The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
136
|
structure length |
136
|
Chain Sequence |
GDKTKVQVSKLKPGRYIIIDDEPCRIVNITVSSPGKHGSAKARIEAVGIFDGKVRSIVKPTSAEVDVPIIDKKTAQVIAITPDTVQIMDMETYETFEVPIDTGVADEIRDQLKEGINVEYWETLGRIKIMRIKGEG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
Initiation Factor 5A
|
| publication title |
Crystal Structure of Hyperthermophilic Archaeal Initiation Factor 5A: A Homologue of Eukaryotic Initiation Factor 5A (eIF-5A)
pubmed doi rcsb |
| source organism |
Pyrococcus horikoshii
|
| molecule tags |
Biosynthetic protein
|
| total genus |
28
|
| structure length |
136
|
| sequence length |
136
|
| chains with identical sequence |
B, C
|
| ec nomenclature | |
| pdb deposition date | 2002-09-25 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01287 | eIF-5a | Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold |
| A | PF08207 | EFP_N | Elongation factor P (EF-P) KOW-like domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | SH3 type barrels. | SH3 type barrels. | ||
| Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | Nucleic acid-binding proteins |
