2DK3A

Solution structure of mib-herc2 domain in hect domain containing protein 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
86
structure length
86
Chain Sequence
GSSGSSGVRSQVLKYMVPGARVIRGLDWKWRDQDGSPQGEGTVTGELHNGWIDVTWDAGGSNSYRMGAEGKFDLKLAPGYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords E3 ubiquitin-protein ligase HECTD1
publication title Solution structure of Mib-herc2 domain in HECT domain containing protein 1
rcsb
source organism Homo sapiens
total genus 8
structure length 86
sequence length 86
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2006-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06701 MIB_HERC2 Mib_herc2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.920 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dk3A00
3DKMA 2DK3A
chains in the Genus database with same CATH superfamily
3INZA 3UA6A 1VQ4A 2CDTA 5LL6S 4KGXB 1TTHB 5J26A 3MEUA 3JCMg 2XICA 1TOVA 1X2KA 1Q86R 3MEAA 3PE0A 4C5IA 4Y92A 3EG0A 1MMNA 2DO3A 4M7AB 1R0BG 4PFZA 4M7AA 1KQSA 2F69A 2D0QB 2QQ9A 1PNJA 3QWYA 2OX7A 2QYZA 1FXXA 4QT7A 1U1TA 4JJCA 1JU5C 4CI0C 1XJWB 3CMAQ 2X35A 2OAUA 4X9DA 2HL3A 1JEGA 1U8RA 3OYDA 5KYWB 5GMKe 4BACA 3TREA 3DKMA 4C0DB 1WI7A 1YCSB 4FT4A 1KJWA 5GAMe 2K4YA 2RI2A 7AT1B 1V76A 4M7DD 3MCAB 2FL7A 4FIBA 1NEBA 4AMCA 2L8DA 1VA7A 5LJ5h 1RADB 5D7UA 3UPUA 1TWBA 2XI9A 1QCFA 4J9BA 3BDLA 3E1SA 3EAEA 4C92D 1QP3A 2VKNA 5HCKA 4FT2A 3KXTA 5DLQE 1VQ6A 2EFIA 2PQWA 1UGVA 2F5KA 2DTHA 4XK8E 1SEMA 5L23A 3OS1A 1X27A 1NM7A 1AT1B 5LJ3g 2QQAA 2DL7A 4JPBW 3RBBB 3VRYA 5KYNA 2PTKA 4A54A 4DBFA 3CC2T 4BD3A 3G4SQ 2JS2A 3QG1A 4M75C 2EBPA 2AKKA 4ME7A 4HCCA 2DYBA 1ZHIA 1WNLA 4XTZA 5GAMj 3FLGA 1PCXA 5GMKi 1EIFA 2GQIA 3VS0A 3OSSC 2O9VA 3CCRQ 3UATA 2ROTA 3L2WA 1FYNA 2DRMA 1M3CA 4XTUA 3CCET 3LGFA 3JB9I 2KRSA 3CPWS 2GBQA 4E7IA 4PL6A 2E1HA 1WZOA 3JCMc 2Y4XA 3MJXA 3OBWA 4DEYA 4EMKA 2KQWA 4J6WA 4M75G 3VS6A 4ZNXA 5KYYB 3U23A 4PJMA 1QVPA 2RJEA 1B3QA 2X4JA 4OMNA 5KYYA 2FO0A 1WX6A 3BFMA 1TG0A 1W6XA 3EGDB 4J83A 2KBTA 5KE3A 3EGDA 3QDFA 1GCPA 2OTJT 3OMCA 1WYXA 1TUCA 4KRTA 3EGUA 2DL4A 3JCMP 1KFZA 2EQIA 2DERA 3OYLA 3L2UA 2KYBA 3OYFA 3KBGA 2X4XA 4FYXB 1WJRA 3SD4A 2CUBA 3CCVT 4XU3A 1KC8C 1AWJA 2DIQA 3FRNA 5LJ5g 3O8VA 1VQ4T 1Y71A 5GANd 5M9OA 2HNIA 4DQ2A 2MMPA 2IPOB 2BE9B 2JS0A 2QQBA 4ZN3A 2HKQB 1YCYA 4OGCA 1ZX6A 2COYA 1RAHB 2DL3A 1KC8R 4O5VA 2BZYA 2LX7A 1Q86U 1SF9A 1G3TA 2JN0A 5GAMf 3FJPA 3TSZA 2ZCFB 2YSQA 1OU8A 2J7IA 3LW5E 3HKSA 4IIOA 1E6HA 2DA9A 2HEQA 5CCAA 4BB7A 3C4SA 1VQ5T 2EKHA 3CMAA 1W2BS 1I5LA 1UHCA 3AHUA 2D9TA 5FU7B 3C12A 2EGEA 2QEXA 2YUPA 3LLRA 2C0TA 3CXCS 1BCOA 2BUDA 4R56A 4J6XA 3CC2Q 2E41A 2WSEE 1QMCA 4LNPA 4F7UE 4C5EA 1VQ7T 3JCMJ 5D6XA 5GJVB 4RTWA 2DE0X 4BE0A 1QKXA 2GTOA 1UGRB 4M78C 3NTHA 3CCJA 4BDZA 2DILA 2D0NA 3JRZA 2JTEA 3CCEQ 4XTYA 3PVLA 2IVWA 3RESA 1GCQA 2M02A 3SWNC 9ATCB 4B9WA 4A63B 4N4HA 3QHSA 4ZGDB 5I2SA 2MI6A 2ZPFB 1IB8A 3L42A 1RABB 4IURA 1YNZA 1C6VX 3JCMV 4PJOF 4C5HA 3M53A 3GLXA 2LC4A 4OGEA 4M78G 1M1FA 2EYQA 2OTJQ 1VQMT 5GAN4 2HQXA 4BY6B 2QQRA 5C6SA 2RF0A 3OS5A 3SDZA 4C8QC 5LJ5j 1VYTA 1QVFS 1VQLT 1BI2A 2RHXA 3LX7A 4BI8B 4PJJA 5CQXA 3EG9A 2RHIA 1VOMA 4C5GA 3HRSA 2DK3A 2LNHB 5CIUA 2JM8A 3CCVQ 2YT6A 2P0QA 2K5FA 3CEYA 3CCRA 2PUOB 1VQ4Q 1VYUA 2QAZA 3CCMA 4ZTFA 4HKEA 1YITA 2V1QA 2E12A 3L2ZA 4RTYA 1WQWA 2QTVA 4KBMB 3A8LB 1SPKA 3FJ5A 5EC7A 4C8QG 4IUVA 1OX8A 2JUFA 3T9NA 1AHJB 2YDLA 4V2SA 2LT4A 4RKUE 2FZGB 1I0CA 4AFSC 4J9IA 2DL8A 1M30A 1BIBA 2KK4A 1Z9QA 2PNIA 2VXFA 1VQ5Q 2ROLA 1C1AA 3M57A 4PJOB 4MZMA 4PJOA 1I1JA 4ZN1A 3VV0A 5HK3A 2MPXC 3PVQA 1OULA 4MZPA 2HAXA 2JJ9A 3C0CA 4M7DF 1QLYA 1TUGB 1LJOA 2XDPA 1HK9A 4A4EA 3ULRB 4FL6A 3RUXA 2NUTB 5CQYA 1VQ7Q 2NUTA 2W10A 2EYZA 3RIRA 2FPDA 4F17A 1YHQA 1KSWA 3A98A 1OYXA 2AIRB 2R58A 2RMOA 1MNDA 3A8MB 2VYTA 3ER0A 1RL2A 4N0AC 3JCMh 1I5OB 5IHNA 5GAMh 1KD1C 2CZ0B 4C92F 4AFUC 4CC2A 1AEYA 2K5IA 1WIEA 5GAN6 4RCCA 2J6KA 3RNJA 1M8MA 4HCZA 2QEXT 1KC8U 4M7AE 2A36A 2CP3A 2RQUA 3BW1A 3L2QA 1QKWA 1KD1R 2J6OA 4M77C 1QWEA 2NYSA 1VQMQ 4A4GA 4OMMA 4JJDA 3CBOA 2O2OA 1Y7XA 4KULA 2D1XA 1YIJT 1JXOA 3A5ZB 2OJ2A 1VQLQ 4GLKA 3CC2A 4XTWA 3GP8A 3CPWA 3QIIA 3FB9A 4M7DB 2KNBB 2BZ8A 2XD0A 4M7DA 2XG8D 3OYMA 1VQKT 2H3JA 3CCJT 4ZTJA 5IHIA 4O6JA 3RKWA 1K9AA 3OW2S 3REAB 1GXIE 2OTLT 2AZSA 4M77G 1WGSA 4Z89A 1E7OA 2JMCA 1IGQA 2X9HA 5IH2A 3GPLA 2ESWA 4JRQA 2RHUA 4J8OA 5HY6A 2EKOA 4QQ6A 4C92B 4E7LA 4OMOA 1R0CB 2BE7D 4C92A 3HSBA 2DVJA 2X51A 4CC4B 1VQOA 1RAGB 1U3OA 2RD1A 1LPLA 2HSPA 2HMAA 1E6GA 2QG9B 3JB9D 2B86A 2KY9A 1JXMA 2OTJA 2K57A 2XIDA 1FX7A 2RA2A 1S1NA 2DLPA 1OV3A 3AT1B 4HA8A 4RTXA 1TUDA 1Q7YC 2RQRA 4J9CA 2LQNA 2COWA 3JB9H 2CZ6B 3CCMT 1M1KC 2FB7A 1YITT 4LDWA 1Q81C 1H3ZA 5KYUB 1QCOA 3CC4T 5GAMg 1ZUYA 2DIGA 1T3LA 1WHMA 4PLLA 3X20B 1W2BA 1PM3A 3OBYA 2DBKA 5FU6B 1AVZC 3V8KA 2LZ6B 1Q7YR 1SRLA 2VB6A 4DOVA 2RI3A 4FYYB 2ZPIB 2K2VA 4HVUA 1D3BB 1RAAB 2DBMA 3CXCA 2DYIA 3CMEA 2ED0A 2F2XA 1M1KR 1NYFA 1D3BA 4E7SA 4MDXA 2A28A 1SHFA 3LH5A 1Q81R 2JXBA 3M59A 2QEXQ 1XQHA 1AWOA 2RQTA 2L5QA 3EGXB 1VQ5A 5KYWA 2M16A 2MWPA 1K1ZA 2YUOA 3EGXA 5FWCA 3PIPA 2F1LA 2PVDB 3X25B 2KE9A 1MHNA 1JO8A 1O75A 2EWNA 5I11A 1N6AA 4OB3B 5FW9A 3A8HB 4FSXA 1YIJQ 1VQNA 4E6RA 3V7CA 4DBHA 4XAXB 1YHQT 4X9CA 1VQ7A 3H41A 2EIFA 3S3MA 5GAN5 1WHJA 1VQKQ 3CCJQ 3NHNA 4HVVA 1N9RA 2JTMA 2I2LA 2V1RA 3A8OB 3E9FA 2LVMA 4F14A 4L6V5 2OTLQ 2JTFA 2LQWA 2CS7A 3EG3A 3PFSA 1X43A 4DBQA 2QASA 1M90C 1UHFA 3SB2A 4LD9K 2K79A 2HBPA 2XKOC 5GJWB 1IREB 4C8QD 4JUVA 2C0IA 2M0OA 4NL3A 1AD5A 4JRPA 3MEVA 1V29B 1VQMA 3NFCA 5GMKj 2NLUA 2L0AA 1M90R 4ANJA 1SKUB 1VQLA 3V7RA 4JJNK 5IXBA 1AZGB 3L1AA 2EPDA 3HPWA 5GAOp 2HDAA 5DLOA 3D7SB 3CCMQ 1IZ6A 1JQQA 3HRTA 1H3HA 1YITQ 5IT9E 1HXDA 2JVVA 3DB4A 1XTDA 1M5Q1 3HRUA 4JRKA 2DX1A 5KH6A 5J3BA 3MKDA 3CC4Q 1YJWA 2QA4T 1EFNA 3FIFA 4NS5A 5CKHA 3GBQA 1KQ2A 3VYHB 4HCKA 1QVGA 1VIFA 4FW2A 1KQSP 3MP6A 1IHWA 4R55A 3JV3A 4OB2B 4FYVB 3H6ZA 3CXCP 3P8DA 2FYKA 1VQOT 4YTLA 5GANe 1YBYA 3MPUB 1F1BB 3PNWC 2VVKA 3EG2A 3MEWA 2B8AA 3P8BB 4IUQA 1M2VB 2EJ9A 2R57A 5CKEA 5FWBA 1K9MU 1M2VA 4OMLA 1Q82C 1ZSZB 1G8XA 4B9XA 2M0YA 1ZSZA 1G83A 2E4HA 5KCOA 1RAFB 3TSWA 4JS4A 1V1CA 1Z9ZA 4HCBA 3I9QA 2EAYA 3M0TA 2LDMA 8ATCB 5GAN7 2L3RA 2G3RA 1X69A 3I5SA 4UC4A 3GF5A 3CCQA 1N9SA 1Y57A 1WA7A 2EYWA 1Q82R 4XU0A 3FC3A 2XDBA 1QCNA 2X3WD 3UT1A 2RI5A 1YHQQ 5I21A 3GNFB 3GOXA 4J7IA 3RMSA 1G2BA 3ZEHA 2X3XD 3IQLA 5GMKl 4KT0E 2XHCA 2AT1B 2QDYB 4OMQA 4PJNA 5LJ3d 3OYCA 2XMFA 2V8KA 2DEQA 4J6YA 3ZFJA 4R0KA 3CMET 1YN8A 1WDXA 3L2VA 4PKCC 5GANj 5FRMA 2DJQA 1NZ9A 2LQKA 1FMWA 4M77D 1Q7YU 1UUEA 2RB6A 3E9GA 1W70A 2H3EB 4MZTA 4XQ3A 2CT3A 4JZ3A 5CAIA 4F7UG 6AT1B 2XU8A 1TS9A 4PJLA 2DVEA 3SEMA 2MYSA 3TQ7P 2RPNA 1VQNT 4E47A 1N8RC 3OYBA 4E2FB 1H8KA 4J9GA 4PJOE 1I4K1 1YIJA 4BI3A 1UGSB 2EGCA 2CYZB 3EFRA 4FW1A 4PLIA 1OPKA 3OY9A 3MHXA 1TXQA 2KT8A 2AHJB 4E7ZA 2RH2A 1VQKA 1ABOA 1PC0A 1ARKA 2J06A 5HKCA 2QGGA 4F16A 2KSSA 2CH4W 1QVGP 2J6FA 2K3XA 2QA4Q 1GFCA 2FRYA 4RTZA 1N8RR 2OTLA 3OS0A 4QVCA 2DTOA 3X26B 1NYGA 2DJZA 3PMIA 1HYOA 1RI0A 2VC8A 4JS5A 2HZYA 4JLIA 4CC3A 2O88A 1H641 1VQOQ 2EJGA 1NJIC 2YXYA 2RK2A 1PD1A 1JB0E 1OX9A 2BIVA 3JB9F 1UEBA 1SG5A 2JZ2A 1YJNA 4HXJA 1IO6A 3BY7A 2VASA 2EVRA 3ME9A 4M75B 4OF1A 4A4HA 3QDRB 2PVGB 4M75A 3BDUA 3M0QA 3LWHA 2DETA 1X01A 4F04B 3OYKA 2RQVA 1NJIR 1BI0A 4L5GA 5CKFA 3SFMA 4DEXA 3OYHA 3VS7A 1G3WA 2K3YA 1PKSA 5GAOl 1H92A 5GANf 1M90U 2NWMA 2VWFA 1RLPC 1K4US 4IUUA 3A8GB 4A53A 1YJWT 2LX9A 1PRLC 4M7DE 5GAOn 3WXMB 2E5QA 3I56T 2DXCA 2BZXA 1JJ2S 3QBYA 2F2VA 3CC4A 1ZBJA 1OEBA 3J7AF 2WACA 1BKBA 3M5AA 4D8DA 1S72A 3S3OA 3EG1A 5FRNA 3OYAA 2KXDA 3OYYA 1B34B 3EFSA 3CMEQ 2F2WA 3KFVA 2GQVA 1Y0MA 1B34A 2KDSA 3M55A 1IGUA 4RTTA 1UTIA 3VUBA 2LP5A 3SHWA 4DBRA 4ATOA 4C92E 3CCLT 2IIMA 2FZKB 2LJ3A 1SSHA 1PSEA 3VS2A 3CQTA 3R6OA 3VKIA 4AFZC 1J3TA 2LRQA 2H8HA 1BBZA 1ZBXA 2KAFA 2RQWA 4AFQC 3DLLA 3CCQT 4OVAA 4M7AC 2CH4A 2L89A 2A0FB 3LH0A 1VQNQ 1D1AA 4J5YA 4P5NA 2V26A 1WHKA 4LDXA 2OI3A 2KYMA 3RDVA 5GMKh 4FU6A 4HT8A 3PTAA 1M3AA 5I2MA 2C06A 2DMOA 4OB1B 1K8AC 2E5KA 1OPLA 2ZPHB 2HD0A 4M7AG 2L2PA 1ZA1B 4E7HA 4C8QF 4AG1C 3NGPA 1K8AR 3EHQA 1T3SA 1I81A 1YI2A 4M75D 1MMDA 1OZ2A 4CRIA 4L59A 1X6GA 3GNGA 2LQ8A 4K11A 3CPFA 2XK0A 4IIMA 1Y96B 1LCKA 4E7KA 4ELZC 2FZCB 1Y96A 3C94A 1ZUKA 3QXEB 4BE1A 4M78B 4N4GA 1YJ9A 1UGQB 1YFNA 4M78A 1M9SA 2NUPB 2M51A 1ZLMA 2NUPA 2GFAA 5IAYA 1G5VA 4LUEA 3QZ5B 1YJWQ 1G3YA 3M0UA 3SWNB 2CGHA 2CT4A 3MP1A 4B6MA 5C0MA 2CKKA 3I56Q 3SWNA 1FMVA 2P4TA 2SRCA 2QA4A 2KRNA 4PFPA 3J80E 4QKUA 1OOTA 5D6YA 3C95A 2ZPEB 3VS1A 2MK5A 1N8RU 3G6ET 4C0GA 2LMJA 1WLPB 1YJNT 3PT9A 4QQDA 1N27A 2DRKA 4QVZA 1T0JA 4C8QB 3CCLQ 2A08A 3QSUA 4C8QA 2L3PA 1TU0B 2RHZA 2K9GA 1VQ8T 1VQ9T 4EMKC 1D0ZA 3CBPA 2ZGWA 1QW1A 5GANh 1K73C 1FWZA 2YWWA 2LCSA 3VRZA 3CCQQ 3DLMA 2AZVA 3JCMX 3PIOA 4BE2A 2DKGA 1BU1A 1O9SA 2MWOA 2W0ZA 1NJIU 4KGVB 3HTRA 4LN2A 1Y07A 2EJFA 5KYUA 4GY5A 1M2OA 3FDRA 1K0SA 1K73R 1S72T 3LYIA 1M1GA 1KG1A 1NBEB 4KGZB 5A2QE 1SHGA 2QTXA 4LXCA 1BCMA 1OU9A 3RKYA 4M77F 1WPYA 1UB4A 1BIAA 1NPRA 1BYMA 5IXFA 1P92A 3N5BB 2GTJA 1WJSA 2ZAEA 2A7YA 3S3NA 2DXTA 1MV3A 1PSFA 3PMTA 1VIEA 3TCJA 1WXUA 2R5MA 2JMAA 4MDWA 3M58A 3CPWP 3RR6A 1NEGA 3JB9J 1CSKA 1AWXA 2ABLA 2CSQA 4M78D 2HBWA 2I0NA 3HHTB 4J9HA 4RTVA 3UWNA 5IHKA 2J05A 5FU7C 3O5ZA 5FLXE 1X75C 1N5ZA 2FPEA 3RERA 4N0AA 3M9QA 3JCMe 1RLQC 3A1PA 2GCXA 2A3LA 3Q1JA 1WJQA 2RM4A 4ORZA 3JSCA 1PWTA 1M4ZA 1WHGA 1ZSGA 4NOYA 2CP5A 2DFUA 4E7JA 4D8KA 2PUKB 2KGTA 5GAN2 2ATCB 4EPCA 2JNGA 2MIOA 1YWPA 1EX4A 3FEOA 1MV0B 4WF2A 1QVFA 3LGLA 3PGGA 2EQKA 4AT1B 3G6EQ 5CVIA 3UDCA 4M77B 1LNXA 4OMPA 2YLCA 1YI2T 1YJNQ 1ZUUA 1A0NB 4M77A 3ASKA 1XNIA 2D6FA 3G1JA 4AG2C 4Z8AA 4WTOB 3CC7A 3MP8A 4RUGA 2BTTA 1G3SA 1GCQC 3V7SA 1K76A 3H0FA 4EMHA 1UG1A 1WQ7A 5GANg 3URGA 1OI1A 2DTIA 1K8AU 1UE9A 4D6WA 5GMKm 1VQ8Q 1VQ9Q 3QYHB 2X4YA 3CCST 1VQPA 3EH2A 1NG2A 1UECA 3JCMd 1KD1U 1R8OB 5GAMd 4PFOA 2K6DA 1WFWA 1HSQA 1YJ9T 1JJ2A 2F5TX 2GGRA 1PHTA 2BKDN 3CD6T 1KIKA 5AT1B 2E64A 1SSFA 2RK1A 1BI1A 3VJPA 1U06A 1ZQ1A 1LVKA 2PVOB 3QJ6A 2JT4A 4BY6C 1EZZB 2FG0A 1X6OA 3CCUT 2E6ZA 1W2BP 2WSFE 2QDLA 2M9UA 3ZBDA 4Z88A 3I56A 3VS4A 1S72Q 2AKLA 1B07A 3VU3C 4KH1B 1MMGA 2HQHA 2DNUA 4FM4B 5EG2A 2VXEA 3TU4K 3E2UA 4J9FA 4X1VA 3OS2A 3G71T 4DA4A 5LJ3e 1D09B 2VGMA 2RJDA 1W4SA 1PKTA 2K5LA 1M27C 2HCKA 4EMKB 1T0HA 4M7AD 2FEIA 2DAQA 3CCLA 2A37A 4KUIA 3HP9A 2DXUA 4RMOA 3META 1RAEB 3I55T 4A4KA 2PZ1A 1OQKA 4M75E 1IXDA 3EHRA 1R77A 3OYEA 8AT1B 3DB3A 1UGPB 2E65A 3M0SA 3M0PA 5AYFA 4QQGA 1HJDA 2P0KA 2XDDA 1ACMB 1GRIA 4PJOC 2PU9B 2E70A 2CP7A 1WXTA 4LUDA 4JDSA 5CKDA 2RN8A 4KH0B 5ECAA 2Y4YA 5HK0A 1DJ7B 5I22A 3CBMA 1K73U 1HD3A 2JW4A 1I8FA 1QVFP 4KUDK 3V8JA 3V8LA 5FROA 1NE8A 4N4IA 2JM9A 4M75F 1SRMA 4A4FA 5GAOm 3M0RA 1QWFA 2O31A 1YI2Q 3BE3A 3JB9G 1M1KU 1GFDA 2FVUA 5LJ3j 3OQ5A 4PJOG 1Q81U 4MMLA 4JLGA 4FCYA 2LCLA 3JCMf 2FRWA 1KK7A 2R5AA 2MF2A 4XU1A 1B7TA 2DF6A 1U1SA 1JJ2P 3OW2A 2HQEA 3CCSQ 2WSCE 1X2QA 2SEMA 2OAWA 3QJYA 3H0IA 4OP0A 1YJ9Q 3E19A 5LJ5e 4LE9A 3VS3A 3CD6Q 1KQSS 2CP6A 4ELYC 4LDVA 5J39A 4ESRA 1GBQA 2KT1A 1WXBA 1U5SA 3CCUQ 2MCNA 2X4WA 1IRXA 1D1CA 2DD5A 4CC7A 4M7DC 3HFOA 2KVQG 2K7AA 1KHCA 2E3HA 1WHHA 4RG8A 5DY9A 1NLPC 2GF7A 3G6EA 3X28B 4QW2A 4IKFA 3CC7T 3G71Q 1UFFA 2DPPB 2ZPBB 2DD4A 3OSVA 2RNAA 1VQ6T 2EQUA 3THKA 5LJ5d 4LDYA 1QQJA 1VQPT 2KI7A 3QWXX 4JZ4A 2YUNA 2CREA 5A0LA 5CR2A 4C92C 1VQ8A 1VQ9A 2AK5A 2P84A 2EQMA 3I55Q 3OA6A 5GAOr 1TSFA 4F7UF 1AWWA 4M7DG 1K0XA 1MNEA 2EQJA 2O4XB 4PNOA 4ZGJB 2KXCA 3M56A 2O4XA 4II1A 3JAME 4J9EA 2FHDA 4OMFB 4X34A 2RO0A 3P8HA 1BK2A 3EG9B 3OB9A 3G4SA 4EIKA 4J7FA 5LJ3f 1BI3A 4M78E 4GBQA 2O9SA 1ZA2B 1MMAA 3WVDB 2KR3A 3EH1A 2E6NA 5DM7R 4C92G 1NPPA 4BI4A 3REBB 1JRIA 3H8ZA 3NTIA 1Q95G 4M4ZA 2D8HA 3TEEA 3OYGA 4RTUA 4VUBA 4C0ZA 1VUBA 1YP5A 1D0YA 2QK0A 3UF4A 2VV5A 4RCBA 1MGQA 2HKNA 3X24B 3KUFA 5GAN8 4C0FA 2GNCA 5FU6C 3OW2P 3NPFA 1M8VA 4C8QE 2E10A 3QUIA 4GLMA 4M78F 2LT1A 2RHYA 2K2MA 2V8IA 2LCCA 5L8RE 3M54A 1CKBA 2YUQA 4XTXA 1C0MA 1QVGS 1PRMC 3HL8A 1FMKA 3RMQA 5GAN3 4F7UB 2CUDA 3S6WA 2V8JA 3JCMQ 4F7UA 1X6BA 2EGAA 2ENMA 2E3IA 1VYVA 2LJ1A 1KHIA 1Q82U 4C0DC 1IHVA 2L3SA 1BB9A 2CP2A 4FSSA 1D0XA 4MMKA 5A0DA 5IN1A 3WVEB 2DM1A 1M3BA 5KE2A 1AZEA 3JCMb 2ZPGB 2MAMA 1MUZA 2YLBA 3M4GA 3J81E 3GIBA 2ED1A 2G6FX 1XOVA 4Y28E 1I07A 5LJ5f 2YRVA 3CC7Q 4RG2A 4DOWA 2IG0A 4QVDA 3UA7A 1VQ6Q 2LTOA 2KEAA 4XU2A 3QYGB 2YRCA 1VQPQ 4IUPA 3CMAT 3H9NA 5CKBA 2QQSA 1YWOA 4NL2A 5A0GA 3G7ZA 4LD6A 1KQ1A 3CCSA 2RJFA 5KCHA 2RJCA 4LDUA 4Y91A 2NUZA 2ECZA 3QZ9B 4JRIA 4WCIA 4J9DA 4EDUA 3VS5A 3EFOB 1JBMA 2KMTA 3CD6A 3QPHA 4HT9A 4OB0B 3EFOA 4PK4A 2P4RA 3QO3A 1WHLA 2DL5A 2CZ1B 2GFUA 2MOXA 5KYXB 1OZ3A 3L2RA 1LOJA 5KYXA 2P0PA 1QP2A 2QXFA 1K9MC 4BUGA 1PG5B 1ABQA 3CCUA 4Q5WA 4IUTA 1CKAA 2CZ7B 2ZZDA 4FYWB 1UJ0A 3ZL7C 3HFNA 1RAIB 3R6NA 2QGFB 1AOJA 3JCMW 4XTVA 3VYGA 4HVWA 2QI2A 1D1BA 2DEUA 1GL5A 4BDYA 4M7AF 1RACB 3CCEA 2HSEB 3M4YA 3RKXA 3G71A 3OYNA 2C0OA 1K9MR 2EW3A 2DZ9A 1RUWA 3NTKA 4Z02A 2CP0A 2Y90A 5GAOq 4M77E 3LWIA 2LNVA 3OYJA 2KROA 3OYIA 5D6WA 4JJBA 1RI9A 4ZGEB 2HL5C 3NMZC 2VUBA 3I55A 2Z0WA 2EYYA 3I5RA 2YHTA 5LJ3h 2JOYA 2LJ0A 3VUZA 1PD0A 4EMGA 1W1FA 1ZSZC 4PJOD 2D8JA 3G4ST 2CSIA 3QKJA 4TVRA 2M1HA 5CK9A 3F70A 1GBRA 1Q86C 1UJYA 2KRMA 1UDLA 2K3BA 2DZCA 1TH7A 2FPFA 2COZA 3OMGA 3MO8A 2VGNA 3TVTA 1NLOC 3H0HA 2EYXA 3CCRT 3CCVA 2DXBA 2O01E 2YRDA 3I35A 2L3QA 5CO7A
chains in the Genus database with same CATH topology
2VYTA 3ER0A 2K3XA 1RL2A 3INZA 4N0AC 1VQ4A 5LL6S 3JCMh 2OTLA 3OS0A 5GAMh 1KD1C 2CZ0B 5J26A 4C92F 2DTOA 3MEUA 4FM4B 2DJZA 3JCMg 3X26B 4QVCA 5EG2A 2VXEA 3PMIA 2XICA 1RI0A 3MEAA 2VC8A 4C5IA 4JS5A 3TU4K 4JLIA 1H641 3OS2A 2EJGA 1NJIC 3G71T 4DA4A 2DO3A 2K5IA 2RK2A 2VGMA 5LJ3e 2RJDA 1W4SA 1JB0E 2K5LA 4M7AB 2BIVA 4EMKB 5GAN6 3JB9F 4M7AA 1KQSA 2F69A 4M7AD 1UEBA 2DAQA 3CCLA 2JZ2A 1YJNA 4RCCA 4KUIA 2QEXT 2D0QB 2QQ9A 4HCZA 1KC8U 4M7AE 3BY7A 3HP9A 2DXUA 4RMOA 3ME9A 4M75B 4OF1A 3META 4A4HA 3BW1A 3QDRB 1FXXA 3L2QA 2PVGB 1U1TA 4A4KA 4CI0C 4M75A 3I55T 2X35A 4M77C 3BDUA 2OAUA 4X9DA 1U8RA 3OYDA 3LWHA 4M75E 4A4GA 3CBOA 1X01A 5GMKe 3OYKA 3OYEA 4BACA 3TREA 1Y7XA 3DB3A 1BI0A 3DKMA 4C0DB 1UGPB 4KULA 4L5GA 5CKFA 1YIJT 3SFMA 2E65A 3A5ZB 3CC2A 4GLKA 3OYHA 4XTWA 3GP8A 5AYFA 1G3WA 2K3YA 4FT4A 4QQGA 5GAOl 5GANf 5GAMe 1M90U 2P0KA 3CPWA 2XDDA 3QIIA 3FB9A 2K4YA 4M7DB 4IUUA 4PJOC 2RI2A 2XD0A 4M7DA 2XG8D 3A8GB 4A53A 3MCAB 2FL7A 3OYMA 1YJWT 4M7DD 1VQKT 2LX9A 2H3JA 2PU9B 3CCJT 4ZTJA 2E70A 4M7DE 5GAOn 4O6JA 3WXMB 4FIBA 2E5QA 3I56T 3RKWA 2DXCA 2L8DA 1JJ2S 5LJ5h 4JDSA 3QBYA 5CKDA 3OW2S 3JB9J 3CC4A 3UPUA 2Y4YA 5HK0A 3J7AF 1DJ7B 2WACA 1BKBA 2OTLT 1GXIE 4M77G 1WGSA 3CBMA 3M5AA 1K73U 1S72A 1I8FA 3S3OA 4KUDK 2XI9A 3V8JA 5FRNA 3OYAA 3V8LA 3OYYA 3GPLA 1B34B 1NE8A 3BDLA 3EFSA 5FROA 4JRQA 2RHUA 4J8OA 3E1SA 2EKOA 4N4IA 2GQVA 4QQ6A 1B34A 5HY6A 4C92B 2KDSA 4E7LA 3EAEA 3M55A 4C92A 4M75F 3VUBA 4A4FA 4C92D 5GAOm 1QP3A 3HSBA 4FT2A 1VQOA 4ATOA 3JB9G 1M1KU 4C92E 2FVUA 5DLQE 3KXTA 2RD1A 5LJ3j 1VQ6A 3OQ5A 3CCLT 4PJOG 1Q81U 4MMLA 2EFIA 2PQWA 4JLGA 2LCLA 3JCMf 2F5KA 2DTHA 4XK8E 2R5AA 2MF2A 4XU1A 3OS1A 1PSEA 3JB9D 3R6OA 2KY9A 1U1SA 3VKIA 5LJ3g 2LRQA 2QQAA 2KAFA 2HQEA 1ZBXA 3DLLA 3CCQT 3OW2A 4M7AC 2K57A 4OVAA 2WSCE 2OTJA 2XIDA 3QJYA 2L89A 3LH0A 1FX7A 4OP0A 3E19A 5LJ5e 4A54A 2RA2A 4J5YA 3CC2T 4BD3A 4P5NA 1KQSS 4HA8A 3QG1A 4M75C 4ELYC 4LDVA 4LDXA 5J39A 4HCCA 4ME7A 1Q7YC 1ZHIA 1WNLA 5GMKh 3JB9H 2CZ6B 4FU6A 4XTZA 5GAMj 3PTAA 3FLGA 3CCMT 5I2MA 1M1KC 2C06A 4HT8A 5GMKi 2FB7A 1YITT 4OB1B 4LDWA 1EIFA 1Q81C 1K8AC 3OSSC 1H3ZA 2ZPHB 3CC4T 3L2WA 2X4WA 5GAMg 2DIGA 4XTUA 2DD5A 4M7DC 2HD0A 3HFOA 3CCET 4PLLA 2KVQG 4M7AG 3X20B 3LGFA 3JB9I 1W2BA 1KHCA 3OBYA 3CPWS 5FU6B 4E7IA 3V8KA 4PL6A 2E1HA 4RG8A 4DOVA 3JCMc 2Y4XA 2RI3A 5DY9A 2GF7A 3G6EA 3OBWA 3X28B 2ZPIB 4QW2A 2K2VA 4E7HA 4EMKA 2KQWA 3CC7T 1D3BB 4J6WA 4M75G 2DPPB 4C8QF 3CXCA 2ZPBB 3CMEA 2DD4A 3OSVA 1D3BA 4MDXA 1VQ6T 2EQUA 5LJ5d 1QVPA 2RJEA 2X4JA 1I81A 4LDYA 1VQPT 3BFMA 1YI2A 3M59A 4M75D 5A0LA 5CR2A 1XQHA 4J83A 5KE3A 1OZ2A 4C92C 1VQ8A 4CRIA 4L59A 1VQ9A 3GNGA 2L5QA 1VQ5A 2EQMA 2OTJT 2M16A 3OMCA 2MWPA 3OA6A 5GAOr 2LQ8A 3CPFA 3PIPA 2PVDB 3X25B 4F7UF 3JCMP 1MHNA 4M7DG 1O75A 2EWNA 2XK0A 3OYLA 2EQJA 2O4XB 1N6AA 1Y96B 4PNOA 4ZGJB 4E7KA 3M56A 4ELZC 4OB3B 3L2UA 2O4XA 1Y96A 3A8HB 3C94A 4II1A 3JAME 3OYFA 3KBGA 4FSXA 2X4XA 3QXEB 4BE1A 4M78B 4N4GA 1VQNA 1WJRA 1UGQB 1YJ9A 2FHDA 4M78A 1M9SA 4OMFB 4X34A 2RO0A 3P8HA 3SD4A 3V7CA 3OB9A 3G4SA 4XAXB 1YHQT 2GFAA 4J7FA 4X9CA 5LJ3f 4XU3A 3CCVT 1VQ7A 1BI3A 5IAYA 1G5VA 4M78E 1KC8C 3QZ5B 2EIFA 3S3MA 2DIQA 3FRNA 5LJ5g 3O8VA 5GAN5 1G3YA 5GANh 1VQ4T 1N9RA 3SWNB 2CGHA 3MP1A 5C0MA 3WVDB 2CKKA 1Y71A 5GANd 3SWNA 5M9OA 2E6NA 2JTMA 2I2LA 5DM7R 4C92G 2P4TA 1NPPA 2HNIA 3A8OB 4DQ2A 2QA4A 3E9FA 4BI4A 1JRIA 2LVMA 3H8ZA 3J80E 2MMPA 3NTIA 4L6V5 2JTFA 5D6YA 3TEEA 3C95A 3OYGA 2CS7A 2ZPEB 3PFSA 4VUBA 1N8RU 4C0ZA 1VUBA 2QQBA 4ZN3A 3G6ET 1M90C 4C0GA 1YCYA 2VV5A 4OGCA 1YJNT 4RCBA 1MGQA 3SB2A 4O5VA 3PT9A 3X24B 4QQDA 1Q86U 1N27A 3KUFA 5GAN8 4C0FA 4LD9K 1G3TA 4QVZA 2HBPA 2JN0A 5GAMf 3FJPA 2ZCFB 4C8QB 2XKOC 5FU6C 3QSUA 4C8QA 1IREB 4C8QD 2RHZA 3LW5E 1VQ8T 4JUVA 2M0OA 3HKSA 1VQ9T 1M8VA 4EMKC 5CCAA 4BB7A 3C4SA 4NL3A 1VQ5T 1W2BS 3CBPA 4C8QE 3CMAA 2E10A 2ZGWA 3QUIA 4JRPA 1I5LA 1QW1A 2D9TA 2LT1A 3C12A 2RHYA 1FWZA 2V8IA 2LCCA 3MEVA 4M78F 5FU7B 5L8RE 2QEXA 1K73C 3M54A 1V29B 4XTXA 1VQMA 3DLMA 3NFCA 3LLRA 1QVGS 5GMKj 2NLUA 3JCMX 3PIOA 3HL8A 4BE2A 2DKGA 3CXCS 3RMQA 2BUDA 5GAN3 4R56A 4F7UB 4J6XA 3S6WA 1O9SA 2V8JA 3V7RA 3JCMQ 4JJNK 1VQLA 4F7UA 2E41A 3L1AA 2MWOA 2WSEE 1NJIU 3HPWA 1KHIA 1Q82U 4F7UE 5GAOp 4C5EA 1VQ7T 4C0DC 5DLOA 1Y07A 5D6XA 3JCMJ 2EJFA 4GY5A 3FDRA 1IZ6A 3HRTA 5IT9E 1HXDA 4BE0A 2JVVA 3DB4A 1S72T 1XTDA 4MMKA 3LYIA 1M1GA 1M5Q1 3HRUA 1UGRB 4JRKA 5A0DA 4M78C 5J3BA 5KH6A 5IN1A 1KG1A 1YJWA 3NTHA 2QA4T 3FIFA 5CKHA 4NS5A 3WVEB 3CCJA 5A2QE 4BDZA 5KE2A 1KQ2A 3JCMb 2ZPGB 3JRZA 2QTXA 3VYHB 2MAMA 2YLBA 3M4GA 4XTYA 1VIFA 3J81E 1QVGA 3GIBA 3MP6A 4R55A 4OB2B 3RKYA 4M77F 3H6ZA 1WPYA 2IVWA 1XOVA 1UB4A 2FYKA 3P8DA 4Y28E 1BIAA 3RESA 1NPRA 1VQOT 4YTLA 5GANe 1BYMA 3SWNC 1P92A 1YBYA 4B9WA 5LJ5f 3PNWC 3N5BB 2YRVA 4N4HA 3MEWA 2B8AA 4RG2A 3P8BB 3QHSA 4IUQA 4DOWA 2IG0A 2EJ9A 2R57A 1WJSA 4QVDA 4ZGDB 5I2SA 5CKEA 2MI6A 2ZPFB 2A7YA 3S3NA 1K9MU 1Q82C 2DXTA 2LTOA 1PSFA 3PMTA 4XU2A 4B9XA 1VIEA 3TCJA 3QYGB 3L42A 4IURA 3JCMV 4IUPA 4PJOF 4C5HA 3CMAT 5CKBA 2QQSA 2R5MA 3M53A 4NL2A 5A0GA 5KCOA 3GLXA 2LC4A 3G7ZA 4LD6A 4OGEA 4JS4A 1KQ1A 4M78G 4HCBA 1M1FA 2EYQA 2RJFA 4MDWA 2RJCA 5KCHA 2EAYA 5GAN4 3CCSA 1VQMT 2HQXA 4LDUA 4Y91A 3M58A 4BY6B 2LDMA 2QQRA 5C6SA 5GAN7 3QZ9B 2L3RA 3OS5A 4JRIA 2G3RA 3SDZA 4C8QC 4EDUA 5LJ5j 4UC4A 1QVFS 3GF5A 1VQLT 3CCQA 1JBMA 2KMTA 1N9SA 1BI2A 3QPHA 2RHXA 4M78D 3CD6A 4HT9A 3LX7A 4BI8B 4OB0B 3HHTB 5CQXA 3UWNA 2RHIA 3QO3A 4C5GA 2CZ1B 2GFUA 4XU0A 5FU7C 1OZ3A 3FC3A 2XDBA 3L2RA 3HRSA 2DK3A 5CIUA 1LOJA 1X75C 5FLXE 3UT1A 3RERA 2RI5A 2P0PA 4N0AA 3M9QA 3JCMe 1QP2A 2P0QA 2QXFA 3GNFB 5I21A 4BUGA 3GOXA 1K9MC 4J7IA 2GCXA 3RMSA 2A3LA 3Q1JA 3ZEHA 1WJQA 2RM4A 2K5FA 3CEYA 3CCRA 3JSCA 2PUOB 1M4ZA 3CCUA 4Q5WA 5GMKl 4IUTA 4KT0E 2XHCA 4NOYA 3CCMA 4ZTFA 2CZ7B 2ZZDA 4HKEA 2QDYB 1YITA 5LJ3d 4E7JA 3HFNA 2E12A 3OYCA 3L2ZA 2V8KA 1WQWA 2DEQA 4J6YA 3JCMW 4XTVA 3VYGA 2PUKB 3ZFJA 5GAN2 2QI2A 4KBMB 3A8LB 4EPCA 3CMET 4BDYA 2JNGA 4C8QG 4IUVA 3FEOA 4M7AF 4WF2A 1QVFA 2JUFA 3LGLA 2EQKA 3PGGA 3T9NA 3CCEA 5CVIA 3UDCA 3M4YA 3L2VA 3RKXA 3G71A 1AHJB 4PKCC 4M77B 3OYNA 1LNXA 1YI2T 2YLCA 5GANj 5FRMA 4V2SA 2LT4A 1NZ9A 4M77A 2LQKA 3ASKA 1XNIA 4M77D 1Q7YU 2D6FA 4RKUE 2DZ9A 3NTKA 4Z02A 2Y90A 2RB6A 5GAOq 3CC7A 3MP8A 4M77E 3E9GA 1G3SA 3LWIA 2LNVA 4MZTA 3V7SA 4EMHA 3OYJA 4XQ3A 3OYIA 1WQ7A 5D6WA 3URGA 1OI1A 2DTIA 4ZGEB 5GANg 1K8AU 4D6WA 5GMKm 1BIBA 5CAIA 4F7UG 2KK4A 3QYHB 2X4YA 3CCST 2VUBA 2VXFA 3I55A 1VQPA 2XU8A 3JCMd 1KD1U 3AHUA 1R8OB 5GAMd 3M57A 2DVEA 4PJOB 2YHTA 5LJ3h 2JOYA 3VUZA 4EMGA 4MZMA 4PJOA 4ZN1A 1VQNT 1YJ9T 1JJ2A 2F5TX 3VV0A 4E47A 5HK3A 1N8RC 4PJOD 2BKDN 4IKFA 4MZPA 3CD6T 3OYBA 2HAXA 3G4ST 4PJOE 3QKJA 1I4K1 4TVRA 4M7DF 2M1HA 1YIJA 2E64A 4BI3A 5CK9A 3F70A 1SSFA 1UGSB 2RK1A 1BI1A 1LJOA 3VJPA 1ZQ1A 1Q86C 2XDPA 1HK9A 4A4EA 2CYZB 2PVOB 3EFRA 4FL6A 2DZCA 3QJ6A 3RUXA 4PLIA 1TH7A 3OY9A 4BY6C 3MHXA 3OMGA 5CQYA 3MO8A 2VGNA 3RIRA 2AHJB 2RH2A 1VQKA 1X6OA 3CCRT 2E6ZA 3CCUT 2WSFE 1YHQA 3CCVA 2M9UA 3ZBDA 5HKCA 1OYXA 2R58A 3I56A 2DXBA 2O01E 2KSSA 5CO7A 3VU3C 3A8MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKM A;  2DK3 A; 
#chains in the Genus database with same CATH topology
 3INZ A;  3UA6 A;  1VQ4 A;  2CDT A;  5LL6 S;  4KGX B;  1TTH B;  5J26 A;  3MEU A;  3JCM g;  2XIC A;  1TOV A;  1X2K A;  1Q86 R;  3MEA A;  3PE0 A;  4C5I A;  4Y92 A;  3EG0 A;  1MMN A;  2DO3 A;  4M7A B;  1R0B G;  4PFZ A;  4M7A A;  1KQS A;  2F69 A;  2D0Q B;  2QQ9 A;  1PNJ A;  3QWY A;  2OX7 A;  2QYZ A;  1FXX A;  4QT7 A;  1U1T A;  4JJC A;  1JU5 C;  4CI0 C;  1XJW B;  3CMA Q;  2X35 A;  2OAU A;  4X9D A;  2HL3 A;  1JEG A;  1U8R A;  3OYD A;  5KYW B;  5GMK e;  4BAC A;  3TRE A;  3DKM A;  4C0D B;  1WI7 A;  1YCS B;  4FT4 A;  1KJW A;  5GAM e;  2K4Y A;  2RI2 A;  7AT1 B;  1V76 A;  4M7D D;  3MCA B;  2FL7 A;  4FIB A;  1NEB A;  4AMC A;  2L8D A;  1VA7 A;  5LJ5 h;  1RAD B;  5D7U A;  3UPU A;  1TWB A;  2XI9 A;  1QCF A;  4J9B A;  3BDL A;  3E1S A;  3EAE A;  4C92 D;  1QP3 A;  2VKN A;  5HCK A;  4FT2 A;  3KXT A;  5DLQ E;  1VQ6 A;  2EFI A;  2PQW A;  1UGV A;  2F5K A;  2DTH A;  4XK8 E;  1SEM A;  5L23 A;  3OS1 A;  1X27 A;  1NM7 A;  1AT1 B;  5LJ3 g;  2QQA A;  2DL7 A;  4JPB W;  3RBB B;  3VRY A;  5KYN A;  2PTK A;  4A54 A;  4DBF A;  3CC2 T;  4BD3 A;  3G4S Q;  2JS2 A;  3QG1 A;  4M75 C;  2EBP A;  2AKK A;  4ME7 A;  4HCC A;  2DYB A;  1ZHI A;  1WNL A;  4XTZ A;  5GAM j;  3FLG A;  1PCX A;  5GMK i;  1EIF A;  2GQI A;  3VS0 A;  3OSS C;  2O9V A;  3CCR Q;  3UAT A;  2ROT A;  3L2W A;  1FYN A;  2DRM A;  1M3C A;  4XTU A;  3CCE T;  3LGF A;  3JB9 I;  2KRS A;  3CPW S;  2GBQ A;  4E7I A;  4PL6 A;  2E1H A;  1WZO A;  3JCM c;  2Y4X A;  3MJX A;  3OBW A;  4DEY A;  4EMK A;  2KQW A;  4J6W A;  4M75 G;  3VS6 A;  4ZNX A;  5KYY B;  3U23 A;  4PJM A;  1QVP A;  2RJE A;  1B3Q A;  2X4J A;  4OMN A;  5KYY A;  2FO0 A;  1WX6 A;  3BFM A;  1TG0 A;  1W6X A;  3EGD B;  4J83 A;  2KBT A;  5KE3 A;  3EGD A;  3QDF A;  1GCP A;  2OTJ T;  3OMC A;  1WYX A;  1TUC A;  4KRT A;  3EGU A;  2DL4 A;  3JCM P;  1KFZ A;  2EQI A;  2DER A;  3OYL A;  3L2U A;  2KYB A;  3OYF A;  3KBG A;  2X4X A;  4FYX B;  1WJR A;  3SD4 A;  2CUB A;  3CCV T;  4XU3 A;  1KC8 C;  1AWJ A;  2DIQ A;  3FRN A;  5LJ5 g;  3O8V A;  1VQ4 T;  1Y71 A;  5GAN d;  5M9O A;  2HNI A;  4DQ2 A;  2MMP A;  2IPO B;  2BE9 B;  2JS0 A;  2QQB A;  4ZN3 A;  2HKQ B;  1YCY A;  4OGC A;  1ZX6 A;  2COY A;  1RAH B;  2DL3 A;  1KC8 R;  4O5V A;  2BZY A;  2LX7 A;  1Q86 U;  1SF9 A;  1G3T A;  2JN0 A;  5GAM f;  3FJP A;  3TSZ A;  2ZCF B;  2YSQ A;  1OU8 A;  2J7I A;  3LW5 E;  3HKS A;  4IIO A;  1E6H A;  2DA9 A;  2HEQ A;  5CCA A;  4BB7 A;  3C4S A;  1VQ5 T;  2EKH A;  3CMA A;  1W2B S;  1I5L A;  1UHC A;  3AHU A;  2D9T A;  5FU7 B;  3C12 A;  2EGE A;  2QEX A;  2YUP A;  3LLR A;  2C0T A;  3CXC S;  1BCO A;  2BUD A;  4R56 A;  4J6X A;  3CC2 Q;  2E41 A;  2WSE E;  1QMC A;  4LNP A;  4F7U E;  4C5E A;  1VQ7 T;  3JCM J;  5D6X A;  5GJV B;  4RTW A;  2DE0 X;  4BE0 A;  1QKX A;  2GTO A;  1UGR B;  4M78 C;  3NTH A;  3CCJ A;  4BDZ A;  2DIL A;  2D0N A;  3JRZ A;  2JTE A;  3CCE Q;  4XTY A;  3PVL A;  2IVW A;  3RES A;  1GCQ A;  2M02 A;  3SWN C;  9ATC B;  4B9W A;  4A63 B;  4N4H A;  3QHS A;  4ZGD B;  5I2S A;  2MI6 A;  2ZPF B;  1IB8 A;  3L42 A;  1RAB B;  4IUR A;  1YNZ A;  1C6V X;  3JCM V;  4PJO F;  4C5H A;  3M53 A;  3GLX A;  2LC4 A;  4OGE A;  4M78 G;  1M1F A;  2EYQ A;  2OTJ Q;  1VQM T;  5GAN 4;  2HQX A;  4BY6 B;  2QQR A;  5C6S A;  2RF0 A;  3OS5 A;  3SDZ A;  4C8Q C;  5LJ5 j;  1VYT A;  1QVF S;  1VQL T;  1BI2 A;  2RHX A;  3LX7 A;  4BI8 B;  4PJJ A;  5CQX A;  3EG9 A;  2RHI A;  1VOM A;  4C5G A;  3HRS A;  2DK3 A;  2LNH B;  5CIU A;  2JM8 A;  3CCV Q;  2YT6 A;  2P0Q A;  2K5F A;  3CEY A;  3CCR A;  2PUO B;  1VQ4 Q;  1VYU A;  2QAZ A;  3CCM A;  4ZTF A;  4HKE A;  1YIT A;  2V1Q A;  2E12 A;  3L2Z A;  4RTY A;  1WQW A;  2QTV A;  4KBM B;  3A8L B;  1SPK A;  3FJ5 A;  5EC7 A;  4C8Q G;  4IUV A;  1OX8 A;  2JUF A;  3T9N A;  1AHJ B;  2YDL A;  4V2S A;  2LT4 A;  4RKU E;  2FZG B;  1I0C A;  4AFS C;  4J9I A;  2DL8 A;  1M30 A;  1BIB A;  2KK4 A;  1Z9Q A;  2PNI A;  2VXF A;  1VQ5 Q;  2ROL A;  1C1A A;  3M57 A;  4PJO B;  4MZM A;  4PJO A;  1I1J A;  4ZN1 A;  3VV0 A;  5HK3 A;  2MPX C;  3PVQ A;  1OUL A;  4MZP A;  2HAX A;  2JJ9 A;  3C0C A;  4M7D F;  1QLY A;  1TUG B;  1LJO A;  2XDP A;  1HK9 A;  4A4E A;  3ULR B;  4FL6 A;  3RUX A;  2NUT B;  5CQY A;  1VQ7 Q;  2NUT A;  2W10 A;  2EYZ A;  3RIR A;  2FPD A;  4F17 A;  1YHQ A;  1KSW A;  3A98 A;  1OYX A;  2AIR B;  2R58 A;  2RMO A;  1MND A;  3A8M B;  2VYT A;  3ER0 A;  1RL2 A;  4N0A C;  3JCM h;  1I5O B;  5IHN A;  5GAM h;  1KD1 C;  2CZ0 B;  4C92 F;  4AFU C;  4CC2 A;  1AEY A;  2K5I A;  1WIE A;  5GAN 6;  4RCC A;  2J6K A;  3RNJ A;  1M8M A;  4HCZ A;  2QEX T;  1KC8 U;  4M7A E;  2A36 A;  2CP3 A;  2RQU A;  3BW1 A;  3L2Q A;  1QKW A;  1KD1 R;  2J6O A;  4M77 C;  1QWE A;  2NYS A;  1VQM Q;  4A4G A;  4OMM A;  4JJD A;  3CBO A;  2O2O A;  1Y7X A;  4KUL A;  2D1X A;  1YIJ T;  1JXO A;  3A5Z B;  2OJ2 A;  1VQL Q;  4GLK A;  3CC2 A;  4XTW A;  3GP8 A;  3CPW A;  3QII A;  3FB9 A;  4M7D B;  2KNB B;  2BZ8 A;  2XD0 A;  4M7D A;  2XG8 D;  3OYM A;  1VQK T;  2H3J A;  3CCJ T;  4ZTJ A;  5IHI A;  4O6J A;  3RKW A;  1K9A A;  3OW2 S;  3REA B;  1GXI E;  2OTL T;  2AZS A;  4M77 G;  1WGS A;  4Z89 A;  1E7O A;  2JMC A;  1IGQ A;  2X9H A;  5IH2 A;  3GPL A;  2ESW A;  4JRQ A;  2RHU A;  4J8O A;  5HY6 A;  2EKO A;  4QQ6 A;  4C92 B;  4E7L A;  4OMO A;  1R0C B;  2BE7 D;  4C92 A;  3HSB A;  2DVJ A;  2X51 A;  4CC4 B;  1VQO A;  1RAG B;  1U3O A;  2RD1 A;  1LPL A;  2HSP A;  2HMA A;  1E6G A;  2QG9 B;  3JB9 D;  2B86 A;  2KY9 A;  1JXM A;  2OTJ A;  2K57 A;  2XID A;  1FX7 A;  2RA2 A;  1S1N A;  2DLP A;  1OV3 A;  3AT1 B;  4HA8 A;  4RTX A;  1TUD A;  1Q7Y C;  2RQR A;  4J9C A;  2LQN A;  2COW A;  3JB9 H;  2CZ6 B;  3CCM T;  1M1K C;  2FB7 A;  1YIT T;  4LDW A;  1Q81 C;  1H3Z A;  5KYU B;  1QCO A;  3CC4 T;  5GAM g;  1ZUY A;  2DIG A;  1T3L A;  1WHM A;  4PLL A;  3X20 B;  1W2B A;  1PM3 A;  3OBY A;  2DBK A;  5FU6 B;  1AVZ C;  3V8K A;  2LZ6 B;  1Q7Y R;  1SRL A;  2VB6 A;  4DOV A;  2RI3 A;  4FYY B;  2ZPI B;  2K2V A;  4HVU A;  1D3B B;  1RAA B;  2DBM A;  3CXC A;  2DYI A;  3CME A;  2ED0 A;  2F2X A;  1M1K R;  1NYF A;  1D3B A;  4E7S A;  4MDX A;  2A28 A;  1SHF A;  3LH5 A;  1Q81 R;  2JXB A;  3M59 A;  2QEX Q;  1XQH A;  1AWO A;  2RQT A;  2L5Q A;  3EGX B;  1VQ5 A;  5KYW A;  2M16 A;  2MWP A;  1K1Z A;  2YUO A;  3EGX A;  5FWC A;  3PIP A;  2F1L A;  2PVD B;  3X25 B;  2KE9 A;  1MHN A;  1JO8 A;  1O75 A;  2EWN A;  5I11 A;  1N6A A;  4OB3 B;  5FW9 A;  3A8H B;  4FSX A;  1YIJ Q;  1VQN A;  4E6R A;  3V7C A;  4DBH A;  4XAX B;  1YHQ T;  4X9C A;  1VQ7 A;  3H41 A;  2EIF A;  3S3M A;  5GAN 5;  1WHJ A;  1VQK Q;  3CCJ Q;  3NHN A;  4HVV A;  1N9R A;  2JTM A;  2I2L A;  2V1R A;  3A8O B;  3E9F A;  2LVM A;  4F14 A;  4L6V 5;  2OTL Q;  2JTF A;  2LQW A;  2CS7 A;  3EG3 A;  3PFS A;  1X43 A;  4DBQ A;  2QAS A;  1M90 C;  1UHF A;  3SB2 A;  4LD9 K;  2K79 A;  2HBP A;  2XKO C;  5GJW B;  1IRE B;  4C8Q D;  4JUV A;  2C0I A;  2M0O A;  4NL3 A;  1AD5 A;  4JRP A;  3MEV A;  1V29 B;  1VQM A;  3NFC A;  5GMK j;  2NLU A;  2L0A A;  1M90 R;  4ANJ A;  1SKU B;  1VQL A;  3V7R A;  4JJN K;  5IXB A;  1AZG B;  3L1A A;  2EPD A;  3HPW A;  5GAO p;  2HDA A;  5DLO A;  3D7S B;  3CCM Q;  1IZ6 A;  1JQQ A;  3HRT A;  1H3H A;  1YIT Q;  5IT9 E;  1HXD A;  2JVV A;  3DB4 A;  1XTD A;  1M5Q 1;  3HRU A;  4JRK A;  2DX1 A;  5KH6 A;  5J3B A;  3MKD A;  3CC4 Q;  1YJW A;  2QA4 T;  1EFN A;  3FIF A;  4NS5 A;  5CKH A;  3GBQ A;  1KQ2 A;  3VYH B;  4HCK A;  1QVG A;  1VIF A;  4FW2 A;  1KQS P;  3MP6 A;  1IHW A;  4R55 A;  3JV3 A;  4OB2 B;  4FYV B;  3H6Z A;  3CXC P;  3P8D A;  2FYK A;  1VQO T;  4YTL A;  5GAN e;  1YBY A;  3MPU B;  1F1B B;  3PNW C;  2VVK A;  3EG2 A;  3MEW A;  2B8A A;  3P8B B;  4IUQ A;  1M2V B;  2EJ9 A;  2R57 A;  5CKE A;  5FWB A;  1K9M U;  1M2V A;  4OML A;  1Q82 C;  1ZSZ B;  1G8X A;  4B9X A;  2M0Y A;  1ZSZ A;  1G83 A;  2E4H A;  5KCO A;  1RAF B;  3TSW A;  4JS4 A;  1V1C A;  1Z9Z A;  4HCB A;  3I9Q A;  2EAY A;  3M0T A;  2LDM A;  8ATC B;  5GAN 7;  2L3R A;  2G3R A;  1X69 A;  3I5S A;  4UC4 A;  3GF5 A;  3CCQ A;  1N9S A;  1Y57 A;  1WA7 A;  2EYW A;  1Q82 R;  4XU0 A;  3FC3 A;  2XDB A;  1QCN A;  2X3W D;  3UT1 A;  2RI5 A;  1YHQ Q;  5I21 A;  3GNF B;  3GOX A;  4J7I A;  3RMS A;  1G2B A;  3ZEH A;  2X3X D;  3IQL A;  5GMK l;  4KT0 E;  2XHC A;  2AT1 B;  2QDY B;  4OMQ A;  4PJN A;  5LJ3 d;  3OYC A;  2XMF A;  2V8K A;  2DEQ A;  4J6Y A;  3ZFJ A;  4R0K A;  3CME T;  1YN8 A;  1WDX A;  3L2V A;  4PKC C;  5GAN j;  5FRM A;  2DJQ A;  1NZ9 A;  2LQK A;  1FMW A;  4M77 D;  1Q7Y U;  1UUE A;  2RB6 A;  3E9G A;  1W70 A;  2H3E B;  4MZT A;  4XQ3 A;  2CT3 A;  4JZ3 A;  5CAI A;  4F7U G;  6AT1 B;  2XU8 A;  1TS9 A;  4PJL A;  2DVE A;  3SEM A;  2MYS A;  3TQ7 P;  2RPN A;  1VQN T;  4E47 A;  1N8R C;  3OYB A;  4E2F B;  1H8K A;  4J9G A;  4PJO E;  1I4K 1;  1YIJ A;  4BI3 A;  1UGS B;  2EGC A;  2CYZ B;  3EFR A;  4FW1 A;  4PLI A;  1OPK A;  3OY9 A;  3MHX A;  1TXQ A;  2KT8 A;  2AHJ B;  4E7Z A;  2RH2 A;  1VQK A;  1ABO A;  1PC0 A;  1ARK A;  2J06 A;  5HKC A;  2QGG A;  4F16 A;  2KSS A;  2CH4 W;  1QVG P;  2J6F A;  2K3X A;  2QA4 Q;  1GFC A;  2FRY A;  4RTZ A;  1N8R R;  2OTL A;  3OS0 A;  4QVC A;  2DTO A;  3X26 B;  1NYG A;  2DJZ A;  3PMI A;  1HYO A;  1RI0 A;  2VC8 A;  4JS5 A;  2HZY A;  4JLI A;  4CC3 A;  2O88 A;  1H64 1;  1VQO Q;  2EJG A;  1NJI C;  2YXY A;  2RK2 A;  1PD1 A;  1JB0 E;  1OX9 A;  2BIV A;  3JB9 F;  1UEB A;  1SG5 A;  2JZ2 A;  1YJN A;  4HXJ A;  1IO6 A;  3BY7 A;  2VAS A;  2EVR A;  3ME9 A;  4M75 B;  4OF1 A;  4A4H A;  3QDR B;  2PVG B;  4M75 A;  3BDU A;  3M0Q A;  3LWH A;  2DET A;  1X01 A;  4F04 B;  3OYK A;  2RQV A;  1NJI R;  1BI0 A;  4L5G A;  5CKF A;  3SFM A;  4DEX A;  3OYH A;  3VS7 A;  1G3W A;  2K3Y A;  1PKS A;  5GAO l;  1H92 A;  5GAN f;  1M90 U;  2NWM A;  2VWF A;  1RLP C;  1K4U S;  4IUU A;  3A8G B;  4A53 A;  1YJW T;  2LX9 A;  1PRL C;  4M7D E;  5GAO n;  3WXM B;  2E5Q A;  3I56 T;  2DXC A;  2BZX A;  1JJ2 S;  3QBY A;  2F2V A;  3CC4 A;  1ZBJ A;  1OEB A;  3J7A F;  2WAC A;  1BKB A;  3M5A A;  4D8D A;  1S72 A;  3S3O A;  3EG1 A;  5FRN A;  3OYA A;  2KXD A;  3OYY A;  1B34 B;  3EFS A;  3CME Q;  2F2W A;  3KFV A;  2GQV A;  1Y0M A;  1B34 A;  2KDS A;  3M55 A;  1IGU A;  4RTT A;  1UTI A;  3VUB A;  2LP5 A;  3SHW A;  4DBR A;  4ATO A;  4C92 E;  3CCL T;  2IIM A;  2FZK B;  2LJ3 A;  1SSH A;  1PSE A;  3VS2 A;  3CQT A;  3R6O A;  3VKI A;  4AFZ C;  1J3T A;  2LRQ A;  2H8H A;  1BBZ A;  1ZBX A;  2KAF A;  2RQW A;  4AFQ C;  3DLL A;  3CCQ T;  4OVA A;  4M7A C;  2CH4 A;  2L89 A;  2A0F B;  3LH0 A;  1VQN Q;  1D1A A;  4J5Y A;  4P5N A;  2V26 A;  1WHK A;  4LDX A;  2OI3 A;  2KYM A;  3RDV A;  5GMK h;  4FU6 A;  4HT8 A;  3PTA A;  1M3A A;  5I2M A;  2C06 A;  2DMO A;  4OB1 B;  1K8A C;  2E5K A;  1OPL A;  2ZPH B;  2HD0 A;  4M7A G;  2L2P A;  1ZA1 B;  4E7H A;  4C8Q F;  4AG1 C;  3NGP A;  1K8A R;  3EHQ A;  1T3S A;  1I81 A;  1YI2 A;  4M75 D;  1MMD A;  1OZ2 A;  4CRI A;  4L59 A;  1X6G A;  3GNG A;  2LQ8 A;  4K11 A;  3CPF A;  2XK0 A;  4IIM A;  1Y96 B;  1LCK A;  4E7K A;  4ELZ C;  2FZC B;  1Y96 A;  3C94 A;  1ZUK A;  3QXE B;  4BE1 A;  4M78 B;  4N4G A;  1YJ9 A;  1UGQ B;  1YFN A;  4M78 A;  1M9S A;  2NUP B;  2M51 A;  1ZLM A;  2NUP A;  2GFA A;  5IAY A;  1G5V A;  4LUE A;  3QZ5 B;  1YJW Q;  1G3Y A;  3M0U A;  3SWN B;  2CGH A;  2CT4 A;  3MP1 A;  4B6M A;  5C0M A;  2CKK A;  3I56 Q;  3SWN A;  1FMV A;  2P4T A;  2SRC A;  2QA4 A;  2KRN A;  4PFP A;  3J80 E;  4QKU A;  1OOT A;  5D6Y A;  3C95 A;  2ZPE B;  3VS1 A;  2MK5 A;  1N8R U;  3G6E T;  4C0G A;  2LMJ A;  1WLP B;  1YJN T;  3PT9 A;  4QQD A;  1N27 A;  2DRK A;  4QVZ A;  1T0J A;  4C8Q B;  3CCL Q;  2A08 A;  3QSU A;  4C8Q A;  2L3P A;  1TU0 B;  2RHZ A;  2K9G A;  1VQ8 T;  1VQ9 T;  4EMK C;  1D0Z A;  3CBP A;  2ZGW A;  1QW1 A;  5GAN h;  1K73 C;  1FWZ A;  2YWW A;  2LCS A;  3VRZ A;  3CCQ Q;  3DLM A;  2AZV A;  3JCM X;  3PIO A;  4BE2 A;  2DKG A;  1BU1 A;  1O9S A;  2MWO A;  2W0Z A;  1NJI U;  4KGV B;  3HTR A;  4LN2 A;  1Y07 A;  2EJF A;  5KYU A;  4GY5 A;  1M2O A;  3FDR A;  1K0S A;  1K73 R;  1S72 T;  3LYI A;  1M1G A;  1KG1 A;  1NBE B;  4KGZ B;  5A2Q E;  1SHG A;  2QTX A;  4LXC A;  1BCM A;  1OU9 A;  3RKY A;  4M77 F;  1WPY A;  1UB4 A;  1BIA A;  1NPR A;  1BYM A;  5IXF A;  1P92 A;  3N5B B;  2GTJ A;  1WJS A;  2ZAE A;  2A7Y A;  3S3N A;  2DXT A;  1MV3 A;  1PSF A;  3PMT A;  1VIE A;  3TCJ A;  1WXU A;  2R5M A;  2JMA A;  4MDW A;  3M58 A;  3CPW P;  3RR6 A;  1NEG A;  3JB9 J;  1CSK A;  1AWX A;  2ABL A;  2CSQ A;  4M78 D;  2HBW A;  2I0N A;  3HHT B;  4J9H A;  4RTV A;  3UWN A;  5IHK A;  2J05 A;  5FU7 C;  3O5Z A;  5FLX E;  1X75 C;  1N5Z A;  2FPE A;  3RER A;  4N0A A;  3M9Q A;  3JCM e;  1RLQ C;  3A1P A;  2GCX A;  2A3L A;  3Q1J A;  1WJQ A;  2RM4 A;  4ORZ A;  3JSC A;  1PWT A;  1M4Z A;  1WHG A;  1ZSG A;  4NOY A;  2CP5 A;  2DFU A;  4E7J A;  4D8K A;  2PUK B;  2KGT A;  5GAN 2;  2ATC B;  4EPC A;  2JNG A;  2MIO A;  1YWP A;  1EX4 A;  3FEO A;  1MV0 B;  4WF2 A;  1QVF A;  3LGL A;  3PGG A;  2EQK A;  4AT1 B;  3G6E Q;  5CVI A;  3UDC A;  4M77 B;  1LNX A;  4OMP A;  2YLC A;  1YI2 T;  1YJN Q;  1ZUU A;  1A0N B;  4M77 A;  3ASK A;  1XNI A;  2D6F A;  3G1J A;  4AG2 C;  4Z8A A;  4WTO B;  3CC7 A;  3MP8 A;  4RUG A;  2BTT A;  1G3S A;  1GCQ C;  3V7S A;  1K76 A;  3H0F A;  4EMH A;  1UG1 A;  1WQ7 A;  5GAN g;  3URG A;  1OI1 A;  2DTI A;  1K8A U;  1UE9 A;  4D6W A;  5GMK m;  1VQ8 Q;  1VQ9 Q;  3QYH B;  2X4Y A;  3CCS T;  1VQP A;  3EH2 A;  1NG2 A;  1UEC A;  3JCM d;  1KD1 U;  1R8O B;  5GAM d;  4PFO A;  2K6D A;  1WFW A;  1HSQ A;  1YJ9 T;  1JJ2 A;  2F5T X;  2GGR A;  1PHT A;  2BKD N;  3CD6 T;  1KIK A;  5AT1 B;  2E64 A;  1SSF A;  2RK1 A;  1BI1 A;  3VJP A;  1U06 A;  1ZQ1 A;  1LVK A;  2PVO B;  3QJ6 A;  2JT4 A;  4BY6 C;  1EZZ B;  2FG0 A;  1X6O A;  3CCU T;  2E6Z A;  1W2B P;  2WSF E;  2QDL A;  2M9U A;  3ZBD A;  4Z88 A;  3I56 A;  3VS4 A;  1S72 Q;  2AKL A;  1B07 A;  3VU3 C;  4KH1 B;  1MMG A;  2HQH A;  2DNU A;  4FM4 B;  5EG2 A;  2VXE A;  3TU4 K;  3E2U A;  4J9F A;  4X1V A;  3OS2 A;  3G71 T;  4DA4 A;  5LJ3 e;  1D09 B;  2VGM A;  2RJD A;  1W4S A;  1PKT A;  2K5L A;  1M27 C;  2HCK A;  4EMK B;  1T0H A;  4M7A D;  2FEI A;  2DAQ A;  3CCL A;  2A37 A;  4KUI A;  3HP9 A;  2DXU A;  4RMO A;  3MET A;  1RAE B;  3I55 T;  4A4K A;  2PZ1 A;  1OQK A;  4M75 E;  1IXD A;  3EHR A;  1R77 A;  3OYE A;  8AT1 B;  3DB3 A;  1UGP B;  2E65 A;  3M0S A;  3M0P A;  5AYF A;  4QQG A;  1HJD A;  2P0K A;  2XDD A;  1ACM B;  1GRI A;  4PJO C;  2PU9 B;  2E70 A;  2CP7 A;  1WXT A;  4LUD A;  4JDS A;  5CKD A;  2RN8 A;  4KH0 B;  5ECA A;  2Y4Y A;  5HK0 A;  1DJ7 B;  5I22 A;  3CBM A;  1K73 U;  1HD3 A;  2JW4 A;  1I8F A;  1QVF P;  4KUD K;  3V8J A;  3V8L A;  5FRO A;  1NE8 A;  4N4I A;  2JM9 A;  4M75 F;  1SRM A;  4A4F A;  5GAO m;  3M0R A;  1QWF A;  2O31 A;  1YI2 Q;  3BE3 A;  3JB9 G;  1M1K U;  1GFD A;  2FVU A;  5LJ3 j;  3OQ5 A;  4PJO G;  1Q81 U;  4MML A;  4JLG A;  4FCY A;  2LCL A;  3JCM f;  2FRW A;  1KK7 A;  2R5A A;  2MF2 A;  4XU1 A;  1B7T A;  2DF6 A;  1U1S A;  1JJ2 P;  3OW2 A;  2HQE A;  3CCS Q;  2WSC E;  1X2Q A;  2SEM A;  2OAW A;  3QJY A;  3H0I A;  4OP0 A;  1YJ9 Q;  3E19 A;  5LJ5 e;  4LE9 A;  3VS3 A;  3CD6 Q;  1KQS S;  2CP6 A;  4ELY C;  4LDV A;  5J39 A;  4ESR A;  1GBQ A;  2KT1 A;  1WXB A;  1U5S A;  3CCU Q;  2MCN A;  2X4W A;  1IRX A;  1D1C A;  2DD5 A;  4CC7 A;  4M7D C;  3HFO A;  2KVQ G;  2K7A A;  1KHC A;  2E3H A;  1WHH A;  4RG8 A;  5DY9 A;  1NLP C;  2GF7 A;  3G6E A;  3X28 B;  4QW2 A;  4IKF A;  3CC7 T;  3G71 Q;  1UFF A;  2DPP B;  2ZPB B;  2DD4 A;  3OSV A;  2RNA A;  1VQ6 T;  2EQU A;  3THK A;  5LJ5 d;  4LDY A;  1QQJ A;  1VQP T;  2KI7 A;  3QWX X;  4JZ4 A;  2YUN A;  2CRE A;  5A0L A;  5CR2 A;  4C92 C;  1VQ8 A;  1VQ9 A;  2AK5 A;  2P84 A;  2EQM A;  3I55 Q;  3OA6 A;  5GAO r;  1TSF A;  4F7U F;  1AWW A;  4M7D G;  1K0X A;  1MNE A;  2EQJ A;  2O4X B;  4PNO A;  4ZGJ B;  2KXC A;  3M56 A;  2O4X A;  4II1 A;  3JAM E;  4J9E A;  2FHD A;  4OMF B;  4X34 A;  2RO0 A;  3P8H A;  1BK2 A;  3EG9 B;  3OB9 A;  3G4S A;  4EIK A;  4J7F A;  5LJ3 f;  1BI3 A;  4M78 E;  4GBQ A;  2O9S A;  1ZA2 B;  1MMA A;  3WVD B;  2KR3 A;  3EH1 A;  2E6N A;  5DM7 R;  4C92 G;  1NPP A;  4BI4 A;  3REB B;  1JRI A;  3H8Z A;  3NTI A;  1Q95 G;  4M4Z A;  2D8H A;  3TEE A;  3OYG A;  4RTU A;  4VUB A;  4C0Z A;  1VUB A;  1YP5 A;  1D0Y A;  2QK0 A;  3UF4 A;  2VV5 A;  4RCB A;  1MGQ A;  2HKN A;  3X24 B;  3KUF A;  5GAN 8;  4C0F A;  2GNC A;  5FU6 C;  3OW2 P;  3NPF A;  1M8V A;  4C8Q E;  2E10 A;  3QUI A;  4GLM A;  4M78 F;  2LT1 A;  2RHY A;  2K2M A;  2V8I A;  2LCC A;  5L8R E;  3M54 A;  1CKB A;  2YUQ A;  4XTX A;  1C0M A;  1QVG S;  1PRM C;  3HL8 A;  1FMK A;  3RMQ A;  5GAN 3;  4F7U B;  2CUD A;  3S6W A;  2V8J A;  3JCM Q;  4F7U A;  1X6B A;  2EGA A;  2ENM A;  2E3I A;  1VYV A;  2LJ1 A;  1KHI A;  1Q82 U;  4C0D C;  1IHV A;  2L3S A;  1BB9 A;  2CP2 A;  4FSS A;  1D0X A;  4MMK A;  5A0D A;  5IN1 A;  3WVE B;  2DM1 A;  1M3B A;  5KE2 A;  1AZE A;  3JCM b;  2ZPG B;  2MAM A;  1MUZ A;  2YLB A;  3M4G A;  3J81 E;  3GIB A;  2ED1 A;  2G6F X;  1XOV A;  4Y28 E;  1I07 A;  5LJ5 f;  2YRV A;  3CC7 Q;  4RG2 A;  4DOW A;  2IG0 A;  4QVD A;  3UA7 A;  1VQ6 Q;  2LTO A;  2KEA A;  4XU2 A;  3QYG B;  2YRC A;  1VQP Q;  4IUP A;  3CMA T;  3H9N A;  5CKB A;  2QQS A;  1YWO A;  4NL2 A;  5A0G A;  3G7Z A;  4LD6 A;  1KQ1 A;  3CCS A;  2RJF A;  5KCH A;  2RJC A;  4LDU A;  4Y91 A;  2NUZ A;  2ECZ A;  3QZ9 B;  4JRI A;  4WCI A;  4J9D A;  4EDU A;  3VS5 A;  3EFO B;  1JBM A;  2KMT A;  3CD6 A;  3QPH A;  4HT9 A;  4OB0 B;  3EFO A;  4PK4 A;  2P4R A;  3QO3 A;  1WHL A;  2DL5 A;  2CZ1 B;  2GFU A;  2MOX A;  5KYX B;  1OZ3 A;  3L2R A;  1LOJ A;  5KYX A;  2P0P A;  1QP2 A;  2QXF A;  1K9M C;  4BUG A;  1PG5 B;  1ABQ A;  3CCU A;  4Q5W A;  4IUT A;  1CKA A;  2CZ7 B;  2ZZD A;  4FYW B;  1UJ0 A;  3ZL7 C;  3HFN A;  1RAI B;  3R6N A;  2QGF B;  1AOJ A;  3JCM W;  4XTV A;  3VYG A;  4HVW A;  2QI2 A;  1D1B A;  2DEU A;  1GL5 A;  4BDY A;  4M7A F;  1RAC B;  3CCE A;  2HSE B;  3M4Y A;  3RKX A;  3G71 A;  3OYN A;  2C0O A;  1K9M R;  2EW3 A;  2DZ9 A;  1RUW A;  3NTK A;  4Z02 A;  2CP0 A;  2Y90 A;  5GAO q;  4M77 E;  3LWI A;  2LNV A;  3OYJ A;  2KRO A;  3OYI A;  5D6W A;  4JJB A;  1RI9 A;  4ZGE B;  2HL5 C;  3NMZ C;  2VUB A;  3I55 A;  2Z0W A;  2EYY A;  3I5R A;  2YHT A;  5LJ3 h;  2JOY A;  2LJ0 A;  3VUZ A;  1PD0 A;  4EMG A;  1W1F A;  1ZSZ C;  4PJO D;  2D8J A;  3G4S T;  2CSI A;  3QKJ A;  4TVR A;  2M1H A;  5CK9 A;  3F70 A;  1GBR A;  1Q86 C;  1UJY A;  2KRM A;  1UDL A;  2K3B A;  2DZC A;  1TH7 A;  2FPF A;  2COZ A;  3OMG A;  3MO8 A;  2VGN A;  3TVT A;  1NLO C;  3H0H A;  2EYX A;  3CCR T;  3CCV A;  2DXB A;  2O01 E;  2YRD A;  3I35 A;  2L3Q A;  5CO7 A; 
#chains in the Genus database with same CATH homology
 2VYT A;  3ER0 A;  2K3X A;  1RL2 A;  3INZ A;  4N0A C;  1VQ4 A;  5LL6 S;  3JCM h;  2OTL A;  3OS0 A;  5GAM h;  1KD1 C;  2CZ0 B;  5J26 A;  4C92 F;  2DTO A;  3MEU A;  4FM4 B;  2DJZ A;  3JCM g;  3X26 B;  4QVC A;  5EG2 A;  2VXE A;  3PMI A;  2XIC A;  1RI0 A;  3MEA A;  2VC8 A;  4C5I A;  4JS5 A;  3TU4 K;  4JLI A;  1H64 1;  3OS2 A;  2EJG A;  1NJI C;  3G71 T;  4DA4 A;  2DO3 A;  2K5I A;  2RK2 A;  2VGM A;  5LJ3 e;  2RJD A;  1W4S A;  1JB0 E;  2K5L A;  4M7A B;  2BIV A;  4EMK B;  5GAN 6;  3JB9 F;  4M7A A;  1KQS A;  2F69 A;  4M7A D;  1UEB A;  2DAQ A;  3CCL A;  2JZ2 A;  1YJN A;  4RCC A;  4KUI A;  2QEX T;  2D0Q B;  2QQ9 A;  4HCZ A;  1KC8 U;  4M7A E;  3BY7 A;  3HP9 A;  2DXU A;  4RMO A;  3ME9 A;  4M75 B;  4OF1 A;  3MET A;  4A4H A;  3BW1 A;  3QDR B;  1FXX A;  3L2Q A;  2PVG B;  1U1T A;  4A4K A;  4CI0 C;  4M75 A;  3I55 T;  2X35 A;  4M77 C;  3BDU A;  2OAU A;  4X9D A;  1U8R A;  3OYD A;  3LWH A;  4M75 E;  4A4G A;  3CBO A;  1X01 A;  5GMK e;  3OYK A;  3OYE A;  4BAC A;  3TRE A;  1Y7X A;  3DB3 A;  1BI0 A;  3DKM A;  4C0D B;  1UGP B;  4KUL A;  4L5G A;  5CKF A;  1YIJ T;  3SFM A;  2E65 A;  3A5Z B;  3CC2 A;  4GLK A;  3OYH A;  4XTW A;  3GP8 A;  5AYF A;  1G3W A;  2K3Y A;  4FT4 A;  4QQG A;  5GAO l;  5GAN f;  5GAM e;  1M90 U;  2P0K A;  3CPW A;  2XDD A;  3QII A;  3FB9 A;  2K4Y A;  4M7D B;  4IUU A;  4PJO C;  2RI2 A;  2XD0 A;  4M7D A;  2XG8 D;  3A8G B;  4A53 A;  3MCA B;  2FL7 A;  3OYM A;  1YJW T;  4M7D D;  1VQK T;  2LX9 A;  2H3J A;  2PU9 B;  3CCJ T;  4ZTJ A;  2E70 A;  4M7D E;  5GAO n;  4O6J A;  3WXM B;  4FIB A;  2E5Q A;  3I56 T;  3RKW A;  2DXC A;  2L8D A;  1JJ2 S;  5LJ5 h;  4JDS A;  3QBY A;  5CKD A;  3OW2 S;  3JB9 J;  3CC4 A;  3UPU A;  2Y4Y A;  5HK0 A;  3J7A F;  1DJ7 B;  2WAC A;  1BKB A;  2OTL T;  1GXI E;  4M77 G;  1WGS A;  3CBM A;  3M5A A;  1K73 U;  1S72 A;  1I8F A;  3S3O A;  4KUD K;  2XI9 A;  3V8J A;  5FRN A;  3OYA A;  3V8L A;  3OYY A;  3GPL A;  1B34 B;  1NE8 A;  3BDL A;  3EFS A;  5FRO A;  4JRQ A;  2RHU A;  4J8O A;  3E1S A;  2EKO A;  4N4I A;  2GQV A;  4QQ6 A;  1B34 A;  5HY6 A;  4C92 B;  2KDS A;  4E7L A;  3EAE A;  3M55 A;  4C92 A;  4M75 F;  3VUB A;  4A4F A;  4C92 D;  5GAO m;  1QP3 A;  3HSB A;  4FT2 A;  1VQO A;  4ATO A;  3JB9 G;  1M1K U;  4C92 E;  2FVU A;  5DLQ E;  3KXT A;  2RD1 A;  5LJ3 j;  1VQ6 A;  3OQ5 A;  3CCL T;  4PJO G;  1Q81 U;  4MML A;  2EFI A;  2PQW A;  4JLG A;  2LCL A;  3JCM f;  2F5K A;  2DTH A;  4XK8 E;  2R5A A;  2MF2 A;  4XU1 A;  3OS1 A;  1PSE A;  3JB9 D;  3R6O A;  2KY9 A;  1U1S A;  3VKI A;  5LJ3 g;  2LRQ A;  2QQA A;  2KAF A;  2HQE A;  1ZBX A;  3DLL A;  3CCQ T;  3OW2 A;  4M7A C;  2K57 A;  4OVA A;  2WSC E;  2OTJ A;  2XID A;  3QJY A;  2L89 A;  3LH0 A;  1FX7 A;  4OP0 A;  3E19 A;  5LJ5 e;  4A54 A;  2RA2 A;  4J5Y A;  3CC2 T;  4BD3 A;  4P5N A;  1KQS S;  4HA8 A;  3QG1 A;  4M75 C;  4ELY C;  4LDV A;  4LDX A;  5J39 A;  4HCC A;  4ME7 A;  1Q7Y C;  1ZHI A;  1WNL A;  5GMK h;  3JB9 H;  2CZ6 B;  4FU6 A;  4XTZ A;  5GAM j;  3PTA A;  3FLG A;  3CCM T;  5I2M A;  1M1K C;  2C06 A;  4HT8 A;  5GMK i;  2FB7 A;  1YIT T;  4OB1 B;  4LDW A;  1EIF A;  1Q81 C;  1K8A C;  3OSS C;  1H3Z A;  2ZPH B;  3CC4 T;  3L2W A;  2X4W A;  5GAM g;  2DIG A;  4XTU A;  2DD5 A;  4M7D C;  2HD0 A;  3HFO A;  3CCE T;  4PLL A;  2KVQ G;  4M7A G;  3X20 B;  3LGF A;  3JB9 I;  1W2B A;  1KHC A;  3OBY A;  3CPW S;  5FU6 B;  4E7I A;  3V8K A;  4PL6 A;  2E1H A;  4RG8 A;  4DOV A;  3JCM c;  2Y4X A;  2RI3 A;  5DY9 A;  2GF7 A;  3G6E A;  3OBW A;  3X28 B;  2ZPI B;  4QW2 A;  2K2V A;  4E7H A;  4EMK A;  2KQW A;  3CC7 T;  1D3B B;  4J6W A;  4M75 G;  2DPP B;  4C8Q F;  3CXC A;  2ZPB B;  3CME A;  2DD4 A;  3OSV A;  1D3B A;  4MDX A;  1VQ6 T;  2EQU A;  5LJ5 d;  1QVP A;  2RJE A;  2X4J A;  1I81 A;  4LDY A;  1VQP T;  3BFM A;  1YI2 A;  3M59 A;  4M75 D;  5A0L A;  5CR2 A;  1XQH A;  4J83 A;  5KE3 A;  1OZ2 A;  4C92 C;  1VQ8 A;  4CRI A;  4L59 A;  1VQ9 A;  3GNG A;  2L5Q A;  1VQ5 A;  2EQM A;  2OTJ T;  2M16 A;  3OMC A;  2MWP A;  3OA6 A;  5GAO r;  2LQ8 A;  3CPF A;  3PIP A;  2PVD B;  3X25 B;  4F7U F;  3JCM P;  1MHN A;  4M7D G;  1O75 A;  2EWN A;  2XK0 A;  3OYL A;  2EQJ A;  2O4X B;  1N6A A;  1Y96 B;  4PNO A;  4ZGJ B;  4E7K A;  3M56 A;  4ELZ C;  4OB3 B;  3L2U A;  2O4X A;  1Y96 A;  3A8H B;  3C94 A;  4II1 A;  3JAM E;  3OYF A;  3KBG A;  4FSX A;  2X4X A;  3QXE B;  4BE1 A;  4M78 B;  4N4G A;  1VQN A;  1WJR A;  1UGQ B;  1YJ9 A;  2FHD A;  4M78 A;  1M9S A;  4OMF B;  4X34 A;  2RO0 A;  3P8H A;  3SD4 A;  3V7C A;  3OB9 A;  3G4S A;  4XAX B;  1YHQ T;  2GFA A;  4J7F A;  4X9C A;  5LJ3 f;  4XU3 A;  3CCV T;  1VQ7 A;  1BI3 A;  5IAY A;  1G5V A;  4M78 E;  1KC8 C;  3QZ5 B;  2EIF A;  3S3M A;  2DIQ A;  3FRN A;  5LJ5 g;  3O8V A;  5GAN 5;  1G3Y A;  5GAN h;  1VQ4 T;  1N9R A;  3SWN B;  2CGH A;  3MP1 A;  5C0M A;  3WVD B;  2CKK A;  1Y71 A;  5GAN d;  3SWN A;  5M9O A;  2E6N A;  2JTM A;  2I2L A;  5DM7 R;  4C92 G;  2P4T A;  1NPP A;  2HNI A;  3A8O B;  4DQ2 A;  2QA4 A;  3E9F A;  4BI4 A;  1JRI A;  2LVM A;  3H8Z A;  3J80 E;  2MMP A;  3NTI A;  4L6V 5;  2JTF A;  5D6Y A;  3TEE A;  3C95 A;  3OYG A;  2CS7 A;  2ZPE B;  3PFS A;  4VUB A;  1N8R U;  4C0Z A;  1VUB A;  2QQB A;  4ZN3 A;  3G6E T;  1M90 C;  4C0G A;  1YCY A;  2VV5 A;  4OGC A;  1YJN T;  4RCB A;  1MGQ A;  3SB2 A;  4O5V A;  3PT9 A;  3X24 B;  4QQD A;  1Q86 U;  1N27 A;  3KUF A;  5GAN 8;  4C0F A;  4LD9 K;  1G3T A;  4QVZ A;  2HBP A;  2JN0 A;  5GAM f;  3FJP A;  2ZCF B;  4C8Q B;  2XKO C;  5FU6 C;  3QSU A;  4C8Q A;  1IRE B;  4C8Q D;  2RHZ A;  3LW5 E;  1VQ8 T;  4JUV A;  2M0O A;  3HKS A;  1VQ9 T;  1M8V A;  4EMK C;  5CCA A;  4BB7 A;  3C4S A;  4NL3 A;  1VQ5 T;  1W2B S;  3CBP A;  4C8Q E;  3CMA A;  2E10 A;  2ZGW A;  3QUI A;  4JRP A;  1I5L A;  1QW1 A;  2D9T A;  2LT1 A;  3C12 A;  2RHY A;  1FWZ A;  2V8I A;  2LCC A;  3MEV A;  4M78 F;  5FU7 B;  5L8R E;  2QEX A;  1K73 C;  3M54 A;  1V29 B;  4XTX A;  1VQM A;  3DLM A;  3NFC A;  3LLR A;  1QVG S;  5GMK j;  2NLU A;  3JCM X;  3PIO A;  3HL8 A;  4BE2 A;  2DKG A;  3CXC S;  3RMQ A;  2BUD A;  5GAN 3;  4R56 A;  4F7U B;  4J6X A;  3S6W A;  1O9S A;  2V8J A;  3V7R A;  3JCM Q;  4JJN K;  1VQL A;  4F7U A;  2E41 A;  3L1A A;  2MWO A;  2WSE E;  1NJI U;  3HPW A;  1KHI A;  1Q82 U;  4F7U E;  5GAO p;  4C5E A;  1VQ7 T;  4C0D C;  5DLO A;  1Y07 A;  5D6X A;  3JCM J;  2EJF A;  4GY5 A;  3FDR A;  1IZ6 A;  3HRT A;  5IT9 E;  1HXD A;  4BE0 A;  2JVV A;  3DB4 A;  1S72 T;  1XTD A;  4MMK A;  3LYI A;  1M1G A;  1M5Q 1;  3HRU A;  1UGR B;  4JRK A;  5A0D A;  4M78 C;  5J3B A;  5KH6 A;  5IN1 A;  1KG1 A;  1YJW A;  3NTH A;  2QA4 T;  3FIF A;  5CKH A;  4NS5 A;  3WVE B;  3CCJ A;  5A2Q E;  4BDZ A;  5KE2 A;  1KQ2 A;  3JCM b;  2ZPG B;  3JRZ A;  2QTX A;  3VYH B;  2MAM A;  2YLB A;  3M4G A;  4XTY A;  1VIF A;  3J81 E;  1QVG A;  3GIB A;  3MP6 A;  4R55 A;  4OB2 B;  3RKY A;  4M77 F;  3H6Z A;  1WPY A;  2IVW A;  1XOV A;  1UB4 A;  2FYK A;  3P8D A;  4Y28 E;  1BIA A;  3RES A;  1NPR A;  1VQO T;  4YTL A;  5GAN e;  1BYM A;  3SWN C;  1P92 A;  1YBY A;  4B9W A;  5LJ5 f;  3PNW C;  3N5B B;  2YRV A;  4N4H A;  3MEW A;  2B8A A;  4RG2 A;  3P8B B;  3QHS A;  4IUQ A;  4DOW A;  2IG0 A;  2EJ9 A;  2R57 A;  1WJS A;  4QVD A;  4ZGD B;  5I2S A;  5CKE A;  2MI6 A;  2ZPF B;  2A7Y A;  3S3N A;  1K9M U;  1Q82 C;  2DXT A;  2LTO A;  1PSF A;  3PMT A;  4XU2 A;  4B9X A;  1VIE A;  3TCJ A;  3QYG B;  3L42 A;  4IUR A;  3JCM V;  4IUP A;  4PJO F;  4C5H A;  3CMA T;  5CKB A;  2QQS A;  2R5M A;  3M53 A;  4NL2 A;  5A0G A;  5KCO A;  3GLX A;  2LC4 A;  3G7Z A;  4LD6 A;  4OGE A;  4JS4 A;  1KQ1 A;  4M78 G;  4HCB A;  1M1F A;  2EYQ A;  2RJF A;  4MDW A;  2RJC A;  5KCH A;  2EAY A;  5GAN 4;  3CCS A;  1VQM T;  2HQX A;  4LDU A;  4Y91 A;  3M58 A;  4BY6 B;  2LDM A;  2QQR A;  5C6S A;  5GAN 7;  3QZ9 B;  2L3R A;  3OS5 A;  4JRI A;  2G3R A;  3SDZ A;  4C8Q C;  4EDU A;  5LJ5 j;  4UC4 A;  1QVF S;  3GF5 A;  1VQL T;  3CCQ A;  1JBM A;  2KMT A;  1N9S A;  1BI2 A;  3QPH A;  2RHX A;  4M78 D;  3CD6 A;  4HT9 A;  3LX7 A;  4BI8 B;  4OB0 B;  3HHT B;  5CQX A;  3UWN A;  2RHI A;  3QO3 A;  4C5G A;  2CZ1 B;  2GFU A;  4XU0 A;  5FU7 C;  1OZ3 A;  3FC3 A;  2XDB A;  3L2R A;  3HRS A;  2DK3 A;  5CIU A;  1LOJ A;  1X75 C;  5FLX E;  3UT1 A;  3RER A;  2RI5 A;  2P0P A;  4N0A A;  3M9Q A;  3JCM e;  1QP2 A;  2P0Q A;  2QXF A;  3GNF B;  5I21 A;  4BUG A;  3GOX A;  1K9M C;  4J7I A;  2GCX A;  3RMS A;  2A3L A;  3Q1J A;  3ZEH A;  1WJQ A;  2RM4 A;  2K5F A;  3CEY A;  3CCR A;  3JSC A;  2PUO B;  1M4Z A;  3CCU A;  4Q5W A;  5GMK l;  4IUT A;  4KT0 E;  2XHC A;  4NOY A;  3CCM A;  4ZTF A;  2CZ7 B;  2ZZD A;  4HKE A;  2QDY B;  1YIT A;  5LJ3 d;  4E7J A;  3HFN A;  2E12 A;  3OYC A;  3L2Z A;  2V8K A;  1WQW A;  2DEQ A;  4J6Y A;  3JCM W;  4XTV A;  3VYG A;  2PUK B;  3ZFJ A;  5GAN 2;  2QI2 A;  4KBM B;  3A8L B;  4EPC A;  3CME T;  4BDY A;  2JNG A;  4C8Q G;  4IUV A;  3FEO A;  4M7A F;  4WF2 A;  1QVF A;  2JUF A;  3LGL A;  2EQK A;  3PGG A;  3T9N A;  3CCE A;  5CVI A;  3UDC A;  3M4Y A;  3L2V A;  3RKX A;  3G71 A;  1AHJ B;  4PKC C;  4M77 B;  3OYN A;  1LNX A;  1YI2 T;  2YLC A;  5GAN j;  5FRM A;  4V2S A;  2LT4 A;  1NZ9 A;  4M77 A;  2LQK A;  3ASK A;  1XNI A;  4M77 D;  1Q7Y U;  2D6F A;  4RKU E;  2DZ9 A;  3NTK A;  4Z02 A;  2Y90 A;  2RB6 A;  5GAO q;  3CC7 A;  3MP8 A;  4M77 E;  3E9G A;  1G3S A;  3LWI A;  2LNV A;  4MZT A;  3V7S A;  4EMH A;  3OYJ A;  4XQ3 A;  3OYI A;  1WQ7 A;  5D6W A;  3URG A;  1OI1 A;  2DTI A;  4ZGE B;  5GAN g;  1K8A U;  4D6W A;  5GMK m;  1BIB A;  5CAI A;  4F7U G;  2KK4 A;  3QYH B;  2X4Y A;  3CCS T;  2VUB A;  2VXF A;  3I55 A;  1VQP A;  2XU8 A;  3JCM d;  1KD1 U;  3AHU A;  1R8O B;  5GAM d;  3M57 A;  2DVE A;  4PJO B;  2YHT A;  5LJ3 h;  2JOY A;  3VUZ A;  4EMG A;  4MZM A;  4PJO A;  4ZN1 A;  1VQN T;  1YJ9 T;  1JJ2 A;  2F5T X;  3VV0 A;  4E47 A;  5HK3 A;  1N8R C;  4PJO D;  2BKD N;  4IKF A;  4MZP A;  3CD6 T;  3OYB A;  2HAX A;  3G4S T;  4PJO E;  3QKJ A;  1I4K 1;  4TVR A;  4M7D F;  2M1H A;  1YIJ A;  2E64 A;  4BI3 A;  5CK9 A;  3F70 A;  1SSF A;  1UGS B;  2RK1 A;  1BI1 A;  1LJO A;  3VJP A;  1ZQ1 A;  1Q86 C;  2XDP A;  1HK9 A;  4A4E A;  2CYZ B;  2PVO B;  3EFR A;  4FL6 A;  2DZC A;  3QJ6 A;  3RUX A;  4PLI A;  1TH7 A;  3OY9 A;  4BY6 C;  3MHX A;  3OMG A;  5CQY A;  3MO8 A;  2VGN A;  3RIR A;  2AHJ B;  2RH2 A;  1VQK A;  1X6O A;  3CCR T;  2E6Z A;  3CCU T;  2WSF E;  1YHQ A;  3CCV A;  2M9U A;  3ZBD A;  5HKC A;  1OYX A;  2R58 A;  3I56 A;  2DXB A;  2O01 E;  2KSS A;  5CO7 A;  3VU3 C;  3A8M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...