1J3TA

Solution structure of the second sh3 domain of human intersectin 2 (kiaa1256)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
GSSGSSGVENLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second SH3 domain of human intersectin 2 (KIAA1256)
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords Intersectin 2
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2003-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1j3tA00
1SEMA 4J9CA 1W70A 2AKKA 2D8HA 2FRYA 2YDLA 1BK2A 1K9AA 3CQTA 1AZEA 1AWJA 2GQIA 5IHIA 3VS7A 4F17A 4Z89A 4HXJA 3R6NA 4LN2A 1XOVA 3M0UA 2OJ2A 1OPLA 1PKSA 1VYVA 1NLPC 2HEQA 1BU1A 5HCKA 1JQQA 1I1JA 4HCKA 1Z9QA 2KRNA 3VRYA 4JZ3A 4D8KA 2EBPA 1QWEA 1ABQA 1AOJA 2LQNA 1CKBA 1KFZA 4CC4B 2K7AA 3UA6A 2DILA 2RQTA 2NWMA 1PHTA 1VYTA 4RUGA 2RN8A 4WCIA 4AFUC 1NLOC 3VS3A 4AG2C 2FPEA 1KJWA 2DL5A 1ZBJA 3UATA 5IHNA 2V1QA 2KRMA 1UHFA 1WXUA 1WA7A 1WFWA 2GBQA 2DMOA 2W0ZA 3VS6A 3H0IA 1GBRA 1I0CA 2CSQA 1N5ZA 2J05A 1T3LA 1E6GA 2RNAA 2E5KA 3C0CA 3REBB 3PVLA 1B07A 1CSKA 2LP5A 1RLQC 1K1ZA 1Y0MA 2DL3A 3H0FA 3TSZA 4AG1C 2KYMA 1UGVA 4J9FA 2YUPA 3NHNA 1JO8A 1MV0B 1NYGA 1AEYA 1T0JA 2MOXA 1UJYA 2JS2A 3JV3A 2JT4A 4LUEA 4QT7A 1M3BA 2EGCA 2JMAA 3SEMA 4JJCA 1G83A 3U23A 3RNJA 5I22A 3O5ZA 1B3QA 2J7IA 3A98A 2LNHB 2BZ8A 2DNUA 3I5SA 2A37A 2EKHA 2HCKA 1A0NB 2EYXA 2VKNA 2D1XA 3EG0A 1RI9A 2K6DA 1SSHA 2F2WA 2L0AA 2C0IA 2ENMA 2KROA 2O2OA 1U5SA 4F16A 1GBQA 2CUBA 1AWXA 1WXBA 2AKLA 1GFCA 2L3PA 1Z9ZA 2DRMA 2RQUA 2QDLA 4FSSA 1SRLA 3ULRB 4X1VA 2RMOA 1YCSB 1PRLC 4JPBW 1J3TA 4RTWA 4E6RA 2BTTA 2MIOA 1X2QA 1AVZC 1OV3A 2RQVA 2ABLA 1WI7A 1AWOA 2AZVA 2ED1A 1VA7A 4OMLA 4CC2A 5I11A 2L3SA 1YN8A 2LJ0A 4AFSC 2ECZA 5IXBA 1W6XA 2FPDA 4CC3A 1ZUKA 2BZYA 4RTUA 1T3SA 1QWFA 2GTOA 2HSPA 1VYUA 4GBQA 5IHKA 1YNZA 3QWXX 2YSQA 1M3AA 1ZSGA 3VRZA 4LNPA 4IIOA 1M3CA 1MV3A 2A08A 4JZ4A 4ESRA 2KBTA 1JXMA 2O88A 1T0HA 2O31A 4EIKA 2DA9A 2LJ3A 1SRMA 2CSIA 1SHGA 1QLYA 2V1RA 2K2MA 1ZUYA 2X3WD 2L2PA 3NMZC 1NYFA 2LJ1A 5IXFA 2KT1A 1ZX6A 2LX7A 1FYNA 2FPFA 2EGAA 4LE9A 4DEYA 1AD5A 2PZ1A 2DM1A 3LH5A 3VS1A 2ROTA 1TUCA 1G2BA 2K9GA 1OOTA 2JMCA 1WYXA 2FRWA 2PTKA 2GNCA 2DL7A 1HD3A 4J9EA 1ZUUA 2D8JA 4HVVA 4HVUA 1ABOA 2L3QA 1HSQA 1K0XA 2I0NA 2KXCA 3VS2A 1AWWA 2KRSA 1M27C 2OAWA 4Z8AA 1E7OA 1MUZA 3TVTA 2SRCA 5FWBA 2RPNA 3GBQA 1JU5C 5FWCA 1OEBA 2KYBA 1YP5A 2CDTA 2YUNA 2CH4W 1E6HA 2W10A 2DYBA 2M0YA 1GCPA 3I9QA 1YWOA 2DL8A 2O9VA 1EFNA 3M0TA 4ZNXA 3KFVA 1TUDA 1NEGA 4A63B 2EYYA 4OMPA 2FG0A 4J9IA 1X6GA 1ZLMA 1UJ0A 3H0HA 1UHCA 2EYZA 1YWPA 2JM9A 3M0SA 3VS0A 1X43A 3SHWA 4OMNA 2CUDA 2JW4A 2K79A 4JJDA 1TG0A 2KR3A 2C0OA 3UF4A 2GGRA 1NG2A 4RTXA 2YT6A 4RTYA 2HBWA 2KE9A 1UECA 3ZL7C 3I5RA 2ED0A 1WDXA 2NUZA 4J9HA 1LCKA 3UA7A 2K3BA 1X6BA 1NM7A 1M8MA 1X69A 1BBZA 2RF0A 2CH4A 5ECAA 3THKA 1UDLA 1WLPB 2FO0A 5EC7A 2JS0A 3REAB 2LMJA 2MCNA 3RBBB 1I07A 2AK5A 2DX1A 3EG1A 2DJQA 1GCQA 4F14A 2A36A 1QKWA 1H8KA 1JEGA 4OMOA 1HJDA 2F2XA 1KIKA 3QWYA 1U06A 2YUOA 2DRKA 2G6FX 4AFZC 1IO6A 2DVJA 2DLPA 4OMMA 1KSWA 2FEIA 1WIEA 2JXBA 4R0KA 2B86A 1BB9A 2F2VA 4Z88A 2XMFA 1W1FA 2M51A 1SPKA 2ROLA 2RQRA 4Y92A 1K4US 4OMQA 4J9BA 2JTEA 2VVKA 2EPDA 1PWTA 2DF6A 4J9DA 3I35A 2DBKA 1GRIA 2LZ6B 2OI3A 3IQLA 2A28A 2KEAA 2JM8A 2DE0X 3M0RA 3TSWA 2PNIA 2P4RA 2CT3A 3EHQA 3M0PA 4J9GA 1U3OA 2KGTA 2X3XD 3PVQA 2LQWA 3NGPA 1PRMC 1X27A 4RTTA 1AZGB 4M4ZA 1FMKA 1K76A 1X2KA 2SEMA 1RLPC 2C0TA 1GFDA 1H3HA 2KT8A 2YUQA 1OPKA 5IH2A 3EG2A 1M30A 4ORZA 1QCFA 1UE9A 4RTVA 1Y57A 1ARKA 2LCSA 2EW3A 2RQWA 4KRTA 1WXTA 2EVRA 2O9SA 3PE0A 4JJBA 2KXDA 2DL4A 1UUEA 3EGUA 2EQIA 1GL5A 2DBMA 2CT4A 2D0NA 2IIMA 2AZSA 3FJ5A 1RUWA 1GCQC 3NPFA 1PNJA 2J6FA 4AFQC 2H8HA 4DEXA 4IIMA 1V1CA 1UFFA 3H41A 4K11A 1NEBA 1S1NA 1UG1A 1CKAA 3VS4A 1JXOA 2J6OA 1QKXA 1WX6A 4D8DA 2HDAA 3VS5A 2J06A 3M0QA 1PKTA 3EG3A 5GJVB 2EGEA 2J6KA 4HVWA 2VWFA 2BZXA 1SHFA 4CC7A 5GJWB 2KNBB 5FW9A 4LUDA 4RTZA 1UTIA 1K0SA 5L23A 1H92A 3EHRA 2CREA 2ESWA 2EYWA 4GLMA 2GTJA
chains in the Genus database with same CATH superfamily
1V76A 2PUKB 1AWJA 1H3ZA 3G71T 3M9QA 3A8HB 3C4SA 4HXJA 5CQYA 2LDMA 1LJOA 4M78F 1XOVA 3LYIA 4FU6A 5FU7C 3TREA 1OPLA 1VQ7T 5GANf 1KQSA 1UGPB 4OP0A 3GF5A 4ELZC 2HEQA 1BU1A 2MMPA 4OGEA 4HCKA 2LVMA 5KYWA 1AOJA 3HFNA 1CKBA 4IURA 1VQ5A 4CC4B 2DD4A 5J3BA 3JSCA 4XU2A 4MMKA 2NWMA 4JRIA 3OYGA 1PHTA 4RUGA 4WCIA 3N5BB 5AT1B 1ACMB 2FPEA 4J6WA 2DL5A 4M7AD 5GANg 2KI7A 5IHNA 4C8QG 1PSFA 1UHFA 1WXUA 4FSXA 1WFWA 4PJJA 3SWNC 3DLLA 5GAMd 2YHTA 3SFMA 1BKBA 5LJ3f 3MKDA 3JCMX 1IGUA 5FROA 4M7DC 2CSQA 4PJMA 3CCVT 3QDRB 5LJ5f 2VXFA 1OYXA 5HKCA 1VQLA 2GCXA 2XKOC 2M0OA 3C0CA 5HY6A 3QZ9B 2LP5A 1RLQC 3OMGA 3LW5E 3H0FA 4M78D 1NZ9A 1YITT 4BB7A 4RG2A 1AEYA 4LDVA 2RK1A 2EGCA 2JMAA 2JTFA 2LCCA 4OGCA 2CP2A 2EAYA 1QCNA 2HAXA 3ZEHA 2EYXA 3EG0A 1RI9A 1C0MA 2XU8A 2F2WA 2C0IA 2KROA 3CPWS 1U5SA 4F16A 2X9HA 1FWZA 1VQNT 2CUBA 1N27A 1GFCA 2L3PA 2MWOA 1X75C 4HCCA 3M53A 3OS1A 3TU4K 3OYHA 1KC8C 2M1HA 2RMOA 5KCHA 1TWBA 4JS5A 3VYGA 4RTWA 4E6RA 4KUDK 1YJNT 1AVZC 2ABLA 2AHJB 1YITA 2ED1A 1QVFS 5CR2A 2QA4A 3O8VA 3OMCA 4NL2A 1M1KC 2IVWA 4BI3A 2L3SA 2EQUA 3SD4A 5KYWB 2RB6A 1EX4A 2CP0A 5LJ3j 2K5LA 1W6XA 4E7KA 2XIDA 3A8GB 3CC7A 1ZUKA 1WJSA 4C0DC 3J81E 2GTOA 1U8RA 1UGSB 2QASA 3HSBA 2CYZB 1M3CA 4EDUA 1BI2A 3ZFJA 3CMEQ 1VQNA 1IB8A 2O88A 5J26A 2LJ3A 1XQHA 1SRMA 2CSIA 1SHGA 3MEVA 3MJXA 1N9SA 4M77G 2FPFA 1Q86C 4DEYA 2DM1A 3CXCS 2K9GA 3GP8A 1WYXA 2FRWA 4PFZA 4E7HA 3I55Q 2DXCA 1YBYA 4C5HA 4TVRA 1HD3A 1ZUUA 4HVVA 2L3QA 1HSQA 2KXCA 1R77A 3MEAA 4OB1B 2OAWA 5GAOr 1K9MU 2MPXC 2RPNA 3FB9A 3GBQA 3G1JA 1D0ZA 5FWCA 4XTXA 4QQGA 2KYBA 3META 3CCRQ 4PLIA 1U1TA 1Q86U 4N0AA 2CDTA 2YUNA 2CH4W 2DYBA 3EFSA 1VQOT 4N4IA 1KQSS 2XDPA 5KYUA 4C5EA 4YTLA 3KFVA 1TUDA 1ZQ1A 3OYKA 2EYYA 1QW1A 2FG0A 2M9UA 4C8QD 1ZLMA 1D3BB 1UHCA 3M0SA 3VS0A 3JRZA 3SHWA 1UB4A 3ER0A 4F7UE 1VQOA 4JJDA 5LJ3g 2C0OA 1NG2A 1WQ7A 4RTXA 4FT4A 4KUIA 1UECA 1QMCA 3T9NA 2HL5C 1S72T 2M02A 4M77F 1VQ8T 1G3WA 1ZA2B 2VYTA 4C8QF 2MAMA 1BCOA 2P84A 1OQKA 1BBZA 4GY5A 2BIVA 2CH4A 2NUTB 2VUBA 1W2BA 1WLPB 2ZAEA 3REAB 1I07A 3HTRA 3PMTA 2HL3A 1GCQA 4F14A 2A36A 1SG5A 3CCVQ 1S72A 1QKWA 3NFCA 4D6WA 4ZTFA 1W4SA 3NTKA 2YUOA 4KULA 3TQ7P 2DLPA 2B8AA 2E70A 2QEXQ 1OU9A 3S3OA 3LLRA 3RKXA 2JXBA 1K73U 2B86A 1KQ2A 3CXCA 2X51A 5GAMj 2RQRA 4FYXB 2HZYA 4DBQA 4GLKA 4C92G 4DOWA 2VVKA 4B6MA 2X35A 4J9DA 4E7LA 3BW1A 2KDSA 3QZ5B 1O9SA 4ZGJB 4J6YA 4UC4A 2DBKA 2LZ6B 2A28A 2KEAA 2HNIA 1SKUB 5CKBA 2DE0X 2COZA 3TSWA 4EMHA 2PNIA 3JCMQ 2OTLA 8AT1B 2CT3A 4J9GA 3HPWA 3ZBDA 1QP2A 2E41A 5KYXA 1PRMC 3GNFB 2COWA 2QXFA 4M4ZA 2Y4YA 3HFOA 1K76A 3PT9A 2SEMA 1RLPC 5CKDA 1GFDA 2CZ0B 1H3HA 1KQSP 3SWNA 2OTLQ 2DETA 2OTLT 2WACA 1QCFA 2HQEA 1WHLA 3BE3A 5GANj 1IGQA 5A0DA 5KYYA 3DB3A 2DJZA 4QVDA 4O5VA 2KXDA 2DL4A 3QJ6A 4M78G 2CT4A 1IREB 4HCBA 1JB0E 4CI0C 2H3JA 2AZSA 1M8VA 1RAEB 2O4XB 2V8JA 3UPUA 3NPFA 1PNJA 3DKMA 2J6FA 4LDYA 4AFQC 4JLIA 2QAZA 3CCRT 3CBPA 4BDZA 1VQ6T 3VU3C 3H41A 3VS4A 2J6OA 1QKXA 3JB9J 5GAOm 2KSSA 3URGA 2DD5A 4CC7A 1ZHIA 2QQSA 1OZ3A 1JJ2P 3CPFA 1K0SA 2JUFA 2X4WA 5L23A 1H92A 5KCOA 4NS5A 4IUTA 1K8AC 2CREA 4BY6B 2GTJA 2GF7A 3G71A 1WQWA 3FC3A 2DERA 1W70A 2D8HA 3CQTA 3I56Q 1AZEA 2R5AA 2GQIA 2NUPB 3VS7A 4F17A 5GAMg 1YHQQ 3DLMA 2DEQA 3CD6T 3M0UA 3CCLQ 1PKSA 3CCQQ 1YFNA 3CCEA 2L89A 1YJWQ 2FZGB 2CZ6B 5HCKA 1M90U 1JQQA 4RKUE 1I1JA 1Z9QA 2HKQB 3OYEA 2VGMA 3EH1A 2EBPA 3OBWA 3JB9D 4A53A 1Q81U 1B34A 1Q7YU 2HQXA 2YLCA 1BIBA 3M54A 4RCBA 2K7AA 1K9MC 3MP1A 4OMFB 4M7AB 2RJFA 1VYTA 1VUBA 2O01E 1VQ5T 3VS3A 3L2RA 1KJWA 1ZBJA 3CCJT 4C5IA 4IUQA 4J8OA 3OY9A 1MMDA 2QA4T 1PC0A 3VS6A 3H0IA 1GBRA 3L1AA 1OULA 5GAN8 1F1BB 1HK9A 1VQ9T 2DYIA 2X4JA 2LQ8A 2QA4Q 1WHGA 3ASKA 4CRIA 2KK4A 1OI1A 1M2VB 1W2BS 2CGHA 2KVQG 2A0FB 4HT8A 4M78A 3UT1A 4PJOF 2KYMA 4FW2A 3EFOA 4WF2A 3CC4A 3M4GA 3RKYA 1MV0B 2IG0A 1T0JA 3LH0A 4BE1A 1UJYA 2JS2A 1VQ9A 1ZSZC 4LUEA 5FU7B 4JJCA 3RNJA 1VQPQ 5I22A 3O5ZA 5GAN2 3A98A 2LNHB 1YCYA 3I5SA 1Q7YC 2A37A 2HCKA 1YITQ 2NLUA 3JB9I 3H8ZA 2L0AA 2ENMA 1M1KR 1GBQA 3M58A 1AWXA 1VIEA 1H641 2E65A 1ZA1B 3PFSA 4M75B 4QQ6A 2QDLA 1MMGA 4FSSA 3JAME 4LDXA 1VQOQ 4X9CA 4X1VA 3RIRA 1YHQA 1ZSZB 1YCSB 1PRLC 4XTYA 1J3TA 4KH0B 2HQHA 1Y96B 2BTTA 1X2QA 1G3SA 3CCMA 1TU0B 2EJ9A 2JOYA 2RQVA 1AWOA 2RD1A 3UDCA 2AZVA 3BDUA 5A0GA 1VA7A 3RESA 4M77C 5GAMe 2DTIA 2RHIA 2E4HA 1FMVA 4XTVA 2QGFB 2EWNA 2QG9B 2LQKA 2FPDA 1JRIA 1PG5B 1FX7A 4DBRA 3QWXX 2O4XA 3H9NA 4LNPA 1QVGS 4IIOA 3MEUA 2EQMA 4JZ4A 1BIAA 4ESRA 3OYCA 3OA6A 2LNVA 1TSFA 1T0HA 2O31A 2FYKA 2V8KA 5GANh 4F7UA 3CD6Q 2V1RA 4M77B 2L2PA 4BD3A 3J80E 2EQKA 2EJFA 2LX7A 1FYNA 3OSVA 2EGAA 1R8OB 4L5GA 1AD5A 3R6OA 2EQJA 5HK0A 3VS1A 3JCMh 3V8LA 3L2VA 1M1FA 1K73R 3AHUA 2LCLA 1IZ6A 1JJ2S 4M7DB 2PTKA 2GNCA 2DL7A 2RK2A 4J9EA 4HVUA 1I4K1 4NOYA 1K0XA 3VS2A 3PIOA 3DB4A 3JCMW 1QQJA 2DAQA 4FM4B 4Z8AA 3EGDB 3TVTA 2DZ9A 2KY9A 2M16A 2SRCA 5CKEA 6AT1B 2QEXT 2MYSA 4F04B 9ATCB 3UWNA 4J7IA 1YP5A 4PKCC 4DA4A 2DTOA 2M0YA 1GCPA 3PNWC 1D1AA 2DL8A 2QQ9A 2ZPGB 1EFNA 4RMOA 4HA8A 4ZNXA 2D0QB 4BY6C 1IRXA 1I8FA 3HRSA 1D1BA 2LC4A 3F70A 1UJ0A 1N8RR 4J6XA 3VUZA 1YWPA 3JCMf 2LX9A 1X43A 4E7IA 4OMNA 2K79A 4MZMA 1TG0A 5I2MA 2YRVA 1VQMQ 2GGRA 4PJOG 2CZ1B 4RTYA 4XK8E 3RUXA 2HBWA 1LNXA 2JZ2A 3I5RA 2KQWA 3MO8A 1RI0A 1WGSA 5D6WA 4AT1B 3OYIA 2K3BA 3QSUA 2K5IA 1X69A 2L3RA 2Y90A 1C6VX 1VQ4Q 3OS5A 1M4ZA 4M77D 1YHQT 2MCNA 3RBBB 1AHJB 2AK5A 1TS9A 4PJOC 3EG1A 4EMKC 5FU6B 2XI9A 1TH7A 1YJ9A 4OMOA 2F2XA 3QWYA 2HD0A 2G6FX 2I2LA 3HP9A 4PL6A 4M7DD 1KSWA 1XNIA 1Q82R 1K8AR 4ZN1A 1BB9A 4PFPA 2F2VA 3CCRA 1M1GA 4Z88A 4DQ2A 4M7AG 3WVEB 4MDXA 2XMFA 3TCJA 2HKNA 1WJQA 4Y92A 1K4US 4KH1B 1BI0A 4OF1A 1YIJQ 1P92A 2EPDA 2OTJA 2XD0A 1PWTA 1UEBA 1U1SA 3E1SA 2L8DA 1VQPT 3L2QA 1GRIA 1MNDA 3IQLA 5IAYA 3VUBA 2ZPBB 3EHQA 3M0PA 1M90R 2WSFE 1U3OA 4C92A 5LJ3e 2QDYB 4IKFA 3FDRA 3NGPA 1X27A 1FMKA 1WHKA 3OQ5A 1KG1A 3GLXA 4Y28E 3PMIA 2WSCE 3CPWP 1OPKA 2PQWA 1WHJA 5IH2A 3EG2A 1RACB 1D3BA 1MMAA 1UE9A 4E2FB 4RTVA 1Y57A 4C0GA 2NUPA 2LCSA 2RQWA 4KRTA 3EGXB 1WXTA 4R55A 3PE0A 4JJBA 5M9OA 1UUEA 1NPRA 3EGUA 2EQIA 1GL5A 2E3IA 2MWPA 2DBMA 4AMCA 3QBYA 3CCJQ 4M75D 3OYAA 1VQPA 1WPYA 3FJ5A 1VQ5Q 1RUWA 1YI2Q 1VQ9Q 4PJOE 3RR6A 2MF2A 2ZPEB 1KD1C 3CBMA 3M57A 1Y96A 3INZA 2H8HA 4IIMA 1V1CA 1UFFA 1UG1A 1RAIB 4D8DA 2J06A 3P8BB 3X26B 4M77A 1PKTA 2H3EB 1MMNA 5GJVB 3WXMB 1VQLQ 4HVWA 2RJCA 1RAHB 2P0QA 1VQ7A 1UTIA 2RI2A 2FB7A 1YJ9Q 3KXTA 2CP6A 3OS2A 3CEYA 2YDLA 1BK2A 2YXYA 4JDSA 5IHIA 5CAIA 4Z89A 3JCMJ 4LN2A 3CCVA 4XTUA 8ATCB 1D09B 2OJ2A 2A3LA 4QW2A 2E5QA 1VYVA 1NLPC 4LDUA 2OTJQ 1PD0A 3P8DA 3C95A 3NTHA 3VRYA 4JZ3A 2JN0A 1ABQA 3SB2A 4QVCA 1R0BG 4EMKB 1KK7A 3HHTB 3UA6A 4DOVA 3D7SB 2R58A 2DILA 3A8MB 3BY7A 1RABB 5D6XA 3OS0A 3LGFA 3L2UA 4QQDA 4FL6A 2RN8A 3KBGA 4AFUC 1NLOC 1OX9A 3KUFA 3QJYA 4HKEA 2XG8D 1VQLT 3V7RA 2V1QA 3EGDA 4JLGA 3QXEB 5HK3A 2JJ9A 2KRMA 1WA7A 1UGRB 2DMOA 1XTDA 2RI3A 1I0CA 3A8LB 4B9WA 1T3LA 1RL2A 4OVAA 4L6V5 2RNAA 4R56A 3G4ST 1B07A 1K1ZA 1Y07A 2DL3A 2BE9B 2QQAA 4J9FA 1PD1A 2YUPA 1VQKQ 5CQXA 4M75G 3FLGA 3CCEQ 3JV3A 2JT4A 3HRUA 1KQ1A 3SEMA 1G83A 5DM7R 4PLLA 2ZCFB 2J7IA 3X28B 5D7UA 4XU3A 2KMTA 4Z02A 4JJNK 3MPUB 3CCET 2EKHA 4KGVB 4E7JA 4HCZA 2QQRA 2VKNA 2XDBA 2K6DA 1SSHA 5KH6A 5D6YA 2O2OA 2RM4A 1WXBA 5EG2A 4M7DF 2RQUA 4XU0A 1YJNQ 1SRLA 2DPPB 1WHMA 2ZGWA 2D9TA 2RI5A 4ELYC 2OX7A 2CKKA 3HRTA 5KYUB 2MIOA 1YI2T 3HL8A 1OV3A 4QKUA 5GMKm 1N8RU 2P4TA 2R57A 4OMLA 2GFAA 4CC2A 3LWHA 2VASA 5KE3A 2LJ0A 3BDLA 4C92D 4A4HA 2ECZA 5IXBA 3OYNA 4J5YA 4CC3A 5FU6C 4KT0E 1V29B 4C8QB 1QWFA 4KBMB 4PJOB 1YJNA 2BE7D 4GBQA 5IHKA 1YNZA 2YSQA 2RHXA 4QVZA 3VRZA 1VQMT 3M56A 4X34A 4M7DG 1SF9A 2DFUA 4M78C 3GOXA 2KBTA 4ATOA 1JXMA 2EFIA 2JTMA 4C8QA 4EIKA 2DA9A 2ZPFB 4O6JA 1QLYA 2ZPHB 5GAN6 2X3WD 3NMZC 3CMET 2LT1A 5IXFA 3JCMc 2DIQA 5C6SA 2PZ1A 3LH5A 2E6ZA 1Q82U 1G2BA 1OOTA 4JRKA 3OYFA 2Y4XA 4M75F 2F5KA 3OBYA 1ABOA 4L59A 2KRSA 1M27C 1E7OA 1MUZA 1MGQA 4ZGEB 2XK0A 1G3TA 3L42A 3EG9A 3VKIA 1KD1R 2QK0A 3JCMb 2E6NA 1E6HA 4DBFA 1R0CB 3JB9G 2GFUA 2RJDA 2O9VA 3M0TA 4BUGA 2ATCB 2RHUA 4IUVA 5FLXE 3PGGA 4A63B 1VQ4T 1VQ6A 3A1PA 3LWIA 1X6GA 4XQ3A 5FRNA 3CCUT 4M77E 3CCSQ 3H0HA 4M7AC 3C12A 2NUTA 1UGQB 2F5TX 2JM9A 4C5GA 2CZ7B 2JW4A 2FHDA 1D0YA 2KR3A 3CC4Q 3CXCP 2VGNA 4Q5WA 2LTOA 3M5AA 4M7DE 3E19A 3OYDA 2RA2A 2ED0A 3OYJA 1WDXA 4J9HA 3OYBA 2HBPA 4A4KA 3CCMT 5ECAA 4E7SA 3JCMe 1UDLA 2FO0A 4E7ZA 3L2ZA 5EC7A 4A54A 2LMJA 5GMKh 4FCYA 2DX1A 3WVDB 2DJQA 2PU9B 3PTAA 3FJPA 3OW2P 4LD6A 4A4EA 2P0KA 1JEGA 3QKJA 3EAEA 3OW2S 1U06A 1VQ4A 2DRKA 2DVJA 2FVUA 5KYNA 2DK3A 1WIEA 4R0KA 1WHHA 5LJ3h 3JB9H 1Y7XA 2RHYA 3NTIA 2K3XA 5LJ5h 1W1FA 1I5LA 3X24B 2ROLA 5A0LA 3FRNA 4J9BA 2JTEA 3MP8A 1K9MR 4J7FA 3E9GA 4XU1A 3I55A 2XICA 1JJ2A 5J39A 3G6ET 2JM8A 1AT1B 1KC8U 2WSEE 1ZBXA 1PCXA 3OW2A 2VB6A 2X3XD 3PVQA 4FYVB 2NYSA 1NPPA 1QP3A 3CCQT 4M75E 4MMLA 5GAN4 3P8HA 4EMGA 5DY9A 4LXCA 1Q7YR 2F69A 2C06A 5GAN5 1BI1A 5DLQE 3TEEA 1X2KA 1YJWA 2C0TA 1LPLA 2YUQA 4PJOD 1M30A 1C1AA 4ORZA 3GPLA 3M4YA 3CD6A 2LT4A 2MK5A 4XTWA 1QVFP 1Q95G 2EVRA 1O75A 2EJGA 1NJIR 1I5OB 4M7AF 2D0NA 2IIMA 4EPCA 5I21A 1HYOA 3QG1A 4PNOA 1GCQC 1G8XA 5CVIA 3CCJA 4BDYA 1GXIE 1OX8A 4HT9A 1S1NA 4C92F 1HXDA 1WX6A 5KYYB 3VS5A 4ZN3A 3EG3A 2DKGA 2J6KA 3S3NA 2VWFA 1SHFA 2DIGA 5CKFA 5FW9A 3SDZA 4LUDA 4RTZA 5FRMA 1TTHB 2DEUA 4V2SA 4N0AC 2VC8A 1S72Q 2ESWA 4GLMA 1VIFA 1K73C 3J7AF 4M78B 1SEMA 2KAFA 4RCCA 4J9CA 2L5QA 3M59A 4P5NA 2AKKA 4FYYB 2FRYA 2E10A 1K9AA 5I2SA 3R6NA 5LJ5e 4FW1A 3VJPA 4IUPA 2BKDN 3CCMQ 4C0DB 3CC7Q 3CC7T 3X25B 3GNGA 5LL6S 1NE8A 1IXDA 5CIUA 2KRNA 3X20B 4D8KA 5KE2A 1QWEA 4II1A 3CCUA 1FMWA 3I56T 2LQNA 1KFZA 2HMAA 3CBOA 1OU8A 4WTOB 2RQTA 4JRQA 4C0ZA 1IHVA 3C94A 4AG2C 4OB0B 1YI2A 3UATA 2QTVA 3G4SQ 2YLBA 4PJOA 1WZOA 4BI8B 4C92B 5GAMf 1Q82C 3RDVA 2JNGA 2GBQA 2W0ZA 2LRQA 4LDWA 2FZCB 2DXBA 4ZGDB 5GAMh 1N5ZA 2QEXA 1OZ2A 1QVFA 5LJ3d 2J05A 4PK4A 1E6GA 5LJ5d 1TOVA 3EFOB 2E5KA 3REBB 4C8QC 3PVLA 1VQMA 1CSKA 5AYFA 1Y0MA 3TSZA 4AG1C 1YJWT 1UGVA 1ZSZA 3G4SA 3NHNA 1JO8A 1NYGA 2MOXA 2AT1B 1SSFA 4JRPA 4QT7A 1M3BA 1BCMA 7AT1B 1EIFA 5GAN7 2GQVA 2QQBA 2PUOB 3U23A 4EMKA 5GMKi 1B3QA 1Y71A 1QVGP 2BZ8A 2DNUA 3ME9A 1WNLA 1A0NB 2XDDA 4N4HA 3JCMP 3M55A 2D1XA 3CMAQ 4M75A 2K4YA 2QGGA 2AKLA 1KD1U 4C92E 1Z9ZA 2DRMA 1M5Q1 4JUVA 4RG8A 3ULRB 2CP7A 4JPBW 1VOMA 1RAAB 3OYMA 2VV5A 1Q81R 2CP3A 2YRDA 1WI7A 2K2VA 5CCAA 4PJLA 2MI6A 5I11A 1D1CA 2A7YA 2E12A 4N4GA 1YN8A 4AFSC 2HSEB 1MNEA 2BZYA 1XJWB 3V8KA 4RTUA 1T3SA 2HSPA 2DVEA 1VYUA 1M2VA 4Y91A 1B7TA 2E1HA 1NBEB 1M3AA 4BE2A 1ZSGA 3VYHB 3V8JA 1X01A 1MV3A 1MHNA 4VUBA 2A08A 3G7ZA 1N6AA 1RAFB 3RERA 4A4GA 3MEWA 1G3YA 2V8IA 4M7AA 5GANd 1YIJA 3CC2A 3CMAT 1LOJA 2COYA 1QCOA 3I56A 2K2MA 1M90C 3V7CA 1ZUYA 1NYFA 1KHIA 2LJ1A 4PFOA 2KT1A 1ZX6A 1PSEA 3FIFA 3G71Q 5CO7A 3G6EA 1TXQA 3RMSA 2VXEA 4M7DA 4LE9A 3JCMd 4MZTA 1W2BP 2CP5A 2DXUA 5GAN3 3Q1JA 2ROTA 1K8AU 1BI3A 1TUCA 2JMCA 1D0XA 3LX7A 2P0PA 2QTXA 4X9DA 3CCLA 3QUIA 4XAXB 4IUUA 3CCST 2D8JA 4A4FA 3V7SA 4C92C 2I0NA 1AWWA 1BYMA 2DZCA 1QVPA 2E3HA 5FWBA 1JU5C 3HKSA 1OEBA 2IPOB 1M1KU 2QI2A 3CPWA 1KC8R 1PM3A 4PJNA 3EG9B 2W10A 3CCSA 3OYYA 2OAUA 4MZPA 3I9QA 1JBMA 1WJRA 3GIBA 1YWOA 1DJ7B 3CMAA 1YIJT 4BE0A 5GMKj 2X4XA 4OB2B 4OB3B 2XHCA 3A8OB 1NEGA 2R5MA 4OMPA 2OTJT 4J9IA 5A2QE 3OYLA 3QPHA 5GAOn 5GMKe 2EKOA 2EYZA 5DLOA 1LVKA 1M2OA 3CC2T 3E9FA 2CUDA 5CK9A 2K57A 5KYXB 5GMKl 3UF4A 3E2UA 3MP6A 2YT6A 3AT1B 2KE9A 4KGZB 3ZL7C 1FXXA 3RKWA 1NJIU 3CC2Q 3L2WA 1YJ9T 2NUZA 1LCKA 3UA7A 3JB9F 1X6BA 1NM7A 1M8MA 3CCUQ 1VQ7Q 1EZZB 3CCLT 2RF0A 2YWWA 4C8QE 1VQ8A 3THKA 3PIPA 1M9SA 2JS0A 3RMQA 3EGXA 4DBHA 2JVVA 1N9RA 3QHSA 3CC4T 2RO0A 3QO3A 3S6WA 4F7UB 4E47A 2PVOB 1H8KA 1I81A 1HJDA 4J83A 1KIKA 1G5VA 3JCMg 4AFZC 1IO6A 4OMMA 2FEIA 3OSSC 2Z0WA 4B9XA 2ZPIB 2QYZA 2M51A 1SPKA 4KGXB 4OMQA 1VQKA 2AIRB 2DTHA 1VQ6Q 2RH2A 2ZZDA 5LJ5j 2DF6A 3I35A 4ZTJA 2FL7A 2BUDA 3LGLA 4MDWA 2K5FA 3MHXA 2G3RA 2X4YA 2OI3A 4C0FA 1Q86R 1IHWA 3M0RA 2RJEA 2P4RA 4FIBA 3S3MA 4FT2A 2KGTA 1VQKT 5IT9E 4M7AE 1NJIC 1TUGB 2YRCA 3QYHB 4XTZA 2LQWA 1B34B 3EFRA 4RTTA 1AZGB 1RADB 4FYWB 4BI4A 5L8RE 4BACA 2KT8A 3CCQA 2PVGB 3QDFA 2DO3A 2E64A 5IN1A 5GAOl 5GANe 2D6FA 3QIIA 4JS4A 3VV0A 1ARKA 1KHCA 2EW3A 3FEOA 2EIFA 2O9SA 3H6ZA 4LD9K 4F7UF 2RHZA 3OB9A 4M78E 3QYGB 2V26A 4NL3A 2DXTA 3MCAB 3A5ZB 1RAGB 3G6EQ 3SWNB 5C0MA 4ANJA 4F7UG 5GAOp 2CS7A 4DEXA 4K11A 1NEBA 3BFMA 5GAOq 1CKAA 1JXOA 2PVDB 2F1LA 1QVGA 5CKHA 2HDAA 1N8RC 3M0QA 3JCMV 2EGEA 3CMEA 1VQNQ 4M75C 2FZKB 1X6OA 2BZXA 5GJWB 2KNBB 3EH2A 2EYQA 2K3YA 3I55T 1VQ8Q 4ME7A 3EHRA 2EYWA 5LJ5g 1Q81C
chains in the Genus database with same CATH topology
1SEMA 4J9CA 1W70A 2AKKA 2D8HA 2FRYA 2YDLA 1BK2A 1K9AA 3CQTA 1AZEA 1AWJA 2GQIA 5IHIA 3VS7A 4F17A 4Z89A 4HXJA 3R6NA 4LN2A 1XOVA 3M0UA 2OJ2A 1OPLA 1PKSA 1VYVA 1NLPC 2HEQA 1BU1A 5HCKA 1JQQA 1I1JA 4HCKA 1Z9QA 2KRNA 3VRYA 4JZ3A 4D8KA 2EBPA 1QWEA 1ABQA 1AOJA 2LQNA 1CKBA 1KFZA 4CC4B 2K7AA 3UA6A 2DILA 2RQTA 2NWMA 1PHTA 1VYTA 4RUGA 2RN8A 4WCIA 4AFUC 1NLOC 3VS3A 4AG2C 2FPEA 1KJWA 2DL5A 1ZBJA 3UATA 5IHNA 2V1QA 2KRMA 1UHFA 1WXUA 1WA7A 1WFWA 2GBQA 2DMOA 2W0ZA 3VS6A 3H0IA 1GBRA 1I0CA 2CSQA 1N5ZA 2J05A 1T3LA 1E6GA 2RNAA 2E5KA 3C0CA 3REBB 3PVLA 1B07A 1CSKA 2LP5A 1RLQC 1K1ZA 1Y0MA 2DL3A 3H0FA 3TSZA 4AG1C 2KYMA 1UGVA 4J9FA 2YUPA 3NHNA 1JO8A 1MV0B 1NYGA 1AEYA 1T0JA 2MOXA 1UJYA 2JS2A 3JV3A 2JT4A 4LUEA 4QT7A 1M3BA 2EGCA 2JMAA 3SEMA 4JJCA 1G83A 3U23A 3RNJA 5I22A 3O5ZA 1B3QA 2J7IA 3A98A 2LNHB 2BZ8A 2DNUA 3I5SA 2A37A 2EKHA 2HCKA 1A0NB 2EYXA 2VKNA 2D1XA 3EG0A 1RI9A 2K6DA 1SSHA 2F2WA 2L0AA 2C0IA 2ENMA 2KROA 2O2OA 1U5SA 4F16A 1GBQA 2CUBA 1AWXA 1WXBA 2AKLA 1GFCA 2L3PA 1Z9ZA 2DRMA 2RQUA 2QDLA 4FSSA 1SRLA 3ULRB 4X1VA 2RMOA 1YCSB 1PRLC 4JPBW 1J3TA 4RTWA 4E6RA 2BTTA 2MIOA 1X2QA 1AVZC 1OV3A 2RQVA 2ABLA 1WI7A 1AWOA 2AZVA 2ED1A 1VA7A 4OMLA 4CC2A 5I11A 2L3SA 1YN8A 2LJ0A 4AFSC 2ECZA 5IXBA 1W6XA 2FPDA 4CC3A 1ZUKA 2BZYA 4RTUA 1T3SA 1QWFA 2GTOA 2HSPA 1VYUA 4GBQA 5IHKA 1YNZA 3QWXX 2YSQA 1M3AA 1ZSGA 3VRZA 4LNPA 4IIOA 1M3CA 1MV3A 2A08A 4JZ4A 4ESRA 2KBTA 1JXMA 2O88A 1T0HA 2O31A 4EIKA 2DA9A 2LJ3A 1SRMA 2CSIA 1SHGA 1QLYA 2V1RA 2K2MA 1ZUYA 2X3WD 2L2PA 3NMZC 1NYFA 2LJ1A 5IXFA 2KT1A 1ZX6A 2LX7A 1FYNA 2FPFA 2EGAA 4LE9A 4DEYA 1AD5A 2PZ1A 2DM1A 3LH5A 3VS1A 2ROTA 1TUCA 1G2BA 2K9GA 1OOTA 2JMCA 1WYXA 2FRWA 2PTKA 2GNCA 2DL7A 1HD3A 4J9EA 1ZUUA 2D8JA 4HVVA 4HVUA 1ABOA 2L3QA 1HSQA 1K0XA 2I0NA 2KXCA 3VS2A 1AWWA 2KRSA 1M27C 2OAWA 4Z8AA 1E7OA 1MUZA 3TVTA 2SRCA 5FWBA 2RPNA 3GBQA 1JU5C 5FWCA 1OEBA 2KYBA 1YP5A 2CDTA 2YUNA 2CH4W 1E6HA 2W10A 2DYBA 2M0YA 1GCPA 3I9QA 1YWOA 2DL8A 2O9VA 1EFNA 3M0TA 4ZNXA 3KFVA 1TUDA 1NEGA 4A63B 2EYYA 4OMPA 2FG0A 4J9IA 1X6GA 1ZLMA 1UJ0A 3H0HA 1UHCA 2EYZA 1YWPA 2JM9A 3M0SA 3VS0A 1X43A 3SHWA 4OMNA 2CUDA 2JW4A 2K79A 4JJDA 1TG0A 2KR3A 2C0OA 3UF4A 2GGRA 1NG2A 4RTXA 2YT6A 4RTYA 2HBWA 2KE9A 1UECA 3ZL7C 3I5RA 2ED0A 1WDXA 2NUZA 4J9HA 1LCKA 3UA7A 2K3BA 1X6BA 1NM7A 1M8MA 1X69A 1BBZA 2RF0A 2CH4A 5ECAA 3THKA 1UDLA 1WLPB 2FO0A 5EC7A 2JS0A 3REAB 2LMJA 2MCNA 3RBBB 1I07A 2AK5A 2DX1A 3EG1A 2DJQA 1GCQA 4F14A 2A36A 1QKWA 1H8KA 1JEGA 4OMOA 1HJDA 2F2XA 1KIKA 3QWYA 1U06A 2YUOA 2DRKA 2G6FX 4AFZC 1IO6A 2DVJA 2DLPA 4OMMA 1KSWA 2FEIA 1WIEA 2JXBA 4R0KA 2B86A 1BB9A 2F2VA 4Z88A 2XMFA 1W1FA 2M51A 1SPKA 2ROLA 2RQRA 4Y92A 1K4US 4OMQA 4J9BA 2JTEA 2VVKA 2EPDA 1PWTA 2DF6A 4J9DA 3I35A 2DBKA 1GRIA 2LZ6B 2OI3A 3IQLA 2A28A 2KEAA 2JM8A 2DE0X 3M0RA 3TSWA 2PNIA 2P4RA 2CT3A 3EHQA 3M0PA 4J9GA 1U3OA 2KGTA 2X3XD 3PVQA 2LQWA 3NGPA 1PRMC 1X27A 4RTTA 1AZGB 4M4ZA 1FMKA 1K76A 1X2KA 2SEMA 1RLPC 2C0TA 1GFDA 1H3HA 2KT8A 2YUQA 1OPKA 5IH2A 3EG2A 1M30A 4ORZA 1QCFA 1UE9A 4RTVA 1Y57A 1ARKA 2LCSA 2EW3A 2RQWA 4KRTA 1WXTA 2EVRA 2O9SA 3PE0A 4JJBA 2KXDA 2DL4A 1UUEA 3EGUA 2EQIA 1GL5A 2DBMA 2CT4A 2D0NA 2IIMA 2AZSA 3FJ5A 1RUWA 1GCQC 3NPFA 1PNJA 2J6FA 4AFQC 2H8HA 4DEXA 4IIMA 1V1CA 1UFFA 3H41A 4K11A 1NEBA 1S1NA 1UG1A 1CKAA 3VS4A 1JXOA 2J6OA 1QKXA 1WX6A 4D8DA 2HDAA 3VS5A 2J06A 3M0QA 1PKTA 3EG3A 5GJVB 2EGEA 2J6KA 4HVWA 2VWFA 2BZXA 1SHFA 4CC7A 5GJWB 2KNBB 5FW9A 4LUDA 4RTZA 1UTIA 1K0SA 5L23A 1H92A 3EHRA 2CREA 2ESWA 2EYWA 4GLMA 2GTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SEM A;  4J9C A;  1W70 A;  2AKK A;  2D8H A;  2FRY A;  2YDL A;  1BK2 A;  1K9A A;  3CQT A;  1AZE A;  1AWJ A;  2GQI A;  5IHI A;  3VS7 A;  4F17 A;  4Z89 A;  4HXJ A;  3R6N A;  4LN2 A;  1XOV A;  3M0U A;  2OJ2 A;  1OPL A;  1PKS A;  1VYV A;  1NLP C;  2HEQ A;  1BU1 A;  5HCK A;  1JQQ A;  1I1J A;  4HCK A;  1Z9Q A;  2KRN A;  3VRY A;  4JZ3 A;  4D8K A;  2EBP A;  1QWE A;  1ABQ A;  1AOJ A;  2LQN A;  1CKB A;  1KFZ A;  4CC4 B;  2K7A A;  3UA6 A;  2DIL A;  2RQT A;  2NWM A;  1PHT A;  1VYT A;  4RUG A;  2RN8 A;  4WCI A;  4AFU C;  1NLO C;  3VS3 A;  4AG2 C;  2FPE A;  1KJW A;  2DL5 A;  1ZBJ A;  3UAT A;  5IHN A;  2V1Q A;  2KRM A;  1UHF A;  1WXU A;  1WA7 A;  1WFW A;  2GBQ A;  2DMO A;  2W0Z A;  3VS6 A;  3H0I A;  1GBR A;  1I0C A;  2CSQ A;  1N5Z A;  2J05 A;  1T3L A;  1E6G A;  2RNA A;  2E5K A;  3C0C A;  3REB B;  3PVL A;  1B07 A;  1CSK A;  2LP5 A;  1RLQ C;  1K1Z A;  1Y0M A;  2DL3 A;  3H0F A;  3TSZ A;  4AG1 C;  2KYM A;  1UGV A;  4J9F A;  2YUP A;  3NHN A;  1JO8 A;  1MV0 B;  1NYG A;  1AEY A;  1T0J A;  2MOX A;  1UJY A;  2JS2 A;  3JV3 A;  2JT4 A;  4LUE A;  4QT7 A;  1M3B A;  2EGC A;  2JMA A;  3SEM A;  4JJC A;  1G83 A;  3U23 A;  3RNJ A;  5I22 A;  3O5Z A;  1B3Q A;  2J7I A;  3A98 A;  2LNH B;  2BZ8 A;  2DNU A;  3I5S A;  2A37 A;  2EKH A;  2HCK A;  1A0N B;  2EYX A;  2VKN A;  2D1X A;  3EG0 A;  1RI9 A;  2K6D A;  1SSH A;  2F2W A;  2L0A A;  2C0I A;  2ENM A;  2KRO A;  2O2O A;  1U5S A;  4F16 A;  1GBQ A;  2CUB A;  1AWX A;  1WXB A;  2AKL A;  1GFC A;  2L3P A;  1Z9Z A;  2DRM A;  2RQU A;  2QDL A;  4FSS A;  1SRL A;  3ULR B;  4X1V A;  2RMO A;  1YCS B;  1PRL C;  4JPB W;  1J3T A;  4RTW A;  4E6R A;  2BTT A;  2MIO A;  1X2Q A;  1AVZ C;  1OV3 A;  2RQV A;  2ABL A;  1WI7 A;  1AWO A;  2AZV A;  2ED1 A;  1VA7 A;  4OML A;  4CC2 A;  5I11 A;  2L3S A;  1YN8 A;  2LJ0 A;  4AFS C;  2ECZ A;  5IXB A;  1W6X A;  2FPD A;  4CC3 A;  1ZUK A;  2BZY A;  4RTU A;  1T3S A;  1QWF A;  2GTO A;  2HSP A;  1VYU A;  4GBQ A;  5IHK A;  1YNZ A;  3QWX X;  2YSQ A;  1M3A A;  1ZSG A;  3VRZ A;  4LNP A;  4IIO A;  1M3C A;  1MV3 A;  2A08 A;  4JZ4 A;  4ESR A;  2KBT A;  1JXM A;  2O88 A;  1T0H A;  2O31 A;  4EIK A;  2DA9 A;  2LJ3 A;  1SRM A;  2CSI A;  1SHG A;  1QLY A;  2V1R A;  2K2M A;  1ZUY A;  2X3W D;  2L2P A;  3NMZ C;  1NYF A;  2LJ1 A;  5IXF A;  2KT1 A;  1ZX6 A;  2LX7 A;  1FYN A;  2FPF A;  2EGA A;  4LE9 A;  4DEY A;  1AD5 A;  2PZ1 A;  2DM1 A;  3LH5 A;  3VS1 A;  2ROT A;  1TUC A;  1G2B A;  2K9G A;  1OOT A;  2JMC A;  1WYX A;  2FRW A;  2PTK A;  2GNC A;  2DL7 A;  1HD3 A;  4J9E A;  1ZUU A;  2D8J A;  4HVV A;  4HVU A;  1ABO A;  2L3Q A;  1HSQ A;  1K0X A;  2I0N A;  2KXC A;  3VS2 A;  1AWW A;  2KRS A;  1M27 C;  2OAW A;  4Z8A A;  1E7O A;  1MUZ A;  3TVT A;  2SRC A;  5FWB A;  2RPN A;  3GBQ A;  1JU5 C;  5FWC A;  1OEB A;  2KYB A;  1YP5 A;  2CDT A;  2YUN A;  2CH4 W;  1E6H A;  2W10 A;  2DYB A;  2M0Y A;  1GCP A;  3I9Q A;  1YWO A;  2DL8 A;  2O9V A;  1EFN A;  3M0T A;  4ZNX A;  3KFV A;  1TUD A;  1NEG A;  4A63 B;  2EYY A;  4OMP A;  2FG0 A;  4J9I A;  1X6G A;  1ZLM A;  1UJ0 A;  3H0H A;  1UHC A;  2EYZ A;  1YWP A;  2JM9 A;  3M0S A;  3VS0 A;  1X43 A;  3SHW A;  4OMN A;  2CUD A;  2JW4 A;  2K79 A;  4JJD A;  1TG0 A;  2KR3 A;  2C0O A;  3UF4 A;  2GGR A;  1NG2 A;  4RTX A;  2YT6 A;  4RTY A;  2HBW A;  2KE9 A;  1UEC A;  3ZL7 C;  3I5R A;  2ED0 A;  1WDX A;  2NUZ A;  4J9H A;  1LCK A;  3UA7 A;  2K3B A;  1X6B A;  1NM7 A;  1M8M A;  1X69 A;  1BBZ A;  2RF0 A;  2CH4 A;  5ECA A;  3THK A;  1UDL A;  1WLP B;  2FO0 A;  5EC7 A;  2JS0 A;  3REA B;  2LMJ A;  2MCN A;  3RBB B;  1I07 A;  2AK5 A;  2DX1 A;  3EG1 A;  2DJQ A;  1GCQ A;  4F14 A;  2A36 A;  1QKW A;  1H8K A;  1JEG A;  4OMO A;  1HJD A;  2F2X A;  1KIK A;  3QWY A;  1U06 A;  2YUO A;  2DRK A;  2G6F X;  4AFZ C;  1IO6 A;  2DVJ A;  2DLP A;  4OMM A;  1KSW A;  2FEI A;  1WIE A;  2JXB A;  4R0K A;  2B86 A;  1BB9 A;  2F2V A;  4Z88 A;  2XMF A;  1W1F A;  2M51 A;  1SPK A;  2ROL A;  2RQR A;  4Y92 A;  1K4U S;  4OMQ A;  4J9B A;  2JTE A;  2VVK A;  2EPD A;  1PWT A;  2DF6 A;  4J9D A;  3I35 A;  2DBK A;  1GRI A;  2LZ6 B;  2OI3 A;  3IQL A;  2A28 A;  2KEA A;  2JM8 A;  2DE0 X;  3M0R A;  3TSW A;  2PNI A;  2P4R A;  2CT3 A;  3EHQ A;  3M0P A;  4J9G A;  1U3O A;  2KGT A;  2X3X D;  3PVQ A;  2LQW A;  3NGP A;  1PRM C;  1X27 A;  4RTT A;  1AZG B;  4M4Z A;  1FMK A;  1K76 A;  1X2K A;  2SEM A;  1RLP C;  2C0T A;  1GFD A;  1H3H A;  2KT8 A;  2YUQ A;  1OPK A;  5IH2 A;  3EG2 A;  1M30 A;  4ORZ A;  1QCF A;  1UE9 A;  4RTV A;  1Y57 A;  1ARK A;  2LCS A;  2EW3 A;  2RQW A;  4KRT A;  1WXT A;  2EVR A;  2O9S A;  3PE0 A;  4JJB A;  2KXD A;  2DL4 A;  1UUE A;  3EGU A;  2EQI A;  1GL5 A;  2DBM A;  2CT4 A;  2D0N A;  2IIM A;  2AZS A;  3FJ5 A;  1RUW A;  1GCQ C;  3NPF A;  1PNJ A;  2J6F A;  4AFQ C;  2H8H A;  4DEX A;  4IIM A;  1V1C A;  1UFF A;  3H41 A;  4K11 A;  1NEB A;  1S1N A;  1UG1 A;  1CKA A;  3VS4 A;  1JXO A;  2J6O A;  1QKX A;  1WX6 A;  4D8D A;  2HDA A;  3VS5 A;  2J06 A;  3M0Q A;  1PKT A;  3EG3 A;  5GJV B;  2EGE A;  2J6K A;  4HVW A;  2VWF A;  2BZX A;  1SHF A;  4CC7 A;  5GJW B;  2KNB B;  5FW9 A;  4LUD A;  4RTZ A;  1UTI A;  1K0S A;  5L23 A;  1H92 A;  3EHR A;  2CRE A;  2ESW A;  2EYW A;  4GLM A;  2GTJ A; 
#chains in the Genus database with same CATH topology
 1V76 A;  2PUK B;  1AWJ A;  1H3Z A;  3G71 T;  3M9Q A;  3A8H B;  3C4S A;  4HXJ A;  5CQY A;  2LDM A;  1LJO A;  4M78 F;  1XOV A;  3LYI A;  4FU6 A;  5FU7 C;  3TRE A;  1OPL A;  1VQ7 T;  5GAN f;  1KQS A;  1UGP B;  4OP0 A;  3GF5 A;  4ELZ C;  2HEQ A;  1BU1 A;  2MMP A;  4OGE A;  4HCK A;  2LVM A;  5KYW A;  1AOJ A;  3HFN A;  1CKB A;  4IUR A;  1VQ5 A;  4CC4 B;  2DD4 A;  5J3B A;  3JSC A;  4XU2 A;  4MMK A;  2NWM A;  4JRI A;  3OYG A;  1PHT A;  4RUG A;  4WCI A;  3N5B B;  5AT1 B;  1ACM B;  2FPE A;  4J6W A;  2DL5 A;  4M7A D;  5GAN g;  2KI7 A;  5IHN A;  4C8Q G;  1PSF A;  1UHF A;  1WXU A;  4FSX A;  1WFW A;  4PJJ A;  3SWN C;  3DLL A;  5GAM d;  2YHT A;  3SFM A;  1BKB A;  5LJ3 f;  3MKD A;  3JCM X;  1IGU A;  5FRO A;  4M7D C;  2CSQ A;  4PJM A;  3CCV T;  3QDR B;  5LJ5 f;  2VXF A;  1OYX A;  5HKC A;  1VQL A;  2GCX A;  2XKO C;  2M0O A;  3C0C A;  5HY6 A;  3QZ9 B;  2LP5 A;  1RLQ C;  3OMG A;  3LW5 E;  3H0F A;  4M78 D;  1NZ9 A;  1YIT T;  4BB7 A;  4RG2 A;  1AEY A;  4LDV A;  2RK1 A;  2EGC A;  2JMA A;  2JTF A;  2LCC A;  4OGC A;  2CP2 A;  2EAY A;  1QCN A;  2HAX A;  3ZEH A;  2EYX A;  3EG0 A;  1RI9 A;  1C0M A;  2XU8 A;  2F2W A;  2C0I A;  2KRO A;  3CPW S;  1U5S A;  4F16 A;  2X9H A;  1FWZ A;  1VQN T;  2CUB A;  1N27 A;  1GFC A;  2L3P A;  2MWO A;  1X75 C;  4HCC A;  3M53 A;  3OS1 A;  3TU4 K;  3OYH A;  1KC8 C;  2M1H A;  2RMO A;  5KCH A;  1TWB A;  4JS5 A;  3VYG A;  4RTW A;  4E6R A;  4KUD K;  1YJN T;  1AVZ C;  2ABL A;  2AHJ B;  1YIT A;  2ED1 A;  1QVF S;  5CR2 A;  2QA4 A;  3O8V A;  3OMC A;  4NL2 A;  1M1K C;  2IVW A;  4BI3 A;  2L3S A;  2EQU A;  3SD4 A;  5KYW B;  2RB6 A;  1EX4 A;  2CP0 A;  5LJ3 j;  2K5L A;  1W6X A;  4E7K A;  2XID A;  3A8G B;  3CC7 A;  1ZUK A;  1WJS A;  4C0D C;  3J81 E;  2GTO A;  1U8R A;  1UGS B;  2QAS A;  3HSB A;  2CYZ B;  1M3C A;  4EDU A;  1BI2 A;  3ZFJ A;  3CME Q;  1VQN A;  1IB8 A;  2O88 A;  5J26 A;  2LJ3 A;  1XQH A;  1SRM A;  2CSI A;  1SHG A;  3MEV A;  3MJX A;  1N9S A;  4M77 G;  2FPF A;  1Q86 C;  4DEY A;  2DM1 A;  3CXC S;  2K9G A;  3GP8 A;  1WYX A;  2FRW A;  4PFZ A;  4E7H A;  3I55 Q;  2DXC A;  1YBY A;  4C5H A;  4TVR A;  1HD3 A;  1ZUU A;  4HVV A;  2L3Q A;  1HSQ A;  2KXC A;  1R77 A;  3MEA A;  4OB1 B;  2OAW A;  5GAO r;  1K9M U;  2MPX C;  2RPN A;  3FB9 A;  3GBQ A;  3G1J A;  1D0Z A;  5FWC A;  4XTX A;  4QQG A;  2KYB A;  3MET A;  3CCR Q;  4PLI A;  1U1T A;  1Q86 U;  4N0A A;  2CDT A;  2YUN A;  2CH4 W;  2DYB A;  3EFS A;  1VQO T;  4N4I A;  1KQS S;  2XDP A;  5KYU A;  4C5E A;  4YTL A;  3KFV A;  1TUD A;  1ZQ1 A;  3OYK A;  2EYY A;  1QW1 A;  2FG0 A;  2M9U A;  4C8Q D;  1ZLM A;  1D3B B;  1UHC A;  3M0S A;  3VS0 A;  3JRZ A;  3SHW A;  1UB4 A;  3ER0 A;  4F7U E;  1VQO A;  4JJD A;  5LJ3 g;  2C0O A;  1NG2 A;  1WQ7 A;  4RTX A;  4FT4 A;  4KUI A;  1UEC A;  1QMC A;  3T9N A;  2HL5 C;  1S72 T;  2M02 A;  4M77 F;  1VQ8 T;  1G3W A;  1ZA2 B;  2VYT A;  4C8Q F;  2MAM A;  1BCO A;  2P84 A;  1OQK A;  1BBZ A;  4GY5 A;  2BIV A;  2CH4 A;  2NUT B;  2VUB A;  1W2B A;  1WLP B;  2ZAE A;  3REA B;  1I07 A;  3HTR A;  3PMT A;  2HL3 A;  1GCQ A;  4F14 A;  2A36 A;  1SG5 A;  3CCV Q;  1S72 A;  1QKW A;  3NFC A;  4D6W A;  4ZTF A;  1W4S A;  3NTK A;  2YUO A;  4KUL A;  3TQ7 P;  2DLP A;  2B8A A;  2E70 A;  2QEX Q;  1OU9 A;  3S3O A;  3LLR A;  3RKX A;  2JXB A;  1K73 U;  2B86 A;  1KQ2 A;  3CXC A;  2X51 A;  5GAM j;  2RQR A;  4FYX B;  2HZY A;  4DBQ A;  4GLK A;  4C92 G;  4DOW A;  2VVK A;  4B6M A;  2X35 A;  4J9D A;  4E7L A;  3BW1 A;  2KDS A;  3QZ5 B;  1O9S A;  4ZGJ B;  4J6Y A;  4UC4 A;  2DBK A;  2LZ6 B;  2A28 A;  2KEA A;  2HNI A;  1SKU B;  5CKB A;  2DE0 X;  2COZ A;  3TSW A;  4EMH A;  2PNI A;  3JCM Q;  2OTL A;  8AT1 B;  2CT3 A;  4J9G A;  3HPW A;  3ZBD A;  1QP2 A;  2E41 A;  5KYX A;  1PRM C;  3GNF B;  2COW A;  2QXF A;  4M4Z A;  2Y4Y A;  3HFO A;  1K76 A;  3PT9 A;  2SEM A;  1RLP C;  5CKD A;  1GFD A;  2CZ0 B;  1H3H A;  1KQS P;  3SWN A;  2OTL Q;  2DET A;  2OTL T;  2WAC A;  1QCF A;  2HQE A;  1WHL A;  3BE3 A;  5GAN j;  1IGQ A;  5A0D A;  5KYY A;  3DB3 A;  2DJZ A;  4QVD A;  4O5V A;  2KXD A;  2DL4 A;  3QJ6 A;  4M78 G;  2CT4 A;  1IRE B;  4HCB A;  1JB0 E;  4CI0 C;  2H3J A;  2AZS A;  1M8V A;  1RAE B;  2O4X B;  2V8J A;  3UPU A;  3NPF A;  1PNJ A;  3DKM A;  2J6F A;  4LDY A;  4AFQ C;  4JLI A;  2QAZ A;  3CCR T;  3CBP A;  4BDZ A;  1VQ6 T;  3VU3 C;  3H41 A;  3VS4 A;  2J6O A;  1QKX A;  3JB9 J;  5GAO m;  2KSS A;  3URG A;  2DD5 A;  4CC7 A;  1ZHI A;  2QQS A;  1OZ3 A;  1JJ2 P;  3CPF A;  1K0S A;  2JUF A;  2X4W A;  5L23 A;  1H92 A;  5KCO A;  4NS5 A;  4IUT A;  1K8A C;  2CRE A;  4BY6 B;  2GTJ A;  2GF7 A;  3G71 A;  1WQW A;  3FC3 A;  2DER A;  1W70 A;  2D8H A;  3CQT A;  3I56 Q;  1AZE A;  2R5A A;  2GQI A;  2NUP B;  3VS7 A;  4F17 A;  5GAM g;  1YHQ Q;  3DLM A;  2DEQ A;  3CD6 T;  3M0U A;  3CCL Q;  1PKS A;  3CCQ Q;  1YFN A;  3CCE A;  2L89 A;  1YJW Q;  2FZG B;  2CZ6 B;  5HCK A;  1M90 U;  1JQQ A;  4RKU E;  1I1J A;  1Z9Q A;  2HKQ B;  3OYE A;  2VGM A;  3EH1 A;  2EBP A;  3OBW A;  3JB9 D;  4A53 A;  1Q81 U;  1B34 A;  1Q7Y U;  2HQX A;  2YLC A;  1BIB A;  3M54 A;  4RCB A;  2K7A A;  1K9M C;  3MP1 A;  4OMF B;  4M7A B;  2RJF A;  1VYT A;  1VUB A;  2O01 E;  1VQ5 T;  3VS3 A;  3L2R A;  1KJW A;  1ZBJ A;  3CCJ T;  4C5I A;  4IUQ A;  4J8O A;  3OY9 A;  1MMD A;  2QA4 T;  1PC0 A;  3VS6 A;  3H0I A;  1GBR A;  3L1A A;  1OUL A;  5GAN 8;  1F1B B;  1HK9 A;  1VQ9 T;  2DYI A;  2X4J A;  2LQ8 A;  2QA4 Q;  1WHG A;  3ASK A;  4CRI A;  2KK4 A;  1OI1 A;  1M2V B;  1W2B S;  2CGH A;  2KVQ G;  2A0F B;  4HT8 A;  4M78 A;  3UT1 A;  4PJO F;  2KYM A;  4FW2 A;  3EFO A;  4WF2 A;  3CC4 A;  3M4G A;  3RKY A;  1MV0 B;  2IG0 A;  1T0J A;  3LH0 A;  4BE1 A;  1UJY A;  2JS2 A;  1VQ9 A;  1ZSZ C;  4LUE A;  5FU7 B;  4JJC A;  3RNJ A;  1VQP Q;  5I22 A;  3O5Z A;  5GAN 2;  3A98 A;  2LNH B;  1YCY A;  3I5S A;  1Q7Y C;  2A37 A;  2HCK A;  1YIT Q;  2NLU A;  3JB9 I;  3H8Z A;  2L0A A;  2ENM A;  1M1K R;  1GBQ A;  3M58 A;  1AWX A;  1VIE A;  1H64 1;  2E65 A;  1ZA1 B;  3PFS A;  4M75 B;  4QQ6 A;  2QDL A;  1MMG A;  4FSS A;  3JAM E;  4LDX A;  1VQO Q;  4X9C A;  4X1V A;  3RIR A;  1YHQ A;  1ZSZ B;  1YCS B;  1PRL C;  4XTY A;  1J3T A;  4KH0 B;  2HQH A;  1Y96 B;  2BTT A;  1X2Q A;  1G3S A;  3CCM A;  1TU0 B;  2EJ9 A;  2JOY A;  2RQV A;  1AWO A;  2RD1 A;  3UDC A;  2AZV A;  3BDU A;  5A0G A;  1VA7 A;  3RES A;  4M77 C;  5GAM e;  2DTI A;  2RHI A;  2E4H A;  1FMV A;  4XTV A;  2QGF B;  2EWN A;  2QG9 B;  2LQK A;  2FPD A;  1JRI A;  1PG5 B;  1FX7 A;  4DBR A;  3QWX X;  2O4X A;  3H9N A;  4LNP A;  1QVG S;  4IIO A;  3MEU A;  2EQM A;  4JZ4 A;  1BIA A;  4ESR A;  3OYC A;  3OA6 A;  2LNV A;  1TSF A;  1T0H A;  2O31 A;  2FYK A;  2V8K A;  5GAN h;  4F7U A;  3CD6 Q;  2V1R A;  4M77 B;  2L2P A;  4BD3 A;  3J80 E;  2EQK A;  2EJF A;  2LX7 A;  1FYN A;  3OSV A;  2EGA A;  1R8O B;  4L5G A;  1AD5 A;  3R6O A;  2EQJ A;  5HK0 A;  3VS1 A;  3JCM h;  3V8L A;  3L2V A;  1M1F A;  1K73 R;  3AHU A;  2LCL A;  1IZ6 A;  1JJ2 S;  4M7D B;  2PTK A;  2GNC A;  2DL7 A;  2RK2 A;  4J9E A;  4HVU A;  1I4K 1;  4NOY A;  1K0X A;  3VS2 A;  3PIO A;  3DB4 A;  3JCM W;  1QQJ A;  2DAQ A;  4FM4 B;  4Z8A A;  3EGD B;  3TVT A;  2DZ9 A;  2KY9 A;  2M16 A;  2SRC A;  5CKE A;  6AT1 B;  2QEX T;  2MYS A;  4F04 B;  9ATC B;  3UWN A;  4J7I A;  1YP5 A;  4PKC C;  4DA4 A;  2DTO A;  2M0Y A;  1GCP A;  3PNW C;  1D1A A;  2DL8 A;  2QQ9 A;  2ZPG B;  1EFN A;  4RMO A;  4HA8 A;  4ZNX A;  2D0Q B;  4BY6 C;  1IRX A;  1I8F A;  3HRS A;  1D1B A;  2LC4 A;  3F70 A;  1UJ0 A;  1N8R R;  4J6X A;  3VUZ A;  1YWP A;  3JCM f;  2LX9 A;  1X43 A;  4E7I A;  4OMN A;  2K79 A;  4MZM A;  1TG0 A;  5I2M A;  2YRV A;  1VQM Q;  2GGR A;  4PJO G;  2CZ1 B;  4RTY A;  4XK8 E;  3RUX A;  2HBW A;  1LNX A;  2JZ2 A;  3I5R A;  2KQW A;  3MO8 A;  1RI0 A;  1WGS A;  5D6W A;  4AT1 B;  3OYI A;  2K3B A;  3QSU A;  2K5I A;  1X69 A;  2L3R A;  2Y90 A;  1C6V X;  1VQ4 Q;  3OS5 A;  1M4Z A;  4M77 D;  1YHQ T;  2MCN A;  3RBB B;  1AHJ B;  2AK5 A;  1TS9 A;  4PJO C;  3EG1 A;  4EMK C;  5FU6 B;  2XI9 A;  1TH7 A;  1YJ9 A;  4OMO A;  2F2X A;  3QWY A;  2HD0 A;  2G6F X;  2I2L A;  3HP9 A;  4PL6 A;  4M7D D;  1KSW A;  1XNI A;  1Q82 R;  1K8A R;  4ZN1 A;  1BB9 A;  4PFP A;  2F2V A;  3CCR A;  1M1G A;  4Z88 A;  4DQ2 A;  4M7A G;  3WVE B;  4MDX A;  2XMF A;  3TCJ A;  2HKN A;  1WJQ A;  4Y92 A;  1K4U S;  4KH1 B;  1BI0 A;  4OF1 A;  1YIJ Q;  1P92 A;  2EPD A;  2OTJ A;  2XD0 A;  1PWT A;  1UEB A;  1U1S A;  3E1S A;  2L8D A;  1VQP T;  3L2Q A;  1GRI A;  1MND A;  3IQL A;  5IAY A;  3VUB A;  2ZPB B;  3EHQ A;  3M0P A;  1M90 R;  2WSF E;  1U3O A;  4C92 A;  5LJ3 e;  2QDY B;  4IKF A;  3FDR A;  3NGP A;  1X27 A;  1FMK A;  1WHK A;  3OQ5 A;  1KG1 A;  3GLX A;  4Y28 E;  3PMI A;  2WSC E;  3CPW P;  1OPK A;  2PQW A;  1WHJ A;  5IH2 A;  3EG2 A;  1RAC B;  1D3B A;  1MMA A;  1UE9 A;  4E2F B;  4RTV A;  1Y57 A;  4C0G A;  2NUP A;  2LCS A;  2RQW A;  4KRT A;  3EGX B;  1WXT A;  4R55 A;  3PE0 A;  4JJB A;  5M9O A;  1UUE A;  1NPR A;  3EGU A;  2EQI A;  1GL5 A;  2E3I A;  2MWP A;  2DBM A;  4AMC A;  3QBY A;  3CCJ Q;  4M75 D;  3OYA A;  1VQP A;  1WPY A;  3FJ5 A;  1VQ5 Q;  1RUW A;  1YI2 Q;  1VQ9 Q;  4PJO E;  3RR6 A;  2MF2 A;  2ZPE B;  1KD1 C;  3CBM A;  3M57 A;  1Y96 A;  3INZ A;  2H8H A;  4IIM A;  1V1C A;  1UFF A;  1UG1 A;  1RAI B;  4D8D A;  2J06 A;  3P8B B;  3X26 B;  4M77 A;  1PKT A;  2H3E B;  1MMN A;  5GJV B;  3WXM B;  1VQL Q;  4HVW A;  2RJC A;  1RAH B;  2P0Q A;  1VQ7 A;  1UTI A;  2RI2 A;  2FB7 A;  1YJ9 Q;  3KXT A;  2CP6 A;  3OS2 A;  3CEY A;  2YDL A;  1BK2 A;  2YXY A;  4JDS A;  5IHI A;  5CAI A;  4Z89 A;  3JCM J;  4LN2 A;  3CCV A;  4XTU A;  8ATC B;  1D09 B;  2OJ2 A;  2A3L A;  4QW2 A;  2E5Q A;  1VYV A;  1NLP C;  4LDU A;  2OTJ Q;  1PD0 A;  3P8D A;  3C95 A;  3NTH A;  3VRY A;  4JZ3 A;  2JN0 A;  1ABQ A;  3SB2 A;  4QVC A;  1R0B G;  4EMK B;  1KK7 A;  3HHT B;  3UA6 A;  4DOV A;  3D7S B;  2R58 A;  2DIL A;  3A8M B;  3BY7 A;  1RAB B;  5D6X A;  3OS0 A;  3LGF A;  3L2U A;  4QQD A;  4FL6 A;  2RN8 A;  3KBG A;  4AFU C;  1NLO C;  1OX9 A;  3KUF A;  3QJY A;  4HKE A;  2XG8 D;  1VQL T;  3V7R A;  2V1Q A;  3EGD A;  4JLG A;  3QXE B;  5HK3 A;  2JJ9 A;  2KRM A;  1WA7 A;  1UGR B;  2DMO A;  1XTD A;  2RI3 A;  1I0C A;  3A8L B;  4B9W A;  1T3L A;  1RL2 A;  4OVA A;  4L6V 5;  2RNA A;  4R56 A;  3G4S T;  1B07 A;  1K1Z A;  1Y07 A;  2DL3 A;  2BE9 B;  2QQA A;  4J9F A;  1PD1 A;  2YUP A;  1VQK Q;  5CQX A;  4M75 G;  3FLG A;  3CCE Q;  3JV3 A;  2JT4 A;  3HRU A;  1KQ1 A;  3SEM A;  1G83 A;  5DM7 R;  4PLL A;  2ZCF B;  2J7I A;  3X28 B;  5D7U A;  4XU3 A;  2KMT A;  4Z02 A;  4JJN K;  3MPU B;  3CCE T;  2EKH A;  4KGV B;  4E7J A;  4HCZ A;  2QQR A;  2VKN A;  2XDB A;  2K6D A;  1SSH A;  5KH6 A;  5D6Y A;  2O2O A;  2RM4 A;  1WXB A;  5EG2 A;  4M7D F;  2RQU A;  4XU0 A;  1YJN Q;  1SRL A;  2DPP B;  1WHM A;  2ZGW A;  2D9T A;  2RI5 A;  4ELY C;  2OX7 A;  2CKK A;  3HRT A;  5KYU B;  2MIO A;  1YI2 T;  3HL8 A;  1OV3 A;  4QKU A;  5GMK m;  1N8R U;  2P4T A;  2R57 A;  4OML A;  2GFA A;  4CC2 A;  3LWH A;  2VAS A;  5KE3 A;  2LJ0 A;  3BDL A;  4C92 D;  4A4H A;  2ECZ A;  5IXB A;  3OYN A;  4J5Y A;  4CC3 A;  5FU6 C;  4KT0 E;  1V29 B;  4C8Q B;  1QWF A;  4KBM B;  4PJO B;  1YJN A;  2BE7 D;  4GBQ A;  5IHK A;  1YNZ A;  2YSQ A;  2RHX A;  4QVZ A;  3VRZ A;  1VQM T;  3M56 A;  4X34 A;  4M7D G;  1SF9 A;  2DFU A;  4M78 C;  3GOX A;  2KBT A;  4ATO A;  1JXM A;  2EFI A;  2JTM A;  4C8Q A;  4EIK A;  2DA9 A;  2ZPF B;  4O6J A;  1QLY A;  2ZPH B;  5GAN 6;  2X3W D;  3NMZ C;  3CME T;  2LT1 A;  5IXF A;  3JCM c;  2DIQ A;  5C6S A;  2PZ1 A;  3LH5 A;  2E6Z A;  1Q82 U;  1G2B A;  1OOT A;  4JRK A;  3OYF A;  2Y4X A;  4M75 F;  2F5K A;  3OBY A;  1ABO A;  4L59 A;  2KRS A;  1M27 C;  1E7O A;  1MUZ A;  1MGQ A;  4ZGE B;  2XK0 A;  1G3T A;  3L42 A;  3EG9 A;  3VKI A;  1KD1 R;  2QK0 A;  3JCM b;  2E6N A;  1E6H A;  4DBF A;  1R0C B;  3JB9 G;  2GFU A;  2RJD A;  2O9V A;  3M0T A;  4BUG A;  2ATC B;  2RHU A;  4IUV A;  5FLX E;  3PGG A;  4A63 B;  1VQ4 T;  1VQ6 A;  3A1P A;  3LWI A;  1X6G A;  4XQ3 A;  5FRN A;  3CCU T;  4M77 E;  3CCS Q;  3H0H A;  4M7A C;  3C12 A;  2NUT A;  1UGQ B;  2F5T X;  2JM9 A;  4C5G A;  2CZ7 B;  2JW4 A;  2FHD A;  1D0Y A;  2KR3 A;  3CC4 Q;  3CXC P;  2VGN A;  4Q5W A;  2LTO A;  3M5A A;  4M7D E;  3E19 A;  3OYD A;  2RA2 A;  2ED0 A;  3OYJ A;  1WDX A;  4J9H A;  3OYB A;  2HBP A;  4A4K A;  3CCM T;  5ECA A;  4E7S A;  3JCM e;  1UDL A;  2FO0 A;  4E7Z A;  3L2Z A;  5EC7 A;  4A54 A;  2LMJ A;  5GMK h;  4FCY A;  2DX1 A;  3WVD B;  2DJQ A;  2PU9 B;  3PTA A;  3FJP A;  3OW2 P;  4LD6 A;  4A4E A;  2P0K A;  1JEG A;  3QKJ A;  3EAE A;  3OW2 S;  1U06 A;  1VQ4 A;  2DRK A;  2DVJ A;  2FVU A;  5KYN A;  2DK3 A;  1WIE A;  4R0K A;  1WHH A;  5LJ3 h;  3JB9 H;  1Y7X A;  2RHY A;  3NTI A;  2K3X A;  5LJ5 h;  1W1F A;  1I5L A;  3X24 B;  2ROL A;  5A0L A;  3FRN A;  4J9B A;  2JTE A;  3MP8 A;  1K9M R;  4J7F A;  3E9G A;  4XU1 A;  3I55 A;  2XIC A;  1JJ2 A;  5J39 A;  3G6E T;  2JM8 A;  1AT1 B;  1KC8 U;  2WSE E;  1ZBX A;  1PCX A;  3OW2 A;  2VB6 A;  2X3X D;  3PVQ A;  4FYV B;  2NYS A;  1NPP A;  1QP3 A;  3CCQ T;  4M75 E;  4MML A;  5GAN 4;  3P8H A;  4EMG A;  5DY9 A;  4LXC A;  1Q7Y R;  2F69 A;  2C06 A;  5GAN 5;  1BI1 A;  5DLQ E;  3TEE A;  1X2K A;  1YJW A;  2C0T A;  1LPL A;  2YUQ A;  4PJO D;  1M30 A;  1C1A A;  4ORZ A;  3GPL A;  3M4Y A;  3CD6 A;  2LT4 A;  2MK5 A;  4XTW A;  1QVF P;  1Q95 G;  2EVR A;  1O75 A;  2EJG A;  1NJI R;  1I5O B;  4M7A F;  2D0N A;  2IIM A;  4EPC A;  5I21 A;  1HYO A;  3QG1 A;  4PNO A;  1GCQ C;  1G8X A;  5CVI A;  3CCJ A;  4BDY A;  1GXI E;  1OX8 A;  4HT9 A;  1S1N A;  4C92 F;  1HXD A;  1WX6 A;  5KYY B;  3VS5 A;  4ZN3 A;  3EG3 A;  2DKG A;  2J6K A;  3S3N A;  2VWF A;  1SHF A;  2DIG A;  5CKF A;  5FW9 A;  3SDZ A;  4LUD A;  4RTZ A;  5FRM A;  1TTH B;  2DEU A;  4V2S A;  4N0A C;  2VC8 A;  1S72 Q;  2ESW A;  4GLM A;  1VIF A;  1K73 C;  3J7A F;  4M78 B;  1SEM A;  2KAF A;  4RCC A;  4J9C A;  2L5Q A;  3M59 A;  4P5N A;  2AKK A;  4FYY B;  2FRY A;  2E10 A;  1K9A A;  5I2S A;  3R6N A;  5LJ5 e;  4FW1 A;  3VJP A;  4IUP A;  2BKD N;  3CCM Q;  4C0D B;  3CC7 Q;  3CC7 T;  3X25 B;  3GNG A;  5LL6 S;  1NE8 A;  1IXD A;  5CIU A;  2KRN A;  3X20 B;  4D8K A;  5KE2 A;  1QWE A;  4II1 A;  3CCU A;  1FMW A;  3I56 T;  2LQN A;  1KFZ A;  2HMA A;  3CBO A;  1OU8 A;  4WTO B;  2RQT A;  4JRQ A;  4C0Z A;  1IHV A;  3C94 A;  4AG2 C;  4OB0 B;  1YI2 A;  3UAT A;  2QTV A;  3G4S Q;  2YLB A;  4PJO A;  1WZO A;  4BI8 B;  4C92 B;  5GAM f;  1Q82 C;  3RDV A;  2JNG A;  2GBQ A;  2W0Z A;  2LRQ A;  4LDW A;  2FZC B;  2DXB A;  4ZGD B;  5GAM h;  1N5Z A;  2QEX A;  1OZ2 A;  1QVF A;  5LJ3 d;  2J05 A;  4PK4 A;  1E6G A;  5LJ5 d;  1TOV A;  3EFO B;  2E5K A;  3REB B;  4C8Q C;  3PVL A;  1VQM A;  1CSK A;  5AYF A;  1Y0M A;  3TSZ A;  4AG1 C;  1YJW T;  1UGV A;  1ZSZ A;  3G4S A;  3NHN A;  1JO8 A;  1NYG A;  2MOX A;  2AT1 B;  1SSF A;  4JRP A;  4QT7 A;  1M3B A;  1BCM A;  7AT1 B;  1EIF A;  5GAN 7;  2GQV A;  2QQB A;  2PUO B;  3U23 A;  4EMK A;  5GMK i;  1B3Q A;  1Y71 A;  1QVG P;  2BZ8 A;  2DNU A;  3ME9 A;  1WNL A;  1A0N B;  2XDD A;  4N4H A;  3JCM P;  3M55 A;  2D1X A;  3CMA Q;  4M75 A;  2K4Y A;  2QGG A;  2AKL A;  1KD1 U;  4C92 E;  1Z9Z A;  2DRM A;  1M5Q 1;  4JUV A;  4RG8 A;  3ULR B;  2CP7 A;  4JPB W;  1VOM A;  1RAA B;  3OYM A;  2VV5 A;  1Q81 R;  2CP3 A;  2YRD A;  1WI7 A;  2K2V A;  5CCA A;  4PJL A;  2MI6 A;  5I11 A;  1D1C A;  2A7Y A;  2E12 A;  4N4G A;  1YN8 A;  4AFS C;  2HSE B;  1MNE A;  2BZY A;  1XJW B;  3V8K A;  4RTU A;  1T3S A;  2HSP A;  2DVE A;  1VYU A;  1M2V A;  4Y91 A;  1B7T A;  2E1H A;  1NBE B;  1M3A A;  4BE2 A;  1ZSG A;  3VYH B;  3V8J A;  1X01 A;  1MV3 A;  1MHN A;  4VUB A;  2A08 A;  3G7Z A;  1N6A A;  1RAF B;  3RER A;  4A4G A;  3MEW A;  1G3Y A;  2V8I A;  4M7A A;  5GAN d;  1YIJ A;  3CC2 A;  3CMA T;  1LOJ A;  2COY A;  1QCO A;  3I56 A;  2K2M A;  1M90 C;  3V7C A;  1ZUY A;  1NYF A;  1KHI A;  2LJ1 A;  4PFO A;  2KT1 A;  1ZX6 A;  1PSE A;  3FIF A;  3G71 Q;  5CO7 A;  3G6E A;  1TXQ A;  3RMS A;  2VXE A;  4M7D A;  4LE9 A;  3JCM d;  4MZT A;  1W2B P;  2CP5 A;  2DXU A;  5GAN 3;  3Q1J A;  2ROT A;  1K8A U;  1BI3 A;  1TUC A;  2JMC A;  1D0X A;  3LX7 A;  2P0P A;  2QTX A;  4X9D A;  3CCL A;  3QUI A;  4XAX B;  4IUU A;  3CCS T;  2D8J A;  4A4F A;  3V7S A;  4C92 C;  2I0N A;  1AWW A;  1BYM A;  2DZC A;  1QVP A;  2E3H A;  5FWB A;  1JU5 C;  3HKS A;  1OEB A;  2IPO B;  1M1K U;  2QI2 A;  3CPW A;  1KC8 R;  1PM3 A;  4PJN A;  3EG9 B;  2W10 A;  3CCS A;  3OYY A;  2OAU A;  4MZP A;  3I9Q A;  1JBM A;  1WJR A;  3GIB A;  1YWO A;  1DJ7 B;  3CMA A;  1YIJ T;  4BE0 A;  5GMK j;  2X4X A;  4OB2 B;  4OB3 B;  2XHC A;  3A8O B;  1NEG A;  2R5M A;  4OMP A;  2OTJ T;  4J9I A;  5A2Q E;  3OYL A;  3QPH A;  5GAO n;  5GMK e;  2EKO A;  2EYZ A;  5DLO A;  1LVK A;  1M2O A;  3CC2 T;  3E9F A;  2CUD A;  5CK9 A;  2K57 A;  5KYX B;  5GMK l;  3UF4 A;  3E2U A;  3MP6 A;  2YT6 A;  3AT1 B;  2KE9 A;  4KGZ B;  3ZL7 C;  1FXX A;  3RKW A;  1NJI U;  3CC2 Q;  3L2W A;  1YJ9 T;  2NUZ A;  1LCK A;  3UA7 A;  3JB9 F;  1X6B A;  1NM7 A;  1M8M A;  3CCU Q;  1VQ7 Q;  1EZZ B;  3CCL T;  2RF0 A;  2YWW A;  4C8Q E;  1VQ8 A;  3THK A;  3PIP A;  1M9S A;  2JS0 A;  3RMQ A;  3EGX A;  4DBH A;  2JVV A;  1N9R A;  3QHS A;  3CC4 T;  2RO0 A;  3QO3 A;  3S6W A;  4F7U B;  4E47 A;  2PVO B;  1H8K A;  1I81 A;  1HJD A;  4J83 A;  1KIK A;  1G5V A;  3JCM g;  4AFZ C;  1IO6 A;  4OMM A;  2FEI A;  3OSS C;  2Z0W A;  4B9X A;  2ZPI B;  2QYZ A;  2M51 A;  1SPK A;  4KGX B;  4OMQ A;  1VQK A;  2AIR B;  2DTH A;  1VQ6 Q;  2RH2 A;  2ZZD A;  5LJ5 j;  2DF6 A;  3I35 A;  4ZTJ A;  2FL7 A;  2BUD A;  3LGL A;  4MDW A;  2K5F A;  3MHX A;  2G3R A;  2X4Y A;  2OI3 A;  4C0F A;  1Q86 R;  1IHW A;  3M0R A;  2RJE A;  2P4R A;  4FIB A;  3S3M A;  4FT2 A;  2KGT A;  1VQK T;  5IT9 E;  4M7A E;  1NJI C;  1TUG B;  2YRC A;  3QYH B;  4XTZ A;  2LQW A;  1B34 B;  3EFR A;  4RTT A;  1AZG B;  1RAD B;  4FYW B;  4BI4 A;  5L8R E;  4BAC A;  2KT8 A;  3CCQ A;  2PVG B;  3QDF A;  2DO3 A;  2E64 A;  5IN1 A;  5GAO l;  5GAN e;  2D6F A;  3QII A;  4JS4 A;  3VV0 A;  1ARK A;  1KHC A;  2EW3 A;  3FEO A;  2EIF A;  2O9S A;  3H6Z A;  4LD9 K;  4F7U F;  2RHZ A;  3OB9 A;  4M78 E;  3QYG B;  2V26 A;  4NL3 A;  2DXT A;  3MCA B;  3A5Z B;  1RAG B;  3G6E Q;  3SWN B;  5C0M A;  4ANJ A;  4F7U G;  5GAO p;  2CS7 A;  4DEX A;  4K11 A;  1NEB A;  3BFM A;  5GAO q;  1CKA A;  1JXO A;  2PVD B;  2F1L A;  1QVG A;  5CKH A;  2HDA A;  1N8R C;  3M0Q A;  3JCM V;  2EGE A;  3CME A;  1VQN Q;  4M75 C;  2FZK B;  1X6O A;  2BZX A;  5GJW B;  2KNB B;  3EH2 A;  2EYQ A;  2K3Y A;  3I55 T;  1VQ8 Q;  4ME7 A;  3EHR A;  2EYW A;  5LJ5 g;  1Q81 C; 
#chains in the Genus database with same CATH homology
 1SEM A;  4J9C A;  1W70 A;  2AKK A;  2D8H A;  2FRY A;  2YDL A;  1BK2 A;  1K9A A;  3CQT A;  1AZE A;  1AWJ A;  2GQI A;  5IHI A;  3VS7 A;  4F17 A;  4Z89 A;  4HXJ A;  3R6N A;  4LN2 A;  1XOV A;  3M0U A;  2OJ2 A;  1OPL A;  1PKS A;  1VYV A;  1NLP C;  2HEQ A;  1BU1 A;  5HCK A;  1JQQ A;  1I1J A;  4HCK A;  1Z9Q A;  2KRN A;  3VRY A;  4JZ3 A;  4D8K A;  2EBP A;  1QWE A;  1ABQ A;  1AOJ A;  2LQN A;  1CKB A;  1KFZ A;  4CC4 B;  2K7A A;  3UA6 A;  2DIL A;  2RQT A;  2NWM A;  1PHT A;  1VYT A;  4RUG A;  2RN8 A;  4WCI A;  4AFU C;  1NLO C;  3VS3 A;  4AG2 C;  2FPE A;  1KJW A;  2DL5 A;  1ZBJ A;  3UAT A;  5IHN A;  2V1Q A;  2KRM A;  1UHF A;  1WXU A;  1WA7 A;  1WFW A;  2GBQ A;  2DMO A;  2W0Z A;  3VS6 A;  3H0I A;  1GBR A;  1I0C A;  2CSQ A;  1N5Z A;  2J05 A;  1T3L A;  1E6G A;  2RNA A;  2E5K A;  3C0C A;  3REB B;  3PVL A;  1B07 A;  1CSK A;  2LP5 A;  1RLQ C;  1K1Z A;  1Y0M A;  2DL3 A;  3H0F A;  3TSZ A;  4AG1 C;  2KYM A;  1UGV A;  4J9F A;  2YUP A;  3NHN A;  1JO8 A;  1MV0 B;  1NYG A;  1AEY A;  1T0J A;  2MOX A;  1UJY A;  2JS2 A;  3JV3 A;  2JT4 A;  4LUE A;  4QT7 A;  1M3B A;  2EGC A;  2JMA A;  3SEM A;  4JJC A;  1G83 A;  3U23 A;  3RNJ A;  5I22 A;  3O5Z A;  1B3Q A;  2J7I A;  3A98 A;  2LNH B;  2BZ8 A;  2DNU A;  3I5S A;  2A37 A;  2EKH A;  2HCK A;  1A0N B;  2EYX A;  2VKN A;  2D1X A;  3EG0 A;  1RI9 A;  2K6D A;  1SSH A;  2F2W A;  2L0A A;  2C0I A;  2ENM A;  2KRO A;  2O2O A;  1U5S A;  4F16 A;  1GBQ A;  2CUB A;  1AWX A;  1WXB A;  2AKL A;  1GFC A;  2L3P A;  1Z9Z A;  2DRM A;  2RQU A;  2QDL A;  4FSS A;  1SRL A;  3ULR B;  4X1V A;  2RMO A;  1YCS B;  1PRL C;  4JPB W;  1J3T A;  4RTW A;  4E6R A;  2BTT A;  2MIO A;  1X2Q A;  1AVZ C;  1OV3 A;  2RQV A;  2ABL A;  1WI7 A;  1AWO A;  2AZV A;  2ED1 A;  1VA7 A;  4OML A;  4CC2 A;  5I11 A;  2L3S A;  1YN8 A;  2LJ0 A;  4AFS C;  2ECZ A;  5IXB A;  1W6X A;  2FPD A;  4CC3 A;  1ZUK A;  2BZY A;  4RTU A;  1T3S A;  1QWF A;  2GTO A;  2HSP A;  1VYU A;  4GBQ A;  5IHK A;  1YNZ A;  3QWX X;  2YSQ A;  1M3A A;  1ZSG A;  3VRZ A;  4LNP A;  4IIO A;  1M3C A;  1MV3 A;  2A08 A;  4JZ4 A;  4ESR A;  2KBT A;  1JXM A;  2O88 A;  1T0H A;  2O31 A;  4EIK A;  2DA9 A;  2LJ3 A;  1SRM A;  2CSI A;  1SHG A;  1QLY A;  2V1R A;  2K2M A;  1ZUY A;  2X3W D;  2L2P A;  3NMZ C;  1NYF A;  2LJ1 A;  5IXF A;  2KT1 A;  1ZX6 A;  2LX7 A;  1FYN A;  2FPF A;  2EGA A;  4LE9 A;  4DEY A;  1AD5 A;  2PZ1 A;  2DM1 A;  3LH5 A;  3VS1 A;  2ROT A;  1TUC A;  1G2B A;  2K9G A;  1OOT A;  2JMC A;  1WYX A;  2FRW A;  2PTK A;  2GNC A;  2DL7 A;  1HD3 A;  4J9E A;  1ZUU A;  2D8J A;  4HVV A;  4HVU A;  1ABO A;  2L3Q A;  1HSQ A;  1K0X A;  2I0N A;  2KXC A;  3VS2 A;  1AWW A;  2KRS A;  1M27 C;  2OAW A;  4Z8A A;  1E7O A;  1MUZ A;  3TVT A;  2SRC A;  5FWB A;  2RPN A;  3GBQ A;  1JU5 C;  5FWC A;  1OEB A;  2KYB A;  1YP5 A;  2CDT A;  2YUN A;  2CH4 W;  1E6H A;  2W10 A;  2DYB A;  2M0Y A;  1GCP A;  3I9Q A;  1YWO A;  2DL8 A;  2O9V A;  1EFN A;  3M0T A;  4ZNX A;  3KFV A;  1TUD A;  1NEG A;  4A63 B;  2EYY A;  4OMP A;  2FG0 A;  4J9I A;  1X6G A;  1ZLM A;  1UJ0 A;  3H0H A;  1UHC A;  2EYZ A;  1YWP A;  2JM9 A;  3M0S A;  3VS0 A;  1X43 A;  3SHW A;  4OMN A;  2CUD A;  2JW4 A;  2K79 A;  4JJD A;  1TG0 A;  2KR3 A;  2C0O A;  3UF4 A;  2GGR A;  1NG2 A;  4RTX A;  2YT6 A;  4RTY A;  2HBW A;  2KE9 A;  1UEC A;  3ZL7 C;  3I5R A;  2ED0 A;  1WDX A;  2NUZ A;  4J9H A;  1LCK A;  3UA7 A;  2K3B A;  1X6B A;  1NM7 A;  1M8M A;  1X69 A;  1BBZ A;  2RF0 A;  2CH4 A;  5ECA A;  3THK A;  1UDL A;  1WLP B;  2FO0 A;  5EC7 A;  2JS0 A;  3REA B;  2LMJ A;  2MCN A;  3RBB B;  1I07 A;  2AK5 A;  2DX1 A;  3EG1 A;  2DJQ A;  1GCQ A;  4F14 A;  2A36 A;  1QKW A;  1H8K A;  1JEG A;  4OMO A;  1HJD A;  2F2X A;  1KIK A;  3QWY A;  1U06 A;  2YUO A;  2DRK A;  2G6F X;  4AFZ C;  1IO6 A;  2DVJ A;  2DLP A;  4OMM A;  1KSW A;  2FEI A;  1WIE A;  2JXB A;  4R0K A;  2B86 A;  1BB9 A;  2F2V A;  4Z88 A;  2XMF A;  1W1F A;  2M51 A;  1SPK A;  2ROL A;  2RQR A;  4Y92 A;  1K4U S;  4OMQ A;  4J9B A;  2JTE A;  2VVK A;  2EPD A;  1PWT A;  2DF6 A;  4J9D A;  3I35 A;  2DBK A;  1GRI A;  2LZ6 B;  2OI3 A;  3IQL A;  2A28 A;  2KEA A;  2JM8 A;  2DE0 X;  3M0R A;  3TSW A;  2PNI A;  2P4R A;  2CT3 A;  3EHQ A;  3M0P A;  4J9G A;  1U3O A;  2KGT A;  2X3X D;  3PVQ A;  2LQW A;  3NGP A;  1PRM C;  1X27 A;  4RTT A;  1AZG B;  4M4Z A;  1FMK A;  1K76 A;  1X2K A;  2SEM A;  1RLP C;  2C0T A;  1GFD A;  1H3H A;  2KT8 A;  2YUQ A;  1OPK A;  5IH2 A;  3EG2 A;  1M30 A;  4ORZ A;  1QCF A;  1UE9 A;  4RTV A;  1Y57 A;  1ARK A;  2LCS A;  2EW3 A;  2RQW A;  4KRT A;  1WXT A;  2EVR A;  2O9S A;  3PE0 A;  4JJB A;  2KXD A;  2DL4 A;  1UUE A;  3EGU A;  2EQI A;  1GL5 A;  2DBM A;  2CT4 A;  2D0N A;  2IIM A;  2AZS A;  3FJ5 A;  1RUW A;  1GCQ C;  3NPF A;  1PNJ A;  2J6F A;  4AFQ C;  2H8H A;  4DEX A;  4IIM A;  1V1C A;  1UFF A;  3H41 A;  4K11 A;  1NEB A;  1S1N A;  1UG1 A;  1CKA A;  3VS4 A;  1JXO A;  2J6O A;  1QKX A;  1WX6 A;  4D8D A;  2HDA A;  3VS5 A;  2J06 A;  3M0Q A;  1PKT A;  3EG3 A;  5GJV B;  2EGE A;  2J6K A;  4HVW A;  2VWF A;  2BZX A;  1SHF A;  4CC7 A;  5GJW B;  2KNB B;  5FW9 A;  4LUD A;  4RTZ A;  1UTI A;  1K0S A;  5L23 A;  1H92 A;  3EHR A;  2CRE A;  2ESW A;  2EYW A;  4GLM A;  2GTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...