2K5FA

Solution nmr structure of feoa protein from chlorobium tepidum. northeast structural genomics consortium target ctr121
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
MKLSELKAGDRAEVTSVAAEPAVRRRLMDLGLVRGAKLKVLRFAPLGDPIEVNCNGMLLTMRRNEAEGITVHILAGDEGHPHGWPGFRRRHRFGKRALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein A
publication title Solution NMR structure of FeoA protein from Chlorobium tepidum. Northeast Structural Genomics Consortium target CtR121
rcsb
source organism Chlorobaculum tepidum
molecule tags Metal transport
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k5fA01
2QQ9A 1BI2A 1BI3A 2H3JA 1G3TA 1FX7A 1QW1A 1BI0A 2K4YA 3HRSA 3MHXA 1BYMA 2GCXA 3HRUA 5CVIA 1QVPA 2K5FA 2K5IA 2QQBA 2LX9A 1P92A 1G3SA 2QQAA 3GLXA 1G3YA 1BI1A 3E19A 4O5VA 2K5LA 1U8RA 1G3WA 3HRTA 1FWZA 4O6JA
chains in the Genus database with same CATH superfamily
1MMDA 4EPCA 4B9XA 1VQLQ 2D0NA 2WSEE 3JCMJ 1QVFS 3OYHA 4C0DB 1JB0E 5GAOq 4M75C 5IHKA 5KYWB 5FWBA 5GAN2 3OMCA 1SEMA 4DEYA 1QVFA 1X75C 1U5SA 2LC4A 1SHFA 5GAMf 4A4GA 3OYFA 3CC2Q 3MJXA 1ACMB 1G2BA 5FU7C 3CCLQ 4JLIA 2EQMA 2X51A 4E2FB 4C8QD 4IUUA 1ZHIA 3RIRA 4BD3A 1Y96B 4RKUE 2CH4A 2DD5A 1NJIU 2XKOC 3PT9A 2CZ1B 4QVZA 4R0KA 4C5GA 2Y4XA 3SD4A 3MP1A 4X1VA 5HY6A 1V76A 3JCMd 4CRIA 3QZ9B 4F14A 3MP8A 2O31A 2FYKA 3OBWA 1M1GA 1UUEA 4AFZC 5GANf 1WHGA 3LGFA 4HCBA 2MWOA 4E7HA 3QYHB 4N4GA 4ELZC 3CCLT 4M77A 1N9RA 2C0IA 2DIGA 1VQ4A 3M56A 2XG8D 2O9SA 2JW4A 8ATCB 2VV5A 3KUFA 1Z9ZA 2D8HA 3A8HB 2K6DA 3EGDB 2E12A 5J3BA 1ZBXA 5L23A 2LP5A 2RQRA 2EJGA 1WHLA 4JS5A 1KD1R 4FIBA 3C95A 4F7UE 1I81A 2ZPIB 1EZZB 1OPKA 1QP3A 3UDCA 1MV0B 1CSKA 2WSFE 3VV0A 5D6XA 5KCHA 3P8HA 5GAN4 4O5VA 2YRVA 3MP6A 3FB9A 3PTAA 4Q5WA 3KFVA 4OVAA 2HAXA 1JBMA 5GMKi 2QDYB 3VS1A 3JCMe 3FC3A 3M0QA 2KE9A 5GANe 4M75A 4JRIA 2L2PA 1HD3A 2X4WA 1OULA 1X69A 2LX9A 2NUTB 3EGXA 3M0PA 2DERA 2R5MA 1MV3A 4WF2A 4QQ6A 4DOWA 2EQJA 2CT3A 2MIOA 1WXBA 2ROLA 2RJCA 1D1BA 1OX8A 3G4SA 3REAB 4D6WA 1RABB 2DMOA 3VS2A 1ZSZB 1UGQB 4QVDA 2C0OA 1GCPA 3OW2A 3EAEA 1W6XA 3BY7A 3DB3A 1M1KR 4M78G 3V8LA 4JDSA 1SPKA 4X34A 2DF6A 2DD4A 2LJ0A 4E7SA 4C8QC 2EYWA 5LJ5h 5A2QE 1X6BA 3EFOA 3O8VA 4BI3A 1IRXA 1BI0A 2VB6A 4DBHA 1I1JA 1VQ5A 3JV3A 3CXCS 3QDRB 3I56A 5GMKm 5KYNA 1UFFA 1LVKA 3BFMA 1MMNA 1TUCA 1KC8R 2EJ9A 4JJBA 2RN8A 4AT1B 2LT1A 1VYVA 3I56Q 2W0ZA 1NLPC 2E41A 4AG1C 2AHJB 4GLKA 2EYQA 5CQXA 1W2BS 3CD6Q 2GBQA 1AEYA 3CCJQ 2DBKA 1K73R 3MPUB 3P8BB 1LNXA 2OX7A 2QTXA 1NBEB 1VIEA 2F5TX 2OTJA 1YBYA 5KYYB 1Q86C 2DFUA 3CCQA 1JQQA 2FZKB 4A63B 4J7FA 3CMAQ 3RUXA 3H6ZA 3MEAA 2AIRB 2KEAA 2LZ6B 1VQ5T 1NG2A 4XU0A 3CCQQ 2E6NA 4XQ3A 5FW9A 3I56T 1HYOA 3JB9H 3GP8A 3JCMV 3U23A 2RHXA 1PM3A 1VQNA 2D9TA 3OYKA 3TREA 4C0DC 1Q86R 4C92F 1AZEA 4C0GA 3QDFA 2QQSA 5GMKe 3CCVA 4FM4B 4OB3B 2I2LA 3E2UA 3EG0A 3G7ZA 5A0DA 2RJEA 2RQUA 2CP2A 4HXJA 1Q7YC 2MOXA 2CYZB 2OTJT 4DBRA 3CCQT 2NLUA 3FLGA 3WXMB 5LJ3d 3VU3C 1QVFP 1K4US 1B3QA 4RCBA 4C92B 2D6FA 4C8QA 2QQRA 4QW2A 2NWMA 1GRIA 4M77F 4NL2A 1VQ7Q 1LCKA 2RI2A 4M78E 1WA7A 4PJOD 3QYGB 3HRSA 5J26A 2GQVA 2P84A 3G6EA 1Q7YR 3EG3A 1U1TA 3GNFB 3A8OB 3L2QA 2YUQA 1VQNT 3CC4Q 3EH1A 2IG0A 2CP7A 4CC4B 1VOMA 1Q95G 2Y4YA 2KSSA 2L3QA 3CCVT 4ORZA 5I2MA 1KQ1A 3I9QA 4GBQA 1YJNQ 1KHIA 2FPEA 2HQXA 3SDZA 1MNDA 2EWNA 4KUIA 5LJ3j 1WHMA 4M77B 4PKCC 1WX6A 1BYMA 3JRZA 2DAQA 4N4IA 3CCRQ 4F16A 3ME9A 1PSEA 1KG1A 1GXIE 3BW1A 5IHIA 3VKIA 2KQWA 4J8OA 2SRCA 2VWFA 3CPWS 4LUEA 2DLPA 3CC4T 4AFSC 5LJ3e 1Q82R 3JCMb 4JJDA 1RACB 3DLLA 2K79A 1EIFA 1M2OA 4HKEA 4PLIA 1JO8A 2YDLA 1YJNT 2A7YA 1M8MA 1TUGB 1E6GA 2PQWA 1N8RC 3S3OA 4R55A 2BIVA 1G3SA 4RG8A 2VXEA 1S72A 4LDXA 2CSQA 2K3YA 2YRCA 2K7AA 2AZSA 3LH0A 2K5FA 2QQBA 5HCKA 2CP0A 3E9FA 3SEMA 1CKAA 3RKWA 1AOJA 2VGNA 3FEOA 5GAMg 1D1AA 1WXUA 1M5Q1 2QK0A 1G83A 2FVUA 1I5OB 1UEBA 2EQKA 2XDDA 2JMCA 3CBOA 4KUDK 2QA4A 4XTXA 5CAIA 4RTZA 2O2OA 2RPNA 2NUPB 2PU9B 3OW2P 2YHTA 5FROA 4NS5A 1YHQA 3L2VA 3M58A 4KBMB 1S72T 4J9CA 3FIFA 4RTXA 1K8AR 1N5ZA 1K9MR 3OYLA 3JCMg 3V7RA 2RNAA 1QWFA 2JTEA 2DM1A 5GANg 4ZTJA 1TS9A 4KH0B 2EW3A 4DBQA 2DETA 2OJ2A 2ZGWA 4M7AE 4OB0B 4Z8AA 3CEYA 3I55Q 4MZPA 4RTTA 2EAYA 2XU8A 4FYVB 4ZNXA 3MCAB 2PZ1A 4O6JA 5HK3A 2EKOA 2DE0X 2RA2A 2QA4T 1M4ZA 4PNOA 4ZN3A 3OSVA 5DLQE 5FWCA 5I11A 1WHHA 2G3RA 2LX7A 1WGSA 2PVGB 4LDVA 4JS4A 1ZBJA 4AG2C 1YHQT 1JEGA 2FZCB 3FDRA 1VUBA 4LD9K 2K2MA 2JOYA 2LDMA 3A8LB 3QPHA 2K3BA 4C5EA 2P4RA 3QKJA 1PG5B 4LD6A 2BUDA 4IUQA 1YITQ 2NUTA 1QVGS 1KQSA 2ED1A 4CI0C 4XTVA 2DYIA 1T0HA 2ROTA 4KT0E 5KH6A 1V29B 5IN1A 1PRLC 5CKBA 2RI5A 4FL6A 1OZ2A 4DBFA 1K9AA 1QVGA 4M78F 2A3LA 4PJJA 3C12A 1ZSZA 3GIBA 2GF7A 4OMMA 1N8RU 1RLQC 4N0AC 2CH4W 4BDZA 1AZGB 2EJFA 2DZCA 4C92C 1KK7A 1M90C 5LJ5f 2CZ7B 2YUPA 4M78B 2OAUA 2M0OA 2CUDA 4J6WA 2LJ3A 2DILA 3QWYA 1M3BA 3DB4A 5CKDA 1NM7A 3HPWA 4L6V5 2HD0A 4PJOA 4QVCA 1B34B 2YXYA 2JXBA 5CK9A 5IXBA 3L42A 3UA7A 3NFCA 2CT4A 3JSCA 1N6AA 2BZ8A 3H41A 4M77C 3LYIA 2JJ9A 2OI3A 2RD1A 1VYTA 3H8ZA 4HA8A 2QEXA 2RHIA 3VUBA 1MUZA 1X6OA 3TCJA 4J9BA 3UPUA 2X3XD 2QI2A 1M30A 1RAEB 2ZAEA 4M4ZA 2DO3A 5GAN3 5CVIA 3PVQA 2K3XA 5EC7A 2FL7A 1VQKA 2OTLQ 3NGPA 2ECZA 3UF4A 5LJ5e 2RQWA 2XICA 4X9CA 1NEBA 1MMAA 3JCMP 2COYA 2DTHA 2RM4A 1YCSB 3OYCA 2ESWA 2MAMA 1WHJA 4E6RA 2Y90A 1GL5A 1UJYA 2KDSA 5GAOl 1Y7XA 3OYGA 1IGQA 2KT1A 3OSSC 1QKWA 4NOYA 4OGEA 1WLPB 2CP6A 4JZ4A 2JM9A 2EGEA 1FYNA 2CDTA 1UG1A 4GY5A 4RUGA 1W4SA 3TQ7P 3QHSA 2QEXT 4N0AA 3UWNA 4F17A 5GAMd 3RERA 1PRMC 1G3WA 1XOVA 4ELYC 4BI4A 2OTLT 3META 4FW2A 3H9NA 4M78D 4JZ3A 1G3TA 4C92A 3G1JA 4E47A 3ZBDA 2YUNA 2MYSA 3AT1B 1VQKT 4RTUA 3CPFA 1KSWA 1X43A 2LQNA 3V7SA 2J6KA 3JB9D 2AKLA 2O9VA 2HBPA 3E19A 1WQWA 5LJ3g 4ZGEB 4PJMA 3EG1A 3MEWA 2GFUA 3RMQA 1D3BB 5GANd 2F2VA 4HVWA 5GAMj 1ZA2B 1KD1C 3CQTA 1N27A 4IKFA 2ZCFB 1D0XA 2K57A 1M90U 1WPYA 2XIDA 3M4GA 2GFAA 3QIIA 2RQVA 3J80E 2EIFA 2A28A 1M8VA 2MF2A 3X20B 3EHRA 3CBPA 4FU6A 1B07A 4F7UA 5GAMe 5M9OA 1VQ4Q 5KE2A 2M9UA 3FJPA 1QVPA 2I0NA 2CSIA 2L5QA 1MGQA 5D6YA 4L5GA 5HKCA 5GANj 1HSQA 2J06A 1UB4A 5ECAA 1UGRB 4A53A 4OMFB 2JT4A 4XU1A 3IQLA 3CCSA 2DKGA 5CO7A 2WACA 1PWTA 4BUGA 3OYIA 1GFDA 1M1KC 1VQ4T 5DLOA 2XI9A 2V1RA 2EPDA 1TTHB 1X01A 3CCSQ 1K76A 1KQSP 1IHVA 4J6YA 1Y71A 1UGPB 2DRMA 3NPFA 3M0TA 4LE9A 4UC4A 1Y07A 3OA6A 1QVGP 4IUVA 1IB8A 1YCYA 1TU0B 5GAOp 2NUPA 9ATCB 2JZ2A 1FXXA 4M75E 1KC8C 2M1HA 4PJOF 3ZEHA 3G4SQ 2J6OA 1TUDA 3EGUA 3R6OA 4M78C 4EMKB 4DOVA 3PE0A 5CIUA 3CCST 4B9WA 2DL5A 2L3SA 3OYAA 3VS0A 3JB9G 1WI7A 1K73C 2KVQG 4Y28E 4M7AD 1BU1A 1WXTA 2MPXC 1YIJA 2OAWA 1HK9A 4PJOB 5KCOA 3VS5A 1OEBA 1VQ5Q 4OB1B 3CXCA 1RAIB 3NTHA 1BCOA 1RUWA 3G4ST 2RF0A 1X2QA 2JNGA 4HVVA 1VQ8A 3EH2A 2ZZDA 1KD1U 5HK0A 2COWA 1OU8A 1IHWA 4K11A 1T3SA 7AT1B 1W2BA 3KXTA 2E6ZA 1TOVA 5IT9E 4FSXA 2A0FB 2PVDB 1VQ6A 5IH2A 1QLYA 5GMKj 1VIFA 1PKTA 1YFNA 4B6MA 1NYFA 1T3LA 2E64A 5KYUB 2OTJQ 5EG2A 2QXFA 2DTOA 4N4HA 2NYSA 2O01E 5CKFA 3TSZA 1W1FA 3TSWA 1GBQA 3M0UA 2A08A 4XTWA 4EDUA 2J7IA 2RHZA 2DL8A 5J39A 3A8GB 3PMTA 6AT1B 1AD5A 2EVRA 1AWOA 1VQNQ 2LJ1A 3OS5A 3VUZA 1VQ8T 1I4K1 2LRQA 3QJYA 4X9DA 1TG0A 3HL8A 4Z88A 3CCVQ 4M7DG 2R5AA 2QQAA 1BIAA 1YN8A 1ZUYA 3PVLA 3EG2A 1M1KU 1VQ6T 3BE3A 4M78A 1OV3A 1VQ9A 2LMJA 3UA6A 4IIOA 1UTIA 2ENMA 2GNCA 1VQMA 1QW1A 3OS2A 3M55A 2HZYA 1YJWA 3MHXA 1BCMA 2P0KA 5L8RE 2ATCB 1AWXA 4CC3A 4BACA 5LJ5g 3LWIA 1B34A 1YI2A 3THKA 4C0FA 3I35A 5GAOm 4F7UF 2KXDA 1YP5A 4PK4A 2DJZA 1KC8U 2VVKA 1LPLA 3G6EQ 4ZGDB 1M2VA 1Q82C 1UE9A 2A37A 4M7AG 3VS6A 3TVTA 1MMGA 2BKDN 4WTOB 4XK8E 2GQIA 1P92A 2PNIA 1K73U 2WSCE 3EG9A 2KY9A 2K5LA 3J7AF 1VQ9T 1WJRA 4F7UB 1IGUA 2L3RA 3NHNA 1IO6A 1VQOA 3SFMA 1VYUA 3CMEA 2DK3A 4OMPA 3TEEA 1QCOA 3PGGA 4RMOA 4C5HA 3L2RA 3G6ET 1YI2T 3L2ZA 2BE7D 3JCMQ 2CP5A 2X9HA 3OYYA 3CPWA 2EFIA 2QTVA 1PD0A 2LCLA 3M5AA 4V2SA 3D7SB 4XTZA 2XD0A 4MMKA 5CQYA 1Q86U 3CCEA 4OMLA 3GOXA 4BB7A 3CCMA 1YJ9A 1S72Q 1H3HA 1TSFA 1Z9QA 5KE3A 2CREA 3L1AA 3C4SA 5GAOn 4ZN1A 1K8AC 3CCEQ 4HT9A 1ZSZC 1YJ9Q 3AHUA 2B86A 1K9MC 2A36A 2AT1B 4LUDA 4M7DE 1QWEA 2D0QB 3QSUA 1DJ7B 1U3OA 4MZMA 3OQ5A 1JRIA 1PC0A 1AWWA 3PIOA 3CCUA 1D3BA 2J6FA 2FHDA 4KGXB 4EMKC 4XU2A 3V7CA 2KROA 1Q7YU 2QA4Q 2VXFA 3CCUQ 5I2SA 3PIPA 1OQKA 2R57A 4RCCA 1HJDA 3QJ6A 3QO3A 3CCET 4DQ2A 1YHQQ 3CCMT 1YJ9T 2HL5C 4PJOC 2HEQA 1WYXA 1RAGB 3QZ5B 2P0QA 1AHJB 2E3HA 2K5IA 2RQTA 4QQGA 3N5BB 3GLXA 1TWBA 1NEGA 2EQIA 5IHNA 2K9GA 2LNHB 2BE9B 3CXCP 1IZ6A 2EKHA 3H0IA 1FMWA 4QQDA 1Y0MA 5C6SA 3CCUT 1Q82U 5D6WA 2MK5A 1SF9A 2ZPGB 3LWHA 1RI9A 1GCQC 1W2BP 2E4HA 1U8RA 3Q1JA 2JS2A 5KYXB 2VKNA 2HNIA 4OMQA 2DIQA 1HXDA 3M57A 1Q81R 1QCNA 3OY9A 4HCZA 4FYXB 4PLLA 3HP9A 2L0AA 4E7LA 1BIBA 2AK5A 1RI0A 2KK4A 3SWNB 3UATA 2LQ8A 2YRDA 3R6NA 3JB9F 1M3AA 1BI3A 1LOJA 4A4FA 2LT4A 3BDUA 2IIMA 1U06A 3MKDA 4XTUA 5GJVB 4EMKA 2O4XB 4PJNA 5LJ5d 1RL2A 4PFPA 3QUIA 1VQPA 1IXDA 2ZPHB 4LNPA 4PJLA 1AT1B 3ZL7C 2E65A 1OOTA 3QWXX 1NPPA 1M27C 2QYZA 4PL6A 4C92G 3CC7A 2DX1A 3VYGA 5CR2A 1NJIR 1K9MU 2MMPA 2IPOB 3M4YA 2MCNA 4E7JA 2F5KA 2DVJA 2KT8A 4KH1B 2F69A 3LX7A 4BE1A 2DXUA 2YLCA 1M2VB 5LJ5j 3JB9J 2L8DA 4WCIA 3C94A 2P0PA 2E1HA 1KHCA 2RMOA 2V8IA 3UT1A 4EMHA 2FG0A 4XU3A 1GBRA 5FLXE 3RBBB 1ZSGA 4M77G 4PFOA 1VQPT 2QEXQ 3EG9B 4MDWA 4MZTA 5KYUA 4C0ZA 1GCQA 2ED0A 2X4XA 4C5IA 2RK2A 2W10A 1I07A 3GPLA 4KGZB 2HL3A 1W70A 2LCSA 4OF1A 4P5NA 3NTIA 1BK2A 2D1XA 4A4KA 2DTIA 2JTFA 1VQKQ 3QG1A 2BZXA 4BE0A 4M7DF 4IUTA 2JTMA 2RHYA 2QDLA 3HFOA 1YWOA 4J9IA 4IIMA 3CPWP 2XHCA 1VQLA 2KYMA 4LDYA 3S3NA 3OS1A 1AVZC 1MNEA 3J81E 4JRKA 1UHFA 1AWJA 1VA7A 1XNIA 4KRTA 2D8JA 4Z02A 2KYBA 2DA9A 2K4YA 1YWPA 4M75G 4ANJA 1QKXA 3CC2A 4M7DB 1KFZA 3CCLA 2EGCA 4BDYA 1H92A 1J3TA 5GJWB 5GAN8 1NLOC 1UDLA 1G8XA 4M7AF 1MHNA 2M02A 2DXCA 1JJ2S 1JU5C 4E7IA 1IREB 1PHTA 4KULA 1QMCA 1ZLMA 3RNJA 1I8FA 4C92E 1C6VX 1VQLT 4J5YA 4A4EA 1JJ2A 2KRSA 1TXQA 3DLMA 3FJ5A 1B7TA 3LH5A 2RHUA 3I5SA 1OX9A 1SSFA 2PUOB 2KRNA 2RJDA 4LDWA 3JCMf 2FPFA 2HCKA 4M7AB 2QG9B 3VRZA 2Z0WA 4OMNA 4FYYB 3CC2T 5DM7R 1LJOA 3HKSA 4BY6B 4Y91A 1C0MA 3O5ZA 3H0FA 2PUKB 4LXCA 3OYMA 4FCYA 3CBMA 4M77E 4XAXB 2QAZA 2YT6A 1NYGA 3BDLA 1M3CA 2EBPA 4JJNK 4RTWA 1WFWA 2CS7A 2KMTA 5CKEA 4J9HA 2FRYA 3OYJA 3RR6A 2HDAA 2LTOA 2JUFA 4JJCA 1UGSB 2H3EB 1WJQA 1RAFB 4J6XA 4YTLA 2C06A 1E6HA 4M7DD 2IVWA 2JMAA 4J9FA 1WHKA 2VGMA 2ZPEB 3FRNA 1ZUKA 2HBWA 1PCXA 4BI8B 5I21A 3SWNC 1FX7A 4OMOA 4FT4A 1D0YA 2GCXA 4ZTFA 2PTKA 4OP0A 2O88A 2LQWA 2EYYA 1G3YA 2DYBA 3OW2S 3NMZC 4GLMA 3C0CA 3L2WA 1BKBA 2SEMA 2MWPA 3V8KA 4OB2B 1PD1A 1OPLA 1PKSA 2QGGA 2XDBA 1D1CA 3S6WA 4TVRA 3SB2A 3X26B 3EFRA 4J83A 4C8QG 3RESA 1QQJA 3SHWA 3A8MB 2KBTA 2E5QA 3HSBA 2RJFA 4J7IA 2EQUA 2YSQA 4R56A 2V26A 1NZ9A 1YIJQ 5DY9A 2GTOA 3JCMW 1A0NB 2DNUA 3WVEB 2DEUA 3CD6A 2HSPA 3PNWC 5IXFA 3CCJA 1XTDA 2AZVA 1C1AA 5GAOr 1N9SA 1GFCA 2CZ0B 1VQ8Q 3TU4K 3QXEB 5KYXA 4ME7A 1O75A 1TH7A 3CMAA 1VQ6Q 3HHTB 1OZ3A 2F2XA 3PMIA 1SSHA 1ZQ1A 1YIJT 1R0CB 4Z89A 1O9SA 4IURA 1H8KA 3JCMc 2DL4A 1K1ZA 2C0TA 2RK1A 3SWNA 4DEXA 1NPRA 3RKYA 5A0GA 2XMFA 2VUBA 4A54A 1D09B 4AMCA 2AKKA 2DRKA 2L3PA 1YNZA 3CD6T 4IUPA 3CCJT 4VUBA 2O4XA 4EMGA 2K2VA 4CC7A 4M7DC 2CKKA 2HMAA 1NE8A 1KIKA 4RG2A 3MEUA 5AYFA 1ZA1B 3CMAT 2KI7A 3M53A 3I5RA 1ARKA 1FMVA 1UJ0A 1VQ7A 1VQ9Q 5GAMh 5A0LA 1EX4A 5LJ3f 1VQMQ 4FSSA 2CUBA 4RTVA 4DA4A 1YJWQ 1WIEA 3CC4A 1YI2Q 2VYTA 4JLGA 4AFQC 2QGFB 4BE2A 4C8QE 3QBYA 4MMLA 5LL6S 2HQHA 4M7AC 1YJNA 3VRYA 2BZYA 2KXCA 1JJ2P 3GBQA 3OYDA 4A4HA 3JB9I 4L59A 3JCMh 3M0RA 3L2UA 2DVEA 2EYZA 4BY6C 3CCRA 5GANh 3HTRA 3RMSA 2J05A 2HSEB 2DL7A 3OYNA 1KJWA 1VQMT 2RH2A 2FB7A 2HKNA 1E7OA 1YJWT 2X3WD 2FPDA 1S1NA 3HRUA 2COZA 2YLBA 1VQ7T 3OYBA 1I5LA 1BB9A 4J9GA 2ABLA 4Y92A 1SG5A 4PFZA 1VQOQ 1K0SA 3P8DA 3PFSA 4ATOA 3CMEQ 2LNVA 2VC8A 2ZPBB 4HVUA 4MDXA 5GAN6 2G6FX 2QQ9A 4M75F 3S3MA 1UECA 1KQ2A 5FU6B 4JPBW 1UHCA 1RLPC 2QASA 2LQKA 3E1SA 2GTJA 3OYEA 2HKQB 2KR3A 3E9GA 2L89A 2KNBB 2DL3A 4M7DA 1XJWB 3CCRT 1R77A 5KYWA 1R8OB 3CCMQ 4HCCA 2P4TA 4RTYA 2GGRA 4J9EA 3X25B 4D8KA 1VQOT 3VS4A 3CMET 4M75B 3M54A 4E7KA 5FRMA 4AFUC 3H0HA 3M59A 1H3ZA 3EGXB 4C92D 4KGVB 2B8AA 1N8RR 1Y96A 5D7UA 5FU7B 4LN2A 1WZOA 1BI1A 1EFNA 2RO0A 4D8DA 1QCFA 1G5VA 3F70A 3M9QA 2E10A 3HRTA 3OMGA 3INZA 4II1A 3GNGA 5CKHA 2V1QA 2R58A 2KGTA 2V8KA 3KBGA 4M7AA 2M16A 1ABQA 1JXMA 5C0MA 2ZPFB 4JRPA 1SHGA 3OS0A 5FRNA 2LCCA 1WJSA 4XTYA 4M77D 3VS7A 3NTKA 2V8JA 3EHQA 3EFOB 3ER0A 4PJOG 1X27A 3WVDB 1OU9A 2FRWA 3EFSA 3I55A 1T0JA 3OBYA 3ULRB 3JCMX 2M0YA 1Q81C 1U1SA 5GMKh 3EGDA 3VYHB 2DXTA 2DZ9A 3LW5E 1K0XA 1WQ7A 3X24B 2JM8A 3OB9A 2DXBA 2XK0A 2RB6A 2X4JA 4ESRA 2F1LA 1Y57A 1OYXA 3M0SA 3V8JA 1WDXA 1X2KA 1YITA 1CKBA 2BTTA 1KQSS 2H8HA 1PNJA 3GF5A 3MEVA 2KAFA 4M75D 4OGCA 1PSFA 1BBZA 1FWZA 2X4YA 3I55T 4JRQA 2E5KA 1RAHB 2DBMA 1RAAB 1NJIC 4CC2A 4J9DA 5GMKl 1BI2A 1WNLA 5CCAA 2KRMA 1SRMA 2X35A 2FEIA 3RDVA 2JN0A 4C8QF 3LGLA 2VASA 2LVMA 1XQHA 3G71A 5I22A 4ZGJB 2E3IA 3A98A 1M9SA 2FO0A 1K8AU 1VQPQ 1ZX6A 4F04B 1YITT 3G71Q 2DJQA 2CZ6B 4FYWB 5AT1B 5GAN5 4FT2A 3HFNA 5LJ3h 3ASKA 4HT8A 1OI1A 2YUOA 4JUVA 3CC7Q 2NUZA 2PVOB 4C8QB 1M1FA 4LDUA 2XDPA 3T9NA 3LLRA 2YWWA 1I0CA 5GAN7 4NL3A 4EIKA 1ABOA 2EGAA 4E7ZA 4QKUA 3X28B 2E70A 3VS3A 3MO8A 2CGHA 4PJOE 1M90R 3ZFJA 1ZUUA 2FZGB 3A5ZB 1JXOA 3G71T 2HQEA 4QT7A 3RKXA 2F2WA 2DPPB 5KYYA 2OTLA 3CC7T 4F7UG 3A1PA 2JS0A 2CP3A 2DEQA 4HCKA 2H3JA 2EYXA 2MI6A 1SRLA 5IAYA 2M51A 1FMKA 1RADB 1H641 1SKUB 1F1BB 1UGVA 1D0ZA 2JVVA 3URGA 1Q81U 5FU6C 2RI3A 4FW1A 1V1CA 1X6GA 3VJPA 1QP2A 3JAME 1R0BG 3DKMA 3REBB 8AT1B
chains in the Genus database with same CATH topology
2EKOA 1BKBA 2RA2A 1Q82C 2QA4T 4EPCA 1M4ZA 4PNOA 4B9XA 4ZN3A 2MWPA 3OSVA 4M7AG 2WSEE 5DLQE 3JCMJ 2G3RA 1QVFS 3V8KA 2BKDN 1WGSA 3OYHA 4C0DB 2PVGB 4LDVA 4OB2B 4JS4A 1YHQT 4XK8E 1JB0E 5GAOq 3FDRA 1VUBA 4LD9K 4M75C 2LDMA 2JOYA 2XDBA 1P92A 3A8LB 3QPHA 5GAN2 4C5EA 3QKJA 3S6WA 1K73U 2WSCE 4TVRA 3SB2A 3X26B 2KY9A 3EFRA 3OMCA 4J83A 4C8QG 1QVFA 2K5LA 2LC4A 1X75C 2BUDA 4IUQA 4LD6A 3RESA 4A4GA 1WJRA 4F7UB 5GAMf 3OYFA 1VQ9T 2L3RA 1QVGS 1KQSA 3A8MB 2E5QA 4CI0C 4XTVA 5FU7C 1VQOA 4JLIA 3SFMA 2EQMA 2RJFA 3HSBA 4J7IA 2EQUA 4KT0E 4IUUA 4C8QD 5KH6A 1V29B 4R56A 2DK3A 1ZHIA 5IN1A 3RIRA 3TEEA 3CMEA 1NZ9A 5CKBA 3PGGA 2RI5A 4FL6A 4BD3A 1OZ2A 1Y96B 4C5HA 4RKUE 2DD5A 3L2ZA 4RMOA 5DY9A 3L2RA 3G6ET 3JCMQ 3JCMW 2XKOC 1YI2T 3PT9A 2CZ1B 4M78F 1QVGA 4QVZA 2A3LA 3OYYA 3CPWA 3WVEB 4C5GA 2Y4XA 3CD6A 3C12A 3PNWC 3GIBA 3SD4A 2GF7A 3CCJA 2EFIA 2LCLA 1N8RU 3M5AA 3MP1A 4V2SA 5HY6A 1XTDA 4N0AC 4XTZA 3JCMd 5GAOr 2XD0A 1N9SA 4CRIA 4MMKA 3QZ9B 2CZ0B 4BDZA 3MP8A 5CQYA 1Q86U 2FYKA 3TU4K 3QXEB 3OBWA 1M1GA 5GANf 2EJFA 4ME7A 3CCEA 1O75A 2DZCA 4BB7A 3LGFA 3GOXA 3CCMA 1YJ9A 4HCBA 2MWOA 4E7HA 4C92C 1TH7A 3QYHB 1M90C 5LJ5f 2CZ7B 4N4GA 4ELZC 5KE3A 3CMAA 3CCLT 4M77A 1N9RA 2DIGA 3HHTB 1OZ3A 3L1AA 4M78B 2OAUA 3PMIA 1VQ4A 2M0OA 3C4SA 5GAOn 1ZQ1A 3M56A 2XG8D 4J6WA 4ZN1A 1YIJT 1K8AC 4HT9A 3AHUA 1M8VA 2VV5A 1K9MC 3KUFA 3DB4A 1O9SA 4IURA 3A8HB 5CKDA 4M7DE 3JCMc 3HPWA 2D0QB 4L6V5 3QSUA 2RK1A 2E12A 2HD0A 5J3BA 4PJOA 1ZBXA 3SWNA 4QVCA 1DJ7B 1B34B 1NPRA 3RKYA 2EJGA 4MZMA 3OQ5A 1JRIA 5A0GA 4JS5A 2VUBA 4A54A 3L42A 5CK9A 4FIBA 3C95A 3NFCA 3PIOA 3CCUA 1D3BA 4F7UE 2FHDA 4EMKC 3JSCA 4XU2A 1I81A 1N6AA 3CD6T 2ZPIB 1QP3A 3V7CA 3UDCA 4M77C 4IUPA 3LYIA 3CCJT 4VUBA 2WSFE 2O4XA 3VV0A 1Q7YU 2RD1A 2K2VA 5D6XA 4EMGA 3H8ZA 2VXFA 4M7DC 4HA8A 3P8HA 5KCHA 4O5VA 5GAN4 2CKKA 2YRVA 3MP6A 2QEXA 3FB9A 1NE8A 5I2SA 2RHIA 3VUBA 1X6OA 4RG2A 3TCJA 3PIPA 3PTAA 2R57A 4Q5WA 4RCCA 3QJ6A 3QO3A 4OVAA 3MEUA 3CCET 5AYFA 4DQ2A 2HAXA 3UPUA 1JBMA 5GMKi 3CCMT 2QDYB 1YJ9T 4PJOC 2QI2A 3JCMe 3FC3A 3QZ5B 3CMAT 3M53A 2P0QA 2DO3A 5GAN3 5CVIA 5GANe 1AHJB 2K3XA 4M75A 2FL7A 2K5IA 4JRIA 2X4WA 4QQGA 1VQ7A 3N5BB 2LX9A 5GAMh 1VQKA 5A0LA 3GLXA 5LJ5e 2XICA 5LJ3f 2R5MA 4X9CA 3JCMP 4WF2A 2DTHA 4QQ6A 4DOWA 2RM4A 4DA4A 2EQJA 1IZ6A 3OYCA 2RJCA 2MAMA 3CC4A 2Y90A 2VYTA 4JLGA 2KDSA 3G4SA 4BE2A 4D6WA 5GAOl 1Y7XA 3QBYA 4MMLA 4QQDA 4C8QE 5C6SA 3CCUT 3OYGA 5LL6S 1Q82U 3OSSC 1UGQB 5D6WA 4QVDA 4M7AC 4NOYA 4OGEA 1YJNA 3L2WA 3EAEA 3OW2A 3BY7A 3DB3A 3OYDA 2ZPGB 4A4HA 3JB9I 3LWHA 4L59A 3JCMh 4GY5A 3L2UA 2DVEA 1W4SA 3QHSA 4M78G 4N0AA 3V8LA 4BY6C 4JDSA 3UWNA 2QEXT 3CCRA 1U8RA 4X34A 3Q1JA 5GAMd 5GANh 4ELYC 1G3WA 1XOVA 3RERA 4BI4A 2DD4A 2OTLT 3META 2HNIA 2DIQA 4C8QC 3RMSA 1HXDA 5LJ5h 5A2QE 3OYNA 4M78D 3M57A 1VQMT 2RH2A 3O8VA 1G3TA 4BI3A 2FB7A 4C92A 4E47A 1BI0A 1YJWT 1VQ5A 3ZBDA 3CXCS 3HRUA 3QDRB 3I56A 2YLBA 1VQ7T 1VQKT 3OYBA 1I5LA 3CPFA 3OY9A 4HCZA 5GMKm 3BFMA 4PLLA 3HP9A 3V7SA 4E7LA 3JB9D 1BIBA 3P8DA 2EJ9A 3PFSA 4ATOA 2HBPA 3E19A 1WQWA 1RI0A 2KK4A 2LNVA 2VC8A 3SWNB 5LJ3g 2ZPBB 4ZGEB 2LT1A 2LQ8A 4MDXA 5GAN6 3MEWA 2E41A 2QQ9A 2GFUA 4M75F 3RMQA 3S3MA 3JB9F 2AHJB 1D3BB 2EYQA 4GLKA 5CQXA 1KQ2A 5GANd 1BI3A 5FU6B 1W2BS 1LOJA 4A4FA 2LT4A 3BDUA 2LQKA 4XTUA 5GAMj 3E1SA 4EMKA 1KD1C 2O4XB 3J7AF 5LJ5d 1RL2A 3OYEA 3QUIA 1VQPA 3E9GA 2L89A 3P8BB 1LNXA 2QTXA 2ZPHB 1N27A 4IKFA 2ZCFB 2K57A 1VIEA 1M90U 1WPYA 2F5TX 2OTJA 1YBYA 4M7DA 2XIDA 3M4GA 1Q86C 3CCRT 3CCQA 2GFAA 3QIIA 1R8OB 3J80E 4HCCA 2E65A 2P4TA 4J7FA 2EIFA 1NPPA 4PL6A 3RUXA 3X25B 3H6ZA 4C92G 3CC7A 3VYGA 1VQOT 2MF2A 3X20B 5CR2A 3MEAA 3CBPA 4FU6A 1K9MU 4F7UA 3CMET 4M75B 2MMPA 5GAMe 3M54A 5M9OA 4E7KA 1VQ5T 3M4YA 5FRMA 4XU0A 2E6NA 5KE2A 4XQ3A 3M59A 3I56T 2M9UA 1H3ZA 4C92D 3FJPA 1QVPA 2B8AA 4E7JA 3JB9H 2L5QA 2F5KA 1MGQA 5D6YA 3GP8A 4L5GA 1Y96A 2F69A 2RHXA 3LX7A 3JCMV 5HKCA 5GANj 1VQNA 5FU7B 2DXUA 2D9TA 2YLCA 4BE1A 3OYKA 3TREA 1KC8U 1BI1A 4C0DC 2RO0A 4C92F 1G5VA 3F70A 4C0GA 2QQSA 3M9QA 5GMKe 5LJ5j 1UB4A 2E10A 3HRTA 3OMGA 2L8DA 3JB9J 3C94A 2P0PA 3INZA 2E1HA 1KHCA 4FM4B 3CCVA 4II1A 1VQMA 3GNGA 5CKHA 4OB3B 1UGRB 2V8IA 2I2LA 3UT1A 2R58A 4EMHA 4A53A 4OMFB 4XU3A 3G7ZA 2V8KA 5FLXE 5A0DA 3KBGA 4XU1A 2RJEA 3CCSA 4M7AA 4M77G 2M16A 1Q7YC 1VQPT 2DKGA 5CO7A 2WACA 4MDWA 4BUGA 5C0MA 2ZPFB 4JRPA 4MZTA 4C0ZA 3OS0A 2CYZB 2LCCA 3OYIA 1M1KC 5FRNA 2OTJT 1VQ4T 5DLOA 1WJSA 2X4XA 4XTYA 4C5IA 2RK2A 2NLUA 2XI9A 3FLGA 4M77D 5LJ3d 3VU3C 3WXMB 3GPLA 1X01A 2V8JA 3NTKA 4RCBA 3ER0A 4C92B 4PJOG 4C8QA 2D6FA 2QQRA 4QW2A 4OF1A 4J6YA 4P5NA 3WVDB 3EFSA 3NTIA 3I55A 1Y71A 4A4KA 1UGPB 2DTIA 2JTFA 3OBYA 4M77F 4NL2A 3JCMX 2RI2A 3QG1A 4M78E 1Q81C 4UC4A 4BE0A 1U1SA 4M7DF 5GMKh 1Y07A 4IUTA 3QYGB 3HRSA 4PJOD 5J26A 2JTMA 3VYHB 2GQVA 3OA6A 3G6EA 2RHYA 2DXTA 3HFOA 2DZ9A 1U1TA 3GNFB 3A8OB 3LW5E 2XHCA 4IUVA 1WQ7A 1YCYA 3X24B 3L2QA 1VQLA 1VQNT 5GAOp 4LDYA 3S3NA 2JZ2A 1FXXA 3OB9A 4M75E 2DXBA 2M1HA 4PJOF 1KC8C 3OS1A 3ZEHA 2IG0A 2XK0A 2Y4YA 2RB6A 2KSSA 2X4JA 3CCVT 3J81E 4JRKA 1NJIU 5I2MA 3R6OA 1OYXA 1KQ1A 4M78C 1KHIA 2HQXA 3SDZA 3V8JA 4EMKB 4DOVA 2EWNA 1XNIA 4KUIA 5CIUA 3CCST 5LJ3j 4Z02A 4M77B 4B9WA 4PKCC 1YITA 3OYAA 2K4YA 4M75G 3JB9G 1BYMA 1KQSS 1K73C 3JRZA 3CC2A 2DAQA 4N4IA 4M7DB 2KVQG 3CCLA 4Y28E 4M7AD 3ME9A 1PSEA 1KG1A 3GF5A 1GXIE 4BDYA 3BW1A 3MEVA 2KAFA 4M75D 3VKIA 1YIJA 5GAN8 2KQWA 1PSFA 4OGCA 4J8OA 1HK9A 4PJOB 5KCOA 4M7AF 1MHNA 1FWZA 2X4YA 4OB1B 2DXCA 3CPWS 3I55T 3CXCA 4JRQA 3NTHA 3CC4T 1JJ2S 5LJ3e 1NJIC 3G4ST 3JCMb 5GMKl 1BI2A 4E7IA 1IREB 1WNLA 5CCAA 4KULA 3DLLA 2X35A 1EIFA 4PLIA 4HKEA 2JNGA 2JN0A 1YJNT 2A7YA 1VQ8A 1I8FA 4C92E 1VQLT 2PQWA 2ZZDA 4C8QF 4J5YA 4A4EA 1N8RC 3LGLA 3S3OA 4R55A 2LVMA 1JJ2A 2BIVA 1G3SA 4RG8A 3DLMA 1KD1U 5HK0A 2VXEA 1XQHA 2RHUA 3G71A 3CCQT 1S72A 4LDXA 1W2BA 3KXTA 2E6ZA 2K3YA 4ZGJB 1SSFA 2PUOB 4LDWA 2RJDA 4FSXA 3JCMf 5IT9E 2PVDB 1VQ6A 1M9SA 4M7AB 1K8AU 5GMKj 1VIFA 1YITT 2E64A 2CZ6B 3CC2T 5DM7R 1LJOA 5EG2A 2QXFA 3HKSA 5GAN5 4BY6B 2DTOA 4Y91A 4FT2A 3LH0A 4N4HA 2K5FA 3HFNA 3ASKA 5LJ3h 1OI1A 2O01E 4HT8A 2QQBA 2PUKB 4JUVA 5CKFA 3E9FA 2PVOB 3OYMA 4C8QB 1M1FA 4LDUA 3RKWA 2XDPA 3CBMA 4M77E 4XTWA 3T9NA 3LLRA 4XAXB 2VGNA 4EDUA 5GAN7 3BDLA 3FEOA 5GAMg 4NL3A 2RHZA 1M5Q1 5J39A 4JJNK 2FVUA 3A8GB 2CS7A 1UEBA 2EQKA 2KMTA 3PMTA 2XDDA 5CKEA 3CBOA 4KUDK 2QA4A 4XTXA 3X28B 2E70A 3OYJA 5CAIA 2LTOA 3MO8A 3OS5A 2CGHA 3VUZA 1VQ8T 1I4K1 4PJOE 2PU9B 2JUFA 3ZFJA 2YHTA 2LRQA 3QJYA 4X9DA 5FROA 1UGSB 4NS5A 3HL8A 1YHQA 3A5ZB 4M7DG 1WJQA 3L2VA 2R5AA 3M58A 4KBMB 3G71T 2HQEA 2QQAA 4J6XA 1BIAA 4YTLA 3FIFA 1S72T 3RKXA 2C06A 1M1KU 1VQ6T 2DPPB 4M78A 4M7DD 2IVWA 3OYLA 1VQ9A 2OTLA 3CC7T 4F7UG 3JCMg 2VGMA 3V7RA 2ZPEB 3FRNA 4BI8B 5I21A 2DEQA 2H3JA 3SWNC 1FX7A 5GANg 4ZTJA 1QW1A 2MI6A 5IAYA 3M55A 4FT4A 3OS2A 1YJWA 3MHXA 1H641 2P0KA 5L8RE 2GCXA 4ZTFA 2ZGWA 4BACA 5LJ5g 3LWIA 1B34A 1YI2A 4C0FA 2JVVA 3URGA 4OP0A 1Q81U 4M7AE 5GAOm 5FU6C 4OB0B 2RI3A 3CEYA 4MZPA 1G3YA 2EAYA 2XU8A 3VJPA 4F7UF 1QP2A 3JAME 3OW2S 3MCAB 3DKMA 4O6JA 2DJZA 5HK3A 4ZGDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQ9 A;  1BI2 A;  1BI3 A;  2H3J A;  1G3T A;  1FX7 A;  1QW1 A;  1BI0 A;  2K4Y A;  3HRS A;  3MHX A;  1BYM A;  2GCX A;  3HRU A;  5CVI A;  1QVP A;  2K5F A;  2K5I A;  2QQB A;  2LX9 A;  1P92 A;  1G3S A;  2QQA A;  3GLX A;  1G3Y A;  1BI1 A;  3E19 A;  4O5V A;  2K5L A;  1U8R A;  1G3W A;  3HRT A;  1FWZ A;  4O6J A; 
#chains in the Genus database with same CATH topology
 1MMD A;  4EPC A;  4B9X A;  1VQL Q;  2D0N A;  2WSE E;  3JCM J;  1QVF S;  3OYH A;  4C0D B;  1JB0 E;  5GAO q;  4M75 C;  5IHK A;  5KYW B;  5FWB A;  5GAN 2;  3OMC A;  1SEM A;  4DEY A;  1QVF A;  1X75 C;  1U5S A;  2LC4 A;  1SHF A;  5GAM f;  4A4G A;  3OYF A;  3CC2 Q;  3MJX A;  1ACM B;  1G2B A;  5FU7 C;  3CCL Q;  4JLI A;  2EQM A;  2X51 A;  4E2F B;  4C8Q D;  4IUU A;  1ZHI A;  3RIR A;  4BD3 A;  1Y96 B;  4RKU E;  2CH4 A;  2DD5 A;  1NJI U;  2XKO C;  3PT9 A;  2CZ1 B;  4QVZ A;  4R0K A;  4C5G A;  2Y4X A;  3SD4 A;  3MP1 A;  4X1V A;  5HY6 A;  1V76 A;  3JCM d;  4CRI A;  3QZ9 B;  4F14 A;  3MP8 A;  2O31 A;  2FYK A;  3OBW A;  1M1G A;  1UUE A;  4AFZ C;  5GAN f;  1WHG A;  3LGF A;  4HCB A;  2MWO A;  4E7H A;  3QYH B;  4N4G A;  4ELZ C;  3CCL T;  4M77 A;  1N9R A;  2C0I A;  2DIG A;  1VQ4 A;  3M56 A;  2XG8 D;  2O9S A;  2JW4 A;  8ATC B;  2VV5 A;  3KUF A;  1Z9Z A;  2D8H A;  3A8H B;  2K6D A;  3EGD B;  2E12 A;  5J3B A;  1ZBX A;  5L23 A;  2LP5 A;  2RQR A;  2EJG A;  1WHL A;  4JS5 A;  1KD1 R;  4FIB A;  3C95 A;  4F7U E;  1I81 A;  2ZPI B;  1EZZ B;  1OPK A;  1QP3 A;  3UDC A;  1MV0 B;  1CSK A;  2WSF E;  3VV0 A;  5D6X A;  5KCH A;  3P8H A;  5GAN 4;  4O5V A;  2YRV A;  3MP6 A;  3FB9 A;  3PTA A;  4Q5W A;  3KFV A;  4OVA A;  2HAX A;  1JBM A;  5GMK i;  2QDY B;  3VS1 A;  3JCM e;  3FC3 A;  3M0Q A;  2KE9 A;  5GAN e;  4M75 A;  4JRI A;  2L2P A;  1HD3 A;  2X4W A;  1OUL A;  1X69 A;  2LX9 A;  2NUT B;  3EGX A;  3M0P A;  2DER A;  2R5M A;  1MV3 A;  4WF2 A;  4QQ6 A;  4DOW A;  2EQJ A;  2CT3 A;  2MIO A;  1WXB A;  2ROL A;  2RJC A;  1D1B A;  1OX8 A;  3G4S A;  3REA B;  4D6W A;  1RAB B;  2DMO A;  3VS2 A;  1ZSZ B;  1UGQ B;  4QVD A;  2C0O A;  1GCP A;  3OW2 A;  3EAE A;  1W6X A;  3BY7 A;  3DB3 A;  1M1K R;  4M78 G;  3V8L A;  4JDS A;  1SPK A;  4X34 A;  2DF6 A;  2DD4 A;  2LJ0 A;  4E7S A;  4C8Q C;  2EYW A;  5LJ5 h;  5A2Q E;  1X6B A;  3EFO A;  3O8V A;  4BI3 A;  1IRX A;  1BI0 A;  2VB6 A;  4DBH A;  1I1J A;  1VQ5 A;  3JV3 A;  3CXC S;  3QDR B;  3I56 A;  5GMK m;  5KYN A;  1UFF A;  1LVK A;  3BFM A;  1MMN A;  1TUC A;  1KC8 R;  2EJ9 A;  4JJB A;  2RN8 A;  4AT1 B;  2LT1 A;  1VYV A;  3I56 Q;  2W0Z A;  1NLP C;  2E41 A;  4AG1 C;  2AHJ B;  4GLK A;  2EYQ A;  5CQX A;  1W2B S;  3CD6 Q;  2GBQ A;  1AEY A;  3CCJ Q;  2DBK A;  1K73 R;  3MPU B;  3P8B B;  1LNX A;  2OX7 A;  2QTX A;  1NBE B;  1VIE A;  2F5T X;  2OTJ A;  1YBY A;  5KYY B;  1Q86 C;  2DFU A;  3CCQ A;  1JQQ A;  2FZK B;  4A63 B;  4J7F A;  3CMA Q;  3RUX A;  3H6Z A;  3MEA A;  2AIR B;  2KEA A;  2LZ6 B;  1VQ5 T;  1NG2 A;  4XU0 A;  3CCQ Q;  2E6N A;  4XQ3 A;  5FW9 A;  3I56 T;  1HYO A;  3JB9 H;  3GP8 A;  3JCM V;  3U23 A;  2RHX A;  1PM3 A;  1VQN A;  2D9T A;  3OYK A;  3TRE A;  4C0D C;  1Q86 R;  4C92 F;  1AZE A;  4C0G A;  3QDF A;  2QQS A;  5GMK e;  3CCV A;  4FM4 B;  4OB3 B;  2I2L A;  3E2U A;  3EG0 A;  3G7Z A;  5A0D A;  2RJE A;  2RQU A;  2CP2 A;  4HXJ A;  1Q7Y C;  2MOX A;  2CYZ B;  2OTJ T;  4DBR A;  3CCQ T;  2NLU A;  3FLG A;  3WXM B;  5LJ3 d;  3VU3 C;  1QVF P;  1K4U S;  1B3Q A;  4RCB A;  4C92 B;  2D6F A;  4C8Q A;  2QQR A;  4QW2 A;  2NWM A;  1GRI A;  4M77 F;  4NL2 A;  1VQ7 Q;  1LCK A;  2RI2 A;  4M78 E;  1WA7 A;  4PJO D;  3QYG B;  3HRS A;  5J26 A;  2GQV A;  2P84 A;  3G6E A;  1Q7Y R;  3EG3 A;  1U1T A;  3GNF B;  3A8O B;  3L2Q A;  2YUQ A;  1VQN T;  3CC4 Q;  3EH1 A;  2IG0 A;  2CP7 A;  4CC4 B;  1VOM A;  1Q95 G;  2Y4Y A;  2KSS A;  2L3Q A;  3CCV T;  4ORZ A;  5I2M A;  1KQ1 A;  3I9Q A;  4GBQ A;  1YJN Q;  1KHI A;  2FPE A;  2HQX A;  3SDZ A;  1MND A;  2EWN A;  4KUI A;  5LJ3 j;  1WHM A;  4M77 B;  4PKC C;  1WX6 A;  1BYM A;  3JRZ A;  2DAQ A;  4N4I A;  3CCR Q;  4F16 A;  3ME9 A;  1PSE A;  1KG1 A;  1GXI E;  3BW1 A;  5IHI A;  3VKI A;  2KQW A;  4J8O A;  2SRC A;  2VWF A;  3CPW S;  4LUE A;  2DLP A;  3CC4 T;  4AFS C;  5LJ3 e;  1Q82 R;  3JCM b;  4JJD A;  1RAC B;  3DLL A;  2K79 A;  1EIF A;  1M2O A;  4HKE A;  4PLI A;  1JO8 A;  2YDL A;  1YJN T;  2A7Y A;  1M8M A;  1TUG B;  1E6G A;  2PQW A;  1N8R C;  3S3O A;  4R55 A;  2BIV A;  1G3S A;  4RG8 A;  2VXE A;  1S72 A;  4LDX A;  2CSQ A;  2K3Y A;  2YRC A;  2K7A A;  2AZS A;  3LH0 A;  2K5F A;  2QQB A;  5HCK A;  2CP0 A;  3E9F A;  3SEM A;  1CKA A;  3RKW A;  1AOJ A;  2VGN A;  3FEO A;  5GAM g;  1D1A A;  1WXU A;  1M5Q 1;  2QK0 A;  1G83 A;  2FVU A;  1I5O B;  1UEB A;  2EQK A;  2XDD A;  2JMC A;  3CBO A;  4KUD K;  2QA4 A;  4XTX A;  5CAI A;  4RTZ A;  2O2O A;  2RPN A;  2NUP B;  2PU9 B;  3OW2 P;  2YHT A;  5FRO A;  4NS5 A;  1YHQ A;  3L2V A;  3M58 A;  4KBM B;  1S72 T;  4J9C A;  3FIF A;  4RTX A;  1K8A R;  1N5Z A;  1K9M R;  3OYL A;  3JCM g;  3V7R A;  2RNA A;  1QWF A;  2JTE A;  2DM1 A;  5GAN g;  4ZTJ A;  1TS9 A;  4KH0 B;  2EW3 A;  4DBQ A;  2DET A;  2OJ2 A;  2ZGW A;  4M7A E;  4OB0 B;  4Z8A A;  3CEY A;  3I55 Q;  4MZP A;  4RTT A;  2EAY A;  2XU8 A;  4FYV B;  4ZNX A;  3MCA B;  2PZ1 A;  4O6J A;  5HK3 A;  2EKO A;  2DE0 X;  2RA2 A;  2QA4 T;  1M4Z A;  4PNO A;  4ZN3 A;  3OSV A;  5DLQ E;  5FWC A;  5I11 A;  1WHH A;  2G3R A;  2LX7 A;  1WGS A;  2PVG B;  4LDV A;  4JS4 A;  1ZBJ A;  4AG2 C;  1YHQ T;  1JEG A;  2FZC B;  3FDR A;  1VUB A;  4LD9 K;  2K2M A;  2JOY A;  2LDM A;  3A8L B;  3QPH A;  2K3B A;  4C5E A;  2P4R A;  3QKJ A;  1PG5 B;  4LD6 A;  2BUD A;  4IUQ A;  1YIT Q;  2NUT A;  1QVG S;  1KQS A;  2ED1 A;  4CI0 C;  4XTV A;  2DYI A;  1T0H A;  2ROT A;  4KT0 E;  5KH6 A;  1V29 B;  5IN1 A;  1PRL C;  5CKB A;  2RI5 A;  4FL6 A;  1OZ2 A;  4DBF A;  1K9A A;  1QVG A;  4M78 F;  2A3L A;  4PJJ A;  3C12 A;  1ZSZ A;  3GIB A;  2GF7 A;  4OMM A;  1N8R U;  1RLQ C;  4N0A C;  2CH4 W;  4BDZ A;  1AZG B;  2EJF A;  2DZC A;  4C92 C;  1KK7 A;  1M90 C;  5LJ5 f;  2CZ7 B;  2YUP A;  4M78 B;  2OAU A;  2M0O A;  2CUD A;  4J6W A;  2LJ3 A;  2DIL A;  3QWY A;  1M3B A;  3DB4 A;  5CKD A;  1NM7 A;  3HPW A;  4L6V 5;  2HD0 A;  4PJO A;  4QVC A;  1B34 B;  2YXY A;  2JXB A;  5CK9 A;  5IXB A;  3L42 A;  3UA7 A;  3NFC A;  2CT4 A;  3JSC A;  1N6A A;  2BZ8 A;  3H41 A;  4M77 C;  3LYI A;  2JJ9 A;  2OI3 A;  2RD1 A;  1VYT A;  3H8Z A;  4HA8 A;  2QEX A;  2RHI A;  3VUB A;  1MUZ A;  1X6O A;  3TCJ A;  4J9B A;  3UPU A;  2X3X D;  2QI2 A;  1M30 A;  1RAE B;  2ZAE A;  4M4Z A;  2DO3 A;  5GAN 3;  5CVI A;  3PVQ A;  2K3X A;  5EC7 A;  2FL7 A;  1VQK A;  2OTL Q;  3NGP A;  2ECZ A;  3UF4 A;  5LJ5 e;  2RQW A;  2XIC A;  4X9C A;  1NEB A;  1MMA A;  3JCM P;  2COY A;  2DTH A;  2RM4 A;  1YCS B;  3OYC A;  2ESW A;  2MAM A;  1WHJ A;  4E6R A;  2Y90 A;  1GL5 A;  1UJY A;  2KDS A;  5GAO l;  1Y7X A;  3OYG A;  1IGQ A;  2KT1 A;  3OSS C;  1QKW A;  4NOY A;  4OGE A;  1WLP B;  2CP6 A;  4JZ4 A;  2JM9 A;  2EGE A;  1FYN A;  2CDT A;  1UG1 A;  4GY5 A;  4RUG A;  1W4S A;  3TQ7 P;  3QHS A;  2QEX T;  4N0A A;  3UWN A;  4F17 A;  5GAM d;  3RER A;  1PRM C;  1G3W A;  1XOV A;  4ELY C;  4BI4 A;  2OTL T;  3MET A;  4FW2 A;  3H9N A;  4M78 D;  4JZ3 A;  1G3T A;  4C92 A;  3G1J A;  4E47 A;  3ZBD A;  2YUN A;  2MYS A;  3AT1 B;  1VQK T;  4RTU A;  3CPF A;  1KSW A;  1X43 A;  2LQN A;  3V7S A;  2J6K A;  3JB9 D;  2AKL A;  2O9V A;  2HBP A;  3E19 A;  1WQW A;  5LJ3 g;  4ZGE B;  4PJM A;  3EG1 A;  3MEW A;  2GFU A;  3RMQ A;  1D3B B;  5GAN d;  2F2V A;  4HVW A;  5GAM j;  1ZA2 B;  1KD1 C;  3CQT A;  1N27 A;  4IKF A;  2ZCF B;  1D0X A;  2K57 A;  1M90 U;  1WPY A;  2XID A;  3M4G A;  2GFA A;  3QII A;  2RQV A;  3J80 E;  2EIF A;  2A28 A;  1M8V A;  2MF2 A;  3X20 B;  3EHR A;  3CBP A;  4FU6 A;  1B07 A;  4F7U A;  5GAM e;  5M9O A;  1VQ4 Q;  5KE2 A;  2M9U A;  3FJP A;  1QVP A;  2I0N A;  2CSI A;  2L5Q A;  1MGQ A;  5D6Y A;  4L5G A;  5HKC A;  5GAN j;  1HSQ A;  2J06 A;  1UB4 A;  5ECA A;  1UGR B;  4A53 A;  4OMF B;  2JT4 A;  4XU1 A;  3IQL A;  3CCS A;  2DKG A;  5CO7 A;  2WAC A;  1PWT A;  4BUG A;  3OYI A;  1GFD A;  1M1K C;  1VQ4 T;  5DLO A;  2XI9 A;  2V1R A;  2EPD A;  1TTH B;  1X01 A;  3CCS Q;  1K76 A;  1KQS P;  1IHV A;  4J6Y A;  1Y71 A;  1UGP B;  2DRM A;  3NPF A;  3M0T A;  4LE9 A;  4UC4 A;  1Y07 A;  3OA6 A;  1QVG P;  4IUV A;  1IB8 A;  1YCY A;  1TU0 B;  5GAO p;  2NUP A;  9ATC B;  2JZ2 A;  1FXX A;  4M75 E;  1KC8 C;  2M1H A;  4PJO F;  3ZEH A;  3G4S Q;  2J6O A;  1TUD A;  3EGU A;  3R6O A;  4M78 C;  4EMK B;  4DOV A;  3PE0 A;  5CIU A;  3CCS T;  4B9W A;  2DL5 A;  2L3S A;  3OYA A;  3VS0 A;  3JB9 G;  1WI7 A;  1K73 C;  2KVQ G;  4Y28 E;  4M7A D;  1BU1 A;  1WXT A;  2MPX C;  1YIJ A;  2OAW A;  1HK9 A;  4PJO B;  5KCO A;  3VS5 A;  1OEB A;  1VQ5 Q;  4OB1 B;  3CXC A;  1RAI B;  3NTH A;  1BCO A;  1RUW A;  3G4S T;  2RF0 A;  1X2Q A;  2JNG A;  4HVV A;  1VQ8 A;  3EH2 A;  2ZZD A;  1KD1 U;  5HK0 A;  2COW A;  1OU8 A;  1IHW A;  4K11 A;  1T3S A;  7AT1 B;  1W2B A;  3KXT A;  2E6Z A;  1TOV A;  5IT9 E;  4FSX A;  2A0F B;  2PVD B;  1VQ6 A;  5IH2 A;  1QLY A;  5GMK j;  1VIF A;  1PKT A;  1YFN A;  4B6M A;  1NYF A;  1T3L A;  2E64 A;  5KYU B;  2OTJ Q;  5EG2 A;  2QXF A;  2DTO A;  4N4H A;  2NYS A;  2O01 E;  5CKF A;  3TSZ A;  1W1F A;  3TSW A;  1GBQ A;  3M0U A;  2A08 A;  4XTW A;  4EDU A;  2J7I A;  2RHZ A;  2DL8 A;  5J39 A;  3A8G B;  3PMT A;  6AT1 B;  1AD5 A;  2EVR A;  1AWO A;  1VQN Q;  2LJ1 A;  3OS5 A;  3VUZ A;  1VQ8 T;  1I4K 1;  2LRQ A;  3QJY A;  4X9D A;  1TG0 A;  3HL8 A;  4Z88 A;  3CCV Q;  4M7D G;  2R5A A;  2QQA A;  1BIA A;  1YN8 A;  1ZUY A;  3PVL A;  3EG2 A;  1M1K U;  1VQ6 T;  3BE3 A;  4M78 A;  1OV3 A;  1VQ9 A;  2LMJ A;  3UA6 A;  4IIO A;  1UTI A;  2ENM A;  2GNC A;  1VQM A;  1QW1 A;  3OS2 A;  3M55 A;  2HZY A;  1YJW A;  3MHX A;  1BCM A;  2P0K A;  5L8R E;  2ATC B;  1AWX A;  4CC3 A;  4BAC A;  5LJ5 g;  3LWI A;  1B34 A;  1YI2 A;  3THK A;  4C0F A;  3I35 A;  5GAO m;  4F7U F;  2KXD A;  1YP5 A;  4PK4 A;  2DJZ A;  1KC8 U;  2VVK A;  1LPL A;  3G6E Q;  4ZGD B;  1M2V A;  1Q82 C;  1UE9 A;  2A37 A;  4M7A G;  3VS6 A;  3TVT A;  1MMG A;  2BKD N;  4WTO B;  4XK8 E;  2GQI A;  1P92 A;  2PNI A;  1K73 U;  2WSC E;  3EG9 A;  2KY9 A;  2K5L A;  3J7A F;  1VQ9 T;  1WJR A;  4F7U B;  1IGU A;  2L3R A;  3NHN A;  1IO6 A;  1VQO A;  3SFM A;  1VYU A;  3CME A;  2DK3 A;  4OMP A;  3TEE A;  1QCO A;  3PGG A;  4RMO A;  4C5H A;  3L2R A;  3G6E T;  1YI2 T;  3L2Z A;  2BE7 D;  3JCM Q;  2CP5 A;  2X9H A;  3OYY A;  3CPW A;  2EFI A;  2QTV A;  1PD0 A;  2LCL A;  3M5A A;  4V2S A;  3D7S B;  4XTZ A;  2XD0 A;  4MMK A;  5CQY A;  1Q86 U;  3CCE A;  4OML A;  3GOX A;  4BB7 A;  3CCM A;  1YJ9 A;  1S72 Q;  1H3H A;  1TSF A;  1Z9Q A;  5KE3 A;  2CRE A;  3L1A A;  3C4S A;  5GAO n;  4ZN1 A;  1K8A C;  3CCE Q;  4HT9 A;  1ZSZ C;  1YJ9 Q;  3AHU A;  2B86 A;  1K9M C;  2A36 A;  2AT1 B;  4LUD A;  4M7D E;  1QWE A;  2D0Q B;  3QSU A;  1DJ7 B;  1U3O A;  4MZM A;  3OQ5 A;  1JRI A;  1PC0 A;  1AWW A;  3PIO A;  3CCU A;  1D3B A;  2J6F A;  2FHD A;  4KGX B;  4EMK C;  4XU2 A;  3V7C A;  2KRO A;  1Q7Y U;  2QA4 Q;  2VXF A;  3CCU Q;  5I2S A;  3PIP A;  1OQK A;  2R57 A;  4RCC A;  1HJD A;  3QJ6 A;  3QO3 A;  3CCE T;  4DQ2 A;  1YHQ Q;  3CCM T;  1YJ9 T;  2HL5 C;  4PJO C;  2HEQ A;  1WYX A;  1RAG B;  3QZ5 B;  2P0Q A;  1AHJ B;  2E3H A;  2K5I A;  2RQT A;  4QQG A;  3N5B B;  3GLX A;  1TWB A;  1NEG A;  2EQI A;  5IHN A;  2K9G A;  2LNH B;  2BE9 B;  3CXC P;  1IZ6 A;  2EKH A;  3H0I A;  1FMW A;  4QQD A;  1Y0M A;  5C6S A;  3CCU T;  1Q82 U;  5D6W A;  2MK5 A;  1SF9 A;  2ZPG B;  3LWH A;  1RI9 A;  1GCQ C;  1W2B P;  2E4H A;  1U8R A;  3Q1J A;  2JS2 A;  5KYX B;  2VKN A;  2HNI A;  4OMQ A;  2DIQ A;  1HXD A;  3M57 A;  1Q81 R;  1QCN A;  3OY9 A;  4HCZ A;  4FYX B;  4PLL A;  3HP9 A;  2L0A A;  4E7L A;  1BIB A;  2AK5 A;  1RI0 A;  2KK4 A;  3SWN B;  3UAT A;  2LQ8 A;  2YRD A;  3R6N A;  3JB9 F;  1M3A A;  1BI3 A;  1LOJ A;  4A4F A;  2LT4 A;  3BDU A;  2IIM A;  1U06 A;  3MKD A;  4XTU A;  5GJV B;  4EMK A;  2O4X B;  4PJN A;  5LJ5 d;  1RL2 A;  4PFP A;  3QUI A;  1VQP A;  1IXD A;  2ZPH B;  4LNP A;  4PJL A;  1AT1 B;  3ZL7 C;  2E65 A;  1OOT A;  3QWX X;  1NPP A;  1M27 C;  2QYZ A;  4PL6 A;  4C92 G;  3CC7 A;  2DX1 A;  3VYG A;  5CR2 A;  1NJI R;  1K9M U;  2MMP A;  2IPO B;  3M4Y A;  2MCN A;  4E7J A;  2F5K A;  2DVJ A;  2KT8 A;  4KH1 B;  2F69 A;  3LX7 A;  4BE1 A;  2DXU A;  2YLC A;  1M2V B;  5LJ5 j;  3JB9 J;  2L8D A;  4WCI A;  3C94 A;  2P0P A;  2E1H A;  1KHC A;  2RMO A;  2V8I A;  3UT1 A;  4EMH A;  2FG0 A;  4XU3 A;  1GBR A;  5FLX E;  3RBB B;  1ZSG A;  4M77 G;  4PFO A;  1VQP T;  2QEX Q;  3EG9 B;  4MDW A;  4MZT A;  5KYU A;  4C0Z A;  1GCQ A;  2ED0 A;  2X4X A;  4C5I A;  2RK2 A;  2W10 A;  1I07 A;  3GPL A;  4KGZ B;  2HL3 A;  1W70 A;  2LCS A;  4OF1 A;  4P5N A;  3NTI A;  1BK2 A;  2D1X A;  4A4K A;  2DTI A;  2JTF A;  1VQK Q;  3QG1 A;  2BZX A;  4BE0 A;  4M7D F;  4IUT A;  2JTM A;  2RHY A;  2QDL A;  3HFO A;  1YWO A;  4J9I A;  4IIM A;  3CPW P;  2XHC A;  1VQL A;  2KYM A;  4LDY A;  3S3N A;  3OS1 A;  1AVZ C;  1MNE A;  3J81 E;  4JRK A;  1UHF A;  1AWJ A;  1VA7 A;  1XNI A;  4KRT A;  2D8J A;  4Z02 A;  2KYB A;  2DA9 A;  2K4Y A;  1YWP A;  4M75 G;  4ANJ A;  1QKX A;  3CC2 A;  4M7D B;  1KFZ A;  3CCL A;  2EGC A;  4BDY A;  1H92 A;  1J3T A;  5GJW B;  5GAN 8;  1NLO C;  1UDL A;  1G8X A;  4M7A F;  1MHN A;  2M02 A;  2DXC A;  1JJ2 S;  1JU5 C;  4E7I A;  1IRE B;  1PHT A;  4KUL A;  1QMC A;  1ZLM A;  3RNJ A;  1I8F A;  4C92 E;  1C6V X;  1VQL T;  4J5Y A;  4A4E A;  1JJ2 A;  2KRS A;  1TXQ A;  3DLM A;  3FJ5 A;  1B7T A;  3LH5 A;  2RHU A;  3I5S A;  1OX9 A;  1SSF A;  2PUO B;  2KRN A;  2RJD A;  4LDW A;  3JCM f;  2FPF A;  2HCK A;  4M7A B;  2QG9 B;  3VRZ A;  2Z0W A;  4OMN A;  4FYY B;  3CC2 T;  5DM7 R;  1LJO A;  3HKS A;  4BY6 B;  4Y91 A;  1C0M A;  3O5Z A;  3H0F A;  2PUK B;  4LXC A;  3OYM A;  4FCY A;  3CBM A;  4M77 E;  4XAX B;  2QAZ A;  2YT6 A;  1NYG A;  3BDL A;  1M3C A;  2EBP A;  4JJN K;  4RTW A;  1WFW A;  2CS7 A;  2KMT A;  5CKE A;  4J9H A;  2FRY A;  3OYJ A;  3RR6 A;  2HDA A;  2LTO A;  2JUF A;  4JJC A;  1UGS B;  2H3E B;  1WJQ A;  1RAF B;  4J6X A;  4YTL A;  2C06 A;  1E6H A;  4M7D D;  2IVW A;  2JMA A;  4J9F A;  1WHK A;  2VGM A;  2ZPE B;  3FRN A;  1ZUK A;  2HBW A;  1PCX A;  4BI8 B;  5I21 A;  3SWN C;  1FX7 A;  4OMO A;  4FT4 A;  1D0Y A;  2GCX A;  4ZTF A;  2PTK A;  4OP0 A;  2O88 A;  2LQW A;  2EYY A;  1G3Y A;  2DYB A;  3OW2 S;  3NMZ C;  4GLM A;  3C0C A;  3L2W A;  1BKB A;  2SEM A;  2MWP A;  3V8K A;  4OB2 B;  1PD1 A;  1OPL A;  1PKS A;  2QGG A;  2XDB A;  1D1C A;  3S6W A;  4TVR A;  3SB2 A;  3X26 B;  3EFR A;  4J83 A;  4C8Q G;  3RES A;  1QQJ A;  3SHW A;  3A8M B;  2KBT A;  2E5Q A;  3HSB A;  2RJF A;  4J7I A;  2EQU A;  2YSQ A;  4R56 A;  2V26 A;  1NZ9 A;  1YIJ Q;  5DY9 A;  2GTO A;  3JCM W;  1A0N B;  2DNU A;  3WVE B;  2DEU A;  3CD6 A;  2HSP A;  3PNW C;  5IXF A;  3CCJ A;  1XTD A;  2AZV A;  1C1A A;  5GAO r;  1N9S A;  1GFC A;  2CZ0 B;  1VQ8 Q;  3TU4 K;  3QXE B;  5KYX A;  4ME7 A;  1O75 A;  1TH7 A;  3CMA A;  1VQ6 Q;  3HHT B;  1OZ3 A;  2F2X A;  3PMI A;  1SSH A;  1ZQ1 A;  1YIJ T;  1R0C B;  4Z89 A;  1O9S A;  4IUR A;  1H8K A;  3JCM c;  2DL4 A;  1K1Z A;  2C0T A;  2RK1 A;  3SWN A;  4DEX A;  1NPR A;  3RKY A;  5A0G A;  2XMF A;  2VUB A;  4A54 A;  1D09 B;  4AMC A;  2AKK A;  2DRK A;  2L3P A;  1YNZ A;  3CD6 T;  4IUP A;  3CCJ T;  4VUB A;  2O4X A;  4EMG A;  2K2V A;  4CC7 A;  4M7D C;  2CKK A;  2HMA A;  1NE8 A;  1KIK A;  4RG2 A;  3MEU A;  5AYF A;  1ZA1 B;  3CMA T;  2KI7 A;  3M53 A;  3I5R A;  1ARK A;  1FMV A;  1UJ0 A;  1VQ7 A;  1VQ9 Q;  5GAM h;  5A0L A;  1EX4 A;  5LJ3 f;  1VQM Q;  4FSS A;  2CUB A;  4RTV A;  4DA4 A;  1YJW Q;  1WIE A;  3CC4 A;  1YI2 Q;  2VYT A;  4JLG A;  4AFQ C;  2QGF B;  4BE2 A;  4C8Q E;  3QBY A;  4MML A;  5LL6 S;  2HQH A;  4M7A C;  1YJN A;  3VRY A;  2BZY A;  2KXC A;  1JJ2 P;  3GBQ A;  3OYD A;  4A4H A;  3JB9 I;  4L59 A;  3JCM h;  3M0R A;  3L2U A;  2DVE A;  2EYZ A;  4BY6 C;  3CCR A;  5GAN h;  3HTR A;  3RMS A;  2J05 A;  2HSE B;  2DL7 A;  3OYN A;  1KJW A;  1VQM T;  2RH2 A;  2FB7 A;  2HKN A;  1E7O A;  1YJW T;  2X3W D;  2FPD A;  1S1N A;  3HRU A;  2COZ A;  2YLB A;  1VQ7 T;  3OYB A;  1I5L A;  1BB9 A;  4J9G A;  2ABL A;  4Y92 A;  1SG5 A;  4PFZ A;  1VQO Q;  1K0S A;  3P8D A;  3PFS A;  4ATO A;  3CME Q;  2LNV A;  2VC8 A;  2ZPB B;  4HVU A;  4MDX A;  5GAN 6;  2G6F X;  2QQ9 A;  4M75 F;  3S3M A;  1UEC A;  1KQ2 A;  5FU6 B;  4JPB W;  1UHC A;  1RLP C;  2QAS A;  2LQK A;  3E1S A;  2GTJ A;  3OYE A;  2HKQ B;  2KR3 A;  3E9G A;  2L89 A;  2KNB B;  2DL3 A;  4M7D A;  1XJW B;  3CCR T;  1R77 A;  5KYW A;  1R8O B;  3CCM Q;  4HCC A;  2P4T A;  4RTY A;  2GGR A;  4J9E A;  3X25 B;  4D8K A;  1VQO T;  3VS4 A;  3CME T;  4M75 B;  3M54 A;  4E7K A;  5FRM A;  4AFU C;  3H0H A;  3M59 A;  1H3Z A;  3EGX B;  4C92 D;  4KGV B;  2B8A A;  1N8R R;  1Y96 A;  5D7U A;  5FU7 B;  4LN2 A;  1WZO A;  1BI1 A;  1EFN A;  2RO0 A;  4D8D A;  1QCF A;  1G5V A;  3F70 A;  3M9Q A;  2E10 A;  3HRT A;  3OMG A;  3INZ A;  4II1 A;  3GNG A;  5CKH A;  2V1Q A;  2R58 A;  2KGT A;  2V8K A;  3KBG A;  4M7A A;  2M16 A;  1ABQ A;  1JXM A;  5C0M A;  2ZPF B;  4JRP A;  1SHG A;  3OS0 A;  5FRN A;  2LCC A;  1WJS A;  4XTY A;  4M77 D;  3VS7 A;  3NTK A;  2V8J A;  3EHQ A;  3EFO B;  3ER0 A;  4PJO G;  1X27 A;  3WVD B;  1OU9 A;  2FRW A;  3EFS A;  3I55 A;  1T0J A;  3OBY A;  3ULR B;  3JCM X;  2M0Y A;  1Q81 C;  1U1S A;  5GMK h;  3EGD A;  3VYH B;  2DXT A;  2DZ9 A;  3LW5 E;  1K0X A;  1WQ7 A;  3X24 B;  2JM8 A;  3OB9 A;  2DXB A;  2XK0 A;  2RB6 A;  2X4J A;  4ESR A;  2F1L A;  1Y57 A;  1OYX A;  3M0S A;  3V8J A;  1WDX A;  1X2K A;  1YIT A;  1CKB A;  2BTT A;  1KQS S;  2H8H A;  1PNJ A;  3GF5 A;  3MEV A;  2KAF A;  4M75 D;  4OGC A;  1PSF A;  1BBZ A;  1FWZ A;  2X4Y A;  3I55 T;  4JRQ A;  2E5K A;  1RAH B;  2DBM A;  1RAA B;  1NJI C;  4CC2 A;  4J9D A;  5GMK l;  1BI2 A;  1WNL A;  5CCA A;  2KRM A;  1SRM A;  2X35 A;  2FEI A;  3RDV A;  2JN0 A;  4C8Q F;  3LGL A;  2VAS A;  2LVM A;  1XQH A;  3G71 A;  5I22 A;  4ZGJ B;  2E3I A;  3A98 A;  1M9S A;  2FO0 A;  1K8A U;  1VQP Q;  1ZX6 A;  4F04 B;  1YIT T;  3G71 Q;  2DJQ A;  2CZ6 B;  4FYW B;  5AT1 B;  5GAN 5;  4FT2 A;  3HFN A;  5LJ3 h;  3ASK A;  4HT8 A;  1OI1 A;  2YUO A;  4JUV A;  3CC7 Q;  2NUZ A;  2PVO B;  4C8Q B;  1M1F A;  4LDU A;  2XDP A;  3T9N A;  3LLR A;  2YWW A;  1I0C A;  5GAN 7;  4NL3 A;  4EIK A;  1ABO A;  2EGA A;  4E7Z A;  4QKU A;  3X28 B;  2E70 A;  3VS3 A;  3MO8 A;  2CGH A;  4PJO E;  1M90 R;  3ZFJ A;  1ZUU A;  2FZG B;  3A5Z B;  1JXO A;  3G71 T;  2HQE A;  4QT7 A;  3RKX A;  2F2W A;  2DPP B;  5KYY A;  2OTL A;  3CC7 T;  4F7U G;  3A1P A;  2JS0 A;  2CP3 A;  2DEQ A;  4HCK A;  2H3J A;  2EYX A;  2MI6 A;  1SRL A;  5IAY A;  2M51 A;  1FMK A;  1RAD B;  1H64 1;  1SKU B;  1F1B B;  1UGV A;  1D0Z A;  2JVV A;  3URG A;  1Q81 U;  5FU6 C;  2RI3 A;  4FW1 A;  1V1C A;  1X6G A;  3VJP A;  1QP2 A;  3JAM E;  1R0B G;  3DKM A;  3REB B;  8AT1 B; 
#chains in the Genus database with same CATH homology
 2EKO A;  1BKB A;  2RA2 A;  1Q82 C;  2QA4 T;  4EPC A;  1M4Z A;  4PNO A;  4B9X A;  4ZN3 A;  2MWP A;  3OSV A;  4M7A G;  2WSE E;  5DLQ E;  3JCM J;  2G3R A;  1QVF S;  3V8K A;  2BKD N;  1WGS A;  3OYH A;  4C0D B;  2PVG B;  4LDV A;  4OB2 B;  4JS4 A;  1YHQ T;  4XK8 E;  1JB0 E;  5GAO q;  3FDR A;  1VUB A;  4LD9 K;  4M75 C;  2LDM A;  2JOY A;  2XDB A;  1P92 A;  3A8L B;  3QPH A;  5GAN 2;  4C5E A;  3QKJ A;  3S6W A;  1K73 U;  2WSC E;  4TVR A;  3SB2 A;  3X26 B;  2KY9 A;  3EFR A;  3OMC A;  4J83 A;  4C8Q G;  1QVF A;  2K5L A;  2LC4 A;  1X75 C;  2BUD A;  4IUQ A;  4LD6 A;  3RES A;  4A4G A;  1WJR A;  4F7U B;  5GAM f;  3OYF A;  1VQ9 T;  2L3R A;  1QVG S;  1KQS A;  3A8M B;  2E5Q A;  4CI0 C;  4XTV A;  5FU7 C;  1VQO A;  4JLI A;  3SFM A;  2EQM A;  2RJF A;  3HSB A;  4J7I A;  2EQU A;  4KT0 E;  4IUU A;  4C8Q D;  5KH6 A;  1V29 B;  4R56 A;  2DK3 A;  1ZHI A;  5IN1 A;  3RIR A;  3TEE A;  3CME A;  1NZ9 A;  5CKB A;  3PGG A;  2RI5 A;  4FL6 A;  4BD3 A;  1OZ2 A;  1Y96 B;  4C5H A;  4RKU E;  2DD5 A;  3L2Z A;  4RMO A;  5DY9 A;  3L2R A;  3G6E T;  3JCM Q;  3JCM W;  2XKO C;  1YI2 T;  3PT9 A;  2CZ1 B;  4M78 F;  1QVG A;  4QVZ A;  2A3L A;  3OYY A;  3CPW A;  3WVE B;  4C5G A;  2Y4X A;  3CD6 A;  3C12 A;  3PNW C;  3GIB A;  3SD4 A;  2GF7 A;  3CCJ A;  2EFI A;  2LCL A;  1N8R U;  3M5A A;  3MP1 A;  4V2S A;  5HY6 A;  1XTD A;  4N0A C;  4XTZ A;  3JCM d;  5GAO r;  2XD0 A;  1N9S A;  4CRI A;  4MMK A;  3QZ9 B;  2CZ0 B;  4BDZ A;  3MP8 A;  5CQY A;  1Q86 U;  2FYK A;  3TU4 K;  3QXE B;  3OBW A;  1M1G A;  5GAN f;  2EJF A;  4ME7 A;  3CCE A;  1O75 A;  2DZC A;  4BB7 A;  3LGF A;  3GOX A;  3CCM A;  1YJ9 A;  4HCB A;  2MWO A;  4E7H A;  4C92 C;  1TH7 A;  3QYH B;  1M90 C;  5LJ5 f;  2CZ7 B;  4N4G A;  4ELZ C;  5KE3 A;  3CMA A;  3CCL T;  4M77 A;  1N9R A;  2DIG A;  3HHT B;  1OZ3 A;  3L1A A;  4M78 B;  2OAU A;  3PMI A;  1VQ4 A;  2M0O A;  3C4S A;  5GAO n;  1ZQ1 A;  3M56 A;  2XG8 D;  4J6W A;  4ZN1 A;  1YIJ T;  1K8A C;  4HT9 A;  3AHU A;  1M8V A;  2VV5 A;  1K9M C;  3KUF A;  3DB4 A;  1O9S A;  4IUR A;  3A8H B;  5CKD A;  4M7D E;  3JCM c;  3HPW A;  2D0Q B;  4L6V 5;  3QSU A;  2RK1 A;  2E12 A;  2HD0 A;  5J3B A;  4PJO A;  1ZBX A;  3SWN A;  4QVC A;  1DJ7 B;  1B34 B;  1NPR A;  3RKY A;  2EJG A;  4MZM A;  3OQ5 A;  1JRI A;  5A0G A;  4JS5 A;  2VUB A;  4A54 A;  3L42 A;  5CK9 A;  4FIB A;  3C95 A;  3NFC A;  3PIO A;  3CCU A;  1D3B A;  4F7U E;  2FHD A;  4EMK C;  3JSC A;  4XU2 A;  1I81 A;  1N6A A;  3CD6 T;  2ZPI B;  1QP3 A;  3V7C A;  3UDC A;  4M77 C;  4IUP A;  3LYI A;  3CCJ T;  4VUB A;  2WSF E;  2O4X A;  3VV0 A;  1Q7Y U;  2RD1 A;  2K2V A;  5D6X A;  4EMG A;  3H8Z A;  2VXF A;  4M7D C;  4HA8 A;  3P8H A;  5KCH A;  4O5V A;  5GAN 4;  2CKK A;  2YRV A;  3MP6 A;  2QEX A;  3FB9 A;  1NE8 A;  5I2S A;  2RHI A;  3VUB A;  1X6O A;  4RG2 A;  3TCJ A;  3PIP A;  3PTA A;  2R57 A;  4Q5W A;  4RCC A;  3QJ6 A;  3QO3 A;  4OVA A;  3MEU A;  3CCE T;  5AYF A;  4DQ2 A;  2HAX A;  3UPU A;  1JBM A;  5GMK i;  3CCM T;  2QDY B;  1YJ9 T;  4PJO C;  2QI2 A;  3JCM e;  3FC3 A;  3QZ5 B;  3CMA T;  3M53 A;  2P0Q A;  2DO3 A;  5GAN 3;  5CVI A;  5GAN e;  1AHJ B;  2K3X A;  4M75 A;  2FL7 A;  2K5I A;  4JRI A;  2X4W A;  4QQG A;  1VQ7 A;  3N5B B;  2LX9 A;  5GAM h;  1VQK A;  5A0L A;  3GLX A;  5LJ5 e;  2XIC A;  5LJ3 f;  2R5M A;  4X9C A;  3JCM P;  4WF2 A;  2DTH A;  4QQ6 A;  4DOW A;  2RM4 A;  4DA4 A;  2EQJ A;  1IZ6 A;  3OYC A;  2RJC A;  2MAM A;  3CC4 A;  2Y90 A;  2VYT A;  4JLG A;  2KDS A;  3G4S A;  4BE2 A;  4D6W A;  5GAO l;  1Y7X A;  3QBY A;  4MML A;  4QQD A;  4C8Q E;  5C6S A;  3CCU T;  3OYG A;  5LL6 S;  1Q82 U;  3OSS C;  1UGQ B;  5D6W A;  4QVD A;  4M7A C;  4NOY A;  4OGE A;  1YJN A;  3L2W A;  3EAE A;  3OW2 A;  3BY7 A;  3DB3 A;  3OYD A;  2ZPG B;  4A4H A;  3JB9 I;  3LWH A;  4L59 A;  3JCM h;  4GY5 A;  3L2U A;  2DVE A;  1W4S A;  3QHS A;  4M78 G;  4N0A A;  3V8L A;  4BY6 C;  4JDS A;  3UWN A;  2QEX T;  3CCR A;  1U8R A;  4X34 A;  3Q1J A;  5GAM d;  5GAN h;  4ELY C;  1G3W A;  1XOV A;  3RER A;  4BI4 A;  2DD4 A;  2OTL T;  3MET A;  2HNI A;  2DIQ A;  4C8Q C;  3RMS A;  1HXD A;  5LJ5 h;  5A2Q E;  3OYN A;  4M78 D;  3M57 A;  1VQM T;  2RH2 A;  3O8V A;  1G3T A;  4BI3 A;  2FB7 A;  4C92 A;  4E47 A;  1BI0 A;  1YJW T;  1VQ5 A;  3ZBD A;  3CXC S;  3HRU A;  3QDR B;  3I56 A;  2YLB A;  1VQ7 T;  1VQK T;  3OYB A;  1I5L A;  3CPF A;  3OY9 A;  4HCZ A;  5GMK m;  3BFM A;  4PLL A;  3HP9 A;  3V7S A;  4E7L A;  3JB9 D;  1BIB A;  3P8D A;  2EJ9 A;  3PFS A;  4ATO A;  2HBP A;  3E19 A;  1WQW A;  1RI0 A;  2KK4 A;  2LNV A;  2VC8 A;  3SWN B;  5LJ3 g;  2ZPB B;  4ZGE B;  2LT1 A;  2LQ8 A;  4MDX A;  5GAN 6;  3MEW A;  2E41 A;  2QQ9 A;  2GFU A;  4M75 F;  3RMQ A;  3S3M A;  3JB9 F;  2AHJ B;  1D3B B;  2EYQ A;  4GLK A;  5CQX A;  1KQ2 A;  5GAN d;  1BI3 A;  5FU6 B;  1W2B S;  1LOJ A;  4A4F A;  2LT4 A;  3BDU A;  2LQK A;  4XTU A;  5GAM j;  3E1S A;  4EMK A;  1KD1 C;  2O4X B;  3J7A F;  5LJ5 d;  1RL2 A;  3OYE A;  3QUI A;  1VQP A;  3E9G A;  2L89 A;  3P8B B;  1LNX A;  2QTX A;  2ZPH B;  1N27 A;  4IKF A;  2ZCF B;  2K57 A;  1VIE A;  1M90 U;  1WPY A;  2F5T X;  2OTJ A;  1YBY A;  4M7D A;  2XID A;  3M4G A;  1Q86 C;  3CCR T;  3CCQ A;  2GFA A;  3QII A;  1R8O B;  3J80 E;  4HCC A;  2E65 A;  2P4T A;  4J7F A;  2EIF A;  1NPP A;  4PL6 A;  3RUX A;  3X25 B;  3H6Z A;  4C92 G;  3CC7 A;  3VYG A;  1VQO T;  2MF2 A;  3X20 B;  5CR2 A;  3MEA A;  3CBP A;  4FU6 A;  1K9M U;  4F7U A;  3CME T;  4M75 B;  2MMP A;  5GAM e;  3M54 A;  5M9O A;  4E7K A;  1VQ5 T;  3M4Y A;  5FRM A;  4XU0 A;  2E6N A;  5KE2 A;  4XQ3 A;  3M59 A;  3I56 T;  2M9U A;  1H3Z A;  4C92 D;  3FJP A;  1QVP A;  2B8A A;  4E7J A;  3JB9 H;  2L5Q A;  2F5K A;  1MGQ A;  5D6Y A;  3GP8 A;  4L5G A;  1Y96 A;  2F69 A;  2RHX A;  3LX7 A;  3JCM V;  5HKC A;  5GAN j;  1VQN A;  5FU7 B;  2DXU A;  2D9T A;  2YLC A;  4BE1 A;  3OYK A;  3TRE A;  1KC8 U;  1BI1 A;  4C0D C;  2RO0 A;  4C92 F;  1G5V A;  3F70 A;  4C0G A;  2QQS A;  3M9Q A;  5GMK e;  5LJ5 j;  1UB4 A;  2E10 A;  3HRT A;  3OMG A;  2L8D A;  3JB9 J;  3C94 A;  2P0P A;  3INZ A;  2E1H A;  1KHC A;  4FM4 B;  3CCV A;  4II1 A;  1VQM A;  3GNG A;  5CKH A;  4OB3 B;  1UGR B;  2V8I A;  2I2L A;  3UT1 A;  2R58 A;  4EMH A;  4A53 A;  4OMF B;  4XU3 A;  3G7Z A;  2V8K A;  5FLX E;  5A0D A;  3KBG A;  4XU1 A;  2RJE A;  3CCS A;  4M7A A;  4M77 G;  2M16 A;  1Q7Y C;  1VQP T;  2DKG A;  5CO7 A;  2WAC A;  4MDW A;  4BUG A;  5C0M A;  2ZPF B;  4JRP A;  4MZT A;  4C0Z A;  3OS0 A;  2CYZ B;  2LCC A;  3OYI A;  1M1K C;  5FRN A;  2OTJ T;  1VQ4 T;  5DLO A;  1WJS A;  2X4X A;  4XTY A;  4C5I A;  2RK2 A;  2NLU A;  2XI9 A;  3FLG A;  4M77 D;  5LJ3 d;  3VU3 C;  3WXM B;  3GPL A;  1X01 A;  2V8J A;  3NTK A;  4RCB A;  3ER0 A;  4C92 B;  4PJO G;  4C8Q A;  2D6F A;  2QQR A;  4QW2 A;  4OF1 A;  4J6Y A;  4P5N A;  3WVD B;  3EFS A;  3NTI A;  3I55 A;  1Y71 A;  4A4K A;  1UGP B;  2DTI A;  2JTF A;  3OBY A;  4M77 F;  4NL2 A;  3JCM X;  2RI2 A;  3QG1 A;  4M78 E;  1Q81 C;  4UC4 A;  4BE0 A;  1U1S A;  4M7D F;  5GMK h;  1Y07 A;  4IUT A;  3QYG B;  3HRS A;  4PJO D;  5J26 A;  2JTM A;  3VYH B;  2GQV A;  3OA6 A;  3G6E A;  2RHY A;  2DXT A;  3HFO A;  2DZ9 A;  1U1T A;  3GNF B;  3A8O B;  3LW5 E;  2XHC A;  4IUV A;  1WQ7 A;  1YCY A;  3X24 B;  3L2Q A;  1VQL A;  1VQN T;  5GAO p;  4LDY A;  3S3N A;  2JZ2 A;  1FXX A;  3OB9 A;  4M75 E;  2DXB A;  2M1H A;  4PJO F;  1KC8 C;  3OS1 A;  3ZEH A;  2IG0 A;  2XK0 A;  2Y4Y A;  2RB6 A;  2KSS A;  2X4J A;  3CCV T;  3J81 E;  4JRK A;  1NJI U;  5I2M A;  3R6O A;  1OYX A;  1KQ1 A;  4M78 C;  1KHI A;  2HQX A;  3SDZ A;  3V8J A;  4EMK B;  4DOV A;  2EWN A;  1XNI A;  4KUI A;  5CIU A;  3CCS T;  5LJ3 j;  4Z02 A;  4M77 B;  4B9W A;  4PKC C;  1YIT A;  3OYA A;  2K4Y A;  4M75 G;  3JB9 G;  1BYM A;  1KQS S;  1K73 C;  3JRZ A;  3CC2 A;  2DAQ A;  4N4I A;  4M7D B;  2KVQ G;  3CCL A;  4Y28 E;  4M7A D;  3ME9 A;  1PSE A;  1KG1 A;  3GF5 A;  1GXI E;  4BDY A;  3BW1 A;  3MEV A;  2KAF A;  4M75 D;  3VKI A;  1YIJ A;  5GAN 8;  2KQW A;  1PSF A;  4OGC A;  4J8O A;  1HK9 A;  4PJO B;  5KCO A;  4M7A F;  1MHN A;  1FWZ A;  2X4Y A;  4OB1 B;  2DXC A;  3CPW S;  3I55 T;  3CXC A;  4JRQ A;  3NTH A;  3CC4 T;  1JJ2 S;  5LJ3 e;  1NJI C;  3G4S T;  3JCM b;  5GMK l;  1BI2 A;  4E7I A;  1IRE B;  1WNL A;  5CCA A;  4KUL A;  3DLL A;  2X35 A;  1EIF A;  4PLI A;  4HKE A;  2JNG A;  2JN0 A;  1YJN T;  2A7Y A;  1VQ8 A;  1I8F A;  4C92 E;  1VQL T;  2PQW A;  2ZZD A;  4C8Q F;  4J5Y A;  4A4E A;  1N8R C;  3LGL A;  3S3O A;  4R55 A;  2LVM A;  1JJ2 A;  2BIV A;  1G3S A;  4RG8 A;  3DLM A;  1KD1 U;  5HK0 A;  2VXE A;  1XQH A;  2RHU A;  3G71 A;  3CCQ T;  1S72 A;  4LDX A;  1W2B A;  3KXT A;  2E6Z A;  2K3Y A;  4ZGJ B;  1SSF A;  2PUO B;  4LDW A;  2RJD A;  4FSX A;  3JCM f;  5IT9 E;  2PVD B;  1VQ6 A;  1M9S A;  4M7A B;  1K8A U;  5GMK j;  1VIF A;  1YIT T;  2E64 A;  2CZ6 B;  3CC2 T;  5DM7 R;  1LJO A;  5EG2 A;  2QXF A;  3HKS A;  5GAN 5;  4BY6 B;  2DTO A;  4Y91 A;  4FT2 A;  3LH0 A;  4N4H A;  2K5F A;  3HFN A;  3ASK A;  5LJ3 h;  1OI1 A;  2O01 E;  4HT8 A;  2QQB A;  2PUK B;  4JUV A;  5CKF A;  3E9F A;  2PVO B;  3OYM A;  4C8Q B;  1M1F A;  4LDU A;  3RKW A;  2XDP A;  3CBM A;  4M77 E;  4XTW A;  3T9N A;  3LLR A;  4XAX B;  2VGN A;  4EDU A;  5GAN 7;  3BDL A;  3FEO A;  5GAM g;  4NL3 A;  2RHZ A;  1M5Q 1;  5J39 A;  4JJN K;  2FVU A;  3A8G B;  2CS7 A;  1UEB A;  2EQK A;  2KMT A;  3PMT A;  2XDD A;  5CKE A;  3CBO A;  4KUD K;  2QA4 A;  4XTX A;  3X28 B;  2E70 A;  3OYJ A;  5CAI A;  2LTO A;  3MO8 A;  3OS5 A;  2CGH A;  3VUZ A;  1VQ8 T;  1I4K 1;  4PJO E;  2PU9 B;  2JUF A;  3ZFJ A;  2YHT A;  2LRQ A;  3QJY A;  4X9D A;  5FRO A;  1UGS B;  4NS5 A;  3HL8 A;  1YHQ A;  3A5Z B;  4M7D G;  1WJQ A;  3L2V A;  2R5A A;  3M58 A;  4KBM B;  3G71 T;  2HQE A;  2QQA A;  4J6X A;  1BIA A;  4YTL A;  3FIF A;  1S72 T;  3RKX A;  2C06 A;  1M1K U;  1VQ6 T;  2DPP B;  4M78 A;  4M7D D;  2IVW A;  3OYL A;  1VQ9 A;  2OTL A;  3CC7 T;  4F7U G;  3JCM g;  2VGM A;  3V7R A;  2ZPE B;  3FRN A;  4BI8 B;  5I21 A;  2DEQ A;  2H3J A;  3SWN C;  1FX7 A;  5GAN g;  4ZTJ A;  1QW1 A;  2MI6 A;  5IAY A;  3M55 A;  4FT4 A;  3OS2 A;  1YJW A;  3MHX A;  1H64 1;  2P0K A;  5L8R E;  2GCX A;  4ZTF A;  2ZGW A;  4BAC A;  5LJ5 g;  3LWI A;  1B34 A;  1YI2 A;  4C0F A;  2JVV A;  3URG A;  4OP0 A;  1Q81 U;  4M7A E;  5GAO m;  5FU6 C;  4OB0 B;  2RI3 A;  3CEY A;  4MZP A;  1G3Y A;  2EAY A;  2XU8 A;  3VJP A;  4F7U F;  1QP2 A;  3JAM E;  3OW2 S;  3MCA B;  3DKM A;  4O6J A;  2DJZ A;  5HK3 A;  4ZGD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...