1J3TA

Solution structure of the second sh3 domain of human intersectin 2 (kiaa1256)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
b'GSSGSSGVENLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intersectin 2
publication title Solution structure of the second SH3 domain of human intersectin 2 (KIAA1256)
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2003-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1j3tA00
2X3XD 2K7AA 2AZVA 1H92A 3VS7A 1AWOA 1AD5A 2LJ1A 1AWJA 5HCKA 2JM8A 2ENMA 1GCQA 2A36A 1GCQC 2JM9A 2RNAA 1PNJA 1UG1A 1HD3A 1UTIA 2NWMA 1X6GA 3NMZC 4WCIA 4J9GA 2CT3A 1UGVA 3ZL7C 2LQWA 5IHIA 4RUGA 1K0XA 1AZGB 2P4RA 2XMFA 2CREA 1YNZA 2RN8A 4J9CA 3UA6A 4RTWA 2O9SA 2K9GA 1B3QA 4AG1C 1XOVA 3LH5A 4HVUA 1K76A 2KRSA 4JZ3A 4M4ZA 2GBQA 3VS6A 1QCFA 2IIMA 1WIEA 2KXCA 1B07A 2D0NA 1SHFA 3C0CA 4E6RA 4ORZA 1Z9QA 4LUEA 2LP5A 2RQWA 2NUZA 2HEQA 2PTKA 1OPLA 1TUDA 1SHGA 2L0AA 2KRNA 5GJWB 4RTZA 2K79A 2RMOA 1GBRA 2FRWA 3QWYA 2LCSA 1UHFA 2CSIA 2DX1A 4D8DA 3REBB 1NLPC 2KE9A 1WA7A 3NHNA 1AOJA 1YP5A 1NYGA 1QLYA 3QWXX 1GCPA 1JU5C 2FEIA 2J6OA 4ESRA 2VKNA 1I1JA 1T3SA 1GFCA 1KIKA 4D8KA 2RQVA 1VYVA 1KSWA 3NPFA 1CSKA 2JT4A 4J9FA 4QT7A 2DL4A 5GJVB 4CC7A 4DEYA 1W70A 3EHQA 2HSPA 4OMQA 1X2KA 1M27C 4GBQA 2RPNA 2FO0A 2J06A 2KXDA 1BK2A 1G83A 1AWWA 3EG2A 1H8KA 1M3BA 4F14A 3A98A 5FW9A 2RQTA 1SRMA 2JXBA 4J9EA 5I11A 1X69A 3O5ZA 3RNJA 2A28A 3RBBB 5FWBA 1NYFA 4Z8AA 1SSHA 3VS5A 1S1NA 1QWFA 2EYXA 2EYYA 4J9IA 1PKSA 1VYUA 2EGAA 4HXJA 2MCNA 1E7OA 3NGPA 1U06A 3THKA 1UECA 1SRLA 1YWOA 2CT4A 1Y0MA 2J6KA 3PVQA 5EC7A 3R6NA 4OMNA 2M51A 2W0ZA 2GTOA 2M0YA 2GGRA 3VS0A 1VA7A 3PVLA 2EVRA 5IXFA 1SPKA 4RTVA 1X2QA 3TSWA 2CUBA 1RLQC 1MUZA 3CQTA 2DM1A 4K11A 2DNUA 2FRYA 1UJYA 2B86A 2EKHA 4RTXA 1PRLC 1UHCA 2A37A 2KYBA 2K3BA 2CUDA 2O31A 2GTJA 3I5RA 2HCKA 2DF6A 4RTTA 5I22A 5IHNA 2PNIA 1NEGA 1ABOA 1OEBA 1NG2A 3M0PA 1WXBA 1WDXA 2HDAA 2FPFA 1FYNA 3JV3A 1TUCA 2KT8A 2D8HA 1ZBJA 1I0CA 2EYWA 1EFNA 2FG0A 1IO6A 2KEAA 1QWEA 2O9VA 1WYXA 1CKAA 2V1RA 2DYBA 2A08A 4F16A 1K0SA 4CC3A 1ZX6A 4OMMA 2KR3A 3EG1A 2RQUA 3VS4A 4J9HA 5ECAA 1YN8A 1HJDA 4Z89A 4OMOA 2H8HA 3M0QA 1JXOA 3IQLA 2YUQA 3VRZA 2SEMA 2LMJA 1OOTA 2LJ0A 2ESWA 1ZSGA 4J9BA 1ARKA 2DJQA 1OV3A 4AFZC 2AK5A 1AEYA 2DILA 2O88A 2KROA 2LJ3A 2FPEA 4AG2C 1VYTA 1JO8A 2VVKA 3VS1A 2JMAA 2G6FX 3H0FA 1AVZC 2DVJA 1LCKA 1U5SA 3UF4A 2ECZA 3H0IA 3GBQA 3SHWA 2BZXA 1X27A 1YCSB 2YDLA 4JPBW 1GFDA 3H0HA 3U23A 2LQNA 1PRMC 1M3CA 4JJDA 3I35A 1WXUA 2L3SA 4OMLA 1WX6A 2O2OA 4RTYA 1UUEA 1I07A 2CSQA 2L3QA 3EG0A 1KFZA 1CKBA 2F2XA 2GNCA 2L2PA 1ZUYA 1WLPB 1X43A 1M30A 2ED1A 3M0UA 1GL5A 4HVWA 1N5ZA 1M3AA 1AWXA 1NEBA 2J7IA 1M8MA 2ABLA 4AFSC 1GRIA 5IHKA 2K2MA 2YUOA 3M0SA 1W6XA 2LNHB 1UFFA 1UE9A 4A63B 2DL8A 2X3WD 4Z88A 3VRYA 2EYZA 4DEXA 2CH4W 3FJ5A 2J05A 2HBWA 2DMOA 1X6BA 1ABQA 4OMPA 1G2BA 1K9AA 1T3LA 2EQIA 2EGEA 2KYMA 1A0NB 1WI7A 1W1FA 1ZUUA 2DBKA 2V1QA 2DBMA 2KGTA 2CH4A 1SEMA 2J6FA 1WFWA 2KT1A 4LNPA 3TSZA 2ROLA 3EHRA 1UJ0A 1K4US 2JTEA 1T0JA 2JS2A 2DLPA 2MOXA 1T0HA 3VS3A 1GBQA 1MV0B 2SRCA 2OJ2A 3M0RA 2JW4A 1AZEA 4JJBA 1WXTA 1KJWA 4Y92A 5FWCA 1TG0A 2PZ1A 2MIOA 4LUDA 2AZSA 2OI3A 1BU1A 1RUWA 3TVTA 1Z9ZA 2EPDA 2C0IA 3I9QA 5IXBA 4R0KA 1PKTA 4RTUA 1QKXA 1QKWA 1ZLMA 1ZUKA 1BBZA 2FPDA 1PHTA 2OAWA 2I0NA 4LN2A 4AFUC 2EGCA 1U3OA 4HVVA 2EBPA 2DL7A 1J3TA 2JMCA 2ED0A 2DRMA 4EIKA 1UDLA 1E6GA 5IH2A 4KRTA 3M0TA 2DRKA 2LX7A 2BTTA 4CC4B 4AFQC 1JXMA 1MV3A 2KBTA 2DE0X 1K1ZA 1NLOC 2E5KA 3I5SA 3EG3A 4J9DA 1OPKA 1RLPC 2DA9A 2F2WA 2F2VA 1V1CA 3UA7A 3SEMA 4IIOA 2W10A 4IIMA 2AKKA 2C0TA 3KFVA 1E6HA 1RI9A 2YUNA 2YSQA 1YWPA 2CDTA 2ROTA 4JZ4A 1PWTA 3VS2A 4HCKA 1JQQA 4X1VA 2L3PA 3PE0A 2C0OA 2JS0A 2AKLA 2K6DA 3ULRB 1H3HA 4ZNXA 1BB9A 2DL3A 2KNBB 1HSQA 2YT6A 1NM7A 2RF0A 2QDLA 2GQIA 2VWFA 2D1XA 2EW3A 4F17A 3H41A 1FMKA 2YUPA 4FSSA 4JJCA 2KRMA 1Y57A 2BZYA 3REAB 4LE9A 2D8JA 1JEGA 3UATA 2DL5A 3EGUA 4GLMA 2RQRA 2LZ6B 2BZ8A 4CC2A 5L23A
chains in the Genus database with same CATH superfamily
3S6WA 4ME7A 3CCVQ 1AD5A 2LJ1A 2DXBA 2XIDA 3M59A 2A36A 2JM9A 1VQNT 3VKIA 3G71T 4XU3A 3CCMQ 1UEBA 2AIRB 3OSSC 2E1HA 2F5KA 2H3JA 4J9GA 4RUGA 2P4RA 4M77B 2DZ9A 4J6XA 2X51A 2XMFA 4C92F 1AHJB 3UA6A 1W2BP 1KD1R 1TH7A 2PU9B 1LPLA 4AG1C 1XOVA 3LH5A 4JZ3A 1PSFA 3BDLA 5KYXB 2GBQA 3LYIA 5I2SA 1VQ8T 2DETA 1W2BS 4KT0E 2RK1A 1SHFA 3C0CA 4E6RA 3JCMh 3EFRA 3DLLA 2PTKA 1OPLA 5FU6C 1SHGA 2KRNA 3CMAA 1VQ5Q 2YRVA 5CQYA 1GBRA 2GQVA 3P8BB 1M8VA 1M90C 3QWYA 1D0ZA 3E1SA 2NUPA 3D7SB 2KE9A 2JVVA 1MMNA 4FYYB 1UGQB 2J6OA 3LWHA 1YJNQ 1N27A 4P5NA 3QZ9B 1BCOA 1GFCA 3URGA 4D8KA 3V8KA 2C06A 1HYOA 1KSWA 1YITA 4OP0A 4M7DD 1B7TA 3V8LA 2QQRA 4F04B 5GJVB 2JTFA 3I55Q 1W70A 3EHQA 3HRSA 4PLLA 2HSPA 4OMQA 1BI1A 3MEWA 4BDYA 4XU1A 3JB9J 4FU6A 1G83A 1KQSS 3OS1A 3TCJA 1D1CA 2E3HA 1M3BA 5LJ5j 3O5ZA 4A53A 2A28A 3RBBB 4MZPA 1V29B 5FWBA 2QG9B 3VS5A 4C92D 4E7SA 1QWFA 2DVEA 2EYYA 5C0MA 3NGPA 1K8AR 1SRLA 3CCST 2PQWA 2BKDN 2IG0A 3M56A 4OMNA 2I2LA 2M0YA 3VS0A 2LVMA 2R57A 2QASA 3PIOA 3CC2T 3VV0A 2EVRA 1G3SA 3QIIA 1MUZA 4Y28E 5GAN6 3RKXA 3EG9A 4K11A 4E7KA 2DNUA 2RD1A 3M58A 5LL6S 2CZ0B 1YI2A 2A37A 4ELYC 4PJNA 4X34A 4HCZA 3I5RA 2HCKA 2DF6A 4RTTA 4C8QA 3RKYA 4C8QC 1R0BG 5HY6A 2Z0WA 4OMFB 3UWNA 4JS5A 4M77G 1WXBA 1WDXA 2RI5A 4GLKA 1TUCA 1YHQQ 2KT8A 5FU6B 3V7CA 2EYWA 2FG0A 4MMLA 4EMGA 3PTAA 1NE8A 3CBOA 5IT9E 4XQ3A 2DYBA 3DB3A 1LOJA 2VUBA 1R8OB 1IGQA 3VS4A 1QVGA 1WJQA 1HJDA 5LJ3h 3L2RA 4HCBA 1OOTA 5LJ3j 4PFZA 1ARKA 2CP3A 2DJQA 1OV3A 6AT1B 3ZFJA 2WSEE 2O88A 3CD6A 3QZ5B 2FPEA 3CCUA 1JB0E 4NL3A 1VYTA 2LT4A 2HAXA 3VS1A 2L3RA 2K3XA 1U5SA 3GF5A 3UF4A 4N4GA 5HK0A 3H0IA 4IUTA 5I21A 1YJWT 3CD6Q 4JPBW 3CCUQ 4RG8A 2LQNA 2E6NA 2L3SA 3PFSA 4XTYA 5GMKj 3M55A 3BE3A 5GAMe 5CR2A 4XK8E 2QEXA 1OX9A 5GAOp 1D1AA 1CKBA 4J6WA 5CKFA 1UGPB 4J7FA 1ZUYA 1X43A 1M30A 1I5OB 1UGSB 2ED1A 4NS5A 2DEQA 1N5ZA 2QEXQ 2J7IA 3RR6A 2HBPA 4M7AA 3C4SA 4M7AC 3E9GA 5HKCA 2FYKA 2MWPA 1D09B 2MPXC 3OYYA 2E10A 1W6XA 3CPWP 1OZ3A 2XU8A 4Z02A 1NJIR 2EYZA 3M5AA 3M4YA 4AMCA 2CH4W 4PJOD 3FJ5A 2HBWA 4IUVA 3OYNA 1ZQ1A 2YHTA 3HFNA 4M78F 1ZUUA 5J3BA 2DBKA 3VUBA 2KGTA 4M7DA 4M7DC 4OB3B 2CH4A 4KH1B 1VQ6A 2Y4XA 2DIQA 4LNPA 4HA8A 3TSZA 2O4XA 1MGQA 1WHLA 1T0JA 4M75F 1TWBA 1M9SA 1VQ6Q 2IVWA 1T0HA 3OSVA 3VS3A 2MMPA 2XDBA 3VYGA 2GCXA 3MEUA 1KJWA 2YRCA 5FWCA 1Q82R 3CCQA 2JNGA 2PUKB 3QYGB 2EPDA 2ZGWA 4J6YA 4M77E 3GP8A 1ZLMA 2FPDA 3CCQQ 4EMKB 1QVGS 4LD6A 2CGHA 1J3TA 1K73C 5GAN2 1O75A 1K73U 1C6VX 1WGSA 2OTJT 2RJFA 3CCJA 4NL2A 3MO8A 2DRKA 3LGLA 4CC4B 1BYMA 1VQMT 4AFQC 3QPHA 1MV3A 2KBTA 2MAMA 1VQOT 1JJ2S 5GAMd 1IHVA 1Y7XA 3CCJQ 2F2WA 2F2VA 3TU4K 2W10A 5GAN5 4IIMA 2CP0A 4EDUA 4F7UB 2CDTA 1OI1A 4X1VA 3PE0A 2C0OA 4HT9A 1BI3A 2JS0A 1VQ9A 2K6DA 3JCMc 1YBYA 2RF0A 4BD3A 5LJ5e 4M75D 1QVFA 2QA4A 2D1XA 2EAYA 1VQPA 3CC7A 3REAB 1JEGA 1WHJA 1D0YA 3PNWC 2X4YA 2K2VA 4GLMA 3OS5A 2QA4Q 4ZGEB 1M4ZA 2BZ8A 1G3YA 2X3XD 3HRTA 1VQPQ 4OF1A 2E64A 3X20B 2HMAA 3VS7A 4DBRA 4XTZA 2JM8A 1GCQA 1GCQC 2O4XB 2VASA 3HHTB 1O9SA 1ACMB 3G4SA 4C0DB 1I81A 2F1LA 3NMZC 1BCMA 2MF2A 3OYEA 3CCRQ 1Q86R 1IB8A 5KYYB 5KCOA 4E47A 1UGVA 3ZL7C 5IHIA 2M0OA 1G8XA 3H8ZA 1AZGB 1TTHB 1N9RA 1OX8A 1BIBA 3G4SQ 5GANj 4ANJA 3L1AA 4Q5WA 3EFOB 2CZ1B 4E2FB 2CREA 4CI0C 5CQXA 1B3QA 4R55A 4C92B 4QQDA 4DOVA 4BB7A 3VS6A 2IIMA 3C95A 2HNIA 3CBMA 1WIEA 2KXCA 2D0NA 2DXUA 1BKBA 3JB9G 1KC8C 5KYXA 2DYIA 2LP5A 3PT9A 1KC8U 2EKOA 3CCEQ 2L0AA 3TEEA 4DBHA 2EYQA 1M1GA 2XK0A 2RMOA 3CMAT 3M57A 3QXEB 2M1HA 1KQ2A 2DX1A 2XKOC 3REBB 4JS4A 3OW2P 1WA7A 1AOJA 1NYGA 1QLYA 1QMCA 1R77A 2EJ9A 2ZPBB 1Y07A 2FEIA 4IURA 2LC4A 4ESRA 4PJOC 5LJ3e 4KGXB 1T3SA 2COZA 1VYVA 2JT4A 4QT7A 1RAIB 5GAMh 4CC7A 4DEYA 1YITT 2E5QA 2EQJA 1SKUB 1X2KA 5KE3A 3EFSA 3QJ6A 4GBQA 5LJ5d 2FO0A 2L8DA 2J06A 4DOWA 2COYA 1AWWA 2EQKA 4X9CA 1RACB 3L2ZA 4F7UG 2RQTA 4J9EA 5I11A 1KQ1A 2JN0A 3RNJA 5GMKe 2PVDB 4XU2A 1S72Q 3DB4A 1OULA 4M7AG 1QVFS 4WF2A 4QVZA 3G6EA 4J9IA 1PKSA 4GY5A 4HXJA 1E7OA 2OX7A 1BI0A 3VUZA 1U06A 3THKA 3EGDB 2CT4A 4O6JA 3SDZA 3PVQA 3CCMA 2CZ6B 3R6NA 4JRIA 3G6EQ 4FM4B 1VQKA 2AT1B 5IXFA 1M1KR 3J7AF 2FB7A 5FRMA 2YRDA 3CQTA 1AT1B 1FWZA 4M7DG 3PGGA 3RDVA 2B86A 1VQKQ 2EKHA 2KMTA 5CK9A 5CKEA 1YI2T 3JB9H 4DA4A 1XNIA 5DLQE 4EMHA 4N4HA 5I22A 1NEGA 2FZKB 4JRKA 3UPUA 1NG2A 3M0PA 1VQ5A 5D6YA 5IN1A 4C8QE 5M9OA 2XI9A 3V8JA 2WACA 5GAOr 3CBPA 1QWEA 2O9VA 2XHCA 5FU7C 4C92G 4B6MA 1CKAA 2A08A 4F16A 3QHSA 1XQHA 1NPRA 4CC3A 4OMMA 3CMEQ 1OYXA 2KR3A 1YJNA 5LJ3d 3A8LB 2QQAA 2RQUA 3MKDA 5ECAA 4PJOB 4ZGJB 2H8HA 2YUQA 5GAOl 3JCMf 3I55A 2HL3A 1Q7YC 1ZSGA 3QKJA 1Q7YU 1PD1A 1AEYA 2DILA 3FRNA 1VQ4A 2LCCA 3CC4Q 3OYGA 4PJLA 2DXCA 2CYZB 1JO8A 1C1AA 2ZPIB 3CD6T 2PUOB 3H0FA 1QCNA 3CCUT 1LCKA 3GBQA 1VQ4Q 3X26B 4RMOA 2YDLA 2ZCFB 1N8RR 1GFDA 3U23A 5LJ5h 4JJDA 5I2MA 5DLOA 3I35A 1WXUA 1WX6A 1WJSA 1WPYA 3KUFA 2F2XA 2L89A 2QEXT 1MMGA 3JCMJ 3NTKA 1Q81R 2L2PA 5HK3A 1WLPB 2EJGA 4FSXA 3JRZA 1LVKA 3I56T 2PVOB 5IHKA 3SB2A 3DLMA 2HKQB 1UE9A 4A63B 2DL8A 3CPWA 2X3WD 3JB9I 3LWIA 1W4SA 4Z88A 4M7AE 3JCMg 4DEXA 3QUIA 2DD5A 2RHZA 2X9HA 3M4GA 5J39A 2QK0A 3CCLQ 1X6BA 1VIEA 4LDXA 4OMPA 2QDYB 1ZA1B 1K9AA 2ZAEA 3EH2A 1WI7A 1H3ZA 1YHQA 2GFUA 3J80E 2V1QA 2YLCA 4QQ6A 3A1PA 3SWNB 5FROA 4M78B 5C6SA 4M77F 2ROLA 3JSCA 5A0GA 3G71Q 4XTUA 3C12A 1UJ0A 3GNFB 1G3WA 5FU7B 3INZA 4M7DE 2DLPA 5GAOn 5GANe 3Q1JA 1MV0B 3M0RA 5GMKl 4M75B 4QKUA 4OVAA 4JLGA 1AZEA 4Y92A 1TG0A 1OQKA 2COWA 5CIUA 1BU1A 2KSSA 3P8HA 2ZPFB 3F70A 4IUPA 4R0KA 2KK4A 1PKTA 3JCMW 1QKWA 1M90R 1ZUKA 4KGVB 1PHTA 2OAWA 2I0NA 1VQ8Q 4FW1A 5CAIA 4LN2A 4AFUC 2NYSA 2DL7A 3VU3C 3G1JA 3NTIA 4CRIA 1QQJA 4EMKA 4EMKC 2ED0A 4PJOG 3RIRA 2RI2A 1B34B 2DRMA 1ZSZC 4N0AA 4N0AC 4JLIA 4MZMA 5IH2A 1E6GA 3OQ5A 1R0CB 2LTOA 4KRTA 1KG1A 3PIPA 1P92A 2FHDA 3L2UA 2DO3A 5LJ3f 3CCJT 1JXMA 2X4WA 2DE0X 1PC0A 3JCMQ 4A4FA 2P0KA 2DTHA 3EG3A 4C5EA 4PFPA 1JRIA 2XICA 1OPKA 1RLPC 2DKGA 3N5BB 2K5LA 5GMKh 4IIOA 3KFVA 1RI9A 2NLUA 2YUNA 5D7UA 1YWPA 3RERA 2ROTA 1K9MC 4JZ4A 2V8IA 2HZYA 3VS2A 1K9MU 3ZBDA 2LX9A 4F7UA 3RESA 4E7JA 4OB2B 1QW1A 3ULRB 1H3HA 3M9QA 1BB9A 2DL3A 2KNBB 5CKHA 1VQ9T 1NM7A 2QDLA 4J83A 2GQIA 1BIAA 3GNGA 2QQBA 2VWFA 4OGCA 2DTOA 2EW3A 1FMKA 2YUPA 4PK4A 3BY7A 4JJCA 1X6OA 1Y57A 1RADB 4LE9A 1VQPT 2DL5A 3CC7T 1H641 3EGUA 3UT1A 3CPWS 2LZ6B 2MK5A 4QW2A 1PSEA 4FYXB 1H92A 3H6ZA 4C5HA 4FCYA 3CCSQ 5HCKA 2CZ7B 2RNAA 1PNJA 4B9XA 2NWMA 1HD3A 2K5FA 5GANd 3RUXA 3X25B 4WCIA 4AT1B 2R5MA 2JUFA 4C0DC 1WHGA 2LQWA 1K0XA 2RHUA 5KYYA 2LNVA 3QYHB 1YNZA 2QI2A 4J9CA 2EIFA 2ATCB 4RTWA 2O9SA 3ER0A 4OB1B 1D1BA 2K9GA 2X4JA 4C5GA 4HVUA 3EFOA 2KRSA 4NOYA 4PKCC 4M4ZA 3NTHA 3OBWA 1QCFA 3TQ7P 4DQ2A 2QYZA 3FIFA 1B07A 4C92A 4C92C 2FZGB 4ORZA 4LUEA 2RQWA 1YIJA 1G5VA 2NUZA 1TS9A 2ZPHB 2P4TA 4RCCA 2L5QA 1ZSZB 4PL6A 5KE2A 7AT1B 5KYWB 3JCMP 2LCSA 1YIJQ 1UHFA 3HL8A 2QGGA 4D8DA 3FDRA 2QQSA 1VIFA 3OYHA 3NHNA 1YP5A 3QWXX 2FZCB 3OW2A 1GCPA 2RI3A 4BE1A 2XDPA 1PM3A 1IRXA 3V7RA 2MYSA 5A2QE 1I1JA 2P0QA 1KIKA 3WXMB 5D6WA 4MMKA 1CSKA 3KBGA 2DL4A 3CXCP 3VJPA 4PJOE 1YFNA 1KK7A 1EZZB 5CKDA 2YLBA 1VOMA 4M78D 8ATCB 9ATCB 1BK2A 2DPPB 4JJNK 3QJYA 1VQ7A 2V8JA 3A98A 3T9NA 5FW9A 2PVGB 1YJWQ 1SRMA 1YCYA 2HSEB 5DY9A 2HQHA 4KUDK 4FT2A 3CPFA 1WHKA 1KHCA 3JAME 4Z8AA 1SSHA 1VQ7Q 1I4K1 3RKWA 1S1NA 2EGAA 1N9SA 2MCNA 2QGFB 3G6ET 1UECA 3CCVT 1Y0MA 2J6KA 5KYUB 2G3RA 2W0ZA 3EGDA 4A4GA 3CCRA 2GGRA 3CCMT 2RHYA 1VA7A 2M02A 2QTVA 2CUBA 3WVEB 1MHNA 2RM4A 2DM1A 1TSFA 4J7IA 4A4HA 4C8QF 1VUBA 5GANh 1UJYA 1MMDA 2EJFA 3A5ZB 4RTXA 1IREB 1PRLC 4XTXA 3MP1A 2KYBA 1M2OA 3MEAA 1Q95G 2K3BA 5FLXE 1ZHIA 1JBMA 2VGNA 1UB4A 3HFOA 5IHNA 2PNIA 1M2VB 1XJWB 1ABOA 2VC8A 3CCEA 3MP8A 2DJZA 2OTLA 2DD4A 2KDSA 2O01E 3JV3A 2DFUA 4L5GA 2F5TX 2D8HA 1ZBJA 3JB9F 1VQ5T 3ASKA 1EFNA 1KD1C 4ZGDB 1GXIE 1KD1U 1WYXA 3FC3A 2OTLQ 3QBYA 1RAHB 1K0SA 1IGUA 4XU0A 4EPCA 1ZX6A 3JCMV 1D3BB 3A8HB 4XAXB 5DM7R 3EG1A 3EGXB 2EFIA 5A0LA 3C94A 1K73R 1QP3A 1YJNT 2DXTA 1YN8A 3SD4A 3FB9A 4OMOA 1JXOA 3QG1A 2SEMA 2LMJA 4PJOA 5GAN3 2LJ0A 3OW2S 4BI3A 3I55T 2HL5C 2A3LA 2DTIA 2AK5A 2KROA 3OS2A 3LLRA 4DBQA 2BE9B 4JUVA 3AHUA 4AG2C 1VQ4T 2QAZA 4FT4A 3L2QA 2JMAA 5D6XA 3HRUA 4LXCA 2DVJA 4MDXA 5GMKm 2RHIA 2OTJQ 3SHWA 5CKBA 3X24B 4ZTFA 1S72A 3OYBA 3H0HA 4C8QD 1PRMC 4QVDA 5GAMf 2O2OA 4RTYA 1UUEA 1I07A 2NUTB 2L3QA 4M7AF 3EG0A 3HKSA 2VB6A 4JRQA 3M54A 4RG2A 3LX7A 4IKFA 3M0UA 1AWXA 2H3EB 1NEBA 1RL2A 1GRIA 1WHMA 3R6OA 2YUOA 2DERA 5KCHA 1K8AC 2LNHB 3QSUA 4LDWA 2LDMA 1K8AU 2V26A 2YXYA 2HD0A 3OYKA 3LH0A 4M7DF 2MWOA 3NFCA 2BIVA 1QP2A 1EX4A 2RA2A 1Y96B 2EGEA 2KYMA 1W1FA 4J8OA 1G3TA 2VXEA 2DK3A 2J6FA 2KT1A 1WFWA 4IUQA 3X28B 4ZN1A 1YHQT 1HXDA 2BE7D 3SWNA 3GPLA 2E4HA 3SWNC 1K4US 2JTEA 1ZBXA 4M78C 4M78A 3CMEA 2MOXA 3VYHB 1GBQA 5GAMg 2D9TA 3FEOA 4BE0A 4JJBA 1KC8R 1WXTA 2M9UA 4BI4A 4LUDA 3FLGA 4M75A 1RUWA 4M75C 2R58A 3S3NA 4JDSA 2RK2A 4C0ZA 3I9QA 1U8RA 1VQLA 1QKXA 1BBZA 2KI7A 1RABB 4M7AD 4YTLA 3CC4A 3SFMA 2EGCA 1U3OA 4HVVA 2EBPA 2XG8D 1VQLQ 4IUUA 4EIKA 4TVRA 3AT1B 3O8VA 1PG5B 2JTMA 3S3MA 2LQKA 4XTVA 1M90U 3CMAQ 1UGRB 2KQWA 1B34A 3M0TA 2LX7A 2KVQG 2RB6A 4V2SA 4LD9K 5AYFA 1YJ9A 4BE2A 1K1ZA 4E7ZA 3OYFA 2RJDA 3A8OB 3UA7A 3SEMA 2EQMA 2QTXA 1IXDA 5AT1B 2C0TA 1YJ9Q 3KXTA 1KQSP 1M5Q1 4PLIA 1YITQ 2HKNA 2L3PA 1U1TA 2AKLA 4L59A 1HSQA 4HT8A 5LJ5f 3HPWA 3LGFA 4F17A 2E65A 4F7UE 3CCLA 1OU8A 4FSSA 2F69A 2KRMA 2D8JA 3UATA 3GLXA 2RQRA 4CC2A 1RAAB 2K7AA 2AZVA 2LQ8A 3MHXA 3FJPA 1SF9A 1VQNA 2ZPGB 1AWOA 3G71A 1NJIC 1AWJA 2ENMA 1NJIU 3HSBA 1UG1A 1UTIA 1X6GA 4J5YA 4E7LA 5CCAA 1WHHA 1VQNQ 1VQ6T 3MP6A 2CT3A 2EWNA 4R56A 3J81E 1FX7A 5EG2A 2RN8A 2OAUA 1K76A 1YI2Q 1VQ8A 3CCQT 4QQGA 4II1A 8AT1B 1Z9QA 2B8AA 1V76A 5LJ5g 2E12A 1I8FA 3EH1A 4WTOB 2HEQA 1Q82C 3E2UA 1TUDA 2E41A 1YIJT 5GJWB 4A4EA 1Q82U 4RTZA 2NUPB 2K79A 4B9WA 3OYJA 2FRWA 4PJOF 4C92E 2Y90A 1ZSZA 2CSIA 5IAYA 3JCMX 1Q7YR 4ZTJA 3A8GB 1NLPC 1X75C 5KYWA 2MI6A 2GFAA 1XTDA 1JU5C 3UDCA 2VKNA 2R5AA 3OYCA 2RQVA 4J9FA 3NPFA 1HK9A 2DAQA 4PJJA 3CXCA 3PMTA 2EQUA 1RAGB 1JJ2A 1M27C 4JRPA 2LT1A 1FMVA 2RPNA 1IHWA 1SG5A 2P0PA 3DKMA 2KXDA 3ME9A 2FL7A 2RJEA 3EG2A 1H8KA 1RI0A 4M77D 4F14A 1ZA2B 1VQ7T 3OB9A 2JXBA 3OMGA 4OB0B 1EIFA 1X69A 1I5LA 4A4KA 4D6WA 3OYAA 1FMWA 1NYFA 3P8DA 2QA4T 1LNXA 2EYXA 3RMSA 2QXFA 2RHXA 1VYUA 3CCSA 2WSFE 1YWOA 3I56A 4LDYA 5EC7A 4C0FA 2M51A 3A8MB 3CC2A 2GTOA 1LJOA 4BUGA 3WVDB 2KAFA 3PVLA 5KYUA 4UC4A 3QDFA 3EG9B 3CCRT 4E7HA 1SPKA 4RTVA 3I56Q 1X2QA 3TSWA 1RLQC 1DJ7B 1NPPA 5LJ3g 3CC2Q 3G4ST 3V7SA 2E3IA 2FRYA 1RAEB 2VYTA 1NBEB 2CP2A 4ELZC 1UHCA 5FRNA 4XTWA 4C8QB 4M78G 2CUDA 4MDWA 1Q86C 2O31A 2GTJA 2P84A 3QO3A 1Q86U 1OEBA 1WNLA 3LW5E 2HDAA 3M53A 2FPFA 1FYNA 2QQ9A 1M2VA 1M1FA 4FIBA 3CCET 2OTLT 1I0CA 4M75G 1QCOA 1IO6A 2KEAA 2XD0A 3H9NA 4C5IA 2V1RA 2XDDA 5GAOq 5GAN4 4DBFA 3S3OA 1QVGP 3G7ZA 3OYLA 1D3BA 4J9HA 4O5VA 4QVCA 2HQXA 4Z89A 2M16A 3EGXA 3M0QA 3IQLA 4FYVB 1MNDA 4PFOA 3VRZA 3JCMe 5KYNA 2FVUA 1WJRA 2ESWA 3OYMA 2CP5A 2ZPEB 4J9BA 4AFZC 2LJ3A 2KY9A 4ATOA 3OYDA 1JJ2P 3GIBA 5GAN7 2VVKA 3PMIA 2G6FX 1AVZC 2ZZDA 2CS7A 2V8KA 3CXCS 1YJWA 2ECZA 2DIGA 4VUBA 2BZXA 1X27A 1YCSB 3L2WA 1K9MR 2BUDA 4PJMA 4BI8B 2Y4YA 3EAEA 5GMKi 1M3CA 1S72T 2RJCA 4E7IA 2CKKA 4OMLA 4BDZA 2CSQA 4HCCA 1KFZA 4FW2A 4MZTA 2GNCA 5GAOm 2NUTA 4M7AB 4L6V5 1GL5A 4C0GA 4HVWA 2X4XA 1M3AA 4BY6C 1M8MA 4LDVA 2GF7A 2ABLA 2RH2A 3OY9A 4AFSC 3MPUB 2K2MA 5CO7A 1WQWA 3M0SA 1VQ9Q 1UFFA 5KH6A 3META 1U1SA 4ZN3A 3VRYA 1VQKT 1F1BB 2K3YA 2J05A 2DMOA 1BI2A 2VGMA 3OS0A 1ABQA 1TXQA 3CC7Q 1G2BA 1T3LA 1M1KC 2AHJB 2EQIA 4M7DB 3OA6A 2JJ9A 2JZ2A 1NZ9A 2D6FA 4OGEA 1M1KU 1A0NB 1C0MA 2JOYA 5GAN8 2DBMA 1Y96A 1SEMA 3TREA 2VV5A 1OZ2A 1TU0B 4KULA 3EHRA 2CP6A 3L42A 4C8QG 3E19A 5L8RE 2E70A 5GANf 2JS2A 2D0QB 3OYIA 2YWWA 2SRCA 2OJ2A 3CMET 2JW4A 4M77A 4M77C 4RKUE 4M78E 2PZ1A 2MIOA 1W2BA 2AZSA 2CP7A 2OI3A 2K5IA 3TVTA 4N4IA 3JCMd 1Z9ZA 3BFMA 2C0IA 3JCMb 1Y71A 5IXBA 2LRQA 4RTUA 2IPOB 2K57A 3GOXA 1WQ7A 1TUGB 1VQLT 4Y91A 4M75E 4LDUA 2X35A 2LCLA 4KGZB 4FL6A 1IZ6A 3MCAB 3RMQA 3CC4T 2JMCA 3CEYA 4HKEA 2OTJA 1UDLA 1VQMA 5J26A 3HTRA 1D0XA 2BTTA 1VQOA 2A0FB 1RAFB 1MNEA 3MEVA 2A7YA 1SSFA 3MJXA 4RCBA 1NLOC 2DEUA 2E5KA 3I5SA 3BDUA 3L2VA 1YJ9T 4J9DA 1VQMQ 4FYWB 5CVIA 2DA9A 4KUIA 1V1CA 4F7UF 1VQOQ 4BACA 5A0DA 2AKKA 3OMCA 1E6HA 1KHIA 1X01A 2YSQA 5GAMj 3E9FA 1WZOA 2RO0A 1PWTA 1N8RC 1MMAA 4PNOA 5GANg 1KQSA 2K4YA 2E6ZA 4HCKA 1JQQA 1N8RU 4BY6B 4A54A 3BW1A 4ZNXA 2YT6A 1OU9A 2VXFA 1QVFP 2HQEA 1Q81C 3JB9D 3H41A 3OBYA 1N6AA 3HP9A 2DZCA 1Q81U 2BZYA 1FXXA 1TOVA 3CCLT 4KBMB 1PCXA 3CCVA 2WSCE 3QDRB 4KH0B 1QVPA 1PD0A 3ZEHA 4X9DA 5L23A
chains in the Genus database with same CATH topology
2X3XD 2K7AA 2AZVA 1H92A 3VS7A 1AWOA 1AD5A 2LJ1A 1AWJA 5HCKA 2JM8A 2ENMA 1GCQA 2A36A 1GCQC 2JM9A 2RNAA 1PNJA 1UG1A 1HD3A 1UTIA 2NWMA 1X6GA 3NMZC 4WCIA 4J9GA 2CT3A 1UGVA 3ZL7C 2LQWA 5IHIA 4RUGA 1K0XA 1AZGB 2P4RA 2XMFA 2CREA 1YNZA 2RN8A 4J9CA 3UA6A 4RTWA 2O9SA 2K9GA 1B3QA 4AG1C 1XOVA 3LH5A 4HVUA 1K76A 2KRSA 4JZ3A 4M4ZA 2GBQA 3VS6A 1QCFA 2IIMA 1WIEA 2KXCA 1B07A 2D0NA 1SHFA 3C0CA 4E6RA 4ORZA 1Z9QA 4LUEA 2LP5A 2RQWA 2NUZA 2HEQA 2PTKA 1OPLA 1TUDA 1SHGA 2L0AA 2KRNA 5GJWB 4RTZA 2K79A 2RMOA 1GBRA 2FRWA 3QWYA 2LCSA 1UHFA 2CSIA 2DX1A 4D8DA 3REBB 1NLPC 2KE9A 1WA7A 3NHNA 1AOJA 1YP5A 1NYGA 1QLYA 3QWXX 1GCPA 1JU5C 2FEIA 2J6OA 4ESRA 2VKNA 1I1JA 1T3SA 1GFCA 1KIKA 4D8KA 2RQVA 1VYVA 1KSWA 3NPFA 1CSKA 2JT4A 4J9FA 4QT7A 2DL4A 5GJVB 4CC7A 4DEYA 1W70A 3EHQA 2HSPA 4OMQA 1X2KA 1M27C 4GBQA 2RPNA 2FO0A 2J06A 2KXDA 1BK2A 1G83A 1AWWA 3EG2A 1H8KA 1M3BA 4F14A 3A98A 5FW9A 2RQTA 1SRMA 2JXBA 4J9EA 5I11A 1X69A 3O5ZA 3RNJA 2A28A 3RBBB 5FWBA 1NYFA 4Z8AA 1SSHA 3VS5A 1S1NA 1QWFA 2EYXA 2EYYA 4J9IA 1PKSA 1VYUA 2EGAA 4HXJA 2MCNA 1E7OA 3NGPA 1U06A 3THKA 1UECA 1SRLA 1YWOA 2CT4A 1Y0MA 2J6KA 3PVQA 5EC7A 3R6NA 4OMNA 2M51A 2W0ZA 2GTOA 2M0YA 2GGRA 3VS0A 1VA7A 3PVLA 2EVRA 5IXFA 1SPKA 4RTVA 1X2QA 3TSWA 2CUBA 1RLQC 1MUZA 3CQTA 2DM1A 4K11A 2DNUA 2FRYA 1UJYA 2B86A 2EKHA 4RTXA 1PRLC 1UHCA 2A37A 2KYBA 2K3BA 2CUDA 2O31A 2GTJA 3I5RA 2HCKA 2DF6A 4RTTA 5I22A 5IHNA 2PNIA 1NEGA 1ABOA 1OEBA 1NG2A 3M0PA 1WXBA 1WDXA 2HDAA 2FPFA 1FYNA 3JV3A 1TUCA 2KT8A 2D8HA 1ZBJA 1I0CA 2EYWA 1EFNA 2FG0A 1IO6A 2KEAA 1QWEA 2O9VA 1WYXA 1CKAA 2V1RA 2DYBA 2A08A 4F16A 1K0SA 4CC3A 1ZX6A 4OMMA 2KR3A 3EG1A 2RQUA 3VS4A 4J9HA 5ECAA 1YN8A 1HJDA 4Z89A 4OMOA 2H8HA 3M0QA 1JXOA 3IQLA 2YUQA 3VRZA 2SEMA 2LMJA 1OOTA 2LJ0A 2ESWA 1ZSGA 4J9BA 1ARKA 2DJQA 1OV3A 4AFZC 2AK5A 1AEYA 2DILA 2O88A 2KROA 2LJ3A 2FPEA 4AG2C 1VYTA 1JO8A 2VVKA 3VS1A 2JMAA 2G6FX 3H0FA 1AVZC 2DVJA 1LCKA 1U5SA 3UF4A 2ECZA 3H0IA 3GBQA 3SHWA 2BZXA 1X27A 1YCSB 2YDLA 4JPBW 1GFDA 3H0HA 3U23A 2LQNA 1PRMC 1M3CA 4JJDA 3I35A 1WXUA 2L3SA 4OMLA 1WX6A 2O2OA 4RTYA 1UUEA 1I07A 2CSQA 2L3QA 3EG0A 1KFZA 1CKBA 2F2XA 2GNCA 2L2PA 1ZUYA 1WLPB 1X43A 1M30A 2ED1A 3M0UA 1GL5A 4HVWA 1N5ZA 1M3AA 1AWXA 1NEBA 2J7IA 1M8MA 2ABLA 4AFSC 1GRIA 5IHKA 2K2MA 2YUOA 3M0SA 1W6XA 2LNHB 1UFFA 1UE9A 4A63B 2DL8A 2X3WD 4Z88A 3VRYA 2EYZA 4DEXA 2CH4W 3FJ5A 2J05A 2HBWA 2DMOA 1X6BA 1ABQA 4OMPA 1G2BA 1K9AA 1T3LA 2EQIA 2EGEA 2KYMA 1A0NB 1WI7A 1W1FA 1ZUUA 2DBKA 2V1QA 2DBMA 2KGTA 2CH4A 1SEMA 2J6FA 1WFWA 2KT1A 4LNPA 3TSZA 2ROLA 3EHRA 1UJ0A 1K4US 2JTEA 1T0JA 2JS2A 2DLPA 2MOXA 1T0HA 3VS3A 1GBQA 1MV0B 2SRCA 2OJ2A 3M0RA 2JW4A 1AZEA 4JJBA 1WXTA 1KJWA 4Y92A 5FWCA 1TG0A 2PZ1A 2MIOA 4LUDA 2AZSA 2OI3A 1BU1A 1RUWA 3TVTA 1Z9ZA 2EPDA 2C0IA 3I9QA 5IXBA 4R0KA 1PKTA 4RTUA 1QKXA 1QKWA 1ZLMA 1ZUKA 1BBZA 2FPDA 1PHTA 2OAWA 2I0NA 4LN2A 4AFUC 2EGCA 1U3OA 4HVVA 2EBPA 2DL7A 1J3TA 2JMCA 2ED0A 2DRMA 4EIKA 1UDLA 1E6GA 5IH2A 4KRTA 3M0TA 2DRKA 2LX7A 2BTTA 4CC4B 4AFQC 1JXMA 1MV3A 2KBTA 2DE0X 1K1ZA 1NLOC 2E5KA 3I5SA 3EG3A 4J9DA 1OPKA 1RLPC 2DA9A 2F2WA 2F2VA 1V1CA 3UA7A 3SEMA 4IIOA 2W10A 4IIMA 2AKKA 2C0TA 3KFVA 1E6HA 1RI9A 2YUNA 2YSQA 1YWPA 2CDTA 2ROTA 4JZ4A 1PWTA 3VS2A 4HCKA 1JQQA 4X1VA 2L3PA 3PE0A 2C0OA 2JS0A 2AKLA 2K6DA 3ULRB 1H3HA 4ZNXA 1BB9A 2DL3A 2KNBB 1HSQA 2YT6A 1NM7A 2RF0A 2QDLA 2GQIA 2VWFA 2D1XA 2EW3A 4F17A 3H41A 1FMKA 2YUPA 4FSSA 4JJCA 2KRMA 1Y57A 2BZYA 3REAB 4LE9A 2D8JA 1JEGA 3UATA 2DL5A 3EGUA 4GLMA 2RQRA 2LZ6B 2BZ8A 4CC2A 5L23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3X D;  2K7A A;  2AZV A;  1H92 A;  3VS7 A;  1AWO A;  1AD5 A;  2LJ1 A;  1AWJ A;  5HCK A;  2JM8 A;  2ENM A;  1GCQ A;  2A36 A;  1GCQ C;  2JM9 A;  2RNA A;  1PNJ A;  1UG1 A;  1HD3 A;  1UTI A;  2NWM A;  1X6G A;  3NMZ C;  4WCI A;  4J9G A;  2CT3 A;  1UGV A;  3ZL7 C;  2LQW A;  5IHI A;  4RUG A;  1K0X A;  1AZG B;  2P4R A;  2XMF A;  2CRE A;  1YNZ A;  2RN8 A;  4J9C A;  3UA6 A;  4RTW A;  2O9S A;  2K9G A;  1B3Q A;  4AG1 C;  1XOV A;  3LH5 A;  4HVU A;  1K76 A;  2KRS A;  4JZ3 A;  4M4Z A;  2GBQ A;  3VS6 A;  1QCF A;  2IIM A;  1WIE A;  2KXC A;  1B07 A;  2D0N A;  1SHF A;  3C0C A;  4E6R A;  4ORZ A;  1Z9Q A;  4LUE A;  2LP5 A;  2RQW A;  2NUZ A;  2HEQ A;  2PTK A;  1OPL A;  1TUD A;  1SHG A;  2L0A A;  2KRN A;  5GJW B;  4RTZ A;  2K79 A;  2RMO A;  1GBR A;  2FRW A;  3QWY A;  2LCS A;  1UHF A;  2CSI A;  2DX1 A;  4D8D A;  3REB B;  1NLP C;  2KE9 A;  1WA7 A;  3NHN A;  1AOJ A;  1YP5 A;  1NYG A;  1QLY A;  3QWX X;  1GCP A;  1JU5 C;  2FEI A;  2J6O A;  4ESR A;  2VKN A;  1I1J A;  1T3S A;  1GFC A;  1KIK A;  4D8K A;  2RQV A;  1VYV A;  1KSW A;  3NPF A;  1CSK A;  2JT4 A;  4J9F A;  4QT7 A;  2DL4 A;  5GJV B;  4CC7 A;  4DEY A;  1W70 A;  3EHQ A;  2HSP A;  4OMQ A;  1X2K A;  1M27 C;  4GBQ A;  2RPN A;  2FO0 A;  2J06 A;  2KXD A;  1BK2 A;  1G83 A;  1AWW A;  3EG2 A;  1H8K A;  1M3B A;  4F14 A;  3A98 A;  5FW9 A;  2RQT A;  1SRM A;  2JXB A;  4J9E A;  5I11 A;  1X69 A;  3O5Z A;  3RNJ A;  2A28 A;  3RBB B;  5FWB A;  1NYF A;  4Z8A A;  1SSH A;  3VS5 A;  1S1N A;  1QWF A;  2EYX A;  2EYY A;  4J9I A;  1PKS A;  1VYU A;  2EGA A;  4HXJ A;  2MCN A;  1E7O A;  3NGP A;  1U06 A;  3THK A;  1UEC A;  1SRL A;  1YWO A;  2CT4 A;  1Y0M A;  2J6K A;  3PVQ A;  5EC7 A;  3R6N A;  4OMN A;  2M51 A;  2W0Z A;  2GTO A;  2M0Y A;  2GGR A;  3VS0 A;  1VA7 A;  3PVL A;  2EVR A;  5IXF A;  1SPK A;  4RTV A;  1X2Q A;  3TSW A;  2CUB A;  1RLQ C;  1MUZ A;  3CQT A;  2DM1 A;  4K11 A;  2DNU A;  2FRY A;  1UJY A;  2B86 A;  2EKH A;  4RTX A;  1PRL C;  1UHC A;  2A37 A;  2KYB A;  2K3B A;  2CUD A;  2O31 A;  2GTJ A;  3I5R A;  2HCK A;  2DF6 A;  4RTT A;  5I22 A;  5IHN A;  2PNI A;  1NEG A;  1ABO A;  1OEB A;  1NG2 A;  3M0P A;  1WXB A;  1WDX A;  2HDA A;  2FPF A;  1FYN A;  3JV3 A;  1TUC A;  2KT8 A;  2D8H A;  1ZBJ A;  1I0C A;  2EYW A;  1EFN A;  2FG0 A;  1IO6 A;  2KEA A;  1QWE A;  2O9V A;  1WYX A;  1CKA A;  2V1R A;  2DYB A;  2A08 A;  4F16 A;  1K0S A;  4CC3 A;  1ZX6 A;  4OMM A;  2KR3 A;  3EG1 A;  2RQU A;  3VS4 A;  4J9H A;  5ECA A;  1YN8 A;  1HJD A;  4Z89 A;  4OMO A;  2H8H A;  3M0Q A;  1JXO A;  3IQL A;  2YUQ A;  3VRZ A;  2SEM A;  2LMJ A;  1OOT A;  2LJ0 A;  2ESW A;  1ZSG A;  4J9B A;  1ARK A;  2DJQ A;  1OV3 A;  4AFZ C;  2AK5 A;  1AEY A;  2DIL A;  2O88 A;  2KRO A;  2LJ3 A;  2FPE A;  4AG2 C;  1VYT A;  1JO8 A;  2VVK A;  3VS1 A;  2JMA A;  2G6F X;  3H0F A;  1AVZ C;  2DVJ A;  1LCK A;  1U5S A;  3UF4 A;  2ECZ A;  3H0I A;  3GBQ A;  3SHW A;  2BZX A;  1X27 A;  1YCS B;  2YDL A;  4JPB W;  1GFD A;  3H0H A;  3U23 A;  2LQN A;  1PRM C;  1M3C A;  4JJD A;  3I35 A;  1WXU A;  2L3S A;  4OML A;  1WX6 A;  2O2O A;  4RTY A;  1UUE A;  1I07 A;  2CSQ A;  2L3Q A;  3EG0 A;  1KFZ A;  1CKB A;  2F2X A;  2GNC A;  2L2P A;  1ZUY A;  1WLP B;  1X43 A;  1M30 A;  2ED1 A;  3M0U A;  1GL5 A;  4HVW A;  1N5Z A;  1M3A A;  1AWX A;  1NEB A;  2J7I A;  1M8M A;  2ABL A;  4AFS C;  1GRI A;  5IHK A;  2K2M A;  2YUO A;  3M0S A;  1W6X A;  2LNH B;  1UFF A;  1UE9 A;  4A63 B;  2DL8 A;  2X3W D;  4Z88 A;  3VRY A;  2EYZ A;  4DEX A;  2CH4 W;  3FJ5 A;  2J05 A;  2HBW A;  2DMO A;  1X6B A;  1ABQ A;  4OMP A;  1G2B A;  1K9A A;  1T3L A;  2EQI A;  2EGE A;  2KYM A;  1A0N B;  1WI7 A;  1W1F A;  1ZUU A;  2DBK A;  2V1Q A;  2DBM A;  2KGT A;  2CH4 A;  1SEM A;  2J6F A;  1WFW A;  2KT1 A;  4LNP A;  3TSZ A;  2ROL A;  3EHR A;  1UJ0 A;  1K4U S;  2JTE A;  1T0J A;  2JS2 A;  2DLP A;  2MOX A;  1T0H A;  3VS3 A;  1GBQ A;  1MV0 B;  2SRC A;  2OJ2 A;  3M0R A;  2JW4 A;  1AZE A;  4JJB A;  1WXT A;  1KJW A;  4Y92 A;  5FWC A;  1TG0 A;  2PZ1 A;  2MIO A;  4LUD A;  2AZS A;  2OI3 A;  1BU1 A;  1RUW A;  3TVT A;  1Z9Z A;  2EPD A;  2C0I A;  3I9Q A;  5IXB A;  4R0K A;  1PKT A;  4RTU A;  1QKX A;  1QKW A;  1ZLM A;  1ZUK A;  1BBZ A;  2FPD A;  1PHT A;  2OAW A;  2I0N A;  4LN2 A;  4AFU C;  2EGC A;  1U3O A;  4HVV A;  2EBP A;  2DL7 A;  1J3T A;  2JMC A;  2ED0 A;  2DRM A;  4EIK A;  1UDL A;  1E6G A;  5IH2 A;  4KRT A;  3M0T A;  2DRK A;  2LX7 A;  2BTT A;  4CC4 B;  4AFQ C;  1JXM A;  1MV3 A;  2KBT A;  2DE0 X;  1K1Z A;  1NLO C;  2E5K A;  3I5S A;  3EG3 A;  4J9D A;  1OPK A;  1RLP C;  2DA9 A;  2F2W A;  2F2V A;  1V1C A;  3UA7 A;  3SEM A;  4IIO A;  2W10 A;  4IIM A;  2AKK A;  2C0T A;  3KFV A;  1E6H A;  1RI9 A;  2YUN A;  2YSQ A;  1YWP A;  2CDT A;  2ROT A;  4JZ4 A;  1PWT A;  3VS2 A;  4HCK A;  1JQQ A;  4X1V A;  2L3P A;  3PE0 A;  2C0O A;  2JS0 A;  2AKL A;  2K6D A;  3ULR B;  1H3H A;  4ZNX A;  1BB9 A;  2DL3 A;  2KNB B;  1HSQ A;  2YT6 A;  1NM7 A;  2RF0 A;  2QDL A;  2GQI A;  2VWF A;  2D1X A;  2EW3 A;  4F17 A;  3H41 A;  1FMK A;  2YUP A;  4FSS A;  4JJC A;  2KRM A;  1Y57 A;  2BZY A;  3REA B;  4LE9 A;  2D8J A;  1JEG A;  3UAT A;  2DL5 A;  3EGU A;  4GLM A;  2RQR A;  2LZ6 B;  2BZ8 A;  4CC2 A;  5L23 A; 
#chains in the Genus database with same CATH topology
 3S6W A;  4ME7 A;  3CCV Q;  1AD5 A;  2LJ1 A;  2DXB A;  2XID A;  3M59 A;  2A36 A;  2JM9 A;  1VQN T;  3VKI A;  3G71 T;  4XU3 A;  3CCM Q;  1UEB A;  2AIR B;  3OSS C;  2E1H A;  2F5K A;  2H3J A;  4J9G A;  4RUG A;  2P4R A;  4M77 B;  2DZ9 A;  4J6X A;  2X51 A;  2XMF A;  4C92 F;  1AHJ B;  3UA6 A;  1W2B P;  1KD1 R;  1TH7 A;  2PU9 B;  1LPL A;  4AG1 C;  1XOV A;  3LH5 A;  4JZ3 A;  1PSF A;  3BDL A;  5KYX B;  2GBQ A;  3LYI A;  5I2S A;  1VQ8 T;  2DET A;  1W2B S;  4KT0 E;  2RK1 A;  1SHF A;  3C0C A;  4E6R A;  3JCM h;  3EFR A;  3DLL A;  2PTK A;  1OPL A;  5FU6 C;  1SHG A;  2KRN A;  3CMA A;  1VQ5 Q;  2YRV A;  5CQY A;  1GBR A;  2GQV A;  3P8B B;  1M8V A;  1M90 C;  3QWY A;  1D0Z A;  3E1S A;  2NUP A;  3D7S B;  2KE9 A;  2JVV A;  1MMN A;  4FYY B;  1UGQ B;  2J6O A;  3LWH A;  1YJN Q;  1N27 A;  4P5N A;  3QZ9 B;  1BCO A;  1GFC A;  3URG A;  4D8K A;  3V8K A;  2C06 A;  1HYO A;  1KSW A;  1YIT A;  4OP0 A;  4M7D D;  1B7T A;  3V8L A;  2QQR A;  4F04 B;  5GJV B;  2JTF A;  3I55 Q;  1W70 A;  3EHQ A;  3HRS A;  4PLL A;  2HSP A;  4OMQ A;  1BI1 A;  3MEW A;  4BDY A;  4XU1 A;  3JB9 J;  4FU6 A;  1G83 A;  1KQS S;  3OS1 A;  3TCJ A;  1D1C A;  2E3H A;  1M3B A;  5LJ5 j;  3O5Z A;  4A53 A;  2A28 A;  3RBB B;  4MZP A;  1V29 B;  5FWB A;  2QG9 B;  3VS5 A;  4C92 D;  4E7S A;  1QWF A;  2DVE A;  2EYY A;  5C0M A;  3NGP A;  1K8A R;  1SRL A;  3CCS T;  2PQW A;  2BKD N;  2IG0 A;  3M56 A;  4OMN A;  2I2L A;  2M0Y A;  3VS0 A;  2LVM A;  2R57 A;  2QAS A;  3PIO A;  3CC2 T;  3VV0 A;  2EVR A;  1G3S A;  3QII A;  1MUZ A;  4Y28 E;  5GAN 6;  3RKX A;  3EG9 A;  4K11 A;  4E7K A;  2DNU A;  2RD1 A;  3M58 A;  5LL6 S;  2CZ0 B;  1YI2 A;  2A37 A;  4ELY C;  4PJN A;  4X34 A;  4HCZ A;  3I5R A;  2HCK A;  2DF6 A;  4RTT A;  4C8Q A;  3RKY A;  4C8Q C;  1R0B G;  5HY6 A;  2Z0W A;  4OMF B;  3UWN A;  4JS5 A;  4M77 G;  1WXB A;  1WDX A;  2RI5 A;  4GLK A;  1TUC A;  1YHQ Q;  2KT8 A;  5FU6 B;  3V7C A;  2EYW A;  2FG0 A;  4MML A;  4EMG A;  3PTA A;  1NE8 A;  3CBO A;  5IT9 E;  4XQ3 A;  2DYB A;  3DB3 A;  1LOJ A;  2VUB A;  1R8O B;  1IGQ A;  3VS4 A;  1QVG A;  1WJQ A;  1HJD A;  5LJ3 h;  3L2R A;  4HCB A;  1OOT A;  5LJ3 j;  4PFZ A;  1ARK A;  2CP3 A;  2DJQ A;  1OV3 A;  6AT1 B;  3ZFJ A;  2WSE E;  2O88 A;  3CD6 A;  3QZ5 B;  2FPE A;  3CCU A;  1JB0 E;  4NL3 A;  1VYT A;  2LT4 A;  2HAX A;  3VS1 A;  2L3R A;  2K3X A;  1U5S A;  3GF5 A;  3UF4 A;  4N4G A;  5HK0 A;  3H0I A;  4IUT A;  5I21 A;  1YJW T;  3CD6 Q;  4JPB W;  3CCU Q;  4RG8 A;  2LQN A;  2E6N A;  2L3S A;  3PFS A;  4XTY A;  5GMK j;  3M55 A;  3BE3 A;  5GAM e;  5CR2 A;  4XK8 E;  2QEX A;  1OX9 A;  5GAO p;  1D1A A;  1CKB A;  4J6W A;  5CKF A;  1UGP B;  4J7F A;  1ZUY A;  1X43 A;  1M30 A;  1I5O B;  1UGS B;  2ED1 A;  4NS5 A;  2DEQ A;  1N5Z A;  2QEX Q;  2J7I A;  3RR6 A;  2HBP A;  4M7A A;  3C4S A;  4M7A C;  3E9G A;  5HKC A;  2FYK A;  2MWP A;  1D09 B;  2MPX C;  3OYY A;  2E10 A;  1W6X A;  3CPW P;  1OZ3 A;  2XU8 A;  4Z02 A;  1NJI R;  2EYZ A;  3M5A A;  3M4Y A;  4AMC A;  2CH4 W;  4PJO D;  3FJ5 A;  2HBW A;  4IUV A;  3OYN A;  1ZQ1 A;  2YHT A;  3HFN A;  4M78 F;  1ZUU A;  5J3B A;  2DBK A;  3VUB A;  2KGT A;  4M7D A;  4M7D C;  4OB3 B;  2CH4 A;  4KH1 B;  1VQ6 A;  2Y4X A;  2DIQ A;  4LNP A;  4HA8 A;  3TSZ A;  2O4X A;  1MGQ A;  1WHL A;  1T0J A;  4M75 F;  1TWB A;  1M9S A;  1VQ6 Q;  2IVW A;  1T0H A;  3OSV A;  3VS3 A;  2MMP A;  2XDB A;  3VYG A;  2GCX A;  3MEU A;  1KJW A;  2YRC A;  5FWC A;  1Q82 R;  3CCQ A;  2JNG A;  2PUK B;  3QYG B;  2EPD A;  2ZGW A;  4J6Y A;  4M77 E;  3GP8 A;  1ZLM A;  2FPD A;  3CCQ Q;  4EMK B;  1QVG S;  4LD6 A;  2CGH A;  1J3T A;  1K73 C;  5GAN 2;  1O75 A;  1K73 U;  1C6V X;  1WGS A;  2OTJ T;  2RJF A;  3CCJ A;  4NL2 A;  3MO8 A;  2DRK A;  3LGL A;  4CC4 B;  1BYM A;  1VQM T;  4AFQ C;  3QPH A;  1MV3 A;  2KBT A;  2MAM A;  1VQO T;  1JJ2 S;  5GAM d;  1IHV A;  1Y7X A;  3CCJ Q;  2F2W A;  2F2V A;  3TU4 K;  2W10 A;  5GAN 5;  4IIM A;  2CP0 A;  4EDU A;  4F7U B;  2CDT A;  1OI1 A;  4X1V A;  3PE0 A;  2C0O A;  4HT9 A;  1BI3 A;  2JS0 A;  1VQ9 A;  2K6D A;  3JCM c;  1YBY A;  2RF0 A;  4BD3 A;  5LJ5 e;  4M75 D;  1QVF A;  2QA4 A;  2D1X A;  2EAY A;  1VQP A;  3CC7 A;  3REA B;  1JEG A;  1WHJ A;  1D0Y A;  3PNW C;  2X4Y A;  2K2V A;  4GLM A;  3OS5 A;  2QA4 Q;  4ZGE B;  1M4Z A;  2BZ8 A;  1G3Y A;  2X3X D;  3HRT A;  1VQP Q;  4OF1 A;  2E64 A;  3X20 B;  2HMA A;  3VS7 A;  4DBR A;  4XTZ A;  2JM8 A;  1GCQ A;  1GCQ C;  2O4X B;  2VAS A;  3HHT B;  1O9S A;  1ACM B;  3G4S A;  4C0D B;  1I81 A;  2F1L A;  3NMZ C;  1BCM A;  2MF2 A;  3OYE A;  3CCR Q;  1Q86 R;  1IB8 A;  5KYY B;  5KCO A;  4E47 A;  1UGV A;  3ZL7 C;  5IHI A;  2M0O A;  1G8X A;  3H8Z A;  1AZG B;  1TTH B;  1N9R A;  1OX8 A;  1BIB A;  3G4S Q;  5GAN j;  4ANJ A;  3L1A A;  4Q5W A;  3EFO B;  2CZ1 B;  4E2F B;  2CRE A;  4CI0 C;  5CQX A;  1B3Q A;  4R55 A;  4C92 B;  4QQD A;  4DOV A;  4BB7 A;  3VS6 A;  2IIM A;  3C95 A;  2HNI A;  3CBM A;  1WIE A;  2KXC A;  2D0N A;  2DXU A;  1BKB A;  3JB9 G;  1KC8 C;  5KYX A;  2DYI A;  2LP5 A;  3PT9 A;  1KC8 U;  2EKO A;  3CCE Q;  2L0A A;  3TEE A;  4DBH A;  2EYQ A;  1M1G A;  2XK0 A;  2RMO A;  3CMA T;  3M57 A;  3QXE B;  2M1H A;  1KQ2 A;  2DX1 A;  2XKO C;  3REB B;  4JS4 A;  3OW2 P;  1WA7 A;  1AOJ A;  1NYG A;  1QLY A;  1QMC A;  1R77 A;  2EJ9 A;  2ZPB B;  1Y07 A;  2FEI A;  4IUR A;  2LC4 A;  4ESR A;  4PJO C;  5LJ3 e;  4KGX B;  1T3S A;  2COZ A;  1VYV A;  2JT4 A;  4QT7 A;  1RAI B;  5GAM h;  4CC7 A;  4DEY A;  1YIT T;  2E5Q A;  2EQJ A;  1SKU B;  1X2K A;  5KE3 A;  3EFS A;  3QJ6 A;  4GBQ A;  5LJ5 d;  2FO0 A;  2L8D A;  2J06 A;  4DOW A;  2COY A;  1AWW A;  2EQK A;  4X9C A;  1RAC B;  3L2Z A;  4F7U G;  2RQT A;  4J9E A;  5I11 A;  1KQ1 A;  2JN0 A;  3RNJ A;  5GMK e;  2PVD B;  4XU2 A;  1S72 Q;  3DB4 A;  1OUL A;  4M7A G;  1QVF S;  4WF2 A;  4QVZ A;  3G6E A;  4J9I A;  1PKS A;  4GY5 A;  4HXJ A;  1E7O A;  2OX7 A;  1BI0 A;  3VUZ A;  1U06 A;  3THK A;  3EGD B;  2CT4 A;  4O6J A;  3SDZ A;  3PVQ A;  3CCM A;  2CZ6 B;  3R6N A;  4JRI A;  3G6E Q;  4FM4 B;  1VQK A;  2AT1 B;  5IXF A;  1M1K R;  3J7A F;  2FB7 A;  5FRM A;  2YRD A;  3CQT A;  1AT1 B;  1FWZ A;  4M7D G;  3PGG A;  3RDV A;  2B86 A;  1VQK Q;  2EKH A;  2KMT A;  5CK9 A;  5CKE A;  1YI2 T;  3JB9 H;  4DA4 A;  1XNI A;  5DLQ E;  4EMH A;  4N4H A;  5I22 A;  1NEG A;  2FZK B;  4JRK A;  3UPU A;  1NG2 A;  3M0P A;  1VQ5 A;  5D6Y A;  5IN1 A;  4C8Q E;  5M9O A;  2XI9 A;  3V8J A;  2WAC A;  5GAO r;  3CBP A;  1QWE A;  2O9V A;  2XHC A;  5FU7 C;  4C92 G;  4B6M A;  1CKA A;  2A08 A;  4F16 A;  3QHS A;  1XQH A;  1NPR A;  4CC3 A;  4OMM A;  3CME Q;  1OYX A;  2KR3 A;  1YJN A;  5LJ3 d;  3A8L B;  2QQA A;  2RQU A;  3MKD A;  5ECA A;  4PJO B;  4ZGJ B;  2H8H A;  2YUQ A;  5GAO l;  3JCM f;  3I55 A;  2HL3 A;  1Q7Y C;  1ZSG A;  3QKJ A;  1Q7Y U;  1PD1 A;  1AEY A;  2DIL A;  3FRN A;  1VQ4 A;  2LCC A;  3CC4 Q;  3OYG A;  4PJL A;  2DXC A;  2CYZ B;  1JO8 A;  1C1A A;  2ZPI B;  3CD6 T;  2PUO B;  3H0F A;  1QCN A;  3CCU T;  1LCK A;  3GBQ A;  1VQ4 Q;  3X26 B;  4RMO A;  2YDL A;  2ZCF B;  1N8R R;  1GFD A;  3U23 A;  5LJ5 h;  4JJD A;  5I2M A;  5DLO A;  3I35 A;  1WXU A;  1WX6 A;  1WJS A;  1WPY A;  3KUF A;  2F2X A;  2L89 A;  2QEX T;  1MMG A;  3JCM J;  3NTK A;  1Q81 R;  2L2P A;  5HK3 A;  1WLP B;  2EJG A;  4FSX A;  3JRZ A;  1LVK A;  3I56 T;  2PVO B;  5IHK A;  3SB2 A;  3DLM A;  2HKQ B;  1UE9 A;  4A63 B;  2DL8 A;  3CPW A;  2X3W D;  3JB9 I;  3LWI A;  1W4S A;  4Z88 A;  4M7A E;  3JCM g;  4DEX A;  3QUI A;  2DD5 A;  2RHZ A;  2X9H A;  3M4G A;  5J39 A;  2QK0 A;  3CCL Q;  1X6B A;  1VIE A;  4LDX A;  4OMP A;  2QDY B;  1ZA1 B;  1K9A A;  2ZAE A;  3EH2 A;  1WI7 A;  1H3Z A;  1YHQ A;  2GFU A;  3J80 E;  2V1Q A;  2YLC A;  4QQ6 A;  3A1P A;  3SWN B;  5FRO A;  4M78 B;  5C6S A;  4M77 F;  2ROL A;  3JSC A;  5A0G A;  3G71 Q;  4XTU A;  3C12 A;  1UJ0 A;  3GNF B;  1G3W A;  5FU7 B;  3INZ A;  4M7D E;  2DLP A;  5GAO n;  5GAN e;  3Q1J A;  1MV0 B;  3M0R A;  5GMK l;  4M75 B;  4QKU A;  4OVA A;  4JLG A;  1AZE A;  4Y92 A;  1TG0 A;  1OQK A;  2COW A;  5CIU A;  1BU1 A;  2KSS A;  3P8H A;  2ZPF B;  3F70 A;  4IUP A;  4R0K A;  2KK4 A;  1PKT A;  3JCM W;  1QKW A;  1M90 R;  1ZUK A;  4KGV B;  1PHT A;  2OAW A;  2I0N A;  1VQ8 Q;  4FW1 A;  5CAI A;  4LN2 A;  4AFU C;  2NYS A;  2DL7 A;  3VU3 C;  3G1J A;  3NTI A;  4CRI A;  1QQJ A;  4EMK A;  4EMK C;  2ED0 A;  4PJO G;  3RIR A;  2RI2 A;  1B34 B;  2DRM A;  1ZSZ C;  4N0A A;  4N0A C;  4JLI A;  4MZM A;  5IH2 A;  1E6G A;  3OQ5 A;  1R0C B;  2LTO A;  4KRT A;  1KG1 A;  3PIP A;  1P92 A;  2FHD A;  3L2U A;  2DO3 A;  5LJ3 f;  3CCJ T;  1JXM A;  2X4W A;  2DE0 X;  1PC0 A;  3JCM Q;  4A4F A;  2P0K A;  2DTH A;  3EG3 A;  4C5E A;  4PFP A;  1JRI A;  2XIC A;  1OPK A;  1RLP C;  2DKG A;  3N5B B;  2K5L A;  5GMK h;  4IIO A;  3KFV A;  1RI9 A;  2NLU A;  2YUN A;  5D7U A;  1YWP A;  3RER A;  2ROT A;  1K9M C;  4JZ4 A;  2V8I A;  2HZY A;  3VS2 A;  1K9M U;  3ZBD A;  2LX9 A;  4F7U A;  3RES A;  4E7J A;  4OB2 B;  1QW1 A;  3ULR B;  1H3H A;  3M9Q A;  1BB9 A;  2DL3 A;  2KNB B;  5CKH A;  1VQ9 T;  1NM7 A;  2QDL A;  4J83 A;  2GQI A;  1BIA A;  3GNG A;  2QQB A;  2VWF A;  4OGC A;  2DTO A;  2EW3 A;  1FMK A;  2YUP A;  4PK4 A;  3BY7 A;  4JJC A;  1X6O A;  1Y57 A;  1RAD B;  4LE9 A;  1VQP T;  2DL5 A;  3CC7 T;  1H64 1;  3EGU A;  3UT1 A;  3CPW S;  2LZ6 B;  2MK5 A;  4QW2 A;  1PSE A;  4FYX B;  1H92 A;  3H6Z A;  4C5H A;  4FCY A;  3CCS Q;  5HCK A;  2CZ7 B;  2RNA A;  1PNJ A;  4B9X A;  2NWM A;  1HD3 A;  2K5F A;  5GAN d;  3RUX A;  3X25 B;  4WCI A;  4AT1 B;  2R5M A;  2JUF A;  4C0D C;  1WHG A;  2LQW A;  1K0X A;  2RHU A;  5KYY A;  2LNV A;  3QYH B;  1YNZ A;  2QI2 A;  4J9C A;  2EIF A;  2ATC B;  4RTW A;  2O9S A;  3ER0 A;  4OB1 B;  1D1B A;  2K9G A;  2X4J A;  4C5G A;  4HVU A;  3EFO A;  2KRS A;  4NOY A;  4PKC C;  4M4Z A;  3NTH A;  3OBW A;  1QCF A;  3TQ7 P;  4DQ2 A;  2QYZ A;  3FIF A;  1B07 A;  4C92 A;  4C92 C;  2FZG B;  4ORZ A;  4LUE A;  2RQW A;  1YIJ A;  1G5V A;  2NUZ A;  1TS9 A;  2ZPH B;  2P4T A;  4RCC A;  2L5Q A;  1ZSZ B;  4PL6 A;  5KE2 A;  7AT1 B;  5KYW B;  3JCM P;  2LCS A;  1YIJ Q;  1UHF A;  3HL8 A;  2QGG A;  4D8D A;  3FDR A;  2QQS A;  1VIF A;  3OYH A;  3NHN A;  1YP5 A;  3QWX X;  2FZC B;  3OW2 A;  1GCP A;  2RI3 A;  4BE1 A;  2XDP A;  1PM3 A;  1IRX A;  3V7R A;  2MYS A;  5A2Q E;  1I1J A;  2P0Q A;  1KIK A;  3WXM B;  5D6W A;  4MMK A;  1CSK A;  3KBG A;  2DL4 A;  3CXC P;  3VJP A;  4PJO E;  1YFN A;  1KK7 A;  1EZZ B;  5CKD A;  2YLB A;  1VOM A;  4M78 D;  8ATC B;  9ATC B;  1BK2 A;  2DPP B;  4JJN K;  3QJY A;  1VQ7 A;  2V8J A;  3A98 A;  3T9N A;  5FW9 A;  2PVG B;  1YJW Q;  1SRM A;  1YCY A;  2HSE B;  5DY9 A;  2HQH A;  4KUD K;  4FT2 A;  3CPF A;  1WHK A;  1KHC A;  3JAM E;  4Z8A A;  1SSH A;  1VQ7 Q;  1I4K 1;  3RKW A;  1S1N A;  2EGA A;  1N9S A;  2MCN A;  2QGF B;  3G6E T;  1UEC A;  3CCV T;  1Y0M A;  2J6K A;  5KYU B;  2G3R A;  2W0Z A;  3EGD A;  4A4G A;  3CCR A;  2GGR A;  3CCM T;  2RHY A;  1VA7 A;  2M02 A;  2QTV A;  2CUB A;  3WVE B;  1MHN A;  2RM4 A;  2DM1 A;  1TSF A;  4J7I A;  4A4H A;  4C8Q F;  1VUB A;  5GAN h;  1UJY A;  1MMD A;  2EJF A;  3A5Z B;  4RTX A;  1IRE B;  1PRL C;  4XTX A;  3MP1 A;  2KYB A;  1M2O A;  3MEA A;  1Q95 G;  2K3B A;  5FLX E;  1ZHI A;  1JBM A;  2VGN A;  1UB4 A;  3HFO A;  5IHN A;  2PNI A;  1M2V B;  1XJW B;  1ABO A;  2VC8 A;  3CCE A;  3MP8 A;  2DJZ A;  2OTL A;  2DD4 A;  2KDS A;  2O01 E;  3JV3 A;  2DFU A;  4L5G A;  2F5T X;  2D8H A;  1ZBJ A;  3JB9 F;  1VQ5 T;  3ASK A;  1EFN A;  1KD1 C;  4ZGD B;  1GXI E;  1KD1 U;  1WYX A;  3FC3 A;  2OTL Q;  3QBY A;  1RAH B;  1K0S A;  1IGU A;  4XU0 A;  4EPC A;  1ZX6 A;  3JCM V;  1D3B B;  3A8H B;  4XAX B;  5DM7 R;  3EG1 A;  3EGX B;  2EFI A;  5A0L A;  3C94 A;  1K73 R;  1QP3 A;  1YJN T;  2DXT A;  1YN8 A;  3SD4 A;  3FB9 A;  4OMO A;  1JXO A;  3QG1 A;  2SEM A;  2LMJ A;  4PJO A;  5GAN 3;  2LJ0 A;  3OW2 S;  4BI3 A;  3I55 T;  2HL5 C;  2A3L A;  2DTI A;  2AK5 A;  2KRO A;  3OS2 A;  3LLR A;  4DBQ A;  2BE9 B;  4JUV A;  3AHU A;  4AG2 C;  1VQ4 T;  2QAZ A;  4FT4 A;  3L2Q A;  2JMA A;  5D6X A;  3HRU A;  4LXC A;  2DVJ A;  4MDX A;  5GMK m;  2RHI A;  2OTJ Q;  3SHW A;  5CKB A;  3X24 B;  4ZTF A;  1S72 A;  3OYB A;  3H0H A;  4C8Q D;  1PRM C;  4QVD A;  5GAM f;  2O2O A;  4RTY A;  1UUE A;  1I07 A;  2NUT B;  2L3Q A;  4M7A F;  3EG0 A;  3HKS A;  2VB6 A;  4JRQ A;  3M54 A;  4RG2 A;  3LX7 A;  4IKF A;  3M0U A;  1AWX A;  2H3E B;  1NEB A;  1RL2 A;  1GRI A;  1WHM A;  3R6O A;  2YUO A;  2DER A;  5KCH A;  1K8A C;  2LNH B;  3QSU A;  4LDW A;  2LDM A;  1K8A U;  2V26 A;  2YXY A;  2HD0 A;  3OYK A;  3LH0 A;  4M7D F;  2MWO A;  3NFC A;  2BIV A;  1QP2 A;  1EX4 A;  2RA2 A;  1Y96 B;  2EGE A;  2KYM A;  1W1F A;  4J8O A;  1G3T A;  2VXE A;  2DK3 A;  2J6F A;  2KT1 A;  1WFW A;  4IUQ A;  3X28 B;  4ZN1 A;  1YHQ T;  1HXD A;  2BE7 D;  3SWN A;  3GPL A;  2E4H A;  3SWN C;  1K4U S;  2JTE A;  1ZBX A;  4M78 C;  4M78 A;  3CME A;  2MOX A;  3VYH B;  1GBQ A;  5GAM g;  2D9T A;  3FEO A;  4BE0 A;  4JJB A;  1KC8 R;  1WXT A;  2M9U A;  4BI4 A;  4LUD A;  3FLG A;  4M75 A;  1RUW A;  4M75 C;  2R58 A;  3S3N A;  4JDS A;  2RK2 A;  4C0Z A;  3I9Q A;  1U8R A;  1VQL A;  1QKX A;  1BBZ A;  2KI7 A;  1RAB B;  4M7A D;  4YTL A;  3CC4 A;  3SFM A;  2EGC A;  1U3O A;  4HVV A;  2EBP A;  2XG8 D;  1VQL Q;  4IUU A;  4EIK A;  4TVR A;  3AT1 B;  3O8V A;  1PG5 B;  2JTM A;  3S3M A;  2LQK A;  4XTV A;  1M90 U;  3CMA Q;  1UGR B;  2KQW A;  1B34 A;  3M0T A;  2LX7 A;  2KVQ G;  2RB6 A;  4V2S A;  4LD9 K;  5AYF A;  1YJ9 A;  4BE2 A;  1K1Z A;  4E7Z A;  3OYF A;  2RJD A;  3A8O B;  3UA7 A;  3SEM A;  2EQM A;  2QTX A;  1IXD A;  5AT1 B;  2C0T A;  1YJ9 Q;  3KXT A;  1KQS P;  1M5Q 1;  4PLI A;  1YIT Q;  2HKN A;  2L3P A;  1U1T A;  2AKL A;  4L59 A;  1HSQ A;  4HT8 A;  5LJ5 f;  3HPW A;  3LGF A;  4F17 A;  2E65 A;  4F7U E;  3CCL A;  1OU8 A;  4FSS A;  2F69 A;  2KRM A;  2D8J A;  3UAT A;  3GLX A;  2RQR A;  4CC2 A;  1RAA B;  2K7A A;  2AZV A;  2LQ8 A;  3MHX A;  3FJP A;  1SF9 A;  1VQN A;  2ZPG B;  1AWO A;  3G71 A;  1NJI C;  1AWJ A;  2ENM A;  1NJI U;  3HSB A;  1UG1 A;  1UTI A;  1X6G A;  4J5Y A;  4E7L A;  5CCA A;  1WHH A;  1VQN Q;  1VQ6 T;  3MP6 A;  2CT3 A;  2EWN A;  4R56 A;  3J81 E;  1FX7 A;  5EG2 A;  2RN8 A;  2OAU A;  1K76 A;  1YI2 Q;  1VQ8 A;  3CCQ T;  4QQG A;  4II1 A;  8AT1 B;  1Z9Q A;  2B8A A;  1V76 A;  5LJ5 g;  2E12 A;  1I8F A;  3EH1 A;  4WTO B;  2HEQ A;  1Q82 C;  3E2U A;  1TUD A;  2E41 A;  1YIJ T;  5GJW B;  4A4E A;  1Q82 U;  4RTZ A;  2NUP B;  2K79 A;  4B9W A;  3OYJ A;  2FRW A;  4PJO F;  4C92 E;  2Y90 A;  1ZSZ A;  2CSI A;  5IAY A;  3JCM X;  1Q7Y R;  4ZTJ A;  3A8G B;  1NLP C;  1X75 C;  5KYW A;  2MI6 A;  2GFA A;  1XTD A;  1JU5 C;  3UDC A;  2VKN A;  2R5A A;  3OYC A;  2RQV A;  4J9F A;  3NPF A;  1HK9 A;  2DAQ A;  4PJJ A;  3CXC A;  3PMT A;  2EQU A;  1RAG B;  1JJ2 A;  1M27 C;  4JRP A;  2LT1 A;  1FMV A;  2RPN A;  1IHW A;  1SG5 A;  2P0P A;  3DKM A;  2KXD A;  3ME9 A;  2FL7 A;  2RJE A;  3EG2 A;  1H8K A;  1RI0 A;  4M77 D;  4F14 A;  1ZA2 B;  1VQ7 T;  3OB9 A;  2JXB A;  3OMG A;  4OB0 B;  1EIF A;  1X69 A;  1I5L A;  4A4K A;  4D6W A;  3OYA A;  1FMW A;  1NYF A;  3P8D A;  2QA4 T;  1LNX A;  2EYX A;  3RMS A;  2QXF A;  2RHX A;  1VYU A;  3CCS A;  2WSF E;  1YWO A;  3I56 A;  4LDY A;  5EC7 A;  4C0F A;  2M51 A;  3A8M B;  3CC2 A;  2GTO A;  1LJO A;  4BUG A;  3WVD B;  2KAF A;  3PVL A;  5KYU A;  4UC4 A;  3QDF A;  3EG9 B;  3CCR T;  4E7H A;  1SPK A;  4RTV A;  3I56 Q;  1X2Q A;  3TSW A;  1RLQ C;  1DJ7 B;  1NPP A;  5LJ3 g;  3CC2 Q;  3G4S T;  3V7S A;  2E3I A;  2FRY A;  1RAE B;  2VYT A;  1NBE B;  2CP2 A;  4ELZ C;  1UHC A;  5FRN A;  4XTW A;  4C8Q B;  4M78 G;  2CUD A;  4MDW A;  1Q86 C;  2O31 A;  2GTJ A;  2P84 A;  3QO3 A;  1Q86 U;  1OEB A;  1WNL A;  3LW5 E;  2HDA A;  3M53 A;  2FPF A;  1FYN A;  2QQ9 A;  1M2V A;  1M1F A;  4FIB A;  3CCE T;  2OTL T;  1I0C A;  4M75 G;  1QCO A;  1IO6 A;  2KEA A;  2XD0 A;  3H9N A;  4C5I A;  2V1R A;  2XDD A;  5GAO q;  5GAN 4;  4DBF A;  3S3O A;  1QVG P;  3G7Z A;  3OYL A;  1D3B A;  4J9H A;  4O5V A;  4QVC A;  2HQX A;  4Z89 A;  2M16 A;  3EGX A;  3M0Q A;  3IQL A;  4FYV B;  1MND A;  4PFO A;  3VRZ A;  3JCM e;  5KYN A;  2FVU A;  1WJR A;  2ESW A;  3OYM A;  2CP5 A;  2ZPE B;  4J9B A;  4AFZ C;  2LJ3 A;  2KY9 A;  4ATO A;  3OYD A;  1JJ2 P;  3GIB A;  5GAN 7;  2VVK A;  3PMI A;  2G6F X;  1AVZ C;  2ZZD A;  2CS7 A;  2V8K A;  3CXC S;  1YJW A;  2ECZ A;  2DIG A;  4VUB A;  2BZX A;  1X27 A;  1YCS B;  3L2W A;  1K9M R;  2BUD A;  4PJM A;  4BI8 B;  2Y4Y A;  3EAE A;  5GMK i;  1M3C A;  1S72 T;  2RJC A;  4E7I A;  2CKK A;  4OML A;  4BDZ A;  2CSQ A;  4HCC A;  1KFZ A;  4FW2 A;  4MZT A;  2GNC A;  5GAO m;  2NUT A;  4M7A B;  4L6V 5;  1GL5 A;  4C0G A;  4HVW A;  2X4X A;  1M3A A;  4BY6 C;  1M8M A;  4LDV A;  2GF7 A;  2ABL A;  2RH2 A;  3OY9 A;  4AFS C;  3MPU B;  2K2M A;  5CO7 A;  1WQW A;  3M0S A;  1VQ9 Q;  1UFF A;  5KH6 A;  3MET A;  1U1S A;  4ZN3 A;  3VRY A;  1VQK T;  1F1B B;  2K3Y A;  2J05 A;  2DMO A;  1BI2 A;  2VGM A;  3OS0 A;  1ABQ A;  1TXQ A;  3CC7 Q;  1G2B A;  1T3L A;  1M1K C;  2AHJ B;  2EQI A;  4M7D B;  3OA6 A;  2JJ9 A;  2JZ2 A;  1NZ9 A;  2D6F A;  4OGE A;  1M1K U;  1A0N B;  1C0M A;  2JOY A;  5GAN 8;  2DBM A;  1Y96 A;  1SEM A;  3TRE A;  2VV5 A;  1OZ2 A;  1TU0 B;  4KUL A;  3EHR A;  2CP6 A;  3L42 A;  4C8Q G;  3E19 A;  5L8R E;  2E70 A;  5GAN f;  2JS2 A;  2D0Q B;  3OYI A;  2YWW A;  2SRC A;  2OJ2 A;  3CME T;  2JW4 A;  4M77 A;  4M77 C;  4RKU E;  4M78 E;  2PZ1 A;  2MIO A;  1W2B A;  2AZS A;  2CP7 A;  2OI3 A;  2K5I A;  3TVT A;  4N4I A;  3JCM d;  1Z9Z A;  3BFM A;  2C0I A;  3JCM b;  1Y71 A;  5IXB A;  2LRQ A;  4RTU A;  2IPO B;  2K57 A;  3GOX A;  1WQ7 A;  1TUG B;  1VQL T;  4Y91 A;  4M75 E;  4LDU A;  2X35 A;  2LCL A;  4KGZ B;  4FL6 A;  1IZ6 A;  3MCA B;  3RMQ A;  3CC4 T;  2JMC A;  3CEY A;  4HKE A;  2OTJ A;  1UDL A;  1VQM A;  5J26 A;  3HTR A;  1D0X A;  2BTT A;  1VQO A;  2A0F B;  1RAF B;  1MNE A;  3MEV A;  2A7Y A;  1SSF A;  3MJX A;  4RCB A;  1NLO C;  2DEU A;  2E5K A;  3I5S A;  3BDU A;  3L2V A;  1YJ9 T;  4J9D A;  1VQM Q;  4FYW B;  5CVI A;  2DA9 A;  4KUI A;  1V1C A;  4F7U F;  1VQO Q;  4BAC A;  5A0D A;  2AKK A;  3OMC A;  1E6H A;  1KHI A;  1X01 A;  2YSQ A;  5GAM j;  3E9F A;  1WZO A;  2RO0 A;  1PWT A;  1N8R C;  1MMA A;  4PNO A;  5GAN g;  1KQS A;  2K4Y A;  2E6Z A;  4HCK A;  1JQQ A;  1N8R U;  4BY6 B;  4A54 A;  3BW1 A;  4ZNX A;  2YT6 A;  1OU9 A;  2VXF A;  1QVF P;  2HQE A;  1Q81 C;  3JB9 D;  3H41 A;  3OBY A;  1N6A A;  3HP9 A;  2DZC A;  1Q81 U;  2BZY A;  1FXX A;  1TOV A;  3CCL T;  4KBM B;  1PCX A;  3CCV A;  2WSC E;  3QDR B;  4KH0 B;  1QVP A;  1PD0 A;  3ZEH A;  4X9D A;  5L23 A; 
#chains in the Genus database with same CATH homology
 2X3X D;  2K7A A;  2AZV A;  1H92 A;  3VS7 A;  1AWO A;  1AD5 A;  2LJ1 A;  1AWJ A;  5HCK A;  2JM8 A;  2ENM A;  1GCQ A;  2A36 A;  1GCQ C;  2JM9 A;  2RNA A;  1PNJ A;  1UG1 A;  1HD3 A;  1UTI A;  2NWM A;  1X6G A;  3NMZ C;  4WCI A;  4J9G A;  2CT3 A;  1UGV A;  3ZL7 C;  2LQW A;  5IHI A;  4RUG A;  1K0X A;  1AZG B;  2P4R A;  2XMF A;  2CRE A;  1YNZ A;  2RN8 A;  4J9C A;  3UA6 A;  4RTW A;  2O9S A;  2K9G A;  1B3Q A;  4AG1 C;  1XOV A;  3LH5 A;  4HVU A;  1K76 A;  2KRS A;  4JZ3 A;  4M4Z A;  2GBQ A;  3VS6 A;  1QCF A;  2IIM A;  1WIE A;  2KXC A;  1B07 A;  2D0N A;  1SHF A;  3C0C A;  4E6R A;  4ORZ A;  1Z9Q A;  4LUE A;  2LP5 A;  2RQW A;  2NUZ A;  2HEQ A;  2PTK A;  1OPL A;  1TUD A;  1SHG A;  2L0A A;  2KRN A;  5GJW B;  4RTZ A;  2K79 A;  2RMO A;  1GBR A;  2FRW A;  3QWY A;  2LCS A;  1UHF A;  2CSI A;  2DX1 A;  4D8D A;  3REB B;  1NLP C;  2KE9 A;  1WA7 A;  3NHN A;  1AOJ A;  1YP5 A;  1NYG A;  1QLY A;  3QWX X;  1GCP A;  1JU5 C;  2FEI A;  2J6O A;  4ESR A;  2VKN A;  1I1J A;  1T3S A;  1GFC A;  1KIK A;  4D8K A;  2RQV A;  1VYV A;  1KSW A;  3NPF A;  1CSK A;  2JT4 A;  4J9F A;  4QT7 A;  2DL4 A;  5GJV B;  4CC7 A;  4DEY A;  1W70 A;  3EHQ A;  2HSP A;  4OMQ A;  1X2K A;  1M27 C;  4GBQ A;  2RPN A;  2FO0 A;  2J06 A;  2KXD A;  1BK2 A;  1G83 A;  1AWW A;  3EG2 A;  1H8K A;  1M3B A;  4F14 A;  3A98 A;  5FW9 A;  2RQT A;  1SRM A;  2JXB A;  4J9E A;  5I11 A;  1X69 A;  3O5Z A;  3RNJ A;  2A28 A;  3RBB B;  5FWB A;  1NYF A;  4Z8A A;  1SSH A;  3VS5 A;  1S1N A;  1QWF A;  2EYX A;  2EYY A;  4J9I A;  1PKS A;  1VYU A;  2EGA A;  4HXJ A;  2MCN A;  1E7O A;  3NGP A;  1U06 A;  3THK A;  1UEC A;  1SRL A;  1YWO A;  2CT4 A;  1Y0M A;  2J6K A;  3PVQ A;  5EC7 A;  3R6N A;  4OMN A;  2M51 A;  2W0Z A;  2GTO A;  2M0Y A;  2GGR A;  3VS0 A;  1VA7 A;  3PVL A;  2EVR A;  5IXF A;  1SPK A;  4RTV A;  1X2Q A;  3TSW A;  2CUB A;  1RLQ C;  1MUZ A;  3CQT A;  2DM1 A;  4K11 A;  2DNU A;  2FRY A;  1UJY A;  2B86 A;  2EKH A;  4RTX A;  1PRL C;  1UHC A;  2A37 A;  2KYB A;  2K3B A;  2CUD A;  2O31 A;  2GTJ A;  3I5R A;  2HCK A;  2DF6 A;  4RTT A;  5I22 A;  5IHN A;  2PNI A;  1NEG A;  1ABO A;  1OEB A;  1NG2 A;  3M0P A;  1WXB A;  1WDX A;  2HDA A;  2FPF A;  1FYN A;  3JV3 A;  1TUC A;  2KT8 A;  2D8H A;  1ZBJ A;  1I0C A;  2EYW A;  1EFN A;  2FG0 A;  1IO6 A;  2KEA A;  1QWE A;  2O9V A;  1WYX A;  1CKA A;  2V1R A;  2DYB A;  2A08 A;  4F16 A;  1K0S A;  4CC3 A;  1ZX6 A;  4OMM A;  2KR3 A;  3EG1 A;  2RQU A;  3VS4 A;  4J9H A;  5ECA A;  1YN8 A;  1HJD A;  4Z89 A;  4OMO A;  2H8H A;  3M0Q A;  1JXO A;  3IQL A;  2YUQ A;  3VRZ A;  2SEM A;  2LMJ A;  1OOT A;  2LJ0 A;  2ESW A;  1ZSG A;  4J9B A;  1ARK A;  2DJQ A;  1OV3 A;  4AFZ C;  2AK5 A;  1AEY A;  2DIL A;  2O88 A;  2KRO A;  2LJ3 A;  2FPE A;  4AG2 C;  1VYT A;  1JO8 A;  2VVK A;  3VS1 A;  2JMA A;  2G6F X;  3H0F A;  1AVZ C;  2DVJ A;  1LCK A;  1U5S A;  3UF4 A;  2ECZ A;  3H0I A;  3GBQ A;  3SHW A;  2BZX A;  1X27 A;  1YCS B;  2YDL A;  4JPB W;  1GFD A;  3H0H A;  3U23 A;  2LQN A;  1PRM C;  1M3C A;  4JJD A;  3I35 A;  1WXU A;  2L3S A;  4OML A;  1WX6 A;  2O2O A;  4RTY A;  1UUE A;  1I07 A;  2CSQ A;  2L3Q A;  3EG0 A;  1KFZ A;  1CKB A;  2F2X A;  2GNC A;  2L2P A;  1ZUY A;  1WLP B;  1X43 A;  1M30 A;  2ED1 A;  3M0U A;  1GL5 A;  4HVW A;  1N5Z A;  1M3A A;  1AWX A;  1NEB A;  2J7I A;  1M8M A;  2ABL A;  4AFS C;  1GRI A;  5IHK A;  2K2M A;  2YUO A;  3M0S A;  1W6X A;  2LNH B;  1UFF A;  1UE9 A;  4A63 B;  2DL8 A;  2X3W D;  4Z88 A;  3VRY A;  2EYZ A;  4DEX A;  2CH4 W;  3FJ5 A;  2J05 A;  2HBW A;  2DMO A;  1X6B A;  1ABQ A;  4OMP A;  1G2B A;  1K9A A;  1T3L A;  2EQI A;  2EGE A;  2KYM A;  1A0N B;  1WI7 A;  1W1F A;  1ZUU A;  2DBK A;  2V1Q A;  2DBM A;  2KGT A;  2CH4 A;  1SEM A;  2J6F A;  1WFW A;  2KT1 A;  4LNP A;  3TSZ A;  2ROL A;  3EHR A;  1UJ0 A;  1K4U S;  2JTE A;  1T0J A;  2JS2 A;  2DLP A;  2MOX A;  1T0H A;  3VS3 A;  1GBQ A;  1MV0 B;  2SRC A;  2OJ2 A;  3M0R A;  2JW4 A;  1AZE A;  4JJB A;  1WXT A;  1KJW A;  4Y92 A;  5FWC A;  1TG0 A;  2PZ1 A;  2MIO A;  4LUD A;  2AZS A;  2OI3 A;  1BU1 A;  1RUW A;  3TVT A;  1Z9Z A;  2EPD A;  2C0I A;  3I9Q A;  5IXB A;  4R0K A;  1PKT A;  4RTU A;  1QKX A;  1QKW A;  1ZLM A;  1ZUK A;  1BBZ A;  2FPD A;  1PHT A;  2OAW A;  2I0N A;  4LN2 A;  4AFU C;  2EGC A;  1U3O A;  4HVV A;  2EBP A;  2DL7 A;  1J3T A;  2JMC A;  2ED0 A;  2DRM A;  4EIK A;  1UDL A;  1E6G A;  5IH2 A;  4KRT A;  3M0T A;  2DRK A;  2LX7 A;  2BTT A;  4CC4 B;  4AFQ C;  1JXM A;  1MV3 A;  2KBT A;  2DE0 X;  1K1Z A;  1NLO C;  2E5K A;  3I5S A;  3EG3 A;  4J9D A;  1OPK A;  1RLP C;  2DA9 A;  2F2W A;  2F2V A;  1V1C A;  3UA7 A;  3SEM A;  4IIO A;  2W10 A;  4IIM A;  2AKK A;  2C0T A;  3KFV A;  1E6H A;  1RI9 A;  2YUN A;  2YSQ A;  1YWP A;  2CDT A;  2ROT A;  4JZ4 A;  1PWT A;  3VS2 A;  4HCK A;  1JQQ A;  4X1V A;  2L3P A;  3PE0 A;  2C0O A;  2JS0 A;  2AKL A;  2K6D A;  3ULR B;  1H3H A;  4ZNX A;  1BB9 A;  2DL3 A;  2KNB B;  1HSQ A;  2YT6 A;  1NM7 A;  2RF0 A;  2QDL A;  2GQI A;  2VWF A;  2D1X A;  2EW3 A;  4F17 A;  3H41 A;  1FMK A;  2YUP A;  4FSS A;  4JJC A;  2KRM A;  1Y57 A;  2BZY A;  3REA B;  4LE9 A;  2D8J A;  1JEG A;  3UAT A;  2DL5 A;  3EGU A;  4GLM A;  2RQR A;  2LZ6 B;  2BZ8 A;  4CC2 A;  5L23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...