1IZ6A

Crystal structure of translation initiation factor 5a from pyrococcus horikoshii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
136
structure length
136
Chain Sequence
GDKTKVQVSKLKPGRYIIIDDEPCRIVNITVSSPGKHGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKKTAQVIAITPDTVQIMDMETYETFEVPIDTGVADEIRDQLKEGINVEYWETLGRIKIMRIKGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Initiation Factor 5A
publication title Crystal Structure of Hyperthermophilic Archaeal Initiation Factor 5A: A Homologue of Eukaryotic Initiation Factor 5A (eIF-5A)
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Biosynthetic protein
total genus 28
structure length 136
sequence length 136
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1iz6A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1iz6A02
1Q1EA 1SRUA 1RL2A 3KYHC 2H5XA 3K7UC 3S1MH 4DR4Q 4JV5L 4X64Q 4GOPC 4AQYQ 1E1OA 3GTJH 1IBLL 2Q2TA 4OX9Q 4A3GG 1YJNA 4YWLA 3NENA 1EQRA 3PF4A 3JC66 3KF6B 1R9TH 2JA8G 1VQOT 3GO5A 2LSSA 4LWCA 5IYBG 1Q81U 5IP7H 4DV3L 3T1YL 5GADC 2JUFA 3OW2A 1K8AU 3A5ZB 4A3JG 1XJVA 1U0LA 5AJ3L 2VUMG 3LGFA 3S2HH 4POFA 2IX1A 1Z47A 1LTLA 1Z9FA 2MO1A 4YHHL 4UY8C 5C0XG 2Y0SG 1SN8A 3NELA 1QUQA 3CCQA 3NEMA 4KLKA 2B63H 2RHSB 1PVOA 1X54A 5JJKA 3MEFA 1OXSC 1CUKA 1D8LA 2UXBL 4A3MG 3J81E 4KHPL 3G6ET 2HHHL 3CD6T 1X3GA 3I55A 2HQLA 1QZGA 2VQFL 1PH6A 1B7YB 3GD7A 3K80C 5IP9G 3U4ZA 1KC8U 1L1OA 5M3MH 4IOCA 4A3CH 1LUZA 5J26A 5HGQA 2UU9L 4HIOA 2OTLT 1PYSB 1VCIA 3A0JA 4JI2Q 3JAMc 1VQPA 1YEZA 4A3BH 3HFZB 5GAGC 1VQ5A 5IP7G 4DV4Q 4GNXB 1V43A 3GTLH 1HZAA 4YY3L 4EQ5A 2LQ8A 2JQOA 2N3SA 3L7ZC 4JI4L 4IPCA 2VW9A 3KBGA 4JI8Q 2R93G 2UXCL 4DR5Q 2ZJQA 4LF7Q 2NN6G 2MQHA 2OTJT 1JJCB 1LM0A 4DR3Q 2RF4A 1A62A 4FDBA 2ZJPA 4JI6Q 4R4CA 1Q81C 1EFWA 2K75A 2YV5A 1Y1WH 2UXDL 1M1KU 3CC7A 4KHZA 2R7ZG 5DLQE 2I5MX 4GKKQ 4IFDG 3CXCS 4GOPA 4LFBQ 3KF8B 2D0OA 2AHOB 4IO9A 1CSPA 2KCMA 3I55T 1JJ2A 1KHIA 1NMFA 2IG0A 1E1TA 5M3MG 5IYCH 2D0PA 1X56A 3BU2A 1YIJA 2Z6KC 4B3SL 1VQ8A 3G4SA 1Y1VG 2NVYH 4R4OA 2WAQG 3CCRA 4HIMA 3U58A 3H3VI 4DV2Q 4JI7Q 3F2CA 1EWIA 1XMQQ 5M5XH 5JEAG 4DV5L 2JVVA 4A3IH 1BBUA 1VQPT 2PQAA 4DV1L 4EX5A 4JBWA 1N34L 2F4VQ 2HIVA 4NPSA 1KC8C 1VQ5T 4O2DA 3J7ZC 4LF5L 4A76A 3H3VH 3CC4T 3TREA 2XTIA 4TVRA 1P16A 4C2MH 5FLMG 1HNZQ 3HOYH 4BY7G 3CPWA 3JAMi 3GTOH 3I4NH 2JEBI 2QA4T 3W1BA 4DR7Q 2ZM6L 5A2QE 1CKNA 1Y1WG 4X65Q 3CCJT 5M3FG 4A3DG 1WCMG 1JE5A 3DB4A 2K5VA 1PV4A 3T1HL 1NJIC 3PO3H 1SFOH 3AYHB 3ICEA 3OYYA 4CRIA 2RHQB 4K0KL 4DAYB 3BZKA 4OO1G 4GN3B 3SGIA 2MWPA 5IYCG 4YTLA 1M1KC 2EXDA 1CKMA 1FGUA 2C35B 3I2ZA 3J7A5 4JBMA 3G4ST 1K73U 4DV7L 3RN2A 2WFWA 3CCMT 3CCRT 4DV6Q 4DR6Q 1KIXA 2MNAA 2E2HH 3RR5A 1VQAA 4AYBE 4LF4L 3KOJA 2LXJA 4H02A 4NXNL 4DUZQ 2AWNA 4L5QA 4BBSG 1O7IA 4YCWA 3A74A 2ZTDA 1G51A 3I4NG 2OQ0A 2B29A 1VQEA 4YHHQ 1VS0A 3OW2S 5IYDG 3BZCA 1WJJA 4A3LH 4RG1A 4BY1H 4LUVA 1AE3A 1HR0Q 3ER0A 2Z6KA 1EYGA 2UUAL 3K7AH 2R7DA 1S3OA 3M3YH 1QVGA 3KLWA 2HHHQ 5IT9E 1YI2T 1VQDA 4DV0L 1VQMA 1YBYA 1VQKA 1HNXL 3GTGH 1SROA 1K0RA 1OTCA 3PSIA 4OWTB 3PIOA 2MO0A 4UP8A 3UDXA 1L0WA 2PI2E 4TQUS 3CCLA 1I94L 4GKJQ 3M9BA 2UU9Q 3HOWH 4Y52H 2CKKA 1QVCA 5H1SE 3CF5A 1FL0A 2V1CC 4DR1L 4JI5L 3CMET 1JT8A 3L0OA 2E6ZA 2IHEA 1PHJA 4ME3A 3PO2G 2KCTA 4P72A 5GROA 1JJGA 5EAYA 3J81c 2JA7G 1K73C 4LF6Q 2JA6G 2PNHA 5BR8Q 2ZTEA 1FJGQ 2I5LX 2ES2A 1VQ4A 1PFSA 1YHAA 4A3LG 5J3BA 5FLXE 5JJIA 3PCOB 5C44H 1E7ZA 4YWKA 1P8LA 1J5EQ 2VNUD 1HNWQ 3P8BB 3STBC 2CWAA 2JNGA 2NVQH 2N8NA 1VQNA 2GVAA 3OTOL 4QL5A 4A3EH 4L5TA 4JYAQ 1BBWA 1U5KA 4TVAB 2VQEL 3RLOA 1PA6A 2R7FA 2IHFA 4B3TQ 2VS1A 1A8VA 1HZ9A 2JE6I 1IYJB 4P74A 1JJ2S 3CMAT 4X34A 1VQBA 3K8AA 1YJWA 2JEAI 1W2BA 1N33Q 2IX0A 4JG2A 1N34Q 1GM5A 3CCEA 4JI3Q 1JMCA 1AH9A 1TWGH 1PH2A 2YYZA 4L5SA 1Q1BA 4Y7NH 2MFIA 4IJLA 1UEBA 4NXMQ 3HOVH 2K5NA 4LF8Q 1VQ7T 1K3RA 1MKHA 2CWPA 3F2BA 4DUYL 4A75A 2UUBQ 3H0GH 2ZM6Q 2NVTH 2WP8J 1VQ4T 2L15A 5C44G 3CPWS 1XPOA 1K9MU 5C0XJ 4DK6C 3J81i 1XNRL 3T1HQ 1K8GA 3G71T 3CC2A 4AYBG 1YHQA 1KQSA 1IL2A 3M4PA 3A5UA 4A3EG 1VQNT 1C9OA 3CQZH 3HOXH 2R92H 2NZHA 1NTGA 3HKZE 4BXXH 3CCVA 3S15H 1SMXA 4B3RQ 4QQBX 1CSQA 4JI0Q 1YJNT 1GD7A 1I3QH 4O0AA 1PH8A 4HJ8A 2ZJRA 1VQ6A 4GLVB 4JI1L 4IFDI 3E9IA 2IT1A 3TS2A 1YJWT 4AH6A 1V9PA 1AE2A 4A3KH 2B63G 1QUQB 1TWAH 4IPHA 1MJCA 1E24A 4PZ6A 4UPAA 5ELOA 4HJ9A 5LMNL 3CCQT 4NXNQ 2R7ZH 1K8AC 3CCSA 2E2JH 4BA2I 3GTMH 1XNQL 4A93H 2E5LQ 1GO3E 1VQHA 3PF5A 4DK3C 3CP0A 3F2DA 4X66L 1Q82U 4GLAC 4DR2Q 1K83H 3J80E 1IBKL 3IRBA 3M4QA 3KDFA 1J6QA 1L1OB 3D31A 3CC2T 4A3CG 3LH0A 1YHQT 4R1JA 1I6HH 3HOZH 1E22A 4QQDA 4X62Q 3LGJA 1NMGA 5M5WH 5HY6A 3ULPA 1HNXQ 4IFDJ 4A3BG 4QIWE 4HIDA 1QVGS 1K9MC 1XPUA 1S72A 4JBKA 2EIFA 1X65A 4HIKA 2Q2HA 4APVA 2Z0SA 4A3FH 3M7NA 1NBWA 1Q7YU 5LMUL 2HIXA 3U4VA 1SE8A 5K36G 4P71A 1A63A 4A3KG 1BKBA 2CQOA 2JA9A 2XGTA 5JEAJ 3H15A 3AEVA 1X3FA 1X6OA 1OXXK 5IT9c 4DR4L 4X64L 3I7FA 4AQYL 3CC7T 2KHIA 1VQFA 4LUOA 4OX9L 2FXQA 4GOPB 4OWWB 2JA5H 1L2FA 1ASYA 5C4XH 4BA1I 4DV7Q 4WJ4A 4HJ7A 3S16H 4GN4B 3HOZG 2A1AA 3OTOQ 5IY0A 4JV5Q 1YIJT 1VQ8T 1S40A 1E3PA 1IBLQ 2VQEQ 1Q82C 1M1GA 4A3IG 1YITA 1UE6A 2PQAB 4OXPA 4DV3Q 2F52A 1NE3A 3T1YQ 4IJHA 4LFAL 3I56A 1PH9A 5AJ3Q 3FKIH 3HOYG 5FLXc 3TRZA 3HOUH 2KHJA 2PI2A 4PMWA 1CKNB 3HKZG 1W2BS 2LCLA 4KI0A 2K50A 1Q7YC 3PO3G 2UXBQ 4AIMA 1XTDA 1EIFA 4KHPQ 4JI2L 3RLNA 1HZBA 4C3HH 2UUCL 1NPPA 2VQFQ 5C4XG 5IWAL 3I4MH 1C7YA 4LF9L 4DR5L 1VQLA 4LF7L 3S1QH 1YZ6A 5LL6S 3GDEA 3PIPA 5FJ8H 3J81j 4DR3L 4UP9A 1KQSS 2CFMA 3BJUA 4GNXC 1N36L 3CW2C 2A19A 4JI6L 3RN5A 3PUZA 4B3ML 4GKKL 4YY3Q 1WFQA 4JI4Q 3EIVA 1C0AA 3UDFA 1I50H 4JI1Q 3NBHB 3RNUA 4LFBL 3I56T 2UXCQ 1HZCA 1DGSA 1SLJA 3PGZA 4A4IA 3KJOA 1IZ6A 2YTVA 2DUDA 3J7AF 3RZOH 4UP7A 4BY1G 3FHWA 5LMNQ 2UXDQ 4MZ9A 3RLFA 3E9HA 4LNQA 2JOYA 1XNQQ 4A3GH 4JI7L 1OXTA 1VQOA 1HH2P 2R6GA 2F4VL 4LUZA 1UE7A 1EQQA 3GTQH 1VQMT 1PH3A 5C0XI 3I4MG 1VQKT 2VUMH 4A3JH 1GVPA 4ALPA 2QGQA 1CKOA 4B3SQ 5LMNW 4RG2A 2CCZA 4K0KQ 2XHCA 3HOWG 3CCLT 1KD1U 3LGLA 4WJ3M 4DR7L 4DV5Q 3FP9A 4XIGS 5IE8A 4X65L 4DV1Q 4QJFA 1YNXA 1N9WA 4C3JH 5GAEC 4LF5Q 3G6EA 1XPRA 4ZN1A 2B3GA 4A3MH 5IAYA 3CD6A 3TQYA 3TEHB 2Q2UA 2DGYA 3J80c 1VQJA 2K14A 5IP9H 3PUVA 4JOIC 4IOAA 2KENA 2OTLA 1YJ9A 1OXUA 4JCVE 2BH8A 4YWMA 4LFCL 1QVFA 1Q12A 4DV6L 2RCNA 4DR6L 1UWVA 1YHBA 3GTPH 2NN6I 4DPGA 4GNXA 3G48A 4X6AH 1OXVA 1WOCA 3E0EA 4LW1A 2ZTCA 2WB1E 3W1GA 2MWOA 1TWCH 4DUZL 1PH1A 3PUYA 1PH7A 3GTKH 2R93H 2KBNA 2OTJA 3PV0A 3RZDH 3AQQA 1PYBA 2BH2A 2BA0A 5GAHC 4LF4Q 1TWHH 1MJEA 5C3EH 4P73A 2LXKA 4LFAQ 1HR0L 3KJPA 2NVXH 1TWFH 2QEXA 3CCET 1KRSA 1UE5A 1D7QA 3DM3A 1KD1C 3WWVA 3HOVG 4R4QA 3UDGA 2YTYA 5E7NA 3S2DH 3H0GG 3S1RH 1IBML 2PMZE 3PUWA 1Q86U 1G291 1Y1VH 4GKJL 2UUAQ 1YJ9T 3J80i 1M90U 2R92G 3HOXG 4ZN3A 4DV0Q 1H95A 2UUCQ 1WYDA 4NB3A 4BXXG 3CC4A 2I5HA 5IWAQ 1FVIA 3CCVT 5FLMH 1X9NA 1NPRA 4LF9Q 1NJIU 1EUJA 3ERSX 5M5YH 4LF6L 4BY7H 1HJPA 4DNIA 2QA4A 3I4OA 3DLLA 5BR8L 1XMOL 1I94Q 1FJGL 1IXRA 2JJQA 2VY3A 2NZOA 4RMFA 4J15A 3CCJA 4DR1Q 1N36Q 1VQ6T 3M85A 2YU9H 4JI5Q 4IPDA 5M3FH 2DO3A 5C3EG 4B3MQ 1J5EL 5DM7R 1WCMH 3CCUA 3KFUA 4A3DH 4OO1I 1HNWL 3L2PA 1N32Q 4JOIA 3ULJA 3K0XA 2QEXT 2EQSA 4OWXB 2OQKA 4A93G 2OWOA 4JYAL 3CCST 1B8AA 3MXNB 4B3TL 3S17H 1KRTA 1W3SA 5C4JH 1G6PA 1N8RU 3CCMA 3S14H 1KAWA 3KDFB 3CAMA 1VQIA 2F3IA 3D0FA 1VQCA 2LVMA 2ID0A 4XTCS 1PH4A 1N33L 3JAME 4JI3L 1VQGA 4QGUA 1Q86C 3EBEA 3PUXA 4BBSH 5GQOA 3ULLA 4NXML 3F8TA 3STBD 4LF8L 2OCEA 3M4OH 1S72T 1M90C 2Q2IA 3ZJYC 4A3FG 4C3IH 2UUBL 3Q8DA 5IYDH 3W5OA 1KL9A 1SR3A 4BBRH 4YCVA 3DB3A 4HJAA 2CKZB 1T9HA 2KVQG 3CCUT 1YI2A 2K4KA 1PH5A 1EIYB 1SSFA 1NY4A 2WB1G 2Y0SE 3UDIA 2E70A 1VQ9A 5ELNA 4DUYQ 4B3RL 5JJLA 4JI0L 2ASBA 3B6YA 2JA5G 1EOVA 2K5HA 1KXLA 4DV4L 1TXYA 2N78A 4MNOA 2KDSA 4OONA 1XNRQ 4LFCQ 2ATWA 3CMEA 4GS3A 4JI8L 1LYLA 1QZHA 1BVSA 4MTNA 3S1NH 3EN2A 4L5RC 4GN5A 3UE0A 2E8GA 3PO2H 1QVFS 1UE1A 2AWOA 2BA1A 3CXCA 4GLXA 2E2IH 1N8RC 2N49A 1YITT 2VL6A 1XNIA 3UE1A 4HJ5A 2JA7H 1MIUA 4QY7A 1B70B 2JA6H 2E5LL 2I0QA 3FKIG 4DKAC 4BBRG 4DR2L 2GVBA 3HOUG 2GN5A 4PZ8A 2L3RA 1Q8KA 2IY5B 1A0IA 4X62L 4R4TA 1VQ9T 2ALYB 4DV2L 3TS0A 1XMQL 2A8VA 4X66Q 1IBMQ 1JB7A 1YVCA 2G3RA 3KF6A 4P75A 2JA8H 4JBJA 1L1OC 3CMAA 5IYBH 1IBKQ 1HR0W 1Q46A 2HT1A 1N32L 2D62A 1HNZL 1NZ9A 1V1QA 3HKSA 1VQLT 5FJ8G 4YCUA 3VDYA 4JC0A 3CPFA 1Y14B 1ASZA 1WI5A 4IPGA 2WAQE 2AMCB 4PG3A 3U50C 1VQ7A 2AKWB 1XMOQ 4POGA 1X55A 1GKHA 1RIPA 3F1ZA 4R4IA 2K52A 4PZ7A 1X3EA 4DAMA 2YTXA 3S24A 2JK8A 5LMUQ 2VZAA 3K81C 3G71A 3AFQA 2MI6A 1I5FA 3AFPA
chains in the Genus database with same CATH superfamily
1CHQD 1Q1EA 1SRUA 1K83B 4DR4Q 4O1NA 5A2QL 1IBLL 4C0GA 1YJNA 4YWLA 2CUBA 2L55A 3JC66 3KF6B 1R9TH 2JA8G 3GO5A 3RIRA 5IYBG 3CMAQ 4M7DF 1SXTA 5IGGA 5IP7H 2JUFA 3OW2A 1K8AU 2ICIA 2RSOA 2F0VA 2JS0A 5AJ3L 4N4GA 1TU2B 2D9UA 4A3FB 2ENBA 3NEMA 2E3IA 2KQ3A 4M7DE 1UJYA 1QWFA 2P5ZX 2RHSB 3TP8A 1X54A 4C3JG 5IIFA 2QCPX 3TMEA 2HHHL 1SYBA 3M0RA 3PIP3 3CD6T 1KJWA 3QOJA 1FMWA 2X35A 4CDDC 1QZGA 2VQFL 1PKSA 3QG1A 1RAIB 3U4ZA 1KC8U 1JB3A 1L1OA 1STYA 4IOAA 2O4XA 3HRSA 2EYLA 3A8LB 2X6GA 2UU9L 2EOTA 3JAMc 3MEWA 4B9WA 4A3BH 2E10A 3KK7A 2PNRC 3RBBB 3CHBD 4GNXB 1HZAA 1X01A 1ILQA 2MAMA 2OI3A 4ZAIA 3OYFA 4DR5Q 1JCKB 1N9SA 1HA5A 1LTTD 2OTJT 2MQHA 1E7OA 4MDWA 4IKFA 4IUVA 1A62A 2RF4A 3QO3A 5KYXA 5EPJA 4DR3Q 5CR3A 4JI6Q 3HFNA 2K75A 1Y1WH 4RKLA 4M7AF 1GL5A 4BBRB 1MNEA 4GKKQ 4C5EA 1LOJA 2B8AA 2HSPA 1EOTA 1K1ZA 1BB9A 4RTWA 3CXCS 4GOPA 4LFBQ 2D0OA 1H9SB 2B8GA 1CSPA 2KCMA 2F5KA 4DBQA 1JJ2A 4M7AE 2OAUA 3K5OA 3KLSA 5L23A 1X56A 5M3MG 4J9EA 4RTYA 1VQ8A 4EGVA 4C3HB 3G4SA 1F77A 4HCKA 4R4OA 2WAQG 3FPPA 5FLXL 1LTID 4HIMA 4K0KL 3I4MB 3F2CA 1XMQQ 2MP1A 5CAIA 1DJ7B 2LTOA 1WTHA 1V1OA 3HS0C 3R93A 2QXFA 1VQ5Q 4EX5A 1V76A 1BBZA 2XIWA 3H3VH 4Z8AA 2A6EC 4C2MH 1B34B 1NR2A 3I4NH 4ATOA 2JEBI 2RHYA 2QA4T 5KYXB 3SHLA 3W1BA 5KYLA 2LX9A 4HVVA 3CC7Q 5M3FG 3GPLA 3SK8A 4A3DG 3MVVA 1GJXA 1O7ZA 4P2CB 1WD1A 5GMKl 1NJIC 4ZRZA 3L1AA 2ZGWA 3PO3H 1Q81R 4U68A 4XTZA 3BZKA 5D3IB 3FRNA 5GAN8 4B08A 1CKMA 4UHVA 1OO9B 4NW2A 2K7VA 1I4K1 3GTQB 2R57A 3G4ST 5LHY1 1PMRA 3SWNA 4M7DC 1KIXA 1PD0A 2MNAA 4YIJA 5LJ5h 5CR2A 1AFPA 3OW2P 4M77G 5CV7A 3GBQA 3AB9A 4MIUA 4NXNL 4DUZQ 2AWNA 4L5QA 4BBSG 4C3JB 1GBQA 4GLKA 2ZTDA 2OQ0A 2B29A 2O88A 3IFDA 1IKMA 1VS0A 2ECZA 1SNMA 5IYDG 3H09A 3OPOA 5HGTA 2A3LA 2DYBA 5IXBA 4A3LH 1RCVD 1KNAA 1Y8NB 4DBRA 1EEID 3RUXA 4BE1A 2ZZDA 1S3OA 1UB4A 1BCMA 1LPLA 2VB3X 3EFSA 2F0OA 2GTOA 1YBYA 5KYNA 4HKEA 3NK9A 1K0RA 4J9CA 3H6ZA 3OYNA 3SEMA 3CCLA 2EJ9A 1TUGB 5CBAE 4Y52H 3J80L 4IUPA 1QVCA 3CF5A 2V1CC 3BDOA 4JI5L 3JB9I 3LW5E 5FU7C 2IHEA 3PO2G 1D1IA 2IPKD 1JJGA 2XNAC 3D4RA 5I2YA 5EQ0A 2KYBA 5ECAA 2PNHA 2YRDA 4PLIA 1FJGQ 2F3VA 4EMHA 2C06A 3EG9A 4M7AC 4QVCA 4C8QE 5J3BA 4JS5A 1SE4A 1YHAA 2E74C 5CVIA 2DK3A 2JN4A 3TP5A 5C44H 5JJIA 4EMKC 1LABA 4HCEA 2O5IC 1BI3A 3RUZA 3STBC 1HNWQ 4PFOA 2KRMA 3H8ZA 4ABNA 2EFIA 4QL5A 5E4WC 2OEOA 1YNZA 1VUBA 1JJ2P 1VQKQ 2WAQB 1W4SA 1U5KA 3JCMJ 2DM1A 4HAEA 4J1MA 2VQEL 2R7FA 3JB9J 3CBPA 4F17A 3KXTA 1CFMA 1TVXA 1ZYRC 3I73A 4P74A 3CRLC 3RKWA 4M77A 1VQBA 1JQQA 3QSUA 3K8AA 5KNDA 4BWGB 1MGSA 1YFNA 1W2BA 1H9JA 2IX0A 4F7UG 3DEOA 1AH9A 3H41A 1I81A 1IW7D 1RACB 1TWGH 2MFIA 5M3FB 4IJLA 1UEBA 1IO6A 1QWEA 2K5NA 5I6WA 4LF8Q 4A75A 2CWPA 5KCOA 1MKHA 1VQ4Q 3F2BA 4DUYL 4KTAA 3H0GH 3RD4A 2UUBQ 2J05A 4PNYA 1XPOA 3EGDA 2BE9B 5D14A 1WHJA 3J81i 3T1HQ 2DXUA 2XRSD 2AUJD 2RBMA 3CEYA 4BI4A 5A0GA 1VQNQ 3OW7A 4G7HC 3M4PA 1IL2A 4A3EG 2XVSA 2EJFC 3QDRB 2NZHA 1G3WA 2D0QB 3I5RA 3CCVA 3C4SA 5E3FA 4FM4B 1GD7A 2BE5C 2QG9B 4M77B 3ZEHA 4DK1A 4GLVB 4JI1L 2CZ1B 1I4PA 1PZKD 4R8NA 1V29B 4BBSB 1AW7A 1JBMA 3CCEQ 4JW0A 2K05A 4J7FA 3A1PA 3RERA 4IUUA 3E9GA 2MF2A 3CCQT 1K8AC 3CCSA 2E2JH 5C6SA 3GTMH 2EQUA 2E5LQ 1GO3E 3PF5A 3P8DA 3CP0A 2FINB 1OI1A 2QGFB 3EGDB 1IYVA 4M4ZA 4LDVA 2C0OA 4E7LA 2KECA 2DRMA 3IRBA 3H9NA 1Y8OB 1J6QA 5J22A 3GF5A 3OS1A 4PJLA 1UE9A 3HOZH 1RADB 2K2MA 1HA6A 5M5WH 3ULPA 5IN1A 2J7IA 1WJSA 1QVGS 1AWXA 4X3KA 2E2HB 2Z1CA 1X65A 1NLPC 2J6KA 4F7UA 1VQ6Q 3NFCA 2F0MA 3PO2B 4C8QC 1IRXA 1NBWA 2EYXA 5K5PA 2HIXA 1SE8A 5CYUA 2F0JA 5K36G 4QUFA 4A3KG 2B2VA 2CQOA 2JA9A 3H15A 3EHQA 2EGAA 4O6JA 3F70A 4WFN3 2JM9A 4FSSA 2DY8A 5IT9c 3A8JE 4DR4L 4E7ZA 1VQFA 1HJDA 1EIHA 1PZID 2DVEA 2ZPEB 2XKOC 1CKBA 2X3XD 1LV9A 3RMSA 2FHTA 1YIJQ 4GN4B 2LMCB 2A1AA 2H8HA 3D3RA 2YUQA 4E2FB 1FGBD 1Q82C 3OMCA 4DQ2A 2DL4A 1X32A 2YRVA 3D4WA 1UE6A 4M75G 2PQAB 2M1HA 1EY8A 4DV3Q 2VGNA 2K79A 1N27A 4F7UB 1W6KA 1FR3A 2FPFA 1U4MA 1W2BP 1K9MR 1D0YA 2PYKA 3FKIH 4LNPA 1LTAD 2KQWA 3VA7A 1Y0MA 3MEAA 1ARKA 1Q90A 2KHJA 3VYGA 3S1RB 3M3YB 4IUQA 1ET9A 2NUPA 1Q7YC 2UXBQ 1XTDA 1EIFA 3QPHA 1WYXA 1FXXA 1NUCA 1STHA 2PW7A 2CHBD 5C5LA 1AZEA 2DX1A 4A3EB 1RTNA 1RAGB 5C4XG 1BXTA 1NPPA 2FHDA 4J6YA 1PFBA 2LFNA 1XJWB 4DOWA 1CI3M 5IWAL 1C7YA 3OSSC 4DR5L 1VQLA 4LF9L 5GJVB 5KYWA 3URYA 4C92C 1UUPA 3P7JA 5FJ8H 4DR3L 1YITQ 1KQSS 2CFMA 4JI6L 2J4XA 1N36L 3CW2C 1SMYC 1WQWA 3TSWA 4GKKL 4XU3A 3R3OA 3EIVA 3NBHB 3RNUA 4LFBL 4J83A 3QBYA 2BDNA 4WORA 5FO8B 1HXDA 4PL6A 2K5DA 2KR3A 3T16A 3M5AA 3RZOH 1WTQA 4BY1G 2E65A 3K5MA 3VYHB 5LJ3f 4LN2A 1ONLA 4AFSC 3G7ZA 2RQXA 4ULLA 5FO9B 1I4HA 2E76C 2KROA 2R61A 4XYOA 3VU3C 3TN2A 1STBA 1UE7A 5GMKm 4LUZA 1VQMT 2VUMH 1GVPA 4M75A 3M0UA 5KYWB 1WTRA 2CCZA 4HVUA 2FG0A 2F2XA 2JTFA 2D5DA 5JVH3 3INZA 4EQPA 3EG0A 1X6GA 4CJ1B 1Z6HA 4MMLA 2DJZA 5GAEC 3EFRA 4RGMA 1EY0A 4A3MH 1DM0B 3JAML 3H0HA 3M59A 4J9IA 4GLMA 1UUEA 3MXPA 2EY1A 3K5LA 3VS4A 2ED0A 5CKFA 5IP9H 2NBFA 5M9OA 1B7TA 1WGSA 2X51A 2A6ED 1HFNA 1QVFA 2FFKB 2RCNA 2AUKA 3QYHB 4J9GA 4DPGA 4J9HA 1E2VA 1OXVA 3H0FA 2MWOA 1SE3A 1TWCH 2KGTA 4M75B 5EG2A 4A4KA 4DUZL 3D4DA 1PH7A 3NHNA 2EAYA 3WDNA 2XDDA 3S6WA 2RMOA 3AQQA 2R58A 1S4ZA 3L2UA 3GTOB 3SD4A 1WZOA 1TWHH 4LFAQ 2LXKA 1MJEA 2R7ZH 2NVXH 1TWFH 2QEXA 3CD6Q 2VASA 5CQYA 1KRSA 4IFDH 3DM3A 1U4RA 3NWSA 2YTYA 3S2DH 3LYIA 4M7DD 1BR9A 1GUWA 1D1BA 1K3BC 3OSVA 3PUWA 2GQIA 4ORZA 3X24B 2UUAQ 4Q0FA 3VRZA 2CP0A 1V1CA 3HRUA 2HQEA 3MFYA 3N6RA 3J80i 2HQHA 2R92G 2WKDA 1Y71A 4NB3A 3CC4A 4Y28E 1RF2D 2L1BA 1QCNA 4OMQA 2OTJQ 3EJIA 2VWFA 2M51A 1HJPA 4DNIA 3DLLA 1I94Q 1FJGL 1N9RA 3VUBA 1ZEQX 1LVKA 4RMFA 3A56A 5AT1B 5EGTA 3E2UA 2DNEA 3BZDB 1HNWL 1C6VX 3AT1B 1X3PA 3LWUA 4EMKB 4BY1B 2KY9A 1BU1A 2QEXT 4A93G 3R8BA 4D8DA 2DYIA 3M4GA 2DJQA 1HQMC 2OQKA 2OWOA 3I8ZA 2FZCB 2ATCB 3MXNB 3R2IA 2HNIA 1GFDA 3ZBDA 2F0PA 1W3SA 4LE9A 3S14H 1GCQC 1ZSZC 4FVMA 3EH2A 2I0NA 4DXFA 1M27C 2F2WA 2KJXA 2J6FA 4XTCS 4M7AD 1TUCA 4QGUA 3JCMV 4E7SA 3EBEA 3CBMA 3DXJC 2QA4Q 1ZA1B 3STBD 4LF8L 2UUBL 1UG1A 1RAHB 2JM8A 5GAOl 1CHPD 4OMFB 4PJOG 2V4DA 1SR3A 4YCVA 3DB3A 4HTHA 3Q0AA 1C0AA 2KVQG 5L37A 1PH5A 2CP2A 5IGBA 5ELNA 1M3CA 5JJLA 2NVQB 1AZGB 4JV5Q 4F16A 2SNMA 2X4YA 3UATA 4FXKC 4L59A 9ATCB 1EX4A 1F2YA 4OONA 1XNRQ 4XQJA 3MP8A 4V2SA 4C92G 1BNZA 1BVSA 1SJED 3S1NH 2LT4A 2VUBA 1K0XA 4FF2A 1E6GA 1D09B 2HZYA 3VS6A 1A3UA 4PJMA 2Q8TA 2AWOA 3UE0A 3CXCA 1ML0D 1PSEA 4JJBA 3V2TA 1OU8A 1ZXTA 3VYSA 4RGNA 1PRTB 2JA7H 1I6VC 1B70B 4V190 4FXDA 2DEQA 2E5LL 5IH2A 4KD3A 4XT3B 2H3JA 4C3IG 3X26B 2XRQD 1H3HA 2Y90A 5GMKj 2YHTA 2B39A 1M90R 2L3RA 2NVTB 2J7ZA 2LY7A 2BE5D 1A0IA 1VQ9Q 3KLRA 2LP5A 3JCMX 1NJIR 2CREA 2DIQA 3TS0A 2HBWA 3VS0A 2PW5A 4RTUA 1C48A 2G3RA 4A63B 3CQZB 5GAN2 4G57A 2R92B 1EZ8A 1L1OC 5HK0A 4JBJA 2HT1A 3S15B 3S3MA 3I70A 3K57A 1SRLA 1V1QA 4C8QB 1Q8IA 1HHVA 2V8JA 4YCUA 1SNQA 2JTMA 3NTIA 3OYJA 1WI5A 2F0QA 4IPGA 2WAQE 1OPKA 4PJOA 2MMPA 1VQ7A 1S5ED 1O7YA 1TY2A 4POGA 1TWAB 3EGXB 4KHVA 2K52A 3TSZA 1X3EA 3JB9G 2R5MA 2KEDA 4A93B 2VZAA 1SEBD 4HSVA 4R8IA 2LNVA 3VKIA 3KYHC 4K14A 1M1FA 4GOPC 4OX9Q 2Q2TA 4C8QD 2F0LA 2PZUA 4JLGA 2ZT9C 1VQOT 4MZTA 2LSSA 4DV3L 1D5ZC 2LCSA 1UTIA 3S2HH 5I4DA 1F1BB 2E5KA 4POFA 4FT4A 2X6LA 2X69A 4FP5D 2IX1A 1LTLA 4M77F 3ERQA 1SN8A 3NELA 2B63H 2L0AA 5HURA 4PJOB 1NYFA 2FRWA 5KYIA 1CUKA 4E7HA 1BCPB 3FDTA 4DNRB 1E2ZA 2EQMA 3NBIA 2UXBL 3G6ET 3L9AX 4DEYA 5FU6C 4M77E 2EYPA 3MTSA 2HQLA 2I07B 1PH6A 1B7YB 2LS01 1G3SA 3JSCA 3GD7A 3R2TA 2QAZA 3K5NA 1ICFB 3EG3A 5JAVA 1MSGA 2BDOA 4PNOA 3WOFA 2RK1A 2OTLT 2K3XA 3A0JA 3S16B 2M02A 1VQPA 2JT4A 4C92B 1EY4A 1YEZA 2DAQA 2F0DA 3HFZB 5IP7G 3ASKA 3AHUA 5IGCA 4ZGDB 4DV4Q 2BOSA 3MC0B 1Y96A 4KJNA 5IT9L 4EQ5A 3GTLH 2X4WA 4IPCA 1EYDA 4JI8Q 1HXYD 1WHLA 4ME5A 3SWNC 3SHWA 1JJCB 1Z9QA 1LM0A 4FDBA 2HMAA 4OGEA 3CCQQ 5DLQE 2I5MX 3QDFA 5GAN4 1JXOA 2I2LA 2EYMA 3KF8B 3V96A 2YLBA 3I55Q 1E2WA 4DAYA 1E0BA 1KHIA 5A0DA 2IG0A 1E1TA 2DFUA 1SMYD 2HDMA 1YIJA 1KDCA 1UGVA 1OQKA 1Y1VG 1CKAA 1QVPA 2RD1A 5GMKe 3CCRA 1SKUB 1ET6A 3W3AA 2NWMA 4DV2Q 4JI7Q 5M5XH 4A3IH 1PHTA 3THKA 1VQPT 4R0KA 3JRZA 4FYXB 3NXWA 4JBWA 4NPSA 2X4JA 1N34L 5LJ3e 1N32Q 5FLMG 3HOYH 3M57A 3JAMi 4XTUA 3BE3A 2CP3A 3EFOA 3QZ5B 4F7UF 1B53A 3MJXA 1I50B 8AT1B 4MDXA 2ZM6L 1Y1WG 3FPUB 1T5EA 1WCMG 1JE5A 1PV4A 4XU1A 1SHGA 1SFOH 1KQ1A 3OYYA 3M0QA 4F7UE 5DM63 1K8AR 1ENCA 4DAYB 2RO0A 3SGIA 2PVDB 4BACA 1M1KC 1HFGA 3I91A 4EVOA 4GZYC 3S3NA 1FGUA 2CZ7B 1SNDA 2C35B 2YT6A 3DM1A 3M4YA 4LMQD 1G8ZD 3DEPA 4JBMA 3J7A5 3RN2A 4KULA 2WFWA 3CCRT 4DV6Q 2M0YA 3K59A 1C0MA 1DCZA 1TKWB 3RR5A 3JB9D 2F0KA 3KOJA 4A4HA 1CK1A 5HK3A 3T56B 4M77C 4ZGJB 4YCWA 5I2XA 1FMVA 5GAOq 2LZ6B 1G51A 4L8JA 4X3SA 3I4NG 1KC8R 2PUKB 1V8QA 1VQEA 2A68C 2K5QA 4YHHQ 1U5SA 3BZCA 1WJJA 3EHRA 4LUVA 5LJ3d 1AE3A 1ZKOA 4IALA 3ER0A 2Z6KA 2DA9A 2UUAL 3K7AH 2R7DA 5HKCA 5KNBA 1QVGA 1SSOA 3KLWA 1YI2T 3T9NA 2K3YA 3HEJA 1KAAA 1HNXL 3GTGH 2DL5A 2QDYB 3A8IE 4IZ8A 1OTCA 2MO0A 2EXZA 4HCZA 2EY2A 1L0WA 1J9OA 1UHCA 4LXCA 1WNLA 1F2LA 1Z7TA 5GAOp 4K5WA 2QQ9A 4CDCC 4BDYA 1I94L 2F0UA 1XQHA 4RAUC 1FL0A 3CMET 2HCKA 3RESA 4RTZA 2N88A 3KLSX 2LC4A 4ME3A 1STEA 4B6MA 2DMOA 4R55A 2QW7A 2QEJC 2JA6G 2I46A 2PVGB 5C3EB 1TS9A 2RH2A 2I5LX 1B2TA 5GANj 3QOLA 5DM73 4A3LG 2JXMB 3G6JB 2C0TA 4XTVA 2RQRA 8ATCB 4YWKA 2VXFA 1P8LA 4NL3A 2A69D 1J5EQ 3CBOA 1MI2A 5GAOm 2CWAA 2VNUD 2N8NA 2GVAA 5IGFA 3OTOL 1X2QA 1VQMQ 1ZSZB 1QKWA 4L5TA 1Y1VB 5FK9C 4JYAQ 1D2BA 2B63G 1CQFA 1KDBA 4IURA 1LO5D 2VS1A 1A8VA 1HZ9A 3BW1A 1SBBB 2JE6I 1PTOC 3O5ZA 1HQRD 4CDEC 1M30A 2NTSA 1FNUA 4M75F 1YJWA 1QOHA 3VR5A 5CKHA 2HAXA 4XTWA 2NTTA 2DTHA 2X3WD 1SDFA 4L5SA 3A55A 1Y1WB 1Q1BA 3QWXX 3NSWA 4NXMQ 3OS2A 1WCMB 2EJMA 4EQOA 4M75E 4CJ0B 3DMUA 5C44G 1XTCD 1A15A 2B2VC 4XU0A 2QDLA 5C0XJ 4L63B 1XNRL 1K8GA 3G71T 1QWYA 3BVGA 3QWYA 1YHQA 1I5OB 1KQSA 1LT6D 3V7CA 1MSHA 4AYBG 2A6HC 3A5UA 5LJ3g 1WFWA 3HOXH 3MEHA 1NTGA 3GP8A 1SMXA 1Y07A 1CSQA 4JI0Q 1YJNT 4DK0A 2C9OA 3WOEA 1HRJA 1P92A 2NZ1D 3TS2A 3M4OB 1YJWT 1U9RA 2AT1B 2V1RA 3GNGA 4AH6A 2D1XA 2RCFA 4PZ6A 1QILA 3NQIA 1GXDC 1R0BG 1K28A 1PD1A 4Z88A 1S5DD 1XNQL 5CCAA 1Y69U 2O31A 2XIDA 1HYOA 1OX8A 1TSFA 4ZNXA 2DEUA 1EYAA 2RVLA 3GQBA 4JVZA 4DK3C 1Q82U 3SXHA 1M3AA 4GLAC 3F2DA 1K83H 4AG2C 4ZUIA 3M4QA 3CC2Q 1QVGP 3KDFA 2QQAA 2RI2A 2WSCE 1F2ZA 1L1OB 2B2WA 3D31A 2PQWA 2O4XB 3LH0A 3EAEA 1YHQT 2GQVA 2OJ2A 4A3CG 1HPCA 5FRMA 1AD5A 3LGJA 4ZGEB 1K8MA 4JS4A 4QIWE 4HIDA 2DPPB 3BDLA 2RKSA 3P1HA 1BIAA 2W0ZA 1S72A 4ZCKA 1RHPA 4APVA 1I4GA 2Z0SA 4A3FH 2E2IB 3I90A 1Q7YU 4BI8B 3U4VA 2JA6B 5C0MA 4GY5A 1YWOA 1I5LA 3GV6A 5JEAJ 1W6XA 2XGTA 3ITPA 1LJOA 3AEVA 4P5NA 2V8KA 4KBMB 4OP0A 1X3FA 2K9GA 5J39A 4OX9L 3N5BB 2KMTA 4C0DC 2PZWA 4CI0C 2EYFA 3CQTA 4PKCC 2CVRA 4GOPB 2KT8A 2EBPA 1SNOA 1L2FA 2HKQB 4OEMB 5GANe 1ZHIA 3NHHA 4BA1I 1E6HA 3HOZG 2JA8B 5IY0A 2HD0A 3TVTA 1CTMA 4R56A 1VQ8T 4CC7A 2C5CA 5JPNC 1MHWC 2BTTA 3TEEA 1A3TA 2PTKA 1S40A 4EQNA 1IYUA 4OVAA 2F52A 1SYCA 4M75C 4RHSA 1QNUA 3I56A 2EQJA 2O2LD 4K11A 1PRTF 2O9SA 1MBYA 5EPKA 3X20B 1I1JA 5FU6B 3G7LA 3TRZA 2PI2A 4KGVB 3HKZG 2Y4XA 1BDOA 3BVMA 1QNKA 5KGUA 3VR4A 4KHPQ 3HRZC 2MYSA 2A73B 3S1MB 1C8CA 2EVRA 2KK4A 2RA2A 4C3HH 3GTJB 1KQSP 4K5VA 2MOXA 1WTPA 3I4MH 2LKVA 2DTOA 5IOCA 1ZBXA 2BUDA 5IHNA 4J7IA 3NPPA 1MNDA 1YZ6A 3L2RA 4UP9A 3SWNB 3FEOA 4C8QF 3PUZA 4A4FA 2YXYA 1WFQA 1D1CA 4QQGA 2LDMA 2J06A 3I56T 3GLXA 1VIFA 1HZCA 3RR6A 4PMBA 3PGZA 1UEAB 5CV4A 1CA6A 2YTVA 2VKNA 3J7AF 2DE0X 2KXDA 3HSBA 3GV3A 5LMNQ 2UXDQ 4LK1C 4PK4A 2IPOB 4FCYA 4LNQA 4JI7L 3ND9A 4F88A 2RN8A 3MWYW 5M3MB 3OS0A 3QXEB 4E7JA 1EQQA 3GTQH 3NQTA 2CT3A 5I21A 1Y57A 2JMAA 3SB2A 5GAMj 2HL3A 3HOWG 3CCLT 1EFNA 2HSEB 1XXGA 4WJ3M 1M4ZA 4DV1Q 4QJFA 4C3JH 1TQOA 4ZN1A 1OPLA 5D6WA 5IAYA 4PJOF 1B9MA 3TEHB 3TQYA 1AZPA 2DGYA 2Q2UA 2L11A 2K3BA 1BCPF 3EG9B 2WV6D 3MAQA 2P84A 1GHKA 2GF7A 3HTRA 3PUVA 2B86A 2MIOA 5A35A 3U9SA 4OL7A 3E1SA 2RB6A 4PJOE 1Q12A 1VQOQ 2MJ8A 4TSSA 4DV6L 1J8IA 3HOZB 3GOXA 2EYOA 2NVYB 4X6AH 3W1GA 5CGKA 1PH1A 4C92F 3UWNA 2KBNA 5C5MA 1ABOA 4OMLA 2L3QA 5KEEA 4PV1C 1R0CB 3I35A 1YCYA 2BH2A 5IHKA 5GAHC 4LF4Q 3ME9A 1NE8A 2ICEC 3G6EQ 5GAOr 2ZPGB 4C92E 1G91A 1PRTC 3HKZB 1M2OA 3META 4L6TB 5E1FA 1KD1C 1TS5A 5J1ZA 4R4QA 3OMGA 2KRNA 3JCMc 5E7NA 5GMKh 4M1UB 2CUDA 4LD9K 1GUTA 4Z89A 3Q24A 1QB5D 1B3AA 1G291 1YJ9Q 4H0LC 4DXGA 1AZQA 3K58A 3VS1A 4M77D 5LJ3h 1UGSB 5FROA 4D8KA 3M0TA 4DV0Q 4I7AA 2M0OA 2IWHA 1WYDA 2UUCQ 2AQ3B 4BXXG 1MUZA 1PKTA 1EEFD 3CU7A 3CCVT 4CDFC 1NPRA 5DAUA 4RKBA 1XMOL 3MXUA 4OB1B 1IXRA 5KYUA 2JJQA 1XOVA 2VY3A 3CCJA 1ENFA 4DR1Q 2YU9H 1RAFB 1ZUUA 1ESRA 2DL3A 1II3A 2N55A 2DO3A 3PMFA 5M3FH 1J5EL 4B3MQ 4A3DH 2L8DA 3CCUA 1M8VA 1C4QA 4JOIA 3ULJA 2PQEA 3K0XA 1YNJC 5L8RE 3JB9F 2EQSA 1WXBA 3EH1A 3VS3A 2GGRA 4JYAL 3CCST 1B8AA 3FDRA 3SK5A 2ZPBB 1AT1B 4JRIA 3L2WA 1XX8A 3CKIB 3CCMA 2LT1A 1G6PA 1JQYD 3CAMA 4JZ3A 4PJJA 1PTOB 4MMKA 1VQIA 3D0FA 3NWTA 1R4PB 2ID0A 1PH4A 1ZA2B 3HOWB 4BUGA 1Q86C 2EVBA 4BBSH 4CC4B 4NXML 5T1IA 1KABA 3MCAB 1WLPB 1ZQ1A 3JCMQ 2DNUA 2LJ1A 3KBXA 2E64A 3QIAA 5GAMe 5IYDH 4XTYA 2FL7A 3VR2A 2L2PA 1SJHD 4J6XA 2A37A 4PJOC 3A8GB 5I11A 3CCUT 4FF3A 1EIYB 3URGA 1BCPC 1NY4A 4WTOB 2Z8LA 2VXEA 4C0ZA 4XAXB 1WJQA 4JI0L 4RUGA 1PRMC 3B6YA 1YWPA 4NMZA 2JA5G 2K5HA 2E3HA 2Q8IB 1HUNA 4N0AA 4MNOA 2VB2X 4LFCQ 2ZPIB 2E4HA 5EBCA 1QZHA 1O80A 4KH1B 2E41A 3H91A 1KSWA 1PFMA 4JZ4A 3PO2H 1WPYA 3IAYA 5EJWA 1WXUA 1N8RC 2ROTA 1XNIA 4HJ5A 4KKUA 2KT1A 1MIUA 1RD9D 1S5CD 1VMPA 5ELBA 2DXCA 2DETA 1H641 3QIIA 2K4YA 2FMCA 4Y91A 2SRCA 1MGQA 3M0PA 4Y7NB 3C3LA 1UGPB 2VYTA 3BS1A 3OYAA 1O78A 3HOUG 2FO0A 5JVG3 2QQBA 1YI2Q 5I6YA 2JMCA 5KYYA 1TOVA 4KUDK 2NUPB 2DXBA 2HDLA 2ALYB 4D6WA 1XMQL 2A8VA 1MMAA 3GNFB 1RI0A 4HXJA 2FJ2A 1IBMQ 2DL8A 4P75A 3FJPA 3CMAA 4IUTA 3CMEQ 1MMDA 3MP1A 4J6HA 4JPBW 2F3WA 1ZSGA 1I3QB 3D8GA 4KMUC 4OMOA 1JWMD 3PVLA 1VQLT 1TT2A 1Y14B 3J7AV 4EDUA 2XK0A 1BCOA 4PG3A 2JYOA 1KHCA 4PJNA 4NKLA 4A3KB 1WTOA 1RIPA 2IW3A 4K6LA 3S1RH 3M3YH 4BB7A 4PZ7A 4JDSA 4JRPA 4BE0A 4C0DB 3S2DB 3AFQA 1I5FA 5I9OA 5JJKA 2B8FA 2PZTA 2H5XA 3K7UC 4JV5L 4J9BA 4A3GG 3E0JA 3V8LA 2BIVA 3BFMA 2DD5A 1I6HB 2QK0A 1W6JA 1RABB 1UFFA 4KN7C 3QJ6A 2D2CC 2CZ0B 2TMPA 5GADC 2WIIB 3A5ZB 4A3JG 1XJVA 1U0LA 3V8JA 1D0ZA 3LGFA 1M8MA 4UC4A 1NCVA 3Q22A 1WXTA 2KI7A 2NB0A 2NN6H 4UY8C 5C0XG 3JCMf 1QUQA 3NTHA 3M53A 3PE0A 1OXSC 1B1ZA 4LDUA 3J81E 4KHPL 1X3GA 3G71Q 1GRIA 1M3BA 3K80C 4PQXA 2DRKA 1AEXA 3C2PA 2JA5B 1DONA 3WXMB 4M75D 1LUZA 3P8HA 4RH6A 2RJDA 5GAOn 4RMOA 4F87A 1YJNQ 4RA8A 4Z02A 5HGQA 2K03A 1KNEA 1PYSB 1VCIA 4JI2Q 2DL7A 4K8IA 5LJ5j 2YUNA 2RA4A 5GAGC 1VQ5A 1RAEB 4M78G 2COWA 4ODGA 2LQ8A 2JQOA 4G7ZC 4JRQA 4FT2A 2VV5A 2R93G 2A28A 2B2TA 5CK9A 4LF7Q 3HL8A 5EKKA 2FVUA 5K36H 1AWWA 2ZJPA 1WI7A 2ABLA 1Q81C 2YV5A 2EGEA 2L4NA 1M1KU 4FYDA 3CC7A 1TG0A 4KHZA 2UXDL 4CJ2C 3HOUB 2IVWA 2RSNA 5GANh 3TCJA 1R77A 5CBEE 3VS7A 4IO9A 2AHOB 4QIWB 1OU9A 5IYCH 2ZAEA 1LT4D 2PCFB 3BU2A 2Z6KC 3R6NA 1VF7A 4HVWA 4J8QA 2EW3A 3U23A 4ANJA 2QQSA 3JCMb 1EWIA 1GUSA 5JEAG 5DNFA 1TXQA 2JVVA 5CKDA 1ZUKA 3S1QB 1BBUA 4DV1L 2AKKA 2F4VQ 2OF1A 2HIVA 4O2DA 1VQ5T 1PFNA 1K76A 4A76A 3CC4T 3TREA 4OMMA 4TVRA 1P16A 4BY7G 1HNZQ 1SRMA 5D6YA 1G6ZA 3GTOH 4IUNA 4K5XA 2F0WA 5A2QE 2NYZD 1CKNA 2DBKA 3D7SB 1D1AA 2ZXRA 1JOQA 1FWZA 2K5VA 4RKUE 5ELCA 2RPNA 3T1HL 1WD0A 1RJTA 2D9TA 3AYHB 2Y4YA 4CRIA 1ZYRD 2RHQB 4OO1G 2YWWA 4OB2B 4A3GB 1QP3A 2MWPA 3C0CA 4HT8A 3OQ5A 2EXDA 2V26A 1FMKA 2O9VA 1OEBA 1VQ8Q 4N4HA 2NUTA 3I2ZA 3G4SQ 2KRSA 2RHIA 2KVMA 1PM3A 2JW4A 4M78A 1QVFP 3LX0A 4HMIA 2E75C 4U673 2QQRA 4DR6Q 1D6EC 4RGTA 4A3JB 4J9DA 1RLPC 3GIBA 3BG3A 4AYBE 4RTVA 1CSKA 4CKCA 2LXJA 3ZL7C 4LF4L 3QWNA 1K0SA 3O13A 3HRTA 1LT5D 3H3VC 1O7IA 1BO0A 3A74A 2R3ZA 4OIJA 1EZ6A 4XQNA 4QVZA 1D0XA 4JUVA 2HEQA 2MUYA 4BY1H 1JRIA 1HR0Q 2RQTA 3ULRB 1RODA 2HHHQ 1TU0B 1WHMA 4K2KA 2M16A 5KRUA 4DV0L 4KV6A 1VQKA 3LWHA 5I2SA 5ELEA 2CYZB 3OB9A 3SFMA 4UP8A 1KTKA 4FF4A 3GTPB 2PI2E 4TQUS 4GKJQ 1PRTD 3M9BA 2UU9Q 2CKKA 2R93B 3HFOA 4DR1L 3GTKB 1JT8A 3MKDA 2E6ZA 4DA4A 1I4XA 1PHJA 1LCKA 2J6OA 3OBYA 5BN3A 3RZDB 2KCTA 2HL5C 5GROA 1NYGA 2SEMA 5IHIA 1SSHA 5GANf 1SYFA 1K73C 4LF6Q 3EQLC 3AU7A 5BR8Q 2ZTEA 1HCZA 5JPMC 2ES2A 1VQ4A 1PFSA 4KK7A 1AWJA 4E7KA 5FLXE 2TSSA 3M0SA 1EYCA 2H4OA 2JJ9A 1E7ZA 3QJYA 3PCOB 3TP7A 2ZPHB 4J8OA 2D8JA 2JNGA 1MHNA 2DZ9A 3UF4A 2NVQH 1VQNA 1WA7A 1AHJB 4E47A 3M56A 1UGQB 5IODA 4TVAB 3NPFA 2IHFA 1W70A 4XXEA 4X9CA 1IYJB 3OYIA 1U8RA 2L89A 2B2WC 3HG9A 2GCXA 5GAN6 3GTLB 2QTVA 1KLGD 2V8IA 4X34A 1KQ2A 4BY7B 5M5YB 5IGDA 2JEAI 3MA2B 1GM5A 2AZVA 4FSXA 3CCEA 4JI3Q 1JMCA 4KD4A 1PH2A 5CQXA 4XK8E 3W2DA 3Q23A 1NM7A 1VQ7T 4CC2A 1K3RA 2KCNA 2WINB 1LTGD 3OYCA 2NVTH 1VQ4T 2A74C 3FIFA 3CPWS 1WTVA 4RG8A 3QKJA 1RUWA 4WRDA 2XMFA 3S17B 2YSQA 1VQNT 1C9OA 3CQZH 5C4JB 2R92H 3HKZE 4QQBX 3S15H 4B3RQ 1K8OA 4V0BA 2E1HA 5M5XB 2F69A 3OSOA 1YN8A 3JV3A 1IHWA 1VMCA 4PJOD 2B2YA 4HMJA 4HJ8A 4ELZC 2B2UA 2EQKA 1VQ6A 1BCPD 4IFDI 1STGA 2NUZA 2NLUA 2WKCA 3PIO3 2RDFA 1X43A 1AE2A 3CXCP 2XD0A 1KFZA 1EQTA 1RI9A 1TWAH 1MJCA 5ELOA 4C3IB 3MHXA 4KRTA 4HJ9A 1IL8A 5GJWB 4NXNQ 4A93H 4CKBA 3TBIB 5CORA 1VQHA 4F7XA 3PQIA 1AP0A 1DZ1A 1OOTA 1PDQA 4JRKA 4HN7A 3J80E 4C92D 3OYBA 1D5MC 1BIBA 1DOKA 4S3SA 5ELFA 4DA2A 1BI0A 1DJRD 1AWOA 1R4QB 1JWSD 1UHFA 1STNA 1LTBD 4R1JA 2KA7A 1EQVA 4RFBA 1ZX6A 3FLGA 2HCCA 4ZLTF 5IXFA 3CCVQ 1LTRD 3S9WA 5HY6A 4IFDJ 1PTOF 3OIQA 4A3BG 3OHXC 1K9MC 1XPUA 3L42A 4IQZA 2E12A 5GAMh 1VYVA 2EIFA 1OV3A 1Y96B 2F1LA 3T53B 2RQUA 4JBKA 7AT1B 3C1FA 1QCOA 5TSSA 4OIKA 1IGUA 3PMIA 1VDZA 1A63A 1BKBA 2F2VA 2K28A 2XI9A 3MEUA 1OXXK 3I7FA 4DFAA 2KHIA 2SDFA 3K7AB 1NBEB 2PUOB 1RLQC 4OWWB 1PRLC 1TS4A 2BZXA 1ASYA 2JZ2A 1DYQA 4I65A 1B44D 4DV7Q 2QASA 1R8OB 4FL6A 3S16H 3VRYA 4DBHA 4KGXB 2FPDA 5E4XA 1YIJT 1E3PA 2VQEQ 1M1GA 1YITA 4C56C 1AOJA 2AK5A 4OXPA 2EJGA 1EWHA 1NE3A 3T1YQ 4LFAL 2O5JC 1Z9ZA 2RHUA 1PH9A 1G5VA 1ZBJA 5CV8A 2EWNA 1H9MA 3EFOB 1HTPA 3LLRA 3H94A 1I8FA 2KE9A 1VIEA 4KI0A 1OX9A 2QYZA 4JLIA 2K50A 4ZKBB 4C1NI 3PO3G 4AIMA 2PPBC 4A3DB 4JI2L 1CQVA 3JCMe 3H6MA 1HZBA 1EFID 1F9QA 1PG5B 2COZA 5KIXA 4OB0B 1R9TB 4LF7L 2F5TX 4OMPA 1IXDA 3J81j 2O2OA 2RF0A 3L2ZA 2GFAA 1LTSD 3P20A 4ID6A 4ZUJA 4YY3Q 4JI4Q 1Q82R 1Q86R 2DZCA 1I50H 5FKAC 2P4RA 4JI1Q 2UXCQ 2MHVA 3NP8A 3JB9H 1DGSA 1SLJA 4IIMA 2E2DC 4X3UA 4DN4M 1IZ6A 2LJ3A 1NEBA 1U3OA 3KJOA 4OF1A 3IKJA 3A7LA 2HQXA 2K04A 1SPKA 4MZ9A 2JOYA 3IQLA 4E6IA 1JXMA 3X3NA 3A8KE 2M9VA 3NGPA 1HH2P 3PNWC 3X28B 2R6GA 1JR0D 2F4VL 1IHZA 3D6CA 1Q7YR 3M7GA 5C0XI 5GAMf 1PH3A 3I4MG 4A3BB 1A2UA 1VQLQ 4B3SQ 2QGQA 1AN8A 4HCBA 1CKOA 1JICA 4RG2A 3BYYB 4G7OC 2XHCA 4NOYA 3EA6A 1KD1U 3UDCA 1Y8PB 5CV6A 3BY7A 3JCMd 1YNNC 3FVQA 4DV5Q 3FP9A 4IIOA 4XIGS 5IE8A 5KNCA 1N9WA 2DXTA 3J7YW 4LF5Q 2DN8A 2QDBA 3BDCA 2B3GA 1F9SA 3CD6A 1HSQA 1S5BD 3RNJA 1IGQA 3M9QA 4DOVA 3T4AC 5FOBB 3HGBA 4Y92A 2F1MA 4F04B 1M5Q1 1J3TA 4JOIC 1Q3LA 2KENA 4LUDA 2EZVA 2BH8A 5KH6A 4YWMA 4DR6L 1G3YA 4CHTB 2BE7D 1UWVA 3RDVA 4HR7B 1S1NA 1YHBA 4N4IA 2EKHA 2CQAA 1BK2A 1MD2D 5CV5A 3G48A 2IX3A 4GNXA 4LW1A 1O75A 2ZTCA 3X25B 3L2VA 3PUYA 2HCIA 2OTJA 1M8AA 5GMKi 4LUEA 2G9HD 3SEBA 2HD3A 1FNVA 1O9SA 4NL2A 4C2MB 1SYEA 2JS2A 5COYA 5FW9A 1QW1A 4FYVB 1PYBA 2K57A 3I4NB 1EY9A 1HR0L 1JU5C 2XICA 5C3EH 2IL8A 4QW2A 1UE5A 1D7QA 3WWVA 3HOVG 2ENMA 5FRNA 3E6ZX 1H9SA 3PO3B 1M4VA 3H0GG 5G3LF 4AT1B 2K7AA 1UECA 1Q86U 1WTXA 1WIEA 1Y1VH 3LNNA 4GKJL 5AFWA 1JORA 1QKXA 2RJEA 3OY9A 1FD7D 1F2MA 2MPMA 4M8AA 4XQQA 2I5HA 5IWAQ 3IL8A 4N0AC 4ILWA 5FLMH 4LF9Q 1B34A 4KN4C 4BDZA 1WVLA 4LF6L 2FRYA 2QA4A 1JOKA 5BR8L 1MMNA 2O01E 2NZOA 3G1JA 3UA7A 2L9HA 4J15A 1N36Q 1QMCA 2LRQA 3DLMA 3M85A 2E2JB 4IPDA 4WJWA 2PO4A 4OO1I 3KFUA 3HZXA 3I9QA 3UPUA 1WCMH 1GFCA 3JCMg 2ESWA 2QEXQ 4E6RA 3L2PA 1VOMA 1ENAA 4OWXB 4N9PA 3AMUA 1UGRB 2K5IA 4DAPA 1EL0A 3OOCA 2V1QA 3QHSA 3LWIA 4H44C 3OYGA 1QP2A 2ZCFB 2D8HA 3A54A 1N8RU 4HEDA 4C1NK 3KDFB 4Q5WA 4ESRA 1G2SA 1WDXA 2LVMA 3CC4Q 2RI5A 3JAME 2KSSA 2DLPA 1VQGA 5I2MA 3V7SA 3E3XA 4JI3L 3X3MA 2SOBA 4OGCA 1PSFA 5LL6X 4KKTA 3LX7A 2LQWA 3WVEB 4QKUA 3M4OH 3F8TA 1S72T 1M90C 1GHJA 2QI2A 1BYMA 5FWCA 1GUGA 2Q2IA 3Q8DA 3ZJYC 3W5OA 5JJZA 3NMZC 3IFTA 3VA5A 2SNSA 2M00A 2D0NA 4KGZB 4ZTFA 4BBRH 1G2TA 3OYHA 2CKZB 3A98A 5BN4A 5HCKA 5C44B 2WB1G 2K32A 3UDIA 3D6WA 1VQ9A 3MZ5A 3VS2A 2HDAA 4FYWB 4OELB 4B3RL 3OYKA 4AYBB 3I3CA 2ASBA 1X6BA 1EOVA 1KXLA 4DV4L 1TXYA 2ATWA 3P75A 4QCLA 4JI8L 2M9UA 1LYLA 3K6OA 2YUOA 1JWUD 1SNPA 1SEMA 1UNSA 4MTNA 4M78F 4RTXA 2FYKA 4XQ3A 1EWCA 1B50A 2E8GA 1PC0A 2OT2A 2BA1A 2E2IH 2K6DA 1K4US 2N49A 1O7LA 5GANd 4A4EA 2XSCA 2JA6H 3I5SA 1HD3A 1TWGB 3FKIG 4M78E 4DKAC 2H1EA 1JE4A 3HOVB 1NLOC 2CS7A 2GVBA 2HBPA 3TP6A 3H0GB 1Q8KA 4LDYA 2BCOA 2IY5B 4CC3A 3C46A 1T5XD 4CGYB 4X9DA 4R4TA 1VQ9T 3MHBA 4DV2L 5D6XA 4X66Q 2JA8H 5IYBH 1IBKQ 2DKGA 2EYWA 2HKNA 3UA6A 1Q46A 1HR0W 1N32L 2LJ0A 2D62A 4H13C 1XYIA 2P0QA 1NZ9A 1NNXA 3HKSA 1I4RA 5FJ8G 3VDYA 4JC0A 1X27A 4FU6A 4XYQA 1SYGA 5CO7A 2AMCB 2L5TA 3QYGB 3U50C 2K5FA 5D7UA 2B2TC 4BY6C 1AVZC 1EIGA 3OA6A 3F1ZA 1UDLA 4R4IA 2DF6A 4DAMA 4PLLA 2YTXA 3S24A 5LMUQ 1H9KA 3K81C 2LMJA 3M55A 4NDXA 4DBFA 3SK6A 2KBTA 3GTMB 2RNAA 4DV7L 1LNXA 1RL2A 4RTTA 3S1MH 2EYZA 4X64Q 2ROLA 4AQYQ 1E1OA 1X3QA 1IB8A 3EG1A 1EU4A 4UAIA 2F0NA 5GAN5 4CKEA 3GTJH 3NENA 1EQRA 3QR8A 1BF4A 3PF4A 2GFUA 1D1KA 4LWCA 1Q81U 5M5WB 2DVJA 3T1YL 1DD2A 2VVKA 4DGZA 2VUMG 2FPEA 3C95A 1OULA 1Z47A 1Z9FA 1IREB 2MO1A 3FMCA 4YHHL 4II1A 2P4TA 2XN9C 2Y0SG 2L3SA 4Z9CB 2YU9B 3CCQA 1G3TA 4KLKA 2K1BA 2PNIA 1VQ7Q 4NP5A 2GNCA 1CA5A 3MEFA 1PVOA 1G8XA 4ZQ3A 1D8LA 3OIPA 5C6AA 4A3MG 2G9DA 4B9XA 4XU2A 5GANg 1K73R 1Q95G 2F0EA 2WB1B 3I55A 2EYYA 3BVZA 1NG2A 4A4GA 5IP9G 4IOCA 2DIGA 3EFXD 3MFGA 5M3MH 4A3CH 2OTLQ 5J26A 5LJ5f 1KG1A 1X69A 4HIOA 2QF7A 2A68D 1V43A 4KY7A 4YY3L 4JI4L 5AYFA 2N3SA 3L7ZC 1S5FD 2VW9A 1YCSB 3KBGA 3T13A 4M78C 3A7AB 4I7ZC 2C0IA 1SE2A 2ZJQA 2NN6G 2UXCL 4HT9A 2RDHA 2PMZB 3EROA 3FKIB 4R4CA 1EFWA 2YLCA 2DERA 5EPLA 1PYWD 2R7ZG 1YP5A 3BYTB 3PMTA 2K5LA 3VYTA 1OYXA 1BUVT 1KLUD 5IGEA 4IFDG 2F0GA 4QT7A 1VA7A 2XG8D 2DNCA 3I55T 4PFZA 1QQJA 1TWBA 1L0YB 1NMFA 1TS3A 2D0PA 2CW0C 4B3SL 2H3EB 1JOOA 3E19A 3U58A 4E7IA 2NVYH 3H3VI 3OS5A 1WHHA 4H7BA 5CV9A 4BI3A 1VQPQ 1F9PA 2R5AA 2K01A 4DV5L 3EG2A 2PQAA 1Y7XA 2RI3A 4C5IA 1DXMA 1KC8C 3VR6A 2RJCA 2BZYA 2RJFA 1I0CA 2JTEA 4FW2A 2XTIA 4MHEA 5FO7B 3J7ZC 3CPWA 4ELYC 6AT1B 3VYRA 4C0FA 5A0LA 5KYUB 5FWBA 4DR7Q 2KEAA 2QILA 4X65Q 3CCJT 2CSIA 3SE0A 4J6WA 3JCMh 3M54A 3DB4A 4ZYSA 4Q5VA 3RZOB 1FX7A 2K6AA 3ICEA 1PTOD 3C94A 2F0FA 2NYSA 4GN3B 3HOVH 5IYCG 2KYMA 4YTLA 1YNND 1QE6A 2LQNA 5GAN3 4DAVA 4KJOA 3CCRQ 4M7DG 1FYCA 1RDPD 1N6AA 1K73U 1ESFA 3CCMT 2VUMB 4KUIA 5EKLA 2M2LA 4K2LA 2CGHA 4BE2A 1VQAA 3V05A 4N8FA 2E2HH 2Y0SB 2AHJB 2NWGA 3DUZA 4H02A 3NBHA 4XTXA 1M2VA 1HK9A 1SYDA 1TY0A 1PLFA 2BKDN 3OYLA 4N9TA 3U9OA 3SVMA 2EYJA 2DBMA 3OW2S 4A3MB 1U4PA 1AEYA 2A6HD 1STAA 2E6NA 4RG1A 4BS9A 3MXGA 2F0IA 1KDAA 4FF1A 1EYGA 3I72A 3SR1A 4RHRA 1T3SA 1L0XB 1C1AA 5IT9E 2YDLA 1VQDA 1X2KA 1VQMA 4F8MA 3C12A 5DLOA 3EGUA 1SROA 3LH5A 3PSIA 4OWTB 5GAMd 3PIOA 3K0YA 1PTOH 3UDXA 4IN3A 2BZ8A 1RAAB 3OYEA 1T0HA 4J5YA 3HOWH 1M1KR 1OZ2A 1TWCB 3VUZA 5H1SE 1MV0B 1D5XC 3L0OA 4N8X1 2L0CA 4QMGA 5D65A 1BBXC 3R6OA 2KUMA 1PXUA 4P72A 2B2YC 1M2VB 2XDPA 4ME7A 1PNJA 2B2UC 5EAYA 4M7AG 2EYQA 5C4ZA 3J81c 1TWHB 2R7ZB 2FB7A 2KCCA 1ZLMA 1VYUA 1TWFB 2NVXB 5C4XB 2L3PA 1NSNS 4MTKA 3A8MB 2Q8RE 1TTHB 3P8BB 2QTXA 5D3DA 5KYYB 2EPDA 1V1PA 3GP7A 4XDXA 3L3OC 4QB4A 4A3EH 2A7YA 3Q6SA 4HCCA 1BBWA 4M7DA 1NAPA 2LX7A 4AFQC 1ZUYA 3RLOA 1PA6A 4B3TQ 4O42A 1MMGA 5C3WA 1JJ2S 3CMAT 5BN5A 3FC3A 2EY6A 2VB6A 4JJCA 4JJDA 3HP3A 1N33Q 1PCXA 4JG2A 1N34Q 1RTOA 2CDTA 2QKIC 3CPWP 2YYZA 1G83A 1H9RA 4Y7NH 1TR5A 2A08A 3ONAB 3V8KA 2WP8J 2ZM6Q 2L15A 2WSFE 2K5WA 1K9MU 4DK6C 1ILPA 3CC2A 3MPUB 1V1PB 4QF4A 1T3LA 3ZFJA 2JXBA 4M7DB 4BXXH 3S14B 1NEGA 3SK4A 1F9RA 1GCPA 3Q1JA 2MPXC 2DY7A 5CC4A 2RK2A 2Z4HA 1I3QH 4AFZC 3NUCA 4O0AA 2LQKA 1U06A 4OHJA 2ZJRA 1PH8A 2LNHB 2KAFA 5GAMg 2GA4B 1EY7A 2OAWA 1YJWQ 2IT1A 3E9IA 2PZ1A 3TQ7P 2AQ2B 2Z0WA 4M7AA 2EYHA 3HP9A 1V9PA 4A3KH 1A3VA 1QUQB 2EJGC 2L5QA 4IPHA 4EMKA 3QUIA 1E24A 2FMMA 3PT9A 4UPAA 5LMNL 4BA2I 3ND8A 5GAN7 3MXNA 3PGGA 4EPCA 4X66L 2CP5A 5EBDA 2XDBA 4DF7A 4OGQC 4DR2Q 3TZUA 1IBKL 1FNWA 3KFVA 4WCIA 2G6FX 2VC8A 1YHQQ 2RHZA 1LACA 3CC2T 1I6HH 1WHKA 2G5DA 2CSQA 1E22A 4QQDA 2F0HA 4X62Q 1NMGA 1HNXQ 5FU7B 2A69C 2EY5A 4UDUC 2JSOA 1JEGA 3S1NB 4C8QG 2WSEE 2VGMA 4RCOA 2Q2HA 4HIKA 2HUGA 3MO8A 4RCCA 3M7NA 4GBQA 2JA7B 4FYYB 4BY6B 5G3LD 4M7AB 2K33A 3ZYYX 2Z4IA 4P71A 5LMUL 2JP1A 3QZ9B 3VV0A 4DNTB 1X6OA 4CBVA 1RKNA 4X64L 4AQYL 3BDUA 3CC7T 4LUOA 2FXQA 2VXWA 2EJFA 2EPBA 1PZJD 3UI2A 1U1SA 3SDZA 2JA5H 3RKYA 4C5HA 3FRPB 5C4XH 1JC7A 4RGOS 1M9SA 4HA8A 4KY5A 3VYUA 4HJ7A 4WJ4A 4XT1B 3OTOQ 2KHSA 5C3XA 1MV3A 1IBLQ 4K8JA 5EKIA 4A3IG 4JJNK 3UT1A 1ICWA 1S72Q 3FB9A 3KUPA 4IJHA 2DJGC 1QCFA 5ISRA 2QGGA 3FEWX 5AJ3Q 3A8OB 3HOYG 2A0FB 5EC7A 1A6XA 5FLXc 3DKMA 2RQWA 5NUCA 1KIKA 4G4KA 3HOUH 5DEHA 4LAAA 1CKNB 5KCHA 3F2UA 4RWSC 4PMWA 1B07A 1W2BS 2LCLA 1JB0E 2X9HA 1GUNA 4LD6A 2J0TD 3RLNA 2UUCL 2VQFQ 3DWPA 1B3QA 3L2QA 3TDQA 3C1EA 2NUTB 4O5VA 1CT1D 3S1QH 1ABQA 4C8QA 4M78B 5LL6S 3GDEA 3PIPA 1X75C 3PTAA 3S2HB 4GNXC 3RMQA 3BJUA 1CM9A 4OMNA 2A19A 1GXIE 2F4IA 2W10A 2RM4A 3REAB 2XWBB 3RN5A 4B3ML 1H8KA 1A0NB 2CZ6B 3I56Q 3I4LA 3T51B 4TRDA 3UDFA 1TUDA 3EGXA 5LJ5e 2B63B 2D6FA 1B9NA 4R9WA 1EY6A 2ZXOA 3VR3A 4A4IA 1N5ZA 4C5GA 2DUDA 4L6V5 4UP7A 3WVDB 3FHWA 4X1VA 3MEVA 4QVDA 3E9HA 3RLFA 1XNQQ 4LJZC 4A3GH 2X4XA 3VS5A 4M78D 5LJ3j 1OXTA 1VQOA 2EE1A 4PMCA 1H3ZA 1WJRA 1I07A 1VQKT 3H0IA 3OBWA 4A3JH 4ALPA 3CCLQ 2SEBD 5LMNW 2AIRB 2EDGA 4K0KQ 3OWEB 4A54A 2E5QA 3DWAA 3LGLA 5C0XH 4DR7L 1YNJD 2A5HA 3CRKC 5CKBA 3REBB 4X65L 4FXGC 1YNXA 1XWEA 3DWQA 2CP6A 3G6EA 1XPRA 3S3OA 4FO2A 1PWTA 2CW0D 1QJOA 2F0SA 3J80c 2LCCA 2F0TA 1UAPA 2MGSA 2AKLA 1VQJA 2K14A 2CH4A 1EY5A 2COYA 4RCBA 2RHXA 1YJ9A 2OTLA 1OXUA 1VF5C 5LJ5d 4JCVE 4LFCL 1WHGA 3FJ5A 3QB3A 1A2TA 1D3BA 1TIID 4C92A 3GTPH 1FYNA 2NN6I 2ED1A 1WOCA 3E0EA 2GBQA 3TU4K 1GOZA 2WB1E 4A3IB 2R93H 1BI1A 4BD3A 4QUCA 3GTKH 3PV0A 2EKOA 5DY9A 1UJ0A 4L5GA 3RZDH 2DILA 3OWFA 4KH0B 2F03A 3HOYB 2BA0A 4P73A 2IJ0A 2AZSA 3KJPA 3CCET 2YRCA 4ZTJA 3O8VA 1K9AA 1EU3A 1LT3D 1KK7A 3KF8A 3UDGA 1LLRD 3OYMA 1SFOB 1IBML 2PMZE 1H92A 5C4HA 1YJ9T 2DJFC 4WF2A 1D3BB 1IHVA 5JEAH 1M90U 1H95A 3HOXG 4ZN3A 1TS2A 1T0JA 4OB3B 1CZWA 1FVIA 4HSPA 1SF9A 2CH4W 1X9NA 1NJIU 1EUJA 4DEXA 3ERSX 5M5YH 2ZXPA 1I4QA 4BY7H 3I4OA 2GTJA 4EMGA 4QQ6A 3VJPA 5F2DA 4LDXA 4F14A 3TZDA 2MK5A 1TH7A 1VQ6T 1B4OA 2NUCA 4JI5Q 3DHQA 5C3EG 5DM7R 4K6DA 2KNBB 3M58A 2JA7G 4ZKCB 1DOMA 5CMDA 3CCSQ 2CP7A 4OO1H 2RDGA 5KE3A 2OX7A 4B3TL 1IW7C 3E5SA 1KRTA 3S17H 3HPWA 1KD1R 3PFSA 5C4JH 3GTGB 1KAWA 5I22A 2F3IA 3HHTB 2IIMA 4KY6A 2WACA 1VQCA 1WQ7A 1N33L 4TKOB 4MZMA 5LJ5g 1SHFA 2KOLA 5ELDA 4ZK9B 1WX6A 1BQQT 3PUXA 5GQOA 2AQ1B 3N52A 1SAPA 3ULLA 1OZ3A 1GUOA 2OCEA 3E9FA 4FW1A 4HCSA 1JO8A 2XWJB 3CCJQ 4C3IH 4A3FG 1U1TA 1CZGA 2XU8A 5I9PA 2FEIA 3NTKA 1EZZB 1KL9A 1WTWA 4HJAA 1QLYA 4FIBA 3CCUQ 4PFPA 4KT0E 1T9HA 1YI2A 2K4KA 1SSFA 2Y0SE 3QO2A 2E70A 3LWEA 4DUYQ 2EQIA 2FZKB 1SNCA 1SG5A 4MN3A 2A36A 3JCMW 3OYDA 3TSSA 3EVQA 3J81L 3CCMQ 2N78A 2KDSA 5JOBA 3CMEA 4GS3A 1NR4A 3A8HB 2CT4A 3PVQA 3EN2A 4L5RC 4GN5A 1QVFS 2P0PA 1QCBD 1UE1A 4GLXA 1HTLD 3UE1A 2DD4A 1YITT 2VL6A 3KUFA 4KKSA 4QY7A 1W1FA 4MZPA 3NE5B 2I0QA 2MCNA 4JK1C 2PVOB 4A53A 4BBRG 2Z6BA 4DR2L 2YUPA 4RCNA 2GN5A 4PZ8A 4AG1C 2OXPA 2ZPFB 1DOLA 1G2BA 4AFUC 1GCQA 1ZSZA 2K2VA 1BOSA 4X62L 5KE2A 4EIKA 1VYTA 1JB7A 1YVCA 2EGCA 3RKXA 3KF6A 3HOXB 5T1GA 4C3HG 3MP6A 4X3TA 2Z9HA 2DTIA 1BI2A 4FNFA 2FZGB 5CIUA 1HNZL 1GBRA 2KEEA 4J9FA 1U4LA 1QG7A 3CPFA 3V7RA 1ASZA 2L12A 4AMCA 4LDWA 4NS5A 2AKWB 2KXCA 1XMOQ 2RQVA 5CKEA 1X55A 3JCMP 1IKLA 2P0KA 1GKHA 2JN0A 3RMHA 1N8RR 4LF5L 2JK8A 2PU9B 1ACMB 3G71A 4DU9A 2MI6A 1HUMA 4VUBA 3AFPA
chains in the Genus database with same CATH topology
1Q1EA 1SRUA 4DR4Q 1IBLL 4C0GA 1YJNA 4YWLA 3JC66 3KF6B 1R9TH 2JA8G 3GO5A 3RIRA 5IYBG 4M7DF 5IP7H 2JUFA 3OW2A 1K8AU 5AJ3L 4N4GA 3NEMA 4M7DE 2RHSB 1X54A 2HHHL 3CD6T 2X35A 1QZGA 2VQFL 3QG1A 3U4ZA 1KC8U 1L1OA 2O4XA 3HRSA 3A8LB 2UU9L 3JAMc 3MEWA 4B9WA 4A3BH 2E10A 4GNXB 1HZAA 1X01A 2MAMA 3OYFA 4DR5Q 1N9SA 2MQHA 2OTJT 4MDWA 4IKFA 4DR3Q 4IUVA 1A62A 2RF4A 3QO3A 4JI6Q 3HFNA 2K75A 1Y1WH 4M7AF 4GKKQ 4C5EA 1LOJA 2B8AA 3CXCS 4GOPA 4LFBQ 2D0OA 1CSPA 2KCMA 2F5KA 1JJ2A 4M7AE 2OAUA 5M3MG 1X56A 1VQ8A 3G4SA 4R4OA 4HIMA 4K0KL 2WAQG 3F2CA 1XMQQ 5CAIA 1DJ7B 2LTOA 2QXFA 4EX5A 3H3VH 4C2MH 1B34B 3I4NH 4ATOA 2JEBI 2RHYA 2QA4T 3W1BA 2LX9A 5M3FG 3GPLA 4A3DG 5GMKl 1NJIC 3PO3H 3L1AA 2ZGWA 4XTZA 3BZKA 3FRNA 5GAN8 1CKMA 1I4K1 2R57A 3G4ST 3SWNA 4M7DC 1KIXA 2MNAA 5LJ5h 5CR2A 4M77G 4NXNL 4DUZQ 2AWNA 4L5QA 4BBSG 2ZTDA 4GLKA 2OQ0A 2B29A 1VS0A 5IYDG 4A3LH 2A3LA 3RUXA 4BE1A 2ZZDA 1S3OA 1UB4A 3EFSA 1YBYA 4HKEA 1K0RA 3H6ZA 3OYNA 3CCLA 2EJ9A 4Y52H 4IUPA 1QVCA 3CF5A 2V1CC 4JI5L 3JB9I 3LW5E 5FU7C 2IHEA 3PO2G 1JJGA 2PNHA 1FJGQ 4PLIA 4EMHA 2C06A 4M7AC 1YHAA 4QVCA 4C8QE 5J3BA 4JS5A 5CVIA 2DK3A 5JJIA 5C44H 4EMKC 1BI3A 3STBC 1HNWQ 3H8ZA 2EFIA 4QL5A 1VUBA 1W4SA 1U5KA 3JCMJ 2VQEL 2R7FA 3JB9J 3CBPA 3KXTA 4P74A 3RKWA 4M77A 1VQBA 3K8AA 3QSUA 1W2BA 2IX0A 4F7UG 1AH9A 1I81A 1TWGH 2MFIA 4IJLA 1UEBA 3HOVH 2K5NA 4LF8Q 4A75A 2CWPA 5KCOA 1MKHA 3F2BA 4DUYL 2UUBQ 3H0GH 1XPOA 3J81i 3T1HQ 2DXUA 1IL2A 3CEYA 4BI4A 5A0GA 3M4PA 4A3EG 3QDRB 2NZHA 1G3WA 2D0QB 3CCVA 3C4SA 4FM4B 1GD7A 4M77B 3ZEHA 4GLVB 4JI1L 2CZ1B 1V29B 1JBMA 4J7FA 3RERA 4IUUA 3E9GA 2MF2A 3CCQT 1K8AC 3CCSA 2E2JH 5C6SA 3GTMH 2EQUA 2E5LQ 1GO3E 3PF5A 3P8DA 3CP0A 1OI1A 4LDVA 4E7LA 3IRBA 1J6QA 3GF5A 3OS1A 3HOZH 5M5WH 3ULPA 5IN1A 1WJSA 1QVGS 1X65A 4F7UA 3NFCA 4C8QC 1NBWA 2HIXA 1SE8A 5K36G 4A3KG 2CQOA 2JA9A 3H15A 4O6JA 3F70A 5IT9c 4DR4L 1VQFA 2DVEA 2ZPEB 2XKOC 3RMSA 4GN4B 2A1AA 1Q82C 3OMCA 4DQ2A 2YRVA 1UE6A 4M75G 2PQAB 2M1HA 4DV3Q 2VGNA 1N27A 4F7UB 3FKIH 2KQWA 3MEAA 2KHJA 3VYGA 4IUQA 1Q7YC 2UXBQ 1XTDA 1EIFA 3QPHA 1FXXA 5C4XG 1NPPA 2FHDA 4J6YA 4DOWA 5IWAL 1C7YA 3OSSC 4DR5L 1VQLA 4LF9L 4C92C 5FJ8H 4DR3L 4JI6L 1KQSS 2CFMA 1N36L 3CW2C 1WQWA 4GKKL 4XU3A 3EIVA 3NBHB 3RNUA 4LFBL 4J83A 3QBYA 1HXDA 4PL6A 3M5AA 3RZOH 4BY1G 2E65A 3VYHB 5LJ3f 3G7ZA 3VU3C 4LUZA 1UE7A 5GMKm 1VQMT 2VUMH 1GVPA 4M75A 2CCZA 2JTFA 3INZA 4MMLA 2DJZA 5GAEC 3EFRA 4A3MH 3M59A 5CKFA 5IP9H 5M9OA 1WGSA 1QVFA 2RCNA 3QYHB 4DPGA 1OXVA 2MWOA 1TWCH 4DUZL 4A4KA 4M75B 5EG2A 1PH7A 2EAYA 2XDDA 3S6WA 3AQQA 2R58A 3L2UA 3SD4A 1TWHH 1MJEA 4LFAQ 2LXKA 2R7ZH 2NVXH 1TWFH 2QEXA 1KRSA 5CQYA 3DM3A 2YTYA 3S2DH 3LYIA 4M7DD 3PUWA 3OSVA 2UUAQ 3X24B 3HRUA 2HQEA 3J80i 2R92G 1Y71A 4NB3A 3CC4A 4Y28E 1HJPA 4DNIA 1I94Q 1FJGL 3DLLA 1N9RA 3VUBA 4RMFA 1HNWL 4EMKB 2KY9A 2QEXT 4A93G 2OQKA 3M4GA 2OWOA 3MXNB 2HNIA 3ZBDA 1W3SA 3S14H 4XTCS 4M7AD 4QGUA 3JCMV 3EBEA 3CBMA 3STBD 4LF8L 2UUBL 5GAOl 4OMFB 4PJOG 1SR3A 4YCVA 3DB3A 2KVQG 1PH5A 5ELNA 5JJLA 2X4YA 4L59A 1XNRQ 4OONA 3MP8A 4V2SA 4C92G 1BVSA 3S1NH 2LT4A 2VUBA 3UE0A 2AWOA 3CXCA 1PSEA 2JA7H 1B70B 2DEQA 2E5LL 2H3JA 3X26B 2Y90A 5GMKj 2YHTA 2L3RA 1A0IA 3JCMX 3TS0A 2DIQA 2G3RA 5GAN2 4JBJA 1L1OC 5HK0A 2HT1A 3S3MA 1V1QA 4C8QB 2V8JA 4YCUA 2JTMA 3NTIA 3OYJA 1WI5A 4IPGA 2WAQE 4PJOA 2MMPA 1VQ7A 4POGA 2K52A 1X3EA 3JB9G 2R5MA 2VZAA 2LNVA 3VKIA 3KYHC 1M1FA 4GOPC 4OX9Q 2Q2TA 4C8QD 4JLGA 1VQOT 4MZTA 2LSSA 4DV3L 3S2HH 4POFA 4FT4A 2IX1A 1LTLA 4M77F 1SN8A 3NELA 2B63H 4PJOB 1CUKA 4E7HA 2UXBL 2EQMA 3G6ET 5FU6C 4M77E 2HQLA 1PH6A 1B7YB 3GD7A 1G3SA 3JSCA 4PNOA 2RK1A 2OTLT 2K3XA 3A0JA 1VQPA 1YEZA 4C92B 3HFZB 2DAQA 5IP7G 3ASKA 3AHUA 4DV4Q 4ZGDB 3GTLH 1Y96A 4EQ5A 2X4WA 4IPCA 4JI8Q 3SWNC 1JJCB 1LM0A 4FDBA 4OGEA 5DLQE 2I5MX 5GAN4 2I2LA 3KF8B 2YLBA 1KHIA 5A0DA 2IG0A 1E1TA 1YIJA 1Y1VG 1QVPA 2RD1A 5GMKe 3CCRA 4DV2Q 4JI7Q 5M5XH 4A3IH 1VQPT 3JRZA 4JBWA 1N34L 4NPSA 2X4JA 1N32Q 5LJ3e 5FLMG 3HOYH 3M57A 3JAMi 4XTUA 4F7UF 3QZ5B 4MDXA 2ZM6L 1Y1WG 1WCMG 1JE5A 1PV4A 4XU1A 1SFOH 1KQ1A 3OYYA 4F7UE 4DAYB 2RO0A 3SGIA 2PVDB 4BACA 1M1KC 3S3NA 1FGUA 2CZ7B 2C35B 3M4YA 3J7A5 4JBMA 3RN2A 4KULA 2WFWA 3CCRT 4DV6Q 3RR5A 3JB9D 3KOJA 4A4HA 5HK3A 4M77C 4ZGJB 4YCWA 5GAOq 1G51A 3I4NG 1VQEA 2PUKB 4YHHQ 3BZCA 1WJJA 4LUVA 5LJ3d 1AE3A 3ER0A 2Z6KA 2UUAL 3K7AH 2R7DA 5HKCA 1QVGA 3KLWA 1YI2T 3T9NA 2K3YA 1HNXL 3GTGH 1OTCA 2QDYB 2MO0A 4HCZA 1L0WA 1WNLA 5GAOp 1I94L 2QQ9A 4BDYA 1XQHA 1FL0A 3CMET 3RESA 2LC4A 4ME3A 4R55A 2JA6G 2PVGB 2RH2A 2I5LX 5GANj 4A3LG 4XTVA 4YWKA 2VXFA 1P8LA 4NL3A 1J5EQ 2VNUD 3CBOA 5GAOm 2CWAA 2N8NA 2GVAA 3OTOL 4L5TA 4JYAQ 4IURA 2VS1A 1A8VA 1HZ9A 3BW1A 2JE6I 4M75F 1YJWA 5CKHA 2HAXA 4XTWA 2DTHA 4L5SA 1Q1BA 4NXMQ 3OS2A 4M75E 5C44G 4XU0A 5C0XJ 1XNRL 1K8GA 3G71T 4AYBG 1YHQA 1KQSA 3V7CA 3A5UA 5LJ3g 3HOXH 1NTGA 3GP8A 1SMXA 1Y07A 1CSQA 4JI0Q 1YJNT 1P92A 3TS2A 1YJWT 3GNGA 4AH6A 4PZ6A 1XNQL 5CCAA 2XIDA 4DK3C 3F2DA 1Q82U 4GLAC 1K83H 3M4QA 3KDFA 2QQAA 2WSCE 2RI2A 1L1OB 3D31A 4A3CG 2PQWA 2O4XB 3LH0A 3EAEA 1YHQT 2GQVA 5FRMA 3LGJA 4ZGEB 4JS4A 4QIWE 4HIDA 2DPPB 3BDLA 1BIAA 1S72A 4APVA