1IZ6A

Crystal structure of translation initiation factor 5a from pyrococcus horikoshii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
136
structure length
136
Chain Sequence
b'GDKTKVQVSKLKPGRYIIIDDEPCRIVNITVSSPGKHGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKKTAQVIAITPDTVQIMDMETYETFEVPIDTGVADEIRDQLKEGINVEYWETLGRIKIMRIKGEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Initiation Factor 5A
publication title Crystal Structure of Hyperthermophilic Archaeal Initiation Factor 5A: A Homologue of Eukaryotic Initiation Factor 5A (eIF-5A)
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Biosynthetic protein
total genus 28
structure length 136
sequence length 136
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1iz6A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1iz6A02
3U50C 4JI1Q 4A3FH 1O7IA 2LCLA 3B6YA 2JA7G 4A3LH 4X6AH 2YV5A 3UDFA 2H5XA 4WJ3M 4K0KQ 2WAQG 1A63A 5LMUQ 2UXCL 1IBMQ 2PMZE 3TS0A 3CMAA 2I5MX 4AIMA 3KJOA 3S1MH 2A19A 1CKOA 2YTXA 3HOUH 5K36G 1LUZA 5GAGC 2E2HH 4GKKQ 2MWOA 1IBKQ 3G4ST 2IHEA 3JC66 1Y1WH 4OO1G 5C4XG 3CCUA 4GLVB 1UEBA 1VQ6A 4X66L 1E22A 3KDFA 2V1CC 4EQ5A 2ZM6Q 2WFWA 1J5EL 1Y1VG 4NXMQ 3GTOH 4LUZA 3U4VA 4HJAA 3CMET 1N32L 2N3SA 1VQ9T 4TQUS 1J6QA 1B8AA 1VQIA 2IX1A 2UU9L 1P16A 4XTCS 1PHJA 5IY0A 1PH5A 3HKZG 1P8LA 4DV2Q 4HJ8A 1L1OB 1HR0W 4BY7H 2AKWB 4QQDA 4JBJA 1EIYB 1GM5A 3CW2C 1IZ6A 4JI2L 1GO3E 1NY4A 2VQFL 3PO2H 4QQBX 5M5WH 4DR4Q 3S1RH 2VQEL 2CKKA 1HZCA 3CPWS 4C2MH 3CF5A 1YIJT 1TWGH 2JA9A 3M4PA 4JI8Q 4JCVE 4A3MG 3PF5A 1N34Q 4B3RL 2KCMA 1PVOA 4YTLA 4DV4Q 1VQPA 3I4MG 1I5FA 2ZJPA 2ZTCA 4HJ5A 5JJKA 4YWKA 1NJIU 4HJ7A 2LXJA 1W2BA 4DR1Q 4X64Q 3HKSA 4LFBQ 4IFDJ 3KDFB 4UP9A 4LFCQ 2I5HA 1JB7A 3F8TA 1I94L 4X34A 3KBGA 5C44G 2ES2A 2KHIA 3IRBA 3GDEA 1OXUA 4LUVA 3J7AF 5GROA 2EXDA 4HJ9A 3A5ZB 4A3MH 1XPOA 2Q2HA 2JA5H 1XMOL 1PFSA 3M7NA 1OXSC 2GVAA 1CKNA 1CSPA 4UP8A 2BH8A 3S16H 4DV6Q 4IFDG 5M3FG 3CCLT 2OQKA 2UUBL 2G3RA 1FJGQ 2PI2A 3GTMH 3NBHB 3PO3H 2K50A 2BH2A 3CXCA 3CCRT 2DGYA 3ERSX 4KHPQ 2JEBI 4GNXB 3M3YH 4P75A 3ICEA 4P71A 1UE1A 3FP9A 1VQAA 1YNXA 2VL6A 4CRIA 4YCWA 1C7YA 2QEXT 1IBML 2K14A 4LF5L 5M3MG 2AHOB 2UXBQ 5FLMG 1YJ9A 4A3EH 3F2CA 1M90C 4JBKA 1IBKL 3D0FA 5M3FH 3GTQH 4DV7L 3GO5A 2WB1G 3H15A 3G48A 1HJPA 1HNWQ 2HHHQ 1PH7A 5IAYA 4NXML 3CCET 3ULJA 3EBEA 4A3GH 2KVQG 3HOVG 4B3RQ 1KIXA 2Z6KA 4GN4B 5J3BA 2PNHA 2VW9A 4DV0Q 2JUFA 1E3PA 2XHCA 5GAEC 2ZJRA 1K3RA 1CKNB 1PH6A 4UY8C 2IY5B 3TRZA 3K7AH 1SN8A 3K7UC 4IJHA 1S40A 2UXCQ 1Z9FA 3DB3A 3PF4A 2N78A 4RMFA 3KJPA 4WJ4A 3DLLA 2LXKA 4L5TA 2ALYB 4GOPC 1VQ6T 1N8RC 1G51A 4A3IH 4GS3A 3PUXA 2OTJA 5DLQE 4X66Q 1N34L 1VQLA 1J5EQ 3HOVH 2NVYH 4DR3L 2R7DA 1V1QA 2RF4A 4DV4L 5IT9E 1LTLA 1U0LA 4L5SA 1BBUA 4BA1I 4X64L 3CCQT 1KC8U 1IXRA 1I3QH 1MKHA 1U5KA 3ULPA 1PH3A 1ASYA 4LNQA 1M90U 1Q81C 4OWXB 3S14H 4QIWE 4JI2Q 3RR5A 1SR3A 4DV7Q 1V9PA 4LF8L 4JI0Q 2KBNA 2NVXH 1VQPT 3VDYA 4JC0A 3DB4A 1QVCA 2OWOA 4DNIA 1HZAA 1A0IA 5IYDG 3GTKH 1Z47A 4BY1G 4BBSH 4YCVA 1K9MU 2MI6A 5GADC 1SMXA 1X65A 2WP8J 2QA4A 1M1KC 3RLNA 1N36L 4JBMA 4IFDI 1K73U 1HR0Q 3CC4A 4KHPL 3H3VI 4A3FG 1R9TH 4APVA 5IE8A 1QVGS 1E7ZA 1EOVA 2UU9Q 3TREA 4UPAA 5ELOA 3FKIH 3U58A 1UE5A 1XMOQ 4DV5Q 2D62A 1HNZL 5BR8Q 5IYDH 1WOCA 2YU9H 1KAWA 1YI2A 1XPUA 5JJIA 1YHQT 4BY1H 2R7ZG 3CPWA 3RN2A 3AEVA 1VQKA 1N33Q 1EFWA 3J7ZC 5IYCH 2JVVA 3M4OH 4QL5A 3RLFA 1VQ7T 2UUBQ 1C0AA 1T9HA 4AYBE 2F4VL 1XJVA 1Q8KA 3S24A 4DV0L 3RN5A 2I0QA 1IL2A 1OXTA 1GKHA 1VQHA 3DM3A 4O2DA 2VUMH 2Y0SE 4R1JA 3S2HH 4A3JH 3LH0A 4LF5Q 4MTNA 4QJFA 4YWMA 2L15A 5GAHC 2R7ZH 1ASZA 2MNAA 1I50H 2DO3A 4A3KH 3PO2G 5IP7H 4QGUA 4HIMA 3CP0A 4AYBG 5H1SE 1WI5A 1VQ4T 1VQOA 1DGSA 1K0RA 4J15A 1E24A 2Y0SG 4A93G 2B63H 1VQ5T 4ME3A 1KQSS 4L5QA 4C3JH 1EQQA 2NVTH 3I55A 1EUJA 1A62A 2IX0A 4PMWA 5ELNA 3HOXG 2N49A 2NZOA 2OTJT 1YJNA 5C0XI 2JNGA 1VQLT 2F52A 3ZJYC 1I6HH 2JA5G 1X3EA 1S72A 3H0GH 4C3HH 5IYBH 3JAMc 3J7A5 4DR3Q 1MJCA 4A93H 4GOPA 2E2JH 4JI4Q 3HOWG 4X65Q 2I5LX 2C35B 4JBWA 2XTIA 2Q2UA 3NENA 1KXLA 2A1AA 1HR0L 3E9IA 3PIPA 1XNIA 1KL9A 1TWAH 2RHSB 3PO3G 2LSSA 2OTLT 4R4OA 3HOXH 3J80c 2E70A 3CD6A 5JEAJ 1X9NA 1EQRA 2HIXA 2K5VA 2OCEA 2HQLA 3CCJT 2JA8G 1PYBA 4DV5L 4LF8Q 5BR8L 2VS1A 2ZTDA 5M5YH 1MJEA 1M1GA 4A3EG 3CCMA 4JV5Q 1N33L 4R4CA 2NN6G 1VQNA 1K8GA 3G6EA 1N36Q 2UXDL 1WJJA 5JEAG 1CUKA 3KYHC 3S17H 2PQAA 4YWLA 4A3GG 2ID0A 4JI6L 3A0JA 1OXXK 4AH6A 5FLXc 4TVAB 3T1YL 4GOPB 2JA8H 3OW2S 3K80C 2AWNA 3PGZA 3KF6A 3UE1A 4OWWB 1NPRA 4MZ9A 3GTPH 1YI2T 1HNZQ 2Q2TA 1H95A 3CCST 1VQKT 1AE3A 1TWFH 3GTJH 3HOZH 1SRUA 3W1BA 3RZDH 1HZBA 4A3IG 1OTCA 3M85A 4IOAA 4JYAL 4OO1I 3BU2A 2R93H 4B3SL 1NMFA 1FL0A 2F4VQ 3CPFA 4PZ8A 1PH4A 5HGQA 1HZ9A 3ER0A 1YJWA 2CKZB 1QZGA 5LMNW 2ASBA 3CC2A 3LGLA 3CMAT 1VQJA 3NELA 4B3TL 2E8GA 1Q86C 4P73A 1W3SA 3CC7A 1QVGA 1GD7A 3PUVA 3M4QA 3CCUT 4DPGA 2R7FA 4NXNL 4DK3C 5FJ8G 1JT8A 1OXVA 1VQOT 1NPPA 4PZ7A 4A3CH 2YYZA 4A3DH 1QUQA 4IJLA 1E1OA 4A4IA 4Y7NH 4JI4L 1Q12A 1V43A 4X65L 3A5UA 4DR7Q 1QVFS 3D31A 3K0XA 4QY7A 2CCZA 3Q8DA 4KLKA 2Q2IA 4R4QA 1X55A 2VZAA 3I55T 4BBSG 1PH8A 3A74A 3W5OA 4K0KL 1K8AC 3S1QH 2PI2E 4OXPA 1YITA 5GQOA 1YJNT 1PYSB 1YZ6A 5FJ8H 4LFAQ 3GTGH 4ALPA 1S72T 2GVBA 3LGFA 2OQ0A 4DAMA 4DK6C 3FKIG 4DR5Q 2ZTEA 4JV5L 4C3IH 3UDIA 3OTOL 2IT1A 3BJUA 1Q82C 1Q86U 1X6OA 1FVIA 2KCTA 2NN6I 3E0EA 4JI3L 3W1GA 3L2PA 3RNUA 3CD6T 1MIUA 1A8VA 1YHBA 2BA0A 3P8BB 3K8AA 1QUQB 1PH2A 1N8RU 1KQSA 1TXYA 4KHZA 4LWCA 1X56A 3HFZB 1N32Q 2VUMG 2CWPA 4DV1Q 1JE5A 1VQFA 2D0OA 3LGJA 4HIDA 4A3JG 1LM0A 3UDXA 4DUZL 4MNOA 4LF6Q 3CCMT 3I2ZA 1NZ9A 1VQNT 4POGA 2E6ZA 3G6ET 4A3KG 1XNRL 5IP7G 3I56A 2UXDQ 2BA1A 4PG3A 4LF4Q 2JOYA 1UE6A 3GD7A 3PV0A 1Q81U 1VQCA 3J81j 4IO9A 4Y52H 4JI6Q 1Q7YC 3J80i 2HT1A 3T1YQ 4IPCA 4AQYL 4XIGS 3F1ZA 2B63G 5HY6A 1YJ9T 3CCRA 1S3OA 2AWOA 5AJ3Q 1Q1EA 4A3CG 1D7QA 1BKBA 4DR2Q 5C4JH 4YHHQ 3NEMA 1B70B 3TQYA 4DUYQ 3T1HQ 3J80E 2B3GA 1X3GA 3HOYH 1M1KU 3ULLA 2EQSA 5IT9c 1Q82U 1VQEA 2K5HA 2K75A 4JYAQ 3HOWH 1JJ2S 3TS2A 3H0GG 5IYBG 1IBLQ 4B3SQ 4X62L 2KENA 4DR7L 1L1OA 2K4KA 1XMQQ 3CC2T 4H02A 4NPSA 2JA6G 5LL6S 1L2FA 3G71A 1XTDA 1Y14B 1GVPA 1E1TA 4PZ6A 4B3TQ 1Q1BA 3CC7T 3I4OA 4R4TA 5A2QE 3J81c 1NJIC 2R6GA 2R93G 3OW2A 4LUOA 1NTGA 3BZKA 1SFOH 4O0AA 4LFAL 1B7YB 4GKJL 3HKZE 1RIPA 5FLXE 4NXNQ 2EIFA 4LF9L 4OX9L 3E9HA 4DR5L 3GTLH 2JA6H 1VQMA 1Q7YU 2JK8A 1X54A 1YVCA 4B3ML 2JA7H 5LMNQ 2KDSA 3EN2A 1CSQA 2UUCL 4DAYB 1SSFA 1YITT 2F3IA 3RLOA 4R4IA 4BBRG 2L3RA 4A3BG 3CCQA 1UE7A 2QGQA 2IHFA 3F2DA 1XPRA 2E5LL 3S15H 1JJCB 1BVSA 2JJQA 2YTVA 1KRTA 4DV1L 5EAYA 3PSIA 2CWAA 5C4XH 1PH1A 4LF6L 4DV3L 2NZHA 4A75A 1Y1VH 4IPDA 1SLJA 2QA4T 1TWCH 1WFQA 4YY3L 1HNXQ 4GNXA 3HOZG 3OTOQ 3RZOH 3CC4T 2N8NA 4JOIA 4UP7A 1JMCA 4JI3Q 4BBRH 1WCMG 4LF4L 2HIVA 1XNQL 4A3BH 4JI7L 1KRSA 3PUWA 5IYCG 1QVFA 1VQBA 1TWHH 3MEFA 4LW1A 4DR6Q 3UE0A 2ZJQA 2IG0A 4NB3A 1JJGA 2R92G 2K52A 5AJ3L 4DR2L 4DUZQ 3L0OA 1VQ8A 2UUCQ 1NMGA 4YHHL 4DUYL 3T1HL 4LF7L 1G6PA 3F2BA 2MQHA 1L1OC 1RL2A 1PH9A 3I56T 1XNRQ 3I4MH 3CCVA 1WCMH 3I4NG 1YHQA 3AQQA 3PUZA 1IBLL 3KF8B 4A76A 1AE2A 3PIOA 2AMCB 4JI5L 5IWAL 1EWIA 2WB1E 1XMQL 1QZHA 3BZCA 4GLAC 2K5NA 2R92H 4A3DG 2KHJA 1LYLA 1VQGA 1VQ7A 1D8LA 3PUYA 4JI1L 5C44H 4IOCA 4AQYQ 5C3EG 1YHAA 1K83H 2UUAQ 5LMUL 3OYYA 2PQAB 2JEAI 2YTYA 1KC8C 1YBYA 3AFQA 3L7ZC 2FXQA 3K81C 4HIKA 3EIVA 1G291 3I4NH 4HIOA 3AYHB 3KFUA 2XGTA 4GKKL 1IYJB 3KF6B 5DM7R 1HH2P 3H3VH 2ATWA 5JJLA 3CQZH 3G4SA 4X62Q 2NVQH 3G71T 2ZM6L 5LMNL 2JE6I 5C3EH 1W2BS 2LVMA 3UDGA 2RHQB 3FHWA 4JG2A 4IPHA 1VQ4A 3CMEA 3KLWA 1SE8A 2JQOA 4L5RC 1VQ9A 1K9MC 5M3MH 4TVRA 1C9OA 4BXXG 5FLMH 1VQ5A 1L0WA 4DV2L 2D0PA 4P72A 4GKJQ 1K73C 4OONA 4LF9Q 4GNXC 4JOIC 4OX9Q 4DR4L 1VQMT 2VNUD 5C0XJ 4JI8L 1X3FA 5IP9G 1YIJA 1HNXL 4B3MQ 3CAMA 1KD1C 1JJ2A 2MO0A 1KHIA 2CQOA 1Q46A 1N9WA 1VQDA 3STBD 5M5XH 3CXCS 4IPGA 4DKAC 1PV4A 4BXXH 4GLXA 4YCUA 4DR1L 4LFBL 4GN3B 3J81i 4DR6L 4LFCL 2GN5A 3I7FA 2E5LQ 5C0XG 1NE3A 2OTLA 4EX5A 3JAMi 1CKMA 2VQFQ 4P74A 5IP9H 2VQEQ 4DV3Q 4OWTB 3M9BA 2E2IH 3CCJA 3J81E 1VS0A 2A8VA 4ZN3A 4POFA 2LQ8A 3PCOB 2RCNA 4YY3Q 3HOYG 2CFMA 3TEHB 1XNQQ 1K8AU 3WWVA 4DV6L 3S2DH 1NBWA 2MWPA 4JI0L 3HOUG 3JAME 1SROA 4JI7Q 1FJGL 2Z0SA 3KOJA 2MO1A 1EYGA 4GN5A 3CCLA 1PA6A 4KI0A 4BY7G 1I94Q 4ZN1A 1UWVA 1VQ8T 2MFIA 4A3LG 1FGUA 2UUAL 1YEZA 4LF7Q 2B29A 2VY3A 2WAQE 2QEXA 2UXBL 1AH9A 3CCVT 3S1NH 1EIFA 1KD1U 1WYDA 3SGIA 4BA2I 2Z6KC 3CCSA 2DUDA 4FDBA 5J26A 3MXNB 4RG2A 3STBC 3U4ZA 1YJWT 2HHHL 1HNWL 5IWAQ 4JI5Q 1VCIA 1Y1WG 4RG1A 3AFPA 1BBWA 5E7NA 3CCEA
chains in the Genus database with same CATH superfamily
4A63B 4BI4A 2JA7G 4A3LH 3N6RA 2YV5A 2F0JA 3DEOA 2WAQG 2EYJA 2I5MX 3KJOA 3S1MH 2MJ8A 2A19A 2YTXA 3T13A 5GAGC 1JRIA 2DL4A 2Z4HA 1G8XA 1Y7XA 2MWOA 5GAN3 3G4ST 4S3SA 3VYRA 1JOQA 4M77E 2KHSA 3CCUA 2CW0C 4GLVB 1VQ6A 4X66L 5A2QL 2QQRA 5GANg 3KDFA 2V1CC 3A56A 2ZXRA 3K5NA 1PTOB 2RCFA 2VB6A 3U4VA 3CMET 1O7YA 3CD6Q 4LDWA 1WHGA 1NLPC 4J7IA 4TQUS 1J6QA 1B8AA 3EGUA 1D2BA 3GTQB 5IY0A 2F0FA 3NSWA 3X3MA 5IGDA 1U1SA 4WFN3 4DV2Q 1G6ZA 5BN3A 1WTQA 4QQDA 4A3GB 2RSOA 2A69D 4RGOS 2ED0A 5D6XA 5LJ3h 2VQEL 2CKKA 3L2QA 3NBHA 3CF5A 5KEEA 4A3MG 4XXEA 1M9SA 2YUQA 4YTLA 4DV4Q 1MD2D 2CP6A 2DJQA 1G2SA 2ZTCA 4FXGC 1C1AA 2ABLA 4HJ7A 2FZCB 4DR1Q 4LFBQ 3HKSA 1YJ9Q 2L9HA 3KDFB 4LFCQ 2GFUA 4KRTA 5C44G 1FNWA 2JXMB 3E3XA 5GROA 2D1XA 3EGXA 1HYOA 3GDEA 1RI0A 4Y7NB 4A3MH 2JA5H 2UU9L 3DWQA 4IIOA 2HEQA 2WSCE 1UGQB 2NUPB 2GVAA 2JW4A 5D7UA 1TT2A 2BH8A 3T53B 3H6ZA 2UUBL 2G3RA 2K5DA 2PI2A 4K2LA 3NBHB 1AZPA 3GTMH 3AB9A 1I4HA 3CC7Q 3OS0A 3ZEHA 1EY0A 4GNXB 2RHYA 4C56C 4P71A 3FP9A 2A69C 1VQAA 2VL6A 1C7YA 1BI2A 2NYSA 1I0CA 2QEXT 5CKHA 2OTJQ 2DJFC 2K14A 3EJIA 2KK4A 5M3MG 1UAPA 2EJMA 1YJ9A 4A3EH 1M4VA 2LCSA 1SYGA 1UEAB 4HT9A 2NN6H 3D0FA 2HQXA 1R9TB 1PDQA 2HHHQ 2B2VA 3EGXB 5JEAH 4ULLA 3OS2A 2VXWA 2EZVA 4XU1A 3HOVG 3S9WA 2HQEA 2PNHA 2VW9A 2JUFA 1CA5A 2XHCA 2CSIA 5GAEC 1K3RA 2A8VA 2MPMA 4PJOA 3K7AH 1PZID 1D5MC 3K7UC 1TXQA 4IJHA 5ELEA 4JJDA 3FPPA 2QGGA 3GV6A 4DGZA 5EKKA 1LTRD 1JU5C 3JCMV 2LXKA 1S5DD 2ALYB 3D4DA 4GOPC 1N8RC 4A3IH 1OZ3A 2OTJA 2QQAA 1QW1A 3K59A 3HOVH 1GCQC 2VUMB 3K0YA 3K58A 2KT8A 2R7DA 1V1QA 2RF4A 1QKXA 2DJZA 1O78A 5CV5A 1VF7A 1B50A 2KEDA 1MV3A 3SEBA 2J6FA 1BBUA 1QMCA 2QG9B 2X6GA 4BA1I 4X64L 1MKHA 3ULPA 1PH3A 4KBMB 4XTYA 2L12A 5KNBA 4BI3A 4LDYA 2F0IA 3QDRB 1Q81C 2RDFA 1I4GA 1SE2A 4OWXB 3S14H 4JI2Q 3AHUA 3ZBDA 1GL5A 2RO0A 4XT1B 4DV7Q 4LF8L 2DILA 3JCMg 3I56Q 4PJOB 4V190 5IHNA 3DB4A 2LTOA 4IUPA 1CTMA 2L1BA 1D5ZC 3VU3C 1EEFD 2I46A 4YCVA 2SOBA 4JBMA 1NUCA 2EYHA 4KHPL 3H3VI 4A3FG 3M53A 3SK5A 5IE8A 1WJQA 2FYKA 2DM1A 1I4PA 4KKUA 3NQTA 3TREA 5ELOA 3JAML 1R0BG 3U58A 3VJPA 2CVRA 4M7DA 4DV5Q 2RH2A 2L0AA 1C8CA 1WOCA 4BI8B 3A98A 1YI2A 1YHQT 2F0QA 2BE7D 1HTPA 2JVVA 2JTFA 1VQ7T 4FYVB 4C5IA 1ZYRD 3I55Q 5IGGA 2GNCA 3DM3A 3M0RA 2NUCA 3S2HH 3LH0A 1BCPD 1EZ8A 4LF5Q 4FW1A 1STYA 4QJFA 2L15A 2H3EB 4EMKC 4C3JG 4KH0B 2KNBB 4BBRB 2XKOC 2MNAA 4PNYA 3EGDA 3S3OA 4A3BB 2VB2X 1WNLA 2F0VA 2GGRA 5IP7H 1TG0A 1IGUA 3OB9A 3HG9A 4QGUA 2M1HA 2H1EA 4XK8E 1YCYA 1VQ4T 4M7DB 1F9PA 3GTPB 1AWJA 4U673 1K0RA 5GAOr 4J15A 2Y0SG 1LV9A 4KY7A 4BUGA 4A93G 4E7IA 2B63H 4H44C 4ME3A 3GTJB 1HRJA 4R0KA 5DNFA 2IWHA 2B39A 3QJYA 3KLSA 4C3JH 3I55A 1M90R 4ODGA 1D3BB 3CBMA 5KCOA 4Z88A 2LFNA 1FMWA 2LNHB 3ZJYC 2DTOA 4IUVA 2ZCFB 4RMOA 3H0GH 4C3HH 1M3CA 2GTOA 1ZYRC 3HHTB 4HAEA 1BI1A 4DR3Q 1MJCA 1M3AA 4FP5D 4A93H 2E2JH 4JI4Q 1OYXA 3TBIB 3EROA 5FWBA 1K73R 2BE9B 1BCPC 2A1AA 3T56B 1HR0L 4HEDA 1T3SA 5CBEE 2OTLT 1R0CB 2VWFA 2E70A 5DAUA 4GLKA 5CORA 3JCMf 3EAEA 2EY1A 2HQLA 2QQ9A 3RNJA 5C3EB 2LC4A 4J9FA 5BR8L 2VS1A 3E9GA 2PZTA 3OSSC 1N33L 4OEMB 4ATOA 3EH2A 2SEBD 1M8MA 2K1BA 1C0MA 3OWEB 4BD3A 1GFCA 3S17H 4LN2A 4A3GG 3A0JA 4E7ZA 1OXXK 2C0OA 4C3IB 3OW2S 3K80C 3PGZA 1X69A 1PTOF 1NPRA 4C1NI 1H92A 3URYA 5LJ3e 4CKBA 3ME9A 2LJ1A 3OY9A 3DM1A 1VQKT 1TWFH 1Y8NB 3N5BB 2TMPA 4AT1B 1SRUA 3HOZH 2RBMA 3M85A 2AZVA 3SWNC 3BU2A 2PCFB 4B3SL 5JJZA 1RAAB 1JWMD 2DXCA 3JCMJ 5HGQA 1QWEA 2KQWA 3EHQA 1Z7TA 4C92B 2B2WA 3CMAT 1VQJA 4B3TL 1Q86C 5FU7C 5DLOA 4JDSA 3OSOA 2E12A 2YWWA 3M55A 1GD7A 3M4QA 3VRZA 3S2DB 2CP7A 2RQVA 1XQHA 2CHBD 4DPGA 2B2UC 5LJ3f 2BIVA 1OXVA 5GAN2 1VQOT 2JTEA 1RAHB 1VUBA 3GLXA 1W6XA 1J3TA 1E1OA 2J05A 2MIOA 2P0QA 2GQVA 1DYQA 1XXGA 4A4IA 4Y7NH 4F88A 4RAUC 5I6WA 2PVDB 5CQXA 3HOWB 4KGVB 1PYSB 1LACA 2F5TX 3DHQA 3R6NA 3I9QA 4ALPA 3OSVA 2GVBA 5DEHA 2JJ9A 4OMNA 1U4LA 1JE4A 2F03A 2WSEE 1KJWA 2QGFB 1UE9A 3CCLQ 1JBMA 1SAPA 3UDIA 3OTOL 4C8QF 4RCOA 3CCRQ 1X6OA 4X1VA 2FMCA 3RNUA 1AH9A 4M7AF 2K04A 1FD7D 2HD3A 3P8BB 3QWYA 2HAXA 2OX7A 3K8AA 4PJJA 2VUMG 3MPUB 1VQFA 4M77A 2RI2A 5GAN7 2D0OA 2L55A 3LGJA 2A08A 1DOKA 3UDXA 4DUZL 2DZ9A 3HFNA 1WHHA 1XTCD 2HL5C 3H8ZA 1QVFP 1UJYA 2D8JA 3T9NA 1VQNT 1PZJD 3O13A 5C6SA 4POGA 3CCEQ 5LHY1 1B4OA 4LAAA 4DR7Q 1KK7A 1EIGA 1S5CD 1G3YA 1LPLA 2EYYA 4LF4Q 2UXDQ 5C4XB 4JI6Q 2G9HD 4K11A 3J80i 1OPKA 3M58A 4IPCA 5C4ZA 4PJOG 2DNUA 1S3OA 3CCRA 4R56A 5AJ3Q 2COWA 1WA7A 2DL3A 4MZMA 3LX7A 1B3AA 5NUCA 3NEMA 4ZAIA 3TQYA 2WKDA 1X3GA 1F1BB 1BIBA 2EQSA 4OVAA 1Q82U 3E19A 2CS7A 2K75A 1SYCA 2XG8D 1IO6A 1JJ2S 4M77B 4OHJA 3ZL7C 4DR7L 4OGQC 1XMQQ 1QG7A 4H02A 3G1JA 3CCQQ 3I4LA 4NPSA 1F9QA 4KH1B 2EVBA 5IXBA 1Q1BA 3I4OA 1GBRA 1J8IA 3OYKA 3DMUA 5KYWA 2LJ0A 1NJIC 3OW2A 1YFNA 3QSUA 4LFAL 1MNEA 1PTOD 2DIGA 2CP2A 2FO0A 4KD4A 2K03A 2A74C 5LJ3d 1KDBA 3NXWA 1YVCA 4B3ML 4CDCC 2DFUA 3W2DA 1K76A 1EFNA 2F3IA 3RLOA 2MPXC 4BBRG 2L3RA 2E76C 5M3FB 4A3BG 4FYDA 3CCQA 3DUZA 4R8IA 3MP1A 1XPRA 2JM9A 1BVSA 3NK9A 1KRTA 5CIUA 3QG1A 4LF6L 1M8AA 4M7DG 1QCOA 5KYWB 5CAIA 4A75A 4IPDA 1SLJA 2FFKB 1WHLA 1WFQA 1M3BA 4XYQA 2HD0A 1RF2D 5IGEA 4PJNA 2ENMA 1XNQL 3P75A 1G5VA 1Q81R 4BBRH 4A3BH 5TSSA 4RFBA 3UE0A 1PTOC 5I4DA 2DVEA 1EFID 4LF7L 5GMKj 4DUYL 1YP5A 4JZ3A 2MQHA 1KLGD 3GPLA 4IIMA 2XSCA 1I3QB 4RTZA 3I4MH 2EW3A 1WHKA 2PPBC 3AQQA 3D8GA 3PUZA 1E2VA 3A8IE 4LJZC 5IWAL 4JI0Q 1NLOC 2K05A 3RKXA 2K5NA 3PGGA 1LYLA 1EWHA 1D8LA 4O42A 1D5XC 5FO9B 3Q22A 3Q6SA 5C3EG 3DWPA 1Y96B 3LNNA 1SG5A 1DOMA 2RPNA 2JEAI 4TKOB 1VMCA 4OF1A 1VQLQ 2NTTA 1YBYA 2RQXA 3AFQA 2TSSA 1R4PB 3L7ZC 4B08A 4HIKA 3FLGA 4HIOA 3KFUA 2RDHA 3HRSA 2F0WA 1EEID 4HVWA 1HCZA 1HH2P 2NVQH 3G71T 4JZ4A 4XTUA 2JE6I 4C3IG 5C3EH 3IAYA 4HVUA 3OPOA 2F3WA 2VXEA 1WI7A 3SEMA 1CFMA 1DCZA 4ZGJB 1O9SA 1AHJB 4D8DA 4BXXG 3CCJQ 1L0WA 2D0PA 3CRKC 4P72A 4GKJQ 5ECAA 2E4HA 1N5ZA 4XQJA 4GNXC 2QK0A 1OU8A 1QCNA 2CT4A 2ECZA 4OX9Q 1VQMT 4KULA 2F2XA 3TSWA 4JI8L 2IL8A 1K1ZA 4RKBA 1YN8A 1YIJA 1HNXL 4C92G 4C8QC 1AWOA 3S6WA 1CZGA 1JJ2A 1KHIA 3S1MB 3HS0C 2KSSA 1VQDA 4KJOA 3STBD 1PV4A 1I50B 4BXXH 4M8AA 3M54A 3NMZC 4PJOD 2F0SA 3G7ZA 1D1CA 2LMCB 3I7FA 2E5LQ 2HMAA 1NE3A 2A3LA 4BB7A 1ILQA 2VQEQ 2HKNA 5FK9C 3CCJA 3J81E 5HURA 2LMJA 2LQ8A 3R2TA 4L5RC 2KCCA 3OOCA 1MNDA 1SRLA 2CFMA 1D09B 3CQTA 1K8AU 3WWVA 3S2DH 1B53A 3HOWG 5JPNC 3M5AA 1PRMC 1FJGL 2Y4YA 4J9BA 3QWXX 3OA6A 4D6WA 4QKUA 5FW9A 1PA6A 5C0MA 4GZYC 1VYUA 5J39A 4JPBW 1VQ8T 2ENBA 3V05A 3QB3A 1FR3A 2B29A 4J9DA 2RJDA 4M78F 2B8FA 3M0TA 2UXBL 2YRCA 1BNZA 3S1NH 2QQBA 3VS5A 1WYDA 1STEA 3U4ZA 3STBC 1ZUYA 5J26A 5GAHC 4GOPA 1AZQA 1KQ2A 4PJOC 2AZSA 1VCIA 3K5MA 2EGEA 2JA5B 1BBWA 5GAOp 3U50C 4JI1Q 2LJ3A 3J80L 4HA8A 4X6AH 3UDFA 1CA6A 5ELFA 2MOXA 1VYVA 3RBBB 2UXCL 1A2UA 4FYXB 4AIMA 4M7DD 4K6LA 2KRMA 5FRMA 3QWNA 3OYEA 1TUCA 1LUZA 3L42A 1B34B 4XTZA 2V26A 4OO1G 5C4XG 4RHSA 4LDVA 4NS5A 2JA8B 1AWXA 1J5EL 4EQ5A 1ENFA 3BYTB 2OEOA 1MUZA 1BCOA 1A15A 3QR8A 4HJAA 5FLXL 4A3EB 1VQ9T 1HJDA 2RQTA 1AEXA 4NMZA 3DLMA 5EKIA 1P16A 5C5LA 5FRNA 5EKLA 1MGSA 1EY5A 5EBDA 4HJ8A 3VYTA 1HR0W 4FF1A 2XMFA 1SMYD 4OO1H 1PD1A 2JS0A 4M77G 5GANh 3S1RH 2HBPA 4JRQA 2OXPA 3K7AB 4QF4A 4XQNA 1B9NA 2DZCA 2MK5A 2EYMA 2LCCA 2J7IA 1VQPA 2ZJPA 3IKJA 5JJKA 5KYLA 2LXJA 4E2FB 4A3IB 2EJFC 4X64Q 1BI3A 3ZFJA 2DF6A 4ANJA 4UP9A 4M7DC 1FX7A 2A36A 2I5HA 3OIPA 1I94L 1JB7A 4HTHA 1GXDC 2EQJA 2QF7A 2EAYA 2CZ1B 3VS2A 3J7AF 1EY7A 4HJ9A 1ZA1B 1SYBA 1KD1R 1XMOL 2RQWA 1ZSZB 4CKCA 2ZPBB 1N27A 1OXSC 4IN3A 4CGYB 1Q90A 4E7LA 4DV6Q 5M3FG 3CC2Q 1CZWA 1G8ZD 1EYDA 4M75E 2BH2A 4KHPQ 1SMYC 3ERSX 1BBXC 1TTHB 2MMPA 1RODA 2P4TA 2JN4A 1X75C 3ICEA 3HGBA 1UE1A 3LWEA 2EYPA 1IHVA 4YCWA 4OMQA 2K3BA 4DEXA 2RI3A 2V1QA 4J9CA 1IGQA 2AHOB 1PRTB 4JJBA 3OYJA 5CR3A 1M90C 4XTWA 1F9RA 2DBKA 3RESA 5M3FH 4C92D 3GO5A 4L63B 3H15A 1MSHA 3M0UA 2ESWA 2EKHA 4NXML 2IJ0A 4B3RQ 2ATCB 1YITQ 4GN4B 1TS2A 1TS9A 3H0FA 2ROLA 4QUCA 4NL2A 4JLIA 2DK3A 1MSGA 1SN8A 2C9OA 2HSEB 2O9SA 3EVQA 5BN4A 3A8JE 2ROTA 2JYOA 1EZ6A 3BDOA 4RMFA 1SNQA 4WJ4A 2A28A 4CKEA 2R5AA 1VQ6T 4MN3A 2DRMA 2EQKA 4RKUE 2RKSA 1N34L 3T4AC 4DBQA 3CC4Q 3BY7A 4RCCA 2DRKA 1ZEQX 4UDUC 1TU0B 2RK2A 4QQ6A 1CKBA 4FF4A 5KYYA 3RMSA 4RWSC 2QQSA 1KC8U 1I3QH 1LVKA 5HKCA 2O4XB 1AVZC 2ZPHB 5EG2A 1F2MA 2NB0A 3OBYA 3MA2B 1ICWA 4QIWE 1X6GA 3BVMA 2HUGA 2CGHA 2X3WD 4C92C 1Z6HA 1SNCA 5IN1A 1V9PA 2B63B 2KBNA 2FHDA 2KA7A 2F0GA 2XN9C 4EVOA 3OWFA 2KE9A 4LD6A 1EY6A 2QI2A 1QVCA 1HZAA 4F7UE 1A0IA 1STNA 2FJ2A 1A3VA 3U9SA 5IYDG 2V8JA 1EYAA 2MI6A 1UTIA 1WQ7A 1N36L 1B1ZA 1AOJA 1CM9A 4C5EA 2DTHA 3RLNA 5IGFA 3PIP3 1CK1A 1HR0Q 4OL7A 3CC4A 3NWSA 3H0GB 3REAB 3UT1A 4C3HB 4APVA 5L37A 2C06A 4G7HC 1QVGS 2JA6B 3JCMh 2ZGWA 5GAOm 2F2VA 5LJ3j 1EOVA 2PQEA 2X69A 2E2JB 4QUFA 5KYYB 3FKIH 1UFFA 5GAMg 4C0GA 1UE5A 2BUDA 2D8HA 5BR8Q 1QILA 2K7VA 1KAWA 1JXOA 5EPKA 1K3BC 3MAQA 2YU9H 5IYDH 3RN2A 4LUEA 2F69A 1N33Q 1ZBJA 3NBIA 1EFWA 5IYCH 3M4OH 4QL5A 3RLFA 3E9FA 2B2WC 2HDMA 1C0AA 5M9OA 2F4VL 1KTKA 2I0QA 1RAFB 4DV0L 3X24B 1OXTA 2D9TA 3VV0A 1GKHA 3A8HB 1VQHA 4RTYA 4O6JA 2E6NA 4A3JH 1KSWA 2PNRC 4M77D 1PH5A 3D6WA 1HD3A 1ASZA 3S17B 4BACA 1I50H 1BQQT 2A0FB 1TWHB 5I9OA 1ZA2B 1NCVA 1PNJA 2L3SA 1TY2A 3URGA 3VYHB 3TEEA 1JXMA 2CYZB 1TWFB 2PTKA 2PO4A 3HOZB 1KQSS 4FYYB 2M2LA 3DEPA 4L5QA 1EQQA 4KGXB 1JB3A 2EPBA 1PM3A 1M2OA 2FZGB 3BDUA 3TP8A 3CCMQ 1A62A 2F3VA 4HKEA 2NZOA 3PNWC 2OTJT 2MUYA 3INZA 2JNGA 3P7JA 3SXHA 4RGTA 2JA5G 1X3EA 3JAMc 1I5LA 3Q24A 3IQLA 4PLIA 4FM4B 1UJ0A 3VA7A 2BDOA 1U4PA 3LWUA 3VR3A 4ZTJA 1WHMA 3MWYW 1GUSA 2I5LX 2BZ8A 2XI9A 1TS5A 3NENA 4FXDA 3M56A 3PIPA 1BCPF 2L89A 4M77C 1BR9A 1KL9A 3I3CA 2R93H 2EDGA 3HRTA 3CD6A 4FYWB 2HIXA 3NHHA 2OCEA 3GF5A 5GAOl 3CCVQ 2JA8G 1HA6A 3OYGA 1R4QB 2K6DA 2YT6A 3EG2A 1PZKD 1MJEA 2O9VA 1WFWA 3QKJA 3P1HA 3P8HA 4C0DB 3CCMA 1YJWQ 4RKLA 4A3EG 4R4CA 2NN6G 4L6TB 1B44D 2K3YA 4OP0A 3ZYYX 2VVKA 1WJJA 1OI1A 5JEAG 5FU6B 4ORZA 1PSFA 1BF4A 2PQAA 3MP8A 1V1PA 4TVAB 1RKNA 3R93A 2JA8H 2DAQA 4CC2A 3IFDA 1F2YA 1OO9B 1X3QA 4E7KA 3KF6A 1YI2T 1HNZQ 2Q2TA 5GANe 4CC7A 3CCST 2H4OA 3G4SQ 3VS7A 1NBEB 2BTTA 4QCLA 2BZYA 3O8VA 1PWTA 4ZGEB 1HZBA 3W1BA 4A3IG 1OTCA 1NAPA 4DN4M 3CMEQ 1NMFA 2CP0A 3CPFA 3D3RA 2H3JA 2F2WA 1YJWA 1QZGA 3OMCA 4BE2A 2E2IB 3LGLA 1C48A 4K14A 5LJ5g 3CC7A 1QVGA 2K57A 1HPCA 3KBXA 3MEAA 4I7AA 1SPKA 5IGCA 5GANf 4NXNL 2JS2A 1V1PB 3OBWA 5CGKA 1AEYA 4EMGA 4A3CH 4PZ7A 3E6ZX 3MO8A 1I8FA 4A3DH 1G91A 4EIKA 2PVGB 3OW2P 1Q12A 1W6JA 4X65L 4QY7A 3K0XA 1JQYD 3GP7A 3Q8DA 3A5UA 2Q2IA 4EMHA 1X55A 4PNOA 3I55T 1E0BA 1EU3A 2VZAA 5ELDA 2YUOA 4CC3A 1BIAA 4RH6A 3EG9A 1SYFA 2NZ1D 2BDNA 5IT9L 4LFAQ 2A68D 2LT1A 4Z8AA 4BY7B 1X2KA 8AT1B 4ABNA 2R61A 5ISRA 1D0YA 3SDZA 2F4IA 4BS9A 1I4QA 3A8GB 3NTHA 1PD0A 2X35A 3R2IA 3RDVA 4BY6B 1X6BA 1Q86U 4V2SA 2KCTA 2NN6I 4JI3L 3L2PA 4ESRA 1JO8A 2BA0A 1K28A 4F7XA 4RTTA 1E7OA 1KQSA 3QIAA 4LWCA 3ND8A 2FL7A 3V7RA 4HIDA 3D6CA 4LF6Q 4L8JA 1JQQA 3Q0AA 3EHRA 2DTIA 3ONAB 2E6ZA 3L3OC 3L9AX 3NWTA 3BDLA 3I56A 2EYFA 3FRPB 5IP7G 1G3TA 5G3LD 3GD7A 2HT1A 5ELBA 3T1YQ 3SD4A 1TWGB 1SJHD 2A68C 2RQUA 2B63G 3QXEB 1Q1EA 3WOEA 1Q8IA 4CI0C 1FNUA 1BB9A 3EFXD 2ZPFB 3WOFA 4DUYQ 1I6VC 3HKZB 4JK1C 3ASKA 1N9SA 2IX3A 1M1KU 4ZCKA 3HOYH 2IIMA 4JYAQ 4Y91A 1H9RA 3PIO3 3TS2A 3H0GG 4C3HG 2AKKA 1STGA 4EQPA 1L1OA 4AG2C 1ESRA 1JOOA 2JA6G 1Y14B 1YWOA 3D4RA 4PFPA 2FPFA 1GVPA 3IL8A 3RR6A 5LJ5f 3MFGA 4DAVA 3I4MB 1ABQA 5DM73 1RDPD 3JCMe 5A2QE 3T51B 1OOTA 5J22A 3J81c 1WTOA 4P5NA 2K5LA 1SFOH 1I1JA 1ENCA 1RIPA 2EE1A 4A4GA 2EIFA 4A53A 3V7SA 2RHIA 2ZPIB 4DR5L 1GHJA 2LP5A 2YUNA 2COYA 5GANd 4M75A 1QKWA 1I4RA 1RCVD 3C3LA 2JA6H 3EGDB 2O2OA 5E4XA 3QYGB 2KDSA 2B86A 3I5RA 4JRKA 4OELB 1CSQA 2UUCL 4R4IA 5CVIA 4HSVA 2R3ZA 4RCNA 2NVQB 5GAN6 2EWNA 3F2DA 3S15H 5K36H 2JJQA 1WXBA 2L3PA 9ATCB 1JJ2P 2YTVA 3LX0A 2I2LA 2QASA 1YHQQ 3NQIA 2K7AA 5EAYA 3OYLA 4DV3L 1LLRD 1Y1VH 1ENAA 2XDPA 3IFTA 1UB4A 2QA4T 1VQ7Q 1HNXQ 1X3PA 3HOZG 2L5TA 3THKA 3OYIA 2WB1B 4JI7L 3I73A 2K9GA 1TWHH 1E2WA 2X4YA 4M75B 5KNDA 2ZJQA 1JJGA 2YDLA 3QO3A 3I72A 4XT3B 5I2YA 1E6GA 4J6YA 1T3LA 1Z9QA 4DR2L 2F0NA 2F0KA 4YHHL 3T1HL 1G6PA 3F2BA 4R8NA 2LQKA 4XU0A 4B6MA 2VGNA 2O2LD 3D4WA 1EX4A 5I11A 2M9VA 2X6LA 1XNRQ 1ET6A 1ZHIA 2AKLA 1AT1B 3KLRA 3FDRA 1VQ4Q 1SYDA 5F2DA 3Q23A 2AIRB 4OB0B 1YHQA 1B07A 2D9UA 1IBLL 1RI9A 3PIOA 4JI5L 1B3QA 2DD5A 4XQQA 3BZCA 1QZHA 4JS5A 4RTVA 4N9TA 1PRTD 1VQ7A 3PUYA 4IOCA 4AQYQ 2NVXB 4C0FA 2RNAA 1OQKA 1JWUD 2QDLA 4F7UA 3K81C 4J5YA 4QVCA 1WLPB 3EIVA 4HCSA 2XGTA 1H9KA 5DM7R 5CCAA 1Q7YR 3E2UA 3S1QH 4IUNA 2ATWA 4FW2A 1GUOA 3CQZH 5FO8B 4X62Q 1PC0A 4Z9CB 5LMNL 4WF2A 2EGAA 3FIFA 1W2BS 4Z02A 2LVMA 1AN8A 3MFYA 1ZSZC 4QQGA 3UDGA 3S1NB 1VQ4A 2OTLQ 4Q0FA 4BY1B 2RMOA 2JQOA 2MF2A 1C9OA 1T5EA 5FLMH 1WD0A 4DV2L 5LJ5d 1CI3M 1BDOA 2DL8A 4LF9Q 2A73B 4C1NK 3CKIB 4JOIC 5EPLA 3KXTA 3SE0A 1VIEA 3VR2A 4NP5A 4BE0A 1CSKA 1NR4A 1PRTC 1RAEB 2EYOA 1KD1C 4F7UB 1IKLA 1SSOA 2CQOA 1N9WA 3EA6A 3CXCS 2Z1CA 2G6FX 2I07B 3H0HA 3BS1A 4DR1L 2XICA 2GTJA 1L0YB 3EG0A 4LFBL 3DKMA 1AW7A 4LFCL 2SNMA 3MTSA 3JRZA 3MXNA 5C0XG 2GQIA 2OTLA 2ZZDA 2F0DA 3UA6A 3JCMd 4Z89A 4PMBA 3M9BA 2E2IH 2J6OA 2E64A 4OMMA 4YY3Q 1R77A 2CT3A 5IHIA 2CUBA 4KMUC 2N55A 2MWPA 3JAME 1SROA 2MO1A 3S1RB 3CCLA 3SB2A 3CMAQ 1LT4D 1I6HB 3M59A 4HSPA 5C0XH 4J8OA 4BY7G 1I94Q 4LD9K 2BOSA 2GF7A 3BZDB 1YEZA 2UUAL 1GUWA 2DL7A 2E5QA 2VY3A 1TY0A 4YIJA 1NG2A 2SDFA 5KE2A 1VQOQ 1SNPA 2MGSA 3SK4A 3SGIA 4N4IA 3X26B 1TWAB 3MXPA 3HOXB 3MXNB 3ND9A 2DIQA 2VXFA 2IPKD 2DMOA 2QAZA 1H9SA 2HHHL 2DXUA 3HRZC 1MHWC 4PJOF 4ZUIA 1QQJA 3CCEA 2ZTDA 3BVZA 4BY7H 1O7IA 1HXDA 1G3WA 3JCMb 1PKTA 4EDUA 2HQHA 2H5XA 2Q8RE 1HFGA 2PZ1A 2E65A 4L5GA 3M4YA 2XWBB 5LMUQ 2PMZE 1L0XB 3CMAA 2LKVA 3FJ5A 2A37A 4X3UA 4QW2A 4V0BA 4GKKQ 2NUZA 4G57A 4MIUA 3JC66 3D7SB 1A3UA 3SR1A 1UEBA 1XJWB 1E22A 2XWJB 2OF1A 1HXYD 2ZM6Q 4NXMQ 2DKGA 5CV8A 2N3SA 2IX1A 3W3AA 2OT2A 4XTCS 4CHTB 4KK7A 2F1LA 2KBTA 1H9SB 3HKZG 4QT7A 3L2ZA 5ELCA 2F0HA 5C6AA 4AFQC 1AWWA 3RZDB 4DBRA 1LTTD 1GM5A 3CW2C 2P5ZX 3BFMA 3GNGA 1NY4A 2KAFA 4JI2L 3PO2H 2OAUA 1MHNA 2XIDA 4RA8A 1VQNQ 4DR4Q 4DV7L 3L2VA 3O5ZA 4PKCC 5D6WA 3CPWS 1YIJT 1HZCA 1TWGH 2RA4A 3A8KE 3PF5A 1N34Q 2RJFA 1NNXA 1PVOA 2RVLA 3I4MG 4E6RA 1I5FA 2E74C 4CBVA 3S3NA 2HKQB 2KVMA 1UHFA 3NUCA 4YWKA 3T16A 2K2MA 1GCQA 1W2BA 2XDDA 4EQNA 2E10A 4L59A 4X34A 3KBGA 4M7DF 5D14A 1YWPA 1M1FA 1XPOA 2EXDA 3A5ZB 1AZEA 4LXCA 2M16A 3VYUA 1G83A 2QILA 4O5VA 3M7NA 3S1QB 1CKNA 3HL8A 1CSPA 2IW3A 4UP8A 1BO0A 4F87A 4IFDG 3BVGA 2Z0WA 3H0IA 3VS6A 4ID6A 3KK7A 2MYSA 1SEBD 3PO3H 3CXCA 1U4RA 3F2UA 4FSXA 3M3YH 3JB9G 4K0KL 1UHCA 3A1PA 1YNXA 4CRIA 4J6WA 1IBML 4QMGA 4LF5L 1RADB 2LX7A 1LTSD 1LOJA 4NKLA 3VUBA 4BWGB 3M57A 4IFDH 4DEYA 1IBKL 2FVUA 2WB1G 3G48A 1GUNA 1HNWQ 3NTIA 1X27A 5IAYA 4M75G 1LABA 3RKWA 2EGCA 2D6FA 2KVQG 2J0TD 3EBEA 3FKIB 1T0JA 3JB9H 4DXGA 2ZXPA 4C0DC 3MEVA 4DV0Q 2YU9B 1MMGA 2ZJRA 1CKNB 1PH6A 4K8IA 3OIQA 3TRZA 2IY5B 3M9QA 1SJED 3M4OB 1EY4A 3DB3A 4RG8A 5FU6C 2N78A 2XIWA 3H6MA 4C8QE 1JR0D 1WGSA 1M4ZA 2K3XA 2PZWA 2FINB 3DLLA 4L5TA 2BKDN 4M7AE 5C4HA 2DEQA 1G51A 1UNSA 3PUXA 2DETA 4X66Q 1VQLA 4K2KA 4EMKA 4A3JB 3TVTA 5JVH3 3R3OA 4DR3L 3K5LA 2V8IA 3AMUA 2K4YA 3NPPA 5CV9A 1LTLA 5C4JB 3H41A 2DD4A 1TVXA 1IXRA 1U5KA 2EOTA 1SKUB 2J7ZA 3CU7A 4LNQA 5KH6A 1M90U 5EJWA 1BBZA 1ZX6A 2WKCA 4N8X1 1SR3A 4HCBA 1JICA 4C92F 2COZA 2L5QA 3QOLA 3L1AA 1CQVA 5JAVA 5L23A 1VQPT 1BUVT 1TH7A 4JC0A 3VDYA 2NVXH 1PG5B 4DNIA 1ZBXA 4BY1G 4BBSH 4MMLA 5GADC 1K9MU 1IRXA 4LUDA 1SMXA 1X65A 5HCKA 1K8MA 4DK0A 4IFDI 1K73U 3FMCA 2WSFE 4AFSC 4JS4A 1RHPA 2AUKA 1I4K1 3NTKA 4OB1B 3OHXC 4K5WA 2PNIA 1WJSA 4J9HA 4B9WA 3UF4A 1WYXA 5GANj 4HT8A 3LYIA 7AT1B 3JB9I 1E7ZA 2AQ3B 1F2ZA 2UU9Q 2B2VC 1S1NA 5FROA 2D62A 2RA2A 5JJIA 3C0CA 3PFSA 4F7UG 4BY1H 2R93B 4D8KA 3CPWA 3QZ5B 5IOCA 3P8DA 3J7ZC 1WDXA 2UUBQ 3BYYB 2YSQA 2F0LA 1Q95G 2LX9A 4AYBE 3A8LB 1Q8KA 1XJVA 5GAOn 2DX1A 2C5CA 4HCZA 2GCXA 1YJNQ 5GAMh 2FPEA 6AT1B 1MBYA 2ICIA 2QDBA 4KY6A 4O2DA 2VKNA 1CHPD 1TWCB 4BY6C 1S72Q 4MTNA 4WRDA 5KCHA 4YWMA 4CDEC 1LTID 2DBMA 2KCNA 3QHSA 1VQMQ 2DY8A 4A3KH 4HIMA 4ZLTF 4TRDA 1YNND 1WI5A 1QVGP 4KT0E 3MHBA 1E24A 1RAGB 3VS4A 1VQ5T 2GA4B 1DJ7B 3OS5A 4PJMA 1C4QA 4XYOA 1WCMB 1H9MA 1BXTA 3OYMA 2IX0A 3HOXG 4KN4C 2KXCA 2N49A 5A35A 2D0QB 1YJNA 1ESFA 5EGTA 1WIEA 3G6EQ 2F52A 1I6HH 1S72A 5IYBH 2LT4A 3C1FA 3J7A5 2CZ7B 4DQ2A 2Y90A 4X65Q 4JBWA 1PH1A 3JB9D 2VASA 2K32A 3E9IA 1RACB 4AG1C 2RHSB 1TWAH 4F8MA 2LSSA 3HSBA 3HOXH 4M77F 4EQOA 1GRIA 4FL6A 4OGCA 5JEAJ 1X9NA 3BG3A 4A3DB 4HCEA 1HA5A 2PW5A 1OPLA 3TU4K 2EYZA 2M51A 2FB7A 1PYBA 4LF8Q 3K6OA 3QPHA 1YNNC 2E3IA 1M1GA 4GBQA 4CJ2C 5M5YH 4M75D 1FNVA 5CV7A 5AYFA 2P4RA 1ZKOA 2JMAA 4N4GA 1KQSP 4TSSA 3G6EA 1PHTA 2UXDL 2KYBA 5LJ5j 1CUKA 3KYHC 1SHGA 3MEUA 1PFMA 1SNMA 2ID0A 1NR2A 4JI6L 2QW7A 1VOMA 2VUBA 4PMCA 3EFSA 2JSOA 3UE1A 2RSNA 4OWWB 4MZ9A 1TU2B 1ONLA 3E5SA 5M5XB 2QYZA 2YRDA 1S5FD 3A55A 2GBQA 5KYUA 1NEBA 3OYAA 3RZDH 4IOAA 1KNAA 4PFOA 4OO1I 3U23A 2EXZA 1G2BA 2KQ3A 1VQ9Q 4XU3A 1HZ9A 3ER0A 4C0ZA 1STBA 5LMNW 2RDGA 2ASBA 3CC2A 5GJVB 1K0XA 3NELA 4FVMA 1JEGA 1IHWA 3ULRB 5KIXA 3I90A 4PQXA 1SDFA 3CCUT 1SHFA 4M4ZA 4NL3A 4PL6A 4QQBX 4MZPA 1JT8A 4OIKA 4EGVA 2CZ0B 1UECA 2YYZA 2RJCA 1QUQA 3HP3A 1PFNA 4IJLA 4E7HA 1TQOA 3M0QA 5KYUB 3FRNA 1Z9ZA 5FWCA 5LJ5h 1PH8A 3HOYB 2E41A 2HDAA 2HCCA 3W5OA 1KAAA 1I5OB 1K8AC 1EU4A 4JVZA 5HGTA 4ME5A 3HOUB 4FF3A 1YITA 2O01E 2DEUA 5GQOA 2EJGA 3MVVA 1YZ6A 2D2CC 3TSSA 3VR4A 4G7ZC 1PRLC 3LGFA 2OQ0A 4DOVA 3FKIG 2EPDA 4DR5Q 2ZTEA 3QYHB 1AZGB 4JV5L 3MHXA 4LNPA 4C5GA 4UAIA 4ZRZA 1TUGB 5KYNA 1SFOB 2RD1A 2IT1A 2FZKB 4KUIA 1QP3A 4M78E 3BJUA 1FVIA 3E0EA 3NPFA 4P2CB 5IYCG 2M0OA 2UUCQ 1Y8OB 1D7QA 3CD6T 1MIUA 1A8VA 1YHBA 1G2TA 1QUQB 1Y1WB 4F04B 3GBQA 1N8RU 1SE3A 1TXYA 4KHZA 4UHVA 1P92A 1GFDA 1K8OA 3HFZB 3LH5A 2D0NA 3L2UA 1Y69U 4DV1Q 1JE5A 1KABA 4A3JG 1LO5D 3CCMT 3I2ZA 4I7ZC 3LLRA 2E1HA 1NZ9A 2RQRA 2EVRA 2OAWA 2V8KA 1B9MA 1KNEA 2KXDA 1QP2A 3S15B 5D3DA 2HCKA 3NHNA 3UA7A 2F5KA 1UE6A 4IQZA 3PV0A 1Q81U 1VQCA 4PG3A 3R8BA 1Q7YC 2YLBA 4HVVA 2K01A 4C2MB 1Y1VB 3MEWA 4XIGS 1FYNA 3I8ZA 5HY6A 1YJ9T 2AWOA 2PVOB 3TN2A 1BKBA 3RIRA 4DR2Q 4FXKC 5C4JH 3NE5B 1VQ6Q 1GUGA 4YHHQ 3T1HQ 4FU6A 3C12A 1K9AA 3J80E 4PV1C 1UUEA 2DLPA 1IHZA 2K28A 5IT9c 5GAN8 1VQEA 4DAYA 4ME7A 4DNTB 1IBLQ 4B3SQ 3BW1A 2AUJD 1QWYA 1II3A 2KENA 2O5JC 2CSQA 5LL6S 1L2FA 3CHBD 1NSNS 5KYIA 2K33A 4PZ6A 4B3TQ 1A6XA 3CC7T 4R4TA 1KHCA 2R58A 1S5BD 3S16B 4BDZA 2R93G 2CH4W 2RHXA 1NTGA 3BZKA 4O0AA 3NFCA 1X32A 4GKJL 3I70A 5FLXE 4DA4A 4RHRA 2DPPB 3PMTA 1IW7D 1WTPA 1GHKA 1FMKA 4H13C 4OX9L 3E9HA 4QB4A 2FG0A 5G3LF 3GTLH 1X54A 2GFAA 1LT6D 4M1UB 4J7FA 4ZK9B 5LMNQ 2JA7H 1BYMA 2KYMA 1I07A 2L3QA 3BDCA 4DAYB 2PU9B 2IPOB 5GAMe 3MEHA 3CQZB 1O7ZA 1N32L 4E7SA 2E5LL 2NUPA 4F17A 3OYHA 1JJCB 4NDXA 1EIYB 2DNEA 2CWAA 2YRVA 3KF8A 2E2HH 2XVSA 1SNOA 2WV6D 4IALA 1RLPC 1TWBA 1QJOA 5GMKi 1AP0A 3MP6A 1O7LA 1TWCH 3PVLA 3M4GA 3FEOA 2ICEC 3OTOQ 4GNXA 1WPYA 1JMCA 3FB9A 1WCMG 5E3FA 1VDZA 3I5SA 2E2DC 3CBOA 5IIFA 1EOTA 4XU2A 4LW1A 4C8QA 2IG0A 5GAMf 2X51A 2NUTA 2K52A 2LQNA 4M7AA 2NVYB 5FO7B 3X20B 2D5DA 5BN5A 1IW7C 2RJEA 2BE5D 4L6V5 3OS1A 1I4XA 3L0OA 4DUZQ 1AFPA 3JCMW 1W4SA 3PTAA 1RL2A 1Q82R 3RKYA 3I56T 4XQ3A 3CCVA 1WCMH 2HCIA 4VUBA 1KQ1A 1RJTA 4J6HA 2WIIB 2XD0A 1AE2A 2AMCB 3GOXA 3KF8B 4A76A 4RCBA 1EWIA 4A3DG 4A3CG 2N88A 3RUZA 2EYXA 2KHJA 1VQGA 4JI1L 5C44H 4KGZB 5T1IA 1D1IA 4KY5A 3F70A 3GTKB 2YHTA 3OYCA 2UUAQ 3OYYA 2EQIA 4II1A 4RTWA 1RD9D 1QNKA 1KC8C 2PQAB 2K79A 4C8QB 3UPUA 2V4DA 1YNJD 1QB5D 2NUTB 4M7AB 1STHA 1XWEA 1PXUA 3A8OB 3KF6B 4J1MA 3H3VH 4J9IA 2L8DA 4A4EA 3G4SA 5JPMC 4LDXA 1UGPB 3WVEB 2J06A 3A8MB 4JG2A 2NLUA 2RHUA 4IPHA 3QUIA 3VR5A 3CMEA 3UATA 2K5WA 2BE5C 1XOVA 2PQWA 1QCBD 4X9CA 3G7LA 1PKSA 4XDXA 4DAPA 4TVRA 5M3MH 1GOZA 1LCKA 1UUPA 3X25B 2RK1A 2ZAEA 4JUVA 2RB6A 4OONA 2K5IA 1JB0E 3FPUB 1DD2A 2VNUD 5E1FA 5C0XJ 1K0SA 3EQLC 3ITPA 5IP9G 4EPCA 2AQ1B 4B3MQ 4PJLA 2NBFA 2KJXA 3CAMA 1PRTF 4DV1L 2P84A 4LK1C 1Q46A 2RN8A 5M5XH 4E47A 4IPGA 4DKAC 5CV6A 2R7ZB 1QLYA 1S5ED 8ATCB 4N8FA 2PW7A 4YCUA 3K57A 3R6OA 4GLXA 3J81i 4DR6L 2QEXQ 1WTXA 4CJ0B 1E2ZA 4K8JA 1TIID 1YI2Q 2Z4IA 2SEMA 1YNJC 1ML0D 3CCSQ 1SEMA 2LZ6B 4EX5A 1CKMA 3M0SA 5IP9H 4E6IA 3EG9B 1W2BP 1VS0A 1NM7A 5IGBA 4POFA 1UDLA 5CYUA 2RCNA 1WVLA 1VYTA 2NVTB 2QKIC 2B2YA 3MXUA 3TEHB 3HOYG 1XNQQ 4KKSA 1ZUKA 4DV6L 1NBWA 2X4WA 3HOUG 3PO2B 1U3OA 1EYGA 5LJ5e 4GN5A 1D1KA 4C5HA 4AYBB 2Q8IB 2KUMA 1IB8A 4U68A 2C0TA 4KI0A 4HCKA 4ZN1A 5GAN4 3TMEA 3QDFA 4Q5WA 4IKFA 4LF7Q 2EJFA 4RGMA 5GAMd 2WAQE 2CH4A 2QEXA 3OYNA 3JSCA 1D6EC 5EBCA 4WCIA 1HQMC 1KD1U 2EYQA 3V7CA 2BCOA 3CXCP 2L11A 4BA2I 1HK9A 3HOUH 3CCSA 2EQMA 4OMOA 1ET9A 2DUDA 4RG2A 2DJGC 3P20A 5I2SA 4FDBA 5IWAQ 1U1TA 3JV3A 4HMJA 3LW5E 1Y1WG 1IREB 1D3BA 1SXTA 3AFPA 4B3RL 4GS3A 5E7NA 2SRCA 3G6JB 4DNRB 4A3FH 2LCLA 3B6YA 3FDTA 4DOWA 4ZGDB 1W6KA 4WJ3M 4K0KQ 1QCFA 3JCMQ 2KRNA 4PFZA 1A63A 1IBMQ 2QDYB 3TS0A 2M9UA 1F77A 3E1SA 3PO3B 1ZLMA 2KY9A 4A4HA 1CKOA 4FO2A 4ZKCB 5K36G 3GV3A 1V8QA 1IBKQ 5I6YA 2IHEA 3M3YB 1Y1WH 1M8VA 5CV4A 2O31A 3GNFB 3OQ5A 5LJ3g 5D65A 2WFWA 3EH1A 1Y1VG 4IZ8A 3GTOH 4LUZA 5E4WC 3C94A 1EL0A 3OW7A 1D0ZA 2AT1B 3CRLC 1VQIA 2MAMA 2FMMA 4Y28E 2EYWA 2KEEA 1PHJA 1CQFA 1P8LA 3C4SA 3VYGA 1HSQA 1L1OB 5IODA 1EYCA 2AKWB 2B2TA 4HMIA 2HL3A 1FMVA 4JBJA 5KRUA 1IZ6A 1GO3E 1U5SA 2VQFL 5M5WH 2KEAA 4JRIA 2F0EA 1OX9A 4JI8Q 2JA9A 4C2MH 3M4PA 4JCVE 1W1FA 4FT2A 5I21A 1K8AR 2KCMA 1HUMA 1SSHA 1K9MR 4HJ5A 1UGRB 5JVG3 2O88A 1NJIU 1PYWD 2KECA 4OB3B 2K6AA 4IFDJ 4G7OC 1T5XD 2ZXOA 3VS1A 3F8TA 1QNUA 4CC4B 2ES2A 2QTXA 4IURA 4IUQA 2KHIA 3IRBA 4LUVA 1OXUA 1KG1A 3JB9J 1BOSA 3MCAB 1FGBD 2Q2HA 2M0YA 1PFSA 4J9EA 2KGTA 3H09A 1A2TA 3J7AV 1X01A 4WTOB 2DERA 3S16H 4MTKA 4C92A 1NYGA 3H94A 3CCLT 1EWCA 3QIIA 2EJ9A 2P0KA 2M00A 2OQKA 1FJGQ 3GTGB 3KUFA 2K50A 5CR2A 1DZ1A 3CCRT 2DGYA 2JEBI 3RMQA 2LRQA 2DYBA 4P75A 1OULA 3CPWP 5CMDA 2PUKB 1NE8A 4OB2B 4KD3A 2F0MA 4BBSB 4RGNA 1GUTA 2G9DA 5IHKA 2DL5A 1PTOH 2XNAC 4N0AA 3SK8A 5FLMG 3C95A 3L2RA 1HTLD 2UXBQ 3F2CA 5IXFA 1A0NB 4JBKA 2DNCA 1VA7A 4Y92A 5FKAC 4KJNA 1MGQA 2RM4A 4M78A 3GTQH 3H3VC 1D1BA 2RHZA 1HJPA 3SFMA 2LS01 1N9RA 4K5VA 1PH7A 4BDYA 3CCET 3ULJA 4A3GH 4KTAA 2KOLA 1KIXA 2Z6KA 1OU9A 5J3BA 1E3PA 4UY8C 2E5KA 1JWSD 3TP6A 2AHJB 2UXCQ 1S40A 1N6AA 1Z9FA 2EY5A 3PF4A 4ZTFA 1TR5A 3OMGA 1X2QA 4QIWB 3KJPA 2BZXA 1EZZB 1ZUUA 2QA4Q 5KNCA 5DLQE 3U9OA 4JW0A 3S3MA 1J5EQ 2NVYH 1IKMA 2L2PA 2LNVA 4E7JA 4DV4L 1KLUD 4J83A 4A4FA 5IT9E 2X9HA 2LY7A 2XDBA 1U0LA 3A7LA 3FVQA 4L5SA 4A3KB 4M78B 3CCQT 1PCXA 1E6HA 1ASYA 1EY9A 4C8QG 2ED1A 1GJXA 4M7AG 1VQKQ 3RR5A 3PT9A 1U4MA 3PE0A 5CKDA 3JCMc 3C46A 2AK5A 2B8AA 2EBPA 4OMFB 1O75A 3RD4A 3GTKH 2OWOA 2LDMA 1MMAA 2KRSA 5GAN5 1Z47A 4X3TA 4MHEA 2V1RA 2WP8J 2QA4A 1M1KC 2JM8A 1M5Q1 1QVPA 1ILPA 3J81L 5KE3A 2W0ZA 2ZT9C 3HFOA 4OMLA 4JJNK 2JN0A 1R9TH 5GMKm 2A6ED 3X3NA 5CKFA 2DXBA 5CKEA 5EQ0A 4UPAA 4QVZA 1XMOQ 1HNZL 1V29B 3CBPA 1QE6A 1ICFB 1HQRD 1PMRA 2NTSA 1XPUA 4FIBA 3VS0A 2R7ZG 3AEVA 1VQKA 1H9JA 1K4US 5AT1B 1WTRA 3LWHA 3C1EA 1T9HA 2RI5A 3S24A 2A5HA 2Z9HA 3RN5A 1IL2A 1LTGD 5M5YB 2VUMH 2Y0SE 4R1JA 3J7YW 2VYTA 3REBB 3RZOB 1WTWA 4NW2A 2R7ZH 3WVDB 2DO3A 1J9OA 3PO2G 3TP5A 5HK0A 2IVWA 1RUWA 1U06A 3CP0A 4AYBG 5H1SE 1M27C 1DGSA 1VQOA 2WACA 1Y8PB 3C2PA 4MMKA 2OJ2A 2VB3X 2EJGC 1KC8R 2HBWA 4N9PA 2A6EC 2J6KA 4HN7A 2NVTH 1EUJA 5DM63 2JXBA 4FT4A 2Z8LA 3A54A 4KKTA 2DN8A 4PMWA 2PZUA 5ELNA 1B7TA 1SE4A 3TZDA 5C0XI 4LE9A 4AFUC 1VQLT 2H8HA 1UGSB 5EPJA 1D0XA 2KMTA 4JJCA 2R92B 1MI2A 3MXGA 1K83B 4JRPA 2MCNA 2PYKA 3NGPA 4F14A 4ZYSA 2C0IA 2VGMA 3MZ5A 4ZUJA 1TUDA 4K5XA 5D3IB 2C35B 2Q2UA 1H3ZA 2XTIA 4J9GA 4AFZC 1KXLA 1GXIE 2CDTA 2EFIA 3TCJA 1VIFA 1XNIA 3I4NB 3PO3G 4R4OA 4DBFA 1HUNA 3ERQA 3J80c 1N8RR 4NOYA 1EQRA 3AT1B 5GMKl 1OV3A 3HP9A 4FCYA 2K5VA 2QEJC 3CCJT 2Z6BA 2R57A 5C5MA 4DV5L 1MMNA 2XRSD 1DJRD 1JORA 1JC7A 4JV5Q 2DXTA 2F1MA 1MMDA 3QOJA 3PMFA 1VQNA 1K8GA 1Y96A 1IL8A 1N36Q 1F2LA 3V96A 1QWFA 3TDQA 4J6XA 1DM0B 3TQ7P 4YWLA 3OYDA 5CO7A 2L0CA 4FNFA 5EC7A 4AH6A 5FLXc 3T1YL 3GIBA 1RABB 4KN7C 5L8RE 4GOPB 5J1ZA 1FXXA 2AWNA 3HPWA 3QO2A 3Q1JA 1H95A 3GTPH 4X9DA 1IYUA 3BE3A 1DONA 1AE3A 3A7AB 4J8QA 4LMQD 3GTJH 3H91A 3OYBA 4JYAL 1LJOA 4MDWA 1VMPA 2HDLA 3TP7A 3JB9F 1FL0A 2F4VQ 4PZ8A 1PH4A 2CKZB 3HRUA 2EY6A 4C8QD 4N4HA 3LWIA 4M7AD 5CK9A 2E8GA 4OIJA 1SBBB 2CCZA 5A0LA 4P73A 1W3SA 1YCSB 4FF2A 3VA5A 3PUVA 1HFNA 2I0NA 1SNDA 3UI2A 1YIJQ 2R7FA 4M75F 3EG3A 4DK3C 5FJ8G 1NPPA 2CP5A 2EQUA 4HXJA 3DXJC 1H3HA 2NYZD 5AFWA 2FPDA 4JI4L 1V43A 5I22A 3SHWA 2YLCA 1QVFS 1DXMA 1UG1A 1SRMA 5GAMj 3D31A 3HTRA 4KLKA 4R4QA 4BBSG 5KYXA 3A74A 2QTVA 2PI2E 4OXPA 3CEYA 2CREA 1YJNT 2NWGA 2AQ2B 5FJ8H 1OX8A 3GTGH 1S72T 5CKBA 2HSPA 4DAMA 1R8OB 2O5IC 4DK6C 5DY9A 5GMKh 2YUPA 1KIKA 3K5OA 4DFAA 4X3KA 1RTOA 2W10A 4WJWA 4C3IH 5C3WA 1KFZA 1U9RA 1WTHA 3MC0B 1TS4A 4HR7B 5CBAE 1TKWB 1Q82C 1RTNA 4M7AC 3RMHA 2KT1A 3W1GA 1DOLA 3SVMA 4EMKB 1WHJA 2E2HB 1HHVA 1Y71A 4ZNXA 3X28B 4ELYC 3WXMB 1CT1D 2VC8A 1PH2A 3GTLB 4OMPA 2WINB 2KR3A 1X56A 1N32Q 1T0HA 1ZSGA 2A7YA 2CQAA 5GAOq 2JZ2A 3QJ6A 3VS3A 3PVQA 4PJOE 2CWPA 2MHVA 1U8RA 5KYXB 1LM0A 1WQWA 4ILWA 4MNOA 1LTAD 1CHQD 2WAQB 2KI7A 3G6ET 3G71Q 4A3KG 1XNRL 3VYSA 4GLMA 4M78G 1KDAA 4BE1A 4FSSA 3TSZA 3EFRA 5CQYA 4QVDA 1AD5A 2BA1A 2JOYA 3J81j 4IO9A 4Y52H 2A6HD 2ZPGB 1M2VA 1GCPA 3V8LA 2JA7B 4AQYL 3QBYA 3V8KA 3F1ZA 5GJWB 1B34A 4DF7A 4F7UF 5JOBA 1EQVA 1B70B 3I91A 1ARKA 5COYA 1ACMB 4RTUA 2B3GA 1Y57A 3ULLA 3DWAA 2Q8TA 2K5HA 1BCPB 3HOWH 1NYFA 4OGEA 5IYBG 1FWZA 4X62L 2K4KA 4A3MB 4A54A 2M02A 1PSEA 2CZ6B 3CC2T 2K5FA 3G71A 1X43A 1XTDA 1IXDA 3SWNA 1A3TA 1E1TA 4MZTA 3VKIA 2B8GA 3GP8A 1VF5C 1D1AA 2P0PA 3H9NA 2J4XA 1W70A 4F16A 2K5QA 3E0JA 2R6GA 3N52A 1YNZA 1UGVA 4LUOA 3EFOA 1XYIA 1B7YB 3HKZE 4R55A 4NXNQ 3GTMB 1M2VB 1XX8A 1G3SA 4LF9L 1WJRA 1VQPQ 5C44B 4HCCA 2XU8A 5FOBB 4M7DE 1VQMA 1Q7YU 2JK8A 2B2UA 4CDFC 5K5PA 1SF9A 2A6HC 3OYFA 3NP8A 1Q86R 1BK2A 3EN2A 2FHTA 3V8JA 1JOKA 1Q3LA 1SSFA 1YITT 1VQ8Q 3MJXA 1F9SA 1WD1A 4O1NA 3FJPA 1OEBA 1ZSZA 5D6YA 1UE7A 2IHFA 2QGQA 1RLQC 4PLLA 3FC3A 2E3HA 2JTMA 3KFVA 1ABOA 3SWNB 2B2YC 5HK3A 3PSIA 5C4XH 4LDUA 1V76A 2NZHA 5M3MB 4GY5A 3KUPA 3FEWX 3EFOB 4YY3L 1I81A 3RZOH 3CC4T 2NWMA 1LTBD 2N8NA 4JOIA 4UP7A 4ELZC 4JI3Q 5FU7B 2HIVA 2EKOA 4LF4L 1KRSA 3PUWA 1QVFA 1VQBA 3V2TA 3MEFA 4DR6Q 2SNSA 4NB3A 4KV6A 5LL6X 2R92G 3HOVB 1LNXA 5A0GA 5AJ3L 5A0DA 2DY7A 4B9XA 1EQTA 1BU1A 3TZUA 1VQ8A 1NMGA 1OZ2A 1H641 1WXUA 1M1KR 2X3XD 1L1OC 4I65A 1PH9A 1PFBA 1QOHA 3SHLA 2DE0X 3I4NG 4H7BA 1EY8A 3S14B 2WB1E 1XMQL 1VQ5Q 4GLAC 4H0LC 2R92H 2JT4A 2YXYA 1Y07A 1K83H 2HNIA 1V1OA 1YHAA 5CC4A 2FRWA 5LMUL 2YTYA 4M75C 1WZOA 2X4XA 4RTXA 2JP1A 2FXQA 1G291 3I4NH 1NEGA 3AYHB 2FEIA 4GKKL 1IYJB 3VUZA 4X3SA 1H8KA 2LQWA 5JJLA 4PK4A 1S4ZA 4XTXA 1V1CA 1IYVA 1SYEA 2ZM6L 2O4XA 2QXFA 2K2VA 1MV0B 1ZXTA 4C92E 2RHQB 3FHWA 2Y4XA 2B2TC 1KDCA 3UWNA 2PUOB 3KLWA 1SE8A 4IUTA 1VQ9A 2CP3A 1K9MC 3L2WA 1VQ5A 2XK0A 4ZQ3A 1K73C 2X4JA 2RF0A 4A3FB 1STAA 1WXTA 4DR4L 3QZ9B 4M78D 2DYIA 2XRQD 1X3FA 1B2TA 1CKAA 2OI3A 2F0OA 3AU7A 2HZYA 3S2HB 1TSFA 2R5MA 4RUGA 1O80A 3EG1A 1EIHA 2MO0A 5C3XA 2E75C 3RUXA 1NJIR 3PMIA 4R9WA 3HEJA 2DVJA 1TS3A 5KGUA 4GN3B 3JCMP 1JCKB 2F0PA 1PLFA 4CJ1B 1ZQ1A 4DA2A 3I35A 2GN5A 3M0PA 3KLSX 2F0TA 1M30A 2EY2A 2MP1A 4G4KA 3GTOB 1LT3D 3JAMi 2VQFQ 4IUUA 2F0UA 4P74A 1FYCA 4XTVA 4OWTB 4DV3Q 5T1GA 4KUDK 1LT5D 2QCPX 4ZN3A 5IH2A 3JCMX 3PCOB 4A4KA 4Q5VA 4AMCA 4C3JB 3RERA 5I2XA 1BCMA 2G5DA 2EYLA 3HZXA 2DA9A 4DU9A 3GQBA 3SK6A 4JI0L 2CW0D 4JI7Q 4ZKBB 2Z0SA 1TOVA 2ZPEB 3KOJA 5M5WB 2VV5A 1Y0MA 4XAXB 1BI0A 3META 4JLGA 4N0AC 3UDCA 3M7GA 4WORA 1RAIB 1UWVA 2MFIA 3WDNA 4A3LG 1FGUA 2Y0SB 4DBHA 4UC4A 3VRYA 2FRYA 3CCUQ 4A93B 4M78C 2PMZB 5I2MA 1GBQA 1C6VX 3MKDA 3CCVT 4K6DA 4RG1A 1EIFA 2JMCA 5GMKe 4CDDC 4DK1A 2L4NA 1WTVA 2Z6KC 4KHVA 1YJWT 3PQIA 1HNWL 4JI5Q 5I9PA 1WX6A 2CUDA 3VR6A 4MDXA 4DXFA 2KROA
chains in the Genus database with same CATH topology
4BI4A 2JA7G 4A3LH 2YV5A 2WAQG 2I5MX 3KJOA 3S1MH 2A19A 2YTXA 5GAGC 1JRIA 2E2HH 2MWOA 1Y7XA 5GAN3 3G4ST 4M77E 3CCUA 4GLVB 1VQ6A 4X66L 2QQRA 5GANg 3KDFA 2V1CC 3U4VA 3CMET 4LDWA 4J7IA 4TQUS 1J6QA 1B8AA 5IY0A 1U1SA 4DV2Q 4QQDA 5D6XA 5LJ3h 2VQEL 2CKKA 3L2QA 3CF5A 4A3MG 1M9SA 4YTLA 4DV4Q 2ZTCA 4HJ7A 4DR1Q 4LFBQ 3HKSA 3KDFB 4LFCQ 2GFUA 5C44G 5GROA 3GDEA 4A3MH 2JA5H 1RI0A 2UU9L 2WSCE 1UGQB 2GVAA 2BH8A 3H6ZA 2UUBL 2G3RA 2PI2A 3GTMH 3NBHB 3OS0A 3ZEHA 4GNXB 2RHYA 4P71A 3FP9A 1VQAA 2VL6A 1C7YA 1BI2A 2QEXT 5CKHA 2K14A 5M3MG 2KK4A 1YJ9A 4A3EH 4HT9A 3D0FA 2HQXA 2HHHQ 3OS2A 4XU1A 3HOVG 2HQEA 2PNHA 2VW9A 2JUFA 2XHCA 5GAEC 1K3RA 4PJOA 3K7AH 3K7UC 4IJHA 2LXKA 3JCMV 2ALYB 4GOPC 4A3IH 1N8RC 1OZ3A 2OTJA 2QQAA 1QW1A 3HOVH 2R7DA 1V1QA 2RF4A 2DJZA 1BBUA 4BA1I 4X64L 1MKHA 3ULPA 1PH3A 4KBMB 4XTYA 4BI3A 4LDYA 3QDRB 1Q81C 4OWXB 3S14H 4JI2Q 3AHUA 3ZBDA 2RO0A 4DV7Q 4LF8L 3JCMg 4PJOB 3DB4A 2LTOA 4IUPA 3VU3C 4YCVA 4JBMA 4KHPL 3H3VI 4A3FG 3M53A 5IE8A 1WJQA 2FYKA 3TREA 5ELOA 3U58A 3VJPA 4M7DA 4DV5Q 2RH2A 1WOCA 4BI8B 1YI2A 1YHQT 2JVVA 2JTFA 1VQ7T 4C5IA 3DM3A 3S2HH 3LH0A 4LF5Q 4QJFA 2L15A 4EMKC 2XKOC 2MNAA 3S3OA 1WNLA 5IP7H 4QGUA 3OB9A 2M1HA 4XK8E 1YCYA 1VQ4T 4M7DB 1K0RA 5GAOr 4J15A 2Y0SG 4BUGA 4A93G 4E7IA 2B63H 4ME3A 4C3JH 3QJYA 3I55A 1D3BB 3CBMA 5KCOA 3ZJYC 2DTOA 4IUVA 2ZCFB 4RMOA 3H0GH 4C3HH 3HHTB 4DR3Q 1BI1A 1MJCA 4A93H 2E2JH 4JI4Q 1OYXA 2A1AA 1HR0L 2OTLT 2E70A 4GLKA 3JCMf 3EAEA 2HQLA 2QQ9A 2LC4A 5BR8L 2VS1A 3E9GA 3OSSC 1N33L 4ATOA 4BD3A 3S17H 4A3GG 3A0JA 1OXXK 3OW2S 3K80C 3PGZA 1NPRA 5LJ3e 3ME9A 3OY9A 1VQKT 1TWFH 3N5BB 3HOZH 1SRUA 3M85A 3SWNC 3BU2A 4B3SL 2DXCA 3JCMJ 5HGQA 2KQWA 4C92B 3CMAT 1VQJA 4B3TL 1Q86C 5FU7C 5DLOA 4JDSA 2E12A 3M55A 1GD7A 3M4QA 1XQHA 4DPGA 5LJ3f 2BIVA 1OXVA 5GAN2 1VQOT 1VUBA 3GLXA 1E1OA 4A4IA 4Y7NH 2P0QA 2GQVA 2PVDB 5CQXA 1PYSB 2F5TX 4ALPA 3OSVA 2GVBA 2WSEE 1JBMA 3UDIA 3OTOL 4C8QF 1X6OA 3RNUA 1AH9A 4M7AF 3P8BB 2HAXA 3K8AA 2VUMG 1VQFA 4M77A 2RI2A 5GAN7 2D0OA 3LGJA 4DUZL 3UDXA 2DZ9A 3HFNA 3H8ZA 3T9NA 1VQNT 4POGA 5C6SA 2UXDQ 1G3YA 4LF4Q 4JI6Q 3J80i 3M58A 4IPCA 4PJOG 1S3OA 3CCRA 4R56A 5AJ3Q 4MZMA 3LX7A 3NEMA 3TQYA 1X3GA 1BIBA 2EQSA 4OVAA 1Q82U 3E19A 2CS7A 2K75A 2XG8D 1JJ2S 4M77B 4DR7L 1XMQQ 4H02A 4NPSA 1Q1BA 3I4OA 3OYKA 1NJIC 3OW2A 3QSUA 4LFAL 2DIGA 5LJ3d 1YVCA 4B3ML 2F3IA 3RLOA 4BBRG 2L3RA 4A3BG 3CCQA 1XPRA 3MP1A 1BVSA 1KRTA 5CIUA 3QG1A 4LF6L 4M7DG 4A75A 5CAIA 4IPDA 1SLJA 1WFQA 2HD0A 1XNQL 1G5VA 4BBRH 4A3BH 3UE0A 2DVEA 4LF7L 5GMKj 4DUYL 2MQHA 3GPLA 3I4MH 3AQQA 3PUZA 5IWAL 4JI0Q 3RKXA 2K5NA 3PGGA 1LYLA 1D8LA 5C3EG 1Y96B 2JEAI 4OF1A 1YBYA 3AFQA 3L7ZC 4HIKA 3FLGA 4HIOA 3KFUA 3HRSA 1HH2P 2NVQH 3G71T 4XTUA 2JE6I 5C3EH 2VXEA 4ZGJB 1O9SA 1AHJB 4BXXG 1L0WA 2D0PA 4P72A 4GKJQ 4GNXC 4OX9Q 1VQMT 4KULA 4JI8L 1YIJA 1HNXL 4C92G 4C8QC 3S6WA 1JJ2A 1KHIA 2KSSA 1VQDA 3STBD 1PV4A 4BXXH 3M54A 4PJOD 3G7ZA 3I7FA 2E5LQ 1NE3A 2A3LA 4BB7A 2VQEQ 3CCJA 3J81E 2LQ8A 2CFMA 1K8AU 3WWVA 3S2DH 3HOWG 3M5AA 1FJGL 2Y4YA 3OA6A 4D6WA 1PA6A 5C0MA 5J39A 1VQ8T 2B29A 2RJDA 4M78F 2UXBL 3S1NH 2QQBA 1WYDA 5GAHC 3U4ZA 3STBC 5J26A 1KQ2A 4PJOC 1VCIA 1BBWA 5GAOp 3U50C 4JI1Q 4HA8A 4X6AH 3UDFA 2UXCL 4AIMA 4M7DD 5FRMA 3OYEA 1LUZA 3L42A 1B34B 4XTZA 4OO1G 5C4XG 4LDVA 4NS5A 1J5EL 4EQ5A 4HJAA 1VQ9T 3DLMA 1P16A 5FRNA 4HJ8A 1HR0W 4M77G 5GANh 3S1RH 2HBPA 4JRQA 2DZCA 2LCCA 1VQPA 2ZJPA 5JJKA 2LXJA 4X64Q 1BI3A 3ZFJA 4UP9A 4M7DC 1FX7A 2I5HA 1JB7A 1I94L 2EQJA 2EAYA 2CZ1B 3J7AF 4HJ9A 1XMOL 2ZPBB 1N27A 1OXSC 4E7LA 4DV6Q 5M3FG 4M75E 2BH2A 4KHPQ 3ERSX 2MMPA 2P4TA 1X75C 3ICEA 1UE1A 4YCWA 2RI3A 2AHOB 3OYJA 1M90C 4XTWA 5M3FH 3RESA 4C92D 3GO5A 3H15A 4NXML 4B3RQ 4GN4B 4NL2A 4JLIA 2DK3A 1SN8A 4RMFA 4WJ4A 2R5AA 1VQ6T 2EQKA 4RKUE 1N34L 3BY7A 4RCCA 2RK2A 4QQ6A 3RMSA 2QQSA 1KC8U 1I3QH 5HKCA 2O4XB 2ZPHB 5EG2A 3OBYA 4QIWE 2CGHA 4C92C 5IN1A 1V9PA 2KBNA 2FHDA 4LD6A 1QVCA 2QI2A 5IYDG 1HZAA 4F7UE 1A0IA 2V8JA 2MI6A 1WQ7A 1N36L 3RLNA 4C5EA 2DTHA 1HR0Q 3CC4A 3UT1A 4APVA 2C06A 1QVGS 3JCMh 2ZGWA 5GAOm 5LJ3j 1EOVA 3FKIH 5GAMg 1UE5A 4C0GA 2BUDA 5BR8Q 5IYDH 2YU9H 1KAWA 3RN2A 2F69A 1N33Q 1EFWA 3M4OH 5IYCH 4QL5A 3RLFA 3E9FA 1C0AA 5M9OA 2F4VL 2I0QA 4DV0L 3X24B 1OXTA 2D9TA 3VV0A 1GKHA 3A8HB 1VQHA 4O6JA 2E6NA 4A3JH 4M77D 1ASZA 4BACA 1I50H 3URGA 3VYHB 3TEEA 2CYZB 1KQSS 4L5QA 1EQQA 3BDUA 1A62A 4HKEA 2NZOA 3PNWC 2OTJT 3INZA 2JNGA 2JA5G 1X3EA 3JAMc 1I5LA 4PLIA 4FM4B 4ZTJA 2I5LX 2XI9A 3NENA 3M56A 3PIPA 1KL9A 2L89A 4M77C 2R93H 3HRTA 3CD6A 2HIXA 2OCEA 3GF5A 5GAOl 2JA8G 3OYGA 1MJEA 3QKJA 4A3EG 3P8HA 4C0DB 3CCMA 4R4CA 2NN6G 2K3YA 4OP0A 1WJJA 1OI1A 5JEAG 5FU6B 1PSFA 2PQAA 3MP8A 4TVAB 2JA8H 2DAQA 3KF6A 4E7KA 1YI2T 1HNZQ 2Q2TA 5GANe 3CCST 3O8VA 4ZGEB 3W1BA 1HZBA 4A3IG 1OTCA 1NMFA 3CPFA 2H3JA 1YJWA 1QZGA 3OMCA 4BE2A 3LGLA 5LJ5g 3CC7A 1QVGA 2K57A 3MEAA 5GANf 4NXNL 3OBWA 4EMGA 4A3CH 4PZ7A 3MO8A 1I8FA 4A3DH 1Q12A 2PVGB 4X65L 3A5UA 4DR7Q 4QY7A 3K0XA 2CCZA 3Q8DA 2Q2IA 4EMHA 1X55A 4PNOA 3I55T 2VZAA 1BIAA 4LFAQ 2LT1A 3SDZA 3A8GB 3NTHA 2X35A 4JI3L 4BY6B 1Q86U 2KCTA 4V2SA 2NN6I 3L2PA 2BA0A 1KQSA 4LWCA 2FL7A