1J3TA

Solution structure of the second sh3 domain of human intersectin 2 (kiaa1256)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
GSSGSSGVENLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second SH3 domain of human intersectin 2 (KIAA1256)
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords Intersectin 2
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2003-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1j3tA00
1ARKA 2D1XA 2VWFA 1CKAA 2DF6A 2EGAA 1UTIA 2F2VA 2LJ3A 1H8KA 1AWOA 2KRMA 3KFVA 2BZ8A 1WX6A 2LQWA 5EC7A 3VS2A 2ROLA 1JQQA 3THKA 1M3AA 3M0QA 4JZ3A 5IHIA 1RLPC 3ZL7C 3UATA 1AZGB 3VS4A 2FPFA 2DVJA 1CKBA 2C0TA 2DBMA 1PNJA 2GQIA 3O5ZA 4J9CA 3M0TA 4AFQC 3VRYA 2CSIA 2DX1A 4FSSA 2EYWA 2J6FA 2FG0A 1UJYA 4RTXA 3JV3A 1T3SA 3SEMA 2YDLA 1EFNA 4RTZA 4JJDA 2SEMA 1GBQA 4RUGA 1UJ0A 1WA7A 1Y0MA 2HDAA 4OMOA 3I9QA 3VS5A 1PKSA 1WXUA 1NEGA 2KXCA 3VS7A 4F14A 2GTOA 2HCKA 1NG2A 2KROA 2O2OA 1UUEA 2DL4A 3NPFA 1VA7A 2K3BA 5ECAA 1I1JA 4GLMA 2PZ1A 4JJBA 2L0AA 4AG2C 1WDXA 1RLQC 2J06A 5FWCA 2RQTA 1QLYA 1K76A 3H0HA 2O88A 1UDLA 1I07A 2EW3A 1QKXA 2X3WD 2EGCA 2IIMA 2ROTA 2O31A 1FYNA 4HVVA 4AFSC 3CQTA 2LCSA 3VS0A 4K11A 1E6HA 1MUZA 1QWFA 2DLPA 4EIKA 4WCIA 2EKHA 4RTWA 1UHFA 4LNPA 1QWEA 2DL8A 4AG1C 1OV3A 2J6KA 2DA9A 2L2PA 2JS0A 4J9GA 1JXOA 1SHFA 1RUWA 1Y57A 3C0CA 1AWJA 1WIEA 2O9SA 2G6FX 2BZYA 2DM1A 2RPNA 3NGPA 2EVRA 2LNHB 1GCQC 1KSWA 4ORZA 2DJQA 1J3TA 3VRZA 5GJVB 4J9FA 1AZEA 5I22A 2K79A 1ABOA 3LH5A 2DNUA 1KFZA 2L3SA 1GRIA 3RBBB 1E6GA 1MV0B 2KRNA 2P4RA 3H41A 2KEAA 4QT7A 1K1ZA 1U06A 1BB9A 3I5SA 1FMKA 1X43A 1MV3A 4IIOA 4GBQA 1SRMA 1JO8A 2V1QA 4DEYA 2AKKA 2CH4W 2EYYA 5HCKA 2NUZA 1Z9ZA 2EQIA 3IQLA 2ECZA 1RI9A 2A36A 4DEXA 2EPDA 2DYBA 1WI7A 4J9EA 2ABLA 2A08A 5GJWB 3TSWA 1X2KA 1VYTA 2CUDA 2LQNA 3EGUA 3EHRA 1YWOA 2W10A 1U3OA 4M4ZA 2NWMA 2C0IA 2C0OA 1WLPB 2DRMA 2FPDA 1OPLA 3QWXX 1PWTA 1AOJA 1M27C 1W70A 1WFWA 2B86A 1M8MA 4OMMA 4OMPA 4J9IA 3M0RA 2V1RA 2KGTA 4CC7A 2DBKA 1M3CA 1S1NA 3H0FA 4HXJA 3NMZC 1YP5A 4LUDA 4IIMA 1E7OA 3REAB 2MCNA 1B3QA 1X69A 2VKNA 2A37A 3VS3A 4LE9A 4F16A 1QKWA 1W6XA 4JJCA 5IHNA 1VYUA 1ZUUA 4F17A 2BZXA 2KE9A 2ED0A 3TSZA 4R0KA 3REBB 1UE9A 1ZUYA 1OOTA 1UG1A 1X6GA 2KBTA 2JMAA 2OI3A 1H92A 1SSHA 1WXTA 4KRTA 2XMFA 1Z9QA 2D0NA 3EG2A 1M3BA 2RQWA 2DL5A 2EYZA 1XOVA 1B07A 2KR3A 1PRLC 3EG0A 1OEBA 3M0UA 2DE0X 4HCKA 2KXDA 2MIOA 1PKTA 3I35A 2YT6A 3M0PA 2GNCA 3H0IA 4Z89A 2CT4A 2KT8A 1NM7A 2X3XD 3UF4A 2CUBA 2K7AA 1AVZC 2H8HA 1LCKA 2LP5A 4ZNXA 4OMLA 3SHWA 2I0NA 1GFCA 2LJ0A 4HVWA 4CC4B 1JXMA 4J9DA 1X2QA 3VS1A 1GBRA 2DL7A 4J9HA 1PRMC 1TUDA 1I0CA 2E5KA 1K4US 2CH4A 2RN8A 4LUEA 2RQVA 2JM8A 2JM9A 2YUOA 2J05A 2RQRA 4D8DA 1TUCA 2OJ2A 1T0HA 1BK2A 1YWPA 5IXFA 1VYVA 2FPEA 1SEMA 2FEIA 1UHCA 2PTKA 2O9VA 4CC2A 5L23A 4RTTA 2LMJA 1W1FA 1HJDA 3EG3A 1JU5C 2DRKA 2ESWA 2JW4A 2ENMA 1CSKA 2KRSA 2HEQA 4ESRA 1OPKA 2YUPA 2K9GA 2L3QA 2JTEA 2KNBB 1X27A 2SRCA 4RTYA 2GBQA 1KJWA 2YUQA 2F2XA 2J7IA 4E6RA 2JS2A 1JEGA 1X6BA 2A28A 1G83A 4D8KA 4JZ4A 1N5ZA 1YNZA 1AWXA 2KYMA 2K6DA 4LN2A 3I5RA 4Z88A 3TVTA 2W0ZA 1WYXA 1GCPA 1SPKA 5FWBA 2RQUA 2AZVA 4RTVA 1V1CA 2LJ1A 3UA6A 2FO0A 2EGEA 1UGVA 1AD5A 1SHGA 1IO6A 1KIKA 4RTUA 2M51A 1AEYA 4AFZC 5IXBA 2AKLA 1T3LA 2M0YA 2J6OA 2JT4A 1BBZA 3NHNA 4A63B 1K0SA 5FW9A 1AWWA 1ZSGA 3FJ5A 2DMOA 2CT3A 3RNJA 2KT1A 2GTJA 1M30A 4CC3A 1GFDA 1U5SA 4OMQA 2HBWA 3PE0A 5IHKA 3R6NA 2D8HA 3PVQA 1QCFA 3PVLA 1K9AA 3GBQA 2JXBA 4HVUA 4Y92A 3EHQA 2RMOA 2F2WA 2AK5A 1HSQA 1ZBJA 1NEBA 2GGRA 1ZLMA 4AFUC 1WXBA 2JMCA 4X1VA 2AZSA 1ZX6A 4J9BA 2RNAA 1UFFA 1K0XA 2MOXA 2FRWA 2LX7A 3ULRB 1NLOC 1GCQA 2EBPA 2CDTA 2LZ6B 2HSPA 3M0SA 2KYBA 5I11A 1YCSB 2QDLA 1NYFA 5IH2A 2D8JA 3VS6A 1PHTA 4Z8AA 2RF0A 1A0NB 1H3HA 1HD3A 2DL3A 2ED1A 2DILA 2YUNA 1ZUKA 1ABQA 2OAWA 1UECA 1TG0A 3QWYA 2VVKA 2CREA 2FRYA 2CSQA 2EYXA 1YN8A 2BTTA 4JPBW 3U23A 2K2MA 3A98A 2L3PA 3UA7A 2PNIA 2YSQA 1G2BA 1NLPC 4OMNA 1BU1A 1GL5A 3EG1A 1NYGA 1T0JA 1SRLA
chains in the Genus database with same CATH superfamily
1VQ7Q 3VU3C 2EJFA 2LDMA 4AMCA 4TVRA 1UTIA 2F2VA 1VQOQ 3OYLA 2M1HA 3DLMA 3G6EA 4DOWA 1QVFA 2LQWA 2HQEA 3FC3A 3LX7A 3VS2A 1JQQA 1MNEA 4PJOA 4ZGEB 1YJWA 2ZPHB 2IPOB 1AZGB 3VS4A 4LD9K 3H9NA 1QVFP 1CKBA 5GAOn 4C8QB 2EJ9A 2BKDN 3RESA 3OYEA 4M77E 5AT1B 3UPUA 4PFZA 1OU9A 2DVEA 4M78G 1UJYA 1TOVA 3JV3A 1T3SA 3V7CA 2QTXA 3HTRA 1KK7A 3PNWC 4JJDA 2SEMA 2WSCE 3CCJA 1WA7A 4OMOA 3I9QA 3VS5A 2CP6A 2LVMA 3VS7A 2GTOA 4DA4A 2RHUA 1UUEA 3BW1A 1VA7A 5GMKi 1Q7YU 2F1LA 1I1JA 4JJBA 4N0AC 2EQKA 4JUVA 2R5AA 4EMGA 3A8GB 4YTLA 2RQTA 3NTIA 1VQOT 4BUGA 3FDRA 2F5KA 3EFOA 3VUBA 1V76A 2EW3A 2XU8A 4BE0A 2L5QA 5C0MA 2FYKA 2O31A 1FYNA 2D9TA 4HVVA 3CQTA 4AFSC 2GFUA 1WHMA 2QQRA 1IXDA 1JBMA 3VS0A 2PVOB 3OYMA 5CKBA 1E6HA 3QG1A 3TREA 2XD0A 1MUZA 1QWFA 4EIKA 4NOYA 3UDCA 1VQ6A 4RMOA 2CYZB 3MHXA 4PJOG 4GLKA 1QWEA 2RB6A 1RAAB 2L2PA 2MWPA 2VXEA 1JXOA 1RADB 1RUWA 3RR6A 3C0CA 2RHYA 3WXMB 2O9SA 2G6FX 2RPNA 5CCAA 1WJRA 2O01E 5GANh 4M75G 3QIIA 3QDFA 2HKNA 5GANd 3G71A 2LNHB 3MEAA 4M7DF 3CEYA 3JB9H 2DJQA 3MEUA 4BACA 1H641 2K79A 2LT4A 2QQ9A 2XDPA 1ABOA 3LH5A 4BE2A 4N4IA 1GRIA 3F70A 4OGCA 2DJZA 2QA4A 3H41A 1M90R 3L2VA 4N0AA 1D1AA 5C6SA 1MV3A 3CC4Q 2IG0A 1B7TA 1SRMA 4BD3A 4QW2A 3NTKA 1FMWA 4M77D 2NUZA 2EQIA 4C92D 3IQLA 4XTUA 5KE3A 1RI9A 5HK3A 2QQAA 3EH1A 5GAOr 2DYBA 1WI7A 3C94A 1YIJT 1X2KA 1P92A 1VYTA 2CUDA 2LQNA 4XK8E 5DLQE 1TH7A 2C0OA 1IGUA 3PGGA 2RHXA 4IUUA 3JCMX 3S3NA 4B9WA 3JB9F 3OW2P 3QWXX 3G71Q 5KYWB 5L8RE 3RERA 2KSSA 1M8MA 4OMMA 3OW2A 2V1RA 4CC7A 1M3CA 3RKYA 2OTJA 3G7ZA 2CZ1B 3NMZC 2RHIA 1YP5A 1YITA 3J81E 3O8VA 1E7OA 3CC7A 2MCNA 1X69A 2DZ9A 2CKKA 4C8QA 3NFCA 3C95A 4IKFA 5D6XA 4OB2B 3VS3A 4LE9A 4DOVA 1W6XA 1ZHIA 1Y71A 1PD0A 3OSSC 1D0YA 1TS9A 3LW5E 2KE9A 3N5BB 3SDZA 2FHDA 4R0KA 1UE9A 1ZUYA 1X6GA 2KBTA 1WXTA 4FYXB 1Z9QA 2VB6A 3EG2A 1M3BA 2D0QB 1IRXA 1W2BP 2RI5A 4JRQA 1SG5A 4KBMB 5GAOq 5A2QE 2DZCA 1RAIB 2AIRB 2ZAEA 1D1BA 2Y90A 2YT6A 3L2RA 3CC2T 3JCMg 3HRSA 3I56A 4M7DC 1R77A 3OB9A 2QGGA 4QVCA 4LDYA 1NM7A 1PSEA 3UF4A 4C5HA 3CC4T 1G3YA 3QSUA 3M4GA 4C92E 1RL2A 4MMLA 1GFCA 2PVGB 4J9DA 4QQ6A 3CBMA 1TUDA 4ANJA 3E9GA 2RQVA 2JM8A 2LC4A 2OTJT 2X4XA 4D8DA 4BDYA 1NPRA 4UC4A 1D3BA 1NZ9A 5IXFA 4M7DB 2FPEA 5FU6B 3SFMA 4C0GA 1UHCA 4RKUE 4O6JA 4XU3A 4D6WA 5L23A 3LLRA 3V8KA 3EG3A 1VQMQ 2ESWA 3Q1JA 2KMTA 4ESRA 2YLCA 2YUPA 1VQ4Q 2JTEA 2KNBB 1X27A 1MGQA 3J7AF 3OBWA 3JCMb 1OZ3A 2FZGB 3G6EQ 1YHQT 1U1TA 2F2XA 2J7IA 5CVIA 2QYZA 4XTXA 4JRKA 2DEUA 1LJOA 4J7IA 2RJFA 3EFRA 3OYGA 1EZZB 4JZ4A 4C8QC 5GANf 1YNZA 3CPWA 3GP8A 3HPWA 3CC7T 4OVAA 3OSVA 2DXTA 2EYQA 4KH1B 5LJ3g 4A4HA 2C06A 4RTVA 4ZTJA 1VQLA 5GAMh 1AEYA 5GAN7 5GAMd 2AKLA 1T3LA 3CC4A 3OYNA 1D09B 1VQ9Q 2JT4A 2M16A 4J6WA 4A63B 1Q82U 5GMKh 5KYXA 2CP0A 2WSFE 4CC3A 1S72A 4C8QF 1XNIA 5DLOA 4FW1A 1F1BB 4M78C 1YI2Q 9ATCB 5IHKA 2E3IA 3JCMP 3R6NA 4MZPA 2D8HA 5AYFA 2LRQA 1C0MA 1JB0E 3QJYA 1QQJA 4M78F 4CRIA 2E5QA 4HVUA 5GMKm 3RIRA 4MMKA 2RMOA 3KUFA 5HY6A 1HSQA 3UT1A 2LX9A 5J39A 3OW2S 1OQKA 2H3JA 2QEXA 2RK1A 5GAN4 1Q81C 2AZSA 4J9BA 2MOXA 2LX7A 3T9NA 5GAMe 3CPWS 1VQ6Q 1GCQA 2EBPA 2HSPA 3M0SA 2HNIA 1D0XA 5I11A 4C5GA 2XKOC 4Z8AA 4A54A 5CR2A 3OYBA 1A0NB 3G6ET 1HD3A 4J7FA 2DL3A 2ED1A 3P8HA 5LJ5d 6AT1B 2YUNA 1VQLT 1ABQA 2QXFA 1M4ZA 1TXQA 2QTVA 1TG0A 1Q82R 2HL3A 1WJSA 2CZ6B 5KH6A 2F5TX 3RMQA 1D0ZA 1MNDA 2DIGA 1BIAA 2P4TA 2V8KA 3LYIA 3BE3A 3U23A 3A98A 2L3PA 3UA7A 1NLPC 3I55Q 3M55A 4XAXB 2OAUA 2JN0A 3EG1A 1PG5B 1SRLA 1ARKA 1TU0B 1K8AU 1CKAA 2DF6A 2E3HA 1G3SA 4QVDA 3J80E 1WHKA 2WACA 5GMKj 1NJIC 4FYYB 2D6FA 3QXEB 1VQ9T 3HKSA 4JLIA 1Q7YC 3PTAA 3R6OA 1K73R 4RG8A 4OGEA 1RAEB 1HXDA 4JZ3A 1Q82C 5D6YA 3ZL7C 2FPFA 5D7UA 3CCVT 2DVJA 2C0TA 1WGSA 3HSBA 2DBMA 4J9CA 3L1AA 2DXCA 2CSIA 1IB8A 3OS2A 4OP0A 2FG0A 3SEMA 2DD5A 1RAGB 1EFNA 4RCCA 4RTZA 1GBQA 3E19A 3FIFA 4HA8A 4F7UE 3VYHB 3JCMc 3I56T 3GIBA 1WXUA 2RHZA 3VJPA 3CXCP 1Q86C 3JCMV 5ECAA 3RDVA 2K3BA 2RA2A 4XTWA 1WHGA 3MP6A 4AG2C 4FW2A 1VQPA 1MMGA 2J06A 5FWCA 3TCJA 1K76A 1N8RC 1U1SA 3URGA 4C92B 2IIMA 2ROTA 1K9MU 1KC8R 1N8RR 1NPPA 1X75C 4PJOE 4EDUA 2LCSA 4K11A 3LGFA 4M7AE 2HZYA 4WCIA 2HQHA 1QVFS 4PJNA 5KYXB 2EKHA 4RTWA 4AG1C 3OYFA 1W4SA 2J6KA 4FL6A 1KG1A 4M75D 2VV5A 2JS0A 4NS5A 1SHFA 4ZN3A 2CS7A 5KE2A 2B8AA 1AWJA 4PFPA 1WIEA 3L2WA 2BZYA 2DM1A 1YCYA 2EVRA 4PK4A 2MAMA 4FM4B 4A4GA 3CBOA 1KSWA 3ZEHA 1J3TA 1QCOA 4LXCA 1AZEA 1BCMA 3LWHA 4M7AB 1VQ6T 2DNUA 2L3SA 4II1A 1MV0B 2P4RA 1R0BG 1M1KC 2QQSA 2KEAA 1U06A 5IAYA 3G4SA 1KHCA 4F7UA 2COZA 4WF2A 4IIOA 2MWOA 2QGFB 2VXFA 4DBQA 2AKKA 3S6WA 2EYYA 5HCKA 1AHJB 1K73C 2ECZA 4KT0E 2EPDA 5GJWB 3TSWA 4E7JA 1HK9A 2MPXC 4PJLA 2E6ZA 3EGUA 3EHRA 1M8VA 1RAHB 4PNOA 4M4ZA 1MMAA 2C0IA 1MMNA 4M7DD 2M02A 1ZA2B 2FPDA 4EMKC 2QG9B 4JJNK 1M27C 2NUTB 2ZPIB 3LWIA 4IURA 4PFOA 2AHJB 4J9IA 3H6ZA 3CMEA 1S1NA 4HXJA 3S3OA 2ZGWA 1X6OA 5GANe 2VKNA 2A37A 1SSFA 2K57A 3CCUQ 1BI3A 1ZUUA 5LJ3j 3PFSA 2LQ8A 3JCMJ 3AHUA 4M77B 1VQ9A 1QVGA 2MYSA 5J26A 2P0KA 1UG1A 2JMAA 4E7LA 2OI3A 4ZGJB 1SSHA 3TEEA 4KRTA 1ZSZB 2GFAA 7AT1B 2CZ0B 2ZZDA 2RQWA 3CC2A 1XOVA 4C5IA 2LCCA 2XG8D 1QMCA 2LTOA 3CCRT 1PKTA 4E2FB 3LGLA 3SD4A 1PCXA 5GAMg 3OBYA 3HP9A 5I2SA 3BDUA 3WVEB 2KT8A 4M7DA 2CUBA 2K7AA 3HFNA 5GMKl 1AVZC 1VQPQ 2X51A 1QCNA 2I0NA 2G3RA 5GAOp 1VIFA 2CZ7B 4PL6A 1X2QA 3VS1A 2O4XA 1VQ4A 3CCMT 4J6XA 2E5KA 1YJ9T 1G3TA 2VGMA 1K4US 2CH4A 1BIBA 2RN8A 3EFSA 4LUEA 2XDDA 2J05A 4RG2A 2RQRA 4AT1B 1BK2A 1YWPA 3QKJA 2P84A 4CC2A 4ZGDB 4ELZC 2QI2A 3OYYA 5LJ5f 2XK0A 4KGVB 5CO7A 2KRSA 3CPFA 3X28B 1YIJQ 5HKCA 4X34A 2E1HA 4A4FA 5LJ3h 4QQGA 4FIBA 4PJOD 3MJXA 4GY5A 1JJ2A 2YUQA 4KUDK 2CP2A 5DM7R 3BDLA 1YJNT 2EQJA 1VQKQ 2XHCA 5IT9E 4PJMA 1JJ2P 1TWBA 4BI4A 3INZA 4M75E 1VQMT 2YLBA 3QZ5B 2KYMA 4JRIA 8ATCB 4Z88A 1OX9A 5CKEA 2W0ZA 1GCPA 1SPKA 3JB9J 2K5FA 4M75F 2DTIA 2QEXQ 4PJOC 3UA6A 2FO0A 2YXYA 4RTUA 4R55A 2M51A 1Y96B 3M4YA 4AFZC 2EIFA 3CCJT 5KYWA 3S3MA 1WJQA 1KQSP 2VGNA 2LCLA 2E41A 3RNJA 2GTJA 3EGDA 1I4K1 4X9DA 3META 1M90U 2PQWA 4JS5A 1JRIA 5FU7C 3PVQA 1WHHA 1QCFA 2JXBA 4Y92A 3H8ZA 3CCET 5KCHA 4HCZA 1C6VX 3C4SA 1QW1A 2FVUA 4A4KA 3MP1A 1WXBA 5LJ5g 2K3YA 4IUQA 1ZSZA 2RNAA 1K0XA 3MKDA 3ULRB 1R0CB 1S72Q 4C0FA 1SF9A 1OZ2A 2LZ6B 2RF0A 1H3HA 2QAZA 2CP5A 1LVKA 2L3RA 3A5ZB 2DILA 5CIUA 1ZUKA 3A8MB 1UECA 3KBGA 4CI0C 5I21A 1M1FA 1U8RA 1VQKT 2BTTA 4O5VA 2KVQG 2K2MA 2PNIA 2MF2A 1Q7YR 3BFMA 3VYGA 4XTZA 4ZTFA 3ASKA 2VASA 2EGAA 2JUFA 3JCMh 1H8KA 1LPLA 4XU1A 2FZCB 4J83A 4XTVA 3AT1B 1KC8C 3KFVA 2EAYA 2BZ8A 1WX6A 2ROLA 1M3AA 3M0QA 5IHIA 1RLPC 1KD1U 2EQMA 1VQ7T 2PUOB 5FRMA 1MHNA 1N8RU 1KC8U 1PNJA 3O5ZA 3QYHB 4AFQC 3VRYA 4FSSA 1IREB 3CBPA 5KYYB 4N4GA 4RUGA 3UWNA 3I55A 3M54A 1UJ0A 2HDAA 2P0PA 1PKSA 1NEGA 2KXCA 2EFIA 3M59A 4BY6B 2HCKA 1OULA 4E7KA 2KROA 3OQ5A 2DL4A 3NPFA 1BI1A 2VC8A 4J5YA 2L0AA 3PIOA 3ER0A 2DXBA 4BI8B 1VIEA 2XIDA 3G1JA 5LJ5h 2O88A 1UDLA 2JOYA 2OTLT 1I07A 2EKOA 2X3WD 3OS0A 1PM3A 1WQ7A 2PVDB 3CCMA 3EGXB 5FLXE 2ZPGB 3RKXA 4MDXA 2NUPA 3I56Q 4OB1B 3OYKA 4C8QD 2DLPA 2F69A 4M75C 2VUBA 3CCUT 4V2SA 2DO3A 1WPYA 1VQPT 1UEBA 1UHFA 1K73U 3ZFJA 4LNPA 3NTHA 1OV3A 2LNVA 2K4YA 2R58A 4Q5WA 1B34A 2RJEA 3QZ9B 1K8AR 4E47A 2O4XB 4DQ2A 3SWNC 3NGPA 2RO0A 5GAMj 4LDWA 2MI6A 1QVGS 4ORZA 1Q86R 1VQ7A 2A7YA 3VRZA 2ZPEB 5I22A 5CKFA 1VQ8T 2COYA 3GPLA 3EGXA 1E6GA 3GLXA 1NJIR 3CC7Q 4E7SA 4XQ3A 1K1ZA 1BB9A 3EFOB 2V26A 2VYTA 2ATCB 2OTLA 1JO8A 5GAN5 4DEYA 2CH4W 5CQXA 4ME7A 1Z9ZA 4C0DC 4PKCC 2V8IA 2A36A 4DBHA 3OY9A 1AT1B 4J9EA 3SWNA 2A08A 3G4ST 2W10A 2E6NA 2DXUA 1U3OA 2NWMA 1O9SA 1WLPB 3JCMf 1OPLA 2RH2A 1IZ6A 3QYGB 3L2QA 1AOJA 2R57A 3MEVA 3JB9D 4X9CA 2BE7D 2B86A 4OMPA 1WQWA 2JNGA 3PMTA 1VUBA 2KGTA 3VV0A 2DBKA 3SB2A 1FX7A 3A1PA 4LUDA 2E4HA 1B3QA 1QP2A 1VQMA 4BY6C 1VQNT 4F16A 3KXTA 1K9MR 5IN1A 4JLGA 3X26B 4C92F 3EG9B 3QPHA 4JJCA 3OYAA 1VYUA 1KQ2A 5GANj 3M56A 2ED0A 2QDYB 4C0DB 3CCRQ 2XICA 2NYSA 1H92A 2EJGA 4J8OA 3VUZA 2D0NA 2GF7A 1OYXA 2EYZA 1YI2T 2KR3A 3EG0A 1OEBA 3M0UA 5LJ5e 2DE0X 1BCOA 4HCKA 2KXDA 2MIOA 3OYDA 3CCJQ 3M0PA 3H0IA 4Z89A 2X3XD 5CQYA 1ACMB 3I55T 1M1KR 4E7ZA 2QA4T 2H8HA 5A0LA 2LP5A 4ZNXA 4M78D 2P0QA 3JRZA 4HVWA 1JXMA 2JVVA 4XTYA 4R56A 1GBRA 4J9HA 1PRMC 2E64A 2DKGA 1M2VA 4NL2A 1Y7XA 2FB7A 5LJ3e 2JM9A 2YUOA 1B34B 3CCVQ 3FJPA 2LT1A 2OJ2A 1I8FA 1KHIA 1N9SA 2COWA 1KD1C 1SEMA 2FEIA 3CXCA 1RABB 5GAN3 3PIPA 2HAXA 1XJWB 1HJDA 2DRKA 2ENMA 4PJOF 2HEQA 3JCMe 1DJ7B 2OTJQ 4M7DE 1HYOA 2KAFA 2SRCA 1IHWA 1GXIE 2KK4A 1YFNA 4F7UF 1ZSZC 1G3WA 5GAMf 4F7UB 4C8QE 1KJWA 1VQOA 4E6RA 2X9HA 2L89A 2DTHA 1X6BA 1JEGA 5J3BA 2QEXT 4IUPA 2I2LA 1UGSB 4Z02A 3CCEQ 1TTHB 4DBFA 3I5RA 2GQVA 4L6V5 4JDSA 1WYXA 3M57A 5GAOl 4XU2A 2LJ1A 4MDWA 2EGEA 1AD5A 4M7AF 1IO6A 1KIKA 5D6WA 4BDZA 2RM4A 5IXBA 2DK3A 4M7AG 4KUIA 2OTLQ 4C5EA 1IGQA 2PU9B 2J6OA 3NHNA 1BBZA 5FW9A 1AWWA 2DERA 1OI1A 3P8DA 1ZSGA 3FJ5A 2QA4Q 2CT3A 1H3ZA 5CKDA 2HBPA 4FT2A 4N4HA 4HT9A 4KGZB 2ZPFB 2JTMA 3QDRB 4OMQA 3RUXA 4EMKA 2HBWA 2JZ2A 4C92A 3MP8A 1I81A 3L2UA 4QQDA 3PVLA 4OMFB 2NLUA 4QVZA 1VQ5T 2CP3A 3CD6Q 2E12A 4KH0B 2M0OA 2HKQB 3FRNA 3EHQA 4KULA 2A3LA 2MMPA 2KI7A 1ZBJA 2MK5A 3A8OB 2YHTA 4IUTA 2X4YA 1M5Q1 4AFUC 2X4WA 2JTFA 5KYNA 1IHVA 4NL3A 1TUGB 1YHQA 3VKIA 5GAOm 3PT9A 1N9RA 2CDTA 5LJ3f 2KYBA 2QDLA 2D8JA 3CCMQ 1ZBXA 1RI0A 3SWNB 3X20B 3C12A 2DETA 5GAN8 2YRCA 3DB3A 5CKHA 3CMAT 3G71T 3QWYA 1UB4A 2VVKA 2CREA 1VQNA 2OX7A 5FU7B 2DAQA 1YN8A 4OF1A 3ZBDA 1EX4A 4JPBW 5GAN2 2EWNA 2L8DA 2NUTA 4M75B 1W2BA 3CXCS 1G2BA 4OMNA 4IUVA 2E10A 1BU1A 3JCMW 1GL5A 1M2VB 1NYGA 1QVGP 1T0JA 2BE9B 4F04B 2D1XA 2VWFA 2LJ3A 2NUPB 4HCBA 5KYUB 1AWOA 3OYIA 4BE1A 2YRVA 4FYVB 1BI0A 3E9FA 2X35A 4XU0A 4FU6A 2KRMA 1FMVA 1YJWQ 3FLGA 3QO3A 3JB9G 5EC7A 3V8LA 1VQ5A 2M9UA 3THKA 4F7UG 2BIVA 2H3EB 2Z0WA 3UATA 3DB4A 5M9OA 1YJNA 2DTOA 3FB9A 4PLIA 3RMSA 3JAME 3CCSA 2GQIA 2FZKB 3M0TA 2DX1A 4OB3B 2CGHA 2DYIA 2EYWA 1PD1A 2J6FA 4M77C 4RTXA 3CMET 5FRNA 2YDLA 2KQWA 3WVDB 2QK0A 3JCMd 3E1SA 1Y0MA 4WTOB 3L2ZA 4F14A 1NG2A 3CCLQ 2O2OA 3OS5A 4GLMA 2PZ1A 3M5AA 3CCLA 1YBYA 1S72T 3OMCA 4B9XA 1WDXA 5HK0A 1RLQC 1M1GA 2PUKB 3EGDB 2HD0A 1QLYA 3H0HA 1QKXA 2EGCA 1NE8A 3V8JA 4EMHA 3MCAB 5CK9A 2GCXA 1PSFA 1M2OA 1X01A 5KYUA 1M1KU 1UGPB 4ZN1A 2EQUA 3CPWP 5GAN6 2DL8A 4OB0B 4LD6A 4L59A 4ELYC 1VQ5Q 2DA9A 4J9GA 3CMEQ 1NBEB 2KY9A 1Y57A 3GNFB 4A4EA 4LDVA 3V7SA 4BB7A 2RJDA 1QVPA 1GCQC 4Y91A 1RACB 5GJVB 4J9FA 1LNXA 2HSEB 2A0FB 3CCUA 4C8QG 1KFZA 2RI2A 3RBBB 1YJ9Q 1SKUB 4P5NA 3V7RA 2KRNA 4FCYA 3PMIA 4QT7A 4M7DG 3D7SB 3I5SA 1K9MC 1FMKA 1X43A 1VQNQ 4GBQA 1Y07A 3CCQT 3DKMA 2V1QA 1KQSA 3CMAQ 3QUIA 3X25B 1UGQB 1MMDA 1M90C 3M9QA 4DEXA 2ABLA 2HQXA 2X4JA 1YWOA 1ZQ1A 3TQ7P 1WHJA 3OMGA 1I5OB 3CCLT 3JB9I 4MZTA 2DRMA 3EH2A 1VQKA 1PWTA 1W70A 4C92C 2R5MA 3CMAA 1WFWA 1D1CA 2RI3A 3M0RA 1R8OB 5LL6S 1RAFB 4PJOB 4EMKB 1WZOA 3GNGA 3H0FA 3G4SQ 1YIJA 1WNLA 4IIMA 3REAB 3OYCA 5FROA 1YJ9A 1QKWA 2XI9A 5DY9A 3DLLA 2E65A 4HKEA 5IHNA 4F17A 4PJJA 1KQSS 2BZXA 3M53A 5KCOA 3TSZA 2QASA 3REBB 1OOTA 1XTDA 4PLLA 4E7HA 1K8AC 2XMFA 4FSXA 4M77F 2DL5A 1OU8A 1B07A 1PRLC 4B6MA 1N27A 1VQ8Q 2RD1A 2AT1B 3I35A 4M7AC 8AT1B 2GNCA 3EAEA 1JJ2S 3CCEA 3QHSA 3CCQA 2CT4A 5FU6C 4LDUA 3CCQQ 1LOJA 3HL8A 3OYHA 2YWWA 1LCKA 4KGXB 5GANg 1BYMA 3QBYA 3P8BB 1FWZA 2K3XA 1VQ8A 1N6AA 2RK2A 4OMLA 3SHWA 3OYJA 3TU4K 2ZPBB 3CC2Q 2LJ0A 4C92G 4CC4B 2HL5C 1W2BS 1I5LA 2DL7A 1I0CA 2E70A 4Y28E 2K5IA 1TUCA 5LJ5j 3QJ6A 1T0HA 2XDBA 1VYVA 3CCVA 2PTKA 2O9VA 4MZMA 1C1AA 4RTTA 3CCSQ 2LMJA 1YJNQ 1W1FA 2DEQA 4L5GA 4JS4A 1JU5C 2WSEE 2JW4A 3JSCA 1CSKA 1OPKA 3HRUA 2K9GA 2L3QA 3X24B 1EIFA 4FYWB 4E7IA 1KD1R 3A8LB 4RTYA 3E2UA 4M7AA 2GBQA 1Y96A 1Q81U 4HCCA 3MEWA 2JS2A 4LDXA 2A28A 3BY7A 1G83A 4D8KA 3GOXA 1UGRB 3L42A 3LH0A 3CD6T 2BUDA 1N5ZA 2CP7A 1AWXA 4M78B 5A0DA 2K6DA 4LN2A 1M9SA 2DPPB 1YHQQ 1G8XA 3TVTA 1WHLA 5FWBA 1G5VA 2RQUA 2AZVA 2DFUA 1V1CA 1UGVA 1SHGA 4ATOA 5A0GA 3RKWA 3JCMQ 1FXXA 2M0YA 4VUBA 3CD6A 2FL7A 3CCRA 1K0SA 4JRPA 2YRDA 3HHTB 2DMOA 1VQ4T 4HT8A 2Y4YA 2KT1A 1YI2A 1OX8A 2Y4XA 1M30A 5EG2A 2RJCA 2JJ9A 1GFDA 1BKBA 1KQ1A 1U5SA 5CAIA 3PE0A 1NJIU 2V8JA 2QQBA 4M78A 3EG9A 4M75A 3GF5A 1YITQ 2DIQA 1BI2A 1K9AA 4A53A 3GBQA 1Q86U 2ZCFB 2F2WA 2AK5A 1QP3A 4RCBA 5GMKe 3HRTA 1NEBA 2GGRA 1VQLQ 1ZLMA 2IVWA 2JMCA 3A8HB 3MPUB 4X1VA 4M78E 4M7AD 1ZX6A 1UFFA 4M77A 1TSFA 4M77G 3CCST 2FRWA 3MO8A 2LQKA 3OS1A 1Q95G 1NLOC 3ME9A 4BI3A 5I2MA 1XQHA 1O75A 1NYFA 1YCSB 5IH2A 1ZA1B 2K5LA 3VS6A 1PHTA 4FT4A 1VOMA 1Q81R 2KDSA 3OA6A 2K2VA 3M58A 2OAWA 1PC0A 5KYYA 2FRYA 3HFOA 4EPCA 4C0ZA 2CSQA 2EYXA 2HMAA 1YITT 1V29B 4DBRA 4J6YA 4QKUA 1YJWT 2YSQA 1D3BB 5LJ3d 3FEOA 2DD4A
chains in the Genus database with same CATH topology
1ARKA 2D1XA 2VWFA 1CKAA 2DF6A 2EGAA 1UTIA 2F2VA 2LJ3A 1H8KA 1AWOA 2KRMA 3KFVA 2BZ8A 1WX6A 2LQWA 5EC7A 3VS2A 2ROLA 1JQQA 3THKA 1M3AA 3M0QA 4JZ3A 5IHIA 1RLPC 3ZL7C 3UATA 1AZGB 3VS4A 2FPFA 2DVJA 1CKBA 2C0TA 2DBMA 1PNJA 2GQIA 3O5ZA 4J9CA 3M0TA 4AFQC 3VRYA 2CSIA 2DX1A 4FSSA 2EYWA 2J6FA 2FG0A 1UJYA 4RTXA 3JV3A 1T3SA 3SEMA 2YDLA 1EFNA 4RTZA 4JJDA 2SEMA 1GBQA 4RUGA 1UJ0A 1WA7A 1Y0MA 2HDAA 4OMOA 3I9QA 3VS5A 1PKSA 1WXUA 1NEGA 2KXCA 3VS7A 4F14A 2GTOA 2HCKA 1NG2A 2KROA 2O2OA 1UUEA 2DL4A 3NPFA 1VA7A 2K3BA 5ECAA 1I1JA 4GLMA 2PZ1A 4JJBA 2L0AA 4AG2C 1WDXA 1RLQC 2J06A 5FWCA 2RQTA 1QLYA 1K76A 3H0HA 2O88A 1UDLA 1I07A 2EW3A 1QKXA 2X3WD 2EGCA 2IIMA 2ROTA 2O31A 1FYNA 4HVVA 4AFSC 3CQTA 2LCSA 3VS0A 4K11A 1E6HA 1MUZA 1QWFA 2DLPA 4EIKA 4WCIA 2EKHA 4RTWA 1UHFA 4LNPA 1QWEA 2DL8A 4AG1C 1OV3A 2J6KA 2DA9A 2L2PA 2JS0A 4J9GA 1JXOA 1SHFA 1RUWA 1Y57A 3C0CA 1AWJA 1WIEA 2O9SA 2G6FX 2BZYA 2DM1A 2RPNA 3NGPA 2EVRA 2LNHB 1GCQC 1KSWA 4ORZA 2DJQA 1J3TA 3VRZA 5GJVB 4J9FA 1AZEA 5I22A 2K79A 1ABOA 3LH5A 2DNUA 1KFZA 2L3SA 1GRIA 3RBBB 1E6GA 1MV0B 2KRNA 2P4RA 3H41A 2KEAA 4QT7A 1K1ZA 1U06A 1BB9A 3I5SA 1FMKA 1X43A 1MV3A 4IIOA 4GBQA 1SRMA 1JO8A 2V1QA 4DEYA 2AKKA 2CH4W 2EYYA 5HCKA 2NUZA 1Z9ZA 2EQIA 3IQLA 2ECZA 1RI9A 2A36A 4DEXA 2EPDA 2DYBA 1WI7A 4J9EA 2ABLA 2A08A 5GJWB 3TSWA 1X2KA 1VYTA 2CUDA 2LQNA 3EGUA 3EHRA 1YWOA 2W10A 1U3OA 4M4ZA 2NWMA 2C0IA 2C0OA 1WLPB 2DRMA 2FPDA 1OPLA 3QWXX 1PWTA 1AOJA 1M27C 1W70A 1WFWA 2B86A 1M8MA 4OMMA 4OMPA 4J9IA 3M0RA 2V1RA 2KGTA 4CC7A 2DBKA 1M3CA 1S1NA 3H0FA 4HXJA 3NMZC 1YP5A 4LUDA 4IIMA 1E7OA 3REAB 2MCNA 1B3QA 1X69A 2VKNA 2A37A 3VS3A 4LE9A 4F16A 1QKWA 1W6XA 4JJCA 5IHNA 1VYUA 1ZUUA 4F17A 2BZXA 2KE9A 2ED0A 3TSZA 4R0KA 3REBB 1UE9A 1ZUYA 1OOTA 1UG1A 1X6GA 2KBTA 2JMAA 2OI3A 1H92A 1SSHA 1WXTA 4KRTA 2XMFA 1Z9QA 2D0NA 3EG2A 1M3BA 2RQWA 2DL5A 2EYZA 1XOVA 1B07A 2KR3A 1PRLC 3EG0A 1OEBA 3M0UA 2DE0X 4HCKA 2KXDA 2MIOA 1PKTA 3I35A 2YT6A 3M0PA 2GNCA 3H0IA 4Z89A 2CT4A 2KT8A 1NM7A 2X3XD 3UF4A 2CUBA 2K7AA 1AVZC 2H8HA 1LCKA 2LP5A 4ZNXA 4OMLA 3SHWA 2I0NA 1GFCA 2LJ0A 4HVWA 4CC4B 1JXMA 4J9DA 1X2QA 3VS1A 1GBRA 2DL7A 4J9HA 1PRMC 1TUDA 1I0CA 2E5KA 1K4US 2CH4A 2RN8A 4LUEA 2RQVA 2JM8A 2JM9A 2YUOA 2J05A 2RQRA 4D8DA 1TUCA 2OJ2A 1T0HA 1BK2A 1YWPA 5IXFA 1VYVA 2FPEA 1SEMA 2FEIA 1UHCA 2PTKA 2O9VA 4CC2A 5L23A 4RTTA 2LMJA 1W1FA 1HJDA 3EG3A 1JU5C 2DRKA 2ESWA 2JW4A 2ENMA 1CSKA 2KRSA 2HEQA 4ESRA 1OPKA 2YUPA 2K9GA 2L3QA 2JTEA 2KNBB 1X27A 2SRCA 4RTYA 2GBQA 1KJWA 2YUQA 2F2XA 2J7IA 4E6RA 2JS2A 1JEGA 1X6BA 2A28A 1G83A 4D8KA 4JZ4A 1N5ZA 1YNZA 1AWXA 2KYMA 2K6DA 4LN2A 3I5RA 4Z88A 3TVTA 2W0ZA 1WYXA 1GCPA 1SPKA 5FWBA 2RQUA 2AZVA 4RTVA 1V1CA 2LJ1A 3UA6A 2FO0A 2EGEA 1UGVA 1AD5A 1SHGA 1IO6A 1KIKA 4RTUA 2M51A 1AEYA 4AFZC 5IXBA 2AKLA 1T3LA 2M0YA 2J6OA 2JT4A 1BBZA 3NHNA 4A63B 1K0SA 5FW9A 1AWWA 1ZSGA 3FJ5A 2DMOA 2CT3A 3RNJA 2KT1A 2GTJA 1M30A 4CC3A 1GFDA 1U5SA 4OMQA 2HBWA 3PE0A 5IHKA 3R6NA 2D8HA 3PVQA 1QCFA 3PVLA 1K9AA 3GBQA 2JXBA 4HVUA 4Y92A 3EHQA 2RMOA 2F2WA 2AK5A 1HSQA 1ZBJA 1NEBA 2GGRA 1ZLMA 4AFUC 1WXBA 2JMCA 4X1VA 2AZSA 1ZX6A 4J9BA 2RNAA 1UFFA 1K0XA 2MOXA 2FRWA 2LX7A 3ULRB 1NLOC 1GCQA 2EBPA 2CDTA 2LZ6B 2HSPA 3M0SA 2KYBA 5I11A 1YCSB 2QDLA 1NYFA 5IH2A 2D8JA 3VS6A 1PHTA 4Z8AA 2RF0A 1A0NB 1H3HA 1HD3A 2DL3A 2ED1A 2DILA 2YUNA 1ZUKA 1ABQA 2OAWA 1UECA 1TG0A 3QWYA 2VVKA 2CREA 2FRYA 2CSQA 2EYXA 1YN8A 2BTTA 4JPBW 3U23A 2K2MA 3A98A 2L3PA 3UA7A 2PNIA 2YSQA 1G2BA 1NLPC 4OMNA 1BU1A 1GL5A 3EG1A 1NYGA 1T0JA 1SRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARK A;  2D1X A;  2VWF A;  1CKA A;  2DF6 A;  2EGA A;  1UTI A;  2F2V A;  2LJ3 A;  1H8K A;  1AWO A;  2KRM A;  3KFV A;  2BZ8 A;  1WX6 A;  2LQW A;  5EC7 A;  3VS2 A;  2ROL A;  1JQQ A;  3THK A;  1M3A A;  3M0Q A;  4JZ3 A;  5IHI A;  1RLP C;  3ZL7 C;  3UAT A;  1AZG B;  3VS4 A;  2FPF A;  2DVJ A;  1CKB A;  2C0T A;  2DBM A;  1PNJ A;  2GQI A;  3O5Z A;  4J9C A;  3M0T A;  4AFQ C;  3VRY A;  2CSI A;  2DX1 A;  4FSS A;  2EYW A;  2J6F A;  2FG0 A;  1UJY A;  4RTX A;  3JV3 A;  1T3S A;  3SEM A;  2YDL A;  1EFN A;  4RTZ A;  4JJD A;  2SEM A;  1GBQ A;  4RUG A;  1UJ0 A;  1WA7 A;  1Y0M A;  2HDA A;  4OMO A;  3I9Q A;  3VS5 A;  1PKS A;  1WXU A;  1NEG A;  2KXC A;  3VS7 A;  4F14 A;  2GTO A;  2HCK A;  1NG2 A;  2KRO A;  2O2O A;  1UUE A;  2DL4 A;  3NPF A;  1VA7 A;  2K3B A;  5ECA A;  1I1J A;  4GLM A;  2PZ1 A;  4JJB A;  2L0A A;  4AG2 C;  1WDX A;  1RLQ C;  2J06 A;  5FWC A;  2RQT A;  1QLY A;  1K76 A;  3H0H A;  2O88 A;  1UDL A;  1I07 A;  2EW3 A;  1QKX A;  2X3W D;  2EGC A;  2IIM A;  2ROT A;  2O31 A;  1FYN A;  4HVV A;  4AFS C;  3CQT A;  2LCS A;  3VS0 A;  4K11 A;  1E6H A;  1MUZ A;  1QWF A;  2DLP A;  4EIK A;  4WCI A;  2EKH A;  4RTW A;  1UHF A;  4LNP A;  1QWE A;  2DL8 A;  4AG1 C;  1OV3 A;  2J6K A;  2DA9 A;  2L2P A;  2JS0 A;  4J9G A;  1JXO A;  1SHF A;  1RUW A;  1Y57 A;  3C0C A;  1AWJ A;  1WIE A;  2O9S A;  2G6F X;  2BZY A;  2DM1 A;  2RPN A;  3NGP A;  2EVR A;  2LNH B;  1GCQ C;  1KSW A;  4ORZ A;  2DJQ A;  1J3T A;  3VRZ A;  5GJV B;  4J9F A;  1AZE A;  5I22 A;  2K79 A;  1ABO A;  3LH5 A;  2DNU A;  1KFZ A;  2L3S A;  1GRI A;  3RBB B;  1E6G A;  1MV0 B;  2KRN A;  2P4R A;  3H41 A;  2KEA A;  4QT7 A;  1K1Z A;  1U06 A;  1BB9 A;  3I5S A;  1FMK A;  1X43 A;  1MV3 A;  4IIO A;  4GBQ A;  1SRM A;  1JO8 A;  2V1Q A;  4DEY A;  2AKK A;  2CH4 W;  2EYY A;  5HCK A;  2NUZ A;  1Z9Z A;  2EQI A;  3IQL A;  2ECZ A;  1RI9 A;  2A36 A;  4DEX A;  2EPD A;  2DYB A;  1WI7 A;  4J9E A;  2ABL A;  2A08 A;  5GJW B;  3TSW A;  1X2K A;  1VYT A;  2CUD A;  2LQN A;  3EGU A;  3EHR A;  1YWO A;  2W10 A;  1U3O A;  4M4Z A;  2NWM A;  2C0I A;  2C0O A;  1WLP B;  2DRM A;  2FPD A;  1OPL A;  3QWX X;  1PWT A;  1AOJ A;  1M27 C;  1W70 A;  1WFW A;  2B86 A;  1M8M A;  4OMM A;  4OMP A;  4J9I A;  3M0R A;  2V1R A;  2KGT A;  4CC7 A;  2DBK A;  1M3C A;  1S1N A;  3H0F A;  4HXJ A;  3NMZ C;  1YP5 A;  4LUD A;  4IIM A;  1E7O A;  3REA B;  2MCN A;  1B3Q A;  1X69 A;  2VKN A;  2A37 A;  3VS3 A;  4LE9 A;  4F16 A;  1QKW A;  1W6X A;  4JJC A;  5IHN A;  1VYU A;  1ZUU A;  4F17 A;  2BZX A;  2KE9 A;  2ED0 A;  3TSZ A;  4R0K A;  3REB B;  1UE9 A;  1ZUY A;  1OOT A;  1UG1 A;  1X6G A;  2KBT A;  2JMA A;  2OI3 A;  1H92 A;  1SSH A;  1WXT A;  4KRT A;  2XMF A;  1Z9Q A;  2D0N A;  3EG2 A;  1M3B A;  2RQW A;  2DL5 A;  2EYZ A;  1XOV A;  1B07 A;  2KR3 A;  1PRL C;  3EG0 A;  1OEB A;  3M0U A;  2DE0 X;  4HCK A;  2KXD A;  2MIO A;  1PKT A;  3I35 A;  2YT6 A;  3M0P A;  2GNC A;  3H0I A;  4Z89 A;  2CT4 A;  2KT8 A;  1NM7 A;  2X3X D;  3UF4 A;  2CUB A;  2K7A A;  1AVZ C;  2H8H A;  1LCK A;  2LP5 A;  4ZNX A;  4OML A;  3SHW A;  2I0N A;  1GFC A;  2LJ0 A;  4HVW A;  4CC4 B;  1JXM A;  4J9D A;  1X2Q A;  3VS1 A;  1GBR A;  2DL7 A;  4J9H A;  1PRM C;  1TUD A;  1I0C A;  2E5K A;  1K4U S;  2CH4 A;  2RN8 A;  4LUE A;  2RQV A;  2JM8 A;  2JM9 A;  2YUO A;  2J05 A;  2RQR A;  4D8D A;  1TUC A;  2OJ2 A;  1T0H A;  1BK2 A;  1YWP A;  5IXF A;  1VYV A;  2FPE A;  1SEM A;  2FEI A;  1UHC A;  2PTK A;  2O9V A;  4CC2 A;  5L23 A;  4RTT A;  2LMJ A;  1W1F A;  1HJD A;  3EG3 A;  1JU5 C;  2DRK A;  2ESW A;  2JW4 A;  2ENM A;  1CSK A;  2KRS A;  2HEQ A;  4ESR A;  1OPK A;  2YUP A;  2K9G A;  2L3Q A;  2JTE A;  2KNB B;  1X27 A;  2SRC A;  4RTY A;  2GBQ A;  1KJW A;  2YUQ A;  2F2X A;  2J7I A;  4E6R A;  2JS2 A;  1JEG A;  1X6B A;  2A28 A;  1G83 A;  4D8K A;  4JZ4 A;  1N5Z A;  1YNZ A;  1AWX A;  2KYM A;  2K6D A;  4LN2 A;  3I5R A;  4Z88 A;  3TVT A;  2W0Z A;  1WYX A;  1GCP A;  1SPK A;  5FWB A;  2RQU A;  2AZV A;  4RTV A;  1V1C A;  2LJ1 A;  3UA6 A;  2FO0 A;  2EGE A;  1UGV A;  1AD5 A;  1SHG A;  1IO6 A;  1KIK A;  4RTU A;  2M51 A;  1AEY A;  4AFZ C;  5IXB A;  2AKL A;  1T3L A;  2M0Y A;  2J6O A;  2JT4 A;  1BBZ A;  3NHN A;  4A63 B;  1K0S A;  5FW9 A;  1AWW A;  1ZSG A;  3FJ5 A;  2DMO A;  2CT3 A;  3RNJ A;  2KT1 A;  2GTJ A;  1M30 A;  4CC3 A;  1GFD A;  1U5S A;  4OMQ A;  2HBW A;  3PE0 A;  5IHK A;  3R6N A;  2D8H A;  3PVQ A;  1QCF A;  3PVL A;  1K9A A;  3GBQ A;  2JXB A;  4HVU A;  4Y92 A;  3EHQ A;  2RMO A;  2F2W A;  2AK5 A;  1HSQ A;  1ZBJ A;  1NEB A;  2GGR A;  1ZLM A;  4AFU C;  1WXB A;  2JMC A;  4X1V A;  2AZS A;  1ZX6 A;  4J9B A;  2RNA A;  1UFF A;  1K0X A;  2MOX A;  2FRW A;  2LX7 A;  3ULR B;  1NLO C;  1GCQ A;  2EBP A;  2CDT A;  2LZ6 B;  2HSP A;  3M0S A;  2KYB A;  5I11 A;  1YCS B;  2QDL A;  1NYF A;  5IH2 A;  2D8J A;  3VS6 A;  1PHT A;  4Z8A A;  2RF0 A;  1A0N B;  1H3H A;  1HD3 A;  2DL3 A;  2ED1 A;  2DIL A;  2YUN A;  1ZUK A;  1ABQ A;  2OAW A;  1UEC A;  1TG0 A;  3QWY A;  2VVK A;  2CRE A;  2FRY A;  2CSQ A;  2EYX A;  1YN8 A;  2BTT A;  4JPB W;  3U23 A;  2K2M A;  3A98 A;  2L3P A;  3UA7 A;  2PNI A;  2YSQ A;  1G2B A;  1NLP C;  4OMN A;  1BU1 A;  1GL5 A;  3EG1 A;  1NYG A;  1T0J A;  1SRL A; 
#chains in the Genus database with same CATH topology
 1VQ7 Q;  3VU3 C;  2EJF A;  2LDM A;  4AMC A;  4TVR A;  1UTI A;  2F2V A;  1VQO Q;  3OYL A;  2M1H A;  3DLM A;  3G6E A;  4DOW A;  1QVF A;  2LQW A;  2HQE A;  3FC3 A;  3LX7 A;  3VS2 A;  1JQQ A;  1MNE A;  4PJO A;  4ZGE B;  1YJW A;  2ZPH B;  2IPO B;  1AZG B;  3VS4 A;  4LD9 K;  3H9N A;  1QVF P;  1CKB A;  5GAO n;  4C8Q B;  2EJ9 A;  2BKD N;  3RES A;  3OYE A;  4M77 E;  5AT1 B;  3UPU A;  4PFZ A;  1OU9 A;  2DVE A;  4M78 G;  1UJY A;  1TOV A;  3JV3 A;  1T3S A;  3V7C A;  2QTX A;  3HTR A;  1KK7 A;  3PNW C;  4JJD A;  2SEM A;  2WSC E;  3CCJ A;  1WA7 A;  4OMO A;  3I9Q A;  3VS5 A;  2CP6 A;  2LVM A;  3VS7 A;  2GTO A;  4DA4 A;  2RHU A;  1UUE A;  3BW1 A;  1VA7 A;  5GMK i;  1Q7Y U;  2F1L A;  1I1J A;  4JJB A;  4N0A C;  2EQK A;  4JUV A;  2R5A A;  4EMG A;  3A8G B;  4YTL A;  2RQT A;  3NTI A;  1VQO T;  4BUG A;  3FDR A;  2F5K A;  3EFO A;  3VUB A;  1V76 A;  2EW3 A;  2XU8 A;  4BE0 A;  2L5Q A;  5C0M A;  2FYK A;  2O31 A;  1FYN A;  2D9T A;  4HVV A;  3CQT A;  4AFS C;  2GFU A;  1WHM A;  2QQR A;  1IXD A;  1JBM A;  3VS0 A;  2PVO B;  3OYM A;  5CKB A;  1E6H A;  3QG1 A;  3TRE A;  2XD0 A;  1MUZ A;  1QWF A;  4EIK A;  4NOY A;  3UDC A;  1VQ6 A;  4RMO A;  2CYZ B;  3MHX A;  4PJO G;  4GLK A;  1QWE A;  2RB6 A;  1RAA B;  2L2P A;  2MWP A;  2VXE A;  1JXO A;  1RAD B;  1RUW A;  3RR6 A;  3C0C A;  2RHY A;  3WXM B;  2O9S A;  2G6F X;  2RPN A;  5CCA A;  1WJR A;  2O01 E;  5GAN h;  4M75 G;  3QII A;  3QDF A;  2HKN A;  5GAN d;  3G71 A;  2LNH B;  3MEA A;  4M7D F;  3CEY A;  3JB9 H;  2DJQ A;  3MEU A;  4BAC A;  1H64 1;  2K79 A;  2LT4 A;  2QQ9 A;  2XDP A;  1ABO A;  3LH5 A;  4BE2 A;  4N4I A;  1GRI A;  3F70 A;  4OGC A;  2DJZ A;  2QA4 A;  3H41 A;  1M90 R;  3L2V A;  4N0A A;  1D1A A;  5C6S A;  1MV3 A;  3CC4 Q;  2IG0 A;  1B7T A;  1SRM A;  4BD3 A;  4QW2 A;  3NTK A;  1FMW A;  4M77 D;  2NUZ A;  2EQI A;  4C92 D;  3IQL A;  4XTU A;  5KE3 A;  1RI9 A;  5HK3 A;  2QQA A;  3EH1 A;  5GAO r;  2DYB A;  1WI7 A;  3C94 A;  1YIJ T;  1X2K A;  1P92 A;  1VYT A;  2CUD A;  2LQN A;  4XK8 E;  5DLQ E;  1TH7 A;  2C0O A;  1IGU A;  3PGG A;  2RHX A;  4IUU A;  3JCM X;  3S3N A;  4B9W A;  3JB9 F;  3OW2 P;  3QWX X;  3G71 Q;  5KYW B;  5L8R E;  3RER A;  2KSS A;  1M8M A;  4OMM A;  3OW2 A;  2V1R A;  4CC7 A;  1M3C A;  3RKY A;  2OTJ A;  3G7Z A;  2CZ1 B;  3NMZ C;  2RHI A;  1YP5 A;  1YIT A;  3J81 E;  3O8V A;  1E7O A;  3CC7 A;  2MCN A;  1X69 A;  2DZ9 A;  2CKK A;  4C8Q A;  3NFC A;  3C95 A;  4IKF A;  5D6X A;  4OB2 B;  3VS3 A;  4LE9 A;  4DOV A;  1W6X A;  1ZHI A;  1Y71 A;  1PD0 A;  3OSS C;  1D0Y A;  1TS9 A;  3LW5 E;  2KE9 A;  3N5B B;  3SDZ A;  2FHD A;  4R0K A;  1UE9 A;  1ZUY A;  1X6G A;  2KBT A;  1WXT A;  4FYX B;  1Z9Q A;  2VB6 A;  3EG2 A;  1M3B A;  2D0Q B;  1IRX A;  1W2B P;  2RI5 A;  4JRQ A;  1SG5 A;  4KBM B;  5GAO q;  5A2Q E;  2DZC A;  1RAI B;  2AIR B;  2ZAE A;  1D1B A;  2Y90 A;  2YT6 A;  3L2R A;  3CC2 T;  3JCM g;  3HRS A;  3I56 A;  4M7D C;  1R77 A;  3OB9 A;  2QGG A;  4QVC A;  4LDY A;  1NM7 A;  1PSE A;  3UF4 A;  4C5H A;  3CC4 T;  1G3Y A;  3QSU A;  3M4G A;  4C92 E;  1RL2 A;  4MML A;  1GFC A;  2PVG B;  4J9D A;  4QQ6 A;  3CBM A;  1TUD A;  4ANJ A;  3E9G A;  2RQV A;  2JM8 A;  2LC4 A;  2OTJ T;  2X4X A;  4D8D A;  4BDY A;  1NPR A;  4UC4 A;  1D3B A;  1NZ9 A;  5IXF A;  4M7D B;  2FPE A;  5FU6 B;  3SFM A;  4C0G A;  1UHC A;  4RKU E;  4O6J A;  4XU3 A;  4D6W A;  5L23 A;  3LLR A;  3V8K A;  3EG3 A;  1VQM Q;  2ESW A;  3Q1J A;  2KMT A;  4ESR A;  2YLC A;  2YUP A;  1VQ4 Q;  2JTE A;  2KNB B;  1X27 A;  1MGQ A;  3J7A F;  3OBW A;  3JCM b;  1OZ3 A;  2FZG B;  3G6E Q;  1YHQ T;  1U1T A;  2F2X A;  2J7I A;  5CVI A;  2QYZ A;  4XTX A;  4JRK A;  2DEU A;  1LJO A;  4J7I A;  2RJF A;  3EFR A;  3OYG A;  1EZZ B;  4JZ4 A;  4C8Q C;  5GAN f;  1YNZ A;  3CPW A;  3GP8 A;  3HPW A;  3CC7 T;  4OVA A;  3OSV A;  2DXT A;  2EYQ A;  4KH1 B;  5LJ3 g;  4A4H A;  2C06 A;  4RTV A;  4ZTJ A;  1VQL A;  5GAM h;  1AEY A;  5GAN 7;  5GAM d;  2AKL A;  1T3L A;  3CC4 A;  3OYN A;  1D09 B;  1VQ9 Q;  2JT4 A;  2M16 A;  4J6W A;  4A63 B;  1Q82 U;  5GMK h;  5KYX A;  2CP0 A;  2WSF E;  4CC3 A;  1S72 A;  4C8Q F;  1XNI A;  5DLO A;  4FW1 A;  1F1B B;  4M78 C;  1YI2 Q;  9ATC B;  5IHK A;  2E3I A;  3JCM P;  3R6N A;  4MZP A;  2D8H A;  5AYF A;  2LRQ A;  1C0M A;  1JB0 E;  3QJY A;  1QQJ A;  4M78 F;  4CRI A;  2E5Q A;  4HVU A;  5GMK m;  3RIR A;  4MMK A;  2RMO A;  3KUF A;  5HY6 A;  1HSQ A;  3UT1 A;  2LX9 A;  5J39 A;  3OW2 S;  1OQK A;  2H3J A;  2QEX A;  2RK1 A;  5GAN 4;  1Q81 C;  2AZS A;  4J9B A;  2MOX A;  2LX7 A;  3T9N A;  5GAM e;  3CPW S;  1VQ6 Q;  1GCQ A;  2EBP A;  2HSP A;  3M0S A;  2HNI A;  1D0X A;  5I11 A;  4C5G A;  2XKO C;  4Z8A A;  4A54 A;  5CR2 A;  3OYB A;  1A0N B;  3G6E T;  1HD3 A;  4J7F A;  2DL3 A;  2ED1 A;  3P8H A;  5LJ5 d;  6AT1 B;  2YUN A;  1VQL T;  1ABQ A;  2QXF A;  1M4Z A;  1TXQ A;  2QTV A;  1TG0 A;  1Q82 R;  2HL3 A;  1WJS A;  2CZ6 B;  5KH6 A;  2F5T X;  3RMQ A;  1D0Z A;  1MND A;  2DIG A;  1BIA A;  2P4T A;  2V8K A;  3LYI A;  3BE3 A;  3U23 A;  3A98 A;  2L3P A;  3UA7 A;  1NLP C;  3I55 Q;  3M55 A;  4XAX B;  2OAU A;  2JN0 A;  3EG1 A;  1PG5 B;  1SRL A;  1ARK A;  1TU0 B;  1K8A U;  1CKA A;  2DF6 A;  2E3H A;  1G3S A;  4QVD A;  3J80 E;  1WHK A;  2WAC A;  5GMK j;  1NJI C;  4FYY B;  2D6F A;  3QXE B;  1VQ9 T;  3HKS A;  4JLI A;  1Q7Y C;  3PTA A;  3R6O A;  1K73 R;  4RG8 A;  4OGE A;  1RAE B;  1HXD A;  4JZ3 A;  1Q82 C;  5D6Y A;  3ZL7 C;  2FPF A;  5D7U A;  3CCV T;  2DVJ A;  2C0T A;  1WGS A;  3HSB A;  2DBM A;  4J9C A;  3L1A A;  2DXC A;  2CSI A;  1IB8 A;  3OS2 A;  4OP0 A;  2FG0 A;  3SEM A;  2DD5 A;  1RAG B;  1EFN A;  4RCC A;  4RTZ A;  1GBQ A;  3E19 A;  3FIF A;  4HA8 A;  4F7U E;  3VYH B;  3JCM c;  3I56 T;  3GIB A;  1WXU A;  2RHZ A;  3VJP A;  3CXC P;  1Q86 C;  3JCM V;  5ECA A;  3RDV A;  2K3B A;  2RA2 A;  4XTW A;  1WHG A;  3MP6 A;  4AG2 C;  4FW2 A;  1VQP A;  1MMG A;  2J06 A;  5FWC A;  3TCJ A;  1K76 A;  1N8R C;  1U1S A;  3URG A;  4C92 B;  2IIM A;  2ROT A;  1K9M U;  1KC8 R;  1N8R R;  1NPP A;  1X75 C;  4PJO E;  4EDU A;  2LCS A;  4K11 A;  3LGF A;  4M7A E;  2HZY A;  4WCI A;  2HQH A;  1QVF S;  4PJN A;  5KYX B;  2EKH A;  4RTW A;  4AG1 C;  3OYF A;  1W4S A;  2J6K A;  4FL6 A;  1KG1 A;  4M75 D;  2VV5 A;  2JS0 A;  4NS5 A;  1SHF A;  4ZN3 A;  2CS7 A;  5KE2 A;  2B8A A;  1AWJ A;  4PFP A;  1WIE A;  3L2W A;  2BZY A;  2DM1 A;  1YCY A;  2EVR A;  4PK4 A;  2MAM A;  4FM4 B;  4A4G A;  3CBO A;  1KSW A;  3ZEH A;  1J3T A;  1QCO A;  4LXC A;  1AZE A;  1BCM A;  3LWH A;  4M7A B;  1VQ6 T;  2DNU A;  2L3S A;  4II1 A;  1MV0 B;  2P4R A;  1R0B G;  1M1K C;  2QQS A;  2KEA A;  1U06 A;  5IAY A;  3G4S A;  1KHC A;  4F7U A;  2COZ A;  4WF2 A;  4IIO A;  2MWO A;  2QGF B;  2VXF A;  4DBQ A;  2AKK A;  3S6W A;  2EYY A;  5HCK A;  1AHJ B;  1K73 C;  2ECZ A;  4KT0 E;  2EPD A;  5GJW B;  3TSW A;  4E7J A;  1HK9 A;  2MPX C;  4PJL A;  2E6Z A;  3EGU A;  3EHR A;  1M8V A;  1RAH B;  4PNO A;  4M4Z A;  1MMA A;  2C0I A;  1MMN A;  4M7D D;  2M02 A;  1ZA2 B;  2FPD A;  4EMK C;  2QG9 B;  4JJN K;  1M27 C;  2NUT B;  2ZPI B;  3LWI A;  4IUR A;  4PFO A;  2AHJ B;  4J9I A;  3H6Z A;  3CME A;  1S1N A;  4HXJ A;  3S3O A;  2ZGW A;  1X6O A;  5GAN e;  2VKN A;  2A37 A;  1SSF A;  2K57 A;  3CCU Q;  1BI3 A;  1ZUU A;  5LJ3 j;  3PFS A;  2LQ8 A;  3JCM J;  3AHU A;  4M77 B;  1VQ9 A;  1QVG A;  2MYS A;  5J26 A;  2P0K A;  1UG1 A;  2JMA A;  4E7L A;  2OI3 A;  4ZGJ B;  1SSH A;  3TEE A;  4KRT A;  1ZSZ B;  2GFA A;  7AT1 B;  2CZ0 B;  2ZZD A;  2RQW A;  3CC2 A;  1XOV A;  4C5I A;  2LCC A;  2XG8 D;  1QMC A;  2LTO A;  3CCR T;  1PKT A;  4E2F B;  3LGL A;  3SD4 A;  1PCX A;  5GAM g;  3OBY A;  3HP9 A;  5I2S A;  3BDU A;  3WVE B;  2KT8 A;  4M7D A;  2CUB A;  2K7A A;  3HFN A;  5GMK l;  1AVZ C;  1VQP Q;  2X51 A;  1QCN A;  2I0N A;  2G3R A;  5GAO p;  1VIF A;  2CZ7 B;  4PL6 A;  1X2Q A;  3VS1 A;  2O4X A;  1VQ4 A;  3CCM T;  4J6X A;  2E5K A;  1YJ9 T;  1G3T A;  2VGM A;  1K4U S;  2CH4 A;  1BIB A;  2RN8 A;  3EFS A;  4LUE A;  2XDD A;  2J05 A;  4RG2 A;  2RQR A;  4AT1 B;  1BK2 A;  1YWP A;  3QKJ A;  2P84 A;  4CC2 A;  4ZGD B;  4ELZ C;  2QI2 A;  3OYY A;  5LJ5 f;  2XK0 A;  4KGV B;  5CO7 A;  2KRS A;  3CPF A;  3X28 B;  1YIJ Q;  5HKC A;  4X34 A;  2E1H A;  4A4F A;  5LJ3 h;  4QQG A;  4FIB A;  4PJO D;  3MJX A;  4GY5 A;  1JJ2 A;  2YUQ A;  4KUD K;  2CP2 A;  5DM7 R;  3BDL A;  1YJN T;  2EQJ A;  1VQK Q;  2XHC A;  5IT9 E;  4PJM A;  1JJ2 P;  1TWB A;  4BI4 A;  3INZ A;  4M75 E;  1VQM T;  2YLB A;  3QZ5 B;  2KYM A;  4JRI A;  8ATC B;  4Z88 A;  1OX9 A;  5CKE A;  2W0Z A;  1GCP A;  1SPK A;  3JB9 J;  2K5F A;  4M75 F;  2DTI A;  2QEX Q;  4PJO C;  3UA6 A;  2FO0 A;  2YXY A;  4RTU A;  4R55 A;  2M51 A;  1Y96 B;  3M4Y A;  4AFZ C;  2EIF A;  3CCJ T;  5KYW A;  3S3M A;  1WJQ A;  1KQS P;  2VGN A;  2LCL A;  2E41 A;  3RNJ A;  2GTJ A;  3EGD A;  1I4K 1;  4X9D A;  3MET A;  1M90 U;  2PQW A;  4JS5 A;  1JRI A;  5FU7 C;  3PVQ A;  1WHH A;  1QCF A;  2JXB A;  4Y92 A;  3H8Z A;  3CCE T;  5KCH A;  4HCZ A;  1C6V X;  3C4S A;  1QW1 A;  2FVU A;  4A4K A;  3MP1 A;  1WXB A;  5LJ5 g;  2K3Y A;  4IUQ A;  1ZSZ A;  2RNA A;  1K0X A;  3MKD A;  3ULR B;  1R0C B;  1S72 Q;  4C0F A;  1SF9 A;  1OZ2 A;  2LZ6 B;  2RF0 A;  1H3H A;  2QAZ A;  2CP5 A;  1LVK A;  2L3R A;  3A5Z B;  2DIL A;  5CIU A;  1ZUK A;  3A8M B;  1UEC A;  3KBG A;  4CI0 C;  5I21 A;  1M1F A;  1U8R A;  1VQK T;  2BTT A;  4O5V A;  2KVQ G;  2K2M A;  2PNI A;  2MF2 A;  1Q7Y R;  3BFM A;  3VYG A;  4XTZ A;  4ZTF A;  3ASK A;  2VAS A;  2EGA A;  2JUF A;  3JCM h;  1H8K A;  1LPL A;  4XU1 A;  2FZC B;  4J83 A;  4XTV A;  3AT1 B;  1KC8 C;  3KFV A;  2EAY A;  2BZ8 A;  1WX6 A;  2ROL A;  1M3A A;  3M0Q A;  5IHI A;  1RLP C;  1KD1 U;  2EQM A;  1VQ7 T;  2PUO B;  5FRM A;  1MHN A;  1N8R U;  1KC8 U;  1PNJ A;  3O5Z A;  3QYH B;  4AFQ C;  3VRY A;  4FSS A;  1IRE B;  3CBP A;  5KYY B;  4N4G A;  4RUG A;  3UWN A;  3I55 A;  3M54 A;  1UJ0 A;  2HDA A;  2P0P A;  1PKS A;  1NEG A;  2KXC A;  2EFI A;  3M59 A;  4BY6 B;  2HCK A;  1OUL A;  4E7K A;  2KRO A;  3OQ5 A;  2DL4 A;  3NPF A;  1BI1 A;  2VC8 A;  4J5Y A;  2L0A A;  3PIO A;  3ER0 A;  2DXB A;  4BI8 B;  1VIE A;  2XID A;  3G1J A;  5LJ5 h;  2O88 A;  1UDL A;  2JOY A;  2OTL T;  1I07 A;  2EKO A;  2X3W D;  3OS0 A;  1PM3 A;  1WQ7 A;  2PVD B;  3CCM A;  3EGX B;  5FLX E;  2ZPG B;  3RKX A;  4MDX A;  2NUP A;  3I56 Q;  4OB1 B;  3OYK A;  4C8Q D;  2DLP A;  2F69 A;  4M75 C;  2VUB A;  3CCU T;  4V2S A;  2DO3 A;  1WPY A;  1VQP T;  1UEB A;  1UHF A;  1K73 U;  3ZFJ A;  4LNP A;  3NTH A;  1OV3 A;  2LNV A;  2K4Y A;  2R58 A;  4Q5W A;  1B34 A;  2RJE A;  3QZ9 B;  1K8A R;  4E47 A;  2O4X B;  4DQ2 A;  3SWN C;  3NGP A;  2RO0 A;  5GAM j;  4LDW A;  2MI6 A;  1QVG S;  4ORZ A;  1Q86 R;  1VQ7 A;  2A7Y A;  3VRZ A;  2ZPE B;  5I22 A;  5CKF A;  1VQ8 T;  2COY A;  3GPL A;  3EGX A;  1E6G A;  3GLX A;  1NJI R;  3CC7 Q;  4E7S A;  4XQ3 A;  1K1Z A;  1BB9 A;  3EFO B;  2V26 A;  2VYT A;  2ATC B;  2OTL A;  1JO8 A;  5GAN 5;  4DEY A;  2CH4 W;  5CQX A;  4ME7 A;  1Z9Z A;  4C0D C;  4PKC C;  2V8I A;  2A36 A;  4DBH A;  3OY9 A;  1AT1 B;  4J9E A;  3SWN A;  2A08 A;  3G4S T;  2W10 A;  2E6N A;  2DXU A;  1U3O A;  2NWM A;  1O9S A;  1WLP B;  3JCM f;  1OPL A;  2RH2 A;  1IZ6 A;  3QYG B;  3L2Q A;  1AOJ A;  2R57 A;  3MEV A;  3JB9 D;  4X9C A;  2BE7 D;  2B86 A;  4OMP A;  1WQW A;  2JNG A;  3PMT A;  1VUB A;  2KGT A;  3VV0 A;  2DBK A;  3SB2 A;  1FX7 A;  3A1P A;  4LUD A;  2E4H A;  1B3Q A;  1QP2 A;  1VQM A;  4BY6 C;  1VQN T;  4F16 A;  3KXT A;  1K9M R;  5IN1 A;  4JLG A;  3X26 B;  4C92 F;  3EG9 B;  3QPH A;  4JJC A;  3OYA A;  1VYU A;  1KQ2 A;  5GAN j;  3M56 A;  2ED0 A;  2QDY B;  4C0D B;  3CCR Q;  2XIC A;  2NYS A;  1H92 A;  2EJG A;  4J8O A;  3VUZ A;  2D0N A;  2GF7 A;  1OYX A;  2EYZ A;  1YI2 T;  2KR3 A;  3EG0 A;  1OEB A;  3M0U A;  5LJ5 e;  2DE0 X;  1BCO A;  4HCK A;  2KXD A;  2MIO A;  3OYD A;  3CCJ Q;  3M0P A;  3H0I A;  4Z89 A;  2X3X D;  5CQY A;  1ACM B;  3I55 T;  1M1K R;  4E7Z A;  2QA4 T;  2H8H A;  5A0L A;  2LP5 A;  4ZNX A;  4M78 D;  2P0Q A;  3JRZ A;  4HVW A;  1JXM A;  2JVV A;  4XTY A;  4R56 A;  1GBR A;  4J9H A;  1PRM C;  2E64 A;  2DKG A;  1M2V A;  4NL2 A;  1Y7X A;  2FB7 A;  5LJ3 e;  2JM9 A;  2YUO A;  1B34 B;  3CCV Q;  3FJP A;  2LT1 A;  2OJ2 A;  1I8F A;  1KHI A;  1N9S A;  2COW A;  1KD1 C;  1SEM A;  2FEI A;  3CXC A;  1RAB B;  5GAN 3;  3PIP A;  2HAX A;  1XJW B;  1HJD A;  2DRK A;  2ENM A;  4PJO F;  2HEQ A;  3JCM e;  1DJ7 B;  2OTJ Q;  4M7D E;  1HYO A;  2KAF A;  2SRC A;  1IHW A;  1GXI E;  2KK4 A;  1YFN A;  4F7U F;  1ZSZ C;  1G3W A;  5GAM f;  4F7U B;  4C8Q E;  1KJW A;  1VQO A;  4E6R A;  2X9H A;  2L89 A;  2DTH A;  1X6B A;  1JEG A;  5J3B A;  2QEX T;  4IUP A;  2I2L A;  1UGS B;  4Z02 A;  3CCE Q;  1TTH B;  4DBF A;  3I5R A;  2GQV A;  4L6V 5;  4JDS A;  1WYX A;  3M57 A;  5GAO l;  4XU2 A;  2LJ1 A;  4MDW A;  2EGE A;  1AD5 A;  4M7A F;  1IO6 A;  1KIK A;  5D6W A;  4BDZ A;  2RM4 A;  5IXB A;  2DK3 A;  4M7A G;  4KUI A;  2OTL Q;  4C5E A;  1IGQ A;  2PU9 B;  2J6O A;  3NHN A;  1BBZ A;  5FW9 A;  1AWW A;  2DER A;  1OI1 A;  3P8D A;  1ZSG A;  3FJ5 A;  2QA4 Q;  2CT3 A;  1H3Z A;  5CKD A;  2HBP A;  4FT2 A;  4N4H A;  4HT9 A;  4KGZ B;  2ZPF B;  2JTM A;  3QDR B;  4OMQ A;  3RUX A;  4EMK A;  2HBW A;  2JZ2 A;  4C92 A;  3MP8 A;  1I81 A;  3L2U A;  4QQD A;  3PVL A;  4OMF B;  2NLU A;  4QVZ A;  1VQ5 T;  2CP3 A;  3CD6 Q;  2E12 A;  4KH0 B;  2M0O A;  2HKQ B;  3FRN A;  3EHQ A;  4KUL A;  2A3L A;  2MMP A;  2KI7 A;  1ZBJ A;  2MK5 A;  3A8O B;  2YHT A;  4IUT A;  2X4Y A;  1M5Q 1;  4AFU C;  2X4W A;  2JTF A;  5KYN A;  1IHV A;  4NL3 A;  1TUG B;  1YHQ A;  3VKI A;  5GAO m;  3PT9 A;  1N9R A;  2CDT A;  5LJ3 f;  2KYB A;  2QDL A;  2D8J A;  3CCM Q;  1ZBX A;  1RI0 A;  3SWN B;  3X20 B;  3C12 A;  2DET A;  5GAN 8;  2YRC A;  3DB3 A;  5CKH A;  3CMA T;  3G71 T;  3QWY A;  1UB4 A;  2VVK A;  2CRE A;  1VQN A;  2OX7 A;  5FU7 B;  2DAQ A;  1YN8 A;  4OF1 A;  3ZBD A;  1EX4 A;  4JPB W;  5GAN 2;  2EWN A;  2L8D A;  2NUT A;  4M75 B;  1W2B A;  3CXC S;  1G2B A;  4OMN A;  4IUV A;  2E10 A;  1BU1 A;  3JCM W;  1GL5 A;  1M2V B;  1NYG A;  1QVG P;  1T0J A;  2BE9 B;  4F04 B;  2D1X A;  2VWF A;  2LJ3 A;  2NUP B;  4HCB A;  5KYU B;  1AWO A;  3OYI A;  4BE1 A;  2YRV A;  4FYV B;  1BI0 A;  3E9F A;  2X35 A;  4XU0 A;  4FU6 A;  2KRM A;  1FMV A;  1YJW Q;  3FLG A;  3QO3 A;  3JB9 G;  5EC7 A;  3V8L A;  1VQ5 A;  2M9U A;  3THK A;  4F7U G;  2BIV A;  2H3E B;  2Z0W A;  3UAT A;  3DB4 A;  5M9O A;  1YJN A;  2DTO A;  3FB9 A;  4PLI A;  3RMS A;  3JAM E;  3CCS A;  2GQI A;  2FZK B;  3M0T A;  2DX1 A;  4OB3 B;  2CGH A;  2DYI A;  2EYW A;  1PD1 A;  2J6F A;  4M77 C;  4RTX A;  3CME T;  5FRN A;  2YDL A;  2KQW A;  3WVD B;  2QK0 A;  3JCM d;  3E1S A;  1Y0M A;  4WTO B;  3L2Z A;  4F14 A;  1NG2 A;  3CCL Q;  2O2O A;  3OS5 A;  4GLM A;  2PZ1 A;  3M5A A;  3CCL A;  1YBY A;  1S72 T;  3OMC A;  4B9X A;  1WDX A;  5HK0 A;  1RLQ C;  1M1G A;  2PUK B;  3EGD B;  2HD0 A;  1QLY A;  3H0H A;  1QKX A;  2EGC A;  1NE8 A;  3V8J A;  4EMH A;  3MCA B;  5CK9 A;  2GCX A;  1PSF A;  1M2O A;  1X01 A;  5KYU A;  1M1K U;  1UGP B;  4ZN1 A;  2EQU A;  3CPW P;  5GAN 6;  2DL8 A;  4OB0 B;  4LD6 A;  4L59 A;  4ELY C;  1VQ5 Q;  2DA9 A;  4J9G A;  3CME Q;  1NBE B;  2KY9 A;  1Y57 A;  3GNF B;  4A4E A;  4LDV A;  3V7S A;  4BB7 A;  2RJD A;  1QVP A;  1GCQ C;  4Y91 A;  1RAC B;  5GJV B;  4J9F A;  1LNX A;  2HSE B;  2A0F B;  3CCU A;  4C8Q G;  1KFZ A;  2RI2 A;  3RBB B;  1YJ9 Q;  1SKU B;  4P5N A;  3V7R A;  2KRN A;  4FCY A;  3PMI A;  4QT7 A;  4M7D G;  3D7S B;  3I5S A;  1K9M C;  1FMK A;  1X43 A;  1VQN Q;  4GBQ A;  1Y07 A;  3CCQ T;  3DKM A;  2V1Q A;  1KQS A;  3CMA Q;  3QUI A;  3X25 B;  1UGQ B;  1MMD A;  1M90 C;  3M9Q A;  4DEX A;  2ABL A;  2HQX A;  2X4J A;  1YWO A;  1ZQ1 A;  3TQ7 P;  1WHJ A;  3OMG A;  1I5O B;  3CCL T;  3JB9 I;  4MZT A;  2DRM A;  3EH2 A;  1VQK A;  1PWT A;  1W70 A;  4C92 C;  2R5M A;  3CMA A;  1WFW A;  1D1C A;  2RI3 A;  3M0R A;  1R8O B;  5LL6 S;  1RAF B;  4PJO B;  4EMK B;  1WZO A;  3GNG A;  3H0F A;  3G4S Q;  1YIJ A;  1WNL A;  4IIM A;  3REA B;  3OYC A;  5FRO A;  1YJ9 A;  1QKW A;  2XI9 A;  5DY9 A;  3DLL A;  2E65 A;  4HKE A;  5IHN A;  4F17 A;  4PJJ A;  1KQS S;  2BZX A;  3M53 A;  5KCO A;  3TSZ A;  2QAS A;  3REB B;  1OOT A;  1XTD A;  4PLL A;  4E7H A;  1K8A C;  2XMF A;  4FSX A;  4M77 F;  2DL5 A;  1OU8 A;  1B07 A;  1PRL C;  4B6M A;  1N27 A;  1VQ8 Q;  2RD1 A;  2AT1 B;  3I35 A;  4M7A C;  8AT1 B;  2GNC A;  3EAE A;  1JJ2 S;  3CCE A;  3QHS A;  3CCQ A;  2CT4 A;  5FU6 C;  4LDU A;  3CCQ Q;  1LOJ A;  3HL8 A;  3OYH A;  2YWW A;  1LCK A;  4KGX B;  5GAN g;  1BYM A;  3QBY A;  3P8B B;  1FWZ A;  2K3X A;  1VQ8 A;  1N6A A;  2RK2 A;  4OML A;  3SHW A;  3OYJ A;  3TU4 K;  2ZPB B;  3CC2 Q;  2LJ0 A;  4C92 G;  4CC4 B;  2HL5 C;  1W2B S;  1I5L A;  2DL7 A;  1I0C A;  2E70 A;  4Y28 E;  2K5I A;  1TUC A;  5LJ5 j;  3QJ6 A;  1T0H A;  2XDB A;  1VYV A;  3CCV A;  2PTK A;  2O9V A;  4MZM A;  1C1A A;  4RTT A;  3CCS Q;  2LMJ A;  1YJN Q;  1W1F A;  2DEQ A;  4L5G A;  4JS4 A;  1JU5 C;  2WSE E;  2JW4 A;  3JSC A;  1CSK A;  1OPK A;  3HRU A;  2K9G A;  2L3Q A;  3X24 B;  1EIF A;  4FYW B;  4E7I A;  1KD1 R;  3A8L B;  4RTY A;  3E2U A;  4M7A A;  2GBQ A;  1Y96 A;  1Q81 U;  4HCC A;  3MEW A;  2JS2 A;  4LDX A;  2A28 A;  3BY7 A;  1G83 A;  4D8K A;  3GOX A;  1UGR B;  3L42 A;  3LH0 A;  3CD6 T;  2BUD A;  1N5Z A;  2CP7 A;  1AWX A;  4M78 B;  5A0D A;  2K6D A;  4LN2 A;  1M9S A;  2DPP B;  1YHQ Q;  1G8X A;  3TVT A;  1WHL A;  5FWB A;  1G5V A;  2RQU A;  2AZV A;  2DFU A;  1V1C A;  1UGV A;  1SHG A;  4ATO A;  5A0G A;  3RKW A;  3JCM Q;  1FXX A;  2M0Y A;  4VUB A;  3CD6 A;  2FL7 A;  3CCR A;  1K0S A;  4JRP A;  2YRD A;  3HHT B;  2DMO A;  1VQ4 T;  4HT8 A;  2Y4Y A;  2KT1 A;  1YI2 A;  1OX8 A;  2Y4X A;  1M30 A;  5EG2 A;  2RJC A;  2JJ9 A;  1GFD A;  1BKB A;  1KQ1 A;  1U5S A;  5CAI A;  3PE0 A;  1NJI U;  2V8J A;  2QQB A;  4M78 A;  3EG9 A;  4M75 A;  3GF5 A;  1YIT Q;  2DIQ A;  1BI2 A;  1K9A A;  4A53 A;  3GBQ A;  1Q86 U;  2ZCF B;  2F2W A;  2AK5 A;  1QP3 A;  4RCB A;  5GMK e;  3HRT A;  1NEB A;  2GGR A;  1VQL Q;  1ZLM A;  2IVW A;  2JMC A;  3A8H B;  3MPU B;  4X1V A;  4M78 E;  4M7A D;  1ZX6 A;  1UFF A;  4M77 A;  1TSF A;  4M77 G;  3CCS T;  2FRW A;  3MO8 A;  2LQK A;  3OS1 A;  1Q95 G;  1NLO C;  3ME9 A;  4BI3 A;  5I2M A;  1XQH A;  1O75 A;  1NYF A;  1YCS B;  5IH2 A;  1ZA1 B;  2K5L A;  3VS6 A;  1PHT A;  4FT4 A;  1VOM A;  1Q81 R;  2KDS A;  3OA6 A;  2K2V A;  3M58 A;  2OAW A;  1PC0 A;  5KYY A;  2FRY A;  3HFO A;  4EPC A;  4C0Z A;  2CSQ A;  2EYX A;  2HMA A;  1YIT T;  1V29 B;  4DBR A;  4J6Y A;  4QKU A;  1YJW T;  2YSQ A;  1D3B B;  5LJ3 d;  3FEO A;  2DD4 A; 
#chains in the Genus database with same CATH homology
 1ARK A;  2D1X A;  2VWF A;  1CKA A;  2DF6 A;  2EGA A;  1UTI A;  2F2V A;  2LJ3 A;  1H8K A;  1AWO A;  2KRM A;  3KFV A;  2BZ8 A;  1WX6 A;  2LQW A;  5EC7 A;  3VS2 A;  2ROL A;  1JQQ A;  3THK A;  1M3A A;  3M0Q A;  4JZ3 A;  5IHI A;  1RLP C;  3ZL7 C;  3UAT A;  1AZG B;  3VS4 A;  2FPF A;  2DVJ A;  1CKB A;  2C0T A;  2DBM A;  1PNJ A;  2GQI A;  3O5Z A;  4J9C A;  3M0T A;  4AFQ C;  3VRY A;  2CSI A;  2DX1 A;  4FSS A;  2EYW A;  2J6F A;  2FG0 A;  1UJY A;  4RTX A;  3JV3 A;  1T3S A;  3SEM A;  2YDL A;  1EFN A;  4RTZ A;  4JJD A;  2SEM A;  1GBQ A;  4RUG A;  1UJ0 A;  1WA7 A;  1Y0M A;  2HDA A;  4OMO A;  3I9Q A;  3VS5 A;  1PKS A;  1WXU A;  1NEG A;  2KXC A;  3VS7 A;  4F14 A;  2GTO A;  2HCK A;  1NG2 A;  2KRO A;  2O2O A;  1UUE A;  2DL4 A;  3NPF A;  1VA7 A;  2K3B A;  5ECA A;  1I1J A;  4GLM A;  2PZ1 A;  4JJB A;  2L0A A;  4AG2 C;  1WDX A;  1RLQ C;  2J06 A;  5FWC A;  2RQT A;  1QLY A;  1K76 A;  3H0H A;  2O88 A;  1UDL A;  1I07 A;  2EW3 A;  1QKX A;  2X3W D;  2EGC A;  2IIM A;  2ROT A;  2O31 A;  1FYN A;  4HVV A;  4AFS C;  3CQT A;  2LCS A;  3VS0 A;  4K11 A;  1E6H A;  1MUZ A;  1QWF A;  2DLP A;  4EIK A;  4WCI A;  2EKH A;  4RTW A;  1UHF A;  4LNP A;  1QWE A;  2DL8 A;  4AG1 C;  1OV3 A;  2J6K A;  2DA9 A;  2L2P A;  2JS0 A;  4J9G A;  1JXO A;  1SHF A;  1RUW A;  1Y57 A;  3C0C A;  1AWJ A;  1WIE A;  2O9S A;  2G6F X;  2BZY A;  2DM1 A;  2RPN A;  3NGP A;  2EVR A;  2LNH B;  1GCQ C;  1KSW A;  4ORZ A;  2DJQ A;  1J3T A;  3VRZ A;  5GJV B;  4J9F A;  1AZE A;  5I22 A;  2K79 A;  1ABO A;  3LH5 A;  2DNU A;  1KFZ A;  2L3S A;  1GRI A;  3RBB B;  1E6G A;  1MV0 B;  2KRN A;  2P4R A;  3H41 A;  2KEA A;  4QT7 A;  1K1Z A;  1U06 A;  1BB9 A;  3I5S A;  1FMK A;  1X43 A;  1MV3 A;  4IIO A;  4GBQ A;  1SRM A;  1JO8 A;  2V1Q A;  4DEY A;  2AKK A;  2CH4 W;  2EYY A;  5HCK A;  2NUZ A;  1Z9Z A;  2EQI A;  3IQL A;  2ECZ A;  1RI9 A;  2A36 A;  4DEX A;  2EPD A;  2DYB A;  1WI7 A;  4J9E A;  2ABL A;  2A08 A;  5GJW B;  3TSW A;  1X2K A;  1VYT A;  2CUD A;  2LQN A;  3EGU A;  3EHR A;  1YWO A;  2W10 A;  1U3O A;  4M4Z A;  2NWM A;  2C0I A;  2C0O A;  1WLP B;  2DRM A;  2FPD A;  1OPL A;  3QWX X;  1PWT A;  1AOJ A;  1M27 C;  1W70 A;  1WFW A;  2B86 A;  1M8M A;  4OMM A;  4OMP A;  4J9I A;  3M0R A;  2V1R A;  2KGT A;  4CC7 A;  2DBK A;  1M3C A;  1S1N A;  3H0F A;  4HXJ A;  3NMZ C;  1YP5 A;  4LUD A;  4IIM A;  1E7O A;  3REA B;  2MCN A;  1B3Q A;  1X69 A;  2VKN A;  2A37 A;  3VS3 A;  4LE9 A;  4F16 A;  1QKW A;  1W6X A;  4JJC A;  5IHN A;  1VYU A;  1ZUU A;  4F17 A;  2BZX A;  2KE9 A;  2ED0 A;  3TSZ A;  4R0K A;  3REB B;  1UE9 A;  1ZUY A;  1OOT A;  1UG1 A;  1X6G A;  2KBT A;  2JMA A;  2OI3 A;  1H92 A;  1SSH A;  1WXT A;  4KRT A;  2XMF A;  1Z9Q A;  2D0N A;  3EG2 A;  1M3B A;  2RQW A;  2DL5 A;  2EYZ A;  1XOV A;  1B07 A;  2KR3 A;  1PRL C;  3EG0 A;  1OEB A;  3M0U A;  2DE0 X;  4HCK A;  2KXD A;  2MIO A;  1PKT A;  3I35 A;  2YT6 A;  3M0P A;  2GNC A;  3H0I A;  4Z89 A;  2CT4 A;  2KT8 A;  1NM7 A;  2X3X D;  3UF4 A;  2CUB A;  2K7A A;  1AVZ C;  2H8H A;  1LCK A;  2LP5 A;  4ZNX A;  4OML A;  3SHW A;  2I0N A;  1GFC A;  2LJ0 A;  4HVW A;  4CC4 B;  1JXM A;  4J9D A;  1X2Q A;  3VS1 A;  1GBR A;  2DL7 A;  4J9H A;  1PRM C;  1TUD A;  1I0C A;  2E5K A;  1K4U S;  2CH4 A;  2RN8 A;  4LUE A;  2RQV A;  2JM8 A;  2JM9 A;  2YUO A;  2J05 A;  2RQR A;  4D8D A;  1TUC A;  2OJ2 A;  1T0H A;  1BK2 A;  1YWP A;  5IXF A;  1VYV A;  2FPE A;  1SEM A;  2FEI A;  1UHC A;  2PTK A;  2O9V A;  4CC2 A;  5L23 A;  4RTT A;  2LMJ A;  1W1F A;  1HJD A;  3EG3 A;  1JU5 C;  2DRK A;  2ESW A;  2JW4 A;  2ENM A;  1CSK A;  2KRS A;  2HEQ A;  4ESR A;  1OPK A;  2YUP A;  2K9G A;  2L3Q A;  2JTE A;  2KNB B;  1X27 A;  2SRC A;  4RTY A;  2GBQ A;  1KJW A;  2YUQ A;  2F2X A;  2J7I A;  4E6R A;  2JS2 A;  1JEG A;  1X6B A;  2A28 A;  1G83 A;  4D8K A;  4JZ4 A;  1N5Z A;  1YNZ A;  1AWX A;  2KYM A;  2K6D A;  4LN2 A;  3I5R A;  4Z88 A;  3TVT A;  2W0Z A;  1WYX A;  1GCP A;  1SPK A;  5FWB A;  2RQU A;  2AZV A;  4RTV A;  1V1C A;  2LJ1 A;  3UA6 A;  2FO0 A;  2EGE A;  1UGV A;  1AD5 A;  1SHG A;  1IO6 A;  1KIK A;  4RTU A;  2M51 A;  1AEY A;  4AFZ C;  5IXB A;  2AKL A;  1T3L A;  2M0Y A;  2J6O A;  2JT4 A;  1BBZ A;  3NHN A;  4A63 B;  1K0S A;  5FW9 A;  1AWW A;  1ZSG A;  3FJ5 A;  2DMO A;  2CT3 A;  3RNJ A;  2KT1 A;  2GTJ A;  1M30 A;  4CC3 A;  1GFD A;  1U5S A;  4OMQ A;  2HBW A;  3PE0 A;  5IHK A;  3R6N A;  2D8H A;  3PVQ A;  1QCF A;  3PVL A;  1K9A A;  3GBQ A;  2JXB A;  4HVU A;  4Y92 A;  3EHQ A;  2RMO A;  2F2W A;  2AK5 A;  1HSQ A;  1ZBJ A;  1NEB A;  2GGR A;  1ZLM A;  4AFU C;  1WXB A;  2JMC A;  4X1V A;  2AZS A;  1ZX6 A;  4J9B A;  2RNA A;  1UFF A;  1K0X A;  2MOX A;  2FRW A;  2LX7 A;  3ULR B;  1NLO C;  1GCQ A;  2EBP A;  2CDT A;  2LZ6 B;  2HSP A;  3M0S A;  2KYB A;  5I11 A;  1YCS B;  2QDL A;  1NYF A;  5IH2 A;  2D8J A;  3VS6 A;  1PHT A;  4Z8A A;  2RF0 A;  1A0N B;  1H3H A;  1HD3 A;  2DL3 A;  2ED1 A;  2DIL A;  2YUN A;  1ZUK A;  1ABQ A;  2OAW A;  1UEC A;  1TG0 A;  3QWY A;  2VVK A;  2CRE A;  2FRY A;  2CSQ A;  2EYX A;  1YN8 A;  2BTT A;  4JPB W;  3U23 A;  2K2M A;  3A98 A;  2L3P A;  3UA7 A;  2PNI A;  2YSQ A;  1G2B A;  1NLP C;  4OMN A;  1BU1 A;  1GL5 A;  3EG1 A;  1NYG A;  1T0J A;  1SRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...