2DK3A

Solution structure of mib-herc2 domain in hect domain containing protein 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
86
structure length
86
Chain Sequence
GSSGSSGVRSQVLKYMVPGARVIRGLDWKWRDQDGSPQGEGTVTGELHNGWIDVTWDAGGSNSYRMGAEGKFDLKLAPGYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase HECTD1
publication title Solution structure of Mib-herc2 domain in HECT domain containing protein 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 8
structure length 86
sequence length 86
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2006-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06701 MIB_HERC2 Mib_herc2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.920 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dk3A00
3DKMA 2DK3A
chains in the Genus database with same CATH superfamily
3EGUA 2ZPFB 5CO7A 3UA7A 2DBMA 3M0PA 4HT9A 2K5LA 3DLMA 3OS0A 3URGA 3ULRB 1YI2Q 5J39A 1OPLA 4C8QC 5LJ3e 4M78E 1X43A 2JS0A 2MI6A 1D1CA 4ZGDB 4EMHA 3M9QA 2P4TA 5M9OA 1N5ZA 4LE9A 2XI9A 1PHTA 3PMIA 1HK9A 1XJWB 2A3LA 3U23A 1TOVA 1WZOA 2FRWA 2EYXA 2E12A 2KR3A 1TTHB 3VU3C 4QKUA 2HZYA 4RTVA 2X3WD 1WJQA 4MMKA 2RQUA 1IGQA 2XDPA 4C8QG 1NM7A 1Q7YU 4C0DB 1M90U 2JW4A 4PJOE 3JCMd 3HHTB 1Y0MA 1YITT 3SWNB 5FU6B 1QQJA 4MMLA 2YRVA 4WF2A 2MAMA 3CCRQ 2KE9A 3ER0A 3OSVA 2JS2A 1OOTA 5DY9A 4E7LA 2QGGA 1WGSA 2QQBA 3VV0A 4B9XA 3HKSA 2GQIA 2DZ9A 1N8RC 4JRPA 1K73R 3JCMh 2I0NA 3NMZC 5HY6A 1WPYA 3EH1A 1SSFA 3X25B 4OMQA 2DERA 4D6WA 1VQ5Q 4V2SA 1RACB 2KK4A 4KT0E 3GIBA 3CBOA 3LGLA 3S6WA 3VRYA 2P84A 3VS2A 3OYNA 4KGZB 1UG1A 1QVGS 2HL5C 4M7AE 1M30A 3GBQA 4Z88A 1Q86C 5FROA 1C0MA 2D1XA 3CMET 3VYHB 2COWA 1QKWA 2EVRA 2L3QA 1PD0A 5KCOA 2KQWA 5GMKj 4HCBA 2ENMA 3V8JA 1K8AC 2CUDA 3LW5E 2LMJA 1V1CA 4M78A 4ZGJB 2DMOA 1J3TA 1YHQA 3QYHB 3VS3A 3I56Q 3OS5A 2P0QA 4IUQA 3EHRA 4M77D 1RAAB 3QKJA 1XTDA 4KBMB 3QG1A 2CZ6B 3GP8A 2RF0A 2OAUA 4FM4B 1O9SA 2ZZDA 2CZ1B 4FSXA 2SRCA 2RHUA 1TG0A 2ZGWA 1ZHIA 1MMAA 3FJPA 1YFNA 1YJWT 2E70A 2X4XA 5GAOm 3RKYA 1HJDA 3P8BB 1Y57A 2VYTA 1S72Q 4PJOA 2M0YA 4OMMA 4C8QB 2JN0A 3OW2A 1NLPC 2HSPA 4HVWA 1LOJA 1QVPA 3GNGA 1LNXA 2QA4Q 4DA4A 4X1VA 2DTIA 2LQNA 2MK5A 3LX7A 5CKEA 3G4SA 4DEYA 1K0SA 1LVKA 2DKGA 2ZPEB 4J9GA 1ZX6A 2RI2A 1KJWA 3EFOA 1X6OA 1VQ6Q 4ZTFA 1T0HA 3CC7A 3CCVA 4A4GA 5D6YA 4A4HA 5GAOn 3N5BB 1TSFA 5DLQE 1M8MA 5HK0A 1VQMQ 1WJSA 1OZ3A 4ME7A 4M7AA 2LCLA 3OYKA 1KK7A 2HKQB 4DBFA 2VXEA 4RTYA 1KQSA 2FL7A 3I9QA 3JCMP 1UGPB 4Y92A 1BK2A 3EGXB 4A4FA 3QXEB 2MWOA 3OYDA 1VYVA 1NE8A 1EZZB 5L8RE 4M78D 2BTTA 1M3CA 1TUCA 2O2OA 1CKBA 2GFUA 2SEMA 3L2VA 3OMGA 3S3NA 3CC2A 4J5YA 1U3OA 3EGDA 5KYWA 2J6FA 1KC8C 4CRIA 3GF5A 1Q81U 4O6JA 1UHCA 5LJ5e 4E2FB 1QVFA 2NLUA 4XTXA 4HCZA 4E7HA 4L5GA 2PUOB 3OYMA 3CCUQ 1ZSZB 4A54A 1K1ZA 1JRIA 2K3XA 2X51A 2COYA 2M51A 4AFUC 1HYOA 2DNUA 3OYLA 3JB9D 4F04B 3H0HA 4RG2A 4PJOD 3FB9A 4BE0A 3VUBA 2HNIA 3MKDA 1O75A 4XAXB 2E6NA 3P8HA 3A8MB 3UDCA 2FPDA 2CP2A 1T3SA 1T3LA 1UJ0A 1VQ7Q 4KRTA 1I81A 2RHYA 3P8DA 1UB4A 2DE0X 2RJDA 3KUFA 2RQVA 5GJVB 2HCKA 1UJYA 4XK8E 5CVIA 1D3BA 1UHFA 4BY6C 3X20B 4QW2A 5IAYA 3HL8A 1YN8A 2EJ9A 2DK3A 2F2WA 2L3SA 2QK0A 3CXCP 2ZPBB 2JT4A 4DOVA 5GAOl 2K3YA 4JS4A 1RADB 1UUEA 4HKEA 2VB6A 3NTIA 1VQ9A 5D6XA 2BZ8A 1OQKA 1I5LA 5FU7C 2M1HA 2YUQA 4MZMA 1X2KA 1VQ6T 3L42A 3HFOA 2XDBA 1IB8A 1GL5A 2DD5A 1YJ9Q 4PKCC 1TUDA 2V8KA 1AWWA 1AZGB 2XU8A 3REAB 3RERA 1D09B 2A0FB 3RESA 1JXMA 2KMTA 1N6AA 3LYIA 2Y4YA 1NJIC 4MDXA 2C0IA 1VQ5A 5FRMA 1VQMT 1G2BA 4OB2B 1NPRA 4ZNXA 3R6OA 2CP3A 1W2BA 2GTOA 2D0NA 4E47A 3TSWA 1U1TA 4OMOA 5GAMg 3TQ7P 5IXFA 2RI5A 4IUVA 5GANg 3JB9J 1BI0A 3X26B 2QDLA 3S3MA 3V7SA 2AT1B 3M54A 1AWJA 1JJ2A 3M58A 3I56A 1MHNA 4A63B 2O4XB 2R58A 2XIDA 2OI3A 1BI1A 2OTJQ 2O88A 1KD1R 9ATCB 2R5MA 3O8VA 3CC4Q 3BY7A 3CCUT 1Y96A 2ED1A 1Z9QA 7AT1B 1WJRA 3CD6A 4M75B 2HQXA 4XU0A 4FYWB 1YNZA 1M27C 4JUVA 4OMNA 4KUIA 1YCYA 3M0TA 2OX7A 1QVGP 1I07A 2DM1A 2DXCA 3HRSA 1OULA 2DZCA 4M78C 1ZLMA 4FU6A 1HXDA 2H8HA 1YIJQ 2QTVA 1VQ7T 1B34B 3CCQA 3EG2A 1K9AA 3OBWA 2YUPA 3J80E 5DM7R 1VQ4Q 1NYGA 2E5QA 3OYJA 2ED0A 1X27A 2V8JA 2CUBA 3CCEA 2QI2A 3SDZA 3MP1A 3I55A 2FEIA 2CS7A 3TSZA 1N8RU 3ASKA 4M78G 4JPBW 3DLLA 3FIFA 3EG9A 5KCHA 4PJOC 2FZGB 4C92B 3OYCA 1AWXA 2KGTA 2NUTA 4ZTJA 3C95A 3JCMc 2OTLQ 3G71T 3QUIA 4JRQA 1YJ9T 2CZ7B 1SEMA 2E3HA 5EG2A 5J26A 2JXBA 1I1JA 4XTUA 1YITQ 1Q86U 2NUPB 1Q82R 2LC4A 3KXTA 2FHDA 2DAQA 4E7IA 4BDYA 4DOWA 2RQWA 2HQEA 1G3SA 4K11A 4LUEA 3R6NA 3TVTA 1TH7A 2LZ6B 3C0CA 3OBYA 4PJOG 4DBHA 1K8AU 4M7AC 1K73C 3G6EA 1I5OB 3QJYA 5GAN6 2HBWA 3JSCA 1SF9A 2HD0A 5KYUA 2KAFA 3ME9A 3JV3A 4E7ZA 4M7DE 3M59A 2DFUA 3VUZA 2K79A 4L59A 3VRZA 1D0ZA 3NHNA 4PFPA 2OTJT 4J6XA 1X2QA 1WLPB 1YJNQ 1FXXA 3CMEQ 3H0IA 2FZKB 1VQPQ 2JMAA 2KY9A 4XTYA 3D7SB 4M7AG 1BCMA 2ROLA 1VQKA 4F7UE 5KYXA 2PNIA 1QCFA 1I0CA 1U06A 5KH6A 5GAN5 2BZXA 3CMAA 4M77F 3JCMf 2KRSA 4J9CA 1G8XA 2G3RA 3C94A 1BKBA 3UPUA 2E10A 2EW3A 4HXJA 2FYKA 1PSEA 3HTRA 2ZPGB 2W0ZA 1VQ4T 1YJWQ 2C0OA 1VQNA 2CT4A 1ZUUA 3FC3A 4JJNK 4M77A 4FYVB 3QPHA 2BZYA 1M2OA 3JCMQ 2FRYA 2ECZA 1EX4A 1X6BA 1QLYA 1GXIE 1AD5A 2RHIA 2VASA 1WXBA 4PLIA 4UC4A 1JEGA 3JAME 3M55A 2WSEE 5LJ3j 2OTLT 2DIQA 3GLXA 2K4YA 5GAN7 4AG1C 3RMSA 2YXYA 5L23A 3PT9A 5GAN3 2XDDA 2PQWA 2VVKA 1RAHB 5GAMd 2MWPA 3JCMX 1ZA2B 1KC8U 4WTOB 2VGNA 5GANd 2XHCA 1VQ8Q 4JJDA 3JCMV 2RB6A 4PFOA 4AFSC 1MMGA 2DJZA 1G5VA 2G6FX 4E7SA 3CCJA 1PG5B 2DF6A 1FMKA 1G3WA 1OV3A 5GAMh 1KHIA 1M1KR 2EYZA 5GANh 1W6XA 3RDVA 2KRNA 3FJ5A 4Y28E 1M4ZA 3TCJA 2VWFA 2GBQA 1TUGB 1IHVA 1PWTA 1OYXA 1VQLA 4B6MA 1QP2A 2MOXA 4QVCA 4F7UA 4M78F 1YJNT 4QQGA 4M7AB 4QT7A 3OMCA 3CCVT 5I2MA 1N9RA 1H3HA 2GTJA 2XG8D 5IN1A 1VQPT 5GMKe 2RHZA 2JVVA 2A36A 3HPWA 1MMDA 5IHIA 1X75C 1AT1B 2LNHB 3UA6A 3TREA 4HVUA 2L89A 3OYGA 2CDTA 3MO8A 3OYAA 3RNJA 1NEGA 3QWYA 2F5TX 5KYWB 1GFCA 4C92D 1FWZA 3V7RA 2K2MA 3RR6A 3JB9F 4PJOF 2AZVA 2DRMA 1K9MR 2DJQA 1B7TA 2L8DA 2V26A 3NTHA 4ELZC 4HT8A 2J05A 4OP0A 2JZ2A 1WYXA 1H641 1NJIU 3EH2A 2Z0WA 5GAN2 1VIEA 1ZBJA 3CCMQ 1JO8A 4M7DD 1YITA 1GRIA 2AKLA 2H3JA 4KUDK 5GMKm 3QHSA 1RABB 3CPWS 4DBQA 1Y71A 3E19A 1G83A 2EWNA 1M9SA 4M7AF 2QDYB 4C8QE 2FB7A 1UGSB 5AYFA 4XTWA 2EBPA 2K57A 2MIOA 1T0JA 1TXQA 1SRLA 3VKIA 2IIMA 4BUGA 1UGQB 1VQ8T 1OEBA 3PFSA 4JRKA 2RHXA 2RJCA 5FW9A 3A1PA 1UEBA 1AHJB 1BIAA 1PNJA 2EYQA 5LJ3f 1IRXA 3M57A 4F17A 5KE2A 2QQSA 4EPCA 2X3XD 3SB2A 1QCOA 1JQQA 2EPDA 4PJLA 4BI3A 4C0ZA 1GFDA 1JXOA 3RBBB 1Q95G 3OYYA 1B3QA 4D8KA 3M4GA 2QGFB 1GCPA 1PSFA 2KVQG 3NGPA 2P0KA 1SSHA 1WHGA 5CKFA 4R0KA 2E41A 4XTZA 3VS7A 2M9UA 5I2SA 2QQ9A 2HAXA 4FYYB 1KD1C 2V1QA 4CI0C 1CSKA 1WA7A 4HVVA 1YI2A 2YSQA 5A0LA 3BDLA 1WQ7A 1UECA 4N0AC 4Q5WA 1MUZA 2KEAA 4NOYA 1QWEA 3J7AF 5LJ5j 1R0CB 3M53A 1KFZA 2XD0A 3OYFA 3CCSQ 2DXUA 3MCAB 3UT1A 1BI2A 1WHKA 3PMTA 2FG0A 3QIIA 2YHTA 3E1SA 1Y96B 1QMCA 4EIKA 1YWOA 2LTOA 2QEXQ 1MV3A 4LUDA 5HK3A 3L2UA 3UWNA 3LWIA 3CCMT 2X4WA 2NWMA 2O9VA 5HCKA 4J7FA 3LWHA 2DL4A 4M77C 4RCCA 1BB9A 3CCRA 2AK5A 2EQUA 3L2QA 2DD4A 1K73U 5ECAA 2ABLA 1C6VX 4J9IA 3G71Q 4OF1A 1QKXA 5I11A 2K5FA 3A8HB 3CCQT 2LQ8A 2F5KA 5J3BA 1VYTA 2VC8A 2A08A 4KGVB 3JB9I 2LJ0A 3OY9A 2FVUA 2D8HA 5CIUA 4J9EA 4C0GA 1VQOT 1RL2A 5KYYB 1Q82C 4BE1A 3EGXA 3CCET 1RAIB 5CQXA 3EG9B 4II1A 4M77G 2KXCA 2QAZA 4GLKA 2DRKA 3UF4A 4EMKC 3PE0A 3AHUA 2KRMA 1WXTA 4N4GA 5GAMe 3BFMA 3V8LA 1M2VB 5GANe 2YT6A 2L3PA 2KBTA 2DEUA 1FX7A 3CXCA 1PKSA 3OW2S 4AG2C 2EQJA 1Q7YR 2EYWA 1ZSZA 1M90R 4J83A 2JTFA 1NPPA 5GMKh 2DLPA 1SRMA 4C5EA 1LPLA 3QDFA 2WSCE 5LL6S 3SHWA 4ZN1A 2KT1A 1K76A 1RAFB 4XTVA 1KC8R 1IREB 4XU3A 3HRTA 2BE9B 3L2WA 3CCLT 3T9NA 4FT4A 2BUDA 2JMCA 4C8QD 5GMKi 5CCAA 3G6ET 2JM9A 1RUWA 1R8OB 4FSSA 3I5SA 2GGRA 1EFNA 1KQ2A 3CCST 4MZTA 4M75E 5CK9A 1S72A 3GNFB 4LDVA 3LGFA 4IKFA 3IQLA 3UATA 2GF7A 3RMQA 4KGXB 4LN2A 2LRQA 2JTMA 2RPNA 4J6WA 2QA4A 1WQWA 4F7UG 4PJJA 3PGGA 2VKNA 2QEXT 1G3YA 2RN8A 2ZPIB 2DXTA 4J9BA 4FW2A 1WHLA 5KYXB 1PC0A 3F70A 4C0FA 1VQ6A 2YUOA 2KROA 3VS0A 3QSUA 4X34A 1VQKT 4CC4B 2RO0A 5LJ5f 1QVFS 1YHQQ 2I2LA 2X4YA 2QG9B 4LDXA 5GJWB 1ACMB 1OX9A 4XU1A 2EQKA 4BY6B 4BACA 1VQMA 2AKKA 2M02A 3L2RA 1IHWA 4A53A 4HA8A 4BI4A 5CAIA 3DKMA 1EIFA 2BIVA 4C0DC 3OYIA 1QVGA 4JLIA 4M77B 3G7ZA 2LVMA 4C92E 5IH2A 1RI0A 4ANJA 1WHHA 3HRUA 2J7IA 5FU7B 3JCMJ 4LD6A 1JU5C 5GAN4 4C5HA 3EHQA 1LJOA 2KYMA 1WFWA 2XK0A 3META 3CPWP 3JB9G 5FWBA 1NJIR 4JLGA 4GLMA 4BD3A 2R57A 4J9FA 3ZFJA 1JBMA 3OYEA 1SPKA 3MEAA 4DEXA 1UDLA 3WXMB 4AFZC 5A0GA 2DVEA 3CCUA 2MMPA 3KBGA 4GBQA 3H8ZA 1M1FA 3MHXA 1PM3A 4LDUA 3RIRA 3G1JA 3MEVA 2X4JA 2D0QB 1WI7A 2GQVA 1GBQA 3CC7Q 3CCVQ 2MYSA 3OB9A 1IO6A 3A8OB 4M75A 2X9HA 1UGVA 4FT2A 3DB4A 2EGEA 2NUZA 2HL3A 1JB0E 5IHNA 4N0AA 4J7IA 2QYZA 4ESRA 1ZA1B 2WSFE 1VQ7A 5D6WA 1VYUA 2CREA 5FRNA 4RMOA 2DL5A 3VJPA 4RCBA 1W4SA 1D0YA 1WXUA 2J6OA 3NPFA 2V8IA 4LD9K 3EG3A 1OU9A 2KDSA 4LXCA 2F1LA 1B34A 4J6YA 3VYGA 1VQLT 2RK2A 2DYBA 4QQ6A 1IXDA 1NBEB 2C0TA 3EG1A 1TU0B 4ORZA 3FRNA 4ZN3A 2Y90A 2YDLA 2YLCA 3CC2Q 5GANf 4BDZA 3FDRA 2DBKA 1OPKA 4TVRA 2DL3A 4M78B 4PJMA 2ESWA 5A0DA 3ZBDA 1Q81R 3JCMW 2CH4A 4Z89A 3G71A 1JJ2S 1C1AA 3GPLA 1YJ9A 2YLBA 3PVQA 1SKUB 2PVOB 5CQYA 2QASA 4C92A 1R0BG 2HEQA 1ARKA 1YHQT 3MP6A 3MP8A 4FCYA 2H3EB 5LJ3g 2CGHA 2EKHA 3ZEHA 5KYNA 2VGMA 1LCKA 2FO0A 2LNVA 1U8RA 3RKXA 4ZGEB 2KNBB 5C0MA 4M7DF 4DBRA 3OYBA 2DEQA 3DB3A 8ATCB 2WACA 2NUPA 4RTXA 5A2QE 4DQ2A 2LX9A 2QXFA 4PJOB 1Z9ZA 4C5IA 2CSIA 4EMKA 2QTXA 4M7DA 1BCOA 4M4ZA 2DX1A 1ZUKA 1TWBA 3J81E 1BBZA 3A8LB 2O31A 1M8VA 2RM4A 3NFCA 1KD1U 4M75D 4RUGA 3KFVA 5D7UA 4F7UF 4N4IA 3HFNA 1D0XA 2OTJA 2MF2A 2BKDN 3EFOB 1VQ9Q 3I5RA 2NYSA 2DPPB 3CC4A 1MGQA 3G4ST 4JZ3A 4CC7A 2LJ1A 1AEYA 1XQHA 3SFMA 1OX8A 2QQRA 4ATOA 1H92A 1ABQA 2K7AA 8AT1B 2EJGA 1H8KA 2GCXA 2LX7A 1VIFA 3CC7T 4PNOA 2L0AA 1XOVA 4RTTA 3CBPA 4E7KA 3A5ZB 1YIJA 4PFZA 4RG8A 1ZSZC 1KSWA 2P4RA 4ELYC 3M0RA 4VUBA 3OYHA 3C12A 3EFSA 3OW2P 2GNCA 1P92A 2RI3A 2LT4A 3EGDB 1VQ4A 1R77A 2IG0A 1TS9A 3S3OA 2PTKA 3OA6A 2CT3A 1MMNA 3M56A 1X01A 3CC2T 1M1GA 3SEMA 3CPFA 4PK4A 2EQMA 1PKTA 2EJFA 1RLPC 3EAEA 5CKDA 1FMVA 2JOYA 4IURA 2OTLA 2AIRB 2M16A 2K2VA 4MDWA 2FPEA 1UTIA 1WHMA 1YI2T 3CD6Q 1Q82U 1NZ9A 3THKA 1V29B 1OU8A 4RTZA 4QVZA 1KQSP 2ZAEA 4F16A 3LH5A 2RJFA 3M4YA 2K3BA 4F14A 2MCNA 2RD1A 2CYZB 3OS1A 4FW1A 3MJXA 4D8DA 1RLQC 2X35A 3SWNA 2KT8A 3O5ZA 1AWOA 2LP5A 4J9DA 1D3BB 1KIKA 1M5Q1 4X9CA 2M0OA 2K9GA 1M3BA 4J8OA 3CCQQ 2ROTA 4BE2A 3WVEB 2PVGB 1FMWA 1QVFP 4QQDA 1PCXA 3EFRA 1ZBXA 2LDMA 2W10A 2L5QA 5DLOA 3JCMb 1VQOQ 1DJ7B 2DTOA 2E1HA 3H0FA 3CCEQ 2E4HA 4OB1B 2E3IA 1YJNA 3I35A 1E6HA 3I55Q 1ABOA 1VQ9T 3QZ9B 3CMEA 3E9FA 3CCRT 1VQPA 2EIFA 2RJEA 1N8RR 3L2ZA 1AOJA 4OVAA 2COZA 2YWWA 3OSSC 1A0NB 3L1AA 3WVDB 1XNIA 2VUBA 2DTHA 3VS1A 2YRCA 1VQ5T 2HSEB 3TU4K 5CKHA 4OGEA 1Q7YC 2CP0A 2RQTA 1I8FA 1OI1A 1PD1A 3RKWA 4E6RA 5KE3A 1M90C 1Q86R 2PZ1A 3BW1A 1NLOC 3TEEA 3X28B 1RAGB 2JUFA 2D6FA 4M75C 2JJ9A 3CCLQ 3MEWA 1GCQC 5HKCA 5C6SA 2F69A 3G6EQ 5LJ5g 1YJWA 1K8AR 4IUUA 3X24B 4C8QF 1X6GA 3QWXX 4OB3B 4A4KA 2RH2A 3VS4A 1SHFA 4FIBA 2JM8A 1KG1A 3CEYA 3I56T 4RTUA 4IUTA 3H6ZA 4J9HA 4MZPA 2BE7D 2DYIA 2P0PA 4OMPA 5LJ3d 1MV0B 1BYMA 2GFAA 4PLLA 3OQ5A 2V1RA 1AVZC 4C8QA 1QWFA 3LH0A 4M75G 3M0QA 1GBRA 3QZ5B 1M3AA 3LLRA 2VV5A 4FL6A 1UGRB 3BDUA 3CD6T 4PJNA 4KH0B 2A28A 3FEOA 1VA7A 3GOXA 3CQTA 1W2BP 2B86A 1BU1A 1VQKQ 4PL6A 1H3ZA 4YTLA 5LJ3h 2YRDA 4NL3A 4AT1B 2D9TA 1NYFA 2CH4W 1VQ8A 2LCCA 4C92C 2RMOA 1S72T 3M5AA 2HMAA 4LDYA 2E5KA 3CMAQ 3HP9A 2DO3A 1UE9A 1M1KU 2IVWA 3C4SA 5GMKl 5FWCA 2QA4T 1JJ2P 3H41A 1E7OA 3M0UA 4M7AD 4KH1B 2KSSA 1IZ6A 4OB0B 3SD4A 1YP5A 1VQNQ 3A8GB 3ZL7C 1WNLA 4Z8AA 1Y7XA 1HSQA 4KULA 2NUTB 5GAOr 4P5NA 2RQRA 4LDWA 3PIPA 4NL2A 2VXFA 4IUPA 3I55T 5IXBA 4HCKA 2YUNA 4M7DC 4C92G 2DIGA 2B8AA 3E2UA 3MPUB 5IHKA 1N9SA 1W1FA 1HD3A 2LJ3A 4Y91A 2EGAA 4LNPA 4QVDA 1U1SA 1Y07A 3JCMe 1UFFA 3H9NA 3PTAA 3JCMg 5CKBA 1K0XA 1SHGA 2J6KA 3QO3A 4NS5A 5GAOq 1G3TA 4L6V5 5GAMj 4AFQC 2HDAA 1YBYA 1K9MU 4JJBA 5GANj 4O5VA 1KHCA 2L2PA 4E7JA 4M7DG 2PVDB 3V7CA 2MPXC 1ZQ1A 2A37A 2EQIA 2KYBA 2CKKA 5KYUB 2ZCFB 3CCJQ 2FPFA 2CP5A 1W70A 1E6GA 5AT1B 2QQAA 2PUKB 2LQWA 3NTKA 1SG5A 1QCNA 1WX6A 4EDUA 2EAYA 1ZUYA 4C5GA 4RTWA 1KQSS 2C06A 4BB7A 2CSQA 1VQLQ 3CCMA 4IIOA 2XKOC 2DL8A 3QJ6A 4OGCA 2DL7A 2PU9B 2F2XA 2KXDA 4FYXB 2DETA 4CC2A 2Y4XA 2XMFA 2R5AA 5EC7A 3BE3A 2CP6A 2AHJB 1YWPA 3INZA 6AT1B 2KI7A 2D8JA 5CR2A 2JTEA 4XQ3A 4A4EA 4CC3A 1RI9A 1Q81C 5I22A 1VUBA 3V8KA 3HSBA 1RAEB 2RNAA 1AZEA 1OZ2A 2DVJA 4JDSA 2E6ZA 1I4K1 4WCIA 2EFIA 4AMCA 3CMAT 4JS5A 1VQOA 2F2VA 1ZSGA 2RA2A 2L3RA 1WDXA 1WIEA 3FLGA 1KQ1A 1X69A 5GAN8 1U5SA 2LT1A 1BI3A 3QBYA 2HKNA 5KYYA 3MEUA 2EKOA 5FLXE 3SWNC 5FU6C 2XICA 1VQNT 1WHJA 4R55A 1S1NA 2J06A 2OAWA 2AZSA 2E65A 2HQHA 4M77E 1M2VA 3RUXA 3Q1JA 1VOMA 1PRMC 2ATCB 2IPOB 2OJ2A 1K4US 1D1AA 3OS2A 2LCSA 2CP7A 3M0SA 1BIBA 2CZ0B 3E9GA 2EYYA 4M75F 1B07A 3REBB 1QW1A 2ZPHB 1M1KC 1CKAA 3G4SQ 3JB9H 2O4XA 1QP3A 2O01E 2DA9A 3JRZA 4R56A 4EMKB 2O9SA 4X9DA 1FYNA 1N27A 3CCLA 4M7DB 5IT9E 2DXBA 2HBPA 3VS5A 4XU2A 2JNGA 1F1BB 2K5IA 1V76A 5LJ5d 1IGUA 1D1BA 1GCQA 3CCSA 3A98A 4JJCA 2K6DA 2RK1A 1YCSB 2LQKA 3CCJT 4GY5A 4OMLA 3EG0A 4RKUE 4EMGA 4BI8B 4JRIA 5LJ5h 3CC4T 2QEXA 4IIMA 4F7UB 2A7YA 2EGCA 3PIOA 1NG2A 1W2BS 3CPWA 5I21A 2E64A 3QDRB 1MNEA 3PVLA 1NEBA 4OMFB 5GAMf 4C92F 4HCCA 4N4HA 4JZ4A 3CBMA 2FZCB 1MNDA 4B9WA 2DILA 1K9MC 3PNWC 1PRLC 3VS6A 3CXCS 4Z02A 3QYGB 3AT1B 1YIJT 5GAOp
chains in the Genus database with same CATH topology
2JOYA 2ZPFB 5CO7A 1VQ7T 4IURA 2OTLA 4HT9A 1B34B 2K5LA 2M16A 2K2VA 4MDWA 2LTOA 3CCQA 1BYMA 3DLMA 3OS0A 3URGA 5J39A 4C8QC 3OBWA 5HK3A 1YI2T 5LJ3e 3L2UA 3J80E 4M78E 2MI6A 1Q82U 3UWNA 5DM7R 1NZ9A 3LWIA 2E5QA 4ZGDB 1V29B 3OYJA 4EMHA 3CCMT 2X4WA 3M9QA 2P4TA 4QVZA 5M9OA 2RJFA 2V8JA 3M4YA 2QI2A 2XI9A 3PMIA 3CCEA 4J7FA 2RD1A 3MP1A 3SDZA 3LWHA 1HK9A 4M77C 2CYZB 3OS1A 2A3LA 3I55A 4RCCA 2CS7A 3CCRA 1N8RU 3ASKA 4M78G 2X35A 2EQUA 3SWNA 3L2QA 2E12A 3DLLA 2DD4A 1K73U 3FIFA 5KCHA 4PJOC 3VU3C 4C92B 3OYCA 1D3BB 4ZTJA 1M5Q1 4X9CA 3C95A 4OF1A 3JCMc 2M0OA 3G71T 4J8OA 3QUIA 2K5FA 4JRQA 1YJ9T 1WJQA 4MMKA 2CZ7B 3A8HB 3CCQT 2LQ8A 2F5KA 5J3BA 3WVEB 2PVGB 2VC8A 2XDPA 4BE2A 4C8QG 3JB9I 5EG2A 3OY9A 5J26A 1Q7YU 4C0DB 4QQDA 1M90U 3EFRA 1ZBXA 2FVUA 2LDMA 2L5QA 4XTUA 5DLOA 5CIUA 3JCMb 4PJOE 3JCMd 1DJ7B 1Q86U 3HHTB 2DTOA 2E1HA 4C0GA 2LC4A 1VQOT 1YITT 1RL2A 3KXTA 4OB1B 3SWNB 4BE1A 1Q82C 2FHDA 5FU6B 3CCET 5CQXA 2DAQA 4E7IA 4MMLA 4II1A 2YRVA 4M77G 2MAMA 4GLKA 4WF2A 4BDYA 4DOWA 1YJNA 1VQ9T 3QZ9B 4EMKC 3ER0A 3CMEA 3OSVA 3AHUA 2HQEA 3E9FA 3CCRT 5DY9A 1G3SA 4E7LA 1VQPA 4N4GA 1WGSA 5GAMe 3BFMA 2QQBA 2EIFA 3V8LA 2RJEA 3VV0A 3L2ZA 1TH7A 3OBYA 4PJOG 4B9XA 3HKSA 5GANe 2DZ9A 1N8RC 4JRPA 1K8AU 4OVAA 3JCMh 4M7AC 1K73C 3G6EA 3OSSC 3QJYA 5GAN6 1FX7A 3JSCA 3L1AA 5HY6A 3CXCA 3WVDB 1XNIA 1WPYA 2VUBA 2DTHA 1SSFA 3X25B 3OW2S 2HD0A 2KAFA 3ME9A 2EQJA 4D6WA 4M7DE 3M59A 3VUZA 4V2SA 1VQ5T 3TU4K 2KK4A 4KT0E 4L59A 5CKHA 3GIBA 3CBOA 3LGLA 4OGEA 3S6WA 3OYNA 1Q7YC 1QVGS 1I8FA 1OI1A 5KE3A 3RKWA 4J6XA 4J83A 1M90C 2JTFA 1NPPA 5GMKh 4M7AE 2OTJT 4C5EA 1FXXA 1Q86C 5FROA 5LL6S 2WSCE 3BW1A 3TEEA 3X28B 4ZN1A 3CMET 2JUFA 2D6FA 4M75C 4XTVA 1IREB 4XU3A 3L2RA 3HRTA 3MEWA 3VYHB 3L2WA 3CCLT 2KY9A 3T9NA 5C6SA 5HKCA 4FT4A 2BUDA 4XTYA 2F69A 5KCOA 4C8QD 5LJ5g 1YJWA 4M7AG 2KQWA 5GMKi 5GMKj 5CCAA 3G6ET 4HCBA 4IUUA 3V8JA 3X24B 1VQKA 1K8AC 4C8QF 1R8OB 3LW5E 4F7UE 4M78A 4OB3B 1KQ2A 4ZGJB 4A4KA 2RH2A 3CCST 1YHQA 3QYHB 4FIBA 4MZTA 4M75E 5CK9A 1S72A 3OS5A 2P0QA 4IUQA 5KH6A 1KG1A 3CEYA 4M77D 3I56T 5GAN5 3QKJA 1XTDA 3GNFB 4LDVA 4KBMB 4IUTA 3CMAA 3H6ZA 4M77F 3QG1A 4MZPA 3JCMf 3LGFA 2P0PA 2CZ6B 4IKFA 2GF7A 3GP8A 3RMQA 5LJ3d 2OAUA 4FM4B 2G3RA 2LRQA 1BKBA 1O9SA 2JTMA 2ZZDA 3C94A 4J6WA 1WQWA 2E10A 2GFAA 4PLLA 4F7UG 3OQ5A 3UPUA 4C8QA 2CZ1B 3LH0A 3PGGA 2QEXT 4M75G 1G3YA 3QZ5B 3LLRA 4FSXA 2VV5A 4FL6A 2ZPIB 1UGRB 2FYKA 1PSEA 3BDUA 3CD6T 2DXTA 2ZPGB 2RHUA 2ZGWA 1ZHIA 3FJPA 3FEOA 1VQ4T 1VQNA 3F70A 4C0FA 3GOXA 3FC3A 1YJWT 4JJNK 1VQ6A 4M77A 4PL6A 3QSUA 1H3ZA 3QPHA 4X34A 4YTLA 5LJ3h 2E70A 2X4XA 4NL3A 1VQKT 1KC8U 5GAOm 2RO0A 3RKYA 5LJ5f 3P8BB 2D9TA 3JCMQ 1QVFS 2I2LA 2VYTA 2X4YA 1VQ8A 2LCCA 4LDXA 4C92C 4PJOA 1S72T 3M5AA 4LDYA 4XU1A 2EQKA 4BY6B 1GXIE 4BACA 4C8QB 1VQMA 2JN0A 2DO3A 2RHIA 3HP9A 3OW2A 1M1KU 2IVWA 3C4SA 4PLIA 1LOJA 4UC4A 4A53A 5GMKl 1QVPA 3GNGA 2WSEE 1LNXA 3M55A 4HA8A 5LJ3j 2DIQA 4BI4A 3JAME 4DA4A 2OTLT 3GLXA 2DTIA 5CAIA 3DKMA 1EIFA 2K4YA 2QA4T 5GAN7 3LX7A 2BIVA 4C0DC 5CKEA 3OYIA 3G4SA 1QVGA 4M7AD 2KSSA 4JLIA 4M77B 1IZ6A 4OB0B 3G7ZA 2LVMA 3SD4A 4C92E 2DKGA 3RMSA 2ZPEB 1RI0A 2RI2A 3A8GB 3PT9A 1X6OA 3HRUA 1WNLA 5GAN3 5FU7B 2XDDA 2PQWA 4ZTFA 1Y7XA 5GAMd 3JCMJ 4LD6A 2MWPA 3JCMX 5GAN4 4KULA 5GAOr 4C5HA 4P5NA 3CC7A 4LDWA 1LJOA 5D6YA 2VGNA 4A4HA 2XHCA 4NL2A 2VXFA 4IUPA 4A4GA 5GANd 3N5BB 5GAOn 3PIPA 3I55T 2XK0A 3JCMV 2RB6A 4M7DC 3META 4C92G 3JB9G 5DLQE 2DIGA 2DJZA 5HK0A 2B8AA 4JLGA 4BD3A 1WJSA 1OZ3A 2R57A 4ME7A 3ZFJA 1G5VA 4M7AA 1JBMA 2LCLA 3OYKA 1N9SA 3OYEA 3MEAA 2VXEA 3CCJA 1G3WA 4Y91A 3WXMB 5GAMh 1KQSA 1KHIA 2FL7A 5A0GA 2DVEA 4QVDA 3JCMP 1UGPB 1U1SA 1Y07A 3JCMe 3CCUA 2MMPA 3KBGA 5GANh 3H8ZA 3PTAA 3JCMg 4A4FA 1M1FA 5CKBA 3MHXA 3QXEB 2MWOA 4LDUA 1M4ZA 4Y28E 3RIRA 3TCJA 3OYDA 1NE8A 3MEVA 5L8RE 1OYXA 2X4JA 1VQLA 2D0QB 3QO3A 4M78D 4NS5A 5GAOq 1G3TA 1QP2A 4QVCA 4L6V5 5GAMj 2GQVA 4F7UA 4M78F 3OB9A 1YJNT 4QQGA 1YBYA 2GFUA 4M7AB 1K9MU 3L2VA 3OMCA 3A8OB 4O5VA 4M75A 1N9RA 3OMGA 5I2MA 3CCVT 5GANj 3S3NA 1KHCA 4M7DG 2XG8D 4E7JA 3CC2A 4J5YA 5IN1A 1VQPT 2PVDB 5GMKe 4FT2A 3V7CA 2RHZA 3DB4A 3GF5A 1ZQ1A 4CRIA 4O6JA 1Q81U 1KC8C 2CKKA 2JVVA 5LJ5e 1JB0E 4N0AA 4J7IA 1QVFA 2ZCFB 3HPWA 2NLUA 2WSFE 1X75C 4XTXA 4HCZA 5D6WA 4E7HA 1VQ7A 3TREA 4L5GA 5FRNA 4RMOA 2L89A 2PUOB 3VJPA 3OYGA 4RCBA 2QQAA 3OYMA 2PUKB 1W4SA 4A54A 3MO8A 1YIJT 3NTKA 3OYAA 1JRIA 2V8IA 4EDUA 2EAYA 2K3XA 4C5GA 4LD9K 1KQSS 2KDSA 2C06A 4BB7A 1B34A 3CCMA 4J6YA 3VYGA 1VQLT 2F5TX 2XKOC 2RK2A 4QQ6A 3QJ6A 4C92D 3OYLA 3JB9D 4RG2A 4PJOD 4OGCA 1FWZA 3FB9A 3V7RA 4BE0A 2PU9B 4ZN3A 3FRNA 3JB9F 2Y90A 3VUBA 2YLCA 2HNIA 4PJOF 5GANf 4BDZA 1O75A 2Y4XA 2R5AA 3FDRA 4XAXB 2E6NA 2L8DA 3P8HA 3A8MB 3UDCA 2AHJB 4TVRA 3NTHA 3INZA 4M78B 5A0DA 5CR2A 3ZBDA 4ELZC 4XQ3A 4A4EA 3JCMW 4HT8A 1I81A 1Q81C 4OP0A 3G71A 1JJ2S 3GPLA 2RHYA 2JZ2A 3P8DA 1UB4A 1VUBA 1H641 1YJ9A 2RJDA 2YLBA 3KUFA 1NJIU 5CVIA 4XK8E 2PVOB 5CQYA 3V8KA 3HSBA 4C92A 5GAN2 1D3BA 1OZ2A 1VIEA 1YHQT 3MP6A 4BY6C 4JDSA 3MP8A 2E6ZA 3X20B 1I4K1 2EFIA 4QW2A 2CGHA 5IAYA 3ZEHA 5LJ3g 3HL8A 2VGMA 2LNVA 3CMAT 2EJ9A 2DK3A 4JS5A 4M7DD 1U8RA 1VQOA 3RKXA 4ZGEB 1YITA 2ZPBB 2H3JA 5C0MA 4DOVA 4KUDK 2RA2A 2L3RA 3QHSA 5GMKm 5GAOl 4M7DF 2K3YA 3OYBA 4JS4A 3FLGA 1KQ1A 5GAN8 4HKEA 3CPWS 3NTIA 2DEQA 3DB3A 5D6XA 1VQ9A 2LT1A 1BI3A 1Y71A 3E19A 2WACA 3QBYA 2EWNA 1M9SA 4M7AF 2QDYB 4C8QE 1I5LA 2FB7A 2EKOA 3MEUA 5A2QE 5FLXE 1UGSB 3SWNC 5FU7C 2LX9A 5AYFA 4DQ2A 5FU6C 2M1HA 4MZMA 2XICA 1VQNT 4XTWA 2QXFA 4R55A 2K57A 4PJOB 1VQ6T 3L42A 3HFOA 2XDBA 2DD5A 4PKCC 3VKIA 4C5IA 2V8KA 4EMKA 2QTXA 4M7DA 4BUGA 2E65A 1UGQB 4M77E 2XU8A 3RUXA 3J81E 1VQ8T 3Q1JA 3RERA 3RESA 3A8LB 2KMTA 3PFSA 1M8VA 2RM4A 1N6AA 3LYIA 2Y4YA 1NJIC 4MDXA 4JRKA 1VQ5A 5FRMA 1VQMT 2RHXA 2RJCA 3NFCA 3OS2A 1KD1U 4OB2B 4M75D 4F7UF 1BIBA 1UEBA 1AHJB 4N4IA 1NPRA 3HFNA 2CZ0B 3E9GA 2OTJA 3R6OA 2MF2A 1BIAA 2BKDN 2EYQA 4M75F 5LJ3f 1QW1A 2ZPHB 1M1KC 1W2BA 3M57A 3JB9H 5KE2A 2QQSA 4EPCA 2DPPB 1QP3A 1MGQA 2O4XA 4E47A 3G4ST 2O01E 3CC4A 1U1TA 4R56A 3JRZA 3SB2A 4EMKB 4X9DA 1N27A 1XQHA 3SFMA 4BI3A 4C0ZA 5GAMg 3CCLA 2QQRA 2DXBA 2HBPA 3CCVA 5IT9E 4M7DB 2RI5A 4ATOA 4IUVA 5GANg 4XU2A 2EJGA 3JB9J 1BI0A 2JNGA 2K5IA 3OYYA 2GCXA 1VIFA 3X26B 3CC7T 3S3MA 4PNOA 3M4GA 5LJ5d 3V7SA 1XOVA 3M54A 3CCSA 1PSFA 2KVQG 3M58A 3CBPA 1JJ2A 4E7KA 2P0KA 3A5ZB 3I56A 1MHNA 2O4XB 2R58A 5CKFA 2RK1A 1YIJA 2E41A 2XIDA 1BI1A 2LQKA 4RG8A 4XTZA 4GY5A 3CCJT 2M9UA 4ELYC 5I2SA 2QQ9A 2R5MA 4RKUE 2HAXA 1KD1C 3O8VA 4EMGA 4VUBA 3OYHA 4BI8B 3BY7A 4CI0C 4JRIA 3CCUT 5LJ5h 3CC4T 2QEXA 1Y96A 1YI2A 4F7UB 2A7YA 3C12A 3EFSA 1WJRA 1P92A 3PIOA 3CD6A 4M75B 2HQXA 4XU0A 5A0LA 3BDLA 1W2BS 3CPWA 1WQ7A 2RI3A 2E64A 2LT4A 3QDRB 5I21A 1VQ4A 4JUVA 2IG0A 4KUIA 4N0AC 4Q5WA 1YCYA 3S3OA 5GAMf 4OMFB 4NOYA 4C92F 3OA6A 3J7AF 5LJ5j 2QA4A 4HCCA 3M53A 2XD0A 2DXCA 4N4HA 3OYFA 3CBMA 3M56A 1X01A 2DXUA 1M1GA 2DZCA 3HRSA 3MCAB 4B9WA 3CC2T 4M78C 1K9MC 3CPFA 3PNWC 3UT1A 1BI2A 4FU6A 2EQMA 3PMTA 4Z02A 1HXDA 3QIIA 3CXCS 2YHTA 3E1SA 2EJFA 3QYGB 1Y96B 3EAEA 5GAOp 5CKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKM A;  2DK3 A; 
#chains in the Genus database with same CATH topology
 3EGU A;  2ZPF B;  5CO7 A;  3UA7 A;  2DBM A;  3M0P A;  4HT9 A;  2K5L A;  3DLM A;  3OS0 A;  3URG A;  3ULR B;  1YI2 Q;  5J39 A;  1OPL A;  4C8Q C;  5LJ3 e;  4M78 E;  1X43 A;  2JS0 A;  2MI6 A;  1D1C A;  4ZGD B;  4EMH A;  3M9Q A;  2P4T A;  5M9O A;  1N5Z A;  4LE9 A;  2XI9 A;  1PHT A;  3PMI A;  1HK9 A;  1XJW B;  2A3L A;  3U23 A;  1TOV A;  1WZO A;  2FRW A;  2EYX A;  2E12 A;  2KR3 A;  1TTH B;  3VU3 C;  4QKU A;  2HZY A;  4RTV A;  2X3W D;  1WJQ A;  4MMK A;  2RQU A;  1IGQ A;  2XDP A;  4C8Q G;  1NM7 A;  1Q7Y U;  4C0D B;  1M90 U;  2JW4 A;  4PJO E;  3JCM d;  3HHT B;  1Y0M A;  1YIT T;  3SWN B;  5FU6 B;  1QQJ A;  4MML A;  2YRV A;  4WF2 A;  2MAM A;  3CCR Q;  2KE9 A;  3ER0 A;  3OSV A;  2JS2 A;  1OOT A;  5DY9 A;  4E7L A;  2QGG A;  1WGS A;  2QQB A;  3VV0 A;  4B9X A;  3HKS A;  2GQI A;  2DZ9 A;  1N8R C;  4JRP A;  1K73 R;  3JCM h;  2I0N A;  3NMZ C;  5HY6 A;  1WPY A;  3EH1 A;  1SSF A;  3X25 B;  4OMQ A;  2DER A;  4D6W A;  1VQ5 Q;  4V2S A;  1RAC B;  2KK4 A;  4KT0 E;  3GIB A;  3CBO A;  3LGL A;  3S6W A;  3VRY A;  2P84 A;  3VS2 A;  3OYN A;  4KGZ B;  1UG1 A;  1QVG S;  2HL5 C;  4M7A E;  1M30 A;  3GBQ A;  4Z88 A;  1Q86 C;  5FRO A;  1C0M A;  2D1X A;  3CME T;  3VYH B;  2COW A;  1QKW A;  2EVR A;  2L3Q A;  1PD0 A;  5KCO A;  2KQW A;  5GMK j;  4HCB A;  2ENM A;  3V8J A;  1K8A C;  2CUD A;  3LW5 E;  2LMJ A;  1V1C A;  4M78 A;  4ZGJ B;  2DMO A;  1J3T A;  1YHQ A;  3QYH B;  3VS3 A;  3I56 Q;  3OS5 A;  2P0Q A;  4IUQ A;  3EHR A;  4M77 D;  1RAA B;  3QKJ A;  1XTD A;  4KBM B;  3QG1 A;  2CZ6 B;  3GP8 A;  2RF0 A;  2OAU A;  4FM4 B;  1O9S A;  2ZZD A;  2CZ1 B;  4FSX A;  2SRC A;  2RHU A;  1TG0 A;  2ZGW A;  1ZHI A;  1MMA A;  3FJP A;  1YFN A;  1YJW T;  2E70 A;  2X4X A;  5GAO m;  3RKY A;  1HJD A;  3P8B B;  1Y57 A;  2VYT A;  1S72 Q;  4PJO A;  2M0Y A;  4OMM A;  4C8Q B;  2JN0 A;  3OW2 A;  1NLP C;  2HSP A;  4HVW A;  1LOJ A;  1QVP A;  3GNG A;  1LNX A;  2QA4 Q;  4DA4 A;  4X1V A;  2DTI A;  2LQN A;  2MK5 A;  3LX7 A;  5CKE A;  3G4S A;  4DEY A;  1K0S A;  1LVK A;  2DKG A;  2ZPE B;  4J9G A;  1ZX6 A;  2RI2 A;  1KJW A;  3EFO A;  1X6O A;  1VQ6 Q;  4ZTF A;  1T0H A;  3CC7 A;  3CCV A;  4A4G A;  5D6Y A;  4A4H A;  5GAO n;  3N5B B;  1TSF A;  5DLQ E;  1M8M A;  5HK0 A;  1VQM Q;  1WJS A;  1OZ3 A;  4ME7 A;  4M7A A;  2LCL A;  3OYK A;  1KK7 A;  2HKQ B;  4DBF A;  2VXE A;  4RTY A;  1KQS A;  2FL7 A;  3I9Q A;  3JCM P;  1UGP B;  4Y92 A;  1BK2 A;  3EGX B;  4A4F A;  3QXE B;  2MWO A;  3OYD A;  1VYV A;  1NE8 A;  1EZZ B;  5L8R E;  4M78 D;  2BTT A;  1M3C A;  1TUC A;  2O2O A;  1CKB A;  2GFU A;  2SEM A;  3L2V A;  3OMG A;  3S3N A;  3CC2 A;  4J5Y A;  1U3O A;  3EGD A;  5KYW A;  2J6F A;  1KC8 C;  4CRI A;  3GF5 A;  1Q81 U;  4O6J A;  1UHC A;  5LJ5 e;  4E2F B;  1QVF A;  2NLU A;  4XTX A;  4HCZ A;  4E7H A;  4L5G A;  2PUO B;  3OYM A;  3CCU Q;  1ZSZ B;  4A54 A;  1K1Z A;  1JRI A;  2K3X A;  2X51 A;  2COY A;  2M51 A;  4AFU C;  1HYO A;  2DNU A;  3OYL A;  3JB9 D;  4F04 B;  3H0H A;  4RG2 A;  4PJO D;  3FB9 A;  4BE0 A;  3VUB A;  2HNI A;  3MKD A;  1O75 A;  4XAX B;  2E6N A;  3P8H A;  3A8M B;  3UDC A;  2FPD A;  2CP2 A;  1T3S A;  1T3L A;  1UJ0 A;  1VQ7 Q;  4KRT A;  1I81 A;  2RHY A;  3P8D A;  1UB4 A;  2DE0 X;  2RJD A;  3KUF A;  2RQV A;  5GJV B;  2HCK A;  1UJY A;  4XK8 E;  5CVI A;  1D3B A;  1UHF A;  4BY6 C;  3X20 B;  4QW2 A;  5IAY A;  3HL8 A;  1YN8 A;  2EJ9 A;  2DK3 A;  2F2W A;  2L3S A;  2QK0 A;  3CXC P;  2ZPB B;  2JT4 A;  4DOV A;  5GAO l;  2K3Y A;  4JS4 A;  1RAD B;  1UUE A;  4HKE A;  2VB6 A;  3NTI A;  1VQ9 A;  5D6X A;  2BZ8 A;  1OQK A;  1I5L A;  5FU7 C;  2M1H A;  2YUQ A;  4MZM A;  1X2K A;  1VQ6 T;  3L42 A;  3HFO A;  2XDB A;  1IB8 A;  1GL5 A;  2DD5 A;  1YJ9 Q;  4PKC C;  1TUD A;  2V8K A;  1AWW A;  1AZG B;  2XU8 A;  3REA B;  3RER A;  1D09 B;  2A0F B;  3RES A;  1JXM A;  2KMT A;  1N6A A;  3LYI A;  2Y4Y A;  1NJI C;  4MDX A;  2C0I A;  1VQ5 A;  5FRM A;  1VQM T;  1G2B A;  4OB2 B;  1NPR A;  4ZNX A;  3R6O A;  2CP3 A;  1W2B A;  2GTO A;  2D0N A;  4E47 A;  3TSW A;  1U1T A;  4OMO A;  5GAM g;  3TQ7 P;  5IXF A;  2RI5 A;  4IUV A;  5GAN g;  3JB9 J;  1BI0 A;  3X26 B;  2QDL A;  3S3M A;  3V7S A;  2AT1 B;  3M54 A;  1AWJ A;  1JJ2 A;  3M58 A;  3I56 A;  1MHN A;  4A63 B;  2O4X B;  2R58 A;  2XID A;  2OI3 A;  1BI1 A;  2OTJ Q;  2O88 A;  1KD1 R;  9ATC B;  2R5M A;  3O8V A;  3CC4 Q;  3BY7 A;  3CCU T;  1Y96 A;  2ED1 A;  1Z9Q A;  7AT1 B;  1WJR A;  3CD6 A;  4M75 B;  2HQX A;  4XU0 A;  4FYW B;  1YNZ A;  1M27 C;  4JUV A;  4OMN A;  4KUI A;  1YCY A;  3M0T A;  2OX7 A;  1QVG P;  1I07 A;  2DM1 A;  2DXC A;  3HRS A;  1OUL A;  2DZC A;  4M78 C;  1ZLM A;  4FU6 A;  1HXD A;  2H8H A;  1YIJ Q;  2QTV A;  1VQ7 T;  1B34 B;  3CCQ A;  3EG2 A;  1K9A A;  3OBW A;  2YUP A;  3J80 E;  5DM7 R;  1VQ4 Q;  1NYG A;  2E5Q A;  3OYJ A;  2ED0 A;  1X27 A;  2V8J A;  2CUB A;  3CCE A;  2QI2 A;  3SDZ A;  3MP1 A;  3I55 A;  2FEI A;  2CS7 A;  3TSZ A;  1N8R U;  3ASK A;  4M78 G;  4JPB W;  3DLL A;  3FIF A;  3EG9 A;  5KCH A;  4PJO C;  2FZG B;  4C92 B;  3OYC A;  1AWX A;  2KGT A;  2NUT A;  4ZTJ A;  3C95 A;  3JCM c;  2OTL Q;  3G71 T;  3QUI A;  4JRQ A;  1YJ9 T;  2CZ7 B;  1SEM A;  2E3H A;  5EG2 A;  5J26 A;  2JXB A;  1I1J A;  4XTU A;  1YIT Q;  1Q86 U;  2NUP B;  1Q82 R;  2LC4 A;  3KXT A;  2FHD A;  2DAQ A;  4E7I A;  4BDY A;  4DOW A;  2RQW A;  2HQE A;  1G3S A;  4K11 A;  4LUE A;  3R6N A;  3TVT A;  1TH7 A;  2LZ6 B;  3C0C A;  3OBY A;  4PJO G;  4DBH A;  1K8A U;  4M7A C;  1K73 C;  3G6E A;  1I5O B;  3QJY A;  5GAN 6;  2HBW A;  3JSC A;  1SF9 A;  2HD0 A;  5KYU A;  2KAF A;  3ME9 A;  3JV3 A;  4E7Z A;  4M7D E;  3M59 A;  2DFU A;  3VUZ A;  2K79 A;  4L59 A;  3VRZ A;  1D0Z A;  3NHN A;  4PFP A;  2OTJ T;  4J6X A;  1X2Q A;  1WLP B;  1YJN Q;  1FXX A;  3CME Q;  3H0I A;  2FZK B;  1VQP Q;  2JMA A;  2KY9 A;  4XTY A;  3D7S B;  4M7A G;  1BCM A;  2ROL A;  1VQK A;  4F7U E;  5KYX A;  2PNI A;  1QCF A;  1I0C A;  1U06 A;  5KH6 A;  5GAN 5;  2BZX A;  3CMA A;  4M77 F;  3JCM f;  2KRS A;  4J9C A;  1G8X A;  2G3R A;  3C94 A;  1BKB A;  3UPU A;  2E10 A;  2EW3 A;  4HXJ A;  2FYK A;  1PSE A;  3HTR A;  2ZPG B;  2W0Z A;  1VQ4 T;  1YJW Q;  2C0O A;  1VQN A;  2CT4 A;  1ZUU A;  3FC3 A;  4JJN K;  4M77 A;  4FYV B;  3QPH A;  2BZY A;  1M2O A;  3JCM Q;  2FRY A;  2ECZ A;  1EX4 A;  1X6B A;  1QLY A;  1GXI E;  1AD5 A;  2RHI A;  2VAS A;  1WXB A;  4PLI A;  4UC4 A;  1JEG A;  3JAM E;  3M55 A;  2WSE E;  5LJ3 j;  2OTL T;  2DIQ A;  3GLX A;  2K4Y A;  5GAN 7;  4AG1 C;  3RMS A;  2YXY A;  5L23 A;  3PT9 A;  5GAN 3;  2XDD A;  2PQW A;  2VVK A;  1RAH B;  5GAM d;  2MWP A;  3JCM X;  1ZA2 B;  1KC8 U;  4WTO B;  2VGN A;  5GAN d;  2XHC A;  1VQ8 Q;  4JJD A;  3JCM V;  2RB6 A;  4PFO A;  4AFS C;  1MMG A;  2DJZ A;  1G5V A;  2G6F X;  4E7S A;  3CCJ A;  1PG5 B;  2DF6 A;  1FMK A;  1G3W A;  1OV3 A;  5GAM h;  1KHI A;  1M1K R;  2EYZ A;  5GAN h;  1W6X A;  3RDV A;  2KRN A;  3FJ5 A;  4Y28 E;  1M4Z A;  3TCJ A;  2VWF A;  2GBQ A;  1TUG B;  1IHV A;  1PWT A;  1OYX A;  1VQL A;  4B6M A;  1QP2 A;  2MOX A;  4QVC A;  4F7U A;  4M78 F;  1YJN T;  4QQG A;  4M7A B;  4QT7 A;  3OMC A;  3CCV T;  5I2M A;  1N9R A;  1H3H A;  2GTJ A;  2XG8 D;  5IN1 A;  1VQP T;  5GMK e;  2RHZ A;  2JVV A;  2A36 A;  3HPW A;  1MMD A;  5IHI A;  1X75 C;  1AT1 B;  2LNH B;  3UA6 A;  3TRE A;  4HVU A;  2L89 A;  3OYG A;  2CDT A;  3MO8 A;  3OYA A;  3RNJ A;  1NEG A;  3QWY A;  2F5T X;  5KYW B;  1GFC A;  4C92 D;  1FWZ A;  3V7R A;  2K2M A;  3RR6 A;  3JB9 F;  4PJO F;  2AZV A;  2DRM A;  1K9M R;  2DJQ A;  1B7T A;  2L8D A;  2V26 A;  3NTH A;  4ELZ C;  4HT8 A;  2J05 A;  4OP0 A;  2JZ2 A;  1WYX A;  1H64 1;  1NJI U;  3EH2 A;  2Z0W A;  5GAN 2;  1VIE A;  1ZBJ A;  3CCM Q;  1JO8 A;  4M7D D;  1YIT A;  1GRI A;  2AKL A;  2H3J A;  4KUD K;  5GMK m;  3QHS A;  1RAB B;  3CPW S;  4DBQ A;  1Y71 A;  3E19 A;  1G83 A;  2EWN A;  1M9S A;  4M7A F;  2QDY B;  4C8Q E;  2FB7 A;  1UGS B;  5AYF A;  4XTW A;  2EBP A;  2K57 A;  2MIO A;  1T0J A;  1TXQ A;  1SRL A;  3VKI A;  2IIM A;  4BUG A;  1UGQ B;  1VQ8 T;  1OEB A;  3PFS A;  4JRK A;  2RHX A;  2RJC A;  5FW9 A;  3A1P A;  1UEB A;  1AHJ B;  1BIA A;  1PNJ A;  2EYQ A;  5LJ3 f;  1IRX A;  3M57 A;  4F17 A;  5KE2 A;  2QQS A;  4EPC A;  2X3X D;  3SB2 A;  1QCO A;  1JQQ A;  2EPD A;  4PJL A;  4BI3 A;  4C0Z A;  1GFD A;  1JXO A;  3RBB B;  1Q95 G;  3OYY A;  1B3Q A;  4D8K A;  3M4G A;  2QGF B;  1GCP A;  1PSF A;  2KVQ G;  3NGP A;  2P0K A;  1SSH A;  1WHG A;  5CKF A;  4R0K A;  2E41 A;  4XTZ A;  3VS7 A;  2M9U A;  5I2S A;  2QQ9 A;  2HAX A;  4FYY B;  1KD1 C;  2V1Q A;  4CI0 C;  1CSK A;  1WA7 A;  4HVV A;  1YI2 A;  2YSQ A;  5A0L A;  3BDL A;  1WQ7 A;  1UEC A;  4N0A C;  4Q5W A;  1MUZ A;  2KEA A;  4NOY A;  1QWE A;  3J7A F;  5LJ5 j;  1R0C B;  3M53 A;  1KFZ A;  2XD0 A;  3OYF A;  3CCS Q;  2DXU A;  3MCA B;  3UT1 A;  1BI2 A;  1WHK A;  3PMT A;  2FG0 A;  3QII A;  2YHT A;  3E1S A;  1Y96 B;  1QMC A;  4EIK A;  1YWO A;  2LTO A;  2QEX Q;  1MV3 A;  4LUD A;  5HK3 A;  3L2U A;  3UWN A;  3LWI A;  3CCM T;  2X4W A;  2NWM A;  2O9V A;  5HCK A;  4J7F A;  3LWH A;  2DL4 A;  4M77 C;  4RCC A;  1BB9 A;  3CCR A;  2AK5 A;  2EQU A;  3L2Q A;  2DD4 A;  1K73 U;  5ECA A;  2ABL A;  1C6V X;  4J9I A;  3G71 Q;  4OF1 A;  1QKX A;  5I11 A;  2K5F A;  3A8H B;  3CCQ T;  2LQ8 A;  2F5K A;  5J3B A;  1VYT A;  2VC8 A;  2A08 A;  4KGV B;  3JB9 I;  2LJ0 A;  3OY9 A;  2FVU A;  2D8H A;  5CIU A;  4J9E A;  4C0G A;  1VQO T;  1RL2 A;  5KYY B;  1Q82 C;  4BE1 A;  3EGX A;  3CCE T;  1RAI B;  5CQX A;  3EG9 B;  4II1 A;  4M77 G;  2KXC A;  2QAZ A;  4GLK A;  2DRK A;  3UF4 A;  4EMK C;  3PE0 A;  3AHU A;  2KRM A;  1WXT A;  4N4G A;  5GAM e;  3BFM A;  3V8L A;  1M2V B;  5GAN e;  2YT6 A;  2L3P A;  2KBT A;  2DEU A;  1FX7 A;  3CXC A;  1PKS A;  3OW2 S;  4AG2 C;  2EQJ A;  1Q7Y R;  2EYW A;  1ZSZ A;  1M90 R;  4J83 A;  2JTF A;  1NPP A;  5GMK h;  2DLP A;  1SRM A;  4C5E A;  1LPL A;  3QDF A;  2WSC E;  5LL6 S;  3SHW A;  4ZN1 A;  2KT1 A;  1K76 A;  1RAF B;  4XTV A;  1KC8 R;  1IRE B;  4XU3 A;  3HRT A;  2BE9 B;  3L2W A;  3CCL T;  3T9N A;  4FT4 A;  2BUD A;  2JMC A;  4C8Q D;  5GMK i;  5CCA A;  3G6E T;  2JM9 A;  1RUW A;  1R8O B;  4FSS A;  3I5S A;  2GGR A;  1EFN A;  1KQ2 A;  3CCS T;  4MZT A;  4M75 E;  5CK9 A;  1S72 A;  3GNF B;  4LDV A;  3LGF A;  4IKF A;  3IQL A;  3UAT A;  2GF7 A;  3RMQ A;  4KGX B;  4LN2 A;  2LRQ A;  2JTM A;  2RPN A;  4J6W A;  2QA4 A;  1WQW A;  4F7U G;  4PJJ A;  3PGG A;  2VKN A;  2QEX T;  1G3Y A;  2RN8 A;  2ZPI B;  2DXT A;  4J9B A;  4FW2 A;  1WHL A;  5KYX B;  1PC0 A;  3F70 A;  4C0F A;  1VQ6 A;  2YUO A;  2KRO A;  3VS0 A;  3QSU A;  4X34 A;  1VQK T;  4CC4 B;  2RO0 A;  5LJ5 f;  1QVF S;  1YHQ Q;  2I2L A;  2X4Y A;  2QG9 B;  4LDX A;  5GJW B;  1ACM B;  1OX9 A;  4XU1 A;  2EQK A;  4BY6 B;  4BAC A;  1VQM A;  2AKK A;  2M02 A;  3L2R A;  1IHW A;  4A53 A;  4HA8 A;  4BI4 A;  5CAI A;  3DKM A;  1EIF A;  2BIV A;  4C0D C;  3OYI A;  1QVG A;  4JLI A;  4M77 B;  3G7Z A;  2LVM A;  4C92 E;  5IH2 A;  1RI0 A;  4ANJ A;  1WHH A;  3HRU A;  2J7I A;  5FU7 B;  3JCM J;  4LD6 A;  1JU5 C;  5GAN 4;  4C5H A;  3EHQ A;  1LJO A;  2KYM A;  1WFW A;  2XK0 A;  3MET A;  3CPW P;  3JB9 G;  5FWB A;  1NJI R;  4JLG A;  4GLM A;  4BD3 A;  2R57 A;  4J9F A;  3ZFJ A;  1JBM A;  3OYE A;  1SPK A;  3MEA A;  4DEX A;  1UDL A;  3WXM B;  4AFZ C;  5A0G A;  2DVE A;  3CCU A;  2MMP A;  3KBG A;  4GBQ A;  3H8Z A;  1M1F A;  3MHX A;  1PM3 A;  4LDU A;  3RIR A;  3G1J A;  3MEV A;  2X4J A;  2D0Q B;  1WI7 A;  2GQV A;  1GBQ A;  3CC7 Q;  3CCV Q;  2MYS A;  3OB9 A;  1IO6 A;  3A8O B;  4M75 A;  2X9H A;  1UGV A;  4FT2 A;  3DB4 A;  2EGE A;  2NUZ A;  2HL3 A;  1JB0 E;  5IHN A;  4N0A A;  4J7I A;  2QYZ A;  4ESR A;  1ZA1 B;  2WSF E;  1VQ7 A;  5D6W A;  1VYU A;  2CRE A;  5FRN A;  4RMO A;  2DL5 A;  3VJP A;  4RCB A;  1W4S A;  1D0Y A;  1WXU A;  2J6O A;  3NPF A;  2V8I A;  4LD9 K;  3EG3 A;  1OU9 A;  2KDS A;  4LXC A;  2F1L A;  1B34 A;  4J6Y A;  3VYG A;  1VQL T;  2RK2 A;  2DYB A;  4QQ6 A;  1IXD A;  1NBE B;  2C0T A;  3EG1 A;  1TU0 B;  4ORZ A;  3FRN A;  4ZN3 A;  2Y90 A;  2YDL A;  2YLC A;  3CC2 Q;  5GAN f;  4BDZ A;  3FDR A;  2DBK A;  1OPK A;  4TVR A;  2DL3 A;  4M78 B;  4PJM A;  2ESW A;  5A0D A;  3ZBD A;  1Q81 R;  3JCM W;  2CH4 A;  4Z89 A;  3G71 A;  1JJ2 S;  1C1A A;  3GPL A;  1YJ9 A;  2YLB A;  3PVQ A;  1SKU B;  2PVO B;  5CQY A;  2QAS A;  4C92 A;  1R0B G;  2HEQ A;  1ARK A;  1YHQ T;  3MP6 A;  3MP8 A;  4FCY A;  2H3E B;  5LJ3 g;  2CGH A;  2EKH A;  3ZEH A;  5KYN A;  2VGM A;  1LCK A;  2FO0 A;  2LNV A;  1U8R A;  3RKX A;  4ZGE B;  2KNB B;  5C0M A;  4M7D F;  4DBR A;  3OYB A;  2DEQ A;  3DB3 A;  8ATC B;  2WAC A;  2NUP A;  4RTX A;  5A2Q E;  4DQ2 A;  2LX9 A;  2QXF A;  4PJO B;  1Z9Z A;  4C5I A;  2CSI A;  4EMK A;  2QTX A;  4M7D A;  1BCO A;  4M4Z A;  2DX1 A;  1ZUK A;  1TWB A;  3J81 E;  1BBZ A;  3A8L B;  2O31 A;  1M8V A;  2RM4 A;  3NFC A;  1KD1 U;  4M75 D;  4RUG A;  3KFV A;  5D7U A;  4F7U F;  4N4I A;  3HFN A;  1D0X A;  2OTJ A;  2MF2 A;  2BKD N;  3EFO B;  1VQ9 Q;  3I5R A;  2NYS A;  2DPP B;  3CC4 A;  1MGQ A;  3G4S T;  4JZ3 A;  4CC7 A;  2LJ1 A;  1AEY A;  1XQH A;  3SFM A;  1OX8 A;  2QQR A;  4ATO A;  1H92 A;  1ABQ A;  2K7A A;  8AT1 B;  2EJG A;  1H8K A;  2GCX A;  2LX7 A;  1VIF A;  3CC7 T;  4PNO A;  2L0A A;  1XOV A;  4RTT A;  3CBP A;  4E7K A;  3A5Z B;  1YIJ A;  4PFZ A;  4RG8 A;  1ZSZ C;  1KSW A;  2P4R A;  4ELY C;  3M0R A;  4VUB A;  3OYH A;  3C12 A;  3EFS A;  3OW2 P;  2GNC A;  1P92 A;  2RI3 A;  2LT4 A;  3EGD B;  1VQ4 A;  1R77 A;  2IG0 A;  1TS9 A;  3S3O A;  2PTK A;  3OA6 A;  2CT3 A;  1MMN A;  3M56 A;  1X01 A;  3CC2 T;  1M1G A;  3SEM A;  3CPF A;  4PK4 A;  2EQM A;  1PKT A;  2EJF A;  1RLP C;  3EAE A;  5CKD A;  1FMV A;  2JOY A;  4IUR A;  2OTL A;  2AIR B;  2M16 A;  2K2V A;  4MDW A;  2FPE A;  1UTI A;  1WHM A;  1YI2 T;  3CD6 Q;  1Q82 U;  1NZ9 A;  3THK A;  1V29 B;  1OU8 A;  4RTZ A;  4QVZ A;  1KQS P;  2ZAE A;  4F16 A;  3LH5 A;  2RJF A;  3M4Y A;  2K3B A;  4F14 A;  2MCN A;  2RD1 A;  2CYZ B;  3OS1 A;  4FW1 A;  3MJX A;  4D8D A;  1RLQ C;  2X35 A;  3SWN A;  2KT8 A;  3O5Z A;  1AWO A;  2LP5 A;  4J9D A;  1D3B B;  1KIK A;  1M5Q 1;  4X9C A;  2M0O A;  2K9G A;  1M3B A;  4J8O A;  3CCQ Q;  2ROT A;  4BE2 A;  3WVE B;  2PVG B;  1FMW A;  1QVF P;  4QQD A;  1PCX A;  3EFR A;  1ZBX A;  2LDM A;  2W10 A;  2L5Q A;  5DLO A;  3JCM b;  1VQO Q;  1DJ7 B;  2DTO A;  2E1H A;  3H0F A;  3CCE Q;  2E4H A;  4OB1 B;  2E3I A;  1YJN A;  3I35 A;  1E6H A;  3I55 Q;  1ABO A;  1VQ9 T;  3QZ9 B;  3CME A;  3E9F A;  3CCR T;  1VQP A;  2EIF A;  2RJE A;  1N8R R;  3L2Z A;  1AOJ A;  4OVA A;  2COZ A;  2YWW A;  3OSS C;  1A0N B;  3L1A A;  3WVD B;  1XNI A;  2VUB A;  2DTH A;  3VS1 A;  2YRC A;  1VQ5 T;  2HSE B;  3TU4 K;  5CKH A;  4OGE A;  1Q7Y C;  2CP0 A;  2RQT A;  1I8F A;  1OI1 A;  1PD1 A;  3RKW A;  4E6R A;  5KE3 A;  1M90 C;  1Q86 R;  2PZ1 A;  3BW1 A;  1NLO C;  3TEE A;  3X28 B;  1RAG B;  2JUF A;  2D6F A;  4M75 C;  2JJ9 A;  3CCL Q;  3MEW A;  1GCQ C;  5HKC A;  5C6S A;  2F69 A;  3G6E Q;  5LJ5 g;  1YJW A;  1K8A R;  4IUU A;  3X24 B;  4C8Q F;  1X6G A;  3QWX X;  4OB3 B;  4A4K A;  2RH2 A;  3VS4 A;  1SHF A;  4FIB A;  2JM8 A;  1KG1 A;  3CEY A;  3I56 T;  4RTU A;  4IUT A;  3H6Z A;  4J9H A;  4MZP A;  2BE7 D;  2DYI A;  2P0P A;  4OMP A;  5LJ3 d;  1MV0 B;  1BYM A;  2GFA A;  4PLL A;  3OQ5 A;  2V1R A;  1AVZ C;  4C8Q A;  1QWF A;  3LH0 A;  4M75 G;  3M0Q A;  1GBR A;  3QZ5 B;  1M3A A;  3LLR A;  2VV5 A;  4FL6 A;  1UGR B;  3BDU A;  3CD6 T;  4PJN A;  4KH0 B;  2A28 A;  3FEO A;  1VA7 A;  3GOX A;  3CQT A;  1W2B P;  2B86 A;  1BU1 A;  1VQK Q;  4PL6 A;  1H3Z A;  4YTL A;  5LJ3 h;  2YRD A;  4NL3 A;  4AT1 B;  2D9T A;  1NYF A;  2CH4 W;  1VQ8 A;  2LCC A;  4C92 C;  2RMO A;  1S72 T;  3M5A A;  2HMA A;  4LDY A;  2E5K A;  3CMA Q;  3HP9 A;  2DO3 A;  1UE9 A;  1M1K U;  2IVW A;  3C4S A;  5GMK l;  5FWC A;  2QA4 T;  1JJ2 P;  3H41 A;  1E7O A;  3M0U A;  4M7A D;  4KH1 B;  2KSS A;  1IZ6 A;  4OB0 B;  3SD4 A;  1YP5 A;  1VQN Q;  3A8G B;  3ZL7 C;  1WNL A;  4Z8A A;  1Y7X A;  1HSQ A;  4KUL A;  2NUT B;  5GAO r;  4P5N A;  2RQR A;  4LDW A;  3PIP A;  4NL2 A;  2VXF A;  4IUP A;  3I55 T;  5IXB A;  4HCK A;  2YUN A;  4M7D C;  4C92 G;  2DIG A;  2B8A A;  3E2U A;  3MPU B;  5IHK A;  1N9S A;  1W1F A;  1HD3 A;  2LJ3 A;  4Y91 A;  2EGA A;  4LNP A;  4QVD A;  1U1S A;  1Y07 A;  3JCM e;  1UFF A;  3H9N A;  3PTA A;  3JCM g;  5CKB A;  1K0X A;  1SHG A;  2J6K A;  3QO3 A;  4NS5 A;  5GAO q;  1G3T A;  4L6V 5;  5GAM j;  4AFQ C;  2HDA A;  1YBY A;  1K9M U;  4JJB A;  5GAN j;  4O5V A;  1KHC A;  2L2P A;  4E7J A;  4M7D G;  2PVD B;  3V7C A;  2MPX C;  1ZQ1 A;  2A37 A;  2EQI A;  2KYB A;  2CKK A;  5KYU B;  2ZCF B;  3CCJ Q;  2FPF A;  2CP5 A;  1W70 A;  1E6G A;  5AT1 B;  2QQA A;  2PUK B;  2LQW A;  3NTK A;  1SG5 A;  1QCN A;  1WX6 A;  4EDU A;  2EAY A;  1ZUY A;  4C5G A;  4RTW A;  1KQS S;  2C06 A;  4BB7 A;  2CSQ A;  1VQL Q;  3CCM A;  4IIO A;  2XKO C;  2DL8 A;  3QJ6 A;  4OGC A;  2DL7 A;  2PU9 B;  2F2X A;  2KXD A;  4FYX B;  2DET A;  4CC2 A;  2Y4X A;  2XMF A;  2R5A A;  5EC7 A;  3BE3 A;  2CP6 A;  2AHJ B;  1YWP A;  3INZ A;  6AT1 B;  2KI7 A;  2D8J A;  5CR2 A;  2JTE A;  4XQ3 A;  4A4E A;  4CC3 A;  1RI9 A;  1Q81 C;  5I22 A;  1VUB A;  3V8K A;  3HSB A;  1RAE B;  2RNA A;  1AZE A;  1OZ2 A;  2DVJ A;  4JDS A;  2E6Z A;  1I4K 1;  4WCI A;  2EFI A;  4AMC A;  3CMA T;  4JS5 A;  1VQO A;  2F2V A;  1ZSG A;  2RA2 A;  2L3R A;  1WDX A;  1WIE A;  3FLG A;  1KQ1 A;  1X69 A;  5GAN 8;  1U5S A;  2LT1 A;  1BI3 A;  3QBY A;  2HKN A;  5KYY A;  3MEU A;  2EKO A;  5FLX E;  3SWN C;  5FU6 C;  2XIC A;  1VQN T;  1WHJ A;  4R55 A;  1S1N A;  2J06 A;  2OAW A;  2AZS A;  2E65 A;  2HQH A;  4M77 E;  1M2V A;  3RUX A;  3Q1J A;  1VOM A;  1PRM C;  2ATC B;  2IPO B;  2OJ2 A;  1K4U S;  1D1A A;  3OS2 A;  2LCS A;  2CP7 A;  3M0S A;  1BIB A;  2CZ0 B;  3E9G A;  2EYY A;  4M75 F;  1B07 A;  3REB B;  1QW1 A;  2ZPH B;  1M1K C;  1CKA A;  3G4S Q;  3JB9 H;  2O4X A;  1QP3 A;  2O01 E;  2DA9 A;  3JRZ A;  4R56 A;  4EMK B;  2O9S A;  4X9D A;  1FYN A;  1N27 A;  3CCL A;  4M7D B;  5IT9 E;  2DXB A;  2HBP A;  3VS5 A;  4XU2 A;  2JNG A;  1F1B B;  2K5I A;  1V76 A;  5LJ5 d;  1IGU A;  1D1B A;  1GCQ A;  3CCS A;  3A98 A;  4JJC A;  2K6D A;  2RK1 A;  1YCS B;  2LQK A;  3CCJ T;  4GY5 A;  4OML A;  3EG0 A;  4RKU E;  4EMG A;  4BI8 B;  4JRI A;  5LJ5 h;  3CC4 T;  2QEX A;  4IIM A;  4F7U B;  2A7Y A;  2EGC A;  3PIO A;  1NG2 A;  1W2B S;  3CPW A;  5I21 A;  2E64 A;  3QDR B;  1MNE A;  3PVL A;  1NEB A;  4OMF B;  5GAM f;  4C92 F;  4HCC A;  4N4H A;  4JZ4 A;  3CBM A;  2FZC B;  1MND A;  4B9W A;  2DIL A;  1K9M C;  3PNW C;  1PRL C;  3VS6 A;  3CXC S;  4Z02 A;  3QYG B;  3AT1 B;  1YIJ T;  5GAO p; 
#chains in the Genus database with same CATH homology
 2JOY A;  2ZPF B;  5CO7 A;  1VQ7 T;  4IUR A;  2OTL A;  4HT9 A;  1B34 B;  2K5L A;  2M16 A;  2K2V A;  4MDW A;  2LTO A;  3CCQ A;  1BYM A;  3DLM A;  3OS0 A;  3URG A;  5J39 A;  4C8Q C;  3OBW A;  5HK3 A;  1YI2 T;  5LJ3 e;  3L2U A;  3J80 E;  4M78 E;  2MI6 A;  1Q82 U;  3UWN A;  5DM7 R;  1NZ9 A;  3LWI A;  2E5Q A;  4ZGD B;  1V29 B;  3OYJ A;  4EMH A;  3CCM T;  2X4W A;  3M9Q A;  2P4T A;  4QVZ A;  5M9O A;  2RJF A;  2V8J A;  3M4Y A;  2QI2 A;  2XI9 A;  3PMI A;  3CCE A;  4J7F A;  2RD1 A;  3MP1 A;  3SDZ A;  3LWH A;  1HK9 A;  4M77 C;  2CYZ B;  3OS1 A;  2A3L A;  3I55 A;  4RCC A;  2CS7 A;  3CCR A;  1N8R U;  3ASK A;  4M78 G;  2X35 A;  2EQU A;  3SWN A;  3L2Q A;  2E12 A;  3DLL A;  2DD4 A;  1K73 U;  3FIF A;  5KCH A;  4PJO C;  3VU3 C;  4C92 B;  3OYC A;  1D3B B;  4ZTJ A;  1M5Q 1;  4X9C A;  3C95 A;  4OF1 A;  3JCM c;  2M0O A;  3G71 T;  4J8O A;  3QUI A;  2K5F A;  4JRQ A;  1YJ9 T;  1WJQ A;  4MMK A;  2CZ7 B;  3A8H B;  3CCQ T;  2LQ8 A;  2F5K A;  5J3B A;  3WVE B;  2PVG B;  2VC8 A;  2XDP A;  4BE2 A;  4C8Q G;  3JB9 I;  5EG2 A;  3OY9 A;  5J26 A;  1Q7Y U;  4C0D B;  4QQD A;  1M90 U;  3EFR A;  1ZBX A;  2FVU A;  2LDM A;  2L5Q A;  4XTU A;  5DLO A;  5CIU A;  3JCM b;  4PJO E;  3JCM d;  1DJ7 B;  1Q86 U;  3HHT B;  2DTO A;  2E1H A;  4C0G A;  2LC4 A;  1VQO T;  1YIT T;  1RL2 A;  3KXT A;  4OB1 B;  3SWN B;  4BE1 A;  1Q82 C;  2FHD A;  5FU6 B;  3CCE T;  5CQX A;  2DAQ A;  4E7I A;  4MML A;  4II1 A;  2YRV A;  4M77 G;  2MAM A;  4GLK A;  4WF2 A;  4BDY A;  4DOW A;  1YJN A;  1VQ9 T;  3QZ9 B;  4EMK C;  3ER0 A;  3CME A;  3OSV A;  3AHU A;  2HQE A;  3E9F A;  3CCR T;  5DY9 A;  1G3S A;  4E7L A;  1VQP A;  4N4G A;  1WGS A;  5GAM e;  3BFM A;  2QQB A;  2EIF A;  3V8L A;  2RJE A;  3VV0 A;  3L2Z A;  1TH7 A;  3OBY A;  4PJO G;  4B9X A;  3HKS A;  5GAN e;  2DZ9 A;  1N8R C;  4JRP A;  1K8A U;  4OVA A;  3JCM h;  4M7A C;  1K73 C;  3G6E A;  3OSS C;  3QJY A;  5GAN 6;  1FX7 A;  3JSC A;  3L1A A;  5HY6 A;  3CXC A;  3WVD B;  1XNI A;  1WPY A;  2VUB A;  2DTH A;  1SSF A;  3X25 B;  3OW2 S;  2HD0 A;  2KAF A;  3ME9 A;  2EQJ A;  4D6W A;  4M7D E;  3M59 A;  3VUZ A;  4V2S A;  1VQ5 T;  3TU4 K;  2KK4 A;  4KT0 E;  4L59 A;  5CKH A;  3GIB A;  3CBO A;  3LGL A;  4OGE A;  3S6W A;  3OYN A;  1Q7Y C;  1QVG S;  1I8F A;  1OI1 A;  5KE3 A;  3RKW A;  4J6X A;  4J83 A;  1M90 C;  2JTF A;  1NPP A;  5GMK h;  4M7A E;  2OTJ T;  4C5E A;  1FXX A;  1Q86 C;  5FRO A;  5LL6 S;  2WSC E;  3BW1 A;  3TEE A;  3X28 B;  4ZN1 A;  3CME T;  2JUF A;  2D6F A;  4M75 C;  4XTV A;  1IRE B;  4XU3 A;  3L2R A;  3HRT A;  3MEW A;  3VYH B;  3L2W A;  3CCL T;  2KY9 A;  3T9N A;  5C6S A;  5HKC A;  4FT4 A;  2BUD A;  4XTY A;  2F69 A;  5KCO A;  4C8Q D;  5LJ5 g;  1YJW A;  4M7A G;  2KQW A;  5GMK i;  5GMK j;  5CCA A;  3G6E T;  4HCB A;  4IUU A;  3V8J A;  3X24 B;  1VQK A;  1K8A C;  4C8Q F;  1R8O B;  3LW5 E;  4F7U E;  4M78 A;  4OB3 B;  1KQ2 A;  4ZGJ B;  4A4K A;  2RH2 A;  3CCS T;  1YHQ A;  3QYH B;  4FIB A;  4MZT A;  4M75 E;  5CK9 A;  1S72 A;  3OS5 A;  2P0Q A;  4IUQ A;  5KH6 A;  1KG1 A;  3CEY A;  4M77 D;  3I56 T;  5GAN 5;  3QKJ A;  1XTD A;  3GNF B;  4LDV A;  4KBM B;  4IUT A;  3CMA A;  3H6Z A;  4M77 F;  3QG1 A;  4MZP A;  3JCM f;  3LGF A;  2P0P A;  2CZ6 B;  4IKF A;  2GF7 A;  3GP8 A;  3RMQ A;  5LJ3 d;  2OAU A;  4FM4 B;  2G3R A;  2LRQ A;  1BKB A;  1O9S A;  2JTM A;  2ZZD A;  3C94 A;  4J6W A;  1WQW A;  2E10 A;  2GFA A;  4PLL A;  4F7U G;  3OQ5 A;  3UPU A;  4C8Q A;  2CZ1 B;  3LH0 A;  3PGG A;  2QEX T;  4M75 G;  1G3Y A;  3QZ5 B;  3LLR A;  4FSX A;  2VV5 A;  4FL6 A;  2ZPI B;  1UGR B;  2FYK A;  1PSE A;  3BDU A;  3CD6 T;  2DXT A;  2ZPG B;  2RHU A;  2ZGW A;  1ZHI A;  3FJP A;  3FEO A;  1VQ4 T;  1VQN A;  3F70 A;  4C0F A;  3GOX A;  3FC3 A;  1YJW T;  4JJN K;  1VQ6 A;  4M77 A;  4PL6 A;  3QSU A;  1H3Z A;  3QPH A;  4X34 A;  4YTL A;  5LJ3 h;  2E70 A;  2X4X A;  4NL3 A;  1VQK T;  1KC8 U;  5GAO m;  2RO0 A;  3RKY A;  5LJ5 f;  3P8B B;  2D9T A;  3JCM Q;  1QVF S;  2I2L A;  2VYT A;  2X4Y A;  1VQ8 A;  2LCC A;  4LDX A;  4C92 C;  4PJO A;  1S72 T;  3M5A A;  4LDY A;  4XU1 A;  2EQK A;  4BY6 B;  1GXI E;  4BAC A;  4C8Q B;  1VQM A;  2JN0 A;  2DO3 A;  2RHI A;  3HP9 A;  3OW2 A;  1M1K U;  2IVW A;  3C4S A;  4PLI A;  1LOJ A;  4UC4 A;  4A53 A;  5GMK l;  1QVP A;  3GNG A;  2WSE E;  1LNX A;  3M55 A;  4HA8 A;  5LJ3 j;  2DIQ A;  4BI4 A;  3JAM E;  4DA4 A;  2OTL T;  3GLX A;  2DTI A;  5CAI A;  3DKM A;  1EIF A;  2K4Y A;  2QA4 T;  5GAN 7;  3LX7 A;  2BIV A;  4C0D C;  5CKE A;  3OYI A;  3G4S A;  1QVG A;  4M7A D;  2KSS A;  4JLI A;  4M77 B;  1IZ6 A;  4OB0 B;  3G7Z A;  2LVM A;  3SD4 A;  4C92 E;  2DKG A;  3RMS A;  2ZPE B;  1RI0 A;  2RI2 A;  3A8G B;  3PT9 A;  1X6O A;  3HRU A;  1WNL A;  5GAN 3;  5FU7 B;  2XDD A;  2PQW A;  4ZTF A;  1Y7X A;  5GAM d;  3JCM J;  4LD6 A;  2MWP A;  3JCM X;  5GAN 4;  4KUL A;  5GAO r;  4C5H A;  4P5N A;  3CC7 A;  4LDW A;  1LJO A;  5D6Y A;  2VGN A;  4A4H A;  2XHC A;  4NL2 A;  2VXF A;  4IUP A;  4A4G A;  5GAN d;  3N5B B;  5GAO n;  3PIP A;  3I55 T;  2XK0 A;  3JCM V;  2RB6 A;  4M7D C;  3MET A;  4C92 G;  3JB9 G;  5DLQ E;  2DIG A;  2DJZ A;  5HK0 A;  2B8A A;  4JLG A;  4BD3 A;  1WJS A;  1OZ3 A;  2R57 A;  4ME7 A;  3ZFJ A;  1G5V A;  4M7A A;  1JBM A;  2LCL A;  3OYK A;  1N9S A;  3OYE A;  3MEA A;  2VXE A;  3CCJ A;  1G3W A;  4Y91 A;  3WXM B;  5GAM h;  1KQS A;  1KHI A;  2FL7 A;  5A0G A;  2DVE A;  4QVD A;  3JCM P;  1UGP B;  1U1S A;  1Y07 A;  3JCM e;  3CCU A;  2MMP A;  3KBG A;  5GAN h;  3H8Z A;  3PTA A;  3JCM g;  4A4F A;  1M1F A;  5CKB A;  3MHX A;  3QXE B;  2MWO A;  4LDU A;  1M4Z A;  4Y28 E;  3RIR A;  3TCJ A;  3OYD A;  1NE8 A;  3MEV A;  5L8R E;  1OYX A;  2X4J A;  1VQL A;  2D0Q B;  3QO3 A;  4M78 D;  4NS5 A;  5GAO q;  1G3T A;  1QP2 A;  4QVC A;  4L6V 5;  5GAM j;  2GQV A;  4F7U A;  4M78 F;  3OB9 A;  1YJN T;  4QQG A;  1YBY A;  2GFU A;  4M7A B;  1K9M U;  3L2V A;  3OMC A;  3A8O B;  4O5V A;  4M75 A;  1N9R A;  3OMG A;  5I2M A;  3CCV T;  5GAN j;  3S3N A;  1KHC A;  4M7D G;  2XG8 D;  4E7J A;  3CC2 A;  4J5Y A;  5IN1 A;  1VQP T;  2PVD B;  5GMK e;  4FT2 A;  3V7C A;  2RHZ A;  3DB4 A;  3GF5 A;  1ZQ1 A;  4CRI A;  4O6J A;  1Q81 U;  1KC8 C;  2CKK A;  2JVV A;  5LJ5 e;  1JB0 E;  4N0A A;  4J7I A;  1QVF A;  2ZCF B;  3HPW A;  2NLU A;  2WSF E;  1X75 C;  4XTX A;  4HCZ A;  5D6W A;  4E7H A;  1VQ7 A;  3TRE A;  4L5G A;  5FRN A;  4RMO A;  2L89 A;  2PUO B;  3VJP A;  3OYG A;  4RCB A;  2QQA A;  3OYM A;  2PUK B;  1W4S A;  4A54 A;  3MO8 A;  1YIJ T;  3NTK A;  3OYA A;  1JRI A;  2V8I A;  4EDU A;  2EAY A;  2K3X A;  4C5G A;  4LD9 K;  1KQS S;  2KDS A;  2C06 A;  4BB7 A;  1B34 A;  3CCM A;  4J6Y A;  3VYG A;  1VQL T;  2F5T X;  2XKO C;  2RK2 A;  4QQ6 A;  3QJ6 A;  4C92 D;  3OYL A;  3JB9 D;  4RG2 A;  4PJO D;  4OGC A;  1FWZ A;  3FB9 A;  3V7R A;  4BE0 A;  2PU9 B;  4ZN3 A;  3FRN A;  3JB9 F;  2Y90 A;  3VUB A;  2YLC A;  2HNI A;  4PJO F;  5GAN f;  4BDZ A;  1O75 A;  2Y4X A;  2R5A A;  3FDR A;  4XAX B;  2E6N A;  2L8D A;  3P8H A;  3A8M B;  3UDC A;  2AHJ B;  4TVR A;  3NTH A;  3INZ A;  4M78 B;  5A0D A;  5CR2 A;  3ZBD A;  4ELZ C;  4XQ3 A;  4A4E A;  3JCM W;  4HT8 A;  1I81 A;  1Q81 C;  4OP0 A;  3G71 A;  1JJ2 S;  3GPL A;  2RHY A;  2JZ2 A;  3P8D A;  1UB4 A;  1VUB A;  1H64 1;  1YJ9 A;  2RJD A;  2YLB A;  3KUF A;  1NJI U;  5CVI A;  4XK8 E;  2PVO B;  5CQY A;  3V8K A;  3HSB A;  4C92 A;  5GAN 2;  1D3B A;  1OZ2 A;  1VIE A;  1YHQ T;  3MP6 A;  4BY6 C;  4JDS A;  3MP8 A;  2E6Z A;  3X20 B;  1I4K 1;  2EFI A;  4QW2 A;  2CGH A;  5IAY A;  3ZEH A;  5LJ3 g;  3HL8 A;  2VGM A;  2LNV A;  3CMA T;  2EJ9 A;  2DK3 A;  4JS5 A;  4M7D D;  1U8R A;  1VQO A;  3RKX A;  4ZGE B;  1YIT A;  2ZPB B;  2H3J A;  5C0M A;  4DOV A;  4KUD K;  2RA2 A;  2L3R A;  3QHS A;  5GMK m;  5GAO l;  4M7D F;  2K3Y A;  3OYB A;  4JS4 A;  3FLG A;  1KQ1 A;  5GAN 8;  4HKE A;  3CPW S;  3NTI A;  2DEQ A;  3DB3 A;  5D6X A;  1VQ9 A;  2LT1 A;  1BI3 A;  1Y71 A;  3E19 A;  2WAC A;  3QBY A;  2EWN A;  1M9S A;  4M7A F;  2QDY B;  4C8Q E;  1I5L A;  2FB7 A;  2EKO A;  3MEU A;  5A2Q E;  5FLX E;  1UGS B;  3SWN C;  5FU7 C;  2LX9 A;  5AYF A;  4DQ2 A;  5FU6 C;  2M1H A;  4MZM A;  2XIC A;  1VQN T;  4XTW A;  2QXF A;  4R55 A;  2K57 A;  4PJO B;  1VQ6 T;  3L42 A;  3HFO A;  2XDB A;  2DD5 A;  4PKC C;  3VKI A;  4C5I A;  2V8K A;  4EMK A;  2QTX A;  4M7D A;  4BUG A;  2E65 A;  1UGQ B;  4M77 E;  2XU8 A;  3RUX A;  3J81 E;  1VQ8 T;  3Q1J A;  3RER A;  3RES A;  3A8L B;  2KMT A;  3PFS A;  1M8V A;  2RM4 A;  1N6A A;  3LYI A;  2Y4Y A;  1NJI C;  4MDX A;  4JRK A;  1VQ5 A;  5FRM A;  1VQM T;  2RHX A;  2RJC A;  3NFC A;  3OS2 A;  1KD1 U;  4OB2 B;  4M75 D;  4F7U F;  1BIB A;  1UEB A;  1AHJ B;  4N4I A;  1NPR A;  3HFN A;  2CZ0 B;  3E9G A;  2OTJ A;  3R6O A;  2MF2 A;  1BIA A;  2BKD N;  2EYQ A;  4M75 F;  5LJ3 f;  1QW1 A;  2ZPH B;  1M1K C;  1W2B A;  3M57 A;  3JB9 H;  5KE2 A;  2QQS A;  4EPC A;  2DPP B;  1QP3 A;  1MGQ A;  2O4X A;  4E47 A;  3G4S T;  2O01 E;  3CC4 A;  1U1T A;  4R56 A;  3JRZ A;  3SB2 A;  4EMK B;  4X9D A;  1N27 A;  1XQH A;  3SFM A;  4BI3 A;  4C0Z A;  5GAM g;  3CCL A;  2QQR A;  2DXB A;  2HBP A;  3CCV A;  5IT9 E;  4M7D B;  2RI5 A;  4ATO A;  4IUV A;  5GAN g;  4XU2 A;  2EJG A;  3JB9 J;  1BI0 A;  2JNG A;  2K5I A;  3OYY A;  2GCX A;  1VIF A;  3X26 B;  3CC7 T;  3S3M A;  4PNO A;  3M4G A;  5LJ5 d;  3V7S A;  1XOV A;  3M54 A;  3CCS A;  1PSF A;  2KVQ G;  3M58 A;  3CBP A;  1JJ2 A;  4E7K A;  2P0K A;  3A5Z B;  3I56 A;  1MHN A;  2O4X B;  2R58 A;  5CKF A;  2RK1 A;  1YIJ A;  2E41 A;  2XID A;  1BI1 A;  2LQK A;  4RG8 A;  4XTZ A;  4GY5 A;  3CCJ T;  2M9U A;  4ELY C;  5I2S A;  2QQ9 A;  2R5M A;  4RKU E;  2HAX A;  1KD1 C;  3O8V A;  4EMG A;  4VUB A;  3OYH A;  4BI8 B;  3BY7 A;  4CI0 C;  4JRI A;  3CCU T;  5LJ5 h;  3CC4 T;  2QEX A;  1Y96 A;  1YI2 A;  4F7U B;  2A7Y A;  3C12 A;  3EFS A;  1WJR A;  1P92 A;  3PIO A;  3CD6 A;  4M75 B;  2HQX A;  4XU0 A;  5A0L A;  3BDL A;  1W2B S;  3CPW A;  1WQ7 A;  2RI3 A;  2E64 A;  2LT4 A;  3QDR B;  5I21 A;  1VQ4 A;  4JUV A;  2IG0 A;  4KUI A;  4N0A C;  4Q5W A;  1YCY A;  3S3O A;  5GAM f;  4OMF B;  4NOY A;  4C92 F;  3OA6 A;  3J7A F;  5LJ5 j;  2QA4 A;  4HCC A;  3M53 A;  2XD0 A;  2DXC A;  4N4H A;  3OYF A;  3CBM A;  3M56 A;  1X01 A;  2DXU A;  1M1G A;  2DZC A;  3HRS A;  3MCA B;  4B9W A;  3CC2 T;  4M78 C;  1K9M C;  3CPF A;  3PNW C;  3UT1 A;  1BI2 A;  4FU6 A;  2EQM A;  3PMT A;  4Z02 A;  1HXD A;  3QII A;  3CXC S;  2YHT A;  3E1S A;  2EJF A;  3QYG B;  1Y96 B;  3EAE A;  5GAO p;  5CKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...