKFA 1AVZC 1XQHA 3JB9H 4O6JA 4M75G 1VQKQ 2JJ9A 2E6NA 4DBFA 3V7RA 2EYQA 4LXCA 4ORZA 3UATA 4BE2A 4AFUC 2WACA 5GANg 2ED0A 3EG9A 1XOVA 3OY9A 3HFOA 1H3HA 1B34B 2K57A 2KAFA 1OPLA 2RJDA 4Z89A 3I55A 2K4YA 2CZ7B 5FWCA 2DM1A 2MAMA 4C8QB 3QYGB 2XHCA 4Z8AA 4XTYA 5CVIA 3CPWA 4A4KA 4LD6A 1BU1A 5GANf 2PVDB 1VQ4Q 1OV3A 3QO3A 4F7UA 2XMFA 4M75C 4R55A 2YHTA 2E5KA 2LCSA 3OYBA 2C0OA 2KRSA 4QVCA 2DFUA 3PT9A 2VWFA 1KJWA 1OU8A 5IXFA 2ZPHB 3OQ5A 4PJOB 2DL8A 2VXEA 1OI1A 2VYTA 4HCBA 3EFRA 5LJ3e 2L3QA 2FHDA 4C0DC 1WLPB 4FT2A 2EJGA 1W4SA 2H8HA 5CO7A 5GAN4 4J9EA 2O4XB 3FJ5A 1IGUA 3NGPA 2J7IA 2P84A 2QGFB 4LN2A 1I8FA 4PJJA 3H9NA 3OS0A 5GAN6 1X2KA 2GQIA 1J3TA 1FWZA 3VS6A 4J8OA 3N5BB 1V1CA 2CSIA 1Q81U 5GAN5 3EFSA 5DY9A 1KQSP 3RERA 4JLGA 4ZN1A 4ZTJA 3VUBA 3CCVQ 2KI7A 1BKBA 2KRNA 2XIDA 3A8OB 2P0QA 4C92F 3PGGA 1OQKA 2EYZA 5AYFA 4DEYA 1IGQA 3ASKA 2G3RA 2YDLA 2FRWA 3EG9B 3CC7T 1VQ7T 3E9GA 1VQOA 4GLKA 1IREB 5IXBA 4HVUA 4M78C 4C0GA 1AWWA 2CZ1B 1IHWA 1YITA 1KHIA 3CMET 3QPHA 4A4HA 2QEXT 3FB9A 4JRIA 4C8QG 3WVDB 1M1KC 2KT8A 1YJNQ 1N8RC 3VRYA 4RCBA 1IO6A 4F7UB 1YIJT 3CCRT 5CAIA 1QW1A 1YFNA 3CMAQ 2EW3A 4C5IA 2V1RA 2HKQB 5GJWB 5KCHA 2EVRA 3JCMg 2Y90A 3OYKA 1VQ8Q 3ULRB 1BBZA 1ZBXA 2KBTA 1BIAA 1T3SA 2DKGA 2RI2A 1WHMA 2GQVA 3BW1A 5KYYA 2K3XA 3V8LA 1Q86R 2R57A 4A53A 9ATCB 2MK5A 4XU1A 1YHQQ 1K8AR 5GAMg 2HQEA 1E7OA 4M77E 1JXOA 1RAIB 3A8GB 3M0UA 1WX6A 1B07A 5D6XA 2CS7A 4A4EA 4X34A 2YUOA 3CBOA 2QXFA 2X4XA 1OEBA 2AK5A 5GANh 2RD1A 5GAMf 4LDXA 3GBQA 1NE8A 1VQ9T 3MKDA 3PNWC 4DBQA 3SWNA 1FXXA 4KULA 1RLPC 2EPDA 2K3BA 2KT1A 3EG1A 3OYMA 3CCJT 3MP8A 3OW2S 4D8DA 2Y4XA 2RN8A 3EH1A 4C8QF 2HNIA 1VQMT 1Q82U 1M27C 5IHKA 1QWFA 2FL7A 3CPWP 3SEMA 1WZOA 1GL5A 1D09B 1O75A 3CCLT 3GPLA 1JRIA 1QQJA 3OYNA 4IIOA 2VGMA 1D3BA 2COWA 4ESRA 3UA6A 3CCST 4AG1C 4PJOF 4HCZA 1JBMA 1KQSS 1OX8A 1KSWA 2R5MA 1CKBA 1GCQA 1MHNA 1M5Q1 1QP2A 3ME9A 3BE3A 3OBYA 1ZSZB 2E4HA 2QYZA 1B7TA 4EMKB 4F7UG 1ZUKA 1JEGA 1IZ6A 2F2WA 2O31A 1GFDA 3BDLA 4II1A 3NHNA 1PSEA 5HKCA 3CCUA 2DZ9A 4IUUA 2NYSA 1QCFA 5GAN2 5KYXA 1UGRB 3JB9J 2EBPA 2JOYA 2JS0A 2WSEE 1G2BA 2OX7A 1IHVA 2YLCA 3P8BB 1Y71A 4B6MA 1LVKA 3AT1B 4M75E 5FRNA 1QVGA 2LCLA 1M1FA 1G5VA 2B8AA 3WVEB 1VQPQ 1JJ2A 5LJ3g 2WSFE 2RQWA 5IHIA 2JVVA 2HBPA 1OPKA 2L5QA 1SSHA 1VQNT 4TVRA 2JTFA 3EG3A 3CCEA 1BCOA 1QMCA 4XQ3A 3CC2T 5FLXE 3L1AA 4BUGA 1SHGA 1UGPB 2RJFA 3OYCA 4Q5WA 5LJ3f 1Y0MA 4JJNK 2BZXA 2OJ2A 1SKUB 2KEAA 2X3XD 1NM7A 3KXTA 1V76A 3EHRA 2ABLA 4V2SA 2YUNA 1K1ZA 2D6FA 1ABOA 3E19A 1YI2T 4HA8A 1G3SA 4J9DA 3KBGA 3R6OA 2EQMA 5KYUA 1YJ9A 3CQTA 5GAOm 1VQLT 2NWMA 4LDVA 1QKWA 1K9MR 2KXDA 4F7UF 4FIBA 2QG9B 1U06A 1PCXA 2J6KA 2LJ1A 4HCCA 4C5GA 4C92A 2KYBA 3CD6T 5KE2A 2ZZDA 3RIRA 4JS5A 2I2LA 2DF6A 4C92D 4XAXB 1D3BB 3GLXA 2KRMA 4PL6A 2JMAA 1KG1A 2C0TA 1MNEA 4OGEA 3G6EQ 1X2QA 3MP6A 1WHGA 2FB7A 2EJFA 3VU3C 2RO0A 1VQOQ 2DILA 4JJBA 2ZPEB 1M1GA 4J9FA 3GNGA 2XICA 4DBRA 4A4GA 3I5SA 2YRCA 5GAMh 1YITQ 1AWXA 3G71Q 2CKKA 2V1QA 1M2VB 2RPNA 1ZLMA 4QT7A 2HZYA 1BI1A 4N0AA 5KYXB 4BE1A 3INZA 2OTJQ 2EQIA 4X9CA 1ZUUA 3A5ZB 4OMPA 2LQNA 4B9WA 5GAMj 1CKAA 2O2OA 1NPPA 3LGLA 3OB9A 1S72T 2QDYB 2D9TA 2EGEA 1R0BG 3QJ6A 2FYKA 2V26A 1RAEB 3RR6A 5I2MA 1UHCA 2FZCB 4YTLA 1VQ5A 4LDWA 4A63B 4PFZA 3OW2A 2LNVA 2L2PA 2P4RA 2DJQA 3META 4CRIA 1X75C 3FIFA 1SPKA 1AT1B 2QA4A 2DVEA 3X25B 1W70A 1SSFA 3NPFA 2ZAEA 4OMFB 1I5LA 2FPDA 4F04B 3CCQT 2JW4A 1KHCA 3GF5A 3JCMd 2RQVA 4C8QE 2K2MA 2RH2A 4M77G 3QDFA 3M9QA 2AIRB 3VS4A 4PJNA 5D6YA 4MZPA 2RI3A 2DEUA 3DKMA 4GLMA 2HCKA 2ENMA 1NEGA 1Q86C 5KYUB 3S3OA 4DQ2A 2O9SA 3MEAA 2F69A 1UGQB 1K8AC 2RHZA 2EYXA 2KGTA 2LX9A 4ZGDB 3OS5A 2XG8D 1LNXA 4MZMA 4RTVA 1YJWT 1U1TA 1KD1R 2K9GA 3BFMA 1XNIA 2A3LA 3M0PA 2AHJB 4RG2A 1VIFA 2E6ZA 2HSPA 3VKIA 3EG2A 1GFCA 3CBPA 4M7DB 1M90R 3LLRA 1G3YA 4M7AA 3SWNC 3SB2A 4M77C 3JCMV 3JRZA 4R56A 1MUZA 2AKLA 4M7AD 2HQXA 3M55A 5J3BA 3QJYA 4Z88A 1JO8A 2W0ZA 4PJOA 2CUBA 2XDDA 2EAYA 4VUBA 4WCIA 1QVGP 1VUBA 4PJOD 3G4SQ 4F17A 2AT1B 1JJ2P 4EPCA 3JCMb 1NEBA 1UECA 4O5VA 3JB9F 1U1SA 4JJDA 3G1JA 4D8KA 2DRMA 3A8HB 3UT1A 4XTZA 3VJPA 1VIEA 3QZ5B 2CSQA 5LJ3j 4HVVA 3E9FA 5I21A 1NLOC 2DYBA 2A36A 2MPXC 4LE9A 1RAGB 1WQWA 1MMDA 2M51A 3MHXA 3PIOA 4KT0E 3X24B 2VC8A 2HMAA 1GCQC 4IURA 2KDSA 4BE0A 1JU5C 2K79A 1RL2A 2GGRA 5GAOl 2LMJA 5DLOA 3X28B 2QQRA 1VQ4T 2A08A 2HD0A 3HP9A 4IUQA 2RQRA 4JZ3A 2CREA 4E7LA 1UUEA 3CC4T 2RHUA 4HXJA 2GTOA 3CCEQ 2IPOB 2E1HA 1TUGB 2DXTA 3DLMA 3S6WA 2ECZA 2YLBA 3PVLA 4JRPA 4F7UE 2E3HA 2P0PA 3OSVA 1C0MA 2KR3A 5L23A 1WNLA 3L2UA 1AOJA 1X43A 5LJ3d 5GMKe 1RLQC 3HKSA 5D7UA 1QP3A 3OMCA 1W2BA 3H0HA 4LUEA 1WIEA 1UB4A 2XD0A 3L42A 2GFUA 1G3TA 4C92G 2JT4A 2DZCA 3BDUA 4KGXB 2HKNA 3MEVA 4ATOA 1I0CA 1YJ9Q 5HCKA 4KRTA 2LVMA 3G7ZA 3QWXX 1K9AA 2V8JA 1TUCA 3JCMX 2LQWA 4ANJA 3EG0A 4M7AB 2JZ2A 4LUDA 1Q81R 3HL8A 1LJOA 1VQPA 2JTMA 2PUKB 1Q7YC 3JSCA 3FJPA 3M53A 2X4YA 2E12A 3P8HA 4RTUA 3RESA 1QVFA 1D1AA 3RMQA 2DIGA 3CCVT 4AFZC 3OW2P 1E6GA 3I35A 2H3EB 1K9MC 1VYUA 2JXBA 2DAQA 3ZFJA 1M8VA 4C92C 2LX7A 1GBRA 1NPRA 3QZ9B 2SEMA 2O88A 1RACB 3V8KA 4GY5A 1VQ6T 3BY7A 2KQWA 2FO0A 2RQUA 4E2FB 1PRMC 3HFNA 1HYOA 1KK7A 1TOVA 4JS4A 1YBYA 3TEEA 2KVQG 1S1NA 1Y7XA 1QVGS 5FU7B 5FRMA 1WHKA 3NTIA 4KGZB 4AFSC 4AFQC 4J6YA 3QBYA 5J26A 2A37A 1WYXA 1JJ2S 2DTHA 1OULA 5CCAA 1ARKA 4J9GA 1PC0A 4PFPA 5IAYA 4X1VA 1K0XA 5FW9A 1X27A 1I81A 1VQ5Q 5CK9A 3M57A 2CYZB 3TSZA 4N0AC 2I0NA 1P92A 3D7SB 3EH2A 1WA7A 4RKUE 1WI7A 3CMAT 3G6EA 2ZCFB 1OU9A 2QA4Q 4XTUA 5A0LA 1WXTA 1YWPA 1UJYA 4ME7A 2MCNA 4MZTA 2L89A 1EIFA 4M7DF 4DOWA 1MV0B 4DEXA 3HTRA 3SHWA 1KQ2A 3G71A 2B86A 1RABB 4ZN3A 3OS2A 2X3WD 1ZBJA 2J06A 5A0DA 1VOMA 1YHQT 2HEQA 3JB9I 2OTJA 5C6SA 3A98A 3TSWA 1ZSZA 2DBMA 1PHTA 4N4GA 4EMKA 1NJIU 3UF4A 1VQLA 3RKXA 3HRUA 3MEWA 3TQ7P 5I11A 1VYVA 3EAEA 2DIQA 2MWPA 1I5OB 2X51A 3NTKA 4QKUA 2IIMA 2M16A 3GP8A 1K73C 3KUFA 1D0YA 4PJOG 2Y4YA 4A4FA 1Y07A 3OYYA 1KC8C 1X6OA 1Q82R 1I1JA 4BB7A 2OAUA 1OZ2A 4C0ZA 1U8RA 3O5ZA 4C8QC 3FC3A 3JCMf 1BI2A 2K3YA 4NOYA 3JB9D 3CMEQ 1ZUYA 2GCXA 2KK4A 3ZBDA 5KCOA 3HSBA 5GMKm 4KGVB 4AG2C 3QDRB 1MGQA 3M4YA 1OOTA 1M90C 1Z9QA 1M9SA 1R77A 1FX7A 2LC4A 5CKHA 2JMCA 1X01A 4PJOC 3CCRQ 3E2UA 2MWOA 1D1BA 5ECAA 1TTHB 2DD4A 4E7SA 1ZA2B 1HXDA 4FT4A 4C5HA 1H8KA 3CEYA 3UDCA 1G83A 4PFOA 6AT1B 1W2BP 2JNGA 4BI3A 3I55T 4QQ6A 1N27A 5EC7A 3OYIA 2XI9A 4FYVB 3QYHB 2K5IA 3CCMA 2A0FB 3OYAA 1E6HA 2EYWA 1HD3A 1C6VX 4JDSA 4CC2A 3I56T 1I4K1 1WGSA 4KH1B 4M7AF 1TUDA 3L2ZA 1U3OA 5FU6B 3G4SA 3M54A 4DA4A 1Q95G 2P0KA 2D0NA 2K7AA 2LDMA 4AMCA 4FM4B 1QVFP 2XKOC 1IB8A 4MMKA 2RQTA 1MMNA 4OGCA 2BKDN 2DXUA 2KXCA 5HK3A 4ZGEB 1VQ9Q 1RI0A 2D8JA 1M2VA 2BE7D 3M5AA 4BY6B 4E7ZA 3CCJQ 8ATCB 3GIBA 1XTDA 1K0SA 2A28A 4D6WA 1N9SA 3MO8A 1PNJA 3PE0A 4OMNA 5I22A 1WHHA 4E7IA 3JCMJ 1R0CB 3CCLQ 2D8HA 2DLPA 2EKHA 3CCSQ 3MP1A 3LH5A 4J7FA 5CKBA 2KY9A 2DL7A 3MCAB 2DO3A 1AHJB 2RJCA 1AZGB 1YP5A 2NUZA 2JN0A 3MEUA 1PKSA 3OS1A 1Q81C 3OMGA 3I9QA 4C92E 2YRDA 2RK1A 1B3QA 4E7JA 1MV3A 1ACMB 3R6NA 2JTEA 3PMIA 3QKJA 4RMOA 4HCKA 3VS3A 5GANe 3VV0A 3LGFA 2LTOA 4NL3A 1MMAA 1WJRA 1JQQA 3M58A 1WQ7A 2RNAA 4CI0C 2E64A 2OAWA 4NL2A 1RUWA 2OTLA 2XDPA 2GFAA 2YT6A 5HK0A 1WFWA 4N4HA 1PD0A 3JCMh 3C94A 2F5TX 3JCMc 2X35A 3M59A 4IKFA 4JRKA 3J7AF 3ZEHA 3CC4A 2NUPB 4QVZA 1WDXA 1VYTA 1AEYA 1BIBA 1BK2A 3SFMA 4M7DA 4J9BA 3OYFA 3Q1JA 4IIMA 4M7DD 3CC2Q 1W2BS 3PFSA 3NTHA 3F70A 1QKXA 4FYYB 2RMOA 3A8LB 5IT9E 4OMQA 3VYGA 4EDUA 2ZPFB 1Q7YU 5GMKl 3FEOA 2EWNA 1FMWA 3PIPA 1YI2Q 2MIOA 1PSFA 2YSQA 2RM4A 1VQLQ 2P4TA 2KNBB 5LL6S 3L2QA 2QQ9A 2RB6A 3A1PA 2CT3A 3JCMP 1QVFS 4C5EA 1UE9A 1YWOA 5CIUA 2BZYA 3JB9G 2EQKA 4P5NA 2QTXA 1H92A 3IQLA 4PKCC 3HHTB 2VGNA 1ZSZC 3VUZA 4WTOB 4EMKC 3CXCA 2VUBA 4M78A 1GXIE 1NLPC 3JAME 4BDYA 1SHFA 3PMTA 4M78D 1KQ1A 4E6RA 2RF0A 2DXCA 3TREA 3VS5A 4BY6C 4IUPA 3TCJA 5LJ5e 2XK0A 1OYXA 2QGGA 2DK3A 3QXEB 1N8RR 1PD1A 1CSKA 4M75B 1IXDA 2M9UA 4L6V5 1Q82C 3H6ZA 3P8DA 2QQBA 3MPUB 5A2QE 5GMKh 2QQAA 3JCMQ 1HK9A 3OBWA 2E3IA 4XTVA 1C1AA 2DE0X 4M7AE 3QIIA 2LJ0A 1PKTA 4J83A 2J05A 1LCKA 4PJOE 4B9XA 1A0NB 3H0IA 4C0DB 5GMKj 3H0FA 1FMVA 3FRNA 1BI3A 3VS0A 2DNUA 4OB1B 3CCMQ 2RHYA 3FLGA 3CCUT 1DJ7B 3CC7A 1M1KU 2LNHB 1VQ7A 2QASA 1N8RU 3M0TA 2ZGWA 4M4ZA 2L8DA 3T9NA 5LJ3h 4KUIA 2EQUA 3CCQQ 3CMEA 2QEXA 1UTIA 3EHQA 1AWOA 1VQKT 4WF2A 2DX1A 3NFCA 3GNFB 1YIJA 5GAMe 2AKKA 3CCRA 1D0XA 5DM7R 1RADB 3CCET 1KC8U 4RUGA 4LDUA 3VS1A 4FL6A 4N4IA 2DYIA 1ZX6A 3PVQA 2CP5A 1V29B 4M78B 1YN8A 2DTIA 1NG2A 3H41A 1PG5B 3QSUA 2R5AA 2E10A 2AZSA 2CH4A 4FW2A 3OA6A 4A54A 3L2RA 1UDLA 1YJ9T 1BI0A 1K4US 3M0QA 4QVDA 2H3JA 1T3LA 2CGHA 2D0QB 2KMTA 2BE9B 2DJZA 2DPPB 2KE9A 4KH0B 1VQ9A 3ER0A 2LJ3A 3PTAA 1TSFA 4IUTA 1Z9ZA 2LQ8A 2DERA 3LW5E 2CT4A 3CCJA 1M8MA 1TWBA 2CP7A 4RTXA 2R58A 1VQMA 4Z02A 2RHIA 5FWBA 3HRSA 3TVTA 1JXMA 1M4ZA 1N6AA 1R8OB 2MMPA 1RAFB 5GAOn 2EGCA 2X9HA 4L5GA 4NS5A 4M7DG 3L2VA 2OTLQ 2CH4W 5L8RE 4FW1A 3CCLA 1AD5A 1M30A 3I56A 2PZ1A 3CCSA 1UG1A 3RKWA 4PLLA 1H641 1AZEA 2GF7A 3CC4Q 5GMKi 2CUDA 2CZ0B 4RTWA 3X26B 5GAOp 1VQ5T 2EJ9A 2JM8A 2JUFA 1YCYA 3CXCP 4JUVA 3RMSA 2EYYA 1VA7A 2QA4T 4OMLA 2SRCA 4F16A 1NYFA 2EIFA 2MI6A 1HJDA 4CC3A 4M7DC 1K76A 2ROLA 4KUDK 1X6BA 1X69A 4M75F 5M9OA 1BB9A 5HY6A 2C06A 4MMLA 4M78G 1TU0B 4AT1B 1YJNT 3LH0A 1NJIR 4JRQA 3E1SA 4PJMA 3A8MB 2MYSA 1OZ3A 2BZ8A 4PJLA 2VKNA 4J9IA 2O01E 2A7YA 1VQNA 3FDRA 3RDVA 5GJVB 3CC2A 1QVPA 2COYA 1VQ8T 5LJ5g 2HBWA 1ZSGA 2EQJA 3VRZA 3V8JA 4BI8B 5A0GA 4KBMB 2RA2A 3RBBB 2E65A 2PVGB 4E7KA 1VQ6Q 1N5ZA 4FCYA 4RTYA 2FZKB 1WXUA 5IN1A 1YI2A 4OB0B 5LJ5f 5EG2A 1QWEA 3M0SA 3M0RA 1TG0A 1WPYA 4CC4B 1QLYA 1X6GA 2NLUA 1UGSB 4M7AG 3HPWA 3CD6A 1GCPA 3EGUA 4RTTA 1WJSA 4OP0A 4X9DA 2DVJA 4ELZC 4EIKA 1H3ZA 1QCNA 1D1CA 1SEMA 2HL5C 4RG8A 1EFNA 3CC7Q 2DBKA 4XTWA 2QQSA 2DEQA 1VQ7Q 1UGVA 1SF9A 3RUXA 5KYWA 4M78F 2CP6A 4OVAA 2YUQA 1KD1C 4E7HA 1EX4A 1MMGA 2QEXQ 2YXYA 3RNJA 2RI5A 2BIVA 2Z0WA 4Y92A 2LRQA 4M7AC 2QDLA 4BACA 1YCSB 2NUTA 4XK8E 1YIJQ 1XJWB 1S72A 1BCMA 4RTZA 1SG5A 3LX7A 5AT1B 2FPFA 2XU8A 3REAB 4OMMA 1W6XA 4DBHA 5GAOr 5KYNA 1JB0E 2QK0A 3U23A 3CXCS 4JPBW 4HKEA 4OB3B 4M77A 2DTOA 4M77D 1NYGA 4OMOA 2FEIA 2LCCA 4L59A 4MDWA 5GANj 1Q86U 2X4WA 2ROTA 2E41A 1PWTA 3REBB 3CCQA 2F5KA 1K8AU 1KFZA 1ABQA 3M56A 3HRTA 1ZQ1A 2V8IA 5GAN3 2NUPA 1VQPT 5FU7C 1U5SA 2DD5A 2JS2A 4R0KA 2BTTA 4PK4A 3NMZC 3JCMW 1UHFA 2GBQA 1TS9A 3QUIA 3V7SA 4XU2A 4J9CA 2W10A
chains in the Genus database with same CATH topology
3KFVA 2YSQA 1I07A 2EYZA 4DEYA 1JU5C 2K79A 1GRIA 2YDLA 2KNBB 2FRWA 2GGRA 2LMJA 2MOXA 2L3SA 1M3AA 2CT3A 5IXBA 1UE9A 2A08A 1YWOA 4HVUA 1AWWA 2JM9A 4FSSA 2BZYA 2RQRA 4JZ3A 2CREA 1UJ0A 1UUEA 1H92A 1W1FA 3IQLA 4JJCA 4HXJA 2GTOA 1AWJA 4CC7A 2LP5A 2ECZA 2KT8A 1NLPC 3PVLA 2PTKA 1SHFA 3VRYA 2KR3A 5L23A 4E6RA 1IO6A 2RF0A 1GBQA 2FG0A 1AOJA 1X43A 3VS5A 1RLQC 1SRLA 3H0HA 2EW3A 2KYMA 4LUEA 1WIEA 2V1RA 1FYNA 5GJWB 1CSKA 2JT4A 2EVRA 1I0CA 3ULRB 1BBZA 2KBTA 5HCKA 1T3SA 4KRTA 2DE0X 3QWXX 1K9AA 2LJ0A 1PKTA 1TUCA 2LQWA 2J05A 3EG0A 4LUDA 1LCKA 2O9VA 1RI9A 3H0IA 1A0NB 1E7OA 1JXOA 3H0FA 4RTUA 3M0UA 1WX6A 1B07A 3VS0A 2LZ6B 2DL3A 2DNUA 2YUOA 4AFZC 1E6GA 2LNHB 3I35A 2DMOA 1VYUA 1OEBA 2AK5A 2JXBA 3M0TA 4M4ZA 2LX7A 1GBRA 3GBQA 2SEMA 2O88A 1RLPC 1UTIA 3EHQA 2EPDA 2K3BA 2KT1A 3EG1A 1KIKA 1AWOA 2FO0A 2G6FX 2RQUA 4D8DA 1PRMC 2RN8A 5IH2A 2DX1A 1M27C 3VS7A 2DL4A 5IHKA 1S1NA 3QWYA 1QWFA 2AKKA 3SEMA 4AFSC 4AFQC 2D1XA 2A37A 1WYXA 4RUGA 4GBQA 1T0JA 1ARKA 4J9GA 1GL5A 3C0CA 3VS1A 3THKA 4X1VA 1K0XA 5FW9A 1X27A 2L3PA 4IIOA 3TSZA 2I0NA 3UA7A 1ZX6A 4ESRA 1WA7A 3UA6A 4AG1C 1WI7A 4F14A 3PVQA 1WXBA 1KSWA 2PNIA 1YN8A 3H41A 1NG2A 1CKBA 1GCQA 2YUPA 1WXTA 1YWPA 1UJYA 2EGAA 2AZSA 2MCNA 2CH4A 1T0HA 1UDLA 1MV0B 4DEXA 1K4US 1ZUKA 1JEGA 3M0QA 4J9HA 3SHWA 2F2WA 2O31A 2B86A 1GFDA 2X3WD 1ZBJA 2K6DA 2J06A 3NHNA 1UFFA 2VVKA 1T3LA 2HEQA 1QCFA 3VS2A 3A98A 3TSWA 2EBPA 2JS0A 1G2BA 2DBMA 1PHTA 4ZNXA 2KE9A 2F2VA 3UF4A 2FPEA 2LJ3A 5I11A 1VYVA 1Z9ZA 2CT4A 1Y57A 2IIMA 2DL5A 1M8MA 2RQWA 5IHIA 4RTXA 1PRLC 1M3BA 5FWBA 2OI3A 1JXMA 1OPKA 3TVTA 1SSHA 2HDAA 2EGCA 3EG3A 1I1JA 2CH4W 5IHNA 2KROA 3O5ZA 1SHGA 1AD5A 1M30A 1HSQA 1Y0MA 2PZ1A 2BZXA 2OJ2A 1UG1A 2ESWA 2KEAA 2X3XD 1NM7A 1ZUYA 1AZEA 3EHRA 2ABLA 2CUDA 2YUNA 4AG2C 1K1ZA 4RTWA 2GNCA 3ZL7C 1SRMA 1ABOA 2F2XA 2JM8A 1YNZA 4J9DA 1OOTA 1Z9QA 2J6OA 2GTJA 3CQTA 2NWMA 2C0IA 2JMCA 1QKWA 2KXDA 2EYYA 1VA7A 4OMLA 5ECAA 1U06A 2LJ1A 2J6KA 2SRCA 4F16A 1NYFA 2KYBA 1H8KA 1G83A 2DF6A 2L0AA 1HJDA 4CC3A 2DRKA 1K76A 2J6FA 2ROLA 2KRMA 1X6BA 5EC7A 1X69A 2JMAA 2C0TA 1X2QA 1BB9A 1M3CA 4LNPA 3I5RA 1E6HA 2ED1A 2EYWA 3JV3A 1HD3A 2DILA 4CC2A 4JJBA 4J9FA 1TUDA 1FMKA 4HVWA 1U3OA 3I5SA 2BZ8A 2VKNA 4J9IA 1AWXA 2D0NA 2K7AA 2V1QA 2DA9A 2RPNA 4K11A 5GJVB 1ZLMA 4QT7A 2AZVA 2FRYA 2EQIA 1ZUUA 2HBWA 4OMPA 2LQNA 1ZSGA 2RQTA 3VRZA 1CKAA 2KXCA 2O2OA 4JZ4A 2CDTA 3RBBB 2EGEA 2D8JA 2M0YA 1AVZC 1N5ZA 1UHCA 4RTYA 1WXUA 4A63B 1K0SA 2A28A 2L2PA 1QWEA 2P4RA 4ORZA 3UATA 3M0SA 3M0RA 1TG0A 4CC4B 2DJQA 1QLYA 1X6GA 1SPKA 4AFUC 1PNJA 3PE0A 4OMNA 2ED0A 5I22A 1XOVA 1W70A 3NPFA 1H3HA 1GCPA 3EGUA 4RTTA 2FPDA 2D8HA 2DVJA 1OPLA 2DLPA 4EIKA 4Z89A 2JW4A 2EKHA 2RQVA 2K2MA 5FWCA 1SEMA 3LH5A 2DM1A 3VS4A 4Z8AA 1EFNA 2DBKA 2DL7A 4GLMA 1BU1A 2HCKA 1AZGB 1UGVA 1YP5A 2ENMA 1NEGA 2NUZA 1PKSA 1OV3A 2O9SA 3I9QA 2XMFA 2YUQA 2EYXA 2E5KA 2KGTA 2LCSA 2C0OA 2KRSA 1B3QA 3RNJA 4RTVA 1MV3A 2VWFA 1KJWA 3R6NA 4Y92A 2JTEA 5IXFA 2K9GA 2DL8A 4HCKA 3VS3A 2QDLA 3M0PA 1YCSB 2L3QA 2HSPA 1JQQA 3EG2A 2RNAA 1GFCA 1WLPB 4RTZA 2OAWA 1RUWA 2FPFA 3REAB 4OMMA 1MUZA 2AKLA 1W6XA 2YT6A 2H8HA 4Z88A 1WFWA 1JO8A 2W0ZA 4J9EA 2CUBA 3FJ5A 3NGPA 4WCIA 2J7IA 3U23A 4LN2A 4F17A 4JPBW 1NEBA 1UECA 1AEYA 1WDXA 1VYTA 1BK2A 1X2KA 1NYGA 2GQIA 4JJDA 1J3TA 4D8KA 2DRMA 4OMOA 4J9BA 3VS6A 2FEIA 4IIMA 1V1CA 2CSIA 2ROTA 2CSQA 1PWTA 3REBB 1KFZA 4HVVA 1QKXA 1ABQA 1NLOC 2DYBA 2RMOA 2A36A 4LE9A 1U5SA 4OMQA 2JS2A 2KRNA 4R0KA 2M51A 2BTTA 3NMZC 1UHFA 2GBQA 1GCQC 4J9CA 2MIOA 2W10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFV A;  2YSQ A;  1I07 A;  2EYZ A;  4DEY A;  1JU5 C;  2K79 A;  1GRI A;  2YDL A;  2KNB B;  2FRW A;  2GGR A;  2LMJ A;  2MOX A;  2L3S A;  1M3A A;  2CT3 A;  5IXB A;  1UE9 A;  2A08 A;  1YWO A;  4HVU A;  1AWW A;  2JM9 A;  4FSS A;  2BZY A;  2RQR A;  4JZ3 A;  2CRE A;  1UJ0 A;  1UUE A;  1H92 A;  1W1F A;  3IQL A;  4JJC A;  4HXJ A;  2GTO A;  1AWJ A;  4CC7 A;  2LP5 A;  2ECZ A;  2KT8 A;  1NLP C;  3PVL A;  2PTK A;  1SHF A;  3VRY A;  2KR3 A;  5L23 A;  4E6R A;  1IO6 A;  2RF0 A;  1GBQ A;  2FG0 A;  1AOJ A;  1X43 A;  3VS5 A;  1RLQ C;  1SRL A;  3H0H A;  2EW3 A;  2KYM A;  4LUE A;  1WIE A;  2V1R A;  1FYN A;  5GJW B;  1CSK A;  2JT4 A;  2EVR A;  1I0C A;  3ULR B;  1BBZ A;  2KBT A;  5HCK A;  1T3S A;  4KRT A;  2DE0 X;  3QWX X;  1K9A A;  2LJ0 A;  1PKT A;  1TUC A;  2LQW A;  2J05 A;  3EG0 A;  4LUD A;  1LCK A;  2O9V A;  1RI9 A;  3H0I A;  1A0N B;  1E7O A;  1JXO A;  3H0F A;  4RTU A;  3M0U A;  1WX6 A;  1B07 A;  3VS0 A;  2LZ6 B;  2DL3 A;  2DNU A;  2YUO A;  4AFZ C;  1E6G A;  2LNH B;  3I35 A;  2DMO A;  1VYU A;  1OEB A;  2AK5 A;  2JXB A;  3M0T A;  4M4Z A;  2LX7 A;  1GBR A;  3GBQ A;  2SEM A;  2O88 A;  1RLP C;  1UTI A;  3EHQ A;  2EPD A;  2K3B A;  2KT1 A;  3EG1 A;  1KIK A;  1AWO A;  2FO0 A;  2G6F X;  2RQU A;  4D8D A;  1PRM C;  2RN8 A;  5IH2 A;  2DX1 A;  1M27 C;  3VS7 A;  2DL4 A;  5IHK A;  1S1N A;  3QWY A;  1QWF A;  2AKK A;  3SEM A;  4AFS C;  4AFQ C;  2D1X A;  2A37 A;  1WYX A;  4RUG A;  4GBQ A;  1T0J A;  1ARK A;  4J9G A;  1GL5 A;  3C0C A;  3VS1 A;  3THK A;  4X1V A;  1K0X A;  5FW9 A;  1X27 A;  2L3P A;  4IIO A;  3TSZ A;  2I0N A;  3UA7 A;  1ZX6 A;  4ESR A;  1WA7 A;  3UA6 A;  4AG1 C;  1WI7 A;  4F14 A;  3PVQ A;  1WXB A;  1KSW A;  2PNI A;  1YN8 A;  3H41 A;  1NG2 A;  1CKB A;  1GCQ A;  2YUP A;  1WXT A;  1YWP A;  1UJY A;  2EGA A;  2AZS A;  2MCN A;  2CH4 A;  1T0H A;  1UDL A;  1MV0 B;  4DEX A;  1K4U S;  1ZUK A;  1JEG A;  3M0Q A;  4J9H A;  3SHW A;  2F2W A;  2O31 A;  2B86 A;  1GFD A;  2X3W D;  1ZBJ A;  2K6D A;  2J06 A;  3NHN A;  1UFF A;  2VVK A;  1T3L A;  2HEQ A;  1QCF A;  3VS2 A;  3A98 A;  3TSW A;  2EBP A;  2JS0 A;  1G2B A;  2DBM A;  1PHT A;  4ZNX A;  2KE9 A;  2F2V A;  3UF4 A;  2FPE A;  2LJ3 A;  5I11 A;  1VYV A;  1Z9Z A;  2CT4 A;  1Y57 A;  2IIM A;  2DL5 A;  1M8M A;  2RQW A;  5IHI A;  4RTX A;  1PRL C;  1M3B A;  5FWB A;  2OI3 A;  1JXM A;  1OPK A;  3TVT A;  1SSH A;  2HDA A;  2EGC A;  3EG3 A;  1I1J A;  2CH4 W;  5IHN A;  2KRO A;  3O5Z A;  1SHG A;  1AD5 A;  1M30 A;  1HSQ A;  1Y0M A;  2PZ1 A;  2BZX A;  2OJ2 A;  1UG1 A;  2ESW A;  2KEA A;  2X3X D;  1NM7 A;  1ZUY A;  1AZE A;  3EHR A;  2ABL A;  2CUD A;  2YUN A;  4AG2 C;  1K1Z A;  4RTW A;  2GNC A;  3ZL7 C;  1SRM A;  1ABO A;  2F2X A;  2JM8 A;  1YNZ A;  4J9D A;  1OOT A;  1Z9Q A;  2J6O A;  2GTJ A;  3CQT A;  2NWM A;  2C0I A;  2JMC A;  1QKW A;  2KXD A;  2EYY A;  1VA7 A;  4OML A;  5ECA A;  1U06 A;  2LJ1 A;  2J6K A;  2SRC A;  4F16 A;  1NYF A;  2KYB A;  1H8K A;  1G83 A;  2DF6 A;  2L0A A;  1HJD A;  4CC3 A;  2DRK A;  1K76 A;  2J6F A;  2ROL A;  2KRM A;  1X6B A;  5EC7 A;  1X69 A;  2JMA A;  2C0T A;  1X2Q A;  1BB9 A;  1M3C A;  4LNP A;  3I5R A;  1E6H A;  2ED1 A;  2EYW A;  3JV3 A;  1HD3 A;  2DIL A;  4CC2 A;  4JJB A;  4J9F A;  1TUD A;  1FMK A;  4HVW A;  1U3O A;  3I5S A;  2BZ8 A;  2VKN A;  4J9I A;  1AWX A;  2D0N A;  2K7A A;  2V1Q A;  2DA9 A;  2RPN A;  4K11 A;  5GJV B;  1ZLM A;  4QT7 A;  2AZV A;  2FRY A;  2EQI A;  1ZUU A;  2HBW A;  4OMP A;  2LQN A;  1ZSG A;  2RQT A;  3VRZ A;  1CKA A;  2KXC A;  2O2O A;  4JZ4 A;  2CDT A;  3RBB B;  2EGE A;  2D8J A;  2M0Y A;  1AVZ C;  1N5Z A;  1UHC A;  4RTY A;  1WXU A;  4A63 B;  1K0S A;  2A28 A;  2L2P A;  1QWE A;  2P4R A;  4ORZ A;  3UAT A;  3M0S A;  3M0R A;  1TG0 A;  4CC4 B;  2DJQ A;  1QLY A;  1X6G A;  1SPK A;  4AFU C;  1PNJ A;  3PE0 A;  4OMN A;  2ED0 A;  5I22 A;  1XOV A;  1W70 A;  3NPF A;  1H3H A;  1GCP A;  3EGU A;  4RTT A;  2FPD A;  2D8H A;  2DVJ A;  1OPL A;  2DLP A;  4EIK A;  4Z89 A;  2JW4 A;  2EKH A;  2RQV A;  2K2M A;  5FWC A;  1SEM A;  3LH5 A;  2DM1 A;  3VS4 A;  4Z8A A;  1EFN A;  2DBK A;  2DL7 A;  4GLM A;  1BU1 A;  2HCK A;  1AZG B;  1UGV A;  1YP5 A;  2ENM A;  1NEG A;  2NUZ A;  1PKS A;  1OV3 A;  2O9S A;  3I9Q A;  2XMF A;  2YUQ A;  2EYX A;  2E5K A;  2KGT A;  2LCS A;  2C0O A;  2KRS A;  1B3Q A;  3RNJ A;  4RTV A;  1MV3 A;  2VWF A;  1KJW A;  3R6N A;  4Y92 A;  2JTE A;  5IXF A;  2K9G A;  2DL8 A;  4HCK A;  3VS3 A;  2QDL A;  3M0P A;  1YCS B;  2L3Q A;  2HSP A;  1JQQ A;  3EG2 A;  2RNA A;  1GFC A;  1WLP B;  4RTZ A;  2OAW A;  1RUW A;  2FPF A;  3REA B;  4OMM A;  1MUZ A;  2AKL A;  1W6X A;  2YT6 A;  2H8H A;  4Z88 A;  1WFW A;  1JO8 A;  2W0Z A;  4J9E A;  2CUB A;  3FJ5 A;  3NGP A;  4WCI A;  2J7I A;  3U23 A;  4LN2 A;  4F17 A;  4JPB W;  1NEB A;  1UEC A;  1AEY A;  1WDX A;  1VYT A;  1BK2 A;  1X2K A;  1NYG A;  2GQI A;  4JJD A;  1J3T A;  4D8K A;  2DRM A;  4OMO A;  4J9B A;  3VS6 A;  2FEI A;  4IIM A;  1V1C A;  2CSI A;  2ROT A;  2CSQ A;  1PWT A;  3REB B;  1KFZ A;  4HVV A;  1QKX A;  1ABQ A;  1NLO C;  2DYB A;  2RMO A;  2A36 A;  4LE9 A;  1U5S A;  4OMQ A;  2JS2 A;  2KRN A;  4R0K A;  2M51 A;  2BTT A;  3NMZ C;  1UHF A;  2GBQ A;  1GCQ C;  4J9C A;  2MIO A;  2W10 A; 
#chains in the Genus database with same CATH topology
 3KFV A;  3VYH B;  1I07 A;  4FYX B;  1GRI A;  2FVU A;  3SD4 A;  5GAO q;  3M4G A;  2MOX A;  2L3S A;  1YJW A;  3EGX A;  2WSC E;  1M3A A;  5CKD A;  2PUO B;  2E70 A;  3X20 B;  4PNO A;  3CBM A;  2HSE B;  1VQM Q;  4QW2 A;  2JM9 A;  4FSS A;  1UJ0 A;  3I55 Q;  3C95 A;  4UC4 A;  1W1F A;  4JJC A;  2RK2 A;  1AWJ A;  4CC7 A;  2LP5 A;  5KYW B;  2PTK A;  1MND A;  2DET A;  1RAH B;  5GAN d;  3OYJ A;  1GBQ A;  3I56 Q;  1G8X A;  2FG0 A;  3DB3 A;  4FYW B;  1PM3 A;  1SRL A;  5KYY B;  2KYM A;  3LWI A;  2ATC B;  1FYN A;  4OF1 A;  2M1H A;  4PLI A;  1VQK A;  2HL3 A;  4XTX A;  3URG A;  2K2V A;  3OSS C;  2NUT B;  3OYL A;  2VB6 A;  3G6E T;  2VAS A;  5LJ5 h;  1G3W A;  2VXF A;  4BD3 A;  3H8Z A;  4HT8 A;  1VQO T;  3S3M A;  3MJX A;  5GAN 7;  2O9V A;  1RI9 A;  4M75 A;  1YIT T;  4M75 D;  5LJ5 j;  3SWN B;  4M77 B;  5J39 A;  3G71 T;  4M7D E;  2LZ6 B;  2DL3 A;  1Q7Y R;  2OTJ T;  2DMO A;  2FZG B;  1VQ4 A;  4HT9 A;  3CPF A;  2BUD A;  4FSX A;  4BDZ A;  1VQN Q;  2M02 A;  2KSS A;  2ZPB B;  1KIK A;  2G6F X;  4IUV A;  1LPL A;  5IH2 A;  2ZPG B;  4RCC A;  1WHL A;  3VS7 A;  2DL4 A;  3SDZ A;  4DOV A;  3QWY A;  1NJI C;  2IG0 A;  1OX9 A;  4Y91 A;  2D1X A;  3J80 E;  3OYG A;  5CQX A;  3DLL A;  4GBQ A;  1T0J A;  2MF2 A;  3EGX B;  3C0C A;  4ELY C;  3THK A;  1TH7 A;  2L3R A;  2CP2 A;  3QHS A;  5D6W A;  2L3P A;  4ZGJ B;  3EGD A;  3UPU A;  2COZ A;  3UA7 A;  2LT1 A;  5KE3 A;  4F14 A;  5LJ5 d;  1WXB A;  4M78 E;  2RJE A;  2CP0 A;  3CPW S;  4JLI A;  2PNI A;  5FU6 C;  1F1B B;  2V8K A;  2YUP A;  3DB4 A;  2PU9 B;  4LDY A;  1UEB A;  1K9M U;  3CD6 Q;  2EGA A;  2QI2 A;  1T0H A;  3LWH A;  2QAZ A;  1BYM A;  4QQD A;  5CR2 A;  4J9H A;  1N9R A;  2PQW A;  2IVW A;  2HAX A;  2K6D A;  4MDX A;  1UFF A;  2VVK A;  3CCV A;  3VS2 A;  1Y96 A;  4ZNX A;  1M1K R;  2F2V A;  2FPE A;  3CCM T;  3EFO A;  4QQG A;  3OYD A;  4EMG A;  2F1L A;  1TXQ A;  2E5Q A;  1VQ6 A;  1Y57 A;  4J7I A;  5FRO A;  2DL5 A;  4FU6 A;  3L2W A;  4ZTF A;  2EKO A;  1PRL C;  1LOJ A;  3G4S T;  1M2O A;  4C0F A;  1M3B A;  3TU4 K;  2OI3 A;  4XU3 A;  4E47 A;  2M0O A;  1K73 R;  2DXB A;  2HDA A;  1RAA B;  1S72 Q;  1O9S A;  5IHN A;  5DLQ E;  3OYE A;  1YJN A;  2KRO A;  1KQS A;  2CP3 A;  1B34 A;  1KC8 R;  4XU0 A;  1HSQ A;  4OB2 B;  2HQH A;  1WHJ A;  2LQK A;  5GAM d;  2ESW A;  3CMA A;  2RHX A;  3C12 A;  3AHU A;  8AT1 B;  4C8Q A;  4C92 B;  3ZL7 C;  2GNC A;  1SRM A;  4C8Q D;  2CZ6 B;  2F2X A;  3V7C A;  4J5Y A;  1YNZ A;  1ZHI A;  1VQ8 A;  2J6O A;  2GTJ A;  5GAN 8;  3JCM e;  2C0I A;  2PVO B;  1IRX A;  5I2S A;  1K73 U;  1YHQ A;  3EGD B;  2L0A A;  3WXM B;  2DRK A;  2J6F A;  3C4S A;  2YRV A;  5CKE A;  2XDB A;  1M3C A;  4LNP A;  1EZZ B;  3I5R A;  2ED1 A;  3JV3 A;  4J6X A;  1NZ9 A;  5CQY A;  1YJW Q;  2VV5 A;  4J6W A;  7AT1 B;  1D0Z A;  3GOX A;  2YWW A;  1FMK A;  4HVW A;  2O4X A;  4EMH A;  3UWN A;  1KD1 U;  1NBE B;  3OYH A;  2K5L A;  2DA9 A;  4K11 A;  3LYI A;  1ZA1 B;  2AZV A;  4M77 F;  2QTV A;  3CCU Q;  5KH6 A;  2FRY A;  5C0M A;  1Y96 B;  1QCO A;  1WJQ A;  1M90 U;  4Y28 E;  2ZPI B;  2LT4 A;  3RKY A;  3EFO B;  2X4J A;  3J81 E;  4LD9 K;  2EFI A;  3O8V A;  4JZ4 A;  2CDT A;  2OTL T;  2K5F A;  3QG1 A;  4BI4 A;  3S3N A;  2M0Y A;  5CKF A;  1AVZ C;  1XQH A;  3JB9 H;  4O6J A;  4M75 G;  1VQK Q;  2JJ9 A;  2E6N A;  4DBF A;  3V7R A;  2EYQ A;  4LXC A;  4ORZ A;  3UAT A;  4BE2 A;  4AFU C;  2WAC A;  5GAN g;  2ED0 A;  3EG9 A;  1XOV A;  3OY9 A;  3HFO A;  1H3H A;  1B34 B;  2K57 A;  2KAF A;  1OPL A;  2RJD A;  4Z89 A;  3I55 A;  2K4Y A;  2CZ7 B;  5FWC A;  2DM1 A;  2MAM A;  4C8Q B;  3QYG B;  2XHC A;  4Z8A A;  4XTY A;  5CVI A;  3CPW A;  4A4K A;  4LD6 A;  1BU1 A;  5GAN f;  2PVD B;  1VQ4 Q;  1OV3 A;  3QO3 A;  4F7U A;  2XMF A;  4M75 C;  4R55 A;  2YHT A;  2E5K A;  2LCS A;  3OYB A;  2C0O A;  2KRS A;  4QVC A;  2DFU A;  3PT9 A;  2VWF A;  1KJW A;  1OU8 A;  5IXF A;  2ZPH B;  3OQ5 A;  4PJO B;  2DL8 A;  2VXE A;  1OI1 A;  2VYT A;  4HCB A;  3EFR A;  5LJ3 e;  2L3Q A;  2FHD A;  4C0D C;  1WLP B;  4FT2 A;  2EJG A;  1W4S A;  2H8H A;  5CO7 A;  5GAN 4;  4J9E A;  2O4X B;  3FJ5 A;  1IGU A;  3NGP A;  2J7I A;  2P84 A;  2QGF B;  4LN2 A;  1I8F A;  4PJJ A;  3H9N A;  3OS0 A;  5GAN 6;  1X2K A;  2GQI A;  1J3T A;  1FWZ A;  3VS6 A;  4J8O A;  3N5B B;  1V1C A;  2CSI A;  1Q81 U;  5GAN 5;  3EFS A;  5DY9 A;  1KQS P;  3RER A;  4JLG A;  4ZN1 A;  4ZTJ A;  3VUB A;  3CCV Q;  2KI7 A;  1BKB A;  2KRN A;  2XID A;  3A8O B;  2P0Q A;  4C92 F;  3PGG A;  1OQK A;  2EYZ A;  5AYF A;  4DEY A;  1IGQ A;  3ASK A;  2G3R A;  2YDL A;  2FRW A;  3EG9 B;  3CC7 T;  1VQ7 T;  3E9G A;  1VQO A;  4GLK A;  1IRE B;  5IXB A;  4HVU A;  4M78 C;  4C0G A;  1AWW A;  2CZ1 B;  1IHW A;  1YIT A;  1KHI A;  3CME T;  3QPH A;  4A4H A;  2QEX T;  3FB9 A;  4JRI A;  4C8Q G;  3WVD B;  1M1K C;  2KT8 A;  1YJN Q;  1N8R C;  3VRY A;  4RCB A;  1IO6 A;  4F7U B;  1YIJ T;  3CCR T;  5CAI A;  1QW1 A;  1YFN A;  3CMA Q;  2EW3 A;  4C5I A;  2V1R A;  2HKQ B;  5GJW B;  5KCH A;  2EVR A;  3JCM g;  2Y90 A;  3OYK A;  1VQ8 Q;  3ULR B;  1BBZ A;  1ZBX A;  2KBT A;  1BIA A;  1T3S A;  2DKG A;  2RI2 A;  1WHM A;  2GQV A;  3BW1 A;  5KYY A;  2K3X A;  3V8L A;  1Q86 R;  2R57 A;  4A53 A;  9ATC B;  2MK5 A;  4XU1 A;  1YHQ Q;  1K8A R;  5GAM g;  2HQE A;  1E7O A;  4M77 E;  1JXO A;  1RAI B;  3A8G B;  3M0U A;  1WX6 A;  1B07 A;  5D6X A;  2CS7 A;  4A4E A;  4X34 A;  2YUO A;  3CBO A;  2QXF A;  2X4X A;  1OEB A;  2AK5 A;  5GAN h;  2RD1 A;  5GAM f;  4LDX A;  3GBQ A;  1NE8 A;  1VQ9 T;  3MKD A;  3PNW C;  4DBQ A;  3SWN A;  1FXX A;  4KUL A;  1RLP C;  2EPD A;  2K3B A;  2KT1 A;  3EG1 A;  3OYM A;  3CCJ T;  3MP8 A;  3OW2 S;  4D8D A;  2Y4X A;  2RN8 A;  3EH1 A;  4C8Q F;  2HNI A;  1VQM T;  1Q82 U;  1M27 C;  5IHK A;  1QWF A;  2FL7 A;  3CPW P;  3SEM A;  1WZO A;  1GL5 A;  1D09 B;  1O75 A;  3CCL T;  3GPL A;  1JRI A;  1QQJ A;  3OYN A;  4IIO A;  2VGM A;  1D3B A;  2COW A;  4ESR A;  3UA6 A;  3CCS T;  4AG1 C;  4PJO F;  4HCZ A;  1JBM A;  1KQS S;  1OX8 A;  1KSW A;  2R5M A;  1CKB A;  1GCQ A;  1MHN A;  1M5Q 1;  1QP2 A;  3ME9 A;  3BE3 A;  3OBY A;  1ZSZ B;  2E4H A;  2QYZ A;  1B7T A;  4EMK B;  4F7U G;  1ZUK A;  1JEG A;  1IZ6 A;  2F2W A;  2O31 A;  1GFD A;  3BDL A;  4II1 A;  3NHN A;  1PSE A;  5HKC A;  3CCU A;  2DZ9 A;  4IUU A;  2NYS A;  1QCF A;  5GAN 2;  5KYX A;  1UGR B;  3JB9 J;  2EBP A;  2JOY A;  2JS0 A;  2WSE E;  1G2B A;  2OX7 A;  1IHV A;  2YLC A;  3P8B B;  1Y71 A;  4B6M A;  1LVK A;  3AT1 B;  4M75 E;  5FRN A;  1QVG A;  2LCL A;  1M1F A;  1G5V A;  2B8A A;  3WVE B;  1VQP Q;  1JJ2 A;  5LJ3 g;  2WSF E;  2RQW A;  5IHI A;  2JVV A;  2HBP A;  1OPK A;  2L5Q A;  1SSH A;  1VQN T;  4TVR A;  2JTF A;  3EG3 A;  3CCE A;  1BCO A;  1QMC A;  4XQ3 A;  3CC2 T;  5FLX E;  3L1A A;  4BUG A;  1SHG A;  1UGP B;  2RJF A;  3OYC A;  4Q5W A;  5LJ3 f;  1Y0M A;  4JJN K;  2BZX A;  2OJ2 A;  1SKU B;  2KEA A;  2X3X D;  1NM7 A;  3KXT A;  1V76 A;  3EHR A;  2ABL A;  4V2S A;  2YUN A;  1K1Z A;  2D6F A;  1ABO A;  3E19 A;  1YI2 T;  4HA8 A;  1G3S A;  4J9D A;  3KBG A;  3R6O A;  2EQM A;  5KYU A;  1YJ9 A;  3CQT A;  5GAO m;  1VQL T;  2NWM A;  4LDV A;  1QKW A;  1K9M R;  2KXD A;  4F7U F;  4FIB A;  2QG9 B;  1U06 A;  1PCX A;  2J6K A;  2LJ1 A;  4HCC A;  4C5G A;  4C92 A;  2KYB A;  3CD6 T;  5KE2 A;  2ZZD A;  3RIR A;  4JS5 A;  2I2L A;  2DF6 A;  4C92 D;  4XAX B;  1D3B B;  3GLX A;  2KRM A;  4PL6 A;  2JMA A;  1KG1 A;  2C0T A;  1MNE A;  4OGE A;  3G6E Q;  1X2Q A;  3MP6 A;  1WHG A;  2FB7 A;  2EJF A;  3VU3 C;  2RO0 A;  1VQO Q;  2DIL A;  4JJB A;  2ZPE B;  1M1G A;  4J9F A;  3GNG A;  2XIC A;  4DBR A;  4A4G A;  3I5S A;  2YRC A;  5GAM h;  1YIT Q;  1AWX A;  3G71 Q;  2CKK A;  2V1Q A;  1M2V B;  2RPN A;  1ZLM A;  4QT7 A;  2HZY A;  1BI1 A;  4N0A A;  5KYX B;  4BE1 A;  3INZ A;  2OTJ Q;  2EQI A;  4X9C A;  1ZUU A;  3A5Z B;  4OMP A;  2LQN A;  4B9W A;  5GAM j;  1CKA A;  2O2O A;  1NPP A;  3LGL A;  3OB9 A;  1S72 T;  2QDY B;  2D9T A;  2EGE A;  1R0B G;  3QJ6 A;  2FYK A;  2V26 A;  1RAE B;  3RR6 A;  5I2M A;  1UHC A;  2FZC B;  4YTL A;  1VQ5 A;  4LDW A;  4A63 B;  4PFZ A;  3OW2 A;  2LNV A;  2L2P A;  2P4R A;  2DJQ A;  3MET A;  4CRI A;  1X75 C;  3FIF A;  1SPK A;  1AT1 B;  2QA4 A;  2DVE A;  3X25 B;  1W70 A;  1SSF A;  3NPF A;  2ZAE A;  4OMF B;  1I5L A;  2FPD A;  4F04 B;  3CCQ T;  2JW4 A;  1KHC A;  3GF5 A;  3JCM d;  2RQV A;  4C8Q E;  2K2M A;  2RH2 A;  4M77 G;  3QDF A;  3M9Q A;  2AIR B;  3VS4 A;  4PJN A;  5D6Y A;  4MZP A;  2RI3 A;  2DEU A;  3DKM A;  4GLM A;  2HCK A;  2ENM A;  1NEG A;  1Q86 C;  5KYU B;  3S3O A;  4DQ2 A;  2O9S A;  3MEA A;  2F69 A;  1UGQ B;  1K8A C;  2RHZ A;  2EYX A;  2KGT A;  2LX9 A;  4ZGD B;  3OS5 A;  2XG8 D;  1LNX A;  4MZM A;  4RTV A;  1YJW T;  1U1T A;  1KD1 R;  2K9G A;  3BFM A;  1XNI A;  2A3L A;  3M0P A;  2AHJ B;  4RG2 A;  1VIF A;  2E6Z A;  2HSP A;  3VKI A;  3EG2 A;  1GFC A;  3CBP A;  4M7D B;  1M90 R;  3LLR A;  1G3Y A;  4M7A A;  3SWN C;  3SB2 A;  4M77 C;  3JCM V;  3JRZ A;  4R56 A;  1MUZ A;  2AKL A;  4M7A D;  2HQX A;  3M55 A;  5J3B A;  3QJY A;  4Z88 A;  1JO8 A;  2W0Z A;  4PJO A;  2CUB A;  2XDD A;  2EAY A;  4VUB A;  4WCI A;  1QVG P;  1VUB A;  4PJO D;  3G4S Q;  4F17 A;  2AT1 B;  1JJ2 P;  4EPC A;  3JCM b;  1NEB A;  1UEC A;  4O5V A;  3JB9 F;  1U1S A;  4JJD A;  3G1J A;  4D8K A;  2DRM A;  3A8H B;  3UT1 A;  4XTZ A;  3VJP A;  1VIE A;  3QZ5 B;  2CSQ A;  5LJ3 j;  4HVV A;  3E9F A;  5I21 A;  1NLO C;  2DYB A;  2A36 A;  2MPX C;  4LE9 A;  1RAG B;  1WQW A;  1MMD A;  2M51 A;  3MHX A;  3PIO A;  4KT0 E;  3X24 B;  2VC8 A;  2HMA A;  1GCQ C;  4IUR A;  2KDS A;  4BE0 A;  1JU5 C;  2K79 A;  1RL2 A;  2GGR A;  5GAO l;  2LMJ A;  5DLO A;  3X28 B;  2QQR A;  1VQ4 T;  2A08 A;  2HD0 A;  3HP9 A;  4IUQ A;  2RQR A;  4JZ3 A;  2CRE A;  4E7L A;  1UUE A;  3CC4 T;  2RHU A;  4HXJ A;  2GTO A;  3CCE Q;  2IPO B;  2E1H A;  1TUG B;  2DXT A;  3DLM A;  3S6W A;  2ECZ A;  2YLB A;  3PVL A;  4JRP A;  4F7U E;  2E3H A;  2P0P A;  3OSV A;  1C0M A;  2KR3 A;  5L23 A;  1WNL A;  3L2U A;  1AOJ A;  1X43 A;  5LJ3 d;  5GMK e;  1RLQ C;  3HKS A;  5D7U A;  1QP3 A;  3OMC A;  1W2B A;  3H0H A;  4LUE A;  1WIE A;  1UB4 A;  2XD0 A;  3L42 A;  2GFU A;  1G3T A;  4C92 G;  2JT4 A;  2DZC A;  3BDU A;  4KGX B;  2HKN A;  3MEV A;  4ATO A;  1I0C A;  1YJ9 Q;  5HCK A;  4KRT A;  2LVM A;  3G7Z A;  3QWX X;  1K9A A;  2V8J A;  1TUC A;  3JCM X;  2LQW A;  4ANJ A;  3EG0 A;  4M7A B;  2JZ2 A;  4LUD A;  1Q81 R;  3HL8 A;  1LJO A;  1VQP A;  2JTM A;  2PUK B;  1Q7Y C;  3JSC A;  3FJP A;  3M53 A;  2X4Y A;  2E12 A;  3P8H A;  4RTU A;  3RES A;  1QVF A;  1D1A A;  3RMQ A;  2DIG A;  3CCV T;  4AFZ C;  3OW2 P;  1E6G A;  3I35 A;  2H3E B;  1K9M C;  1VYU A;  2JXB A;  2DAQ A;  3ZFJ A;  1M8V A;  4C92 C;  2LX7 A;  1GBR A;  1NPR A;  3QZ9 B;  2SEM A;  2O88 A;  1RAC B;  3V8K A;  4GY5 A;  1VQ6 T;  3BY7 A;  2KQW A;  2FO0 A;  2RQU A;  4E2F B;  1PRM C;  3HFN A;  1HYO A;  1KK7 A;  1TOV A;  4JS4 A;  1YBY A;  3TEE A;  2KVQ G;  1S1N A;  1Y7X A;  1QVG S;  5FU7 B;  5FRM A;  1WHK A;  3NTI A;  4KGZ B;  4AFS C;  4AFQ C;  4J6Y A;  3QBY A;  5J26 A;  2A37 A;  1WYX A;  1JJ2 S;  2DTH A;  1OUL A;  5CCA A;  1ARK A;  4J9G A;  1PC0 A;  4PFP A;  5IAY A;  4X1V A;  1K0X A;  5FW9 A;  1X27 A;  1I81 A;  1VQ5 Q;  5CK9 A;  3M57 A;  2CYZ B;  3TSZ A;  4N0A C;  2I0N A;  1P92 A;  3D7S B;  3EH2 A;  1WA7 A;  4RKU E;  1WI7 A;  3CMA T;  3G6E A;  2ZCF B;  1OU9 A;  2QA4 Q;  4XTU A;  5A0L A;  1WXT A;  1YWP A;  1UJY A;  4ME7 A;  2MCN A;  4MZT A;  2L89 A;  1EIF A;  4M7D F;  4DOW A;  1MV0 B;  4DEX A;  3HTR A;  3SHW A;  1KQ2 A;  3G71 A;  2B86 A;  1RAB B;  4ZN3 A;  3OS2 A;  2X3W D;  1ZBJ A;  2J06 A;  5A0D A;  1VOM A;  1YHQ T;  2HEQ A;  3JB9 I;  2OTJ A;  5C6S A;  3A98 A;  3TSW A;  1ZSZ A;  2DBM A;  1PHT A;  4N4G A;  4EMK A;  1NJI U;  3UF4 A;  1VQL A;  3RKX A;  3HRU A;  3MEW A;  3TQ7 P;  5I11 A;  1VYV A;  3EAE A;  2DIQ A;  2MWP A;  1I5O B;  2X51 A;  3NTK A;  4QKU A;  2IIM A;  2M16 A;  3GP8 A;  1K73 C;  3KUF A;  1D0Y A;  4PJO G;  2Y4Y A;  4A4F A;  1Y07 A;  3OYY A;  1KC8 C;  1X6O A;  1Q82 R;  1I1J A;  4BB7 A;  2OAU A;  1OZ2 A;  4C0Z A;  1U8R A;  3O5Z A;  4C8Q C;  3FC3 A;  3JCM f;  1BI2 A;  2K3Y A;  4NOY A;  3JB9 D;  3CME Q;  1ZUY A;  2GCX A;  2KK4 A;  3ZBD A;  5KCO A;  3HSB A;  5GMK m;  4KGV B;  4AG2 C;  3QDR B;  1MGQ A;  3M4Y A;  1OOT A;  1M90 C;  1Z9Q A;  1M9S A;  1R77 A;  1FX7 A;  2LC4 A;  5CKH A;  2JMC A;  1X01 A;  4PJO C;  3CCR Q;  3E2U A;  2MWO A;  1D1B A;  5ECA A;  1TTH B;  2DD4 A;  4E7S A;  1ZA2 B;  1HXD A;  4FT4 A;  4C5H A;  1H8K A;  3CEY A;  3UDC A;  1G83 A;  4PFO A;  6AT1 B;  1W2B P;  2JNG A;  4BI3 A;  3I55 T;  4QQ6 A;  1N27 A;  5EC7 A;  3OYI A;  2XI9 A;  4FYV B;  3QYH B;  2K5I A;  3CCM A;  2A0F B;  3OYA A;  1E6H A;  2EYW A;  1HD3 A;  1C6V X;  4JDS A;  4CC2 A;  3I56 T;  1I4K 1;  1WGS A;  4KH1 B;  4M7A F;  1TUD A;  3L2Z A;  1U3O A;  5FU6 B;  3G4S A;  3M54 A;  4DA4 A;  1Q95 G;  2P0K A;  2D0N A;  2K7A A;  2LDM A;  4AMC A;  4FM4 B;  1QVF P;  2XKO C;  1IB8 A;  4MMK A;  2RQT A;  1MMN A;  4OGC A;  2BKD N;  2DXU A;  2KXC A;  5HK3 A;  4ZGE B;  1VQ9 Q;  1RI0 A;  2D8J A;  1M2V A;  2BE7 D;  3M5A A;  4BY6 B;  4E7Z A;  3CCJ Q;  8ATC B;  3GIB A;  1XTD A;  1K0S A;  2A28 A;  4D6W A;  1N9S A;  3MO8 A;  1PNJ A;  3PE0 A;  4OMN A;  5I22 A;  1WHH A;  4E7I A;  3JCM J;  1R0C B;  3CCL Q;  2D8H A;  2DLP A;  2EKH A;  3CCS Q;  3MP1 A;  3LH5 A;  4J7F A;  5CKB A;  2KY9 A;  2DL7 A;  3MCA B;  2DO3 A;  1AHJ B;  2RJC A;  1AZG B;  1YP5 A;  2NUZ A;  2JN0 A;  3MEU A;  1PKS A;  3OS1 A;  1Q81 C;  3OMG A;  3I9Q A;  4C92 E;  2YRD A;  2RK1 A;  1B3Q A;  4E7J A;  1MV3 A;  1ACM B;  3R6N A;  2JTE A;  3PMI A;  3QKJ A;  4RMO A;  4HCK A;  3VS3 A;  5GAN e;  3VV0 A;  3LGF A;  2LTO A;  4NL3 A;  1MMA A;  1WJR A;  1JQQ A;  3M58 A;  1WQ7 A;  2RNA A;  4CI0 C;  2E64 A;  2OAW A;  4NL2 A;  1RUW A;  2OTL A;  2XDP A;  2GFA A;  2YT6 A;  5HK0 A;  1WFW A;  4N4H A;  1PD0 A;  3JCM h;  3C94 A;  2F5T X;  3JCM c;  2X35 A;  3M59 A;  4IKF A;  4JRK A;  3J7A F;  3ZEH A;  3CC4 A;  2NUP B;  4QVZ A;  1WDX A;  1VYT A;  1AEY A;  1BIB A;  1BK2 A;  3SFM A;  4M7D A;  4J9B A;  3OYF A;  3Q1J A;  4IIM A;  4M7D D;  3CC2 Q;  1W2B S;  3PFS A;  3NTH A;  3F70 A;  1QKX A;  4FYY B;  2RMO A;  3A8L B;  5IT9 E;  4OMQ A;  3VYG A;  4EDU A;  2ZPF B;  1Q7Y U;  5GMK l;  3FEO A;  2EWN A;  1FMW A;  3PIP A;  1YI2 Q;  2MIO A;  1PSF A;  2YSQ A;  2RM4 A;  1VQL Q;  2P4T A;  2KNB B;  5LL6 S;  3L2Q A;  2QQ9 A;  2RB6 A;  3A1P A;  2CT3 A;  3JCM P;  1QVF S;  4C5E A;  1UE9 A;  1YWO A;  5CIU A;  2BZY A;  3JB9 G;  2EQK A;  4P5N A;  2QTX A;  1H92 A;  3IQL A;  4PKC C;  3HHT B;  2VGN A;  1ZSZ C;  3VUZ A;  4WTO B;  4EMK C;  3CXC A;  2VUB A;  4M78 A;  1GXI E;  1NLP C;  3JAM E;  4BDY A;  1SHF A;  3PMT A;  4M78 D;  1KQ1 A;  4E6R A;  2RF0 A;  2DXC A;  3TRE A;  3VS5 A;  4BY6 C;  4IUP A;  3TCJ A;  5LJ5 e;  2XK0 A;  1OYX A;  2QGG A;  2DK3 A;  3QXE B;  1N8R R;  1PD1 A;  1CSK A;  4M75 B;  1IXD A;  2M9U A;  4L6V 5;  1Q82 C;  3H6Z A;  3P8D A;  2QQB A;  3MPU B;  5A2Q E;  5GMK h;  2QQA A;  3JCM Q;  1HK9 A;  3OBW A;  2E3I A;  4XTV A;  1C1A A;  2DE0 X;  4M7A E;  3QII A;  2LJ0 A;  1PKT A;  4J83 A;  2J05 A;  1LCK A;  4PJO E;  4B9X A;  1A0N B;  3H0I A;  4C0D B;  5GMK j;  3H0F A;  1FMV A;  3FRN A;  1BI3 A;  3VS0 A;  2DNU A;  4OB1 B;  3CCM Q;  2RHY A;  3FLG A;  3CCU T;  1DJ7 B;  3CC7 A;  1M1K U;  2LNH B;  1VQ7 A;  2QAS A;  1N8R U;  3M0T A;  2ZGW A;  4M4Z A;  2L8D A;  3T9N A;  5LJ3 h;  4KUI A;  2EQU A;  3CCQ Q;  3CME A;  2QEX A;  1UTI A;  3EHQ A;  1AWO A;  1VQK T;  4WF2 A;  2DX1 A;  3NFC A;  3GNF B;  1YIJ A;  5GAM e;  2AKK A;  3CCR A;  1D0X A;  5DM7 R;  1RAD B;  3CCE T;  1KC8 U;  4RUG A;  4LDU A;  3VS1 A;  4FL6 A;  4N4I A;  2DYI A;  1ZX6 A;  3PVQ A;  2CP5 A;  1V29 B;  4M78 B;  1YN8 A;  2DTI A;  1NG2 A;  3H41 A;  1PG5 B;  3QSU A;  2R5A A;  2E10 A;  2AZS A;  2CH4 A;  4FW2 A;  3OA6 A;  4A54 A;  3L2R A;  1UDL A;  1YJ9 T;  1BI0 A;  1K4U S;  3M0Q A;  4QVD A;  2H3J A;  1T3L A;  2CGH A;  2D0Q B;  2KMT A;  2BE9 B;  2DJZ A;  2DPP B;  2KE9 A;  4KH0 B;  1VQ9 A;  3ER0 A;  2LJ3 A;  3PTA A;  1TSF A;  4IUT A;  1Z9Z A;  2LQ8 A;  2DER A;  3LW5 E;  2CT4 A;  3CCJ A;  1M8M A;  1TWB A;  2CP7 A;  4RTX A;  2R58 A;  1VQM A;  4Z02 A;  2RHI A;  5FWB A;  3HRS A;  3TVT A;  1JXM A;  1M4Z A;  1N6A A;  1R8O B;  2MMP A;  1RAF B;  5GAO n;  2EGC A;  2X9H A;  4L5G A;  4NS5 A;  4M7D G;  3L2V A;  2OTL Q;  2CH4 W;  5L8R E;  4FW1 A;  3CCL A;  1AD5 A;  1M30 A;  3I56 A;  2PZ1 A;  3CCS A;  1UG1 A;  3RKW A;  4PLL A;  1H64 1;  1AZE A;  2GF7 A;  3CC4 Q;  5GMK i;  2CUD A;  2CZ0 B;  4RTW A;  3X26 B;  5GAO p;  1VQ5 T;  2EJ9 A;  2JM8 A;  2JUF A;  1YCY A;  3CXC P;  4JUV A;  3RMS A;  2EYY A;  1VA7 A;  2QA4 T;  4OML A;  2SRC A;  4F16 A;  1NYF A;  2EIF A;  2MI6 A;  1HJD A;  4CC3 A;  4M7D C;  1K76 A;  2ROL A;  4KUD K;  1X6B A;  1X69 A;  4M75 F;  5M9O A;  1BB9 A;  5HY6 A;  2C06 A;  4MML A;  4M78 G;  1TU0 B;  4AT1 B;  1YJN T;  3LH0 A;  1NJI R;  4JRQ A;  3E1S A;  4PJM A;  3A8M B;  2MYS A;  1OZ3 A;  2BZ8 A;  4PJL A;  2VKN A;  4J9I A;  2O01 E;  2A7Y A;  1VQN A;  3FDR A;  3RDV A;  5GJV B;  3CC2 A;  1QVP A;  2COY A;  1VQ8 T;  5LJ5 g;  2HBW A;  1ZSG A;  2EQJ A;  3VRZ A;  3V8J A;  4BI8 B;  5A0G A;  4KBM B;  2RA2 A;  3RBB B;  2E65 A;  2PVG B;  4E7K A;  1VQ6 Q;  1N5Z A;  4FCY A;  4RTY A;  2FZK B;  1WXU A;  5IN1 A;  1YI2 A;  4OB0 B;  5LJ5 f;  5EG2 A;  1QWE A;  3M0S A;  3M0R A;  1TG0 A;  1WPY A;  4CC4 B;  1QLY A;  1X6G A;  2NLU A;  1UGS B;  4M7A G;  3HPW A;  3CD6 A;  1GCP A;  3EGU A;  4RTT A;  1WJS A;  4OP0 A;  4X9D A;  2DVJ A;  4ELZ C;  4EIK A;  1H3Z A;  1QCN A;  1D1C A;  1SEM A;  2HL5 C;  4RG8 A;  1EFN A;  3CC7 Q;  2DBK A;  4XTW A;  2QQS A;  2DEQ A;  1VQ7 Q;  1UGV A;  1SF9 A;  3RUX A;  5KYW A;  4M78 F;  2CP6 A;  4OVA A;  2YUQ A;  1KD1 C;  4E7H A;  1EX4 A;  1MMG A;  2QEX Q;  2YXY A;  3RNJ A;  2RI5 A;  2BIV A;  2Z0W A;  4Y92 A;  2LRQ A;  4M7A C;  2QDL A;  4BAC A;  1YCS B;  2NUT A;  4XK8 E;  1YIJ Q;  1XJW B;  1S72 A;  1BCM A;  4RTZ A;  1SG5 A;  3LX7 A;  5AT1 B;  2FPF A;  2XU8 A;  3REA B;  4OMM A;  1W6X A;  4DBH A;  5GAO r;  5KYN A;  1JB0 E;  2QK0 A;  3U23 A;  3CXC S;  4JPB W;  4HKE A;  4OB3 B;  4M77 A;  2DTO A;  4M77 D;  1NYG A;  4OMO A;  2FEI A;  2LCC A;  4L59 A;  4MDW A;  5GAN j;  1Q86 U;  2X4W A;  2ROT A;  2E41 A;  1PWT A;  3REB B;  3CCQ A;  2F5K A;  1K8A U;  1KFZ A;  1ABQ A;  3M56 A;  3HRT A;  1ZQ1 A;  2V8I A;  5GAN 3;  2NUP A;  1VQP T;  5FU7 C;  1U5S A;  2DD5 A;  2JS2 A;  4R0K A;  2BTT A;  4PK4 A;  3NMZ C;  3JCM W;  1UHF A;  2GBQ A;  1TS9 A;  3QUI A;  3V7S A;  4XU2 A;  4J9C A;  2W10 A; 
#chains in the Genus database with same CATH homology
 3KFV A;  2YSQ A;  1I07 A;  2EYZ A;  4DEY A;  1JU5 C;  2K79 A;  1GRI A;  2YDL A;  2KNB B;  2FRW A;  2GGR A;  2LMJ A;  2MOX A;  2L3S A;  1M3A A;  2CT3 A;  5IXB A;  1UE9 A;  2A08 A;  1YWO A;  4HVU A;  1AWW A;  2JM9 A;  4FSS A;  2BZY A;  2RQR A;  4JZ3 A;  2CRE A;  1UJ0 A;  1UUE A;  1H92 A;  1W1F A;  3IQL A;  4JJC A;  4HXJ A;  2GTO A;  1AWJ A;  4CC7 A;  2LP5 A;  2ECZ A;  2KT8 A;  1NLP C;  3PVL A;  2PTK A;  1SHF A;  3VRY A;  2KR3 A;  5L23 A;  4E6R A;  1IO6 A;  2RF0 A;  1GBQ A;  2FG0 A;  1AOJ A;  1X43 A;  3VS5 A;  1RLQ C;  1SRL A;  3H0H A;  2EW3 A;  2KYM A;  4LUE A;  1WIE A;  2V1R A;  1FYN A;  5GJW B;  1CSK A;  2JT4 A;  2EVR A;  1I0C A;  3ULR B;  1BBZ A;  2KBT A;  5HCK A;  1T3S A;  4KRT A;  2DE0 X;  3QWX X;  1K9A A;  2LJ0 A;  1PKT A;  1TUC A;  2LQW A;  2J05 A;  3EG0 A;  4LUD A;  1LCK A;  2O9V A;  1RI9 A;  3H0I A;  1A0N B;  1E7O A;  1JXO A;  3H0F A;  4RTU A;  3M0U A;  1WX6 A;  1B07 A;  3VS0 A;  2LZ6 B;  2DL3 A;  2DNU A;  2YUO A;  4AFZ C;  1E6G A;  2LNH B;  3I35 A;  2DMO A;  1VYU A;  1OEB A;  2AK5 A;  2JXB A;  3M0T A;  4M4Z A;  2LX7 A;  1GBR A;  3GBQ A;  2SEM A;  2O88 A;  1RLP C;  1UTI A;  3EHQ A;  2EPD A;  2K3B A;  2KT1 A;  3EG1 A;  1KIK A;  1AWO A;  2FO0 A;  2G6F X;  2RQU A;  4D8D A;  1PRM C;  2RN8 A;  5IH2 A;  2DX1 A;  1M27 C;  3VS7 A;  2DL4 A;  5IHK A;  1S1N A;  3QWY A;  1QWF A;  2AKK A;  3SEM A;  4AFS C;  4AFQ C;  2D1X A;  2A37 A;  1WYX A;  4RUG A;  4GBQ A;  1T0J A;  1ARK A;  4J9G A;  1GL5 A;  3C0C A;  3VS1 A;  3THK A;  4X1V A;  1K0X A;  5FW9 A;  1X27 A;  2L3P A;  4IIO A;  3TSZ A;  2I0N A;  3UA7 A;  1ZX6 A;  4ESR A;  1WA7 A;  3UA6 A;  4AG1 C;  1WI7 A;  4F14 A;  3PVQ A;  1WXB A;  1KSW A;  2PNI A;  1YN8 A;  3H41 A;  1NG2 A;  1CKB A;  1GCQ A;  2YUP A;  1WXT A;  1YWP A;  1UJY A;  2EGA A;  2AZS A;  2MCN A;  2CH4 A;  1T0H A;  1UDL A;  1MV0 B;  4DEX A;  1K4U S;  1ZUK A;  1JEG A;  3M0Q A;  4J9H A;  3SHW A;  2F2W A;  2O31 A;  2B86 A;  1GFD A;  2X3W D;  1ZBJ A;  2K6D A;  2J06 A;  3NHN A;  1UFF A;  2VVK A;  1T3L A;  2HEQ A;  1QCF A;  3VS2 A;  3A98 A;  3TSW A;  2EBP A;  2JS0 A;  1G2B A;  2DBM A;  1PHT A;  4ZNX A;  2KE9 A;  2F2V A;  3UF4 A;  2FPE A;  2LJ3 A;  5I11 A;  1VYV A;  1Z9Z A;  2CT4 A;  1Y57 A;  2IIM A;  2DL5 A;  1M8M A;  2RQW A;  5IHI A;  4RTX A;  1PRL C;  1M3B A;  5FWB A;  2OI3 A;  1JXM A;  1OPK A;  3TVT A;  1SSH A;  2HDA A;  2EGC A;  3EG3 A;  1I1J A;  2CH4 W;  5IHN A;  2KRO A;  3O5Z A;  1SHG A;  1AD5 A;  1M30 A;  1HSQ A;  1Y0M A;  2PZ1 A;  2BZX A;  2OJ2 A;  1UG1 A;  2ESW A;  2KEA A;  2X3X D;  1NM7 A;  1ZUY A;  1AZE A;  3EHR A;  2ABL A;  2CUD A;  2YUN A;  4AG2 C;  1K1Z A;  4RTW A;  2GNC A;  3ZL7 C;  1SRM A;  1ABO A;  2F2X A;  2JM8 A;  1YNZ A;  4J9D A;  1OOT A;  1Z9Q A;  2J6O A;  2GTJ A;  3CQT A;  2NWM A;  2C0I A;  2JMC A;  1QKW A;  2KXD A;  2EYY A;  1VA7 A;  4OML A;  5ECA A;  1U06 A;  2LJ1 A;  2J6K A;  2SRC A;  4F16 A;  1NYF A;  2KYB A;  1H8K A;  1G83 A;  2DF6 A;  2L0A A;  1HJD A;  4CC3 A;  2DRK A;  1K76 A;  2J6F A;  2ROL A;  2KRM A;  1X6B A;  5EC7 A;  1X69 A;  2JMA A;  2C0T A;  1X2Q A;  1BB9 A;  1M3C A;  4LNP A;  3I5R A;  1E6H A;  2ED1 A;  2EYW A;  3JV3 A;  1HD3 A;  2DIL A;  4CC2 A;  4JJB A;  4J9F A;  1TUD A;  1FMK A;  4HVW A;  1U3O A;  3I5S A;  2BZ8 A;  2VKN A;  4J9I A;  1AWX A;  2D0N A;  2K7A A;  2V1Q A;  2DA9 A;  2RPN A;  4K11 A;  5GJV B;  1ZLM A;  4QT7 A;  2AZV A;  2FRY A;  2EQI A;  1ZUU A;  2HBW A;  4OMP A;  2LQN A;  1ZSG A;  2RQT A;  3VRZ A;  1CKA A;  2KXC A;  2O2O A;  4JZ4 A;  2CDT A;  3RBB B;  2EGE A;  2D8J A;  2M0Y A;  1AVZ C;  1N5Z A;  1UHC A;  4RTY A;  1WXU A;  4A63 B;  1K0S A;  2A28 A;  2L2P A;  1QWE A;  2P4R A;  4ORZ A;  3UAT A;  3M0S A;  3M0R A;  1TG0 A;  4CC4 B;  2DJQ A;  1QLY A;  1X6G A;  1SPK A;  4AFU C;  1PNJ A;  3PE0 A;  4OMN A;  2ED0 A;  5I22 A;  1XOV A;  1W70 A;  3NPF A;  1H3H A;  1GCP A;  3EGU A;  4RTT A;  2FPD A;  2D8H A;  2DVJ A;  1OPL A;  2DLP A;  4EIK A;  4Z89 A;  2JW4 A;  2EKH A;  2RQV A;  2K2M A;  5FWC A;  1SEM A;  3LH5 A;  2DM1 A;  3VS4 A;  4Z8A A;  1EFN A;  2DBK A;  2DL7 A;  4GLM A;  1BU1 A;  2HCK A;  1AZG B;  1UGV A;  1YP5 A;  2ENM A;  1NEG A;  2NUZ A;  1PKS A;  1OV3 A;  2O9S A;  3I9Q A;  2XMF A;  2YUQ A;  2EYX A;  2E5K A;  2KGT A;  2LCS A;  2C0O A;  2KRS A;  1B3Q A;  3RNJ A;  4RTV A;  1MV3 A;  2VWF A;  1KJW A;  3R6N A;  4Y92 A;  2JTE A;  5IXF A;  2K9G A;  2DL8 A;  4HCK A;  3VS3 A;  2QDL A;  3M0P A;  1YCS B;  2L3Q A;  2HSP A;  1JQQ A;  3EG2 A;  2RNA A;  1GFC A;  1WLP B;  4RTZ A;  2OAW A;  1RUW A;  2FPF A;  3REA B;  4OMM A;  1MUZ A;  2AKL A;  1W6X A;  2YT6 A;  2H8H A;  4Z88 A;  1WFW A;  1JO8 A;  2W0Z A;  4J9E A;  2CUB A;  3FJ5 A;  3NGP A;  4WCI A;  2J7I A;  3U23 A;  4LN2 A;  4F17 A;  4JPB W;  1NEB A;  1UEC A;  1AEY A;  1WDX A;  1VYT A;  1BK2 A;  1X2K A;  1NYG A;  2GQI A;  4JJD A;  1J3T A;  4D8K A;  2DRM A;  4OMO A;  4J9B A;  3VS6 A;  2FEI A;  4IIM A;  1V1C A;  2CSI A;  2ROT A;  2CSQ A;  1PWT A;  3REB B;  1KFZ A;  4HVV A;  1QKX A;  1ABQ A;  1NLO C;  2DYB A;  2RMO A;  2A36 A;  4LE9 A;  1U5S A;  4OMQ A;  2JS2 A;  2KRN A;  4R0K A;  2M51 A;  2BTT A;  3NMZ C;  1UHF A;  2GBQ A;  1GCQ C;  4J9C A;  2MIO A;  2W10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...