1QP2A

Solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PROTEIN (PSAE PROTEIN)
publication title The solution structure of photosystem I accessory protein E from the cyanobacterium Nostoc sp. strain PCC 8009.
pubmed doi rcsb
source organism Nostoc sp.
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qp2A00
2ZZDA 3X20B 3QYGB 1DJ7B 3A8GB 3QZ5B 2PUKB 4RKUE 3X26B 2DXBA 3VYGA 1AHJB 2ZPGB 2DPPB 2PUOB 3X24B 2QDYB 2CZ0B 1UGQB 2CYZB 1UGPB 2PVOB 2ZPIB 3LW5E 4ZGDB 4Y28E 1PSFA 2ZPHB 1IREB 2ZPEB 1QP3A 4ZGJB 3WVEB 2WSFE 4FM4B 3X25B 4OB0B 3A8MB 2DD4A 3A8HB 3X28B 4OB2B 3HHTB 1UGSB 3QXEB 4XK8E 3QZ9B 4ZGEB 2CZ7B 2ZCFB 2D0QB 1V29B 3VYHB 2PVGB 2WSEE 2WSCE 2ZPBB 1GXIE 4L6V5 2O01E 1UGRB 2DXCA 2CZ1B 3A8OB 2ZPFB 3WVDB 2AHJB 2PVDB 4KT0E 2DD5A 3A8LB 4OB1B 4OB3B 3QYHB 2CZ6B 2PU9B 5L8RE 1PSEA 1JB0E 1QP2A
chains in the Genus database with same CATH superfamily
2WACA 1OEBA 1M90U 2EW3A 3EH1A 5IT9E 5FWBA 3ULRB 3SHWA 3X26B 2HL5C 1MUZA 3SWNB 2YUQA 4FSSA 3GOXA 4BE2A 6AT1B 3X24B 5GMKe 2QDYB 5LL6S 4M77E 2F2VA 5GAMg 3OYEA 3CCEQ 3LWIA 2RJFA 4LDUA 4LUDA 3CCJT 3EH2A 1KFZA 5KYYA 2K4YA 2DF6A 3HFOA 2QA4T 4CC2A 2J6FA 4E7SA 4KUIA 2D9TA 3PFSA 4Z8AA 2RJCA 3V7CA 3HHTB 2R5AA 2JOYA 1VQNQ 1D1BA 2JUFA 2MYSA 3NGPA 4QKUA 4N4IA 1UEBA 3I56A 1T3LA 1VQMT 1ZSGA 4OVAA 4OP0A 1MMGA 4MZPA 3TEEA 1MMDA 3I9QA 4DOWA 3A5ZB 1VQKQ 1VQ8Q 4RTZA 3CCLQ 1VQ9A 3JV3A 2X4YA 4CC7A 4C92E 3G6EA 1UGRB 4C8QG 3INZA 1YITA 3KUFA 2BE9B 4HXJA 1M3AA 3A8OB 4II1A 2FPEA 4JDSA 2KROA 2RHUA 1G8XA 1WA7A 5KYUA 3OYMA 2O4XA 2EGEA 5CO7A 4OB3B 4A4FA 3JB9D 1BCMA 2HSEB 3GF5A 1ARKA 4NOYA 1IGQA 1I0CA 1LJOA 1G83A 1OZ2A 2A37A 3OYFA 2RO0A 1TUDA 1Z9ZA 3OYDA 3QZ5B 4RKUE 1EZZB 2HBWA 4J9CA 4L5GA 3EHQA 1J3TA 2D8JA 1WGSA 4PL6A 4JJCA 2L5QA 3JCMX 2M0YA 4HCZA 2RQVA 3M59A 1U3OA 1YJWT 2OX7A 1OPKA 2K6DA 4JZ3A 2CZ0B 2KYBA 4IUQA 4ZGDB 1I5LA 4M7AC 1PKSA 1PM3A 3CCJA 2XHCA 1YHQT 2ZPEB 3IQLA 2L89A 3VS2A 4HVWA 4M77B 4AFUC 2QA4A 1K1ZA 4RTYA 3I55Q 1WJQA 1ZUYA 3M55A 5KYXB 3A8HB 1D1AA 2E5KA 3CCUT 5GAMd 3OW2S 1ZX6A 1VQMA 2D6FA 1RABB 5L23A 2ESWA 5GANg 3OYKA 3A1PA 5FU7B 1B3QA 3TCJA 3FEOA 2P0KA 3J80E 4PKCC 1YI2T 1UG1A 2KGTA 2ZPBB 1K0XA 1GXIE 3N5BB 1K73C 4JLGA 2CGHA 3CCMT 1NLOC 3QJYA 2R58A 2EQIA 3WXMB 4C92B 3FJ5A 4FSXA 2CDTA 4HT9A 4PJOE 3MEWA 4KH1B 4Z88A 3JCMW 2X4JA 1D1CA 3PNWC 2F2XA 3QBYA 2CUDA 2QASA 1YIJQ 1PG5B 2ED0A 3QSUA 5CKBA 1JB0E 3CMAT 3LGFA 1X2QA 1WNLA 1ZSZC 2DFUA 1VQ7Q 1GRIA 2FZCB 1Y96B 1ZUUA 1WYXA 3SWNA 1N8RR 1MV0B 2DVEA 5LJ3f 2GBQA 3OYAA 4OGCA 1E6HA 3GBQA 3META 3E1SA 4XTYA 1YP5A 1YHQA 1W2BA 1X27A 1AZGB 3CC2T 2H3EB 1XJWB 1VQPQ 4UC4A 3CQTA 4RCCA 4EMKC 1AD5A 3UA7A 2P0PA 3LLRA 4MZMA 3WVEB 3CCVT 3CCRA 2WSFE 2CH4W 3CPWA 3L2RA 3CCUA 1VQ5A 2W0ZA 3RKWA 3M9QA 4NL3A 4RTUA 2COYA 2ROTA 2D0QB 2HCKA 3LWHA 1JBMA 3QDFA 1UUEA 3HRTA 4FYYB 4PFZA 3M0QA 3CCQQ 1VQOT 5CIUA 5FW9A 2IPOB 3NPFA 3BDUA 4HVVA 4M7DE 1TXQA 2LCCA 1RACB 5GANd 2OJ2A 1GCPA 1NE8A 3QO3A 2LJ0A 2VVKA 4C8QC 3E2UA 2LT1A 1KC8C 1K9MU 2JXBA 1VYTA 1YCYA 4PJOB 3H9NA 1EFNA 3L2ZA 1BI3A 5HK3A 2LZ6B 1TG0A 5I2SA 2VWFA 3VU3C 5IH2A 3ME9A 1KIKA 4OMMA 4JLIA 1K73R 2DL5A 1B34B 1S72Q 2EQUA 4KUDK 2MCNA 1Y57A 2RQWA 5IHIA 2MWOA 5LJ5g 5LJ3j 1ZA1B 4DBRA 2COWA 1PSFA 5IHKA 2K5IA 3SEMA 1NLPC 1WPYA 2L2PA 1KG1A 1PCXA 2RQRA 4M77A 1MMNA 2IG0A 1QWEA 4AG2C 1IZ6A 4HT8A 4M7AD 5KYXA 3OW2P 3CXCS 1SPKA 2COZA 4OB2B 5GAN3 3QXEB 1LOJA 4BDZA 2HMAA 3L1AA 4LD6A 2V8JA 1NG2A 3LGLA 2QEXT 1UECA 2KDSA 3VRZA 1VQOA 4AFQC 1M2VB 2PVGB 3RBBB 5GJVB 1Q86R 1G3YA 1PRMC 2JMAA 4AT1B 2M1HA 4C0GA 3S3MA 4AFZC 2JM8A 2KR3A 2DILA 3TSWA 4B6MA 2V1RA 1GFCA 4R0KA 4C92A 1SSHA 3I56Q 3OYIA 2RNAA 4M7DB 1FWZA 4O6JA 3V7RA 2A0FB 1B07A 3VV0A 2QAZA 2LTOA 1TU0B 2LT4A 4LDWA 7AT1B 3URGA 4RTXA 1VQ4T 2HZYA 1VQ9Q 2DNUA 3CC4Q 3G6EQ 1LVKA 2OTLA 2NWMA 2J6KA 5IN1A 2DKGA 3UPUA 3A98A 4TVRA 1Y96A 1K9AA 2ATCB 4IUPA 2XICA 1M1KC 1RL2A 2BTTA 2DVJA 1W6XA 2E64A 1MV3A 3L2VA 1M27C 3PE0A 1KC8R 4QQGA 5J39A 2YRCA 1K0SA 2LCSA 2CYZB 4EPCA 2DERA 3SB2A 2FEIA 1PRLC 1BYMA 3C95A 2MAMA 1QVPA 2DZCA 4KGXB 2H8HA 2AZSA 3PMTA 3L2QA 5HKCA 1W2BS 1IXDA 1UHCA 3H0IA 2K2VA 3CMEA 1TSFA 2KRSA 1X01A 2DTHA 2GTJA 5LJ5d 1Y07A 5GJWB 4N4GA 3CPWS 4ME7A 4ZGEB 2P4RA 4BACA 4J5YA 4PJOF 3JAME 2F5KA 4J6XA 1AWWA 2RI2A 4EMHA 3CCJQ 4FL6A 2YLCA 2PNIA 1Q95G 1U1TA 1WQWA 2QA4Q 3P8DA 4BB7A 2E10A 5KYWB 2X9HA 1YN8A 2EGCA 4C5EA 2HSPA 4L6V5 2DXCA 1M2OA 3RKXA 1VQMQ 5FROA 5KYNA 2MOXA 4HCKA 4FIBA 1EIFA 2KVQG 2CP5A 2YT6A 1VQ4A 2L3RA 4ATOA 4PJOA 2EPDA 2AZVA 1H92A 1YJNT 3UA6A 2XDBA 5FRMA 5DLOA 3M0PA 1O9SA 4C8QD 2YXYA 3MP1A 3DB4A 1YITT 1B34A 2ED1A 1KJWA 2M02A 5CKDA 1CSKA 4BD3A 2BE7D 4LE9A 3JB9J 3LX7A 4EMGA 1CKAA 2FO0A 5C0MA 2DBKA 1M30A 2DPPB 3GLXA 4OMPA 4E2FB 1XQHA 1I07A 4FYVB 4M77G 3PMIA 1D3BA 4FW1A 4QQ6A 3T9NA 3VUBA 5GMKi 1R0CB 1UJYA 2QTXA 3ZL7C 1Z9QA 1AZEA 5IXFA 1Q7YU 3CXCP 1R0BG 2DK3A 5GAOp 2FRWA 3CBOA 1Q81C 3VKIA 3SD4A 3X25B 1YJWQ 4M7DF 1K4US 5I2MA 1EX4A 2VV5A 2O9SA 2KMTA 5GAMe 4M78E 2OTJT 4J9HA 1YHQQ 1KHCA 1QCFA 3NMZC 1UJ0A 1YWPA 1VQ6T 4K11A 4XAXB 2FPFA 1GBRA 2QK0A 1M2VA 5A2QE 1QKWA 3THKA 3VS7A 2EAYA 3CCUQ 1AVZC 3MCAB 2LX7A 4C92G 4PFOA 2A08A 3AT1B 4NL2A 5IAYA 2BZYA 3JCMf 2DL3A 2YRVA 1QCNA 2A36A 2HD0A 1NM7A 2EWNA 2H3JA 4M7DA 4PJOD 3CCST 2C0TA 2HAXA 1HJDA 1YI2Q 2M51A 1YJNA 8ATCB 3J7AF 2K3YA 1M1FA 3CCMQ 4PJMA 4V2SA 3UWNA 2P4TA 4E7JA 3OYJA 4ESRA 4J8OA 2QQBA 2PUKB 1OQKA 5I22A 3VS4A 2HNIA 2F2WA 3EG9B 4RCBA 5FRNA 2YRDA 1M90C 2CT4A 2M16A 1NBEB 3SWNC 2DXUA 3OBWA 4Y91A 1Q7YC 3MHXA 2Y4XA 4PJLA 3CMAQ 3CPFA 2EKHA 3V8LA 1HSQA 3JCMJ 1W2BP 1K8AU 2KK4A 2DJZA 2VKNA 2RI5A 1IREB 4BY6C 2GFAA 2YDLA 4A54A 1M8MA 4AFSC 3PIPA 1YFNA 4ZGJB 2DRMA 1QMCA 1W1FA 1QQJA 3CPWP 2CREA 3OYBA 4B9XA 3OS0A 1PKTA 2DAQA 2OTJA 5GAMf 3O5ZA 2VYTA 4DA4A 3CC2Q 2HQEA 1TUGB 3GNGA 2PTKA 1VQ6A 3OS2A 2DIQA 4M78B 3CCVQ 2NLUA 2YLBA 2RHIA 2MIOA 2YUPA 2EGAA 3EFOB 4D8DA 3LYIA 5KYWA 3CCRT 2R57A 4JRPA 2LVMA 4QVDA 1Q81R 1UB4A 1U5SA 4MMKA 3OYLA 1RAAB 2O88A 1ZSZB 1VQ5T 4PK4A 5GANe 1QVGA 3TU4K 2ZPFB 3ER0A 1VQLT 3CCSA 4PJOG 1P92A 4R55A 1N5ZA 3CEYA 3EG0A 1VQOQ 4MDXA 2L8DA 4LDYA 4OMOA 4ZN1A 2NYSA 3QYHB 4A4EA 5L8RE 5IXBA 2DETA 1QVFS 2LCLA 4XU0A 1Y0MA 1Q86U 2F69A 2JTFA 1OZ3A 2KRNA 2RMOA 1YJ9A 4E47A 2OAUA 4MZTA 2EYQA 3MP8A 1V76A 3UT1A 1IRXA 5CAIA 5ECAA 4C5IA 3M0RA 4PFPA 4AMCA 4JJBA 1UGVA 3UATA 1UGPB 4FU6A 1KQSA 3RESA 3C4SA 1NPRA 4PLLA 2CP0A 4XU3A 4N0AA 3VS5A 3VS3A 1QP3A 2GCXA 1BK2A 4M77C 2K9GA 4JPBW 2QI2A 4OB0B 3M53A 1FMKA 4KGVB 1M90R 1M3BA 2Y4YA 5GAMj 5GMKm 5GMKj 1KD1U 3RMQA 1UDLA 5I11A 1OX8A 1GCQA 1RLQC 4M75E 2B8AA 3HRUA 3RR6A 2JNGA 1KK7A 3OYYA 5FU7C 2CP3A 4HA8A 3MPUB 2JJ9A 1C6VX 1PD1A 2ZAEA 4CC3A 2KXCA 5GAOr 3KFVA 4O5VA 2O01E 4Z89A 4M7DG 3EG1A 3FIFA 2QEXQ 1VQLA 4C0DB 3C94A 5CK9A 2GTOA 4C92C 2AKKA 1FX7A 2DD5A 3M0TA 2LQNA 1O75A 4BI3A 2EVRA 3PTAA 2RD1A 5FU6B 5LJ3d 1M4ZA 2CZ6B 5HY6A 3GIBA 3LH0A 2FHDA 1RAFB 1NJIU 3C12A 1BBZA 1N9SA 4Z02A 1DJ7B 3EFRA 4JRKA 2J05A 4JS5A 4XTWA 3QWXX 1AOJA 1U06A 4QVZA 1VQKA 2K3XA 5LJ3h 1H3ZA 1VQ4Q 2BZXA 4QQDA 3CD6T 8AT1B 1RAIB 4M77F 1WHJA 2E41A 4C5HA 3EAEA 2AT1B 2VASA 1SF9A 1VIEA 1WFWA 1BI2A 1SKUB 1Y7XA 5A0LA 2P84A 1AWOA 4XTVA 1FMWA 2E65A 2V8KA 2OTLT 4FYXB 1AWXA 2A7YA 3QHSA 5GAN6 5LJ5e 3RNJA 3L2UA 1Q82U 1RADB 1UGSB 2G3RA 4X34A 1SRMA 2J7IA 1CKBA 1G2BA 3FRNA 4J9FA 4J83A 2X3XD 4M78A 1X6OA 3DLMA 1YWOA 5GMKl 3UDCA 3QWYA 3VUZA 1LCKA 3NHNA 4C92F 3EFOA 4M75B 3V8JA 1NZ9A 3CMET 3FC3A 1VUBA 1QWFA 1D09B 2KE9A 3MP6A 2V26A 1PWTA 1NEGA 5GANj 1GL5A 4JRIA 4E7ZA 1SG5A 2LNHB 2CSIA 4Q5WA 3TREA 1QVGS 4IUVA 1QVFP 4IURA 2J06A 4JJNK 4FCYA 4PJOC 1K9MC 1PSEA 4A4GA 2HKNA 2ZGWA 4F16A 3OQ5A 1PHTA 1FYNA 2DO3A 2LQWA 2RA2A 4XQ3A 3CD6A 2NUPB 2DRKA 4LDXA 1W70A 2RM4A 1YJNQ 3OMCA 1WQ7A 1IHVA 3M56A 2AK5A 3RERA 3LW5E 2GQIA 3TVTA 1YITQ 1TTHB 5J3BA 2ZPHB 2KQWA 2QYZA 1WIEA 2RK1A 2F1LA 3RDVA 2E5QA 2VGNA 3CC7T 1RAEB 1KQSS 2V8IA 3HRSA 1OX9A 5LJ5f 2HL3A 1JEGA 3MEUA 3A8MB 1JJ2A 1UFFA 2RN8A 4DBFA 3QZ9B 3EGUA 2EJ9A 2KT1A 4CC4B 1PD0A 2HBPA 3MEVA 4M77D 4A53A 2ABLA 1VQ7A 2FL7A 4X1VA 1YNZA 5C6SA 5KE2A 2R5MA 2O4XB 1G5VA 5A0GA 4FW2A 1JU5C 2EKOA 1I1JA 1SSFA 2J6OA 4QT7A 1SHFA 2JZ2A 4B9WA 1WHKA 2KNBB 4XTXA 3BY7A 4DBQA 3M54A 2CZ1B 3OS1A 1M9SA 2KYMA 1VQ6Q 2RF0A 1ABOA 2HQHA 1BB9A 5GAN8 4DEXA 1R77A 4M7DC 3H0FA 3QIIA 2QTVA 1KHIA 2Y90A 3V7SA 3DB3A 1D0XA 3RUXA 1U8RA 4LN2A 1N9RA 2DTIA 4C92D 4KGZB 1OI1A 4FYWB 2AIRB 1RAGB 1T0JA 3X20B 1ZBXA 1WXBA 5GAN7 4F7UE 4J9DA 3CCSQ 2EIFA 2KY9A 4J7FA 2L0AA 2MPXC 3E19A 4M7AE 1GFDA 2JTEA 1M8VA 1X43A 1WJSA 3VJPA 1AHJB 1M1GA 2X4WA 3QG1A 4HCBA 3MKDA 2RH2A 2C0IA 3P8BB 1UGQB 2YHTA 4MMLA 4WF2A 4M75F 2FG0A 3JB9F 1K9MR 3CC7A 3VS0A 2JVVA 1I5OB 3OYHA 4IKFA 1RAHB 2EYYA 2RJEA 4RUGA 2PZ1A 5LJ5j 3R6NA 4JS4A 3GNFB 2JS0A 1WLPB 5CQXA 1N27A 2LJ3A 2QG9B 4M78G 3M4GA 2DE0X 5KE3A 3FJPA 1I4K1 3I35A 4ORZA 4N4HA 1V29B 4HVUA 1S72A 3MJXA 2E6ZA 4F17A 2ROLA 3G7ZA 2LJ1A 2YUOA 4M75A 5CKFA 1HD3A 5GAOq 1M1KR 1IB8A 3HSBA 1N8RU 4J9BA 4EDUA 3FDRA 3OSSC 1JRIA 1QVGP 2XI9A 3MEAA 3OSVA 1NEBA 2FYKA 3DLLA 3LH5A 2HQXA 2GFUA 1G3WA 1MNDA 1ZQ1A 3ZEHA 3QPHA 3A8LB 2DBMA 2LDMA 1WXUA 1UE9A 2GF7A 4FT2A 3CCRQ 2AKLA 2O9VA 4LDVA 4J9EA 3VS6A 3E9FA 1X69A 2SEMA 1VQ5Q 4LUEA 2DXTA 3FB9A 2K2MA 4BY6B 3GP8A 2ZZDA 1VQLQ 4KBMB 4X9CA 2M9UA 3G71T 4ZNXA 4PJJA 4BI4A 3OYGA 4RTTA 4BE0A 2NUPA 2CSQA 2DYIA 4F7UB 4BDYA 2QGFB 1G3SA 2E1HA 4XTZA 4CRIA 5CR2A 2EQJA 4GBQA 3NFCA 2CKKA 3FLGA 2E70A 3G4ST 4M7AB 2PVOB 3I5RA 1TS9A 4ZTFA 3HP9A 1KQSP 3ASKA 3AHUA 3JCMb 3JSCA 3JCMc 3PIOA 2D8HA 1OU8A 2VB6A 2XDPA 3D7SB 4N0AC 1YJ9T 1QKXA 3HPWA 4A63B 2V1QA 2XG8D 1PNJA 3CC4A 3X28B 5D6XA 1MNEA 2EJFA 1B7TA 1VOMA 2D1XA 1OV3A 3JCMd 2EQMA 1JJ2S 1KQ2A 1N8RC 1WHGA 2JN0A 2MK5A 3QDRB 4P5NA 4M75D 1GCQC 2BKDN 3RMSA 3REBB 4RG8A 1LPLA 5D6YA 1K73U 1ZLMA 4BUGA 2O31A 2WSCE 1RI9A 1YBYA 2FZKB 4BE1A 5M9OA 5D7UA 3JCMh 4C8QE 1A0NB 2K3BA 4WTOB 1RUWA 2DA9A 1QCOA 2GNCA 2XMFA 2KSSA 4ZTJA 5CKEA 2VXFA 4DOVA 3O8VA 1OOTA 5LJ3e 1RLPC 2X51A 4OMLA 1QW1A 1QLYA 1MGQA 5LJ3g 1UTIA 3S3OA 1BU1A 1R8OB 2A28A 2DTOA 4M7DD 5KCOA 2DIGA 3G71A 2DL8A 4PNOA 3CCET 2MI6A 4A4HA 2E12A 3CXCA 1S1NA 2FVUA 1C1AA 1ZBJA 3G4SA 1U1SA 2QXFA 3SDZA 1X6BA 2ZPIB 3J81E 2K7AA 2K5LA 1VQNT 2HKQB 4EMKB 3RKYA 1BI1A 1X75C 2QQ9A 3OYCA 1K8AC 5CVIA 2CP2A 2EYWA 3CD6Q 2CH4A 1KQ1A 5CQYA 4CI0C 1VQKT 4VUBA 5GAMh 1E6GA 5GMKh 1VQ8T 3M58A 3CCLT 4C0FA 2EJGA 4XK8E 1H3HA 1ACMB 1RI0A 1XNIA 3G1JA 2OTLQ 2DX1A 1WZOA 2OI3A 1VYUA 3JB9I 2E6NA 4M75G 4OF1A 4M4ZA 4M78C 3JB9G 3NTIA 1YCSB 2XKOC 1JXOA 2JMCA 4QW2A 1JQQA 4C0ZA 4E7IA 1OPLA 1VYVA 2JM9A 2CT3A 4LNPA 4OGEA 4F7UF 2RB6A 2I2LA 2X35A 1BIBA 3CBMA 4GY5A 5D6WA 1Q7YR 4F04B 4J7IA 2DEUA 2I0NA 4JRQA 1KC8U 2P0QA 4RTWA 4QVCA 3EG3A 4M7AF 2PVDB 5DLQE 3EG2A 4IIMA 3EGDB 4C8QB 3HL8A 1WHLA 4OB1B 4LXCA 1OU9A 2C0OA 5GAN5 1YJWA 4XTUA 3CMEQ 1Y71A 4OMFB 4MDWA 5GAN4 3HTRA 2DZ9A 3C0CA 2VC8A 2FPDA 1MHNA 1SRLA 1ABQA 3S6WA 1JO8A 2BIVA 5GANf 3CCEA 3RIRA 3A8GB 2CS7A 5HK0A 2EFIA 1VA7A 1Q86C 3KBGA 2RHYA 4E6RA 4F7UA 5AYFA 3PVQA 3I55T 2YUNA 2L3SA 2Z0WA 4ELZC 2G6FX 2M0OA 3Q1JA 1MMAA 2JTMA 2LMJA 3HKSA 4M7AA 3OBYA 2K79A 1VQNA 1TUCA 4Y28E 4XU1A 4LD9K 3ZFJA 5FLXE 1FXXA 2YWWA 2CP6A 1WJRA 2NUTB 1X2KA 2B86A 2A3LA 5CCAA 3BE3A 2QGGA 3EG9A 5GAOm 1N6AA 2KEAA 5A0DA 1YI2A 2MMPA 2GQVA 1VQ8A 4EIKA 3L2WA 4M78F 3CCLA 1X6GA 3CCMA 4WCIA 1IO6A 3OB9A 1JJ2P 2K57A 1JXMA 2KI7A 3HFNA 2DL4A 3VS1A 2LNVA 3M0UA 3SFMA 1SEMA 3H41A 2EBPA 3OMGA 3F70A 2KT8A 3CC7Q 1NYGA 4IUTA 1KD1C 1WXTA 2QQRA 4J9IA 4OMNA 2SRCA 1M3CA 1K8AR 2QQAA 3DKMA 2DMOA 3CMAA 2LX9A 9ATCB 1TH7A 4DQ2A 2JS2A 4RTVA 5GANh 1YIJT 3H0HA 1LNXA 1WDXA 1WI7A 4X9DA 3GPLA 4XU2A 3WVDB 3TSZA 4C0DC 4PJNA 1VQ7T 3M0SA 5CKHA 4JUVA 3JCMV 1T0HA 1ZA2B 3L42A 3OY9A 2RJDA 5IHNA 3JRZA 1UHFA 1AWJA 2RQUA 5FU6C 2PU9B 3EGXB 4YTLA 3M57A 3CC2A 1ZSZA 1D3BB 2DJQA 2XU8A 1QP2A 1I81A 1M1KU 1IGUA 2VGMA 3CCVA 4DBHA 1NJIC 4R56A 1VQPT 2DYBA 2KAFA 4BI8B 3I55A 2DXBA 2RQTA 4D8KA 4ELYC 3QUIA 2FRYA 3BW1A 3PGGA 2BUDA 4F14A 2W10A 1HXDA 2RI3A 4HKEA 2QQSA 3I5SA 1M5Q1 3UF4A 4EMKA 2HDAA 3PVLA 2DLPA 1OULA 2MWPA 5KYYB 3M4YA 1BCOA 2CP7A 1HK9A 3QKJA 4JZ4A 4FM4B 2O2OA 2QDLA 4C8QF 2X3WD 2DL7A 2CUBA 3CCQT 2F5TX 2IVWA 2FZGB 3KXTA 5GAOl 5EG2A 1TWBA 3REAB 2CZ7B 3P8HA 1FMVA 1Q82C 4IUUA 1XOVA 4HCCA 3V8KA 2D0NA 3OYNA 4KRTA 3VRYA 5DM7R 3VYHB 1D0ZA 2IIMA 2FB7A 2WSEE 2E3IA 2NUZA 4NS5A 4E7HA 3EHRA 4M75C 1YIJA 4RG2A 4AG1C 2LC4A 1W4SA 2ECZA 2XD0A 4M78D 4KULA 2GGRA 2RHZA 1SHGA 4J6WA 2KRMA 2EQKA 5KH6A 2AHJB 1T3SA 2KXDA 2E3HA 2BZ8A 3EGDA 4C8QA 5KYUB 4PLIA 4IIOA 1VIFA 2LQ8A 4OMQA 3BDLA 4Y92A 1C0MA 3EFSA 4KH0B 1S72T 2XIDA 1KD1R 1TOVA 4L59A 4J6YA 1G3TA 2PQWA 4GLKA 2EYXA 2OTJQ 3JB9H 2KBTA 1KSWA 5KCHA 3OS5A 2E4HA 3E9GA 3QYGB 4F7UG 3TQ7P 2DM1A 1IHWA 4J9GA 3H6ZA 1VQPA 3R6OA 3MO8A 1XTDA 3JCMQ 3QJ6A 2RK2A 3VYGA 3S3NA 4M7AG 2YSQA 1ZUKA 4E7LA 1BI0A 2ZPGB 5J26A 4GLMA 1D0YA 3ZBDA 2PUOB 4ANJA 4JJDA 2QEXA 2ENMA 1F1BB 1ZHIA 2NUTA 2L3QA 1Q81U 3G71Q 2LQKA 2DEQA 5LJ5h 2JT4A 5GAN2 1BKBA 3OA6A 1NPPA 1E7OA 2EYZA 1H641 3CCQA 2K5FA 1NJIR 2L3PA 2DD4A 3OW2A 1AT1B 3G4SQ 4ZN3A 3H8ZA 2XDDA 2MF2A 3NTKA 3JCMe 2ZCFB 1HYOA 3BFMA 1OYXA 4A4KA 2X4XA 4D6WA 3JCMg 1YJ9Q 3I56T 5FWCA 3CBPA 5GAOn 1QVFA 2LRQA 1AEYA 2RHXA 5DY9A 1K76A 3U23A 4RMOA 3M5AA 1GBQA 2JW4A 3NTHA 1VQ9T 1PC0A 1V1CA 3CC4T 3G6ET 3PT9A 2HEQA 5HCKA 1I8FA 3JCMP 4E7KA 4KT0E 4DEYA 1Q82R 4C5GA 4FT4A 2OAWA 5I21A 2VXEA 2LP5A 1WHHA 1NYFA 1H8KA 1WHMA 1BIAA 2RPNA 2VUBA 2C06A 2XK0A 3EGXA 5AT1B 5EC7A 1WX6A
chains in the Genus database with same CATH topology
5KCOA 1N9SA 2DKGA 2WACA 2DIGA 3UPUA 4Z02A 1DJ7B 3EFRA 4JRKA 1M90U 3G71A 4TVRA 5IT9E 1Y96A 4PNOA 4JS5A 3CCET 4XTWA 2MI6A 3X26B 2E12A 4A4HA 3CXCA 4QVZA 1VQKA 4IUPA 2XICA 2FVUA 2K3XA 1RL2A 5LJ3h 3SWNB 1M1KC 1H3ZA 4QQDA 3CD6T 2E64A 3GOXA 3L2VA 4M77F 3G4SA 4BE2A 4QQGA 1U1SA 2E41A 2QXFA 4C5HA 3X24B 5J39A 3EAEA 2QDYB 3SDZA 5GMKe 2CYZB 2ZPIB 5LL6S 4EPCA 1VIEA 4M77E 3SB2A 3J81E 1BI2A 5A0LA 1Y7XA 5GAMg 2K5LA 4XTVA 3OYEA 1VQNT 2E65A 1BYMA 2V8KA 3C95A 2MAMA 2OTLT 3LWIA 1QVPA 2DZCA 2RJFA 4EMKB 4LDUA 3RKYA 1BI1A 2A7YA 3PMTA 3L2QA 1X75C 2QQ9A 5HKCA 3CCJT 1W2BS 3OYCA 1K8AC 5CVIA 2K2VA 3QHSA 2K4YA 3CMEA 5GAN6 1KQ1A 1X01A 2DTHA 3HFOA 5LJ5e 5LJ5d 2QA4T 5CQYA 1Y07A 4CI0C 3L2UA 1VQKT 4VUBA 5GAMh 4KUIA 2D9TA 3PFSA 5GMKh 1Q82U 2RJCA 3V7CA 1VQ8T 3HHTB 3M58A 4C0FA 3CCLT 1UGSB 2R5AA 4N4GA 2JOYA 2EJGA 2G3RA 4X34A 4XK8E 3CPWS 4ME7A 1RI0A 4ZGEB 3FRNA 2JUFA 4BACA 4J5YA 1XNIA 4PJOF 4N4IA 3JAME 2F5KA 4J6XA 4J83A 2RI2A 4EMHA 1UEBA 3JB9I 3I56A 1VQMT 4M78A 1X6OA 2E6NA 4M75G 4OF1A 4FL6A 2YLCA 3DLMA 4OVAA 5GMKl 4OP0A 4M78C 4MZPA 3NTIA 3TEEA 3JB9G 1U1TA 1WQWA 3UDCA 3VUZA 4DOWA 3P8DA 3A5ZB 2XKOC 4BB7A 4C92F 2E10A 4QW2A 4M75B 4C0ZA 3V8JA 1NZ9A 4E7IA 1VQ9A 3CMET 2X4YA 3FC3A 1VUBA 4OGEA 4C92E 4C5EA 4L6V5 4F7UF 1UGRB 2RB6A 3G6EA 2I2LA 2X35A 2DXCA 1BIBA 3CBMA 4GY5A 5D6WA 4C8QG 3INZA 1YITA 3MP6A 3RKXA 4J7IA 3KUFA 5FROA 4JRQA 3A8OB 5GANj 4II1A 1KC8U 2P0QA 4JDSA 2RHUA 4FIBA 4QVCA 4JRIA 4M7AF 2PVDB 5DLQE 3OYMA 2O4XA 4Q5WA 1EIFA 2KVQG 3TREA 4C8QB 1QVGS 3HL8A 4OB1B 5CO7A 4OB3B 4A4FA 3JB9D 4IUVA 5GAN5 1VQ4A 2L3RA 1YJWA 4XTUA 4ATOA 1Y71A 4OMFB 4MDWA 4PJOA 4IURA 3GF5A 5GAN4 4JJNK 4PJOC 4NOYA 1YJNT 1LJOA 2DZ9A 1K9MC 1OZ2A 2VC8A 1PSEA 2XDBA 1MHNA 4A4GA 5FRMA 5DLOA 3OYFA 2ZGWA 1O9SA 3OQ5A 3S6WA 2RO0A 2BIVA 4C8QD 5GANf 3MP1A 3RIRA 3CCEA 3A8GB 2CS7A 3OYDA 3QZ5B 3DB4A 4RKUE 5HK0A 1YITT 1B34A 2DO3A 2EFIA 1Q86C 5CKDA 3KBGA 4BD3A 4L5GA 2RA2A 3JB9J 2RHYA 4XQ3A 3CD6A 1WGSA 4PL6A 4F7UA 5AYFA 3LX7A 4LDXA 2RM4A 4EMGA 2L5QA 3JCMX 3I55T 4HCZA 5C0MA 3M59A 4ELZC 2DPPB 3GLXA 1YJWT 2M0OA 3OMCA 3Q1JA 1XQHA 2JTMA 1WQ7A 3HKSA 4M7AA 2CZ0B 3M56A 3OBYA 4IUQA 3RERA 1VQNA 4M77G 3LW5E 4ZGDB 4Y28E 4XU1A 3PMIA 1D3BA 1I5LA 4QQ6A 4LD9K 4M7AC 3T9NA 3ZFJA 5J3BA 3VUBA 5FLXE 2ZPHB 1FXXA 3CCJA 5GMKi 2XHCA 1WJRA 2KQWA 2ZPEB 1YHQT 2QTXA 2RK1A 2L89A 2E5QA 2A3LA 2VGNA 4M77B 5CCAA 3CC7T 1Q7YU 1KQSS 2QA4A 2DK3A 2V8IA 5GAOp 1N6AA 5A0DA 5GAOm 1YI2A 3CBOA 1WJQA 3HRSA 5LJ5f 1Q81C 2MMPA 3MEUA 2GQVA 3VKIA 3SD4A 1VQ8A 3X25B 3L2WA 4M7DF 3M55A 4M78F 3A8MB 3CCMA 3CCLA 3A8HB 3OB9A 5I2MA 2K57A 1JJ2A 2VV5A 3HFNA 3CCUT 2KMTA 5GAMe 4M78E 5GAMd 2OTJT 3QZ9B 2LNVA 3SFMA 3OW2S 2EJ9A 1VQMA 2HBPA 3MEVA 3OMGA 4M77D 4A53A 1VQ7A 2D6FA 2FL7A 3F70A 1KHCA 5C6SA 5GANg 5KE2A 1VQ6T 3OYKA 2R5MA 2O4XB 4IUTA 1G5VA 5A0GA 1KD1C 4XAXB 5FU7B 3TCJA 5A2QE 2QQRA 2EKOA 3FEOA 2P0KA 3J80E 1SSFA 2QQAA 4PKCC 1YI2T 3DKMA 2EAYA 2JZ2A 2ZPBB 4B9WA 3MCAB 3CMAA 4C92G 1GXIE 2LX9A 3N5BB 1TH7A 1K73C 4JLGA 4XTXA 3BY7A 2CGHA 4DQ2A 5GANh 3CCMT 3M54A 4NL2A 5IAYA 1YIJT 2CZ1B 3QJYA 3OS1A 1LNXA 2R58A 4X9DA 3GPLA 4XU2A 1M9SA 3JCMf 3WXMB 2YRVA 3WVDB 4C92B 4FSXA 4C0DC 2HD0A 4HT9A 2EWNA 2H3JA 4M7DA 1VQ7T 4PJOE 3MEWA 4PJOD 5GAN8 5CKHA 4JUVA 3CCST 3JCMW 3JCMV 4M7DC 2X4JA 3L42A 2HAXA 3QIIA 1KHIA 3OY9A 2RJDA 3PNWC 2Y90A 3V7SA 1YJNA 3J7AF 3DB3A 3JRZA 3QBYA 2K3YA 5FU6C 1M1FA 3RUXA 2PU9B 1U8RA 4V2SA 3UWNA 3QSUA 2P4TA 1N9RA 2DTIA 4YTLA 4C92D 3M57A 4E7JA 1OI1A 5CKBA 3OYJA 3CC2A 1JB0E 1D3BB 2XU8A 3CMAT 1QP2A 3LGFA 1I81A 3X20B 1ZBXA 1WNLA 5GAN7 1M1KU 4F7UE 4J8OA 2QQBA 2PUKB 2VGMA 3CCVA 1Y96B 2EIFA 2KY9A 2HNIA 1NJIC 4R56A 1VQPT 4RCBA 5FRNA 4J7FA 2KAFA 4BI8B 3SWNA 3I55A 2DXBA 1M90C 3E19A 2M16A 4M7AE 2DVEA 1M8VA 3SWNC 4ELYC 2DXUA 3OBWA 1WJSA 5LJ3f 1AHJB 4Y91A 1M1GA 2X4WA 3VJPA 1Q7YC 3OYAA 3MHXA 4OGCA 3QG1A 3QUIA 2Y4XA 4HCBA 3BW1A 3META 2RH2A 3P8BB 1UGQB 3PGGA 2BUDA 2YHTA 3CPFA 3E1SA 4XTYA 3V8LA 4MMLA 4WF2A 1HXDA 3JCMJ 4M75F 1K8AU 1YHQA 1W2BA 2RI3A 2KK4A 4HKEA 2DJZA 2QQSA 3JB9F 3CC2T 1M5Q1 1IREB 2RI5A 4EMKA 3CC7A 4BY6C 2GFAA 4A54A 4UC4A 2JVVA 4RCCA 3PIPA 4EMKC 3OYHA 2MWPA 4IKFA 2P0PA 2RJEA 3LLRA 3M4YA 4MZMA 1HK9A 3QKJA 3WVEB 4ZGJB 3CCRA 3CCVT 2WSFE 4FM4B 5LJ5j 3OYBA 3CPWA 4B9XA 3OS0A 4C8QF 3L2RA 3CCUA 2DAQA 2F5TX 3CCQT 1VQ5A 2OTJA 4JS4A 2IVWA 3GNFB 5GAMf 5CQXA 1N27A 4M78G 3RKWA 3M9QA 5GAOl 3KXTA 3M4GA 2VYTA 4NL3A 5EG2A 4DA4A 5KE3A 2CZ7B 2HQEA 3FJPA 3GNGA 3P8HA 1I4K1 1Q82C 1VQ6A 3OS2A 2D0QB 4N4HA 3LWHA 1JBMA 4IUUA 2DIQA 1XOVA 4HCCA 4M78B 3V8KA 1V29B 3HRTA 2NLUA 3OYNA 1S72A 2E6ZA 5DM7R 3VYHB 3G7ZA 2YLBA 2RHIA 2FB7A 2WSEE 1VQOT 4M75A 5CKFA 4NS5A 5CIUA 3LYIA 4E7HA 3CCRT 2R57A 4JRPA 2LVMA 5GAOq 4M75C 4QVDA 1YIJA 4RG2A 1UB4A 3BDUA 3HSBA 4MMKA 3OYLA 1N8RU 2LC4A 4EDUA 4M7DE 3FDRA 1W4SA 3OSSC 1VQ5T 2XD0A 4M78D 1JRIA 4KULA 2RHZA 2LCCA 2XI9A 3MEAA 3OSVA 2FYKA 4J6WA 5GANe 5GANd 3DLLA 3TU4K 1QVGA 2ZPFB 2EQKA 3ER0A 5KH6A 2AHJB 3CCSA 1VQLT 2HQXA 2GFUA 4PJOG 1G3WA 1P92A 4C8QA 1NE8A 1ZQ1A 3ZEHA 4R55A 4PLIA 3QO3A 3QPHA 1VIFA 3A8LB 2LQ8A 3CEYA 4MDXA 3BDLA 2LDMA 4C8QC 2LT1A 1KC8C 2GF7A 4FT2A 1K9MU 2L8DA 3EFSA 4LDYA 1S72T 1YCYA 2XIDA 4LDVA 3QYHB 4L59A 4ZN1A 4A4EA 4PJOB 4J6YA 3E9FA 1G3TA 2PQWA 3L2ZA 4GLKA 1BI3A 5HK3A 5L8RE 3JB9H 5I2SA 1QVFS 3VU3C 2LCLA 4XU0A 5KCHA 1Q86U 3ME9A 3OS5A 2DXTA 2F69A 3FB9A 3E9GA 4JLIA 4BY6B 3GP8A 2ZZDA 2JTFA 1OZ3A 3QYGB 4F7UG 3H6ZA 1YJ9A 4KBMB 4E47A 1VQPA 3R6OA 2OAUA 4MZTA 4X9CA 2EYQA 1B34B 3MO8A 3MP8A 1XTDA 3JCMQ 2M9UA 3G71T 4BI4A 3OYGA 3QJ6A 2EQUA 3UT1A 5CAIA 4BE0A 4KUDK 4C5IA 4F7UB 2RK2A 3VYGA 4BDYA 3S3NA 1G3SA 4M7AG 2E1HA 4XTZA 4E7LA 2MWOA 4CRIA 1BI0A 5CR2A 2EQJA 2ZPGB 5J26A 5LJ3j 3NFCA 5LJ5g 2CKKA 3ZBDA 3FLGA 2PUOB 2E70A 3G4ST 2QEXA 4M7AB 1UGPB 2PVOB 4FU6A 4ZTFA 3HP9A 1PSFA 3ASKA 1ZHIA 3AHUA 2K5IA 1KQSA 3RESA 3JCMb 1WPYA 1NPRA 3C4SA 4PLLA 1Q81U 1KG1A 3JSCA 4XU3A 3JCMc 4N0AA 2LQKA 4M77A 3PIOA 2DEQA 1QP3A 5LJ5h 5GAN2 2GCXA 1BKBA 2XDPA 3OA6A 2IG0A 4N0AC 1YJ9T 4M77C 1NPPA 3HPWA 1IZ6A 2XG8D 1H641 4HT8A 3CCQA 2K5FA 2QI2A 4M7AD 4OB0B 3M53A 3CC4A 2DD4A 3CXCS 3OW2A 3X28B 4ZN3A 4OB2B 5GAN3 5D6XA 2EJFA 1LOJA 3QXEB 2Y4YA 4BDZA 3L1AA 3H8ZA 5GAMj 5GMKm 2XDDA 5GMKj 2MF2A 3NTKA 4LD6A 1KD1U 2V8JA 3RMQA 3LGLA 3JCMe 2ZCFB 3JCMd 3BFMA 2EQMA 2QEXT 1JJ2S 1KQ2A 1OYXA 4A4KA 1N8RC 2X4XA 4D6WA 2JN0A 3JCMg 3QDRB 2KDSA 4M75E 4P5NA 4M75D 2B8AA 2BKDN 3HRUA 3RMSA 3I56T 4RG8A 1VQOA 2JNGA 3OYYA 5D6YA 3CBPA 5FU7C 1K73U 2PVGB 4HA8A 5GAOn 1QVFA 4BUGA 5GAOr 2LRQA 1G3YA 2RHXA 5DY9A 2WSCE 2M1HA 4C0GA 1YBYA 3M5AA 4RMOA 4BE1A 3S3MA 4O5VA 5M9OA 2O01E 3NTHA 1VQ9T 3CC4T 4M7DG 3JCMh 3FIFA 4C8QE 3G6ET 1VQLA 3PT9A 4C0DB 4C92A 1I8FA 3C94A 3OYIA 5CK9A 3JCMP 4E7KA 4C92C 4KT0E 4M7DB 1FX7A 1FWZA 2KSSA 4O6JA 3V7RA 2DD5A 4ZTJA 4C5GA 4FT4A 1O75A 5CKEA 4BI3A 3VV0A 2VXFA 5I21A 2LTOA 4DOVA 2VXEA 3PTAA 3O8VA 2LT4A 4LDWA 5LJ3e 2RD1A 5FU6B 5LJ3d 1BIAA 3URGA 1M4ZA 1VQ4T 1QW1A 2VUBA 2CZ6B 2C06A 5HY6A 1MGQA 3GIBA 2XK0A 3LH0A 2FHDA 5LJ3g 3S3OA 1R8OB 2OTLA 2DTOA 1NJIU 3C12A 5IN1A 4M7DD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZD A;  3X20 B;  3QYG B;  1DJ7 B;  3A8G B;  3QZ5 B;  2PUK B;  4RKU E;  3X26 B;  2DXB A;  3VYG A;  1AHJ B;  2ZPG B;  2DPP B;  2PUO B;  3X24 B;  2QDY B;  2CZ0 B;  1UGQ B;  2CYZ B;  1UGP B;  2PVO B;  2ZPI B;  3LW5 E;  4ZGD B;  4Y28 E;  1PSF A;  2ZPH B;  1IRE B;  2ZPE B;  1QP3 A;  4ZGJ B;  3WVE B;  2WSF E;  4FM4 B;  3X25 B;  4OB0 B;  3A8M B;  2DD4 A;  3A8H B;  3X28 B;  4OB2 B;  3HHT B;  1UGS B;  3QXE B;  4XK8 E;  3QZ9 B;  4ZGE B;  2CZ7 B;  2ZCF B;  2D0Q B;  1V29 B;  3VYH B;  2PVG B;  2WSE E;  2WSC E;  2ZPB B;  1GXI E;  4L6V 5;  2O01 E;  1UGR B;  2DXC A;  2CZ1 B;  3A8O B;  2ZPF B;  3WVD B;  2AHJ B;  2PVD B;  4KT0 E;  2DD5 A;  3A8L B;  4OB1 B;  4OB3 B;  3QYH B;  2CZ6 B;  2PU9 B;  5L8R E;  1PSE A;  1JB0 E;  1QP2 A; 
#chains in the Genus database with same CATH topology
 2WAC A;  1OEB A;  1M90 U;  2EW3 A;  3EH1 A;  5IT9 E;  5FWB A;  3ULR B;  3SHW A;  3X26 B;  2HL5 C;  1MUZ A;  3SWN B;  2YUQ A;  4FSS A;  3GOX A;  4BE2 A;  6AT1 B;  3X24 B;  5GMK e;  2QDY B;  5LL6 S;  4M77 E;  2F2V A;  5GAM g;  3OYE A;  3CCE Q;  3LWI A;  2RJF A;  4LDU A;  4LUD A;  3CCJ T;  3EH2 A;  1KFZ A;  5KYY A;  2K4Y A;  2DF6 A;  3HFO A;  2QA4 T;  4CC2 A;  2J6F A;  4E7S A;  4KUI A;  2D9T A;  3PFS A;  4Z8A A;  2RJC A;  3V7C A;  3HHT B;  2R5A A;  2JOY A;  1VQN Q;  1D1B A;  2JUF A;  2MYS A;  3NGP A;  4QKU A;  4N4I A;  1UEB A;  3I56 A;  1T3L A;  1VQM T;  1ZSG A;  4OVA A;  4OP0 A;  1MMG A;  4MZP A;  3TEE A;  1MMD A;  3I9Q A;  4DOW A;  3A5Z B;  1VQK Q;  1VQ8 Q;  4RTZ A;  3CCL Q;  1VQ9 A;  3JV3 A;  2X4Y A;  4CC7 A;  4C92 E;  3G6E A;  1UGR B;  4C8Q G;  3INZ A;  1YIT A;  3KUF A;  2BE9 B;  4HXJ A;  1M3A A;  3A8O B;  4II1 A;  2FPE A;  4JDS A;  2KRO A;  2RHU A;  1G8X A;  1WA7 A;  5KYU A;  3OYM A;  2O4X A;  2EGE A;  5CO7 A;  4OB3 B;  4A4F A;  3JB9 D;  1BCM A;  2HSE B;  3GF5 A;  1ARK A;  4NOY A;  1IGQ A;  1I0C A;  1LJO A;  1G83 A;  1OZ2 A;  2A37 A;  3OYF A;  2RO0 A;  1TUD A;  1Z9Z A;  3OYD A;  3QZ5 B;  4RKU E;  1EZZ B;  2HBW A;  4J9C A;  4L5G A;  3EHQ A;  1J3T A;  2D8J A;  1WGS A;  4PL6 A;  4JJC A;  2L5Q A;  3JCM X;  2M0Y A;  4HCZ A;  2RQV A;  3M59 A;  1U3O A;  1YJW T;  2OX7 A;  1OPK A;  2K6D A;  4JZ3 A;  2CZ0 B;  2KYB A;  4IUQ A;  4ZGD B;  1I5L A;  4M7A C;  1PKS A;  1PM3 A;  3CCJ A;  2XHC A;  1YHQ T;  2ZPE B;  3IQL A;  2L89 A;  3VS2 A;  4HVW A;  4M77 B;  4AFU C;  2QA4 A;  1K1Z A;  4RTY A;  3I55 Q;  1WJQ A;  1ZUY A;  3M55 A;  5KYX B;  3A8H B;  1D1A A;  2E5K A;  3CCU T;  5GAM d;  3OW2 S;  1ZX6 A;  1VQM A;  2D6F A;  1RAB B;  5L23 A;  2ESW A;  5GAN g;  3OYK A;  3A1P A;  5FU7 B;  1B3Q A;  3TCJ A;  3FEO A;  2P0K A;  3J80 E;  4PKC C;  1YI2 T;  1UG1 A;  2KGT A;  2ZPB B;  1K0X A;  1GXI E;  3N5B B;  1K73 C;  4JLG A;  2CGH A;  3CCM T;  1NLO C;  3QJY A;  2R58 A;  2EQI A;  3WXM B;  4C92 B;  3FJ5 A;  4FSX A;  2CDT A;  4HT9 A;  4PJO E;  3MEW A;  4KH1 B;  4Z88 A;  3JCM W;  2X4J A;  1D1C A;  3PNW C;  2F2X A;  3QBY A;  2CUD A;  2QAS A;  1YIJ Q;  1PG5 B;  2ED0 A;  3QSU A;  5CKB A;  1JB0 E;  3CMA T;  3LGF A;  1X2Q A;  1WNL A;  1ZSZ C;  2DFU A;  1VQ7 Q;  1GRI A;  2FZC B;  1Y96 B;  1ZUU A;  1WYX A;  3SWN A;  1N8R R;  1MV0 B;  2DVE A;  5LJ3 f;  2GBQ A;  3OYA A;  4OGC A;  1E6H A;  3GBQ A;  3MET A;  3E1S A;  4XTY A;  1YP5 A;  1YHQ A;  1W2B A;  1X27 A;  1AZG B;  3CC2 T;  2H3E B;  1XJW B;  1VQP Q;  4UC4 A;  3CQT A;  4RCC A;  4EMK C;  1AD5 A;  3UA7 A;  2P0P A;  3LLR A;  4MZM A;  3WVE B;  3CCV T;  3CCR A;  2WSF E;  2CH4 W;  3CPW A;  3L2R A;  3CCU A;  1VQ5 A;  2W0Z A;  3RKW A;  3M9Q A;  4NL3 A;  4RTU A;  2COY A;  2ROT A;  2D0Q B;  2HCK A;  3LWH A;  1JBM A;  3QDF A;  1UUE A;  3HRT A;  4FYY B;  4PFZ A;  3M0Q A;  3CCQ Q;  1VQO T;  5CIU A;  5FW9 A;  2IPO B;  3NPF A;  3BDU A;  4HVV A;  4M7D E;  1TXQ A;  2LCC A;  1RAC B;  5GAN d;  2OJ2 A;  1GCP A;  1NE8 A;  3QO3 A;  2LJ0 A;  2VVK A;  4C8Q C;  3E2U A;  2LT1 A;  1KC8 C;  1K9M U;  2JXB A;  1VYT A;  1YCY A;  4PJO B;  3H9N A;  1EFN A;  3L2Z A;  1BI3 A;  5HK3 A;  2LZ6 B;  1TG0 A;  5I2S A;  2VWF A;  3VU3 C;  5IH2 A;  3ME9 A;  1KIK A;  4OMM A;  4JLI A;  1K73 R;  2DL5 A;  1B34 B;  1S72 Q;  2EQU A;  4KUD K;  2MCN A;  1Y57 A;  2RQW A;  5IHI A;  2MWO A;  5LJ5 g;  5LJ3 j;  1ZA1 B;  4DBR A;  2COW A;  1PSF A;  5IHK A;  2K5I A;  3SEM A;  1NLP C;  1WPY A;  2L2P A;  1KG1 A;  1PCX A;  2RQR A;  4M77 A;  1MMN A;  2IG0 A;  1QWE A;  4AG2 C;  1IZ6 A;  4HT8 A;  4M7A D;  5KYX A;  3OW2 P;  3CXC S;  1SPK A;  2COZ A;  4OB2 B;  5GAN 3;  3QXE B;  1LOJ A;  4BDZ A;  2HMA A;  3L1A A;  4LD6 A;  2V8J A;  1NG2 A;  3LGL A;  2QEX T;  1UEC A;  2KDS A;  3VRZ A;  1VQO A;  4AFQ C;  1M2V B;  2PVG B;  3RBB B;  5GJV B;  1Q86 R;  1G3Y A;  1PRM C;  2JMA A;  4AT1 B;  2M1H A;  4C0G A;  3S3M A;  4AFZ C;  2JM8 A;  2KR3 A;  2DIL A;  3TSW A;  4B6M A;  2V1R A;  1GFC A;  4R0K A;  4C92 A;  1SSH A;  3I56 Q;  3OYI A;  2RNA A;  4M7D B;  1FWZ A;  4O6J A;  3V7R A;  2A0F B;  1B07 A;  3VV0 A;  2QAZ A;  2LTO A;  1TU0 B;  2LT4 A;  4LDW A;  7AT1 B;  3URG A;  4RTX A;  1VQ4 T;  2HZY A;  1VQ9 Q;  2DNU A;  3CC4 Q;  3G6E Q;  1LVK A;  2OTL A;  2NWM A;  2J6K A;  5IN1 A;  2DKG A;  3UPU A;  3A98 A;  4TVR A;  1Y96 A;  1K9A A;  2ATC B;  4IUP A;  2XIC A;  1M1K C;  1RL2 A;  2BTT A;  2DVJ A;  1W6X A;  2E64 A;  1MV3 A;  3L2V A;  1M27 C;  3PE0 A;  1KC8 R;  4QQG A;  5J39 A;  2YRC A;  1K0S A;  2LCS A;  2CYZ B;  4EPC A;  2DER A;  3SB2 A;  2FEI A;  1PRL C;  1BYM A;  3C95 A;  2MAM A;  1QVP A;  2DZC A;  4KGX B;  2H8H A;  2AZS A;  3PMT A;  3L2Q A;  5HKC A;  1W2B S;  1IXD A;  1UHC A;  3H0I A;  2K2V A;  3CME A;  1TSF A;  2KRS A;  1X01 A;  2DTH A;  2GTJ A;  5LJ5 d;  1Y07 A;  5GJW B;  4N4G A;  3CPW S;  4ME7 A;  4ZGE B;  2P4R A;  4BAC A;  4J5Y A;  4PJO F;  3JAM E;  2F5K A;  4J6X A;  1AWW A;  2RI2 A;  4EMH A;  3CCJ Q;  4FL6 A;  2YLC A;  2PNI A;  1Q95 G;  1U1T A;  1WQW A;  2QA4 Q;  3P8D A;  4BB7 A;  2E10 A;  5KYW B;  2X9H A;  1YN8 A;  2EGC A;  4C5E A;  2HSP A;  4L6V 5;  2DXC A;  1M2O A;  3RKX A;  1VQM Q;  5FRO A;  5KYN A;  2MOX A;  4HCK A;  4FIB A;  1EIF A;  2KVQ G;  2CP5 A;  2YT6 A;  1VQ4 A;  2L3R A;  4ATO A;  4PJO A;  2EPD A;  2AZV A;  1H92 A;  1YJN T;  3UA6 A;  2XDB A;  5FRM A;  5DLO A;  3M0P A;  1O9S A;  4C8Q D;  2YXY A;  3MP1 A;  3DB4 A;  1YIT T;  1B34 A;  2ED1 A;  1KJW A;  2M02 A;  5CKD A;  1CSK A;  4BD3 A;  2BE7 D;  4LE9 A;  3JB9 J;  3LX7 A;  4EMG A;  1CKA A;  2FO0 A;  5C0M A;  2DBK A;  1M30 A;  2DPP B;  3GLX A;  4OMP A;  4E2F B;  1XQH A;  1I07 A;  4FYV B;  4M77 G;  3PMI A;  1D3B A;  4FW1 A;  4QQ6 A;  3T9N A;  3VUB A;  5GMK i;  1R0C B;  1UJY A;  2QTX A;  3ZL7 C;  1Z9Q A;  1AZE A;  5IXF A;  1Q7Y U;  3CXC P;  1R0B G;  2DK3 A;  5GAO p;  2FRW A;  3CBO A;  1Q81 C;  3VKI A;  3SD4 A;  3X25 B;  1YJW Q;  4M7D F;  1K4U S;  5I2M A;  1EX4 A;  2VV5 A;  2O9S A;  2KMT A;  5GAM e;  4M78 E;  2OTJ T;  4J9H A;  1YHQ Q;  1KHC A;  1QCF A;  3NMZ C;  1UJ0 A;  1YWP A;  1VQ6 T;  4K11 A;  4XAX B;  2FPF A;  1GBR A;  2QK0 A;  1M2V A;  5A2Q E;  1QKW A;  3THK A;  3VS7 A;  2EAY A;  3CCU Q;  1AVZ C;  3MCA B;  2LX7 A;  4C92 G;  4PFO A;  2A08 A;  3AT1 B;  4NL2 A;  5IAY A;  2BZY A;  3JCM f;  2DL3 A;  2YRV A;  1QCN A;  2A36 A;  2HD0 A;  1NM7 A;  2EWN A;  2H3J A;  4M7D A;  4PJO D;  3CCS T;  2C0T A;  2HAX A;  1HJD A;  1YI2 Q;  2M51 A;  1YJN A;  8ATC B;  3J7A F;  2K3Y A;  1M1F A;  3CCM Q;  4PJM A;  4V2S A;  3UWN A;  2P4T A;  4E7J A;  3OYJ A;  4ESR A;  4J8O A;  2QQB A;  2PUK B;  1OQK A;  5I22 A;  3VS4 A;  2HNI A;  2F2W A;  3EG9 B;  4RCB A;  5FRN A;  2YRD A;  1M90 C;  2CT4 A;  2M16 A;  1NBE B;  3SWN C;  2DXU A;  3OBW A;  4Y91 A;  1Q7Y C;  3MHX A;  2Y4X A;  4PJL A;  3CMA Q;  3CPF A;  2EKH A;  3V8L A;  1HSQ A;  3JCM J;  1W2B P;  1K8A U;  2KK4 A;  2DJZ A;  2VKN A;  2RI5 A;  1IRE B;  4BY6 C;  2GFA A;  2YDL A;  4A54 A;  1M8M A;  4AFS C;  3PIP A;  1YFN A;  4ZGJ B;  2DRM A;  1QMC A;  1W1F A;  1QQJ A;  3CPW P;  2CRE A;  3OYB A;  4B9X A;  3OS0 A;  1PKT A;  2DAQ A;  2OTJ A;  5GAM f;  3O5Z A;  2VYT A;  4DA4 A;  3CC2 Q;  2HQE A;  1TUG B;  3GNG A;  2PTK A;  1VQ6 A;  3OS2 A;  2DIQ A;  4M78 B;  3CCV Q;  2NLU A;  2YLB A;  2RHI A;  2MIO A;  2YUP A;  2EGA A;  3EFO B;  4D8D A;  3LYI A;  5KYW A;  3CCR T;  2R57 A;  4JRP A;  2LVM A;  4QVD A;  1Q81 R;  1UB4 A;  1U5S A;  4MMK A;  3OYL A;  1RAA B;  2O88 A;  1ZSZ B;  1VQ5 T;  4PK4 A;  5GAN e;  1QVG A;  3TU4 K;  2ZPF B;  3ER0 A;  1VQL T;  3CCS A;  4PJO G;  1P92 A;  4R55 A;  1N5Z A;  3CEY A;  3EG0 A;  1VQO Q;  4MDX A;  2L8D A;  4LDY A;  4OMO A;  4ZN1 A;  2NYS A;  3QYH B;  4A4E A;  5L8R E;  5IXB A;  2DET A;  1QVF S;  2LCL A;  4XU0 A;  1Y0M A;  1Q86 U;  2F69 A;  2JTF A;  1OZ3 A;  2KRN A;  2RMO A;  1YJ9 A;  4E47 A;  2OAU A;  4MZT A;  2EYQ A;  3MP8 A;  1V76 A;  3UT1 A;  1IRX A;  5CAI A;  5ECA A;  4C5I A;  3M0R A;  4PFP A;  4AMC A;  4JJB A;  1UGV A;  3UAT A;  1UGP B;  4FU6 A;  1KQS A;  3RES A;  3C4S A;  1NPR A;  4PLL A;  2CP0 A;  4XU3 A;  4N0A A;  3VS5 A;  3VS3 A;  1QP3 A;  2GCX A;  1BK2 A;  4M77 C;  2K9G A;  4JPB W;  2QI2 A;  4OB0 B;  3M53 A;  1FMK A;  4KGV B;  1M90 R;  1M3B A;  2Y4Y A;  5GAM j;  5GMK m;  5GMK j;  1KD1 U;  3RMQ A;  1UDL A;  5I11 A;  1OX8 A;  1GCQ A;  1RLQ C;  4M75 E;  2B8A A;  3HRU A;  3RR6 A;  2JNG A;  1KK7 A;  3OYY A;  5FU7 C;  2CP3 A;  4HA8 A;  3MPU B;  2JJ9 A;  1C6V X;  1PD1 A;  2ZAE A;  4CC3 A;  2KXC A;  5GAO r;  3KFV A;  4O5V A;  2O01 E;  4Z89 A;  4M7D G;  3EG1 A;  3FIF A;  2QEX Q;  1VQL A;  4C0D B;  3C94 A;  5CK9 A;  2GTO A;  4C92 C;  2AKK A;  1FX7 A;  2DD5 A;  3M0T A;  2LQN A;  1O75 A;  4BI3 A;  2EVR A;  3PTA A;  2RD1 A;  5FU6 B;  5LJ3 d;  1M4Z A;  2CZ6 B;  5HY6 A;  3GIB A;  3LH0 A;  2FHD A;  1RAF B;  1NJI U;  3C12 A;  1BBZ A;  1N9S A;  4Z02 A;  1DJ7 B;  3EFR A;  4JRK A;  2J05 A;  4JS5 A;  4XTW A;  3QWX X;  1AOJ A;  1U06 A;  4QVZ A;  1VQK A;  2K3X A;  5LJ3 h;  1H3Z A;  1VQ4 Q;  2BZX A;  4QQD A;  3CD6 T;  8AT1 B;  1RAI B;  4M77 F;  1WHJ A;  2E41 A;  4C5H A;  3EAE A;  2AT1 B;  2VAS A;  1SF9 A;  1VIE A;  1WFW A;  1BI2 A;  1SKU B;  1Y7X A;  5A0L A;  2P84 A;  1AWO A;  4XTV A;  1FMW A;  2E65 A;  2V8K A;  2OTL T;  4FYX B;  1AWX A;  2A7Y A;  3QHS A;  5GAN 6;  5LJ5 e;  3RNJ A;  3L2U A;  1Q82 U;  1RAD B;  1UGS B;  2G3R A;  4X34 A;  1SRM A;  2J7I A;  1CKB A;  1G2B A;  3FRN A;  4J9F A;  4J83 A;  2X3X D;  4M78 A;  1X6O A;  3DLM A;  1YWO A;  5GMK l;  3UDC A;  3QWY A;  3VUZ A;  1LCK A;  3NHN A;  4C92 F;  3EFO A;  4M75 B;  3V8J A;  1NZ9 A;  3CME T;  3FC3 A;  1VUB A;  1QWF A;  1D09 B;  2KE9 A;  3MP6 A;  2V26 A;  1PWT A;  1NEG A;  5GAN j;  1GL5 A;  4JRI A;  4E7Z A;  1SG5 A;  2LNH B;  2CSI A;  4Q5W A;  3TRE A;  1QVG S;  4IUV A;  1QVF P;  4IUR A;  2J06 A;  4JJN K;  4FCY A;  4PJO C;  1K9M C;  1PSE A;  4A4G A;  2HKN A;  2ZGW A;  4F16 A;  3OQ5 A;  1PHT A;  1FYN A;  2DO3 A;  2LQW A;  2RA2 A;  4XQ3 A;  3CD6 A;  2NUP B;  2DRK A;  4LDX A;  1W70 A;  2RM4 A;  1YJN Q;  3OMC A;  1WQ7 A;  1IHV A;  3M56 A;  2AK5 A;  3RER A;  3LW5 E;  2GQI A;  3TVT A;  1YIT Q;  1TTH B;  5J3B A;  2ZPH B;  2KQW A;  2QYZ A;  1WIE A;  2RK1 A;  2F1L A;  3RDV A;  2E5Q A;  2VGN A;  3CC7 T;  1RAE B;  1KQS S;  2V8I A;  3HRS A;  1OX9 A;  5LJ5 f;  2HL3 A;  1JEG A;  3MEU A;  3A8M B;  1JJ2 A;  1UFF A;  2RN8 A;  4DBF A;  3QZ9 B;  3EGU A;  2EJ9 A;  2KT1 A;  4CC4 B;  1PD0 A;  2HBP A;  3MEV A;  4M77 D;  4A53 A;  2ABL A;  1VQ7 A;  2FL7 A;  4X1V A;  1YNZ A;  5C6S A;  5KE2 A;  2R5M A;  2O4X B;  1G5V A;  5A0G A;  4FW2 A;  1JU5 C;  2EKO A;  1I1J A;  1SSF A;  2J6O A;  4QT7 A;  1SHF A;  2JZ2 A;  4B9W A;  1WHK A;  2KNB B;  4XTX A;  3BY7 A;  4DBQ A;  3M54 A;  2CZ1 B;  3OS1 A;  1M9S A;  2KYM A;  1VQ6 Q;  2RF0 A;  1ABO A;  2HQH A;  1BB9 A;  5GAN 8;  4DEX A;  1R77 A;  4M7D C;  3H0F A;  3QII A;  2QTV A;  1KHI A;  2Y90 A;  3V7S A;  3DB3 A;  1D0X A;  3RUX A;  1U8R A;  4LN2 A;  1N9R A;  2DTI A;  4C92 D;  4KGZ B;  1OI1 A;  4FYW B;  2AIR B;  1RAG B;  1T0J A;  3X20 B;  1ZBX A;  1WXB A;  5GAN 7;  4F7U E;  4J9D A;  3CCS Q;  2EIF A;  2KY9 A;  4J7F A;  2L0A A;  2MPX C;  3E19 A;  4M7A E;  1GFD A;  2JTE A;  1M8V A;  1X43 A;  1WJS A;  3VJP A;  1AHJ B;  1M1G A;  2X4W A;  3QG1 A;  4HCB A;  3MKD A;  2RH2 A;  2C0I A;  3P8B B;  1UGQ B;  2YHT A;  4MML A;  4WF2 A;  4M75 F;  2FG0 A;  3JB9 F;  1K9M R;  3CC7 A;  3VS0 A;  2JVV A;  1I5O B;  3OYH A;  4IKF A;  1RAH B;  2EYY A;  2RJE A;  4RUG A;  2PZ1 A;  5LJ5 j;  3R6N A;  4JS4 A;  3GNF B;  2JS0 A;  1WLP B;  5CQX A;  1N27 A;  2LJ3 A;  2QG9 B;  4M78 G;  3M4G A;  2DE0 X;  5KE3 A;  3FJP A;  1I4K 1;  3I35 A;  4ORZ A;  4N4H A;  1V29 B;  4HVU A;  1S72 A;  3MJX A;  2E6Z A;  4F17 A;  2ROL A;  3G7Z A;  2LJ1 A;  2YUO A;  4M75 A;  5CKF A;  1HD3 A;  5GAO q;  1M1K R;  1IB8 A;  3HSB A;  1N8R U;  4J9B A;  4EDU A;  3FDR A;  3OSS C;  1JRI A;  1QVG P;  2XI9 A;  3MEA A;  3OSV A;  1NEB A;  2FYK A;  3DLL A;  3LH5 A;  2HQX A;  2GFU A;  1G3W A;  1MND A;  1ZQ1 A;  3ZEH A;  3QPH A;  3A8L B;  2DBM A;  2LDM A;  1WXU A;  1UE9 A;  2GF7 A;  4FT2 A;  3CCR Q;  2AKL A;  2O9V A;  4LDV A;  4J9E A;  3VS6 A;  3E9F A;  1X69 A;  2SEM A;  1VQ5 Q;  4LUE A;  2DXT A;  3FB9 A;  2K2M A;  4BY6 B;  3GP8 A;  2ZZD A;  1VQL Q;  4KBM B;  4X9C A;  2M9U A;  3G71 T;  4ZNX A;  4PJJ A;  4BI4 A;  3OYG A;  4RTT A;  4BE0 A;  2NUP A;  2CSQ A;  2DYI A;  4F7U B;  4BDY A;  2QGF B;  1G3S A;  2E1H A;  4XTZ A;  4CRI A;  5CR2 A;  2EQJ A;  4GBQ A;  3NFC A;  2CKK A;  3FLG A;  2E70 A;  3G4S T;  4M7A B;  2PVO B;  3I5R A;  1TS9 A;  4ZTF A;  3HP9 A;  1KQS P;  3ASK A;  3AHU A;  3JCM b;  3JSC A;  3JCM c;  3PIO A;  2D8H A;  1OU8 A;  2VB6 A;  2XDP A;  3D7S B;  4N0A C;  1YJ9 T;  1QKX A;  3HPW A;  4A63 B;  2V1Q A;  2XG8 D;  1PNJ A;  3CC4 A;  3X28 B;  5D6X A;  1MNE A;  2EJF A;  1B7T A;  1VOM A;  2D1X A;  1OV3 A;  3JCM d;  2EQM A;  1JJ2 S;  1KQ2 A;  1N8R C;  1WHG A;  2JN0 A;  2MK5 A;  3QDR B;  4P5N A;  4M75 D;  1GCQ C;  2BKD N;  3RMS A;  3REB B;  4RG8 A;  1LPL A;  5D6Y A;  1K73 U;  1ZLM A;  4BUG A;  2O31 A;  2WSC E;  1RI9 A;  1YBY A;  2FZK B;  4BE1 A;  5M9O A;  5D7U A;  3JCM h;  4C8Q E;  1A0N B;  2K3B A;  4WTO B;  1RUW A;  2DA9 A;  1QCO A;  2GNC A;  2XMF A;  2KSS A;  4ZTJ A;  5CKE A;  2VXF A;  4DOV A;  3O8V A;  1OOT A;  5LJ3 e;  1RLP C;  2X51 A;  4OML A;  1QW1 A;  1QLY A;  1MGQ A;  5LJ3 g;  1UTI A;  3S3O A;  1BU1 A;  1R8O B;  2A28 A;  2DTO A;  4M7D D;  5KCO A;  2DIG A;  3G71 A;  2DL8 A;  4PNO A;  3CCE T;  2MI6 A;  4A4H A;  2E12 A;  3CXC A;  1S1N A;  2FVU A;  1C1A A;  1ZBJ A;  3G4S A;  1U1S A;  2QXF A;  3SDZ A;  1X6B A;  2ZPI B;  3J81 E;  2K7A A;  2K5L A;  1VQN T;  2HKQ B;  4EMK B;  3RKY A;  1BI1 A;  1X75 C;  2QQ9 A;  3OYC A;  1K8A C;  5CVI A;  2CP2 A;  2EYW A;  3CD6 Q;  2CH4 A;  1KQ1 A;  5CQY A;  4CI0 C;  1VQK T;  4VUB A;  5GAM h;  1E6G A;  5GMK h;  1VQ8 T;  3M58 A;  3CCL T;  4C0F A;  2EJG A;  4XK8 E;  1H3H A;  1ACM B;  1RI0 A;  1XNI A;  3G1J A;  2OTL Q;  2DX1 A;  1WZO A;  2OI3 A;  1VYU A;  3JB9 I;  2E6N A;  4M75 G;  4OF1 A;  4M4Z A;  4M78 C;  3JB9 G;  3NTI A;  1YCS B;  2XKO C;  1JXO A;  2JMC A;  4QW2 A;  1JQQ A;  4C0Z A;  4E7I A;  1OPL A;  1VYV A;  2JM9 A;  2CT3 A;  4LNP A;  4OGE A;  4F7U F;  2RB6 A;  2I2L A;  2X35 A;  1BIB A;  3CBM A;  4GY5 A;  5D6W A;  1Q7Y R;  4F04 B;  4J7I A;  2DEU A;  2I0N A;  4JRQ A;  1KC8 U;  2P0Q A;  4RTW A;  4QVC A;  3EG3 A;  4M7A F;  2PVD B;  5DLQ E;  3EG2 A;  4IIM A;  3EGD B;  4C8Q B;  3HL8 A;  1WHL A;  4OB1 B;  4LXC A;  1OU9 A;  2C0O A;  5GAN 5;  1YJW A;  4XTU A;  3CME Q;  1Y71 A;  4OMF B;  4MDW A;  5GAN 4;  3HTR A;  2DZ9 A;  3C0C A;  2VC8 A;  2FPD A;  1MHN A;  1SRL A;  1ABQ A;  3S6W A;  1JO8 A;  2BIV A;  5GAN f;  3CCE A;  3RIR A;  3A8G B;  2CS7 A;  5HK0 A;  2EFI A;  1VA7 A;  1Q86 C;  3KBG A;  2RHY A;  4E6R A;  4F7U A;  5AYF A;  3PVQ A;  3I55 T;  2YUN A;  2L3S A;  2Z0W A;  4ELZ C;  2G6F X;  2M0O A;  3Q1J A;  1MMA A;  2JTM A;  2LMJ A;  3HKS A;  4M7A A;  3OBY A;  2K79 A;  1VQN A;  1TUC A;  4Y28 E;  4XU1 A;  4LD9 K;  3ZFJ A;  5FLX E;  1FXX A;  2YWW A;  2CP6 A;  1WJR A;  2NUT B;  1X2K A;  2B86 A;  2A3L A;  5CCA A;  3BE3 A;  2QGG A;  3EG9 A;  5GAO m;  1N6A A;  2KEA A;  5A0D A;  1YI2 A;  2MMP A;  2GQV A;  1VQ8 A;  4EIK A;  3L2W A;  4M78 F;  3CCL A;  1X6G A;  3CCM A;  4WCI A;  1IO6 A;  3OB9 A;  1JJ2 P;  2K57 A;  1JXM A;  2KI7 A;  3HFN A;  2DL4 A;  3VS1 A;  2LNV A;  3M0U A;  3SFM A;  1SEM A;  3H41 A;  2EBP A;  3OMG A;  3F70 A;  2KT8 A;  3CC7 Q;  1NYG A;  4IUT A;  1KD1 C;  1WXT A;  2QQR A;  4J9I A;  4OMN A;  2SRC A;  1M3C A;  1K8A R;  2QQA A;  3DKM A;  2DMO A;  3CMA A;  2LX9 A;  9ATC B;  1TH7 A;  4DQ2 A;  2JS2 A;  4RTV A;  5GAN h;  1YIJ T;  3H0H A;  1LNX A;  1WDX A;  1WI7 A;  4X9D A;  3GPL A;  4XU2 A;  3WVD B;  3TSZ A;  4C0D C;  4PJN A;  1VQ7 T;  3M0S A;  5CKH A;  4JUV A;  3JCM V;  1T0H A;  1ZA2 B;  3L42 A;  3OY9 A;  2RJD A;  5IHN A;  3JRZ A;  1UHF A;  1AWJ A;  2RQU A;  5FU6 C;  2PU9 B;  3EGX B;  4YTL A;  3M57 A;  3CC2 A;  1ZSZ A;  1D3B B;  2DJQ A;  2XU8 A;  1QP2 A;  1I81 A;  1M1K U;  1IGU A;  2VGM A;  3CCV A;  4DBH A;  1NJI C;  4R56 A;  1VQP T;  2DYB A;  2KAF A;  4BI8 B;  3I55 A;  2DXB A;  2RQT A;  4D8K A;  4ELY C;  3QUI A;  2FRY A;  3BW1 A;  3PGG A;  2BUD A;  4F14 A;  2W10 A;  1HXD A;  2RI3 A;  4HKE A;  2QQS A;  3I5S A;  1M5Q 1;  3UF4 A;  4EMK A;  2HDA A;  3PVL A;  2DLP A;  1OUL A;  2MWP A;  5KYY B;  3M4Y A;  1BCO A;  2CP7 A;  1HK9 A;  3QKJ A;  4JZ4 A;  4FM4 B;  2O2O A;  2QDL A;  4C8Q F;  2X3W D;  2DL7 A;  2CUB A;  3CCQ T;  2F5T X;  2IVW A;  2FZG B;  3KXT A;  5GAO l;  5EG2 A;  1TWB A;  3REA B;  2CZ7 B;  3P8H A;  1FMV A;  1Q82 C;  4IUU A;  1XOV A;  4HCC A;  3V8K A;  2D0N A;  3OYN A;  4KRT A;  3VRY A;  5DM7 R;  3VYH B;  1D0Z A;  2IIM A;  2FB7 A;  2WSE E;  2E3I A;  2NUZ A;  4NS5 A;  4E7H A;  3EHR A;  4M75 C;  1YIJ A;  4RG2 A;  4AG1 C;  2LC4 A;  1W4S A;  2ECZ A;  2XD0 A;  4M78 D;  4KUL A;  2GGR A;  2RHZ A;  1SHG A;  4J6W A;  2KRM A;  2EQK A;  5KH6 A;  2AHJ B;  1T3S A;  2KXD A;  2E3H A;  2BZ8 A;  3EGD A;  4C8Q A;  5KYU B;  4PLI A;  4IIO A;  1VIF A;  2LQ8 A;  4OMQ A;  3BDL A;  4Y92 A;  1C0M A;  3EFS A;  4KH0 B;  1S72 T;  2XID A;  1KD1 R;  1TOV A;  4L59 A;  4J6Y A;  1G3T A;  2PQW A;  4GLK A;  2EYX A;  2OTJ Q;  3JB9 H;  2KBT A;  1KSW A;  5KCH A;  3OS5 A;  2E4H A;  3E9G A;  3QYG B;  4F7U G;  3TQ7 P;  2DM1 A;  1IHW A;  4J9G A;  3H6Z A;  1VQP A;  3R6O A;  3MO8 A;  1XTD A;  3JCM Q;  3QJ6 A;  2RK2 A;  3VYG A;  3S3N A;  4M7A G;  2YSQ A;  1ZUK A;  4E7L A;  1BI0 A;  2ZPG B;  5J26 A;  4GLM A;  1D0Y A;  3ZBD A;  2PUO B;  4ANJ A;  4JJD A;  2QEX A;  2ENM A;  1F1B B;  1ZHI A;  2NUT A;  2L3Q A;  1Q81 U;  3G71 Q;  2LQK A;  2DEQ A;  5LJ5 h;  2JT4 A;  5GAN 2;  1BKB A;  3OA6 A;  1NPP A;  1E7O A;  2EYZ A;  1H64 1;  3CCQ A;  2K5F A;  1NJI R;  2L3P A;  2DD4 A;  3OW2 A;  1AT1 B;  3G4S Q;  4ZN3 A;  3H8Z A;  2XDD A;  2MF2 A;  3NTK A;  3JCM e;  2ZCF B;  1HYO A;  3BFM A;  1OYX A;  4A4K A;  2X4X A;  4D6W A;  3JCM g;  1YJ9 Q;  3I56 T;  5FWC A;  3CBP A;  5GAO n;  1QVF A;  2LRQ A;  1AEY A;  2RHX A;  5DY9 A;  1K76 A;  3U23 A;  4RMO A;  3M5A A;  1GBQ A;  2JW4 A;  3NTH A;  1VQ9 T;  1PC0 A;  1V1C A;  3CC4 T;  3G6E T;  3PT9 A;  2HEQ A;  5HCK A;  1I8F A;  3JCM P;  4E7K A;  4KT0 E;  4DEY A;  1Q82 R;  4C5G A;  4FT4 A;  2OAW A;  5I21 A;  2VXE A;  2LP5 A;  1WHH A;  1NYF A;  1H8K A;  1WHM A;  1BIA A;  2RPN A;  2VUB A;  2C06 A;  2XK0 A;  3EGX A;  5AT1 B;  5EC7 A;  1WX6 A; 
#chains in the Genus database with same CATH homology
 5KCO A;  1N9S A;  2DKG A;  2WAC A;  2DIG A;  3UPU A;  4Z02 A;  1DJ7 B;  3EFR A;  4JRK A;  1M90 U;  3G71 A;  4TVR A;  5IT9 E;  1Y96 A;  4PNO A;  4JS5 A;  3CCE T;  4XTW A;  2MI6 A;  3X26 B;  2E12 A;  4A4H A;  3CXC A;  4QVZ A;  1VQK A;  4IUP A;  2XIC A;  2FVU A;  2K3X A;  1RL2 A;  5LJ3 h;  3SWN B;  1M1K C;  1H3Z A;  4QQD A;  3CD6 T;  2E64 A;  3GOX A;  3L2V A;  4M77 F;  3G4S A;  4BE2 A;  4QQG A;  1U1S A;  2E41 A;  2QXF A;  4C5H A;  3X24 B;  5J39 A;  3EAE A;  2QDY B;  3SDZ A;  5GMK e;  2CYZ B;  2ZPI B;  5LL6 S;  4EPC A;  1VIE A;  4M77 E;  3SB2 A;  3J81 E;  1BI2 A;  5A0L A;  1Y7X A;  5GAM g;  2K5L A;  4XTV A;  3OYE A;  1VQN T;  2E65 A;  1BYM A;  2V8K A;  3C95 A;  2MAM A;  2OTL T;  3LWI A;  1QVP A;  2DZC A;  2RJF A;  4EMK B;  4LDU A;  3RKY A;  1BI1 A;  2A7Y A;  3PMT A;  3L2Q A;  1X75 C;  2QQ9 A;  5HKC A;  3CCJ T;  1W2B S;  3OYC A;  1K8A C;  5CVI A;  2K2V A;  3QHS A;  2K4Y A;  3CME A;  5GAN 6;  1KQ1 A;  1X01 A;  2DTH A;  3HFO A;  5LJ5 e;  5LJ5 d;  2QA4 T;  5CQY A;  1Y07 A;  4CI0 C;  3L2U A;  1VQK T;  4VUB A;  5GAM h;  4KUI A;  2D9T A;  3PFS A;  5GMK h;  1Q82 U;  2RJC A;  3V7C A;  1VQ8 T;  3HHT B;  3M58 A;  4C0F A;  3CCL T;  1UGS B;  2R5A A;  4N4G A;  2JOY A;  2EJG A;  2G3R A;  4X34 A;  4XK8 E;  3CPW S;  4ME7 A;  1RI0 A;  4ZGE B;  3FRN A;  2JUF A;  4BAC A;  4J5Y A;  1XNI A;  4PJO F;  4N4I A;  3JAM E;  2F5K A;  4J6X A;  4J83 A;  2RI2 A;  4EMH A;  1UEB A;  3JB9 I;  3I56 A;  1VQM T;  4M78 A;  1X6O A;  2E6N A;  4M75 G;  4OF1 A;  4FL6 A;  2YLC A;  3DLM A;  4OVA A;  5GMK l;  4OP0 A;  4M78 C;  4MZP A;  3NTI A;  3TEE A;  3JB9 G;  1U1T A;  1WQW A;  3UDC A;  3VUZ A;  4DOW A;  3P8D A;  3A5Z B;  2XKO C;  4BB7 A;  4C92 F;  2E10 A;  4QW2 A;  4M75 B;  4C0Z A;  3V8J A;  1NZ9 A;  4E7I A;  1VQ9 A;  3CME T;  2X4Y A;  3FC3 A;  1VUB A;  4OGE A;  4C92 E;  4C5E A;  4L6V 5;  4F7U F;  1UGR B;  2RB6 A;  3G6E A;  2I2L A;  2X35 A;  2DXC A;  1BIB A;  3CBM A;  4GY5 A;  5D6W A;  4C8Q G;  3INZ A;  1YIT A;  3MP6 A;  3RKX A;  4J7I A;  3KUF A;  5FRO A;  4JRQ A;  3A8O B;  5GAN j;  4II1 A;  1KC8 U;  2P0Q A;  4JDS A;  2RHU A;  4FIB A;  4QVC A;  4JRI A;  4M7A F;  2PVD B;  5DLQ E;  3OYM A;  2O4X A;  4Q5W A;  1EIF A;  2KVQ G;  3TRE A;  4C8Q B;  1QVG S;  3HL8 A;  4OB1 B;  5CO7 A;  4OB3 B;  4A4F A;  3JB9 D;  4IUV A;  5GAN 5;  1VQ4 A;  2L3R A;  1YJW A;  4XTU A;  4ATO A;  1Y71 A;  4OMF B;  4MDW A;  4PJO A;  4IUR A;  3GF5 A;  5GAN 4;  4JJN K;  4PJO C;  4NOY A;  1YJN T;  1LJO A;  2DZ9 A;  1K9M C;  1OZ2 A;  2VC8 A;  1PSE A;  2XDB A;  1MHN A;  4A4G A;  5FRM A;  5DLO A;  3OYF A;  2ZGW A;  1O9S A;  3OQ5 A;  3S6W A;  2RO0 A;  2BIV A;  4C8Q D;  5GAN f;  3MP1 A;  3RIR A;  3CCE A;  3A8G B;  2CS7 A;  3OYD A;  3QZ5 B;  3DB4 A;  4RKU E;  5HK0 A;  1YIT T;  1B34 A;  2DO3 A;  2EFI A;  1Q86 C;  5CKD A;  3KBG A;  4BD3 A;  4L5G A;  2RA2 A;  3JB9 J;  2RHY A;  4XQ3 A;  3CD6 A;  1WGS A;  4PL6 A;  4F7U A;  5AYF A;  3LX7 A;  4LDX A;  2RM4 A;  4EMG A;  2L5Q A;  3JCM X;  3I55 T;  4HCZ A;  5C0M A;  3M59 A;  4ELZ C;  2DPP B;  3GLX A;  1YJW T;  2M0O A;  3OMC A;  3Q1J A;  1XQH A;  2JTM A;  1WQ7 A;  3HKS A;  4M7A A;  2CZ0 B;  3M56 A;  3OBY A;  4IUQ A;  3RER A;  1VQN A;  4M77 G;  3LW5 E;  4ZGD B;  4Y28 E;  4XU1 A;  3PMI A;  1D3B A;  1I5L A;  4QQ6 A;  4LD9 K;  4M7A C;  3T9N A;  3ZFJ A;  5J3B A;  3VUB A;  5FLX E;  2ZPH B;  1FXX A;  3CCJ A;  5GMK i;  2XHC A;  1WJR A;  2KQW A;  2ZPE B;  1YHQ T;  2QTX A;  2RK1 A;  2L89 A;  2E5Q A;  2A3L A;  2VGN A;  4M77 B;  5CCA A;  3CC7 T;  1Q7Y U;  1KQS S;  2QA4 A;  2DK3 A;  2V8I A;  5GAO p;  1N6A A;  5A0D A;  5GAO m;  1YI2 A;  3CBO A;  1WJQ A;  3HRS A;  5LJ5 f;  1Q81 C;  2MMP A;  3MEU A;  2GQV A;  3VKI A;  3SD4 A;  1VQ8 A;  3X25 B;  3L2W A;  4M7D F;  3M55 A;  4M78 F;  3A8M B;  3CCM A;  3CCL A;  3A8H B;  3OB9 A;  5I2M A;  2K57 A;  1JJ2 A;  2VV5 A;  3HFN A;  3CCU T;  2KMT A;  5GAM e;  4M78 E;  5GAM d;  2OTJ T;  3QZ9 B;  2LNV A;  3SFM A;  3OW2 S;  2EJ9 A;  1VQM A;  2HBP A;  3MEV A;  3OMG A;  4M77 D;  4A53 A;  1VQ7 A;  2D6F A;  2FL7 A;  3F70 A;  1KHC A;  5C6S A;  5GAN g;  5KE2 A;  1VQ6 T;  3OYK A;  2R5M A;  2O4X B;  4IUT A;  1G5V A;  5A0G A;  1KD1 C;  4XAX B;  5FU7 B;  3TCJ A;  5A2Q E;  2QQR A;  2EKO A;  3FEO A;  2P0K A;  3J80 E;  1SSF A;  2QQA A;  4PKC C;  1YI2 T;  3DKM A;  2EAY A;  2JZ2 A;  2ZPB B;  4B9W A;  3MCA B;  3CMA A;  4C92 G;  1GXI E;  2LX9 A;  3N5B B;  1TH7 A;  1K73 C;  4JLG A;  4XTX A;  3BY7 A;  2CGH A;  4DQ2 A;  5GAN h;  3CCM T;  3M54 A;  4NL2 A;  5IAY A;  1YIJ T;  2CZ1 B;  3QJY A;  3OS1 A;  1LNX A;  2R58 A;  4X9D A;  3GPL A;  4XU2 A;  1M9S A;  3JCM f;  3WXM B;  2YRV A;  3WVD B;  4C92 B;  4FSX A;  4C0D C;  2HD0 A;  4HT9 A;  2EWN A;  2H3J A;  4M7D A;  1VQ7 T;  4PJO E;  3MEW A;  4PJO D;  5GAN 8;  5CKH A;  4JUV A;  3CCS T;  3JCM W;  3JCM V;  4M7D C;  2X4J A;  3L42 A;  2HAX A;  3QII A;  1KHI A;  3OY9 A;  2RJD A;  3PNW C;  2Y90 A;  3V7S A;  1YJN A;  3J7A F;  3DB3 A;  3JRZ A;  3QBY A;  2K3Y A;  5FU6 C;  1M1F A;  3RUX A;  2PU9 B;  1U8R A;  4V2S A;  3UWN A;  3QSU A;  2P4T A;  1N9R A;  2DTI A;  4YTL A;  4C92 D;  3M57 A;  4E7J A;  1OI1 A;  5CKB A;  3OYJ A;  3CC2 A;  1JB0 E;  1D3B B;  2XU8 A;  3CMA T;  1QP2 A;  3LGF A;  1I81 A;  3X20 B;  1ZBX A;  1WNL A;  5GAN 7;  1M1K U;  4F7U E;  4J8O A;  2QQB A;  2PUK B;  2VGM A;  3CCV A;  1Y96 B;  2EIF A;  2KY9 A;  2HNI A;  1NJI C;  4R56 A;  1VQP T;  4RCB A;  5FRN A;  4J7F A;  2KAF A;  4BI8 B;  3SWN A;  3I55 A;  2DXB A;  1M90 C;  3E19 A;  2M16 A;  4M7A E;  2DVE A;  1M8V A;  3SWN C;  4ELY C;  2DXU A;  3OBW A;  1WJS A;  5LJ3 f;  1AHJ B;  4Y91 A;  1M1G A;  2X4W A;  3VJP A;  1Q7Y C;  3OYA A;  3MHX A;  4OGC A;  3QG1 A;  3QUI A;  2Y4X A;  4HCB A;  3BW1 A;  3MET A;  2RH2 A;  3P8B B;  1UGQ B;  3PGG A;  2BUD A;  2YHT A;  3CPF A;  3E1S A;  4XTY A;  3V8L A;  4MML A;  4WF2 A;  1HXD A;  3JCM J;  4M75 F;  1K8A U;  1YHQ A;  1W2B A;  2RI3 A;  2KK4 A;  4HKE A;  2DJZ A;  2QQS A;  3JB9 F;  3CC2 T;  1M5Q 1;  1IRE B;  2RI5 A;  4EMK A;  3CC7 A;  4BY6 C;  2GFA A;  4A54 A;  4UC4 A;  2JVV A;  4RCC A;  3PIP A;  4EMK C;  3OYH A;  2MWP A;  4IKF A;  2P0P A;  2RJE A;  3LLR A;  3M4Y A;  4MZM A;  1HK9 A;  3QKJ A;  3WVE B;  4ZGJ B;  3CCR A;  3CCV T;  2WSF E;  4FM4 B;  5LJ5 j;  3OYB A;  3CPW A;  4B9X A;  3OS0 A;  4C8Q F;  3L2R A;  3CCU A;  2DAQ A;  2F5T X;  3CCQ T;  1VQ5 A;  2OTJ A;  4JS4 A;  2IVW A;  3GNF B;  5GAM f;  5CQX A;  1N27 A;  4M78 G;  3RKW A;  3M9Q A;  5GAO l;  3KXT A;  3M4G A;  2VYT A;  4NL3 A;  5EG2 A;  4DA4 A;  5KE3 A;  2CZ7 B;  2HQE A;  3FJP A;  3GNG A;  3P8H A;  1I4K 1;  1Q82 C;  1VQ6 A;  3OS2 A;  2D0Q B;  4N4H A;  3LWH A;  1JBM A;  4IUU A;  2DIQ A;  1XOV A;  4HCC A;  4M78 B;  3V8K A;  1V29 B;  3HRT A;  2NLU A;  3OYN A;  1S72 A;  2E6Z A;  5DM7 R;  3VYH B;  3G7Z A;  2YLB A;  2RHI A;  2FB7 A;  2WSE E;  1VQO T;  4M75 A;  5CKF A;  4NS5 A;  5CIU A;  3LYI A;  4E7H A;  3CCR T;  2R57 A;  4JRP A;  2LVM A;  5GAO q;  4M75 C;  4QVD A;  1YIJ A;  4RG2 A;  1UB4 A;  3BDU A;  3HSB A;  4MMK A;  3OYL A;  1N8R U;  2LC4 A;  4EDU A;  4M7D E;  3FDR A;  1W4S A;  3OSS C;  1VQ5 T;  2XD0 A;  4M78 D;  1JRI A;  4KUL A;  2RHZ A;  2LCC A;  2XI9 A;  3MEA A;  3OSV A;  2FYK A;  4J6W A;  5GAN e;  5GAN d;  3DLL A;  3TU4 K;  1QVG A;  2ZPF B;  2EQK A;  3ER0 A;  5KH6 A;  2AHJ B;  3CCS A;  1VQL T;  2HQX A;  2GFU A;  4PJO G;  1G3W A;  1P92 A;  4C8Q A;  1NE8 A;  1ZQ1 A;  3ZEH A;  4R55 A;  4PLI A;  3QO3 A;  3QPH A;  1VIF A;  3A8L B;  2LQ8 A;  3CEY A;  4MDX A;  3BDL A;  2LDM A;  4C8Q C;  2LT1 A;  1KC8 C;  2GF7 A;  4FT2 A;  1K9M U;  2L8D A;  3EFS A;  4LDY A;  1S72 T;  1YCY A;  2XID A;  4LDV A;  3QYH B;  4L59 A;  4ZN1 A;  4A4E A;  4PJO B;  4J6Y A;  3E9F A;  1G3T A;  2PQW A;  3L2Z A;  4GLK A;  1BI3 A;  5HK3 A;  5L8R E;  3JB9 H;  5I2S A;  1QVF S;  3VU3 C;  2LCL A;  4XU0 A;  5KCH A;  1Q86 U;  3ME9 A;  3OS5 A;  2DXT A;  2F69 A;  3FB9 A;  3E9G A;  4JLI A;  4BY6 B;  3GP8 A;  2ZZD A;  2JTF A;  1OZ3 A;  3QYG B;  4F7U G;  3H6Z A;  1YJ9 A;  4KBM B;  4E47 A;  1VQP A;  3R6O A;  2OAU A;  4MZT A;  4X9C A;  2EYQ A;  1B34 B;  3MO8 A;  3MP8 A;  1XTD A;  3JCM Q;  2M9U A;  3G71 T;  4BI4 A;  3OYG A;  3QJ6 A;  2EQU A;  3UT1 A;  5CAI A;  4BE0 A;  4KUD K;  4C5I A;  4F7U B;  2RK2 A;  3VYG A;  4BDY A;  3S3N A;  1G3S A;  4M7A G;  2E1H A;  4XTZ A;  4E7L A;  2MWO A;  4CRI A;  1BI0 A;  5CR2 A;  2EQJ A;  2ZPG B;  5J26 A;  5LJ3 j;  3NFC A;  5LJ5 g;  2CKK A;  3ZBD A;  3FLG A;  2PUO B;  2E70 A;  3G4S T;  2QEX A;  4M7A B;  1UGP B;  2PVO B;  4FU6 A;  4ZTF A;  3HP9 A;  1PSF A;  3ASK A;  1ZHI A;  3AHU A;  2K5I A;  1KQS A;  3RES A;  3JCM b;  1WPY A;  1NPR A;  3C4S A;  4PLL A;  1Q81 U;  1KG1 A;  3JSC A;  4XU3 A;  3JCM c;  4N0A A;  2LQK A;  4M77 A;  3PIO A;  2DEQ A;  1QP3 A;  5LJ5 h;  5GAN 2;  2GCX A;  1BKB A;  2XDP A;  3OA6 A;  2IG0 A;  4N0A C;  1YJ9 T;  4M77 C;  1NPP A;  3HPW A;  1IZ6 A;  2XG8 D;  1H64 1;  4HT8 A;  3CCQ A;  2K5F A;  2QI2 A;  4M7A D;  4OB0 B;  3M53 A;  3CC4 A;  2DD4 A;  3CXC S;  3OW2 A;  3X28 B;  4ZN3 A;  4OB2 B;  5GAN 3;  5D6X A;  2EJF A;  1LOJ A;  3QXE B;  2Y4Y A;  4BDZ A;  3L1A A;  3H8Z A;  5GAM j;  5GMK m;  2XDD A;  5GMK j;  2MF2 A;  3NTK A;  4LD6 A;  1KD1 U;  2V8J A;  3RMQ A;  3LGL A;  3JCM e;  2ZCF B;  3JCM d;  3BFM A;  2EQM A;  2QEX T;  1JJ2 S;  1KQ2 A;  1OYX A;  4A4K A;  1N8R C;  2X4X A;  4D6W A;  2JN0 A;  3JCM g;  3QDR B;  2KDS A;  4M75 E;  4P5N A;  4M75 D;  2B8A A;  2BKD N;  3HRU A;  3RMS A;  3I56 T;  4RG8 A;  1VQO A;  2JNG A;  3OYY A;  5D6Y A;  3CBP A;  5FU7 C;  1K73 U;  2PVG B;  4HA8 A;  5GAO n;  1QVF A;  4BUG A;  5GAO r;  2LRQ A;  1G3Y A;  2RHX A;  5DY9 A;  2WSC E;  2M1H A;  4C0G A;  1YBY A;  3M5A A;  4RMO A;  4BE1 A;  3S3M A;  4O5V A;  5M9O A;  2O01 E;  3NTH A;  1VQ9 T;  3CC4 T;  4M7D G;  3JCM h;  3FIF A;  4C8Q E;  3G6E T;  1VQL A;  3PT9 A;  4C0D B;  4C92 A;  1I8F A;  3C94 A;  3OYI A;  5CK9 A;  3JCM P;  4E7K A;  4C92 C;  4KT0 E;  4M7D B;  1FX7 A;  1FWZ A;  2KSS A;  4O6J A;  3V7R A;  2DD5 A;  4ZTJ A;  4C5G A;  4FT4 A;  1O75 A;  5CKE A;  4BI3 A;  3VV0 A;  2VXF A;  5I21 A;  2LTO A;  4DOV A;  2VXE A;  3PTA A;  3O8V A;  2LT4 A;  4LDW A;  5LJ3 e;  2RD1 A;  5FU6 B;  5LJ3 d;  1BIA A;  3URG A;  1M4Z A;  1VQ4 T;  1QW1 A;  2VUB A;  2CZ6 B;  2C06 A;  5HY6 A;  1MGQ A;  3GIB A;  2XK0 A;  3LH0 A;  2FHD A;  5LJ3 g;  3S3O A;  1R8O B;  2OTL A;  2DTO A;  1NJI U;  3C12 A;  5IN1 A;  4M7D D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...