1QP2A

Solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of photosystem I accessory protein E from the cyanobacterium Nostoc sp. strain PCC 8009.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
molecule keywords PROTEIN (PSAE PROTEIN)
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qp2A00
4OB0B 4KT0E 4OB3B 4RKUE 3VYGA 2D0QB 2PU9B 1PSFA 2DD4A 3WVDB 1V29B 2WSEE 4Y28E 2WSCE 1IREB 2AHJB 4ZGEB 2ZCFB 1JB0E 2CYZB 2DXCA 3A8GB 3QXEB 1AHJB 2PVDB 1UGSB 3QZ5B 5L8RE 3A8HB 2CZ1B 2CZ6B 3X25B 3VYHB 3LW5E 4OB2B 2DD5A 3QYHB 2ZPBB 4ZGDB 1DJ7B 4OB1B 4ZGJB 2PUKB 2CZ0B 3X26B 2PVOB 2WSFE 3QYGB 2PVGB 4L6V5 3X24B 1GXIE 1UGRB 3HHTB 3A8OB 2ZPEB 2ZPIB 2O01E 1QP2A 3A8MB 3X20B 2ZPFB 2PUOB 4XK8E 3QZ9B 3A8LB 4FM4B 3WVEB 2ZPHB 1PSEA 2QDYB 2DXBA 2ZPGB 1UGQB 2ZZDA 3X28B 2DPPB 2CZ7B 1QP3A 1UGPB
chains in the Genus database with same CATH superfamily
4HVVA 4M75B 3OYEA 2D6FA 2QGGA 4N4GA 3OYMA 5GAOn 3FEOA 3EG2A 2IVWA 2COWA 4RCBA 3CCJT 5CK9A 2KK4A 4HCKA 2YUOA 3G7ZA 5IAYA 1AWOA 5GANd 4AFUC 3CD6T 5CKFA 3EGXA 1D3BA 1IGQA 1TS9A 1T0JA 2FO0A 1MMAA 1A0NB 2NUPB 3QO3A 3P8BB 4R0KA 1JEGA 2VASA 5FU7B 4OMPA 1O9SA 3EG1A 3VS3A 2SRCA 1H8KA 1JO8A 2HSEB 3V7CA 1Q86C 5LJ3g 2MCNA 4MMKA 2RQUA 5EG2A 3VYGA 4J7IA 2DIGA 2WSEE 2PNIA 2RO0A 2ZCFB 1E6HA 3QZ5B 5L8RE 1B07A 3CCUQ 1S1NA 3EGDB 4NL3A 3PMIA 4OB2B 5D7UA 2X4JA 4DBFA 1NE8A 1K73U 1BBZA 3CCVT 1EX4A 4DBRA 3QZ9B 3G1JA 1BI1A 1I1JA 2NUZA 2ZPHB 2DL8A 3CBMA 3R6NA 5GAN6 4PJOB 2DJZA 2W0ZA 5EC7A 2JN0A 2H3JA 1R0BG 2X3XD 3ULRB 2YLBA 4DEXA 1VQ5T 1Q82U 3A8OB 2O01E 1M9SA 1I81A 5IHKA 3UA6A 4QT7A 4M75A 2QGFB 4C8QF 3F70A 2CKKA 2DILA 1E7OA 2D0QB 3CMAA 1I5LA 2O88A 5CAIA 3TCJA 1AWWA 2W10A 4RTWA 3SEMA 4N0AA 4PJJA 3QYGB 4A4HA 3CCEQ 2LP5A 3RMQA 3OBYA 2QQRA 2DL7A 3ASKA 2ZPGB 1WJRA 3G6ET 1M1GA 1QCFA 1VYVA 1IZ6A 2GQIA 2FL7A 3BW1A 2DXCA 3FDRA 3QG1A 5LL6S 2COZA 2JUFA 4JZ4A 2EJ9A 4M77D 1VQKA 1N9RA 2KROA 1D0ZA 2EYYA 2QQAA 2DETA 2V1RA 3NHNA 2HNIA 4NS5A 2EQJA 1YNZA 1K73C 2C0IA 3HSBA 2GNCA 1QVFP 5D6WA 2DBKA 4HXJA 1ZBJA 4IURA 2EYZA 2DE0X 1YJWA 3H9NA 4EMKA 3SWNA 4XTWA 1X6OA 3OYFA 3G71A 2P0PA 1VA7A 4J9DA 3G4ST 2YUQA 1RUWA 5GAOr 4M75E 2QA4T 1K8AC 1Q82C 4J7FA 4IKFA 2DFUA 2EQIA 1VQ4A 4XTXA 4E7LA 4JUVA 3GNGA 1PRMC 4OGEA 3ZL7C 1XNIA 3CCLA 1W70A 2CH4W 1OULA 2YLCA 1D1BA 2DL5A 2M9UA 1X43A 1PWTA 3I35A 2DVJA 3CPWS 5FU7C 2FYKA 3VS2A 3JCMd 4OB0B 3QSUA 1QCNA 5GAMd 1IRXA 3GPLA 2QEXQ 1GCQC 4LDWA 4OVAA 4M77A 2HBPA 1SHFA 2YRCA 4J9FA 1RI9A 2CZ0B 1G5VA 2EPDA 2P0KA 2H8HA 4KGXB 3CCRQ 4WF2A 1SF9A 1MGQA 4AFQC 1OV3A 2DXTA 2QDLA 3QBYA 4NL2A 3G4SQ 4M78B 3FC3A 4E7IA 1MHNA 1AWJA 1VIFA 2XIDA 1AZGB 3X25B 3LH5A 4MDWA 4PFPA 2XMFA 1MV0B 2EWNA 1RAFB 4M7DC 2HKNA 4ZN1A 4VUBA 1RAIB 4EDUA 3A98A 2QASA 3OYYA 4EPCA 1VQPT 3H0IA 4M7AA 2XI9A 3QXEB 1LCKA 2FRYA 3L2WA 1TXQA 1TUCA 1UECA 3BDUA 1FYNA 4M78G 9ATCB 1G8XA 4M7DE 2LTOA 3J7AF 1BI3A 2JS2A 3V8LA 1QKWA 3C4SA 1PM3A 2COYA 3L2UA 3E9FA 2XDPA 1JBMA 1NG2A 1ZHIA 2RJFA 3A1PA 5DLQE 4ORZA 1HYOA 2P84A 1M90U 1JJ2P 1JU5C 3GOXA 1CKBA 4C8QA 1YHQA 2QAZA 4HT8A 5CKBA 1WNLA 1MUZA 5IT9E 3C95A 2XKOC 2RHYA 4XK8E 4D8KA 2LT1A 4M77F 5I22A 4KUIA 1YIJT 3C12A 5KH6A 1BCMA 2QK0A 2X35A 4II1A 3CC2T 4PKCC 3S3OA 3NFCA 3FB9A 1VQ9T 4CC3A 4EIKA 3CCLT 2OTLT 4IUUA 5GANh 5CKEA 4L59A 1UB4A 1TSFA 2A28A 1H3HA 5D6YA 3RESA 3CCVA 1YFNA 4A4FA 1G2BA 4F7UG 1RAHB 3OSVA 4FT4A 4MZTA 2OTLA 4JS5A 2YUNA 1NLOC 3PVLA 3CCSQ 3META 5CCAA 1VIEA 2L2PA 4JRKA 2XK0A 3JCMP 1VUBA 4TVRA 3E19A 3MEAA 4RTTA 3H0HA 1Y7XA 3OYCA 2PUOB 1M8MA 2CP7A 2CS7A 1FMKA 2DPPB 4IIOA 3OS0A 3OYGA 2QG9B 3PIOA 5GAOq 3GBQA 3PGGA 1ARKA 1W6XA 4JJCA 5KYXB 1ZSZA 1VYTA 4AT1B 2K3BA 1YN8A 2EYXA 1UJ0A 3M57A 1M5Q1 2CDTA 2A08A 2RD1A 4HCZA 3RUXA 4M7AC 4RTUA 4BE0A 4J9BA 4DEYA 1TUGB 2E6NA 1W2BS 3DLLA 2RQVA 2DX1A 3CMAQ 3EG3A 3HRSA 4PFOA 2KXDA 1XJWB 1Z9QA 2QI2A 5GJVB 2EGEA 1NJIR 3X20B 1S72T 1LOJA 3L42A 3WVEB 2K3YA 4JRPA 4XAXB 2PTKA 1OU9A 3G71T 4Z89A 2CP3A 3ZBDA 4ZGEB 1VYUA 1G3YA 2Y4XA 4BUGA 2A36A 4BY6B 3V7SA 4PJOG 3KXTA 1K8AU 1HJDA 4L6V5 4Z88A 3PMTA 2ZAEA 3RKYA 2Z0WA 3I9QA 1BB9A 1X69A 3QIIA 3ZFJA 2QQ9A 1K9MR 4D8DA 3HP9A 3A8GB 3OS1A 2WACA 5GANj 1M3CA 2CP0A 3CMAT 3M55A 2JOYA 1PRLC 2LZ6B 2MOXA 3TU4K 2E65A 1PCXA 3CCJA 2AHJB 4DBHA 1Y96B 2DZ9A 1YJ9T 3CCET 2EQMA 2RNAA 4PL6A 3RMSA 4F7UF 1AOJA 3NPFA 2PVOB 3CQTA 5GAMj 4KH1B 4JS4A 2LRQA 2QEXA 2JT4A 2HQEA 3CC7Q 1CSKA 4PK4A 1U3OA 2DD5A 4C8QE 4M77C 3FJ5A 4PNOA 5GMKe 1S72A 3CCUT 1QW1A 2B8AA 2F2VA 2KE9A 1YP5A 5HCKA 1TWBA 4C92F 1GBRA 2LJ0A 2A7YA 2RM4A 3JB9F 3C0CA 3L2RA 3QPHA 4EMHA 2LQNA 2ZZDA 1WYXA 4J83A 2M51A 5KYUB 3JCMX 2YT6A 1ZQ1A 2CZ1B 2M02A 4AG2C 3M0PA 1OX9A 2QA4A 2K2MA 4V2SA 3PE0A 4Z8AA 2EKHA 4C92E 2QA4Q 2ABLA 2KI7A 2DJQA 1XTDA 2KY9A 2D8JA 3CC7T 2LNVA 1X75C 2YXYA 2K9GA 1GFCA 4LUDA 2DZCA 4FYWB 3SFMA 3M4YA 2AT1B 4E7ZA 2OTJQ 2KYMA 2DL4A 4CC2A 3TVTA 3QHSA 2VXFA 2FPDA 2BZ8A 5KYYB 2X4YA 3EFSA 2RF0A 1AZEA 1T3LA 5CQYA 2MF2A 5FWBA 4C8QB 3LYIA 3V8KA 2ATCB 3EGUA 3MPUB 1Q86U 1VQ9A 2PUKB 3CEYA 4WTOB 3OS2A 3HFNA 3I56A 1WX6A 1VQ7Q 3DKMA 1PSFA 4QVCA 3PIPA 2VYTA 1TG0A 3OYNA 4QW2A 1K1ZA 1H3ZA 4JJDA 3PVQA 3QYHB 1U8RA 2MWOA 2PVGB 2LNHB 2LX9A 2RI5A 3P8DA 2R5AA 2CGHA 3A8MB 4LXCA 3T9NA 1PC0A 2L0AA 2LVMA 3LGLA 4CI0C 3A5ZB 1OPKA 4YTLA 4J9GA 2RI2A 1BIAA 5GAN2 4ZTFA 1WHKA 1VQ8T 3LX7A 2DBMA 4GLKA 1RACB 1W2BA 2LQ8A 1D1AA 5FLXE 5FW9A 2K5FA 3GIBA 3JCMg 1QWEA 2YWWA 2MK5A 2BZYA 2CP6A 5GAOp 4X1VA 4EMKC 1WJSA 3GP8A 2GGRA 2XHCA 5LJ3h 2ROLA 3R6OA 2CSQA 4QQ6A 1WZOA 1ZUYA 2D8HA 2DA9A 1HSQA 4J6WA 2O31A 4NOYA 3VS5A 2DYIA 5IXFA 1Q7YC 2KQWA 2F1LA 3RDVA 5GAOm 4ESRA 2DXUA 1D0XA 2ZPEB 3EHRA 1NEBA 2JZ2A 3I5RA 2MI6A 5GAMh 3I55A 2GFAA 3S6WA 4M75F 2F69A 2GCXA 3E1SA 3ZEHA 2EKOA 3JCMb 1KQSS 3I5SA 1M1KR 1YJWQ 5I2SA 1HXDA 5GAN5 5GANg 1UEBA 5GJWB 5GMKj 1VQ8Q 4BE1A 4RG2A 1WHJA 5IXBA 2K5IA 2LMJA 3OYHA 4F16A 1BIBA 2C0OA 2XD0A 1YJWT 5CKDA 2V1QA 4C0FA 3BFMA 1IHVA 2CYZB 1W2BP 1AHJB 2R57A 3VUBA 2K4YA 3M0RA 4XU3A 5DY9A 1MNEA 1VQKQ 4XU0A 3M56A 1VQ9Q 2YRDA 2K57A 3DLMA 2O4XA 3X26B 3OYBA 4E47A 1VQ8A 1ACMB 5A0LA 3M59A 2HQHA 4BY6C 5KYWA 2RH2A 4RTVA 2P0QA 4C92A 4DQ2A 5GANe 1JQQA 2GTJA 4JJBA 2X3WD 3HL8A 4M75C 3JAME 3OW2P 2FVUA 3DB4A 3SD4A 2KYBA 1YI2T 2GQVA 2QTXA 2HQXA 3MEVA 3FLGA 4ZGJB 1QVGS 1OZ3A 1PKSA 1VQ6Q 3THKA 5CO7A 2HL3A 3KBGA 2RI3A 1E6GA 2JTEA 2GBQA 4X9CA 5KYNA 3EHQA 4FW2A 1NYGA 1Q81U 1O75A 1M3AA 1OQKA 4D6WA 2NYSA 2ROTA 3JCMV 1RAAB 1QCOA 5CKHA 2KR3A 2LJ3A 1VQ6T 3VV0A 3PFSA 2EYWA 2QTVA 1WXTA 1SRMA 1N5ZA 2V8IA 1B7TA 3G6EA 3MP1A 2VV5A 1AT1B 1WXBA 1UUEA 2G3RA 2BTTA 3INZA 2VVKA 3H8ZA 4J6YA 3MJXA 1BYMA 2GTOA 2L3QA 3CMET 1C0MA 3PT9A 4MZMA 1H641 3EH1A 5I21A 1K8AR 3MKDA 1LVKA 3OYKA 1EIFA 3H0FA 1Q81R 1MNDA 5FU6B 4QQGA 2HSPA 1VQ4Q 1JJ2S 1XQHA 2E41A 4FL6A 1YITA 2C0TA 3CMEQ 3RNJA 2E10A 3G71Q 3LW5E 1AEYA 5KYYA 4F7UE 2OI3A 4KRTA 1G83A 2HDAA 4OP0A 2ZPIB 4N0AC 1VQLQ 1IXDA 1TU0B 1WHGA 2RB6A 2EW3A 1M90C 3I56T 3CBPA 3EFRA 1I0CA 2DD4A 1W1FA 3L2VA 1OEBA 3QKJA 3CD6Q 5CIUA 4J5YA 4B9WA 3AHUA 1VQOT 2AZVA 1IHWA 2YHTA 2LT4A 4C92B 3Q1JA 3FRNA 1RADB 1Y07A 4JJNK 2JS0A 2EYQA 2EGCA 2A3LA 1VQNA 2KT1A 1VQOA 1MMGA 2LDMA 1VQNQ 1WQ7A 2QQSA 1BI2A 2BUDA 4IUVA 4J9EA 2MYSA 1QWFA 2AK5A 4JLGA 2A0FB 4ZNXA 3EAEA 1XOVA 1FXXA 3EGDA 4HT9A 3I55T 1R8OB 3EFOA 1Q7YR 5A0GA 1N9SA 1VQNT 4ANJA 2DAQA 3VKIA 3VS6A 2I2LA 4A63B 2K5LA 2L5QA 3TSZA 1KFZA 4Y28E 2DF6A 1UGVA 3M53A 2Y4YA 4M77E 3CBOA 2VB6A 2KMTA 5KE3A 2E3IA 1K76A 3CXCP 2KBTA 3TREA 1SKUB 1D09B 2DNUA 5CR2A 1VQMT 4LN2A 3G6EQ 1VQ5Q 2P4TA 1M2VB 4RTYA 3IQLA 3LLRA 5ECAA 4M77B 4JDSA 1YJ9Q 2JJ9A 4ZTJA 4MDXA 3JCMf 2X4WA 4OMOA 3CPWA 4M7DD 2ENMA 2ED0A 1M1FA 2E70A 4EMKB 3LH0A 3PTAA 3L2ZA 4C8QC 1YJNT 4ATOA 1P92A 1SHGA 2SEMA 1UTIA 1NPRA 1YHQQ 1UGPB 3M58A 3OW2S 1M90R 2PU9B 4QKUA 6AT1B 3JCMW 4PJLA 5J39A 5I2MA 2FPFA 5GAN3 2OX7A 3OA6A 2QXFA 3HPWA 2CT3A 4J9CA 2HEQA 1NBEB 3TEEA 1ZX6A 3M0TA 4OB1B 3JCMJ 3MHXA 3M0SA 2YDLA 1KQ2A 2AKLA 2ESWA 4DA4A 3M54A 2FZKB 3UA7A 2EBPA 3WVDB 2FRWA 1NLPC 4DOWA 1KHCA 1KC8U 4XTUA 1V76A 3KFVA 3P8HA 3TQ7P 2F5TX 2OAWA 4ZGDB 2V8JA 2EJFA 4M7DB 4LNPA 2E5KA 5HK0A 2HAXA 4XTYA 2VUBA 5LJ5d 3SDZA 4BI4A 1M27C 3NTKA 1GCQA 4M7DG 2QEXT 3VS1A 4QVDA 4OB3B 3O5ZA 2VXEA 4PJOC 4E7SA 4AMCA 2LQWA 4C0GA 3VU3C 5IHNA 4IUTA 4RMOA 4BDZA 1WPYA 2L8DA 1GFDA 2EIFA 4IUQA 1UGRB 2RQWA 3JCMc 4PLLA 4C5HA 5GAMe 2DEUA 4LUEA 5IN1A 4M7DF 1W4SA 3CCQT 3OQ5A 5IHIA 4KT0E 3SWNC 1KQ1A 2HD0A 1AVZC 2ZGWA 4HVUA 2PVDB 4C5EA 1IGUA 3VYHB 1RAEB 1YJ9A 3LWHA 2J06A 1OZ2A 3HRUA 2E4HA 2AZSA 5KCOA 3EGXB 3OYIA 4C92D 4BACA 2ED1A 2RMOA 5KYWB 3VS0A 1UHCA 2WSCE 2IIMA 1JJ2A 2NUTA 5A2QE 1N27A 4PJOF 1OI1A 1FWZA 1ZUUA 1U1TA 4BB7A 1Q7YU 2CP5A 3OYAA 2L3PA 4ME7A 4UC4A 1T0HA 2Y90A 4KH0B 1OOTA 1KQSA 3OYLA 1X6GA 2B86A 1Q81C 2F2WA 5KYXA 1KJWA 1Y71A 2KSSA 2EJGA 4RCCA 3OW2A 2CZ6B 5LJ3f 4E6RA 3JB9I 2K6DA 2K7AA 2XU8A 2RPNA 1K0SA 4A53A 1T3SA 1YIJA 2JNGA 1SG5A 5LJ3j 1K0XA 3URGA 2NWMA 4WCIA 4C5GA 2JM8A 4XTVA 4C0ZA 1IO6A 1YBYA 3WXMB 1Q86R 2BIVA 5AT1B 1TH7A 3JB9J 3REBB 3M0QA 1BU1A 1NJIC 4GY5A 4DBQA 5CVIA 4M78C 4BD3A 3JCMe 2BE9B 1C6VX 1K9AA 1Z9ZA 3L2QA 1X27A 1WQWA 2FG0A 2R58A 1VQLA 4M78F 4M7AB 1EZZB 2BZXA 1BKBA 1FMWA 4PLIA 4C92G 4FW1A 1YITQ 5KE2A 2M0YA 4OGCA 5GAOl 4FT2A 1ZSZB 2XDDA 1C1AA 1B34A 3UATA 4IUPA 4AFZC 1RI0A 4B6MA 1YJNA 2RQRA 4X9DA 4M4ZA 3UPUA 1JB0E 4RTXA 1VQ5A 1QMCA 5L23A 2FPEA 1PKTA 3JRZA 5M9OA 1WI7A 2E12A 3GNFB 1Q82R 1TOVA 4BI8B 1SSFA 2JMCA 4XU1A 4F7UB 5C6SA 3J81E 3OMCA 2D0NA 3CCST 3H41A 1NPPA 1UG1A 1WGSA 4HA8A 2QYZA 2KAFA 2KRMA 1RAGB 2FZGB 1B34B 4PJOE 2K3XA 4OMFB 2HCKA 1J3TA 3CC4Q 1QKXA 2VC8A 1VOMA 2ZPBB 4F04B 1S72Q 1PD1A 2YSQA 4BDYA 2DTHA 1VQLT 3I56Q 3FJPA 3V8JA 5IH2A 3RERA 3VJPA 1QP2A 2KXCA 3CC7A 3N5BB 2JTMA 4M7AE 1D0YA 2L3RA 1QVFA 3GF5A 4E7HA 2K2VA 1M4ZA 2EVRA 4FYVB 4M7DA 3HFOA 4JZ3A 1Q95G 5GMKl 1WHHA 2O9SA 4R56A 1MV3A 1YI2Q 5D6XA 3UT1A 5FWCA 2F2XA 3CCLQ 1N8RU 4B9XA 2JXBA 2V8KA 2NUPA 4ELZC 1UJYA 2DLPA 1KHIA 4LD6A 1YCSB 4LE9A 1WHLA 3S3NA 2PZ1A 3JB9H 4CC4B 1K9MU 3CC2A 3MEUA 3RBBB 3NGPA 4C8QG 1M8VA 1GRIA 2DTIA 1VQ7A 1ZA1B 2HL5C 2PQWA 3CCUA 3UF4A 1VQ4T 4LDYA 1PNJA 2O4XB 1VQOQ 3E2UA 2DEQA 3X28B 1UGQB 2HBWA 1RLQC 4DOVA 2J6FA 4EMGA 1V29B 4BE2A 3VUZA 3CCMQ 4KULA 1M3BA 1NEGA 1WIEA 1D3BB 4K11A 2YUPA 2RN8A 3TSWA 1WA7A 2WSFE 2JW4A 2RK1A 3GLXA 5LJ5h 3V7RA 1NJIU 5KYUA 4LD9K 4KGVB 3MO8A 4RKUE 5GAMg 3QWYA 3RIRA 2DRKA 4OMNA 4KUDK 2KT8A 1WXUA 1BK2A 1OPLA 1YJNQ 2DRMA 2C06A 2E64A 1YCYA 3M4GA 4FYYB 1VQPA 4QVZA 2DMOA 3QDRB 1WJQA 4M75G 4R55A 3CCVQ 4F14A 1WLPB 2DERA 4PFZA 5LJ5f 1AD5A 2OAUA 1N8RC 3JB9D 1VQ6A 2X4XA 1WFWA 4C5IA 3A8HB 2JMAA 2HMAA 3M0UA 5KCHA 3MCAB 1TTHB 2CUDA 1X2QA 1WHMA 1KG1A 4AFSC 5I11A 2H3EB 4F7UA 3CCJQ 4FCYA 2EAYA 2ZPFB 4E2FB 1UFFA 1HD3A 3REAB 1RABB 5FRNA 2IG0A 5GMKi 2E5QA 1OU8A 2KGTA 1TUDA 1M2OA 4QQDA 3JV3A 3CPFA 3EH2A 4OF1A 1VQMQ 1F1BB 3CCEA 5LJ5g 5J26A 1UDLA 2EQKA 3LGFA 4FIBA 1GXIE 2AIRB 4HKEA 1X01A 2RHIA 4N4HA 1YWOA 8AT1B 4PJOD 2MPXC 2FZCB 2DO3A 4PJNA 5GMKm 3CMEA 4CC7A 2DL3A 4Z02A 2FHDA 1PG5B 3VRYA 1SEMA 3HKSA 5LJ3d 2J05A 1V1CA 2CP2A 5LJ3e 2JM9A 5HK3A 1KD1R 3UWNA 3OYJA 3CCQA 5FROA 2D1XA 2OTJT 2LCSA 3CCQQ 2BE7D 2DYBA 4OMLA 4P5NA 3LWIA 3HRTA 1FX7A 4XQ3A 3OMGA 5GAN4 2EGAA 2GFUA 2LQKA 2LCLA 2OJ2A 3QJ6A 4M7AD 4FYXB 5HKCA 4O5VA 3QDFA 1N6AA 5HY6A 3CXCA 4J9HA 3BE3A 4C92C 1Y0MA 5GAMf 3X24B 1QVGA 4PJOA 2P4RA 4M75D 3CCMA 5GANf 3S3MA 1VQMA 1I07A 2G6FX 3NTIA 3RKXA 1SSHA 2EFIA 5GAN8 1X2KA 1IREB 1NYFA 1VQ7T 1YHQT 5LJ5j 1NM7A 4Y92A 4A4EA 2RHXA 7AT1B 4PJMA 3OYDA 1RLPC 2L3SA 2RJDA 1KD1C 5DM7R 2CH4A 4JRIA 1YWPA 1KK7A 1PSEA 2E6ZA 2K79A 3EG9B 1R77A 2LX7A 1GL5A 1RL2A 5LJ5e 1LNXA 2KRSA 3OSSC 3U23A 1N8RR 2J6OA 3PNWC 3OBWA 4ZN3A 2CT4A 3JCMQ 3BDLA 4FSSA 2DM1A 1I8FA 2RHZA 3M9QA 3HTRA 2RHUA 1R0CB 2LJ1A 1VQPQ 4A54A 4J6XA 1U1SA 2OTJA 3AT1B 4X34A 4HVWA 4KGZB 2JVVA 1KQSP 4M78D 1QVPA 2I0NA 2O2OA 1K9MC 4M78A 2CUBA 2NLUA 4J9IA 4JLIA 2O9VA 2EQUA 2RA2A 4RUGA 5J3BA 4L5GA 1D1CA 4M7AG 4RTZA 3CXCS 3MP6A 3ER0A 1OX8A 1Y57A 3QUIA 2KRNA 2DK3A 2CZ7B 1X6BA 4C0DC 3G4SA 4LDVA 3RKWA 2MAMA 2E1HA 1VQKT 4MMLA 2VGMA 1AWXA 1LJOA 1NZ9A 1UE9A 4N4IA 1KSWA 1ABOA 3D7SB 1M1KC 3H6ZA 5AYFA 1H92A 3MP8A 4GLMA 2RJCA 2D9TA 1M2VA 2KNBB 1QQJA 1YIJQ 2MMPA 4HCBA 2MWPA 2KDSA 2DIQA 3VS4A 1BI0A 3CC2Q 2QDYB 4F17A 2VGNA 2F5KA 1KC8C 2LC4A 4CRIA 1OYXA 4MZPA 1MMNA 1G3TA 8ATCB 1CKAA 1M30A 2DKGA 2MIOA 2FEIA 1JRIA 4XTZA 2BKDN 4GBQA 4AG1C 3CD6A 3RR6A 1YITT 2L89A 3MEWA 2CREA 1U5SA 1KD1U 2V26A 4FM4B 4E7JA 3JCMh 5CQXA 3EG0A 3EFOB 1ZSZC 2ECZA 3CCRT 4A4GA 2IPOB 1UHFA 1PHTA 4O6JA 4BI3A 3CPWP 3OY9A 2XG8D 3NMZC 3JSCA 2RJEA 1Y96A 1ZUKA 2NUTB 3VS7A 2LCCA 3QWXX 3JB9G 1QLYA 1JXOA 2DTOA 4Q5WA 3CCRA 1K73R 3A8LB 4Y91A 2R5MA 4JPBW 1HK9A 1QP3A 4ELYC 2JTFA 3CC4A 2J7IA 1IB8A 2XICA 2J6KA 2VWFA 4IIMA 5C0MA 4E7KA 1I5OB 1GCPA 1ZA2B 1ZLMA 3SHWA 3DB3A 3CC4T 2E3HA 4FU6A 3O8VA 2M0OA 4XU2A 4HCCA 2RQTA 1M1KU 4KBMB 3EG9A 1QVFS 2DXBA 2VKNA 2FB7A 3BY7A 2YRVA 4C0DB 1G3WA 3QJYA 4OMQA 4LDUA 1WDXA 2M1HA 4C8QD 2X51A 1B3QA 2OTLQ 1SRLA 5FU6C 3J80E 1EFNA 2KVQG 3SB2A 1YI2A 1DJ7B 2M16A 3FIFA 3ME9A 4LDXA 1ZSGA 2X9HA 5GMKh 1SPKA 2CSIA 1ABQA 2HKQB 1MMDA 3L1AA 4JRQA 1GBQA 3OS5A 4M7AF 2AKKA 4J8OA 2HZYA 3CCMT 4FSXA 1KC8R 5GAN7 1K4US 2GF7A 3SWNB 1FMVA 5FRMA 3C94A 1PD0A 3NTHA 4OMMA 1QVGP 2A37A 3HHTB 1KIKA 4M77G 3VRZA 1ZBXA 1LPLA 5DLOA 1I4K1 1UGSB 1BCOA 1JXMA 3I55Q 2QQBA 1G3SA 3OB9A 2XDBA 1U06A 2KEAA 3M5AA 3UDCA 3E9GA 2DVEA 3KUFA 4RG8A 5A0DA 4A4KA 3CCSA 2RK2A 4M78E
chains in the Genus database with same CATH topology
4DOVA 3CBPA 3EFRA 4M75B 2DD4A 4EMGA 3OYEA 3G71T 1V29B 4N4GA 3OYMA 3L2VA 5GAOn 3QKJA 3ZBDA 4ZGEB 4BE2A 3FEOA 1G3YA 2IVWA 2Y4XA 3VUZA 5CIUA 4J5YA 4KULA 4BUGA 1D3BB 4RCBA 3CCJT 4BY6B 4B9WA 5CK9A 3V7SA 4PJOG 3AHUA 3KXTA 2KK4A 1VQOT 1K8AU 2WSFE 4L6V5 2YHTA 2RK1A 2LT4A 3GLXA 4C92B 3G7ZA 3PMTA 5IAYA 3Q1JA 3FRNA 3RKYA 5LJ5h 5GANd 1Y07A 3V7RA 1NJIU 4JJNK 2EYQA 4LD9K 3CD6T 5CKFA 2A3LA 3MO8A 1VQNA 1VQOA 4RKUE 2LDMA 5GAMg 3QIIA 1WQ7A 1D3BA 3ZFJA 2QQ9A 2QQSA 3RIRA 1BI2A 2BUDA 4IUVA 3HP9A 3A8GB 4KUDK 3OS1A 2WACA 3QO3A 3P8BB 5GANj 4JLGA 5FU7B 3EAEA 3CMAT 3M55A 2C06A 1O9SA 1XOVA 2JOYA 2E64A 1YCYA 3M4GA 1FXXA 1VQPA 4QVZA 4HT9A 3I55T 1R8OB 3V7CA 5A0GA 3QDRB 1WJQA 4M75G 1N9SA 1Q86C 1VQNT 5LJ3g 4R55A 3TU4K 2DAQA 3VKIA 2I2LA 4MMKA 5LJ5f 2OAUA 5EG2A 3VYGA 2K5LA 2L5QA 2DIGA 2E65A 4J7IA 1N8RC 2WSEE 4Y28E 3CCJA 3JB9D 2AHJB 3M53A 2RO0A 2Y4YA 2ZCFB 1VQ6A 1Y96B 2DZ9A 2X4XA 3QZ5B 4C5IA 5L8RE 3A8HB 4NL3A 4M77E 1YJ9T 3CBOA 3PMIA 5KCHA 3MCAB 2KMTA 4OB2B 2EQMA 5KE3A 3CCET 2X4JA 1NE8A 4PL6A 3RMSA 4F7UF 1KG1A 2PVOB 3TREA 5GAMj 4JS4A 1K73U 2LRQA 4F7UA 2QEXA 5CR2A 3CCVT 2HQEA 1VQMT 2EAYA 2ZPFB 3QZ9B 2P4TA 1BI1A 5GAN6 2ZPHB 3CBMA 5FRNA 2DD5A 4C8QE 4PJOB 3LLRA 4M77C 4PNOA 5GMKe 1S72A 2DJZA 3CCUT 4M77B 4JDSA 1QW1A 2IG0A 4ZTJA 5GMKi 4MDXA 2B8AA 2E5QA 3JCMf 2X4WA 3CPWA 4M7DD 2JN0A 1M1FA 4QQDA 4C92F 3CPFA 2E70A 4EMKB 4OF1A 3LH0A 3PTAA 3CCEA 5LJ5g 2H3JA 2A7YA 5J26A 2EQKA 2RM4A 2YLBA 3LGFA 4FIBA 1VQ5T 3L2ZA 3L2RA 3JB9F 1GXIE 4C8QC 4HKEA 1X01A 3QPHA 1YJNT 2RHIA 3CCSA 4N4HA 1Q82U 3A8OB 4ATOA 1P92A 2O01E 1M9SA 4EMHA 1I81A 4PJOD 3G71A 4M75A 1NPRA 2DO3A 2ZZDA 4C8QF 3F70A 2CKKA 1UGPB 3M58A 4J83A 3OW2S 2D0QB 2PU9B 5GMKm 3CMEA 3CMAA 3JCMW 4Z02A 3JCMX 1I5LA 5CAIA 2FHDA 5J39A 5I2MA 5GAN3 1ZQ1A 2CZ1B 3HKSA 5LJ3d 3TCJA 3OA6A 2QXFA 3HPWA 5LJ3e 4N0AA 3TEEA 4OB1B 5HK3A 3JCMJ 3UWNA 3OYJA 3QYGB 4A4HA 3MHXA 5FROA 3CCQA 2QA4A 4V2SA 2OTJT 4C92E 1KQ2A 4P5NA 3LWIA 3RMQA 3HRTA 3OBYA 4DA4A 2QQRA 1XTDA 2ZPGB 2KY9A 3ASKA 1FX7A 4XQ3A 3OMGA 5GAN4 1WJRA 3M54A 3G6ET 2LNVA 1M1GA 2GFUA 3CC7T 3WVDB 1X75C 1IZ6A 2LQKA 4DOWA 1KHCA 2FL7A 2LCLA 2DZCA 3BW1A 3QJ6A 3SFMA 2DXCA 3FDRA 3QG1A 4XTUA 5LL6S 1KC8U 3M4YA 4M7AD 2JUFA 3P8HA 2EJ9A 4M77D 1VQKA 2F5TX 5HKCA 4O5VA 1N6AA 5HY6A 4ZGDB 1N9RA 2V8JA 3CXCA 2EJFA 4M7DB 4C92C 3QHSA 2VXFA 2QQAA 5GAMf 3X24B 5HK0A 2HAXA 4XTYA 2VUBA 5LJ5d 1QVGA 4PJOA 3SDZA 4BI4A 2X4YA 2HNIA 3EFSA 4M75D 3CCMA 5GANf 3S3MA 4NS5A 3NTKA 2EQJA 1VQMA 5CQYA 4M7DG 1K73C 2QEXT 2MF2A 3NTIA 3RKXA 4QVDA 4OB3B 2EFIA 4C8QB 5GAN8 3LYIA 2VXEA 3V8KA 3HSBA 1IREB 4PJOC 5D6WA 1VQ7T 1YHQT 5LJ5j 4C0GA 3VU3C 4IUTA 4RMOA 4BDZA 4IURA 4A4EA 1Q86U 1WPYA 2L8DA 1YJWA 2PUKB 1VQ9A 2RHXA 2EIFA 4IUQA 4EMKA 3CEYA 1UGRB 3SWNA 4XTWA 4PLLA 1X6OA 3JCMc 3OYDA 3OYFA 2P0PA 2RJDA 4C5HA 5GAMe 5DM7R 3OS2A 4JRIA 3G4ST 5GAOr 1KD1C 4M75E 3HFNA 5IN1A 3I56A 1PSEA 2E6ZA 1W4SA 4M7DF 3CCQT 2QA4T 1K8AC 1Q82C 4J7FA 3DKMA 4IKFA 3OQ5A 4KT0E 1VQ4A 4XTXA 1RL2A 5LJ5e 1PSFA 3SWNC 1KQ1A 4E7LA 4QVCA 2HD0A 1LNXA 2VYTA 4JUVA 2ZGWA 3PIPA 3GNGA 3OSSC 4OGEA 3OYNA 2PVDB 4C5EA 1XNIA 4QW2A 1H3ZA 3PNWC 3CCLA 3OBWA 4ZN3A 3JCMQ 3VYHB 3BDLA 3QYHB 1U8RA 1YJ9A 2YLCA 3LWHA 1I8FA 2M9UA 2RHZA 3M9QA 2MWOA 2RHUA 2PVGB 2RI5A 2LX9A 1OZ2A 3HRUA 3P8DA 2R5AA 5KCOA 2CGHA 3A8MB 4A54A 3T9NA 4J6XA 3CPWS 5FU7C 1U1SA 3OYIA 2OTJA 4C92D 2LVMA 2FYKA 3LGLA 4CI0C 3A5ZB 3JCMd 4BACA 4OB0B 4YTLA 2RI2A 1BIAA 4X34A 5GAMd 5GAN2 3QSUA 4ZTFA 2JVVA 2WSCE 1VQ8T 3GPLA 3LX7A 4GLKA 4M78D 1QVPA 4LDWA 4OVAA 1K9MC 4M78A 1W2BA 4M77A 1JJ2A 2NLUA 5A2QE 1N27A 4JLIA 4PJOF 1OI1A 2HBPA 2LQ8A 2EQUA 2RA2A 5FLXE 5J3BA 4L5GA 4M7AG 3CXCS 1FWZA 2CZ0B 1G5VA 2P0KA 3MP6A 3ER0A 1U1TA 4BB7A 1Q7YU 2K5FA 3GIBA 3JCMg 3OYAA 4ME7A 4WF2A 4UC4A 2Y90A 5GAOp 3QUIA 2DK3A 1MGQA 4EMKC 1WJSA 2CZ7B 3OYLA 1KQSA 4C0DC 2DXTA 3QBYA 4NL2A 3G4SA 3GP8A 1Q81C 2XHCA 4M78B 5LJ3h 3FC3A 1MHNA 4LDVA 3RKWA 2MAMA 4E7IA 3R6OA 4QQ6A 2E1HA 1VIFA 1VQKT 1Y71A 4MMLA 1LJOA 1NZ9A 2KSSA 2EJGA 2VGMA 2XIDA 4RCCA 3OW2A 3X25B 2CZ6B 4N4IA 5LJ3f 3JB9I 4J6WA 4MDWA 2XU8A 4NOYA 1M1KC 3H6ZA 5AYFA 1Q7YC 3MP8A 2KQWA 2RJCA 2D9TA 4A53A 2EWNA 4M7DC 5GAOm 1YIJA 2MMPA 4HCBA 2DXUA 2KDSA 2MWPA 4ZN1A 2DIQA 2JNGA 2ZPEB 4VUBA 5LJ3j 3URGA 2JZ2A 1BI0A 4C5GA 2MI6A 4XTVA 4EDUA 5GAMh 3OYYA 3I55A 2QDYB 2GFAA 2VGNA 2F5KA 4M75F 3S6WA 1YBYA 2LC4A 4C0ZA 4EPCA 3WXMB 2F69A 1VQPT 2GCXA 4CRIA 3E1SA 3ZEHA 2EKOA 1OYXA 3JCMb 4MZPA 1KQSS 2BIVA 4M7AA 2XI9A 3QXEB 1TH7A 1G3TA 5I2SA 1HXDA 3L2WA 5GAN5 5GANg 1UEBA 5GMKj 3JB9J 2DKGA 3BDUA 4BE1A 4RG2A 4M78G 4M7DE 1JRIA 4GY5A 4XTZA 1NJIC 2LTOA 5CVIA 3J7AF 1BI3A 2BKDN 3V8LA 2K5IA 4M78C 4BD3A 3JCMe 3CD6A 1YITT 3C4SA 2L89A 3MEWA 3OYHA 3L2UA 3E9FA 2XDPA 1KD1U 1JBMA 1BIBA 3L2QA 4FM4B 4E7JA 3JCMh 1WQWA 2R58A 5CQXA 1ZHIA 1VQLA 4M78F 4M7AB 2XD0A 2RJFA 1YJWT 1BKBA 3CCRT 5CKDA 4A4GA 5DLQE 4C0FA 3BFMA 4PLIA 4C92G 2CYZB 1M90U 4O6JA 1AHJB 4BI3A 3GOXA 2R57A 3VUBA 2XG8D 4C8QA 3OY9A 1YHQA 2K4YA 4XU3A 3JSCA 2RJEA 5DY9A 5KE2A 1KC8C 4HT8A 1Y96A 4XU0A 3M56A 4OGCA 5GAOl 2K57A 3DLMA 2O4XA 3X26B 4FT2A 5CKBA 4E47A 3OYBA 1WNLA 5IT9E 1VQ8A 2LCCA 2XDDA 3JB9G 5A0LA 3C95A 1B34A 2XKOC 2RHYA 3M59A 2DTOA 4Q5WA 4BY6C 4XK8E 3CCRA 3A8LB 2LT1A 4IUPA 4M77F 4Y91A 1RI0A 2RH2A 4KUIA 2R5MA 1YIJT 1YJNA 2P0QA 1HK9A 4X9DA 4C92A 1JB0E 1QP3A 4DQ2A 4ELYC 5GANe 3UPUA 1VQ5A 3C12A 3JRZA 2JTFA 5KH6A 3CC4A 2X35A 5M9OA 4II1A 3CC2T 4PKCC 3HL8A 4M75C 2XICA 3JAME 2E12A 3GNFB 3S3OA 3NFCA 3FB9A 4BI8B 1SSFA 2FVUA 3DB4A 5C0MA 1VQ9T 4E7KA 4XU1A 3SD4A 4F7UB 1YI2T 2GQVA 2QTXA 2HQXA 2D6FA 3MEVA 3CCLT 5C6SA 3DB3A 3CC4T 3FLGA 4ZGJB 1QVGS 4FU6A 2OTLT 3O8VA 2M0OA 3J81E 1OZ3A 3OMCA 4XU2A 4IUUA 5GANh 3CCST 4HCCA 1M90C 1NPPA 4L59A 3KBGA 5CKEA 5CO7A 1UB4A 1WGSA 2RI3A 4HA8A 1M1KU 4KBMB 2KAFA 4X9CA 5D6YA 3RESA 2DXBA 3CCVA 1QVFS 2FB7A 1B34B 1Q81U 1O75A 4PJOE 3BY7A 2YRVA 4A4FA 4C0DB 4D6WA 1G3WA 2K3XA 4F7UG 3JCMV 3OSVA 3QJYA 4FT4A 4LDUA 4MZTA 4OMFB 2M1HA 5CKHA 4C8QD 2OTLA 2VC8A 4JS5A 5FU6C 3J80E 1VQ6T 3META 3VV0A 2KVQG 3PFSA 3SB2A 1YI2A 2ZPBB 5CCAA 1DJ7B 1VIEA 2M16A 3FIFA 3ME9A 4BDYA 4LDXA 4JRKA 2DTHA 2XK0A 2V8IA 5GMKh 3JCMP 1VUBA 1VQLT 4TVRA 3FJPA 3V8JA 3E19A 3RERA 3MEAA 3VJPA 1Y7XA 1QP2A 3OYCA 3G6EA 3CC7A 2PUOB 3MP1A 2VV5A 3L1AA 3N5BB 2CS7A 4JRQA 3OS5A 4M7AF 2DPPB 4J8OA 3CCMT 3OS0A 2JTMA 4M7AE 2G3RA 3INZA 4FSXA 2L3RA 3OYGA 3GF5A 4E7HA 1QVFA 2K2VA 3H8ZA 3PIOA 5GAN7 4J6YA 1M4ZA 5GAOq 4M7DA 3PGGA 3HFOA 1BYMA 2GF7A 3SWNB 3CMET 5FRMA 3C94A 3NTHA 5GMKl 4R56A 3PT9A 4MZMA 3M57A 5D6XA 3UT1A 1H641 1M5Q1 3HHTB 5I21A 1N8RU 2RD1A 4M77G 4HCZA 3RUXA 4B9XA 3OYKA 1EIFA 4M7AC 5FU6B 4BE0A 4QQGA 1ZBXA 2V8KA 4ELZC 2E6NA 1W2BS 3DLLA 1JJ2S 1XQHA 2E41A 4FL6A 5DLOA 1YITA 1KHIA 1I4K1 4LD6A 1UGSB 3S3NA 3HRSA 2E10A 3JB9H 3LW5E 1K9MU 3CC2A 2QQBA 3MEUA 4C8QG 1G3SA 3OB9A 2XDBA 2QI2A 1M8VA 2DTIA 1VQ7A 3M5AA 3UDCA 4F7UE 3E9GA 2PQWA 2DVEA 4OP0A 2ZPIB 3X20B 3CCUA 3KUFA 1VQ4T 4LDYA 4N0AC 1S72T 2O4XB 1LOJA 4RG8A 3L42A 3WVEB 2RB6A 5A0DA 2DEQA 3X28B 2K3YA 4A4KA 1UGQB 3I56T 4XAXB 4JRPA 2RK2A 4M78E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OB0 B;  4KT0 E;  4OB3 B;  4RKU E;  3VYG A;  2D0Q B;  2PU9 B;  1PSF A;  2DD4 A;  3WVD B;  1V29 B;  2WSE E;  4Y28 E;  2WSC E;  1IRE B;  2AHJ B;  4ZGE B;  2ZCF B;  1JB0 E;  2CYZ B;  2DXC A;  3A8G B;  3QXE B;  1AHJ B;  2PVD B;  1UGS B;  3QZ5 B;  5L8R E;  3A8H B;  2CZ1 B;  2CZ6 B;  3X25 B;  3VYH B;  3LW5 E;  4OB2 B;  2DD5 A;  3QYH B;  2ZPB B;  4ZGD B;  1DJ7 B;  4OB1 B;  4ZGJ B;  2PUK B;  2CZ0 B;  3X26 B;  2PVO B;  2WSF E;  3QYG B;  2PVG B;  4L6V 5;  3X24 B;  1GXI E;  1UGR B;  3HHT B;  3A8O B;  2ZPE B;  2ZPI B;  2O01 E;  1QP2 A;  3A8M B;  3X20 B;  2ZPF B;  2PUO B;  4XK8 E;  3QZ9 B;  3A8L B;  4FM4 B;  3WVE B;  2ZPH B;  1PSE A;  2QDY B;  2DXB A;  2ZPG B;  1UGQ B;  2ZZD A;  3X28 B;  2DPP B;  2CZ7 B;  1QP3 A;  1UGP B; 
#chains in the Genus database with same CATH topology
 4HVV A;  4M75 B;  3OYE A;  2D6F A;  2QGG A;  4N4G A;  3OYM A;  5GAO n;  3FEO A;  3EG2 A;  2IVW A;  2COW A;  4RCB A;  3CCJ T;  5CK9 A;  2KK4 A;  4HCK A;  2YUO A;  3G7Z A;  5IAY A;  1AWO A;  5GAN d;  4AFU C;  3CD6 T;  5CKF A;  3EGX A;  1D3B A;  1IGQ A;  1TS9 A;  1T0J A;  2FO0 A;  1MMA A;  1A0N B;  2NUP B;  3QO3 A;  3P8B B;  4R0K A;  1JEG A;  2VAS A;  5FU7 B;  4OMP A;  1O9S A;  3EG1 A;  3VS3 A;  2SRC A;  1H8K A;  1JO8 A;  2HSE B;  3V7C A;  1Q86 C;  5LJ3 g;  2MCN A;  4MMK A;  2RQU A;  5EG2 A;  3VYG A;  4J7I A;  2DIG A;  2WSE E;  2PNI A;  2RO0 A;  2ZCF B;  1E6H A;  3QZ5 B;  5L8R E;  1B07 A;  3CCU Q;  1S1N A;  3EGD B;  4NL3 A;  3PMI A;  4OB2 B;  5D7U A;  2X4J A;  4DBF A;  1NE8 A;  1K73 U;  1BBZ A;  3CCV T;  1EX4 A;  4DBR A;  3QZ9 B;  3G1J A;  1BI1 A;  1I1J A;  2NUZ A;  2ZPH B;  2DL8 A;  3CBM A;  3R6N A;  5GAN 6;  4PJO B;  2DJZ A;  2W0Z A;  5EC7 A;  2JN0 A;  2H3J A;  1R0B G;  2X3X D;  3ULR B;  2YLB A;  4DEX A;  1VQ5 T;  1Q82 U;  3A8O B;  2O01 E;  1M9S A;  1I81 A;  5IHK A;  3UA6 A;  4QT7 A;  4M75 A;  2QGF B;  4C8Q F;  3F70 A;  2CKK A;  2DIL A;  1E7O A;  2D0Q B;  3CMA A;  1I5L A;  2O88 A;  5CAI A;  3TCJ A;  1AWW A;  2W10 A;  4RTW A;  3SEM A;  4N0A A;  4PJJ A;  3QYG B;  4A4H A;  3CCE Q;  2LP5 A;  3RMQ A;  3OBY A;  2QQR A;  2DL7 A;  3ASK A;  2ZPG B;  1WJR A;  3G6E T;  1M1G A;  1QCF A;  1VYV A;  1IZ6 A;  2GQI A;  2FL7 A;  3BW1 A;  2DXC A;  3FDR A;  3QG1 A;  5LL6 S;  2COZ A;  2JUF A;  4JZ4 A;  2EJ9 A;  4M77 D;  1VQK A;  1N9R A;  2KRO A;  1D0Z A;  2EYY A;  2QQA A;  2DET A;  2V1R A;  3NHN A;  2HNI A;  4NS5 A;  2EQJ A;  1YNZ A;  1K73 C;  2C0I A;  3HSB A;  2GNC A;  1QVF P;  5D6W A;  2DBK A;  4HXJ A;  1ZBJ A;  4IUR A;  2EYZ A;  2DE0 X;  1YJW A;  3H9N A;  4EMK A;  3SWN A;  4XTW A;  1X6O A;  3OYF A;  3G71 A;  2P0P A;  1VA7 A;  4J9D A;  3G4S T;  2YUQ A;  1RUW A;  5GAO r;  4M75 E;  2QA4 T;  1K8A C;  1Q82 C;  4J7F A;  4IKF A;  2DFU A;  2EQI A;  1VQ4 A;  4XTX A;  4E7L A;  4JUV A;  3GNG A;  1PRM C;  4OGE A;  3ZL7 C;  1XNI A;  3CCL A;  1W70 A;  2CH4 W;  1OUL A;  2YLC A;  1D1B A;  2DL5 A;  2M9U A;  1X43 A;  1PWT A;  3I35 A;  2DVJ A;  3CPW S;  5FU7 C;  2FYK A;  3VS2 A;  3JCM d;  4OB0 B;  3QSU A;  1QCN A;  5GAM d;  1IRX A;  3GPL A;  2QEX Q;  1GCQ C;  4LDW A;  4OVA A;  4M77 A;  2HBP A;  1SHF A;  2YRC A;  4J9F A;  1RI9 A;  2CZ0 B;  1G5V A;  2EPD A;  2P0K A;  2H8H A;  4KGX B;  3CCR Q;  4WF2 A;  1SF9 A;  1MGQ A;  4AFQ C;  1OV3 A;  2DXT A;  2QDL A;  3QBY A;  4NL2 A;  3G4S Q;  4M78 B;  3FC3 A;  4E7I A;  1MHN A;  1AWJ A;  1VIF A;  2XID A;  1AZG B;  3X25 B;  3LH5 A;  4MDW A;  4PFP A;  2XMF A;  1MV0 B;  2EWN A;  1RAF B;  4M7D C;  2HKN A;  4ZN1 A;  4VUB A;  1RAI B;  4EDU A;  3A98 A;  2QAS A;  3OYY A;  4EPC A;  1VQP T;  3H0I A;  4M7A A;  2XI9 A;  3QXE B;  1LCK A;  2FRY A;  3L2W A;  1TXQ A;  1TUC A;  1UEC A;  3BDU A;  1FYN A;  4M78 G;  9ATC B;  1G8X A;  4M7D E;  2LTO A;  3J7A F;  1BI3 A;  2JS2 A;  3V8L A;  1QKW A;  3C4S A;  1PM3 A;  2COY A;  3L2U A;  3E9F A;  2XDP A;  1JBM A;  1NG2 A;  1ZHI A;  2RJF A;  3A1P A;  5DLQ E;  4ORZ A;  1HYO A;  2P84 A;  1M90 U;  1JJ2 P;  1JU5 C;  3GOX A;  1CKB A;  4C8Q A;  1YHQ A;  2QAZ A;  4HT8 A;  5CKB A;  1WNL A;  1MUZ A;  5IT9 E;  3C95 A;  2XKO C;  2RHY A;  4XK8 E;  4D8K A;  2LT1 A;  4M77 F;  5I22 A;  4KUI A;  1YIJ T;  3C12 A;  5KH6 A;  1BCM A;  2QK0 A;  2X35 A;  4II1 A;  3CC2 T;  4PKC C;  3S3O A;  3NFC A;  3FB9 A;  1VQ9 T;  4CC3 A;  4EIK A;  3CCL T;  2OTL T;  4IUU A;  5GAN h;  5CKE A;  4L59 A;  1UB4 A;  1TSF A;  2A28 A;  1H3H A;  5D6Y A;  3RES A;  3CCV A;  1YFN A;  4A4F A;  1G2B A;  4F7U G;  1RAH B;  3OSV A;  4FT4 A;  4MZT A;  2OTL A;  4JS5 A;  2YUN A;  1NLO C;  3PVL A;  3CCS Q;  3MET A;  5CCA A;  1VIE A;  2L2P A;  4JRK A;  2XK0 A;  3JCM P;  1VUB A;  4TVR A;  3E19 A;  3MEA A;  4RTT A;  3H0H A;  1Y7X A;  3OYC A;  2PUO B;  1M8M A;  2CP7 A;  2CS7 A;  1FMK A;  2DPP B;  4IIO A;  3OS0 A;  3OYG A;  2QG9 B;  3PIO A;  5GAO q;  3GBQ A;  3PGG A;  1ARK A;  1W6X A;  4JJC A;  5KYX B;  1ZSZ A;  1VYT A;  4AT1 B;  2K3B A;  1YN8 A;  2EYX A;  1UJ0 A;  3M57 A;  1M5Q 1;  2CDT A;  2A08 A;  2RD1 A;  4HCZ A;  3RUX A;  4M7A C;  4RTU A;  4BE0 A;  4J9B A;  4DEY A;  1TUG B;  2E6N A;  1W2B S;  3DLL A;  2RQV A;  2DX1 A;  3CMA Q;  3EG3 A;  3HRS A;  4PFO A;  2KXD A;  1XJW B;  1Z9Q A;  2QI2 A;  5GJV B;  2EGE A;  1NJI R;  3X20 B;  1S72 T;  1LOJ A;  3L42 A;  3WVE B;  2K3Y A;  4JRP A;  4XAX B;  2PTK A;  1OU9 A;  3G71 T;  4Z89 A;  2CP3 A;  3ZBD A;  4ZGE B;  1VYU A;  1G3Y A;  2Y4X A;  4BUG A;  2A36 A;  4BY6 B;  3V7S A;  4PJO G;  3KXT A;  1K8A U;  1HJD A;  4L6V 5;  4Z88 A;  3PMT A;  2ZAE A;  3RKY A;  2Z0W A;  3I9Q A;  1BB9 A;  1X69 A;  3QII A;  3ZFJ A;  2QQ9 A;  1K9M R;  4D8D A;  3HP9 A;  3A8G B;  3OS1 A;  2WAC A;  5GAN j;  1M3C A;  2CP0 A;  3CMA T;  3M55 A;  2JOY A;  1PRL C;  2LZ6 B;  2MOX A;  3TU4 K;  2E65 A;  1PCX A;  3CCJ A;  2AHJ B;  4DBH A;  1Y96 B;  2DZ9 A;  1YJ9 T;  3CCE T;  2EQM A;  2RNA A;  4PL6 A;  3RMS A;  4F7U F;  1AOJ A;  3NPF A;  2PVO B;  3CQT A;  5GAM j;  4KH1 B;  4JS4 A;  2LRQ A;  2QEX A;  2JT4 A;  2HQE A;  3CC7 Q;  1CSK A;  4PK4 A;  1U3O A;  2DD5 A;  4C8Q E;  4M77 C;  3FJ5 A;  4PNO A;  5GMK e;  1S72 A;  3CCU T;  1QW1 A;  2B8A A;  2F2V A;  2KE9 A;  1YP5 A;  5HCK A;  1TWB A;  4C92 F;  1GBR A;  2LJ0 A;  2A7Y A;  2RM4 A;  3JB9 F;  3C0C A;  3L2R A;  3QPH A;  4EMH A;  2LQN A;  2ZZD A;  1WYX A;  4J83 A;  2M51 A;  5KYU B;  3JCM X;  2YT6 A;  1ZQ1 A;  2CZ1 B;  2M02 A;  4AG2 C;  3M0P A;  1OX9 A;  2QA4 A;  2K2M A;  4V2S A;  3PE0 A;  4Z8A A;  2EKH A;  4C92 E;  2QA4 Q;  2ABL A;  2KI7 A;  2DJQ A;  1XTD A;  2KY9 A;  2D8J A;  3CC7 T;  2LNV A;  1X75 C;  2YXY A;  2K9G A;  1GFC A;  4LUD A;  2DZC A;  4FYW B;  3SFM A;  3M4Y A;  2AT1 B;  4E7Z A;  2OTJ Q;  2KYM A;  2DL4 A;  4CC2 A;  3TVT A;  3QHS A;  2VXF A;  2FPD A;  2BZ8 A;  5KYY B;  2X4Y A;  3EFS A;  2RF0 A;  1AZE A;  1T3L A;  5CQY A;  2MF2 A;  5FWB A;  4C8Q B;  3LYI A;  3V8K A;  2ATC B;  3EGU A;  3MPU B;  1Q86 U;  1VQ9 A;  2PUK B;  3CEY A;  4WTO B;  3OS2 A;  3HFN A;  3I56 A;  1WX6 A;  1VQ7 Q;  3DKM A;  1PSF A;  4QVC A;  3PIP A;  2VYT A;  1TG0 A;  3OYN A;  4QW2 A;  1K1Z A;  1H3Z A;  4JJD A;  3PVQ A;  3QYH B;  1U8R A;  2MWO A;  2PVG B;  2LNH B;  2LX9 A;  2RI5 A;  3P8D A;  2R5A A;  2CGH A;  3A8M B;  4LXC A;  3T9N A;  1PC0 A;  2L0A A;  2LVM A;  3LGL A;  4CI0 C;  3A5Z B;  1OPK A;  4YTL A;  4J9G A;  2RI2 A;  1BIA A;  5GAN 2;  4ZTF A;  1WHK A;  1VQ8 T;  3LX7 A;  2DBM A;  4GLK A;  1RAC B;  1W2B A;  2LQ8 A;  1D1A A;  5FLX E;  5FW9 A;  2K5F A;  3GIB A;  3JCM g;  1QWE A;  2YWW A;  2MK5 A;  2BZY A;  2CP6 A;  5GAO p;  4X1V A;  4EMK C;  1WJS A;  3GP8 A;  2GGR A;  2XHC A;  5LJ3 h;  2ROL A;  3R6O A;  2CSQ A;  4QQ6 A;  1WZO A;  1ZUY A;  2D8H A;  2DA9 A;  1HSQ A;  4J6W A;  2O31 A;  4NOY A;  3VS5 A;  2DYI A;  5IXF A;  1Q7Y C;  2KQW A;  2F1L A;  3RDV A;  5GAO m;  4ESR A;  2DXU A;  1D0X A;  2ZPE B;  3EHR A;  1NEB A;  2JZ2 A;  3I5R A;  2MI6 A;  5GAM h;  3I55 A;  2GFA A;  3S6W A;  4M75 F;  2F69 A;  2GCX A;  3E1S A;  3ZEH A;  2EKO A;  3JCM b;  1KQS S;  3I5S A;  1M1K R;  1YJW Q;  5I2S A;  1HXD A;  5GAN 5;  5GAN g;  1UEB A;  5GJW B;  5GMK j;  1VQ8 Q;  4BE1 A;  4RG2 A;  1WHJ A;  5IXB A;  2K5I A;  2LMJ A;  3OYH A;  4F16 A;  1BIB A;  2C0O A;  2XD0 A;  1YJW T;  5CKD A;  2V1Q A;  4C0F A;  3BFM A;  1IHV A;  2CYZ B;  1W2B P;  1AHJ B;  2R57 A;  3VUB A;  2K4Y A;  3M0R A;  4XU3 A;  5DY9 A;  1MNE A;  1VQK Q;  4XU0 A;  3M56 A;  1VQ9 Q;  2YRD A;  2K57 A;  3DLM A;  2O4X A;  3X26 B;  3OYB A;  4E47 A;  1VQ8 A;  1ACM B;  5A0L A;  3M59 A;  2HQH A;  4BY6 C;  5KYW A;  2RH2 A;  4RTV A;  2P0Q A;  4C92 A;  4DQ2 A;  5GAN e;  1JQQ A;  2GTJ A;  4JJB A;  2X3W D;  3HL8 A;  4M75 C;  3JAM E;  3OW2 P;  2FVU A;  3DB4 A;  3SD4 A;  2KYB A;  1YI2 T;  2GQV A;  2QTX A;  2HQX A;  3MEV A;  3FLG A;  4ZGJ B;  1QVG S;  1OZ3 A;  1PKS A;  1VQ6 Q;  3THK A;  5CO7 A;  2HL3 A;  3KBG A;  2RI3 A;  1E6G A;  2JTE A;  2GBQ A;  4X9C A;  5KYN A;  3EHQ A;  4FW2 A;  1NYG A;  1Q81 U;  1O75 A;  1M3A A;  1OQK A;  4D6W A;  2NYS A;  2ROT A;  3JCM V;  1RAA B;  1QCO A;  5CKH A;  2KR3 A;  2LJ3 A;  1VQ6 T;  3VV0 A;  3PFS A;  2EYW A;  2QTV A;  1WXT A;  1SRM A;  1N5Z A;  2V8I A;  1B7T A;  3G6E A;  3MP1 A;  2VV5 A;  1AT1 B;  1WXB A;  1UUE A;  2G3R A;  2BTT A;  3INZ A;  2VVK A;  3H8Z A;  4J6Y A;  3MJX A;  1BYM A;  2GTO A;  2L3Q A;  3CME T;  1C0M A;  3PT9 A;  4MZM A;  1H64 1;  3EH1 A;  5I21 A;  1K8A R;  3MKD A;  1LVK A;  3OYK A;  1EIF A;  3H0F A;  1Q81 R;  1MND A;  5FU6 B;  4QQG A;  2HSP A;  1VQ4 Q;  1JJ2 S;  1XQH A;  2E41 A;  4FL6 A;  1YIT A;  2C0T A;  3CME Q;  3RNJ A;  2E10 A;  3G71 Q;  3LW5 E;  1AEY A;  5KYY A;  4F7U E;  2OI3 A;  4KRT A;  1G83 A;  2HDA A;  4OP0 A;  2ZPI B;  4N0A C;  1VQL Q;  1IXD A;  1TU0 B;  1WHG A;  2RB6 A;  2EW3 A;  1M90 C;  3I56 T;  3CBP A;  3EFR A;  1I0C A;  2DD4 A;  1W1F A;  3L2V A;  1OEB A;  3QKJ A;  3CD6 Q;  5CIU A;  4J5Y A;  4B9W A;  3AHU A;  1VQO T;  2AZV A;  1IHW A;  2YHT A;  2LT4 A;  4C92 B;  3Q1J A;  3FRN A;  1RAD B;  1Y07 A;  4JJN K;  2JS0 A;  2EYQ A;  2EGC A;  2A3L A;  1VQN A;  2KT1 A;  1VQO A;  1MMG A;  2LDM A;  1VQN Q;  1WQ7 A;  2QQS A;  1BI2 A;  2BUD A;  4IUV A;  4J9E A;  2MYS A;  1QWF A;  2AK5 A;  4JLG A;  2A0F B;  4ZNX A;  3EAE A;  1XOV A;  1FXX A;  3EGD A;  4HT9 A;  3I55 T;  1R8O B;  3EFO A;  1Q7Y R;  5A0G A;  1N9S A;  1VQN T;  4ANJ A;  2DAQ A;  3VKI A;  3VS6 A;  2I2L A;  4A63 B;  2K5L A;  2L5Q A;  3TSZ A;  1KFZ A;  4Y28 E;  2DF6 A;  1UGV A;  3M53 A;  2Y4Y A;  4M77 E;  3CBO A;  2VB6 A;  2KMT A;  5KE3 A;  2E3I A;  1K76 A;  3CXC P;  2KBT A;  3TRE A;  1SKU B;  1D09 B;  2DNU A;  5CR2 A;  1VQM T;  4LN2 A;  3G6E Q;  1VQ5 Q;  2P4T A;  1M2V B;  4RTY A;  3IQL A;  3LLR A;  5ECA A;  4M77 B;  4JDS A;  1YJ9 Q;  2JJ9 A;  4ZTJ A;  4MDX A;  3JCM f;  2X4W A;  4OMO A;  3CPW A;  4M7D D;  2ENM A;  2ED0 A;  1M1F A;  2E70 A;  4EMK B;  3LH0 A;  3PTA A;  3L2Z A;  4C8Q C;  1YJN T;  4ATO A;  1P92 A;  1SHG A;  2SEM A;  1UTI A;  1NPR A;  1YHQ Q;  1UGP B;  3M58 A;  3OW2 S;  1M90 R;  2PU9 B;  4QKU A;  6AT1 B;  3JCM W;  4PJL A;  5J39 A;  5I2M A;  2FPF A;  5GAN 3;  2OX7 A;  3OA6 A;  2QXF A;  3HPW A;  2CT3 A;  4J9C A;  2HEQ A;  1NBE B;  3TEE A;  1ZX6 A;  3M0T A;  4OB1 B;  3JCM J;  3MHX A;  3M0S A;  2YDL A;  1KQ2 A;  2AKL A;  2ESW A;  4DA4 A;  3M54 A;  2FZK B;  3UA7 A;  2EBP A;  3WVD B;  2FRW A;  1NLP C;  4DOW A;  1KHC A;  1KC8 U;  4XTU A;  1V76 A;  3KFV A;  3P8H A;  3TQ7 P;  2F5T X;  2OAW A;  4ZGD B;  2V8J A;  2EJF A;  4M7D B;  4LNP A;  2E5K A;  5HK0 A;  2HAX A;  4XTY A;  2VUB A;  5LJ5 d;  3SDZ A;  4BI4 A;  1M27 C;  3NTK A;  1GCQ A;  4M7D G;  2QEX T;  3VS1 A;  4QVD A;  4OB3 B;  3O5Z A;  2VXE A;  4PJO C;  4E7S A;  4AMC A;  2LQW A;  4C0G A;  3VU3 C;  5IHN A;  4IUT A;  4RMO A;  4BDZ A;  1WPY A;  2L8D A;  1GFD A;  2EIF A;  4IUQ A;  1UGR B;  2RQW A;  3JCM c;  4PLL A;  4C5H A;  5GAM e;  2DEU A;  4LUE A;  5IN1 A;  4M7D F;  1W4S A;  3CCQ T;  3OQ5 A;  5IHI A;  4KT0 E;  3SWN C;  1KQ1 A;  2HD0 A;  1AVZ C;  2ZGW A;  4HVU A;  2PVD B;  4C5E A;  1IGU A;  3VYH B;  1RAE B;  1YJ9 A;  3LWH A;  2J06 A;  1OZ2 A;  3HRU A;  2E4H A;  2AZS A;  5KCO A;  3EGX B;  3OYI A;  4C92 D;  4BAC A;  2ED1 A;  2RMO A;  5KYW B;  3VS0 A;  1UHC A;  2WSC E;  2IIM A;  1JJ2 A;  2NUT A;  5A2Q E;  1N27 A;  4PJO F;  1OI1 A;  1FWZ A;  1ZUU A;  1U1T A;  4BB7 A;  1Q7Y U;  2CP5 A;  3OYA A;  2L3P A;  4ME7 A;  4UC4 A;  1T0H A;  2Y90 A;  4KH0 B;  1OOT A;  1KQS A;  3OYL A;  1X6G A;  2B86 A;  1Q81 C;  2F2W A;  5KYX A;  1KJW A;  1Y71 A;  2KSS A;  2EJG A;  4RCC A;  3OW2 A;  2CZ6 B;  5LJ3 f;  4E6R A;  3JB9 I;  2K6D A;  2K7A A;  2XU8 A;  2RPN A;  1K0S A;  4A53 A;  1T3S A;  1YIJ A;  2JNG A;  1SG5 A;  5LJ3 j;  1K0X A;  3URG A;  2NWM A;  4WCI A;  4C5G A;  2JM8 A;  4XTV A;  4C0Z A;  1IO6 A;  1YBY A;  3WXM B;  1Q86 R;  2BIV A;  5AT1 B;  1TH7 A;  3JB9 J;  3REB B;  3M0Q A;  1BU1 A;  1NJI C;  4GY5 A;  4DBQ A;  5CVI A;  4M78 C;  4BD3 A;  3JCM e;  2BE9 B;  1C6V X;  1K9A A;  1Z9Z A;  3L2Q A;  1X27 A;  1WQW A;  2FG0 A;  2R58 A;  1VQL A;  4M78 F;  4M7A B;  1EZZ B;  2BZX A;  1BKB A;  1FMW A;  4PLI A;  4C92 G;  4FW1 A;  1YIT Q;  5KE2 A;  2M0Y A;  4OGC A;  5GAO l;  4FT2 A;  1ZSZ B;  2XDD A;  1C1A A;  1B34 A;  3UAT A;  4IUP A;  4AFZ C;  1RI0 A;  4B6M A;  1YJN A;  2RQR A;  4X9D A;  4M4Z A;  3UPU A;  1JB0 E;  4RTX A;  1VQ5 A;  1QMC A;  5L23 A;  2FPE A;  1PKT A;  3JRZ A;  5M9O A;  1WI7 A;  2E12 A;  3GNF B;  1Q82 R;  1TOV A;  4BI8 B;  1SSF A;  2JMC A;  4XU1 A;  4F7U B;  5C6S A;  3J81 E;  3OMC A;  2D0N A;  3CCS T;  3H41 A;  1NPP A;  1UG1 A;  1WGS A;  4HA8 A;  2QYZ A;  2KAF A;  2KRM A;  1RAG B;  2FZG B;  1B34 B;  4PJO E;  2K3X A;  4OMF B;  2HCK A;  1J3T A;  3CC4 Q;  1QKX A;  2VC8 A;  1VOM A;  2ZPB B;  4F04 B;  1S72 Q;  1PD1 A;  2YSQ A;  4BDY A;  2DTH A;  1VQL T;  3I56 Q;  3FJP A;  3V8J A;  5IH2 A;  3RER A;  3VJP A;  1QP2 A;  2KXC A;  3CC7 A;  3N5B B;  2JTM A;  4M7A E;  1D0Y A;  2L3R A;  1QVF A;  3GF5 A;  4E7H A;  2K2V A;  1M4Z A;  2EVR A;  4FYV B;  4M7D A;  3HFO A;  4JZ3 A;  1Q95 G;  5GMK l;  1WHH A;  2O9S A;  4R56 A;  1MV3 A;  1YI2 Q;  5D6X A;  3UT1 A;  5FWC A;  2F2X A;  3CCL Q;  1N8R U;  4B9X A;  2JXB A;  2V8K A;  2NUP A;  4ELZ C;  1UJY A;  2DLP A;  1KHI A;  4LD6 A;  1YCS B;  4LE9 A;  1WHL A;  3S3N A;  2PZ1 A;  3JB9 H;  4CC4 B;  1K9M U;  3CC2 A;  3MEU A;  3RBB B;  3NGP A;  4C8Q G;  1M8V A;  1GRI A;  2DTI A;  1VQ7 A;  1ZA1 B;  2HL5 C;  2PQW A;  3CCU A;  3UF4 A;  1VQ4 T;  4LDY A;  1PNJ A;  2O4X B;  1VQO Q;  3E2U A;  2DEQ A;  3X28 B;  1UGQ B;  2HBW A;  1RLQ C;  4DOV A;  2J6F A;  4EMG A;  1V29 B;  4BE2 A;  3VUZ A;  3CCM Q;  4KUL A;  1M3B A;  1NEG A;  1WIE A;  1D3B B;  4K11 A;  2YUP A;  2RN8 A;  3TSW A;  1WA7 A;  2WSF E;  2JW4 A;  2RK1 A;  3GLX A;  5LJ5 h;  3V7R A;  1NJI U;  5KYU A;  4LD9 K;  4KGV B;  3MO8 A;  4RKU E;  5GAM g;  3QWY A;  3RIR A;  2DRK A;  4OMN A;  4KUD K;  2KT8 A;  1WXU A;  1BK2 A;  1OPL A;  1YJN Q;  2DRM A;  2C06 A;  2E64 A;  1YCY A;  3M4G A;  4FYY B;  1VQP A;  4QVZ A;  2DMO A;  3QDR B;  1WJQ A;  4M75 G;  4R55 A;  3CCV Q;  4F14 A;  1WLP B;  2DER A;  4PFZ A;  5LJ5 f;  1AD5 A;  2OAU A;  1N8R C;  3JB9 D;  1VQ6 A;  2X4X A;  1WFW A;  4C5I A;  3A8H B;  2JMA A;  2HMA A;  3M0U A;  5KCH A;  3MCA B;  1TTH B;  2CUD A;  1X2Q A;  1WHM A;  1KG1 A;  4AFS C;  5I11 A;  2H3E B;  4F7U A;  3CCJ Q;  4FCY A;  2EAY A;  2ZPF B;  4E2F B;  1UFF A;  1HD3 A;  3REA B;  1RAB B;  5FRN A;  2IG0 A;  5GMK i;  2E5Q A;  1OU8 A;  2KGT A;  1TUD A;  1M2O A;  4QQD A;  3JV3 A;  3CPF A;  3EH2 A;  4OF1 A;  1VQM Q;  1F1B B;  3CCE A;  5LJ5 g;  5J26 A;  1UDL A;  2EQK A;  3LGF A;  4FIB A;  1GXI E;  2AIR B;  4HKE A;  1X01 A;  2RHI A;  4N4H A;  1YWO A;  8AT1 B;  4PJO D;  2MPX C;  2FZC B;  2DO3 A;  4PJN A;  5GMK m;  3CME A;  4CC7 A;  2DL3 A;  4Z02 A;  2FHD A;  1PG5 B;  3VRY A;  1SEM A;  3HKS A;  5LJ3 d;  2J05 A;  1V1C A;  2CP2 A;  5LJ3 e;  2JM9 A;  5HK3 A;  1KD1 R;  3UWN A;  3OYJ A;  3CCQ A;  5FRO A;  2D1X A;  2OTJ T;  2LCS A;  3CCQ Q;  2BE7 D;  2DYB A;  4OML A;  4P5N A;  3LWI A;  3HRT A;  1FX7 A;  4XQ3 A;  3OMG A;  5GAN 4;  2EGA A;  2GFU A;  2LQK A;  2LCL A;  2OJ2 A;  3QJ6 A;  4M7A D;  4FYX B;  5HKC A;  4O5V A;  3QDF A;  1N6A A;  5HY6 A;  3CXC A;  4J9H A;  3BE3 A;  4C92 C;  1Y0M A;  5GAM f;  3X24 B;  1QVG A;  4PJO A;  2P4R A;  4M75 D;  3CCM A;  5GAN f;  3S3M A;  1VQM A;  1I07 A;  2G6F X;  3NTI A;  3RKX A;  1SSH A;  2EFI A;  5GAN 8;  1X2K A;  1IRE B;  1NYF A;  1VQ7 T;  1YHQ T;  5LJ5 j;  1NM7 A;  4Y92 A;  4A4E A;  2RHX A;  7AT1 B;  4PJM A;  3OYD A;  1RLP C;  2L3S A;  2RJD A;  1KD1 C;  5DM7 R;  2CH4 A;  4JRI A;  1YWP A;  1KK7 A;  1PSE A;  2E6Z A;  2K79 A;  3EG9 B;  1R77 A;  2LX7 A;  1GL5 A;  1RL2 A;  5LJ5 e;  1LNX A;  2KRS A;  3OSS C;  3U23 A;  1N8R R;  2J6O A;  3PNW C;  3OBW A;  4ZN3 A;  2CT4 A;  3JCM Q;  3BDL A;  4FSS A;  2DM1 A;  1I8F A;  2RHZ A;  3M9Q A;  3HTR A;  2RHU A;  1R0C B;  2LJ1 A;  1VQP Q;  4A54 A;  4J6X A;  1U1S A;  2OTJ A;  3AT1 B;  4X34 A;  4HVW A;  4KGZ B;  2JVV A;  1KQS P;  4M78 D;  1QVP A;  2I0N A;  2O2O A;  1K9M C;  4M78 A;  2CUB A;  2NLU A;  4J9I A;  4JLI A;  2O9V A;  2EQU A;  2RA2 A;  4RUG A;  5J3B A;  4L5G A;  1D1C A;  4M7A G;  4RTZ A;  3CXC S;  3MP6 A;  3ER0 A;  1OX8 A;  1Y57 A;  3QUI A;  2KRN A;  2DK3 A;  2CZ7 B;  1X6B A;  4C0D C;  3G4S A;  4LDV A;  3RKW A;  2MAM A;  2E1H A;  1VQK T;  4MML A;  2VGM A;  1AWX A;  1LJO A;  1NZ9 A;  1UE9 A;  4N4I A;  1KSW A;  1ABO A;  3D7S B;  1M1K C;  3H6Z A;  5AYF A;  1H92 A;  3MP8 A;  4GLM A;  2RJC A;  2D9T A;  1M2V A;  2KNB B;  1QQJ A;  1YIJ Q;  2MMP A;  4HCB A;  2MWP A;  2KDS A;  2DIQ A;  3VS4 A;  1BI0 A;  3CC2 Q;  2QDY B;  4F17 A;  2VGN A;  2F5K A;  1KC8 C;  2LC4 A;  4CRI A;  1OYX A;  4MZP A;  1MMN A;  1G3T A;  8ATC B;  1CKA A;  1M30 A;  2DKG A;  2MIO A;  2FEI A;  1JRI A;  4XTZ A;  2BKD N;  4GBQ A;  4AG1 C;  3CD6 A;  3RR6 A;  1YIT T;  2L89 A;  3MEW A;  2CRE A;  1U5S A;  1KD1 U;  2V26 A;  4FM4 B;  4E7J A;  3JCM h;  5CQX A;  3EG0 A;  3EFO B;  1ZSZ C;  2ECZ A;  3CCR T;  4A4G A;  2IPO B;  1UHF A;  1PHT A;  4O6J A;  4BI3 A;  3CPW P;  3OY9 A;  2XG8 D;  3NMZ C;  3JSC A;  2RJE A;  1Y96 A;  1ZUK A;  2NUT B;  3VS7 A;  2LCC A;  3QWX X;  3JB9 G;  1QLY A;  1JXO A;  2DTO A;  4Q5W A;  3CCR A;  1K73 R;  3A8L B;  4Y91 A;  2R5M A;  4JPB W;  1HK9 A;  1QP3 A;  4ELY C;  2JTF A;  3CC4 A;  2J7I A;  1IB8 A;  2XIC A;  2J6K A;  2VWF A;  4IIM A;  5C0M A;  4E7K A;  1I5O B;  1GCP A;  1ZA2 B;  1ZLM A;  3SHW A;  3DB3 A;  3CC4 T;  2E3H A;  4FU6 A;  3O8V A;  2M0O A;  4XU2 A;  4HCC A;  2RQT A;  1M1K U;  4KBM B;  3EG9 A;  1QVF S;  2DXB A;  2VKN A;  2FB7 A;  3BY7 A;  2YRV A;  4C0D B;  1G3W A;  3QJY A;  4OMQ A;  4LDU A;  1WDX A;  2M1H A;  4C8Q D;  2X51 A;  1B3Q A;  2OTL Q;  1SRL A;  5FU6 C;  3J80 E;  1EFN A;  2KVQ G;  3SB2 A;  1YI2 A;  1DJ7 B;  2M16 A;  3FIF A;  3ME9 A;  4LDX A;  1ZSG A;  2X9H A;  5GMK h;  1SPK A;  2CSI A;  1ABQ A;  2HKQ B;  1MMD A;  3L1A A;  4JRQ A;  1GBQ A;  3OS5 A;  4M7A F;  2AKK A;  4J8O A;  2HZY A;  3CCM T;  4FSX A;  1KC8 R;  5GAN 7;  1K4U S;  2GF7 A;  3SWN B;  1FMV A;  5FRM A;  3C94 A;  1PD0 A;  3NTH A;  4OMM A;  1QVG P;  2A37 A;  3HHT B;  1KIK A;  4M77 G;  3VRZ A;  1ZBX A;  1LPL A;  5DLO A;  1I4K 1;  1UGS B;  1BCO A;  1JXM A;  3I55 Q;  2QQB A;  1G3S A;  3OB9 A;  2XDB A;  1U06 A;  2KEA A;  3M5A A;  3UDC A;  3E9G A;  2DVE A;  3KUF A;  4RG8 A;  5A0D A;  4A4K A;  3CCS A;  2RK2 A;  4M78 E; 
#chains in the Genus database with same CATH homology
 4DOV A;  3CBP A;  3EFR A;  4M75 B;  2DD4 A;  4EMG A;  3OYE A;  3G71 T;  1V29 B;  4N4G A;  3OYM A;  3L2V A;  5GAO n;  3QKJ A;  3ZBD A;  4ZGE B;  4BE2 A;  3FEO A;  1G3Y A;  2IVW A;  2Y4X A;  3VUZ A;  5CIU A;  4J5Y A;  4KUL A;  4BUG A;  1D3B B;  4RCB A;  3CCJ T;  4BY6 B;  4B9W A;  5CK9 A;  3V7S A;  4PJO G;  3AHU A;  3KXT A;  2KK4 A;  1VQO T;  1K8A U;  2WSF E;  4L6V 5;  2YHT A;  2RK1 A;  2LT4 A;  3GLX A;  4C92 B;  3G7Z A;  3PMT A;  5IAY A;  3Q1J A;  3FRN A;  3RKY A;  5LJ5 h;  5GAN d;  1Y07 A;  3V7R A;  1NJI U;  4JJN K;  2EYQ A;  4LD9 K;  3CD6 T;  5CKF A;  2A3L A;  3MO8 A;  1VQN A;  1VQO A;  4RKU E;  2LDM A;  5GAM g;  3QII A;  1WQ7 A;  1D3B A;  3ZFJ A;  2QQ9 A;  2QQS A;  3RIR A;  1BI2 A;  2BUD A;  4IUV A;  3HP9 A;  3A8G B;  4KUD K;  3OS1 A;  2WAC A;  3QO3 A;  3P8B B;  5GAN j;  4JLG A;  5FU7 B;  3EAE A;  3CMA T;  3M55 A;  2C06 A;  1O9S A;  1XOV A;  2JOY A;  2E64 A;  1YCY A;  3M4G A;  1FXX A;  1VQP A;  4QVZ A;  4HT9 A;  3I55 T;  1R8O B;  3V7C A;  5A0G A;  3QDR B;  1WJQ A;  4M75 G;  1N9S A;  1Q86 C;  1VQN T;  5LJ3 g;  4R55 A;  3TU4 K;  2DAQ A;  3VKI A;  2I2L A;  4MMK A;  5LJ5 f;  2OAU A;  5EG2 A;  3VYG A;  2K5L A;  2L5Q A;  2DIG A;  2E65 A;  4J7I A;  1N8R C;  2WSE E;  4Y28 E;  3CCJ A;  3JB9 D;  2AHJ B;  3M53 A;  2RO0 A;  2Y4Y A;  2ZCF B;  1VQ6 A;  1Y96 B;  2DZ9 A;  2X4X A;  3QZ5 B;  4C5I A;  5L8R E;  3A8H B;  4NL3 A;  4M77 E;  1YJ9 T;  3CBO A;  3PMI A;  5KCH A;  3MCA B;  2KMT A;  4OB2 B;  2EQM A;  5KE3 A;  3CCE T;  2X4J A;  1NE8 A;  4PL6 A;  3RMS A;  4F7U F;  1KG1 A;  2PVO B;  3TRE A;  5GAM j;  4JS4 A;  1K73 U;  2LRQ A;  4F7U A;  2QEX A;  5CR2 A;  3CCV T;  2HQE A;  1VQM T;  2EAY A;  2ZPF B;  3QZ9 B;  2P4T A;  1BI1 A;  5GAN 6;  2ZPH B;  3CBM A;  5FRN A;  2DD5 A;  4C8Q E;  4PJO B;  3LLR A;  4M77 C;  4PNO A;  5GMK e;  1S72 A;  2DJZ A;  3CCU T;  4M77 B;  4JDS A;  1QW1 A;  2IG0 A;  4ZTJ A;  5GMK i;  4MDX A;  2B8A A;  2E5Q A;  3JCM f;  2X4W A;  3CPW A;  4M7D D;  2JN0 A;  1M1F A;  4QQD A;  4C92 F;  3CPF A;  2E70 A;  4EMK B;  4OF1 A;  3LH0 A;  3PTA A;  3CCE A;  5LJ5 g;  2H3J A;  2A7Y A;  5J26 A;  2EQK A;  2RM4 A;  2YLB A;  3LGF A;  4FIB A;  1VQ5 T;  3L2Z A;  3L2R A;  3JB9 F;  1GXI E;  4C8Q C;  4HKE A;  1X01 A;  3QPH A;  1YJN T;  2RHI A;  3CCS A;  4N4H A;  1Q82 U;  3A8O B;  4ATO A;  1P92 A;  2O01 E;  1M9S A;  4EMH A;  1I81 A;  4PJO D;  3G71 A;  4M75 A;  1NPR A;  2DO3 A;  2ZZD A;  4C8Q F;  3F70 A;  2CKK A;  1UGP B;  3M58 A;  4J83 A;  3OW2 S;  2D0Q B;  2PU9 B;  5GMK m;  3CME A;  3CMA A;  3JCM W;  4Z02 A;  3JCM X;  1I5L A;  5CAI A;  2FHD A;  5J39 A;  5I2M A;  5GAN 3;  1ZQ1 A;  2CZ1 B;  3HKS A;  5LJ3 d;  3TCJ A;  3OA6 A;  2QXF A;  3HPW A;  5LJ3 e;  4N0A A;  3TEE A;  4OB1 B;  5HK3 A;  3JCM J;  3UWN A;  3OYJ A;  3QYG B;  4A4H A;  3MHX A;  5FRO A;  3CCQ A;  2QA4 A;  4V2S A;  2OTJ T;  4C92 E;  1KQ2 A;  4P5N A;  3LWI A;  3RMQ A;  3HRT A;  3OBY A;  4DA4 A;  2QQR A;  1XTD A;  2ZPG B;  2KY9 A;  3ASK A;  1FX7 A;  4XQ3 A;  3OMG A;  5GAN 4;  1WJR A;  3M54 A;  3G6E T;  2LNV A;  1M1G A;  2GFU A;  3CC7 T;  3WVD B;  1X75 C;  1IZ6 A;  2LQK A;  4DOW A;  1KHC A;  2FL7 A;  2LCL A;  2DZC A;  3BW1 A;  3QJ6 A;  3SFM A;  2DXC A;  3FDR A;  3QG1 A;  4XTU A;  5LL6 S;  1KC8 U;  3M4Y A;  4M7A D;  2JUF A;  3P8H A;  2EJ9 A;  4M77 D;  1VQK A;  2F5T X;  5HKC A;  4O5V A;  1N6A A;  5HY6 A;  4ZGD B;  1N9R A;  2V8J A;  3CXC A;  2EJF A;  4M7D B;  4C92 C;  3QHS A;  2VXF A;  2QQA A;  5GAM f;  3X24 B;  5HK0 A;  2HAX A;  4XTY A;  2VUB A;  5LJ5 d;  1QVG A;  4PJO A;  3SDZ A;  4BI4 A;  2X4Y A;  2HNI A;  3EFS A;  4M75 D;  3CCM A;  5GAN f;  3S3M A;  4NS5 A;  3NTK A;  2EQJ A;  1VQM A;  5CQY A;  4M7D G;  1K73 C;  2QEX T;  2MF2 A;  3NTI A;  3RKX A;  4QVD A;  4OB3 B;  2EFI A;  4C8Q B;  5GAN 8;  3LYI A;  2VXE A;  3V8K A;  3HSB A;  1IRE B;  4PJO C;  5D6W A;  1VQ7 T;  1YHQ T;  5LJ5 j;  4C0G A;  3VU3 C;  4IUT A;  4RMO A;  4BDZ A;  4IUR A;  4A4E A;  1Q86 U;  1WPY A;  2L8D A;  1YJW A;  2PUK B;  1VQ9 A;  2RHX A;  2EIF A;  4IUQ A;  4EMK A;  3CEY A;  1UGR B;  3SWN A;  4XTW A;  4PLL A;  1X6O A;  3JCM c;  3OYD A;  3OYF A;  2P0P A;  2RJD A;  4C5H A;  5GAM e;  5DM7 R;  3OS2 A;  4JRI A;  3G4S T;  5GAO r;  1KD1 C;  4M75 E;  3HFN A;  5IN1 A;  3I56 A;  1PSE A;  2E6Z A;  1W4S A;  4M7D F;  3CCQ T;  2QA4 T;  1K8A C;  1Q82 C;  4J7F A;  3DKM A;  4IKF A;  3OQ5 A;  4KT0 E;  1VQ4 A;  4XTX A;  1RL2 A;  5LJ5 e;  1PSF A;  3SWN C;  1KQ1 A;  4E7L A;  4QVC A;  2HD0 A;  1LNX A;  2VYT A;  4JUV A;  2ZGW A;  3PIP A;  3GNG A;  3OSS C;  4OGE A;  3OYN A;  2PVD B;  4C5E A;  1XNI A;  4QW2 A;  1H3Z A;  3PNW C;  3CCL A;  3OBW A;  4ZN3 A;  3JCM Q;  3VYH B;  3BDL A;  3QYH B;  1U8R A;  1YJ9 A;  2YLC A;  3LWH A;  1I8F A;  2M9U A;  2RHZ A;  3M9Q A;  2MWO A;  2RHU A;  2PVG B;  2RI5 A;  2LX9 A;  1OZ2 A;  3HRU A;  3P8D A;  2R5A A;  5KCO A;  2CGH A;  3A8M B;  4A54 A;  3T9N A;  4J6X A;  3CPW S;  5FU7 C;  1U1S A;  3OYI A;  2OTJ A;  4C92 D;  2LVM A;  2FYK A;  3LGL A;  4CI0 C;  3A5Z B;  3JCM d;  4BAC A;  4OB0 B;  4YTL A;  2RI2 A;  1BIA A;  4X34 A;  5GAM d;  5GAN 2;  3QSU A;  4ZTF A;  2JVV A;  2WSC E;  1VQ8 T;  3GPL A;  3LX7 A;  4GLK A;  4M78 D;  1QVP A;  4LDW A;  4OVA A;  1K9M C;  4M78 A;  1W2B A;  4M77 A;  1JJ2 A;  2NLU A;  5A2Q E;  1N27 A;  4JLI A;  4PJO F;  1OI1 A;  2HBP A;  2LQ8 A;  2EQU A;  2RA2 A;  5FLX E;  5J3B A;  4L5G A;  4M7A G;  3CXC S;  1FWZ A;  2CZ0 B;  1G5V A;  2P0K A;  3MP6 A;  3ER0 A;  1U1T A;  4BB7 A;  1Q7Y U;  2K5F A;  3GIB A;  3JCM g;  3OYA A;  4ME7 A;  4WF2 A;  4UC4 A;  2Y90 A;  5GAO p;  3QUI A;  2DK3 A;  1MGQ A;  4EMK C;  1WJS A;  2CZ7 B;  3OYL A;  1KQS A;  4C0D C;  2DXT A;  3QBY A;  4NL2 A;  3G4S A;  3GP8 A;  1Q81 C;  2XHC A;  4M78 B;  5LJ3 h;  3FC3 A;  1MHN A;  4LDV A;  3RKW A;  2MAM A;  4E7I A;  3R6O A;  4QQ6 A;  2E1H A;  1VIF A;  1VQK T;  1Y71 A;  4MML A;  1LJO A;  1NZ9 A;  2KSS A;  2EJG A;  2VGM A;  2XID A;  4RCC A;  3OW2 A;  3X25 B;  2CZ6 B;  4N4I A;  5LJ3 f;  3JB9 I;  4J6W A;  4MDW A;  2XU8 A;  4NOY A;  1M1K C;  3H6Z A;  5AYF A;  1Q7Y C;  3MP8 A;  2KQW A;  2RJC A;  2D9T A;  4A53 A;  2EWN A;  4M7D C;  5GAO m;  1YIJ A;  2MMP A;  4HCB A;  2DXU A;  2KDS A;  2MWP A;  4ZN1 A;  2DIQ A;  2JNG A;  2ZPE B;  4VUB A;  5LJ3 j;  3URG A;  2JZ2 A;  1BI0 A;  4C5G A;  2MI6 A;  4XTV A;  4EDU A;  5GAM h;  3OYY A;  3I55 A;  2QDY B;  2GFA A;  2VGN A;  2F5K A;  4M75 F;  3S6W A;  1YBY A;  2LC4 A;  4C0Z A;  4EPC A;  3WXM B;  2F69 A;  1VQP T;  2GCX A;  4CRI A;  3E1S A;  3ZEH A;  2EKO A;  1OYX A;  3JCM b;  4MZP A;  1KQS S;  2BIV A;  4M7A A;  2XI9 A;  3QXE B;  1TH7 A;  1G3T A;  5I2S A;  1HXD A;  3L2W A;  5GAN 5;  5GAN g;  1UEB A;  5GMK j;  3JB9 J;  2DKG A;  3BDU A;  4BE1 A;  4RG2 A;  4M78 G;  4M7D E;  1JRI A;  4GY5 A;  4XTZ A;  1NJI C;  2LTO A;  5CVI A;  3J7A F;  1BI3 A;  2BKD N;  3V8L A;  2K5I A;  4M78 C;  4BD3 A;  3JCM e;  3CD6 A;  1YIT T;  3C4S A;  2L89 A;  3MEW A;  3OYH A;  3L2U A;  3E9F A;  2XDP A;  1KD1 U;  1JBM A;  1BIB A;  3L2Q A;  4FM4 B;  4E7J A;  3JCM h;  1WQW A;  2R58 A;  5CQX A;  1ZHI A;  1VQL A;  4M78 F;  4M7A B;  2XD0 A;  2RJF A;  1YJW T;  1BKB A;  3CCR T;  5CKD A;  4A4G A;  5DLQ E;  4C0F A;  3BFM A;  4PLI A;  4C92 G;  2CYZ B;  1M90 U;  4O6J A;  1AHJ B;  4BI3 A;  3GOX A;  2R57 A;  3VUB A;  2XG8 D;  4C8Q A;  3OY9 A;  1YHQ A;  2K4Y A;  4XU3 A;  3JSC A;  2RJE A;  5DY9 A;  5KE2 A;  1KC8 C;  4HT8 A;  1Y96 A;  4XU0 A;  3M56 A;  4OGC A;  5GAO l;  2K57 A;  3DLM A;  2O4X A;  3X26 B;  4FT2 A;  5CKB A;  4E47 A;  3OYB A;  1WNL A;  5IT9 E;  1VQ8 A;  2LCC A;  2XDD A;  3JB9 G;  5A0L A;  3C95 A;  1B34 A;  2XKO C;  2RHY A;  3M59 A;  2DTO A;  4Q5W A;  4BY6 C;  4XK8 E;  3CCR A;  3A8L B;  2LT1 A;  4IUP A;  4M77 F;  4Y91 A;  1RI0 A;  2RH2 A;  4KUI A;  2R5M A;  1YIJ T;  1YJN A;  2P0Q A;  1HK9 A;  4X9D A;  4C92 A;  1JB0 E;  1QP3 A;  4DQ2 A;  4ELY C;  5GAN e;  3UPU A;  1VQ5 A;  3C12 A;  3JRZ A;  2JTF A;  5KH6 A;  3CC4 A;  2X35 A;  5M9O A;  4II1 A;  3CC2 T;  4PKC C;  3HL8 A;  4M75 C;  2XIC A;  3JAM E;  2E12 A;  3GNF B;  3S3O A;  3NFC A;  3FB9 A;  4BI8 B;  1SSF A;  2FVU A;  3DB4 A;  5C0M A;  1VQ9 T;  4E7K A;  4XU1 A;  3SD4 A;  4F7U B;  1YI2 T;  2GQV A;  2QTX A;  2HQX A;  2D6F A;  3MEV A;  3CCL T;  5C6S A;  3DB3 A;  3CC4 T;  3FLG A;  4ZGJ B;  1QVG S;  4FU6 A;  2OTL T;  3O8V A;  2M0O A;  3J81 E;  1OZ3 A;  3OMC A;  4XU2 A;  4IUU A;  5GAN h;  3CCS T;  4HCC A;  1M90 C;  1NPP A;  4L59 A;  3KBG A;  5CKE A;  5CO7 A;  1UB4 A;  1WGS A;  2RI3 A;  4HA8 A;  1M1K U;  4KBM B;  2KAF A;  4X9C A;  5D6Y A;  3RES A;  2DXB A;  3CCV A;  1QVF S;  2FB7 A;  1B34 B;  1Q81 U;  1O75 A;  4PJO E;  3BY7 A;  2YRV A;  4A4F A;  4C0D B;  4D6W A;  1G3W A;  2K3X A;  4F7U G;  3JCM V;  3OSV A;  3QJY A;  4FT4 A;  4LDU A;  4MZT A;  4OMF B;  2M1H A;  5CKH A;  4C8Q D;  2OTL A;  2VC8 A;  4JS5 A;  5FU6 C;  3J80 E;  1VQ6 T;  3MET A;  3VV0 A;  2KVQ G;  3PFS A;  3SB2 A;  1YI2 A;  2ZPB B;  5CCA A;  1DJ7 B;  1VIE A;  2M16 A;  3FIF A;  3ME9 A;  4BDY A;  4LDX A;  4JRK A;  2DTH A;  2XK0 A;  2V8I A;  5GMK h;  3JCM P;  1VUB A;  1VQL T;  4TVR A;  3FJP A;  3V8J A;  3E19 A;  3RER A;  3MEA A;  3VJP A;  1Y7X A;  1QP2 A;  3OYC A;  3G6E A;  3CC7 A;  2PUO B;  3MP1 A;  2VV5 A;  3L1A A;  3N5B B;  2CS7 A;  4JRQ A;  3OS5 A;  4M7A F;  2DPP B;  4J8O A;  3CCM T;  3OS0 A;  2JTM A;  4M7A E;  2G3R A;  3INZ A;  4FSX A;  2L3R A;  3OYG A;  3GF5 A;  4E7H A;  1QVF A;  2K2V A;  3H8Z A;  3PIO A;  5GAN 7;  4J6Y A;  1M4Z A;  5GAO q;  4M7D A;  3PGG A;  3HFO A;  1BYM A;  2GF7 A;  3SWN B;  3CME T;  5FRM A;  3C94 A;  3NTH A;  5GMK l;  4R56 A;  3PT9 A;  4MZM A;  3M57 A;  5D6X A;  3UT1 A;  1H64 1;  1M5Q 1;  3HHT B;  5I21 A;  1N8R U;  2RD1 A;  4M77 G;  4HCZ A;  3RUX A;  4B9X A;  3OYK A;  1EIF A;  4M7A C;  5FU6 B;  4BE0 A;  4QQG A;  1ZBX A;  2V8K A;  4ELZ C;  2E6N A;  1W2B S;  3DLL A;  1JJ2 S;  1XQH A;  2E41 A;  4FL6 A;  5DLO A;  1YIT A;  1KHI A;  1I4K 1;  4LD6 A;  1UGS B;  3S3N A;  3HRS A;  2E10 A;  3JB9 H;  3LW5 E;  1K9M U;  3CC2 A;  2QQB A;  3MEU A;  4C8Q G;  1G3S A;  3OB9 A;  2XDB A;  2QI2 A;  1M8V A;  2DTI A;  1VQ7 A;  3M5A A;  3UDC A;  4F7U E;  3E9G A;  2PQW A;  2DVE A;  4OP0 A;  2ZPI B;  3X20 B;  3CCU A;  3KUF A;  1VQ4 T;  4LDY A;  4N0A C;  1S72 T;  2O4X B;  1LOJ A;  4RG8 A;  3L42 A;  3WVE B;  2RB6 A;  5A0D A;  2DEQ A;  3X28 B;  2K3Y A;  4A4K A;  1UGQ B;  3I56 T;  4XAX B;  4JRP A;  2RK2 A;  4M78 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...