1QP2A

Solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PSAE PROTEIN)
publication title The solution structure of photosystem I accessory protein E from the cyanobacterium Nostoc sp. strain PCC 8009.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qp2A00
1IREB 4OB3B 4RKUE 3WVDB 2PU9B 4ZGEB 1JB0E 4ZGDB 1QP2A 4OB2B 3QYHB 3WVEB 4ZGJB 2DD5A 3QYGB 2CZ6B 3QZ9B 2QDYB 2ZPFB 3A8HB 4OB1B 3X28B 1UGRB 2PVGB 3A8GB 2PUOB 2WSEE 2CZ0B 2ZCFB 2D0QB 4FM4B 3X20B 3A8MB 1UGQB 1UGSB 2DD4A 2WSCE 2WSFE 4L6V5 2ZPBB 1QP3A 1GXIE 1DJ7B 2CYZB 1PSEA 2CZ1B 1V29B 2PVDB 3X24B 4OB0B 3HHTB 3X26B 2PUKB 1PSFA 2DXBA 2AHJB 3VYHB 2CZ7B 3LW5E 3X25B 2ZPIB 4KT0E 3A8OB 3VYGA 2PVOB 2DXCA 2ZPEB 2O01E 3QXEB 5L8RE 1UGPB 4Y28E 1AHJB 2ZPGB 2DPPB 2ZPHB 3QZ5B 3A8LB 2ZZDA 4XK8E
chains in the Genus database with same CATH superfamily
5CR2A 1WXTA 2XK0A 4OB3B 5LJ3h 2MYSA 1M90U 2V8JA 1W2BS 1LJOA 4OB2B 1VQ5A 3LH0A 3RMSA 1K0SA 1LNXA 2J6KA 4OMQA 1M3BA 4X34A 3P8DA 2RPNA 4HVWA 4AFZC 2V26A 2X9HA 4ME7A 4BE2A 4GY5A 4C92G 1I07A 1WDXA 4EIKA 2EW3A 1YJWT 4BI3A 2YUOA 2ZCFB 2D0QB 5A0GA 3VS4A 1SRLA 1GFCA 2VGNA 1U5SA 4AMCA 4M7DF 1N27A 1OPLA 1VQ9T 3JB9I 2V8IA 1VQNT 2K5FA 4Z89A 4M7AC 5GMKe 3RERA 1H3ZA 2GFAA 2JN0A 3PVQA 2LJ1A 1HJDA 3PNWC 2OTJT 1WJSA 2MOXA 3D7SB 4JZ3A 1NM7A 5KYWA 4XTXA 3VS2A 4DQ2A 1BIAA 1G3TA 5KE3A 4IUQA 1MUZA 1QKXA 2DXTA 2RK2A 2DRKA 3QIIA 1QCOA 2R5AA 3JV3A 1X27A 3EGDA 3P8HA 2J06A 3META 3BDLA 3UPUA 2HSPA 4J9BA 3HKSA 1KQSA 2DM1A 2PQWA 3UT1A 3N5BB 3SHWA 4R55A 2PVOB 2QQBA 4FT4A 5LJ5h 2FYKA 2DEQA 1IXDA 3I9QA 4OMOA 2RA2A 4N0AA 2HBWA 2YUNA 4FW1A 4PFOA 5FU7B 1SHGA 4E7IA 4F7UF 1HXDA 3L1AA 4L59A 4ZGJB 2E65A 5ECAA 2FZGB 2LQ8A 2IG0A 1VQ5T 1I1JA 5CIUA 3CCEQ 2MI6A 1Q82U 2KRMA 2RK1A 5GAOm 1Q81R 1VQMT 2QAZA 1ZSZA 1IZ6A 1PWTA 1M8VA 4OMFB 1Q81C 2EFIA 3RMQA 2EJ9A 3OYMA 5GAMe 5IHIA 4FIBA 2RQTA 2F5TX 5KYYB 2OI3A 3RKYA 4M7AE 1VQLA 2M9UA 2YLCA 2PTKA 2E5KA 3U23A 4EMKC 1K1ZA 1AWWA 3JB9G 4JJNK 3CCUQ 4E2FB 3RIRA 2MPXC 1I5LA 2KEAA 1K76A 2YRDA 4MZTA 2EQKA 1WHGA 3CCEA 1AD5A 2XICA 4AT1B 4MMLA 3G4SQ 3BY7A 1G5VA 2DAQA 1K73U 1KD1U 2KDSA 5FU6B 1AVZC 1EFNA 1FXXA 3MEVA 2KY9A 4LDVA 2YUPA 3QDRB 5GMKl 1D1BA 2MK5A 3M58A 2G3RA 1YHQT 3E1SA 1BCMA 4M75C 1AHJB 2GTOA 4CRIA 3GBQA 4FT2A 1K8AC 2EQIA 3JCMd 1GCQC 2BE7D 4OVAA 4UC4A 1VOMA 4A63B 2E5QA 1M2VB 4FSSA 2COZA 1VA7A 1M4ZA 2CP0A 2CUDA 2K9GA 3VUZA 3CCUA 1RAEB 3EFRA 2DD5A 4A4EA 1TS9A 2XDBA 2CP3A 2K5LA 1FYNA 4RTZA 1NYGA 3UATA 2AKKA 5C0MA 1JXMA 4E7HA 2R58A 2MCNA 3G4SA 5FW9A 4RUGA 1X2KA 1Q86U 4HVUA 2QG9B 2CP7A 5HY6A 2COWA 1B7TA 2KT8A 4KULA 4J9HA 2LNHB 2LMJA 3OYLA 3OS0A 4PL6A 4Y91A 2A08A 3LWIA 1RI0A 2IPOB 4RTXA 4HCKA 3CXCP 2MF2A 2K5IA 4A4HA 2VWFA 5EC7A 2DERA 1VQLT 4CC3A 2DTOA 4TVRA 5D6XA 4PJOD 3OYJA 2B86A 1KIKA 1PKTA 5GAN4 4JRPA 2PVDB 3TEEA 2MWOA 4M78D 3H0FA 2HEQA 4E6RA 3CCMA 1JQQA 4BI8B 1NJIU 2PUKB 2DXBA 4C8QB 5KYYA 2KRSA 2L5QA 1PRMC 3CCET 1NPPA 4LN2A 2E4HA 3QXEB 1NEGA 1WQ7A 5GAN5 2K4YA 2RJEA 4LD9K 1W6XA 2EIFA 1WZOA 2JXBA 2GTJA 1T0HA 4KUIA 4M75E 1PC0A 1JRIA 2YUQA 5HCKA 3V8KA 2RQRA 3I55T 4CI0C 4M77G 1AWJA 1R0CB 2FZKB 3MHXA 2LT4A 1S72Q 4M7DC 3QBYA 3QYGB 4E7KA 2C0IA 3M55A 3CCUT 2JVVA 2DO3A 4AG1C 3REBB 2M16A 3CBMA 3LGFA 1I5OB 1BCOA 1PD0A 5FROA 4A4GA 1R8OB 9ATCB 2ED0A 1M2VA 3FDRA 1YP5A 1ZUUA 3G4ST 3S3NA 2XKOC 2FHDA 1K9MU 2K57A 1VQ4T 2XDPA 2GBQA 1M1KU 4A4FA 4II1A 1XJWB 1KSWA 3EGUA 2L2PA 4PJOB 2KYBA 1WHMA 1RAFB 4WCIA 4RCBA 1I8FA 3MP6A 1RADB 1ZA2B 2LTOA 4XQ3A 4M78B 1QVFA 3H0HA 2M02A 2P4RA 2XG8D 1UECA 3ZFJA 1WLPB 2CT4A 3OW2A 3VJPA 1NEBA 3C0CA 2BIVA 2EQJA 3CCMT 3HTRA 1VIFA 3P8BB 2DXCA 2GF7A 3I5RA 5GAMf 4J5YA 2CGHA 4BDZA 2BZYA 1VQ7Q 1V76A 2KT1A 2RI5A 4RTUA 5DM7R 3QHSA 3M9QA 2DJQA 2RHIA 4L5GA 2RQUA 2HL5C 4C8QA 4R0KA 4NL3A 3VU3C 4OF1A 1D1AA 2CREA 3J7AF 3QYHB 4C0ZA 1QVFS 1MMDA 1VYUA 1X6BA 5D6WA 3ZL7C 3KFVA 3KBGA 1M30A 1I4K1 1SG5A 4C8QF 4B6MA 4M7DE 3HPWA 3REAB 1GCPA 1M1GA 1W70A 3OW2S 1TTHB 3CC7Q 5D6YA 2BE9B 2WSEE 3SB2A 1IHWA 4Z88A 5I2SA 4ZTJA 5KYNA 1IGQA 3KUFA 2O9SA 1LVKA 2XI9A 2M0YA 4C0DC 1VQ7A 2D9TA 1VQKT 3G1JA 3EG9B 4M75F 1BI1A 2WSCE 4KGZB 5IXFA 2WSFE 1ZBJA 2DL5A 4RMOA 3JAME 3CCQQ 3MKDA 2YHTA 1QP3A 1GXIE 3M56A 1Q95G 3JCMQ 1V1CA 4QQ6A 5GAMj 1VYVA 2HQXA 1IHVA 2OJ2A 2X51A 1OU8A 1XTDA 4KH0B 3CMAQ 4C92F 1UJYA 3X24B 4FL6A 4LXCA 4OB0B 3HHTB 1YIJQ 1QCNA 3CC7A 2HQHA 2DLPA 4PKCC 1KJWA 2Y4XA 3O5ZA 4PJOA 2L3PA 4J6XA 4JJDA 3V8JA 3VYGA 1D3BB 1QQJA 2P0QA 4F7UE 2E3IA 2RH2A 2DILA 4M78A 5L8RE 4A53A 3G6EQ 4N4GA 4DBQA 1HK9A 1Q7YR 4J9EA 1C0MA 1MGQA 3MEWA 3OYBA 3GP8A 3VS0A 2VGMA 1WPYA 3CCQA 2QQSA 4B9XA 1YN8A 4RKUE 2KAFA 2PU9B 1UE9A 4F04B 3WVEB 1H641 4PLLA 2JM9A 3OB9A 4XAXB 1JO8A 3FEOA 2CH4A 5FU7C 2CSQA 2ZPFB 2EJGA 2FRYA 3O8VA 3M0SA 2CZ0B 4BUGA 4M4ZA 4QKUA 2KI7A 2ED1A 2R5MA 1YWOA 2F2XA 1VIEA 4N4HA 5IXBA 3HFNA 1YJNT 1UG1A 3G6EA 1UGVA 4X1VA 4KUDK 4BI4A 4BB7A 4DBHA 3MPUB 3NFCA 4OP0A 3NPFA 3CCSQ 3OYGA 1VQ7T 1JEGA 2JOYA 1LPLA 2YXYA 1SSFA 1ZA1B 5C6SA 2QASA 5HK0A 3M0RA 3L42A 3CCVA 4KGVB 4FU6A 4J9IA 2DE0X 4ZNXA 2XD0A 2RHUA 3OYKA 2QQ9A 4LE9A 1RAIB 3EG9A 2A37A 5GAMg 3GIBA 4RG2A 2JTEA 1SKUB 5FRMA 3VYHB 1SF9A 1R77A 5A2QE 4PJOG 1D0YA 3EH2A 3M5AA 4Q5WA 4MDWA 2LJ3A 1RAHB 3CD6Q 4M78G 2KSSA 1FWZA 1X6OA 2V1RA 2OTLQ 3V7RA 1IB8A 2O31A 1MMGA 3SWNC 2DPPB 1KC8R 3JB9F 3C4SA 5FU6C 4M77B 1X01A 1O9SA 2ZGWA 2GQVA 3L2UA 3F70A 3CC4T 4M7AD 1KC8C 1MNDA 1D3BA 1Y71A 4PFPA 2RHYA 1KQ1A 5DY9A 2CZ6B 2OAUA 2QDYB 3QPHA 3H9NA 2VV5A 2DVEA 4RCCA 4JS5A 5CKEA 1TUGB 3RKXA 2WACA 2C06A 3EFOB 1Z9QA 1GRIA 4FM4B 5GJWB 1R0BG 1ACMB 3OSVA 3CD6A 1H92A 2CP5A 5A0LA 3CCJQ 2OTLA 4HVVA 3AT1B 1U3OA 5A0DA 2V1QA 1BI3A 3JSCA 3G6ET 3RDVA 2QXFA 1MNEA 1KQSS 3CC2Q 4IUVA 4DOWA 3L2WA 1TOVA 3NTKA 1FMKA 2E70A 5CO7A 2P84A 4C5IA 5LJ3d 2CKKA 1JXOA 2XMFA 2A0FB 1UTIA 1VUBA 3QG1A 4CC2A 3CCVT 3Q1JA 4P5NA 1QKWA 5CQXA 2D0NA 1HSQA 3CPFA 4OGEA 2LJ0A 2AZVA 3SD4A 2LZ6B 2QK0A 2W10A 3J81E 1RLPC 1PCXA 2ZPEB 1TUDA 2M1HA 1YJ9Q 2HL3A 8AT1B 3CCJA 3VS1A 3L2ZA 4Y28E 5GMKh 4C8QC 2LP5A 1GBRA 2ZPGB 1TH7A 5I2MA 1OV3A 4OMPA 1OYXA 3CBPA 1XOVA 2MWPA 4M7AB 1W1FA 3UA6A 1KQ2A 2RNAA 3CC2A 4QVZA 2FL7A 5J39A 2DVJA 2DFUA 3EHQA 2RI2A 1K8AR 2EYYA 3BFMA 1WHLA 4JJBA 1OX9A 1HYOA 4XTWA 1ZQ1A 5CVIA 2D1XA 2QA4Q 4M77A 2K2VA 3JCMb 2XIDA 2X4JA 1WJQA 1WXBA 1YJ9A 1UDLA 1YCSB 3JCMf 5LJ5d 3CPWA 2HKNA 2KQWA 4QVCA 4C92C 4XU3A 3QUIA 3GOXA 3CD6T 4QT7A 2XHCA 3M0TA 4XU1A 5I21A 1AZEA 1U1TA 1PG5B 4M75D 2J6OA 2OAWA 2DRMA 4N4IA 3EFOA 5GAOp 2FG0A 2HAXA 1A0NB 3M0QA 3VS5A 5GAOn 1VQ8Q 2VYTA 2DX1A 3EHRA 1TWBA 3LW5E 2ROLA 2QA4A 3H6ZA 2SEMA 1M2OA 2HMAA 5I22A 1QLYA 2FVUA 3CPWS 2E1HA 2W0ZA 5GAMh 3I56Q 4ELZC 1N9RA 1QMCA 3OMCA 2ZPHB 4C8QE 3CCJT 4E7JA 4X9CA 4IIOA 2YDLA 2RI3A 4PJLA 1HD3A 1OPKA 1E7OA 3WVDB 2I0NA 2KK4A 1QVGA 5CKHA 4EMKB 1VQ6Q 2AK5A 3MO8A 1B3QA 2G6FX 1PNJA 3CXCA 3QWXX 3QZ9B 5GMKi 2JMCA 1VQ8A 4E47A 1BK2A 1ZX6A 4RTWA 3GPLA 3EAEA 4BE0A 2X35A 4J9CA 1WQWA 4ZTFA 4M7AA 2E12A 4NS5A 1WXUA 5HK3A 1Y96B 2DETA 5KCOA 4FYXB 2L3RA 2QQRA 1JJ2A 1MV0B 2D6FA 1UGSB 4IURA 2LC4A 3I56A 1M3AA 1ZUKA 2DL4A 1PKSA 2GGRA 1ZBXA 1FMWA 4BD3A 2EGCA 1YI2Q 4X9DA 4C92E 1NG2A 3A1PA 3CCRQ 1SEMA 2EAYA 2ZPBB 2KYMA 2FPEA 2DNUA 3LWHA 1RUWA 5GANd 3KXTA 1ABQA 3VS7A 4JJCA 2QTXA 1TUCA 2HBPA 2CH4W 2EGAA 3JB9H 4PJNA 2X4YA 5GANf 3X26B 2A7YA 3E2UA 2O2OA 2NUTB 1QVFP 3TU4K 2IIMA 4M7DD 3TCJA 3VRYA 4MZPA 2QEXQ 3OYIA 1WHJA 4IUUA 4A54A 4CC4B 3OW2P 3M4YA 3OA6A 4IUPA 8ATCB 1TG0A 1MMAA 3VS6A 2RF0A 2JS0A 2M51A 3OS1A 1S72A 2GNCA 1BB9A 4XTUA 3PGGA 1IO6A 1YI2A 3WXMB 4K11A 1N8RR 1RL2A 2QYZA 3CCRA 1K4US 3QJ6A 1QVPA 3QJYA 2HCKA 5KCHA 3C95A 1XNIA 1QW1A 3THKA 2AT1B 1N8RC 2K6DA 4NOYA 1QP2A 3V7CA 3ZBDA 1UEBA 2A3LA 4LDUA 3MP8A 1G83A 1TXQA 4N0AC 4PK4A 4CC7A 2FRWA 1VQPQ 2DBKA 2MIOA 2X4WA 3V7SA 2RMOA 2KRNA 3QSUA 2COYA 2FB7A 1Y57A 2EBPA 3NGPA 3JCMg 4M7AG 1Q7YU 2PVGB 3SDZA 3OYEA 2J7IA 1X69A 1T3SA 2QTVA 3M59A 4FW2A 1D09B 2QEXA 3RNJA 1PD1A 5CK9A 4EMKA 1WNLA 3G71Q 3QDFA 3EG1A 2EYZA 2H8HA 2CT3A 5GAOr 4XTYA 5D7UA 2M0OA 3RBBB 5GANj 1BKBA 1YJWQ 1ZSZC 4XTZA 2DIQA 4LUDA 2A36A 1M1FA 1OEBA 1ZLMA 1GFDA 4AFUC 4KGXB 1VQ9Q 1Y96A 1GBQA 5LJ3e 4F14A 3PVLA 4AG2C 2EWNA 4J6WA 1G3YA 2OTJQ 1TSFA 4HCBA 4M7DB 3CEYA 2XDDA 1JBMA 2DBMA 4KH1B 2YRCA 2O9VA 4DEXA 1VYTA 1WFWA 1MV3A 3EGXB 2O88A 4A4KA 1GCQA 3G71A 7AT1B 2JW4A 2GQIA 2F2WA 2RB6A 1UGPB 2YWWA 3UWNA 4MZMA 2L3QA 3LX7A 1YJWA 4PLIA 1K9MC 2RJDA 5KH6A 5FWCA 2FPDA 4BE1A 4ATOA 2Y90A 1BBZA 3PT9A 3JCMc 1S72T 4PJJA 2NUTA 3C94A 3GLXA 1VQOQ 1IREB 3R6OA 2DTIA 4J9DA 1YCYA 4ZGEB 1JB0E 1Y7XA 2JTMA 2AKLA 5AT1B 5L23A 2KROA 4E7LA 2KVQG 1TU0B 1RLQC 4VUBA 3A8HB 3I5SA 3LH5A 3BE3A 4PJOF 4M77C 3JCMe 2DTHA 3VV0A 2EQMA 2LQWA 5KYUB 2PUOB 2EQUA 4GBQA 5CKDA 1NLPC 4M78F 4ESRA 1Y07A 2JUFA 1W2BA 4F7UB 3JB9J 3TSZA 1UGQB 5LJ5e 2QGGA 2DYIA 1S1NA 2KMTA 2DKGA 5IHKA 3CMAA 1VQMQ 5I11A 1T0JA 4KBMB 2E41A 1YIJA 1K9AA 4JS4A 2RD1A 4J9FA 1XQHA 4PFZA 5GANg 2KXDA 2P0PA 1VQOA 2HKQB 4LDYA 2CYZB 1ABOA 1UUEA 5GJVB 4LDXA 5KYXB 1AEYA 2PNIA 1OZ2A 4OMMA 2RHZA 1OULA 3QO3A 1WA7A 4J7IA 5EG2A 2YLBA 1PSFA 3RUXA 4M75G 2AHJB 2DEUA 2C0OA 2D8JA 2DL7A 3X25B 2VC8A 4QVDA 4QQGA 1O75A 1YWPA 2VXFA 3EG2A 1Q81U 3L2RA 3OBYA 1OQKA 2J05A 1VQMA 1PRLC 2X4XA 4C0DB 3H8ZA 3G71T 2P4TA 4IUTA 4M7DA 3NHNA 4DBRA 3QZ5B 1RACB 3S3MA 4OMNA 1EIFA 3QKJA 3UDCA 2PZ1A 2KNBB 1E6GA 2VB6A 1YHQQ 2L89A 3EGXA 3CC7T 2LCCA 3NTIA 1I81A 4AFSC 1AWOA 2LQNA 2K7AA 3OBWA 1KQSP 3ME9A 1OU9A 4JUVA 2BTTA 2E6ZA 3H41A 4B9WA 2KXCA 4JLIA 1H3HA 4JLGA 1D0ZA 4BY6B 3CCSA 1C1AA 1G3WA 2H3EB 3X28B 1UGRB 3S6WA 4C0GA 4M77E 1SPKA 3SFMA 5IAYA 1I0CA 1NBEB 4ZN1A 4JRQA 3X20B 4ELYC 2EJFA 3EFSA 1N5ZA 3A8MB 3RESA 3CCQT 3A5ZB 2GCXA 1QWFA 5IT9E 4IKFA 2Y4YA 3FJPA 3HRSA 3M57A 4BACA 3H0IA 2NLUA 2NUPB 1K8AU 3JCMh 2F1LA 3GNGA 4J9GA 2K79A 5DLQE 4L6V5 1N9SA 3CMAT 2MAMA 5GANe 2DZCA 2HZYA 5KYUA 2HNIA 4NL2A 1YNZA 1YIJT 1YHQA 1CKAA 1WX6A 5IN1A 2DF6A 4F7UA 1VQOT 2LCSA 4D8KA 1QCFA 4C5HA 1NYFA 1VQLQ 5GAN2 1AZGB 1UHCA 2IVWA 2CS7A 1M90R 4O5VA 3HFOA 3JRZA 5M9OA 3DLLA 1UJ0A 3HRUA 4HT9A 1M90C 1B07A 5KYXA 3G7ZA 3TSWA 4JZ4A 2E6NA 4QQDA 1MHNA 2BZXA 4LUEA 5GAOl 4M7DG 1U1SA 2XU8A 1F1BB 5LJ3f 2Z0WA 5GAN7 1C6VX 2L8DA 2AZSA 1YFNA 2VVKA 3MEAA 2BKDN 3PFSA 1P92A 4HA8A 3CQTA 4DEYA 1BYMA 4MDXA 3I55Q 2JTFA 4RG8A 2L0AA 1IRXA 3E9GA 4F17A 1G8XA 1M8MA 4F16A 1PM3A 1LOJA 2CSIA 5GAN8 2DYBA 3M4GA 2F69A 1NE8A 3QWYA 1EZZB 3CCST 3NTHA 2EKOA 2RO0A 3ZEHA 5IHNA 2DD4A 2FO0A 1OI1A 1WHKA 2F2VA 2NYSA 1M9SA 2FPFA 5GMKm 1CKBA 2RQVA 2VXEA 3L2QA 3SWNB 4C5GA 2SRCA 3CPWP 4E7ZA 2OX7A 4LDWA 2RHXA 4EDUA 4DA4A 1VQ4Q 4C8QD 3M53A 4Y92A 4GLKA 1K0XA 2HQEA 3OYNA 1M27C 2HDAA 4F7UG 4HCCA 2CZ1B 3I55A 3SEMA 4GLMA 3TQ7P 5HKCA 3URGA 2KR3A 1WIEA 5GAOq 2DIGA 5GAN6 1KFZA 3VRZA 4FCYA 4PNOA 2E10A 2E64A 2NUPA 4M77F 1WHHA 5GANh 3FB9A 2F5KA 5LJ3j 2KBTA 2OTLT 2K2MA 4Z02A 5LJ5f 3DB3A 3A8OB 3M0PA 2DJZA 2RQWA 5CAIA 5FLXE 5CKFA 3BDUA 1Q82R 2EGEA 1B34B 3CCMQ 3OYAA 1IGUA 1ARKA 4PJOC 2LVMA 3CBOA 4XK8E 1WJRA 1H8KA 1VQ4A 1Q82C 4C92D 4YTLA 4M78C 1KHIA 2KE9A 1ZHIA 3INZA 4FYWB 4WTOB 3M54A 3ULRB 1WYXA 2YT6A 4ZN3A 1YBYA 1QVGP 2DL3A 2L3SA 2ESWA 3MP1A 1N8RU 2V8KA 3I35A 3C12A 3GF5A 3FLGA 1WGSA 4Z8AA 3CC2T 4ANJA 4J7FA 2BZ8A 3LYIA 4J83A 3HP9A 2VASA 3PMTA 2HD0A 3M0UA 2FEIA 4JRKA 1K73R 1KD1R 4PJMA 2C0TA 1JJ2P 2AIRB 1AOJA 5IH2A 1U06A 5LJ5j 3VKIA 2ATCB 4C0FA 1DJ7B 1VQKQ 3T9NA 1K73C 1KD1C 1JU5C 4FYVB 4MMKA 5AYFA 1FMVA 4BDYA 3ASKA 1V29B 1G2BA 2R57A 4EMGA 4M7AF 3PMIA 1KG1A 3JCMV 2EYXA 1SSHA 5FWBA 1YJ9T 2LRQA 4D8DA 4M75B 4C5EA 3SWNA 3TVTA 6AT1B 2K3XA 3JCMW 1EX4A 2NWMA 3E19A 1PHTA 2RN8A 2ABLA 1X75C 2CDTA 1D1CA 1QVGS 1VQ6A 1AT1B 1KHCA 4KRTA 5LJ3g 1NLOC 3PTAA 2JJ9A 3R6NA 3CXCS 2JS2A 2EYWA 4JDSA 4WF2A 2A28A 4HCZA 4C92B 1YITQ 1Q86R 5CCAA 2CP2A 4RTVA 4PJOE 2ROTA 1FX7A 4XU2A 2QGFB 1X2QA 1VQKA 3AHUA 1BIBA 4HXJA 3CMEQ 4M78E 2D8HA 1Q86C 1JJ2S 1LCKA 2QA4T 1OOTA 2H3JA 3OYHA 3E9FA 2QI2A 3OSSC 2QDLA 3RR6A 1B34A 4OB1B 3HRTA 4FYYB 3CCLQ 3A8GB 4LD6A 4D6WA 3OQ5A 2JT4A 2X3WD 4V2SA 1NPRA 2VKNA 4JPBW 1D0XA 5GMKj 1E6HA 1N6AA 3MJXA 3JB9D 1M5Q1 1Z9ZA 5J3BA 3OY9A 1NJIR 3TREA 3S3OA 3FRNA 5GAMd 2X3XD 3FJ5A 3PIOA 1YITA 3PIPA 1KK7A 2JNGA 1UFFA 4OMLA 2RM4A 1NJIC 3EG0A 3OMGA 4XU0A 3V8LA 1YJNQ 1VQ8T 3DB4A 3HL8A 1PSEA 1MMNA 3CMEA 2BUDA 1BI2A 1BU1A 3UA7A 5LJ5g 4E7SA 3UF4A 1RI9A 3J80E 2O4XB 3A98A 4J6YA 4RTYA 3OYYA 4JRIA 5J26A 2ENMA 4IIMA 1M3CA 2CZ7B 2LNVA 3I56T 2JMAA 2K3YA 3CCLA 3EH1A 5FRNA 1UB4A 5GAN3 3MEUA 4R56A 3JCMJ 1VQNQ 2RJCA 1SHFA 1VQPA 1VQ6T 3VS3A 2B8AA 4XTVA 4AFQC 2HSEB 1W4SA 1OZ3A 3A8LB 4M75A 4RTTA 4HT8A 2EPDA 2ZZDA 1YJNA 4EPCA 2ZAEA 1NZ9A 2JM8A 5CQYA 5LL6S 2GFUA 1GL5A 1K9MR 3EG3A 1RAAB 2QQAA 3LGLA 3RKWA 1M1KR 2I2LA 4ZGDB 3DKMA 2VUBA 2KGTA 4OGCA 2J6FA 3GNFB 2CUBA 1G3SA 2DXUA 1M1KC 3CC4Q 1RAGB 2LDMA 4C92A 2K3BA 5KE2A 5KYWB 3JCMX 1YI2T 2DK3A 1J3TA 4QW2A 4FSXA 1VQ9A 2EVRA 3CCRT 1VQNA 1X43A 2LX9A 2ECZA 3NMZC 3FC3A 4O6JA 2FZCB 4EMHA 3VUBA 1QWEA 4BY6C 3JCMP 2OTJA 3EGDB 3L2VA 2P0KA 1Y0MA 1W2BP 4LNPA 3HSBA 4HKEA 2JZ2A 3IQLA 3DLMA 1SRMA 1KC8U 2CP6A 1AWXA 1ZSGA 3OS5A 1U8RA 5DLOA 2LQKA 4ORZA 3OYFA 1YITT 3LLRA 1VQ5Q 2RJFA 1UHFA 3MCAB 1BI0A 2EKHA 2LCLA 2QEXT 3CMET 1WI7A 1X6GA 4DBFA 3CC4A 3ER0A 2LT1A 2EYQA 4C8QG 2DA9A 3FIFA 2YSQA 2DMOA 1T3LA 2ZPIB 4KT0E 1Q7YC 3OS2A 2NUZA 2DZ9A 3CCVQ 4M77D 3CCLT 3OYDA 1RABB 1ZUYA 2O01E 2DL8A 2LX7A 4DOVA 1CSKA 4J8OA 5CKBA 2O4XA 2MMPA 1OX8A 3BW1A 1ZSZB 3OYCA 1VQPT 2YRVA 3PE0A 2E3HA
chains in the Genus database with same CATH topology
2L8DA 5CR2A 4OF1A 2XK0A 4OB3B 5LJ3h 3WVDB 2KK4A 3MEAA 1QVGA 2BKDN 5CKHA 4EMKB 1M90U 2V8JA 3J7AF 1W2BS 3PFSA 1P92A 3MO8A 1LJOA 4HA8A 3QYHB 4OB2B 4C0ZA 1VQ5A 3LH0A 3RMSA 1QVFS 4MDXA 5D6WA 1BYMA 1LNXA 3CXCA 3KBGA 4X34A 1I4K1 2JTFA 3QZ9B 4RG8A 4C8QF 5GMKi 3P8DA 1VQ8A 4M7DE 4E47A 3HPWA 3E9GA 3GPLA 1M1GA 3EAEA 3OW2S 4ME7A 4BE2A 4BE0A 2X35A 4GY5A 4C92G 1WQWA 4ZTFA 1LOJA 4M7AA 5GAN8 5D6YA 2E12A 3M4GA 4NS5A 1YJWT 2F69A 1NE8A 2WSEE 4BI3A 2ZCFB 2D0QB 5HK3A 1Y96B 3SB2A 5KCOA 5I2SA 5A0GA 3CCST 4ZTJA 2L3RA 3NTHA 2EKOA 2RO0A 3KUFA 3ZEHA 2QQRA 2VGNA 1JJ2A 2D6FA 2XI9A 1UGSB 4M7DF 1N27A 4IURA 2DD4A 2LC4A 4C0DC 1OI1A 3I56A 1VQ7A 2D9TA 1VQKT 1VQ9T 3JB9I 1M9SA 2V8IA 2K5FA 4M75F 1BI1A 1ZBXA 2WSCE 5GMKm 1VQNT 4M7AC 4BD3A 5GMKe 3RERA 1H3ZA 2GFAA 2JN0A 2WSFE 4X9DA 4C92E 2VXEA 3L2QA 3SWNB 4C5GA 4RMOA 2EAYA 2ZPBB 3JAME 3PNWC 2OTJT 1WJSA 2YHTA 4LDWA 1QP3A 1GXIE 4XTXA 2RHXA 3M56A 3JCMQ 4EDUA 3LWHA 4DA4A 4C8QD 5GANd 3M53A 4QQ6A 4GLKA 4DQ2A 5GAMj 2HQEA 3OYNA 2HQXA 3KXTA 1BIAA 1G3TA 2QTXA 5KE3A 4IUQA 4F7UG 4HCCA 2HBPA 1XTDA 2CZ1B 2DXTA 3I55A 3JB9H 5HKCA 3URGA 2RK2A 2X4YA 4C92F 3QIIA 3X24B 4FL6A 5GANf 4OB0B 2R5AA 5GAOq 3HHTB 2DIGA 5GAN6 3X26B 4PNOA 3P8HA 2E10A 2A7YA 2E64A 4M77F 3CC7A 3META 3BDLA 4PKCC 5GANh 3UPUA 3FB9A 2F5KA 5LJ3j 2OTLT 3HKSA 3TU4K 1KQSA 4M7DD 4Z02A 5LJ5f 2Y4XA 2PQWA 3TCJA 3UT1A 3DB3A 3A8OB 3N5BB 4MZPA 4J6XA 2DJZA 4PJOA 4R55A 3VYGA 2PVOB 3V8JA 1D3BB 5CAIA 2QQBA 4FT4A 2P0QA 4F7UE 3OYIA 4IUUA 4A54A 5LJ5h 2RH2A 3M4YA 5FLXE 5CKFA 2FYKA 2DEQA 3OA6A 4IUPA 4M78A 5L8RE 3OS1A 4A53A 1S72A 3BDUA 4N4GA 4XTUA 3PGGA 1HK9A 1B34B 2RA2A 1YI2A 3WXMB 3OYAA 4N0AA 1MGQA 1RL2A 3MEWA 3CCRA 3QJ6A 3OYBA 3GP8A 1QVPA 5FU7B 4PJOC 2VGMA 1WPYA 3CCQA 2QQSA 3QJYA 2LVMA 5KCHA 3CBOA 3C95A 1XNIA 4XK8E 1WJRA 4B9XA 1HXDA 1QW1A 4F7UF 4E7IA 1VQ4A 1Q82C 4C92D 4RKUE 4YTLA 3L1AA 4M78C 4L59A 2KAFA 2PU9B 1N8RC 4NOYA 1QP2A 3V7CA 3WVEB 3ZBDA 1KHIA 4ZGJB 1UEBA 1H641 2A3LA 4LDUA 3MP8A 4PLLA 1ZHIA 4N0AC 3INZA 3OB9A 4XAXB 3M54A 2E65A 3FEOA 3V7SA 2X4WA 2LQ8A 5FU7C 2IG0A 4ZN3A 1YBYA 2ZPFB 1VQ5T 3QSUA 5CIUA 2EJGA 2FB7A 2MI6A 1Q82U 2RK1A 3O8VA 3JCMg 5GAOm 4M7AG 1VQMT 1Q7YU 2PVGB 3SDZA 3MP1A 3OYEA 1N8RU 2V8KA 2CZ0B 3C12A 4BUGA 3GF5A 1IZ6A 3M59A 3FLGA 2QEXA 1WGSA 5CK9A 4EMKA 1WNLA 2R5MA 1VIEA 4N4HA 1M8VA 3CC2T 3HFNA 4OMFB 4J7FA 1Q81C 1YJNT 3LYIA 2EFIA 5GAOr 4XTYA 3G6EA 4J83A 2EJ9A 3HP9A 3RMQA 3OYMA 3PMTA 2HD0A 2M0OA 5GANj 4KUDK 5GAMe 1BKBA 4BI4A 4BB7A 4FIBA 4JRKA 3NFCA 4OP0A 2F5TX 4XTZA 2DIQA 3RKYA 4M7AE 1M1FA 1VQLA 2M9UA 3OYGA 1VQ7T 2YLCA 2JOYA 1SSFA 5LJ5j 4EMKC 3VKIA 5C6SA 4C0FA 5HK0A 3JB9G 4JJNK 1DJ7B 3L42A 3T9NA 1Y96A 1K73C 5LJ3e 1KD1C 5AYFA 3CCVA 4MMKA 4FU6A 3RIRA 1I5LA 4BDYA 2EWNA 3ASKA 4J6WA 2XD0A 1V29B 4MZTA 2RHUA 2R57A 1G3YA 2EQKA 3OYKA 2QQ9A 4EMGA 4M7AF 3PMIA 1KG1A 4HCBA 5GAMg 3CEYA 3JCMV 2XDDA 3GIBA 4M7DB 1JBMA 3CCEA 2XICA 1YJ9T 2LRQA 4RG2A 4M75B 5FRMA 4C5EA 4MMLA 3VYHB 3SWNA 3BY7A 2K3XA 2DAQA 3JCMW 1K73U 2KDSA 3E19A 5A2QE 1KD1U 1G5VA 4PJOG 3M5AA 1X75C 5FU6B 4Q5WA 4A4KA 1QVGS 1VQ6A 4MDWA 1FXXA 1KHCA 3G71A 3MEVA 2KY9A 4LDVA 5LJ3g 3QDRB 5GMKl 3PTAA 4M78G 2KSSA 1FWZA 1X6OA 2RB6A 3CXCS 3M58A 1UGPB 2G3RA 3UWNA 3E1SA 3V7RA 4MZMA 1YHQT 3LX7A 1YJWA 4M75C 4PLIA 1K9MC 2RJDA 3SWNC 5KH6A 4JDSA 1AHJB 2DPPB 4WF2A 4CRIA 4BE1A 2Y90A 4ATOA 4HCZA 3PT9A 3JCMc 4C92B 3JB9F 4FT2A 1S72T 3C4SA 5CCAA 1K8AC 5FU6C 3JCMd 4PJOE 3C94A 3GLXA 4M77B 1FX7A 1X01A 4OVAA 4XU2A 1IREB 1O9SA 2ZGWA 4UC4A 1VQKA 3R6OA 2GQVA 2DTIA 3L2UA 3F70A 2E5QA 1BIBA 3CC4T 3AHUA 4M7AD 1YCYA 1M4ZA 1JB0E 4ZGEB 3VUZA 3CCUA 1KC8C 1D3BA 1Y71A 4M78E 3EFRA 1Q86C 1Y7XA 1KQ1A 2DD5A 2JTMA 2RHYA 1JJ2S 5DY9A 4A4EA 2QA4T 4E7LA 2XDBA 2KVQG 2CZ6B 2H3JA 2K5LA 2OAUA 2QDYB 3QPHA 3OYHA 3E9FA 2QI2A 3OSSC 4VUBA 5C0MA 3A8HB 1B34A 2VV5A 4OB1B 4PJOF 4M77C 2DVEA 3HRTA 4E7HA 4RCCA 4JS5A 2R58A 3JCMe 2DTHA 3VV0A 2EQMA 3G4SA 3A8GB 2PUOB 4LD6A 2EQUA 5CKEA 3RKXA 4D6WA 2WACA 3OQ5A 2C06A 5CKDA 4M78F 1Q86U 5HY6A 4V2SA 1NPRA 4FM4B 1Y07A 2JUFA 1W2BA 4F7UB 3OSVA 5GMKj 3JB9J 3CD6A 1N6AA 1UGQB 4KULA 5LJ5e 3JB9D 1M5Q1 5J3BA 3OY9A 5A0LA 2KMTA 2OTLA 2DKGA 3OYLA 3OS0A 3CMAA 4PL6A 4KBMB 4Y91A 3TREA 3S3OA 2E41A 3LWIA 5A0DA 3FRNA 1YIJA 1BI3A 1RI0A 5GAMd 3JSCA 3PIOA 1YITA 3PIPA 4JS4A 2JNGA 3G6ET 2QXFA 2RD1A 1XQHA 2RM4A 1KQSS 2MF2A 2K5IA 1NJIC 3OMGA 4IUVA 4DOWA 4XU0A 3V8LA 2P0PA 4A4HA 5GANg 3L2WA 1VQOA 1VQ8T 3DB4A 3NTKA 4LDYA 3HL8A 2CYZB 1PSEA 1VQLT 2E70A 5CO7A 2BUDA 3CMEA 2DTOA 4TVRA 5D6XA 4PJOD 4C5IA 3OYJA 5LJ3d 4LDXA 2CKKA 1BI2A 5LJ5g 5GAN4 4JRPA 1VUBA 3QG1A 1OZ2A 2PVDB 3TEEA 2O4XB 3J80E 2MWOA 2RHZA 4J6YA 3QO3A 3CCVT 4M78D 4J7IA 3CCMA 3Q1JA 4BI8B 5EG2A 4P5NA 1NJIU 2PUKB 2YLBA 3OYYA 4JRIA 1PSFA 5CQXA 5J26A 3RUXA 4M75G 3CPFA 2DXBA 2AHJB 4OGEA 4C8QB 2CZ7B 2LNVA 3I56T 2K3YA 2L5QA 3CCLA 3SD4A 5FRNA 3X25B 1UB4A 2VC8A 4QVDA 5GAN3 3CCET 4QQGA 1O75A 3MEUA 2VXFA 1NPPA 4R56A 1Q81U 3L2RA 3JCMJ 3J81E 2ZPEB 2M1HA 3OBYA 3QXEB 1WQ7A 5GAN5 3CCJA 2K4YA 2RJEA 3L2ZA 2RJCA 4LD9K 2EIFA 1VQMA 1VQPA 1VQ6T 4Y28E 2B8AA 4XTVA 5GMKh 2X4XA 4C0DB 3H8ZA 4C8QC 3G71T 2P4TA 1TH7A 2ZPGB 4KUIA 4M75E 5I2MA 4IUTA 1JRIA 4M7DA 1OYXA 1W4SA 3CBPA 1XOVA 2MWPA 4M7AB 3V8KA 3I55T 1KQ2A 4CI0C 3QZ5B 1OZ3A 3S3MA 3A8LB 4M75A 3CC2A 4HT8A 2ZZDA 4M77G 1YJNA 1EIFA 4EPCA 3QKJA 3UDCA 1NZ9A 5CQYA 5LL6S 2GFUA 4QVZA 2FL7A 2L89A 3LGLA 2QQAA 5J39A 2LCCA 3RKWA 3CC7T 3NTIA 2I2LA 1I81A 3MHXA 3DKMA 2VUBA 4ZGDB 4OGCA 2RI2A 3OBWA 2LT4A 3ME9A 4M7DC 3QBYA 3QYGB 4E7KA 3BFMA 4JUVA 3GNFB 3M55A 2E6ZA 4B9WA 3CCUT 4JLIA 1G3SA 2DXUA 1M1KC 4JLGA 4BY6B 3CCSA 2JVVA 1G3WA 4XTWA 2LDMA 3X28B 1UGRB 1ZQ1A 2DO3A 5CVIA 4M77E 3S6WA 4C0GA 4C92A 5KE2A 2M16A 3CBMA 3LGFA 3SFMA 5IAYA 3JCMX 1YI2T 2DK3A 4M77A 2K2VA 5FROA 4QW2A 4FSXA 3JCMb 4A4GA 1R8OB 2XIDA 1VQ9A 4ZN1A 2X4JA 3CCRT 4JRQA 1WJQA 3X20B 1VQNA 2LX9A 4ELYC 2EJFA 3EFSA 3FDRA 3A8MB 3RESA 2XKOC 2FHDA 3A5ZB 3G4ST 3CCQT 2GCXA 3S3NA 3FC3A 1YJ9A 4O6JA 1K9MU 4EMHA 2K57A 3JCMf 5IT9E 3VUBA 5LJ5d 3CPWA 1VQ4T 2XDPA 2Y4YA 4IKFA 1M1KU 3FJPA 3HRSA 4BY6C 2KQWA 3M57A 4A4FA 4QVCA 4BACA 4C92C 4XU3A 3JCMP 2NLUA 3QUIA 3L2VA 2P0KA 3GOXA 1K8AU 3CD6T 3JCMh 4II1A 2XHCA 3GNGA 3HSBA 2OTJA 4HKEA 5DLQE 4L6V5 1N9SA 2JZ2A 2MAMA 4XU1A 3CMAT 3DLMA 5GANe 4PJOB 2DZCA 5I21A 1KC8U 2HNIA 1U1TA 4NL2A 1YIJT 3OS5A 4M75D 1U8RA 1YHQA 5DLOA 4N4IA 4RCBA 1I8FA 2LQKA 5GAOp 3OYFA 1YITT 3LLRA 3MP6A 2LTOA 4XQ3A 2RJFA 5IN1A 4M78B 4F7UA 1QVFA 1VQOT 2HAXA 3MCAB 1BI0A 2XG8D 2LCLA 2QEXT 3CMET 5GAOn 3ZFJA 4C5HA 2VYTA 3CC4A 3ER0A 2LT1A 3OW2A 3VJPA 2EYQA 4C8QG 5GAN2 3FIFA 2BIVA 2IVWA 2CS7A 3LW5E 2EQJA 4O5VA 2QA4A 3CCMT 2ZPIB 4KT0E 1Q7YC 3OS2A 1VIFA 2DXCA 2GF7A 3HFOA 3P8BB 3JRZA 2DZ9A 3H6ZA 5GAMf 4M77D 3CCLT 4J5YA 5M9OA 3DLLA 3OYDA 2O01E 2FVUA 2CGHA 3HRUA 4HT9A 3CPWS 2E1HA 1M90C 3G7ZA 4DOVA 5GAMh 4BDZA 4ELZC 2E6NA 1N9RA 2RI5A 4J8OA 4QQDA 1MHNA 5CKBA 2O4XA 5DM7R 3OMCA 3QHSA 2ZPHB 2MMPA 3M9QA 5GAOl 4M7DG 4C8QE 2RHIA 4L5GA 3CCJT 1U1SA 4E7JA 2XU8A 3BW1A 4X9CA 3OYCA 1VQPT 5LJ3f 2RI3A 2YRVA 4C8QA 5GAN7 4NL3A 3VU3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRE B;  4OB3 B;  4RKU E;  3WVD B;  2PU9 B;  4ZGE B;  1JB0 E;  4ZGD B;  1QP2 A;  4OB2 B;  3QYH B;  3WVE B;  4ZGJ B;  2DD5 A;  3QYG B;  2CZ6 B;  3QZ9 B;  2QDY B;  2ZPF B;  3A8H B;  4OB1 B;  3X28 B;  1UGR B;  2PVG B;  3A8G B;  2PUO B;  2WSE E;  2CZ0 B;  2ZCF B;  2D0Q B;  4FM4 B;  3X20 B;  3A8M B;  1UGQ B;  1UGS B;  2DD4 A;  2WSC E;  2WSF E;  4L6V 5;  2ZPB B;  1QP3 A;  1GXI E;  1DJ7 B;  2CYZ B;  1PSE A;  2CZ1 B;  1V29 B;  2PVD B;  3X24 B;  4OB0 B;  3HHT B;  3X26 B;  2PUK B;  1PSF A;  2DXB A;  2AHJ B;  3VYH B;  2CZ7 B;  3LW5 E;  3X25 B;  2ZPI B;  4KT0 E;  3A8O B;  3VYG A;  2PVO B;  2DXC A;  2ZPE B;  2O01 E;  3QXE B;  5L8R E;  1UGP B;  4Y28 E;  1AHJ B;  2ZPG B;  2DPP B;  2ZPH B;  3QZ5 B;  3A8L B;  2ZZD A;  4XK8 E; 
#chains in the Genus database with same CATH topology
 5CR2 A;  1WXT A;  2XK0 A;  4OB3 B;  5LJ3 h;  2MYS A;  1M90 U;  2V8J A;  1W2B S;  1LJO A;  4OB2 B;  1VQ5 A;  3LH0 A;  3RMS A;  1K0S A;  1LNX A;  2J6K A;  4OMQ A;  1M3B A;  4X34 A;  3P8D A;  2RPN A;  4HVW A;  4AFZ C;  2V26 A;  2X9H A;  4ME7 A;  4BE2 A;  4GY5 A;  4C92 G;  1I07 A;  1WDX A;  4EIK A;  2EW3 A;  1YJW T;  4BI3 A;  2YUO A;  2ZCF B;  2D0Q B;  5A0G A;  3VS4 A;  1SRL A;  1GFC A;  2VGN A;  1U5S A;  4AMC A;  4M7D F;  1N27 A;  1OPL A;  1VQ9 T;  3JB9 I;  2V8I A;  1VQN T;  2K5F A;  4Z89 A;  4M7A C;  5GMK e;  3RER A;  1H3Z A;  2GFA A;  2JN0 A;  3PVQ A;  2LJ1 A;  1HJD A;  3PNW C;  2OTJ T;  1WJS A;  2MOX A;  3D7S B;  4JZ3 A;  1NM7 A;  5KYW A;  4XTX A;  3VS2 A;  4DQ2 A;  1BIA A;  1G3T A;  5KE3 A;  4IUQ A;  1MUZ A;  1QKX A;  2DXT A;  2RK2 A;  2DRK A;  3QII A;  1QCO A;  2R5A A;  3JV3 A;  1X27 A;  3EGD A;  3P8H A;  2J06 A;  3MET A;  3BDL A;  3UPU A;  2HSP A;  4J9B A;  3HKS A;  1KQS A;  2DM1 A;  2PQW A;  3UT1 A;  3N5B B;  3SHW A;  4R55 A;  2PVO B;  2QQB A;  4FT4 A;  5LJ5 h;  2FYK A;  2DEQ A;  1IXD A;  3I9Q A;  4OMO A;  2RA2 A;  4N0A A;  2HBW A;  2YUN A;  4FW1 A;  4PFO A;  5FU7 B;  1SHG A;  4E7I A;  4F7U F;  1HXD A;  3L1A A;  4L59 A;  4ZGJ B;  2E65 A;  5ECA A;  2FZG B;  2LQ8 A;  2IG0 A;  1VQ5 T;  1I1J A;  5CIU A;  3CCE Q;  2MI6 A;  1Q82 U;  2KRM A;  2RK1 A;  5GAO m;  1Q81 R;  1VQM T;  2QAZ A;  1ZSZ A;  1IZ6 A;  1PWT A;  1M8V A;  4OMF B;  1Q81 C;  2EFI A;  3RMQ A;  2EJ9 A;  3OYM A;  5GAM e;  5IHI A;  4FIB A;  2RQT A;  2F5T X;  5KYY B;  2OI3 A;  3RKY A;  4M7A E;  1VQL A;  2M9U A;  2YLC A;  2PTK A;  2E5K A;  3U23 A;  4EMK C;  1K1Z A;  1AWW A;  3JB9 G;  4JJN K;  3CCU Q;  4E2F B;  3RIR A;  2MPX C;  1I5L A;  2KEA A;  1K76 A;  2YRD A;  4MZT A;  2EQK A;  1WHG A;  3CCE A;  1AD5 A;  2XIC A;  4AT1 B;  4MML A;  3G4S Q;  3BY7 A;  1G5V A;  2DAQ A;  1K73 U;  1KD1 U;  2KDS A;  5FU6 B;  1AVZ C;  1EFN A;  1FXX A;  3MEV A;  2KY9 A;  4LDV A;  2YUP A;  3QDR B;  5GMK l;  1D1B A;  2MK5 A;  3M58 A;  2G3R A;  1YHQ T;  3E1S A;  1BCM A;  4M75 C;  1AHJ B;  2GTO A;  4CRI A;  3GBQ A;  4FT2 A;  1K8A C;  2EQI A;  3JCM d;  1GCQ C;  2BE7 D;  4OVA A;  4UC4 A;  1VOM A;  4A63 B;  2E5Q A;  1M2V B;  4FSS A;  2COZ A;  1VA7 A;  1M4Z A;  2CP0 A;  2CUD A;  2K9G A;  3VUZ A;  3CCU A;  1RAE B;  3EFR A;  2DD5 A;  4A4E A;  1TS9 A;  2XDB A;  2CP3 A;  2K5L A;  1FYN A;  4RTZ A;  1NYG A;  3UAT A;  2AKK A;  5C0M A;  1JXM A;  4E7H A;  2R58 A;  2MCN A;  3G4S A;  5FW9 A;  4RUG A;  1X2K A;  1Q86 U;  4HVU A;  2QG9 B;  2CP7 A;  5HY6 A;  2COW A;  1B7T A;  2KT8 A;  4KUL A;  4J9H A;  2LNH B;  2LMJ A;  3OYL A;  3OS0 A;  4PL6 A;  4Y91 A;  2A08 A;  3LWI A;  1RI0 A;  2IPO B;  4RTX A;  4HCK A;  3CXC P;  2MF2 A;  2K5I A;  4A4H A;  2VWF A;  5EC7 A;  2DER A;  1VQL T;  4CC3 A;  2DTO A;  4TVR A;  5D6X A;  4PJO D;  3OYJ A;  2B86 A;  1KIK A;  1PKT A;  5GAN 4;  4JRP A;  2PVD B;  3TEE A;  2MWO A;  4M78 D;  3H0F A;  2HEQ A;  4E6R A;  3CCM A;  1JQQ A;  4BI8 B;  1NJI U;  2PUK B;  2DXB A;  4C8Q B;  5KYY A;  2KRS A;  2L5Q A;  1PRM C;  3CCE T;  1NPP A;  4LN2 A;  2E4H A;  3QXE B;  1NEG A;  1WQ7 A;  5GAN 5;  2K4Y A;  2RJE A;  4LD9 K;  1W6X A;  2EIF A;  1WZO A;  2JXB A;  2GTJ A;  1T0H A;  4KUI A;  4M75 E;  1PC0 A;  1JRI A;  2YUQ A;  5HCK A;  3V8K A;  2RQR A;  3I55 T;  4CI0 C;  4M77 G;  1AWJ A;  1R0C B;  2FZK B;  3MHX A;  2LT4 A;  1S72 Q;  4M7D C;  3QBY A;  3QYG B;  4E7K A;  2C0I A;  3M55 A;  3CCU T;  2JVV A;  2DO3 A;  4AG1 C;  3REB B;  2M16 A;  3CBM A;  3LGF A;  1I5O B;  1BCO A;  1PD0 A;  5FRO A;  4A4G A;  1R8O B;  9ATC B;  2ED0 A;  1M2V A;  3FDR A;  1YP5 A;  1ZUU A;  3G4S T;  3S3N A;  2XKO C;  2FHD A;  1K9M U;  2K57 A;  1VQ4 T;  2XDP A;  2GBQ A;  1M1K U;  4A4F A;  4II1 A;  1XJW B;  1KSW A;  3EGU A;  2L2P A;  4PJO B;  2KYB A;  1WHM A;  1RAF B;  4WCI A;  4RCB A;  1I8F A;  3MP6 A;  1RAD B;  1ZA2 B;  2LTO A;  4XQ3 A;  4M78 B;  1QVF A;  3H0H A;  2M02 A;  2P4R A;  2XG8 D;  1UEC A;  3ZFJ A;  1WLP B;  2CT4 A;  3OW2 A;  3VJP A;  1NEB A;  3C0C A;  2BIV A;  2EQJ A;  3CCM T;  3HTR A;  1VIF A;  3P8B B;  2DXC A;  2GF7 A;  3I5R A;  5GAM f;  4J5Y A;  2CGH A;  4BDZ A;  2BZY A;  1VQ7 Q;  1V76 A;  2KT1 A;  2RI5 A;  4RTU A;  5DM7 R;  3QHS A;  3M9Q A;  2DJQ A;  2RHI A;  4L5G A;  2RQU A;  2HL5 C;  4C8Q A;  4R0K A;  4NL3 A;  3VU3 C;  4OF1 A;  1D1A A;  2CRE A;  3J7A F;  3QYH B;  4C0Z A;  1QVF S;  1MMD A;  1VYU A;  1X6B A;  5D6W A;  3ZL7 C;  3KFV A;  3KBG A;  1M30 A;  1I4K 1;  1SG5 A;  4C8Q F;  4B6M A;  4M7D E;  3HPW A;  3REA B;  1GCP A;  1M1G A;  1W70 A;  3OW2 S;  1TTH B;  3CC7 Q;  5D6Y A;  2BE9 B;  2WSE E;  3SB2 A;  1IHW A;  4Z88 A;  5I2S A;  4ZTJ A;  5KYN A;  1IGQ A;  3KUF A;  2O9S A;  1LVK A;  2XI9 A;  2M0Y A;  4C0D C;  1VQ7 A;  2D9T A;  1VQK T;  3G1J A;  3EG9 B;  4M75 F;  1BI1 A;  2WSC E;  4KGZ B;  5IXF A;  2WSF E;  1ZBJ A;  2DL5 A;  4RMO A;  3JAM E;  3CCQ Q;  3MKD A;  2YHT A;  1QP3 A;  1GXI E;  3M56 A;  1Q95 G;  3JCM Q;  1V1C A;  4QQ6 A;  5GAM j;  1VYV A;  2HQX A;  1IHV A;  2OJ2 A;  2X51 A;  1OU8 A;  1XTD A;  4KH0 B;  3CMA Q;  4C92 F;  1UJY A;  3X24 B;  4FL6 A;  4LXC A;  4OB0 B;  3HHT B;  1YIJ Q;  1QCN A;  3CC7 A;  2HQH A;  2DLP A;  4PKC C;  1KJW A;  2Y4X A;  3O5Z A;  4PJO A;  2L3P A;  4J6X A;  4JJD A;  3V8J A;  3VYG A;  1D3B B;  1QQJ A;  2P0Q A;  4F7U E;  2E3I A;  2RH2 A;  2DIL A;  4M78 A;  5L8R E;  4A53 A;  3G6E Q;  4N4G A;  4DBQ A;  1HK9 A;  1Q7Y R;  4J9E A;  1C0M A;  1MGQ A;  3MEW A;  3OYB A;  3GP8 A;  3VS0 A;  2VGM A;  1WPY A;  3CCQ A;  2QQS A;  4B9X A;  1YN8 A;  4RKU E;  2KAF A;  2PU9 B;  1UE9 A;  4F04 B;  3WVE B;  1H64 1;  4PLL A;  2JM9 A;  3OB9 A;  4XAX B;  1JO8 A;  3FEO A;  2CH4 A;  5FU7 C;  2CSQ A;  2ZPF B;  2EJG A;  2FRY A;  3O8V A;  3M0S A;  2CZ0 B;  4BUG A;  4M4Z A;  4QKU A;  2KI7 A;  2ED1 A;  2R5M A;  1YWO A;  2F2X A;  1VIE A;  4N4H A;  5IXB A;  3HFN A;  1YJN T;  1UG1 A;  3G6E A;  1UGV A;  4X1V A;  4KUD K;  4BI4 A;  4BB7 A;  4DBH A;  3MPU B;  3NFC A;  4OP0 A;  3NPF A;  3CCS Q;  3OYG A;  1VQ7 T;  1JEG A;  2JOY A;  1LPL A;  2YXY A;  1SSF A;  1ZA1 B;  5C6S A;  2QAS A;  5HK0 A;  3M0R A;  3L42 A;  3CCV A;  4KGV B;  4FU6 A;  4J9I A;  2DE0 X;  4ZNX A;  2XD0 A;  2RHU A;  3OYK A;  2QQ9 A;  4LE9 A;  1RAI B;  3EG9 A;  2A37 A;  5GAM g;  3GIB A;  4RG2 A;  2JTE A;  1SKU B;  5FRM A;  3VYH B;  1SF9 A;  1R77 A;  5A2Q E;  4PJO G;  1D0Y A;  3EH2 A;  3M5A A;  4Q5W A;  4MDW A;  2LJ3 A;  1RAH B;  3CD6 Q;  4M78 G;  2KSS A;  1FWZ A;  1X6O A;  2V1R A;  2OTL Q;  3V7R A;  1IB8 A;  2O31 A;  1MMG A;  3SWN C;  2DPP B;  1KC8 R;  3JB9 F;  3C4S A;  5FU6 C;  4M77 B;  1X01 A;  1O9S A;  2ZGW A;  2GQV A;  3L2U A;  3F70 A;  3CC4 T;  4M7A D;  1KC8 C;  1MND A;  1D3B A;  1Y71 A;  4PFP A;  2RHY A;  1KQ1 A;  5DY9 A;  2CZ6 B;  2OAU A;  2QDY B;  3QPH A;  3H9N A;  2VV5 A;  2DVE A;  4RCC A;  4JS5 A;  5CKE A;  1TUG B;  3RKX A;  2WAC A;  2C06 A;  3EFO B;  1Z9Q A;  1GRI A;  4FM4 B;  5GJW B;  1R0B G;  1ACM B;  3OSV A;  3CD6 A;  1H92 A;  2CP5 A;  5A0L A;  3CCJ Q;  2OTL A;  4HVV A;  3AT1 B;  1U3O A;  5A0D A;  2V1Q A;  1BI3 A;  3JSC A;  3G6E T;  3RDV A;  2QXF A;  1MNE A;  1KQS S;  3CC2 Q;  4IUV A;  4DOW A;  3L2W A;  1TOV A;  3NTK A;  1FMK A;  2E70 A;  5CO7 A;  2P84 A;  4C5I A;  5LJ3 d;  2CKK A;  1JXO A;  2XMF A;  2A0F B;  1UTI A;  1VUB A;  3QG1 A;  4CC2 A;  3CCV T;  3Q1J A;  4P5N A;  1QKW A;  5CQX A;  2D0N A;  1HSQ A;  3CPF A;  4OGE A;  2LJ0 A;  2AZV A;  3SD4 A;  2LZ6 B;  2QK0 A;  2W10 A;  3J81 E;  1RLP C;  1PCX A;  2ZPE B;  1TUD A;  2M1H A;  1YJ9 Q;  2HL3 A;  8AT1 B;  3CCJ A;  3VS1 A;  3L2Z A;  4Y28 E;  5GMK h;  4C8Q C;  2LP5 A;  1GBR A;  2ZPG B;  1TH7 A;  5I2M A;  1OV3 A;  4OMP A;  1OYX A;  3CBP A;  1XOV A;  2MWP A;  4M7A B;  1W1F A;  3UA6 A;  1KQ2 A;  2RNA A;  3CC2 A;  4QVZ A;  2FL7 A;  5J39 A;  2DVJ A;  2DFU A;  3EHQ A;  2RI2 A;  1K8A R;  2EYY A;  3BFM A;  1WHL A;  4JJB A;  1OX9 A;  1HYO A;  4XTW A;  1ZQ1 A;  5CVI A;  2D1X A;  2QA4 Q;  4M77 A;  2K2V A;  3JCM b;  2XID A;  2X4J A;  1WJQ A;  1WXB A;  1YJ9 A;  1UDL A;  1YCS B;  3JCM f;  5LJ5 d;  3CPW A;  2HKN A;  2KQW A;  4QVC A;  4C92 C;  4XU3 A;  3QUI A;  3GOX A;  3CD6 T;  4QT7 A;  2XHC A;  3M0T A;  4XU1 A;  5I21 A;  1AZE A;  1U1T A;  1PG5 B;  4M75 D;  2J6O A;  2OAW A;  2DRM A;  4N4I A;  3EFO A;  5GAO p;  2FG0 A;  2HAX A;  1A0N B;  3M0Q A;  3VS5 A;  5GAO n;  1VQ8 Q;  2VYT A;  2DX1 A;  3EHR A;  1TWB A;  3LW5 E;  2ROL A;  2QA4 A;  3H6Z A;  2SEM A;  1M2O A;  2HMA A;  5I22 A;  1QLY A;  2FVU A;  3CPW S;  2E1H A;  2W0Z A;  5GAM h;  3I56 Q;  4ELZ C;  1N9R A;  1QMC A;  3OMC A;  2ZPH B;  4C8Q E;  3CCJ T;  4E7J A;  4X9C A;  4IIO A;  2YDL A;  2RI3 A;  4PJL A;  1HD3 A;  1OPK A;  1E7O A;  3WVD B;  2I0N A;  2KK4 A;  1QVG A;  5CKH A;  4EMK B;  1VQ6 Q;  2AK5 A;  3MO8 A;  1B3Q A;  2G6F X;  1PNJ A;  3CXC A;  3QWX X;  3QZ9 B;  5GMK i;  2JMC A;  1VQ8 A;  4E47 A;  1BK2 A;  1ZX6 A;  4RTW A;  3GPL A;  3EAE A;  4BE0 A;  2X35 A;  4J9C A;  1WQW A;  4ZTF A;  4M7A A;  2E12 A;  4NS5 A;  1WXU A;  5HK3 A;  1Y96 B;  2DET A;  5KCO A;  4FYX B;  2L3R A;  2QQR A;  1JJ2 A;  1MV0 B;  2D6F A;  1UGS B;  4IUR A;  2LC4 A;  3I56 A;  1M3A A;  1ZUK A;  2DL4 A;  1PKS A;  2GGR A;  1ZBX A;  1FMW A;  4BD3 A;  2EGC A;  1YI2 Q;  4X9D A;  4C92 E;  1NG2 A;  3A1P A;  3CCR Q;  1SEM A;  2EAY A;  2ZPB B;  2KYM A;  2FPE A;  2DNU A;  3LWH A;  1RUW A;  5GAN d;  3KXT A;  1ABQ A;  3VS7 A;  4JJC A;  2QTX A;  1TUC A;  2HBP A;  2CH4 W;  2EGA A;  3JB9 H;  4PJN A;  2X4Y A;  5GAN f;  3X26 B;  2A7Y A;  3E2U A;  2O2O A;  2NUT B;  1QVF P;  3TU4 K;  2IIM A;  4M7D D;  3TCJ A;  3VRY A;  4MZP A;  2QEX Q;  3OYI A;  1WHJ A;  4IUU A;  4A54 A;  4CC4 B;  3OW2 P;  3M4Y A;  3OA6 A;  4IUP A;  8ATC B;  1TG0 A;  1MMA A;  3VS6 A;  2RF0 A;  2JS0 A;  2M51 A;  3OS1 A;  1S72 A;  2GNC A;  1BB9 A;  4XTU A;  3PGG A;  1IO6 A;  1YI2 A;  3WXM B;  4K11 A;  1N8R R;  1RL2 A;  2QYZ A;  3CCR A;  1K4U S;  3QJ6 A;  1QVP A;  3QJY A;  2HCK A;  5KCH A;  3C95 A;  1XNI A;  1QW1 A;  3THK A;  2AT1 B;  1N8R C;  2K6D A;  4NOY A;  1QP2 A;  3V7C A;  3ZBD A;  1UEB A;  2A3L A;  4LDU A;  3MP8 A;  1G83 A;  1TXQ A;  4N0A C;  4PK4 A;  4CC7 A;  2FRW A;  1VQP Q;  2DBK A;  2MIO A;  2X4W A;  3V7S A;  2RMO A;  2KRN A;  3QSU A;  2COY A;  2FB7 A;  1Y57 A;  2EBP A;  3NGP A;  3JCM g;  4M7A G;  1Q7Y U;  2PVG B;  3SDZ A;  3OYE A;  2J7I A;  1X69 A;  1T3S A;  2QTV A;  3M59 A;  4FW2 A;  1D09 B;  2QEX A;  3RNJ A;  1PD1 A;  5CK9 A;  4EMK A;  1WNL A;  3G71 Q;  3QDF A;  3EG1 A;  2EYZ A;  2H8H A;  2CT3 A;  5GAO r;  4XTY A;  5D7U A;  2M0O A;  3RBB B;  5GAN j;  1BKB A;  1YJW Q;  1ZSZ C;  4XTZ A;  2DIQ A;  4LUD A;  2A36 A;  1M1F A;  1OEB A;  1ZLM A;  1GFD A;  4AFU C;  4KGX B;  1VQ9 Q;  1Y96 A;  1GBQ A;  5LJ3 e;  4F14 A;  3PVL A;  4AG2 C;  2EWN A;  4J6W A;  1G3Y A;  2OTJ Q;  1TSF A;  4HCB A;  4M7D B;  3CEY A;  2XDD A;  1JBM A;  2DBM A;  4KH1 B;  2YRC A;  2O9V A;  4DEX A;  1VYT A;  1WFW A;  1MV3 A;  3EGX B;  2O88 A;  4A4K A;  1GCQ A;  3G71 A;  7AT1 B;  2JW4 A;  2GQI A;  2F2W A;  2RB6 A;  1UGP B;  2YWW A;  3UWN A;  4MZM A;  2L3Q A;  3LX7 A;  1YJW A;  4PLI A;  1K9M C;  2RJD A;  5KH6 A;  5FWC A;  2FPD A;  4BE1 A;  4ATO A;  2Y90 A;  1BBZ A;  3PT9 A;  3JCM c;  1S72 T;  4PJJ A;  2NUT A;  3C94 A;  3GLX A;  1VQO Q;  1IRE B;  3R6O A;  2DTI A;  4J9D A;  1YCY A;  4ZGE B;  1JB0 E;  1Y7X A;  2JTM A;  2AKL A;  5AT1 B;  5L23 A;  2KRO A;  4E7L A;  2KVQ G;  1TU0 B;  1RLQ C;  4VUB A;  3A8H B;  3I5S A;  3LH5 A;  3BE3 A;  4PJO F;  4M77 C;  3JCM e;  2DTH A;  3VV0 A;  2EQM A;  2LQW A;  5KYU B;  2PUO B;  2EQU A;  4GBQ A;  5CKD A;  1NLP C;  4M78 F;  4ESR A;  1Y07 A;  2JUF A;  1W2B A;  4F7U B;  3JB9 J;  3TSZ A;  1UGQ B;  5LJ5 e;  2QGG A;  2DYI A;  1S1N A;  2KMT A;  2DKG A;  5IHK A;  3CMA A;  1VQM Q;  5I11 A;  1T0J A;  4KBM B;  2E41 A;  1YIJ A;  1K9A A;  4JS4 A;  2RD1 A;  4J9F A;  1XQH A;  4PFZ A;  5GAN g;  2KXD A;  2P0P A;  1VQO A;  2HKQ B;  4LDY A;  2CYZ B;  1ABO A;  1UUE A;  5GJV B;  4LDX A;  5KYX B;  1AEY A;  2PNI A;  1OZ2 A;  4OMM A;  2RHZ A;  1OUL A;  3QO3 A;  1WA7 A;  4J7I A;  5EG2 A;  2YLB A;  1PSF A;  3RUX A;  4M75 G;  2AHJ B;  2DEU A;  2C0O A;  2D8J A;  2DL7 A;  3X25 B;  2VC8 A;  4QVD A;  4QQG A;  1O75 A;  1YWP A;  2VXF A;  3EG2 A;  1Q81 U;  3L2R A;  3OBY A;  1OQK A;  2J05 A;  1VQM A;  1PRL C;  2X4X A;  4C0D B;  3H8Z A;  3G71 T;  2P4T A;  4IUT A;  4M7D A;  3NHN A;  4DBR A;  3QZ5 B;  1RAC B;  3S3M A;  4OMN A;  1EIF A;  3QKJ A;  3UDC A;  2PZ1 A;  2KNB B;  1E6G A;  2VB6 A;  1YHQ Q;  2L89 A;  3EGX A;  3CC7 T;  2LCC A;  3NTI A;  1I81 A;  4AFS C;  1AWO A;  2LQN A;  2K7A A;  3OBW A;  1KQS P;  3ME9 A;  1OU9 A;  4JUV A;  2BTT A;  2E6Z A;  3H41 A;  4B9W A;  2KXC A;  4JLI A;  1H3H A;  4JLG A;  1D0Z A;  4BY6 B;  3CCS A;  1C1A A;  1G3W A;  2H3E B;  3X28 B;  1UGR B;  3S6W A;  4C0G A;  4M77 E;  1SPK A;  3SFM A;  5IAY A;  1I0C A;  1NBE B;  4ZN1 A;  4JRQ A;  3X20 B;  4ELY C;  2EJF A;  3EFS A;  1N5Z A;  3A8M B;  3RES A;  3CCQ T;  3A5Z B;  2GCX A;  1QWF A;  5IT9 E;  4IKF A;  2Y4Y A;  3FJP A;  3HRS A;  3M57 A;  4BAC A;  3H0I A;  2NLU A;  2NUP B;  1K8A U;  3JCM h;  2F1L A;  3GNG A;  4J9G A;  2K79 A;  5DLQ E;  4L6V 5;  1N9S A;  3CMA T;  2MAM A;  5GAN e;  2DZC A;  2HZY A;  5KYU A;  2HNI A;  4NL2 A;  1YNZ A;  1YIJ T;  1YHQ A;  1CKA A;  1WX6 A;  5IN1 A;  2DF6 A;  4F7U A;  1VQO T;  2LCS A;  4D8K A;  1QCF A;  4C5H A;  1NYF A;  1VQL Q;  5GAN 2;  1AZG B;  1UHC A;  2IVW A;  2CS7 A;  1M90 R;  4O5V A;  3HFO A;  3JRZ A;  5M9O A;  3DLL A;  1UJ0 A;  3HRU A;  4HT9 A;  1M90 C;  1B07 A;  5KYX A;  3G7Z A;  3TSW A;  4JZ4 A;  2E6N A;  4QQD A;  1MHN A;  2BZX A;  4LUE A;  5GAO l;  4M7D G;  1U1S A;  2XU8 A;  1F1B B;  5LJ3 f;  2Z0W A;  5GAN 7;  1C6V X;  2L8D A;  2AZS A;  1YFN A;  2VVK A;  3MEA A;  2BKD N;  3PFS A;  1P92 A;  4HA8 A;  3CQT A;  4DEY A;  1BYM A;  4MDX A;  3I55 Q;  2JTF A;  4RG8 A;  2L0A A;  1IRX A;  3E9G A;  4F17 A;  1G8X A;  1M8M A;  4F16 A;  1PM3 A;  1LOJ A;  2CSI A;  5GAN 8;  2DYB A;  3M4G A;  2F69 A;  1NE8 A;  3QWY A;  1EZZ B;  3CCS T;  3NTH A;  2EKO A;  2RO0 A;  3ZEH A;  5IHN A;  2DD4 A;  2FO0 A;  1OI1 A;  1WHK A;  2F2V A;  2NYS A;  1M9S A;  2FPF A;  5GMK m;  1CKB A;  2RQV A;  2VXE A;  3L2Q A;  3SWN B;  4C5G A;  2SRC A;  3CPW P;  4E7Z A;  2OX7 A;  4LDW A;  2RHX A;  4EDU A;  4DA4 A;  1VQ4 Q;  4C8Q D;  3M53 A;  4Y92 A;  4GLK A;  1K0X A;  2HQE A;  3OYN A;  1M27 C;  2HDA A;  4F7U G;  4HCC A;  2CZ1 B;  3I55 A;  3SEM A;  4GLM A;  3TQ7 P;  5HKC A;  3URG A;  2KR3 A;  1WIE A;  5GAO q;  2DIG A;  5GAN 6;  1KFZ A;  3VRZ A;  4FCY A;  4PNO A;  2E10 A;  2E64 A;  2NUP A;  4M77 F;  1WHH A;  5GAN h;  3FB9 A;  2F5K A;  5LJ3 j;  2KBT A;  2OTL T;  2K2M A;  4Z02 A;  5LJ5 f;  3DB3 A;  3A8O B;  3M0P A;  2DJZ A;  2RQW A;  5CAI A;  5FLX E;  5CKF A;  3BDU A;  1Q82 R;  2EGE A;  1B34 B;  3CCM Q;  3OYA A;  1IGU A;  1ARK A;  4PJO C;  2LVM A;  3CBO A;  4XK8 E;  1WJR A;  1H8K A;  1VQ4 A;  1Q82 C;  4C92 D;  4YTL A;  4M78 C;  1KHI A;  2KE9 A;  1ZHI A;  3INZ A;  4FYW B;  4WTO B;  3M54 A;  3ULR B;  1WYX A;  2YT6 A;  4ZN3 A;  1YBY A;  1QVG P;  2DL3 A;  2L3S A;  2ESW A;  3MP1 A;  1N8R U;  2V8K A;  3I35 A;  3C12 A;  3GF5 A;  3FLG A;  1WGS A;  4Z8A A;  3CC2 T;  4ANJ A;  4J7F A;  2BZ8 A;  3LYI A;  4J83 A;  3HP9 A;  2VAS A;  3PMT A;  2HD0 A;  3M0U A;  2FEI A;  4JRK A;  1K73 R;  1KD1 R;  4PJM A;  2C0T A;  1JJ2 P;  2AIR B;  1AOJ A;  5IH2 A;  1U06 A;  5LJ5 j;  3VKI A;  2ATC B;  4C0F A;  1DJ7 B;  1VQK Q;  3T9N A;  1K73 C;  1KD1 C;  1JU5 C;  4FYV B;  4MMK A;  5AYF A;  1FMV A;  4BDY A;  3ASK A;  1V29 B;  1G2B A;  2R57 A;  4EMG A;  4M7A F;  3PMI A;  1KG1 A;  3JCM V;  2EYX A;  1SSH A;  5FWB A;  1YJ9 T;  2LRQ A;  4D8D A;  4M75 B;  4C5E A;  3SWN A;  3TVT A;  6AT1 B;  2K3X A;  3JCM W;  1EX4 A;  2NWM A;  3E19 A;  1PHT A;  2RN8 A;  2ABL A;  1X75 C;  2CDT A;  1D1C A;  1QVG S;  1VQ6 A;  1AT1 B;  1KHC A;  4KRT A;  5LJ3 g;  1NLO C;  3PTA A;  2JJ9 A;  3R6N A;  3CXC S;  2JS2 A;  2EYW A;  4JDS A;  4WF2 A;  2A28 A;  4HCZ A;  4C92 B;  1YIT Q;  1Q86 R;  5CCA A;  2CP2 A;  4RTV A;  4PJO E;  2ROT A;  1FX7 A;  4XU2 A;  2QGF B;  1X2Q A;  1VQK A;  3AHU A;  1BIB A;  4HXJ A;  3CME Q;  4M78 E;  2D8H A;  1Q86 C;  1JJ2 S;  1LCK A;  2QA4 T;  1OOT A;  2H3J A;  3OYH A;  3E9F A;  2QI2 A;  3OSS C;  2QDL A;  3RR6 A;  1B34 A;  4OB1 B;  3HRT A;  4FYY B;  3CCL Q;  3A8G B;  4LD6 A;  4D6W A;  3OQ5 A;  2JT4 A;  2X3W D;  4V2S A;  1NPR A;  2VKN A;  4JPB W;  1D0X A;  5GMK j;  1E6H A;  1N6A A;  3MJX A;  3JB9 D;  1M5Q 1;  1Z9Z A;  5J3B A;  3OY9 A;  1NJI R;  3TRE A;  3S3O A;  3FRN A;  5GAM d;  2X3X D;  3FJ5 A;  3PIO A;  1YIT A;  3PIP A;  1KK7 A;  2JNG A;  1UFF A;  4OML A;  2RM4 A;  1NJI C;  3EG0 A;  3OMG A;  4XU0 A;  3V8L A;  1YJN Q;  1VQ8 T;  3DB4 A;  3HL8 A;  1PSE A;  1MMN A;  3CME A;  2BUD A;  1BI2 A;  1BU1 A;  3UA7 A;  5LJ5 g;  4E7S A;  3UF4 A;  1RI9 A;  3J80 E;  2O4X B;  3A98 A;  4J6Y A;  4RTY A;  3OYY A;  4JRI A;  5J26 A;  2ENM A;  4IIM A;  1M3C A;  2CZ7 B;  2LNV A;  3I56 T;  2JMA A;  2K3Y A;  3CCL A;  3EH1 A;  5FRN A;  1UB4 A;  5GAN 3;  3MEU A;  4R56 A;  3JCM J;  1VQN Q;  2RJC A;  1SHF A;  1VQP A;  1VQ6 T;  3VS3 A;  2B8A A;  4XTV A;  4AFQ C;  2HSE B;  1W4S A;  1OZ3 A;  3A8L B;  4M75 A;  4RTT A;  4HT8 A;  2EPD A;  2ZZD A;  1YJN A;  4EPC A;  2ZAE A;  1NZ9 A;  2JM8 A;  5CQY A;  5LL6 S;  2GFU A;  1GL5 A;  1K9M R;  3EG3 A;  1RAA B;  2QQA A;  3LGL A;  3RKW A;  1M1K R;  2I2L A;  4ZGD B;  3DKM A;  2VUB A;  2KGT A;  4OGC A;  2J6F A;  3GNF B;  2CUB A;  1G3S A;  2DXU A;  1M1K C;  3CC4 Q;  1RAG B;  2LDM A;  4C92 A;  2K3B A;  5KE2 A;  5KYW B;  3JCM X;  1YI2 T;  2DK3 A;  1J3T A;  4QW2 A;  4FSX A;  1VQ9 A;  2EVR A;  3CCR T;  1VQN A;  1X43 A;  2LX9 A;  2ECZ A;  3NMZ C;  3FC3 A;  4O6J A;  2FZC B;  4EMH A;  3VUB A;  1QWE A;  4BY6 C;  3JCM P;  2OTJ A;  3EGD B;  3L2V A;  2P0K A;  1Y0M A;  1W2B P;  4LNP A;  3HSB A;  4HKE A;  2JZ2 A;  3IQL A;  3DLM A;  1SRM A;  1KC8 U;  2CP6 A;  1AWX A;  1ZSG A;  3OS5 A;  1U8R A;  5DLO A;  2LQK A;  4ORZ A;  3OYF A;  1YIT T;  3LLR A;  1VQ5 Q;  2RJF A;  1UHF A;  3MCA B;  1BI0 A;  2EKH A;  2LCL A;  2QEX T;  3CME T;  1WI7 A;  1X6G A;  4DBF A;  3CC4 A;  3ER0 A;  2LT1 A;  2EYQ A;  4C8Q G;  2DA9 A;  3FIF A;  2YSQ A;  2DMO A;  1T3L A;  2ZPI B;  4KT0 E;  1Q7Y C;  3OS2 A;  2NUZ A;  2DZ9 A;  3CCV Q;  4M77 D;  3CCL T;  3OYD A;  1RAB B;  1ZUY A;  2O01 E;  2DL8 A;  2LX7 A;  4DOV A;  1CSK A;  4J8O A;  5CKB A;  2O4X A;  2MMP A;  1OX8 A;  3BW1 A;  1ZSZ B;  3OYC A;  1VQP T;  2YRV A;  3PE0 A;  2E3H A; 
#chains in the Genus database with same CATH homology
 2L8D A;  5CR2 A;  4OF1 A;  2XK0 A;  4OB3 B;  5LJ3 h;  3WVD B;  2KK4 A;  3MEA A;  1QVG A;  2BKD N;  5CKH A;  4EMK B;  1M90 U;  2V8J A;  3J7A F;  1W2B S;  3PFS A;  1P92 A;  3MO8 A;  1LJO A;  4HA8 A;  3QYH B;  4OB2 B;  4C0Z A;  1VQ5 A;  3LH0 A;  3RMS A;  1QVF S;  4MDX A;  5D6W A;  1BYM A;  1LNX A;  3CXC A;  3KBG A;  4X34 A;  1I4K 1;  2JTF A;  3QZ9 B;  4RG8 A;  4C8Q F;  5GMK i;  3P8D A;  1VQ8 A;  4M7D E;  4E47 A;  3HPW A;  3E9G A;  3GPL A;  1M1G A;  3EAE A;  3OW2 S;  4ME7 A;  4BE2 A;  4BE0 A;  2X35 A;  4GY5 A;  4C92 G;  1WQW A;  4ZTF A;  1LOJ A;  4M7A A;  5GAN 8;  5D6Y A;  2E12 A;  3M4G A;  4NS5 A;  1YJW T;  2F69 A;  1NE8 A;  2WSE E;  4BI3 A;  2ZCF B;  2D0Q B;  5HK3 A;  1Y96 B;  3SB2 A;  5KCO A;  5I2S A;  5A0G A;  3CCS T;  4ZTJ A;  2L3R A;  3NTH A;  2EKO A;  2RO0 A;  3KUF A;  3ZEH A;  2QQR A;  2VGN A;  1JJ2 A;  2D6F A;  2XI9 A;  1UGS B;  4M7D F;  1N27 A;  4IUR A;  2DD4 A;  2LC4 A;  4C0D C;  1OI1 A;  3I56 A;  1VQ7 A;  2D9T A;  1VQK T;  1VQ9 T;  3JB9 I;  1M9S A;  2V8I A;  2K5F A;  4M75 F;  1BI1 A;  1ZBX A;  2WSC E;  5GMK m;  1VQN T;  4M7A C;  4BD3 A;  5GMK e;  3RER A;  1H3Z A;  2GFA A;  2JN0 A;  2WSF E;  4X9D A;  4C92 E;  2VXE A;  3L2Q A;  3SWN B;  4C5G A;  4RMO A;  2EAY A;  2ZPB B;  3JAM E;  3PNW C;  2OTJ T;  1WJS A;  2YHT A;  4LDW A;  1QP3 A;  1GXI E;  4XTX A;  2RHX A;  3M56 A;  3JCM Q;  4EDU A;  3LWH A;  4DA4 A;  4C8Q D;  5GAN d;  3M53 A;  4QQ6 A;  4GLK A;  4DQ2 A;  5GAM j;  2HQE A;  3OYN A;  2HQX A;  3KXT A;  1BIA A;  1G3T A;  2QTX A;  5KE3 A;  4IUQ A;  4F7U G;  4HCC A;  2HBP A;  1XTD A;  2CZ1 B;  2DXT A;  3I55 A;  3JB9 H;  5HKC A;  3URG A;  2RK2 A;  2X4Y A;  4C92 F;  3QII A;  3X24 B;  4FL6 A;  5GAN f;  4OB0 B;  2R5A A;  5GAO q;  3HHT B;  2DIG A;  5GAN 6;  3X26 B;  4PNO A;  3P8H A;  2E10 A;  2A7Y A;  2E64 A;  4M77 F;  3CC7 A;  3MET A;  3BDL A;  4PKC C;  5GAN h;  3UPU A;  3FB9 A;  2F5K A;  5LJ3 j;  2OTL T;  3HKS A;  3TU4 K;  1KQS A;  4M7D D;  4Z02 A;  5LJ5 f;  2Y4X A;  2PQW A;  3TCJ A;  3UT1 A;  3DB3 A;  3A8O B;  3N5B B;  4MZP A;  4J6X A;  2DJZ A;  4PJO A;  4R55 A;  3VYG A;  2PVO B;  3V8J A;  1D3B B;  5CAI A;  2QQB A;  4FT4 A;  2P0Q A;  4F7U E;  3OYI A;  4IUU A;  4A54 A;  5LJ5 h;  2RH2 A;  3M4Y A;  5FLX E;  5CKF A;  2FYK A;  2DEQ A;  3OA6 A;  4IUP A;  4M78 A;  5L8R E;  3OS1 A;  4A53 A;  1S72 A;  3BDU A;  4N4G A;  4XTU A;  3PGG A;  1HK9 A;  1B34 B;  2RA2 A;  1YI2 A;  3WXM B;  3OYA A;  4N0A A;  1MGQ A;  1RL2 A;  3MEW A;  3CCR A;  3QJ6 A;  3OYB A;  3GP8 A;  1QVP A;  5FU7 B;  4PJO C;  2VGM A;  1WPY A;  3CCQ A;  2QQS A;  3QJY A;  2LVM A;  5KCH A;  3CBO A;  3C95 A;  1XNI A;  4XK8 E;  1WJR A;  4B9X A;  1HXD A;  1QW1 A;  4F7U F;  4E7I A;  1VQ4 A;  1Q82 C;  4C92 D;  4RKU E;  4YTL A;  3L1A A;  4M78 C;  4L59 A;  2KAF A;  2PU9 B;  1N8R C;  4NOY A;  1QP2 A;  3V7C A;  3WVE B;  3ZBD A;  1KHI A;  4ZGJ B;  1UEB A;  1H64 1;  2A3L A;  4LDU A;  3MP8 A;  4PLL A;  1ZHI A;  4N0A C;  3INZ A;  3OB9 A;  4XAX B;  3M54 A;  2E65 A;  3FEO A;  3V7S A;  2X4W A;  2LQ8 A;  5FU7 C;  2IG0 A;  4ZN3 A;  1YBY A;  2ZPF B;  1VQ5 T;  3QSU A;  5CIU A;  2EJG A;  2FB7 A;  2MI6 A;  1Q82 U;  2RK1 A;  3O8V A;  3JCM g;  5GAO m;  4M7A G;  1VQM T;  1Q7Y U;  2PVG B;  3SDZ A;  3MP1 A;  3OYE A;  1N8R U;  2V8K A;  2CZ0 B;  3C12 A;  4BUG A;  3GF5 A;  1IZ6 A;  3M59 A;  3FLG A;  2QEX A;  1WGS A;  5CK9 A;  4EMK A;  1WNL A;  2R5M A;  1VIE A;  4N4H A;  1M8V A;  3CC2 T;  3HFN A;  4OMF B;  4J7F A;  1Q81 C;  1YJN T;  3LYI A;  2EFI A;  5GAO r;  4XTY A;  3G6E A;  4J83 A;  2EJ9 A;  3HP9 A;  3RMQ A;  3OYM A;  3PMT A;  2HD0 A;  2M0O A;  5GAN j;  4KUD K;  5GAM e;  1BKB A;  4BI4 A;  4BB7 A;  4FIB A;  4JRK A;  3NFC A;  4OP0 A;  2F5T X;  4XTZ A;  2DIQ A;  3RKY A;  4M7A E;  1M1F A;  1VQL A;  2M9U A;  3OYG A;  1VQ7 T;  2YLC A;  2JOY A;  1SSF A;  5LJ5 j;  4EMK C;  3VKI A;  5C6S A;  4C0F A;  5HK0 A;  3JB9 G;  4JJN K;  1DJ7 B;  3L42 A;  3T9N A;  1Y96 A;  1K73 C;  5LJ3 e;  1KD1 C;  5AYF A;  3CCV A;  4MMK A;  4FU6 A;  3RIR A;  1I5L A;  4BDY A;  2EWN A;  3ASK A;  4J6W A;  2XD0 A;  1V29 B;  4MZT A;  2RHU A;  2R57 A;  1G3Y A;  2EQK A;  3OYK A;  2QQ9 A;  4EMG A;  4M7A F;  3PMI A;  1KG1 A;  4HCB A;  5GAM g;  3CEY A;  3JCM V;  2XDD A;  3GIB A;  4M7D B;  1JBM A;  3CCE A;  2XIC A;  1YJ9 T;  2LRQ A;  4RG2 A;  4M75 B;  5FRM A;  4C5E A;  4MML A;  3VYH B;  3SWN A;  3BY7 A;  2K3X A;  2DAQ A;  3JCM W;  1K73 U;  2KDS A;  3E19 A;  5A2Q E;  1KD1 U;  1G5V A;  4PJO G;  3M5A A;  1X75 C;  5FU6 B;  4Q5W A;  4A4K A;  1QVG S;  1VQ6 A;  4MDW A;  1FXX A;  1KHC A;  3G71 A;  3MEV A;  2KY9 A;  4LDV A;  5LJ3 g;  3QDR B;  5GMK l;  3PTA A;  4M78 G;  2KSS A;  1FWZ A;  1X6O A;  2RB6 A;  3CXC S;  3M58 A;  1UGP B;  2G3R A;  3UWN A;  3E1S A;  3V7R A;  4MZM A;  1YHQ T;  3LX7 A;  1YJW A;  4M75 C;  4PLI A;  1K9M C;  2RJD A;  3SWN C;  5KH6 A;  4JDS A;  1AHJ B;  2DPP B;  4WF2 A;  4CRI A;  4BE1 A;  2Y90 A;  4ATO A;  4HCZ A;  3PT9 A;  3JCM c;  4C92 B;  3JB9 F;  4FT2 A;  1S72 T;  3C4S A;  5CCA A;  1K8A C;  5FU6 C;  3JCM d;  4PJO E;  3C94 A;  3GLX A;  4M77 B;  1FX7 A;  1X01 A;  4OVA A;  4XU2 A;  1IRE B;  1O9S A;  2ZGW A;  4UC4 A;  1VQK A;  3R6O A;  2GQV A;  2DTI A;  3L2U A;  3F70 A;  2E5Q A;  1BIB A;  3CC4 T;  3AHU A;  4M7A D;  1YCY A;  1M4Z A;  1JB0 E;  4ZGE B;  3VUZ A;  3CCU A;  1KC8 C;  1D3B A;  1Y71 A;  4M78 E;  3EFR A;  1Q86 C;  1Y7X A;  1KQ1 A;  2DD5 A;  2JTM A;  2RHY A;  1JJ2 S;  5DY9 A;  4A4E A;  2QA4 T;  4E7L A;  2XDB A;  2KVQ G;  2CZ6 B;  2H3J A;  2K5L A;  2OAU A;  2QDY B;  3QPH A;  3OYH A;  3E9F A;  2QI2 A;  3OSS C;  4VUB A;  5C0M A;  3A8H B;  1B34 A;  2VV5 A;  4OB1 B;  4PJO F;  4M77 C;  2DVE A;  3HRT A;  4E7H A;  4RCC A;  4JS5 A;  2R58 A;  3JCM e;  2DTH A;  3VV0 A;  2EQM A;  3G4S A;  3A8G B;  2PUO B;  4LD6 A;  2EQU A;  5CKE A;  3RKX A;  4D6W A;  2WAC A;  3OQ5 A;  2C06 A;  5CKD A;  4M78 F;  1Q86 U;  5HY6 A;  4V2S A;  1NPR A;  4FM4 B;  1Y07 A;  2JUF A;  1W2B A;  4F7U B;  3OSV A;  5GMK j;  3JB9 J;  3CD6 A;  1N6A A;  1UGQ B;  4KUL A;  5LJ5 e;  3JB9 D;  1M5Q 1;  5J3B A;  3OY9 A;  5A0L A;  2KMT A;  2OTL A;  2DKG A;  3OYL A;  3OS0 A;  3CMA A;  4PL6 A;  4KBM B;  4Y91 A;  3TRE A;  3S3O A;  2E41 A;  3LWI A;  5A0D A;  3FRN A;  1YIJ A;  1BI3 A;  1RI0 A;  5GAM d;  3JSC A;  3PIO A;  1YIT A;  3PIP A;  4JS4 A;  2JNG A;  3G6E T;  2QXF A;  2RD1 A;  1XQH A;  2RM4 A;  1KQS S;  2MF2 A;  2K5I A;  1NJI C;  3OMG A;  4IUV A;  4DOW A;  4XU0 A;  3V8L A;  2P0P A;  4A4H A;  5GAN g;  3L2W A;  1VQO A;  1VQ8 T;  3DB4 A;  3NTK A;  4LDY A;  3HL8 A;  2CYZ B;  1PSE A;  1VQL T;  2E70 A;  5CO7 A;  2BUD A;  3CME A;  2DTO A;  4TVR A;  5D6X A;  4PJO D;  4C5I A;  3OYJ A;  5LJ3 d;  4LDX A;  2CKK A;  1BI2 A;  5LJ5 g;  5GAN 4;  4JRP A;  1VUB A;  3QG1 A;  1OZ2 A;  2PVD B;  3TEE A;  2O4X B;  3J80 E;  2MWO A;  2RHZ A;  4J6Y A;  3QO3 A;  3CCV T;  4M78 D;  4J7I A;  3CCM A;  3Q1J A;  4BI8 B;  5EG2 A;  4P5N A;  1NJI U;  2PUK B;  2YLB A;  3OYY A;  4JRI A;  1PSF A;  5CQX A;  5J26 A;  3RUX A;  4M75 G;  3CPF A;  2DXB A;  2AHJ B;  4OGE A;  4C8Q B;  2CZ7 B;  2LNV A;  3I56 T;  2K3Y A;  2L5Q A;  3CCL A;  3SD4 A;  5FRN A;  3X25 B;  1UB4 A;  2VC8 A;  4QVD A;  5GAN 3;  3CCE T;  4QQG A;  1O75 A;  3MEU A;  2VXF A;  1NPP A;  4R56 A;  1Q81 U;  3L2R A;  3JCM J;  3J81 E;  2ZPE B;  2M1H A;  3OBY A;  3QXE B;  1WQ7 A;  5GAN 5;  3CCJ A;  2K4Y A;  2RJE A;  3L2Z A;  2RJC A;  4LD9 K;  2EIF A;  1VQM A;  1VQP A;  1VQ6 T;  4Y28 E;  2B8A A;  4XTV A;  5GMK h;  2X4X A;  4C0D B;  3H8Z A;  4C8Q C;  3G71 T;  2P4T A;  1TH7 A;  2ZPG B;  4KUI A;  4M75 E;  5I2M A;  4IUT A;  1JRI A;  4M7D A;  1OYX A;  1W4S A;  3CBP A;  1XOV A;  2MWP A;  4M7A B;  3V8K A;  3I55 T;  1KQ2 A;  4CI0 C;  3QZ5 B;  1OZ3 A;  3S3M A;  3A8L B;  4M75 A;  3CC2 A;  4HT8 A;  2ZZD A;  4M77 G;  1YJN A;  1EIF A;  4EPC A;  3QKJ A;  3UDC A;  1NZ9 A;  5CQY A;  5LL6 S;  2GFU A;  4QVZ A;  2FL7 A;  2L89 A;  3LGL A;  2QQA A;  5J39 A;  2LCC A;  3RKW A;  3CC7 T;  3NTI A;  2I2L A;  1I81 A;  3MHX A;  3DKM A;  2VUB A;  4ZGD B;  4OGC A;  2RI2 A;  3OBW A;  2LT4 A;  3ME9 A;  4M7D C;  3QBY A;  3QYG B;  4E7K A;  3BFM A;  4JUV A;  3GNF B;  3M55 A;  2E6Z A;  4B9W A;  3CCU T;  4JLI A;  1G3S A;  2DXU A;  1M1K C;  4JLG A;  4BY6 B;  3CCS A;  2JVV A;  1G3W A;  4XTW A;  2LDM A;  3X28 B;  1UGR B;  1ZQ1 A;  2DO3 A;  5CVI A;  4M77 E;  3S6W A;  4C0G A;  4C92 A;  5KE2 A;  2M16 A;  3CBM A;  3LGF A;  3SFM A;  5IAY A;  3JCM X;  1YI2 T;  2DK3 A;  4M77 A;  2K2V A;  5FRO A;  4QW2 A;  4FSX A;  3JCM b;  4A4G A;  1R8O B;  2XID A;  1VQ9 A;  4ZN1 A;  2X4J A;  3CCR T;  4JRQ A;  1WJQ A;  3X20 B;  1VQN A;  2LX9 A;  4ELY C;  2EJF A;  3EFS A;  3FDR A;  3A8M B;  3RES A;  2XKO C;  2FHD A;  3A5Z B;  3G4S T;  3CCQ T;  2GCX A;  3S3N A;  3FC3 A;  1YJ9 A;  4O6J A;  1K9M U;  4EMH A;  2K57 A;  3JCM f;  5IT9 E;  3VUB A;  5LJ5 d;  3CPW A;  1VQ4 T;  2XDP A;  2Y4Y A;  4IKF A;  1M1K U;  3FJP A;  3HRS A;  4BY6 C;  2KQW A;  3M57 A;  4A4F A;  4QVC A;  4BAC A;  4C92 C;  4XU3 A;  3JCM P;  2NLU A;  3QUI A;  3L2V A;  2P0K A;  3GOX A;  1K8A U;  3CD6 T;  3JCM h;  4II1 A;  2XHC A;  3GNG A;  3HSB A;  2OTJ A;  4HKE A;  5DLQ E;  4L6V 5;  1N9S A;  2JZ2 A;  2MAM A;  4XU1 A;  3CMA T;  3DLM A;  5GAN e;  4PJO B;  2DZC A;  5I21 A;  1KC8 U;  2HNI A;  1U1T A;  4NL2 A;  1YIJ T;  3OS5 A;  4M75 D;  1U8R A;  1YHQ A;  5DLO A;  4N4I A;  4RCB A;  1I8F A;  2LQK A;  5GAO p;  3OYF A;  1YIT T;  3LLR A;  3MP6 A;  2LTO A;  4XQ3 A;  2RJF A;  5IN1 A;  4M78 B;  4F7U A;  1QVF A;  1VQO T;  2HAX A;  3MCA B;  1BI0 A;  2XG8 D;  2LCL A;  2QEX T;  3CME T;  5GAO n;  3ZFJ A;  4C5H A;  2VYT A;  3CC4 A;  3ER0 A;  2LT1 A;  3OW2 A;  3VJP A;  2EYQ A;  4C8Q G;  5GAN 2;  3FIF A;  2BIV A;  2IVW A;  2CS7 A;  3LW5 E;  2EQJ A;  4O5V A;  2QA4 A;  3CCM T;  2ZPI B;  4KT0 E;  1Q7Y C;  3OS2 A;  1VIF A;  2DXC A;  2GF7 A;  3HFO A;  3P8B B;  3JRZ A;  2DZ9 A;  3H6Z A;  5GAM f;  4M77 D;  3CCL T;  4J5Y A;  5M9O A;  3DLL A;  3OYD A;  2O01 E;  2FVU A;  2CGH A;  3HRU A;  4HT9 A;  3CPW S;  2E1H A;  1M90 C;  3G7Z A;  4DOV A;  5GAM h;  4BDZ A;  4ELZ C;  2E6N A;  1N9R A;  2RI5 A;  4J8O A;  4QQD A;  1MHN A;  5CKB A;  2O4X A;  5DM7 R;  3OMC A;  3QHS A;  2ZPH B;  2MMP A;  3M9Q A;  5GAO l;  4M7D G;  4C8Q E;  2RHI A;  4L5G A;  3CCJ T;  1U1S A;  4E7J A;  2XU8 A;  3BW1 A;  4X9C A;  3OYC A;  1VQP T;  5LJ3 f;  2RI3 A;  2YRV A;  4C8Q A;  5GAN 7;  4NL3 A;  3VU3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...