1QP2A

Solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of photosystem I accessory protein E from the cyanobacterium Nostoc sp. strain PCC 8009.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
molecule keywords PROTEIN (PSAE PROTEIN)
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qp2A00
3A8LB 1UGPB 2O01E 3HHTB 2WSCE 1QP2A 2DD5A 4Y28E 4ZGDB 1PSFA 2PUKB 1DJ7B 4OB0B 2PVDB 2ZPEB 3X24B 1PSEA 3QYGB 2WSEE 3A8OB 3WVDB 2PUOB 1IREB 2PVOB 1V29B 4ZGEB 2DXCA 3QXEB 3QZ9B 3A8MB 3VYHB 1GXIE 2PU9B 1QP3A 3A8HB 2CZ1B 2ZZDA 3QYHB 4FM4B 3QZ5B 2CYZB 2PVGB 2QDYB 4OB3B 3X25B 4OB1B 1UGQB 2WSFE 3A8GB 2ZPBB 2ZPHB 2CZ0B 4KT0E 4L6V5 4OB2B 3X26B 4XK8E 2CZ7B 3WVEB 1JB0E 5L8RE 2ZPGB 4RKUE 2DXBA 2ZCFB 2DPPB 3LW5E 2ZPIB 2ZPFB 3VYGA 3X20B 3X28B 1UGRB 4ZGJB 1AHJB 2AHJB 2CZ6B 2DD4A 2D0QB 1UGSB
chains in the Genus database with same CATH superfamily
1BIAA 3EGXA 2VWFA 5KYXB 3DLLA 4EMKB 4JJBA 2GGRA 2BTTA 2QQAA 4ELZC 2LMJA 2YDLA 5IT9E 1OV3A 2BZ8A 2DL8A 2E3HA 1YIJQ 3FJ5A 2JMCA 3SDZA 2K57A 3GF5A 4JJNK 3HHTB 4XQ3A 4GY5A 3OS2A 2LCCA 3NTHA 1GCPA 2DVJA 3MP8A 4M78F 2JS0A 2DXCA 1GXIE 1PG5B 3I5SA 1YI2A 4TVRA 1WHJA 2LCLA 3PVQA 3CBOA 4XTXA 4ZNXA 2V8JA 2KK4A 2GNCA 3MPUB 3CXCA 3V8KA 5GAMf 1M1GA 4ANJA 4EPCA 3OY9A 1U1TA 3VU3C 3VS4A 2PNIA 1PRLC 3M4GA 4AFQC 2BKDN 3FC3A 2EYQA 1M8MA 2CP3A 3MJXA 4C92E 3SFMA 1V1CA 2X4YA 4OVAA 3JB9J 1WA7A 1VOMA 3PTAA 4LDVA 4QKUA 1NLOC 1TOVA 1B3QA 4OGEA 1QCOA 2LQNA 3VRZA 3M53A 3JSCA 4PJOF 5LJ5j 2M9UA 3GOXA 2M51A 3CCJA 3R6OA 3T9NA 1X01A 4D8KA 2DYIA 2YRVA 1SPKA 2QQRA 5KYYB 2AKLA 2Y90A 3JV3A 1AD5A 5CKDA 1YNZA 3P8BB 1WLPB 1UECA 1HXDA 2XIDA 3NTIA 4J9EA 2WSEE 4ZN1A 1M2OA 4E7HA 3OS1A 2P0PA 3P8HA 5KCHA 1NYFA 3L2QA 3LLRA 1M9SA 2AKKA 4RTUA 3HRUA 1S72A 5GAN2 5CR2A 4PJJA 1VQPT 1N8RC 2XG8D 4OMMA 5D7UA 2VVKA 3OYYA 3JCMV 2EKOA 4A4KA 4F16A 2LQWA 4RTXA 1Q7YC 1KFZA 3CCRQ 3H9NA 2KBTA 1I8FA 2JW4A 2RNAA 1OX8A 8ATCB 2HAXA 1K9MR 1X6OA 3CCMQ 2QYZA 4AFUC 1AVZC 3UA6A 1U3OA 1KC8R 5HCKA 2JXBA 5HK0A 2CUDA 2ED0A 3REAB 3UWNA 3RESA 2DTHA 2EQMA 3SWNC 2XDPA 3CCUT 3CC2T 2FPDA 1SHGA 1D0YA 3A1PA 2VGMA 5GMKh 2FZGB 4RCBA 1TU0B 2H8HA 2QK0A 1Y96B 1BCOA 3QWYA 2RI2A 5GAOn 4OB3B 2GF7A 3ULRB 3EG9A 1VIEA 3JCMe 5GJVB 3CC2A 1T0JA 2KI7A 4DEXA 4J9FA 1YCSB 5LJ5h 5AYFA 2LJ3A 3NHNA 2Z0WA 1W1FA 4Y91A 1NPPA 2EQKA 2A0FB 1CKBA 1YP5A 1R0BG 3QYHB 5LJ3f 1E6HA 4DBRA 3JRZA 3MCAB 3EGDA 1Z9QA 1Q95G 2AZVA 2Y4XA 4J5YA 4PJOE 1SRMA 1VQ6T 3RR6A 3ASKA 4E7IA 2VKNA 4LNPA 3L2ZA 2FPFA 3CEYA 5L23A 4J9IA 2CZ0B 3FB9A 3WXMB 1E7OA 1U5SA 3UT1A 1VQMQ 3CC7A 3GNGA 4PJOB 4EMHA 4L5GA 4LDXA 1S72T 2LJ0A 1QP2A 2NUZA 2G6FX 2L3PA 2K7AA 2BZXA 3EFOB 2EYXA 1QKWA 3UATA 1D0XA 3CCEQ 2QGGA 3M0SA 1Q82R 1IXDA 2ZPIB 5EG2A 3MEVA 2D1XA 1QQJA 1AZGB 1JQQA 4M7DB 4OMFB 3OYMA 2FEIA 1Q81R 1VQ5A 2IG0A 2A36A 4OB0B 1BI0A 1KQSS 4KH0B 2KT1A 1M1KR 3HFOA 1BIBA 1BB9A 1YWOA 3RKYA 4JLIA 5GJWB 4PJMA 2ZZDA 1PD0A 1BK2A 2CYZB 2OAUA 2GTOA 3QKJA 1VQ5T 4DA4A 1VQ7Q 2CUBA 2VC8A 3VS3A 1IHWA 4OP0A 1PM3A 1VQNA 1PSFA 4PJOC 1WHGA 2E10A 4FW2A 2EJ9A 2E4HA 5KYXA 3SWNB 3META 2DRMA 3SB2A 3THKA 2MI6A 1I5OB 2Y4YA 3VS5A 3M58A 2FPEA 4R55A 2XHCA 1IGUA 2JM9A 2K9GA 1JJ2S 1ZSZA 2E3IA 2LC4A 4F7UG 1VQNT 2XD0A 4CC3A 1JEGA 2COZA 2R57A 3MEAA 2CH4A 1N27A 4Y92A 3NMZC 1V29B 2YUPA 3A98A 2X4JA 3CCRA 3PGGA 3TU4K 3PE0A 2HBPA 3VUZA 2JNGA 4M78A 1KHCA 5CKHA 1RACB 4C5IA 3AT1B 2CT4A 3GBQA 3URGA 1ARKA 3EGUA 2X4WA 1IHVA 2V1RA 2HQEA 2ECZA 1FMKA 2ESWA 1ABOA 1PSEA 1AOJA 5GAMg 2E5QA 1UGVA 3VYHB 4FYVB 1FMWA 3CMEA 4FIBA 1D3BA 2EKHA 4PJOG 3ME9A 1FYNA 1SRLA 2L3QA 2DPPB 5FWBA 5IN1A 3CMAQ 4FYYB 2GFAA 3P8DA 4XAXB 1YHQA 2X35A 4BDZA 2QG9B 5KCOA 2BZYA 1AWJA 1OZ3A 3CC4A 2D8HA 3FJPA 1BI3A 3H6ZA 3RBBB 4C5HA 1NBEB 2H3JA 2KQWA 1P92A 3S3OA 2OTJT 1K4US 1VQ6Q 2E41A 1VYVA 1Q82U 2W10A 1K8AU 3JB9G 2RK1A 1U1SA 1D09B 2ROTA 1UJ0A 2L0AA 5GAOr 3L2WA 1VUBA 3PMTA 3OYLA 3CPFA 1NLPC 5IH2A 3HRSA 2ZPBB 1W2BS 1G2BA 4FSSA 2F5TX 4M7AC 3E19A 1YJWA 3QIIA 1RAIB 2HL5C 2KXDA 4M7AG 4C8QE 3WVDB 1CSKA 2FVUA 3CMEQ 1K9MU 1X43A 1VQPA 2QXFA 2JMAA 2LNVA 1SEMA 2K4YA 4J6XA 1AHJB 3OYKA 2LQ8A 5A2QE 4MZTA 4XU3A 3QBYA 4N0AC 4JUVA 2EQJA 2K2VA 1OU8A 4M75D 1ZSGA 2KGTA 3BDUA 2KMTA 5LJ3h 1S72Q 4HVUA 3OYNA 2R58A 3G71A 4E7JA 1PCXA 1RABB 4BI4A 1V76A 5CK9A 2DRKA 3CCUA 4C8QB 2EW3A 3M57A 2HNIA 1RLQC 3ZFJA 1KD1R 3M4YA 1VQ7T 1VQOQ 4PJOD 2FRYA 2LNHB 2JOYA 3FIFA 2IPOB 1PHTA 1OX9A 3TEEA 1UEBA 1VQLT 2K5FA 1NYGA 1Q7YU 4VUBA 2RHXA 1KQ2A 5LJ5f 1Y07A 4JDSA 3QYGB 2M0YA 4QW2A 4LUDA 4M77B 1D1BA 2V1QA 4JS4A 1ZLMA 4PJOA 1MV0B 2LDMA 1I0CA 4EDUA 2WSFE 5HY6A 5GMKm 2QA4Q 2OX7A 2NLUA 3KXTA 4NL3A 2RF0A 4DEYA 1VQ6A 1FX7A 4QQDA 2RHYA 3VV0A 3EH1A 3L1AA 2CSQA 4N4HA 3QO3A 4PL6A 3OS0A 5A0GA 4BUGA 2GCXA 5FROA 1KSWA 3V7SA 2M0OA 4AMCA 4C8QD 4RMOA 2DL5A 4Z8AA 1YI2Q 2CP2A 2J7IA 4KBMB 4HVVA 2K5LA 3MP6A 4ZN3A 3QPHA 1ABQA 2EGCA 3PVLA 1MNDA 5FU7C 2QEXA 3ZBDA 4JPBW 4A63B 1KC8C 1TUDA 2F5KA 3I56A 1QVGS 5CKEA 4PNOA 3LX7A 2BE9B 3CC4Q 4RG8A 1WYXA 2CZ7B 1OQKA 3VYGA 1JXOA 2BE7D 2QAZA 3VRYA 3CPWA 1WI7A 2RK2A 2COWA 2KRMA 3GP8A 2JTEA 2JTMA 3CCLQ 3C12A 4ZTJA 1PKTA 1UJYA 4R0KA 2YSQA 4RTWA 3KUFA 2QA4A 1BI1A 4M78B 4A53A 2KE9A 3SHWA 1JO8A 2L89A 2XDDA 1G3TA 2FL7A 4A4HA 2YXYA 1QWEA 5HK3A 3X26B 3L2UA 2EQUA 4XTWA 4LD9K 4XU1A 1Z9ZA 2D6FA 3OMGA 1IGQA 2O88A 5GAN6 2MMPA 1AEYA 6AT1B 2LP5A 2XU8A 2K5IA 3C0CA 1VQMA 1LNXA 2VV5A 1SSHA 4YTLA 5LJ3g 2DBKA 1ZBJA 4IUVA 4EMGA 1N8RR 1WHLA 5GAOl 1G83A 1GFDA 2DO3A 2J06A 4FSXA 1M3AA 1K73R 4FCYA 3TVTA 3OW2P 1N6AA 3G4ST 5FU6B 3QDRB 2PQWA 1M1KC 2DZ9A 3QZ9B 1M90C 1MMGA 4QVCA 1LPLA 4F7UE 4QVZA 3A8GB 2CREA 3GPLA 3CMAT 2KRNA 2E64A 2LVMA 3G4SA 1YJNQ 1W2BP 2HQHA 2D0QB 2XI9A 4MMLA 2RJFA 2HDAA 2QTVA 3I9QA 3M59A 4M7DD 2L3RA 4HT9A 1VQKT 2D0NA 1ZA2B 2FO0A 3CC7T 2DMOA 1RLPC 3V8JA 4FYXB 3JCMX 5KYNA 2CS7A 2ZPGB 1NG2A 3SEMA 1KD1U 3TCJA 2P84A 3CC4T 1UE9A 4MZMA 4MZPA 1KD1C 3RMSA 2JM8A 3MKDA 1MMAA 2EJGA 2EQIA 3OYFA 2RMOA 5GAMd 4OB1B 4IUQA 1MMDA 1UHFA 5M9OA 1WZOA 1ZSZB 4C0FA 5L8RE 4C92A 2DIQA 4J9HA 3BDLA 2CZ6B 2G3RA 4A4GA 2DL7A 5GMKi 3H0FA 2X4XA 1TXQA 3H0IA 1VQLQ 1G3SA 4HVWA 1VQ9Q 3L2RA 4LDYA 4M75E 2YRCA 1W2BA 2R5MA 4JJDA 1F1BB 1RI0A 5GAMe 4J8OA 2AHJB 4NS5A 1M1KU 1Q86C 2XICA 2IIMA 4KRTA 3JCMg 2OAWA 4A4FA 3TSWA 4ELYC 1Q86U 2OTLQ 3TSZA 1H3ZA 4M78E 1QP3A 2CZ1B 4J9BA 1RADB 2YT6A 2M02A 2BUDA 1FWZA 4ZTFA 5CQXA 1I1JA 1U06A 1LJOA 4ME7A 4M77D 2RQRA 3CMAA 1SF9A 4C92B 4CC7A 3CCEA 4KULA 4PJLA 1Y71A 1HK9A 1RAEB 4D6WA 3CCQA 1YI2T 3M5AA 3CCVA 2CGHA 1HD3A 1GFCA 4IIOA 2XK0A 4E6RA 4FM4B 1YHQT 4AG2C 3G4SQ 1YJNA 1I07A 5IXFA 1AZEA 2F2WA 1OYXA 2MCNA 2EFIA 4XTYA 1WXTA 3I55T 3CCVT 1J3TA 2DL4A 4ATOA 1VQ7A 2DD5A 2MWPA 2RI5A 4F17A 4N0AA 5KYUB 4F7UB 1S1NA 1ZUYA 2HKNA 3MEUA 5D6YA 4RTTA 4B9WA 1KQSP 3EFRA 3H0HA 2DTIA 3QZ5B 1XTDA 1B34B 1X69A 4IUPA 4MMKA 3EG9B 4M77E 5IAYA 1OULA 1RAFB 1MHNA 1M30A 4BDYA 2O4XA 5IHNA 1QMCA 2PVDB 2CT3A 2ENMA 2GQIA 2AZSA 3L42A 2VGNA 1YJ9T 1VQ4Q 4WF2A 5I11A 2QQ9A 1ZQ1A 5GANj 2HBWA 2RQVA 5KYYA 1WJQA 1EZZB 4OF1A 4FT2A 1D1AA 2LQKA 4C8QA 3A8LB 1VQ9A 4HCCA 1O9SA 4J6YA 2RQTA 1H641 3CXCS 2OJ2A 2OTJQ 1YITT 1N8RU 5GANf 4E2FB 3JB9D 3C94A 4MDXA 4BY6B 3I5RA 1K73U 2EVRA 2JT4A 1TSFA 3MP1A 4CC2A 3JB9I 1YJWT 1QVFS 3X25B 3H41A 1K8AR 4IUTA 3S3MA 1N9RA 2HKQB 1EX4A 1X2KA 1KG1A 4C0DC 1OZ2A 4HT8A 4WCIA 2DXTA 1W70A 1K8AC 3DB4A 4LUEA 3E2UA 1YIJT 3S3NA 2C0OA 1D0ZA 1QVFA 1YITQ 1WHMA 2X3XD 3M54A 3PT9A 2W0ZA 3C4SA 2ZPFB 4KGZB 4C92G 3CC7Q 4PFPA 2JVVA 1WQ7A 2A28A 3UPUA 3JB9F 1VQLA 4Y28E 5FRNA 2PUKB 4F7UA 1BBZA 2CP6A 4C92F 2EGEA 4C0GA 1M2VB 4OGCA 1UUEA 4LD6A 1AWXA 2JJ9A 4QQ6A 4JLGA 4X9CA 5CAIA 5A0DA 3EHQA 1MV3A 2L8DA 2K3XA 1ZBXA 2DXUA 2OTLT 3UA7A 1OU9A 4OMNA 3JAME 1NZ9A 1TWBA 3JCMf 3LGLA 4ZGDB 1ZA1B 1TS9A 2MF2A 4M78G 3OMCA 4F14A 2COYA 2QTXA 8AT1B 5DY9A 3GLXA 2CP0A 5D6XA 4EMKC 2LX9A 4RTYA 2JTFA 4AFSC 3CD6T 1YJ9A 2YUQA 1D1CA 5KYWB 4A4EA 5GAOq 3PMIA 2QQSA 3HRTA 3VS2A 5CVIA 2KY9A 1IB8A 4M75G 4M78D 4DBFA 1XJWB 2X3WD 1X27A 4C0DB 2O9VA 4B6MA 3CD6A 3FLGA 1PC0A 1YCYA 1BCMA 3CCVQ 1Y7XA 1WHHA 2L3SA 3RMQA 1IRXA 3I35A 3LW5E 4RG2A 4E7SA 1Q81U 1JJ2P 2QI2A 4BY6C 5GMKe 3ZL7C 5GAMj 1I81A 2LT1A 5GANg 1M27C 3D7SB 4PLIA 2AT1B 4ZGEB 3JCMJ 1AWWA 1X75C 3EFOA 1UTIA 4C5EA 3NPFA 4PJNA 1YIJA 2A08A 3OB9A 1LVKA 1UGQB 2EAYA 4KT0E 5I2MA 4AFZC 4Q5WA 1JXMA 3G71T 2HCKA 4C5GA 2RD1A 3RKXA 1UGPB 4M77F 5GAMh 1GL5A 2HD0A 5KYUA 2CKKA 4C92D 1DJ7B 2LTOA 2RJEA 2E6ZA 5D6WA 1QCFA 1QKXA 4XU0A 3I55Q 2DA9A 3G1JA 2ED1A 3RIRA 5A0LA 2E70A 4J7FA 2PVGB 4QT7A 3OW2S 5FRMA 4LDUA 3OSVA 1WDXA 4BI3A 3NFCA 4M7AA 2HL3A 3JCMc 1VQOT 3PIPA 4R56A 4AG1C 3RUXA 5KE3A 4C92C 3OBYA 2WSCE 3MEWA 3OYEA 1LCKA 2MIOA 1VQ5Q 2QA4T 4DQ2A 3ZEHA 2RPNA 5LJ3d 1KIKA 3CCJT 5CIUA 4RTZA 4PK4A 3MHXA 5FLXE 1JJ2A 5C0MA 1WXBA 4XU2A 1K9MC 5CCAA 1VQ4T 1VYTA 1MMNA 2DETA 1PNJA 1QVFP 2EBPA 2FZKB 3CCRT 4GBQA 1VQNQ 2RJDA 1VQMT 4IKFA 4PFZA 2PVOB 2LT4A 4M75C 3QJ6A 2L5QA 4X9DA 4KH1B 2KVQG 2VYTA 3OYHA 2RQUA 4RKUE 5DLQE 4JRQA 3X28B 3CBMA 1TUGB 2SRCA 4M75B 3CCLT 4CI0C 1YJWQ 1K9AA 5FW9A 2X9HA 2KROA 4DOWA 1H92A 1Q82C 1YJNT 2RB6A 1UFFA 1NE8A 4E7LA 2C06A 1QLYA 3BFMA 4HXJA 1JRIA 3CC2Q 3Q1JA 2NUTB 3LH0A 4DOVA 2FHDA 1PD1A 2FRWA 4JRIA 2E65A 3HL8A 2HMAA 1ZUKA 1A0NB 2ATCB 3G6ET 1H3HA 2KYBA 2I0NA 2RN8A 3QSUA 3WVEB 3CCMA 3OYJA 1X2QA 3DKMA 4M77G 1GRIA 4M75A 4JZ3A 1KJWA 2L2PA 2J6FA 5I22A 3CD6Q 3RDVA 4C8QF 1VYUA 1D3BB 3M0UA 1BI2A 1Y96A 3EH2A 5AT1B 4J83A 5GANh 2EIFA 4FYWB 2PTKA 2HEQA 2ZPHB 3E9FA 1WJRA 4O6JA 2GQVA 5KYWA 3G7ZA 5CQYA 1PWTA 3CCQQ 2VXFA 3BE3A 2D9TA 2GFUA 2DEUA 4RCCA 3CCET 2HZYA 1SHFA 1WIEA 1FXXA 4Z02A 5IHKA 2P0KA 1B07A 2ABLA 2DJZA 1YFNA 1K73C 1T3LA 4IURA 3CMET 3SD4A 4C0ZA 2YLCA 5I21A 5J26A 2ZGWA 1G3YA 2XKOC 1GBQA 3QXEB 3BY7A 4NL2A 3EG0A 2RQWA 3V7RA 2IVWA 3SWNA 3VS6A 1X6GA 4M7DA 4B9XA 2E6NA 1K76A 2DD4A 4KGVB 4GLMA 3REBB 2H3EB 2DK3A 5LL6S 3O8VA 3FRNA 5LJ5e 1WJSA 4JS5A 3O5ZA 2PUOB 1I4K1 3LYIA 3M0TA 3F70A 2NUTA 2RHUA 1PRMC 4XTVA 2CSIA 3GNFB 3OYIA 4K11A 4N4GA 2VXEA 4ESRA 1XQHA 4M7AF 1G8XA 3C95A 2J6KA 3IQLA 1G3WA 3CCMT 1VA7A 2D8JA 4M7DF 4C8QC 1WFWA 2OTJA 4M7DE 4J6WA 2LZ6B 3LWIA 1RUWA 2QDYB 2K2MA 2DERA 2YWWA 4V2SA 4JJCA 5LJ5g 1WQWA 2DIGA 1Y57A 2EYYA 2KYMA 3EGDB 4PLLA 2DX1A 2QEXQ 4DBQA 2OI3A 4JRKA 3CPWP 1KHIA 1YN8A 2KSSA 2M16A 4LDWA 2F69A 2PZ1A 1ZUUA 2RH2A 4D8DA 3QG1A 2V8KA 1TG0A 4BE1A 1YITA 2FB7A 3LH5A 3HPWA 3OA6A 3I56T 1YHQQ 1M3BA 2GTJA 3CCSA 3JCMP 2DAQA 2P0QA 4X1VA 4Z89A 3EFSA 3KFVA 1E6GA 1EIFA 1X6BA 2PU9B 3M56A 1QVGP 3OSSC 2LX7A 2F2XA 2DBMA 4M7AB 1H8KA 4J7IA 2SEMA 4BACA 2FYKA 5GAOp 1JBMA 2K6DA 3FDRA 1YWPA 4DBHA 5GAOm 5DM7R 1N5ZA 4M77A 4RUGA 2ZPEB 4FU6A 1WXUA 3I56Q 3TREA 1VQ8Q 3M0PA 2RA2A 2DILA 2LRQA 5GANd 1K0SA 4HCZA 2R5AA 5CO7A 1NEBA 1AT1B 1CKAA 1ZSZC 2J6OA 3EAEA 4KUIA 1BU1A 5GAN5 3E1SA 4F7UF 1HJDA 1C0MA 3H8ZA 4BE0A 5LJ3e 5GANe 1BKBA 3X20B 1M90U 2KEAA 1UGRB 1UB4A 4M7DC 2CP7A 2O9SA 1C1AA 2C0IA 2GBQA 1RI9A 1Q86R 1OPLA 1TH7A 4HCBA 4J9DA 4E47A 1QVPA 4P5NA 2FG0A 3VS0A 4PFOA 1M2VA 2YHTA 1C6VX 2QGFB 2QEXT 1XOVA 2RJCA 1QVGA 4JZ4A 4RTVA 1KQSA 3N5BB 1U8RA 4ZGJB 4E7ZA 2WACA 4NOYA 4BE2A 4M7DG 4IUUA 3V8LA 5J3BA 3VKIA 2NUPB 3EG1A 2P4RA 2FZCB 2DYBA 2F2VA 1VQKA 2V26A 1QWFA 3CCST 2KRSA 2MWOA 1M90R 3JCMd 2E1HA 5GAN7 3RERA 3LGFA 4E7KA 2LJ1A 2QDLA 2MOXA 4XK8E 5FU6C 2HSEB 2DF6A 4FW1A 2DVEA 3OBWA 5DLOA 1IO6A 2HQXA 2RHZA 1MGQA 4OMQA 1PKSA 3MO8A 2KR3A 3HKSA 2A37A 3G71Q 3J81E 4X34A 2EWNA 3M9QA 1B34A 4BI8B 3PFSA 1LOJA 2LCSA 5IHIA 3DLMA 4QQGA 1K0XA 2EPDA 3M0RA 4PKCC 3CBPA 2EYWA 1Y0MA 3RNJA 3A5ZB 1O75A 5IXBA 3OYBA 1W4SA 4KUDK 2DJQA 4M7AD 2DL3A 4OMLA 2MAMA 2OTLA 3KBGA 4OMPA 1GBRA 2HSPA 3HP9A 2A3LA 3A8OB 2KXCA 1VQOA 3E9GA 1KK7A 4LE9A 1Q7YR 1I5LA 2KT8A 1ZHIA 2YUNA 4WTOB 1SKUB 1ZX6A 2MPXC 3EGXB 2JN0A 2MK5A 2X51A 2F1LA 3QJYA 1NJIR 2EGAA 3DB3A 3CPWS 2YLBA 4O5VA 3OW2A 1IZ6A 7AT1B 1VQ4A 1HYOA 2VASA 3TQ7P 1KQ1A 1SSFA 1XNIA 3EG2A 1YBYA 1OI1A 4OB2B 3QWXX 1QCNA 1K1ZA 1R8OB 2DM1A 4BD3A 1B7TA 4EIKA 4F04B 2K3BA 1VQ8T 2KAFA 4HA8A 1BYMA 3OQ5A 5GAN3 4L59A 5ECAA 4M78C 3OYAA 4HCKA 2C0TA 4C8QG 5I2SA 2I2LA 1RAGB 1UDLA 3I55A 2DEQA 3PNWC 1VQ8A 1VQKQ 2NUPA 5KH6A 1NEGA 1HSQA 3G6EA 1EFNA 3A8HB 4BB7A 1FMVA 5GMKl 1W6XA 2CDTA 3LWHA 1MNEA 2AK5A 2VUBA 4M77C 1JU5C 4JRPA 1R0CB 5J39A 1T3SA 3X24B 1M5Q1 3OYCA 2O2OA 4QVDA 3M0QA 3UF4A 1AWOA 3NTKA 3JB9H 5HKCA 1WGSA 3FEOA 2AIRB 3V7CA 1GCQA 2KNBB 4XTUA 2K3YA 2DXBA 2ROLA 2ZCFB 3JCMW 1M4ZA 2EYZA 1UGSB 3CQTA 4N4IA 2CH4W 2V8IA 1KC8U 1NJIC 3RKWA 3EHRA 4HKEA 4AT1B 4M7AE 2RHIA 2VB6A 1M3CA 2A7YA 3A8MB 9ATCB 3AHUA 2MYSA 3OYGA 3BW1A 2DZCA 4M75F 1ACMB 1VQ9T 3J7AF 4GLKA 4LXCA 3JCMb 4XTZA 3UDCA 1GCQC 4J9CA 3CCJQ 2O31A 2NWMA 2JZ2A 3R6NA 1TTHB 3M55A 5EC7A 1Q81C 1RL2A 2RI3A 3VUBA 1VIFA 5KE2A 2J05A 2YRDA 1WNLA 3QHSA 2P4TA 3J80E 3CCQT 2DTOA 2XDBA 1N9SA 3HTRA 4LN2A 2QASA 2B8AA 1YJ9Q 1OPKA 3ER0A 1UHCA 1G5VA 4FL6A 1WPYA 3PIOA 2KDSA 2CP5A 3EG3A 1QW1A 3CCLA 1MUZA 2DKGA 1NJIU 2O4XB 1IREB 1RAAB 2K79A 1UG1A 2RO0A 5C6SA 4FT4A 3OS5A 4L6V5 2E12A 2BIVA 1JB0E 2B86A 3VS7A 3CCSQ 1T0HA 2JUFA 2XMFA 3S6WA 2O01E 1RAHB 4Z88A 3QUIA 4EMKA 2EJFA 3OYDA 3VS1A 4ORZA 3NGPA 1TUCA 3VJPA 3JCMh 3CCUQ 3JCMQ 3CXCP 5LJ3j 1OOTA 5FU7B 1OEBA 1M1FA 2JS2A 2DLPA 3L2VA 5GMKj 3G6EQ 3HSBA 3INZA 3QDFA 2DE0X 2ZAEA 4OMOA 2E5KA 2DFUA 5FWCA 4CC4B 4IIMA 4CRIA 1SG5A 2QQBA 3HFNA 4J9GA 5CKBA 4UC4A 2DNUA 4A54A 3U23A 5LJ5d 1VQPQ 1WHKA 2YUOA 2NYSA 4II1A 2M1HA 2RM4A 5CKFA 4M4ZA 1R77A 3GIBA 1M8VA 5GAN4 1WX6A 5GAN8 4KGXB 1NPRA 1NM7A 4MDWA
chains in the Genus database with same CATH topology
3A8LB 1BIAA 1VQ9A 4HCCA 1O9SA 4J6YA 1H641 3CXCS 3OW2S 1YITT 3QIIA 1N8RU 5GANf 3JB9D 3C94A 3DLLA 4JRKA 4EMKB 4M7AG 4MDXA 4BY6B 1KHIA 3WVDB 4C8QE 2KSSA 2M16A 2QQAA 1K73U 4ELZC 2FVUA 3MP1A 4LDWA 3JB9I 1YJWT 1K9MU 2F69A 1QVFS 3X25B 2RH2A 1VQPA 3QG1A 5IT9E 2QXFA 4IUTA 2LNVA 2K4YA 2V8KA 4BE1A 3S3MA 1N9RA 1YITA 4J6XA 1AHJB 2FB7A 3OYKA 3SDZA 2LQ8A 5A2QE 2K57A 4MZTA 1KG1A 3GF5A 4JJNK 4XU3A 3HPWA 1OZ2A 3HHTB 3QBYA 4C0DC 3OA6A 3I56T 3CCSA 4HT8A 2DXTA 4N0AC 4JUVA 2EQJA 2K2VA 4XQ3A 3JCMP 4GY5A 1K8AC 3OS2A 2DAQA 2LCCA 3DB4A 2P0QA 3NTHA 3BDUA 4M75D 1YIJT 3MP8A 2KMTA 3EFSA 4M78F 3S3NA 2DXCA 1EIFA 5LJ3h 1GXIE 3M56A 2PU9B 1QVFA 1YI2A 3OYNA 2R58A 4TVRA 3G71A 2LCLA 3OSSC 4E7JA 3CBOA 4XTXA 4BI4A 3M54A 3PT9A 4M7AB 2V8JA 2KK4A 5CK9A 4J7IA 3CCUA 3C4SA 4BACA 2ZPFB 4C92G 3CXCA 2FYKA 3V8KA 5GAMf 1M1GA 1WQ7A 1JBMA 2JVVA 4C8QB 4EPCA 1U1TA 3VU3C 3OY9A 3M57A 3UPUA 3FDRA 3JB9F 1VQLA 4Y28E 5GAOm 2HNIA 4M77A 5DM7R 5FRNA 2PUKB 3ZFJA 3M4GA 4F7UA 2BKDN 3M4YA 2EYQA 2ZPEB 3FC3A 4C92F 1VQ7T 4X9DA 4FU6A 4PJOD 4C0GA 4C92E 3TREA 2JOYA 3FIFA 4OGCA 3SFMA 4LD6A 4QQ6A 2RA2A 2X4YA 4OVAA 5GANd 2LRQA 4JLGA 4X9CA 5CAIA 3JB9J 3TEEA 5A0DA 4HCZA 2R5AA 3PTAA 4LDVA 5CO7A 1UEBA 2K3XA 2L8DA 1VQLT 2K5FA 1ZBXA 4OGEA 1Q7YU 2DXUA 4VUBA 2RHXA 2OTLT 1KQ2A 3M53A 3EAEA 3JSCA 3JAME 1NZ9A 4KUIA 3JCMf 4PJOF 5LJ5f 5LJ5j 2M9UA 3LGLA 4ZGDB 2MF2A 3GOXA 4M78G 3CCJA 1Y07A 3OMCA 4JDSA 2QTXA 3QYGB 1YHQA 3R6OA 4QW2A 5GAN5 4M77B 3T9NA 1X01A 3E1SA 2YRVA 4JS4A 5DY9A 3GLXA 2QQRA 5D6XA 4EMKC 4F7UF 4PJOA 2LX9A 2LDMA 4EDUA 2WSFE 2JTFA 5HY6A 5GMKm 1YJ9A 3H8ZA 4BE0A 3CD6T 5LJ3e 2Y90A 4A4EA 5GANe 1BKBA 3X20B 3PMIA 2QQSA 5CKDA 5GAOq 1M90U 3HRTA 1UGRB 2NLUA 3P8BB 5CVIA 3KXTA 4NL3A 1UB4A 1VQ6A 1FX7A 4QQDA 4M7DC 2RHYA 2KY9A 1HXDA 4M75G 2XIDA 3VV0A 4M7DG 3L1AA 4M78D 3NTIA 4N4HA 3QO3A 4PL6A 3OS0A 1TH7A 5A0GA 4HCBA 4BUGA 4E47A 2WSEE 2GCXA 1QVPA 4P5NA 4C0DB 4ZN1A 5FROA 3OS1A 3FLGA 4E7HA 2P0PA 3P8HA 1YCYA 2YHTA 5KCHA 3L2QA 3V7SA 2M0OA 3LLRA 2QEXT 1M9SA 4C8QD 1Y7XA 3HRUA 4RMOA 1XOVA 2RJCA 1QVGA 1S72A 3RMQA 5GAN2 5CR2A 1KQSA 3N5BB 1U8RA 3LW5E 4RG2A 4ZGJB 1VQPT 2WACA 4KBMB 4NOYA 4BE2A 4IUUA 1Q81U 3V8LA 2XG8D 5J3BA 3VKIA 1N8RC 2K5LA 3MP6A 4ZN3A 2QI2A 3QPHA 4BY6C 1VQKA 3OYYA 5GMKe 5GAMj 3JCMV 2EKOA 1I81A 2LT1A 5FU7C 2QEXA 3ZBDA 5GANg 4A4KA 1KC8C 2F5KA 3I56A 1QVGS 3CCST 4PLIA 4ZGEB 3JCMJ 5CKEA 1Q7YC 1X75C 2MWOA 3JCMd 2E1HA 5GAN7 4C5EA 3RERA 4PNOA 3LX7A 3LGFA 1I8FA 4E7KA 1YIJA 3OB9A 1UGQB 2EAYA 4KT0E 4RG8A 2HAXA 5I2MA 4XK8E 1X6OA 2CZ7B 5FU6C 4Q5WA 2DVEA 3OBWA 3G71T 3VYGA 5DLOA 4C5GA 5HK0A 2HQXA 2RD1A 2RHZA 3UWNA 1MGQA 3RESA 2DTHA 2EQMA 1UGPB 3RKXA 2XDPA 3SWNC 3MO8A 3CPWA 4M77F 2RK2A 5GAMh 3CCUT 2HD0A 3HKSA 5FRMA 3CC2T 4C92D 2CKKA 3GP8A 1DJ7B 2LTOA 2RJEA 2E6ZA 2JTMA 2VGMA 3C12A 5D6WA 4X34A 2EWNA 3M9QA 5GMKh 1B34A 3J81E 4RCBA 4ZTJA 4XU0A 1Y96B 4BI8B 3PFSA 3RIRA 1LOJA 5A0LA 2E70A 2RI2A 2PVGB 3DLMA 4J7FA 4OB3B 2GF7A 3KUFA 4LDUA 3OSVA 4QQGA 5GAOn 1BI1A 2QA4A 4PKCC 4BI3A 1VIEA 4M78B 3CBPA 4A53A 3NFCA 3JCMe 4M7AA 2L89A 3JCMc 3CC2A 1VQOT 2XDDA 3PIPA 1G3TA 4R56A 2FL7A 1O75A 3A5ZB 3OYBA 4A4HA 1W4SA 3RUXA 5HK3A 5KE3A 3X26B 4C92C 5LJ5h 3L2UA 4KUDK 3OBYA 4M7AD 5AYFA 2EQUA 4XTWA 2WSCE 4LD9K 3MEWA 4XU1A 3OYEA 4Y91A 1NPPA 2MAMA 2OTLA 3KBGA 2EQKA 2D6FA 2QA4T 3HP9A 3OMGA 2A3LA 3A8OB 4DQ2A 5GAOp 5GAN6 2MMPA 3ZEHA 5LJ3d 1VQOA 3E9GA 3CCJT 5CIUA 1I5LA 3QYHB 5LJ3f 1ZHIA 2XU8A 2K5IA 3MHXA 1LNXA 1VQMA 2VV5A 3JRZA 5FLXE 1JJ2A 5C0MA 4YTLA 5LJ3g 4XU2A 1K9MC 4IUVA 2JN0A 3MCAB 5CCAA 1VQ4T 4EMGA 5GAOl 3QJYA 2DO3A 2Y4XA 4FSXA 4J5YA 4PJOE 3CCRT 3DB3A 1VQ6T 1N6AA 2RJDA 5FU6B 3QDRB 3G4ST 1VQMT 2PQWA 3ASKA 3CPWS 2YLBA 1M1KC 4IKFA 4O5VA 2PVOB 2DZ9A 4E7IA 3QZ9B 2LT4A 3OW2A 4M75C 1IZ6A 3QJ6A 1M90C 4QVCA 2L5QA 3L2ZA 1VQ4A 4F7UE 1KQ1A 1SSFA 1XNIA 3CEYA 1YBYA 1OI1A 4QVZA 3A8GB 2KVQG 2VYTA 4OB2B 2CZ0B 3FB9A 3WXMB 3GPLA 3CMAT 3UT1A 3OYHA 3CC7A 2E64A 3GNGA 4RKUE 4C8QA 4EMHA 5DLQE 4JRQA 4PJOB 3X28B 3CBMA 2LVMA 1R8OB 3G4SA 4M75B 4L5GA 3CCLT 2D0QB 2XI9A 4BD3A 4CI0C 1S72T 4MMLA 4LDXA 2RJFA 1QP2A 1VQ8T 2KAFA 4HA8A 3M59A 1BYMA 4M7DD 3OQ5A 2L3RA 4DOWA 5GAN3 1Q82C 4L59A 4HT9A 4M78C 3OYAA 1YJNT 1VQKT 2RB6A 1NE8A 3CC7T 4E7LA 2C06A 3V8JA 4C8QG 5I2SA 3BFMA 2I2LA 3JCMX 1JRIA 3I55A 2DEQA 3PNWC 2CS7A 1VQ8A 3Q1JA 2ZPGB 5KH6A 3LH0A 2ZPIB 5EG2A 3G6EA 3MEVA 3A8HB 4BB7A 4DOVA 5GMKl 1KD1U 4M7DB 4OMFB 3LWHA 3TCJA 2FHDA 3OYMA 3CC4T 2VUBA 1VQ5A 2IG0A 4MZMA 4M77C 4MZPA 4OB0B 4JRPA 1BI0A 5J39A 1KQSS 3X24B 1M5Q1 3OYCA 1KD1C 4JRIA 2E65A 1BIBA 3HFOA 3HL8A 3RMSA 3RKYA 4QVDA 4JLIA 2EJGA 2ZZDA 3G6ET 3OYFA 2CYZB 3NTKA 3JB9H 5HKCA 5GAMd 1WGSA 3FEOA 4OB1B 4IUQA 2OAUA 3V7CA 5M9OA 3QSUA 3QKJA 4XTUA 3WVEB 1VQ5T 4C0FA 2K3YA 5L8RE 4C92A 4DA4A 2DXBA 2ZCFB 2DIQA 2VC8A 3CCMA 3BDLA 2CZ6B 3JCMW 2G3RA 1M4ZA 4A4GA 4N4IA 1UGSB 3DKMA 3OYJA 5GMKi 1KC8U 2V8IA 1NJIC 4M77G 2X4XA 4OP0A 4M75A 1VQNA 3RKWA 1PSFA 4PJOC 2E10A 4HKEA 1G3SA 4M7AE 2EJ9A 4C8QF 3L2RA 2RHIA 1D3BB 3META 1BI2A 2A7YA 3SWNB 3A8MB 3SB2A 2MI6A 2Y4YA 4LDYA 1Y96A 3AHUA 3M58A 4M75E 4R55A 3OYGA 4J83A 5GANh 3BW1A 2XHCA 2DZCA 2EIFA 4M75F 1W2BA 2ZPHB 1JJ2S 2R5MA 4F7UG 2LC4A 3E9FA 4GLKA 1VQ9T 1VQNT 3JCMb 3J7AF 4XTZA 3UDCA 2XD0A 1RI0A 5GAMe 4J8OA 2AHJB 1WJRA 4O6JA 2GQVA 4NS5A 1M1KU 2R57A 3G7ZA 5CQYA 1Q86C 3MEAA 2XICA 2VXFA 2JZ2A 3M55A 3JCMg 4A4FA 1N27A 1Q81C 1RL2A 2RI3A 3VUBA 1VIFA 2D9TA 2GFUA 5KE2A 4ELYC 1Q86U 1H3ZA 4M78E 1V29B 4RCCA 3CCET 1WNLA 2X4JA 3QHSA 3PGGA 1QP3A 2P4TA 2CZ1B 3J80E 3CCRA 3TU4K 1FXXA 4Z02A 3CCQT 2DTOA 2HBPA 2P0KA 3VUZA 2XDBA 1N9SA 2BUDA 2DJZA 1K73C 2JNGA 4M78A 1KHCA 3CD6A 4IURA 5CKHA 2B8AA 1FWZA 3ER0A 4C5IA 4ZTFA 5CQXA 1G5VA 3URGA 3CMET 1LJOA 4ME7A 4FL6A 4M77D 3SD4A 4C0ZA 3CMAA 1WPYA 4C92B 2YLCA 2KDSA 3PIOA 2X4WA 3CCEA 4KULA 2HQEA 5I21A 1QW1A 1Y71A 1HK9A 4D6WA 3CCQA 3CCLA 5J26A 1YI2T 2DKGA 3M5AA 1NJIU 2ZGWA 1PSEA 3CCVA 2O4XB 5GAMg 1G3YA 2CGHA 2E5QA 2XKOC 1IREB 3QXEB 2XK0A 3VYHB 3BY7A 4NL2A 4FM4B 1YHQT 3V7RA 3CMEA 4FIBA 2IVWA 1D3BA 2RO0A 3SWNA 4FT4A 5C6SA 1YJNA 3OS5A 4L6V5 4PJOG 3ME9A 2E12A 2BIVA 1JB0E 4M7DA 4B9XA 1OYXA 2E6NA 2DPPB 2EFIA 4XTYA 2DD4A 3I55T 3CCVT 2JUFA 5IN1A 3S6WA 2O01E 4ATOA 1VQ7A 2GFAA 2DD5A 3P8DA 2DK3A 2MWPA 4XAXB 5LL6S 2RI5A 3O8VA 2X35A 3FRNA 4N0AA 1WJSA 3QUIA 4EMKA 4F7UB 5LJ5e 4JS5A 3MEUA 5D6YA 4BDZA 2EJFA 5KCOA 4B9WA 3OYDA 2PUOB 1I4K1 1OZ3A 3EFRA 3LYIA 3CC4A 3FJPA 1BI3A 3H6ZA 3VJPA 3JCMh 4C5HA 2DTIA 2H3JA 1XTDA 2KQWA 1B34B 3F70A 3QZ5B 1P92A 2RHUA 4IUPA 4MMKA 4XTVA 3JCMQ 3S3OA 4M77E 5LJ3j 3GNFB 5IAYA 3OYIA 2OTJT 4N4GA 2VXEA 1MHNA 5FU7B 1M1FA 3L2VA 2E41A 5GMKj 3HSBA 3INZA 1XQHA 4M7AF 1Q82U 4BDYA 3C95A 1K8AU 3JB9G 2O4XA 1G3WA 3CCMT 2RK1A 1U1SA 2PVDB 4CRIA 2QQBA 3HFNA 4M7DF 5CKBA 3L42A 4UC4A 4C8QC 2VGNA 5GAOr 4A54A 2OTJA 3L2WA 1YJ9T 4M7DE 4J6WA 1VUBA 5LJ5d 3PMTA 3LWIA 3OYLA 4WF2A 3CPFA 2QDYB 4II1A 2QQ9A 2M1HA 1ZQ1A 5GANj 3HRSA 2ZPBB 2RM4A 1W2BS 5CKFA 4V2SA 2F5TX 1WJQA 5LJ5g 1WQWA 3GIBA 2DIGA 1M8VA 4M7AC 5GAN4 5GAN8 3E19A 4OF1A 1YJWA 4FT2A 1NPRA 4PLLA 2LQKA 4MDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8L B;  1UGP B;  2O01 E;  3HHT B;  2WSC E;  1QP2 A;  2DD5 A;  4Y28 E;  4ZGD B;  1PSF A;  2PUK B;  1DJ7 B;  4OB0 B;  2PVD B;  2ZPE B;  3X24 B;  1PSE A;  3QYG B;  2WSE E;  3A8O B;  3WVD B;  2PUO B;  1IRE B;  2PVO B;  1V29 B;  4ZGE B;  2DXC A;  3QXE B;  3QZ9 B;  3A8M B;  3VYH B;  1GXI E;  2PU9 B;  1QP3 A;  3A8H B;  2CZ1 B;  2ZZD A;  3QYH B;  4FM4 B;  3QZ5 B;  2CYZ B;  2PVG B;  2QDY B;  4OB3 B;  3X25 B;  4OB1 B;  1UGQ B;  2WSF E;  3A8G B;  2ZPB B;  2ZPH B;  2CZ0 B;  4KT0 E;  4L6V 5;  4OB2 B;  3X26 B;  4XK8 E;  2CZ7 B;  3WVE B;  1JB0 E;  5L8R E;  2ZPG B;  4RKU E;  2DXB A;  2ZCF B;  2DPP B;  3LW5 E;  2ZPI B;  2ZPF B;  3VYG A;  3X20 B;  3X28 B;  1UGR B;  4ZGJ B;  1AHJ B;  2AHJ B;  2CZ6 B;  2DD4 A;  2D0Q B;  1UGS B; 
#chains in the Genus database with same CATH topology
 1BIA A;  3EGX A;  2VWF A;  5KYX B;  3DLL A;  4EMK B;  4JJB A;  2GGR A;  2BTT A;  2QQA A;  4ELZ C;  2LMJ A;  2YDL A;  5IT9 E;  1OV3 A;  2BZ8 A;  2DL8 A;  2E3H A;  1YIJ Q;  3FJ5 A;  2JMC A;  3SDZ A;  2K57 A;  3GF5 A;  4JJN K;  3HHT B;  4XQ3 A;  4GY5 A;  3OS2 A;  2LCC A;  3NTH A;  1GCP A;  2DVJ A;  3MP8 A;  4M78 F;  2JS0 A;  2DXC A;  1GXI E;  1PG5 B;  3I5S A;  1YI2 A;  4TVR A;  1WHJ A;  2LCL A;  3PVQ A;  3CBO A;  4XTX A;  4ZNX A;  2V8J A;  2KK4 A;  2GNC A;  3MPU B;  3CXC A;  3V8K A;  5GAM f;  1M1G A;  4ANJ A;  4EPC A;  3OY9 A;  1U1T A;  3VU3 C;  3VS4 A;  2PNI A;  1PRL C;  3M4G A;  4AFQ C;  2BKD N;  3FC3 A;  2EYQ A;  1M8M A;  2CP3 A;  3MJX A;  4C92 E;  3SFM A;  1V1C A;  2X4Y A;  4OVA A;  3JB9 J;  1WA7 A;  1VOM A;  3PTA A;  4LDV A;  4QKU A;  1NLO C;  1TOV A;  1B3Q A;  4OGE A;  1QCO A;  2LQN A;  3VRZ A;  3M53 A;  3JSC A;  4PJO F;  5LJ5 j;  2M9U A;  3GOX A;  2M51 A;  3CCJ A;  3R6O A;  3T9N A;  1X01 A;  4D8K A;  2DYI A;  2YRV A;  1SPK A;  2QQR A;  5KYY B;  2AKL A;  2Y90 A;  3JV3 A;  1AD5 A;  5CKD A;  1YNZ A;  3P8B B;  1WLP B;  1UEC A;  1HXD A;  2XID A;  3NTI A;  4J9E A;  2WSE E;  4ZN1 A;  1M2O A;  4E7H A;  3OS1 A;  2P0P A;  3P8H A;  5KCH A;  1NYF A;  3L2Q A;  3LLR A;  1M9S A;  2AKK A;  4RTU A;  3HRU A;  1S72 A;  5GAN 2;  5CR2 A;  4PJJ A;  1VQP T;  1N8R C;  2XG8 D;  4OMM A;  5D7U A;  2VVK A;  3OYY A;  3JCM V;  2EKO A;  4A4K A;  4F16 A;  2LQW A;  4RTX A;  1Q7Y C;  1KFZ A;  3CCR Q;  3H9N A;  2KBT A;  1I8F A;  2JW4 A;  2RNA A;  1OX8 A;  8ATC B;  2HAX A;  1K9M R;  1X6O A;  3CCM Q;  2QYZ A;  4AFU C;  1AVZ C;  3UA6 A;  1U3O A;  1KC8 R;  5HCK A;  2JXB A;  5HK0 A;  2CUD A;  2ED0 A;  3REA B;  3UWN A;  3RES A;  2DTH A;  2EQM A;  3SWN C;  2XDP A;  3CCU T;  3CC2 T;  2FPD A;  1SHG A;  1D0Y A;  3A1P A;  2VGM A;  5GMK h;  2FZG B;  4RCB A;  1TU0 B;  2H8H A;  2QK0 A;  1Y96 B;  1BCO A;  3QWY A;  2RI2 A;  5GAO n;  4OB3 B;  2GF7 A;  3ULR B;  3EG9 A;  1VIE A;  3JCM e;  5GJV B;  3CC2 A;  1T0J A;  2KI7 A;  4DEX A;  4J9F A;  1YCS B;  5LJ5 h;  5AYF A;  2LJ3 A;  3NHN A;  2Z0W A;  1W1F A;  4Y91 A;  1NPP A;  2EQK A;  2A0F B;  1CKB A;  1YP5 A;  1R0B G;  3QYH B;  5LJ3 f;  1E6H A;  4DBR A;  3JRZ A;  3MCA B;  3EGD A;  1Z9Q A;  1Q95 G;  2AZV A;  2Y4X A;  4J5Y A;  4PJO E;  1SRM A;  1VQ6 T;  3RR6 A;  3ASK A;  4E7I A;  2VKN A;  4LNP A;  3L2Z A;  2FPF A;  3CEY A;  5L23 A;  4J9I A;  2CZ0 B;  3FB9 A;  3WXM B;  1E7O A;  1U5S A;  3UT1 A;  1VQM Q;  3CC7 A;  3GNG A;  4PJO B;  4EMH A;  4L5G A;  4LDX A;  1S72 T;  2LJ0 A;  1QP2 A;  2NUZ A;  2G6F X;  2L3P A;  2K7A A;  2BZX A;  3EFO B;  2EYX A;  1QKW A;  3UAT A;  1D0X A;  3CCE Q;  2QGG A;  3M0S A;  1Q82 R;  1IXD A;  2ZPI B;  5EG2 A;  3MEV A;  2D1X A;  1QQJ A;  1AZG B;  1JQQ A;  4M7D B;  4OMF B;  3OYM A;  2FEI A;  1Q81 R;  1VQ5 A;  2IG0 A;  2A36 A;  4OB0 B;  1BI0 A;  1KQS S;  4KH0 B;  2KT1 A;  1M1K R;  3HFO A;  1BIB A;  1BB9 A;  1YWO A;  3RKY A;  4JLI A;  5GJW B;  4PJM A;  2ZZD A;  1PD0 A;  1BK2 A;  2CYZ B;  2OAU A;  2GTO A;  3QKJ A;  1VQ5 T;  4DA4 A;  1VQ7 Q;  2CUB A;  2VC8 A;  3VS3 A;  1IHW A;  4OP0 A;  1PM3 A;  1VQN A;  1PSF A;  4PJO C;  1WHG A;  2E10 A;  4FW2 A;  2EJ9 A;  2E4H A;  5KYX A;  3SWN B;  3MET A;  2DRM A;  3SB2 A;  3THK A;  2MI6 A;  1I5O B;  2Y4Y A;  3VS5 A;  3M58 A;  2FPE A;  4R55 A;  2XHC A;  1IGU A;  2JM9 A;  2K9G A;  1JJ2 S;  1ZSZ A;  2E3I A;  2LC4 A;  4F7U G;  1VQN T;  2XD0 A;  4CC3 A;  1JEG A;  2COZ A;  2R57 A;  3MEA A;  2CH4 A;  1N27 A;  4Y92 A;  3NMZ C;  1V29 B;  2YUP A;  3A98 A;  2X4J A;  3CCR A;  3PGG A;  3TU4 K;  3PE0 A;  2HBP A;  3VUZ A;  2JNG A;  4M78 A;  1KHC A;  5CKH A;  1RAC B;  4C5I A;  3AT1 B;  2CT4 A;  3GBQ A;  3URG A;  1ARK A;  3EGU A;  2X4W A;  1IHV A;  2V1R A;  2HQE A;  2ECZ A;  1FMK A;  2ESW A;  1ABO A;  1PSE A;  1AOJ A;  5GAM g;  2E5Q A;  1UGV A;  3VYH B;  4FYV B;  1FMW A;  3CME A;  4FIB A;  1D3B A;  2EKH A;  4PJO G;  3ME9 A;  1FYN A;  1SRL A;  2L3Q A;  2DPP B;  5FWB A;  5IN1 A;  3CMA Q;  4FYY B;  2GFA A;  3P8D A;  4XAX B;  1YHQ A;  2X35 A;  4BDZ A;  2QG9 B;  5KCO A;  2BZY A;  1AWJ A;  1OZ3 A;  3CC4 A;  2D8H A;  3FJP A;  1BI3 A;  3H6Z A;  3RBB B;  4C5H A;  1NBE B;  2H3J A;  2KQW A;  1P92 A;  3S3O A;  2OTJ T;  1K4U S;  1VQ6 Q;  2E41 A;  1VYV A;  1Q82 U;  2W10 A;  1K8A U;  3JB9 G;  2RK1 A;  1U1S A;  1D09 B;  2ROT A;  1UJ0 A;  2L0A A;  5GAO r;  3L2W A;  1VUB A;  3PMT A;  3OYL A;  3CPF A;  1NLP C;  5IH2 A;  3HRS A;  2ZPB B;  1W2B S;  1G2B A;  4FSS A;  2F5T X;  4M7A C;  3E19 A;  1YJW A;  3QII A;  1RAI B;  2HL5 C;  2KXD A;  4M7A G;  4C8Q E;  3WVD B;  1CSK A;  2FVU A;  3CME Q;  1K9M U;  1X43 A;  1VQP A;  2QXF A;  2JMA A;  2LNV A;  1SEM A;  2K4Y A;  4J6X A;  1AHJ B;  3OYK A;  2LQ8 A;  5A2Q E;  4MZT A;  4XU3 A;  3QBY A;  4N0A C;  4JUV A;  2EQJ A;  2K2V A;  1OU8 A;  4M75 D;  1ZSG A;  2KGT A;  3BDU A;  2KMT A;  5LJ3 h;  1S72 Q;  4HVU A;  3OYN A;  2R58 A;  3G71 A;  4E7J A;  1PCX A;  1RAB B;  4BI4 A;  1V76 A;  5CK9 A;  2DRK A;  3CCU A;  4C8Q B;  2EW3 A;  3M57 A;  2HNI A;  1RLQ C;  3ZFJ A;  1KD1 R;  3M4Y A;  1VQ7 T;  1VQO Q;  4PJO D;  2FRY A;  2LNH B;  2JOY A;  3FIF A;  2IPO B;  1PHT A;  1OX9 A;  3TEE A;  1UEB A;  1VQL T;  2K5F A;  1NYG A;  1Q7Y U;  4VUB A;  2RHX A;  1KQ2 A;  5LJ5 f;  1Y07 A;  4JDS A;  3QYG B;  2M0Y A;  4QW2 A;  4LUD A;  4M77 B;  1D1B A;  2V1Q A;  4JS4 A;  1ZLM A;  4PJO A;  1MV0 B;  2LDM A;  1I0C A;  4EDU A;  2WSF E;  5HY6 A;  5GMK m;  2QA4 Q;  2OX7 A;  2NLU A;  3KXT A;  4NL3 A;  2RF0 A;  4DEY A;  1VQ6 A;  1FX7 A;  4QQD A;  2RHY A;  3VV0 A;  3EH1 A;  3L1A A;  2CSQ A;  4N4H A;  3QO3 A;  4PL6 A;  3OS0 A;  5A0G A;  4BUG A;  2GCX A;  5FRO A;  1KSW A;  3V7S A;  2M0O A;  4AMC A;  4C8Q D;  4RMO A;  2DL5 A;  4Z8A A;  1YI2 Q;  2CP2 A;  2J7I A;  4KBM B;  4HVV A;  2K5L A;  3MP6 A;  4ZN3 A;  3QPH A;  1ABQ A;  2EGC A;  3PVL A;  1MND A;  5FU7 C;  2QEX A;  3ZBD A;  4JPB W;  4A63 B;  1KC8 C;  1TUD A;  2F5K A;  3I56 A;  1QVG S;  5CKE A;  4PNO A;  3LX7 A;  2BE9 B;  3CC4 Q;  4RG8 A;  1WYX A;  2CZ7 B;  1OQK A;  3VYG A;  1JXO A;  2BE7 D;  2QAZ A;  3VRY A;  3CPW A;  1WI7 A;  2RK2 A;  2COW A;  2KRM A;  3GP8 A;  2JTE A;  2JTM A;  3CCL Q;  3C12 A;  4ZTJ A;  1PKT A;  1UJY A;  4R0K A;  2YSQ A;  4RTW A;  3KUF A;  2QA4 A;  1BI1 A;  4M78 B;  4A53 A;  2KE9 A;  3SHW A;  1JO8 A;  2L89 A;  2XDD A;  1G3T A;  2FL7 A;  4A4H A;  2YXY A;  1QWE A;  5HK3 A;  3X26 B;  3L2U A;  2EQU A;  4XTW A;  4LD9 K;  4XU1 A;  1Z9Z A;  2D6F A;  3OMG A;  1IGQ A;  2O88 A;  5GAN 6;  2MMP A;  1AEY A;  6AT1 B;  2LP5 A;  2XU8 A;  2K5I A;  3C0C A;  1VQM A;  1LNX A;  2VV5 A;  1SSH A;  4YTL A;  5LJ3 g;  2DBK A;  1ZBJ A;  4IUV A;  4EMG A;  1N8R R;  1WHL A;  5GAO l;  1G83 A;  1GFD A;  2DO3 A;  2J06 A;  4FSX A;  1M3A A;  1K73 R;  4FCY A;  3TVT A;  3OW2 P;  1N6A A;  3G4S T;  5FU6 B;  3QDR B;  2PQW A;  1M1K C;  2DZ9 A;  3QZ9 B;  1M90 C;  1MMG A;  4QVC A;  1LPL A;  4F7U E;  4QVZ A;  3A8G B;  2CRE A;  3GPL A;  3CMA T;  2KRN A;  2E64 A;  2LVM A;  3G4S A;  1YJN Q;  1W2B P;  2HQH A;  2D0Q B;  2XI9 A;  4MML A;  2RJF A;  2HDA A;  2QTV A;  3I9Q A;  3M59 A;  4M7D D;  2L3R A;  4HT9 A;  1VQK T;  2D0N A;  1ZA2 B;  2FO0 A;  3CC7 T;  2DMO A;  1RLP C;  3V8J A;  4FYX B;  3JCM X;  5KYN A;  2CS7 A;  2ZPG B;  1NG2 A;  3SEM A;  1KD1 U;  3TCJ A;  2P84 A;  3CC4 T;  1UE9 A;  4MZM A;  4MZP A;  1KD1 C;  3RMS A;  2JM8 A;  3MKD A;  1MMA A;  2EJG A;  2EQI A;  3OYF A;  2RMO A;  5GAM d;  4OB1 B;  4IUQ A;  1MMD A;  1UHF A;  5M9O A;  1WZO A;  1ZSZ B;  4C0F A;  5L8R E;  4C92 A;  2DIQ A;  4J9H A;  3BDL A;  2CZ6 B;  2G3R A;  4A4G A;  2DL7 A;  5GMK i;  3H0F A;  2X4X A;  1TXQ A;  3H0I A;  1VQL Q;  1G3S A;  4HVW A;  1VQ9 Q;  3L2R A;  4LDY A;  4M75 E;  2YRC A;  1W2B A;  2R5M A;  4JJD A;  1F1B B;  1RI0 A;  5GAM e;  4J8O A;  2AHJ B;  4NS5 A;  1M1K U;  1Q86 C;  2XIC A;  2IIM A;  4KRT A;  3JCM g;  2OAW A;  4A4F A;  3TSW A;  4ELY C;  1Q86 U;  2OTL Q;  3TSZ A;  1H3Z A;  4M78 E;  1QP3 A;  2CZ1 B;  4J9B A;  1RAD B;  2YT6 A;  2M02 A;  2BUD A;  1FWZ A;  4ZTF A;  5CQX A;  1I1J A;  1U06 A;  1LJO A;  4ME7 A;  4M77 D;  2RQR A;  3CMA A;  1SF9 A;  4C92 B;  4CC7 A;  3CCE A;  4KUL A;  4PJL A;  1Y71 A;  1HK9 A;  1RAE B;  4D6W A;  3CCQ A;  1YI2 T;  3M5A A;  3CCV A;  2CGH A;  1HD3 A;  1GFC A;  4IIO A;  2XK0 A;  4E6R A;  4FM4 B;  1YHQ T;  4AG2 C;  3G4S Q;  1YJN A;  1I07 A;  5IXF A;  1AZE A;  2F2W A;  1OYX A;  2MCN A;  2EFI A;  4XTY A;  1WXT A;  3I55 T;  3CCV T;  1J3T A;  2DL4 A;  4ATO A;  1VQ7 A;  2DD5 A;  2MWP A;  2RI5 A;  4F17 A;  4N0A A;  5KYU B;  4F7U B;  1S1N A;  1ZUY A;  2HKN A;  3MEU A;  5D6Y A;  4RTT A;  4B9W A;  1KQS P;  3EFR A;  3H0H A;  2DTI A;  3QZ5 B;  1XTD A;  1B34 B;  1X69 A;  4IUP A;  4MMK A;  3EG9 B;  4M77 E;  5IAY A;  1OUL A;  1RAF B;  1MHN A;  1M30 A;  4BDY A;  2O4X A;  5IHN A;  1QMC A;  2PVD B;  2CT3 A;  2ENM A;  2GQI A;  2AZS A;  3L42 A;  2VGN A;  1YJ9 T;  1VQ4 Q;  4WF2 A;  5I11 A;  2QQ9 A;  1ZQ1 A;  5GAN j;  2HBW A;  2RQV A;  5KYY A;  1WJQ A;  1EZZ B;  4OF1 A;  4FT2 A;  1D1A A;  2LQK A;  4C8Q A;  3A8L B;  1VQ9 A;  4HCC A;  1O9S A;  4J6Y A;  2RQT A;  1H64 1;  3CXC S;  2OJ2 A;  2OTJ Q;  1YIT T;  1N8R U;  5GAN f;  4E2F B;  3JB9 D;  3C94 A;  4MDX A;  4BY6 B;  3I5R A;  1K73 U;  2EVR A;  2JT4 A;  1TSF A;  3MP1 A;  4CC2 A;  3JB9 I;  1YJW T;  1QVF S;  3X25 B;  3H41 A;  1K8A R;  4IUT A;  3S3M A;  1N9R A;  2HKQ B;  1EX4 A;  1X2K A;  1KG1 A;  4C0D C;  1OZ2 A;  4HT8 A;  4WCI A;  2DXT A;  1W70 A;  1K8A C;  3DB4 A;  4LUE A;  3E2U A;  1YIJ T;  3S3N A;  2C0O A;  1D0Z A;  1QVF A;  1YIT Q;  1WHM A;  2X3X D;  3M54 A;  3PT9 A;  2W0Z A;  3C4S A;  2ZPF B;  4KGZ B;  4C92 G;  3CC7 Q;  4PFP A;  2JVV A;  1WQ7 A;  2A28 A;  3UPU A;  3JB9 F;  1VQL A;  4Y28 E;  5FRN A;  2PUK B;  4F7U A;  1BBZ A;  2CP6 A;  4C92 F;  2EGE A;  4C0G A;  1M2V B;  4OGC A;  1UUE A;  4LD6 A;  1AWX A;  2JJ9 A;  4QQ6 A;  4JLG A;  4X9C A;  5CAI A;  5A0D A;  3EHQ A;  1MV3 A;  2L8D A;  2K3X A;  1ZBX A;  2DXU A;  2OTL T;  3UA7 A;  1OU9 A;  4OMN A;  3JAM E;  1NZ9 A;  1TWB A;  3JCM f;  3LGL A;  4ZGD B;  1ZA1 B;  1TS9 A;  2MF2 A;  4M78 G;  3OMC A;  4F14 A;  2COY A;  2QTX A;  8AT1 B;  5DY9 A;  3GLX A;  2CP0 A;  5D6X A;  4EMK C;  2LX9 A;  4RTY A;  2JTF A;  4AFS C;  3CD6 T;  1YJ9 A;  2YUQ A;  1D1C A;  5KYW B;  4A4E A;  5GAO q;  3PMI A;  2QQS A;  3HRT A;  3VS2 A;  5CVI A;  2KY9 A;  1IB8 A;  4M75 G;  4M78 D;  4DBF A;  1XJW B;  2X3W D;  1X27 A;  4C0D B;  2O9V A;  4B6M A;  3CD6 A;  3FLG A;  1PC0 A;  1YCY A;  1BCM A;  3CCV Q;  1Y7X A;  1WHH A;  2L3S A;  3RMQ A;  1IRX A;  3I35 A;  3LW5 E;  4RG2 A;  4E7S A;  1Q81 U;  1JJ2 P;  2QI2 A;  4BY6 C;  5GMK e;  3ZL7 C;  5GAM j;  1I81 A;  2LT1 A;  5GAN g;  1M27 C;  3D7S B;  4PLI A;  2AT1 B;  4ZGE B;  3JCM J;  1AWW A;  1X75 C;  3EFO A;  1UTI A;  4C5E A;  3NPF A;  4PJN A;  1YIJ A;  2A08 A;  3OB9 A;  1LVK A;  1UGQ B;  2EAY A;  4KT0 E;  5I2M A;  4AFZ C;  4Q5W A;  1JXM A;  3G71 T;  2HCK A;  4C5G A;  2RD1 A;  3RKX A;  1UGP B;  4M77 F;  5GAM h;  1GL5 A;  2HD0 A;  5KYU A;  2CKK A;  4C92 D;  1DJ7 B;  2LTO A;  2RJE A;  2E6Z A;  5D6W A;  1QCF A;  1QKX A;  4XU0 A;  3I55 Q;  2DA9 A;  3G1J A;  2ED1 A;  3RIR A;  5A0L A;  2E70 A;  4J7F A;  2PVG B;  4QT7 A;  3OW2 S;  5FRM A;  4LDU A;  3OSV A;  1WDX A;  4BI3 A;  3NFC A;  4M7A A;  2HL3 A;  3JCM c;  1VQO T;  3PIP A;  4R56 A;  4AG1 C;  3RUX A;  5KE3 A;  4C92 C;  3OBY A;  2WSC E;  3MEW A;  3OYE A;  1LCK A;  2MIO A;  1VQ5 Q;  2QA4 T;  4DQ2 A;  3ZEH A;  2RPN A;  5LJ3 d;  1KIK A;  3CCJ T;  5CIU A;  4RTZ A;  4PK4 A;  3MHX A;  5FLX E;  1JJ2 A;  5C0M A;  1WXB A;  4XU2 A;  1K9M C;  5CCA A;  1VQ4 T;  1VYT A;  1MMN A;  2DET A;  1PNJ A;  1QVF P;  2EBP A;  2FZK B;  3CCR T;  4GBQ A;  1VQN Q;  2RJD A;  1VQM T;  4IKF A;  4PFZ A;  2PVO B;  2LT4 A;  4M75 C;  3QJ6 A;  2L5Q A;  4X9D A;  4KH1 B;  2KVQ G;  2VYT A;  3OYH A;  2RQU A;  4RKU E;  5DLQ E;  4JRQ A;  3X28 B;  3CBM A;  1TUG B;  2SRC A;  4M75 B;  3CCL T;  4CI0 C;  1YJW Q;  1K9A A;  5FW9 A;  2X9H A;  2KRO A;  4DOW A;  1H92 A;  1Q82 C;  1YJN T;  2RB6 A;  1UFF A;  1NE8 A;  4E7L A;  2C06 A;  1QLY A;  3BFM A;  4HXJ A;  1JRI A;  3CC2 Q;  3Q1J A;  2NUT B;  3LH0 A;  4DOV A;  2FHD A;  1PD1 A;  2FRW A;  4JRI A;  2E65 A;  3HL8 A;  2HMA A;  1ZUK A;  1A0N B;  2ATC B;  3G6E T;  1H3H A;  2KYB A;  2I0N A;  2RN8 A;  3QSU A;  3WVE B;  3CCM A;  3OYJ A;  1X2Q A;  3DKM A;  4M77 G;  1GRI A;  4M75 A;  4JZ3 A;  1KJW A;  2L2P A;  2J6F A;  5I22 A;  3CD6 Q;  3RDV A;  4C8Q F;  1VYU A;  1D3B B;  3M0U A;  1BI2 A;  1Y96 A;  3EH2 A;  5AT1 B;  4J83 A;  5GAN h;  2EIF A;  4FYW B;  2PTK A;  2HEQ A;  2ZPH B;  3E9F A;  1WJR A;  4O6J A;  2GQV A;  5KYW A;  3G7Z A;  5CQY A;  1PWT A;  3CCQ Q;  2VXF A;  3BE3 A;  2D9T A;  2GFU A;  2DEU A;  4RCC A;  3CCE T;  2HZY A;  1SHF A;  1WIE A;  1FXX A;  4Z02 A;  5IHK A;  2P0K A;  1B07 A;  2ABL A;  2DJZ A;  1YFN A;  1K73 C;  1T3L A;  4IUR A;  3CME T;  3SD4 A;  4C0Z A;  2YLC A;  5I21 A;  5J26 A;  2ZGW A;  1G3Y A;  2XKO C;  1GBQ A;  3QXE B;  3BY7 A;  4NL2 A;  3EG0 A;  2RQW A;  3V7R A;  2IVW A;  3SWN A;  3VS6 A;  1X6G A;  4M7D A;  4B9X A;  2E6N A;  1K76 A;  2DD4 A;  4KGV B;  4GLM A;  3REB B;  2H3E B;  2DK3 A;  5LL6 S;  3O8V A;  3FRN A;  5LJ5 e;  1WJS A;  4JS5 A;  3O5Z A;  2PUO B;  1I4K 1;  3LYI A;  3M0T A;  3F70 A;  2NUT A;  2RHU A;  1PRM C;  4XTV A;  2CSI A;  3GNF B;  3OYI A;  4K11 A;  4N4G A;  2VXE A;  4ESR A;  1XQH A;  4M7A F;  1G8X A;  3C95 A;  2J6K A;  3IQL A;  1G3W A;  3CCM T;  1VA7 A;  2D8J A;  4M7D F;  4C8Q C;  1WFW A;  2OTJ A;  4M7D E;  4J6W A;  2LZ6 B;  3LWI A;  1RUW A;  2QDY B;  2K2M A;  2DER A;  2YWW A;  4V2S A;  4JJC A;  5LJ5 g;  1WQW A;  2DIG A;  1Y57 A;  2EYY A;  2KYM A;  3EGD B;  4PLL A;  2DX1 A;  2QEX Q;  4DBQ A;  2OI3 A;  4JRK A;  3CPW P;  1KHI A;  1YN8 A;  2KSS A;  2M16 A;  4LDW A;  2F69 A;  2PZ1 A;  1ZUU A;  2RH2 A;  4D8D A;  3QG1 A;  2V8K A;  1TG0 A;  4BE1 A;  1YIT A;  2FB7 A;  3LH5 A;  3HPW A;  3OA6 A;  3I56 T;  1YHQ Q;  1M3B A;  2GTJ A;  3CCS A;  3JCM P;  2DAQ A;  2P0Q A;  4X1V A;  4Z89 A;  3EFS A;  3KFV A;  1E6G A;  1EIF A;  1X6B A;  2PU9 B;  3M56 A;  1QVG P;  3OSS C;  2LX7 A;  2F2X A;  2DBM A;  4M7A B;  1H8K A;  4J7I A;  2SEM A;  4BAC A;  2FYK A;  5GAO p;  1JBM A;  2K6D A;  3FDR A;  1YWP A;  4DBH A;  5GAO m;  5DM7 R;  1N5Z A;  4M77 A;  4RUG A;  2ZPE B;  4FU6 A;  1WXU A;  3I56 Q;  3TRE A;  1VQ8 Q;  3M0P A;  2RA2 A;  2DIL A;  2LRQ A;  5GAN d;  1K0S A;  4HCZ A;  2R5A A;  5CO7 A;  1NEB A;  1AT1 B;  1CKA A;  1ZSZ C;  2J6O A;  3EAE A;  4KUI A;  1BU1 A;  5GAN 5;  3E1S A;  4F7U F;  1HJD A;  1C0M A;  3H8Z A;  4BE0 A;  5LJ3 e;  5GAN e;  1BKB A;  3X20 B;  1M90 U;  2KEA A;  1UGR B;  1UB4 A;  4M7D C;  2CP7 A;  2O9S A;  1C1A A;  2C0I A;  2GBQ A;  1RI9 A;  1Q86 R;  1OPL A;  1TH7 A;  4HCB A;  4J9D A;  4E47 A;  1QVP A;  4P5N A;  2FG0 A;  3VS0 A;  4PFO A;  1M2V A;  2YHT A;  1C6V X;  2QGF B;  2QEX T;  1XOV A;  2RJC A;  1QVG A;  4JZ4 A;  4RTV A;  1KQS A;  3N5B B;  1U8R A;  4ZGJ B;  4E7Z A;  2WAC A;  4NOY A;  4BE2 A;  4M7D G;  4IUU A;  3V8L A;  5J3B A;  3VKI A;  2NUP B;  3EG1 A;  2P4R A;  2FZC B;  2DYB A;  2F2V A;  1VQK A;  2V26 A;  1QWF A;  3CCS T;  2KRS A;  2MWO A;  1M90 R;  3JCM d;  2E1H A;  5GAN 7;  3RER A;  3LGF A;  4E7K A;  2LJ1 A;  2QDL A;  2MOX A;  4XK8 E;  5FU6 C;  2HSE B;  2DF6 A;  4FW1 A;  2DVE A;  3OBW A;  5DLO A;  1IO6 A;  2HQX A;  2RHZ A;  1MGQ A;  4OMQ A;  1PKS A;  3MO8 A;  2KR3 A;  3HKS A;  2A37 A;  3G71 Q;  3J81 E;  4X34 A;  2EWN A;  3M9Q A;  1B34 A;  4BI8 B;  3PFS A;  1LOJ A;  2LCS A;  5IHI A;  3DLM A;  4QQG A;  1K0X A;  2EPD A;  3M0R A;  4PKC C;  3CBP A;  2EYW A;  1Y0M A;  3RNJ A;  3A5Z B;  1O75 A;  5IXB A;  3OYB A;  1W4S A;  4KUD K;  2DJQ A;  4M7A D;  2DL3 A;  4OML A;  2MAM A;  2OTL A;  3KBG A;  4OMP A;  1GBR A;  2HSP A;  3HP9 A;  2A3L A;  3A8O B;  2KXC A;  1VQO A;  3E9G A;  1KK7 A;  4LE9 A;  1Q7Y R;  1I5L A;  2KT8 A;  1ZHI A;  2YUN A;  4WTO B;  1SKU B;  1ZX6 A;  2MPX C;  3EGX B;  2JN0 A;  2MK5 A;  2X51 A;  2F1L A;  3QJY A;  1NJI R;  2EGA A;  3DB3 A;  3CPW S;  2YLB A;  4O5V A;  3OW2 A;  1IZ6 A;  7AT1 B;  1VQ4 A;  1HYO A;  2VAS A;  3TQ7 P;  1KQ1 A;  1SSF A;  1XNI A;  3EG2 A;  1YBY A;  1OI1 A;  4OB2 B;  3QWX X;  1QCN A;  1K1Z A;  1R8O B;  2DM1 A;  4BD3 A;  1B7T A;  4EIK A;  4F04 B;  2K3B A;  1VQ8 T;  2KAF A;  4HA8 A;  1BYM A;  3OQ5 A;  5GAN 3;  4L59 A;  5ECA A;  4M78 C;  3OYA A;  4HCK A;  2C0T A;  4C8Q G;  5I2S A;  2I2L A;  1RAG B;  1UDL A;  3I55 A;  2DEQ A;  3PNW C;  1VQ8 A;  1VQK Q;  2NUP A;  5KH6 A;  1NEG A;  1HSQ A;  3G6E A;  1EFN A;  3A8H B;  4BB7 A;  1FMV A;  5GMK l;  1W6X A;  2CDT A;  3LWH A;  1MNE A;  2AK5 A;  2VUB A;  4M77 C;  1JU5 C;  4JRP A;  1R0C B;  5J39 A;  1T3S A;  3X24 B;  1M5Q 1;  3OYC A;  2O2O A;  4QVD A;  3M0Q A;  3UF4 A;  1AWO A;  3NTK A;  3JB9 H;  5HKC A;  1WGS A;  3FEO A;  2AIR B;  3V7C A;  1GCQ A;  2KNB B;  4XTU A;  2K3Y A;  2DXB A;  2ROL A;  2ZCF B;  3JCM W;  1M4Z A;  2EYZ A;  1UGS B;  3CQT A;  4N4I A;  2CH4 W;  2V8I A;  1KC8 U;  1NJI C;  3RKW A;  3EHR A;  4HKE A;  4AT1 B;  4M7A E;  2RHI A;  2VB6 A;  1M3C A;  2A7Y A;  3A8M B;  9ATC B;  3AHU A;  2MYS A;  3OYG A;  3BW1 A;  2DZC A;  4M75 F;  1ACM B;  1VQ9 T;  3J7A F;  4GLK A;  4LXC A;  3JCM b;  4XTZ A;  3UDC A;  1GCQ C;  4J9C A;  3CCJ Q;  2O31 A;  2NWM A;  2JZ2 A;  3R6N A;  1TTH B;  3M55 A;  5EC7 A;  1Q81 C;  1RL2 A;  2RI3 A;  3VUB A;  1VIF A;  5KE2 A;  2J05 A;  2YRD A;  1WNL A;  3QHS A;  2P4T A;  3J80 E;  3CCQ T;  2DTO A;  2XDB A;  1N9S A;  3HTR A;  4LN2 A;  2QAS A;  2B8A A;  1YJ9 Q;  1OPK A;  3ER0 A;  1UHC A;  1G5V A;  4FL6 A;  1WPY A;  3PIO A;  2KDS A;  2CP5 A;  3EG3 A;  1QW1 A;  3CCL A;  1MUZ A;  2DKG A;  1NJI U;  2O4X B;  1IRE B;  1RAA B;  2K79 A;  1UG1 A;  2RO0 A;  5C6S A;  4FT4 A;  3OS5 A;  4L6V 5;  2E12 A;  2BIV A;  1JB0 E;  2B86 A;  3VS7 A;  3CCS Q;  1T0H A;  2JUF A;  2XMF A;  3S6W A;  2O01 E;  1RAH B;  4Z88 A;  3QUI A;  4EMK A;  2EJF A;  3OYD A;  3VS1 A;  4ORZ A;  3NGP A;  1TUC A;  3VJP A;  3JCM h;  3CCU Q;  3JCM Q;  3CXC P;  5LJ3 j;  1OOT A;  5FU7 B;  1OEB A;  1M1F A;  2JS2 A;  2DLP A;  3L2V A;  5GMK j;  3G6E Q;  3HSB A;  3INZ A;  3QDF A;  2DE0 X;  2ZAE A;  4OMO A;  2E5K A;  2DFU A;  5FWC A;  4CC4 B;  4IIM A;  4CRI A;  1SG5 A;  2QQB A;  3HFN A;  4J9G A;  5CKB A;  4UC4 A;  2DNU A;  4A54 A;  3U23 A;  5LJ5 d;  1VQP Q;  1WHK A;  2YUO A;  2NYS A;  4II1 A;  2M1H A;  2RM4 A;  5CKF A;  4M4Z A;  1R77 A;  3GIB A;  1M8V A;  5GAN 4;  1WX6 A;  5GAN 8;  4KGX B;  1NPR A;  1NM7 A;  4MDW A; 
#chains in the Genus database with same CATH homology
 3A8L B;  1BIA A;  1VQ9 A;  4HCC A;  1O9S A;  4J6Y A;  1H64 1;  3CXC S;  3OW2 S;  1YIT T;  3QII A;  1N8R U;  5GAN f;  3JB9 D;  3C94 A;  3DLL A;  4JRK A;  4EMK B;  4M7A G;  4MDX A;  4BY6 B;  1KHI A;  3WVD B;  4C8Q E;  2KSS A;  2M16 A;  2QQA A;  1K73 U;  4ELZ C;  2FVU A;  3MP1 A;  4LDW A;  3JB9 I;  1YJW T;  1K9M U;  2F69 A;  1QVF S;  3X25 B;  2RH2 A;  1VQP A;  3QG1 A;  5IT9 E;  2QXF A;  4IUT A;  2LNV A;  2K4Y A;  2V8K A;  4BE1 A;  3S3M A;  1N9R A;  1YIT A;  4J6X A;  1AHJ B;  2FB7 A;  3OYK A;  3SDZ A;  2LQ8 A;  5A2Q E;  2K57 A;  4MZT A;  1KG1 A;  3GF5 A;  4JJN K;  4XU3 A;  3HPW A;  1OZ2 A;  3HHT B;  3QBY A;  4C0D C;  3OA6 A;  3I56 T;  3CCS A;  4HT8 A;  2DXT A;  4N0A C;  4JUV A;  2EQJ A;  2K2V A;  4XQ3 A;  3JCM P;  4GY5 A;  1K8A C;  3OS2 A;  2DAQ A;  2LCC A;  3DB4 A;  2P0Q A;  3NTH A;  3BDU A;  4M75 D;  1YIJ T;  3MP8 A;  2KMT A;  3EFS A;  4M78 F;  3S3N A;  2DXC A;  1EIF A;  5LJ3 h;  1GXI E;  3M56 A;  2PU9 B;  1QVF A;  1YI2 A;  3OYN A;  2R58 A;  4TVR A;  3G71 A;  2LCL A;  3OSS C;  4E7J A;  3CBO A;  4XTX A;  4BI4 A;  3M54 A;  3PT9 A;  4M7A B;  2V8J A;  2KK4 A;  5CK9 A;  4J7I A;  3CCU A;  3C4S A;  4BAC A;  2ZPF B;  4C92 G;  3CXC A;  2FYK A;  3V8K A;  5GAM f;  1M1G A;  1WQ7 A;  1JBM A;  2JVV A;  4C8Q B;  4EPC A;  1U1T A;  3VU3 C;  3OY9 A;  3M57 A;  3UPU A;  3FDR A;  3JB9 F;  1VQL A;  4Y28 E;  5GAO m;  2HNI A;  4M77 A;  5DM7 R;  5FRN A;  2PUK B;  3ZFJ A;  3M4G A;  4F7U A;  2BKD N;  3M4Y A;  2EYQ A;  2ZPE B;  3FC3 A;  4C92 F;  1VQ7 T;  4X9D A;  4FU6 A;  4PJO D;  4C0G A;  4C92 E;  3TRE A;  2JOY A;  3FIF A;  4OGC A;  3SFM A;  4LD6 A;  4QQ6 A;  2RA2 A;  2X4Y A;  4OVA A;  5GAN d;  2LRQ A;  4JLG A;  4X9C A;  5CAI A;  3JB9 J;  3TEE A;  5A0D A;  4HCZ A;  2R5A A;  3PTA A;  4LDV A;  5CO7 A;  1UEB A;  2K3X A;  2L8D A;  1VQL T;  2K5F A;  1ZBX A;  4OGE A;  1Q7Y U;  2DXU A;  4VUB A;  2RHX A;  2OTL T;  1KQ2 A;  3M53 A;  3EAE A;  3JSC A;  3JAM E;  1NZ9 A;  4KUI A;  3JCM f;  4PJO F;  5LJ5 f;  5LJ5 j;  2M9U A;  3LGL A;  4ZGD B;  2MF2 A;  3GOX A;  4M78 G;  3CCJ A;  1Y07 A;  3OMC A;  4JDS A;  2QTX A;  3QYG B;  1YHQ A;  3R6O A;  4QW2 A;  5GAN 5;  4M77 B;  3T9N A;  1X01 A;  3E1S A;  2YRV A;  4JS4 A;  5DY9 A;  3GLX A;  2QQR A;  5D6X A;  4EMK C;  4F7U F;  4PJO A;  2LX9 A;  2LDM A;  4EDU A;  2WSF E;  2JTF A;  5HY6 A;  5GMK m;  1YJ9 A;  3H8Z A;  4BE0 A;  3CD6 T;  5LJ3 e;  2Y90 A;  4A4E A;  5GAN e;  1BKB A;  3X20 B;  3PMI A;  2QQS A;  5CKD A;  5GAO q;  1M90 U;  3HRT A;  1UGR B;  2NLU A;  3P8B B;  5CVI A;  3KXT A;  4NL3 A;  1UB4 A;  1VQ6 A;  1FX7 A;  4QQD A;  4M7D C;  2RHY A;  2KY9 A;  1HXD A;  4M75 G;  2XID A;  3VV0 A;  4M7D G;  3L1A A;  4M78 D;  3NTI A;  4N4H A;  3QO3 A;  4PL6 A;  3OS0 A;  1TH7 A;  5A0G A;  4HCB A;  4BUG A;  4E47 A;  2WSE E;  2GCX A;  1QVP A;  4P5N A;  4C0D B;  4ZN1 A;  5FRO A;  3OS1 A;  3FLG A;  4E7H A;  2P0P A;  3P8H A;  1YCY A;  2YHT A;  5KCH A;  3L2Q A;  3V7S A;  2M0O A;  3LLR A;  2QEX T;  1M9S A;  4C8Q D;  1Y7X A;  3HRU A;  4RMO A;  1XOV A;  2RJC A;  1QVG A;  1S72 A;  3RMQ A;  5GAN 2;  5CR2 A;  1KQS A;  3N5B B;  1U8R A;  3LW5 E;  4RG2 A;  4ZGJ B;  1VQP T;  2WAC A;  4KBM B;  4NOY A;  4BE2 A;  4IUU A;  1Q81 U;  3V8L A;  2XG8 D;  5J3B A;  3VKI A;  1N8R C;  2K5L A;  3MP6 A;  4ZN3 A;  2QI2 A;  3QPH A;  4BY6 C;  1VQK A;  3OYY A;  5GMK e;  5GAM j;  3JCM V;  2EKO A;  1I81 A;  2LT1 A;  5FU7 C;  2QEX A;  3ZBD A;  5GAN g;  4A4K A;  1KC8 C;  2F5K A;  3I56 A;  1QVG S;  3CCS T;  4PLI A;  4ZGE B;  3JCM J;  5CKE A;  1Q7Y C;  1X75 C;  2MWO A;  3JCM d;  2E1H A;  5GAN 7;  4C5E A;  3RER A;  4PNO A;  3LX7 A;  3LGF A;  1I8F A;  4E7K A;  1YIJ A;  3OB9 A;  1UGQ B;  2EAY A;  4KT0 E;  4RG8 A;  2HAX A;  5I2M A;  4XK8 E;  1X6O A;  2CZ7 B;  5FU6 C;  4Q5W A;  2DVE A;  3OBW A;  3G71 T;  3VYG A;  5DLO A;  4C5G A;  5HK0 A;  2HQX A;  2RD1 A;  2RHZ A;  3UWN A;  1MGQ A;  3RES A;  2DTH A;  2EQM A;  1UGP B;  3RKX A;  2XDP A;  3SWN C;  3MO8 A;  3CPW A;  4M77 F;  2RK2 A;  5GAM h;  3CCU T;  2HD0 A;  3HKS A;  5FRM A;  3CC2 T;  4C92 D;  2CKK A;  3GP8 A;  1DJ7 B;  2LTO A;  2RJE A;  2E6Z A;  2JTM A;  2VGM A;  3C12 A;  5D6W A;  4X34 A;  2EWN A;  3M9Q A;  5GMK h;  1B34 A;  3J81 E;  4RCB A;  4ZTJ A;  4XU0 A;  1Y96 B;  4BI8 B;  3PFS A;  3RIR A;  1LOJ A;  5A0L A;  2E70 A;  2RI2 A;  2PVG B;  3DLM A;  4J7F A;  4OB3 B;  2GF7 A;  3KUF A;  4LDU A;  3OSV A;  4QQG A;  5GAO n;  1BI1 A;  2QA4 A;  4PKC C;  4BI3 A;  1VIE A;  4M78 B;  3CBP A;  4A53 A;  3NFC A;  3JCM e;  4M7A A;  2L89 A;  3JCM c;  3CC2 A;  1VQO T;  2XDD A;  3PIP A;  1G3T A;  4R56 A;  2FL7 A;  1O75 A;  3A5Z B;  3OYB A;  4A4H A;  1W4S A;  3RUX A;  5HK3 A;  5KE3 A;  3X26 B;  4C92 C;  5LJ5 h;  3L2U A;  4KUD K;  3OBY A;  4M7A D;  5AYF A;  2EQU A;  4XTW A;  2WSC E;  4LD9 K;  3MEW A;  4XU1 A;  3OYE A;  4Y91 A;  1NPP A;  2MAM A;  2OTL A;  3KBG A;  2EQK A;  2D6F A;  2QA4 T;  3HP9 A;  3OMG A;  2A3L A;  3A8O B;  4DQ2 A;  5GAO p;  5GAN 6;  2MMP A;  3ZEH A;  5LJ3 d;  1VQO A;  3E9G A;  3CCJ T;  5CIU A;  1I5L A;  3QYH B;  5LJ3 f;  1ZHI A;  2XU8 A;  2K5I A;  3MHX A;  1LNX A;  1VQM A;  2VV5 A;  3JRZ A;  5FLX E;  1JJ2 A;  5C0M A;  4YTL A;  5LJ3 g;  4XU2 A;  1K9M C;  4IUV A;  2JN0 A;  3MCA B;  5CCA A;  1VQ4 T;  4EMG A;  5GAO l;  3QJY A;  2DO3 A;  2Y4X A;  4FSX A;  4J5Y A;  4PJO E;  3CCR T;  3DB3 A;  1VQ6 T;  1N6A A;  2RJD A;  5FU6 B;  3QDR B;  3G4S T;  1VQM T;  2PQW A;  3ASK A;  3CPW S;  2YLB A;  1M1K C;  4IKF A;  4O5V A;  2PVO B;  2DZ9 A;  4E7I A;  3QZ9 B;  2LT4 A;  3OW2 A;  4M75 C;  1IZ6 A;  3QJ6 A;  1M90 C;  4QVC A;  2L5Q A;  3L2Z A;  1VQ4 A;  4F7U E;  1KQ1 A;  1SSF A;  1XNI A;  3CEY A;  1YBY A;  1OI1 A;  4QVZ A;  3A8G B;  2KVQ G;  2VYT A;  4OB2 B;  2CZ0 B;  3FB9 A;  3WXM B;  3GPL A;  3CMA T;  3UT1 A;  3OYH A;  3CC7 A;  2E64 A;  3GNG A;  4RKU E;  4C8Q A;  4EMH A;  5DLQ E;  4JRQ A;  4PJO B;  3X28 B;  3CBM A;  2LVM A;  1R8O B;  3G4S A;  4M75 B;  4L5G A;  3CCL T;  2D0Q B;  2XI9 A;  4BD3 A;  4CI0 C;  1S72 T;  4MML A;  4LDX A;  2RJF A;  1QP2 A;  1VQ8 T;  2KAF A;  4HA8 A;  3M59 A;  1BYM A;  4M7D D;  3OQ5 A;  2L3R A;  4DOW A;  5GAN 3;  1Q82 C;  4L59 A;  4HT9 A;  4M78 C;  3OYA A;  1YJN T;  1VQK T;  2RB6 A;  1NE8 A;  3CC7 T;  4E7L A;  2C06 A;  3V8J A;  4C8Q G;  5I2S A;  3BFM A;  2I2L A;  3JCM X;  1JRI A;  3I55 A;  2DEQ A;  3PNW C;  2CS7 A;  1VQ8 A;  3Q1J A;  2ZPG B;  5KH6 A;  3LH0 A;  2ZPI B;  5EG2 A;  3G6E A;  3MEV A;  3A8H B;  4BB7 A;  4DOV A;  5GMK l;  1KD1 U;  4M7D B;  4OMF B;  3LWH A;  3TCJ A;  2FHD A;  3OYM A;  3CC4 T;  2VUB A;  1VQ5 A;  2IG0 A;  4MZM A;  4M77 C;  4MZP A;  4OB0 B;  4JRP A;  1BI0 A;  5J39 A;  1KQS S;  3X24 B;  1M5Q 1;  3OYC A;  1KD1 C;  4JRI A;  2E65 A;  1BIB A;  3HFO A;  3HL8 A;  3RMS A;  3RKY A;  4QVD A;  4JLI A;  2EJG A;  2ZZD A;  3G6E T;  3OYF A;  2CYZ B;  3NTK A;  3JB9 H;  5HKC A;  5GAM d;  1WGS A;  3FEO A;  4OB1 B;  4IUQ A;  2OAU A;  3V7C A;  5M9O A;  3QSU A;  3QKJ A;  4XTU A;  3WVE B;  1VQ5 T;  4C0F A;  2K3Y A;  5L8R E;  4C92 A;  4DA4 A;  2DXB A;  2ZCF B;  2DIQ A;  2VC8 A;  3CCM A;  3BDL A;  2CZ6 B;  3JCM W;  2G3R A;  1M4Z A;  4A4G A;  4N4I A;  1UGS B;  3DKM A;  3OYJ A;  5GMK i;  1KC8 U;  2V8I A;  1NJI C;  4M77 G;  2X4X A;  4OP0 A;  4M75 A;  1VQN A;  3RKW A;  1PSF A;  4PJO C;  2E10 A;  4HKE A;  1G3S A;  4M7A E;  2EJ9 A;  4C8Q F;  3L2R A;  2RHI A;  1D3B B;  3MET A;  1BI2 A;  2A7Y A;  3SWN B;  3A8M B;  3SB2 A;  2MI6 A;  2Y4Y A;  4LDY A;  1Y96 A;  3AHU A;  3M58 A;  4M75 E;  4R55 A;  3OYG A;  4J83 A;  5GAN h;  3BW1 A;  2XHC A;  2DZC A;  2EIF A;  4M75 F;  1W2B A;  2ZPH B;  1JJ2 S;  2R5M A;  4F7U G;  2LC4 A;  3E9F A;  4GLK A;  1VQ9 T;  1VQN T;  3JCM b;  3J7A F;  4XTZ A;  3UDC A;  2XD0 A;  1RI0 A;  5GAM e;  4J8O A;  2AHJ B;  1WJR A;  4O6J A;  2GQV A;  4NS5 A;  1M1K U;  2R57 A;  3G7Z A;  5CQY A;  1Q86 C;  3MEA A;  2XIC A;  2VXF A;  2JZ2 A;  3M55 A;  3JCM g;  4A4F A;  1N27 A;  1Q81 C;  1RL2 A;  2RI3 A;  3VUB A;  1VIF A;  2D9T A;  2GFU A;  5KE2 A;  4ELY C;  1Q86 U;  1H3Z A;  4M78 E;  1V29 B;  4RCC A;  3CCE T;  1WNL A;  2X4J A;  3QHS A;  3PGG A;  1QP3 A;  2P4T A;  2CZ1 B;  3J80 E;  3CCR A;  3TU4 K;  1FXX A;  4Z02 A;  3CCQ T;  2DTO A;  2HBP A;  2P0K A;  3VUZ A;  2XDB A;  1N9S A;  2BUD A;  2DJZ A;  1K73 C;  2JNG A;  4M78 A;  1KHC A;  3CD6 A;  4IUR A;  5CKH A;  2B8A A;  1FWZ A;  3ER0 A;  4C5I A;  4ZTF A;  5CQX A;  1G5V A;  3URG A;  3CME T;  1LJO A;  4ME7 A;  4FL6 A;  4M77 D;  3SD4 A;  4C0Z A;  3CMA A;  1WPY A;  4C92 B;  2YLC A;  2KDS A;  3PIO A;  2X4W A;  3CCE A;  4KUL A;  2HQE A;  5I21 A;  1QW1 A;  1Y71 A;  1HK9 A;  4D6W A;  3CCQ A;  3CCL A;  5J26 A;  1YI2 T;  2DKG A;  3M5A A;  1NJI U;  2ZGW A;  1PSE A;  3CCV A;  2O4X B;  5GAM g;  1G3Y A;  2CGH A;  2E5Q A;  2XKO C;  1IRE B;  3QXE B;  2XK0 A;  3VYH B;  3BY7 A;  4NL2 A;  4FM4 B;  1YHQ T;  3V7R A;  3CME A;  4FIB A;  2IVW A;  1D3B A;  2RO0 A;  3SWN A;  4FT4 A;  5C6S A;  1YJN A;  3OS5 A;  4L6V 5;  4PJO G;  3ME9 A;  2E12 A;  2BIV A;  1JB0 E;  4M7D A;  4B9X A;  1OYX A;  2E6N A;  2DPP B;  2EFI A;  4XTY A;  2DD4 A;  3I55 T;  3CCV T;  2JUF A;  5IN1 A;  3S6W A;  2O01 E;  4ATO A;  1VQ7 A;  2GFA A;  2DD5 A;  3P8D A;  2DK3 A;  2MWP A;  4XAX B;  5LL6 S;  2RI5 A;  3O8V A;  2X35 A;  3FRN A;  4N0A A;  1WJS A;  3QUI A;  4EMK A;  4F7U B;  5LJ5 e;  4JS5 A;  3MEU A;  5D6Y A;  4BDZ A;  2EJF A;  5KCO A;  4B9W A;  3OYD A;  2PUO B;  1I4K 1;  1OZ3 A;  3EFR A;  3LYI A;  3CC4 A;  3FJP A;  1BI3 A;  3H6Z A;  3VJP A;  3JCM h;  4C5H A;  2DTI A;  2H3J A;  1XTD A;  2KQW A;  1B34 B;  3F70 A;  3QZ5 B;  1P92 A;  2RHU A;  4IUP A;  4MMK A;  4XTV A;  3JCM Q;  3S3O A;  4M77 E;  5LJ3 j;  3GNF B;  5IAY A;  3OYI A;  2OTJ T;  4N4G A;  2VXE A;  1MHN A;  5FU7 B;  1M1F A;  3L2V A;  2E41 A;  5GMK j;  3HSB A;  3INZ A;  1XQH A;  4M7A F;  1Q82 U;  4BDY A;  3C95 A;  1K8A U;  3JB9 G;  2O4X A;  1G3W A;  3CCM T;  2RK1 A;  1U1S A;  2PVD B;  4CRI A;  2QQB A;  3HFN A;  4M7D F;  5CKB A;  3L42 A;  4UC4 A;  4C8Q C;  2VGN A;  5GAO r;  4A54 A;  2OTJ A;  3L2W A;  1YJ9 T;  4M7D E;  4J6W A;  1VUB A;  5LJ5 d;  3PMT A;  3LWI A;  3OYL A;  4WF2 A;  3CPF A;  2QDY B;  4II1 A;  2QQ9 A;  2M1H A;  1ZQ1 A;  5GAN j;  3HRS A;  2ZPB B;  2RM4 A;  1W2B S;  5CKF A;  4V2S A;  2F5T X;  1WJQ A;  5LJ5 g;  1WQW A;  3GIB A;  2DIG A;  1M8V A;  4M7A C;  5GAN 4;  5GAN 8;  3E19 A;  4OF1 A;  1YJW A;  4FT2 A;  1NPR A;  4PLL A;  2LQK A;  4MDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...