2K5FA

Solution nmr structure of feoa protein from chlorobium tepidum. northeast structural genomics consortium target ctr121
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
MKLSELKAGDRAEVTSVAAEPAVRRRLMDLGLVRGAKLKVLRFAPLGDPIEVNCNGMLLTMRRNEAEGITVHILAGDEGHPHGWPGFRRRHRFGKRALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Ferrous iron transport protein A
publication title Solution NMR structure of FeoA protein from Chlorobium tepidum. Northeast Structural Genomics Consortium target CtR121
rcsb
source organism Chlorobaculum tepidum
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k5fA01
3MHXA 2K5LA 1BI3A 1P92A 2H3JA 3GLXA 3E19A 1U8RA 1G3TA 2LX9A 1BI0A 1G3SA 2K5FA 1FX7A 2K5IA 2QQBA 4O6JA 1G3WA 1FWZA 5CVIA 1BI1A 3HRUA 1QW1A 1QVPA 2QQ9A 3HRSA 1BI2A 1G3YA 2GCXA 3HRTA 2K4YA 1BYMA 2QQAA 4O5VA
chains in the Genus database with same CATH superfamily
4LD9K 1I5LA 1GFCA 2DVJA 3OBYA 1RAGB 1OZ3A 3KXTA 1BB9A 3I55A 2L89A 2KYBA 1YIJT 1F1BB 4P5NA 3JCMV 1QKWA 1AWWA 4ME7A 2NYSA 3V7RA 4JRQA 4C5EA 3LX7A 5GMKh 1N8RU 2E65A 4BACA 2RNAA 3S3MA 4ORZA 2Y4YA 2HSPA 2KXDA 4M78A 1WX6A 4CC3A 1N27A 1YCSB 5DY9A 1MMGA 1WJSA 4M77G 3NGPA 1NJIR 2EPDA 2GFUA 5DLQE 1XTDA 1Y96A 2XI9A 1AWXA 1KG1A 4AT1B 2GTJA 3CXCS 3JSCA 4OVAA 2NUTA 4JRPA 2XKOC 3M55A 5FW9A 2LZ6B 2COZA 4M78C 1QLYA 3EAEA 3M53A 5HK0A 2RHUA 1K0SA 1O9SA 2G6FX 4IIOA 1OULA 1M1GA 2OI3A 1MGQA 4C8QC 4FCYA 4RCCA 4F7UA 5GAN5 1VQ5Q 4XK8E 1VQLQ 4X1VA 1TOVA 4TVRA 4X9CA 3LWIA 3HSBA 2QAZA 2JN0A 3CCST 1YJWT 3I35A 5GMKj 4JJCA 3MEAA 4OGEA 2OTJQ 2WACA 2CT4A 3HP9A 5FWBA 5DLOA 5FU6C 3FDRA 4V2SA 1MNDA 1GBRA 1GFDA 4IIMA 3L42A 2LVMA 5GAOp 3CC2T 2COWA 5LJ3g 1ZSZA 3RKXA 2VV5A 2EW3A 2LQ8A 2MF2A 5C0MA 1OI1A 2VWFA 1QP3A 2HL3A 1VQ8A 2HBWA 1YJNA 2LMJA 1K76A 4C92A 3QYGB 1OX8A 4BE2A 1T0JA 2CYZB 3G71T 4FYWB 1TUCA 2VKNA 1ZSZC 4E7IA 1B7TA 5KYXA 3RR6A 4BUGA 2BZXA 1TTHB 1OU8A 1VQ4T 4QVZA 5GAMd 2QTXA 5GAOm 2WSFE 2XICA 1QVPA 2ECZA 1YIJQ 5GAN8 9ATCB 3I9QA 3ULRB 2O9VA 3OYJA 4C92C 3OYNA 2KBTA 2E3HA 2DF6A 3EGDA 1Q95G 3P8DA 3OSSC 1KK7A 4CC7A 5CCAA 1BI3A 4IUQA 5GANe 5IHKA 5KE2A 1KD1R 1UDLA 2NUZA 2JTFA 1NJIC 1KC8R 2D0QB 4M78D 1NE8A 2A7YA 1FWZA 4C8QF 2LTOA 2LCSA 2E6ZA 3VV0A 1VQPA 1PHTA 1M27C 5CKEA 4M7AE 1WLPB 4C8QD 3JCMP 3QO3A 3EFOA 2FRYA 4M77A 2EYXA 2PU9B 3S3NA 5FRNA 1RABB 3CCRT 4PJNA 2VGMA 2B86A 5LJ3h 2JVVA 4C5HA 4F17A 3G7ZA 1NJIU 1UGPB 1Q82R 4PJOE 4JJBA 3RERA 1VQKA 3L2QA 5IXBA 4M77C 4JDSA 3TU4K 1YWOA 1WXUA 2ABLA 5CR2A 4DBQA 1YP5A 3CCSQ 4RCBA 1YJWQ 5CKBA 1AWJA 3X26B 2KY9A 4XQ3A 3LH5A 5FU7C 3CCQT 2BZYA 3JCMb 4M7DG 1S1NA 4IURA 1R8OB 1MV3A 2KAFA 4A4FA 1UFFA 3WXMB 4E2FB 2DIGA 2FPDA 5KYWA 1PC0A 3QBYA 1CKBA 3CC2Q 1V29B 1H3ZA 4M75F 4OMNA 4ZTJA 3EGXB 3JCMQ 1Z9QA 3VS5A 4J6YA 4M7DB 3OYBA 4C92D 2O88A 1QVGA 1K8AR 3J80E 1PSEA 2SRCA 3G71Q 4BDZA 2FEIA 5LJ3j 2RQRA 4E7JA 2EKHA 4BY6B 1D1BA 1VQ4Q 2A28A 4MZMA 3A8MB 1VQ7T 4AMCA 1YBYA 3OW2P 1RACB 2A36A 4KUDK 4X9DA 1KD1C 2NWMA 2CP0A 2RJCA 5HCKA 1KC8C 5IH2A 1C6VX 3ER0A 1D1CA 4J9FA 3GOXA 4FL6A 2DXCA 3HPWA 4JRKA 2CZ7B 5IHIA 2RHXA 2HBPA 3HRSA 3KUFA 4HKEA 1UUEA 4PJMA 5D6WA 1J3TA 4F14A 5GAMe 4M77D 3VYGA 2QI2A 2O9SA 1N9RA 2KI7A 5A0LA 3H41A 3GNGA 3CCRQ 3LYIA 2K79A 4N4HA 3I5SA 2COYA 1RL2A 1KC8U 1Q82C 3QIIA 3M57A 5CO7A 2CSIA 3P8BB 2H8HA 3GIBA 3QWYA 7AT1B 4IUVA 4VUBA 1ZBXA 1HYOA 3PIOA 4OF1A 4XTZA 1TXQA 4HT9A 1ZUKA 1H92A 1FMVA 2RJEA 2DNUA 4BE0A 3G6EA 2O4XB 1YITQ 3FIFA 2C0IA 3QDRB 1KQ2A 2DRMA 5FWCA 4RKUE 4PFOA 2E70A 2MMPA 2KSSA 4J9IA 2GQVA 3CCQQ 2AKKA 3TQ7P 1BU1A 2FZGB 2MYSA 2LCCA 3H0FA 2X4XA 2F69A 1E7OA 4ZN1A 3QJYA 1YWPA 4AFQC 2MIOA 5LJ5d 3VYHB 1KJWA 3CXCP 3OBWA 3SWNB 1W2BA 3CCET 4C0ZA 2YT6A 2K2MA 1PKTA 5GAN6 4KULA 5D7UA 4BE1A 2V1RA 2F2WA 1UGSB 4AFZC 1K8AC 3EG9B 5D6YA 3GP8A 4J9CA 3META 2RD1A 4R56A 4QQDA 3VS1A 2FYKA 2LNVA 4J9GA 1YHQA 2FZKB 1TSFA 1VQ7Q 3CCMA 2ATCB 3CCVA 2ZGWA 3REBB 2M0OA 3X24B 4RTXA 1PWTA 3OYIA 1VUBA 2FG0A 3CC7T 1YI2T 3VS0A 2B8AA 1RADB 3RESA 1VQOA 2C0OA 1K8AU 3R6NA 3OYCA 3SHWA 4ZGDB 1LOJA 2QASA 2O2OA 5A2QE 5M9OA 1TUGB 1KQSP 1D09B 2EVRA 4WCIA 3OMCA 2X4JA 3FB9A 4OMFB 1VQNA 2RN8A 5GANh 4IUTA 2KROA 3GBQA 3JB9F 2LNHB 2Z0WA 2JM8A 2DETA 3CPWA 3WVEB 4M78G 2PZ1A 4LUEA 1MNEA 3V7SA 2DYBA 1MMNA 2VUBA 3FJPA 1KHCA 4BI4A 1QKXA 3UA6A 4GLKA 2EKOA 3LH0A 2YXYA 4MDWA 3BY7A 5CVIA 1XJWB 2K7AA 2FHDA 4C8QG 3NFCA 1NYFA 2L3RA 1WHJA 1ZX6A 3G4SA 3E9FA 4OB0B 3JCMe 4M78B 1QVGS 1R0BG 1PD0A 5CAIA 1T3LA 3NTKA 2CH4W 1WHLA 1Y96B 1G3WA 4BDYA 2CKKA 1E6GA 1X01A 3A8GB 4F7UG 3VJPA 3DKMA 2O31A 2NUTB 5HK3A 1IHWA 2MWPA 4Q5WA 4ZNXA 3CCEQ 1IGQA 1MUZA 4Z8AA 2DIQA 5C6SA 2HDAA 3RMSA 1GRIA 1SEMA 3OW2S 2W0ZA 2D9TA 2X4WA 4FT2A 3OYFA 4F7UB 2M9UA 1BCOA 5FU6B 4D8KA 1UJ0A 3CMAQ 1ZHIA 3CC4A 4L6V5 1NLOC 1K9MU 1SSHA 1Y07A 4JZ3A 1S72T 4N4IA 1M2VA 2YWWA 2DPPB 3I56T 1ZA2B 4HVVA 4FW1A 3OS2A 2YDLA 5LJ5e 3TEEA 4M75G 2G3RA 1I07A 2V26A 2KEAA 4C92G 3L2RA 1V1CA 3CC7Q 1YI2Q 2KT1A 1RLPC 1KIKA 5I22A 5GAOn 2DKGA 2HL5C 3LLRA 5GANd 4HCCA 2EYZA 1LJOA 1WHMA 2OTLT 2KRMA 4QVDA 1ZSZB 2CP3A 1LNXA 1VQMT 2DLPA 4LE9A 2AZVA 2PNIA 3CEYA 1IXDA 3TVTA 1ZLMA 1W4SA 1WJQA 1VQ6A 1SKUB 4C92B 2J6KA 1G5VA 2RQTA 1I5OB 3EH1A 2MWOA 3UF4A 2XHCA 2EWNA 2K3XA 3N5BB 3OYYA 5KYXB 3ME9A 3V8JA 3S6WA 5A0GA 4XTYA 2DMOA 2L2PA 2JOYA 4E7SA 1E6HA 1O75A 3ZFJA 2VXEA 3DLMA 1T0HA 5GAMh 2JTMA 1W2BS 4ELZC 3PVLA 2PUOB 3OB9A 5GANf 3A5ZB 4HVUA 2RA2A 1AT1B 2JTEA 1Y71A 1EZZB 2CH4A 2EFIA 2P0QA 1VQ5A 2EBPA 4WTOB 2BIVA 4C8QA 1VQLA 2VB6A 1AWOA 3C95A 3M0RA 4Y28E 4JZ4A 2BUDA 4J83A 1Y0MA 2D0NA 2E3IA 2CP6A 1I1JA 1KFZA 1M1FA 2PVOB 2F1LA 3EFOB 3OY9A 2OTJA 4M77B 1JJ2A 1X6GA 2M1HA 2BE9B 2DL8A 2EGCA 2ZPFB 1IGUA 4PJOA 2WSEE 1AD5A 3SDZA 2ZZDA 5GMKm 1WXTA 3VS2A 4KT0E 4A54A 1K73U 2HQXA 1BI0A 5FU7B 2VYTA 2X3WD 3PMIA 2KK4A 2ENMA 3NTHA 2KNBB 2DE0X 2EQIA 4KGXB 1K1ZA 2FL7A 2QXFA 4PJOC 4Z89A 3JCMW 5GAMj 4DA4A 3RKWA 2CS7A 1S72Q 5GAN7 2WSCE 5GAN3 2YLCA 3I56Q 2JS0A 2H3JA 4GLMA 1WHGA 4XTUA 4AG2C 1KQSS 4DEYA 4II1A 4J5YA 1JEGA 2X51A 2L0AA 1HK9A 2RQUA 2LT1A 4PL6A 2EQKA 1YN8A 4HCKA 2OJ2A 1YIJA 3VS4A 3M9QA 1QVFA 1KHIA 1D0XA 4M75A 5KYWB 2OTLQ 2DFUA 1H3HA 1K0XA 1CSKA 2ZPHB 1VQMQ 4ZGJB 1JXMA 2RF0A 2FPFA 3JAME 4IUPA 3GLXA 1G3TA 1T3SA 2DX1A 1XOVA 3M0UA 4HA8A 3JB9J 3PT9A 2RPNA 4FW2A 1YJ9T 1W6XA 2RJFA 4M75C 1NBEB 4JLIA 4EMKA 2DXUA 4QVCA 2YHTA 2R57A 1BYMA 4RG8A 3UATA 4UC4A 1VA7A 2LJ0A 3EG0A 2ESWA 3CCUT 3RKYA 1Q86R 1KSWA 4M7AF 1X2KA 2KT8A 4EMKC 4OMOA 3CCJT 4LDUA 1V76A 2MAMA 1BK2A 2FZCB 3JB9G 2EJGA 4O5VA 5GJVB 1W1FA 3OYLA 2R5MA 5CK9A 1SHGA 2DL3A 4LNPA 3CCSA 4M78E 1YJWA 1I4K1 5GAMf 5KYNA 4PJOF 3QDFA 4KH1B 4BI3A 2J6FA 4HVWA 3JCMh 4FIBA 2LT4A 2O01E 4NOYA 4FYYB 3OYAA 1U06A 4KBMB 4PJOD 2A3LA 2DAQA 3C94A 3M5AA 1VYVA 4Z88A 3S3OA 3H8ZA 3VUBA 3QKJA 1ABOA 3CC2A 2LC4A 1WPYA 1YITT 1WDXA 3DLLA 1X43A 1XNIA 4LDXA 2C0TA 1RAFB 2Y90A 1PKSA 2MCNA 4ZGEB 5DM7R 3IQLA 2ZPIB 3CPFA 4F7UE 1QWFA 3UWNA 1IRXA 1Z9ZA 2JZ2A 1M4ZA 1X27A 2H3EB 2JUFA 2QG9B 3G71A 2EGAA 2PVDB 2DJZA 2AHJB 2QTVA 4RTVA 1QVGP 1VQ4A 1G3SA 3GNFB 4EPCA 4OB3B 1FMWA 1G2BA 2QQBA 1PRMC 1MHNA 2CUBA 5I2SA 3H0HA 4AG1C 1EFNA 1SHFA 4ATOA 3TCJA 3VUZA 4M75D 4ESRA 1JB0E 4PKCC 1RAEB 5LJ5h 4ZTFA 3JV3A 2K3BA 3TREA 2RHYA 3MP6A 4XTXA 4DQ2A 4MMKA 3MPUB 4B6MA 4C0DC 1Q7YR 1YJ9Q 3FJ5A 4D8DA 3CMET 1OEBA 3ASKA 2K2VA 4C92E 3C12A 3L2WA 2V8JA 2LP5A 2QA4T 4JJNK 2LDMA 3LWHA 1M1KR 2QQAA 4K11A 2HD0A 2EIFA 3OYMA 3MKDA 1FXXA 2D1XA 3CCRA 2J6OA 2DVEA 1Q86C 3CCUQ 3CD6T 2J06A 4C0FA 4OMMA 1VIFA 2CDTA 3OMGA 3HRUA 3CCJQ 3VRZA 1RUWA 1M5Q1 1GL5A 3JCMd 2E41A 4RTUA 1UG1A 4M4ZA 4XU0A 5HY6A 4XAXB 2IG0A 2KDSA 2DTIA 1PM3A 2ED0A 2KQWA 4ANJA 1UGRB 1UGVA 3CBMA 3T9NA 5LJ5j 2A08A 3CCQA 2LX7A 5GMKe 2CZ0B 2EJFA 5CQYA 1K4US 1VQ9T 2Y4XA 4FM4B 1Q86U 1VIEA 2DO3A 4J9HA 2E10A 4E7KA 2K57A 4M77E 2J05A 3PE0A 1EX4A 3QUIA 3BDLA 1QVFS 2EAYA 5IN1A 2SEMA 2E6NA 3EHRA 2LX9A 4OMLA 2HNIA 1AZGB 3INZA 1X6OA 2VGNA 3WVDB 5GANg 1X6BA 1QWEA 1X2QA 1W2BP 3JCMf 1SRMA 2HKNA 3HL8A 2JXBA 4HT8A 4Z02A 2KYMA 4FU6A 1K9MR 2EQUA 2OX7A 4ZN3A 2NUPB 2RHIA 3OS1A 2KRNA 2P0PA 5EC7A 1VQ7A 2BZ8A 3RDVA 2LJ1A 2DL7A 2XIDA 3UA7A 5FRMA 2QEXT 2XDBA 2GNCA 2JT4A 1Q7YC 2KE9A 4A4HA 3CMAT 1PSFA 1UE9A 1BCMA 1B07A 2YUPA 1RI9A 5KYYA 1D0ZA 1TG0A 3CMEQ 2DEQA 5J39A 2RO0A 3M54A 1BI1A 2LQWA 4E7HA 1WJRA 1M1KC 3CXCA 3C4SA 2QA4Q 2CP2A 3NMZC 2CT3A 2EGEA 5LJ5f 2DRKA 1FYNA 3QSUA 3CD6Q 2YLBA 4OMQA 4C5GA 2DA9A 3MEWA 1Q7YU 3CPWP 3CCLT 3QWXX 2QQRA 2DM1A 3NHNA 3BW1A 3SEMA 2JNGA 2NLUA 1M1KU 1HD3A 1TUDA 2K5LA 4PJLA 3QG1A 2KVQG 4QQ6A 2L3PA 3L2VA 3JB9D 3CCVQ 3ZBDA 1VQ9Q 4NL2A 2DYIA 2GQIA 1H641 2HQEA 2R58A 3D7SB 2L8DA 1LPLA 2GF7A 3X25B 3VU3C 4FYXB 2YRVA 3CCEA 2E12A 1NPPA 1K73R 1NEGA 2K5FA 1AEYA 1FX7A 4E47A 3OS0A 4A4EA 3E1SA 4OP0A 2DZCA 1K9MC 4JS4A 2K6DA 3I55T 4PJOG 2VXFA 2DEUA 4JJDA 4C8QB 1D3BA 1G8XA 3HRTA 4J9DA 5LJ3e 4F16A 3FLGA 1OPKA 2PVGB 5GANj 4BD3A 5GAMg 1B34A 2IPOB 5IT9E 1GCQA 1NYGA 3SWNA 4M7DF 1FMKA 3CC7A 1YI2A 2QEXQ 1VYUA 2X3XD 4M7DE 3M58A 1UJYA 5LL6S 4KGZB 2W10A 2RI2A 1RLQC 2F5TX 2JW4A 4L5GA 1GCQC 5I21A 4MZPA 3L1AA 2QGFB 3E9GA 4L59A 3SWNC 3PGGA 1NLPC 4IUUA 1ACMB 2XK0A 1IREB 1RAHB 3V8LA 1RAIB 3VS3A 3JB9H 4R55A 3ZL7C 1QMCA 2V8KA 3QZ5B 1YNZA 3M0TA 4QW2A 2LQNA 2E1HA 2DL4A 4A63B 2XD0A 4XTWA 4XU2A 1TU0B 5CKFA 2JS2A 3CCLQ 4M75B 1G83A 4KH0B 3HHTB 3KFVA 4PFPA 1XQHA 1JO8A 1OZ2A 1PG5B 1NZ9A 3L2UA 2K4YA 5GAOr 1WXBA 2MPXC 3CBOA 2HSEB 2LCLA 5GAOl 5L8RE 1UGQB 2P84A 2DERA 1OV3A 2HCKA 3L2ZA 3QJ6A 5J3BA 1YCYA 5FROA 4EMKB 3MCAB 5KE3A 2BE7D 2EYYA 3EGDB 3JCMJ 3GPLA 3PMTA 1NG2A 3SD4A 1VQ8T 2I0NA 3QHSA 1YJNT 1K73C 3EFRA 3V8KA 2HQHA 4M7AA 3TSZA 1M90U 1JJ2P 2VASA 2CP7A 1YFNA 1LCKA 4YTLA 2ZCFB 1M3BA 2KGTA 1I81A 1MV0B 4X34A 1VQ6Q 3E2UA 2RQVA 3I55Q 2M02A 2ZPBB 4Y92A 1X69A 2EYWA 4PK4A 1VOMA 1AVZC 3Q1JA 3M0PA 3J7AF 4M7AC 1S72A 3PFSA 2F5KA 4DBFA 1N6AA 3I56A 1UEBA 2X9HA 1PNJA 3VS7A 3OYDA 2LQKA 2A37A 3PIPA 1SPKA 3SFMA 3OQ5A 3MP1A 2YSQA 1M8VA 4D6WA 1M8MA 5KYUA 2RB6A 1UTIA 1VQPT 2E64A 2OTLA 1RI0A 4PJJA 1TS9A 3VRYA 1VQMA 2RHZA 3RNJA 3DB3A 3UT1A 3EGUA 5GMKi 1QVFP 3O5ZA 3M4YA 2BKDN 4RG2A 2QGGA 3F70A 3JCMg 3CPWS 4RTZA 2OAWA 1KQ1A 3U23A 2J7IA 2FB7A 3A8LB 3A1PA 3H9NA 1VQKT 2E5QA 1QCOA 1P92A 3M56A 4C0DB 3OYEA 3FEOA 3REAB 5IHNA 1R0CB 2JMAA 1OPLA 3M59A 4DOVA 4J8OA 1R77A 3BE3A 2FPEA 2XDPA 2HAXA 1WQ7A 4MDXA 1BI2A 1G3YA 1M30A 8ATCB 2FRWA 2ROLA 1N5ZA 1CKAA 3MJXA 1H8KA 1JRIA 2XMFA 2GFAA 4PFZA 1Q81R 3I5RA 1M3AA 4FT4A 2IIMA 1ZUYA 3QZ9B 2RMOA 4OB1B 2MOXA 2XU8A 2OAUA 3JCMc 1VQ8Q 2DD4A 2JJ9A 5LJ5g 4DBHA 5CIUA 1YJNQ 3OA6A 3LGLA 6AT1B 4M78F 2M51A 4MMLA 4M7AD 5D6XA 1UHFA 2M0YA 2RJDA 1QCNA 2GGRA 1GBQA 1U5SA 1JU5C 2CP5A 1K9AA 5GAOq 5CKDA 2KMTA 4EMGA 2QQ9A 2HMAA 3PNWC 2DXTA 4C8QE 4LD6A 3QYHB 4LDVA 1JBMA 2XDDA 1ZQ1A 2YRCA 4FSXA 2ZAEA 2QQSA 3BFMA 1MMAA 2HKQB 4LDYA 4F7UF 1WA7A 3VS6A 3FRNA 4N4GA 3MEUA 1PRLC 3EH2A 1VQPQ 1GXIE 2E4HA 1UHCA 2V8IA 3OSVA 4NL3A 2EYQA 4BI8B 5I11A 2YUQA 4XU1A 1C0MA 1OX9A 4R0KA 5IXFA 2K3YA 3OYGA 5AYFA 2YRDA 1YJ9A 1I0CA 3THKA 4J7IA 4PLIA 3FC3A 1OYXA 2CSQA 4HXJA 4J9BA 2JMCA 1WHHA 1VQKQ 1OU9A 2QDYB 1SRLA 3EG2A 2DTOA 1RAAB 1TH7A 2RK2A 3G6ET 3CCUA 3M0QA 1M2OA 4C92F 2EJ9A 2GBQA 2CGHA 2DZ9A 1N9SA 4M75E 2XG8D 3UDCA 3CCJA 1WI7A 3HFNA 4C5IA 3A8OB 4BB7A 3J81E 4HCZA 4OGCA 1OQKA 2KR3A 2PTKA 3JB9I 4FYVB 3RMQA 1Q81C 5KYYB 2K9GA 3MHXA 1JJ2S 1C1AA 2A0FB 2I2LA 1UECA 4CI0C 2RM4A 4J6WA 4LDWA 1IHVA 4EDUA 5KCHA 2DXBA 4J6XA 2VVKA 1WGSA 5CKHA 4NS5A 3MP8A 1Y7XA 1BBZA 2FO0A 2QYZA 3OS5A 3QXEB 5I2MA 4CC4B 1UB4A 5AT1B 4LUDA 1WZOA 4N0AA 1YITA 3OW2A 1YHQT 1BIAA 1AHJB 3EG3A 2AIRB 1Q81U 5EG2A 5GAN4 2K5IA 4AFSC 3CCMT 3CCVT 4M77F 1TWBA 3C0CA 1HJDA 5LJ3d 1ARKA 4DBRA 3SB2A 2YUOA 3RBBB 5L23A 5ECAA 3EHQA 2P4RA 3VKIA 1ZA1B 4QKUA 4N0AC 1HXDA 1BIBA 2PUKB 2ED1A 3DB4A 3OYKA 2DK3A 1VQOT 5GJWB 1M9SA 1KD1U 2AKLA 2EQMA 1M3CA 1QQJA 1WQWA 4O6JA 1IB8A 4A4KA 1HSQA 1JQQA 2EQJA 2E5KA 1VQNT 4AFUC 3OYHA 3UPUA 1PD1A 5KCOA 1SF9A 3JRZA 4Y91A 2IVWA 3V7CA 2V1QA 3CQTA 3E19A 3EG1A 3G1JA 2L3QA 3P8HA 3CMEA 1WYXA 4XU3A 2X35A 1D3BB 2CZ1B 3QPHA 5LJ3f 4MZTA 1QW1A 4E7LA 2LJ3A 1NPRA 2JM9A 2RK1A 3EGXA 2L3SA 2QA4A 2C06A 2F2VA 1D0YA 3H0IA 1Q82U 1Y57A 3MO8A 1AOJA 5A0DA 3G6EQ 1B34B 4M7DA 4JS5A 5KH6A 4PNOA 3G4ST 2D6FA 3CD6A 3LW5E 4GBQA 4RUGA 3PVQA 1MMDA 1IZ6A 1WFWA 2CZ6B 4PLLA 1ZBJA 2AK5A 1BKBA 2RH2A 4JUVA 4EMHA 3EFSA 5CQXA 4M7DC 1M2VB 4KUIA 2D8JA 2HZYA 2LRQA 4E7ZA 1A0NB 2DD5A 1U8RA 3A98A 1SG5A 4BY6C 2DJQA 1VQ9A 3MEVA 2X4YA 3GF5A 4LXCA 1WHKA 3HTRA 4JRIA 3LGFA 2AT1B 5IAYA 4E6RA 2HEQA 2PQWA 3HKSA 1VYTA 1YHQQ 3CC4T 1N8RR 1X75C 5HKCA 1M90R 4CRIA 2ZPEB 2DILA 3CCMQ 2DBKA 4J7FA 2R5AA 2DTHA 1EIFA 2AZSA 2KRSA 3BDUA 4XTVA 2MK5A 1U1TA 2CREA 3X28B 4M7AG 3ZEHA 4F04B 1KQSA 2GCXA 4LN2A 3AT1B 3M0SA 4KRTA 1VQOQ 4HCBA 4DEXA 4EIKA 5FLXE 2RQWA 2D8HA 4WF2A 2O4XA 5J26A 1QCFA 1SSFA 2YUNA 4KGVB 1VQNQ 4J9EA 2P4TA 4QQGA 2QEXA 1VQ6T 4JLGA 4RTWA 4DOWA 4M7AB 3H6ZA 4B9WA 3CMAA 5GAN2 1PCXA 2FVUA 4FSSA 2VC8A 1ZSGA 3AHUA 2NUPA 3JCMX 3X20B 3A8HB 1AZEA 3CBPA 3PTAA 4RMOA 1QP2A 4GY5A 5GMKl 2GTOA 4PJOB 1DJ7B 2DBMA 4M7DD 1IO6A 1WNLA 3G4SQ 3EG9A 1B3QA 4C0GA 1GCPA 1W70A 1VQ5T 1U3OA 1VQLT 1ZUUA 3RUXA 2DL5A 2KXCA 3TSWA 3CCLA 4ELYC 5KYUB 2BTTA 2M16A 4A4GA 1WIEA 3RIRA 3NPFA 4OMPA 2OTJT 3HFOA 2ROTA 3O8VA 2F2XA 1U1SA 8AT1B 2QK0A 1OOTA 3R6OA 3URGA 4QT7A 2CUDA 2MI6A 4RTTA 1LVKA 2L5QA 1NEBA 3M4GA 4RTYA 1D1AA 2RI3A 2P0KA 1JXOA 1I8FA 4JPBW 3KBGA 4B9XA 4CC2A 4A53A 4OB2B 1N8RC 2QDLA 1NM7A 1ABQA 1M90C 3CC4Q 4IKFA 2RI5A 3NTIA 2ZPGB
chains in the Genus database with same CATH topology
2EIFA 3OYMA 4LD9K 4ZGDB 1FXXA 1I5LA 1JRIA 1LOJA 3CCRA 1Q86C 2DVEA 2GFAA 5A2QE 5M9OA 3CD6T 4C0FA 3OBYA 1VIFA 1OZ3A 3KXTA 3OMGA 3OMCA 4FT4A 1VQ9T 2X4JA 3I55A 3FB9A 3HRUA 4OMFB 2L89A 3QZ9B 1VQNA 1M5Q1 4OB1B 3JCMc 2XU8A 2OAUA 4IUTA 5GANh 2DD4A 5LJ5g 2E41A 3JCMd 5CIUA 4P5NA 1YIJT 3JB9F 3JCMV 3OA6A 3LGLA 4XU0A 4ME7A 5HY6A 4M78F 4XAXB 3V7RA 2IG0A 4MMLA 2KDSA 2DTIA 4M7AD 4JRQA 4C5EA 3CPWA 3LX7A 3WVEB 5GMKh 2E65A 5D6XA 1N8RU 4M78G 2KQWA 3V7SA 4BACA 1UGRB 3S3MA 3CBMA 2RJDA 2VUBA 3FJPA 3T9NA 1KHCA 2Y4YA 4BI4A 5LJ5j 4GLKA 2EKOA 3LH0A 3CCQA 4MDWA 3BY7A 4M78A 2CZ0B 2EJFA 5CQYA 5CVIA 5CKDA 5GMKe 5GAOq 1N27A 2KMTA 2Y4XA 4FM4B 4EMGA 1VIEA 2QQ9A 1Q86U 3PNWC 5DY9A 1WJSA 2FHDA 4M77G 2DO3A 3NFCA 4C8QG 2GFUA 5DLQE 2E10A 1XTDA 1Y96A 4E7KA 2DXTA 2XI9A 2K57A 4M77E 4C8QE 4LD6A 3QYHB 2L3RA 4M7AC 1KG1A 4LDVA 3G4SA 1JBMA 2XDDA 3E9FA 1ZQ1A 3QUIA 4OB0B 3BDLA 3JSCA 4OVAA 4FSXA 3CXCS 3JCMe 1QVFS 4JRPA 2EAYA 5IN1A 2XKOC 4M78B 2E6NA 3M55A 1QVGS 2LX9A 2QQSA 3BFMA 5CAIA 4M78C 4LDYA 3NTKA 4F7UF 2HNIA 3INZA 1X6OA 3FRNA 4N4GA 1Y96B 1G3WA 2VGNA 3EAEA 3WVDB 5GANg 4BDYA 2CKKA 3M53A 5HK0A 3MEUA 1X01A 2RHUA 3A8GB 4F7UG 3JCMf 3VJPA 1O9SA 3HL8A 4HT8A 1GXIE 3DKMA 1M1GA 1MGQA 4Z02A 4C8QC 5HK3A 4FU6A 2MWPA 2V8IA 4RCCA 2EQUA 4ZN3A 4F7UA 3OSVA 5GAN5 4NL3A 2EYQA 4Q5WA 4XK8E 4BI8B 4XU1A 4TVRA 4X9CA 3LWIA 2RHIA 2DIQA 5C6SA 3OS1A 3HSBA 1VQ7A 2K3YA 2P0PA 3OYGA 5AYFA 2JN0A 3CCST 1YJWT 1YJ9A 3RMSA 3OW2S 4J7IA 2D9TA 2X4WA 4PLIA 5GMKj 4FT2A 3OYFA 3FC3A 4F7UB 2XIDA 2M9UA 3MEAA 4OGEA 1OYXA 5FU6B 2WACA 5FRMA 2QEXT 3HP9A 5DLOA 2XDBA 5FU6C 2QDYB 1ZHIA 3CC4A 4L6V5 1K9MU 3FDRA 4V2SA 2DTOA 1Y07A 1Q7YC 4A4HA 3CMAT 1PSFA 2RK2A 1TH7A 3G6ET 3CCJA 1S72T 4N4IA 3L42A 2DPPB 3I56T 3CCUA 2LVMA 5GAOp 3CC2T 2DEQA 4C92F 2EJ9A 5LJ3g 3OS2A 5LJ5e 3TEEA 4M75G 2CGHA 5J39A 2DZ9A 2G3RA 3RKXA 2VV5A 2LQ8A 2RO0A 1BI1A 3M54A 1N9SA 2XG8D 2MF2A 4M75E 3UDCA 1OI1A 4C92G 5C0MA 1WJRA 1QP3A 3HFNA 4C5IA 3L2RA 4E7HA 1M1KC 3CXCA 3A8OB 5GAOn 4BB7A 2DKGA 3J81E 3C4SA 4HCZA 4OGCA 3LLRA 1VQ8A 5GANd 1YJNA 4HCCA 3JB9I 4C92A 3QYGB 1LJOA 5LJ5f 3RMQA 1Q81C 4BE2A 2OTLT 4QVDA 3QSUA 3MHXA 1LNXA 2CYZB 3G71T 2YLBA 1VQMT 1JJ2S 4C5GA 4E7IA 2I2LA 4CI0C 2RM4A 4J6WA 3MEWA 4LDWA 4BUGA 3CEYA 1VQ4T 4EDUA 5KCHA 1W4SA 1Q7YU 1WJQA 4QVZA 2DXBA 3CCLT 5GAMd 1VQ6A 2QTXA 4J6XA 5GAOm 2WSFE 4C92B 2XICA 1QVPA 1G5VA 5GAN8 1WGSA 5CKHA 2QQRA 3OYJA 4NS5A 4C92C 3MP8A 1Y7XA 3OS5A 5I2MA 3QXEB 3OYNA 2MWOA 2XHCA 2EWNA 2K3XA 3BW1A 3N5BB 3OYYA 2JNGA 1UB4A 2NLUA 3P8DA 3ME9A 3OSSC 3S6WA 3V8JA 5A0GA 1M1KU 4XTYA 5CCAA 4N0AA 1YITA 3OW2A 2K5LA 1BI3A 4IUQA 5GANe 5KE2A 1YHQT 3QG1A 1BIAA 2KVQG 2JOYA 4QQ6A 3L2VA 3ZFJA 1O75A 1AHJB 3JB9D 2VXEA 3ZBDA 2JTFA 3DLMA 1Q81U 1NJIC 5EG2A 5GAN4 2K5IA 2D0QB 3CCMT 4M78D 1NE8A 2A7YA 5GAMh 2JTMA 3CCVT 1FWZA 4M77F 4NL2A 4C8QF 1W2BS 1H641 2HQEA 2LTOA 2R58A 4ELZC 5LJ3d 2E6ZA 2PUOB 3VV0A 2L8DA 3OB9A 5GANf 1VQPA 3SB2A 3A5ZB 5CKEA 2GF7A 2RA2A 4M7AE 3VKIA 3X25B 3VU3C 4C8QD 1Y71A 1HXDA 3QO3A 4N0AC 3JCMP 1BIBA 2EFIA 2P0QA 2PUKB 1VQ5A 2BIVA 3DB4A 4M77A 2PU9B 2YRVA 4C8QA 2DK3A 3OYKA 3CCEA 1VQOT 1M9SA 3S3NA 3C95A 4Y28E 2E12A 1KD1U 5FRNA 1NPPA 2BUDA 2EQMA 3CCRT 1WQWA 2K5FA 1FX7A 4J83A 4E47A 4A4EA 3OS0A 3E1SA 4O6JA 4OP0A 2VGMA 4A4KA 1M1FA 2DZCA 2PVOB 5LJ3h 1K9MC 2JVVA 3I55T 4C5HA 2EQJA 4JS4A 4PJOG 2VXFA 3OY9A 2OTJA 1VQNT 3G7ZA 4M77B 4C8QB 1D3BA 1NJIU 1JJ2A 1UGPB 2M1HA 4PJOE 3OYHA 3UPUA 1VQKA 3RERA 3L2QA 2ZPFB 3HRTA 4M77C 5KCOA 4JDSA 5LJ3e 4PJOA 2WSEE 3JRZA 3SDZA 4Y91A 2ZZDA 5GMKm 3TU4K 2IVWA 3FLGA 3V7CA 2PVGB 5CR2A 5GANj 4KT0E 4BD3A 3E19A 4RCBA 4A54A 1K73U 5GAMg 1B34A 2HQXA 1BI0A 3P8HA 5CKBA 3CMEA 5IT9E 5FU7B 3X26B 2KY9A 4XQ3A 4XU3A 2VYTA 3SWNA 4M7DF 2X35A 1D3BB 2CZ1B 3PMIA 3QPHA 5FU7C 2KK4A 5LJ3f 4MZTA 3NTHA 1QW1A 4E7LA 3CC7A 3CCQT 1YI2A 3JCMb 1NPRA 2RK1A 4M7DG 4IURA 2QA4A 2C06A 1R8OB 2FL7A 1Q82U 2KAFA 2QXFA 3M58A 4A4FA 3MO8A 4M7DE 4PJOC 5LL6S 3WXMB 3JCMW 5A0DA 5GAMj 4DA4A 3RKWA 2CS7A 1B34B 4M7DA 5GAN7 2RI2A 2DIGA 2WSCE 4JS5A 5KH6A 2F5TX 2YLCA 4PNOA 5GAN3 3G4ST 2D6FA 3CD6A 4L5GA 3QBYA 2H3JA 3LW5E 1V29B 1H3ZA 4XTUA 4M75F 5I21A 1KQSS 4MZPA 3L1AA 3E9GA 4II1A 4L59A 4J5YA 3SWNC 3PGGA 4IUUA 1HK9A 4ZTJA 2LT1A 3JCMQ 2XK0A 4PL6A 1IREB 1IZ6A 2EQKA 3V8LA 2CZ6B 1YIJA 4PLLA 3JB9H 4R55A 4J6YA 3M9QA 1BKBA 2RH2A 4M7DB 1QVFA 2V8KA 3QZ5B 1KHIA 3OYBA 4JUVA 4M75A 4C92D 4EMHA 3EFSA 4QW2A 5CQXA 4M7DC 1QVGA 4KUIA 3J80E 2E1HA 1PSEA 2ZPHB 4BDZA 4ZGJB 5LJ3j 2LRQA 4E7JA 3JAME 2DD5A 2XD0A 4IUPA 3GLXA 4XTWA 4BY6B 1U8RA 1G3TA 4XU2A 5CKFA 4MZMA 4BY6C 3A8MB 1VQ7T 1XOVA 1VQ9A 3MEVA 4HA8A 3JB9J 3PT9A 4M75B 2X4YA 1YBYA 1YJ9T 3GF5A 2RJFA 3HHTB 4KUDK 4X9DA 4M75C 1XQHA 4JRIA 1OZ2A 3LGFA 4JLIA 5IAYA 1NZ9A 4EMKA 2DXUA 4QVCA 3L2UA 2YHTA 2PQWA 3HKSA 1KD1C 2R57A 2K4YA 1BYMA 5GAOr 4RG8A 2RJCA 3CC4T 3CBOA 4UC4A 1KC8C 1X75C 2LCLA 5HKCA 5GAOl 3ER0A 4CRIA 2ZPEB 5L8RE 1UGQB 3GOXA 4FL6A 2DXCA 3L2ZA 4J7FA 2R5AA 3HPWA 3QJ6A 3CCUT 5J3BA 4JRKA 2DTHA 1YCYA 3RKYA 1EIFA 5FROA 4EMKB 2CZ7B 3MCAB 5KE3A 4M7AF 3BDUA 2RHXA 4XTVA 2HBPA 3HRSA 4EMKC 3JCMJ 3CCJT 3GPLA 1U1TA 3KUFA 3PMTA 4HKEA 3X28B 4M7AG 3SD4A 5D6WA 1VQ8T 4LDUA 3ZEHA 3QHSA 2MAMA 1KQSA 2GCXA 1YJNT 5GAMe 1K73C 3EFRA 3JB9G 4M77D 3VYGA 2EJGA 4O5VA 4HCBA 2QI2A 1N9RA 3OYLA 3V8KA 2R5MA 4M7AA 5CK9A 5A0LA 1M90U 3GNGA 3LYIA 5FLXE 4M78E 4N4HA 3CCSA 1I4K1 1YJWA 4WF2A 2O4XA 5J26A 4YTLA 2ZCFB 1SSFA 1I81A 1RL2A 4X34A 1KC8U 1Q82C 5GAMf 4PJOF 3QIIA 3M57A 5CO7A 4BI3A 2ZPBB 3P8BB 3JCMh 2P4TA 4QQGA 2QEXA 1VQ6T 3GIBA 4JLGA 4FIBA 4DOWA 4IUVA 2LT4A 2O01E 1ZBXA 4VUBA 4NOYA 4M7AB 3PIOA 4OF1A 4XTZA 3OYAA 3H6ZA 3Q1JA 4KBMB 4HT9A 4B9WA 4PJOD 2A3LA 2RJEA 2DAQA 3CMAA 4BE0A 1S72A 3PFSA 3G6EA 3J7AF 2O4XB 3C94A 2F5KA 2FVUA 3M5AA 5GAN2 1N6AA 3S3OA 3FIFA 3H8ZA 1UEBA 3QDRB 3VUBA 3I56A 1KQ2A 4RKUE 2LQKA 3OYDA 3QKJA 2E70A 2VC8A 2LC4A 1WPYA 1YITT 3CC2A 3AHUA 3PIPA 2MMPA 2KSSA 3SFMA 3OQ5A 1XNIA 3MP1A 3X20B 3A8HB 3JCMX 3CBPA 3DLLA 4LDXA 2GQVA 3PTAA 4RMOA 2Y90A 1QP2A 4D6WA 1M8VA 2LCCA 4ZGEB 4GY5A 5GMKl 5DM7R 2ZPIB 3CPFA 2X4XA 4F7UE 3UWNA 4PJOB 2F69A 2RB6A 4ZN1A 1VQLA 3QJYA 1VQPT 1DJ7B 2E64A 2OTLA 2JZ2A 1RI0A 4M7DD 1M4ZA 1WNLA 2JUFA 5LJ5d 3G71A 1VQMA 4C0GA 2RHZA 3VYHB 3DB3A 3UT1A 1VQ5T 2PVDB 5GMKi 2DJZA 3OBWA 3SWNB 1W2BA 3M4YA 4C0ZA 1VQLT 2AHJB 2BKDN 3RUXA 3CCET 5GAN6 4RG2A 1VQ4A 1G3SA 4KULA 3F70A 3GNFB 4EPCA 4BE1A 3CCLA 4OB3B 4ELYC 2QQBA 3JCMg 3CPWS 1UGSB 1MHNA 5I2SA 1K8AC 4ATOA 1KQ1A 3TCJA 3VUZA 2M16A 4M75D 4A4GA 2FB7A 3A8LB 5D6YA 3RIRA 3GP8A 2OTJT 3HFOA 1JB0E 4PKCC 5LJ5h 3META 2RD1A 3O8VA 4R56A 4ZTFA 4QQDA 1VQKT 2FYKA 1U1SA 2LNVA 1YHQA 2E5QA 3R6OA 1P92A 3URGA 3M56A 3TREA 2RHYA 3MP6A 4C0DB 3OYEA 3FEOA 4XTXA 2MI6A 4DQ2A 4MMKA 3CCMA 2L5QA 3M59A 4C0DC 4DOVA 3CCVA 3M4GA 2ZGWA 2M0OA 2P0KA 2RI3A 4J8OA 3X24B 3CMET 3ASKA 1I8FA 3KBGA 2K2VA 4B9XA 2XDPA 2HAXA 4C92E 1WQ7A 3OYIA 4MDXA 1VUBA 4A53A 1BI2A 4OB2B 1N8RC 1G3YA 3C12A 3L2WA 1YI2T 3CC7T 2B8AA 2V8JA 1M90C 2QA4T 4JJNK 3RESA 2LDMA 3LWHA 4IKFA 2RI5A 1VQOA 1K8AU 2QQAA 2HD0A 3NTIA 2ZPGB 3OYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHX A;  2K5L A;  1BI3 A;  1P92 A;  2H3J A;  3GLX A;  3E19 A;  1U8R A;  1G3T A;  2LX9 A;  1BI0 A;  1G3S A;  2K5F A;  1FX7 A;  2K5I A;  2QQB A;  4O6J A;  1G3W A;  1FWZ A;  5CVI A;  1BI1 A;  3HRU A;  1QW1 A;  1QVP A;  2QQ9 A;  3HRS A;  1BI2 A;  1G3Y A;  2GCX A;  3HRT A;  2K4Y A;  1BYM A;  2QQA A;  4O5V A; 
#chains in the Genus database with same CATH topology
 4LD9 K;  1I5L A;  1GFC A;  2DVJ A;  3OBY A;  1RAG B;  1OZ3 A;  3KXT A;  1BB9 A;  3I55 A;  2L89 A;  2KYB A;  1YIJ T;  1F1B B;  4P5N A;  3JCM V;  1QKW A;  1AWW A;  4ME7 A;  2NYS A;  3V7R A;  4JRQ A;  4C5E A;  3LX7 A;  5GMK h;  1N8R U;  2E65 A;  4BAC A;  2RNA A;  3S3M A;  4ORZ A;  2Y4Y A;  2HSP A;  2KXD A;  4M78 A;  1WX6 A;  4CC3 A;  1N27 A;  1YCS B;  5DY9 A;  1MMG A;  1WJS A;  4M77 G;  3NGP A;  1NJI R;  2EPD A;  2GFU A;  5DLQ E;  1XTD A;  1Y96 A;  2XI9 A;  1AWX A;  1KG1 A;  4AT1 B;  2GTJ A;  3CXC S;  3JSC A;  4OVA A;  2NUT A;  4JRP A;  2XKO C;  3M55 A;  5FW9 A;  2LZ6 B;  2COZ A;  4M78 C;  1QLY A;  3EAE A;  3M53 A;  5HK0 A;  2RHU A;  1K0S A;  1O9S A;  2G6F X;  4IIO A;  1OUL A;  1M1G A;  2OI3 A;  1MGQ A;  4C8Q C;  4FCY A;  4RCC A;  4F7U A;  5GAN 5;  1VQ5 Q;  4XK8 E;  1VQL Q;  4X1V A;  1TOV A;  4TVR A;  4X9C A;  3LWI A;  3HSB A;  2QAZ A;  2JN0 A;  3CCS T;  1YJW T;  3I35 A;  5GMK j;  4JJC A;  3MEA A;  4OGE A;  2OTJ Q;  2WAC A;  2CT4 A;  3HP9 A;  5FWB A;  5DLO A;  5FU6 C;  3FDR A;  4V2S A;  1MND A;  1GBR A;  1GFD A;  4IIM A;  3L42 A;  2LVM A;  5GAO p;  3CC2 T;  2COW A;  5LJ3 g;  1ZSZ A;  3RKX A;  2VV5 A;  2EW3 A;  2LQ8 A;  2MF2 A;  5C0M A;  1OI1 A;  2VWF A;  1QP3 A;  2HL3 A;  1VQ8 A;  2HBW A;  1YJN A;  2LMJ A;  1K76 A;  4C92 A;  3QYG B;  1OX8 A;  4BE2 A;  1T0J A;  2CYZ B;  3G71 T;  4FYW B;  1TUC A;  2VKN A;  1ZSZ C;  4E7I A;  1B7T A;  5KYX A;  3RR6 A;  4BUG A;  2BZX A;  1TTH B;  1OU8 A;  1VQ4 T;  4QVZ A;  5GAM d;  2QTX A;  5GAO m;  2WSF E;  2XIC A;  1QVP A;  2ECZ A;  1YIJ Q;  5GAN 8;  9ATC B;  3I9Q A;  3ULR B;  2O9V A;  3OYJ A;  4C92 C;  3OYN A;  2KBT A;  2E3H A;  2DF6 A;  3EGD A;  1Q95 G;  3P8D A;  3OSS C;  1KK7 A;  4CC7 A;  5CCA A;  1BI3 A;  4IUQ A;  5GAN e;  5IHK A;  5KE2 A;  1KD1 R;  1UDL A;  2NUZ A;  2JTF A;  1NJI C;  1KC8 R;  2D0Q B;  4M78 D;  1NE8 A;  2A7Y A;  1FWZ A;  4C8Q F;  2LTO A;  2LCS A;  2E6Z A;  3VV0 A;  1VQP A;  1PHT A;  1M27 C;  5CKE A;  4M7A E;  1WLP B;  4C8Q D;  3JCM P;  3QO3 A;  3EFO A;  2FRY A;  4M77 A;  2EYX A;  2PU9 B;  3S3N A;  5FRN A;  1RAB B;  3CCR T;  4PJN A;  2VGM A;  2B86 A;  5LJ3 h;  2JVV A;  4C5H A;  4F17 A;  3G7Z A;  1NJI U;  1UGP B;  1Q82 R;  4PJO E;  4JJB A;  3RER A;  1VQK A;  3L2Q A;  5IXB A;  4M77 C;  4JDS A;  3TU4 K;  1YWO A;  1WXU A;  2ABL A;  5CR2 A;  4DBQ A;  1YP5 A;  3CCS Q;  4RCB A;  1YJW Q;  5CKB A;  1AWJ A;  3X26 B;  2KY9 A;  4XQ3 A;  3LH5 A;  5FU7 C;  3CCQ T;  2BZY A;  3JCM b;  4M7D G;  1S1N A;  4IUR A;  1R8O B;  1MV3 A;  2KAF A;  4A4F A;  1UFF A;  3WXM B;  4E2F B;  2DIG A;  2FPD A;  5KYW A;  1PC0 A;  3QBY A;  1CKB A;  3CC2 Q;  1V29 B;  1H3Z A;  4M75 F;  4OMN A;  4ZTJ A;  3EGX B;  3JCM Q;  1Z9Q A;  3VS5 A;  4J6Y A;  4M7D B;  3OYB A;  4C92 D;  2O88 A;  1QVG A;  1K8A R;  3J80 E;  1PSE A;  2SRC A;  3G71 Q;  4BDZ A;  2FEI A;  5LJ3 j;  2RQR A;  4E7J A;  2EKH A;  4BY6 B;  1D1B A;  1VQ4 Q;  2A28 A;  4MZM A;  3A8M B;  1VQ7 T;  4AMC A;  1YBY A;  3OW2 P;  1RAC B;  2A36 A;  4KUD K;  4X9D A;  1KD1 C;  2NWM A;  2CP0 A;  2RJC A;  5HCK A;  1KC8 C;  5IH2 A;  1C6V X;  3ER0 A;  1D1C A;  4J9F A;  3GOX A;  4FL6 A;  2DXC A;  3HPW A;  4JRK A;  2CZ7 B;  5IHI A;  2RHX A;  2HBP A;  3HRS A;  3KUF A;  4HKE A;  1UUE A;  4PJM A;  5D6W A;  1J3T A;  4F14 A;  5GAM e;  4M77 D;  3VYG A;  2QI2 A;  2O9S A;  1N9R A;  2KI7 A;  5A0L A;  3H41 A;  3GNG A;  3CCR Q;  3LYI A;  2K79 A;  4N4H A;  3I5S A;  2COY A;  1RL2 A;  1KC8 U;  1Q82 C;  3QII A;  3M57 A;  5CO7 A;  2CSI A;  3P8B B;  2H8H A;  3GIB A;  3QWY A;  7AT1 B;  4IUV A;  4VUB A;  1ZBX A;  1HYO A;  3PIO A;  4OF1 A;  4XTZ A;  1TXQ A;  4HT9 A;  1ZUK A;  1H92 A;  1FMV A;  2RJE A;  2DNU A;  4BE0 A;  3G6E A;  2O4X B;  1YIT Q;  3FIF A;  2C0I A;  3QDR B;  1KQ2 A;  2DRM A;  5FWC A;  4RKU E;  4PFO A;  2E70 A;  2MMP A;  2KSS A;  4J9I A;  2GQV A;  3CCQ Q;  2AKK A;  3TQ7 P;  1BU1 A;  2FZG B;  2MYS A;  2LCC A;  3H0F A;  2X4X A;  2F69 A;  1E7O A;  4ZN1 A;  3QJY A;  1YWP A;  4AFQ C;  2MIO A;  5LJ5 d;  3VYH B;  1KJW A;  3CXC P;  3OBW A;  3SWN B;  1W2B A;  3CCE T;  4C0Z A;  2YT6 A;  2K2M A;  1PKT A;  5GAN 6;  4KUL A;  5D7U A;  4BE1 A;  2V1R A;  2F2W A;  1UGS B;  4AFZ C;  1K8A C;  3EG9 B;  5D6Y A;  3GP8 A;  4J9C A;  3MET A;  2RD1 A;  4R56 A;  4QQD A;  3VS1 A;  2FYK A;  2LNV A;  4J9G A;  1YHQ A;  2FZK B;  1TSF A;  1VQ7 Q;  3CCM A;  2ATC B;  3CCV A;  2ZGW A;  3REB B;  2M0O A;  3X24 B;  4RTX A;  1PWT A;  3OYI A;  1VUB A;  2FG0 A;  3CC7 T;  1YI2 T;  3VS0 A;  2B8A A;  1RAD B;  3RES A;  1VQO A;  2C0O A;  1K8A U;  3R6N A;  3OYC A;  3SHW A;  4ZGD B;  1LOJ A;  2QAS A;  2O2O A;  5A2Q E;  5M9O A;  1TUG B;  1KQS P;  1D09 B;  2EVR A;  4WCI A;  3OMC A;  2X4J A;  3FB9 A;  4OMF B;  1VQN A;  2RN8 A;  5GAN h;  4IUT A;  2KRO A;  3GBQ A;  3JB9 F;  2LNH B;  2Z0W A;  2JM8 A;  2DET A;  3CPW A;  3WVE B;  4M78 G;  2PZ1 A;  4LUE A;  1MNE A;  3V7S A;  2DYB A;  1MMN A;  2VUB A;  3FJP A;  1KHC A;  4BI4 A;  1QKX A;  3UA6 A;  4GLK A;  2EKO A;  3LH0 A;  2YXY A;  4MDW A;  3BY7 A;  5CVI A;  1XJW B;  2K7A A;  2FHD A;  4C8Q G;  3NFC A;  1NYF A;  2L3R A;  1WHJ A;  1ZX6 A;  3G4S A;  3E9F A;  4OB0 B;  3JCM e;  4M78 B;  1QVG S;  1R0B G;  1PD0 A;  5CAI A;  1T3L A;  3NTK A;  2CH4 W;  1WHL A;  1Y96 B;  1G3W A;  4BDY A;  2CKK A;  1E6G A;  1X01 A;  3A8G B;  4F7U G;  3VJP A;  3DKM A;  2O31 A;  2NUT B;  5HK3 A;  1IHW A;  2MWP A;  4Q5W A;  4ZNX A;  3CCE Q;  1IGQ A;  1MUZ A;  4Z8A A;  2DIQ A;  5C6S A;  2HDA A;  3RMS A;  1GRI A;  1SEM A;  3OW2 S;  2W0Z A;  2D9T A;  2X4W A;  4FT2 A;  3OYF A;  4F7U B;  2M9U A;  1BCO A;  5FU6 B;  4D8K A;  1UJ0 A;  3CMA Q;  1ZHI A;  3CC4 A;  4L6V 5;  1NLO C;  1K9M U;  1SSH A;  1Y07 A;  4JZ3 A;  1S72 T;  4N4I A;  1M2V A;  2YWW A;  2DPP B;  3I56 T;  1ZA2 B;  4HVV A;  4FW1 A;  3OS2 A;  2YDL A;  5LJ5 e;  3TEE A;  4M75 G;  2G3R A;  1I07 A;  2V26 A;  2KEA A;  4C92 G;  3L2R A;  1V1C A;  3CC7 Q;  1YI2 Q;  2KT1 A;  1RLP C;  1KIK A;  5I22 A;  5GAO n;  2DKG A;  2HL5 C;  3LLR A;  5GAN d;  4HCC A;  2EYZ A;  1LJO A;  1WHM A;  2OTL T;  2KRM A;  4QVD A;  1ZSZ B;  2CP3 A;  1LNX A;  1VQM T;  2DLP A;  4LE9 A;  2AZV A;  2PNI A;  3CEY A;  1IXD A;  3TVT A;  1ZLM A;  1W4S A;  1WJQ A;  1VQ6 A;  1SKU B;  4C92 B;  2J6K A;  1G5V A;  2RQT A;  1I5O B;  3EH1 A;  2MWO A;  3UF4 A;  2XHC A;  2EWN A;  2K3X A;  3N5B B;  3OYY A;  5KYX B;  3ME9 A;  3V8J A;  3S6W A;  5A0G A;  4XTY A;  2DMO A;  2L2P A;  2JOY A;  4E7S A;  1E6H A;  1O75 A;  3ZFJ A;  2VXE A;  3DLM A;  1T0H A;  5GAM h;  2JTM A;  1W2B S;  4ELZ C;  3PVL A;  2PUO B;  3OB9 A;  5GAN f;  3A5Z B;  4HVU A;  2RA2 A;  1AT1 B;  2JTE A;  1Y71 A;  1EZZ B;  2CH4 A;  2EFI A;  2P0Q A;  1VQ5 A;  2EBP A;  4WTO B;  2BIV A;  4C8Q A;  1VQL A;  2VB6 A;  1AWO A;  3C95 A;  3M0R A;  4Y28 E;  4JZ4 A;  2BUD A;  4J83 A;  1Y0M A;  2D0N A;  2E3I A;  2CP6 A;  1I1J A;  1KFZ A;  1M1F A;  2PVO B;  2F1L A;  3EFO B;  3OY9 A;  2OTJ A;  4M77 B;  1JJ2 A;  1X6G A;  2M1H A;  2BE9 B;  2DL8 A;  2EGC A;  2ZPF B;  1IGU A;  4PJO A;  2WSE E;  1AD5 A;  3SDZ A;  2ZZD A;  5GMK m;  1WXT A;  3VS2 A;  4KT0 E;  4A54 A;  1K73 U;  2HQX A;  1BI0 A;  5FU7 B;  2VYT A;  2X3W D;  3PMI A;  2KK4 A;  2ENM A;  3NTH A;  2KNB B;  2DE0 X;  2EQI A;  4KGX B;  1K1Z A;  2FL7 A;  2QXF A;  4PJO C;  4Z89 A;  3JCM W;  5GAM j;  4DA4 A;  3RKW A;  2CS7 A;  1S72 Q;  5GAN 7;  2WSC E;  5GAN 3;  2YLC A;  3I56 Q;  2JS0 A;  2H3J A;  4GLM A;  1WHG A;  4XTU A;  4AG2 C;  1KQS S;  4DEY A;  4II1 A;  4J5Y A;  1JEG A;  2X51 A;  2L0A A;  1HK9 A;  2RQU A;  2LT1 A;  4PL6 A;  2EQK A;  1YN8 A;  4HCK A;  2OJ2 A;  1YIJ A;  3VS4 A;  3M9Q A;  1QVF A;  1KHI A;  1D0X A;  4M75 A;  5KYW B;  2OTL Q;  2DFU A;  1H3H A;  1K0X A;  1CSK A;  2ZPH B;  1VQM Q;  4ZGJ B;  1JXM A;  2RF0 A;  2FPF A;  3JAM E;  4IUP A;  3GLX A;  1G3T A;  1T3S A;  2DX1 A;  1XOV A;  3M0U A;  4HA8 A;  3JB9 J;  3PT9 A;  2RPN A;  4FW2 A;  1YJ9 T;  1W6X A;  2RJF A;  4M75 C;  1NBE B;  4JLI A;  4EMK A;  2DXU A;  4QVC A;  2YHT A;  2R57 A;  1BYM A;  4RG8 A;  3UAT A;  4UC4 A;  1VA7 A;  2LJ0 A;  3EG0 A;  2ESW A;  3CCU T;  3RKY A;  1Q86 R;  1KSW A;  4M7A F;  1X2K A;  2KT8 A;  4EMK C;  4OMO A;  3CCJ T;  4LDU A;  1V76 A;  2MAM A;  1BK2 A;  2FZC B;  3JB9 G;  2EJG A;  4O5V A;  5GJV B;  1W1F A;  3OYL A;  2R5M A;  5CK9 A;  1SHG A;  2DL3 A;  4LNP A;  3CCS A;  4M78 E;  1YJW A;  1I4K 1;  5GAM f;  5KYN A;  4PJO F;  3QDF A;  4KH1 B;  4BI3 A;  2J6F A;  4HVW A;  3JCM h;  4FIB A;  2LT4 A;  2O01 E;  4NOY A;  4FYY B;  3OYA A;  1U06 A;  4KBM B;  4PJO D;  2A3L A;  2DAQ A;  3C94 A;  3M5A A;  1VYV A;  4Z88 A;  3S3O A;  3H8Z A;  3VUB A;  3QKJ A;  1ABO A;  3CC2 A;  2LC4 A;  1WPY A;  1YIT T;  1WDX A;  3DLL A;  1X43 A;  1XNI A;  4LDX A;  2C0T A;  1RAF B;  2Y90 A;  1PKS A;  2MCN A;  4ZGE B;  5DM7 R;  3IQL A;  2ZPI B;  3CPF A;  4F7U E;  1QWF A;  3UWN A;  1IRX A;  1Z9Z A;  2JZ2 A;  1M4Z A;  1X27 A;  2H3E B;  2JUF A;  2QG9 B;  3G71 A;  2EGA A;  2PVD B;  2DJZ A;  2AHJ B;  2QTV A;  4RTV A;  1QVG P;  1VQ4 A;  1G3S A;  3GNF B;  4EPC A;  4OB3 B;  1FMW A;  1G2B A;  2QQB A;  1PRM C;  1MHN A;  2CUB A;  5I2S A;  3H0H A;  4AG1 C;  1EFN A;  1SHF A;  4ATO A;  3TCJ A;  3VUZ A;  4M75 D;  4ESR A;  1JB0 E;  4PKC C;  1RAE B;  5LJ5 h;  4ZTF A;  3JV3 A;  2K3B A;  3TRE A;  2RHY A;  3MP6 A;  4XTX A;  4DQ2 A;  4MMK A;  3MPU B;  4B6M A;  4C0D C;  1Q7Y R;  1YJ9 Q;  3FJ5 A;  4D8D A;  3CME T;  1OEB A;  3ASK A;  2K2V A;  4C92 E;  3C12 A;  3L2W A;  2V8J A;  2LP5 A;  2QA4 T;  4JJN K;  2LDM A;  3LWH A;  1M1K R;  2QQA A;  4K11 A;  2HD0 A;  2EIF A;  3OYM A;  3MKD A;  1FXX A;  2D1X A;  3CCR A;  2J6O A;  2DVE A;  1Q86 C;  3CCU Q;  3CD6 T;  2J06 A;  4C0F A;  4OMM A;  1VIF A;  2CDT A;  3OMG A;  3HRU A;  3CCJ Q;  3VRZ A;  1RUW A;  1M5Q 1;  1GL5 A;  3JCM d;  2E41 A;  4RTU A;  1UG1 A;  4M4Z A;  4XU0 A;  5HY6 A;  4XAX B;  2IG0 A;  2KDS A;  2DTI A;  1PM3 A;  2ED0 A;  2KQW A;  4ANJ A;  1UGR B;  1UGV A;  3CBM A;  3T9N A;  5LJ5 j;  2A08 A;  3CCQ A;  2LX7 A;  5GMK e;  2CZ0 B;  2EJF A;  5CQY A;  1K4U S;  1VQ9 T;  2Y4X A;  4FM4 B;  1Q86 U;  1VIE A;  2DO3 A;  4J9H A;  2E10 A;  4E7K A;  2K57 A;  4M77 E;  2J05 A;  3PE0 A;  1EX4 A;  3QUI A;  3BDL A;  1QVF S;  2EAY A;  5IN1 A;  2SEM A;  2E6N A;  3EHR A;  2LX9 A;  4OML A;  2HNI A;  1AZG B;  3INZ A;  1X6O A;  2VGN A;  3WVD B;  5GAN g;  1X6B A;  1QWE A;  1X2Q A;  1W2B P;  3JCM f;  1SRM A;  2HKN A;  3HL8 A;  2JXB A;  4HT8 A;  4Z02 A;  2KYM A;  4FU6 A;  1K9M R;  2EQU A;  2OX7 A;  4ZN3 A;  2NUP B;  2RHI A;  3OS1 A;  2KRN A;  2P0P A;  5EC7 A;  1VQ7 A;  2BZ8 A;  3RDV A;  2LJ1 A;  2DL7 A;  2XID A;  3UA7 A;  5FRM A;  2QEX T;  2XDB A;  2GNC A;  2JT4 A;  1Q7Y C;  2KE9 A;  4A4H A;  3CMA T;  1PSF A;  1UE9 A;  1BCM A;  1B07 A;  2YUP A;  1RI9 A;  5KYY A;  1D0Z A;  1TG0 A;  3CME Q;  2DEQ A;  5J39 A;  2RO0 A;  3M54 A;  1BI1 A;  2LQW A;  4E7H A;  1WJR A;  1M1K C;  3CXC A;  3C4S A;  2QA4 Q;  2CP2 A;  3NMZ C;  2CT3 A;  2EGE A;  5LJ5 f;  2DRK A;  1FYN A;  3QSU A;  3CD6 Q;  2YLB A;  4OMQ A;  4C5G A;  2DA9 A;  3MEW A;  1Q7Y U;  3CPW P;  3CCL T;  3QWX X;  2QQR A;  2DM1 A;  3NHN A;  3BW1 A;  3SEM A;  2JNG A;  2NLU A;  1M1K U;  1HD3 A;  1TUD A;  2K5L A;  4PJL A;  3QG1 A;  2KVQ G;  4QQ6 A;  2L3P A;  3L2V A;  3JB9 D;  3CCV Q;  3ZBD A;  1VQ9 Q;  4NL2 A;  2DYI A;  2GQI A;  1H64 1;  2HQE A;  2R58 A;  3D7S B;  2L8D A;  1LPL A;  2GF7 A;  3X25 B;  3VU3 C;  4FYX B;  2YRV A;  3CCE A;  2E12 A;  1NPP A;  1K73 R;  1NEG A;  2K5F A;  1AEY A;  1FX7 A;  4E47 A;  3OS0 A;  4A4E A;  3E1S A;  4OP0 A;  2DZC A;  1K9M C;  4JS4 A;  2K6D A;  3I55 T;  4PJO G;  2VXF A;  2DEU A;  4JJD A;  4C8Q B;  1D3B A;  1G8X A;  3HRT A;  4J9D A;  5LJ3 e;  4F16 A;  3FLG A;  1OPK A;  2PVG B;  5GAN j;  4BD3 A;  5GAM g;  1B34 A;  2IPO B;  5IT9 E;  1GCQ A;  1NYG A;  3SWN A;  4M7D F;  1FMK A;  3CC7 A;  1YI2 A;  2QEX Q;  1VYU A;  2X3X D;  4M7D E;  3M58 A;  1UJY A;  5LL6 S;  4KGZ B;  2W10 A;  2RI2 A;  1RLQ C;  2F5T X;  2JW4 A;  4L5G A;  1GCQ C;  5I21 A;  4MZP A;  3L1A A;  2QGF B;  3E9G A;  4L59 A;  3SWN C;  3PGG A;  1NLP C;  4IUU A;  1ACM B;  2XK0 A;  1IRE B;  1RAH B;  3V8L A;  1RAI B;  3VS3 A;  3JB9 H;  4R55 A;  3ZL7 C;  1QMC A;  2V8K A;  3QZ5 B;  1YNZ A;  3M0T A;  4QW2 A;  2LQN A;  2E1H A;  2DL4 A;  4A63 B;  2XD0 A;  4XTW A;  4XU2 A;  1TU0 B;  5CKF A;  2JS2 A;  3CCL Q;  4M75 B;  1G83 A;  4KH0 B;  3HHT B;  3KFV A;  4PFP A;  1XQH A;  1JO8 A;  1OZ2 A;  1PG5 B;  1NZ9 A;  3L2U A;  2K4Y A;  5GAO r;  1WXB A;  2MPX C;  3CBO A;  2HSE B;  2LCL A;  5GAO l;  5L8R E;  1UGQ B;  2P84 A;  2DER A;  1OV3 A;  2HCK A;  3L2Z A;  3QJ6 A;  5J3B A;  1YCY A;  5FRO A;  4EMK B;  3MCA B;  5KE3 A;  2BE7 D;  2EYY A;  3EGD B;  3JCM J;  3GPL A;  3PMT A;  1NG2 A;  3SD4 A;  1VQ8 T;  2I0N A;  3QHS A;  1YJN T;  1K73 C;  3EFR A;  3V8K A;  2HQH A;  4M7A A;  3TSZ A;  1M90 U;  1JJ2 P;  2VAS A;  2CP7 A;  1YFN A;  1LCK A;  4YTL A;  2ZCF B;  1M3B A;  2KGT A;  1I81 A;  1MV0 B;  4X34 A;  1VQ6 Q;  3E2U A;  2RQV A;  3I55 Q;  2M02 A;  2ZPB B;  4Y92 A;  1X69 A;  2EYW A;  4PK4 A;  1VOM A;  1AVZ C;  3Q1J A;  3M0P A;  3J7A F;  4M7A C;  1S72 A;  3PFS A;  2F5K A;  4DBF A;  1N6A A;  3I56 A;  1UEB A;  2X9H A;  1PNJ A;  3VS7 A;  3OYD A;  2LQK A;  2A37 A;  3PIP A;  1SPK A;  3SFM A;  3OQ5 A;  3MP1 A;  2YSQ A;  1M8V A;  4D6W A;  1M8M A;  5KYU A;  2RB6 A;  1UTI A;  1VQP T;  2E64 A;  2OTL A;  1RI0 A;  4PJJ A;  1TS9 A;  3VRY A;  1VQM A;  2RHZ A;  3RNJ A;  3DB3 A;  3UT1 A;  3EGU A;  5GMK i;  1QVF P;  3O5Z A;  3M4Y A;  2BKD N;  4RG2 A;  2QGG A;  3F70 A;  3JCM g;  3CPW S;  4RTZ A;  2OAW A;  1KQ1 A;  3U23 A;  2J7I A;  2FB7 A;  3A8L B;  3A1P A;  3H9N A;  1VQK T;  2E5Q A;  1QCO A;  1P92 A;  3M56 A;  4C0D B;  3OYE A;  3FEO A;  3REA B;  5IHN A;  1R0C B;  2JMA A;  1OPL A;  3M59 A;  4DOV A;  4J8O A;  1R77 A;  3BE3 A;  2FPE A;  2XDP A;  2HAX A;  1WQ7 A;  4MDX A;  1BI2 A;  1G3Y A;  1M30 A;  8ATC B;  2FRW A;  2ROL A;  1N5Z A;  1CKA A;  3MJX A;  1H8K A;  1JRI A;  2XMF A;  2GFA A;  4PFZ A;  1Q81 R;  3I5R A;  1M3A A;  4FT4 A;  2IIM A;  1ZUY A;  3QZ9 B;  2RMO A;  4OB1 B;  2MOX A;  2XU8 A;  2OAU A;  3JCM c;  1VQ8 Q;  2DD4 A;  2JJ9 A;  5LJ5 g;  4DBH A;  5CIU A;  1YJN Q;  3OA6 A;  3LGL A;  6AT1 B;  4M78 F;  2M51 A;  4MML A;  4M7A D;  5D6X A;  1UHF A;  2M0Y A;  2RJD A;  1QCN A;  2GGR A;  1GBQ A;  1U5S A;  1JU5 C;  2CP5 A;  1K9A A;  5GAO q;  5CKD A;  2KMT A;  4EMG A;  2QQ9 A;  2HMA A;  3PNW C;  2DXT A;  4C8Q E;  4LD6 A;  3QYH B;  4LDV A;  1JBM A;  2XDD A;  1ZQ1 A;  2YRC A;  4FSX A;  2ZAE A;  2QQS A;  3BFM A;  1MMA A;  2HKQ B;  4LDY A;  4F7U F;  1WA7 A;  3VS6 A;  3FRN A;  4N4G A;  3MEU A;  1PRL C;  3EH2 A;  1VQP Q;  1GXI E;  2E4H A;  1UHC A;  2V8I A;  3OSV A;  4NL3 A;  2EYQ A;  4BI8 B;  5I11 A;  2YUQ A;  4XU1 A;  1C0M A;  1OX9 A;  4R0K A;  5IXF A;  2K3Y A;  3OYG A;  5AYF A;  2YRD A;  1YJ9 A;  1I0C A;  3THK A;  4J7I A;  4PLI A;  3FC3 A;  1OYX A;  2CSQ A;  4HXJ A;  4J9B A;  2JMC A;  1WHH A;  1VQK Q;  1OU9 A;  2QDY B;  1SRL A;  3EG2 A;  2DTO A;  1RAA B;  1TH7 A;  2RK2 A;  3G6E T;  3CCU A;  3M0Q A;  1M2O A;  4C92 F;  2EJ9 A;  2GBQ A;  2CGH A;  2DZ9 A;  1N9S A;  4M75 E;  2XG8 D;  3UDC A;  3CCJ A;  1WI7 A;  3HFN A;  4C5I A;  3A8O B;  4BB7 A;  3J81 E;  4HCZ A;  4OGC A;  1OQK A;  2KR3 A;  2PTK A;  3JB9 I;  4FYV B;  3RMQ A;  1Q81 C;  5KYY B;  2K9G A;  3MHX A;  1JJ2 S;  1C1A A;  2A0F B;  2I2L A;  1UEC A;  4CI0 C;  2RM4 A;  4J6W A;  4LDW A;  1IHV A;  4EDU A;  5KCH A;  2DXB A;  4J6X A;  2VVK A;  1WGS A;  5CKH A;  4NS5 A;  3MP8 A;  1Y7X A;  1BBZ A;  2FO0 A;  2QYZ A;  3OS5 A;  3QXE B;  5I2M A;  4CC4 B;  1UB4 A;  5AT1 B;  4LUD A;  1WZO A;  4N0A A;  1YIT A;  3OW2 A;  1YHQ T;  1BIA A;  1AHJ B;  3EG3 A;  2AIR B;  1Q81 U;  5EG2 A;  5GAN 4;  2K5I A;  4AFS C;  3CCM T;  3CCV T;  4M77 F;  1TWB A;  3C0C A;  1HJD A;  5LJ3 d;  1ARK A;  4DBR A;  3SB2 A;  2YUO A;  3RBB B;  5L23 A;  5ECA A;  3EHQ A;  2P4R A;  3VKI A;  1ZA1 B;  4QKU A;  4N0A C;  1HXD A;  1BIB A;  2PUK B;  2ED1 A;  3DB4 A;  3OYK A;  2DK3 A;  1VQO T;  5GJW B;  1M9S A;  1KD1 U;  2AKL A;  2EQM A;  1M3C A;  1QQJ A;  1WQW A;  4O6J A;  1IB8 A;  4A4K A;  1HSQ A;  1JQQ A;  2EQJ A;  2E5K A;  1VQN T;  4AFU C;  3OYH A;  3UPU A;  1PD1 A;  5KCO A;  1SF9 A;  3JRZ A;  4Y91 A;  2IVW A;  3V7C A;  2V1Q A;  3CQT A;  3E19 A;  3EG1 A;  3G1J A;  2L3Q A;  3P8H A;  3CME A;  1WYX A;  4XU3 A;  2X35 A;  1D3B B;  2CZ1 B;  3QPH A;  5LJ3 f;  4MZT A;  1QW1 A;  4E7L A;  2LJ3 A;  1NPR A;  2JM9 A;  2RK1 A;  3EGX A;  2L3S A;  2QA4 A;  2C06 A;  2F2V A;  1D0Y A;  3H0I A;  1Q82 U;  1Y57 A;  3MO8 A;  1AOJ A;  5A0D A;  3G6E Q;  1B34 B;  4M7D A;  4JS5 A;  5KH6 A;  4PNO A;  3G4S T;  2D6F A;  3CD6 A;  3LW5 E;  4GBQ A;  4RUG A;  3PVQ A;  1MMD A;  1IZ6 A;  1WFW A;  2CZ6 B;  4PLL A;  1ZBJ A;  2AK5 A;  1BKB A;  2RH2 A;  4JUV A;  4EMH A;  3EFS A;  5CQX A;  4M7D C;  1M2V B;  4KUI A;  2D8J A;  2HZY A;  2LRQ A;  4E7Z A;  1A0N B;  2DD5 A;  1U8R A;  3A98 A;  1SG5 A;  4BY6 C;  2DJQ A;  1VQ9 A;  3MEV A;  2X4Y A;  3GF5 A;  4LXC A;  1WHK A;  3HTR A;  4JRI A;  3LGF A;  2AT1 B;  5IAY A;  4E6R A;  2HEQ A;  2PQW A;  3HKS A;  1VYT A;  1YHQ Q;  3CC4 T;  1N8R R;  1X75 C;  5HKC A;  1M90 R;  4CRI A;  2ZPE B;  2DIL A;  3CCM Q;  2DBK A;  4J7F A;  2R5A A;  2DTH A;  1EIF A;  2AZS A;  2KRS A;  3BDU A;  4XTV A;  2MK5 A;  1U1T A;  2CRE A;  3X28 B;  4M7A G;  3ZEH A;  4F04 B;  1KQS A;  2GCX A;  4LN2 A;  3AT1 B;  3M0S A;  4KRT A;  1VQO Q;  4HCB A;  4DEX A;  4EIK A;  5FLX E;  2RQW A;  2D8H A;  4WF2 A;  2O4X A;  5J26 A;  1QCF A;  1SSF A;  2YUN A;  4KGV B;  1VQN Q;  4J9E A;  2P4T A;  4QQG A;  2QEX A;  1VQ6 T;  4JLG A;  4RTW A;  4DOW A;  4M7A B;  3H6Z A;  4B9W A;  3CMA A;  5GAN 2;  1PCX A;  2FVU A;  4FSS A;  2VC8 A;  1ZSG A;  3AHU A;  2NUP A;  3JCM X;  3X20 B;  3A8H B;  1AZE A;  3CBP A;  3PTA A;  4RMO A;  1QP2 A;  4GY5 A;  5GMK l;  2GTO A;  4PJO B;  1DJ7 B;  2DBM A;  4M7D D;  1IO6 A;  1WNL A;  3G4S Q;  3EG9 A;  1B3Q A;  4C0G A;  1GCP A;  1W70 A;  1VQ5 T;  1U3O A;  1VQL T;  1ZUU A;  3RUX A;  2DL5 A;  2KXC A;  3TSW A;  3CCL A;  4ELY C;  5KYU B;  2BTT A;  2M16 A;  4A4G A;  1WIE A;  3RIR A;  3NPF A;  4OMP A;  2OTJ T;  3HFO A;  2ROT A;  3O8V A;  2F2X A;  1U1S A;  8AT1 B;  2QK0 A;  1OOT A;  3R6O A;  3URG A;  4QT7 A;  2CUD A;  2MI6 A;  4RTT A;  1LVK A;  2L5Q A;  1NEB A;  3M4G A;  4RTY A;  1D1A A;  2RI3 A;  2P0K A;  1JXO A;  1I8F A;  4JPB W;  3KBG A;  4B9X A;  4CC2 A;  4A53 A;  4OB2 B;  1N8R C;  2QDL A;  1NM7 A;  1ABQ A;  1M90 C;  3CC4 Q;  4IKF A;  2RI5 A;  3NTI A;  2ZPG B; 
#chains in the Genus database with same CATH homology
 2EIF A;  3OYM A;  4LD9 K;  4ZGD B;  1FXX A;  1I5L A;  1JRI A;  1LOJ A;  3CCR A;  1Q86 C;  2DVE A;  2GFA A;  5A2Q E;  5M9O A;  3CD6 T;  4C0F A;  3OBY A;  1VIF A;  1OZ3 A;  3KXT A;  3OMG A;  3OMC A;  4FT4 A;  1VQ9 T;  2X4J A;  3I55 A;  3FB9 A;  3HRU A;  4OMF B;  2L89 A;  3QZ9 B;  1VQN A;  1M5Q 1;  4OB1 B;  3JCM c;  2XU8 A;  2OAU A;  4IUT A;  5GAN h;  2DD4 A;  5LJ5 g;  2E41 A;  3JCM d;  5CIU A;  4P5N A;  1YIJ T;  3JB9 F;  3JCM V;  3OA6 A;  3LGL A;  4XU0 A;  4ME7 A;  5HY6 A;  4M78 F;  4XAX B;  3V7R A;  2IG0 A;  4MML A;  2KDS A;  2DTI A;  4M7A D;  4JRQ A;  4C5E A;  3CPW A;  3LX7 A;  3WVE B;  5GMK h;  2E65 A;  5D6X A;  1N8R U;  4M78 G;  2KQW A;  3V7S A;  4BAC A;  1UGR B;  3S3M A;  3CBM A;  2RJD A;  2VUB A;  3FJP A;  3T9N A;  1KHC A;  2Y4Y A;  4BI4 A;  5LJ5 j;  4GLK A;  2EKO A;  3LH0 A;  3CCQ A;  4MDW A;  3BY7 A;  4M78 A;  2CZ0 B;  2EJF A;  5CQY A;  5CVI A;  5CKD A;  5GMK e;  5GAO q;  1N27 A;  2KMT A;  2Y4X A;  4FM4 B;  4EMG A;  1VIE A;  2QQ9 A;  1Q86 U;  3PNW C;  5DY9 A;  1WJS A;  2FHD A;  4M77 G;  2DO3 A;  3NFC A;  4C8Q G;  2GFU A;  5DLQ E;  2E10 A;  1XTD A;  1Y96 A;  4E7K A;  2DXT A;  2XI9 A;  2K57 A;  4M77 E;  4C8Q E;  4LD6 A;  3QYH B;  2L3R A;  4M7A C;  1KG1 A;  4LDV A;  3G4S A;  1JBM A;  2XDD A;  3E9F A;  1ZQ1 A;  3QUI A;  4OB0 B;  3BDL A;  3JSC A;  4OVA A;  4FSX A;  3CXC S;  3JCM e;  1QVF S;  4JRP A;  2EAY A;  5IN1 A;  2XKO C;  4M78 B;  2E6N A;  3M55 A;  1QVG S;  2LX9 A;  2QQS A;  3BFM A;  5CAI A;  4M78 C;  4LDY A;  3NTK A;  4F7U F;  2HNI A;  3INZ A;  1X6O A;  3FRN A;  4N4G A;  1Y96 B;  1G3W A;  2VGN A;  3EAE A;  3WVD B;  5GAN g;  4BDY A;  2CKK A;  3M53 A;  5HK0 A;  3MEU A;  1X01 A;  2RHU A;  3A8G B;  4F7U G;  3JCM f;  3VJP A;  1O9S A;  3HL8 A;  4HT8 A;  1GXI E;  3DKM A;  1M1G A;  1MGQ A;  4Z02 A;  4C8Q C;  5HK3 A;  4FU6 A;  2MWP A;  2V8I A;  4RCC A;  2EQU A;  4ZN3 A;  4F7U A;  3OSV A;  5GAN 5;  4NL3 A;  2EYQ A;  4Q5W A;  4XK8 E;  4BI8 B;  4XU1 A;  4TVR A;  4X9C A;  3LWI A;  2RHI A;  2DIQ A;  5C6S A;  3OS1 A;  3HSB A;  1VQ7 A;  2K3Y A;  2P0P A;  3OYG A;  5AYF A;  2JN0 A;  3CCS T;  1YJW T;  1YJ9 A;  3RMS A;  3OW2 S;  4J7I A;  2D9T A;  2X4W A;  4PLI A;  5GMK j;  4FT2 A;  3OYF A;  3FC3 A;  4F7U B;  2XID A;  2M9U A;  3MEA A;  4OGE A;  1OYX A;  5FU6 B;  2WAC A;  5FRM A;  2QEX T;  3HP9 A;  5DLO A;  2XDB A;  5FU6 C;  2QDY B;  1ZHI A;  3CC4 A;  4L6V 5;  1K9M U;  3FDR A;  4V2S A;  2DTO A;  1Y07 A;  1Q7Y C;  4A4H A;  3CMA T;  1PSF A;  2RK2 A;  1TH7 A;  3G6E T;  3CCJ A;  1S72 T;  4N4I A;  3L42 A;  2DPP B;  3I56 T;  3CCU A;  2LVM A;  5GAO p;  3CC2 T;  2DEQ A;  4C92 F;  2EJ9 A;  5LJ3 g;  3OS2 A;  5LJ5 e;  3TEE A;  4M75 G;  2CGH A;  5J39 A;  2DZ9 A;  2G3R A;  3RKX A;  2VV5 A;  2LQ8 A;  2RO0 A;  1BI1 A;  3M54 A;  1N9S A;  2XG8 D;  2MF2 A;  4M75 E;  3UDC A;  1OI1 A;  4C92 G;  5C0M A;  1WJR A;  1QP3 A;  3HFN A;  4C5I A;  3L2R A;  4E7H A;  1M1K C;  3CXC A;  3A8O B;  5GAO n;  4BB7 A;  2DKG A;  3J81 E;  3C4S A;  4HCZ A;  4OGC A;  3LLR A;  1VQ8 A;  5GAN d;  1YJN A;  4HCC A;  3JB9 I;  4C92 A;  3QYG B;  1LJO A;  5LJ5 f;  3RMQ A;  1Q81 C;  4BE2 A;  2OTL T;  4QVD A;  3QSU A;  3MHX A;  1LNX A;  2CYZ B;  3G71 T;  2YLB A;  1VQM T;  1JJ2 S;  4C5G A;  4E7I A;  2I2L A;  4CI0 C;  2RM4 A;  4J6W A;  3MEW A;  4LDW A;  4BUG A;  3CEY A;  1VQ4 T;  4EDU A;  5KCH A;  1W4S A;  1Q7Y U;  1WJQ A;  4QVZ A;  2DXB A;  3CCL T;  5GAM d;  1VQ6 A;  2QTX A;  4J6X A;  5GAO m;  2WSF E;  4C92 B;  2XIC A;  1QVP A;  1G5V A;  5GAN 8;  1WGS A;  5CKH A;  2QQR A;  3OYJ A;  4NS5 A;  4C92 C;  3MP8 A;  1Y7X A;  3OS5 A;  5I2M A;  3QXE B;  3OYN A;  2MWO A;  2XHC A;  2EWN A;  2K3X A;  3BW1 A;  3N5B B;  3OYY A;  2JNG A;  1UB4 A;  2NLU A;  3P8D A;  3ME9 A;  3OSS C;  3S6W A;  3V8J A;  5A0G A;  1M1K U;  4XTY A;  5CCA A;  4N0A A;  1YIT A;  3OW2 A;  2K5L A;  1BI3 A;  4IUQ A;  5GAN e;  5KE2 A;  1YHQ T;  3QG1 A;  1BIA A;  2KVQ G;  2JOY A;  4QQ6 A;  3L2V A;  3ZFJ A;  1O75 A;  1AHJ B;  3JB9 D;  2VXE A;  3ZBD A;  2JTF A;  3DLM A;  1Q81 U;  1NJI C;  5EG2 A;  5GAN 4;  2K5I A;  2D0Q B;  3CCM T;  4M78 D;  1NE8 A;  2A7Y A;  5GAM h;  2JTM A;  3CCV T;  1FWZ A;  4M77 F;  4NL2 A;  4C8Q F;  1W2B S;  1H64 1;  2HQE A;  2LTO A;  2R58 A;  4ELZ C;  5LJ3 d;  2E6Z A;  2PUO B;  3VV0 A;  2L8D A;  3OB9 A;  5GAN f;  1VQP A;  3SB2 A;  3A5Z B;  5CKE A;  2GF7 A;  2RA2 A;  4M7A E;  3VKI A;  3X25 B;  3VU3 C;  4C8Q D;  1Y71 A;  1HXD A;  3QO3 A;  4N0A C;  3JCM P;  1BIB A;  2EFI A;  2P0Q A;  2PUK B;  1VQ5 A;  2BIV A;  3DB4 A;  4M77 A;  2PU9 B;  2YRV A;  4C8Q A;  2DK3 A;  3OYK A;  3CCE A;  1VQO T;  1M9S A;  3S3N A;  3C95 A;  4Y28 E;  2E12 A;  1KD1 U;  5FRN A;  1NPP A;  2BUD A;  2EQM A;  3CCR T;  1WQW A;  2K5F A;  1FX7 A;  4J83 A;  4E47 A;  4A4E A;  3OS0 A;  3E1S A;  4O6J A;  4OP0 A;  2VGM A;  4A4K A;  1M1F A;  2DZC A;  2PVO B;  5LJ3 h;  1K9M C;  2JVV A;  3I55 T;  4C5H A;  2EQJ A;  4JS4 A;  4PJO G;  2VXF A;  3OY9 A;  2OTJ A;  1VQN T;  3G7Z A;  4M77 B;  4C8Q B;  1D3B A;  1NJI U;  1JJ2 A;  1UGP B;  2M1H A;  4PJO E;  3OYH A;  3UPU A;  1VQK A;  3RER A;  3L2Q A;  2ZPF B;  3HRT A;  4M77 C;  5KCO A;  4JDS A;  5LJ3 e;  4PJO A;  2WSE E;  3JRZ A;  3SDZ A;  4Y91 A;  2ZZD A;  5GMK m;  3TU4 K;  2IVW A;  3FLG A;  3V7C A;  2PVG B;  5CR2 A;  5GAN j;  4KT0 E;  4BD3 A;  3E19 A;  4RCB A;  4A54 A;  1K73 U;  5GAM g;  1B34 A;  2HQX A;  1BI0 A;  3P8H A;  5CKB A;  3CME A;  5IT9 E;  5FU7 B;  3X26 B;  2KY9 A;  4XQ3 A;  4XU3 A;  2VYT A;  3SWN A;  4M7D F;  2X35 A;  1D3B B;  2CZ1 B;  3PMI A;  3QPH A;  5FU7 C;  2KK4 A;  5LJ3 f;  4MZT A;  3NTH A;  1QW1 A;  4E7L A;  3CC7 A;  3CCQ T;  1YI2 A;  3JCM b;  1NPR A;  2RK1 A;  4M7D G;  4IUR A;  2QA4 A;  2C06 A;  1R8O B;  2FL7 A;  1Q82 U;  2KAF A;  2QXF A;  3M58 A;  4A4F A;  3MO8 A;  4M7D E;  4PJO C;  5LL6 S;  3WXM B;  3JCM W;  5A0D A;  5GAM j;  4DA4 A;  3RKW A;  2CS7 A;  1B34 B;  4M7D A;  5GAN 7;  2RI2 A;  2DIG A;  2WSC E;  4JS5 A;  5KH6 A;  2F5T X;  2YLC A;  4PNO A;  5GAN 3;  3G4S T;  2D6F A;  3CD6 A;  4L5G A;  3QBY A;  2H3J A;  3LW5 E;  1V29 B;  1H3Z A;  4XTU A;  4M75 F;  5I21 A;  1KQS S;  4MZP A;  3L1A A;  3E9G A;  4II1 A;  4L59 A;  4J5Y A;  3SWN C;  3PGG A;  4IUU A;  1HK9 A;  4ZTJ A;  2LT1 A;  3JCM Q;  2XK0 A;  4PL6 A;  1IRE B;  1IZ6 A;  2EQK A;  3V8L A;  2CZ6 B;  1YIJ A;  4PLL A;  3JB9 H;  4R55 A;  4J6Y A;  3M9Q A;  1BKB A;  2RH2 A;  4M7D B;  1QVF A;  2V8K A;  3QZ5 B;  1KHI A;  3OYB A;  4JUV A;  4M75 A;  4C92 D;  4EMH A;  3EFS A;  4QW2 A;  5CQX A;  4M7D C;  1QVG A;  4KUI A;  3J80 E;  2E1H A;  1PSE A;  2ZPH B;  4BDZ A;  4ZGJ B;  5LJ3 j;  2LRQ A;  4E7J A;  3JAM E;  2DD5 A;  2XD0 A;  4IUP A;  3GLX A;  4XTW A;  4BY6 B;  1U8R A;  1G3T A;  4XU2 A;  5CKF A;  4MZM A;  4BY6 C;  3A8M B;  1VQ7 T;  1XOV A;  1VQ9 A;  3MEV A;  4HA8 A;  3JB9 J;  3PT9 A;  4M75 B;  2X4Y A;  1YBY A;  1YJ9 T;  3GF5 A;  2RJF A;  3HHT B;  4KUD K;  4X9D A;  4M75 C;  1XQH A;  4JRI A;  1OZ2 A;  3LGF A;  4JLI A;  5IAY A;  1NZ9 A;  4EMK A;  2DXU A;  4QVC A;  3L2U A;  2YHT A;  2PQW A;  3HKS A;  1KD1 C;  2R57 A;  2K4Y A;  1BYM A;  5GAO r;  4RG8 A;  2RJC A;  3CC4 T;  3CBO A;  4UC4 A;  1KC8 C;  1X75 C;  2LCL A;  5HKC A;  5GAO l;  3ER0 A;  4CRI A;  2ZPE B;  5L8R E;  1UGQ B;  3GOX A;  4FL6 A;  2DXC A;  3L2Z A;  4J7F A;  2R5A A;  3HPW A;  3QJ6 A;  3CCU T;  5J3B A;  4JRK A;  2DTH A;  1YCY A;  3RKY A;  1EIF A;  5FRO A;  4EMK B;  2CZ7 B;  3MCA B;  5KE3 A;  4M7A F;  3BDU A;  2RHX A;  4XTV A;  2HBP A;  3HRS A;  4EMK C;  3JCM J;  3CCJ T;  3GPL A;  1U1T A;  3KUF A;  3PMT A;  4HKE A;  3X28 B;  4M7A G;  3SD4 A;  5D6W A;  1VQ8 T;  4LDU A;  3ZEH A;  3QHS A;  2MAM A;  1KQS A;  2GCX A;  1YJN T;  5GAM e;  1K73 C;  3EFR A;  3JB9 G;  4M77 D;  3VYG A;  2EJG A;  4O5V A;  4HCB A;  2QI2 A;  1N9R A;  3OYL A;  3V8K A;  2R5M A;  4M7A A;  5CK9 A;  5A0L A;  1M90 U;  3GNG A;  3LYI A;  5FLX E;  4M78 E;  4N4H A;  3CCS A;  1I4K 1;  1YJW A;  4WF2 A;  2O4X A;  5J26 A;  4YTL A;  2ZCF B;  1SSF A;  1I81 A;  1RL2 A;  4X34 A;  1KC8 U;  1Q82 C;  5GAM f;  4PJO F;  3QII A;  3M57 A;  5CO7 A;  4BI3 A;  2ZPB B;  3P8B B;  3JCM h;  2P4T A;  4QQG A;  2QEX A;  1VQ6 T;  3GIB A;  4JLG A;  4FIB A;  4DOW A;  4IUV A;  2LT4 A;  2O01 E;  1ZBX A;  4VUB A;  4NOY A;  4M7A B;  3PIO A;  4OF1 A;  4XTZ A;  3OYA A;  3H6Z A;  3Q1J A;  4KBM B;  4HT9 A;  4B9W A;  4PJO D;  2A3L A;  2RJE A;  2DAQ A;  3CMA A;  4BE0 A;  1S72 A;  3PFS A;  3G6E A;  3J7A F;  2O4X B;  3C94 A;  2F5K A;  2FVU A;  3M5A A;  5GAN 2;  1N6A A;  3S3O A;  3FIF A;  3H8Z A;  1UEB A;  3QDR B;  3VUB A;  3I56 A;  1KQ2 A;  4RKU E;  2LQK A;  3OYD A;  3QKJ A;  2E70 A;  2VC8 A;  2LC4 A;  1WPY A;  1YIT T;  3CC2 A;  3AHU A;  3PIP A;  2MMP A;  2KSS A;  3SFM A;  3OQ5 A;  1XNI A;  3MP1 A;  3X20 B;  3A8H B;  3JCM X;  3CBP A;  3DLL A;  4LDX A;  2GQV A;  3PTA A;  4RMO A;  2Y90 A;  1QP2 A;  4D6W A;  1M8V A;  2LCC A;  4ZGE B;  4GY5 A;  5GMK l;  5DM7 R;  2ZPI B;  3CPF A;  2X4X A;  4F7U E;  3UWN A;  4PJO B;  2F69 A;  2RB6 A;  4ZN1 A;  1VQL A;  3QJY A;  1VQP T;  1DJ7 B;  2E64 A;  2OTL A;  2JZ2 A;  1RI0 A;  4M7D D;  1M4Z A;  1WNL A;  2JUF A;  5LJ5 d;  3G71 A;  1VQM A;  4C0G A;  2RHZ A;  3VYH B;  3DB3 A;  3UT1 A;  1VQ5 T;  2PVD B;  5GMK i;  2DJZ A;  3OBW A;  3SWN B;  1W2B A;  3M4Y A;  4C0Z A;  1VQL T;  2AHJ B;  2BKD N;  3RUX A;  3CCE T;  5GAN 6;  4RG2 A;  1VQ4 A;  1G3S A;  4KUL A;  3F70 A;  3GNF B;  4EPC A;  4BE1 A;  3CCL A;  4OB3 B;  4ELY C;  2QQB A;  3JCM g;  3CPW S;  1UGS B;  1MHN A;  5I2S A;  1K8A C;  4ATO A;  1KQ1 A;  3TCJ A;  3VUZ A;  2M16 A;  4M75 D;  4A4G A;  2FB7 A;  3A8L B;  5D6Y A;  3RIR A;  3GP8 A;  2OTJ T;  3HFO A;  1JB0 E;  4PKC C;  5LJ5 h;  3MET A;  2RD1 A;  3O8V A;  4R56 A;  4ZTF A;  4QQD A;  1VQK T;  2FYK A;  1U1S A;  2LNV A;  1YHQ A;  2E5Q A;  3R6O A;  1P92 A;  3URG A;  3M56 A;  3TRE A;  2RHY A;  3MP6 A;  4C0D B;  3OYE A;  3FEO A;  4XTX A;  2MI6 A;  4DQ2 A;  4MMK A;  3CCM A;  2L5Q A;  3M59 A;  4C0D C;  4DOV A;  3CCV A;  3M4G A;  2ZGW A;  2M0O A;  2P0K A;  2RI3 A;  4J8O A;  3X24 B;  3CME T;  3ASK A;  1I8F A;  3KBG A;  2K2V A;  4B9X A;  2XDP A;  2HAX A;  4C92 E;  1WQ7 A;  3OYI A;  4MDX A;  1VUB A;  4A53 A;  1BI2 A;  4OB2 B;  1N8R C;  1G3Y A;  3C12 A;  3L2W A;  1YI2 T;  3CC7 T;  2B8A A;  2V8J A;  1M90 C;  2QA4 T;  4JJN K;  3RES A;  2LDM A;  3LWH A;  4IKF A;  2RI5 A;  1VQO A;  1K8A U;  2QQA A;  2HD0 A;  3NTI A;  2ZPG B;  3OYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...