1QP2A

Solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
b'MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PSAE PROTEIN)
publication title The solution structure of photosystem I accessory protein E from the cyanobacterium Nostoc sp. strain PCC 8009.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qp2A00
2ZPHB 3WVDB 3X25B 4XK8E 4OB0B 3A8OB 2PUOB 3HHTB 2D0QB 2ZPFB 3LW5E 2O01E 1UGRB 2DXCA 2PUKB 2PVOB 3X26B 3QZ9B 1UGPB 5L8RE 1QP2A 2CZ7B 1QP3A 4ZGJB 4OB1B 1PSFA 4Y28E 2ZPEB 2DD5A 3QXEB 4KT0E 3QYHB 2DXBA 2ZPBB 4ZGEB 2ZPIB 4OB2B 2WSCE 2ZZDA 4ZGDB 1JB0E 3X24B 1IREB 2CZ0B 2PVGB 2PU9B 2ZCFB 3A8GB 3A8MB 1DJ7B 2DPPB 4RKUE 1V29B 3VYGA 3VYHB 1GXIE 3A8LB 1UGSB 1PSEA 2DD4A 4FM4B 2CZ1B 4L6V5 2AHJB 3A8HB 2CYZB 3QYGB 3WVEB 3QZ5B 2CZ6B 2WSEE 4OB3B 2WSFE 1UGQB 2ZPGB 2QDYB 3X20B 2PVDB 1AHJB 3X28B
chains in the Genus database with same CATH superfamily
2RH2A 2KXDA 1YHQA 3CPWP 1AZEA 2CSQA 2DZ9A 2K9GA 2RHXA 2GCXA 3JCMb 4PNOA 1BCOA 4XTXA 4RCBA 3T9NA 4EDUA 2KI7A 3OBWA 3VUBA 2QQBA 1B34A 1FYNA 3CMAA 1UJYA 3M0SA 2DRMA 3P8DA 3PFSA 2CGHA 1YIJT 1YJ9A 1Q7YR 3S3MA 4OMPA 2L8DA 2A0FB 2ROTA 2KDSA 2LMJA 2FPDA 2J05A 3QWYA 2KSSA 2DM1A 2FZGB 3QPHA 1WJSA 2L2PA 3OW2A 1Q81U 5GAMf 3MP6A 3BW1A 4FL6A 3V7SA 1Q86R 2ABLA 1JBMA 1SRLA 5KH6A 2X9HA 4M78C 1RAEB 2CP0A 3DLLA 4OMFB 5LJ3d 3VV0A 1QP3A 2QA4T 2X4XA 1K8AU 2BKDN 3EFRA 5GANj 3LH5A 4F14A 5GAOp 1UHFA 2P0PA 3VUZA 4O6JA 2J06A 1M8MA 2DLPA 4E6RA 3OW2P 3JCMQ 1U1TA 2EKOA 2BTTA 2FL7A 1SG5A 2XDBA 2A28A 1FMVA 4C5HA 4ORZA 2M16A 2KYMA 2KMTA 5FROA 1M1KR 2L0AA 1PD1A 2RPNA 2K7AA 4BDYA 1M90C 1X6GA 2ED1A 2DIGA 1KK7A 4M78F 1VQ9Q 4LDYA 3OYBA 2HL5C 1D1AA 5GMKl 3QDRB 1D1CA 2PZ1A 3HFNA 3H41A 1VYUA 1WXTA 4A4KA 4JS5A 3LYIA 4FM4B 4J9FA 1BI2A 2RJCA 2LJ3A 2CUBA 2LJ1A 1Y57A 3MP1A 2EJ9A 2JW4A 3GLXA 3PIPA 1NJIR 1KQSS 1OZ3A 2XG8D 2RM4A 3JCMh 2L3QA 1RI0A 5FLXE 1IO6A 2OI3A 3QJ6A 1QVGS 5HKCA 1C6VX 1I81A 3RUXA 2EFIA 2XI9A 2VGMA 6AT1B 4LNPA 4C0FA 4MZMA 5DLOA 1ZSZB 2HBPA 3THKA 1K0SA 2K3XA 4XTZA 3UDCA 3ER0A 1WHJA 3SFMA 1N8RC 1JEGA 3M0UA 1W4SA 4C5GA 1M30A 3J80E 3CD6Q 2DTOA 1R0CB 4PJOA 4RTZA 1RAHB 2E1HA 3CMEA 2AKLA 3MEVA 4N4GA 1RAIB 3F70A 4ZGJB 4CRIA 3CCEA 4PLLA 2QK0A 1R8OB 1YITA 1NPRA 5ECAA 3H8ZA 2E64A 3RNJA 3CCLQ 4IKFA 1TS9A 4RMOA 2FPEA 3EG9B 1JB0E 2XKOC 1W2BA 3M0QA 1W1FA 4F7UG 3RMSA 3CCMT 1VYVA 5GAN6 3PMIA 2MI6A 5LJ3h 4KGXB 1U1SA 1Z9QA 4IIOA 1VQMQ 1UJ0A 4AFQC 1XOVA 3EG3A 4BE2A 3LLRA 1X2KA 1SHGA 3JB9D 2MWOA 2Z0WA 1M3AA 3D7SB 2H3JA 1W2BP 4M7DC 2Y90A 4M7AC 4BY6C 2LX7A 4E7LA 3BDUA 4OGEA 2LQKA 4EMHA 3H0FA 3CC4T 3OYEA 1YI2A 2YDLA 4QT7A 3JCMV 1VQ5T 5GAMd 2VASA 3NPFA 1QQJA 1X75C 1FXXA 2QG9B 4JZ3A 2CT4A 2YUQA 4PFPA 3CC4A 1H641 1BI0A 1I4K1 1KC8U 4XTYA 3FDRA 3QKJA 4ESRA 2B8AA 1EX4A 1Y7XA 2QEXT 4QQGA 3M56A 2KNBB 1U5SA 2E6NA 4JLIA 3JCMg 2NYSA 4M7DF 4M7AF 3GBQA 3SWNC 3GPLA 3VS0A 1H92A 1X69A 1M3BA 1QW1A 3UWNA 2QTVA 4PJOE 2RI3A 1NEGA 2GF7A 2IG0A 5IH2A 1K1ZA 1BIAA 3RKXA 2Y4YA 3DKMA 3HFOA 1PSFA 3C0CA 3E9GA 4KT0E 1RAFB 1ZSZA 5GMKe 3CCQQ 2JTMA 4B9WA 3BDLA 5CKFA 1VA7A 3JB9I 1KIKA 3VS6A 1G5VA 5KYUA 2ATCB 2R5AA 2RJEA 4QQ6A 2XD0A 3HTRA 5FU6B 5D6XA 1QVFA 5GAN5 2RHZA 2E12A 1B07A 2RA2A 1VQOA 1HJDA 1YJWQ 4GLMA 2RK2A 4IUUA 1PKTA 1M8VA 3H9NA 1RLPC 3A8HB 2RQTA 5GAOl 1VQ4T 2HQEA 2LCCA 3BFMA 2HEQA 2V8KA 3EG9A 3CPFA 3CCRT 1ABQA 1O9SA 4OP0A 4C92E 1Q82U 5D6YA 3G1JA 4WTOB 5GMKj 1QVFP 3G7ZA 4R56A 1M9SA 3L1AA 4L5GA 1C1AA 3GOXA 2KY9A 2VB6A 3X25B 3FRNA 3CCVQ 2DL8A 3A8OB 2OTJA 4QKUA 1IGUA 1PWTA 1TU0B 4EMGA 3QUIA 2AZVA 4FT4A 4DBRA 4J7FA 4M77C 4C0DC 3E1SA 5CR2A 2EYQA 2L3RA 3CCJA 2H8HA 3CC2Q 4LXCA 2YXYA 3QJYA 2FEIA 1WJRA 2G6FX 1PNJA 2KT1A 4LDWA 3OYCA 3GF5A 1OULA 5GMKi 5LJ5h 2JM9A 1M90R 2QTXA 1KJWA 2DE0X 2M1HA 1MHNA 2LQWA 3NTHA 1ZUUA 3I5RA 4J9HA 1WPYA 3KXTA 2ZPIB 1VQ8Q 2K3BA 1MV0B 1RUWA 4M77F 1Q95G 4FYVB 2XDPA 4B6MA 1WLPB 4Z8AA 3CC7Q 2EQIA 3UATA 3G71T 4Z88A 4PJOD 2F2VA 4M78G 1I07A 1OPLA 2I0NA 1WNLA 1UGSB 2OX7A 2COWA 1PCXA 2DF6A 3FEOA 2AHJB 2RJFA 2RNAA 3PIOA 1SEMA 2EKHA 1SF9A 5HK0A 4LDUA 2H3EB 2CP6A 2VV5A 4F7UF 1QCFA 1BB9A 2KRNA 2JN0A 2C0IA 1BI1A 1NE8A 4AG1C 2RF0A 1E6GA 4QW2A 2D1XA 3FLGA 4A54A 3EAEA 2VC8A 5M9OA 1YJNA 2D0QB 4M75C 2ZPFB 5J3BA 4LN2A 2XHCA 4RG2A 1AWWA 5KCOA 4RTWA 3RIRA 2KEAA 1MMAA 1VQKA 4A4HA 1WGSA 3C12A 2LCLA 2XICA 3X26B 2BZYA 4JLGA 4C92D 4UC4A 1S72Q 1UGPB 4C8QE 4II1A 3ZFJA 3MHXA 2V8IA 5CK9A 1QP2A 2CP3A 2GTJA 4A4GA 3OYNA 3ZEHA 1MUZA 4M7DB 1G3YA 4M7AB 2V1RA 1NG2A 3QYHB 1VQLQ 3I56T 4XU3A 1RI9A 3M55A 2CH4A 4NL3A 1E6HA 1M2VB 1W70A 3CXCA 5DY9A 5LJ5g 1XTDA 3CPWS 2ZCFB 3A8GB 3INZA 2ROLA 4IUPA 2B86A 2EPDA 1Q7YU 2EYWA 4X9CA 2DL3A 1AVZC 1YHQQ 4XTUA 2DL5A 5GANf 2DXTA 5IAYA 4HCBA 3SWNB 2D0NA 2ZAEA 2DL4A 2E70A 1I0CA 4EIKA 3CXCP 2E6ZA 4J6WA 4E7KA 3CMAQ 1H3HA 1M27C 3OS0A 1Q86U 1YJ9Q 3O8VA 1UGQB 1CKAA 2DA9A 5IHIA 3MEAA 1TG0A 3V8LA 4CC4B 2OAWA 1XJWB 1OU8A 3IQLA 2KAFA 4OB0B 1VQ7T 1VQNT 1T0HA 4LDVA 4JRKA 2EVRA 1M3CA 2RQRA 1PM3A 5D6WA 3EG2A 4M7AG 3CQTA 4PFZA 2KT8A 4FYWB 2CSIA 2HL3A 4QVZA 1Z9ZA 1M1KU 2P0QA 2K5LA 3H6ZA 3HRUA 1D1BA 1CKBA 5LL6S 1KQ2A 4JJNK 1WHKA 4OF1A 4PLIA 1HD3A 2FVUA 1KD1C 4OMMA 1RADB 5IXBA 2ZPBB 1RAAB 1VQPT 5HY6A 1K73R 1KC8C 1V76A 2O4XB 2WSCE 4FIBA 4O5VA 4D8KA 1YIJA 1WHHA 1ZX6A 3BE3A 1NJIU 4EMKB 3OYGA 1TUCA 1XNIA 3TSZA 3E9FA 4BD3A 4LDXA 2FZCB 1X2QA 2PVGB 3KBGA 4J5YA 4C8QD 4ELYC 2DPPB 1V29B 4JRIA 3VYGA 2MPXC 3FB9A 4N0AC 4M77B 4BUGA 3I35A 2QA4A 4M7DA 4C0DB 4M7AA 1UDLA 2KR3A 1AWOA 3EG0A 3MPUB 4KBMB 2QXFA 4CC7A 4FYYB 1OI1A 4OMOA 1M2VA 4J83A 3EH1A 3QIIA 4ZN3A 3VS2A 1BKBA 2QQRA 5CO7A 1IXDA 2X4JA 4PFOA 2P0KA 2GFAA 1FMWA 3WVDB 2MAMA 2HCKA 2DX1A 4JJBA 2ED0A 1ARKA 1G83A 4DOWA 1T0JA 4F7UB 3CMEQ 2C06A 2Y4XA 3SWNA 4KGVB 3CCEQ 4XU2A 1YITQ 2E5KA 4RTXA 2DERA 4MDXA 2RB6A 5L8RE 2DFUA 4HVWA 2BZ8A 3UA7A 5LJ5e 4QQDA 7AT1B 1AWJA 2YLBA 1Q82C 2BZXA 1SSFA 2FHDA 4MMKA 3RKWA 1EZZB 2LJ0A 5L23A 1UB4A 3L2UA 2MCNA 4R55A 4PJMA 1GCQA 3G6ET 5GANd 4M77G 2RMOA 2BE7D 2AZSA 3H0HA 5GAOq 2CH4W 2GQIA 3HRSA 2M9UA 2NLUA 3JB9F 4FT2A 3G6EA 5KYNA 1OOTA 4F17A 3CCST 4IUTA 2HSPA 3BY7A 4LD9K 3KUFA 4RKUE 3TEEA 1YI2Q 1QVPA 3CCSA 2LP5A 1KQSA 1SPKA 1QCOA 4M7DE 3QO3A 4BB7A 5LJ5j 1ZUYA 3EH2A 4Y91A 2E4HA 4JRPA 2RHIA 3LWHA 1IB8A 3WVEB 2O4XA 4LE9A 3OS5A 4IURA 2E3IA 2HSEB 5GJWB 4NL2A 4EMKA 2JUFA 2DKGA 2JTFA 3H0IA 1MMDA 3CCMA 3L2WA 3ZL7C 4Z89A 1ZQ1A 3OYYA 2DK3A 4D8DA 2RQUA 3VS3A 4M4ZA 2EQUA 3CD6T 4M77A 3M5AA 2OJ2A 4F04B 3REBB 4JUVA 5GAOn 2RQWA 1IHWA 2VGNA 2QAZA 2MF2A 1K76A 4PJLA 3CCLT 1AWXA 1D0XA 1P92A 1VQ5A 4ANJA 2J7IA 2ZPEB 1JJ2A 3EFOB 4M75G 2BE9B 2VXEA 1B3QA 3AHUA 4F7UA 4ZGDB 1VQMT 5I21A 1TXQA 1VQOQ 2LT4A 2QEXA 3X24B 1PRMC 3NTIA 1WHMA 5J39A 1EIFA 1K9MR 1QVFS 1OX8A 5IHNA 1YWOA 4LD6A 2O9VA 2KK4A 4QVCA 1H3ZA 1JJ2P 2M0OA 5KCHA 4X1VA 2AT1B 3M4YA 4KGZB 2HD0A 1KSWA 3JB9H 2DYIA 1PC0A 3LGLA 3I55T 2OTJQ 4CI0C 1U06A 3FC3A 2CZ6B 2EAYA 2JVVA 4PK4A 3OYHA 3E2UA 2YWWA 4J9BA 3I55A 5CKDA 4RTVA 2DJZA 1UEBA 4A53A 4Z02A 2EGCA 3QWXX 1M90U 1NYFA 2CP7A 5GAN2 3CCJQ 1YCYA 5LJ3g 4GLKA 1WJQA 4M7DD 1I8FA 3TVTA 2MYSA 3V7RA 1Q7YC 2K79A 1KD1R 5FRMA 3C94A 5FW9A 4M78B 3ULRB 2J6FA 1VQ4A 2PVOB 1UHCA 2FB7A 3VRZA 2GFUA 3A98A 3CCRA 4HCCA 1IRXA 2CUDA 1RACB 2ESWA 1WIEA 4E47A 5HK3A 3NFCA 5I22A 1YBYA 1BIBA 3CCQT 2L3SA 1VOMA 4DBHA 3OYKA 4AFZC 2DD5A 2K2MA 3QXEB 4WCIA 4FSSA 2G3RA 3GP8A 4F7UE 2A3LA 2KRMA 2F69A 3Q1JA 5CAIA 5GAMh 2YRDA 1UTIA 3MCAB 1YFNA 1YJWT 3NGPA 3SEMA 1QCNA 2CP5A 2LRQA 2F5KA 2HBWA 2QQ9A 3EFSA 1M1KC 3OB9A 2O9SA 4HCZA 8ATCB 2COYA 4BE0A 4DBFA 4C92C 1QKWA 3OSSC 4OMQA 3JCMf 1JU5C 1M1FA 1QMCA 3EFOA 3R6NA 4GBQA 4BE1A 1WZOA 2LQNA 3JCMc 2E65A 2K6DA 3PE0A 5D7UA 5KE3A 3PTAA 4PL6A 1YJNQ 2KXCA 3CCVT 2DXUA 1ZUKA 2WSFE 3OQ5A 4XU0A 2QGGA 4CC3A 2KBTA 4DA4A 1NJIC 1F1BB 1AHJB 1NPPA 1VQKQ 1Q81C 2EJGA 2RHUA 1YNZA 4HA8A 5KE2A 1MMGA 1SHFA 5CKEA 3CCUT 3AT1B 3O5ZA 8AT1B 3LWIA 3FJPA 3G71A 5FU7C 2F1LA 2YT6A 3M0PA 4L59A 1KQ1A 2MMPA 1G3WA 1PG5B 1TTHB 3M9QA 4C92F 2YHTA 1K8AC 1GL5A 1VQ6T 1OV3A 1AOJA 3CC2T 4ATOA 3CCUA 2J6KA 1MGQA 2VXFA 1LJOA 5CKBA 2C0OA 3MO8A 3JCMe 1K4US 1N8RR 5I2MA 1E7OA 1VQ6A 5IN1A 3G4ST 2PUKB 4XAXB 2DBMA 4TVRA 3VKIA 5C0MA 1SSHA 5DLQE 2FYKA 4A4EA 2RO0A 1OYXA 2XU8A 1VQ8T 2HMAA 4OMLA 3G4SA 4ZNXA 4E7SA 2CZ7B 4OB1B 4MZPA 4BI3A 1GCPA 1RAGB 4AFSC 2LX9A 3CC7T 1GBQA 1WHLA 3HKSA 1N9SA 3NHNA 4FU6A 4RTYA 4ZGEB 5GMKm 2CKKA 3ZBDA 4OGCA 3JB9G 4HKEA 2DTHA 3OYLA 4M78A 4AT1B 5FWCA 2A08A 3URGA 4AG2C 4KUIA 1I1JA 2JZ2A 5GAN8 4AFUC 2NUTB 2V26A 5AYFA 5IHKA 5EC7A 5I11A 3VS7A 4N0AA 4BY6B 2F5TX 1Y96B 5GAMg 4M75F 2K57A 2D8JA 4ELZC 3M59A 1K0XA 2DYBA 1UUEA 3EGDB 5LJ3e 3TSWA 2F2WA 2JS2A 4GY5A 2DEUA 3I56A 3JCMJ 2NWMA 2ZPGB 2EBPA 3J7AF 3X20B 3VRYA 1X43A 3X28B 3PVLA 4D6WA 2EQJA 1I5OB 3PGGA 3R6OA 3WXMB 1HSQA 4C8QC 1K73U 4P5NA 1S72T 2O01E 2O31A 1UGRB 1UE9A 3GNFB 4JDSA 2XIDA 3S6WA 4K11A 3META 2I2LA 4IUQA 2DXCA 3PMTA 2L89A 2F2XA 4FCYA 1YIJQ 3TQ7P 1VQLT 5LJ3j 5GMKh 2FO0A 4FYXB 3V8JA 4E7JA 2W10A 2ENMA 2C0TA 2EWNA 4JS4A 2HZYA 1VQ7A 2KQWA 3JCMd 4C8QF 3OW2S 1VQNA 2YUPA 1TWBA 1WA7A 3OYDA 4OB2B 2A7YA 1VUBA 4HVVA 4HT9A 2YUNA 2O88A 2QA4Q 2IIMA 2EIFA 4M78E 1M5Q1 4XU1A 1I5LA 4PJJA 1TUGB 2CREA 2OTLT 1WYXA 3QSUA 1ZA1B 2PNIA 5DM7R 1V1CA 2LNHB 3CMAT 2K3YA 1YJ9T 2KGTA 2SEMA 2OTLA 2JMCA 1YCSB 3EG1A 2LT1A 2KYBA 4BI4A 2DD4A 4L6V5 2K2VA 1WI7A 3PVQA 2MIOA 5FU6C 3QYGB 4N4IA 2E5QA 5CKHA 3S3OA 1X6BA 4Q5WA 1VQPA 2WSEE 4IIMA 3VS1A 1AD5A 3HP9A 5FRNA 2HKNA 4KH0B 4C0GA 4CC2A 3M4GA 2NUTA 4MDWA 2LNVA 4J7IA 2CT3A 2AKKA 2MWPA 1JXOA 3OMCA 3JV3A 3DB4A 4DOVA 5GAOr 1Y96A 3I9QA 3HHTB 5GAN3 4LUEA 3TREA 2DVJA 1OU9A 3S3NA 1ACMB 2D9TA 2QDLA 3OBYA 5LJ5f 3EGDA 2X4WA 1O75A 2R58A 3I5SA 3OS1A 3OYAA 2JTEA 4C92B 3MEWA 3QBYA 1J3TA 2VUBA 1GFCA 1N5ZA 3G6EQ 3PT9A 4PJOG 3QHSA 5GAMe 1LNXA 2FG0A 2DXBA 1MNDA 3RDVA 2EQKA 4J9GA 1PD0A 3CCSQ 4OMNA 3RKYA 1NBEB 5GAOm 3NMZC 2DL7A 3DLMA 1IREB 2E41A 1RL2A 2NUPB 2YRCA 3CEYA 5FU7B 4RG8A 1IZ6A 1AT1B 5EG2A 2EYYA 2LZ6B 3OYJA 5IT9E 1Q81R 2P4TA 3VS5A 1GXIE 1W2BS 5A0GA 4C0ZA 1X01A 3CCMQ 4PJNA 4RUGA 1K8AR 1HXDA 1VQ9T 5KYWB 3CBOA 3QZ5B 2HQHA 3DB3A 1U3OA 1QLYA 2BUDA 2P84A 4M78D 3LH0A 4NOYA 5GAMj 4JPBW 4J9CA 2PVDB 1VQ9A 2J6OA 3CMET 3UPUA 4M75B 3M57A 2M0YA 3GNGA 3VJPA 2X3WD 5KYUB 2DJQA 2QASA 2ZPHB 1Y71A 4C92G 3L2VA 3CCET 2VYTA 4Y92A 4M7AE 1YITT 2YRVA 5A2QE 3JCMP 3HPWA 3CC4Q 3LW5E 1QVGA 1VQ5Q 1D09B 2JJ9A 3UA6A 1D0ZA 4HXJA 5I2SA 1NYGA 4E2FB 1YWPA 1K9MU 3PNWC 1WQWA 1OX9A 4J8OA 4RTTA 1YP5A 2RD1A 1UFFA 1G3TA 1EFNA 2GTOA 3OYIA 4BDZA 2QEXQ 2L3PA 1KQSP 1AEYA 1JJ2S 2YUOA 2RJDA 3ME9A 3UF4A 4AMCA 2LTOA 1QVGP 4J9DA 2XDDA 2GNCA 1PKSA 4QVDA 3CD6A 1RLQC 2KRSA 3EGXB 4FW2A 1WFWA 2ZZDA 3OS2A 3OA6A 1YI2T 3OYFA 1K9AA 2RK1A 2LCSA 4WF2A 1ZA2B 4C92A 1RABB 3A8MB 4PKCC 4C8QB 1KG1A 5A0DA 1JRIA 3REAB 2K5IA 2K4YA 4J9EA 2FRYA 1LOJA 3CCLA 4MZTA 1N6AA 3VYHB 1BI3A 2RI5A 3I55Q 5CCAA 3NTKA 4YTLA 2EW3A 1KD1U 4IUVA 2DO3A 4HT8A 2DRKA 2CYZB 2HAXA 1OZ2A 2DTIA 2DVEA 5LJ5d 2LDMA 4XQ3A 4BACA 4OB3B 5C6SA 2QQAA 2HKQB 1VQMA 2X35A 1Y07A 1M1GA 2QDYB 4J6XA 1HK9A 2NUPA 3SB2A 1LPLA 3SD4A 3MP8A 1VQ4Q 4JJDA 1WX6A 2X51A 5GANh 3CCRQ 1HYOA 3OYMA 2K5FA 4LUDA 2PUOB 1NM7A 2DEQA 3V7CA 2RI2A 1VIEA 2DAQA 2YLCA 2E10A 3MEUA 4OVAA 5KYWA 5CVIA 2QYZA 3RR6A 4J6YA 3JCMX 1MMNA 1FWZA 2EQMA 3EHQA 1GCQC 2AK5A 3LGFA 1C0MA 4HVUA 1GFDA 4M75A 3OSVA 2PTKA 5KYXB 1KHIA 4PJOC 4DEYA 1VQOT 2X4YA 2X3XD 1VYTA 4M77E 4M7AD 4C8QG 4Y28E 3MJXA 5A0LA 4RTUA 4FW1A 1BYMA 2JOYA 3A5ZB 2DZCA 2EYZA 1KC8R 1K73C 2L5QA 4ZTFA 2ZGWA 4E7HA 2FZKB 5GJVB 3JB9J 2BIVA 1Q86C 1FX7A 5J26A 3U23A 4KRTA 3M54A 4V2SA 3KFVA 2V8JA 5HCKA 4ZTJA 1QWEA 2JXBA 2GGRA 2WACA 5CIUA 2O2OA 2OTJT 4EMKC 2KVQG 1IGQA 4JZ4A 4PJOF 3A8LB 2OAUA 3CCQA 1FMKA 3JCMW 1WDXA 1S1NA 1ZHIA 2RQVA 3M0TA 1N8RU 3G71Q 1OQKA 4KH1B 1T3SA 5KYYB 3EGXA 1D0YA 1ZBJA 3SDZA 4XTVA 1U8RA 2CS7A 3CCJT 2A37A 1CSKA 3CCUQ 2D8HA 1YJWA 2CP2A 1VQ6Q 1JO8A 1NEBA 4C8QA 1G8XA 2IVWA 3L2RA 1X6OA 3RESA 1AZGB 3A1PA 3N5BB 1QWFA 1X27A 3FIFA 3G4SQ 3EHRA 4VUBA 4E7ZA 1ABOA 3QDFA 2LVMA 3L2ZA 5IXFA 4KULA 5GANg 1H8KA 5GAN4 4ZN1A 4JJCA 3E19A 3FJ5A 2D6FA 3CCVA 1WHGA 4A63B 2LC4A 2JS0A 4M75E 2RHYA 4JRQA 2XMFA 1Q82R 3M0RA 1WXBA 2JM8A 3OMGA 3SHWA 3L2QA 3RBBB 1UG1A 2GBQA 1BK2A 1PRLC 2DETA 3CC2A 3L42A 2QI2A 3M58A 4B9XA 4MMLA 3C4SA 2COZA 2E3HA 1ZSZC 2IPOB 4J9IA 2V1QA 1D3BB 2CDTA 2SRCA 4ME7A 3GIBA 2KROA 2PU9B 1JQQA 4DEXA 1DJ7B 3I56Q 5LJ3f 1BBZA 5KYXA 1YJNT 1M4ZA 4M77D 1VQ8A 5CQYA 1B34B 1UGVA 3CXCS 3CBPA 1OEBA 1PSEA 2RN8A 1Y0MA 4EPCA 1GBRA 1VQKT 1ZLMA 2FPFA 3CC7A 2M51A 1VIFA 1WXUA 2JMAA 3CBMA 4A4FA 2XK0A 1R0BG 2VKNA 2GQVA 3JRZA 5FWBA 2AIRB 2ECZA 2EJFA 3OY9A 4C5IA 3J81E 2EGEA 1T3LA 1M2OA 1ZBXA 1N9RA 1XQHA 4BI8B 3MKDA 2QGFB 3P8HA 3C95A 4XK8E 1G2BA 1SKUB 3EGUA 4C5EA 2HQXA 3QG1A 2M02A 1A0NB 1BCMA 3UT1A 2EYXA 5AT1B 4F16A 1PHTA 2P4RA 1NLPC 2YSQA 3V8KA 2MK5A 3ASKA 2JNGA 5KYYA 1MV3A 3VS4A 3JSCA 1VQ7Q 2HDAA 1VQNQ 1KFZA 9ATCB 2VWFA 4XTWA 3QZ9B 4FSXA 4NS5A 4N4HA 4E7IA 3TU4K 2W0ZA 3RMQA 2QQSA 1R77A 1NZ9A 1WQ7A 4DBQA 1QKXA 3M53A 2HNIA 1TUDA 2DMOA 3HL8A 1UECA 1ZSGA 2DNUA 1B7TA 3HSBA 4HCKA 1LCKA 5CQXA 1G3SA 1JXMA 1BU1A 4X34A 1S72A 1TH7A 2OTLQ 2JT4A 2VVKA 1NLOC 1N27A 2LQ8A 1OPKA 1TSFA 2DBKA 2KE9A 4KUDK 1K9MC 2PQWA 2DILA 2CZ0B 5GAN7 3LX7A 1LVKA 2R5MA 2R57A 1VQPQ 4M75D 3TCJA 2EGAA 3VU3C 1VQLA 2MOXA 3CPWA 1IHVA 1W6XA 2DIQA 4R0KA 1TOVA 2CZ1B 4DQ2A 1YN8A 3HRTA 1GRIA 1YHQT 1KHCA 3RERA 1MNEA 4M7DG 1SRMA 3JAME 3P8BB 2NUZA 4PJOB 1D3BA 4X9DA 5GANe 2A36A 2FRWA 4RCCA
chains in the Genus database with same CATH topology
1UEBA 2RH2A 3M57A 3GNGA 4A53A 3VJPA 4Z02A 1YHQA 1M90U 2DZ9A 2ZPHB 4QW2A 2RHXA 1Y71A 4C92G 3FLGA 2GCXA 3L2VA 3CCET 2VYTA 3JCMb 4PNOA 5GAN2 4M7AE 4A54A 4XTXA 4RCBA 3EAEA 2YRVA 3T9NA 2VC8A 4EDUA 5A2QE 3JCMP 1YITT 1YCYA 5M9OA 1YJNA 3HPWA 3OBWA 3VUBA 2QQBA 1B34A 2D0QB 4M75C 2ZPFB 3LW5E 4GLKA 5J3BA 5LJ3g 3CMAA 1WJQA 3P8DA 3PFSA 1I8FA 2CGHA 1YIJT 2XHCA 1YJ9A 3S3MA 4RG2A 3V7RA 1Q7YC 1QVGA 2L8DA 5I2SA 5KCOA 5FRMA 3RIRA 1VQKA 3C94A 4A4HA 1K9MU 4M78B 2KDSA 3PNWC 1WGSA 3C12A 1WQWA 2LCLA 4J8OA 1VQ4A 2RD1A 2KSSA 2XICA 2PVOB 3X26B 4JLGA 1G3TA 2FB7A 4C92D 2GFUA 3QPHA 1WJSA 4UC4A 3OW2A 3CCRA 3OYIA 1UGPB 4HCCA 4BDZA 1Q81U 4C8QE 5GAMf 3MP6A 3BW1A 4FL6A 4II1A 3V7SA 1JBMA 3ZFJA 5KH6A 3MHXA 4E47A 2V8IA 5CK9A 5HK3A 1JJ2S 3NFCA 1YBYA 1BIBA 4M78C 3CCQT 1QP2A 4A4GA 2RJDA 3OYNA 3OYKA 4OMFB 5LJ3d 3DLLA 3VV0A 1QP3A 3ME9A 2QA4T 3ZEHA 2LTOA 2X4XA 1K8AU 2BKDN 3EFRA 2DD5A 5GANj 4M7DB 1G3YA 4M7AB 3QXEB 5GAOp 2XDDA 4QVDA 2G3RA 3QYHB 3GP8A 3CD6A 4F7UE 2P0PA 2A3LA 3VUZA 4O6JA 3OS2A 2ZZDA 3I56T 4XU3A 2F69A 3Q1JA 3M55A 5CAIA 5GAMh 4NL3A 3OA6A 3JCMQ 1U1TA 3CXCA 1YI2T 2EKOA 2FL7A 3MCAB 1YJWT 2XDBA 3OYFA 5DY9A 5LJ5g 2RK1A 4C5HA 2M16A 4WF2A 1XTDA 2KMTA 2LRQA 3CPWS 2F5KA 5FROA 2QQ9A 4C92A 2ZCFB 3EFSA 3A8GB 1M1KC 3OB9A 3A8MB 4PKCC 4C8QB 1KG1A 5A0DA 1JRIA 3INZA 4HCZA 2K5IA 4IUPA 4BDYA 2K4YA 1M90C 4BE0A 2DIGA 4C92C 1LOJA 3CCLA 4MZTA 1N6AA 4M78F 1BI3A 2RI5A 4LDYA 3VYHB 5CCAA 5GMKl 3OYBA 1Q7YU 3OSSC 3QDRB 3NTKA 3HFNA 3JCMf 4X9CA 4YTLA 4A4KA 4JS5A 1KD1U 1M1FA 3LYIA 4IUVA 4FM4B 4XTUA 2DO3A 5GANf 1BI2A 2DXTA 2RJCA 5IAYA 3SWNB 4BE1A 4HT8A 4HCBA 3JCMc 2CYZB 2HAXA 2E65A 5KE3A 1OZ2A 2DTIA 2E70A 3PTAA 4PL6A 2DVEA 5LJ5d 2E6ZA 2LDMA 4J6WA 4XQ3A 4E7KA 3MP1A 4BACA 2EJ9A 3CCVT 2DXUA 4OB3B 5C6SA 2QQAA 2WSFE 3OQ5A 3O8VA 1UGQB 2X35A 4XU0A 3OS0A 1VQMA 1Q86U 1Y07A 3GLXA 1M1GA 3PIPA 2QDYB 4DA4A 4J6XA 1KQSS 1NJIC 1HK9A 1AHJB 1OZ3A 1NPPA 3SB2A 2XG8D 1Q81C 2RM4A 2EJGA 3MEAA 3SD4A 2RHUA 4HA8A 5KE2A 3JCMh 3MP8A 5CKEA 3V8LA 3CCUT 3LWIA 3G71A 1RI0A 3FJPA 5GANh 5FLXE 5FU7C 1K73C 2KAFA 3QJ6A 4L59A 4OB0B 1KQ1A 2MMPA 1G3WA 3OYMA 5HKCA 2K5FA 1QVGS 2PUOB 1I81A 3M9QA 4JRKA 2YHTA 4LDVA 3RUXA 2EFIA 4C92F 1K8AC 1VQ6T 2XI9A 2DEQA 3V7CA 2VGMA 3CC2T 4ATOA 3CCUA 2RI2A 4C0FA 1VIEA 5D6WA 4MZMA 5DLOA 2HBPA 1MGQA 2DAQA 2VXFA 2YLCA 2E10A 1LJOA 2K3XA 4M7AG 4XTZA 5CKBA 3UDCA 3MO8A 3JCMe 3MEUA 4OVAA 3ER0A 5CVIA 3SFMA 1N8RC 3JCMX 4J6YA 5I2MA 4QVZA 1VQ6A 1W4SA 5IN1A 3G4ST 1FWZA 2PUKB 4C5GA 4XAXB 3J80E 1M1KU 4TVRA 2EQMA 2P0QA 2K5LA 3LGFA 2DTOA 3VKIA 3H6ZA 5C0MA 4PJOA 3HRUA 5DLQE 2FYKA 4M75A 4A4EA 2RO0A 1OYXA 3OSVA 2XU8A 1VQ8T 2E1HA 3CMEA 5LL6S 1KHIA 4PJOC 1VQOT 2X4YA 3G4SA 1KQ2A 4JJNK 3MEVA 4N4GA 4OF1A 4PLIA 2CZ7B 3F70A 4M77E 4ZGJB 4OB1B 4M7AD 4MZPA 4C8QG 4BI3A 4Y28E 4CRIA 2LX9A 2FVUA 5A0LA 3CCEA 4PLLA 3CC7T 1KD1C 1R8OB 1YITA 1NPRA 3HKSA 1BYMA 1N9SA 3H8ZA 2JOYA 2E64A 2ZPBB 3A5ZB 4FU6A 5GMKm 4ZGEB 2DZCA 4IKFA 1VQPT 5HY6A 4RMOA 1KC8C 2O4XB 2WSCE 2CKKA 2L5QA 4FIBA 4O5VA 3ZBDA 4ZTFA 4OGCA 1YIJA 2ZGWA 4E7HA 1JB0E 2XKOC 3JB9J 4HKEA 3JB9G 4EMKB 3OYGA 1W2BA 1NJIU 2DTHA 3OYLA 1XNIA 4M78A 3E9FA 2BIVA 3URGA 4BD3A 1FX7A 4F7UG 1Q86C 4LDXA 4KUIA 5J26A 3RMSA 3CCMT 2JZ2A 3M54A 5GAN8 4V2SA 2PVGB 2V8JA 3KBGA 4J5YA 4C8QD 3PMIA 2MI6A 5AYFA 5GAN6 4ZTJA 5LJ3h 1U1SA 4ELYC 2WACA 5CIUA 2DPPB 1V29B 2OTJT 4JRIA 4N0AA 4EMKC 2KVQG 3VYGA 4BY6B 1XOVA 2F5TX 4PJOF 3A8LB 1Y96B 2OAUA 5GAMg 4BE2A 3CCQA 4M75F 2K57A 3LLRA 4ELZC 3FB9A 4N0AC 4M77B 4BUGA 3M59A 3JB9D 3JCMW 2QA4A 2MWOA 1ZHIA 4C0DB 1N8RU 4M7AA 4M7DA 2H3JA 4KBMB 5LJ3e 4M7DC 2Y90A 4M7AC 4BY6C 4E7LA 2QXFA 3SDZA 4GY5A 4XTVA 1U8RA 3BDUA 2CS7A 3CCJT 1OI1A 4OGEA 3I56A 3JCMJ 2LQKA 2ZPGB 4J83A 4EMHA 3QIIA 3J7AF 4RCCA 3X20B 3CC4T 3OYEA 4ZN3A 1YI2A 3X28B 1YJWA 1BKBA 2QQRA 3JCMV 5CO7A 1VQ5T 4D6WA 2EQJA 5GAMd 2X4JA 2P0KA 1X75C 1FXXA 2GFAA 3PGGA 4C8QA 3WVDB 3R6OA 3WXMB 2MAMA 2IVWA 3L2RA 3CC4A 1H641 1X6OA 1BI0A 1I4K1 4C8QC 4XTYA 3RESA 4DOWA 1K73U 3FDRA 1KC8U 4P5NA 3N5BB 3QKJA 4F7UB 1S72T 2O01E 2B8AA 3FIFA 1Y7XA 2QEXT 2C06A 4QQGA 2Y4XA 3M56A 3SWNA 4VUBA 1UGRB 2E6NA 4JLIA 3JCMg 3GNFB 2LVMA 3L2ZA 4JDSA 2XIDA 4M7DF 3S6WA 4KULA 3SWNC 4M7AF 5GANg 3META 4XU2A 2I2LA 4IUQA 2DXCA 5GAN4 3GPLA 4ZN1A 3PMTA 1QW1A 4MDXA 2L89A 3E19A 2D6FA 3UWNA 3CCVA 2RB6A 5L8RE 4PJOE 1VQLT 2LC4A 5LJ3j 5GMKh 2RI3A 4M75E 2RHYA 5LJ5e 4JRQA 4QQDA 2GF7A 2IG0A 2YLBA 3V8JA 1Q82C 4E7JA 1BIAA 3OMGA 1SSFA 2FHDA 4MMKA 3RKXA 3RKWA 2Y4YA 3L2QA 3DKMA 3HFOA 1PSFA 2EWNA 3E9GA 4JS4A 1UB4A 3L2UA 1VQ7A 2KQWA 4KT0E 4C8QF 3JCMd 4R55A 3OW2S 1VQNA 3OYDA 3G6ET 5GANd 4OB2B 4M77G 5GMKe 4M7DD 3CC2A 3L42A 2QI2A 2A7YA 1VUBA 3M58A 4MMLA 4B9XA 5GAOq 4HT9A 3C4SA 2JTMA 1VQ7T 4B9WA 3HRSA 3BDLA 2M9UA 4M78E 2EIFA 5CKFA 2NLUA 3JB9I 1M5Q1 1D3BB 3JB9F 4XU1A 1I5LA 4FT2A 3G6EA 1G5VA 4ME7A 2R5AA 2RJEA 4QQ6A 4IUTA 3CCST 2OTLT 2XD0A 2PU9B 3GIBA 3BY7A 4LD9K 3QSUA 3KUFA 5FU6B 1DJ7B 4RKUE 5D6XA 5LJ3f 1QVFA 3TEEA 5GAN5 1YJNT 2RHZA 1M4ZA 5DM7R 2E12A 2RA2A 3CMAT 4M77D 2K3YA 1VQ8A 5CQYA 1QVPA 1YJ9T 1VQOA 1B34B 3CCSA 2OTLA 3CXCS 3CBPA 1KQSA 1PSEA 2LT1A 2RK2A 4EPCA 4BI4A 4IUUA 2DD4A 4M7DE 3QO3A 4BB7A 5LJ5j 1VQKT 4L6V5 1M8VA 2K2VA 3A8HB 5FU6C 4Y91A 4JRPA 2RHIA 3LWHA 3CC7A 3QYGB 4N4IA 5GAOl 2E5QA 3WVEB 1VQ4T 2HQEA 2LCCA 5CKHA 3S3OA 1VIFA 2O4XA 3BFMA 4Q5WA 3OS5A 4IURA 2V8KA 3CBMA 4A4FA 3CPFA 1VQPA 2WSEE 2XK0A 3CCRT 4NL2A 4EMKA 2JUFA 2DKGA 1O9SA 2GQVA 2JTFA 3JRZA 4OP0A 4C92E 3HP9A 5FRNA 2EJFA 3OY9A 4C5IA 1Q82U 5D6YA 3J81E 1ZBXA 5GMKj 4C0GA 1N9RA 1XQHA 3G7ZA 3M4GA 4BI8B 3CCMA 4MDWA 3L2WA 4R56A 1M9SA 1ZQ1A 3L1AA 4L5GA 2LNVA 4J7IA 3GOXA 3OYYA 2DK3A 2KY9A 3P8HA 3C95A 2MWPA 4XK8E 3X25B 3FRNA 3OMCA 3A8OB 2EQUA 2OTJA 3DB4A 4DOVA 5GAOr 1Y96A 4C5EA 3CD6T 2HQXA 3QG1A 3HHTB 4EMGA 3UT1A 5GAN3 4M77A 3TREA 3M5AA 3QUIA 4FT4A 3S3NA 2D9TA 3OBYA 3V8KA 4J7FA 5LJ5f 4M77C 4JUVA 2X4WA 5GAOn 3ASKA 2JNGA 1O75A 4C0DC 3E1SA 5CR2A 2R58A 3JSCA 3OS1A 3OYAA 2VGNA 4XTWA 2EYQA 3QZ9B 4FSXA 4NS5A 2L3RA 2MF2A 3CCJA 3QJYA 4C92B 4N4HA 3MEWA 4E7IA 3TU4K 1WJRA 3QBYA 3CCLT 3RMQA 2QQSA 2VUBA 4LDWA 1P92A 1NZ9A 1WQ7A 3OYCA 3GF5A 1VQ5A 3M53A 2HNIA 3HL8A 5GMKi 5LJ5h 3PT9A 4PJOG 2QTXA 2ZPEB 1JJ2A 2M1HA 4M75G 1MHNA 3HSBA 3NTHA 2VXEA 3QHSA 5GAMe 1LNXA 3AHUA 5CQXA 4F7UA 1WPYA 1G3SA 2DXBA 3KXTA 2ZPIB 4X34A 2EQKA 4ZGDB 1S72A 1TH7A 1VQMT 5I21A 2LT4A 2QEXA 3X24B 4M77F 3RKYA 3NTIA 1N27A 5J39A 1EIFA 2LQ8A 2XDPA 5GAOm 3DLMA 1IREB 2E41A 1VQNT 1RL2A 1QVFS 4KUDK 1K9MC 3CEYA 5FU7B 4RG8A 2PQWA 3G71T 2CZ0B 5GAN7 1IZ6A 3LX7A 4PJOD 4LD6A 5EG2A 2R5MA 2R57A 3OYJA 4M75D 3TCJA 4M78G 2KK4A 4QVCA 5IT9E 3VU3C 1H3ZA 1VQLA 2P4TA 2M0OA 5KCHA 3CPWA 1GXIE 1W2BS 3M4YA 5A0GA 1WNLA 2DIQA 4C0ZA 1UGSB 1X01A 2HD0A 3JB9H 2CZ1B 3FEOA 4DQ2A 2AHJB 3LGLA 2RJFA 1HXDA 3PIOA 3I55T 1VQ9T 3CBOA 3QZ5B 3DB3A 3HRTA 4CI0C 5HK0A 3FC3A 1YHQT 1KHCA 4LDUA 2CZ6B 2EAYA 3RERA 2JVVA 2VV5A 4M7DG 3JAME 4F7UF 2BUDA 4M78D 3OYHA 3P8BB 3LH0A 4NOYA 5GAMj 4PJOB 1D3BA 4X9DA 5GANe 3I55A 2PVDB 2JN0A 1VQ9A 5CKDA 3CMET 4M75B 3UPUA 1BI1A 1NE8A 2DJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPH B;  3WVD B;  3X25 B;  4XK8 E;  4OB0 B;  3A8O B;  2PUO B;  3HHT B;  2D0Q B;  2ZPF B;  3LW5 E;  2O01 E;  1UGR B;  2DXC A;  2PUK B;  2PVO B;  3X26 B;  3QZ9 B;  1UGP B;  5L8R E;  1QP2 A;  2CZ7 B;  1QP3 A;  4ZGJ B;  4OB1 B;  1PSF A;  4Y28 E;  2ZPE B;  2DD5 A;  3QXE B;  4KT0 E;  3QYH B;  2DXB A;  2ZPB B;  4ZGE B;  2ZPI B;  4OB2 B;  2WSC E;  2ZZD A;  4ZGD B;  1JB0 E;  3X24 B;  1IRE B;  2CZ0 B;  2PVG B;  2PU9 B;  2ZCF B;  3A8G B;  3A8M B;  1DJ7 B;  2DPP B;  4RKU E;  1V29 B;  3VYG A;  3VYH B;  1GXI E;  3A8L B;  1UGS B;  1PSE A;  2DD4 A;  4FM4 B;  2CZ1 B;  4L6V 5;  2AHJ B;  3A8H B;  2CYZ B;  3QYG B;  3WVE B;  3QZ5 B;  2CZ6 B;  2WSE E;  4OB3 B;  2WSF E;  1UGQ B;  2ZPG B;  2QDY B;  3X20 B;  2PVD B;  1AHJ B;  3X28 B; 
#chains in the Genus database with same CATH topology
 2RH2 A;  2KXD A;  1YHQ A;  3CPW P;  1AZE A;  2CSQ A;  2DZ9 A;  2K9G A;  2RHX A;  2GCX A;  3JCM b;  4PNO A;  1BCO A;  4XTX A;  4RCB A;  3T9N A;  4EDU A;  2KI7 A;  3OBW A;  3VUB A;  2QQB A;  1B34 A;  1FYN A;  3CMA A;  1UJY A;  3M0S A;  2DRM A;  3P8D A;  3PFS A;  2CGH A;  1YIJ T;  1YJ9 A;  1Q7Y R;  3S3M A;  4OMP A;  2L8D A;  2A0F B;  2ROT A;  2KDS A;  2LMJ A;  2FPD A;  2J05 A;  3QWY A;  2KSS A;  2DM1 A;  2FZG B;  3QPH A;  1WJS A;  2L2P A;  3OW2 A;  1Q81 U;  5GAM f;  3MP6 A;  3BW1 A;  4FL6 A;  3V7S A;  1Q86 R;  2ABL A;  1JBM A;  1SRL A;  5KH6 A;  2X9H A;  4M78 C;  1RAE B;  2CP0 A;  3DLL A;  4OMF B;  5LJ3 d;  3VV0 A;  1QP3 A;  2QA4 T;  2X4X A;  1K8A U;  2BKD N;  3EFR A;  5GAN j;  3LH5 A;  4F14 A;  5GAO p;  1UHF A;  2P0P A;  3VUZ A;  4O6J A;  2J06 A;  1M8M A;  2DLP A;  4E6R A;  3OW2 P;  3JCM Q;  1U1T A;  2EKO A;  2BTT A;  2FL7 A;  1SG5 A;  2XDB A;  2A28 A;  1FMV A;  4C5H A;  4ORZ A;  2M16 A;  2KYM A;  2KMT A;  5FRO A;  1M1K R;  2L0A A;  1PD1 A;  2RPN A;  2K7A A;  4BDY A;  1M90 C;  1X6G A;  2ED1 A;  2DIG A;  1KK7 A;  4M78 F;  1VQ9 Q;  4LDY A;  3OYB A;  2HL5 C;  1D1A A;  5GMK l;  3QDR B;  1D1C A;  2PZ1 A;  3HFN A;  3H41 A;  1VYU A;  1WXT A;  4A4K A;  4JS5 A;  3LYI A;  4FM4 B;  4J9F A;  1BI2 A;  2RJC A;  2LJ3 A;  2CUB A;  2LJ1 A;  1Y57 A;  3MP1 A;  2EJ9 A;  2JW4 A;  3GLX A;  3PIP A;  1NJI R;  1KQS S;  1OZ3 A;  2XG8 D;  2RM4 A;  3JCM h;  2L3Q A;  1RI0 A;  5FLX E;  1IO6 A;  2OI3 A;  3QJ6 A;  1QVG S;  5HKC A;  1C6V X;  1I81 A;  3RUX A;  2EFI A;  2XI9 A;  2VGM A;  6AT1 B;  4LNP A;  4C0F A;  4MZM A;  5DLO A;  1ZSZ B;  2HBP A;  3THK A;  1K0S A;  2K3X A;  4XTZ A;  3UDC A;  3ER0 A;  1WHJ A;  3SFM A;  1N8R C;  1JEG A;  3M0U A;  1W4S A;  4C5G A;  1M30 A;  3J80 E;  3CD6 Q;  2DTO A;  1R0C B;  4PJO A;  4RTZ A;  1RAH B;  2E1H A;  3CME A;  2AKL A;  3MEV A;  4N4G A;  1RAI B;  3F70 A;  4ZGJ B;  4CRI A;  3CCE A;  4PLL A;  2QK0 A;  1R8O B;  1YIT A;  1NPR A;  5ECA A;  3H8Z A;  2E64 A;  3RNJ A;  3CCL Q;  4IKF A;  1TS9 A;  4RMO A;  2FPE A;  3EG9 B;  1JB0 E;  2XKO C;  1W2B A;  3M0Q A;  1W1F A;  4F7U G;  3RMS A;  3CCM T;  1VYV A;  5GAN 6;  3PMI A;  2MI6 A;  5LJ3 h;  4KGX B;  1U1S A;  1Z9Q A;  4IIO A;  1VQM Q;  1UJ0 A;  4AFQ C;  1XOV A;  3EG3 A;  4BE2 A;  3LLR A;  1X2K A;  1SHG A;  3JB9 D;  2MWO A;  2Z0W A;  1M3A A;  3D7S B;  2H3J A;  1W2B P;  4M7D C;  2Y90 A;  4M7A C;  4BY6 C;  2LX7 A;  4E7L A;  3BDU A;  4OGE A;  2LQK A;  4EMH A;  3H0F A;  3CC4 T;  3OYE A;  1YI2 A;  2YDL A;  4QT7 A;  3JCM V;  1VQ5 T;  5GAM d;  2VAS A;  3NPF A;  1QQJ A;  1X75 C;  1FXX A;  2QG9 B;  4JZ3 A;  2CT4 A;  2YUQ A;  4PFP A;  3CC4 A;  1H64 1;  1BI0 A;  1I4K 1;  1KC8 U;  4XTY A;  3FDR A;  3QKJ A;  4ESR A;  2B8A A;  1EX4 A;  1Y7X A;  2QEX T;  4QQG A;  3M56 A;  2KNB B;  1U5S A;  2E6N A;  4JLI A;  3JCM g;  2NYS A;  4M7D F;  4M7A F;  3GBQ A;  3SWN C;  3GPL A;  3VS0 A;  1H92 A;  1X69 A;  1M3B A;  1QW1 A;  3UWN A;  2QTV A;  4PJO E;  2RI3 A;  1NEG A;  2GF7 A;  2IG0 A;  5IH2 A;  1K1Z A;  1BIA A;  3RKX A;  2Y4Y A;  3DKM A;  3HFO A;  1PSF A;  3C0C A;  3E9G A;  4KT0 E;  1RAF B;  1ZSZ A;  5GMK e;  3CCQ Q;  2JTM A;  4B9W A;  3BDL A;  5CKF A;  1VA7 A;  3JB9 I;  1KIK A;  3VS6 A;  1G5V A;  5KYU A;  2ATC B;  2R5A A;  2RJE A;  4QQ6 A;  2XD0 A;  3HTR A;  5FU6 B;  5D6X A;  1QVF A;  5GAN 5;  2RHZ A;  2E12 A;  1B07 A;  2RA2 A;  1VQO A;  1HJD A;  1YJW Q;  4GLM A;  2RK2 A;  4IUU A;  1PKT A;  1M8V A;  3H9N A;  1RLP C;  3A8H B;  2RQT A;  5GAO l;  1VQ4 T;  2HQE A;  2LCC A;  3BFM A;  2HEQ A;  2V8K A;  3EG9 A;  3CPF A;  3CCR T;  1ABQ A;  1O9S A;  4OP0 A;  4C92 E;  1Q82 U;  5D6Y A;  3G1J A;  4WTO B;  5GMK j;  1QVF P;  3G7Z A;  4R56 A;  1M9S A;  3L1A A;  4L5G A;  1C1A A;  3GOX A;  2KY9 A;  2VB6 A;  3X25 B;  3FRN A;  3CCV Q;  2DL8 A;  3A8O B;  2OTJ A;  4QKU A;  1IGU A;  1PWT A;  1TU0 B;  4EMG A;  3QUI A;  2AZV A;  4FT4 A;  4DBR A;  4J7F A;  4M77 C;  4C0D C;  3E1S A;  5CR2 A;  2EYQ A;  2L3R A;  3CCJ A;  2H8H A;  3CC2 Q;  4LXC A;  2YXY A;  3QJY A;  2FEI A;  1WJR A;  2G6F X;  1PNJ A;  2KT1 A;  4LDW A;  3OYC A;  3GF5 A;  1OUL A;  5GMK i;  5LJ5 h;  2JM9 A;  1M90 R;  2QTX A;  1KJW A;  2DE0 X;  2M1H A;  1MHN A;  2LQW A;  3NTH A;  1ZUU A;  3I5R A;  4J9H A;  1WPY A;  3KXT A;  2ZPI B;  1VQ8 Q;  2K3B A;  1MV0 B;  1RUW A;  4M77 F;  1Q95 G;  4FYV B;  2XDP A;  4B6M A;  1WLP B;  4Z8A A;  3CC7 Q;  2EQI A;  3UAT A;  3G71 T;  4Z88 A;  4PJO D;  2F2V A;  4M78 G;  1I07 A;  1OPL A;  2I0N A;  1WNL A;  1UGS B;  2OX7 A;  2COW A;  1PCX A;  2DF6 A;  3FEO A;  2AHJ B;  2RJF A;  2RNA A;  3PIO A;  1SEM A;  2EKH A;  1SF9 A;  5HK0 A;  4LDU A;  2H3E B;  2CP6 A;  2VV5 A;  4F7U F;  1QCF A;  1BB9 A;  2KRN A;  2JN0 A;  2C0I A;  1BI1 A;  1NE8 A;  4AG1 C;  2RF0 A;  1E6G A;  4QW2 A;  2D1X A;  3FLG A;  4A54 A;  3EAE A;  2VC8 A;  5M9O A;  1YJN A;  2D0Q B;  4M75 C;  2ZPF B;  5J3B A;  4LN2 A;  2XHC A;  4RG2 A;  1AWW A;  5KCO A;  4RTW A;  3RIR A;  2KEA A;  1MMA A;  1VQK A;  4A4H A;  1WGS A;  3C12 A;  2LCL A;  2XIC A;  3X26 B;  2BZY A;  4JLG A;  4C92 D;  4UC4 A;  1S72 Q;  1UGP B;  4C8Q E;  4II1 A;  3ZFJ A;  3MHX A;  2V8I A;  5CK9 A;  1QP2 A;  2CP3 A;  2GTJ A;  4A4G A;  3OYN A;  3ZEH A;  1MUZ A;  4M7D B;  1G3Y A;  4M7A B;  2V1R A;  1NG2 A;  3QYH B;  1VQL Q;  3I56 T;  4XU3 A;  1RI9 A;  3M55 A;  2CH4 A;  4NL3 A;  1E6H A;  1M2V B;  1W70 A;  3CXC A;  5DY9 A;  5LJ5 g;  1XTD A;  3CPW S;  2ZCF B;  3A8G B;  3INZ A;  2ROL A;  4IUP A;  2B86 A;  2EPD A;  1Q7Y U;  2EYW A;  4X9C A;  2DL3 A;  1AVZ C;  1YHQ Q;  4XTU A;  2DL5 A;  5GAN f;  2DXT A;  5IAY A;  4HCB A;  3SWN B;  2D0N A;  2ZAE A;  2DL4 A;  2E70 A;  1I0C A;  4EIK A;  3CXC P;  2E6Z A;  4J6W A;  4E7K A;  3CMA Q;  1H3H A;  1M27 C;  3OS0 A;  1Q86 U;  1YJ9 Q;  3O8V A;  1UGQ B;  1CKA A;  2DA9 A;  5IHI A;  3MEA A;  1TG0 A;  3V8L A;  4CC4 B;  2OAW A;  1XJW B;  1OU8 A;  3IQL A;  2KAF A;  4OB0 B;  1VQ7 T;  1VQN T;  1T0H A;  4LDV A;  4JRK A;  2EVR A;  1M3C A;  2RQR A;  1PM3 A;  5D6W A;  3EG2 A;  4M7A G;  3CQT A;  4PFZ A;  2KT8 A;  4FYW B;  2CSI A;  2HL3 A;  4QVZ A;  1Z9Z A;  1M1K U;  2P0Q A;  2K5L A;  3H6Z A;  3HRU A;  1D1B A;  1CKB A;  5LL6 S;  1KQ2 A;  4JJN K;  1WHK A;  4OF1 A;  4PLI A;  1HD3 A;  2FVU A;  1KD1 C;  4OMM A;  1RAD B;  5IXB A;  2ZPB B;  1RAA B;  1VQP T;  5HY6 A;  1K73 R;  1KC8 C;  1V76 A;  2O4X B;  2WSC E;  4FIB A;  4O5V A;  4D8K A;  1YIJ A;  1WHH A;  1ZX6 A;  3BE3 A;  1NJI U;  4EMK B;  3OYG A;  1TUC A;  1XNI A;  3TSZ A;  3E9F A;  4BD3 A;  4LDX A;  2FZC B;  1X2Q A;  2PVG B;  3KBG A;  4J5Y A;  4C8Q D;  4ELY C;  2DPP B;  1V29 B;  4JRI A;  3VYG A;  2MPX C;  3FB9 A;  4N0A C;  4M77 B;  4BUG A;  3I35 A;  2QA4 A;  4M7D A;  4C0D B;  4M7A A;  1UDL A;  2KR3 A;  1AWO A;  3EG0 A;  3MPU B;  4KBM B;  2QXF A;  4CC7 A;  4FYY B;  1OI1 A;  4OMO A;  1M2V A;  4J83 A;  3EH1 A;  3QII A;  4ZN3 A;  3VS2 A;  1BKB A;  2QQR A;  5CO7 A;  1IXD A;  2X4J A;  4PFO A;  2P0K A;  2GFA A;  1FMW A;  3WVD B;  2MAM A;  2HCK A;  2DX1 A;  4JJB A;  2ED0 A;  1ARK A;  1G83 A;  4DOW A;  1T0J A;  4F7U B;  3CME Q;  2C06 A;  2Y4X A;  3SWN A;  4KGV B;  3CCE Q;  4XU2 A;  1YIT Q;  2E5K A;  4RTX A;  2DER A;  4MDX A;  2RB6 A;  5L8R E;  2DFU A;  4HVW A;  2BZ8 A;  3UA7 A;  5LJ5 e;  4QQD A;  7AT1 B;  1AWJ A;  2YLB A;  1Q82 C;  2BZX A;  1SSF A;  2FHD A;  4MMK A;  3RKW A;  1EZZ B;  2LJ0 A;  5L23 A;  1UB4 A;  3L2U A;  2MCN A;  4R55 A;  4PJM A;  1GCQ A;  3G6E T;  5GAN d;  4M77 G;  2RMO A;  2BE7 D;  2AZS A;  3H0H A;  5GAO q;  2CH4 W;  2GQI A;  3HRS A;  2M9U A;  2NLU A;  3JB9 F;  4FT2 A;  3G6E A;  5KYN A;  1OOT A;  4F17 A;  3CCS T;  4IUT A;  2HSP A;  3BY7 A;  4LD9 K;  3KUF A;  4RKU E;  3TEE A;  1YI2 Q;  1QVP A;  3CCS A;  2LP5 A;  1KQS A;  1SPK A;  1QCO A;  4M7D E;  3QO3 A;  4BB7 A;  5LJ5 j;  1ZUY A;  3EH2 A;  4Y91 A;  2E4H A;  4JRP A;  2RHI A;  3LWH A;  1IB8 A;  3WVE B;  2O4X A;  4LE9 A;  3OS5 A;  4IUR A;  2E3I A;  2HSE B;  5GJW B;  4NL2 A;  4EMK A;  2JUF A;  2DKG A;  2JTF A;  3H0I A;  1MMD A;  3CCM A;  3L2W A;  3ZL7 C;  4Z89 A;  1ZQ1 A;  3OYY A;  2DK3 A;  4D8D A;  2RQU A;  3VS3 A;  4M4Z A;  2EQU A;  3CD6 T;  4M77 A;  3M5A A;  2OJ2 A;  4F04 B;  3REB B;  4JUV A;  5GAO n;  2RQW A;  1IHW A;  2VGN A;  2QAZ A;  2MF2 A;  1K76 A;  4PJL A;  3CCL T;  1AWX A;  1D0X A;  1P92 A;  1VQ5 A;  4ANJ A;  2J7I A;  2ZPE B;  1JJ2 A;  3EFO B;  4M75 G;  2BE9 B;  2VXE A;  1B3Q A;  3AHU A;  4F7U A;  4ZGD B;  1VQM T;  5I21 A;  1TXQ A;  1VQO Q;  2LT4 A;  2QEX A;  3X24 B;  1PRM C;  3NTI A;  1WHM A;  5J39 A;  1EIF A;  1K9M R;  1QVF S;  1OX8 A;  5IHN A;  1YWO A;  4LD6 A;  2O9V A;  2KK4 A;  4QVC A;  1H3Z A;  1JJ2 P;  2M0O A;  5KCH A;  4X1V A;  2AT1 B;  3M4Y A;  4KGZ B;  2HD0 A;  1KSW A;  3JB9 H;  2DYI A;  1PC0 A;  3LGL A;  3I55 T;  2OTJ Q;  4CI0 C;  1U06 A;  3FC3 A;  2CZ6 B;  2EAY A;  2JVV A;  4PK4 A;  3OYH A;  3E2U A;  2YWW A;  4J9B A;  3I55 A;  5CKD A;  4RTV A;  2DJZ A;  1UEB A;  4A53 A;  4Z02 A;  2EGC A;  3QWX X;  1M90 U;  1NYF A;  2CP7 A;  5GAN 2;  3CCJ Q;  1YCY A;  5LJ3 g;  4GLK A;  1WJQ A;  4M7D D;  1I8F A;  3TVT A;  2MYS A;  3V7R A;  1Q7Y C;  2K79 A;  1KD1 R;  5FRM A;  3C94 A;  5FW9 A;  4M78 B;  3ULR B;  2J6F A;  1VQ4 A;  2PVO B;  1UHC A;  2FB7 A;  3VRZ A;  2GFU A;  3A98 A;  3CCR A;  4HCC A;  1IRX A;  2CUD A;  1RAC B;  2ESW A;  1WIE A;  4E47 A;  5HK3 A;  3NFC A;  5I22 A;  1YBY A;  1BIB A;  3CCQ T;  2L3S A;  1VOM A;  4DBH A;  3OYK A;  4AFZ C;  2DD5 A;  2K2M A;  3QXE B;  4WCI A;  4FSS A;  2G3R A;  3GP8 A;  4F7U E;  2A3L A;  2KRM A;  2F69 A;  3Q1J A;  5CAI A;  5GAM h;  2YRD A;  1UTI A;  3MCA B;  1YFN A;  1YJW T;  3NGP A;  3SEM A;  1QCN A;  2CP5 A;  2LRQ A;  2F5K A;  2HBW A;  2QQ9 A;  3EFS A;  1M1K C;  3OB9 A;  2O9S A;  4HCZ A;  8ATC B;  2COY A;  4BE0 A;  4DBF A;  4C92 C;  1QKW A;  3OSS C;  4OMQ A;  3JCM f;  1JU5 C;  1M1F A;  1QMC A;  3EFO A;  3R6N A;  4GBQ A;  4BE1 A;  1WZO A;  2LQN A;  3JCM c;  2E65 A;  2K6D A;  3PE0 A;  5D7U A;  5KE3 A;  3PTA A;  4PL6 A;  1YJN Q;  2KXC A;  3CCV T;  2DXU A;  1ZUK A;  2WSF E;  3OQ5 A;  4XU0 A;  2QGG A;  4CC3 A;  2KBT A;  4DA4 A;  1NJI C;  1F1B B;  1AHJ B;  1NPP A;  1VQK Q;  1Q81 C;  2EJG A;  2RHU A;  1YNZ A;  4HA8 A;  5KE2 A;  1MMG A;  1SHF A;  5CKE A;  3CCU T;  3AT1 B;  3O5Z A;  8AT1 B;  3LWI A;  3FJP A;  3G71 A;  5FU7 C;  2F1L A;  2YT6 A;  3M0P A;  4L59 A;  1KQ1 A;  2MMP A;  1G3W A;  1PG5 B;  1TTH B;  3M9Q A;  4C92 F;  2YHT A;  1K8A C;  1GL5 A;  1VQ6 T;  1OV3 A;  1AOJ A;  3CC2 T;  4ATO A;  3CCU A;  2J6K A;  1MGQ A;  2VXF A;  1LJO A;  5CKB A;  2C0O A;  3MO8 A;  3JCM e;  1K4U S;  1N8R R;  5I2M A;  1E7O A;  1VQ6 A;  5IN1 A;  3G4S T;  2PUK B;  4XAX B;  2DBM A;  4TVR A;  3VKI A;  5C0M A;  1SSH A;  5DLQ E;  2FYK A;  4A4E A;  2RO0 A;  1OYX A;  2XU8 A;  1VQ8 T;  2HMA A;  4OML A;  3G4S A;  4ZNX A;  4E7S A;  2CZ7 B;  4OB1 B;  4MZP A;  4BI3 A;  1GCP A;  1RAG B;  4AFS C;  2LX9 A;  3CC7 T;  1GBQ A;  1WHL A;  3HKS A;  1N9S A;  3NHN A;  4FU6 A;  4RTY A;  4ZGE B;  5GMK m;  2CKK A;  3ZBD A;  4OGC A;  3JB9 G;  4HKE A;  2DTH A;  3OYL A;  4M78 A;  4AT1 B;  5FWC A;  2A08 A;  3URG A;  4AG2 C;  4KUI A;  1I1J A;  2JZ2 A;  5GAN 8;  4AFU C;  2NUT B;  2V26 A;  5AYF A;  5IHK A;  5EC7 A;  5I11 A;  3VS7 A;  4N0A A;  4BY6 B;  2F5T X;  1Y96 B;  5GAM g;  4M75 F;  2K57 A;  2D8J A;  4ELZ C;  3M59 A;  1K0X A;  2DYB A;  1UUE A;  3EGD B;  5LJ3 e;  3TSW A;  2F2W A;  2JS2 A;  4GY5 A;  2DEU A;  3I56 A;  3JCM J;  2NWM A;  2ZPG B;  2EBP A;  3J7A F;  3X20 B;  3VRY A;  1X43 A;  3X28 B;  3PVL A;  4D6W A;  2EQJ A;  1I5O B;  3PGG A;  3R6O A;  3WXM B;  1HSQ A;  4C8Q C;  1K73 U;  4P5N A;  1S72 T;  2O01 E;  2O31 A;  1UGR B;  1UE9 A;  3GNF B;  4JDS A;  2XID A;  3S6W A;  4K11 A;  3MET A;  2I2L A;  4IUQ A;  2DXC A;  3PMT A;  2L89 A;  2F2X A;  4FCY A;  1YIJ Q;  3TQ7 P;  1VQL T;  5LJ3 j;  5GMK h;  2FO0 A;  4FYX B;  3V8J A;  4E7J A;  2W10 A;  2ENM A;  2C0T A;  2EWN A;  4JS4 A;  2HZY A;  1VQ7 A;  2KQW A;  3JCM d;  4C8Q F;  3OW2 S;  1VQN A;  2YUP A;  1TWB A;  1WA7 A;  3OYD A;  4OB2 B;  2A7Y A;  1VUB A;  4HVV A;  4HT9 A;  2YUN A;  2O88 A;  2QA4 Q;  2IIM A;  2EIF A;  4M78 E;  1M5Q 1;  4XU1 A;  1I5L A;  4PJJ A;  1TUG B;  2CRE A;  2OTL T;  1WYX A;  3QSU A;  1ZA1 B;  2PNI A;  5DM7 R;  1V1C A;  2LNH B;  3CMA T;  2K3Y A;  1YJ9 T;  2KGT A;  2SEM A;  2OTL A;  2JMC A;  1YCS B;  3EG1 A;  2LT1 A;  2KYB A;  4BI4 A;  2DD4 A;  4L6V 5;  2K2V A;  1WI7 A;  3PVQ A;  2MIO A;  5FU6 C;  3QYG B;  4N4I A;  2E5Q A;  5CKH A;  3S3O A;  1X6B A;  4Q5W A;  1VQP A;  2WSE E;  4IIM A;  3VS1 A;  1AD5 A;  3HP9 A;  5FRN A;  2HKN A;  4KH0 B;  4C0G A;  4CC2 A;  3M4G A;  2NUT A;  4MDW A;  2LNV A;  4J7I A;  2CT3 A;  2AKK A;  2MWP A;  1JXO A;  3OMC A;  3JV3 A;  3DB4 A;  4DOV A;  5GAO r;  1Y96 A;  3I9Q A;  3HHT B;  5GAN 3;  4LUE A;  3TRE A;  2DVJ A;  1OU9 A;  3S3N A;  1ACM B;  2D9T A;  2QDL A;  3OBY A;  5LJ5 f;  3EGD A;  2X4W A;  1O75 A;  2R58 A;  3I5S A;  3OS1 A;  3OYA A;  2JTE A;  4C92 B;  3MEW A;  3QBY A;  1J3T A;  2VUB A;  1GFC A;  1N5Z A;  3G6E Q;  3PT9 A;  4PJO G;  3QHS A;  5GAM e;  1LNX A;  2FG0 A;  2DXB A;  1MND A;  3RDV A;  2EQK A;  4J9G A;  1PD0 A;  3CCS Q;  4OMN A;  3RKY A;  1NBE B;  5GAO m;  3NMZ C;  2DL7 A;  3DLM A;  1IRE B;  2E41 A;  1RL2 A;  2NUP B;  2YRC A;  3CEY A;  5FU7 B;  4RG8 A;  1IZ6 A;  1AT1 B;  5EG2 A;  2EYY A;  2LZ6 B;  3OYJ A;  5IT9 E;  1Q81 R;  2P4T A;  3VS5 A;  1GXI E;  1W2B S;  5A0G A;  4C0Z A;  1X01 A;  3CCM Q;  4PJN A;  4RUG A;  1K8A R;  1HXD A;  1VQ9 T;  5KYW B;  3CBO A;  3QZ5 B;  2HQH A;  3DB3 A;  1U3O A;  1QLY A;  2BUD A;  2P84 A;  4M78 D;  3LH0 A;  4NOY A;  5GAM j;  4JPB W;  4J9C A;  2PVD B;  1VQ9 A;  2J6O A;  3CME T;  3UPU A;  4M75 B;  3M57 A;  2M0Y A;  3GNG A;  3VJP A;  2X3W D;  5KYU B;  2DJQ A;  2QAS A;  2ZPH B;  1Y71 A;  4C92 G;  3L2V A;  3CCE T;  2VYT A;  4Y92 A;  4M7A E;  1YIT T;  2YRV A;  5A2Q E;  3JCM P;  3HPW A;  3CC4 Q;  3LW5 E;  1QVG A;  1VQ5 Q;  1D09 B;  2JJ9 A;  3UA6 A;  1D0Z A;  4HXJ A;  5I2S A;  1NYG A;  4E2F B;  1YWP A;  1K9M U;  3PNW C;  1WQW A;  1OX9 A;  4J8O A;  4RTT A;  1YP5 A;  2RD1 A;  1UFF A;  1G3T A;  1EFN A;  2GTO A;  3OYI A;  4BDZ A;  2QEX Q;  2L3P A;  1KQS P;  1AEY A;  1JJ2 S;  2YUO A;  2RJD A;  3ME9 A;  3UF4 A;  4AMC A;  2LTO A;  1QVG P;  4J9D A;  2XDD A;  2GNC A;  1PKS A;  4QVD A;  3CD6 A;  1RLQ C;  2KRS A;  3EGX B;  4FW2 A;  1WFW A;  2ZZD A;  3OS2 A;  3OA6 A;  1YI2 T;  3OYF A;  1K9A A;  2RK1 A;  2LCS A;  4WF2 A;  1ZA2 B;  4C92 A;  1RAB B;  3A8M B;  4PKC C;  4C8Q B;  1KG1 A;  5A0D A;  1JRI A;  3REA B;  2K5I A;  2K4Y A;  4J9E A;  2FRY A;  1LOJ A;  3CCL A;  4MZT A;  1N6A A;  3VYH B;  1BI3 A;  2RI5 A;  3I55 Q;  5CCA A;  3NTK A;  4YTL A;  2EW3 A;  1KD1 U;  4IUV A;  2DO3 A;  4HT8 A;  2DRK A;  2CYZ B;  2HAX A;  1OZ2 A;  2DTI A;  2DVE A;  5LJ5 d;  2LDM A;  4XQ3 A;  4BAC A;  4OB3 B;  5C6S A;  2QQA A;  2HKQ B;  1VQM A;  2X35 A;  1Y07 A;  1M1G A;  2QDY B;  4J6X A;  1HK9 A;  2NUP A;  3SB2 A;  1LPL A;  3SD4 A;  3MP8 A;  1VQ4 Q;  4JJD A;  1WX6 A;  2X51 A;  5GAN h;  3CCR Q;  1HYO A;  3OYM A;  2K5F A;  4LUD A;  2PUO B;  1NM7 A;  2DEQ A;  3V7C A;  2RI2 A;  1VIE A;  2DAQ A;  2YLC A;  2E10 A;  3MEU A;  4OVA A;  5KYW A;  5CVI A;  2QYZ A;  3RR6 A;  4J6Y A;  3JCM X;  1MMN A;  1FWZ A;  2EQM A;  3EHQ A;  1GCQ C;  2AK5 A;  3LGF A;  1C0M A;  4HVU A;  1GFD A;  4M75 A;  3OSV A;  2PTK A;  5KYX B;  1KHI A;  4PJO C;  4DEY A;  1VQO T;  2X4Y A;  2X3X D;  1VYT A;  4M77 E;  4M7A D;  4C8Q G;  4Y28 E;  3MJX A;  5A0L A;  4RTU A;  4FW1 A;  1BYM A;  2JOY A;  3A5Z B;  2DZC A;  2EYZ A;  1KC8 R;  1K73 C;  2L5Q A;  4ZTF A;  2ZGW A;  4E7H A;  2FZK B;  5GJV B;  3JB9 J;  2BIV A;  1Q86 C;  1FX7 A;  5J26 A;  3U23 A;  4KRT A;  3M54 A;  4V2S A;  3KFV A;  2V8J A;  5HCK A;  4ZTJ A;  1QWE A;  2JXB A;  2GGR A;  2WAC A;  5CIU A;  2O2O A;  2OTJ T;  4EMK C;  2KVQ G;  1IGQ A;  4JZ4 A;  4PJO F;  3A8L B;  2OAU A;  3CCQ A;  1FMK A;  3JCM W;  1WDX A;  1S1N A;  1ZHI A;  2RQV A;  3M0T A;  1N8R U;  3G71 Q;  1OQK A;  4KH1 B;  1T3S A;  5KYY B;  3EGX A;  1D0Y A;  1ZBJ A;  3SDZ A;  4XTV A;  1U8R A;  2CS7 A;  3CCJ T;  2A37 A;  1CSK A;  3CCU Q;  2D8H A;  1YJW A;  2CP2 A;  1VQ6 Q;  1JO8 A;  1NEB A;  4C8Q A;  1G8X A;  2IVW A;  3L2R A;  1X6O A;  3RES A;  1AZG B;  3A1P A;  3N5B B;  1QWF A;  1X27 A;  3FIF A;  3G4S Q;  3EHR A;  4VUB A;  4E7Z A;  1ABO A;  3QDF A;  2LVM A;  3L2Z A;  5IXF A;  4KUL A;  5GAN g;  1H8K A;  5GAN 4;  4ZN1 A;  4JJC A;  3E19 A;  3FJ5 A;  2D6F A;  3CCV A;  1WHG A;  4A63 B;  2LC4 A;  2JS0 A;  4M75 E;  2RHY A;  4JRQ A;  2XMF A;  1Q82 R;  3M0R A;  1WXB A;  2JM8 A;  3OMG A;  3SHW A;  3L2Q A;  3RBB B;  1UG1 A;  2GBQ A;  1BK2 A;  1PRL C;  2DET A;  3CC2 A;  3L42 A;  2QI2 A;  3M58 A;  4B9X A;  4MML A;  3C4S A;  2COZ A;  2E3H A;  1ZSZ C;  2IPO B;  4J9I A;  2V1Q A;  1D3B B;  2CDT A;  2SRC A;  4ME7 A;  3GIB A;  2KRO A;  2PU9 B;  1JQQ A;  4DEX A;  1DJ7 B;  3I56 Q;  5LJ3 f;  1BBZ A;  5KYX A;  1YJN T;  1M4Z A;  4M77 D;  1VQ8 A;  5CQY A;  1B34 B;  1UGV A;  3CXC S;  3CBP A;  1OEB A;  1PSE A;  2RN8 A;  1Y0M A;  4EPC A;  1GBR A;  1VQK T;  1ZLM A;  2FPF A;  3CC7 A;  2M51 A;  1VIF A;  1WXU A;  2JMA A;  3CBM A;  4A4F A;  2XK0 A;  1R0B G;  2VKN A;  2GQV A;  3JRZ A;  5FWB A;  2AIR B;  2ECZ A;  2EJF A;  3OY9 A;  4C5I A;  3J81 E;  2EGE A;  1T3L A;  1M2O A;  1ZBX A;  1N9R A;  1XQH A;  4BI8 B;  3MKD A;  2QGF B;  3P8H A;  3C95 A;  4XK8 E;  1G2B A;  1SKU B;  3EGU A;  4C5E A;  2HQX A;  3QG1 A;  2M02 A;  1A0N B;  1BCM A;  3UT1 A;  2EYX A;  5AT1 B;  4F16 A;  1PHT A;  2P4R A;  1NLP C;  2YSQ A;  3V8K A;  2MK5 A;  3ASK A;  2JNG A;  5KYY A;  1MV3 A;  3VS4 A;  3JSC A;  1VQ7 Q;  2HDA A;  1VQN Q;  1KFZ A;  9ATC B;  2VWF A;  4XTW A;  3QZ9 B;  4FSX A;  4NS5 A;  4N4H A;  4E7I A;  3TU4 K;  2W0Z A;  3RMQ A;  2QQS A;  1R77 A;  1NZ9 A;  1WQ7 A;  4DBQ A;  1QKX A;  3M53 A;  2HNI A;  1TUD A;  2DMO A;  3HL8 A;  1UEC A;  1ZSG A;  2DNU A;  1B7T A;  3HSB A;  4HCK A;  1LCK A;  5CQX A;  1G3S A;  1JXM A;  1BU1 A;  4X34 A;  1S72 A;  1TH7 A;  2OTL Q;  2JT4 A;  2VVK A;  1NLO C;  1N27 A;  2LQ8 A;  1OPK A;  1TSF A;  2DBK A;  2KE9 A;  4KUD K;  1K9M C;  2PQW A;  2DIL A;  2CZ0 B;  5GAN 7;  3LX7 A;  1LVK A;  2R5M A;  2R57 A;  1VQP Q;  4M75 D;  3TCJ A;  2EGA A;  3VU3 C;  1VQL A;  2MOX A;  3CPW A;  1IHV A;  1W6X A;  2DIQ A;  4R0K A;  1TOV A;  2CZ1 B;  4DQ2 A;  1YN8 A;  3HRT A;  1GRI A;  1YHQ T;  1KHC A;  3RER A;  1MNE A;  4M7D G;  1SRM A;  3JAM E;  3P8B B;  2NUZ A;  4PJO B;  1D3B A;  4X9D A;  5GAN e;  2A36 A;  2FRW A;  4RCC A; 
#chains in the Genus database with same CATH homology
 1UEB A;  2RH2 A;  3M57 A;  3GNG A;  4A53 A;  3VJP A;  4Z02 A;  1YHQ A;  1M90 U;  2DZ9 A;  2ZPH B;  4QW2 A;  2RHX A;  1Y71 A;  4C92 G;  3FLG A;  2GCX A;  3L2V A;  3CCE T;  2VYT A;  3JCM b;  4PNO A;  5GAN 2;  4M7A E;  4A54 A;  4XTX A;  4RCB A;  3EAE A;  2YRV A;  3T9N A;  2VC8 A;  4EDU A;  5A2Q E;  3JCM P;  1YIT T;  1YCY A;  5M9O A;  1YJN A;  3HPW A;  3OBW A;  3VUB A;  2QQB A;  1B34 A;  2D0Q B;  4M75 C;  2ZPF B;  3LW5 E;  4GLK A;  5J3B A;  5LJ3 g;  3CMA A;  1WJQ A;  3P8D A;  3PFS A;  1I8F A;  2CGH A;  1YIJ T;  2XHC A;  1YJ9 A;  3S3M A;  4RG2 A;  3V7R A;  1Q7Y C;  1QVG A;  2L8D A;  5I2S A;  5KCO A;  5FRM A;  3RIR A;  1VQK A;  3C94 A;  4A4H A;  1K9M U;  4M78 B;  2KDS A;  3PNW C;  1WGS A;  3C12 A;  1WQW A;  2LCL A;  4J8O A;  1VQ4 A;  2RD1 A;  2KSS A;  2XIC A;  2PVO B;  3X26 B;  4JLG A;  1G3T A;  2FB7 A;  4C92 D;  2GFU A;  3QPH A;  1WJS A;  4UC4 A;  3OW2 A;  3CCR A;  3OYI A;  1UGP B;  4HCC A;  4BDZ A;  1Q81 U;  4C8Q E;  5GAM f;  3MP6 A;  3BW1 A;  4FL6 A;  4II1 A;  3V7S A;  1JBM A;  3ZFJ A;  5KH6 A;  3MHX A;  4E47 A;  2V8I A;  5CK9 A;  5HK3 A;  1JJ2 S;  3NFC A;  1YBY A;  1BIB A;  4M78 C;  3CCQ T;  1QP2 A;  4A4G A;  2RJD A;  3OYN A;  3OYK A;  4OMF B;  5LJ3 d;  3DLL A;  3VV0 A;  1QP3 A;  3ME9 A;  2QA4 T;  3ZEH A;  2LTO A;  2X4X A;  1K8A U;  2BKD N;  3EFR A;  2DD5 A;  5GAN j;  4M7D B;  1G3Y A;  4M7A B;  3QXE B;  5GAO p;  2XDD A;  4QVD A;  2G3R A;  3QYH B;  3GP8 A;  3CD6 A;  4F7U E;  2P0P A;  2A3L A;  3VUZ A;  4O6J A;  3OS2 A;  2ZZD A;  3I56 T;  4XU3 A;  2F69 A;  3Q1J A;  3M55 A;  5CAI A;  5GAM h;  4NL3 A;  3OA6 A;  3JCM Q;  1U1T A;  3CXC A;  1YI2 T;  2EKO A;  2FL7 A;  3MCA B;  1YJW T;  2XDB A;  3OYF A;  5DY9 A;  5LJ5 g;  2RK1 A;  4C5H A;  2M16 A;  4WF2 A;  1XTD A;  2KMT A;  2LRQ A;  3CPW S;  2F5K A;  5FRO A;  2QQ9 A;  4C92 A;  2ZCF B;  3EFS A;  3A8G B;  1M1K C;  3OB9 A;  3A8M B;  4PKC C;  4C8Q B;  1KG1 A;  5A0D A;  1JRI A;  3INZ A;  4HCZ A;  2K5I A;  4IUP A;  4BDY A;  2K4Y A;  1M90 C;  4BE0 A;  2DIG A;  4C92 C;  1LOJ A;  3CCL A;  4MZT A;  1N6A A;  4M78 F;  1BI3 A;  2RI5 A;  4LDY A;  3VYH B;  5CCA A;  5GMK l;  3OYB A;  1Q7Y U;  3OSS C;  3QDR B;  3NTK A;  3HFN A;  3JCM f;  4X9C A;  4YTL A;  4A4K A;  4JS5 A;  1KD1 U;  1M1F A;  3LYI A;  4IUV A;  4FM4 B;  4XTU A;  2DO3 A;  5GAN f;  1BI2 A;  2DXT A;  2RJC A;  5IAY A;  3SWN B;  4BE1 A;  4HT8 A;  4HCB A;  3JCM c;  2CYZ B;  2HAX A;  2E65 A;  5KE3 A;  1OZ2 A;  2DTI A;  2E70 A;  3PTA A;  4PL6 A;  2DVE A;  5LJ5 d;  2E6Z A;  2LDM A;  4J6W A;  4XQ3 A;  4E7K A;  3MP1 A;  4BAC A;  2EJ9 A;  3CCV T;  2DXU A;  4OB3 B;  5C6S A;  2QQA A;  2WSF E;  3OQ5 A;  3O8V A;  1UGQ B;  2X35 A;  4XU0 A;  3OS0 A;  1VQM A;  1Q86 U;  1Y07 A;  3GLX A;  1M1G A;  3PIP A;  2QDY B;  4DA4 A;  4J6X A;  1KQS S;  1NJI C;  1HK9 A;  1AHJ B;  1OZ3 A;  1NPP A;  3SB2 A;  2XG8 D;  1Q81 C;  2RM4 A;  2EJG A;  3MEA A;  3SD4 A;  2RHU A;  4HA8 A;  5KE2 A;  3JCM h;  3MP8 A;  5CKE A;  3V8L A;  3CCU T;  3LWI A;  3G71 A;  1RI0 A;  3FJP A;  5GAN h;  5FLX E;  5FU7 C;  1K73 C;  2KAF A;  3QJ6 A;  4L59 A;  4OB0 B;  1KQ1 A;  2MMP A;  1G3W A;  3OYM A;  5HKC A;  2K5F A;  1QVG S;  2PUO B;  1I81 A;  3M9Q A;  4JRK A;  2YHT A;  4LDV A;  3RUX A;  2EFI A;  4C92 F;  1K8A C;  1VQ6 T;  2XI9 A;  2DEQ A;  3V7C A;  2VGM A;  3CC2 T;  4ATO A;  3CCU A;  2RI2 A;  4C0F A;  1VIE A;  5D6W A;  4MZM A;  5DLO A;  2HBP A;  1MGQ A;  2DAQ A;  2VXF A;  2YLC A;  2E10 A;  1LJO A;  2K3X A;  4M7A G;  4XTZ A;  5CKB A;  3UDC A;  3MO8 A;  3JCM e;  3MEU A;  4OVA A;  3ER0 A;  5CVI A;  3SFM A;  1N8R C;  3JCM X;  4J6Y A;  5I2M A;  4QVZ A;  1VQ6 A;  1W4S A;  5IN1 A;  3G4S T;  1FWZ A;  2PUK B;  4C5G A;  4XAX B;  3J80 E;  1M1K U;  4TVR A;  2EQM A;  2P0Q A;  2K5L A;  3LGF A;  2DTO A;  3VKI A;  3H6Z A;  5C0M A;  4PJO A;  3HRU A;  5DLQ E;  2FYK A;  4M75 A;  4A4E A;  2RO0 A;  1OYX A;  3OSV A;  2XU8 A;  1VQ8 T;  2E1H A;  3CME A;  5LL6 S;  1KHI A;  4PJO C;  1VQO T;  2X4Y A;  3G4S A;  1KQ2 A;  4JJN K;  3MEV A;  4N4G A;  4OF1 A;  4PLI A;  2CZ7 B;  3F70 A;  4M77 E;  4ZGJ B;  4OB1 B;  4M7A D;  4MZP A;  4C8Q G;  4BI3 A;  4Y28 E;  4CRI A;  2LX9 A;  2FVU A;  5A0L A;  3CCE A;  4PLL A;  3CC7 T;  1KD1 C;  1R8O B;  1YIT A;  1NPR A;  3HKS A;  1BYM A;  1N9S A;  3H8Z A;  2JOY A;  2E64 A;  2ZPB B;  3A5Z B;  4FU6 A;  5GMK m;  4ZGE B;  2DZC A;  4IKF A;  1VQP T;  5HY6 A;  4RMO A;  1KC8 C;  2O4X B;  2WSC E;  2CKK A;  2L5Q A;  4FIB A;  4O5V A;  3ZBD A;  4ZTF A;  4OGC A;  1YIJ A;  2ZGW A;  4E7H A;  1JB0 E;  2XKO C;  3JB9 J;  4HKE A;  3JB9 G;  4EMK B;  3OYG A;  1W2B A;  1NJI U;  2DTH A;  3OYL A;  1XNI A;  4M78 A;  3E9F A;  2BIV A;  3URG A;  4BD3 A;  1FX7 A;  4F7U G;  1Q86 C;  4LDX A;  4KUI A;  5J26 A;  3RMS A;  3CCM T;  2JZ2 A;  3M54 A;  5GAN 8;  4V2S A;  2PVG B;  2V8J A;  3KBG A;  4J5Y A;  4C8Q D;  3PMI A;  2MI6 A;  5AYF A;  5GAN 6;  4ZTJ A;  5LJ3 h;  1U1S A;  4ELY C;  2WAC A;  5CIU A;  2DPP B;  1V29 B;  2OTJ T;  4JRI A;  4N0A A;  4EMK C;  2KVQ G;  3VYG A;  4BY6 B;  1XOV A;  2F5T X;  4PJO F;  3A8L B;  1Y96 B;  2OAU A;  5GAM g;  4BE2 A;  3CCQ A;  4M75 F;  2K57 A;  3LLR A;  4ELZ C;  3FB9 A;  4N0A C;  4M77 B;  4BUG A;  3M59 A;  3JB9 D;  3JCM W;  2QA4 A;  2MWO A;  1ZHI A;  4C0D B;  1N8R U;  4M7A A;  4M7D A;  2H3J A;  4KBM B;  5LJ3 e;  4M7D C;  2Y90 A;  4M7A C;  4BY6 C;  4E7L A;  2QXF A;  3SDZ A;  4GY5 A;  4XTV A;  1U8R A;  3BDU A;  2CS7 A;  3CCJ T;  1OI1 A;  4OGE A;  3I56 A;  3JCM J;  2LQK A;  2ZPG B;  4J83 A;  4EMH A;  3QII A;  3J7A F;  4RCC A;  3X20 B;  3CC4 T;  3OYE A;  4ZN3 A;  1YI2 A;  3X28 B;  1YJW A;  1BKB A;  2QQR A;  3JCM V;  5CO7 A;  1VQ5 T;  4D6W A;  2EQJ A;  5GAM d;  2X4J A;  2P0K A;  1X75 C;  1FXX A;  2GFA A;  3PGG A;  4C8Q A;  3WVD B;  3R6O A;  3WXM B;  2MAM A;  2IVW A;  3L2R A;  3CC4 A;  1H64 1;  1X6O A;  1BI0 A;  1I4K 1;  4C8Q C;  4XTY A;  3RES A;  4DOW A;  1K73 U;  3FDR A;  1KC8 U;  4P5N A;  3N5B B;  3QKJ A;  4F7U B;  1S72 T;  2O01 E;  2B8A A;  3FIF A;  1Y7X A;  2QEX T;  2C06 A;  4QQG A;  2Y4X A;  3M56 A;  3SWN A;  4VUB A;  1UGR B;  2E6N A;  4JLI A;  3JCM g;  3GNF B;  2LVM A;  3L2Z A;  4JDS A;  2XID A;  4M7D F;  3S6W A;  4KUL A;  3SWN C;  4M7A F;  5GAN g;  3MET A;  4XU2 A;  2I2L A;  4IUQ A;  2DXC A;  5GAN 4;  3GPL A;  4ZN1 A;  3PMT A;  1QW1 A;  4MDX A;  2L89 A;  3E19 A;  2D6F A;  3UWN A;  3CCV A;  2RB6 A;  5L8R E;  4PJO E;  1VQL T;  2LC4 A;  5LJ3 j;  5GMK h;  2RI3 A;  4M75 E;  2RHY A;  5LJ5 e;  4JRQ A;  4QQD A;  2GF7 A;  2IG0 A;  2YLB A;  3V8J A;  1Q82 C;  4E7J A;  1BIA A;  3OMG A;  1SSF A;  2FHD A;  4MMK A;  3RKX A;  3RKW A;  2Y4Y A;  3L2Q A;  3DKM A;  3HFO A;  1PSF A;  2EWN A;  3E9G A;  4JS4 A;  1UB4 A;  3L2U A;  1VQ7 A;  2KQW A;  4KT0 E;  4C8Q F;  3JCM d;  4R55 A;  3OW2 S;  1VQN A;  3OYD A;  3G6E T;  5GAN d;  4OB2 B;  4M77 G;  5GMK e;  4M7D D;  3CC2 A;  3L42 A;  2QI2 A;  2A7Y A;  1VUB A;  3M58 A;  4MML A;  4B9X A;  5GAO q;  4HT9 A;  3C4S A;  2JTM A;  1VQ7 T;  4B9W A;  3HRS A;  3BDL A;  2M9U A;  4M78 E;  2EIF A;  5CKF A;  2NLU A;  3JB9 I;  1M5Q 1;  1D3B B;  3JB9 F;  4XU1 A;  1I5L A;  4FT2 A;  3G6E A;  1G5V A;  4ME7 A;  2R5A A;  2RJE A;  4QQ6 A;  4IUT A;  3CCS T;  2OTL T;  2XD0 A;  2PU9 B;  3GIB A;  3BY7 A;  4LD9 K;  3QSU A;  3KUF A;  5FU6 B;  1DJ7 B;  4RKU E;  5D6X A;  5LJ3 f;  1QVF A;  3TEE A;  5GAN 5;  1YJN T;  2RHZ A;  1M4Z A;  5DM7 R;  2E12 A;  2RA2 A;  3CMA T;  4M77 D;  2K3Y A;  1VQ8 A;  5CQY A;  1QVP A;  1YJ9 T;  1VQO A;  1B34 B;  3CCS A;  2OTL A;  3CXC S;  3CBP A;  1KQS A;  1PSE A;  2LT1 A;  2RK2 A;  4EPC A;  4BI4 A;  4IUU A;  2DD4 A;  4M7D E;  3QO3 A;  4BB7 A;  5LJ5 j;  1VQK T;  4L6V 5;  1M8V A;  2K2V A;  3A8H B;  5FU6 C;  4Y91 A;  4JRP A;  2RHI A;  3LWH A;  3CC7 A;  3QYG B;  4N4I A;  5GAO l;  2E5Q A;  3WVE B;  1VQ4 T;  2HQE A;  2LCC A;  5CKH A;  3S3O A;  1VIF A;  2O4X A;  3BFM A;  4Q5W A;  3OS5 A;  4IUR A;  2V8K A;  3CBM A;  4A4F A;  3CPF A;  1VQP A;  2WSE E;  2XK0 A;  3CCR T;  4NL2 A;  4EMK A;  2JUF A;  2DKG A;  1O9S A;  2GQV A;  2JTF A;  3JRZ A;  4OP0 A;  4C92 E;  3HP9 A;  5FRN A;  2EJF A;  3OY9 A;  4C5I A;  1Q82 U;  5D6Y A;  3J81 E;  1ZBX A;  5GMK j;  4C0G A;  1N9R A;  1XQH A;  3G7Z A;  3M4G A;  4BI8 B;  3CCM A;  4MDW A;  3L2W A;  4R56 A;  1M9S A;  1ZQ1 A;  3L1A A;  4L5G A;  2LNV A;  4J7I A;  3GOX A;  3OYY A;  2DK3 A;  2KY9 A;  3P8H A;  3C95 A;  2MWP A;  4XK8 E;  3X25 B;  3FRN A;  3OMC A;  3A8O B;  2EQU A;  2OTJ A;  3DB4 A;  4DOV A;  5GAO r;  1Y96 A;  4C5E A;  3CD6 T;  2HQX A;  3QG1 A;  3HHT B;  4EMG A;  3UT1 A;  5GAN 3;  4M77 A;  3TRE A;  3M5A A;  3QUI A;  4FT4 A;  3S3N A;  2D9T A;  3OBY A;  3V8K A;  4J7F A;  5LJ5 f;  4M77 C;  4JUV A;  2X4W A;  5GAO n;  3ASK A;  2JNG A;  1O75 A;  4C0D C;  3E1S A;  5CR2 A;  2R58 A;  3JSC A;  3OS1 A;  3OYA A;  2VGN A;  4XTW A;  2EYQ A;  3QZ9 B;  4FSX A;  4NS5 A;  2L3R A;  2MF2 A;  3CCJ A;  3QJY A;  4C92 B;  4N4H A;  3MEW A;  4E7I A;  3TU4 K;  1WJR A;  3QBY A;  3CCL T;  3RMQ A;  2QQS A;  2VUB A;  4LDW A;  1P92 A;  1NZ9 A;  1WQ7 A;  3OYC A;  3GF5 A;  1VQ5 A;  3M53 A;  2HNI A;  3HL8 A;  5GMK i;  5LJ5 h;  3PT9 A;  4PJO G;  2QTX A;  2ZPE B;  1JJ2 A;  2M1H A;  4M75 G;  1MHN A;  3HSB A;  3NTH A;  2VXE A;  3QHS A;  5GAM e;  1LNX A;  3AHU A;  5CQX A;  4F7U A;  1WPY A;  1G3S A;  2DXB A;  3KXT A;  2ZPI B;  4X34 A;  2EQK A;  4ZGD B;  1S72 A;  1TH7 A;  1VQM T;  5I21 A;  2LT4 A;  2QEX A;  3X24 B;  4M77 F;  3RKY A;  3NTI A;  1N27 A;  5J39 A;  1EIF A;  2LQ8 A;  2XDP A;  5GAO m;  3DLM A;  1IRE B;  2E41 A;  1VQN T;  1RL2 A;  1QVF S;  4KUD K;  1K9M C;  3CEY A;  5FU7 B;  4RG8 A;  2PQW A;  3G71 T;  2CZ0 B;  5GAN 7;  1IZ6 A;  3LX7 A;  4PJO D;  4LD6 A;  5EG2 A;  2R5M A;  2R57 A;  3OYJ A;  4M75 D;  3TCJ A;  4M78 G;  2KK4 A;  4QVC A;  5IT9 E;  3VU3 C;  1H3Z A;  1VQL A;  2P4T A;  2M0O A;  5KCH A;  3CPW A;  1GXI E;  1W2B S;  3M4Y A;  5A0G A;  1WNL A;  2DIQ A;  4C0Z A;  1UGS B;  1X01 A;  2HD0 A;  3JB9 H;  2CZ1 B;  3FEO A;  4DQ2 A;  2AHJ B;  3LGL A;  2RJF A;  1HXD A;  3PIO A;  3I55 T;  1VQ9 T;  3CBO A;  3QZ5 B;  3DB3 A;  3HRT A;  4CI0 C;  5HK0 A;  3FC3 A;  1YHQ T;  1KHC A;  4LDU A;  2CZ6 B;  2EAY A;  3RER A;  2JVV A;  2VV5 A;  4M7D G;  3JAM E;  4F7U F;  2BUD A;  4M78 D;  3OYH A;  3P8B B;  3LH0 A;  4NOY A;  5GAM j;  4PJO B;  1D3B A;  4X9D A;  5GAN e;  3I55 A;  2PVD B;  2JN0 A;  1VQ9 A;  5CKD A;  3CME T;  4M75 B;  3UPU A;  1BI1 A;  1NE8 A;  2DJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...