1J3TA

Solution structure of the second sh3 domain of human intersectin 2 (kiaa1256)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
b'GSSGSSGVENLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intersectin 2
molecule tags Endocytosis/exocytosis
source organism Homo sapiens
publication title Solution structure of the second SH3 domain of human intersectin 2 (KIAA1256)
rcsb
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2003-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1j3tA00
2EPDA 2DBMA 4CC4B 3NHNA 4RTTA 2GTOA 1M3BA 1ZUKA 4M4ZA 3UATA 1XOVA 1BB9A 1U06A 1UDLA 1SHFA 1PRMC 1X6BA 1A0NB 1FYNA 2A28A 3PVLA 1KJWA 3NGPA 4IIMA 3NPFA 4AFQC 2LJ1A 4AG2C 1NEBA 3SEMA 2KYMA 2NWMA 3VRYA 4ORZA 2K3BA 1GBRA 2K6DA 2J06A 4IIOA 1JU5C 4F16A 1ZX6A 4LNPA 1JO8A 4JZ4A 3TSWA 2FRWA 3M0QA 1WFWA 3M0TA 2RN8A 2AKKA 2L3PA 1X27A 1E6GA 1YWOA 1K1ZA 1SSHA 1K4US 4J9EA 2LQNA 2GTJA 2FPFA 2SRCA 1UGVA 4OMMA 2K7AA 2FEIA 4RTXA 2X3XD 1JXMA 2DF6A 2O9SA 2O31A 2D8JA 4HVWA 1X6GA 2CSIA 3O5ZA 2JT4A 1CKBA 3LH5A 4RTYA 1UE9A 2HEQA 1MUZA 3VS5A 2W0ZA 2PNIA 2ENMA 1BK2A 1Y57A 3QWXX 2LCSA 1W6XA 1HSQA 1YNZA 1GRIA 2AK5A 4J9IA 4AFUC 4J9FA 2LX7A 1K0XA 3M0PA 1X69A 2DL8A 2AKLA 1NM7A 4JPBW 1JQQA 1G83A 2GGRA 1M8MA 2DMOA 2IIMA 2JW4A 2DL5A 2RPNA 3I9QA 1GBQA 1T0JA 2CUBA 1I1JA 1KIKA 1UFFA 1FMKA 2DL3A 2A36A 2EQIA 1IO6A 4LE9A 2DLPA 5I11A 1E7OA 5IHKA 2DRKA 1NYGA 2HBWA 2W10A 1AZGB 4J9HA 4DEXA 3CQTA 4J9GA 2ED0A 3VS7A 4RTZA 2FO0A 4A63B 3VS6A 2RNAA 3EG3A 4D8KA 2OJ2A 3EG0A 1GL5A 2L3SA 2DM1A 2G6FX 2V1QA 2VWFA 3I5RA 2HDAA 4Y92A 2GQIA 1ZBJA 2HCKA 1RLPC 3RBBB 3IQLA 2KT1A 4QT7A 1SEMA 2CH4W 4OMOA 3JV3A 4X1VA 2A37A 1BU1A 1OEBA 1B07A 2EW3A 1X43A 1HD3A 3VS1A 4RUGA 1WIEA 1NLPC 2BTTA 1QKXA 2RQTA 2JTEA 1PWTA 4J9DA 1RLQC 1M3AA 3M0RA 2JMCA 2KRNA 1ZSGA 5GJVB 3UF4A 1WDXA 5I22A 2LJ0A 1T3SA 2KEAA 1TUCA 5HCKA 2YT6A 1TUDA 1CKAA 3GBQA 2LQWA 4Z88A 1H8KA 1PNJA 2ED1A 4JJDA 3ZL7C 4F17A 1YWPA 4J9BA 3VS3A 2C0TA 3PVQA 1VYTA 1HJDA 2M0YA 3ULRB 1NYFA 1W70A 1PHTA 4HXJA 1N5ZA 2YUPA 1AZEA 1ZUYA 2KRSA 1BBZA 2KXCA 2OI3A 2RQWA 1X2KA 2EGEA 2ECZA 1JEGA 2PTKA 1V1CA 1KSWA 2ROLA 2VKNA 1AD5A 2KBTA 3R6NA 1RUWA 4LN2A 1AWWA 2DRMA 1OPKA 2RF0A 1H3HA 3A98A 1M30A 5IXFA 4LUEA 4D8DA 1H92A 2L2PA 2C0IA 3TVTA 4EIKA 1WI7A 2YUNA 2K2MA 2CH4A 2FPEA 1CSKA 2SEMA 1AWJA 2LNHB 5EC7A 2KE9A 1QKWA 1QWFA 1WXBA 3RNJA 4JJCA 5ECAA 3EHQA 4KRTA 2YUOA 2F2VA 2CREA 3NMZC 1NEGA 1GFDA 3I35A 5IXBA 1UG1A 2FPDA 3FJ5A 2DA9A 2JM9A 2ABLA 2CDTA 1WYXA 3H0FA 1UHFA 1T3LA 1KFZA 2YUQA 4AFSC 2DX1A 2PZ1A 2L0AA 3M0SA 3VS4A 2EGAA 1VA7A 2DBKA 2J6OA 2KT8A 2EVRA 5FWCA 2E5KA 4CC2A 2CT4A 2D0NA 2JM8A 1GFCA 1M3CA 1VYVA 4CC7A 2MCNA 2AZSA 3EG2A 3TSZA 1OV3A 2BZXA 2LP5A 1QWEA 2BZYA 2D8HA 2I0NA 1E6HA 1G2BA 2DVJA 4GBQA 5FWBA 5IHNA 5IHIA 3QWYA 1Y0MA 2DYBA 2V1RA 2EYWA 1YCSB 1WXUA 4DEYA 1TG0A 1M27C 3EHRA 2J6FA 2GNCA 4E6RA 1NG2A 3C0CA 1NLOC 2J7IA 3U23A 2MIOA 2F2WA 1UTIA 4LUDA 1UJYA 1AEYA 1T0HA 1QCFA 4HVVA 1PRLC 4JJBA 1SRLA 4K11A 3REBB 1AWXA 2MOXA 4RTUA 5GJWB 4Z89A 2XMFA 2BZ8A 1GCQA 3VRZA 1YP5A 2EGCA 1ZLMA 4OMNA 2J6KA 1OOTA 2KYBA 1B3QA 2KXDA 2QDLA 3THKA 1SHGA 2D1XA 4AFZC 1U3OA 1ABOA 4CC3A 2P4RA 2YDLA 2CUDA 1AVZC 1K76A 1AWOA 1X2QA 2O88A 2YSQA 3KFVA 3PE0A 1SRMA 4R0KA 2EKHA 1JXOA 2RQVA 2FRYA 3M0UA 4WCIA 2ROTA 1UJ0A 5L23A 2F2XA 2LJ3A 2KROA 2M51A 3EG1A 1K0SA 3H0IA 1PKTA 4OMPA 3UA7A 2AZVA 4Z8AA 2LZ6B 2A08A 2DJQA 2VVKA 1S1NA 1ZUUA 2JS0A 2JS2A 1K9AA 2CT3A 2FG0A 2KRMA 4F14A 1Z9QA 2NUZA 1UECA 4ESRA 1UHCA 2RQRA 2EBPA 2DL4A 4J9CA 1UUEA 5IH2A 4RTVA 2JXBA 3I5SA 1GCQC 2B86A 3H0HA 1I07A 2HSPA 1ARKA 1J3TA 3SHWA 1WXTA 1VYUA 5FW9A 2DILA 2O9VA 2KNBB 1WX6A 4ZNXA 4OMQA 2RMOA 4GLMA 2CSQA 1LCKA 4HCKA 3VS2A 1W1FA 3REAB 1GCPA 4AG1C 2OAWA 1SPKA 2C0OA 2EYXA 4FSSA 2KGTA 1WA7A 2DE0X 2LMJA 1YN8A 3UA6A 1WLPB 2L3QA 3H41A 2K9GA 1Z9ZA 2GBQA 1QLYA 2ESWA 1MV3A 2J05A 1ABQA 1EFNA 2K79A 1MV0B 1I0CA 4OMLA 4RTWA 3VS0A 1RI9A 2EYZA 2DNUA 3EGUA 1PKSA 2EYYA 2DL7A 2X3WD 2H8HA 2RQUA 4JZ3A 2JMAA 2O2OA 1U5SA 1AOJA 2KR3A 1OPLA 4HVUA
chains in the Genus database with same CATH superfamily
3BW1A 5CCAA 5GAMg 1Y96A 5GAMd 1YITA 1I5OB 3X24B 4M7DF 3LWHA 2PVOB 2Y4YA 1YHQA 9ATCB 4PJOD 2A28A 3ZEHA 1Q82U 1BCMA 2R5MA 4M77F 2KYMA 3SEMA 5GAOm 2NWMA 3M56A 3VRYA 1RAGB 4MMKA 3UPUA 3A1PA 3NTIA 1IGQA 2QQ9A 4JLGA 1N6AA 1YJNQ 3EFSA 4BI8B 2VGMA 5KE2A 2XG8D 4LNPA 5LJ3h 3VUZA 1JO8A 3G7ZA 3OYGA 2GFAA 2FRWA 3UDCA 3M0TA 1OZ2A 1UGRB 4XU3A 1WHJA 1M90C 1KHIA 1E6GA 4RG8A 1K4US 4J9EA 2M16A 2KAFA 4C92A 5LJ5d 3EFRA 2FPFA 4BDYA 3CC7T 1UGVA 4OMMA 3CCLQ 1YIJQ 4RTXA 1N8RR 2R5AA 2QTVA 4DQ2A 2JT4A 3UT1A 3GIBA 3EG9A 3CCEA 3GOXA 2W0ZA 3JB9I 3RKXA 2VYTA 4HT8A 1BK2A 3CMAQ 1EX4A 1N27A 4C92E 1YNZA 5CKEA 3OSVA 4M77C 4J9FA 1VIEA 1K8AR 1GXIE 3VV0A 1I81A 1WHLA 3TCJA 5EG2A 2AKLA 4A4EA 1NM7A 5GAMh 4JPBW 4DBHA 1G3TA 3V7CA 1JQQA 3JB9D 3OB9A 2HL5C 1M1KR 5GMKe 1QVGA 4C8QG 2RPNA 2FZKB 5CVIA 2M0OA 1M1FA 1WJSA 1G3WA 2QXFA 1KIKA 2OTJQ 1UFFA 1FMKA 2EQIA 1IO6A 2X35A 4LE9A 3SD4A 2DRKA 3AT1B 3JCMP 4HT9A 3X28B 1W2BS 4HCZA 2PQWA 3QPHA 4J9HA 4DEXA 3DB4A 1S72Q 2ED0A 5CKHA 3CCMQ 1VQ6T 2HAXA 2EQJA 1GL5A 1MMGA 1NZ9A 2HDAA 4Y92A 2E64A 1OULA 1QVGS 4QVCA 5I2SA 3RBBB 2YRDA 2KT1A 1NPPA 3CCSA 5GAOn 1SEMA 5DLOA 1D3BB 2RHYA 3OYKA 4M78E 2A37A 1BU1A 1NE8A 2PUOB 3C12A 3RDVA 3VS1A 3CMAA 3JCMc 1RAAB 4ZGDB 2BTTA 3JB9H 2FYKA 4J9DA 4KUIA 1RABB 1M3AA 2RI2A 3S3MA 2KRNA 1ZSGA 2E10A 3E9FA 3UF4A 4IUQA 2LJ0A 5KYWA 3PGGA 2DO3A 4C92B 3L2QA 3GBQA 3JCMh 4EMKC 2ED1A 4JJDA 1YFNA 2EJGA 2C0TA 4ZTJA 4XK8E 1PHTA 2AHJB 1N5ZA 4NL3A 2YUPA 1ZUYA 4GLKA 2KRSA 1BBZA 2OI3A 1X2KA 5FRNA 3V8JA 2D9TA 4M7DA 2PTKA 4BI3A 3GLXA 4M78G 2KBTA 3OMGA 3R6NA 1VQMQ 1RUWA 3I56A 3M59A 1IGUA 1M90R 1Y7XA 4V2SA 4OGCA 8ATCB 3S3OA 1H3HA 2WACA 2OAUA 1PD1A 1M30A 5M9OA 2MMPA 3MHXA 1VQKT 5DY9A 3QXEB 3TVTA 4EIKA 2DJZA 2DXTA 1AWJA 4M75C 2O01E 2KE9A 1WXBA 3BDUA 2WSFE 1YBYA 1M9SA 1UGQB 2CREA 4X9DA 2DAQA 1UG1A 3NTHA 4LDYA 4JRKA 4FM4B 2PUKB 1ZSZB 3CXCS 3CCRT 4IURA 2HQXA 1UHFA 4AFSC 1JB0E 3OA6A 2COYA 2DX1A 2PZ1A 2L0AA 2JOYA 1YJWT 1VA7A 3H9NA 2E3IA 2R57A 2E5KA 4CC2A 2D0NA 2MAMA 2F5TX 1GFCA 1VYVA 2AZSA 3EG2A 5FU6B 1VQNQ 2CZ0B 2BZXA 2LP5A 3C95A 1VQ9A 2I0NA 1YJ9A 2GFUA 3DLMA 5FWBA 5D6YA 5GAN2 3M57A 2E5QA 3QZ9B 1YCSB 2A0FB 2GNCA 3EGDA 2BIVA 1NG2A 3SDZA 3CCMT 1VQ6Q 3HRTA 2VC8A 5I21A 2F2WA 4LUDA 2EFIA 4E7ZA 1VQLA 1QCFA 4JJBA 1VQOA 1WPYA 1SRLA 4C8QC 2CP5A 1AWXA 3OYEA 1C0MA 4LD6A 3M54A 3MEVA 2VASA 2DIGA 3WVEB 5GJWB 4Z89A 2BZ8A 1GCQA 2M1HA 3VRZA 4R55A 5CKBA 4OMNA 2RB6A 1B34B 2DZ9A 2RK1A 4E7IA 1VQPT 2KYBA 1KD1C 1BYMA 4PLLA 3MEWA 2X4WA 1VQ5A 3DB3A 2RJDA 5D6WA 3LLRA 3OYBA 2XDDA 1VQ4A 3JCMJ 2YDLA 2CUDA 1AWOA 1SSFA 2LDMA 3OYHA 1Q86R 1JXOA 2RQVA 3M9QA 3CMAT 2DTHA 2FRYA 2COWA 4RCBA 1YIJA 1M1KU 1TSFA 1UJ0A 3S3NA 2LJ3A 4OF1A 5CQXA 2RI5A 1LNXA 2M51A 3EG1A 4XQ3A 2DVEA 2XK0A 1K0SA 1PM3A 3EFOA 4OMPA 4MMLA 2EYQA 3I56Q 1G3SA 5GANg 2VVKA 1VQ6A 2JS0A 1UGSB 2WSCE 5LJ5j 4IUUA 2CT3A 3OYLA 2YWWA 1QMCA 5CKDA 1UHCA 2EBPA 2M02A 1UUEA 5IH2A 1YITQ 2KY9A 2HSPA 4JJNK 3SHWA 1WXTA 2VXEA 3MP6A 2RJFA 2E6NA 3KXTA 2E4HA 2KNBB 2QYZA 3CC2Q 1HXDA 2L89A 2RMOA 3M55A 3CCJT 3RMSA 4HCKA 3LWIA 3REAB 4BE1A 4AG1C 3WXMB 4FSSA 5GANf 1S72A 2KGTA 2ZPBB 3OW2P 4BE2A 3UA6A 1KC8U 1WLPB 3H41A 3OQ5A 1Z9ZA 3MJXA 2ESWA 1YI2A 1EFNA 3G71A 3CC4Q 1I0CA 1UGPB 4OMLA 4UC4A 2XDBA 2EYZA 2DNUA 2H8HA 2CP0A 1U5SA 3RERA 2QA4T 1BI1A 2DBMA 5KCOA 2GTOA 1M3BA 3SFMA 1XOVA 4OB3B 4JRIA 4OB2B 1UDLA 3HFNA 2QEXT 1VQ7A 2P0KA 1SHFA 4VUBA 5GAOq 1K9MR 1A0NB 4M75E 1KJWA 3NGPA 4IIMA 4AFQC 2LJ1A 4AG2C 1NEBA 3AHUA 3PIOA 4ORZA 4FT2A 5J26A 2K6DA 4M7AC 1WHHA 2DTIA 2A3LA 2J06A 1M1KC 2VGNA 4IIOA 3ZFJA 2DETA 5KYWB 1JU5C 1LPLA 2BE9B 3QJYA 3OMCA 1RAIB 3TSWA 3M0QA 2KDSA 2RN8A 1W2BA 2L3PA 4DOWA 4KGZB 1YI2Q 1TUGB 2GTJA 2IVWA 1N9SA 1Y96B 2RH2A 4A53A 2K7AA 2X3XD 2DF6A 3TREA 5GANd 1QQJA 4OP0A 4LDXA 4HVWA 3ASKA 1KQSP 2CSIA 1RAEB 2KK4A 3O5ZA 2LQ8A 1CKBA 3BY7A 4E7JA 3LH5A 4RTYA 3LGLA 1MUZA 4P5NA 4N4HA 3FC3A 2CP7A 1ACMB 1HSQA 3CEYA 1C6VX 4NS5A 4AFUC 2X4YA 1K0XA 3M0PA 1XQHA 1ZSZA 3RKWA 1D1BA 1G83A 2DMOA 3VYHB 1OX8A 4FCYA 2DL5A 4M7DD 1KHCA 1GBQA 1T0JA 5D6XA 2LCCA 1IHVA 3OSSC 4PK4A 4LDUA 4M78C 5KYNA 2MWOA 5CQYA 1Y07A 3PFSA 5I11A 5IHKA 4WTOB 4C5GA 2W10A 1AZGB 3V7RA 3CQTA 4J9GA 2MPXC 5A2QE 2FO0A 4A63B 3J7AF 3EG3A 4XU0A 4D8KA 5HK0A 2OJ2A 4PJJA 1VQ9Q 2DM1A 2G6FX 3M5AA 2HCKA 4OVAA 3CC4A 3CCEQ 3IQLA 3A8LB 3RMQA 2CH4W 3JV3A 4C0DC 2V26A 3CD6A 4A54A 3J81E 1X43A 4XTVA 4ZGJB 1ZHIA 1WIEA 1QKXA 2JTEA 1HK9A 3JCMb 5KE3A 1K8AU 4HCBA 4PJOE 2JMCA 3A8GB 5C6SA 4PL6A 5GAN7 2RHZA 3KUFA 5I22A 1T3SA 2KEAA 1AT1B 2C06A 1TUCA 5HCKA 1P92A 1CKAA 3V8KA 3OYFA 1YHQQ 2Z0WA 1PNJA 3ZL7C 4J9BA 2LCLA 1HJDA 4FL6A 2LQKA 3CCST 1NYFA 1KQ2A 2A7YA 1AZEA 2P0PA 2NUPB 4Y91A 2RHIA 2XDPA 2EGEA 2ECZA 4F7UF 4BD3A 3JB9G 2K5LA 1KSWA 4E7HA 4F7UE 2ROLA 4LXCA 1AD5A 5CKFA 1MMAA 3CCLA 4LN2A 3GNFB 1VQ9T 2LTOA 3J80E 3C94A 5IXFA 4M7AD 4LUEA 4D8DA 1H92A 1XTDA 1PSEA 2C0IA 3QDFA 3H6ZA 5KYYA 4PJOB 5A0DA 1MNEA 1WI7A 3MP1A 3QUIA 3VKIA 1TH7A 5CIUA 4FW2A 4O6JA 2LNHB 5EC7A 2MK5A 1QWFA 4A4HA 3G4SQ 3ER0A 2EAYA 3HL8A 3M53A 1VQLQ 2CP6A 2F2VA 3CBMA 4EPCA 3CCQQ 4N4GA 4AMCA 1GFDA 3I35A 4A4GA 3L2WA 3L2UA 3G1JA 3F70A 2JM9A 1WYXA 1NPRA 3EH1A 1KFZA 1IHWA 4BY6C 3TQ7P 1TOVA 2K5FA 4D6WA 5GMKm 2OTLA 4ZGEB 3JCMV 2J6OA 1NJIC 2EVRA 4Q5WA 2HL3A 3HHTB 2CT4A 4C92C 3G71Q 3OS1A 5IN1A 1U1TA 1M2OA 1PSFA 3TEEA 3DKMA 1I5LA 2MCNA 2MYSA 2BZYA 5IHNA 1VQMT 5IHIA 4F7UA 3QWYA 3HKSA 4PJOG 4DEYA 1JRIA 1TG0A 1YI2T 1NJIR 4PFZA 4E6RA 1O9SA 1QVFA 1NLOC 1X75C 1Q82C 2MIOA 3G4SA 1UTIA 3QKJA 2VXFA 1LJOA 1T0HA 4HVVA 1VQ7Q 1K73U 4ATOA 3LW5E 4AT1B 4M7DC 3REBB 4FYXB 2JJ9A 2MOXA 1RL2A 4LDWA 1VQ8Q 3RESA 1FX7A 1YP5A 2EGCA 4C5HA 2J6KA 4QQ6A 3INZA 4IUTA 2IG0A 2QK0A 1VIFA 2OX7A 1WJRA 2JTFA 1SHGA 4AFZC 1TXQA 1YCYA 4XTZA 1ABOA 5GAOl 3HTRA 3A5ZB 1ZQ1A 2O88A 2DD4A 3KFVA 1SRMA 1WHMA 2EKHA 1RACB 1YITT 3M0UA 4PFOA 2ROTA 4XU2A 3PTAA 3QYGB 3CMET 1YJ9Q 1M4ZA 3PT9A 3JAME 2JNGA 3PMIA 3QHSA 3H0IA 2CS7A 4A4KA 1FXXA 2QAZA 4Z8AA 3L2ZA 2DJQA 3CCVQ 1S1NA 3OYNA 1ZUUA 1K9AA 2FG0A 2KRMA 1KD1R 2NUZA 1UECA 2CGHA 3VYGA 3PIPA 2RQRA 1BI3A 5FU6C 2JXBA 1GCQC 4XTXA 1X01A 1I07A 2NYSA 2VB6A 2XHCA 3EAEA 4QQDA 5CAIA 2DILA 1OU8A 1HYOA 4E7SA 5FU7B 4OMQA 4GLMA 5GMKh 3VS2A 4JS4A 2HD0A 2M9UA 1GCPA 1MMNA 2C0OA 1D09B 2DK3A 4R56A 3MKDA 3I55Q 2CKKA 1WA7A 2LMJA 2DYIA 3MPUB 3URGA 1WNLA 4C8QB 3CCMA 2BE7D 2LC4A 4NOYA 1YN8A 1D0XA 2L3QA 2K9GA 1I8FA 1ABQA 3JRZA 1W2BP 4RTWA 2O4XA 5D7UA 2GF7A 1IREB 2FHDA 1OYXA 3UWNA 2X9HA 3CCJA 4ZN3A 1O75A 2DL7A 2DXUA 3QYHB 1QVPA 1AOJA 1QVFS 2K3YA 4GY5A 4Z02A 4XTWA 2GQVA 3NHNA 4RTTA 1ZUKA 1VQ8T 1BI0A 6AT1B 3OS2A 1VQNT 3M4GA 3FLGA 3UATA 2RO0A 3VU3C 1BB9A 3CCUT 3EGXB 2EIFA 4M7AE 1UB4A 3ME9A 2QQSA 1X6BA 2RI3A 1FYNA 2FB7A 2QDYB 2NUTA 7AT1B 2ZZDA 1GBRA 5FRMA 3OYDA 1D1CA 3P8HA 2PVGB 4N4IA 2JVVA 5DM7R 3NFCA 3C4SA 1M2VA 4JZ4A 1PG5B 4FYWB 1X27A 1OU9A 4PJNA 1K1ZA 1SSHA 5LJ5g 4PJOA 3CXCA 2HKQB 5KYUB 4J6YA 1LVKA 3GNGA 2FEIA 1JXMA 2O9SA 4E47A 1M2VB 2D8JA 3VUBA 3GP8A 3RR6A 4N0AA 4EMKB 5KCHA 1KG1A 1UE9A 2HEQA 3EFOB 2PNIA 1Y57A 5GAN3 1W6XA 1GRIA 3VJPA 3FEOA 2I2LA 1TS9A 1ZA2B 1X69A 2O4XB 2DL8A 3HSBA 3QBYA 3E1SA 1QCOA 2GGRA 1B7TA 1ZA1B 2F69A 2IIMA 1QVGP 4NL2A 4YTLA 2E41A 2E6ZA 3M58A 4XTUA 5IT9E 1QW1A 4KH0B 1IRXA 4KGVB 2D0QB 2V8IA 2DL3A 4C8QF 2H3EB 5GANe 2A36A 2DPPB 2RK2A 4JDSA 1F1BB 3OYJA 3CC4T 5LJ3d 3L2RA 3VS7A 4RTZA 3JCMd 1Q7YR 3G6EQ 2RNAA 4J7IA 2RD1A 3I5RA 4C8QA 4IUPA 1S72T 5CR2A 2DERA 1RLPC 2X51A 3G71T 3QZ5B 1MHNA 3HRUA 2HQHA 4QT7A 3E19A 4OMOA 4X1VA 2OTJT 1D0YA 2MWPA 3A8OB 2EW3A 1OI1A 4Y28E 4ZTFA 1QP3A 3QSUA 1NLPC 3CPFA 2RQTA 2JTMA 4M75G 3OYMA 1PWTA 1RLQC 1K9MU 3M0RA 3P8BB 4M77D 3JCMf 5GJVB 1WDXA 4EDUA 2P0QA 4QW2A 2XU8A 2GCXA 2KI7A 2LQWA 5GAN4 1Q86U 4F17A 1YWPA 2ZPFB 3VS3A 1VYTA 4MZPA 2M0YA 4E7KA 3MP8A 3ULRB 4M77B 3BDLA 4M7AF 2PU9B 2KXCA 2RQWA 5C0MA 2QGFB 5GMKi 2HMAA 4QVZA 2OTLQ 1V1CA 2QA4A 3OS0A 3I55T 3CBOA 3V8LA 2HZYA 2WSEE 1WGSA 4JRPA 4M7AA 1AWWA 2DRMA 2NUPA 3CCVA 2LRQA 1R77A 4HKEA 4J7FA 2L2PA 1WHKA 2QQRA 4O5VA 1VQPQ 2L8DA 2K2MA 2CH4A 1H641 2FPEA 2L3RA 2SEMA 4B9XA 5ECAA 4F7UB 1XNIA 4KRTA 4X34A 2YUOA 2DD5A 1Q81U 2QGGA 3SWNA 3NMZC 2KMTA 5LJ5h 4CI0C 4C0ZA 2DEQA 2IPOB 4M7DB 1BIBA 2DA9A 1D1AA 2ABLA 3NTKA 5GAN5 3CPWA 3P8DA 1QVFP 2ZAEA 3CC7Q 2K3XA 3HFOA 2PVDB 1T3LA 2YUQA 2P4TA 5LJ3g 4IUVA 2VV5A 1LOJA 5KYXA 3M0SA 2R58A 1QCNA 2DBKA 5A0GA 1V76A 4M78F 1YJNT 1VUBA 4C8QD 2JUFA 3MO8A 3TSZA 1OV3A 1VQ4T 1RADB 2E12A 1JJ2S 2D8HA 1G2BA 2DVJA 3SWNC 2DFUA 2DYBA 2V1RA 2KQWA 2EYWA 3LX7A 5A0LA 3X26B 1WXUA 1M27C 4M75B 3EHRA 2YHTA 3CBPA 1R8OB 4C0FA 3G6ET 1JBMA 2ATCB 3PMTA 3U23A 4X9CA 2K5IA 1UJYA 1AEYA 2QEXQ 1PRLC 3FJPA 1RAFB 1KQSA 2DKGA 2CP2A 3CPWS 4ELYC 4C92D 1KK7A 1X6OA 3OBYA 1OOTA 4BI4A 1PC0A 2KXDA 2LVMA 4KBMB 4OB1B 4KUDK 3THKA 1Q82R 3E9GA 4CC3A 2YLBA 5HK3A 5FU7C 1AVZC 1K76A 2YRVA 1X2QA 2NUTB 2YSQA 2YRCA 2V8JA 3OYYA 3PE0A 5LJ3e 1VQKA 3EGXA 1RI0A 5DLQE 4WCIA 3A8HB 5L23A 2F2XA 4LD9K 4C92F 2KROA 4IKFA 1H3ZA 4RMOA 2QA4Q 3QDRB 2LT4A 2XKOC 1PKTA 1NJIU 2AZVA 4WF2A 5LJ3f 4C0GA 2A08A 1WQWA 3CCJQ 1G5VA 5GMKl 1DJ7B 2JS2A 2L5QA 4PJLA 3CCUQ 3GPLA 3V7SA 1G3YA 1Z9QA 1VQPA 4M78D 1M90U 4PFPA 1TWBA 4BUGA 3JCMQ 2YXYA 1N9RA 1JJ2A 1W4SA 4KH1B 2XI9A 2B86A 3H0HA 3OYAA 4BACA 1ARKA 1EIFA 1BIAA 1VYUA 1BCOA 4PNOA 3KBGA 4QVDA 3HPWA 2RJCA 4ZNXA 5GAN8 2XD0A 3MEUA 4FYYB 1W1FA 1VQ4Q 2QASA 2ZPIB 2D6FA 1SPKA 3EGDB 4II1A 1VOMA 5LJ5e 2DE0X 4L59A 4E7LA 1Q81C 3WVDB 4F04B 3S6WA 1QLYA 2G3RA 1D3BA 2F5KA 3LH0A 1MV0B 4DA4A 3QJ6A 3CCSQ 3QO3A 2OTLT 4J6XA 1RI9A 1TTHB 3EGUA 3FB9A 4OGEA 1WQ7A 1IZ6A 2DEUA 1PCXA 4EMKA 5AT1B 3I56T 2X3WD 1R0CB 3RUXA 5GAN6 2O2OA 4N0AC 2K79A 4HVUA 2HNIA 1Y71A 1IB8A 1XJWB 2EPDA 3CCUA 4CC4B 2DTOA 2XICA 3OYCA 4XAXB 1C1AA 4M7DE 4M4ZA 1VQ5T 1Q7YC 1OX9A 5GANh 2CP3A 1U06A 1SKUB 4JRQA 5KYUA 3JCMg 1PRMC 4JLIA 3PVLA 2RA2A 3NPFA 3N5BB 4B6MA 3CCVT 2E70A 4E2FB 2K57A 2K3BA 5LL6S 4BB7A 2KSSA 1U8RA 2Y90A 3T9NA 4F16A 1VQ5Q 1ZX6A 3R6OA 2FZGB 2VUBA 1WFWA 4M7AG 2AKKA 1Q81R 2ZGWA 1YWOA 4DOVA 3CCLT 4RKUE 4DBFA 3DLLA 2LQNA 3PNWC 2SRCA 1VQMA 1YJWQ 2O31A 3OYIA 1X6GA 4FIBA 4L6V5 5GAMj 4PJMA 4QQGA 2X4JA 3CCET 2QQAA 1PD0A 2RJEA 3VS5A 3CMEA 1MMDA 1K73C 3MCAB 2ENMA 2EQUA 4C8QE 3E2UA 3QWXX 1B34A 2LCSA 4C5IA 3OS5A 2NLUA 5GAMe 4ZN1A 2AK5A 4J9IA 4PLIA 2E3HA 4LDVA 2LX7A 4MZTA 4PKCC 1SG5A 3CD6T 5GANj 2K2VA 1M1GA 1M8MA 2DIQA 2JW4A 1ZBXA 3I9QA 2CZ7B 3M4YA 3LYIA 2CUBA 1I1JA 3JCMX 4HCCA 3X20B 3MEAA 5AYFA 2DLPA 1E7OA 1NYGA 2BKDN 2HBWA 1KC8C 3JB9F 4PJOC 1Q86C 1FMWA 3I55A 4FT4A 2XIDA 3HRSA 5HKCA 3VS6A 1VQNA 3JSCA 1D0ZA 1Q95G 3EG0A 2L3SA 4OB0B 2V1QA 2VWFA 1N8RC 4FSXA 5LJ5f 5LJ3j 2GQIA 1EZZB 4MDWA 1FWZA 1ZBJA 4M7AB 3QIIA 1OQKA 3HP9A 1KC8R 3JCMW 2EQKA 1OEBA 1B07A 2JN0A 5HY6A 4KULA 1HD3A 4RUGA 3CCQT 1KQSS 4M75F 4QKUA 1VQLT 2BUDA 3TU4K 4M77A 5I2MA 1VQOQ 4KGXB 4EMGA 2QI2A 3O8VA 2CZ6B 2Y4XA 1VQ8A 1R0BG 2CZ1B 5J39A 2YT6A 1TUDA 4Z88A 2RHUA 1H8KA 4M78B 1BI2A 4TVRA 3PVQA 2OTJA 1WZOA 3CC7A 1N8RU 1W70A 4J5YA 4HXJA 2DZCA 5GMKj 1YJNA 4FU6A 3FIFA 1VQKQ 3G4ST 4PJOF 3EG9B 3L42A 5J3BA 2YLCA 1JEGA 4XU1A 5FROA 2VKNA 2HSEB 3JB9J 4C0DB 1OPKA 2RF0A 1KD1U 1K73R 3A98A 3CD6Q 2F1LA 4ELZC 4BE0A 1YHQT 2RHXA 3SWNB 2YUNA 3OY9A 3CPWP 2AT1B 1CSKA 1QKWA 3RNJA 4MZMA 4JJCA 4A4FA 3EHQA 4XTYA 1SF9A 3L2VA 1MGQA 1NEGA 3CC2A 5IXBA 1RAHB 2FPDA 3FJ5A 3LGFA 4M78A 2CDTA 4JUVA 1WHGA 3H0FA 2MF2A 2H3JA 4M75D 3BFMA 1JJ2P 5IAYA 8AT1B 3GF5A 3VS4A 4ME7A 2EGAA 1K8AC 1K9MC 5CK9A 2KT8A 4RCCA 4CRIA 5FWCA 1QP2A 1MNDA 2JM8A 4M7DG 1M3CA 3META 4CC7A 1NBEB 3QG1A 4F7UG 2QG9B 2ZPHB 4J83A 1QWEA 1E6HA 4GBQA 1Y0MA 1FMVA 2FVUA 4MDXA 2J6FA 3H8ZA 4M77E 3C0CA 1U1SA 4FW1A 1YIJT 4M75A 2J7IA 3OW2A 4RG2A 2K4YA 2COZA 3RIRA 2QQBA 2DXBA 4J8OA 3FRNA 3CCQA 4K11A 2EJFA 4RTUA 2EJ9A 2XMFA 1ZSZC 2EQMA 1M8VA 3ZBDA 1ZLMA 4BY6B 3CCRA 1B3QA 2ZPGB 2P84A 2QDLA 3A8MB 2EWNA 2KVQG 2D1XA 5CO7A 1U3OA 2FZCB 2P4RA 3OW2S 2QTXA 4R0KA 2RM4A 2E65A 4JS5A 1YJWA 4OMFB 5KYXB 2MI6A 3UA7A 1WJQA 2FL7A 2AIRB 3FDRA 2LZ6B 3CMEQ 1YJ9T 3D7SB 4DBQA 4L5GA 3EH2A 4BDZA 2QEXA 4B9WA 1VQ7T 4F14A 1I4K1 4ESRA 2DL4A 2LT1A 3JCMe 4J9CA 4ANJA 4RTVA 3I5SA 2X4XA 5GAOr 4EMHA 4C5EA 1AHJB 1J3TA 4FYVB 1VQOT 5L8RE 2EKOA 3Q1JA 1M5Q1 5FW9A 2E1HA 2B8AA 5FLXE 3CCRQ 2O9VA 1WX6A 3SB2A 3L1AA 1Q7YU 2CSQA 1LCKA 1G8XA 1TU0B 4KT0E 2HKNA 2LNVA 1UEBA 3OBWA 2HQEA 2OAWA 4DBRA 3BE3A 2EYXA 2LX9A 5GAMf 3G6EA 5GAOp 1OZ3A 2GBQA 2HBPA 2ZPEB 2JZ2A 1MV3A 2J05A 4C92G 2V8KA 1KQ1A 5KYYB 2CYZB 2ZCFB 4J6WA 4M77G 3VS0A 1V29B 3X25B 1PKSA 2EYYA 4HA8A 3RKYA 3CC2T 2RQUA 2DXCA 4JZ3A 1BKBA 2JMAA 1IXDA 3CXCP 5KH6A 2KR3A 1OPLA
chains in the Genus database with same CATH topology
2EPDA 2DBMA 4CC4B 3NHNA 4RTTA 2GTOA 1M3BA 1ZUKA 4M4ZA 3UATA 1XOVA 1BB9A 1U06A 1UDLA 1SHFA 1PRMC 1X6BA 1A0NB 1FYNA 2A28A 3PVLA 1KJWA 3NGPA 4IIMA 3NPFA 4AFQC 2LJ1A 4AG2C 1NEBA 3SEMA 2KYMA 2NWMA 3VRYA 4ORZA 2K3BA 1GBRA 2K6DA 2J06A 4IIOA 1JU5C 4F16A 1ZX6A 4LNPA 1JO8A 4JZ4A 3TSWA 2FRWA 3M0QA 1WFWA 3M0TA 2RN8A 2AKKA 2L3PA 1X27A 1E6GA 1YWOA 1K1ZA 1SSHA 1K4US 4J9EA 2LQNA 2GTJA 2FPFA 2SRCA 1UGVA 4OMMA 2K7AA 2FEIA 4RTXA 2X3XD 1JXMA 2DF6A 2O9SA 2O31A 2D8JA 4HVWA 1X6GA 2CSIA 3O5ZA 2JT4A 1CKBA 3LH5A 4RTYA 1UE9A 2HEQA 1MUZA 3VS5A 2W0ZA 2PNIA 2ENMA 1BK2A 1Y57A 3QWXX 2LCSA 1W6XA 1HSQA 1YNZA 1GRIA 2AK5A 4J9IA 4AFUC 4J9FA 2LX7A 1K0XA 3M0PA 1X69A 2DL8A 2AKLA 1NM7A 4JPBW 1JQQA 1G83A 2GGRA 1M8MA 2DMOA 2IIMA 2JW4A 2DL5A 2RPNA 3I9QA 1GBQA 1T0JA 2CUBA 1I1JA 1KIKA 1UFFA 1FMKA 2DL3A 2A36A 2EQIA 1IO6A 4LE9A 2DLPA 5I11A 1E7OA 5IHKA 2DRKA 1NYGA 2HBWA 2W10A 1AZGB 4J9HA 4DEXA 3CQTA 4J9GA 2ED0A 3VS7A 4RTZA 2FO0A 4A63B 3VS6A 2RNAA 3EG3A 4D8KA 2OJ2A 3EG0A 1GL5A 2L3SA 2DM1A 2G6FX 2V1QA 2VWFA 3I5RA 2HDAA 4Y92A 2GQIA 1ZBJA 2HCKA 1RLPC 3RBBB 3IQLA 2KT1A 4QT7A 1SEMA 2CH4W 4OMOA 3JV3A 4X1VA 2A37A 1BU1A 1OEBA 1B07A 2EW3A 1X43A 1HD3A 3VS1A 4RUGA 1WIEA 1NLPC 2BTTA 1QKXA 2RQTA 2JTEA 1PWTA 4J9DA 1RLQC 1M3AA 3M0RA 2JMCA 2KRNA 1ZSGA 5GJVB 3UF4A 1WDXA 5I22A 2LJ0A 1T3SA 2KEAA 1TUCA 5HCKA 2YT6A 1TUDA 1CKAA 3GBQA 2LQWA 4Z88A 1H8KA 1PNJA 2ED1A 4JJDA 3ZL7C 4F17A 1YWPA 4J9BA 3VS3A 2C0TA 3PVQA 1VYTA 1HJDA 2M0YA 3ULRB 1NYFA 1W70A 1PHTA 4HXJA 1N5ZA 2YUPA 1AZEA 1ZUYA 2KRSA 1BBZA 2KXCA 2OI3A 2RQWA 1X2KA 2EGEA 2ECZA 1JEGA 2PTKA 1V1CA 1KSWA 2ROLA 2VKNA 1AD5A 2KBTA 3R6NA 1RUWA 4LN2A 1AWWA 2DRMA 1OPKA 2RF0A 1H3HA 3A98A 1M30A 5IXFA 4LUEA 4D8DA 1H92A 2L2PA 2C0IA 3TVTA 4EIKA 1WI7A 2YUNA 2K2MA 2CH4A 2FPEA 1CSKA 2SEMA 1AWJA 2LNHB 5EC7A 2KE9A 1QKWA 1QWFA 1WXBA 3RNJA 4JJCA 5ECAA 3EHQA 4KRTA 2YUOA 2F2VA 2CREA 3NMZC 1NEGA 1GFDA 3I35A 5IXBA 1UG1A 2FPDA 3FJ5A 2DA9A 2JM9A 2ABLA 2CDTA 1WYXA 3H0FA 1UHFA 1T3LA 1KFZA 2YUQA 4AFSC 2DX1A 2PZ1A 2L0AA 3M0SA 3VS4A 2EGAA 1VA7A 2DBKA 2J6OA 2KT8A 2EVRA 5FWCA 2E5KA 4CC2A 2CT4A 2D0NA 2JM8A 1GFCA 1M3CA 1VYVA 4CC7A 2MCNA 2AZSA 3EG2A 3TSZA 1OV3A 2BZXA 2LP5A 1QWEA 2BZYA 2D8HA 2I0NA 1E6HA 1G2BA 2DVJA 4GBQA 5FWBA 5IHNA 5IHIA 3QWYA 1Y0MA 2DYBA 2V1RA 2EYWA 1YCSB 1WXUA 4DEYA 1TG0A 1M27C 3EHRA 2J6FA 2GNCA 4E6RA 1NG2A 3C0CA 1NLOC 2J7IA 3U23A 2MIOA 2F2WA 1UTIA 4LUDA 1UJYA 1AEYA 1T0HA 1QCFA 4HVVA 1PRLC 4JJBA 1SRLA 4K11A 3REBB 1AWXA 2MOXA 4RTUA 5GJWB 4Z89A 2XMFA 2BZ8A 1GCQA 3VRZA 1YP5A 2EGCA 1ZLMA 4OMNA 2J6KA 1OOTA 2KYBA 1B3QA 2KXDA 2QDLA 3THKA 1SHGA 2D1XA 4AFZC 1U3OA 1ABOA 4CC3A 2P4RA 2YDLA 2CUDA 1AVZC 1K76A 1AWOA 1X2QA 2O88A 2YSQA 3KFVA 3PE0A 1SRMA 4R0KA 2EKHA 1JXOA 2RQVA 2FRYA 3M0UA 4WCIA 2ROTA 1UJ0A 5L23A 2F2XA 2LJ3A 2KROA 2M51A 3EG1A 1K0SA 3H0IA 1PKTA 4OMPA 3UA7A 2AZVA 4Z8AA 2LZ6B 2A08A 2DJQA 2VVKA 1S1NA 1ZUUA 2JS0A 2JS2A 1K9AA 2CT3A 2FG0A 2KRMA 4F14A 1Z9QA 2NUZA 1UECA 4ESRA 1UHCA 2RQRA 2EBPA 2DL4A 4J9CA 1UUEA 5IH2A 4RTVA 2JXBA 3I5SA 1GCQC 2B86A 3H0HA 1I07A 2HSPA 1ARKA 1J3TA 3SHWA 1WXTA 1VYUA 5FW9A 2DILA 2O9VA 2KNBB 1WX6A 4ZNXA 4OMQA 2RMOA 4GLMA 2CSQA 1LCKA 4HCKA 3VS2A 1W1FA 3REAB 1GCPA 4AG1C 2OAWA 1SPKA 2C0OA 2EYXA 4FSSA 2KGTA 1WA7A 2DE0X 2LMJA 1YN8A 3UA6A 1WLPB 2L3QA 3H41A 2K9GA 1Z9ZA 2GBQA 1QLYA 2ESWA 1MV3A 2J05A 1ABQA 1EFNA 2K79A 1MV0B 1I0CA 4OMLA 4RTWA 3VS0A 1RI9A 2EYZA 2DNUA 3EGUA 1PKSA 2EYYA 2DL7A 2X3WD 2H8HA 2RQUA 4JZ3A 2JMAA 2O2OA 1U5SA 1AOJA 2KR3A 1OPLA 4HVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPD A;  2DBM A;  4CC4 B;  3NHN A;  4RTT A;  2GTO A;  1M3B A;  1ZUK A;  4M4Z A;  3UAT A;  1XOV A;  1BB9 A;  1U06 A;  1UDL A;  1SHF A;  1PRM C;  1X6B A;  1A0N B;  1FYN A;  2A28 A;  3PVL A;  1KJW A;  3NGP A;  4IIM A;  3NPF A;  4AFQ C;  2LJ1 A;  4AG2 C;  1NEB A;  3SEM A;  2KYM A;  2NWM A;  3VRY A;  4ORZ A;  2K3B A;  1GBR A;  2K6D A;  2J06 A;  4IIO A;  1JU5 C;  4F16 A;  1ZX6 A;  4LNP A;  1JO8 A;  4JZ4 A;  3TSW A;  2FRW A;  3M0Q A;  1WFW A;  3M0T A;  2RN8 A;  2AKK A;  2L3P A;  1X27 A;  1E6G A;  1YWO A;  1K1Z A;  1SSH A;  1K4U S;  4J9E A;  2LQN A;  2GTJ A;  2FPF A;  2SRC A;  1UGV A;  4OMM A;  2K7A A;  2FEI A;  4RTX A;  2X3X D;  1JXM A;  2DF6 A;  2O9S A;  2O31 A;  2D8J A;  4HVW A;  1X6G A;  2CSI A;  3O5Z A;  2JT4 A;  1CKB A;  3LH5 A;  4RTY A;  1UE9 A;  2HEQ A;  1MUZ A;  3VS5 A;  2W0Z A;  2PNI A;  2ENM A;  1BK2 A;  1Y57 A;  3QWX X;  2LCS A;  1W6X A;  1HSQ A;  1YNZ A;  1GRI A;  2AK5 A;  4J9I A;  4AFU C;  4J9F A;  2LX7 A;  1K0X A;  3M0P A;  1X69 A;  2DL8 A;  2AKL A;  1NM7 A;  4JPB W;  1JQQ A;  1G83 A;  2GGR A;  1M8M A;  2DMO A;  2IIM A;  2JW4 A;  2DL5 A;  2RPN A;  3I9Q A;  1GBQ A;  1T0J A;  2CUB A;  1I1J A;  1KIK A;  1UFF A;  1FMK A;  2DL3 A;  2A36 A;  2EQI A;  1IO6 A;  4LE9 A;  2DLP A;  5I11 A;  1E7O A;  5IHK A;  2DRK A;  1NYG A;  2HBW A;  2W10 A;  1AZG B;  4J9H A;  4DEX A;  3CQT A;  4J9G A;  2ED0 A;  3VS7 A;  4RTZ A;  2FO0 A;  4A63 B;  3VS6 A;  2RNA A;  3EG3 A;  4D8K A;  2OJ2 A;  3EG0 A;  1GL5 A;  2L3S A;  2DM1 A;  2G6F X;  2V1Q A;  2VWF A;  3I5R A;  2HDA A;  4Y92 A;  2GQI A;  1ZBJ A;  2HCK A;  1RLP C;  3RBB B;  3IQL A;  2KT1 A;  4QT7 A;  1SEM A;  2CH4 W;  4OMO A;  3JV3 A;  4X1V A;  2A37 A;  1BU1 A;  1OEB A;  1B07 A;  2EW3 A;  1X43 A;  1HD3 A;  3VS1 A;  4RUG A;  1WIE A;  1NLP C;  2BTT A;  1QKX A;  2RQT A;  2JTE A;  1PWT A;  4J9D A;  1RLQ C;  1M3A A;  3M0R A;  2JMC A;  2KRN A;  1ZSG A;  5GJV B;  3UF4 A;  1WDX A;  5I22 A;  2LJ0 A;  1T3S A;  2KEA A;  1TUC A;  5HCK A;  2YT6 A;  1TUD A;  1CKA A;  3GBQ A;  2LQW A;  4Z88 A;  1H8K A;  1PNJ A;  2ED1 A;  4JJD A;  3ZL7 C;  4F17 A;  1YWP A;  4J9B A;  3VS3 A;  2C0T A;  3PVQ A;  1VYT A;  1HJD A;  2M0Y A;  3ULR B;  1NYF A;  1W70 A;  1PHT A;  4HXJ A;  1N5Z A;  2YUP A;  1AZE A;  1ZUY A;  2KRS A;  1BBZ A;  2KXC A;  2OI3 A;  2RQW A;  1X2K A;  2EGE A;  2ECZ A;  1JEG A;  2PTK A;  1V1C A;  1KSW A;  2ROL A;  2VKN A;  1AD5 A;  2KBT A;  3R6N A;  1RUW A;  4LN2 A;  1AWW A;  2DRM A;  1OPK A;  2RF0 A;  1H3H A;  3A98 A;  1M30 A;  5IXF A;  4LUE A;  4D8D A;  1H92 A;  2L2P A;  2C0I A;  3TVT A;  4EIK A;  1WI7 A;  2YUN A;  2K2M A;  2CH4 A;  2FPE A;  1CSK A;  2SEM A;  1AWJ A;  2LNH B;  5EC7 A;  2KE9 A;  1QKW A;  1QWF A;  1WXB A;  3RNJ A;  4JJC A;  5ECA A;  3EHQ A;  4KRT A;  2YUO A;  2F2V A;  2CRE A;  3NMZ C;  1NEG A;  1GFD A;  3I35 A;  5IXB A;  1UG1 A;  2FPD A;  3FJ5 A;  2DA9 A;  2JM9 A;  2ABL A;  2CDT A;  1WYX A;  3H0F A;  1UHF A;  1T3L A;  1KFZ A;  2YUQ A;  4AFS C;  2DX1 A;  2PZ1 A;  2L0A A;  3M0S A;  3VS4 A;  2EGA A;  1VA7 A;  2DBK A;  2J6O A;  2KT8 A;  2EVR A;  5FWC A;  2E5K A;  4CC2 A;  2CT4 A;  2D0N A;  2JM8 A;  1GFC A;  1M3C A;  1VYV A;  4CC7 A;  2MCN A;  2AZS A;  3EG2 A;  3TSZ A;  1OV3 A;  2BZX A;  2LP5 A;  1QWE A;  2BZY A;  2D8H A;  2I0N A;  1E6H A;  1G2B A;  2DVJ A;  4GBQ A;  5FWB A;  5IHN A;  5IHI A;  3QWY A;  1Y0M A;  2DYB A;  2V1R A;  2EYW A;  1YCS B;  1WXU A;  4DEY A;  1TG0 A;  1M27 C;  3EHR A;  2J6F A;  2GNC A;  4E6R A;  1NG2 A;  3C0C A;  1NLO C;  2J7I A;  3U23 A;  2MIO A;  2F2W A;  1UTI A;  4LUD A;  1UJY A;  1AEY A;  1T0H A;  1QCF A;  4HVV A;  1PRL C;  4JJB A;  1SRL A;  4K11 A;  3REB B;  1AWX A;  2MOX A;  4RTU A;  5GJW B;  4Z89 A;  2XMF A;  2BZ8 A;  1GCQ A;  3VRZ A;  1YP5 A;  2EGC A;  1ZLM A;  4OMN A;  2J6K A;  1OOT A;  2KYB A;  1B3Q A;  2KXD A;  2QDL A;  3THK A;  1SHG A;  2D1X A;  4AFZ C;  1U3O A;  1ABO A;  4CC3 A;  2P4R A;  2YDL A;  2CUD A;  1AVZ C;  1K76 A;  1AWO A;  1X2Q A;  2O88 A;  2YSQ A;  3KFV A;  3PE0 A;  1SRM A;  4R0K A;  2EKH A;  1JXO A;  2RQV A;  2FRY A;  3M0U A;  4WCI A;  2ROT A;  1UJ0 A;  5L23 A;  2F2X A;  2LJ3 A;  2KRO A;  2M51 A;  3EG1 A;  1K0S A;  3H0I A;  1PKT A;  4OMP A;  3UA7 A;  2AZV A;  4Z8A A;  2LZ6 B;  2A08 A;  2DJQ A;  2VVK A;  1S1N A;  1ZUU A;  2JS0 A;  2JS2 A;  1K9A A;  2CT3 A;  2FG0 A;  2KRM A;  4F14 A;  1Z9Q A;  2NUZ A;  1UEC A;  4ESR A;  1UHC A;  2RQR A;  2EBP A;  2DL4 A;  4J9C A;  1UUE A;  5IH2 A;  4RTV A;  2JXB A;  3I5S A;  1GCQ C;  2B86 A;  3H0H A;  1I07 A;  2HSP A;  1ARK A;  1J3T A;  3SHW A;  1WXT A;  1VYU A;  5FW9 A;  2DIL A;  2O9V A;  2KNB B;  1WX6 A;  4ZNX A;  4OMQ A;  2RMO A;  4GLM A;  2CSQ A;  1LCK A;  4HCK A;  3VS2 A;  1W1F A;  3REA B;  1GCP A;  4AG1 C;  2OAW A;  1SPK A;  2C0O A;  2EYX A;  4FSS A;  2KGT A;  1WA7 A;  2DE0 X;  2LMJ A;  1YN8 A;  3UA6 A;  1WLP B;  2L3Q A;  3H41 A;  2K9G A;  1Z9Z A;  2GBQ A;  1QLY A;  2ESW A;  1MV3 A;  2J05 A;  1ABQ A;  1EFN A;  2K79 A;  1MV0 B;  1I0C A;  4OML A;  4RTW A;  3VS0 A;  1RI9 A;  2EYZ A;  2DNU A;  3EGU A;  1PKS A;  2EYY A;  2DL7 A;  2X3W D;  2H8H A;  2RQU A;  4JZ3 A;  2JMA A;  2O2O A;  1U5S A;  1AOJ A;  2KR3 A;  1OPL A;  4HVU A; 
#chains in the Genus database with same CATH topology
 3BW1 A;  5CCA A;  5GAM g;  1Y96 A;  5GAM d;  1YIT A;  1I5O B;  3X24 B;  4M7D F;  3LWH A;  2PVO B;  2Y4Y A;  1YHQ A;  9ATC B;  4PJO D;  2A28 A;  3ZEH A;  1Q82 U;  1BCM A;  2R5M A;  4M77 F;  2KYM A;  3SEM A;  5GAO m;  2NWM A;  3M56 A;  3VRY A;  1RAG B;  4MMK A;  3UPU A;  3A1P A;  3NTI A;  1IGQ A;  2QQ9 A;  4JLG A;  1N6A A;  1YJN Q;  3EFS A;  4BI8 B;  2VGM A;  5KE2 A;  2XG8 D;  4LNP A;  5LJ3 h;  3VUZ A;  1JO8 A;  3G7Z A;  3OYG A;  2GFA A;  2FRW A;  3UDC A;  3M0T A;  1OZ2 A;  1UGR B;  4XU3 A;  1WHJ A;  1M90 C;  1KHI A;  1E6G A;  4RG8 A;  1K4U S;  4J9E A;  2M16 A;  2KAF A;  4C92 A;  5LJ5 d;  3EFR A;  2FPF A;  4BDY A;  3CC7 T;  1UGV A;  4OMM A;  3CCL Q;  1YIJ Q;  4RTX A;  1N8R R;  2R5A A;  2QTV A;  4DQ2 A;  2JT4 A;  3UT1 A;  3GIB A;  3EG9 A;  3CCE A;  3GOX A;  2W0Z A;  3JB9 I;  3RKX A;  2VYT A;  4HT8 A;  1BK2 A;  3CMA Q;  1EX4 A;  1N27 A;  4C92 E;  1YNZ A;  5CKE A;  3OSV A;  4M77 C;  4J9F A;  1VIE A;  1K8A R;  1GXI E;  3VV0 A;  1I81 A;  1WHL A;  3TCJ A;  5EG2 A;  2AKL A;  4A4E A;  1NM7 A;  5GAM h;  4JPB W;  4DBH A;  1G3T A;  3V7C A;  1JQQ A;  3JB9 D;  3OB9 A;  2HL5 C;  1M1K R;  5GMK e;  1QVG A;  4C8Q G;  2RPN A;  2FZK B;  5CVI A;  2M0O A;  1M1F A;  1WJS A;  1G3W A;  2QXF A;  1KIK A;  2OTJ Q;  1UFF A;  1FMK A;  2EQI A;  1IO6 A;  2X35 A;  4LE9 A;  3SD4 A;  2DRK A;  3AT1 B;  3JCM P;  4HT9 A;  3X28 B;  1W2B S;  4HCZ A;  2PQW A;  3QPH A;  4J9H A;  4DEX A;  3DB4 A;  1S72 Q;  2ED0 A;  5CKH A;  3CCM Q;  1VQ6 T;  2HAX A;  2EQJ A;  1GL5 A;  1MMG A;  1NZ9 A;  2HDA A;  4Y92 A;  2E64 A;  1OUL A;  1QVG S;  4QVC A;  5I2S A;  3RBB B;  2YRD A;  2KT1 A;  1NPP A;  3CCS A;  5GAO n;  1SEM A;  5DLO A;  1D3B B;  2RHY A;  3OYK A;  4M78 E;  2A37 A;  1BU1 A;  1NE8 A;  2PUO B;  3C12 A;  3RDV A;  3VS1 A;  3CMA A;  3JCM c;  1RAA B;  4ZGD B;  2BTT A;  3JB9 H;  2FYK A;  4J9D A;  4KUI A;  1RAB B;  1M3A A;  2RI2 A;  3S3M A;  2KRN A;  1ZSG A;  2E10 A;  3E9F A;  3UF4 A;  4IUQ A;  2LJ0 A;  5KYW A;  3PGG A;  2DO3 A;  4C92 B;  3L2Q A;  3GBQ A;  3JCM h;  4EMK C;  2ED1 A;  4JJD A;  1YFN A;  2EJG A;  2C0T A;  4ZTJ A;  4XK8 E;  1PHT A;  2AHJ B;  1N5Z A;  4NL3 A;  2YUP A;  1ZUY A;  4GLK A;  2KRS A;  1BBZ A;  2OI3 A;  1X2K A;  5FRN A;  3V8J A;  2D9T A;  4M7D A;  2PTK A;  4BI3 A;  3GLX A;  4M78 G;  2KBT A;  3OMG A;  3R6N A;  1VQM Q;  1RUW A;  3I56 A;  3M59 A;  1IGU A;  1M90 R;  1Y7X A;  4V2S A;  4OGC A;  8ATC B;  3S3O A;  1H3H A;  2WAC A;  2OAU A;  1PD1 A;  1M30 A;  5M9O A;  2MMP A;  3MHX A;  1VQK T;  5DY9 A;  3QXE B;  3TVT A;  4EIK A;  2DJZ A;  2DXT A;  1AWJ A;  4M75 C;  2O01 E;  2KE9 A;  1WXB A;  3BDU A;  2WSF E;  1YBY A;  1M9S A;  1UGQ B;  2CRE A;  4X9D A;  2DAQ A;  1UG1 A;  3NTH A;  4LDY A;  4JRK A;  4FM4 B;  2PUK B;  1ZSZ B;  3CXC S;  3CCR T;  4IUR A;  2HQX A;  1UHF A;  4AFS C;  1JB0 E;  3OA6 A;  2COY A;  2DX1 A;  2PZ1 A;  2L0A A;  2JOY A;  1YJW T;  1VA7 A;  3H9N A;  2E3I A;  2R57 A;  2E5K A;  4CC2 A;  2D0N A;  2MAM A;  2F5T X;  1GFC A;  1VYV A;  2AZS A;  3EG2 A;  5FU6 B;  1VQN Q;  2CZ0 B;  2BZX A;  2LP5 A;  3C95 A;  1VQ9 A;  2I0N A;  1YJ9 A;  2GFU A;  3DLM A;  5FWB A;  5D6Y A;  5GAN 2;  3M57 A;  2E5Q A;  3QZ9 B;  1YCS B;  2A0F B;  2GNC A;  3EGD A;  2BIV A;  1NG2 A;  3SDZ A;  3CCM T;  1VQ6 Q;  3HRT A;  2VC8 A;  5I21 A;  2F2W A;  4LUD A;  2EFI A;  4E7Z A;  1VQL A;  1QCF A;  4JJB A;  1VQO A;  1WPY A;  1SRL A;  4C8Q C;  2CP5 A;  1AWX A;  3OYE A;  1C0M A;  4LD6 A;  3M54 A;  3MEV A;  2VAS A;  2DIG A;  3WVE B;  5GJW B;  4Z89 A;  2BZ8 A;  1GCQ A;  2M1H A;  3VRZ A;  4R55 A;  5CKB A;  4OMN A;  2RB6 A;  1B34 B;  2DZ9 A;  2RK1 A;  4E7I A;  1VQP T;  2KYB A;  1KD1 C;  1BYM A;  4PLL A;  3MEW A;  2X4W A;  1VQ5 A;  3DB3 A;  2RJD A;  5D6W A;  3LLR A;  3OYB A;  2XDD A;  1VQ4 A;  3JCM J;  2YDL A;  2CUD A;  1AWO A;  1SSF A;  2LDM A;  3OYH A;  1Q86 R;  1JXO A;  2RQV A;  3M9Q A;  3CMA T;  2DTH A;  2FRY A;  2COW A;  4RCB A;  1YIJ A;  1M1K U;  1TSF A;  1UJ0 A;  3S3N A;  2LJ3 A;  4OF1 A;  5CQX A;  2RI5 A;  1LNX A;  2M51 A;  3EG1 A;  4XQ3 A;  2DVE A;  2XK0 A;  1K0S A;  1PM3 A;  3EFO A;  4OMP A;  4MML A;  2EYQ A;  3I56 Q;  1G3S A;  5GAN g;  2VVK A;  1VQ6 A;  2JS0 A;  1UGS B;  2WSC E;  5LJ5 j;  4IUU A;  2CT3 A;  3OYL A;  2YWW A;  1QMC A;  5CKD A;  1UHC A;  2EBP A;  2M02 A;  1UUE A;  5IH2 A;  1YIT Q;  2KY9 A;  2HSP A;  4JJN K;  3SHW A;  1WXT A;  2VXE A;  3MP6 A;  2RJF A;  2E6N A;  3KXT A;  2E4H A;  2KNB B;  2QYZ A;  3CC2 Q;  1HXD A;  2L89 A;  2RMO A;  3M55 A;  3CCJ T;  3RMS A;  4HCK A;  3LWI A;  3REA B;  4BE1 A;  4AG1 C;  3WXM B;  4FSS A;  5GAN f;  1S72 A;  2KGT A;  2ZPB B;  3OW2 P;  4BE2 A;  3UA6 A;  1KC8 U;  1WLP B;  3H41 A;  3OQ5 A;  1Z9Z A;  3MJX A;  2ESW A;  1YI2 A;  1EFN A;  3G71 A;  3CC4 Q;  1I0C A;  1UGP B;  4OML A;  4UC4 A;  2XDB A;  2EYZ A;  2DNU A;  2H8H A;  2CP0 A;  1U5S A;  3RER A;  2QA4 T;  1BI1 A;  2DBM A;  5KCO A;  2GTO A;  1M3B A;  3SFM A;  1XOV A;  4OB3 B;  4JRI A;  4OB2 B;  1UDL A;  3HFN A;  2QEX T;  1VQ7 A;  2P0K A;  1SHF A;  4VUB A;  5GAO q;  1K9M R;  1A0N B;  4M75 E;  1KJW A;  3NGP A;  4IIM A;  4AFQ C;  2LJ1 A;  4AG2 C;  1NEB A;  3AHU A;  3PIO A;  4ORZ A;  4FT2 A;  5J26 A;  2K6D A;  4M7A C;  1WHH A;  2DTI A;  2A3L A;  2J06 A;  1M1K C;  2VGN A;  4IIO A;  3ZFJ A;  2DET A;  5KYW B;  1JU5 C;  1LPL A;  2BE9 B;  3QJY A;  3OMC A;  1RAI B;  3TSW A;  3M0Q A;  2KDS A;  2RN8 A;  1W2B A;  2L3P A;  4DOW A;  4KGZ B;  1YI2 Q;  1TUG B;  2GTJ A;  2IVW A;  1N9S A;  1Y96 B;  2RH2 A;  4A53 A;  2K7A A;  2X3X D;  2DF6 A;  3TRE A;  5GAN d;  1QQJ A;  4OP0 A;  4LDX A;  4HVW A;  3ASK A;  1KQS P;  2CSI A;  1RAE B;  2KK4 A;  3O5Z A;  2LQ8 A;  1CKB A;  3BY7 A;  4E7J A;  3LH5 A;  4RTY A;  3LGL A;  1MUZ A;  4P5N A;  4N4H A;  3FC3 A;  2CP7 A;  1ACM B;  1HSQ A;  3CEY A;  1C6V X;  4NS5 A;  4AFU C;  2X4Y A;  1K0X A;  3M0P A;  1XQH A;  1ZSZ A;  3RKW A;  1D1B A;  1G83 A;  2DMO A;  3VYH B;  1OX8 A;  4FCY A;  2DL5 A;  4M7D D;  1KHC A;  1GBQ A;  1T0J A;  5D6X A;  2LCC A;  1IHV A;  3OSS C;  4PK4 A;  4LDU A;  4M78 C;  5KYN A;  2MWO A;  5CQY A;  1Y07 A;  3PFS A;  5I11 A;  5IHK A;  4WTO B;  4C5G A;  2W10 A;  1AZG B;  3V7R A;  3CQT A;  4J9G A;  2MPX C;  5A2Q E;  2FO0 A;  4A63 B;  3J7A F;  3EG3 A;  4XU0 A;  4D8K A;  5HK0 A;  2OJ2 A;  4PJJ A;  1VQ9 Q;  2DM1 A;  2G6F X;  3M5A A;  2HCK A;  4OVA A;  3CC4 A;  3CCE Q;  3IQL A;  3A8L B;  3RMQ A;  2CH4 W;  3JV3 A;  4C0D C;  2V26 A;  3CD6 A;  4A54 A;  3J81 E;  1X43 A;  4XTV A;  4ZGJ B;  1ZHI A;  1WIE A;  1QKX A;  2JTE A;  1HK9 A;  3JCM b;  5KE3 A;  1K8A U;  4HCB A;  4PJO E;  2JMC A;  3A8G B;  5C6S A;  4PL6 A;  5GAN 7;  2RHZ A;  3KUF A;  5I22 A;  1T3S A;  2KEA A;  1AT1 B;  2C06 A;  1TUC A;  5HCK A;  1P92 A;  1CKA A;  3V8K A;  3OYF A;  1YHQ Q;  2Z0W A;  1PNJ A;  3ZL7 C;  4J9B A;  2LCL A;  1HJD A;  4FL6 A;  2LQK A;  3CCS T;  1NYF A;  1KQ2 A;  2A7Y A;  1AZE A;  2P0P A;  2NUP B;  4Y91 A;  2RHI A;  2XDP A;  2EGE A;  2ECZ A;  4F7U F;  4BD3 A;  3JB9 G;  2K5L A;  1KSW A;  4E7H A;  4F7U E;  2ROL A;  4LXC A;  1AD5 A;  5CKF A;  1MMA A;  3CCL A;  4LN2 A;  3GNF B;  1VQ9 T;  2LTO A;  3J80 E;  3C94 A;  5IXF A;  4M7A D;  4LUE A;  4D8D A;  1H92 A;  1XTD A;  1PSE A;  2C0I A;  3QDF A;  3H6Z A;  5KYY A;  4PJO B;  5A0D A;  1MNE A;  1WI7 A;  3MP1 A;  3QUI A;  3VKI A;  1TH7 A;  5CIU A;  4FW2 A;  4O6J A;  2LNH B;  5EC7 A;  2MK5 A;  1QWF A;  4A4H A;  3G4S Q;  3ER0 A;  2EAY A;  3HL8 A;  3M53 A;  1VQL Q;  2CP6 A;  2F2V A;  3CBM A;  4EPC A;  3CCQ Q;  4N4G A;  4AMC A;  1GFD A;  3I35 A;  4A4G A;  3L2W A;  3L2U A;  3G1J A;  3F70 A;  2JM9 A;  1WYX A;  1NPR A;  3EH1 A;  1KFZ A;  1IHW A;  4BY6 C;  3TQ7 P;  1TOV A;  2K5F A;  4D6W A;  5GMK m;  2OTL A;  4ZGE B;  3JCM V;  2J6O A;  1NJI C;  2EVR A;  4Q5W A;  2HL3 A;  3HHT B;  2CT4 A;  4C92 C;  3G71 Q;  3OS1 A;  5IN1 A;  1U1T A;  1M2O A;  1PSF A;  3TEE A;  3DKM A;  1I5L A;  2MCN A;  2MYS A;  2BZY A;  5IHN A;  1VQM T;  5IHI A;  4F7U A;  3QWY A;  3HKS A;  4PJO G;  4DEY A;  1JRI A;  1TG0 A;  1YI2 T;  1NJI R;  4PFZ A;  4E6R A;  1O9S A;  1QVF A;  1NLO C;  1X75 C;  1Q82 C;  2MIO A;  3G4S A;  1UTI A;  3QKJ A;  2VXF A;  1LJO A;  1T0H A;  4HVV A;  1VQ7 Q;  1K73 U;  4ATO A;  3LW5 E;  4AT1 B;  4M7D C;  3REB B;  4FYX B;  2JJ9 A;  2MOX A;  1RL2 A;  4LDW A;  1VQ8 Q;  3RES A;  1FX7 A;  1YP5 A;  2EGC A;  4C5H A;  2J6K A;  4QQ6 A;  3INZ A;  4IUT A;  2IG0 A;  2QK0 A;  1VIF A;  2OX7 A;  1WJR A;  2JTF A;  1SHG A;  4AFZ C;  1TXQ A;  1YCY A;  4XTZ A;  1ABO A;  5GAO l;  3HTR A;  3A5Z B;  1ZQ1 A;  2O88 A;  2DD4 A;  3KFV A;  1SRM A;  1WHM A;  2EKH A;  1RAC B;  1YIT T;  3M0U A;  4PFO A;  2ROT A;  4XU2 A;  3PTA A;  3QYG B;  3CME T;  1YJ9 Q;  1M4Z A;  3PT9 A;  3JAM E;  2JNG A;  3PMI A;  3QHS A;  3H0I A;  2CS7 A;  4A4K A;  1FXX A;  2QAZ A;  4Z8A A;  3L2Z A;  2DJQ A;  3CCV Q;  1S1N A;  3OYN A;  1ZUU A;  1K9A A;  2FG0 A;  2KRM A;  1KD1 R;  2NUZ A;  1UEC A;  2CGH A;  3VYG A;  3PIP A;  2RQR A;  1BI3 A;  5FU6 C;  2JXB A;  1GCQ C;  4XTX A;  1X01 A;  1I07 A;  2NYS A;  2VB6 A;  2XHC A;  3EAE A;  4QQD A;  5CAI A;  2DIL A;  1OU8 A;  1HYO A;  4E7S A;  5FU7 B;  4OMQ A;  4GLM A;  5GMK h;  3VS2 A;  4JS4 A;  2HD0 A;  2M9U A;  1GCP A;  1MMN A;  2C0O A;  1D09 B;  2DK3 A;  4R56 A;  3MKD A;  3I55 Q;  2CKK A;  1WA7 A;  2LMJ A;  2DYI A;  3MPU B;  3URG A;  1WNL A;  4C8Q B;  3CCM A;  2BE7 D;  2LC4 A;  4NOY A;  1YN8 A;  1D0X A;  2L3Q A;  2K9G A;  1I8F A;  1ABQ A;  3JRZ A;  1W2B P;  4RTW A;  2O4X A;  5D7U A;  2GF7 A;  1IRE B;  2FHD A;  1OYX A;  3UWN A;  2X9H A;  3CCJ A;  4ZN3 A;  1O75 A;  2DL7 A;  2DXU A;  3QYH B;  1QVP A;  1AOJ A;  1QVF S;  2K3Y A;  4GY5 A;  4Z02 A;  4XTW A;  2GQV A;  3NHN A;  4RTT A;  1ZUK A;  1VQ8 T;  1BI0 A;  6AT1 B;  3OS2 A;  1VQN T;  3M4G A;  3FLG A;  3UAT A;  2RO0 A;  3VU3 C;  1BB9 A;  3CCU T;  3EGX B;  2EIF A;  4M7A E;  1UB4 A;  3ME9 A;  2QQS A;  1X6B A;  2RI3 A;  1FYN A;  2FB7 A;  2QDY B;  2NUT A;  7AT1 B;  2ZZD A;  1GBR A;  5FRM A;  3OYD A;  1D1C A;  3P8H A;  2PVG B;  4N4I A;  2JVV A;  5DM7 R;  3NFC A;  3C4S A;  1M2V A;  4JZ4 A;  1PG5 B;  4FYW B;  1X27 A;  1OU9 A;  4PJN A;  1K1Z A;  1SSH A;  5LJ5 g;  4PJO A;  3CXC A;  2HKQ B;  5KYU B;  4J6Y A;  1LVK A;  3GNG A;  2FEI A;  1JXM A;  2O9S A;  4E47 A;  1M2V B;  2D8J A;  3VUB A;  3GP8 A;  3RR6 A;  4N0A A;  4EMK B;  5KCH A;  1KG1 A;  1UE9 A;  2HEQ A;  3EFO B;  2PNI A;  1Y57 A;  5GAN 3;  1W6X A;  1GRI A;  3VJP A;  3FEO A;  2I2L A;  1TS9 A;  1ZA2 B;  1X69 A;  2O4X B;  2DL8 A;  3HSB A;  3QBY A;  3E1S A;  1QCO A;  2GGR A;  1B7T A;  1ZA1 B;  2F69 A;  2IIM A;  1QVG P;  4NL2 A;  4YTL A;  2E41 A;  2E6Z A;  3M58 A;  4XTU A;  5IT9 E;  1QW1 A;  4KH0 B;  1IRX A;  4KGV B;  2D0Q B;  2V8I A;  2DL3 A;  4C8Q F;  2H3E B;  5GAN e;  2A36 A;  2DPP B;  2RK2 A;  4JDS A;  1F1B B;  3OYJ A;  3CC4 T;  5LJ3 d;  3L2R A;  3VS7 A;  4RTZ A;  3JCM d;  1Q7Y R;  3G6E Q;  2RNA A;  4J7I A;  2RD1 A;  3I5R A;  4C8Q A;  4IUP A;  1S72 T;  5CR2 A;  2DER A;  1RLP C;  2X51 A;  3G71 T;  3QZ5 B;  1MHN A;  3HRU A;  2HQH A;  4QT7 A;  3E19 A;  4OMO A;  4X1V A;  2OTJ T;  1D0Y A;  2MWP A;  3A8O B;  2EW3 A;  1OI1 A;  4Y28 E;  4ZTF A;  1QP3 A;  3QSU A;  1NLP C;  3CPF A;  2RQT A;  2JTM A;  4M75 G;  3OYM A;  1PWT A;  1RLQ C;  1K9M U;  3M0R A;  3P8B B;  4M77 D;  3JCM f;  5GJV B;  1WDX A;  4EDU A;  2P0Q A;  4QW2 A;  2XU8 A;  2GCX A;  2KI7 A;  2LQW A;  5GAN 4;  1Q86 U;  4F17 A;  1YWP A;  2ZPF B;  3VS3 A;  1VYT A;  4MZP A;  2M0Y A;  4E7K A;  3MP8 A;  3ULR B;  4M77 B;  3BDL A;  4M7A F;  2PU9 B;  2KXC A;  2RQW A;  5C0M A;  2QGF B;  5GMK i;  2HMA A;  4QVZ A;  2OTL Q;  1V1C A;  2QA4 A;  3OS0 A;  3I55 T;  3CBO A;  3V8L A;  2HZY A;  2WSE E;  1WGS A;  4JRP A;  4M7A A;  1AWW A;  2DRM A;  2NUP A;  3CCV A;  2LRQ A;  1R77 A;  4HKE A;  4J7F A;  2L2P A;  1WHK A;  2QQR A;  4O5V A;  1VQP Q;  2L8D A;  2K2M A;  2CH4 A;  1H64 1;  2FPE A;  2L3R A;  2SEM A;  4B9X A;  5ECA A;  4F7U B;  1XNI A;  4KRT A;  4X34 A;  2YUO A;  2DD5 A;  1Q81 U;  2QGG A;  3SWN A;  3NMZ C;  2KMT A;  5LJ5 h;  4CI0 C;  4C0Z A;  2DEQ A;  2IPO B;  4M7D B;  1BIB A;  2DA9 A;  1D1A A;  2ABL A;  3NTK A;  5GAN 5;  3CPW A;  3P8D A;  1QVF P;  2ZAE A;  3CC7 Q;  2K3X A;  3HFO A;  2PVD B;  1T3L A;  2YUQ A;  2P4T A;  5LJ3 g;  4IUV A;  2VV5 A;  1LOJ A;  5KYX A;  3M0S A;  2R58 A;  1QCN A;  2DBK A;  5A0G A;  1V76 A;  4M78 F;  1YJN T;  1VUB A;  4C8Q D;  2JUF A;  3MO8 A;  3TSZ A;  1OV3 A;  1VQ4 T;  1RAD B;  2E12 A;  1JJ2 S;  2D8H A;  1G2B A;  2DVJ A;  3SWN C;  2DFU A;  2DYB A;  2V1R A;  2KQW A;  2EYW A;  3LX7 A;  5A0L A;  3X26 B;  1WXU A;  1M27 C;  4M75 B;  3EHR A;  2YHT A;  3CBP A;  1R8O B;  4C0F A;  3G6E T;  1JBM A;  2ATC B;  3PMT A;  3U23 A;  4X9C A;  2K5I A;  1UJY A;  1AEY A;  2QEX Q;  1PRL C;  3FJP A;  1RAF B;  1KQS A;  2DKG A;  2CP2 A;  3CPW S;  4ELY C;  4C92 D;  1KK7 A;  1X6O A;  3OBY A;  1OOT A;  4BI4 A;  1PC0 A;  2KXD A;  2LVM A;  4KBM B;  4OB1 B;  4KUD K;  3THK A;  1Q82 R;  3E9G A;  4CC3 A;  2YLB A;  5HK3 A;  5FU7 C;  1AVZ C;  1K76 A;  2YRV A;  1X2Q A;  2NUT B;  2YSQ A;  2YRC A;  2V8J A;  3OYY A;  3PE0 A;  5LJ3 e;  1VQK A;  3EGX A;  1RI0 A;  5DLQ E;  4WCI A;  3A8H B;  5L23 A;  2F2X A;  4LD9 K;  4C92 F;  2KRO A;  4IKF A;  1H3Z A;  4RMO A;  2QA4 Q;  3QDR B;  2LT4 A;  2XKO C;  1PKT A;  1NJI U;  2AZV A;  4WF2 A;  5LJ3 f;  4C0G A;  2A08 A;  1WQW A;  3CCJ Q;  1G5V A;  5GMK l;  1DJ7 B;  2JS2 A;  2L5Q A;  4PJL A;  3CCU Q;  3GPL A;  3V7S A;  1G3Y A;  1Z9Q A;  1VQP A;  4M78 D;  1M90 U;  4PFP A;  1TWB A;  4BUG A;  3JCM Q;  2YXY A;  1N9R A;  1JJ2 A;  1W4S A;  4KH1 B;  2XI9 A;  2B86 A;  3H0H A;  3OYA A;  4BAC A;  1ARK A;  1EIF A;  1BIA A;  1VYU A;  1BCO A;  4PNO A;  3KBG A;  4QVD A;  3HPW A;  2RJC A;  4ZNX A;  5GAN 8;  2XD0 A;  3MEU A;  4FYY B;  1W1F A;  1VQ4 Q;  2QAS A;  2ZPI B;  2D6F A;  1SPK A;  3EGD B;  4II1 A;  1VOM A;  5LJ5 e;  2DE0 X;  4L59 A;  4E7L A;  1Q81 C;  3WVD B;  4F04 B;  3S6W A;  1QLY A;  2G3R A;  1D3B A;  2F5K A;  3LH0 A;  1MV0 B;  4DA4 A;  3QJ6 A;  3CCS Q;  3QO3 A;  2OTL T;  4J6X A;  1RI9 A;  1TTH B;  3EGU A;  3FB9 A;  4OGE A;  1WQ7 A;  1IZ6 A;  2DEU A;  1PCX A;  4EMK A;  5AT1 B;  3I56 T;  2X3W D;  1R0C B;  3RUX A;  5GAN 6;  2O2O A;  4N0A C;  2K79 A;  4HVU A;  2HNI A;  1Y71 A;  1IB8 A;  1XJW B;  2EPD A;  3CCU A;  4CC4 B;  2DTO A;  2XIC A;  3OYC A;  4XAX B;  1C1A A;  4M7D E;  4M4Z A;  1VQ5 T;  1Q7Y C;  1OX9 A;  5GAN h;  2CP3 A;  1U06 A;  1SKU B;  4JRQ A;  5KYU A;  3JCM g;  1PRM C;  4JLI A;  3PVL A;  2RA2 A;  3NPF A;  3N5B B;  4B6M A;  3CCV T;  2E70 A;  4E2F B;  2K57 A;  2K3B A;  5LL6 S;  4BB7 A;  2KSS A;  1U8R A;  2Y90 A;  3T9N A;  4F16 A;  1VQ5 Q;  1ZX6 A;  3R6O A;  2FZG B;  2VUB A;  1WFW A;  4M7A G;  2AKK A;  1Q81 R;  2ZGW A;  1YWO A;  4DOV A;  3CCL T;  4RKU E;  4DBF A;  3DLL A;  2LQN A;  3PNW C;  2SRC A;  1VQM A;  1YJW Q;  2O31 A;  3OYI A;  1X6G A;  4FIB A;  4L6V 5;  5GAM j;  4PJM A;  4QQG A;  2X4J A;  3CCE T;  2QQA A;  1PD0 A;  2RJE A;  3VS5 A;  3CME A;  1MMD A;  1K73 C;  3MCA B;  2ENM A;  2EQU A;  4C8Q E;  3E2U A;  3QWX X;  1B34 A;  2LCS A;  4C5I A;  3OS5 A;  2NLU A;  5GAM e;  4ZN1 A;  2AK5 A;  4J9I A;  4PLI A;  2E3H A;  4LDV A;  2LX7 A;  4MZT A;  4PKC C;  1SG5 A;  3CD6 T;  5GAN j;  2K2V A;  1M1G A;  1M8M A;  2DIQ A;  2JW4 A;  1ZBX A;  3I9Q A;  2CZ7 B;  3M4Y A;  3LYI A;  2CUB A;  1I1J A;  3JCM X;  4HCC A;  3X20 B;  3MEA A;  5AYF A;  2DLP A;  1E7O A;  1NYG A;  2BKD N;  2HBW A;  1KC8 C;  3JB9 F;  4PJO C;  1Q86 C;  1FMW A;  3I55 A;  4FT4 A;  2XID A;  3HRS A;  5HKC A;  3VS6 A;  1VQN A;  3JSC A;  1D0Z A;  1Q95 G;  3EG0 A;  2L3S A;  4OB0 B;  2V1Q A;  2VWF A;  1N8R C;  4FSX A;  5LJ5 f;  5LJ3 j;  2GQI A;  1EZZ B;  4MDW A;  1FWZ A;  1ZBJ A;  4M7A B;  3QII A;  1OQK A;  3HP9 A;  1KC8 R;  3JCM W;  2EQK A;  1OEB A;  1B07 A;  2JN0 A;  5HY6 A;  4KUL A;  1HD3 A;  4RUG A;  3CCQ T;  1KQS S;  4M75 F;  4QKU A;  1VQL T;  2BUD A;  3TU4 K;  4M77 A;  5I2M A;  1VQO Q;  4KGX B;  4EMG A;  2QI2 A;  3O8V A;  2CZ6 B;  2Y4X A;  1VQ8 A;  1R0B G;  2CZ1 B;  5J39 A;  2YT6 A;  1TUD A;  4Z88 A;  2RHU A;  1H8K A;  4M78 B;  1BI2 A;  4TVR A;  3PVQ A;  2OTJ A;  1WZO A;  3CC7 A;  1N8R U;  1W70 A;  4J5Y A;  4HXJ A;  2DZC A;  5GMK j;  1YJN A;  4FU6 A;  3FIF A;  1VQK Q;  3G4S T;  4PJO F;  3EG9 B;  3L42 A;  5J3B A;  2YLC A;  1JEG A;  4XU1 A;  5FRO A;  2VKN A;  2HSE B;  3JB9 J;  4C0D B;  1OPK A;  2RF0 A;  1KD1 U;  1K73 R;  3A98 A;  3CD6 Q;  2F1L A;  4ELZ C;  4BE0 A;  1YHQ T;  2RHX A;  3SWN B;  2YUN A;  3OY9 A;  3CPW P;  2AT1 B;  1CSK A;  1QKW A;  3RNJ A;  4MZM A;  4JJC A;  4A4F A;  3EHQ A;  4XTY A;  1SF9 A;  3L2V A;  1MGQ A;  1NEG A;  3CC2 A;  5IXB A;  1RAH B;  2FPD A;  3FJ5 A;  3LGF A;  4M78 A;  2CDT A;  4JUV A;  1WHG A;  3H0F A;  2MF2 A;  2H3J A;  4M75 D;  3BFM A;  1JJ2 P;  5IAY A;  8AT1 B;  3GF5 A;  3VS4 A;  4ME7 A;  2EGA A;  1K8A C;  1K9M C;  5CK9 A;  2KT8 A;  4RCC A;  4CRI A;  5FWC A;  1QP2 A;  1MND A;  2JM8 A;  4M7D G;  1M3C A;  3MET A;  4CC7 A;  1NBE B;  3QG1 A;  4F7U G;  2QG9 B;  2ZPH B;  4J83 A;  1QWE A;  1E6H A;  4GBQ A;  1Y0M A;  1FMV A;  2FVU A;  4MDX A;  2J6F A;  3H8Z A;  4M77 E;  3C0C A;  1U1S A;  4FW1 A;  1YIJ T;  4M75 A;  2J7I A;  3OW2 A;  4RG2 A;  2K4Y A;  2COZ A;  3RIR A;  2QQB A;  2DXB A;  4J8O A;  3FRN A;  3CCQ A;  4K11 A;  2EJF A;  4RTU A;  2EJ9 A;  2XMF A;  1ZSZ C;  2EQM A;  1M8V A;  3ZBD A;  1ZLM A;  4BY6 B;  3CCR A;  1B3Q A;  2ZPG B;  2P84 A;  2QDL A;  3A8M B;  2EWN A;  2KVQ G;  2D1X A;  5CO7 A;  1U3O A;  2FZC B;  2P4R A;  3OW2 S;  2QTX A;  4R0K A;  2RM4 A;  2E65 A;  4JS5 A;  1YJW A;  4OMF B;  5KYX B;  2MI6 A;  3UA7 A;  1WJQ A;  2FL7 A;  2AIR B;  3FDR A;  2LZ6 B;  3CME Q;  1YJ9 T;  3D7S B;  4DBQ A;  4L5G A;  3EH2 A;  4BDZ A;  2QEX A;  4B9W A;  1VQ7 T;  4F14 A;  1I4K 1;  4ESR A;  2DL4 A;  2LT1 A;  3JCM e;  4J9C A;  4ANJ A;  4RTV A;  3I5S A;  2X4X A;  5GAO r;  4EMH A;  4C5E A;  1AHJ B;  1J3T A;  4FYV B;  1VQO T;  5L8R E;  2EKO A;  3Q1J A;  1M5Q 1;  5FW9 A;  2E1H A;  2B8A A;  5FLX E;  3CCR Q;  2O9V A;  1WX6 A;  3SB2 A;  3L1A A;  1Q7Y U;  2CSQ A;  1LCK A;  1G8X A;  1TU0 B;  4KT0 E;  2HKN A;  2LNV A;  1UEB A;  3OBW A;  2HQE A;  2OAW A;  4DBR A;  3BE3 A;  2EYX A;  2LX9 A;  5GAM f;  3G6E A;  5GAO p;  1OZ3 A;  2GBQ A;  2HBP A;  2ZPE B;  2JZ2 A;  1MV3 A;  2J05 A;  4C92 G;  2V8K A;  1KQ1 A;  5KYY B;  2CYZ B;  2ZCF B;  4J6W A;  4M77 G;  3VS0 A;  1V29 B;  3X25 B;  1PKS A;  2EYY A;  4HA8 A;  3RKY A;  3CC2 T;  2RQU A;  2DXC A;  4JZ3 A;  1BKB A;  2JMA A;  1IXD A;  3CXC P;  5KH6 A;  2KR3 A;  1OPL A; 
#chains in the Genus database with same CATH homology
 2EPD A;  2DBM A;  4CC4 B;  3NHN A;  4RTT A;  2GTO A;  1M3B A;  1ZUK A;  4M4Z A;  3UAT A;  1XOV A;  1BB9 A;  1U06 A;  1UDL A;  1SHF A;  1PRM C;  1X6B A;  1A0N B;  1FYN A;  2A28 A;  3PVL A;  1KJW A;  3NGP A;  4IIM A;  3NPF A;  4AFQ C;  2LJ1 A;  4AG2 C;  1NEB A;  3SEM A;  2KYM A;  2NWM A;  3VRY A;  4ORZ A;  2K3B A;  1GBR A;  2K6D A;  2J06 A;  4IIO A;  1JU5 C;  4F16 A;  1ZX6 A;  4LNP A;  1JO8 A;  4JZ4 A;  3TSW A;  2FRW A;  3M0Q A;  1WFW A;  3M0T A;  2RN8 A;  2AKK A;  2L3P A;  1X27 A;  1E6G A;  1YWO A;  1K1Z A;  1SSH A;  1K4U S;  4J9E A;  2LQN A;  2GTJ A;  2FPF A;  2SRC A;  1UGV A;  4OMM A;  2K7A A;  2FEI A;  4RTX A;  2X3X D;  1JXM A;  2DF6 A;  2O9S A;  2O31 A;  2D8J A;  4HVW A;  1X6G A;  2CSI A;  3O5Z A;  2JT4 A;  1CKB A;  3LH5 A;  4RTY A;  1UE9 A;  2HEQ A;  1MUZ A;  3VS5 A;  2W0Z A;  2PNI A;  2ENM A;  1BK2 A;  1Y57 A;  3QWX X;  2LCS A;  1W6X A;  1HSQ A;  1YNZ A;  1GRI A;  2AK5 A;  4J9I A;  4AFU C;  4J9F A;  2LX7 A;  1K0X A;  3M0P A;  1X69 A;  2DL8 A;  2AKL A;  1NM7 A;  4JPB W;  1JQQ A;  1G83 A;  2GGR A;  1M8M A;  2DMO A;  2IIM A;  2JW4 A;  2DL5 A;  2RPN A;  3I9Q A;  1GBQ A;  1T0J A;  2CUB A;  1I1J A;  1KIK A;  1UFF A;  1FMK A;  2DL3 A;  2A36 A;  2EQI A;  1IO6 A;  4LE9 A;  2DLP A;  5I11 A;  1E7O A;  5IHK A;  2DRK A;  1NYG A;  2HBW A;  2W10 A;  1AZG B;  4J9H A;  4DEX A;  3CQT A;  4J9G A;  2ED0 A;  3VS7 A;  4RTZ A;  2FO0 A;  4A63 B;  3VS6 A;  2RNA A;  3EG3 A;  4D8K A;  2OJ2 A;  3EG0 A;  1GL5 A;  2L3S A;  2DM1 A;  2G6F X;  2V1Q A;  2VWF A;  3I5R A;  2HDA A;  4Y92 A;  2GQI A;  1ZBJ A;  2HCK A;  1RLP C;  3RBB B;  3IQL A;  2KT1 A;  4QT7 A;  1SEM A;  2CH4 W;  4OMO A;  3JV3 A;  4X1V A;  2A37 A;  1BU1 A;  1OEB A;  1B07 A;  2EW3 A;  1X43 A;  1HD3 A;  3VS1 A;  4RUG A;  1WIE A;  1NLP C;  2BTT A;  1QKX A;  2RQT A;  2JTE A;  1PWT A;  4J9D A;  1RLQ C;  1M3A A;  3M0R A;  2JMC A;  2KRN A;  1ZSG A;  5GJV B;  3UF4 A;  1WDX A;  5I22 A;  2LJ0 A;  1T3S A;  2KEA A;  1TUC A;  5HCK A;  2YT6 A;  1TUD A;  1CKA A;  3GBQ A;  2LQW A;  4Z88 A;  1H8K A;  1PNJ A;  2ED1 A;  4JJD A;  3ZL7 C;  4F17 A;  1YWP A;  4J9B A;  3VS3 A;  2C0T A;  3PVQ A;  1VYT A;  1HJD A;  2M0Y A;  3ULR B;  1NYF A;  1W70 A;  1PHT A;  4HXJ A;  1N5Z A;  2YUP A;  1AZE A;  1ZUY A;  2KRS A;  1BBZ A;  2KXC A;  2OI3 A;  2RQW A;  1X2K A;  2EGE A;  2ECZ A;  1JEG A;  2PTK A;  1V1C A;  1KSW A;  2ROL A;  2VKN A;  1AD5 A;  2KBT A;  3R6N A;  1RUW A;  4LN2 A;  1AWW A;  2DRM A;  1OPK A;  2RF0 A;  1H3H A;  3A98 A;  1M30 A;  5IXF A;  4LUE A;  4D8D A;  1H92 A;  2L2P A;  2C0I A;  3TVT A;  4EIK A;  1WI7 A;  2YUN A;  2K2M A;  2CH4 A;  2FPE A;  1CSK A;  2SEM A;  1AWJ A;  2LNH B;  5EC7 A;  2KE9 A;  1QKW A;  1QWF A;  1WXB A;  3RNJ A;  4JJC A;  5ECA A;  3EHQ A;  4KRT A;  2YUO A;  2F2V A;  2CRE A;  3NMZ C;  1NEG A;  1GFD A;  3I35 A;  5IXB A;  1UG1 A;  2FPD A;  3FJ5 A;  2DA9 A;  2JM9 A;  2ABL A;  2CDT A;  1WYX A;  3H0F A;  1UHF A;  1T3L A;  1KFZ A;  2YUQ A;  4AFS C;  2DX1 A;  2PZ1 A;  2L0A A;  3M0S A;  3VS4 A;  2EGA A;  1VA7 A;  2DBK A;  2J6O A;  2KT8 A;  2EVR A;  5FWC A;  2E5K A;  4CC2 A;  2CT4 A;  2D0N A;  2JM8 A;  1GFC A;  1M3C A;  1VYV A;  4CC7 A;  2MCN A;  2AZS A;  3EG2 A;  3TSZ A;  1OV3 A;  2BZX A;  2LP5 A;  1QWE A;  2BZY A;  2D8H A;  2I0N A;  1E6H A;  1G2B A;  2DVJ A;  4GBQ A;  5FWB A;  5IHN A;  5IHI A;  3QWY A;  1Y0M A;  2DYB A;  2V1R A;  2EYW A;  1YCS B;  1WXU A;  4DEY A;  1TG0 A;  1M27 C;  3EHR A;  2J6F A;  2GNC A;  4E6R A;  1NG2 A;  3C0C A;  1NLO C;  2J7I A;  3U23 A;  2MIO A;  2F2W A;  1UTI A;  4LUD A;  1UJY A;  1AEY A;  1T0H A;  1QCF A;  4HVV A;  1PRL C;  4JJB A;  1SRL A;  4K11 A;  3REB B;  1AWX A;  2MOX A;  4RTU A;  5GJW B;  4Z89 A;  2XMF A;  2BZ8 A;  1GCQ A;  3VRZ A;  1YP5 A;  2EGC A;  1ZLM A;  4OMN A;  2J6K A;  1OOT A;  2KYB A;  1B3Q A;  2KXD A;  2QDL A;  3THK A;  1SHG A;  2D1X A;  4AFZ C;  1U3O A;  1ABO A;  4CC3 A;  2P4R A;  2YDL A;  2CUD A;  1AVZ C;  1K76 A;  1AWO A;  1X2Q A;  2O88 A;  2YSQ A;  3KFV A;  3PE0 A;  1SRM A;  4R0K A;  2EKH A;  1JXO A;  2RQV A;  2FRY A;  3M0U A;  4WCI A;  2ROT A;  1UJ0 A;  5L23 A;  2F2X A;  2LJ3 A;  2KRO A;  2M51 A;  3EG1 A;  1K0S A;  3H0I A;  1PKT A;  4OMP A;  3UA7 A;  2AZV A;  4Z8A A;  2LZ6 B;  2A08 A;  2DJQ A;  2VVK A;  1S1N A;  1ZUU A;  2JS0 A;  2JS2 A;  1K9A A;  2CT3 A;  2FG0 A;  2KRM A;  4F14 A;  1Z9Q A;  2NUZ A;  1UEC A;  4ESR A;  1UHC A;  2RQR A;  2EBP A;  2DL4 A;  4J9C A;  1UUE A;  5IH2 A;  4RTV A;  2JXB A;  3I5S A;  1GCQ C;  2B86 A;  3H0H A;  1I07 A;  2HSP A;  1ARK A;  1J3T A;  3SHW A;  1WXT A;  1VYU A;  5FW9 A;  2DIL A;  2O9V A;  2KNB B;  1WX6 A;  4ZNX A;  4OMQ A;  2RMO A;  4GLM A;  2CSQ A;  1LCK A;  4HCK A;  3VS2 A;  1W1F A;  3REA B;  1GCP A;  4AG1 C;  2OAW A;  1SPK A;  2C0O A;  2EYX A;  4FSS A;  2KGT A;  1WA7 A;  2DE0 X;  2LMJ A;  1YN8 A;  3UA6 A;  1WLP B;  2L3Q A;  3H41 A;  2K9G A;  1Z9Z A;  2GBQ A;  1QLY A;  2ESW A;  1MV3 A;  2J05 A;  1ABQ A;  1EFN A;  2K79 A;  1MV0 B;  1I0C A;  4OML A;  4RTW A;  3VS0 A;  1RI9 A;  2EYZ A;  2DNU A;  3EGU A;  1PKS A;  2EYY A;  2DL7 A;  2X3W D;  2H8H A;  2RQU A;  4JZ3 A;  2JMA A;  2O2O A;  1U5S A;  1AOJ A;  2KR3 A;  1OPL A;  4HVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...