1IZ6A

Crystal structure of translation initiation factor 5a from pyrococcus horikoshii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
136
structure length
136
Chain Sequence
GDKTKVQVSKLKPGRYIIIDDEPCRIVNITVSSPGKHGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKKTAQVIAITPDTVQIMDMETYETFEVPIDTGVADEIRDQLKEGINVEYWETLGRIKIMRIKGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Initiation Factor 5A
publication title Crystal Structure of Hyperthermophilic Archaeal Initiation Factor 5A: A Homologue of Eukaryotic Initiation Factor 5A (eIF-5A)
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 28
structure length 136
sequence length 136
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1iz6A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1iz6A02
3A5ZB 1HH2P 1XMQQ 4YWLA 2MWPA 3CCJA 3CCMA 2AMCB 4LFCL 4HIMA 4GLXA 5C4JH 1HR0W 3LH0A 1VQOT 1VQ6T 1UE7A 1IZ6A 2DO3A 1QVGS 1SR3A 1YNXA 3F2BA 4HJ8A 1RIPA 2G3RA 2Y0SG 3U58A 3GTLH 3H3VH 2ZM6L 4L5RC 4DKAC 4JOIA 2JK8A 1VQPA 1VQ9A 1PH2A 5LL6S 4PG3A 1YI2A 1NJIC 4R4TA 5M3MH 4A3KH 1PV4A 3RLFA 4JI5L 3L7ZC 3CMAT 1VQDA 4X64Q 3KJPA 1VQGA 4YHHQ 1YEZA 3D0FA 4ZN3A 4A3FG 4JI0L 3I4MH 2IX0A 1HNZL 4BXXG 4O0AA 3CCQT 3PUZA 4A3DG 2AWOA 1KRSA 4YY3L 4EX5A 4DUZL 4HIOA 1NMGA 1I6HH 1RL2A 1A8VA 4DNIA 5M5YH 4DR2Q 3PF4A 2Q2IA 3TRZA 2YV5A 1W2BS 3G4ST 1IL2A 2JQOA 3AFPA 2NN6I 4MTNA 3HOVH 1Q82U 2Y0SE 1HZ9A 5J3BA 4A3CH 1PH7A 2E2IH 1I3QH 1HNXQ 2ATWA 3G71T 5BR8L 2R92H 4A3MG 3NBHB 4DR1L 2R93H 3CCLA 3AYHB 4DV1L 1N36Q 1M90U 2PI2A 5FJ8H 2LSSA 2VQFQ 1ASZA 2PQAA 3FKIH 4DV6L 1QVFA 4HJ5A 4P74A 2Q2HA 4LFBQ 1TWCH 1JE5A 5GROA 3PCOB 1VQJA 3T1YQ 4OWXB 1PYSB 3S24A 3PGZA 2VL6A 4LFCQ 3PUYA 1YIJA 2VS1A 5C44H 2DGYA 4A3EG 1A62A 3KDFB 3TS0A 2E2JH 3ULJA 4JI7Q 4JV5Q 1MKHA 4DR3L 2BA0A 1MJEA 2E6ZA 1Q1EA 2ZTDA 1VQCA 1UE5A 1VQ5A 2CKZB 3CMET 3AQQA 3E0EA 3ULPA 1XPRA 5IYCH 1JJ2S 4TVAB 2OQKA 2ZJQA 5GAHC 1UEBA 1DGSA 3RLNA 4WJ4A 2Z6KC 3CP0A 4GOPC 4JI0Q 2OTLA 3S16H 2E8GA 1VQ7A 1WCMG 1K73C 1TWHH 3A0JA 4OONA 4R1JA 1JJ2A 3PUVA 1NPRA 2JA5H 3J81c 3BU2A 1SE8A 5IY0A 4OX9L 1NJIU 2XGTA 2ES2A 4GLAC 3CPWS 4AQYL 2EIFA 2N78A 4LF4Q 1MJCA 2WB1G 4ALPA 1VQEA 1WJJA 2L3RA 1BBUA 5GADC 4A3FH 4IFDJ 4BXXH 4DR1Q 3AFQA 3H3VI 4A3DH 2F3IA 1G51A 4DV1Q 4A3GG 1NZ9A 5C0XJ 2KENA 3S2HH 4P73A 3CXCA 2YTVA 1EIFA 4X62L 4DV4L 3KLWA 3GTOH 3KFUA 3CCET 1VQ8A 4JC0A 4JI2L 3OW2A 2K52A 2R6GA 4PZ7A 3CCST 4IFDI 1EWIA 2LCLA 4IFDG 4A4IA 1EIYB 4DR4Q 4BA2I 5JJLA 2BH8A 3H15A 5C0XI 3M4QA 4A3MH 4B3SL 4RG2A 2JA7H 4POGA 5DM7R 4P75A 3PF5A 1Y1WG 2WB1E 4DV0Q 3ICEA 1VQOA 1VQ6A 1X3GA 4EQ5A 4JI3Q 1WFQA 4ME3A 2A1AA 2CQOA 1P16A 3HOWG 1H95A 1SMXA 4JBMA 5M3FG 4BBRG 1R9TH 1KC8C 2F4VL 1OXUA 1XTDA 2MWOA 2OTJT 2FXQA 3LGLA 2K75A 1OXXK 1PH9A 5C3EH 4DUYL 3BJUA 5IYDG 4CRIA 3CMAA 4FDBA 2I5LX 4IPDA 1PH8A 3RR5A 2R7ZH 4GS3A 3I4NG 3CCVT 2I5MX 4OWTB 2VNUD 2QGQA 1OXSC 2JA9A 4GOPB 4BY1G 5E7NA 1CKNB 3CCQA 2K5HA 4WJ3M 4NPSA 3S1MH 1E3PA 4YCVA 3HOYG 4NXNL 1BVSA 4LUZA 2ASBA 3G4SA 4OO1G 1J6QA 4OO1I 3HKSA 2UXDL 3M7NA 1Z47A 3U50C 2EQSA 4AYBG 4JBKA 1WCMH 3JAME 1QZHA 3F1ZA 1AE3A 1IBKQ 2VUMH 1N32L 3I7FA 2JUFA 4DAMA 1J5EL 1EYGA 2UXDQ 3G71A 1PH1A 1L0WA 1Q86C 4X62Q 4XIGS 4NB3A 1KIXA 4L5SA 3DLLA 5IYBG 2NZOA 1E7ZA 2KCTA 4APVA 4HIKA 4QY7A 4LFAL 3F2CA 1PFSA 3KDFA 5LMNL 3KJOA 4QQDA 2HIVA 4AH6A 4MZ9A 4B3SQ 2JE6I 3K80C 1FGUA 1BKBA 2E5LL 1N33L 2DUDA 3TREA 3KF6B 4A3GH 2MQHA 4GNXC 4R4IA 3ULLA 4UP8A 1TXYA 3DB4A 1QVGA 2KDSA 1K9MU 5ELNA 3ZJYC 4AYBE 4POFA 2IY5B 3E9IA 2I0QA 4GLVB 2UXBL 2R7FA 3GTKH 1CKOA 3CMEA 1NBWA 1Q1BA 4DUYQ 3FP9A 4DR5L 3PO3H 3UDFA 4X65L 3PIPA 1VQAA 2K14A 3RLOA 5FLMG 1Y1VG 1PH6A 3J80E 1Y1WH 1NE3A 3RZOH 5IE8A 1EUJA 3M3YH 5GQOA 2NVXH 3S14H 2VY3A 2RHQB 4NXNQ 4UP9A 1NY4A 3K0XA 1KXLA 2LVMA 2RHSB 3E9HA 3LGJA 2VW9A 2K4KA 1EOVA 1LUZA 2HIXA 4GN5A 1W2BA 4H02A 4R4CA 1YJ9T 1N34L 2KCMA 5AJ3L 4XTCS 3OTOL 3I4NH 2OQ0A 3JC66 1K8AU 4BY1H 3PIOA 3PV0A 2NVTH 1QZGA 1GD7A 2YYZA 1Q7YU 1BBWA 1HZBA 1B7YB 4DV3Q 2K5VA 2QA4T 3HOYH 2GN5A 4C3HH 4LFAQ 4YWKA 3CCEA 4JI6L 4YTLA 1C9OA 5LMNQ 1X3EA 1N8RC 2ZTCA 3RN5A 3CCSA 1PA6A 1NMFA 3UDXA 1XNIA 1Q8KA 5IWAL 5LMUL 4LF9L 4A93G 4IPCA 1OTCA 2ZM6Q 4LF8L 2WP8J 4KHZA 4LF7L 5C4XG 1Q86U 1T9HA 1WOCA 3HOZG 4YCWA 4A3LH 2A8VA 3CCRT 5IYBH 1KHIA 4GNXB 4JI5Q 4R4OA 1YVCA 4DV5L 1ASYA 2E2HH 3HOUG 4KHPL 4DV7L 4GKJL 2UXBQ 4QGUA 2Z6KA 5DLQE 5EAYA 4DAYB 4DV2L 2BH2A 2V1CC 1HZCA 3CQZH 4GOPA 1PH5A 1CKNA 1I94L 1JB7A 1HNZQ 2PI2E 4DR5Q 2ID0A 3UDGA 4DUZQ 2OTJA 3CCUA 1X65A 1Q12A 3BZCA 4TQUS 4JI8L 4YY3Q 4X65Q 5FLXc 1XMOL 3M4OH 1JJCB 3UDIA 3P8BB 1YJWT 2VQEL 4A76A 2JA8G 1LTLA 4X66L 2R7DA 3CCVA 2MNAA 4GKKL 2Q2TA 1TWAH 1E1OA 4GN4B 1EFWA 4LF6L 2IHFA 2VZAA 4LWCA 2IX1A 1YJNT 1YITT 3CD6T 5BR8Q 3HOXG 1XJVA 1N34Q 2UUAL 2NVQH 1KL9A 3CPWA 3J81E 1N9WA 2MFIA 3K7UC 5AJ3Q 3OTOQ 2Q2UA 1AH9A 3PUWA 1Y1VH 4DV6Q 2RCNA 1GVPA 1O7IA 3J81j 4R4QA 2UUBL 3W1GA 1YHQT 3I55T 4LUOA 5J26A 2JEBI 3KYHC 1I5FA 4JI1L 1S3OA 3KF6A 2N49A 4DK3C 3A5UA 2JA6G 1D8LA 3F8TA 3W5OA 4JI4L 1IBLL 3FHWA 3L0OA 4IPHA 4DR3Q 1UE1A 3K7AH 3S15H 1A63A 2ALYB 1PH4A 2PNHA 2CCZA 2OWOA 1GKHA 4KHPQ 1E24A 3CF5A 4BBSG 2MO1A 3D31A 3STBC 3M85A 1XPOA 3CCUT 4DV7Q 4A3KG 1K83H 3H0GG 4GKJQ 3G48A 3HFZB 4DV2Q 1C7YA 4JCVE 2LQ8A 1X54A 2K5NA 1X56A 3CAMA 3M4PA 4LUVA 1XMQL 4A3EH 4A3BG 1XMOQ 2RF4A 4JBWA 4JI8Q 4A93H 2UXCL 2HQLA 3S1RH 3NELA 5C4XH 1K0RA 4OX9Q 4X66Q 3CC2T 1K8GA 2HHHL 2EXDA 1SN8A 4AQYQ 3CC7T 3HOUH 3NEMA 3PO2G 4P71A 4PMWA 2KHJA 3UE1A 1K73U 5IT9c 3CC4T 1Q82C 4C2MH 4YHHL 5JJIA 2IG0A 4A3IG 2R92G 1YJ9A 4C3IH 3RN2A 1VQHA 4DV4Q 3VDYA 3K8AA 2JA8H 1M90C 1IXRA 4JI2Q 1HR0L 4MNOA 3FKIG 3GD7A 3I56T 2CWPA 5K36G 4JI1Q 4OXPA 3U4ZA 2QA4A 3GO5A 2ZTEA 3GTQH 4DPGA 1YZ6A 5JEAG 4JI4Q 1M1GA 3JAMi 2N3SA 1IBLQ 4GNXA 1QVCA 1HNXL 4IOAA 2XTIA 2KVQG 3STBD 1YHAA 1JJGA 2CKKA 3RNUA 3BZKA 5C44G 4AIMA 4KI0A 5M5WH 2ZJRA 4QQBX 4RMFA 1C0AA 2JNGA 3A74A 4HJAA 1KRTA 4ZN1A 2F4VQ 1GO3E 2YU9H 3CCRA 1B70B 4LFBL 5JJKA 3HKZG 5IYCG 1CSPA 4DR6L 3MXNB 4IPGA 1HNWL 1KQSS 2I5HA 3WWVA 4IO9A 2UXCQ 2CFMA 3PUXA 3G6ET 1AE2A 1EQQA 4BY7G 4LNQA 2LXJA 3L2PA 2Z0SA 3MEFA 5LMNW 4JI7L 2HHHQ 2JA5G 4NXML 3HOWH 4JV5L 1KD1C 1KQSA 1YJWA 1KC8U 3K81C 4JOIC 4BBRH 1I50H 1W3SA 2A19A 1WI5A 5M3FH 5M5XH 3H0GH 3J80c 5H1SE 4GN3B 3EN2A 2BA1A 2B3GA 5IP9G 4JYAL 4K0KL 1CSQA 1PYBA 3GTPH 5IYDH 3LGFA 4DR7L 1N32Q 3NENA 5HGQA 1J5EQ 1VCIA 1YJNA 1YITA 3CD6A 4A3BH 2D0PA 2C35B 3KOJA 3J80i 3EIVA 2D62A 4BA1I 1VQNT 3HKZE 4JG2A 2AWNA 1M1KC 1S72T 1HR0Q 1G6PA 4QL5A 1VQLT 1IYJB 4LF5L 1YHQA 4C3JH 2H5XA 3I55A 1LYLA 4LF4L 1SFOH 3TS2A 2JJQA 2NN6G 2PMZE 4LW1A 2E5LQ 1VQIA 4KLKA 4B3ML 2GVAA 1N33Q 1QVFS 1D7QA 1VQKT 4A3IH 1Q81C 4IJLA 4HJ9A 1E22A 4QJFA 5ELOA 3TQYA 3S1NH 4Y52H 1E1TA 2ZJPA 1X6OA 2JA7G 1FJGL 3M9BA 1YHBA 2QEXT 3CPFA 1VQ4T 1L1OC 1L1OA 3I2ZA 2N8NA 1VQMT 4JBJA 1LM0A 3CCJT 5IP7G 3CCMT 1UE6A 1FL0A 3DB3A 1X3FA 1Y14B 4TVRA 1QUQB 2B63G 4DR6Q 1HNWQ 2JVVA 2MI6A 4DR4L 1PH3A 3PSIA 3I4OA 5C3EG 4A3JG 2R7ZG 3GTGH 1VQPT 1VQ9T 4A75A 3S1QH 1YI2T 3AEVA 1XPUA 4RG1A 3TEHB 4NXMQ 4DV0L 2KBNA 2UU9L 3T1HL 4JI3L 1OXTA 1TWFH 3S2DH 3CC2A 4X6AH 5FLXE 3CC7A 4JYAQ 4K0KQ 1A0IA 4DR7Q 2JEAI 2AKWB 4B3TL 5FLMH 2B29A 2JOYA 4P72A 4PZ8A 1PHJA 3CC4A 4BY7H 3RZDH 1P8LA 1X9NA 2VUMG 3CW2C 4HIDA 1KD1U 1EQRA 3OYYA 2YTXA 2LXKA 3PO2H 2K50A 4Y7NH 5A2QE 1NPPA 1VQBA 4JI6Q 2YTYA 2D0OA 4DK6C 4LF5Q 4OWWB 5IP9H 3GTMH 2UUCL 3I56A 4B3RL 3CCLT 5IWAQ 2WAQG 1TWGH 5LMUQ 3J81i 3CXCS 1Z9FA 4B3MQ 1Q46A 4LF8Q 1XNRL 4QIWE 3GTJH 4LF7Q 1CKMA 2GVBA 2MO0A 3ER0A 2XHCA 3OW2S 2WFWA 1IBKL 1FJGQ 1M1KU 3J7AF 4DV5Q 1IBML 5IAYA 1FVIA 4J15A 1HJPA 5M3MG 1XNQL 1B8AA 4L5TA 1HZAA 1N8RU 1K9MC 1UWVA 1I94Q 4LF9Q 2PQAB 1L1OB 1JT8A 4X34A 1YIJT 1SSFA 2AHOB 3KBGA 3I4MG 1Q81U 2VQEQ 1K3RA 5C0XG 3PO3G 3HOZH 1PVOA 3S17H 1V1QA 1VQ5T 4LF6Q 4IJHA 1YBYA 3G6EA 2WAQE 2F52A 4YCUA 2UU9Q 3T1HQ 1V43A 2IT1A 3U4VA 2UUAQ 1VS0A 3DM3A 4L5QA 2OTLT 2L15A 2IHEA 5IP7H 4X64L 1VQ7T 4UP7A 4IOCA 3HOVG 4A3CG 5GAEC 2B63H 3W1BA 4B3TQ 2R93G 2KHIA 5JEAJ 4A3JH 1JMCA 2E70A 5FJ8G 2UUBQ 4O2DA 1K8AC 3IRBA 3JAMc 4DR2L 1VQFA 1VQNA 5IT9E 1Q7YC 5GAGC 1X55A 1S72A 3HOXH 4UY8C 4B3RQ 4PZ6A 2UUCQ 1SRUA 1WYDA 2NZHA 3EBEA 4GKKQ 1VQLA 1KAWA 3UE0A 1SROA 1XNRQ 2HT1A 3J7ZC 3F2DA 3ERSX 1MIUA 1GM5A 4BBSH 1U0LA 2NVYH 4HJ7A 2OCEA 1SLJA 1N36L 5HY6A 2VQFL 1VQ8T 1VQKA 3GDEA 3J7A5 1IBMQ 1V9PA 3SGIA 2CWAA 4UPAA 3Q8DA 1S40A 1QUQA 1OXVA 1XNQQ 1CUKA 4YWMA 1U5KA 2JA6H 1NTGA 4A3LG 1L2FA 3KF8B 2QEXA 1VQ4A 4DV3L 3B6YA 1G291 3T1YL 1VQMA
chains in the Genus database with same CATH superfamily
3A5ZB 5CC4A 3R6OA 4DAYB 3CCMA 4LFCL 2MAMA 3VS6A 5LJ3h 4GLXA 2MYSA 1UE7A 1YNXA 1VQ6T 2DO3A 3VUZA 1DOKA 2O9VA 3FDTA 2ZM6L 4L5RC 2JK8A 3F70A 4M77B 2JT4A 3TCJA 1K9AA 4R4TA 4A3KH 1FGBD 3RLFA 3FLGA 3JCMX 2PZ1A 3L7ZC 3CMAT 1VQDA 5M3FB 3E9FA 1VQGA 1I50B 4HCSA 5KE2A 1NBEB 3D0FA 4ZN3A 2AIRB 3GV3A 2EJGA 4O0AA 1UJ0A 3PUZA 2JSOA 3GTPB 1IYVA 3MXPA 1HHVA 2B2UC 1G8XA 2JJ9A 1A8VA 4Z89A 3AU7A 4DR2Q 3META 2Q2IA 2R57A 2F0FA 1IL2A 2RJCA 1M3BA 3MEWA 2BOSA 2F0UA 3HOVH 1HK9A 1QP3A 1Q82U 1F2LA 2E2IH 1I5OB 2FVUA 4O42A 4RCOA 1LOJA 1MSHA 1S5FD 3NBHB 3NPPA 4DR1L 4E6RA 2RHXA 1SXTA 3EG3A 3U23A 3CCLA 3D4RA 1UG1A 2AUJD 2BE9B 5FJ8H 4JZ4A 1ASZA 3F2UA 2RDFA 3FKIH 4KJNA 5CV8A 1Q82R 2RQXA 3VYRA 2C0TA 4KBMB 2Q2HA 3OYFA 3CCRQ 5GROA 1RDPD 3PCOB 8AT1B 4X3KA 4ME5A 1MUZA 2LT4A 4EMHA 3O13A 3CQZB 1JBMA 4X3TA 2LFNA 4XYOA 1WYXA 1SNPA 1A62A 4XYQA 2F0SA 1MKHA 4DR3L 1ILQA 3GTGB 3M54A 3NTIA 7AT1B 3OS2A 4XTVA 1TWAB 4XU3A 4M7DF 1VDZA 1VQCA 3BDCA 1XPRA 2NB0A 3MEAA 1UJYA 3CXCP 4C0DB 2K3XA 1DGSA 4TVAB 5CV6A 3VRYA 3RLNA 3T16A 3S2DB 1PDQA 4JI0Q 2OTLA 1NR2A 2ZXOA 3S16H 1K73C 1B7TA 2OI3A 1LTBD 3HKZB 1TUGB 3OBYA 5I2SA 2YRDA 3PUVA 3SHLA 1YNJD 4PQXA 1STBA 2V8IA 5D65A 4OX9L 1TUCA 2VXWA 4PFZA 5A0DA 2ES2A 1M3AA 2EGAA 5AT1B 2E6NA 2HAXA 3ZL7C 3CPWS 1BQQT 2PMZB 2PUOB 3I55Q 4Y7NB 2NUTB 2A3LA 4E7JA 1BBUA 3NHHA 4IFDJ 1GJXA 3I72A 4KK7A 4A3GG 2RNAA 4L59A 2CT4A 5A0LA 1LT6D 2KENA 2PO4A 4WJWA 5C0XJ 2K4YA 2YTVA 1EIFA 2H3EB 4X62L 4DV4L 1LTTD 4G7ZC 1PLFA 1WIEA 4ANJA 4A4GA 3C94A 4JC0A 2D8HA 5KH6A 3OW2A 2R6GA 3QYHB 4KJOA 1V1OA 2F2WA 3IKJA 4CHTB 1X6BA 4OMQA 1EX4A 5DLOA 3M4QA 2PW5A 3C4SA 4M77A 4RG2A 1Q3LA 2YRCA 2JA7H 4POGA 1YP5A 1KQ2A 3ICEA 3JAML 3VR5A 5LJ5j 3HL8A 2HQHA 4NL2A 1WFQA 3S17B 4GKJL 4L5GA 1ZSGA 3QYGB 3SWNC 2WSFE 5KCHA 1KC8C 4H0LC 5M3FG 3E3XA 3NTHA 4C1NI 1PH9A 4DUYL 3G6JB 3OYKA 4Z02A 2R7ZH 3ZEHA 4GS3A 3P8DA 3CCVT 4OWTB 1Y69U 2VNUD 2SEBD 1OXSC 4RTZA 1U8RA 1CKNB 4J83A 4MMKA 4A3JB 1O75A 2RA4A 2EAYA 2GQIA 2DL3A 4PJOF 3HP3A 4WJ3M 1PSFA 2JN4A 3NBHA 2F0VA 2EJFA 3IFTA 4FSSA 4DBHA 5CORA 3G4SA 3BE3A 1I4GA 2UXDL 2L1BA 1ZSZB 3U50C 2J7IA 1UUEA 3F1ZA 4DAMA 2JUFA 4M4ZA 3K5OA 1M4VA 1AT1B 6AT1B 1Q86C 1BCPF 1EQVA 2EYOA 1X69A 3DLLA 3QDRB 2KCTA 2E75C 4HIKA 4C92C 3F2CA 3NGPA 1PFSA 3NSWA 2F69A 2B8AA 3TN2A 4A4FA 3K80C 3HS0C 2L12A 2F0LA 2DUDA 2MQHA 1H3HA 2EDGA 3ULLA 4GNXC 2SNSA 5TSSA 1SE3A 4A54A 3G6EQ 1TXYA 4OEMB 2F0HA 2JM9A 2KDSA 4FXGC 3OS1A 2YUNA 4HVVA 1JXMA 2XIDA 3GTKH 4IFDH 3ONAB 1NBWA 1Q1BA 1GFDA 4DR5L 2LX9A 3HFNA 2K01A 5JJZA 1I4RA 3DMUA 3PIPA 4BWGB 2K14A 1Y1VG 1Y1WH 2DIQA 2MUYA 2YWWA 4OF1A 5JAVA 5I21A 2NUTA 4CDDC 2RHQB 1WTOA 1AZPA 4NXNQ 1E7OA 4UP9A 3NWTA 4ODGA 3VR6A 1KXLA 2RHSB 3LGJA 5GAOn 1VQLQ 1N34L 2EJMA 3T53B 4C5IA 2KCMA 3RUXA 4XTCS 2OQ0A 3GP8A 3JV3A 4A3IB 3DXJC 4RHRA 4WRDA 4OB3B 3S1NB 2RB6A 1KFZA 4DOVA 5IGEA 1Q7YU 1BBWA 4DV3Q 2K5VA 4K5XA 3HOYH 2O4XA 3BS1A 1QE6A 1CA6A 3MPUB 4C3HH 4M78E 3CCEA 4OO1H 1NG2A 2FZGB 2ZTCA 2DY8A 3RN5A 1PA6A 1SMYD 2P4TA 1Q7YR 5IWAL 5LMUL 4A93G 4J9EA 4IPCA 2DTOA 2WP8J 5FOBB 4KHVA 2RN8A 4C0FA 2CP7A 4C0GA 3JCMh 5GAMj 3RR6A 1YI2Q 3EFXD 2DNEA 3ND8A 5C44B 2A8VA 4JI5Q 2RI2A 4R4OA 4DV5L 1ESFA 4DV7L 3DEPA 3L9AX 2Z6KA 4M7DD 1EU4A 2NYZD 2V1CC 1HZCA 1PH5A 3NP8A 1CKNA 3SK4A 3M7GA 1HA6A 4M7AF 3UDGA 4DUZQ 2M51A 4X65Q 1U3OA 1Q12A 2MK5A 2ZCFB 4O1NA 1WTQA 2VXEA 4QT7A 1LVKA 2H3JA 4X66L 2MNAA 4BY7B 1G2TA 4M7DB 5J1ZA 5CKHA 2BDOA 1GUTA 1IW7C 1ZSZA 2JA5B 2IHFA 3JCMd 1U4LA 2DETA 2EE1A 3SK8A 1A3VA 1LNXA 2M02A 1WDXA 3A56A 5BR8Q 1O7ZA 1NJIR 3CPWA 1CHQD 3OTOQ 1AH9A 2PYKA 1H9JA 3FJ5A 4PKCC 5KE3A 1QWYA 4FNFA 4A3FB 4ZGJB 2RCNA 4E2FB 4CKCA 4Y91A 1OOTA 4PJOE 4R4QA 4E6IA 2F03A 3S2HB 4LUOA 2KCNA 3P75A 3K58A 2DNUA 1PCXA 1PFMA 3VV0A 2N49A 1XWEA 2CP0A 5CIUA 5IH2A 3BYTB 3QR8A 3W5OA 4JI4L 1MV3A 3L0OA 1JOQA 1MV0B 2D0QB 2KRMA 1OI1A 1UE1A 4FXKC 1V29B 3DKMA 1D5ZC 1PH4A 2PNHA 1A3TA 3V7CA 4M75C 1VQ5Q 1E24A 2CCZA 1QWFA 4IURA 4KD4A 1H641 5GAN7 3CCUT 4GKJQ 3PFSA 1V76A 3HFZB 4DV2Q 4JCVE 2EKOA 2XK0A 4DQ2A 4Y92A 1B34B 1H92A 2LQ8A 2VB2X 2K5NA 2VVKA 3OPOA 1D5XC 1ZBJA 4A3BG 2RF4A 3KUPA 5C3EB 4CKEA 1HXDA 4PFPA 2LDMA 1JICA 4XTWA 1RF2D 1BDOA 4DGZA 1X32A 3W2DA 2L0AA 2KHJA 3UE1A 2ABLA 3JB9I 3MP6A 1K0SA 4K2LA 4PFOA 4RGNA 3I90A 4OP0A 3TSSA 2IG0A 4A3IG 2F0KA 4J9FA 1YJ9A 3K8AA 4OGQC 1IHWA 2O01E 2E5KA 4ZUJA 4JI2Q 1CZWA 2K5LA 1BCPD 2OAUA 3MEHA 3OYAA 5K36G 4JI1Q 2XNAC 2E3IA 1HPCA 5BN5A 2O9SA 4AG1C 2QA4A 1GXIE 1YZ6A 4BI8B 1M1GA 2WAQB 1IBLQ 1KDCA 1HNXL 2XTIA 3AB9A 1D0ZA 4IOAA 1VQ6Q 1BCPB 1PTOC 5C44G 4AIMA 1JB0E 4AMCA 5IIFA 2OAWA 4ZAIA 2BCOA 3BVGA 1KRTA 3HP9A 2FZKB 2KNBB 4B6MA 1B70B 3V96A 3OW7A 3CMAQ 3M0TA 4ZGEB 1MMGA 3MXNB 4DR6L 1HNWL 4M7DA 2I5HA 1O9SA 2KRSA 2MCNA 3K5NA 4BY7G 1AWJA 2LXJA 3L2PA 2X4WA 4K11A 2MP1A 3MEFA 5LMNW 4C92E 2R5AA 3MHBA 3L2VA 2F0NA 1KG1A 2HHHQ 2JA5G 5M3FH 3K81C 1K3BC 1EEID 1I50H 1W3SA 1WI5A 4HCCA 4ZQ3A 3J80c 3M0UA 4GN3B 4I7AA 5IP9G 4EQPA 4JYAL 1BI3A 1CSQA 1X3QA 1SYCA 2ZT9C 4NP5A 2EYJA 3GTPH 4DR7L 2FHTA 5GMKi 5F2DA 4JS5A 4KN4C 1J5EQ 1B2TA 1YITA 2CDTA 3H6ZA 5LJ3e 3CD6A 3J80i 2EJGC 4DU9A 2NUCA 5FO7B 3QKJA 1WXBA 1VQNT 3I4NB 4JG2A 1M1KC 1RAIB 2B8GA 1TG0A 2MMPA 2XWJB 1GRIA 1YHQA 2RH2A 2H5XA 2PQEA 1LYLA 1HA5A 3TZDA 3K5LA 3TS2A 2JJQA 1D7QA 4KLKA 4XTZA 3G7LA 4DA2A 1VQKT 1Q81C 4IJLA 1VQPQ 1UGPB 4AFQC 1E1TA 3QPHA 3L1AA 1FJGL 4ID6A 4X3UA 3EG9B 1AHJB 3CPFA 4N4IA 1VQ4T 4XT1B 2A6EC 1JE4A 1VQMT 2KQ3A 1KIKA 2CZ0B 1TQOA 4OGEA 3CCMT 1BUVT 1TVXA 1GBQA 1LTRD 1RODA 4QMGA 4U68A 3DB3A 2DM1A 5A2QL 1B07A 2RQTA 2ZGWA 4N0AA 1QUQB 3OYNA 1UEAB 2MI6A 5JEAH 1D1KA 5C3EG 4M7AD 2AQ3B 2Z8LA 3TZUA 3GTGH 4A75A 3AEVA 1ZUUA 2K33A 2PCFB 5E4WC 1E6HA 1GBRA 2A73B 2D9UA 2KBNA 2O2OA 3T1HL 4C8QF 3E1SA 1OXTA 3S2DH 2LNHB 3CC2A 5LJ5g 3VRZA 3CC7A 2R61A 4M7AB 2EY2A 1CKAA 3URYA 4B3TL 2V1RA 1O7YA 5KRUA 5CK9A 4Z8AA 2SDFA 1PRMC 1P8LA 1X9NA 1C8CA 1Q8IA 1N6AA 3CW2C 1CA5A 1KD1U 3OYYA 2EQMA 2V26A 3JSCA 4KKTA 4Y7NH 1TY2A 2CQAA 3LLRA 2D0OA 4OWWB 4B3RL 1LT3D 1JWSD 3CCLT 2WAQG 3V8LA 1Z9FA 4B3MQ 4LF8Q 4PJMA 5GMKl 4KRTA 4N8FA 3MAQA 2KSSA 4DNTB 1CKMA 4RCCA 2XHCA 1U06A 1AOJA 2LC4A 1IBML 5IAYA 1NNXA 4FP5D 2Z1CA 4J15A 3TP6A 1HJPA 1PG5B 2VB3X 3A8GB 2PQAB 3FIFA 3MXGA 2AHOB 1N9RA 4F88A 4RFBA 2VQEQ 1Y8NB 4BB7A 3RUZA 3S17H 1V1QA 3CCVQ 3G7ZA 4OMNA 1W6XA 5C4XB 1G83A 1ACMB 4C0ZA 3U4VA 3QG1A 2DTHA 3RIRA 4ELYC 1VS0A 4F17A 2OTLT 2IHEA 3MTSA 4X64L 3HOVG 4LD6A 1CTMA 2F3VA 1UTIA 3THKA 2EPBA 4L8JA 3H0FA 3W1BA 1T3LA 2G6FX 2BZYA 4A3JH 4M75E 3OA6A 1JQQA 5CBEE 5FJ8G 5LMNQ 2I2LA 2UUBQ 1VYUA 1OULA 2PNRC 1PFNA 2ZPBB 2JA8B 2K6AA 1UDLA 1ABQA 2QAZA 1X55A 4XQJA 2VWFA 1S72A 3M57A 4UHVA 4PZ6A 2UUCQ 2TSSA 1WYDA 2NZHA 1STEA 2KROA 2IJ0A 2HT1A 4XDXA 1WHKA 3EG9A 2LTOA 2E2DC 2LJ1A 2A68D 3ERSX 3VYTA 1FNVA 5CMDA 1GM5A 3GTQB 4BBSH 1HQRD 4EQNA 2F0OA 2KEDA 1V9PA 2KECA 4XAXB 1S40A 2Y4YA 1QUQA 1U5KA 4OMFB 3ZBDA 3NMZC 1V8QA 3V05A 3KF8B 2QEXA 4XT3B 4DV3L 2NUZA 1HD3A 1G291 4H44C 1HH2P 4DFAA 1XMQQ 3CCJA 5I11A 4KY6A 2LCCA 2AMCB 1A6XA 1G91A 5IHKA 1KHCA 1RHPA 2G3RA 1RIPA 2Y0SG 3T4AC 3H3VH 4DKAC 4M7AA 3EROA 3FVQA 1VQ9A 4RKLA 4C0DC 4ZK9B 4PG3A 1GUWA 1PV4A 3HOWB 4LN2A 2QTXA 4JI5L 5GAMg 2FINB 3I35A 4BBRB 3KJPA 3AMUA 4YHHQ 3PGGA 4KH1B 4DNRB 4LUEA 2HSEB 1QCBD 3M53A 5ELEA 2IX0A 1TH7A 2V8JA 1F2YA 1Q90A 3D4WA 1HXYD 3U9SA 4DUZL 2NBFA 2E64A 3FB9A 1DONA 1NMGA 1RL2A 4CC4B 1Q95G 1UGRB 4MZMA 5GAN2 1IYUA 4G7HC 3TRZA 3LWIA 1W2BS 1UAPA 3G4ST 4K8JA 1F9PA 3EG2A 3AFPA 2V4DA 2NN6I 4FYDA 2E65A 2A7YA 2DFUA 1I4K1 2KY9A 3QWXX 3RKWA 2G9HD 2EYHA 4A3CH 3MP1A 2B2YA 2GFAA 4EMKB 4C3JB 5BR8L 3VU3C 2M9VA 4AYBB 1WTHA 1SFOB 2FYKA 3RDVA 1SYBA 4DV1L 1N36Q 3TU4K 5FO9B 5GANe 3EFOB 2FG0A 4OMMA 2PQAA 4CKBA 3TEEA 2XU8A 3MHXA 3QXEB 2J0TD 4FO2A 5KYUB 1PFBA 2JYOA 2PTKA 2OT2A 4CI0C 5IN1A 3S24A 5IHNA 3OYDA 3OYBA 1M8VA 1C0MA 4L63B 5C44H 4ZNXA 5FKAC 4JI7Q 4JV5Q 4PV1C 4R0KA 1QMCA 5LJ5d 1MJEA 5E3FA 1GUOA 2D0NA 2P5ZX 3ULPA 1UE9A 2PQWA 2RPNA 1KDBA 2IW3A 4RKUE 4J8QA 1I1JA 2BDNA 4ZGDB 4J9HA 1BR9A 2Z6KC 1E6GA 1GHKA 3VS2A 3OW2P 1BF4A 1UNSA 1D0YA 2JA5H 4ZCKA 4Q5WA 3J81c 4EIKA 3BU2A 3M5AA 1SE8A 5IY0A 3JCMe 1RADB 2YT6A 1BBZA 1TS5A 2XGTA 3A7AB 1YNND 2LJ0A 2QG9B 1Y57A 1ZSZC 2N78A 3R2IA 5FO8B 1MJCA 1STYA 4LF4Q 3PO2B 4ALPA 4K14A 1VUBA 4RTXA 4A3FH 1YN8A 2BZXA 2I46A 5KYXB 5A0GA 2QTVA 4F7UB 5A35A 4FF2A 3EHQA 1NZ9A 3S2HH 2HSPA 1F9QA 3RESA 1RAGB 3EH2A 3FC3A 2O2LD 3KLWA 4TRDA 3CCET 1VQ8A 2CZ6B 2EYYA 1DOMA 1WI7A 4ILWA 4PZ7A 5JVG3 4JI2L 4HCBA 1RLQC 1EWIA 4IFDI 4IFDG 4A4IA 3CCUQ 2WSCE 3V7SA 1PYWD 1EIYB 1BK2A 2WACA 4HTHA 3H15A 5C0XI 5JJLA 2GBQA 4LUDA 1PRTD 1M8MA 2DA9A 4AT1B 1CQFA 5GAOq 4BI3A 3IFDA 1Y1WG 2JTFA 3H8ZA 1QOHA 1LJOA 3J7AV 5EQ0A 2K2VA 3TMEA 1WTVA 1OQKA 3HOZB 3HOWG 3K0YA 2P0KA 1PZID 4BBRG 4XTYA 3EG0A 1BYMA 1PRTB 1R4QB 2FXQA 5D3IB 4DXGA 1ET6A 5IGCA 5C3EH 3SEMA 1PD0A 3VS5A 4CRIA 4FDBA 4IPDA 1M4ZA 3RR5A 2FL7A 5GMKe 4HMJA 4D8KA 2DY7A 4GOPB 2DXCA 3QJYA 2EYMA 4RWSC 3UI2A 3OYIA 3GOXA 2RJEA 3HOYG 5KNCA 3VR4A 2FEIA 1NE8A 4C3HG 4QUCA 1NLPC 1BVSA 4LUZA 4OO1I 4OO1G 5LJ5f 1J6QA 3EFOA 1GXDC 3V7RA 3TDQA 4AYBG 2RQRA 1WCMH 1SJED 1QZHA 2A5HA 2VV5A 2DAQA 1F9SA 1J5EL 1EYGA 2EOTA 5KYUA 2JXMB 1L0WA 4XIGS 2EQIA 4V2SA 1ZEQX 3O5ZA 3E0JA 4OL7A 3RMSA 2K7AA 1H9KA 2NZOA 2DYIA 4A63B 1F9RA 1QCFA 2RKSA 4L6TB 1M2OA 3SB2A 1CFMA 4LFAL 3I3CA 3MFYA 2JA6B 1TWBA 3KJOA 5I9PA 2HIVA 4MZ9A 4B3SQ 3T56B 2DYBA 1M30A 9ATCB 4IALA 4J7FA 4NDXA 5GAMd 1SMYC 3DB4A 5ELNA 1K9MU 3NXWA 3K5MA 4POFA 3GTLB 3PIO3 2I0QA 2R7FA 2YU9B 4NKLA 4D6WA 2B2TA 1JXOA 2DILA 3CMEA 1R4PB 1TS4A 3MCAB 1SPKA 1CK1A 1VQAA 1K9MR 3RLOA 5FLMG 3I4MB 4DEYA 5GAN4 4CGYB 1OX9A 3EGDB 5M5XH 1FMVA 1WTRA 1XYIA 2JS2A 2E1HA 2L5QA 3CU7A 1VQNQ 2ZXPA 1I6HB 2GTJA 1TS9A 2HBWA 1XJWB 5KYXA 2A69D 2K03A 1NY4A 4F7UA 4CBVA 1LUZA 2G9DA 1W2BA 4R4CA 1YJ9T 1GOZA 4F7UG 5JPMC 2QDBA 3JC66 3I4NH 1K8AU 1RLPC 2NWGA 2KEAA 2R93B 1VQKQ 3PV0A 4KMUC 1QZGA 1GD7A 2JS0A 4LXCA 3AHUA 3A98A 1HZBA 1C6VX 3BVZA 1RKNA 2C0OA 1VQ4Q 2QA4T 2GN5A 4F16A 1VQMQ 3FEOA 1PM3A 4YWKA 1K8AR 4K5WA 1IHVA 5D6XA 2RHYA 3CCMQ 1N8RC 1C9OA 3CCSA 2H4OA 2E10A 2EKHA 2NYSA 1YWOA 2WIIB 4HCEA 1XNIA 4KKUA 5DAUA 2DERA 3C1EA 1AN8A 4LF8L 2ESWA 4XXEA 1SG5A 1Q86U 1O78A 2RJDA 1T9HA 2DBKA 3CPWP 1WOCA 4M8AA 4YCWA 3HOZG 2LQKA 5IYBH 4KHPL 2I0NA 2CW0D 5CQYA 4UAIA 1Y71A 2E2HH 1E2VA 2UXBQ 2H1EA 1TOVA 4WFN3 4QGUA 4GOPA 1HNZQ 3EAEA 3QHSA 1RAHB 1XOVA 2PI2E 4H13C 2EY1A 1Q86R 3BZCA 5FLXc 2AZVA 1XMOL 3M0PA 4G57A 4LMQD 2MOXA 2VQEL 4A76A 3Q0AA 3MVVA 2KYBA 2Q2TA 3J7YW 1E1OA 2EYWA 1PMRA 3QO3A 2IX1A 3PVLA 4LWCA 4JJNK 4M78F 1NR4A 1SJHD 2NZ1D 2KGTA 3KLRA 3W3AA 1YITT 3CD6T 1MGQA 1GCQA 1UGSB 5GAMf 4RG8A 5GMKm 3JCMJ 1RTNA 1UHFA 3MXUA 1OZ2A 3J81E 5AJ3Q 3CCLQ 4DV6Q 3UA6A 1SYDA 1B3QA 4A3DB 3J81j 1TXQA 2UUBL 1YHQT 2DE0X 3KYHC 2JA6G 3A5UA 3EQLC 2EZVA 2M00A 2O4XB 1BCPC 2LCSA 2FMMA 2QILA 3OSVA 1AWXA 3KLSX 1CKBA 4M77G 1FNWA 1A63A 1SF9A 2DXTA 3HSBA 2YUQA 5DY9A 1AP0A 4IUNA 2JN0A 1MGSA 1SHGA 3CF5A 1OO9B 4EMGA 3M85A 1LTSD 2X51A 3RBBB 4CC3A 3EGDA 2OTLQ 1X54A 1X56A 1XMQL 1VYTA 4JI8Q 3CEYA 4X9CA 4DF7A 2UXCL 3NK9A 1HFNA 4OB2B 4PNOA 5C4XH 1KAAA 4LDYA 4ZTJA 3CC2T 1B9NA 2GF7A 5E1FA 3CC7T 5HK0A 2ZPEB 1WQ7A 2QQAA 3K6OA 1E0BA 3NEMA 4QIWB 2P4RA 1SBBB 2EY5A 2A6HD 2F1LA 3DEOA 5EBDA 1Q82C 4YHHL 3V2TA 5C4HA 5J22A 2L4NA 1WGSA 4XQQA 3CBOA 3RN2A 3CKIB 5K5PA 3VDYA 4K6DA 5EKKA 2JA8H 1M9SA 3C1FA 2VUMB 2KRNA 1HR0L 5FU7B 2RSNA 4MNOA 4OIJA 3GD7A 3MC0B 1EWCA 4ABNA 1ZYRC 1M2VB 2CWPA 1E2ZA 4ORZA 3U4ZA 2Q8RE 3KBXA 3GTQH 1KK7A 3OYLA 3GO5A 5JEAG 1G2SA 3JAMi 2L2PA 2N3SA 4E47A 1R77A 4FYWB 3N52A 3STBD 2CKKA 3FEWX 2LZ6B 3BZKA 5M5WH 5CKFA 3UWNA 3X20B 2AKLA 2JNGA 1C0AA 2HCCA 4BACA 4HJAA 1DJRD 1T5XD 4EGVA 2LQNA 3FPUB 1GO3E 1LACA 2HD3A 2DVJA 4FSXA 2F0MA 5I6WA 3HKZG 5IYCG 1CSPA 2XDPA 1V1CA 3LX7A 1TKWB 3WWVA 2X6LA 1D3BB 3NPFA 2CFMA 3JCMV 1PZKD 3RD4A 3PO3B 4P5NA 2IVWA 2DKGA 4FM4B 5I9OA 4JI7L 3HOWH 4JV5L 3I9QA 1KQSA 1YJWA 3A7LA 4M7AC 1NCVA 4BBRH 1EIHA 3UT1A 3LH5A 5H1SE 3G4SQ 2R58A 1A15A 2L5TA 1QCNA 3EN2A 1WD0A 1X6GA 2P84A 3LGFA 4FT4A 2CSQA 1WFWA 5LL6X 2YSQA 1YJNA 5G3LF 2D0PA 1EY4A 2C35B 2J6KA 3R3OA 4A4HA 4QB4A 4BA1I 4WTOB 5GJVB 4CDEC 1S72T 4DA4A 4J6WA 2EXZA 4BY1B 1AWOA 4QL5A 2MPMA 2QQSA 1Y96B 2MJ8A 2L55A 1IYJB 3I70A 2JXBA 4LF5L 4C3JH 2RQUA 1Y7XA 1ZKOA 2F0EA 1SFOH 4LF4L 2CZ1B 4XQ3A 5IXBA 5CKEA 2E5LQ 1VQIA 1N33Q 1JORA 1QVFS 2B2YC 4R8IA 2CP6A 5GAOp 1E22A 1D1CA 5ELOA 4HT8A 1ZBXA 4C92F 4WCIA 5IGGA 5L37A 3X28B 5JPNC 4IIOA 3VJPA 2QEXT 2FB7A 1L1OA 1SNMA 3AT1B 4PMBA 3OYMA 5C6AA 2CP2A 3CCJT 1UE6A 4QUFA 2KAFA 1QCOA 5IGDA 4AG2C 1X3FA 2O88A 5KYNA 1PH3A 1XX8A 4A3JG 4JZ3A 3HGBA 4CC7A 1VQ9T 2K04A 2JM8A 1HUMA 2JTEA 3M4OB 1HSQA 2ED1A 4JDSA 1KLGD 3TEHB 4NXMQ 1SEBD 2UU9L 3PMTA 2NTTA 2BZ8A 1VF7A 1IO6A 5FLXE 4X9DA 4M78D 3FDRA 2F0QA 1ML0D 3SK5A 2ENBA 5FLMH 2XWBB 1WPYA 4PZ8A 1M2VA 3CC4A 3FRNA 3DUZA 2IPKD 2VUMG 2W10A 5LJ3j 1G6ZA 4II1A 1X2QA 1O80A 3EGXB 2YTXA 3PO2H 4M78B 1NPPA 1STGA 1VQBA 2RBMA 1QILA 2YTYA 4DK6C 3CCEQ 2RDHA 4JI6Q 5GAOm 3I56A 1ZA1B 2RO0A 3UPUA 5KGUA 4GKKL 1XNRL 4LNPA 3NWSA 1EOTA 2DBMA 4J8OA 2KYMA 2YDLA 1M1KU 1MMAA 5KCOA 3ME9A 1LT5D 1DCZA 1D3BA 3OY9A 1HZAA 1WHLA 1K8OA 3OIPA 1KTKA 1D1BA 4X34A 1LTGD 2AK5A 3JCMW 4MDWA 1K83B 1JB7A 1I0CA 1Q81U 5FU6B 3VYSA 1K3RA 1K0XA 3PO3G 3HOZH 4HEDA 4RHSA 1X3PA 4LF6Q 1EQTA 2WAQE 2FPDA 4YCUA 4PJOD 3S1RB 3HTRA 2RQVA 2IT1A 2XG8D 5HCKA 5D6WA 4KH0B 3JCMc 1Q81R 4IUPA 1JC7A 2EBPA 3H09A 1IXDA 4HN7A 5IP7H 2B2WA 1SDFA 4A3CG 1WJSA 1EIGA 2WSEE 3MEUA 1S1NA 5JEAJ 2LMCB 1WCMB 1VOMA 1Y96A 2E70A 4PJOB 4JLGA 3NQTA 3NFCA 4K2KA 3D3RA 3KUFA 1I5LA 3OYHA 4V190 4DR2L 4JK1C 1U5SA 3A8HB 4HR7B 1Z9QA 1Q7YC 2KQWA 4HMIA 5EPJA 1EFID 2I07B 3R6NA 4EMKC 4UY8C 4E7KA 1IRXA 5CKDA 4N4HA 2WB1B 1UFFA 5FRMA 3M58A 4I7ZC 5C3XA 3UE0A 3LWHA 2Q8TA 4E7ZA 3L2QA 1RI9A 1ICWA 2EJ9A 1U0LA 2OCEA 1SLJA 4HJ7A 1VQ8T 4P2CB 3J7A5 3C46A 1ONLA 2CWAA 4UPAA 2PVOB 1XNQQ 2JA6H 4J1MA 2NUPB 4HVUA 1F77A 4XU2A 4DK0A 2RHZA 2ZTDA 4ZKCB 5DM73 1G3WA 4MDXA 3LH0A 4M75F 1IHZA 1QVGS 4J5YA 3OBWA 1SR3A 4M7DG 3HEJA 3F2BA 2K57A 1SNCA 3GTLH 2FMCA 1VQPA 3OSOA 1PH2A 5LL6S 1NJIC 2K5IA 2Z6BA 5KYLA 2OEOA 4BBSB 4NMZA 4QVDA 5ELBA 1WHJA 4XQNA 3O8VA 5T1GA 3N6RA 4A3FG 4JI0L 1HNZL 3I4MH 3EGXA 3G1JA 4M78A 1YJ9Q 2AWOA 2DJFC 1KRSA 4FF4A 4HIOA 2CHBD 1EEFD 1I6HH 2EW3A 4MIUA 3SXHA 2HKNA 2YV5A 4FT2A 2RMOA 3QSUA 4LDVA 3L3OC 5ELCA 2LT1A 3WOFA 4MTKA 5KIXA 2QA4Q 1HZ9A 2Y0SE 5J3BA 1PH7A 1OYXA 1JOOA 2R93H 1IGUA 2BE7D 1EY6A 2C9OA 3AYHB 1J8IA 3INZA 1M90U 4AFSC 2LSSA 1OPLA 3S3OA 3OWEB 2VQFQ 1CQVA 1QVFA 4DV6L 3GLXA 5EBCA 3PE0A 4P74A 2IWHA 4LFBQ 3H9NA 5IXFA 2AUKA 3RZOB 1VQJA 3T1YQ 1PTOF 3P7JA 4XK8E 1M90R 2X3WD 3PGZA 4LFCQ 4KGZB 1VIFA 3DWAA 1YIJA 1SSHA 5FW9A 4KUDK 2DGYA 1JWMD 3TS0A 4NOYA 2X35A 3ULJA 2BA0A 1SEMA 2E6ZA 1ABOA 1Q1EA 2J05A 1KLUD 1PRTC 3S1QB 1WHMA 1Y07A 1TY0A 3CMET 1X2KA 5IOCA 2RQWA 5KNDA 5IYCH 2KXCA 4AFZC 4J6YA 5LHY1 4PJOA 1UEBA 2YUOA 3ASKA 5GAHC 2ZJQA 1DM0B 2FPFA 3JCMP 1GHJA 3P20A 3WVDB 2PVDB 2E8GA 1YITQ 2J6FA 1VQ7A 3CD6Q 1SNOA 1TWHH 1WCMG 4JJCA 4PJOG 3A0JA 4HA8A 2DMOA 2F2XA 1D09B 2XKOC 1JJ2A 1NPRA 1ENFA 1Y8PB 2F0IA 4R1JA 4TKOB 4QVZA 2CP5A 2CH4A 4QKUA 2Z0WA 2YXYA 1YHQQ 1QG7A 4DN4M 2WB1G 2K79A 4CJ1B 1AW7A 1D6EC 3CHBD 1KD1R 4Q5VA 1BI0A 5GADC 2Z4IA 2XRQD 1DXMA 4JRIA 4X3SA 4KT0E 4DR1Q 3GTMB 4BXXH 4A3DH 1OX8A 1I6VC 2F3IA 1G51A 4EDUA 2VB6A 1QP2A 4JLIA 1TWGB 3L2WA 4K8IA 5DNFA 3I4LA 2NUPA 3HG9A 2YLBA 2LMJA 5CCAA 5GANj 2K52A 4FCYA 4LDXA 2F5TX 3M55A 3CCST 1O7LA 4DR4Q 3A8KE 3DM1A 2YRVA 2A28A 3LWEA 1WHGA 4M77C 1F2ZA 5DEHA 4IKFA 2B86A 3SFMA 1TU2B 5CAIA 5DM7R 1TS2A 4FIBA 4RTWA 1HTPA 1VQOA 1X3GA 4DV0Q 4IUUA 3X26B 1QWEA 4ZUIA 4JI3Q 1X75C 4OVAA 3RERA 2L89A 1P16A 3CC2Q 2CQOA 1RCVD 4JBMA 3CC7Q 2PZUA 1XTDA 2MWOA 2K1BA 2K75A 4JVZA 1OXXK 4FXDA 3BJUA 1VYVA 1EY5A 4ZRZA 2AHJB 3Q1JA 3ITPA 3I4NG 2I5MX 2LS01 2B63B 2BTTA 2QGQA 2GNCA 3EHRA 2JA9A 5E7NA 4EVOA 4QW2A 4MZPA 3CCQA 2K5HA 4YIJA 1WXUA 1GUNA 4A3MG 4NPSA 2DJZA 1D5MC 4YCVA 4F87A 2EJFC 4LK1C 2DJQA 1PKTA 4NXNL 5M9OA 1FXXA 3HKSA 2YLCA 2K5QA 2ROTA 2XI9A 2EQSA 1AE3A 2L9HA 4RA8A 4ESRA 3I7FA 2VUMH 3DWPA 4GOPC 3G71A 4GY5A 2SRCA 2M1HA 2EY6A 3QZ5B 4X62Q 2NVYB 5M5WB 4NB3A 1KIXA 4L5SA 5IYBG 1M1FA 1E7ZA 3EGUA 4RUGA 1T0HA 3KXTA 3GV6A 4MZTA 1AVZC 1SRLA 1YWPA 2X4JA 3RKXA 1WD1A 1WA7A 1OU9A 4XU1A 2JE6I 1BKBA 1NM7A 4J7IA 4O6JA 3OS0A 1U9RA 2BE5D 3KF6B 1P92A 4M75D 2E5LL 1N33L 5C4JB 1W2BP 4IUVA 4UP8A 1QVGA 3ZJYC 4ZKBB 1FNUA 4AYBE 4M7AG 1CHPD 2IY5B 1R0BG 1QJOA 5D7UA 4DUYQ 4M75B 1EY0A 5GAN5 3PO3H 2CW0C 1K28A 2L0CA 4F7XA 4X65L 4JRPA 2Z4HA 1RAFB 2DRKA 3T1YL 1PH6A 3J80E 2PNIA 1K8MA 2X69A 5JOBA 5GMKj 1EUJA 2VY3A 2QI2A 4DV2L 1YNJC 1S72Q 3PMFA 2QCPX 1X27A 2XN9C 3E9HA 1EOVA 1A2UA 2HIXA 4HCKA 3N5BB 5IODA 2WKCA 5LJ5h 2QQ9A 3EFSA 3OTOL 5KYIA 2Z9HA 2IPOB 3KFVA 1IL8A 1I3QB 5E4XA 4BY1H 3PIOA 2R92B 2RHUA 2YYZA 1HYOA 2K5FA 2K2MA 1B7YB 3SE0A 1CI3M 1AFPA 2X4YA 1ZHIA 2QEXQ 4N8X1 5I4DA 1UECA 5LJ3g 4JI6L 1X43A 4OGCA 4YTLA 3CCJQ 1TWCB 3TSWA 4BDYA 1Z6HA 1NMFA 1PTOD 3OOCA 2DL7A 4HT9A 4RCNA 2HCIA 3UDXA 1IB8A 2P0QA 2QQRA 2HDLA 3LW5E 3QOLA 3J81L 4KHZA 5C4XG 1VQ9Q 3VS7A 3CRKC 2CSIA 5CYUA 4C1NK 1KHIA 3QOJA 4C8QD 4F7UE 2HCKA 1YVCA 1ASYA 1M27C 2NWMA 2E3HA 2RI5A 2OJ2A 2EYPA 2L3QA 5DLQE 1F2MA 1PTOB 3QIIA 2XMFA 3D4DA 3MWYW 3NBIA 4RKBA 5EAYA 2Y90A 4A4EA 5HURA 3Q23A 5CR3A 1QKWA 4DR5Q 2ID0A 1I4XA 2OTJA 3CCUA 1U4RA 1X65A 4LDWA 4TQUS 4YY3Q 3M4OH 1JJCB 3P8BB 1W4SA 4C8QB 1YJWT 4QF4A 2JA8G 1LTLA 1DYQA 2R7DA 1SYFA 4R8NA 1VF5C 4HAEA 3MKDA 1EFWA 4LF6L 2VZAA 1NUCA 3HFOA 1YJNT 4KV6A 2UUAL 1N34Q 1XQHA 5FWBA 3A8JE 1MNDA 3GBQA 3TSZA 2ZPFB 4RAUC 3NHNA 5FU7C 2KJXA 2RF0A 1T0JA 2DLPA 1GUSA 2J06A 5C3WA 4J9GA 3TP8A 5EKLA 1NSNS 5J26A 2YHTA 4WORA 2CUBA 3H91A 3D7SB 1S3OA 3KF6A 4JI1L 4DK3C 2C5CA 3GTOB 1D8LA 3F8TA 2ICIA 1IBLL 1STAA 3H3VC 3PMIA 2A6ED 1PWTA 4A3MB 2HD0A 2COWA 3SDZA 3X25B 5KYWB 2EYFA 2HL3A 3QUIA 4M75A 2LX7A 1B1ZA 1GKHA 2MO1A 3A8MB 3STBC 1XPOA 4DV7Q 1G3SA 1K83H 3G48A 3I73A 1C7YA 3NQIA 3FMCA 4UC4A 1R9TB 3QWNA 2D9TA 3M4PA 3M9QA 2FHDA 4HSVA 4LUVA 5D6YA 4ZTFA 4JBWA 2HQLA 3S1RH 1RI0A 1K0RA 4N9PA 2K9GA 4PJNA 4X66Q 1BNZA 1SYGA 2HHHL 2EXDA 1SN8A 4JUVA 4HSPA 4AQYQ 3HOUH 3I91A 4P71A 4PMWA 4M77E 4J9BA 2ICEC 3A54A 4C3JG 3S1MB 4JPBW 3QJ6A 2KK4A 1K73U 3ULRB 1FR3A 1EY8A 3CC4T 5AFWA 5IT9c 2B2WC 5GAMh 1WVLA 2EWNA 2JZ2A 2R92G 2DZCA 3MO8A 1U1TA 4RGMA 3FRPB 5FWCA 3JCMQ 1IXRA 1VQ8Q 2SNMA 1K73R 4KKSA 3I56T 5CKBA 1HNXQ 4RCBA 1PNJA 1L0XB 2PW7A 1K1ZA 2ZPGB 1KQSP 2ZTEA 4DPGA 1WQWA 4JI4Q 2FO0A 4B9WA 2KVQG 4QCLA 1YHAA 2HL5C 1JJGA 3RNUA 3E9GA 3OYEA 3PTAA 4DAYA 1WTPA 2ZJRA 4E7HA 4ZN1A 1S5DD 2VGNA 2X4XA 2F4VQ 4BD3A 3CCRA 4LFBL 5JJKA 2HKQB 4J9IA 4C8QA 5JVH3 2EPDA 3REAB 1KQSS 4M7DC 3HRUA 4IO9A 2VC8A 3PUXA 4C8QG 2P0PA 1AE2A 3LX0A 1EQQA 4X1VA 2HUGA 4LNQA 1X01A 2HZYA 2J7ZA 1OZ3A 2QEJC 3RMQA 3OMGA 5I2MA 2OF1A 1KC8U 2L3PA 3I5SA 2F0GA 3PO2G 2RD1A 3QWYA 1HQMC 2FRYA 4BE0A 3VS4A 4RTYA 2A19A 2KVMA 3H0GH 4KN7C 4N9TA 4OIKA 2BA1A 2B3GA 1RJTA 2QW7A 4PMCA 1PYBA 3S14B 3X24B 2D2CC 1N32Q 3KLSA 5HGQA 4E7IA 2E41A 3GIBA 1VCIA 3CBPA 2O31A 1KSWA 3E5SA 1CT1D 1KC8R 1W6KA 3KOJA 4J6XA 4M78C 4DBFA 3EIVA 1N27A 3JB9F 1WTXA 3HKZE 4FW1A 5LJ3d 4JJDA 1J3TA 1G6PA 1ESRA 3H0IA 1UB4A 4FYYB 2KT1A 1EYCA 1JO8A 1TT2A 2NVTB 4XTXA 3L2UA 1NYGA 2JMAA 5L8RE 1XTCD 3I55A 5GAN3 1QB5D 1IGQA 1E2WA 2KUMA 2PMZE 4LW1A 5FLXL 4B3ML 5KYWA 2GVAA 3C2PA 2MHVA 3UDCA 2WKDA 5EKIA 4HJ9A 1H8KA 4JRQA 3K57A 3IL8A 2ZJPA 1X6OA 5CVIA 4DOWA 4IN3A 3M9BA 2QKIC 2N8NA 2RM4A 2G5DA 1MMNA 5IP7G 3CMEQ 2RA2A 2EVRA 5FU6C 5I2YA 2M0OA 4GZYC 4N0AC 3OSSC 5GANg 4DR6Q 1HNWQ 4DR4L 3D6CA 3PSIA 2J6OA 3L2RA 4KY5A 1TWHB 1VQPT 5COYA 3S1QH 2ZPIB 4OELB 4J9DA 1BO0A 5CV9A 2VGMA 4N4GA 4RG1A 4A4KA 1EYDA 4DV0L 3MZ5A 2PZWA 3A1PA 1EU3A 1TWFH 4JI3L 5I2XA 2M2LA 2WV6D 4DAVA 4X6AH 3I8ZA 4JYAQ 4K0KQ 1A0IA 4DBRA 4PJOC 2DJGC 4DR7Q 3QZ9B 2E2HB 2GQVA 2R3ZA 2DIGA 1T5EA 2O5IC 2NVQB 4GLMA 1UHCA 4B9XA 4K0KL 3C12A 2V8KA 8ATCB 4E7LA 3RMHA 1WXTA 2DD4A 1ENCA 1EQRA 1Y1VB 3IQLA 2WINB 2RHIA 2DTIA 5GAN6 3GTMH 1U1SA 2UUCL 3BZDB 3JRZA 3CCSQ 1ZUKA 3GPLA 4LF9Q 2DZ9A 1TWGH 2FFKB 3CXCS 1Q46A 4XU0A 2CH4W 3JCMg 4QIWE 3GTJH 4LF7Q 3EG1A 1B53A 1QVPA 2MO0A 2HQEA 1FJGQ 1RACB 3J7AF 4RH6A 1BCOA 1VIEA 2LP5A 1KABA 1KNAA 3K7AB 3S15B 4ATOA 4L5TA 1I94Q 1K9MC 3OYCA 1UWVA 1VA7A 1XXGA 2ATWA 1L1OB 1JT8A 1YIJT 1QQJA 3CQTA 5LJ3f 1WTWA 2NN6H 1PSEA 3I4MG 2DL8A 4BY6B 1GUGA 3P8HA 4MN3A 1PVOA 4A3EB 4A93B 4IJHA 3G6EA 3S6WA 1SYEA 1MNEA 2AT1B 2F52A 2DVEA 4UDUC 2EYLA 1V43A 5EPLA 2DPPB 5HGTA 3ZFJA 4RMOA 2F0PA 1DZ1A 4LE9A 3DM3A 1I8FA 2KR3A 3M4GA 4GBQA 1VQ7T 2L15A 4H7BA 4UP7A 1NEBA 2KHSA 3SK6A 2B63H 4B3TQ 2R93G 2KHIA 1H9SB 4BE2A 3K59A 5C0MA 4C2MB 3S3MA 3E19A 4BDZA 3EA6A 3VR3A 1GFCA 1K8AC 2EGCA 3IRBA 3JAMc 4C3IB 3L2ZA 1UGVA 5IT9E 4IQZA 5CV4A 2NLUA 4B3RQ 1C1AA 1PHTA 4DBQA 2X3XD 1QW1A 1Z7TA 4DK1A 1VQLA 1ARKA 1KAWA 2QF7A 4S3SA 2HBPA 2N88A 4CJ0B 3J7ZC 3F2DA 1MIUA 4FVMA 2NVYH 1STNA 2F2VA 1N36L 1FMKA 1JOKA 1SNQA 1IBMQ 1II3A 3SGIA 2O5JC 2GA4B 1OXVA 4YWMA 4A3LG 1Z9ZA 1YCSB 4WF2A 3TVTA 1L2FA 5EPKA 3B6YA 3CAMA 5CGKA 2MIOA 1EZ6A 3D8GA 2MWPA 4R9WA 3M0SA 4YWLA 4HIMA 4LJZC 1HR0W 2B2VA 3DHQA 4ME7A 5C6SA 2RCFA 1VQOT 4DEXA 5ELDA 1IZ6A 4HKEA 1MHWC 2KCCA 2KBTA 1HCZA 1BB9A 3MJXA 3OB9A 2RDGA 5I22A 4HJ8A 3U58A 1LTID 4JOIA 3GF5A 2ZXRA 1YI2A 5M3MH 2HQXA 4X64Q 1QVFP 3TP7A 1YEZA 3VUBA 1ZX6A 2ZPHB 2M9UA 2A74C 3WVEB 2JMCA 3HHTB 4BXXG 3CCQT 1N9SA 3E6ZX 5C0XH 4A3DG 4YY3L 1LABA 4EX5A 4AFUC 4A3BB 4DNIA 5GANh 5M5YH 4CDCC 3VS3A 3PF4A 3JB9D 3BDUA 1L0YB 2NTSA 1RUWA 1ZXTA 3URGA 2JQOA 1MD2D 4M7DE 4MTNA 2PUKB 2QASA 3LYIA 3EH1A 1I3QH 2R92H 3G71T 2DXUA 2K28A 2PI2A 4PLIA 4TSSA 4JW0A 4FF1A 4HJ5A 2VKNA 1R8OB 3PNWC 3BFMA 2C0IA 3V8KA 5GANd 1JJ2P 1TWCH 1JE5A 2J4XA 2C06A 4C5GA 3OWFA 2E74C 2FJ2A 2E76C 4V0BA 4IUQA 4OWXB 5BN4A 1PYSB 4RTUA 5FK9C 2VL6A 2KE9A 3PUYA 5LJ5e 2VS1A 4Q0FA 1AWWA 4Y28E 4A3EG 2E2JH 3KDFB 1A2TA 1WZOA 1D1AA 4RGTA 1MBYA 1I4PA 1YJWQ 4MHEA 2QDLA 1PTOH 1I07A 3V8JA 4BUGA 1B44D 1PRLC 1ZUYA 4JRKA 1VQ5A 1H9SA 1UE5A 2CKZB 2K5WA 3AQQA 3E0EA 4C56C 1JJ2S 3M0RA 2OQKA 3M59A 1DOLA 1UUPA 4WJ4A 3CP0A 2RK1A 1YJNQ 4DXFA 3DWQA 2BIVA 4OONA 1RTOA 2L3SA 1IKMA 2DL4A 5KNBA 3IAYA 4C3IG 1G2BA 2GGRA 3M56A 2AQ1B 1ZQ1A 1STHA 1NJIU 1PC0A 3RZDB 4GLAC 1WNLA 4AQYL 2N55A 2EIFA 1XJVA 2UUAQ 3GNGA 1Y0MA 4LD9K 3HRSA 5EC7A 2F0WA 4CC2A 1VQEA 1WJJA 2L3RA 5BN3A 3T1HQ 1S5ED 2YUPA 3NUCA 2MPXC 3AFQA 3H3VI 1SE4A 2A08A 4DV1Q 5I6YA 4FU6A 2CZ7B 2VXFA 4P73A 3CXCA 2A68C 3BG3A 1BI1A 1UGQB 2QXFA 1LLRD 3GTOH 3KFUA 3M0QA 1KJWA 5ISRA 4FF3A 2LCLA 4JJBA 4RTVA 1M1KR 3CRLC 4BA2I 2FPEA 2B8FA 2BH8A 4NL3A 1C48A 1AZGB 3PT9A 4JS4A 4A3MH 4B3SL 3FJPA 4GLKA 1EWHA 5GMKh 1DJ7B 4P75A 3PF5A 2WB1E 1T3SA 1MSGA 1VQ6A 4EQ5A 1RABB 4ME3A 2A1AA 4O5VA 2KA7A 3H94A 1H95A 1IREB 2M0YA 1JR0D 1SMXA 2BE5C 3P1HA 3R93A 1R9TH 3HOUB 1N5ZA 2F4IA 1OXUA 3FPPA 1M5Q1 2OTJT 2F4VL 1ILPA 3LGLA 2F0JA 3S3NA 3C0CA 5IYDG 1PH8A 3CMAA 2I5LX 2COYA 2F1MA 2EFIA 5GANf 3LNNA 3CC4Q 5NUCA 3R2TA 1HTLD 4F14A 4BY1G 5D14A 4KUIA 2A37A 5CQXA 3H6MA 1LV9A 5DM63 3S1MH 1E3PA 1WJRA 2Q8IB 1G8ZD 1RAAB 1W6JA 3I56Q 2ASBA 4KTAA 2HDMA 1QVGP 2QGGA 3HOXB 1Z47A 2CVRA 5CV7A 3A55A 4JBKA 3M7NA 2E4HA 5GJWB 3JAME 1N32L 3JB9G 1IBKQ 1FX7A 1D1IA 3Q24A 4CDFC 1PH1A 3OIQA 3X3MA 1VMPA 1PKSA 3J80L 3PIP3 3EVQA 2LY7A 3Q6SA 4APVA 5IHIA 2L11A 4QY7A 3KDFA 5LMNL 2X6GA 4PNYA 4LAAA 2EYXA 3E2UA 4QQDA 4AH6A 3Q22A 1ENAA 4J9CA 1FGUA 2XRSD 5GAMe 1WX6A 1B3AA 3TREA 3T9NA 2PPBC 2DEUA 1JU5C 3JCMf 5KYYB 4R4IA 4A3GH 2FZCB 3HRTA 2CP3A 3LWUA 2H8HA 2RK2A 1G3YA 3E9IA 1NEGA 5AYFA 4GLVB 2UXBL 5GAOr 5CBAE 5M5XB 4A3KB 2B2TC 4HCZA 3H0GB 1CKOA 2EYZA 2OX7A 3VA5A 1FYNA 2HEQA 3SWNB 3FP9A 4RTTA 4C8QC 3UDFA 2JTMA 2B2UA 1V1PB 1RAEB 5G3LD 2E5QA 3WXMB 1NE3A 4M78G 3RZOH 1FWZA 2EYQA 5IE8A 3M3YH 5GQOA 2NVXH 3S14H 5IGBA 1W1FA 2DF6A 2K6DA 4PK4A 2LJ3A 3K0XA 2LVMA 4B08A 2VW9A 2K4KA 3RKYA 1YNNC 4GN5A 1SNDA 4H02A 2K3BA 1TR5A 3HOVB 1VMCA 5AJ3L 4EQOA 4M7AE 3OS5A 2E2IB 1HJDA 4C92D 2NVTH 1LT4D 1ZYRD 2EVBA 4R55A 1OU8A 3VS0A 4IZ8A 3FKIB 3EJIA 5EGTA 3X3NA 4J6HA 2K32A 2MGSA 4LFAQ 1X3EA 4C92B 4DAPA 1H9MA 3HZXA 1Q8KA 4LF9L 4QQGA 2ED0A 1OTCA 2KI7A 2ZM6Q 4LF7L 2DEQA 1WHHA 2QDYB 4A3LH 3CCRT 4GNXB 1OV3A 3HOUG 1B34A 2IL8A 1TWFB 2BH2A 3BDLA 4FW2A 3CQZH 2L8DA 1EY7A 1TU0B 1I94L 2RSOA 4Z9CB 1CZGA 3OMCA 1CSKA 4JI8L 2KMTA 2XICA 2D8JA 3S16B 5CR2A 3NTKA 3UDIA 1SRMA 5C5LA 3CCVA 1TWAH 1QNUA 2Y0SB 4A53A 4GN4B 1QNKA 3SVMA 2GFUA 3C3LA 1B9MA 3KK7A 3UA7A 4M1UB 4ZLTF 2E12A 1BXTA 2NVQH 1GCQC 3U9OA 3HOXG 3ZYYX 1OEBA 1KL9A 1AZQA 2RJFA 1N9WA 2MFIA 3K7UC 2Q2UA 3PUWA 1Y1VH 1NAPA 2FRWA 4E7SA 3GTJB 2NVXB 4ELZC 3MA2B 1GVPA 1O7IA 4F7UF 1JRIA 3M4YA 3W1GA 2AKKA 3I55T 2AQ2B 2F3WA 2JEBI 1I5FA 3BVMA 3NE5B 5KYYA 2VUBA 3QDFA 4NS5A 2DXBA 1YIJQ 1AEXA 2DX1A 3FHWA 4IPHA 1YNZA 4DR3Q 4KD3A 3K7AH 3S15H 5C5MA 3A8OB 2ALYB 2JA7B 2K05A 2OWOA 4KHPQ 3SWNA 4BBSG 3D31A 2QYZA 4L6V5 3MXNA 2IIMA 1FD7D 1V1PA 3H0GG 4A3KG 3TBIB 2SEMA 2ECZA 4QQ6A 2ZZDA 3SD4A 4BI4A 1VQ7Q 2BUDA 2LKVA 1PRTF 1G3TA 3WOEA 4A3EH 3QBYA 1IW7D 1XMOQ 4A93H 2EGEA 2A36A 1H9RA 4KGXB 3JB9J 2R7ZB 1EYAA 3NELA 4OX9Q 2F5KA 3A8LB 1K8GA 2ZAEA 1ICFB 3RNJA 1A0NB 1M8AA 2K7VA 2K3YA 2VYTA 2OXPA 4IIMA 1D2BA 1OPKA 2A69C 4C2MH 5JJIA 2ROLA 1YFNA 3VYUA 4C3IH 1C4QA 1VQHA 4DV4Q 5EG2A 1GL5A 1TSFA 2DRMA 2DD5A 1LPLA 1K4US 2CS7A 3TP5A 1M90C 4G7OC 1LCKA 2CUDA 3L42A 3FKIG 2ENMA 4C92A 5C4JH 1K76A 1EZZB 5ECAA 2D1XA 1SSOA 1R0CB 4OXPA 3H41A 4C92G 1IKLA 2KXDA 3MEVA 1SKUB 4GNXA 1QVCA 3A8IE 4RGOS 4IUTA 5FROA 1J9OA 1VQOQ 2XIWA 3OYJA 1S5BD 1TTHB 4KI0A 4QQBX 4RMFA 3OQ5A 3C95A 4OB0B 1ET9A 1I81A 2ATCB 3A74A 1M3CA 2DNCA 4M77F 5M3MB 2W0ZA 2YU9H 3UATA 5KEEA 3QO2A 2LQWA 3GNFB 2JP1A 4IPGA 5EJWA 1QLYA 3GTKB 3QB3A 2UXCQ 3D6WA 2B2VC 3G6ET 1BU1A 5HKCA 3CCQQ 2F0DA 1JB3A 2Z0SA 1LO5D 1B50A 1HUNA 4NXML 5M5YB 1KD1C 3T13A 1BOSA 2F0TA 1Y1WB 4JOIC 3GP7A 4ZYSA 2R5MA 2UXDQ 2DK3A 4HVWA 5IYDH 5IGFA 2HMAA 4ULLA 5D3DA 3NENA 2DN8A 3BYYB 4A3BH 1PD1A 2CT3A 3G71Q 2XVSA 4HXJA 2PZTA 4K5VA 2D62A 1I4HA 3OYGA 2AWNA 4KULA 2K5DA 1HR0Q 4PJLA 4D8DA 1RD9D 2AZSA 4C8QE 1VQLT 5CO7A 2HDAA 3BDOA 3HOYB 2NN6G 3JB9H 4C3HB 3GQBA 4A3IH 1BIBA 3BW1A 4QJFA 3TQYA 3S1NH 2DL5A 4LDUA 1AEYA 2CGHA 5GAN8 1JWUD 4Y52H 2JA7G 2E2JB 2MF2A 1FYCA 1EL0A 2PVGB 1WLPB 1YHBA 2SOBA 1L1OC 4JBJA 2KOLA 3I2ZA 1EY9A 2IX3A 1MMDA 4PL6A 1LM0A 3QIAA 5K36H 2BKDN 4BY6C 1WJQA 4R56A 1FL0A 4VUBA 1Y14B 4TVRA 1PXUA 2B63G 2JVVA 1S5CD 3I4OA 2GTOA 3VKIA 4OMLA 2R7ZG 3JCMb 2D5DA 4OMPA 1CM9A 1NYFA 1YI2T 1JQYD 1FMWA 1ZLMA 4NW2A 2XSCA 1XPUA 1SHFA 2RI3A 3PVQA 1BCMA 3SR1A 3VYGA 4KGVB 1S4ZA 3SEBA 3HRZC 2GCXA 1U4PA 2AKWB 2JEAI 2B29A 2V1QA 4CJ2C 1KDAA 2LNVA 2JOYA 4P72A 1GCPA 2A6HC 1PHJA 1DD2A 4BE1A 4BY7H 3RZDH 2KT8A 1G5VA 1YCYA 2A0FB 4Z88A 3S9WA 4HIDA 4G4KA 2COZA 2LXKA 1AD5A 2K50A 5A2QE 4FYVB 1HRJA 2EQUA 3MP8A 4I65A 4LF5Q 4FYXB 4OB1B 5IP9H 2X9HA 3VA7A 3REBB 1U4MA 4MMLA 5IWAQ 5LMUQ 3J81i 3VYHB 5HK3A 5L23A 1ZA2B 2JW4A 2LRQA 4F04B 2GVBA 3OHXC 2QK0A 3ER0A 3OW2S 1F1BB 2QQBA 4PLLA 2WFWA 4F8MA 4OHJA 2XD0A 1IBKL 4DV5Q 1MHNA 1MI2A 3KF8A 1FVIA 3CBMA 5M3MG 1XNQL 3M3YB 1D0XA 1B8AA 3T51B 5ELFA 4M75G 1N8RU 1EFNA 1JEGA 3SHWA 5IT9L 4KY7A 3PQIA 1SSFA 4FL6A 2OTJQ 3KBGA 4PJJA 1TS3A 2VASA 5GAOl 2EQKA 3H0HA 3DLMA 1AZEA 5C4ZA 5C0XG 1BI2A 1VQ5T 2RVLA 3EFRA 1N8RR 5FRNA 1EZ8A 5J39A 1YBYA 4XTUA 2UU9Q 2CYZB 4K6LA 3HPWA 4L5QA 4IOCA 2XDDA 3TQ7P 2D6FA 1H3ZA 3VS1A 1A3UA 5GAEC 1KNEA 4EPCA 1W70A 1JMCA 3WDNA 1Y8OB 3UF4A 1BIAA 4O2DA 3R8BA 1SAPA 1TUDA 1VQFA 2B39A 1TIID 2HNIA 1VQNA 2XDBA 5GAGC 3HOXH 4EMKA 2Y4XA 1B4OA 1QKXA 3I5RA 1SRUA 3EBEA 4C5HA 4U673 4GKKQ 5CV5A 3ERQA 5T1IA 1SROA 2EQJA 2CREA 1XNRQ 3ND9A 1PZJD 1I4QA 1BBXC 2QGFB 2KEEA 5HY6A 2VQFL 1VQKA 3GDEA 3VR2A 4A3GB 3MFGA 4OMOA 4C5EA 2TMPA 1LTAD 3Q8DA 1NLOC 4BS9A 1CUKA 1SE2A 1HFGA 2M16A 1NTGA 1KQ1A 3BY7A 4QVCA 1VQ4A 1JCKB 4M77D 2PU9B 1VQMA
chains in the Genus database with same CATH topology
3A5ZB 3R6OA 3CCMA 4LFCL 2MAMA 4GLXA 5LJ3h 1UE7A 1YNXA 1VQ6T 2DO3A 3VUZA 2ZM6L 4L5RC 2JK8A 3F70A 4M77B 3TCJA 4A3KH 4R4TA 3RLFA 3FLGA 3JCMX 3L7ZC 3CMAT 1VQDA 3E9FA 1VQGA 5KE2A 3D0FA 4ZN3A 2EJGA 4O0AA 3PUZA 1A8VA 4DR2Q 3META 2Q2IA 2R57A 1IL2A 2RJCA 3MEWA 3HOVH 1HK9A 1QP3A 1Q82U 2E2IH 1HNXQ 2FVUA 2ATWA 1LOJA 4A3MG 3NBHB 4DR1L 2RHXA 3CCLA 5FJ8H 1ASZA 3FKIH 4KBMB 2Q2HA 3OYFA 5GROA 3PCOB 2LT4A 4EMHA 1JBMA 1A62A 1MKHA 4DR3L 3M54A 3NTIA 3OS2A 4XTVA 1VQCA 4XU3A 4M7DF 1XPRA 3MEAA 4TVAB 4C0DB 2K3XA 1DGSA 3RLNA 4JI0Q 2OTLA 3S16H 1K73C 3OBYA 5I2SA 3PUVA 2V8IA 4OX9L 2ES2A 5A0DA 2E6NA 2HAXA 3CPWS 2PUOB 1BBUA 2A3LA 4E7JA 4IFDJ 4A3GG 4L59A 5A0LA 2KENA 5C0XJ 2K4YA 2YTVA 1EIFA 4X62L 4DV4L 4JC0A 4A4GA 3C94A 3OW2A 5KH6A 2R6GA 3QYHB 5DLOA 3M4QA 3C4SA 4M77A 4RG2A 2JA7H 4POGA 1KQ2A 3ICEA 5LJ5j 3HL8A 4NL2A 1WFQA 4L5GA 3QYGB 3SWNC 5KCHA 2WSFE 1KC8C 5M3FG 3NTHA 1PH9A 4DUYL 2R7ZH 3OYKA 4Z02A 3ZEHA 4GS3A 3P8DA 3CCVT 4OWTB 2VNUD 1OXSC 1U8RA 1CKNB 4J83A 4MMKA 1O75A 2EAYA 4WJ3M 4PJOF 1PSFA 2EJFA 3G4SA 2UXDL 3U50C 3F1ZA 4DAMA 2JUFA 1Q86C 3DLLA 3QDRB 2KCTA 4HIKA 4C92C 3F2CA 1PFSA 2F69A 2B8AA 4A4FA 3K80C 2DUDA 2MQHA 4GNXC 3ULLA 4A54A 1TXYA 2KDSA 3OS1A 2XIDA 3GTKH 1NBWA 1Q1BA 4DR5L 2LX9A 3HFNA 3PIPA 2K14A 1Y1VG 1Y1WH 2DIQA 4OF1A 5I21A 2RHQB 4NXNQ 4UP9A 1KXLA 2RHSB 3LGJA 5GAOn 1N34L 4C5IA 2KCMA 3RUXA 4XTCS 2OQ0A 3GP8A 4OB3B 2RB6A 4DOVA 1Q7YU 1BBWA 4DV3Q 2K5VA 3HOYH 2O4XA 4C3HH 4M78E 3CCEA 2ZTCA 3RN5A 1PA6A 2P4TA 5IWAL 4A93G 5LMUL 4IPCA 2DTOA 2WP8J 4C0FA 4C0GA 3JCMh 5GAMj 2A8VA 4JI5Q 2RI2A 4R4OA 4DV5L 4DV7L 2Z6KA 4M7DD 2V1CC 1HZCA 1PH5A 1CKNA 4M7AF 3UDGA 4DUZQ 4X65Q 1Q12A 2ZCFB 2VXEA 2H3JA 4X66L 2MNAA 4M7DB 5CKHA 2IHFA 3JCMd 1LNXA 5BR8Q 3CPWA 3OTOQ 1AH9A 5KE3A 4PKCC 4ZGJB 2RCNA 4Y91A 4PJOE 4R4QA 4LUOA 3VV0A 2N49A 5CIUA 3W5OA 4JI4L 3L0OA 2D0QB 1UE1A 1OI1A 1V29B 3DKMA 1PH4A 2PNHA 2CCZA 3V7CA 4M75C 1E24A 4IURA 1H641 5GAN7 3CCUT 4GKJQ 3PFSA 3HFZB 4DV2Q 4JCVE 2EKOA 2XK0A 4DQ2A 1B34B 2LQ8A 2K5NA 4A3BG 2RF4A 1HXDA 2LDMA 4XTWA 2KHJA 3UE1A 3JB9I 3MP6A 4OP0A 2IG0A 4A3IG 1YJ9A 3K8AA 2O01E 4JI2Q 2K5LA 2OAUA 3OYAA 5K36G 4JI1Q 2QA4A 1GXIE 1YZ6A 4BI8B 1M1GA 1IBLQ 1HNXL 4IOAA 2XTIA 5C44G 4AIMA 1JB0E 1KRTA 3HP9A 1B70B 4ZGEB 3MXNB 4DR6L 1HNWL 4M7DA 2I5HA 1O9SA 4BY7G 2LXJA 3L2PA 2X4WA 3MEFA 5LMNW 4C92E 2R5AA 2HHHQ 3L2VA 2JA5G 1KG1A 5M3FH 3K81C 1I50H 1W3SA 1WI5A 4HCCA 3J80c 4GN3B 5IP9G 4JYAL 4K0KL 1BI3A 1CSQA 3GTPH 4DR7L 5GMKi 4JS5A 1J5EQ 1YITA 3H6ZA 5LJ3e 3CD6A 3J80i 3QKJA 1VQNT 4JG2A 1M1KC 2MMPA 1YHQA 2RH2A 2H5XA 1LYLA 3TS2A 2JJQA 1D7QA 4KLKA 4XTZA 1VQKT 1Q81C 4IJLA 1UGPB 1E1TA 3QPHA 3L1AA 1FJGL 1VQ4T 1AHJB 3CPFA 4N4IA 1VQMT 2CZ0B 4OGEA 3CCMT 3DB3A 2ZGWA 4N0AA 1QUQB 3OYNA 2MI6A 5C3EG 4M7AD 3GTGH 4A75A 3AEVA 2KBNA 3T1HL 4C8QF 3E1SA 1OXTA 3S2DH 3CC2A 5LJ5g 3CC7A 4M7AB 4B3TL 5CK9A 1P8LA 1X9NA 1N6AA 3CW2C 1KD1U 3OYYA 2EQMA 3JSCA 4Y7NH 2D0OA 3LLRA 4OWWB 4B3RL 3CCLT 2WAQG 3V8LA 1Z9FA 4B3MQ 4LF8Q 5GMKl 2KSSA 1CKMA 4RCCA 2XHCA 2LC4A 1IBML 5IAYA 4J15A 1HJPA 3A8GB 2PQAB 3FIFA 2AHOB 1N9RA 2VQEQ 4BB7A 3S17H 1V1QA 3G7ZA 4C0ZA 3U4VA 3QG1A 2DTHA 3RIRA 4ELYC 1VS0A 2OTLT 2IHEA 4X64L 3HOVG 4LD6A 3W1BA 4A3JH 4M75E 3OA6A 5FJ8G 2I2LA 2UUBQ 2ZPBB 1X55A 1S72A 3M57A 4PZ6A 2UUCQ 1WYDA 2NZHA 2HT1A 2LTOA 3ERSX 1GM5A 1V9PA 4XAXB 1S40A 2Y4YA 1QUQA 1U5KA 4OMFB 3ZBDA 3KF8B 2QEXA 4DV3L 1G291 1HH2P 1XMQQ 3CCJA 2LCCA 2AMCB 1KHCA 1RIPA 2G3RA 2Y0SG 3H3VH 4DKAC 4M7AA 1VQ9A 4C0DC 4PG3A 1PV4A 2QTXA 4JI5L 5GAMg 3KJPA 4YHHQ 3PGGA 3M53A 2IX0A 1TH7A 2V8JA 4DUZL 2E64A 3FB9A 1NMGA 1RL2A 1UGRB 4MZMA 5GAN2 3TRZA 3LWIA 1W2BS 3G4ST 3AFPA 2NN6I 2E65A 2A7YA 3RKWA 1I4K1 2KY9A 4A3CH 3MP1A 2GFAA 4EMKB 5BR8L 3VU3C 2FYKA 4DV1L 1N36Q 3TU4K 5GANe 2PQAA 3TEEA 2XU8A 3MHXA 3QXEB 4CI0C 5IN1A 3S24A 3OYDA 3OYBA 1M8VA 5C44H 4JI7Q 4JV5Q 5LJ5d 1MJEA 3ULPA 2PQWA 4RKUE 4ZGDB 2Z6KC 2JA5H 4Q5WA 3J81c 3BU2A 3M5AA 1SE8A 5IY0A 3JCMe 2XGTA 4LF4Q 2N78A 1MJCA 4ALPA 1VUBA 4A3FH 5A0GA 4F7UB 1NZ9A 3S2HH 3RESA 3FC3A 3KLWA 3CCET 1VQ8A 2CZ6B 4JI2L 4PZ7A 4HCBA 1EWIA 4IFDI 4IFDG 4A4IA 1EIYB 2WSCE 3V7SA 5JJLA 2WACA 3H15A 5C0XI 5GAOq 4BI3A 1Y1WG 2JTFA 3H8ZA 1LJOA 2K2VA 3HOWG 2P0KA 4BBRG 4XTYA 1BYMA 2FXQA 5C3EH 4CRIA 4FDBA 4IPDA 1M4ZA 3RR5A 2FL7A 5GMKe 4GOPB 2DXCA 3QJYA 3OYIA 3GOXA 2RJEA 3HOYG 1NE8A 1BVSA 4LUZA 4OO1I 4OO1G 5LJ5f 1J6QA 3V7RA 4AYBG 1WCMH 1QZHA 2VV5A 2DAQA 1J5EL 1EYGA 1L0WA 4XIGS 4V2SA 3RMSA 2NZOA 3SB2A 4LFAL 3KJOA 2HIVA 4MZ9A 4B3SQ 4J7FA 5GAMd 3DB4A 5ELNA 1K9MU 4POFA 2I0QA 2R7FA 4D6WA 3CMEA 3MCAB 1VQAA 3RLOA 5FLMG 5GAN4 2E1HA 2L5QA 1NY4A 4F7UA 1LUZA 1W2BA 4R4CA 1YJ9T 4F7UG 3I4NH 3JC66 1K8AU 3PV0A 1QZGA 1GD7A 3AHUA 1HZBA 2QA4T 2GN5A 3FEOA 4YWKA 5D6XA 1C9OA 2RHYA 1N8RC 5LMNQ 3CCSA 2E10A 1XNIA 4LF8L 1Q86U 1T9HA 1WOCA 2RJDA 4YCWA 3HOZG 2LQKA 5IYBH 4KHPL 2E2HH 5CQYA 1Y71A 2UXBQ 4QGUA 4GOPA 1HNZQ 3EAEA 3QHSA 1XOVA 2PI2E 3BZCA 5FLXc 1XMOL 2VQEL 4A76A 2Q2TA 1E1OA 3QO3A 2IX1A 4LWCA 4JJNK 4M78F 1YITT 3CD6T 1MGQA 1XJVA 1UGSB 5GAMf 4RG8A 5GMKm 3JCMJ 1OZ2A 3J81E 5AJ3Q 4DV6Q 3J81j 2UUBL 1YHQT 3KYHC 2JA6G 3A5UA 2O4XB