2K5FA

Solution nmr structure of feoa protein from chlorobium tepidum. northeast structural genomics consortium target ctr121
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
b'MKLSELKAGDRAEVTSVAAEPAVRRRLMDLGLVRGAKLKVLRFAPLGDPIEVNCNGMLLTMRRNEAEGITVHILAGDEGHPHGWPGFRRRHRFGKRALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein A
publication title Solution NMR structure of FeoA protein from Chlorobium tepidum. Northeast Structural Genomics Consortium target CtR121
rcsb
source organism Chlorobaculum tepidum
molecule tags Metal transport
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k5fA01
4O5VA 2QQ9A 2K5LA 1G3TA 5CVIA 2K4YA 3E19A 1BYMA 1BI3A 1QVPA 2LX9A 3MHXA 2K5IA 3HRUA 1BI0A 1P92A 2K5FA 1QW1A 1G3SA 2QQBA 3HRTA 3GLXA 1G3WA 3HRSA 2QQAA 1U8RA 1BI2A 1FX7A 1BI1A 2GCXA 4O6JA 1FWZA 2H3JA 1G3YA
chains in the Genus database with same CATH superfamily
2MAMA 4A63B 1AWWA 3EG9A 3QBYA 3CC2A 1WPYA 2K3XA 1M8VA 3UA7A 2HL5C 2EGEA 2NUTA 1D1BA 2ZPGB 4PJOC 5GMKm 3C94A 2RH2A 1T0HA 4M75F 1W2BS 1UGQB 4J8OA 4M4ZA 4OMFB 4HVVA 1M1KC 2J6FA 2DM1A 2V8IA 2L3SA 1BI3A 2JS0A 4C8QB 2RQTA 1M1KU 2EQMA 2F5KA 4RG8A 2LT4A 1VYTA 2B8AA 1CKAA 3G4SQ 2J05A 2NYSA 4OMMA 1D0ZA 3OYIA 2DXCA 1YIJT 3IQLA 5ECAA 5GMKj 1N6AA 4DQ2A 2X4JA 2RJDA 2ROLA 3MKDA 4B6MA 1NPRA 2LJ0A 2EW3A 4P5NA 4A53A 3M58A 2FZGB 3CBPA 1Y96A 5M9OA 4ZTJA 4JPBW 1X01A 3OYHA 2OAWA 3JCMX 4EMKB 4VUBA 5LJ3h 5DY9A 2YDLA 5GAMf 4Q5WA 2HCKA 3C0CA 5LJ5e 3E9GA 2C0TA 2GGRA 3ASKA 1N9SA 8ATCB 3JCMV 3CCET 3EG9B 3V8LA 4BY6B 3QUIA 3M57A 3H0IA 2YSQA 2DYIA 1UFFA 4C92C 3OA6A 1VQMQ 3GOXA 2LX9A 2FB7A 1GBRA 1TG0A 2MPXC 1ACMB 2L0AA 4IKFA 1H3ZA 2NUTB 2CT4A 2BUDA 4PJOE 4ATOA 2LJ3A 2VVKA 4DBHA 1ZX6A 2HL3A 4M77F 5IH2A 3JB9G 4PJOF 1YI2A 1WJRA 2E6NA 2DXBA 4BB7A 4WF2A 3TEEA 4ZGJB 2KYBA 3M0TA 3CPWP 3ZL7C 2O01E 5I21A 5CCAA 4C8QD 2AK5A 2JVVA 4JJDA 5KYXA 2DETA 2RMOA 3CCRQ 4J9BA 1M8MA 2LP5A 5LJ5d 2RHYA 3V7CA 3M4GA 2GCXA 1FYNA 2V26A 1ARKA 1NJIR 3OBWA 3LX7A 4E7KA 3M55A 1OPLA 4DBRA 3LH5A 3L2UA 2M0OA 4C8QC 3CBMA 1Y96B 3C12A 3X25B 4RCBA 1ABOA 2M16A 5FU7B 2CSIA 2ZPBB 3TREA 2RI5A 4L6V5 1NEGA 1PRLC 4XU2A 2HBPA 4DBFA 3CCRA 4N4HA 4B9XA 1I4K1 2O4XA 1GBQA 2R5AA 4C92E 1NE8A 1SHFA 2DYBA 1HD3A 2JM9A 2COWA 2KY9A 1Q7YR 2E12A 2QI2A 4AT1B 4RCCA 4RTXA 4EMKC 2FRWA 3VS5A 3VS6A 1VQLT 3TU4K 2G6FX 3EH1A 2DBMA 3LYIA 3J81E 3EFOB 4F7UG 1VQPT 2QYZA 3CMEA 2KK4A 5HK0A 4E7JA 4BY6C 4OB3B 4A4FA 3OYJA 2YLBA 3M5AA 3QDFA 5KYXB 2K5FA 1QW1A 4HCKA 2EKOA 2ZCFB 2C0IA 1SRLA 3CBOA 4BE1A 4BACA 2KGTA 2DL5A 2JT4A 2CH4A 1K8AC 1TU0B 4QQGA 1M27C 2QG9B 3M56A 3SFMA 2L2PA 1K8AU 1C0MA 2HZYA 3LH0A 4C8QF 3I56A 2XK0A 4IUVA 3QO3A 2DFUA 3FB9A 1WHHA 4DBQA 3JCMP 2DKGA 2QA4Q 3MP8A 4FYVB 3CQTA 1G8XA 2D8JA 4J6XA 1XNIA 2YWWA 3NFCA 4DOVA 4MZTA 2O4XB 3LW5E 1NEBA 1JXOA 4XTYA 3TVTA 3LWHA 1VQ4Q 3VS0A 5FW9A 5GAN6 1XQHA 1B7TA 2YUNA 4F04B 4CI0C 4QQDA 5FU7C 2K2VA 1MGQA 4IUPA 3FC3A 2MOXA 3PNWC 1NLOC 1VQ6A 1RAEB 1TWBA 1GCQA 1SSFA 3F70A 2EFIA 2EGCA 2QA4A 4OGEA 4PJNA 1SHGA 3I5SA 4BI3A 1W4SA 3PMTA 2ED0A 3A8LB 5AYFA 4C0GA 5LJ5h 2D1XA 1B07A 4M7AF 1VQ4A 2FHDA 2K57A 1WFWA 2CH4W 3EFRA 4BUGA 3SWNA 3X28B 3UPUA 1VQNQ 3A8OB 3META 1WHGA 3QZ5B 1Q82C 4M7DG 1YIJQ 2FG0A 1MV3A 5LJ3g 4PLLA 3PVLA 1FMWA 4XQ3A 2ZPFB 3CPWA 1P92A 1WXUA 1I5LA 3HRTA 1WNLA 1LNXA 4LDYA 4E7IA 4M75A 4XK8E 1VQ9A 3EHQA 2CT3A 3QYHB 4OP0A 1AT1B 3JCMf 2KXCA 2VYTA 3J7AF 3QJ6A 4ME7A 2FYKA 3QSUA 1YWPA 3VS2A 4FT2A 3I55T 1KC8C 1KQSS 2D6FA 3V7SA 3M59A 3EH2A 1IGQA 1X69A 3QKJA 4KGVB 1KC8U 3BW1A 1VQKT 4EDUA 4J7FA 4J9GA 2FVUA 1G3SA 2MWOA 3VUBA 3C95A 1ZA2B 1PD0A 1ZHIA 2EYWA 1W2BP 3X24B 1C6VX 4Y92A 4A4EA 4RTWA 2P84A 1IHVA 1EZZB 1X6GA 2DBKA 4JRKA 4KH1B 2DNUA 2HQXA 3G4ST 4MMKA 3TSWA 1W6XA 5KYNA 1B34A 1MUZA 4QQ6A 2A0FB 3CCEA 1VQ4T 1RI9A 4DEXA 1JEGA 4HXJA 1S1NA 2DMOA 3NGPA 1M1GA 3OS2A 3VRYA 2ZPHB 5GAN4 3KBGA 2ECZA 3OW2S 1WDXA 4XU1A 2YRDA 3E9FA 5LJ3j 2B86A 4ESRA 4JRQA 4C0DB 3R6OA 2E6ZA 4M77A 1G83A 3VKIA 3GNGA 3JCMQ 2O88A 4KBMB 1BI1A 3CC7T 1N9RA 1N8RC 4ELYC 4M78G 3P8HA 2KQWA 3CC4Q 2DEQA 4UC4A 2RQVA 1VQMT 1N8RU 2I0NA 1Y57A 3AHUA 3EG1A 3O8VA 3L2VA 1ZA1B 5KCHA 4Z89A 4RTTA 1BCMA 1KQ1A 2CZ0B 1YITT 5EG2A 4XTXA 4A4KA 2IPOB 1Q81C 4D8DA 1H3HA 2LDMA 1VQLQ 5CVIA 4E7ZA 2K4YA 2W10A 1K0SA 2D0NA 4DA4A 5J3BA 1K4US 1B34B 4OMLA 2RK1A 1SG5A 3CCVT 2FO0A 3BDLA 4FIBA 2A36A 1I8FA 3HSBA 1R0CB 2BZXA 2J6KA 1LCKA 2EQUA 3VRZA 1GCQC 5IHKA 1IHWA 1G3TA 1LPLA 1HSQA 4LDUA 4M7DB 3VS1A 3QPHA 1VQLA 5GMKl 1BIAA 2RHZA 4M77B 1VQPA 4HKEA 2K9GA 3L42A 3ULRB 3EG0A 1QLYA 3MEAA 1X27A 3NTIA 3Q1JA 5GAOn 2O31A 1FWZA 4ANJA 1V1CA 3PIOA 2K5LA 1MNDA 2O9SA 1E6HA 3THKA 3JCMW 2EJFA 1Y0MA 2HEQA 1K8AR 4C0DC 2XHCA 4FW1A 1D3BB 1WJQA 4XU0A 1X2QA 1Q86C 3HTRA 1UHCA 4M75C 5GMKi 4ELZC 5LJ5g 1Q86U 5CO7A 3INZA 4ORZA 2NUZA 1KK7A 5CR2A 2YRCA 1OOTA 1SKUB 1MHNA 2GFUA 1ZQ1A 4C8QA 4PK4A 3QYGB 2LRQA 1QKWA 2F69A 5J26A 1OPKA 1QP3A 1YCSB 2VASA 1MMDA 4Z8AA 4KUDK 2JXBA 2M02A 3G6ET 3VUZA 2ZZDA 1OZ2A 2KYMA 2J6OA 4OMQA 1BU1A 5LJ3f 1BYMA 4J9IA 1TS9A 3UT1A 1NM7A 4M7DD 2ABLA 3EFSA 2LMJA 5GAMe 3VS3A 2QDLA 4M77D 1VQ5Q 1AVZC 4F7UF 3JRZA 1KQ2A 1QVGS 4JS5A 2HSEB 2HBWA 2VXEA 4M7AA 2JZ2A 3VS7A 1U5SA 3OSVA 2QQSA 3I55Q 5HK3A 4E7LA 4M77C 4ZGDB 2RO0A 1VQKQ 1XJWB 4M75E 4IIMA 2NUPB 2QEXT 3GPLA 1PD1A 3OY9A 5GANd 4MDWA 1PM3A 4JLGA 5LJ5j 5KYWA 1IB8A 1JXMA 1JJ2A 4A54A 1UDLA 1K76A 2GQVA 5GAMd 1VQNT 1VYUA 1A0NB 5KYUA 1KC8R 2HDAA 3I55A 1HJDA 1K9MC 1QVFS 1DJ7B 3KFVA 1N27A 1YN8A 1VQKA 1K9MU 1PSFA 1W70A 2EQKA 3FIFA 2QGGA 4IIOA 4J9CA 2KR3A 4OB2B 5DLQE 5FWBA 1ZUKA 2DRMA 3HFNA 1ZUYA 4J5YA 1EFNA 2DK3A 5I2MA 2DEUA 3RMSA 2P4RA 3G4SA 2DE0X 3GF5A 4AFSC 2MK5A 4KULA 4JLIA 4C5IA 5GAOq 4XU3A 1KQSP 2RI2A 5D6XA 3HHTB 3CC7Q 1KIKA 1FMKA 2ZPEB 4QW2A 4M7AB 5IHNA 5GAN5 2ESWA 2EKHA 1WIEA 4RTVA 1XTDA 4C5EA 3A8GB 3KXTA 1HK9A 3CCUT 2V8JA 2GTJA 3OB9A 4M7DF 4M78D 4F16A 1LOJA 2O2OA 4M77E 3H0FA 1IGUA 2G3RA 3QHSA 2YHTA 2RA2A 1YITQ 3ZBDA 3EFOA 1OI1A 5EC7A 4KRTA 3JV3A 2LT1A 5KYWB 2HKQB 3FRNA 1MMAA 1N8RR 3PFSA 1TH7A 3EGDA 3CPFA 3CC7A 2SEMA 3U23A 3JSCA 5GMKe 5KYUB 2MWPA 1VQMA 1FXXA 1YJNT 5L23A 1UUEA 3CCVQ 2EYYA 5KE3A 3SD4A 2DLPA 3OW2P 2VB6A 2RB6A 2YXYA 5LL6S 1WYXA 4E7HA 4FCYA 3GBQA 1D09B 3WXMB 1RI0A 4L59A 2CDTA 3V8KA 2EJ9A 2DF6A 3CC4T 3VJPA 3CCQT 4XTZA 4N4IA 5GAOp 1UGSB 2AZSA 3CCVA 2LNHB 2FEIA 1K9AA 2OX7A 3M0SA 1X6BA 2HQEA 2OAUA 4M7AD 2ZPIB 3MEVA 2AHJB 1M2VA 1CKBA 5GANh 3CEYA 2F2VA 2RJCA 1UHFA 2P0PA 2Y4XA 3SDZA 1QCFA 2XIDA 5I2SA 2QK0A 3MP1A 4QKUA 3REAB 3ZEHA 1KG1A 2I2LA 4RMOA 4GBQA 4AMCA 5GAMh 2KT1A 3G71T 1QWEA 4M7AC 3MEWA 3HRUA 3EGDB 2MIOA 1QQJA 4HVWA 4LDVA 2C06A 4FSXA 4M78F 2H8HA 4J6YA 5DLOA 1OX8A 1YBYA 2DVEA 1Q86R 2RQRA 2E64A 3QZ9B 1VQOT 2AKKA 3G6EQ 3TSZA 4R56A 1VQ7T 4C8QE 2XD0A 2CZ7B 3OYLA 1YHQT 1YJ9T 2L89A 2CZ6B 3HPWA 1R0BG 1GFCA 5GJWB 4R55A 2RK2A 4HT8A 2RHIA 3V7RA 4JZ3A 5GAN7 3JCMe 2DD5A 4JJCA 5FWCA 2BE9B 1KHIA 3GIBA 1TTHB 3S3MA 5FRMA 1SSHA 2JTEA 3G6EA 1M2VB 3PIPA 4C0ZA 1U06A 4J7IA 1YJWT 4NOYA 4FSSA 1RAHB 2RM4A 4FYWB 4HVUA 4NL2A 2QEXQ 3S3OA 3H6ZA 1ZBXA 3SEMA 3LGLA 4RTUA 4Y91A 1M3AA 3H9NA 4M7AE 1GL5A 2HQHA 2K5IA 1KQSA 2QXFA 1KHCA 2PUOB 2CS7A 4F7UA 1Y71A 2VUBA 4WCIA 4OMNA 2RJFA 2DX1A 3D7SB 3JCMd 2E3IA 3JCMb 2LX7A 1X6OA 4DOWA 2KAFA 5A0GA 1Q82U 1JO8A 4L5GA 1I81A 2CP5A 1VIFA 1IREB 5CAIA 4AFZC 1VQ5T 1M1KR 2OTLT 2VGMA 1EIFA 1M9SA 1X43A 4A4GA 3CMAT 4AG2C 4BE0A 2XDPA 4BE2A 1SF9A 4BI4A 1KD1C 1QVGP 1BBZA 1AWXA 1WXTA 2W0ZA 2DD4A 1H8KA 1RACB 1KD1U 2CGHA 4J83A 2DVJA 5GMKh 2RQUA 1VQNA 4PJOG 2BZ8A 2CP7A 4X34A 4X9CA 3OW2A 1YIJA 3BFMA 2GF7A 3NPFA 4XTWA 5I11A 4LDWA 4JUVA 4OGCA 3QJYA 2BKDN 3A5ZB 5KYYA 4AG1C 1ZLMA 2JM8A 2V8KA 3CCUQ 4MMLA 2X4WA 4J9EA 3FEOA 4O5VA 4DEYA 1U1SA 5FRNA 2J7IA 2RI3A 1QKXA 4PFOA 2PVGB 4KGXB 4JJNK 2CUDA 3JB9D 3ME9A 4F7UB 5FROA 4FL6A 4OB1B 2HD0A 4JRIA 4QVCA 1QVFP 4D8KA 1KFZA 2OJ2A 2AZVA 1RAAB 3X20B 3VYHB 2K3YA 1YJNQ 5L8RE 2X4YA 4EMGA 1Z9ZA 4M7DA 3ZFJA 1M3CA 3RESA 2X4XA 1PKSA 4K11A 3HRSA 4C92G 1OULA 2X9HA 1M2OA 1N5ZA 2DL3A 2RN8A 4O6JA 3REBB 2KRMA 3FLGA 1XOVA 5GANg 3CCQQ 3M0UA 2EWNA 4Z02A 5IN1A 1YJNA 2XICA 4LN2A 1MMGA 1S72T 2JMCA 3M9QA 2OTJT 2QQBA 5KYYB 2DJQA 1D3BA 2VWFA 3P8BB 1H92A 3DKMA 3TCJA 4EIKA 1AOJA 4BDYA 2H3JA 3JCMJ 1Q81U 1PG5B 2RHUA 2XU8A 2CP0A 1OZ3A 3JCMh 3RBBB 4BI8B 2O9VA 1AEYA 1NYFA 3CC4A 3CCQA 4J9DA 1WI7A 3G71Q 1NJIC 1RADB 2Y90A 2MMPA 1RUWA 1OU8A 2DZCA 9ATCB 2KROA 3C4SA 2L3PA 5LJ3e 5J39A 2QAZA 2JOYA 4Z88A 4LUDA 1UGPB 4PNOA 2PVOB 1VQOQ 2KE9A 2JTFA 4II1A 3JB9F 3FJPA 4LXCA 1VQ7Q 3WVEB 2VXFA 3CXCS 4OB0B 1VQ8T 2JJ9A 2LQNA 3G71A 1YHQQ 1NPPA 1YJ9Q 2EGAA 2LCCA 4LE9A 4RG2A 2RHXA 3L1AA 1JQQA 1Q7YC 2DERA 2EVRA 2LQ8A 1D1CA 4F14A 5GANj 2FRYA 2KDSA 5GAOl 1PC0A 4M78A 4F17A 3CMET 2VGNA 4X9DA 5FU6B 3RR6A 5CIUA 2E3HA 1KJWA 2DTHA 1TSFA 2F1LA 1VQOA 1D0YA 2DA9A 2NUPA 4N0AA 1VQ7A 1EX4A 3BDUA 4CC2A 2D8HA 1YHQA 4N4GA 1YJ9A 1YJWQ 1PSEA 2CSQA 2EPDA 2LNVA 3CCLT 1NBEB 2IIMA 4D6WA 1YP5A 4MDXA 3UWNA 1V76A 2KT8A 2R58A 5IHIA 1JU5C 2E4HA 2E5QA 1M5Q1 3I56T 4JDSA 5KE2A 1J3TA 6AT1B 1T3LA 3KUFA 1W2BA 2EYZA 1CSKA 1RAFB 2CP3A 4OMOA 4CC3A 1YJWA 1PWTA 2DZ9A 1VIEA 1PHTA 2CP2A 2AKLA 4F7UE 3I9QA 2R5MA 3G7ZA 2SRCA 2OTLQ 1U8RA 1MV0B 3L2QA 1UTIA 4J6WA 2D0QB 4LUEA 3LWIA 3CMAQ 3PE0A 2P0QA 1MNEA 1QVFA 2LVMA 3RKWA 4CC7A 1ZSZA 3QXEB 1VQ6T 1Q82R 2BIVA 4HCCA 4M7DC 3OBYA 2PTKA 1WLPB 3M0RA 4M78B 2FZKB 1UB4A 2GQIA 1MMNA 1Z9QA 2PU9B 3OYCA 2BZYA 1OEBA 5CKDA 3HP9A 1PKTA 1G3YA 5IT9E 2V1RA 2OTLA 1VQ5A 1OV3A 3MEUA 3CCST 5CQXA 4JZ4A 1KD1R 3EGXB 3EG3A 3CMAA 5CQYA 3VYGA 2KNBB 1OU9A 3M4YA 3OS5A 3T9NA 4V2SA 1NZ9A 2ED1A 5FU6C 5GAOm 2CUBA 2P4TA 1TUDA 1NYGA 3M0QA 4ZN1A 1YNZA 2E70A 4HCZA 1VQ9T 5D6WA 3I5RA 4AFQC 3OYMA 2GFAA 4XAXB 2FPEA 1I07A 2EYXA 2ZAEA 1RLQC 3PMIA 1WX6A 1UJ0A 2M1HA 2DXTA 5HCKA 4FW2A 1G5VA 1GRIA 3CD6T 4R0KA 2K79A 1WHLA 2DTOA 4AFUC 2A08A 4WTOB 3MPUB 5GAN3 1ZSZB 2HSPA 5GANf 1ZUUA 2PUKB 4J9FA 4C92D 1HYOA 4M7DE 3EHRA 1WHMA 2YUQA 4LDXA 1LJOA 2M0YA 1YI2Q 4ZTFA 3M53A 2HAXA 3FDRA 3JCMg 1S72Q 3JB9I 3UA6A 1T0JA 3TQ7P 2OTJQ 4GLMA 5D7UA 4ZNXA 3RKXA 1VOMA 3L2WA 1JJ2S 3A1PA 2K3BA 4CC4B 1GXIE 2YUOA 3G1JA 2JTMA 1QCOA 1OQKA 2R57A 1KSWA 4M78C 3AT1B 3OYGA 5KH6A 3BE3A 4C0FA 1RLPC 2KI7A 2K2MA 5IXBA 4BDZA 4N0AC 4PL6A 4E2FB 2MYSA 2M9UA 3UDCA 1S72A 5GAN2 2OTJA 3EAEA 4RKUE 2DO3A 2A28A 1Q81R 3CCJT 1TXQA 2LC4A 1U1TA 3HKSA 1YITA 3I35A 3QIIA 3DLMA 1WZOA 3OYFA 2GBQA 1G2BA 2OI3A 4XTUA 2RNAA 3SHWA 3S3NA 2DTIA 3MP6A 4CRIA 1VQ8Q 4J9HA 2E65A 3NMZC 1WHJA 1ABQA 2QASA 4B9WA 3E1SA 2DL7A 4QT7A 1OYXA 2HKNA 3RUXA 1Y7XA 5A0DA 2LCLA 4IURA 2DPPB 3CMEQ 3OYYA 3JB9H 1SPKA 3QDRB 2CKKA 4OVAA 3P8DA 3JCMc 4MZMA 4RUGA 5LJ5f 1UGRB 1OX9A 1BCOA 2VC8A 3MCAB 4JRPA 1ZSZC 2KVQG 3ER0A 1AWOA 3PGGA 3M54A 1VQ8A 3JB9J 1YFNA 4KT0E 4C92F 2QDYB 3CCLQ 1U3OA 4M78E 2LZ6B 2AIRB 2DAQA 1G3WA 3NTKA 2KSSA 4LNPA 2LCSA 5D6YA 1TUGB 1PNJA 3CCMT 2COZA 4PFZA 2KMTA 2E5KA 1TUCA 3OYDA 4C5GA 4PKCC 3I56Q 2RJEA 2FL7A 3O5ZA 3MHXA 1I1JA 2EBPA 3CXCP 2ROTA 2MCNA 3PT9A 2MI6A 3URGA 1K73C 4PJLA 2MF2A 3CCLA 2HMAA 4PJMA 1K73U 3PVQA 3L2ZA 3OMCA 2L8DA 5FLXE 1K1ZA 4M75G 1Y07A 3HFOA 4EPCA 3EG2A 2JS2A 1M90C 3OQ5A 1RAGB 5C0MA 1VQ6Q 2XG8D 1M90U 1X75C 5GAN8 1JB0E 4ZGEB 2JMAA 1BK2A 5C6SA 2JNGA 2IVWA 3OMGA 2RF0A 1UECA 3RIRA 1M4ZA 3WVDB 1UEBA 2XMFA 2XDBA 3VS4A 2X3WD 1BIBA 1IO6A 5GAOr 3JAME 3CCSQ 2GTOA 2CZ1B 1BI0A 5CKFA 2JUFA 2DL4A 3GLXA 4XTVA 1RL2A 5CKEA 3HL8A 2FPDA 1AZEA 1I5OB 1VYVA 1R77A 2M51A 3LLRA 5CKHA 1LVKA 1ZBJA 1UJYA 3BY7A 2KRNA 5KCOA 3L2RA 2PNIA 2QEXA 1VQ9Q 1WHKA 1M30A 3FJ5A 3N5BB 2DJZA 2DILA 3A8MB 1H641 2GNCA 2DL8A 2XDDA 1UG1A 3CC2T 1GFDA 2FPFA 2WACA 3CCSA 1AHJB 1GCPA 2VV5A 4E7SA 1D1AA 1NLPC 4M77G 3CD6Q 1W1FA 3E19A 2CP6A 1Q95G 3M0PA 1K9MR 3DB4A 4OF1A 4HT9A 5GJVB 1R8OB 4NS5A 1M3BA 4LD6A 5IAYA 1BKBA 1D0XA 4IUTA 2H3EB 2QQ9A 3OYEA 3EGUA 3VU3C 2RQWA 4IUUA 2NWMA 3MO8A 3CCEQ 3E2UA 1F1BB 4MZPA 3CD6A 3OS1A 1JRIA 4RTZA 7AT1B 4IUQA 4QVDA 1QMCA 2YLCA 3NTHA 4FU6A 1YCYA 3V8JA 2RD1A 3UATA 1VA7A 8AT1B 2YUPA 3X26B 2Z0WA 3OYBA 4ZN3A 2VKNA 3CCUA 2EAYA 2K7AA 1ZSGA 4FYXB 5IXFA 3CPWS 4PJJA 4Y28E 3RNJA 3CCJQ 1QCNA 4PFPA 3SWNB 2QQAA 2JN0A 4JS4A 5DM7R 1K0XA 3H41A 1BI2A 2NLUA 4FYYB 2HNIA 2QQRA 2LQKA 2F2WA 3QWXX 1AWJA 2EJGA 5CKBA 3DLLA 2D9TA 1YI2T 2DIGA 3RERA 3NHNA 1E6GA 3OYKA 2E1HA 3DB3A 2K6DA 4PJOA 4M75B 5GAMg 2EIFA 2L3RA 2JW4A 2KRSA 2V1QA 2ENMA 3QWYA 3CXCA 3CCJA 5A2QE 1JJ2P 1SRMA 3S6WA 2YRVA 4KGZB 3A98A 1WGSA 2ATCB 2FZCB 1IZ6A 2KBTA 2QGFB 1QVPA 1WQWA 2BTTA 2EQIA 1PCXA 2DXUA 2P0KA 2CREA 2QTXA 2WSEE 4QVZA 1NJIU 4C8QG 4E6RA 2LTOA 1O9SA 1E7OA 1AZGB 4NL3A 2J06A 3H8ZA 2BE7D 1M1FA 1V29B 2EQJA 3CCMQ 4FM4B 4GLKA 4C5HA 2LJ1A 2PVDB 1VQPQ 3CCRT 4PLIA 4X1VA 2F2XA 2PZ1A 1JBMA 2RPNA 3A8HB 2L5QA 5HY6A 2PQWA 1WXBA 4OMPA 2A37A 2DIQA 4C92A 1SEMA 3RDVA 4HCBA 3RKYA 4YTLA 1Q7YU 3CCMA 4LD9K 2AT1B 2EYQA 4PJOB 2KXDA 2F5TX 3R6NA 5I22A 4A4HA 3QG1A 1QWFA 3SWNC 4M75D 4M7AG 1X2KA 2WSFE 5GAMj 2WSCE 1YWOA 1B3QA 3GP8A 2E41A 5LJ3d 1K73R 1FMVA 1T3SA 1QVGA 3EGXA 4KUIA 3GNFB 1WA7A 2X3XD 1VUBA 4HA8A 1WJSA 1WQ7A 3SB2A 4BD3A 5CK9A 1M90R 1PRMC 2COYA 2QTVA 5AT1B 4E47A 2X51A 1FX7A 1I0CA 1C1AA 3VV0A 2YT6A 3H0HA 2C0OA 1RAIB 1HXDA 2Y4YA 2ZGWA 2A3LA 2XI9A 2CYZB 2IG0A 3OYAA 3PTAA 3OSSC 4RTYA 3OS0A 2L3QA 1UE9A 1QP2A 4FT4A 1O75A 5HKCA 2XKOC 2KEAA 5A0LA 3CC2Q 1BB9A 5GANe 3RMQA 3MJXA 4JJBA 3OYNA 2E10A 2A7YA 2DRKA 4C92B 3J80E 1RABB 1AD5A 4GY5A 4EMHA 2QA4T 1TOVA 4TVRA 2LQWA 4EMKA 1IXDA 1NG2A 4PJOD 1UGVA 3UF4A 1IRXA 3LGFA 2X35A 4KH0B
chains in the Genus database with same CATH topology
4CRIA 2LDMA 2MAMA 4DOWA 2KAFA 5A0GA 1Q82U 4L5GA 5CVIA 2K4YA 2E65A 3QBYA 3CC2A 1WPYA 2K3XA 1M8VA 1I81A 1VIFA 4B9WA 3E1SA 4DA4A 5J3BA 1B34B 1IREB 1OYXA 2RK1A 3RUXA 5CAIA 1VQ5T 2OTLT 2VGMA 1EIFA 1M9SA 1Y7XA 4A4GA 5A0DA 2LCLA 3CMAT 3CCVT 2ZPGB 4BE0A 2XDPA 4PJOC 3BDLA 4FIBA 4IURA 4BE2A 5GMKm 1I8FA 3HSBA 4BI4A 3C94A 2DPPB 1KD1C 2RH2A 3OYYA 3JB9H 2DD4A 4M75F 3QDRB 1W2BS 2CKKA 1UGQB 4J8OA 4OVAA 2EQUA 3P8DA 3JCMc 1KD1U 4MZMA 5LJ5f 2CGHA 1UGRB 4J83A 5GMKh 4OMFB 1VQNA 4PJOG 1M1KC 2VC8A 1G3TA 2V8IA 3MCAB 4JRPA 2KVQG 3ER0A 4LDUA 1BI3A 4C8QB 3PGGA 3M54A 4X34A 1M1KU 4M7DB 1VQ8A 4X9CA 2EQMA 2F5KA 3QPHA 4RG8A 3OW2A 3JB9J 2LT4A 3BFMA 4KT0E 4C92F 5GMKl 2QDYB 2B8AA 2GF7A 1YIJA 1BIAA 4XTWA 2RHZA 4LDWA 4JUVA 4OGCA 3QJYA 4M78E 2BKDN 3A5ZB 4M77B 1VQPA 3LGFA 2DAQA 1G3WA 3NTKA 2KSSA 3L42A 4HKEA 3OYIA 2V8KA 2DXCA 5D6YA 4MMLA 1YIJT 2X4WA 3MEAA 5GMKj 3NTIA 3Q1JA 5GAOn 1N6AA 3CCMT 1FWZA 4DQ2A 2X4JA 2KMTA 3PIOA 2RJDA 3FEOA 4O5VA 2K5LA 3OYDA 1U1SA 5FRNA 1NPRA 4C5GA 4PKCC 2RI3A 2RJEA 2FL7A 4P5NA 4A53A 3M58A 3JCMW 2EJFA 3CBPA 2PVGB 1Y96A 3MHXA 4JJNK 5M9OA 4ZTJA 3JB9D 3ME9A 1X01A 3OYHA 4F7UB 3JCMX 4C0DC 5FROA 2XHCA 3PT9A 4FL6A 4EMKB 2MI6A 1D3BB 1WJQA 2HD0A 4JRIA 4OB1B 4VUBA 4XU0A 5DY9A 5LJ3h 3URGA 4Q5WA 4M75C 2MF2A 5GAMf 5GMKi 3CCLA 4ELZC 5LJ5g 1K73U 1Q86U 5CO7A 5LJ5e 3X20B 3E9GA 3VYHB 3ASKA 1N9SA 3L2ZA 2K3YA 3INZA 3OMCA 2L8DA 3JCMV 3CCET 5FLXE 5L8RE 2X4YA 3V8LA 3QUIA 4BY6B 4EMGA 5CR2A 3M57A 4M75G 1MHNA 1Y07A 2GFUA 3HFOA 4C92C 1ZQ1A 4C8QA 4EPCA 3OA6A 3GOXA 1VQLA 2LX9A 2FB7A 2LRQA 3QYGB 4M7DA 3ZFJA 2F69A 1M90C 5J26A 4IKFA 1H3ZA 3OQ5A 5C0MA 2XG8D 3RESA 1QP3A 1M90U 1X75C 2BUDA 2X4XA 4PJOE 3HRSA 4ATOA 5GAN8 1JB0E 4C92G 4ZGEB 4M77F 4KUDK 5C6SA 3JB9G 4PJOF 1YI2A 2JNGA 1WJRA 2IVWA 2E6NA 3OMGA 4O6JA 3G6ET 2DXBA 3FLGA 1XOVA 4BB7A 5GANg 4WF2A 2ZZDA 1OZ2A 3TEEA 3VUZA 3RIRA 1M4ZA 3WVDB 4ZGJB 1UEBA 2EWNA 5LJ3f 4Z02A 2XDBA 1BYMA 5IN1A 2O01E 1YJNA 5I21A 1BIBA 3UT1A 5CCAA 5GAOr 3JAME 4C8QD 2JVVA 4M7DD 2XICA 1S72T 2CZ1B 1BI0A 3EFSA 3M9QA 5CKFA 2OTJT 2JUFA 2QQBA 5GAMe 3GLXA 4XTVA 1RL2A 5CKEA 1D3BA 4M77D 4F7UF 3HL8A 5LJ5d 3P8BB 2RHYA 3V7CA 3JRZA 2GCXA 3DKMA 3M4GA 3TCJA 1KQ2A 1QVGS 3LLRA 2H3JA 4JS5A 4BDYA 3JCMJ 5CKHA 3OBWA 3LX7A 1Q81U 3BY7A 2VXEA 2RHUA 2XU8A 3M55A 4E7KA 3L2UA 1OZ3A 4M7AA 2JZ2A 3JCMh 4BI8B 2M0OA 4C8QC 3CBMA 5KCOA 3L2RA 1Y96B 3CC4A 2QEXA 3C12A 3X25B 3CCQA 3OSVA 4RCBA 2QQSA 2M16A 5HK3A 3N5BB 2DJZA 5FU7B 4E7LA 3A8MB 1NJIC 2Y90A 1H641 2ZPBB 2XDDA 2MMPA 4M77C 2WACA 3TREA 4ZGDB 2RI5A 3CCSA 3CC2T 2RO0A 4M75E 2DZCA 2QEXT 4L6V5 4XU2A 3C4SA 3GPLA 1AHJB 2HBPA 2VV5A 3OY9A 3CCRA 5GANd 4N4HA 4MDWA 4B9XA 1I4K1 2O4XA 4JLGA 4M77G 5LJ3e 5LJ5j 3E19A 2R5AA 3DB4A 4OF1A 4C92E 1NE8A 5J39A 1JJ2A 2JOYA 4HT9A 4A54A 1UGPB 4PNOA 2PVOB 1R8OB 4NS5A 2JTFA 2KY9A 2GQVA 4II1A 5GAMd 4LD6A 1VQNT 2E12A 2QI2A 3JB9F 3FJPA 3WVEB 4RCCA 2VXFA 3CXCS 4OB0B 4EMKC 1VQ8T 5IAYA 3G71A 3I55A 1NPPA 1VQLT 1BKBA 3TU4K 1K9MC 2LCCA 1QVFS 4IUTA 1DJ7B 1N27A 3LYIA 4RG2A 2RHXA 2QQ9A 3J81E 3OYEA 1K9MU 1VQKA 1PSFA 3VU3C 2EQKA 3L1AA 3FIFA 4F7UG 1VQPT 1Q7YC 3CMEA 4IUUA 2KK4A 5HK0A 4E7JA 3MO8A 4BY6C 2LQ8A 4OB3B 5DLQE 4OB2B 4V2SA 5GANj 4A4FA 2KDSA 3HFNA 4MZPA 5GAOl 3OS1A 1JRIA 4J5YA 3OYJA 3CD6A 2YLBA 3M5AA 4IUQA 2DK3A 4M78A 5I2MA 3CMET 2K5FA 2VGNA 4QVDA 1QW1A 2YLCA 3NTHA 4FU6A 4X9DA 5FU6B 1YCYA 5CIUA 3V8JA 2DTHA 2RD1A 1VQOA 3RMSA 3G4SA 4N0AA 2EKOA 1VQ7A 2ZCFB 3BDUA 3GF5A 3X26B 3OYBA 3CBOA 4BE1A 4ZN3A 4BACA 4KULA 4JLIA 1YHQA 4N4GA 4C5IA 1YJ9A 5GAOq 4XU3A 3CCUA 2RI2A 5D6XA 1PSEA 2LNVA 3HHTB 2EAYA 2ZPEB 4QW2A 3CCLT 1K8AC 4M7AB 5GAN5 4QQGA 3M56A 4D6WA 3SFMA 1XTDA 3CPWS 4C5EA 1K8AU 3A8GB 3UWNA 4MDXA 3LH0A 1HK9A 3KXTA 3CCUT 2V8JA 4C8QF 3I56A 4M7DF 3OB9A 2XK0A 4Y28E 4M78D 4IUVA 1LOJA 3QO3A 3FB9A 4M77E 3JCMP 3SWNB 2QQAA 2R58A 2JN0A 4JS4A 2E5QA 1M5Q1 2DKGA 5DM7R 2G3RA 3MP8A 3QHSA 2YHTA 1BI2A 3I56T 4JDSA 5KE2A 2NLUA 2RA2A 2HNIA 2QQRA 4J6XA 2LQKA 1XNIA 3NFCA 4DOVA 4MZTA 3KUFA 1K73C 2O4XB 3LW5E 3ZBDA 4XTYA 1W2BA 1OI1A 2EJGA 3LWHA 2LT1A 5CKBA 3FRNA 3DLLA 2D9TA 1YI2T 2DIGA 3RERA 3PFSA 5GAN6 1TH7A 1XQHA 1YJWA 3OYKA 3CPFA 3CC7A 2E1HA 2DZ9A 3DB3A 4CI0C 1VIEA 3JSCA 4QQDA 5GMKe 5FU7C 4PJOA 2K2VA 4F7UE 1MGQA 2MWPA 4M75B 2EIFA 2L3RA 2R5MA 4IUPA 5GAMg 3FC3A 1FXXA 3G7ZA 1VQMA 1YJNT 1U8RA 3PNWC 3L2QA 4J6WA 3LWIA 2D0QB 3CXCA 3CCJA 5A2QE 1VQ6A 1SSFA 2P0QA 3F70A 5KE3A 3SD4A 2EFIA 2LVMA 3RKWA 3S6WA 2YRVA 2QA4A 1QVFA 1WGSA 3QXEB 4OGEA 2RB6A 1W4SA 3PMTA 4BI3A 1VQ6T 1IZ6A 3A8LB 1QVPA 1WQWA 2BIVA 5AYFA 5LL6S 4HCCA 4M7DC 4C0GA 5LJ5h 3OBYA 4E7HA 4M7AF 4M78B 4QVCA 1VQ4A 2FHDA 1UB4A 2K57A 3WXMB 1RI0A 2DXUA 2PU9B 3EFRA 4BUGA 4L59A 2P0KA 2EJ9A 3V8KA 2QTXA 3OYCA 3SWNA 3X28B 3UPUA 3A8OB 2WSEE 4QVZA 3CC4T 1NJIU 3META 3VJPA 4C8QG 3QZ5B 3CCQT 1Q82C 4M7DG 5CKDA 3HP9A 2LTOA 4XTZA 1G3YA 1O9SA 5IT9E 4NL3A 3H8ZA 4N4IA 1M1FA 1VQ5A 2OTLA 3MEUA 5LJ3g 5CQXA 1UGSB 1V29B 5GAOp 3CMAA 3CCST 3CCVA 4PLLA 2EQJA 5CQYA 4FM4B 4GLKA 4C5HA 2PVDB 3VYGA 2HQEA 3CCRT 2OAUA 4M7AD 4PLIA 2ZPIB 3MEVA 2AHJB 4XQ3A 2ZPFB 3M4YA 3CPWA 1P92A 3OS5A 3T9NA 5GANh 1I5LA 3CEYA 1JBMA 1WNLA 1LNXA 1NZ9A 3A8HB 3HRTA 4LDYA 4E7IA 2RJCA 4M75A 4XK8E 5FU6C 2L5QA 1VQ9A 5HY6A 5GAOm 2P4TA 2P0PA 2Y4XA 3SDZA 3QYHB 2PQWA 4OP0A 3JCMf 2XIDA 5I2SA 4ZN1A 2VYTA 3MP1A 3ZEHA 2E70A 1KG1A 2I2LA 4RMOA 3J7AF 3QJ6A 4HCZA 2FYKA 4ME7A 1VQ9T 5D6WA 5GAMh 3QSUA 2DIQA 4FT2A 2GFAA 3OYMA 4C92A 3I55T 4XAXB 3G71T 1KC8C 1KQSS 4HCBA 3RKYA 2D6FA 4M7AC 3V7SA 3M59A 4YTLA 1Q7YU 3MEWA 3HRUA 3QKJA 1KC8U 3BW1A 1VQKT 4EDUA 3PMIA 3CCMA 4LD9K 2EYQA 4J7FA 2M1HA 2DXTA 2FVUA 1G3SA 2MWOA 2F5TX 3VUBA 4PJOB 3C95A 4LDVA 4A4HA 4FSXA 1ZHIA 4M78F 2C06A 3QG1A 1G5VA 3SWNC 4J6YA 4M75D 4M7AG 3X24B 3CD6T 4A4EA 2WSFE 5DLOA 2DTOA 2WSCE 5GAMj 1YBYA 3GP8A 5GAN3 2E41A 5LJ3d 2DVEA 2E64A 4JRKA 5GANf 1QVGA 3QZ9B 1VQOT 4KUIA 2HQXA 4R56A 3G4ST 2PUKB 4MMKA 4C92D 1VQ7T 3GNFB 4C8QE 2XD0A 4M7DE 1B34A 4QQ6A 2CZ7B 3OYLA 1VUBA 1YHQT 4LDXA 1LJOA 1YJ9T 2L89A 4HA8A 2CZ6B 3HPWA 4ZTFA 3M53A 3CCEA 1WJSA 1WQ7A 4R55A 2HAXA 1VQ4T 3SB2A 2RK2A 4BD3A 5CK9A 4HT8A 2RHIA 3FDRA 3V7RA 3JCMg 3JB9I 5GAN7 3JCMe 4E47A 2DD5A 1M1GA 3OS2A 2ZPHB 3RKXA 1KHIA 1FX7A 3L2WA 3VV0A 5GAN4 3KBGA 1JJ2S 3GIBA 1Q86C 1GXIE 3S3MA 5FRMA 1HXDA 2Y4YA 3OW2S 2ZGWA 4XU1A 2A3LA 2XI9A 2CYZB 3E9FA 2JTMA 5LJ3j 2IG0A 3OYAA 3PTAA 3G6EA 3OSSC 2R57A 3OS0A 3PIPA 4C0DB 3R6OA 2E6ZA 4M78C 4C0ZA 4JRQA 3OYGA 4M77A 3VKIA 3GNGA 5KH6A 4C0FA 1QP2A 3JCMQ 4FT4A 1S72A 1O75A 5HKCA 2XKOC 4KBMB 4J7IA 1YJWT 4NOYA 1BI1A 3CC7T 1N9RA 4BDZA 1N8RC 4N0AC 5A0LA 4PL6A 2RM4A 4ELYC 4M78G 3P8HA 2M9UA 2KQWA 4NL2A 3UDCA 2DEQA 3RMQA 5GANe 5GAN2 3H6ZA 1ZBXA 4UC4A 3S3OA 1VQMT 1N8RU 3OYNA 2OTJA 2E10A 3EAEA 4RKUE 2A7YA 3LGLA 2DO3A 4C92B 4Y91A 3J80E 3AHUA 3O8VA 3CCJT 2LC4A 1U1TA 3HKSA 4M7AE 1YITA 3L2VA 2K5IA 1KQSA 2QXFA 3QIIA 4GY5A 1KHCA 4EMHA 2QA4T 3DLMA 5KCHA 2PUOB 2CS7A 4F7UA 3OYFA 1Y71A 2VUBA 2RJFA 4TVRA 4EMKA 1KQ1A 3JCMd 2CZ0B 1YITT 4PJOD 4XTUA 5EG2A 3JCMb 4XTXA 4A4KA 1Q81C 3S3NA 1X6OA 2DTIA 2X35A 3MP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5V A;  2QQ9 A;  2K5L A;  1G3T A;  5CVI A;  2K4Y A;  3E19 A;  1BYM A;  1BI3 A;  1QVP A;  2LX9 A;  3MHX A;  2K5I A;  3HRU A;  1BI0 A;  1P92 A;  2K5F A;  1QW1 A;  1G3S A;  2QQB A;  3HRT A;  3GLX A;  1G3W A;  3HRS A;  2QQA A;  1U8R A;  1BI2 A;  1FX7 A;  1BI1 A;  2GCX A;  4O6J A;  1FWZ A;  2H3J A;  1G3Y A; 
#chains in the Genus database with same CATH topology
 2MAM A;  4A63 B;  1AWW A;  3EG9 A;  3QBY A;  3CC2 A;  1WPY A;  2K3X A;  1M8V A;  3UA7 A;  2HL5 C;  2EGE A;  2NUT A;  1D1B A;  2ZPG B;  4PJO C;  5GMK m;  3C94 A;  2RH2 A;  1T0H A;  4M75 F;  1W2B S;  1UGQ B;  4J8O A;  4M4Z A;  4OMF B;  4HVV A;  1M1K C;  2J6F A;  2DM1 A;  2V8I A;  2L3S A;  1BI3 A;  2JS0 A;  4C8Q B;  2RQT A;  1M1K U;  2EQM A;  2F5K A;  4RG8 A;  2LT4 A;  1VYT A;  2B8A A;  1CKA A;  3G4S Q;  2J05 A;  2NYS A;  4OMM A;  1D0Z A;  3OYI A;  2DXC A;  1YIJ T;  3IQL A;  5ECA A;  5GMK j;  1N6A A;  4DQ2 A;  2X4J A;  2RJD A;  2ROL A;  3MKD A;  4B6M A;  1NPR A;  2LJ0 A;  2EW3 A;  4P5N A;  4A53 A;  3M58 A;  2FZG B;  3CBP A;  1Y96 A;  5M9O A;  4ZTJ A;  4JPB W;  1X01 A;  3OYH A;  2OAW A;  3JCM X;  4EMK B;  4VUB A;  5LJ3 h;  5DY9 A;  2YDL A;  5GAM f;  4Q5W A;  2HCK A;  3C0C A;  5LJ5 e;  3E9G A;  2C0T A;  2GGR A;  3ASK A;  1N9S A;  8ATC B;  3JCM V;  3CCE T;  3EG9 B;  3V8L A;  4BY6 B;  3QUI A;  3M57 A;  3H0I A;  2YSQ A;  2DYI A;  1UFF A;  4C92 C;  3OA6 A;  1VQM Q;  3GOX A;  2LX9 A;  2FB7 A;  1GBR A;  1TG0 A;  2MPX C;  1ACM B;  2L0A A;  4IKF A;  1H3Z A;  2NUT B;  2CT4 A;  2BUD A;  4PJO E;  4ATO A;  2LJ3 A;  2VVK A;  4DBH A;  1ZX6 A;  2HL3 A;  4M77 F;  5IH2 A;  3JB9 G;  4PJO F;  1YI2 A;  1WJR A;  2E6N A;  2DXB A;  4BB7 A;  4WF2 A;  3TEE A;  4ZGJ B;  2KYB A;  3M0T A;  3CPW P;  3ZL7 C;  2O01 E;  5I21 A;  5CCA A;  4C8Q D;  2AK5 A;  2JVV A;  4JJD A;  5KYX A;  2DET A;  2RMO A;  3CCR Q;  4J9B A;  1M8M A;  2LP5 A;  5LJ5 d;  2RHY A;  3V7C A;  3M4G A;  2GCX A;  1FYN A;  2V26 A;  1ARK A;  1NJI R;  3OBW A;  3LX7 A;  4E7K A;  3M55 A;  1OPL A;  4DBR A;  3LH5 A;  3L2U A;  2M0O A;  4C8Q C;  3CBM A;  1Y96 B;  3C12 A;  3X25 B;  4RCB A;  1ABO A;  2M16 A;  5FU7 B;  2CSI A;  2ZPB B;  3TRE A;  2RI5 A;  4L6V 5;  1NEG A;  1PRL C;  4XU2 A;  2HBP A;  4DBF A;  3CCR A;  4N4H A;  4B9X A;  1I4K 1;  2O4X A;  1GBQ A;  2R5A A;  4C92 E;  1NE8 A;  1SHF A;  2DYB A;  1HD3 A;  2JM9 A;  2COW A;  2KY9 A;  1Q7Y R;  2E12 A;  2QI2 A;  4AT1 B;  4RCC A;  4RTX A;  4EMK C;  2FRW A;  3VS5 A;  3VS6 A;  1VQL T;  3TU4 K;  2G6F X;  3EH1 A;  2DBM A;  3LYI A;  3J81 E;  3EFO B;  4F7U G;  1VQP T;  2QYZ A;  3CME A;  2KK4 A;  5HK0 A;  4E7J A;  4BY6 C;  4OB3 B;  4A4F A;  3OYJ A;  2YLB A;  3M5A A;  3QDF A;  5KYX B;  2K5F A;  1QW1 A;  4HCK A;  2EKO A;  2ZCF B;  2C0I A;  1SRL A;  3CBO A;  4BE1 A;  4BAC A;  2KGT A;  2DL5 A;  2JT4 A;  2CH4 A;  1K8A C;  1TU0 B;  4QQG A;  1M27 C;  2QG9 B;  3M56 A;  3SFM A;  2L2P A;  1K8A U;  1C0M A;  2HZY A;  3LH0 A;  4C8Q F;  3I56 A;  2XK0 A;  4IUV A;  3QO3 A;  2DFU A;  3FB9 A;  1WHH A;  4DBQ A;  3JCM P;  2DKG A;  2QA4 Q;  3MP8 A;  4FYV B;  3CQT A;  1G8X A;  2D8J A;  4J6X A;  1XNI A;  2YWW A;  3NFC A;  4DOV A;  4MZT A;  2O4X B;  3LW5 E;  1NEB A;  1JXO A;  4XTY A;  3TVT A;  3LWH A;  1VQ4 Q;  3VS0 A;  5FW9 A;  5GAN 6;  1XQH A;  1B7T A;  2YUN A;  4F04 B;  4CI0 C;  4QQD A;  5FU7 C;  2K2V A;  1MGQ A;  4IUP A;  3FC3 A;  2MOX A;  3PNW C;  1NLO C;  1VQ6 A;  1RAE B;  1TWB A;  1GCQ A;  1SSF A;  3F70 A;  2EFI A;  2EGC A;  2QA4 A;  4OGE A;  4PJN A;  1SHG A;  3I5S A;  4BI3 A;  1W4S A;  3PMT A;  2ED0 A;  3A8L B;  5AYF A;  4C0G A;  5LJ5 h;  2D1X A;  1B07 A;  4M7A F;  1VQ4 A;  2FHD A;  2K57 A;  1WFW A;  2CH4 W;  3EFR A;  4BUG A;  3SWN A;  3X28 B;  3UPU A;  1VQN Q;  3A8O B;  3MET A;  1WHG A;  3QZ5 B;  1Q82 C;  4M7D G;  1YIJ Q;  2FG0 A;  1MV3 A;  5LJ3 g;  4PLL A;  3PVL A;  1FMW A;  4XQ3 A;  2ZPF B;  3CPW A;  1P92 A;  1WXU A;  1I5L A;  3HRT A;  1WNL A;  1LNX A;  4LDY A;  4E7I A;  4M75 A;  4XK8 E;  1VQ9 A;  3EHQ A;  2CT3 A;  3QYH B;  4OP0 A;  1AT1 B;  3JCM f;  2KXC A;  2VYT A;  3J7A F;  3QJ6 A;  4ME7 A;  2FYK A;  3QSU A;  1YWP A;  3VS2 A;  4FT2 A;  3I55 T;  1KC8 C;  1KQS S;  2D6F A;  3V7S A;  3M59 A;  3EH2 A;  1IGQ A;  1X69 A;  3QKJ A;  4KGV B;  1KC8 U;  3BW1 A;  1VQK T;  4EDU A;  4J7F A;  4J9G A;  2FVU A;  1G3S A;  2MWO A;  3VUB A;  3C95 A;  1ZA2 B;  1PD0 A;  1ZHI A;  2EYW A;  1W2B P;  3X24 B;  1C6V X;  4Y92 A;  4A4E A;  4RTW A;  2P84 A;  1IHV A;  1EZZ B;  1X6G A;  2DBK A;  4JRK A;  4KH1 B;  2DNU A;  2HQX A;  3G4S T;  4MMK A;  3TSW A;  1W6X A;  5KYN A;  1B34 A;  1MUZ A;  4QQ6 A;  2A0F B;  3CCE A;  1VQ4 T;  1RI9 A;  4DEX A;  1JEG A;  4HXJ A;  1S1N A;  2DMO A;  3NGP A;  1M1G A;  3OS2 A;  3VRY A;  2ZPH B;  5GAN 4;  3KBG A;  2ECZ A;  3OW2 S;  1WDX A;  4XU1 A;  2YRD A;  3E9F A;  5LJ3 j;  2B86 A;  4ESR A;  4JRQ A;  4C0D B;  3R6O A;  2E6Z A;  4M77 A;  1G83 A;  3VKI A;  3GNG A;  3JCM Q;  2O88 A;  4KBM B;  1BI1 A;  3CC7 T;  1N9R A;  1N8R C;  4ELY C;  4M78 G;  3P8H A;  2KQW A;  3CC4 Q;  2DEQ A;  4UC4 A;  2RQV A;  1VQM T;  1N8R U;  2I0N A;  1Y57 A;  3AHU A;  3EG1 A;  3O8V A;  3L2V A;  1ZA1 B;  5KCH A;  4Z89 A;  4RTT A;  1BCM A;  1KQ1 A;  2CZ0 B;  1YIT T;  5EG2 A;  4XTX A;  4A4K A;  2IPO B;  1Q81 C;  4D8D A;  1H3H A;  2LDM A;  1VQL Q;  5CVI A;  4E7Z A;  2K4Y A;  2W10 A;  1K0S A;  2D0N A;  4DA4 A;  5J3B A;  1K4U S;  1B34 B;  4OML A;  2RK1 A;  1SG5 A;  3CCV T;  2FO0 A;  3BDL A;  4FIB A;  2A36 A;  1I8F A;  3HSB A;  1R0C B;  2BZX A;  2J6K A;  1LCK A;  2EQU A;  3VRZ A;  1GCQ C;  5IHK A;  1IHW A;  1G3T A;  1LPL A;  1HSQ A;  4LDU A;  4M7D B;  3VS1 A;  3QPH A;  1VQL A;  5GMK l;  1BIA A;  2RHZ A;  4M77 B;  1VQP A;  4HKE A;  2K9G A;  3L42 A;  3ULR B;  3EG0 A;  1QLY A;  3MEA A;  1X27 A;  3NTI A;  3Q1J A;  5GAO n;  2O31 A;  1FWZ A;  4ANJ A;  1V1C A;  3PIO A;  2K5L A;  1MND A;  2O9S A;  1E6H A;  3THK A;  3JCM W;  2EJF A;  1Y0M A;  2HEQ A;  1K8A R;  4C0D C;  2XHC A;  4FW1 A;  1D3B B;  1WJQ A;  4XU0 A;  1X2Q A;  1Q86 C;  3HTR A;  1UHC A;  4M75 C;  5GMK i;  4ELZ C;  5LJ5 g;  1Q86 U;  5CO7 A;  3INZ A;  4ORZ A;  2NUZ A;  1KK7 A;  5CR2 A;  2YRC A;  1OOT A;  1SKU B;  1MHN A;  2GFU A;  1ZQ1 A;  4C8Q A;  4PK4 A;  3QYG B;  2LRQ A;  1QKW A;  2F69 A;  5J26 A;  1OPK A;  1QP3 A;  1YCS B;  2VAS A;  1MMD A;  4Z8A A;  4KUD K;  2JXB A;  2M02 A;  3G6E T;  3VUZ A;  2ZZD A;  1OZ2 A;  2KYM A;  2J6O A;  4OMQ A;  1BU1 A;  5LJ3 f;  1BYM A;  4J9I A;  1TS9 A;  3UT1 A;  1NM7 A;  4M7D D;  2ABL A;  3EFS A;  2LMJ A;  5GAM e;  3VS3 A;  2QDL A;  4M77 D;  1VQ5 Q;  1AVZ C;  4F7U F;  3JRZ A;  1KQ2 A;  1QVG S;  4JS5 A;  2HSE B;  2HBW A;  2VXE A;  4M7A A;  2JZ2 A;  3VS7 A;  1U5S A;  3OSV A;  2QQS A;  3I55 Q;  5HK3 A;  4E7L A;  4M77 C;  4ZGD B;  2RO0 A;  1VQK Q;  1XJW B;  4M75 E;  4IIM A;  2NUP B;  2QEX T;  3GPL A;  1PD1 A;  3OY9 A;  5GAN d;  4MDW A;  1PM3 A;  4JLG A;  5LJ5 j;  5KYW A;  1IB8 A;  1JXM A;  1JJ2 A;  4A54 A;  1UDL A;  1K76 A;  2GQV A;  5GAM d;  1VQN T;  1VYU A;  1A0N B;  5KYU A;  1KC8 R;  2HDA A;  3I55 A;  1HJD A;  1K9M C;  1QVF S;  1DJ7 B;  3KFV A;  1N27 A;  1YN8 A;  1VQK A;  1K9M U;  1PSF A;  1W70 A;  2EQK A;  3FIF A;  2QGG A;  4IIO A;  4J9C A;  2KR3 A;  4OB2 B;  5DLQ E;  5FWB A;  1ZUK A;  2DRM A;  3HFN A;  1ZUY A;  4J5Y A;  1EFN A;  2DK3 A;  5I2M A;  2DEU A;  3RMS A;  2P4R A;  3G4S A;  2DE0 X;  3GF5 A;  4AFS C;  2MK5 A;  4KUL A;  4JLI A;  4C5I A;  5GAO q;  4XU3 A;  1KQS P;  2RI2 A;  5D6X A;  3HHT B;  3CC7 Q;  1KIK A;  1FMK A;  2ZPE B;  4QW2 A;  4M7A B;  5IHN A;  5GAN 5;  2ESW A;  2EKH A;  1WIE A;  4RTV A;  1XTD A;  4C5E A;  3A8G B;  3KXT A;  1HK9 A;  3CCU T;  2V8J A;  2GTJ A;  3OB9 A;  4M7D F;  4M78 D;  4F16 A;  1LOJ A;  2O2O A;  4M77 E;  3H0F A;  1IGU A;  2G3R A;  3QHS A;  2YHT A;  2RA2 A;  1YIT Q;  3ZBD A;  3EFO A;  1OI1 A;  5EC7 A;  4KRT A;  3JV3 A;  2LT1 A;  5KYW B;  2HKQ B;  3FRN A;  1MMA A;  1N8R R;  3PFS A;  1TH7 A;  3EGD A;  3CPF A;  3CC7 A;  2SEM A;  3U23 A;  3JSC A;  5GMK e;  5KYU B;  2MWP A;  1VQM A;  1FXX A;  1YJN T;  5L23 A;  1UUE A;  3CCV Q;  2EYY A;  5KE3 A;  3SD4 A;  2DLP A;  3OW2 P;  2VB6 A;  2RB6 A;  2YXY A;  5LL6 S;  1WYX A;  4E7H A;  4FCY A;  3GBQ A;  1D09 B;  3WXM B;  1RI0 A;  4L59 A;  2CDT A;  3V8K A;  2EJ9 A;  2DF6 A;  3CC4 T;  3VJP A;  3CCQ T;  4XTZ A;  4N4I A;  5GAO p;  1UGS B;  2AZS A;  3CCV A;  2LNH B;  2FEI A;  1K9A A;  2OX7 A;  3M0S A;  1X6B A;  2HQE A;  2OAU A;  4M7A D;  2ZPI B;  3MEV A;  2AHJ B;  1M2V A;  1CKB A;  5GAN h;  3CEY A;  2F2V A;  2RJC A;  1UHF A;  2P0P A;  2Y4X A;  3SDZ A;  1QCF A;  2XID A;  5I2S A;  2QK0 A;  3MP1 A;  4QKU A;  3REA B;  3ZEH A;  1KG1 A;  2I2L A;  4RMO A;  4GBQ A;  4AMC A;  5GAM h;  2KT1 A;  3G71 T;  1QWE A;  4M7A C;  3MEW A;  3HRU A;  3EGD B;  2MIO A;  1QQJ A;  4HVW A;  4LDV A;  2C06 A;  4FSX A;  4M78 F;  2H8H A;  4J6Y A;  5DLO A;  1OX8 A;  1YBY A;  2DVE A;  1Q86 R;  2RQR A;  2E64 A;  3QZ9 B;  1VQO T;  2AKK A;  3G6E Q;  3TSZ A;  4R56 A;  1VQ7 T;  4C8Q E;  2XD0 A;  2CZ7 B;  3OYL A;  1YHQ T;  1YJ9 T;  2L89 A;  2CZ6 B;  3HPW A;  1R0B G;  1GFC A;  5GJW B;  4R55 A;  2RK2 A;  4HT8 A;  2RHI A;  3V7R A;  4JZ3 A;  5GAN 7;  3JCM e;  2DD5 A;  4JJC A;  5FWC A;  2BE9 B;  1KHI A;  3GIB A;  1TTH B;  3S3M A;  5FRM A;  1SSH A;  2JTE A;  3G6E A;  1M2V B;  3PIP A;  4C0Z A;  1U06 A;  4J7I A;  1YJW T;  4NOY A;  4FSS A;  1RAH B;  2RM4 A;  4FYW B;  4HVU A;  4NL2 A;  2QEX Q;  3S3O A;  3H6Z A;  1ZBX A;  3SEM A;  3LGL A;  4RTU A;  4Y91 A;  1M3A A;  3H9N A;  4M7A E;  1GL5 A;  2HQH A;  2K5I A;  1KQS A;  2QXF A;  1KHC A;  2PUO B;  2CS7 A;  4F7U A;  1Y71 A;  2VUB A;  4WCI A;  4OMN A;  2RJF A;  2DX1 A;  3D7S B;  3JCM d;  2E3I A;  3JCM b;  2LX7 A;  1X6O A;  4DOW A;  2KAF A;  5A0G A;  1Q82 U;  1JO8 A;  4L5G A;  1I81 A;  2CP5 A;  1VIF A;  1IRE B;  5CAI A;  4AFZ C;  1VQ5 T;  1M1K R;  2OTL T;  2VGM A;  1EIF A;  1M9S A;  1X43 A;  4A4G A;  3CMA T;  4AG2 C;  4BE0 A;  2XDP A;  4BE2 A;  1SF9 A;  4BI4 A;  1KD1 C;  1QVG P;  1BBZ A;  1AWX A;  1WXT A;  2W0Z A;  2DD4 A;  1H8K A;  1RAC B;  1KD1 U;  2CGH A;  4J83 A;  2DVJ A;  5GMK h;  2RQU A;  1VQN A;  4PJO G;  2BZ8 A;  2CP7 A;  4X34 A;  4X9C A;  3OW2 A;  1YIJ A;  3BFM A;  2GF7 A;  3NPF A;  4XTW A;  5I11 A;  4LDW A;  4JUV A;  4OGC A;  3QJY A;  2BKD N;  3A5Z B;  5KYY A;  4AG1 C;  1ZLM A;  2JM8 A;  2V8K A;  3CCU Q;  4MML A;  2X4W A;  4J9E A;  3FEO A;  4O5V A;  4DEY A;  1U1S A;  5FRN A;  2J7I A;  2RI3 A;  1QKX A;  4PFO A;  2PVG B;  4KGX B;  4JJN K;  2CUD A;  3JB9 D;  3ME9 A;  4F7U B;  5FRO A;  4FL6 A;  4OB1 B;  2HD0 A;  4JRI A;  4QVC A;  1QVF P;  4D8K A;  1KFZ A;  2OJ2 A;  2AZV A;  1RAA B;  3X20 B;  3VYH B;  2K3Y A;  1YJN Q;  5L8R E;  2X4Y A;  4EMG A;  1Z9Z A;  4M7D A;  3ZFJ A;  1M3C A;  3RES A;  2X4X A;  1PKS A;  4K11 A;  3HRS A;  4C92 G;  1OUL A;  2X9H A;  1M2O A;  1N5Z A;  2DL3 A;  2RN8 A;  4O6J A;  3REB B;  2KRM A;  3FLG A;  1XOV A;  5GAN g;  3CCQ Q;  3M0U A;  2EWN A;  4Z02 A;  5IN1 A;  1YJN A;  2XIC A;  4LN2 A;  1MMG A;  1S72 T;  2JMC A;  3M9Q A;  2OTJ T;  2QQB A;  5KYY B;  2DJQ A;  1D3B A;  2VWF A;  3P8B B;  1H92 A;  3DKM A;  3TCJ A;  4EIK A;  1AOJ A;  4BDY A;  2H3J A;  3JCM J;  1Q81 U;  1PG5 B;  2RHU A;  2XU8 A;  2CP0 A;  1OZ3 A;  3JCM h;  3RBB B;  4BI8 B;  2O9V A;  1AEY A;  1NYF A;  3CC4 A;  3CCQ A;  4J9D A;  1WI7 A;  3G71 Q;  1NJI C;  1RAD B;  2Y90 A;  2MMP A;  1RUW A;  1OU8 A;  2DZC A;  9ATC B;  2KRO A;  3C4S A;  2L3P A;  5LJ3 e;  5J39 A;  2QAZ A;  2JOY A;  4Z88 A;  4LUD A;  1UGP B;  4PNO A;  2PVO B;  1VQO Q;  2KE9 A;  2JTF A;  4II1 A;  3JB9 F;  3FJP A;  4LXC A;  1VQ7 Q;  3WVE B;  2VXF A;  3CXC S;  4OB0 B;  1VQ8 T;  2JJ9 A;  2LQN A;  3G71 A;  1YHQ Q;  1NPP A;  1YJ9 Q;  2EGA A;  2LCC A;  4LE9 A;  4RG2 A;  2RHX A;  3L1A A;  1JQQ A;  1Q7Y C;  2DER A;  2EVR A;  2LQ8 A;  1D1C A;  4F14 A;  5GAN j;  2FRY A;  2KDS A;  5GAO l;  1PC0 A;  4M78 A;  4F17 A;  3CME T;  2VGN A;  4X9D A;  5FU6 B;  3RR6 A;  5CIU A;  2E3H A;  1KJW A;  2DTH A;  1TSF A;  2F1L A;  1VQO A;  1D0Y A;  2DA9 A;  2NUP A;  4N0A A;  1VQ7 A;  1EX4 A;  3BDU A;  4CC2 A;  2D8H A;  1YHQ A;  4N4G A;  1YJ9 A;  1YJW Q;  1PSE A;  2CSQ A;  2EPD A;  2LNV A;  3CCL T;  1NBE B;  2IIM A;  4D6W A;  1YP5 A;  4MDX A;  3UWN A;  1V76 A;  2KT8 A;  2R58 A;  5IHI A;  1JU5 C;  2E4H A;  2E5Q A;  1M5Q 1;  3I56 T;  4JDS A;  5KE2 A;  1J3T A;  6AT1 B;  1T3L A;  3KUF A;  1W2B A;  2EYZ A;  1CSK A;  1RAF B;  2CP3 A;  4OMO A;  4CC3 A;  1YJW A;  1PWT A;  2DZ9 A;  1VIE A;  1PHT A;  2CP2 A;  2AKL A;  4F7U E;  3I9Q A;  2R5M A;  3G7Z A;  2SRC A;  2OTL Q;  1U8R A;  1MV0 B;  3L2Q A;  1UTI A;  4J6W A;  2D0Q B;  4LUE A;  3LWI A;  3CMA Q;  3PE0 A;  2P0Q A;  1MNE A;  1QVF A;  2LVM A;  3RKW A;  4CC7 A;  1ZSZ A;  3QXE B;  1VQ6 T;  1Q82 R;  2BIV A;  4HCC A;  4M7D C;  3OBY A;  2PTK A;  1WLP B;  3M0R A;  4M78 B;  2FZK B;  1UB4 A;  2GQI A;  1MMN A;  1Z9Q A;  2PU9 B;  3OYC A;  2BZY A;  1OEB A;  5CKD A;  3HP9 A;  1PKT A;  1G3Y A;  5IT9 E;  2V1R A;  2OTL A;  1VQ5 A;  1OV3 A;  3MEU A;  3CCS T;  5CQX A;  4JZ4 A;  1KD1 R;  3EGX B;  3EG3 A;  3CMA A;  5CQY A;  3VYG A;  2KNB B;  1OU9 A;  3M4Y A;  3OS5 A;  3T9N A;  4V2S A;  1NZ9 A;  2ED1 A;  5FU6 C;  5GAO m;  2CUB A;  2P4T A;  1TUD A;  1NYG A;  3M0Q A;  4ZN1 A;  1YNZ A;  2E70 A;  4HCZ A;  1VQ9 T;  5D6W A;  3I5R A;  4AFQ C;  3OYM A;  2GFA A;  4XAX B;  2FPE A;  1I07 A;  2EYX A;  2ZAE A;  1RLQ C;  3PMI A;  1WX6 A;  1UJ0 A;  2M1H A;  2DXT A;  5HCK A;  4FW2 A;  1G5V A;  1GRI A;  3CD6 T;  4R0K A;  2K79 A;  1WHL A;  2DTO A;  4AFU C;  2A08 A;  4WTO B;  3MPU B;  5GAN 3;  1ZSZ B;  2HSP A;  5GAN f;  1ZUU A;  2PUK B;  4J9F A;  4C92 D;  1HYO A;  4M7D E;  3EHR A;  1WHM A;  2YUQ A;  4LDX A;  1LJO A;  2M0Y A;  1YI2 Q;  4ZTF A;  3M53 A;  2HAX A;  3FDR A;  3JCM g;  1S72 Q;  3JB9 I;  3UA6 A;  1T0J A;  3TQ7 P;  2OTJ Q;  4GLM A;  5D7U A;  4ZNX A;  3RKX A;  1VOM A;  3L2W A;  1JJ2 S;  3A1P A;  2K3B A;  4CC4 B;  1GXI E;  2YUO A;  3G1J A;  2JTM A;  1QCO A;  1OQK A;  2R57 A;  1KSW A;  4M78 C;  3AT1 B;  3OYG A;  5KH6 A;  3BE3 A;  4C0F A;  1RLP C;  2KI7 A;  2K2M A;  5IXB A;  4BDZ A;  4N0A C;  4PL6 A;  4E2F B;  2MYS A;  2M9U A;  3UDC A;  1S72 A;  5GAN 2;  2OTJ A;  3EAE A;  4RKU E;  2DO3 A;  2A28 A;  1Q81 R;  3CCJ T;  1TXQ A;  2LC4 A;  1U1T A;  3HKS A;  1YIT A;  3I35 A;  3QII A;  3DLM A;  1WZO A;  3OYF A;  2GBQ A;  1G2B A;  2OI3 A;  4XTU A;  2RNA A;  3SHW A;  3S3N A;  2DTI A;  3MP6 A;  4CRI A;  1VQ8 Q;  4J9H A;  2E65 A;  3NMZ C;  1WHJ A;  1ABQ A;  2QAS A;  4B9W A;  3E1S A;  2DL7 A;  4QT7 A;  1OYX A;  2HKN A;  3RUX A;  1Y7X A;  5A0D A;  2LCL A;  4IUR A;  2DPP B;  3CME Q;  3OYY A;  3JB9 H;  1SPK A;  3QDR B;  2CKK A;  4OVA A;  3P8D A;  3JCM c;  4MZM A;  4RUG A;  5LJ5 f;  1UGR B;  1OX9 A;  1BCO A;  2VC8 A;  3MCA B;  4JRP A;  1ZSZ C;  2KVQ G;  3ER0 A;  1AWO A;  3PGG A;  3M54 A;  1VQ8 A;  3JB9 J;  1YFN A;  4KT0 E;  4C92 F;  2QDY B;  3CCL Q;  1U3O A;  4M78 E;  2LZ6 B;  2AIR B;  2DAQ A;  1G3W A;  3NTK A;  2KSS A;  4LNP A;  2LCS A;  5D6Y A;  1TUG B;  1PNJ A;  3CCM T;  2COZ A;  4PFZ A;  2KMT A;  2E5K A;  1TUC A;  3OYD A;  4C5G A;  4PKC C;  3I56 Q;  2RJE A;  2FL7 A;  3O5Z A;  3MHX A;  1I1J A;  2EBP A;  3CXC P;  2ROT A;  2MCN A;  3PT9 A;  2MI6 A;  3URG A;  1K73 C;  4PJL A;  2MF2 A;  3CCL A;  2HMA A;  4PJM A;  1K73 U;  3PVQ A;  3L2Z A;  3OMC A;  2L8D A;  5FLX E;  1K1Z A;  4M75 G;  1Y07 A;  3HFO A;  4EPC A;  3EG2 A;  2JS2 A;  1M90 C;  3OQ5 A;  1RAG B;  5C0M A;  1VQ6 Q;  2XG8 D;  1M90 U;  1X75 C;  5GAN 8;  1JB0 E;  4ZGE B;  2JMA A;  1BK2 A;  5C6S A;  2JNG A;  2IVW A;  3OMG A;  2RF0 A;  1UEC A;  3RIR A;  1M4Z A;  3WVD B;  1UEB A;  2XMF A;  2XDB A;  3VS4 A;  2X3W D;  1BIB A;  1IO6 A;  5GAO r;  3JAM E;  3CCS Q;  2GTO A;  2CZ1 B;  1BI0 A;  5CKF A;  2JUF A;  2DL4 A;  3GLX A;  4XTV A;  1RL2 A;  5CKE A;  3HL8 A;  2FPD A;  1AZE A;  1I5O B;  1VYV A;  1R77 A;  2M51 A;  3LLR A;  5CKH A;  1LVK A;  1ZBJ A;  1UJY A;  3BY7 A;  2KRN A;  5KCO A;  3L2R A;  2PNI A;  2QEX A;  1VQ9 Q;  1WHK A;  1M30 A;  3FJ5 A;  3N5B B;  2DJZ A;  2DIL A;  3A8M B;  1H64 1;  2GNC A;  2DL8 A;  2XDD A;  1UG1 A;  3CC2 T;  1GFD A;  2FPF A;  2WAC A;  3CCS A;  1AHJ B;  1GCP A;  2VV5 A;  4E7S A;  1D1A A;  1NLP C;  4M77 G;  3CD6 Q;  1W1F A;  3E19 A;  2CP6 A;  1Q95 G;  3M0P A;  1K9M R;  3DB4 A;  4OF1 A;  4HT9 A;  5GJV B;  1R8O B;  4NS5 A;  1M3B A;  4LD6 A;  5IAY A;  1BKB A;  1D0X A;  4IUT A;  2H3E B;  2QQ9 A;  3OYE A;  3EGU A;  3VU3 C;  2RQW A;  4IUU A;  2NWM A;  3MO8 A;  3CCE Q;  3E2U A;  1F1B B;  4MZP A;  3CD6 A;  3OS1 A;  1JRI A;  4RTZ A;  7AT1 B;  4IUQ A;  4QVD A;  1QMC A;  2YLC A;  3NTH A;  4FU6 A;  1YCY A;  3V8J A;  2RD1 A;  3UAT A;  1VA7 A;  8AT1 B;  2YUP A;  3X26 B;  2Z0W A;  3OYB A;  4ZN3 A;  2VKN A;  3CCU A;  2EAY A;  2K7A A;  1ZSG A;  4FYX B;  5IXF A;  3CPW S;  4PJJ A;  4Y28 E;  3RNJ A;  3CCJ Q;  1QCN A;  4PFP A;  3SWN B;  2QQA A;  2JN0 A;  4JS4 A;  5DM7 R;  1K0X A;  3H41 A;  1BI2 A;  2NLU A;  4FYY B;  2HNI A;  2QQR A;  2LQK A;  2F2W A;  3QWX X;  1AWJ A;  2EJG A;  5CKB A;  3DLL A;  2D9T A;  1YI2 T;  2DIG A;  3RER A;  3NHN A;  1E6G A;  3OYK A;  2E1H A;  3DB3 A;  2K6D A;  4PJO A;  4M75 B;  5GAM g;  2EIF A;  2L3R A;  2JW4 A;  2KRS A;  2V1Q A;  2ENM A;  3QWY A;  3CXC A;  3CCJ A;  5A2Q E;  1JJ2 P;  1SRM A;  3S6W A;  2YRV A;  4KGZ B;  3A98 A;  1WGS A;  2ATC B;  2FZC B;  1IZ6 A;  2KBT A;  2QGF B;  1QVP A;  1WQW A;  2BTT A;  2EQI A;  1PCX A;  2DXU A;  2P0K A;  2CRE A;  2QTX A;  2WSE E;  4QVZ A;  1NJI U;  4C8Q G;  4E6R A;  2LTO A;  1O9S A;  1E7O A;  1AZG B;  4NL3 A;  2J06 A;  3H8Z A;  2BE7 D;  1M1F A;  1V29 B;  2EQJ A;  3CCM Q;  4FM4 B;  4GLK A;  4C5H A;  2LJ1 A;  2PVD B;  1VQP Q;  3CCR T;  4PLI A;  4X1V A;  2F2X A;  2PZ1 A;  1JBM A;  2RPN A;  3A8H B;  2L5Q A;  5HY6 A;  2PQW A;  1WXB A;  4OMP A;  2A37 A;  2DIQ A;  4C92 A;  1SEM A;  3RDV A;  4HCB A;  3RKY A;  4YTL A;  1Q7Y U;  3CCM A;  4LD9 K;  2AT1 B;  2EYQ A;  4PJO B;  2KXD A;  2F5T X;  3R6N A;  5I22 A;  4A4H A;  3QG1 A;  1QWF A;  3SWN C;  4M75 D;  4M7A G;  1X2K A;  2WSF E;  5GAM j;  2WSC E;  1YWO A;  1B3Q A;  3GP8 A;  2E41 A;  5LJ3 d;  1K73 R;  1FMV A;  1T3S A;  1QVG A;  3EGX A;  4KUI A;  3GNF B;  1WA7 A;  2X3X D;  1VUB A;  4HA8 A;  1WJS A;  1WQ7 A;  3SB2 A;  4BD3 A;  5CK9 A;  1M90 R;  1PRM C;  2COY A;  2QTV A;  5AT1 B;  4E47 A;  2X51 A;  1FX7 A;  1I0C A;  1C1A A;  3VV0 A;  2YT6 A;  3H0H A;  2C0O A;  1RAI B;  1HXD A;  2Y4Y A;  2ZGW A;  2A3L A;  2XI9 A;  2CYZ B;  2IG0 A;  3OYA A;  3PTA A;  3OSS C;  4RTY A;  3OS0 A;  2L3Q A;  1UE9 A;  1QP2 A;  4FT4 A;  1O75 A;  5HKC A;  2XKO C;  2KEA A;  5A0L A;  3CC2 Q;  1BB9 A;  5GAN e;  3RMQ A;  3MJX A;  4JJB A;  3OYN A;  2E10 A;  2A7Y A;  2DRK A;  4C92 B;  3J80 E;  1RAB B;  1AD5 A;  4GY5 A;  4EMH A;  2QA4 T;  1TOV A;  4TVR A;  2LQW A;  4EMK A;  1IXD A;  1NG2 A;  4PJO D;  1UGV A;  3UF4 A;  1IRX A;  3LGF A;  2X35 A;  4KH0 B; 
#chains in the Genus database with same CATH homology
 4CRI A;  2LDM A;  2MAM A;  4DOW A;  2KAF A;  5A0G A;  1Q82 U;  4L5G A;  5CVI A;  2K4Y A;  2E65 A;  3QBY A;  3CC2 A;  1WPY A;  2K3X A;  1M8V A;  1I81 A;  1VIF A;  4B9W A;  3E1S A;  4DA4 A;  5J3B A;  1B34 B;  1IRE B;  1OYX A;  2RK1 A;  3RUX A;  5CAI A;  1VQ5 T;  2OTL T;  2VGM A;  1EIF A;  1M9S A;  1Y7X A;  4A4G A;  5A0D A;  2LCL A;  3CMA T;  3CCV T;  2ZPG B;  4BE0 A;  2XDP A;  4PJO C;  3BDL A;  4FIB A;  4IUR A;  4BE2 A;  5GMK m;  1I8F A;  3HSB A;  4BI4 A;  3C94 A;  2DPP B;  1KD1 C;  2RH2 A;  3OYY A;  3JB9 H;  2DD4 A;  4M75 F;  3QDR B;  1W2B S;  2CKK A;  1UGQ B;  4J8O A;  4OVA A;  2EQU A;  3P8D A;  3JCM c;  1KD1 U;  4MZM A;  5LJ5 f;  2CGH A;  1UGR B;  4J83 A;  5GMK h;  4OMF B;  1VQN A;  4PJO G;  1M1K C;  2VC8 A;  1G3T A;  2V8I A;  3MCA B;  4JRP A;  2KVQ G;  3ER0 A;  4LDU A;  1BI3 A;  4C8Q B;  3PGG A;  3M54 A;  4X34 A;  1M1K U;  4M7D B;  1VQ8 A;  4X9C A;  2EQM A;  2F5K A;  3QPH A;  4RG8 A;  3OW2 A;  3JB9 J;  2LT4 A;  3BFM A;  4KT0 E;  4C92 F;  5GMK l;  2QDY B;  2B8A A;  2GF7 A;  1YIJ A;  1BIA A;  4XTW A;  2RHZ A;  4LDW A;  4JUV A;  4OGC A;  3QJY A;  4M78 E;  2BKD N;  3A5Z B;  4M77 B;  1VQP A;  3LGF A;  2DAQ A;  1G3W A;  3NTK A;  2KSS A;  3L42 A;  4HKE A;  3OYI A;  2V8K A;  2DXC A;  5D6Y A;  4MML A;  1YIJ T;  2X4W A;  3MEA A;  5GMK j;  3NTI A;  3Q1J A;  5GAO n;  1N6A A;  3CCM T;  1FWZ A;  4DQ2 A;  2X4J A;  2KMT A;  3PIO A;  2RJD A;  3FEO A;  4O5V A;  2K5L A;  3OYD A;  1U1S A;  5FRN A;  1NPR A;  4C5G A;  4PKC C;  2RI3 A;  2RJE A;  2FL7 A;  4P5N A;  4A53 A;  3M58 A;  3JCM W;  2EJF A;  3CBP A;  2PVG B;  1Y96 A;  3MHX A;  4JJN K;  5M9O A;  4ZTJ A;  3JB9 D;  3ME9 A;  1X01 A;  3OYH A;  4F7U B;  3JCM X;  4C0D C;  5FRO A;  2XHC A;  3PT9 A;  4FL6 A;  4EMK B;  2MI6 A;  1D3B B;  1WJQ A;  2HD0 A;  4JRI A;  4OB1 B;  4VUB A;  4XU0 A;  5DY9 A;  5LJ3 h;  3URG A;  4Q5W A;  4M75 C;  2MF2 A;  5GAM f;  5GMK i;  3CCL A;  4ELZ C;  5LJ5 g;  1K73 U;  1Q86 U;  5CO7 A;  5LJ5 e;  3X20 B;  3E9G A;  3VYH B;  3ASK A;  1N9S A;  3L2Z A;  2K3Y A;  3INZ A;  3OMC A;  2L8D A;  3JCM V;  3CCE T;  5FLX E;  5L8R E;  2X4Y A;  3V8L A;  3QUI A;  4BY6 B;  4EMG A;  5CR2 A;  3M57 A;  4M75 G;  1MHN A;  1Y07 A;  2GFU A;  3HFO A;  4C92 C;  1ZQ1 A;  4C8Q A;  4EPC A;  3OA6 A;  3GOX A;  1VQL A;  2LX9 A;  2FB7 A;  2LRQ A;  3QYG B;  4M7D A;  3ZFJ A;  2F69 A;  1M90 C;  5J26 A;  4IKF A;  1H3Z A;  3OQ5 A;  5C0M A;  2XG8 D;  3RES A;  1QP3 A;  1M90 U;  1X75 C;  2BUD A;  2X4X A;  4PJO E;  3HRS A;  4ATO A;  5GAN 8;  1JB0 E;  4C92 G;  4ZGE B;  4M77 F;  4KUD K;  5C6S A;  3JB9 G;  4PJO F;  1YI2 A;  2JNG A;  1WJR A;  2IVW A;  2E6N A;  3OMG A;  4O6J A;  3G6E T;  2DXB A;  3FLG A;  1XOV A;  4BB7 A;  5GAN g;  4WF2 A;  2ZZD A;  1OZ2 A;  3TEE A;  3VUZ A;  3RIR A;  1M4Z A;  3WVD B;  4ZGJ B;  1UEB A;  2EWN A;  5LJ3 f;  4Z02 A;  2XDB A;  1BYM A;  5IN1 A;  2O01 E;  1YJN A;  5I21 A;  1BIB A;  3UT1 A;  5CCA A;  5GAO r;  3JAM E;  4C8Q D;  2JVV A;  4M7D D;  2XIC A;  1S72 T;  2CZ1 B;  1BI0 A;  3EFS A;  3M9Q A;  5CKF A;  2OTJ T;  2JUF A;  2QQB A;  5GAM e;  3GLX A;  4XTV A;  1RL2 A;  5CKE A;  1D3B A;  4M77 D;  4F7U F;  3HL8 A;  5LJ5 d;  3P8B B;  2RHY A;  3V7C A;  3JRZ A;  2GCX A;  3DKM A;  3M4G A;  3TCJ A;  1KQ2 A;  1QVG S;  3LLR A;  2H3J A;  4JS5 A;  4BDY A;  3JCM J;  5CKH A;  3OBW A;  3LX7 A;  1Q81 U;  3BY7 A;  2VXE A;  2RHU A;  2XU8 A;  3M55 A;  4E7K A;  3L2U A;  1OZ3 A;  4M7A A;  2JZ2 A;  3JCM h;  4BI8 B;  2M0O A;  4C8Q C;  3CBM A;  5KCO A;  3L2R A;  1Y96 B;  3CC4 A;  2QEX A;  3C12 A;  3X25 B;  3CCQ A;  3OSV A;  4RCB A;  2QQS A;  2M16 A;  5HK3 A;  3N5B B;  2DJZ A;  5FU7 B;  4E7L A;  3A8M B;  1NJI C;  2Y90 A;  1H64 1;  2ZPB B;  2XDD A;  2MMP A;  4M77 C;  2WAC A;  3TRE A;  4ZGD B;  2RI5 A;  3CCS A;  3CC2 T;  2RO0 A;  4M75 E;  2DZC A;  2QEX T;  4L6V 5;  4XU2 A;  3C4S A;  3GPL A;  1AHJ B;  2HBP A;  2VV5 A;  3OY9 A;  3CCR A;  5GAN d;  4N4H A;  4MDW A;  4B9X A;  1I4K 1;  2O4X A;  4JLG A;  4M77 G;  5LJ3 e;  5LJ5 j;  3E19 A;  2R5A A;  3DB4 A;  4OF1 A;  4C92 E;  1NE8 A;  5J39 A;  1JJ2 A;  2JOY A;  4HT9 A;  4A54 A;  1UGP B;  4PNO A;  2PVO B;  1R8O B;  4NS5 A;  2JTF A;  2KY9 A;  2GQV A;  4II1 A;  5GAM d;  4LD6 A;  1VQN T;  2E12 A;  2QI2 A;  3JB9 F;  3FJP A;  3WVE B;  4RCC A;  2VXF A;  3CXC S;  4OB0 B;  4EMK C;  1VQ8 T;  5IAY A;  3G71 A;  3I55 A;  1NPP A;  1VQL T;  1BKB A;  3TU4 K;  1K9M C;  2LCC A;  1QVF S;  4IUT A;  1DJ7 B;  1N27 A;  3LYI A;  4RG2 A;  2RHX A;  2QQ9 A;  3J81 E;  3OYE A;  1K9M U;  1VQK A;  1PSF A;  3VU3 C;  2EQK A;  3L1A A;  3FIF A;  4F7U G;  1VQP T;  1Q7Y C;  3CME A;  4IUU A;  2KK4 A;  5HK0 A;  4E7J A;  3MO8 A;  4BY6 C;  2LQ8 A;  4OB3 B;  5DLQ E;  4OB2 B;  4V2S A;  5GAN j;  4A4F A;  2KDS A;  3HFN A;  4MZP A;  5GAO l;  3OS1 A;  1JRI A;  4J5Y A;  3OYJ A;  3CD6 A;  2YLB A;  3M5A A;  4IUQ A;  2DK3 A;  4M78 A;  5I2M A;  3CME T;  2K5F A;  2VGN A;  4QVD A;  1QW1 A;  2YLC A;  3NTH A;  4FU6 A;  4X9D A;  5FU6 B;  1YCY A;  5CIU A;  3V8J A;  2DTH A;  2RD1 A;  1VQO A;  3RMS A;  3G4S A;  4N0A A;  2EKO A;  1VQ7 A;  2ZCF B;  3BDU A;  3GF5 A;  3X26 B;  3OYB A;  3CBO A;  4BE1 A;  4ZN3 A;  4BAC A;  4KUL A;  4JLI A;  1YHQ A;  4N4G A;  4C5I A;  1YJ9 A;  5GAO q;  4XU3 A;  3CCU A;  2RI2 A;  5D6X A;  1PSE A;  2LNV A;  3HHT B;  2EAY A;  2ZPE B;  4QW2 A;  3CCL T;  1K8A C;  4M7A B;  5GAN 5;  4QQG A;  3M56 A;  4D6W A;  3SFM A;  1XTD A;  3CPW S;  4C5E A;  1K8A U;  3A8G B;  3UWN A;  4MDX A;  3LH0 A;  1HK9 A;  3KXT A;  3CCU T;  2V8J A;  4C8Q F;  3I56 A;  4M7D F;  3OB9 A;  2XK0 A;  4Y28 E;  4M78 D;  4IUV A;  1LOJ A;  3QO3 A;  3FB9 A;  4M77 E;  3JCM P;  3SWN B;  2QQA A;  2R58 A;  2JN0 A;  4JS4 A;  2E5Q A;  1M5Q 1;  2DKG A;  5DM7 R;  2G3R A;  3MP8 A;  3QHS A;  2YHT A;  1BI2 A;  3I56 T;  4JDS A;  5KE2 A;  2NLU A;  2RA2 A;  2HNI A;  2QQR A;  4J6X A;  2LQK A;  1XNI A;  3NFC A;  4DOV A;  4MZT A;  3KUF A;  1K73 C;  2O4X B;  3LW5 E;  3ZBD A;  4XTY A;  1W2B A;  1OI1 A;  2EJG A;  3LWH A;  2LT1 A;  5CKB A;  3FRN A;  3DLL A;  2D9T A;  1YI2 T;  2DIG A;  3RER A;  3PFS A;  5GAN 6;  1TH7 A;  1XQH A;  1YJW A;  3OYK A;  3CPF A;  3CC7 A;  2E1H A;  2DZ9 A;  3DB3 A;  4CI0 C;  1VIE A;  3JSC A;  4QQD A;  5GMK e;  5FU7 C;  4PJO A;  2K2V A;  4F7U E;  1MGQ A;  2MWP A;  4M75 B;  2EIF A;  2L3R A;  2R5M A;  4IUP A;  5GAM g;  3FC3 A;  1FXX A;  3G7Z A;  1VQM A;  1YJN T;  1U8R A;  3PNW C;  3L2Q A;  4J6W A;  3LWI A;  2D0Q B;  3CXC A;  3CCJ A;  5A2Q E;  1VQ6 A;  1SSF A;  2P0Q A;  3F70 A;  5KE3 A;  3SD4 A;  2EFI A;  2LVM A;  3RKW A;  3S6W A;  2YRV A;  2QA4 A;  1QVF A;  1WGS A;  3QXE B;  4OGE A;  2RB6 A;  1W4S A;  3PMT A;  4BI3 A;  1VQ6 T;  1IZ6 A;  3A8L B;  1QVP A;  1WQW A;  2BIV A;  5AYF A;  5LL6 S;  4HCC A;  4M7D C;  4C0G A;  5LJ5 h;  3OBY A;  4E7H A;  4M7A F;  4M78 B;  4QVC A;  1VQ4 A;  2FHD A;  1UB4 A;  2K57 A;  3WXM B;  1RI0 A;  2DXU A;  2PU9 B;  3EFR A;  4BUG A;  4L59 A;  2P0K A;  2EJ9 A;  3V8K A;  2QTX A;  3OYC A;  3SWN A;  3X28 B;  3UPU A;  3A8O B;  2WSE E;  4QVZ A;  3CC4 T;  1NJI U;  3MET A;  3VJP A;  4C8Q G;  3QZ5 B;  3CCQ T;  1Q82 C;  4M7D G;  5CKD A;  3HP9 A;  2LTO A;  4XTZ A;  1G3Y A;  1O9S A;  5IT9 E;  4NL3 A;  3H8Z A;  4N4I A;  1M1F A;  1VQ5 A;  2OTL A;  3MEU A;  5LJ3 g;  5CQX A;  1UGS B;  1V29 B;  5GAO p;  3CMA A;  3CCS T;  3CCV A;  4PLL A;  2EQJ A;  5CQY A;  4FM4 B;  4GLK A;  4C5H A;  2PVD B;  3VYG A;  2HQE A;  3CCR T;  2OAU A;  4M7A D;  4PLI A;  2ZPI B;  3MEV A;  2AHJ B;  4XQ3 A;  2ZPF B;  3M4Y A;  3CPW A;  1P92 A;  3OS5 A;  3T9N A;  5GAN h;  1I5L A;  3CEY A;  1JBM A;  1WNL A;  1LNX A;  1NZ9 A;  3A8H B;  3HRT A;  4LDY A;  4E7I A;  2RJC A;  4M75 A;  4XK8 E;  5FU6 C;  2L5Q A;  1VQ9 A;  5HY6 A;  5GAO m;  2P4T A;  2P0P A;  2Y4X A;  3SDZ A;  3QYH B;  2PQW A;  4OP0 A;  3JCM f;  2XID A;  5I2S A;  4ZN1 A;  2VYT A;  3MP1 A;  3ZEH A;  2E70 A;  1KG1 A;  2I2L A;  4RMO A;  3J7A F;  3QJ6 A;  4HCZ A;  2FYK A;  4ME7 A;  1VQ9 T;  5D6W A;  5GAM h;  3QSU A;  2DIQ A;  4FT2 A;  2GFA A;  3OYM A;  4C92 A;  3I55 T;  4XAX B;  3G71 T;  1KC8 C;  1KQS S;  4HCB A;  3RKY A;  2D6F A;  4M7A C;  3V7S A;  3M59 A;  4YTL A;  1Q7Y U;  3MEW A;  3HRU A;  3QKJ A;  1KC8 U;  3BW1 A;  1VQK T;  4EDU A;  3PMI A;  3CCM A;  4LD9 K;  2EYQ A;  4J7F A;  2M1H A;  2DXT A;  2FVU A;  1G3S A;  2MWO A;  2F5T X;  3VUB A;  4PJO B;  3C95 A;  4LDV A;  4A4H A;  4FSX A;  1ZHI A;  4M78 F;  2C06 A;  3QG1 A;  1G5V A;  3SWN C;  4J6Y A;  4M75 D;  4M7A G;  3X24 B;  3CD6 T;  4A4E A;  2WSF E;  5DLO A;  2DTO A;  2WSC E;  5GAM j;  1YBY A;  3GP8 A;  5GAN 3;  2E41 A;  5LJ3 d;  2DVE A;  2E64 A;  4JRK A;  5GAN f;  1QVG A;  3QZ9 B;  1VQO T;  4KUI A;  2HQX A;  4R56 A;  3G4S T;  2PUK B;  4MMK A;  4C92 D;  1VQ7 T;  3GNF B;  4C8Q E;  2XD0 A;  4M7D E;  1B34 A;  4QQ6 A;  2CZ7 B;  3OYL A;  1VUB A;  1YHQ T;  4LDX A;  1LJO A;  1YJ9 T;  2L89 A;  4HA8 A;  2CZ6 B;  3HPW A;  4ZTF A;  3M53 A;  3CCE A;  1WJS A;  1WQ7 A;  4R55 A;  2HAX A;  1VQ4 T;  3SB2 A;  2RK2 A;  4BD3 A;  5CK9 A;  4HT8 A;  2RHI A;  3FDR A;  3V7R A;  3JCM g;  3JB9 I;  5GAN 7;  3JCM e;  4E47 A;  2DD5 A;  1M1G A;  3OS2 A;  2ZPH B;  3RKX A;  1KHI A;  1FX7 A;  3L2W A;  3VV0 A;  5GAN 4;  3KBG A;  1JJ2 S;  3GIB A;  1Q86 C;  1GXI E;  3S3M A;  5FRM A;  1HXD A;  2Y4Y A;  3OW2 S;  2ZGW A;  4XU1 A;  2A3L A;  2XI9 A;  2CYZ B;  3E9F A;  2JTM A;  5LJ3 j;  2IG0 A;  3OYA A;  3PTA A;  3G6E A;  3OSS C;  2R57 A;  3OS0 A;  3PIP A;  4C0D B;  3R6O A;  2E6Z A;  4M78 C;  4C0Z A;  4JRQ A;  3OYG A;  4M77 A;  3VKI A;  3GNG A;  5KH6 A;  4C0F A;  1QP2 A;  3JCM Q;  4FT4 A;  1S72 A;  1O75 A;  5HKC A;  2XKO C;  4KBM B;  4J7I A;  1YJW T;  4NOY A;  1BI1 A;  3CC7 T;  1N9R A;  4BDZ A;  1N8R C;  4N0A C;  5A0L A;  4PL6 A;  2RM4 A;  4ELY C;  4M78 G;  3P8H A;  2M9U A;  2KQW A;  4NL2 A;  3UDC A;  2DEQ A;  3RMQ A;  5GAN e;  5GAN 2;  3H6Z A;  1ZBX A;  4UC4 A;  3S3O A;  1VQM T;  1N8R U;  3OYN A;  2OTJ A;  2E10 A;  3EAE A;  4RKU E;  2A7Y A;  3LGL A;  2DO3 A;  4C92 B;  4Y91 A;  3J80 E;  3AHU A;  3O8V A;  3CCJ T;  2LC4 A;  1U1T A;  3HKS A;  4M7A E;  1YIT A;  3L2V A;  2K5I A;  1KQS A;  2QXF A;  3QII A;  4GY5 A;  1KHC A;  4EMH A;  2QA4 T;  3DLM A;  5KCH A;  2PUO B;  2CS7 A;  4F7U A;  3OYF A;  1Y71 A;  2VUB A;  2RJF A;  4TVR A;  4EMK A;  1KQ1 A;  3JCM d;  2CZ0 B;  1YIT T;  4PJO D;  4XTU A;  5EG2 A;  3JCM b;  4XTX A;  4A4K A;  1Q81 C;  3S3N A;  1X6O A;  2DTI A;  2X35 A;  3MP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...