1J3TA

Solution structure of the second sh3 domain of human intersectin 2 (kiaa1256)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
GSSGSSGVENLKAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords Intersectin 2
publication title Solution structure of the second SH3 domain of human intersectin 2 (KIAA1256)
rcsb
source organism Homo sapiens
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2003-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1j3tA00
2RMOA 1BK2A 2FRYA 4KRTA 4F16A 1XOVA 1RI9A 1T0JA 1M27C 2YUQA 1MV0B 2CT3A 3M0TA 1UGVA 3VS4A 2KYMA 1M3AA 3NHNA 2BZ8A 4J9EA 5IHKA 2FPEA 5GJWB 5IHIA 2L3SA 2DL3A 2JW4A 3EG2A 2LMJA 2M51A 1V1CA 2J6FA 2KE9A 3I9QA 4AG2C 1WLPB 4J9HA 5IH2A 2ENMA 3PVLA 2KYBA 1TUCA 2SRCA 3H0FA 3H0IA 2O9VA 4RTUA 1T3LA 1JQQA 2DBMA 2YSQA 2CH4A 3M0RA 3UATA 3R6NA 2V1QA 3PE0A 1NLPC 1Y57A 2KRMA 1SPKA 4HVUA 4OMOA 1BB9A 5HCKA 1B3QA 2ED0A 1I1JA 1X6GA 2ROLA 2DILA 3H41A 2DYBA 2DM1A 2DL7A 2ROTA 2KGTA 2LQWA 2KRNA 1LCKA 1ZLMA 1UE9A 2ESWA 1ZX6A 2DLPA 1H92A 1A0NB 2OJ2A 4Z89A 4RTYA 2KNBB 5FWBA 1W1FA 1YWPA 5IHNA 4LNPA 3SEMA 3VRZA 2KROA 2LZ6B 2F2XA 2A37A 1YN8A 1YWOA 1X43A 5IXFA 1UUEA 3M0SA 1GCQA 1GCQC 1VYUA 1BBZA 3TSWA 4AFQC 3NGPA 1UG1A 4LUDA 2GTJA 1SEMA 2CSQA 2LJ3A 1GRIA 1X69A 1WXBA 2I0NA 2YUPA 1K0SA 4GLMA 5IXBA 2DX1A 3M0UA 4JZ3A 4J9DA 1J3TA 1Z9ZA 1I0CA 2L3PA 1RLPC 5GJVB 2BZYA 1M30A 1PWTA 4HXJA 2OI3A 1U5SA 4J9GA 2EGCA 1BU1A 5EC7A 4OMMA 5FWCA 3M0QA 4AFZC 2GQIA 2RPNA 1M3BA 3VS0A 1ABQA 2EYWA 1UECA 1X27A 1GFCA 1WFWA 2CSIA 4ZNXA 4RTWA 3REAB 2EYXA 1WA7A 1HSQA 1WXTA 2EKHA 1ABOA 3NMZC 2JS0A 3A98A 2CDTA 2LX7A 2DRMA 1GBRA 2RQRA 2G6FX 1EFNA 4R0KA 2J7IA 2RQWA 4RUGA 4RTVA 2DRKA 1JEGA 1K4US 1K0XA 2D0NA 3I5SA 2C0IA 2M0YA 2V1RA 3I35A 3C0CA 1QWFA 1B07A 2D8HA 2GTOA 1AWJA 4GBQA 1SRLA 2H8HA 2JTEA 1JO8A 2W0ZA 3EGUA 3EG0A 2BZXA 1G83A 2BTTA 2E5KA 4J9CA 3H0HA 1NM7A 1JU5C 2DJQA 2YUNA 2KXCA 3UF4A 2JT4A 1OPLA 1CSKA 2YUOA 2C0OA 2KBTA 1GFDA 2RQUA 2PTKA 2DL8A 2K2MA 4IIMA 1W6XA 3RNJA 1W70A 1CKBA 4RTXA 4AFUC 4JJDA 1AVZC 2CUBA 4J9FA 2MIOA 4HVWA 1JXOA 1QCFA 1WI7A 1HJDA 2PNIA 2EGAA 1AEYA 4Y92A 3NPFA 2X3XD 1H8KA 1E7OA 1TUDA 4RTTA 2KT8A 3THKA 1UFFA 2O2OA 4CC2A 2K3BA 2YT6A 1K1ZA 1YCSB 1WIEA 3KFVA 1Z9QA 4F17A 1ZUKA 2JM8A 3EHRA 2NWMA 4OMPA 1AWXA 1PNJA 2A36A 2J06A 2VKNA 2NUZA 3EHQA 1NG2A 5FW9A 1M3CA 2LP5A 4LE9A 1E6HA 2HEQA 2KR3A 5I11A 2L0AA 2RN8A 1X2QA 3VRYA 1G2BA 1UTIA 2QDLA 1FMKA 2MOXA 1RUWA 1NEBA 2B86A 3O5ZA 2FEIA 2JMCA 1SHFA 3JV3A 2GNCA 2D8JA 2EGEA 1PHTA 2X3WD 3VS2A 2LNHB 4JPBW 4Z8AA 4ORZA 1QLYA 2KXDA 2IIMA 1X6BA 3TVTA 2C0TA 1PRMC 2ED1A 2LJ1A 3M0PA 4J9BA 3TSZA 1ZUUA 2LJ0A 2RQTA 2FPFA 2DA9A 1PKSA 1ZBJA 2P4RA 1WDXA 1VYVA 2K6DA 1MUZA 3VS1A 4CC4B 3CQTA 1Y0MA 2JMAA 1YNZA 2FG0A 1AZEA 4CC7A 3UA6A 1PRLC 4A63B 4LUEA 4FSSA 4E6RA 1OEBA 4X1VA 1QKXA 1U06A 1GL5A 1N5ZA 1KSWA 4HCKA 4JZ4A 2RF0A 4Z88A 5I22A 1E6GA 3U23A 1AWWA 3RBBB 2AKLA 3VS7A 1ZSGA 4JJBA 1GBQA 1X2KA 2ABLA 1I07A 2O88A 1FYNA 4OMLA 4D8KA 2HBWA 2DVJA 4LN2A 1S1NA 1K76A 1NYGA 1K9AA 1WXUA 2K9GA 4D8DA 1AD5A 2EW3A 1VA7A 2K79A 2D1XA 2DL4A 1UHCA 1KFZA 1UDLA 2DMOA 4F14A 1SSHA 1WYXA 4EIKA 2JXBA 4HVVA 2F2VA 4ESRA 2L2PA 1H3HA 2CH4W 2LQNA 1AOJA 2AK5A 4OMNA 2XMFA 1IO6A 2O9SA 4J9IA 1ARKA 3GBQA 5L23A 1KIKA 2OAWA 5ECAA 3QWYA 4DEYA 2KT1A 1U3OA 4WCIA 2DBKA 3EG3A 1NEGA 4QT7A 1AZGB 2CUDA 1PKTA 4K11A 2O31A 3EG1A 1NLOC 1UJ0A 2LCSA 2L3QA 1TG0A 2EQIA 1ZUYA 2PZ1A 2YDLA 4JJCA 2MCNA 1T0HA 3VS6A 2J6KA 1QKWA 1OV3A 2RQVA 1RLQC 1KJWA 2EYZA 1YP5A 3PVQA 2EVRA 2VVKA 1SRMA 3ZL7C 4CC3A 2KRSA 2HDAA 4IIOA 2FPDA 2HCKA 3UA7A 2J05A 2DNUA 1OOTA 2CREA 2J6OA 2RNAA 4AFSC 2FO0A 2JM9A 1UJYA 3I5RA 4RTZA 2A28A 2HSPA 2DF6A 4DEXA 1JXMA 4OMQA 3LH5A 2AZVA 2EPDA 2SEMA 3VS3A 1MV3A 2F2WA 2ECZA 2K7AA 4M4ZA 3REBB 1NYFA 2W10A 3SHWA 1QWEA 2DL5A 2AZSA 2CT4A 2DE0X 3FJ5A 3ULRB 4AG1C 1M8MA 1VYTA 1WX6A 3IQLA 3QWXX 1SHGA 2FRWA 2VWFA 2EYYA 2JS2A 1CKAA 1UHFA 2EBPA 2KEAA 2A08A 1AWOA 3VS5A 1GCPA 2GGRA 2AKKA 1OPKA 1T3SA 1HD3A 2GBQA
chains in the Genus database with same CATH superfamily
2RMOA 2ATCB 5HK0A 5LJ3j 5L8RE 1KC8U 1RI9A 4F7UG 1Q81U 2MAMA 3FLGA 2ZPGB 4M7DA 1MV0B 4DBHA 4M75C 3M0TA 4M7AC 1UGVA 3VS4A 3S3NA 2FB7A 5GJWB 1QMCA 2MWPA 3PIOA 3CCUT 1EIFA 4PJOB 4C0GA 1GXIE 2D6FA 2L3SA 2DL3A 4C5IA 2JW4A 3C94A 4XU0A 5LJ5h 1ZHIA 3QIIA 3CCST 2E6ZA 5IH2A 3MPUB 3RKXA 3JB9H 4DOWA 2SRCA 2O9VA 2EIFA 2RK1A 4HT9A 1JQQA 2DBMA 4IUUA 3M0RA 3MEWA 2X4YA 1NLPC 2B8AA 1I4K1 5GANj 4HVUA 4OMOA 3G6ET 5CVIA 1D1BA 1KD1R 4M77G 4E7KA 3EFRA 1UGRB 1AHJB 4PJJA 4OMFB 4BD3A 1K73C 2LQWA 2DEUA 2KRNA 4ELZC 1M1KC 1TUGB 1ZX6A 4R55A 1H92A 1VQOT 1A0NB 4C0FA 2E41A 4C92F 5GAN2 5FWBA 5GMKi 2DYIA 1G8XA 4LNPA 5AYFA 5AT1B 1JJ2S 2R57A 2NUTA 4IUTA 2F2XA 1D3BB 4NS5A 5IXFA 4JS4A 4EMKA 2PVDB 3V8JA 3M0SA 1VUBA 2ZAEA 3CD6T 1GCQA 1VQMQ 1VYUA 4ZN3A 2LCCA 3OYKA 1O9SA 1QQJA 2V8IA 4M7DF 3E1SA 3EGXB 2LJ3A 3JCMc 3JCMJ 1I8FA 1BCOA 2I0NA 2YUPA 3V7SA 1WJSA 5FU6B 3CMAA 4A54A 5IXBA 3M0UA 1WZOA 2AHJB 4JZ3A 1J3TA 1I0CA 5GJVB 4RCCA 7AT1B 2E3IA 2BIVA 4LD6A 2OI3A 1VQNA 2EGCA 1BU1A 4M7DD 3CCJQ 4XTYA 4OMMA 1S72T 3RMSA 4N0AC 2RK2A 2Y4YA 4TVRA 1AT1B 4PJOE 4ZTFA 4KT0E 2CSIA 2EYXA 4A4FA 1YHQT 1G5VA 2QTXA 3DB3A 1VQMA 2C06A 1TSFA 3EFOB 1LJOA 4FIBA 2EWNA 1GBRA 5DY9A 2DTOA 3TU4K 4KH1B 1K4US 3AT1B 1K0XA 1XTDA 2M0YA 3CCRT 1QWFA 1B07A 2D8HA 4EMHA 4QQDA 1AWJA 1D0XA 1SRLA 3M57A 4C8QB 1QVFS 3EG9B 1JO8A 3EG0A 4C5HA 2E5KA 4XAXB 2DJQA 2HQHA 2KXCA 1JB0E 1GFDA 3CCJA 1ZSZC 2HD0A 4OF1A 1AVZC 4C92G 1WI7A 3GOXA 2PNIA 2HKQB 3G1JA 3MEVA 1EX4A 3NPFA 4RTTA 4PK4A 4MZTA 2O2OA 2K3BA 2RJEA 3CC4Q 1LOJA 1YCSB 4BDZA 1ZUKA 2JM8A 4LDYA 3CXCA 4M7DG 1KG1A 1BIBA 4P5NA 2VKNA 2NUZA 3JB9I 3EHQA 1M3CA 4BDYA 3OYIA 2CP0A 1X2QA 1G2BA 2B86A 1NEBA 2X9HA 2QEXQ 2WSEE 1LPLA 2LNHB 4DA4A 2A7YA 3NTHA 1QLYA 2HZYA 1X6BA 1Q7YU 3OSVA 1PRMC 3CCLQ 5FRMA 5KYUA 3TSZA 1ZUUA 4CI0C 1ZBXA 1K9MC 5J39A 2JZ2A 3KUFA 4FW1A 5CCAA 5GMKj 3CC4A 1NZ9A 3UA6A 4A4GA 1D1AA 4C92C 2EQKA 3HFNA 4FSSA 3A5ZB 4E6RA 3JCMd 4C8QE 2CYZB 1KQSS 5DLQE 1MNEA 1IXDA 1K9MR 3HP9A 1XJWB 1I81A 4JJBA 3CCVQ 3OYAA 2K5FA 2R5MA 4BE2A 4ATOA 2HBWA 2Y4XA 4EDUA 2H3EB 1W2BP 1S1NA 2CP5A 2DJZA 1WXUA 4BY6B 4M75A 2EW3A 4RKUE 2E5QA 2K79A 5DLOA 2DZ9A 2FYKA 3SWNC 3CCLA 4EIKA 2D0QB 2JXBA 1UB4A 2F2VA 3S6WA 1O75A 4FCYA 3CPWS 3GNGA 1N8RR 2CH4W 2LQNA 4MMLA 2ZPHB 2FHDA 1OU8A 5D6WA 4AT1B 1IO6A 4EMGA 1KIKA 3QWYA 2KT1A 1U3OA 4WCIA 1OZ2A 2IG0A 1RAAB 1NEGA 3BDLA 1AZGB 2CUDA 2JVVA 1PKTA 5GAMe 3HFOA 1NLOC 2K2VA 2KMTA 1KD1U 5J3BA 1OQKA 1TG0A 2EQIA 3OS1A 5KYUB 2YDLA 2RHXA 3NTKA 4JJCA 2MCNA 3VUBA 1KQ2A 1X6OA 2EYZA 1YP5A 4RCBA 2M16A 1JJ2A 2X4XA 3OQ5A 3DLLA 1VQKQ 2EJGA 2L3RA 3UDCA 3JAME 2FPDA 2DNUA 1K8AU 1NPPA 2J6OA 4A4KA 2CS7A 2L89A 2JM9A 2I2LA 2F69A 4RTZA 5C0MA 2CP2A 3QO3A 3GNFB 2EPDA 3E9GA 3VS3A 1BI3A 2E64A 2ECZA 2W10A 3MHXA 3SHWA 2X35A 2JN0A 2QK0A 2CT4A 4RG8A 1VQ7Q 4M75B 2CGHA 4M7AB 4BUGA 4AG1C 3QDFA 3QWXX 3I56Q 4FSXA 2RI2A 2DK3A 2DAQA 1BI1A 3CC4T 1UHFA 3V8KA 1IGQA 2OTLQ 2KEAA 3META 2QA4Q 1GCPA 4FT2A 2GGRA 3L2QA 1UGQB 1PD1A 1VQ8A 1BK2A 4F16A 1XOVA 1T0JA 2YUQA 2CT3A 1SF9A 2QEXT 5IHKA 4QVCA 2FPEA 5M9OA 4LDXA 2RHYA 5CK9A 1BI2A 2LMJA 3I9QA 4NL2A 5GAMg 2ZPFB 3CC2Q 2ZGWA 1WLPB 4J9HA 1QVFA 1VQ7A 3PVLA 3OYGA 4MZMA 5A0LA 3I56A 2DIGA 4PJNA 1T3LA 3MP1A 2CP3A 3INZA 2V1QA 1LNXA 5FROA 1VQ6A 5D6YA 5HCKA 3FJPA 3AHUA 4PJOA 2P0QA 1I1JA 1X6GA 2NYSA 2ROLA 2K57A 3S3MA 1LCKA 5GAN4 3CCVT 1RI0A 2OJ2A 3QHSA 3O8VA 3WVDB 2XHCA 3MKDA 1W1FA 5HKCA 1YWPA 5IHNA 4N4HA 3H6ZA 2KAFA 4M78F 4L59A 3X28B 2LZ6B 2AT1B 2HKNA 3ER0A 5A0DA 1YWOA 5GAOm 2X51A 5CKEA 3Q1JA 3CC2A 3URGA 3G71A 2DD4A 5LJ3f 1BYMA 2GQVA 2M0OA 4M7AE 1Q86U 5GMKl 2VGNA 1QVGP 2DIQA 4LD9K 3JCMQ 1WXBA 1X69A 1IREB 1VOMA 1K0SA 4GLMA 3E19A 2DX1A 1BI0A 1VQPA 2O01E 5J26A 1Z9ZA 1G3SA 1RLPC 1M30A 3M59A 1X75C 1ZA1B 2CKKA 2FZGB 1PWTA 1R0CB 1D09B 3GLXA 4J9GA 4CRIA 2LC4A 2EJFA 4ZTJA 2RHUA 4KGZB 2RI3A 1VQ4A 5EC7A 1HYOA 4J6XA 2VASA 1NJIC 2QQSA 1VQLA 4AFZC 1C0MA 1M3BA 4V2SA 3VS0A 2EYWA 2E65A 2R58A 3EGXA 1X27A 2GFUA 5GANf 4PJOF 3D7SB 3T9NA 3I55A 1VQKT 1BCMA 1ZSZB 1KQSA 2XU8A 3SFMA 3A98A 2CDTA 4J6YA 1NJIR 2LX7A 2RQRA 1EFNA 2YRVA 4MZPA 2DRKA 1JEGA 2D0NA 4FW2A 2ZZDA 3UPUA 3JCMW 4FYVB 2GTOA 2HQXA 1Q82U 4GBQA 2H8HA 4KGXB 2JTEA 4PJOD 2W0ZA 5KYYB 4KBMB 5KH6A 3M54A 5A0GA 3MO8A 2BZXA 2LQKA 3I56T 3SWNA 1TTHB 1OPLA 3CMAQ 3CPWA 2YUOA 3RDVA 3MEAA 1N8RU 2OTLT 2QA4T 2DL8A 4IIMA 1W6XA 3EFOA 1W70A 4X9CA 4AFUC 1VQNQ 4J9FA 2EYQA 2HSEB 1JXOA 1FXXA 3WXMB 1HJDA 1AEYA 3A8MB 4Y92A 5CQXA 1M90C 1TUDA 1E7OA 2DVEA 2MI6A 4M78G 4C8QA 1WQ7A 3EG9A 4MDWA 3MP6A 5CAIA 3JCMP 2H3JA 2QQAA 8AT1B 1YJWQ 2E1HA 2YT6A 1K1ZA 3KFVA 1Z9QA 1KHIA 2NWMA 4OMPA 4M77E 1TU0B 3QKJA 4HCBA 5CKBA 1D0YA 3CBPA 1K73R 1M2VA 3CC2T 1M1KR 1NBEB 4XTXA 1WHLA 4ZGDB 2X4JA 5FW9A 2MK5A 4LE9A 2F5KA 4J6WA 3LGFA 3VU3C 3BE3A 3CCQA 2RN8A 1FMKA 1RUWA 3PMIA 3EAEA 4C92B 2V8KA 3UWNA 2D8JA 2EGEA 2LT4A 1PHTA 2X3WD 4ORZA 5IAYA 3E9FA 2IIMA 3TVTA 2LCLA 3M0PA 3P8HA 2AIRB 2LJ0A 3VJPA 1YIJQ 2KSSA 2DA9A 1I5OB 1ZBJA 1VYVA 1F1BB 4PJOG 1MUZA 2L5QA 2EAYA 2RHZA 1YJWA 3JCMh 4KH0B 3LX7A 2F1LA 5LJ3h 4CC7A 2MF2A 4OB0B 4M77C 4LUEA 3SWNB 4QVDA 3JCMe 1I5LA 4Q5WA 4HCCA 4X1VA 1U06A 5LJ3e 2EQUA 1GL5A 1N5ZA 4VUBA 5GAMf 1KSWA 3OYCA 4HCKA 3KXTA 3HRTA 1DJ7B 1RACB 2VXFA 5CO7A 4C8QF 1YJNQ 1AWWA 3E2UA 5GAOn 2O88A 1FYNA 4OMLA 4D8KA 4R56A 2DVJA 4LN2A 1K76A 1K9AA 3EGDB 4J83A 3RMQA 1NPRA 1H3ZA 1M2OA 4WF2A 1TH7A 2LX9A 2DL4A 1XNIA 1WJRA 3CMEQ 1OX9A 1WYXA 1BIAA 1SG5A 1VIFA 4OB3B 4C8QD 4ESRA 2RO0A 1H3HA 2XDPA 1YIJA 2EQJA 1W4SA 5FLXE 5GANh 1M2VB 2AK5A 4OMNA 2XMFA 2FVUA 3GBQA 1RAGB 3G4SA 5L23A 5LJ5d 5GANe 5ECAA 4DEYA 2GCXA 3FC3A 2PVOB 4JS5A 2P0KA 5CQYA 1TWBA 3EG1A 1YJNA 2GFAA 1FMWA 2LCSA 2XDDA 2L3QA 2PQWA 3LW5E 2JTMA 1RAIB 3OBYA 2RB6A 1T0HA 5GAN6 2QDYB 2X4WA 4C92E 2KI7A 3UT1A 2EVRA 2DEQA 2DO3A 1PSEA 2VVKA 3QYGB 4CC3A 1OULA 2KRSA 3NTIA 2HDAA 3RKWA 2HCKA 3CMEA 4IUQA 5C6SA 3J80E 2RNAA 1VQ5Q 4AFSC 3OYJA 3CMAT 1UJYA 1NE8A 3I5RA 4GLKA 2OTJQ 4Y91A 2DFUA 2QYZA 2R5AA 4E7IA 4OVAA 3JCMg 2ZPEB 1VQNT 2KQWA 3LH5A 2AZVA 3FIFA 4PLLA 3CPFA 5LJ3g 2SEMA 4E47A 2F2WA 2K7AA 4QKUA 2HAXA 4FT4A 2Y90A 3OW2P 2DL5A 2AZSA 2QGFB 4L6V5 3FJ5A 3CXCP 1KC8C 4LXCA 4E2FB 1Q81C 1WX6A 1QW1A 1YJWT 3HL8A 5HY6A 3M5AA 1M8VA 2EBPA 4C8QG 2BE9B 1TOVA 2VV5A 2RA2A 2AKKA 1T3SA 1HD3A 2LVMA 2MPXC 1VQMT 2FRYA 1KC8R 1IRXA 1Q81R 4AMCA 4L5GA 3TQ7P 3ME9A 2RH2A 1VQ5A 4M7AA 4M7DC 3NHNA 1M3AA 2K5IA 5GANg 2OTJA 2P4TA 2E6NA 2YWWA 4DOVA 4E7SA 1MGQA 1NJIU 3QXEB 3EG2A 2M51A 4XTUA 1V1CA 2J6FA 1UEBA 3J81E 4BE1A 2YRDA 2L8DA 3CCJT 1YIJT 3X25B 1YI2A 2KYBA 1TUCA 3H0IA 3HPWA 4RTUA 5GAMh 2CH4A 4PJLA 3UATA 3M4GA 3PE0A 2IVWA 1Y57A 2KRMA 1BB9A 1OI1A 2O4XB 2KK4A 2ZPBB 1B3QA 3X24B 1D0ZA 2DILA 3PMTA 4O5VA 2DYBA 3RIRA 4ZGEB 1OU9A 1YJ9A 2A3LA 1UE9A 2ESWA 1UGSB 4Z89A 4RTYA 1VQ8Q 3OS5A 1U8RA 1M1GA 2CZ7B 1RAHB 2PU9B 1VQ9Q 3SEMA 2QTVA 3V7CA 1WQWA 3VRZA 2DERA 2KROA 3OYLA 2VGMA 3RESA 2WSCE 3CMET 4DQ2A 4EMKC 1UUEA 3GF5A 1K73U 1GCQC 2WACA 4AFQC 3JB9J 1M1KU 4M75F 4M7AF 2HL3A 4LUDA 2GTJA 1SEMA 2CSQA 4OB1B 3QG1A 3M4YA 2BZYA 2NLUA 3CCUQ 3EFSA 3A1PA 1MMGA 5GMKh 1U5SA 1IZ6A 8ATCB 3PFSA 3BDUA 2QGGA 4O6JA 4M75D 1VQ6Q 4M7AD 2K3XA 4PL6A 1JJ2P 1B34B 5GMKe 3BY7A 5FWCA 3M0QA 4N0AA 3HTRA 3MP8A 3JB9D 2GQIA 1VQ9A 2LQ8A 2ZCFB 2DTIA 1GFCA 2OAUA 4M77A 4RTWA 3REAB 3H9NA 1PSFA 3G7ZA 1WXTA 1ABOA 5D7UA 4FM4B 3NMZC 1PM3A 1RABB 3OA6A 2VYTA 2M02A 2COWA 1VQ5T 2OTJT 4E7LA 4BE0A 3GIBA 2RHIA 2JTFA 4ANJA 2G6FX 2RJCA 4R0KA 3QBYA 1SKUB 1WHGA 2EJ9A 4RTVA 3CCLT 3OMGA 1WHKA 1OYXA 2C0IA 2V1RA 3G71Q 3I35A 3C0CA 4HA8A 2K3YA 4C0ZA 1C6VX 4FU6A 4LDWA 4YTLA 3CCUA 4OGCA 1IHWA 3H0HA 1PD0A 1JU5C 2PVGB 3UF4A 5LJ5j 1HXDA 4KULA 1RAEB 2C0OA 1VQPQ 1ZSZA 3CCSA 3LWIA 4F7UB 3LH0A 2RJFA 3VYHB 2CZ0B 2CUBA 3BW1A 3OYHA 1H641 3VKIA 4PNOA 1VQ4Q 2X3XD 1H8KA 2M9UA 1VQLQ 3G6EA 2KT8A 3THKA 5KYYA 3A8GB 4NOYA 3MJXA 2XDBA 3VV0A 1QVFP 4F17A 6AT1B 3I55Q 4JRPA 1KQ1A 4MMKA 4M75G 3RKYA 4M7AG 1VQOA 3JCMf 5CIUA 3QZ5B 1AWXA 3OSSC 1PNJA 1Q7YC 3LGLA 2J06A 4QQGA 1ZQ1A 1U1SA 3P8DA 1NG2A 4HKEA 3OYYA 1WNLA 2LP5A 2HEQA 2KR3A 4FYYB 5I11A 2L0AA 3VRYA 1UTIA 2QDLA 4M77B 2MOXA 2FEIA 2JMCA 1SHFA 3OYMA 4N4GA 2GNCA 3CD6A 4PFZA 3VS2A 2CP7A 2YLCA 4Z8AA 1Q7YR 3RERA 4M77D 2C0TA 1W2BS 2LJ1A 3LYIA 4A53A 2HMAA 1VIEA 2HQEA 1WDXA 2K6DA 4CC4B 1VQ8T 1WHJA 4XK8E 3HKSA 1Y0MA 2JMAA 1YNZA 1AZEA 2E3HA 1XQHA 3L2UA 1PRLC 4A63B 2DETA 1Y7XA 4C92A 5FRNA 2EFIA 3OYBA 1QKXA 2NUPB 4F04B 5GAOr 5HK3A 2K4YA 2RF0A 4Z88A 2FL7A 1X01A 4NL3A 2A0FB 1E6GA 3U23A 2LT1A 1K9MU 2AKLA 1X2KA 2ABLA 1I07A 3OYDA 1YHQA 3DKMA 3CC7Q 2K9GA 3EH1A 4F7UE 1G3YA 1VQ7T 5A2QE 3J7AF 1YCYA 2EQMA 4JRIA 1M5Q1 3CCQQ 4PJMA 2DMOA 1ZA2B 1SSHA 4F14A 4HVVA 2L2PA 4Y28E 4C5GA 3CCRA 1Y71A 1VQ6T 1AOJA 4OGEA 5CKHA 1KD1C 3SB2A 5KYWB 1N9RA 5LJ5e 2DXCA 9ATCB 1HK9A 2OAWA 4XTWA 1KQSP 2CZ1B 3EGDA 2YXYA 2DBKA 5CKFA 3EG3A 3M55A 4QT7A 3QYHB 3CBMA 2G3RA 4ME7A 1K8AC 3HHTB 1SSFA 5GMKm 1UJ0A 3ZEHA 2PZ1A 3VS6A 2RJDA 2J6KA 3SD4A 1OV3A 1RLQC 1KJWA 3CC7A 4GY5A 1M90R 3G71T 5KE2A 3CPWP 3A8OB 3PVQA 3OYEA 3ZL7C 4M78E 2QXFA 3CBOA 4N4IA 1WPYA 1B7TA 4Z02A 1K8AR 2J05A 2XK0A 5GAN8 2A28A 1VQPT 4UC4A 3C12A 5I21A 1IB8A 2DXBA 5GAOq 1JRIA 4C92D 2P0PA 3LWHA 3MEUA 1MV3A 2JUFA 3FEOA 2KY9A 3P8BB 1VQ4T 2DD5A 1YITQ 3OYNA 4A4EA 4M7DB 3ULRB 1VQLT 2VXEA 1M8MA 3CCEQ 3IQLA 4PFPA 3G4SQ 2FRWA 2VWFA 2EYYA 3OMCA 3PNWC 1WHHA 4A4HA 1CKAA 3NFCA 2A08A 4C5EA 3FDRA 2HL5C 3I55T 5IT9E 4BI8B 3V8LA 1C1AA 1PCXA 4B9WA 3L2RA 4M78C 2V8JA 2KVQG 4KGVB 4KRTA 3CCMQ 4BACA 5KYNA 1ACMB 1M27C 5LJ5g 4IUVA 1M1FA 2KYMA 4J9EA 4XTVA 2BZ8A 3R6OA 5FU7C 2CP6A 4DBFA 1LVKA 5IHIA 3H8ZA 4C0DC 3HSBA 1JBMA 1RADB 4JLGA 2KE9A 3L42A 4AG2C 5LL6S 3OY9A 1YITA 2ENMA 2HNIA 4IKFA 2CZ6B 2DZCA 4PFOA 4J5YA 3CCEA 3H0FA 3X26B 2NUTB 2YSQA 4XTZA 3R6NA 4ELYC 2EKOA 4EMKB 1YBYA 3CEYA 1SPKA 1QVGS 3QUIA 2VB6A 2ED0A 4PJOC 3L2WA 3H41A 2DM1A 5I2MA 2DL7A 2ROTA 2KGTA 3CCMA 5GAMj 1ZLMA 1Q86C 2DLPA 3QJYA 2QQRA 2KNBB 3JCMV 1OZ3A 3CC7T 1QVPA 1P92A 2VUBA 3OW2A 5DM7R 2A37A 1YN8A 2ZPIB 3EH2A 4KUIA 3CCQT 3X20B 1TXQA 3OS0A 3RR6A 1X43A 5GAN7 4MDXA 1V29B 1N6AA 2O4XA 2GF7A 2LTOA 3QDRB 3ASKA 1BBZA 3TSWA 1Q86R 4M7DE 3NGPA 1UG1A 5CR2A 3PTAA 2DTHA 1GRIA 4QW2A 3ZBDA 2BE7D 4OP0A 4J9DA 3C95A 3N5BB 1U1TA 3V7RA 1YI2Q 2XI9A 2L3PA 1W2BA 4HXJA 4X34A 3QZ9B 5GAOp 1YFNA 1G3WA 3L1AA 3A8LB 2RPNA 4KUDK 1ABQA 1RL2A 1UECA 2PUKB 1YJ9Q 1WFWA 3FRNA 4ZNXA 1N9SA 1TS9A 1Q82C 3HRUA 2DKGA 4J8OA 1Y07A 5FU6C 1WA7A 1HSQA 2EKHA 2RI5A 2BUDA 3S3OA 3GP8A 2JS0A 3ZFJA 3WVEB 1KHCA 4RG2A 1WHMA 4FYXB 5LJ3d 2DRMA 1N8RC 4EPCA 4PLIA 2J7IA 2RQWA 2IPOB 4RUGA 5GAN5 4FYWB 3BFMA 1B34A 3I5SA 3SDZA 1MHNA 2QEXA 1Q82R 4JJNK 1YITT 3TEEA 3EGUA 2F5TX 1UGPB 1G83A 2BTTA 3CCET 4J9CA 3G4ST 4B6MA 3HRSA 1NM7A 1FX7A 3KBGA 2YUNA 3QPHA 2JT4A 1PC0A 2JJ9A 1CSKA 2KBTA 2RQUA 2PTKA 2JNGA 2K2MA 3RNJA 1M9SA 1QCNA 2QQ9A 3OB9A 1CKBA 4RTXA 4BI4A 4JJDA 2MIOA 4HVWA 1YJNT 1QCFA 3TREA 2MMPA 4BI3A 2EGAA 2QQBA 3CCMT 3PT9A 5GANd 1QP2A 4C8QC 1IGUA 1EZZB 4DBRA 4RMOA 1UFFA 3QJ6A 4PKCC 4CC2A 4JUVA 1WIEA 2DPPB 4LDUA 3EHRA 1WJQA 3CCVA 5KCHA 4J7IA 4E7JA 4F7UA 4HT8A 4JDSA 3RUXA 1QCOA 2A36A 5D6XA 3L2VA 1RAFB 1M4ZA 1M90U 3JCMb 3MCAB 2BKDN 1E6HA 2XKOC 3JB9F 4ZGJB 3O5ZA 1QP3A 3JV3A 4QVZA 3A8HB 4II1A 2RD1A 4JLIA 2QASA 4JPBW 2YHTA 2KXDA 4XQ3A 3JRZA 2YLBA 2ED1A 2E10A 4E7ZA 4J9BA 3OBWA 2P84A 1G3TA 4XU2A 2QG9B 4B9XA 2RQTA 3DLMA 3CCSQ 2FPFA 5GAOl 3JCMX 1PKSA 3OYFA 2P4RA 3M58A 3DB4A 3VS1A 2E4HA 1IHVA 5LJ5f 3CQTA 2OX7A 2FG0A 3M56A 2E12A 4IURA 3JSCA 1FWZA 2E70A 3G6EQ 4X9DA 1OEBA 4IUPA 1PG5B 4M78A 5KCOA 4ZN1A 4JZ4A 3LLRA 5I22A 1BKBA 2D9TA 3RBBB 3VS7A 1D1CA 1ZSGA 1GBQA 4HCZA 1VQKA 1VQOQ 1MMNA 1NYGA 5KYXA 4QQ6A 1MMAA 4BB7A 1AD5A 4D8DA 2MWOA 3GPLA 1VA7A 4F7UF 2FZCB 1N27A 5KE3A 2D1XA 1YI2T 1Y96A 2WSFE 2LRQA 1UHCA 1KFZA 1R77A 2M1HA 1UDLA 5EG2A 2FZKB 2LDMA 5IN1A 3PIPA 3CD6Q 4FL6A 2NUPA 2COYA 4D6WA 2V26A 2XD0A 4LDVA 2O9SA 4J9IA 1ARKA 2XG8D 2YRCA 2JOYA 3F70A 2K5LA 1YJ9T 2PUOB 2Z0WA 2OTLA 2QA4A 3VUZA 2DXUA 4BY6C 1QVGA 4J7FA 1R8OB 2QI2A 1WGSA 4K11A 2O31A 2LNVA 2KDSA 5GAMd 3PGGA 3OS2A 4XU3A 3OW2S 3TCJA 2XICA 1ZUYA 2RM4A 2VC8A 3CXCS 1S72Q 3VYGA 3FB9A 4M77F 4JRQA 5CKDA 1FMVA 1QKWA 2RQVA 5KYWA 3M9QA 3JB9G 3C4SA 1Q95G 1SRMA 4E7HA 5I2SA 1V76A 4IIOA 3UA7A 1YHQQ 1OOTA 2CREA 2FO0A 2DXTA 1KK7A 4M75E 2HSPA 2XIDA 2DF6A 4M78B 4DEXA 1JXMA 2MYSA 4XU1A 2QAZA 3L2ZA 4OMQA 2COZA 3REBB 4M4ZA 4DBQA 3CCRQ 1NYFA 1QWEA 1OX8A 5KYXB 4M78D 2DE0X 1MMDA 4OB2B 3QSUA 5FU7B 1VYTA 1VQ9T 1SHGA 1Y96B 1R0BG 2HBPA 2JS2A 4C0DB 1D3BA 5GAN3 4JRKA 1AWOA 3M53A 3VS5A 1S72A 1MNDA 1OPKA 4WTOB 2GBQA
chains in the Genus database with same CATH topology
2RMOA 1BK2A 2FRYA 4KRTA 4F16A 1XOVA 1RI9A 1T0JA 1M27C 2YUQA 1MV0B 2CT3A 3M0TA 1UGVA 3VS4A 2KYMA 1M3AA 3NHNA 2BZ8A 4J9EA 5IHKA 2FPEA 5GJWB 5IHIA 2L3SA 2DL3A 2JW4A 3EG2A 2LMJA 2M51A 1V1CA 2J6FA 2KE9A 3I9QA 4AG2C 1WLPB 4J9HA 5IH2A 2ENMA 3PVLA 2KYBA 1TUCA 2SRCA 3H0FA 3H0IA 2O9VA 4RTUA 1T3LA 1JQQA 2DBMA 2YSQA 2CH4A 3M0RA 3UATA 3R6NA 2V1QA 3PE0A 1NLPC 1Y57A 2KRMA 1SPKA 4HVUA 4OMOA 1BB9A 5HCKA 1B3QA 2ED0A 1I1JA 1X6GA 2ROLA 2DILA 3H41A 2DYBA 2DM1A 2DL7A 2ROTA 2KGTA 2LQWA 2KRNA 1LCKA 1ZLMA 1UE9A 2ESWA 1ZX6A 2DLPA 1H92A 1A0NB 2OJ2A 4Z89A 4RTYA 2KNBB 5FWBA 1W1FA 1YWPA 5IHNA 4LNPA 3SEMA 3VRZA 2KROA 2LZ6B 2F2XA 2A37A 1YN8A 1YWOA 1X43A 5IXFA 1UUEA 3M0SA 1GCQA 1GCQC 1VYUA 1BBZA 3TSWA 4AFQC 3NGPA 1UG1A 4LUDA 2GTJA 1SEMA 2CSQA 2LJ3A 1GRIA 1X69A 1WXBA 2I0NA 2YUPA 1K0SA 4GLMA 5IXBA 2DX1A 3M0UA 4JZ3A 4J9DA 1J3TA 1Z9ZA 1I0CA 2L3PA 1RLPC 5GJVB 2BZYA 1M30A 1PWTA 4HXJA 2OI3A 1U5SA 4J9GA 2EGCA 1BU1A 5EC7A 4OMMA 5FWCA 3M0QA 4AFZC 2GQIA 2RPNA 1M3BA 3VS0A 1ABQA 2EYWA 1UECA 1X27A 1GFCA 1WFWA 2CSIA 4ZNXA 4RTWA 3REAB 2EYXA 1WA7A 1HSQA 1WXTA 2EKHA 1ABOA 3NMZC 2JS0A 3A98A 2CDTA 2LX7A 2DRMA 1GBRA 2RQRA 2G6FX 1EFNA 4R0KA 2J7IA 2RQWA 4RUGA 4RTVA 2DRKA 1JEGA 1K4US 1K0XA 2D0NA 3I5SA 2C0IA 2M0YA 2V1RA 3I35A 3C0CA 1QWFA 1B07A 2D8HA 2GTOA 1AWJA 4GBQA 1SRLA 2H8HA 2JTEA 1JO8A 2W0ZA 3EGUA 3EG0A 2BZXA 1G83A 2BTTA 2E5KA 4J9CA 3H0HA 1NM7A 1JU5C 2DJQA 2YUNA 2KXCA 3UF4A 2JT4A 1OPLA 1CSKA 2YUOA 2C0OA 2KBTA 1GFDA 2RQUA 2PTKA 2DL8A 2K2MA 4IIMA 1W6XA 3RNJA 1W70A 1CKBA 4RTXA 4AFUC 4JJDA 1AVZC 2CUBA 4J9FA 2MIOA 4HVWA 1JXOA 1QCFA 1WI7A 1HJDA 2PNIA 2EGAA 1AEYA 4Y92A 3NPFA 2X3XD 1H8KA 1E7OA 1TUDA 4RTTA 2KT8A 3THKA 1UFFA 2O2OA 4CC2A 2K3BA 2YT6A 1K1ZA 1YCSB 1WIEA 3KFVA 1Z9QA 4F17A 1ZUKA 2JM8A 3EHRA 2NWMA 4OMPA 1AWXA 1PNJA 2A36A 2J06A 2VKNA 2NUZA 3EHQA 1NG2A 5FW9A 1M3CA 2LP5A 4LE9A 1E6HA 2HEQA 2KR3A 5I11A 2L0AA 2RN8A 1X2QA 3VRYA 1G2BA 1UTIA 2QDLA 1FMKA 2MOXA 1RUWA 1NEBA 2B86A 3O5ZA 2FEIA 2JMCA 1SHFA 3JV3A 2GNCA 2D8JA 2EGEA 1PHTA 2X3WD 3VS2A 2LNHB 4JPBW 4Z8AA 4ORZA 1QLYA 2KXDA 2IIMA 1X6BA 3TVTA 2C0TA 1PRMC 2ED1A 2LJ1A 3M0PA 4J9BA 3TSZA 1ZUUA 2LJ0A 2RQTA 2FPFA 2DA9A 1PKSA 1ZBJA 2P4RA 1WDXA 1VYVA 2K6DA 1MUZA 3VS1A 4CC4B 3CQTA 1Y0MA 2JMAA 1YNZA 2FG0A 1AZEA 4CC7A 3UA6A 1PRLC 4A63B 4LUEA 4FSSA 4E6RA 1OEBA 4X1VA 1QKXA 1U06A 1GL5A 1N5ZA 1KSWA 4HCKA 4JZ4A 2RF0A 4Z88A 5I22A 1E6GA 3U23A 1AWWA 3RBBB 2AKLA 3VS7A 1ZSGA 4JJBA 1GBQA 1X2KA 2ABLA 1I07A 2O88A 1FYNA 4OMLA 4D8KA 2HBWA 2DVJA 4LN2A 1S1NA 1K76A 1NYGA 1K9AA 1WXUA 2K9GA 4D8DA 1AD5A 2EW3A 1VA7A 2K79A 2D1XA 2DL4A 1UHCA 1KFZA 1UDLA 2DMOA 4F14A 1SSHA 1WYXA 4EIKA 2JXBA 4HVVA 2F2VA 4ESRA 2L2PA 1H3HA 2CH4W 2LQNA 1AOJA 2AK5A 4OMNA 2XMFA 1IO6A 2O9SA 4J9IA 1ARKA 3GBQA 5L23A 1KIKA 2OAWA 5ECAA 3QWYA 4DEYA 2KT1A 1U3OA 4WCIA 2DBKA 3EG3A 1NEGA 4QT7A 1AZGB 2CUDA 1PKTA 4K11A 2O31A 3EG1A 1NLOC 1UJ0A 2LCSA 2L3QA 1TG0A 2EQIA 1ZUYA 2PZ1A 2YDLA 4JJCA 2MCNA 1T0HA 3VS6A 2J6KA 1QKWA 1OV3A 2RQVA 1RLQC 1KJWA 2EYZA 1YP5A 3PVQA 2EVRA 2VVKA 1SRMA 3ZL7C 4CC3A 2KRSA 2HDAA 4IIOA 2FPDA 2HCKA 3UA7A 2J05A 2DNUA 1OOTA 2CREA 2J6OA 2RNAA 4AFSC 2FO0A 2JM9A 1UJYA 3I5RA 4RTZA 2A28A 2HSPA 2DF6A 4DEXA 1JXMA 4OMQA 3LH5A 2AZVA 2EPDA 2SEMA 3VS3A 1MV3A 2F2WA 2ECZA 2K7AA 4M4ZA 3REBB 1NYFA 2W10A 3SHWA 1QWEA 2DL5A 2AZSA 2CT4A 2DE0X 3FJ5A 3ULRB 4AG1C 1M8MA 1VYTA 1WX6A 3IQLA 3QWXX 1SHGA 2FRWA 2VWFA 2EYYA 2JS2A 1CKAA 1UHFA 2EBPA 2KEAA 2A08A 1AWOA 3VS5A 1GCPA 2GGRA 2AKKA 1OPKA 1T3SA 1HD3A 2GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMO A;  1BK2 A;  2FRY A;  4KRT A;  4F16 A;  1XOV A;  1RI9 A;  1T0J A;  1M27 C;  2YUQ A;  1MV0 B;  2CT3 A;  3M0T A;  1UGV A;  3VS4 A;  2KYM A;  1M3A A;  3NHN A;  2BZ8 A;  4J9E A;  5IHK A;  2FPE A;  5GJW B;  5IHI A;  2L3S A;  2DL3 A;  2JW4 A;  3EG2 A;  2LMJ A;  2M51 A;  1V1C A;  2J6F A;  2KE9 A;  3I9Q A;  4AG2 C;  1WLP B;  4J9H A;  5IH2 A;  2ENM A;  3PVL A;  2KYB A;  1TUC A;  2SRC A;  3H0F A;  3H0I A;  2O9V A;  4RTU A;  1T3L A;  1JQQ A;  2DBM A;  2YSQ A;  2CH4 A;  3M0R A;  3UAT A;  3R6N A;  2V1Q A;  3PE0 A;  1NLP C;  1Y57 A;  2KRM A;  1SPK A;  4HVU A;  4OMO A;  1BB9 A;  5HCK A;  1B3Q A;  2ED0 A;  1I1J A;  1X6G A;  2ROL A;  2DIL A;  3H41 A;  2DYB A;  2DM1 A;  2DL7 A;  2ROT A;  2KGT A;  2LQW A;  2KRN A;  1LCK A;  1ZLM A;  1UE9 A;  2ESW A;  1ZX6 A;  2DLP A;  1H92 A;  1A0N B;  2OJ2 A;  4Z89 A;  4RTY A;  2KNB B;  5FWB A;  1W1F A;  1YWP A;  5IHN A;  4LNP A;  3SEM A;  3VRZ A;  2KRO A;  2LZ6 B;  2F2X A;  2A37 A;  1YN8 A;  1YWO A;  1X43 A;  5IXF A;  1UUE A;  3M0S A;  1GCQ A;  1GCQ C;  1VYU A;  1BBZ A;  3TSW A;  4AFQ C;  3NGP A;  1UG1 A;  4LUD A;  2GTJ A;  1SEM A;  2CSQ A;  2LJ3 A;  1GRI A;  1X69 A;  1WXB A;  2I0N A;  2YUP A;  1K0S A;  4GLM A;  5IXB A;  2DX1 A;  3M0U A;  4JZ3 A;  4J9D A;  1J3T A;  1Z9Z A;  1I0C A;  2L3P A;  1RLP C;  5GJV B;  2BZY A;  1M30 A;  1PWT A;  4HXJ A;  2OI3 A;  1U5S A;  4J9G A;  2EGC A;  1BU1 A;  5EC7 A;  4OMM A;  5FWC A;  3M0Q A;  4AFZ C;  2GQI A;  2RPN A;  1M3B A;  3VS0 A;  1ABQ A;  2EYW A;  1UEC A;  1X27 A;  1GFC A;  1WFW A;  2CSI A;  4ZNX A;  4RTW A;  3REA B;  2EYX A;  1WA7 A;  1HSQ A;  1WXT A;  2EKH A;  1ABO A;  3NMZ C;  2JS0 A;  3A98 A;  2CDT A;  2LX7 A;  2DRM A;  1GBR A;  2RQR A;  2G6F X;  1EFN A;  4R0K A;  2J7I A;  2RQW A;  4RUG A;  4RTV A;  2DRK A;  1JEG A;  1K4U S;  1K0X A;  2D0N A;  3I5S A;  2C0I A;  2M0Y A;  2V1R A;  3I35 A;  3C0C A;  1QWF A;  1B07 A;  2D8H A;  2GTO A;  1AWJ A;  4GBQ A;  1SRL A;  2H8H A;  2JTE A;  1JO8 A;  2W0Z A;  3EGU A;  3EG0 A;  2BZX A;  1G83 A;  2BTT A;  2E5K A;  4J9C A;  3H0H A;  1NM7 A;  1JU5 C;  2DJQ A;  2YUN A;  2KXC A;  3UF4 A;  2JT4 A;  1OPL A;  1CSK A;  2YUO A;  2C0O A;  2KBT A;  1GFD A;  2RQU A;  2PTK A;  2DL8 A;  2K2M A;  4IIM A;  1W6X A;  3RNJ A;  1W70 A;  1CKB A;  4RTX A;  4AFU C;  4JJD A;  1AVZ C;  2CUB A;  4J9F A;  2MIO A;  4HVW A;  1JXO A;  1QCF A;  1WI7 A;  1HJD A;  2PNI A;  2EGA A;  1AEY A;  4Y92 A;  3NPF A;  2X3X D;  1H8K A;  1E7O A;  1TUD A;  4RTT A;  2KT8 A;  3THK A;  1UFF A;  2O2O A;  4CC2 A;  2K3B A;  2YT6 A;  1K1Z A;  1YCS B;  1WIE A;  3KFV A;  1Z9Q A;  4F17 A;  1ZUK A;  2JM8 A;  3EHR A;  2NWM A;  4OMP A;  1AWX A;  1PNJ A;  2A36 A;  2J06 A;  2VKN A;  2NUZ A;  3EHQ A;  1NG2 A;  5FW9 A;  1M3C A;  2LP5 A;  4LE9 A;  1E6H A;  2HEQ A;  2KR3 A;  5I11 A;  2L0A A;  2RN8 A;  1X2Q A;  3VRY A;  1G2B A;  1UTI A;  2QDL A;  1FMK A;  2MOX A;  1RUW A;  1NEB A;  2B86 A;  3O5Z A;  2FEI A;  2JMC A;  1SHF A;  3JV3 A;  2GNC A;  2D8J A;  2EGE A;  1PHT A;  2X3W D;  3VS2 A;  2LNH B;  4JPB W;  4Z8A A;  4ORZ A;  1QLY A;  2KXD A;  2IIM A;  1X6B A;  3TVT A;  2C0T A;  1PRM C;  2ED1 A;  2LJ1 A;  3M0P A;  4J9B A;  3TSZ A;  1ZUU A;  2LJ0 A;  2RQT A;  2FPF A;  2DA9 A;  1PKS A;  1ZBJ A;  2P4R A;  1WDX A;  1VYV A;  2K6D A;  1MUZ A;  3VS1 A;  4CC4 B;  3CQT A;  1Y0M A;  2JMA A;  1YNZ A;  2FG0 A;  1AZE A;  4CC7 A;  3UA6 A;  1PRL C;  4A63 B;  4LUE A;  4FSS A;  4E6R A;  1OEB A;  4X1V A;  1QKX A;  1U06 A;  1GL5 A;  1N5Z A;  1KSW A;  4HCK A;  4JZ4 A;  2RF0 A;  4Z88 A;  5I22 A;  1E6G A;  3U23 A;  1AWW A;  3RBB B;  2AKL A;  3VS7 A;  1ZSG A;  4JJB A;  1GBQ A;  1X2K A;  2ABL A;  1I07 A;  2O88 A;  1FYN A;  4OML A;  4D8K A;  2HBW A;  2DVJ A;  4LN2 A;  1S1N A;  1K76 A;  1NYG A;  1K9A A;  1WXU A;  2K9G A;  4D8D A;  1AD5 A;  2EW3 A;  1VA7 A;  2K79 A;  2D1X A;  2DL4 A;  1UHC A;  1KFZ A;  1UDL A;  2DMO A;  4F14 A;  1SSH A;  1WYX A;  4EIK A;  2JXB A;  4HVV A;  2F2V A;  4ESR A;  2L2P A;  1H3H A;  2CH4 W;  2LQN A;  1AOJ A;  2AK5 A;  4OMN A;  2XMF A;  1IO6 A;  2O9S A;  4J9I A;  1ARK A;  3GBQ A;  5L23 A;  1KIK A;  2OAW A;  5ECA A;  3QWY A;  4DEY A;  2KT1 A;  1U3O A;  4WCI A;  2DBK A;  3EG3 A;  1NEG A;  4QT7 A;  1AZG B;  2CUD A;  1PKT A;  4K11 A;  2O31 A;  3EG1 A;  1NLO C;  1UJ0 A;  2LCS A;  2L3Q A;  1TG0 A;  2EQI A;  1ZUY A;  2PZ1 A;  2YDL A;  4JJC A;  2MCN A;  1T0H A;  3VS6 A;  2J6K A;  1QKW A;  1OV3 A;  2RQV A;  1RLQ C;  1KJW A;  2EYZ A;  1YP5 A;  3PVQ A;  2EVR A;  2VVK A;  1SRM A;  3ZL7 C;  4CC3 A;  2KRS A;  2HDA A;  4IIO A;  2FPD A;  2HCK A;  3UA7 A;  2J05 A;  2DNU A;  1OOT A;  2CRE A;  2J6O A;  2RNA A;  4AFS C;  2FO0 A;  2JM9 A;  1UJY A;  3I5R A;  4RTZ A;  2A28 A;  2HSP A;  2DF6 A;  4DEX A;  1JXM A;  4OMQ A;  3LH5 A;  2AZV A;  2EPD A;  2SEM A;  3VS3 A;  1MV3 A;  2F2W A;  2ECZ A;  2K7A A;  4M4Z A;  3REB B;  1NYF A;  2W10 A;  3SHW A;  1QWE A;  2DL5 A;  2AZS A;  2CT4 A;  2DE0 X;  3FJ5 A;  3ULR B;  4AG1 C;  1M8M A;  1VYT A;  1WX6 A;  3IQL A;  3QWX X;  1SHG A;  2FRW A;  2VWF A;  2EYY A;  2JS2 A;  1CKA A;  1UHF A;  2EBP A;  2KEA A;  2A08 A;  1AWO A;  3VS5 A;  1GCP A;  2GGR A;  2AKK A;  1OPK A;  1T3S A;  1HD3 A;  2GBQ A; 
#chains in the Genus database with same CATH topology
 2RMO A;  2ATC B;  5HK0 A;  5LJ3 j;  5L8R E;  1KC8 U;  1RI9 A;  4F7U G;  1Q81 U;  2MAM A;  3FLG A;  2ZPG B;  4M7D A;  1MV0 B;  4DBH A;  4M75 C;  3M0T A;  4M7A C;  1UGV A;  3VS4 A;  3S3N A;  2FB7 A;  5GJW B;  1QMC A;  2MWP A;  3PIO A;  3CCU T;  1EIF A;  4PJO B;  4C0G A;  1GXI E;  2D6F A;  2L3S A;  2DL3 A;  4C5I A;  2JW4 A;  3C94 A;  4XU0 A;  5LJ5 h;  1ZHI A;  3QII A;  3CCS T;  2E6Z A;  5IH2 A;  3MPU B;  3RKX A;  3JB9 H;  4DOW A;  2SRC A;  2O9V A;  2EIF A;  2RK1 A;  4HT9 A;  1JQQ A;  2DBM A;  4IUU A;  3M0R A;  3MEW A;  2X4Y A;  1NLP C;  2B8A A;  1I4K 1;  5GAN j;  4HVU A;  4OMO A;  3G6E T;  5CVI A;  1D1B A;  1KD1 R;  4M77 G;  4E7K A;  3EFR A;  1UGR B;  1AHJ B;  4PJJ A;  4OMF B;  4BD3 A;  1K73 C;  2LQW A;  2DEU A;  2KRN A;  4ELZ C;  1M1K C;  1TUG B;  1ZX6 A;  4R55 A;  1H92 A;  1VQO T;  1A0N B;  4C0F A;  2E41 A;  4C92 F;  5GAN 2;  5FWB A;  5GMK i;  2DYI A;  1G8X A;  4LNP A;  5AYF A;  5AT1 B;  1JJ2 S;  2R57 A;  2NUT A;  4IUT A;  2F2X A;  1D3B B;  4NS5 A;  5IXF A;  4JS4 A;  4EMK A;  2PVD B;  3V8J A;  3M0S A;  1VUB A;  2ZAE A;  3CD6 T;  1GCQ A;  1VQM Q;  1VYU A;  4ZN3 A;  2LCC A;  3OYK A;  1O9S A;  1QQJ A;  2V8I A;  4M7D F;  3E1S A;  3EGX B;  2LJ3 A;  3JCM c;  3JCM J;  1I8F A;  1BCO A;  2I0N A;  2YUP A;  3V7S A;  1WJS A;  5FU6 B;  3CMA A;  4A54 A;  5IXB A;  3M0U A;  1WZO A;  2AHJ B;  4JZ3 A;  1J3T A;  1I0C A;  5GJV B;  4RCC A;  7AT1 B;  2E3I A;  2BIV A;  4LD6 A;  2OI3 A;  1VQN A;  2EGC A;  1BU1 A;  4M7D D;  3CCJ Q;  4XTY A;  4OMM A;  1S72 T;  3RMS A;  4N0A C;  2RK2 A;  2Y4Y A;  4TVR A;  1AT1 B;  4PJO E;  4ZTF A;  4KT0 E;  2CSI A;  2EYX A;  4A4F A;  1YHQ T;  1G5V A;  2QTX A;  3DB3 A;  1VQM A;  2C06 A;  1TSF A;  3EFO B;  1LJO A;  4FIB A;  2EWN A;  1GBR A;  5DY9 A;  2DTO A;  3TU4 K;  4KH1 B;  1K4U S;  3AT1 B;  1K0X A;  1XTD A;  2M0Y A;  3CCR T;  1QWF A;  1B07 A;  2D8H A;  4EMH A;  4QQD A;  1AWJ A;  1D0X A;  1SRL A;  3M57 A;  4C8Q B;  1QVF S;  3EG9 B;  1JO8 A;  3EG0 A;  4C5H A;  2E5K A;  4XAX B;  2DJQ A;  2HQH A;  2KXC A;  1JB0 E;  1GFD A;  3CCJ A;  1ZSZ C;  2HD0 A;  4OF1 A;  1AVZ C;  4C92 G;  1WI7 A;  3GOX A;  2PNI A;  2HKQ B;  3G1J A;  3MEV A;  1EX4 A;  3NPF A;  4RTT A;  4PK4 A;  4MZT A;  2O2O A;  2K3B A;  2RJE A;  3CC4 Q;  1LOJ A;  1YCS B;  4BDZ A;  1ZUK A;  2JM8 A;  4LDY A;  3CXC A;  4M7D G;  1KG1 A;  1BIB A;  4P5N A;  2VKN A;  2NUZ A;  3JB9 I;  3EHQ A;  1M3C A;  4BDY A;  3OYI A;  2CP0 A;  1X2Q A;  1G2B A;  2B86 A;  1NEB A;  2X9H A;  2QEX Q;  2WSE E;  1LPL A;  2LNH B;  4DA4 A;  2A7Y A;  3NTH A;  1QLY A;  2HZY A;  1X6B A;  1Q7Y U;  3OSV A;  1PRM C;  3CCL Q;  5FRM A;  5KYU A;  3TSZ A;  1ZUU A;  4CI0 C;  1ZBX A;  1K9M C;  5J39 A;  2JZ2 A;  3KUF A;  4FW1 A;  5CCA A;  5GMK j;  3CC4 A;  1NZ9 A;  3UA6 A;  4A4G A;  1D1A A;  4C92 C;  2EQK A;  3HFN A;  4FSS A;  3A5Z B;  4E6R A;  3JCM d;  4C8Q E;  2CYZ B;  1KQS S;  5DLQ E;  1MNE A;  1IXD A;  1K9M R;  3HP9 A;  1XJW B;  1I81 A;  4JJB A;  3CCV Q;  3OYA A;  2K5F A;  2R5M A;  4BE2 A;  4ATO A;  2HBW A;  2Y4X A;  4EDU A;  2H3E B;  1W2B P;  1S1N A;  2CP5 A;  2DJZ A;  1WXU A;  4BY6 B;  4M75 A;  2EW3 A;  4RKU E;  2E5Q A;  2K79 A;  5DLO A;  2DZ9 A;  2FYK A;  3SWN C;  3CCL A;  4EIK A;  2D0Q B;  2JXB A;  1UB4 A;  2F2V A;  3S6W A;  1O75 A;  4FCY A;  3CPW S;  3GNG A;  1N8R R;  2CH4 W;  2LQN A;  4MML A;  2ZPH B;  2FHD A;  1OU8 A;  5D6W A;  4AT1 B;  1IO6 A;  4EMG A;  1KIK A;  3QWY A;  2KT1 A;  1U3O A;  4WCI A;  1OZ2 A;  2IG0 A;  1RAA B;  1NEG A;  3BDL A;  1AZG B;  2CUD A;  2JVV A;  1PKT A;  5GAM e;  3HFO A;  1NLO C;  2K2V A;  2KMT A;  1KD1 U;  5J3B A;  1OQK A;  1TG0 A;  2EQI A;  3OS1 A;  5KYU B;  2YDL A;  2RHX A;  3NTK A;  4JJC A;  2MCN A;  3VUB A;  1KQ2 A;  1X6O A;  2EYZ A;  1YP5 A;  4RCB A;  2M16 A;  1JJ2 A;  2X4X A;  3OQ5 A;  3DLL A;  1VQK Q;  2EJG A;  2L3R A;  3UDC A;  3JAM E;  2FPD A;  2DNU A;  1K8A U;  1NPP A;  2J6O A;  4A4K A;  2CS7 A;  2L89 A;  2JM9 A;  2I2L A;  2F69 A;  4RTZ A;  5C0M A;  2CP2 A;  3QO3 A;  3GNF B;  2EPD A;  3E9G A;  3VS3 A;  1BI3 A;  2E64 A;  2ECZ A;  2W10 A;  3MHX A;  3SHW A;  2X35 A;  2JN0 A;  2QK0 A;  2CT4 A;  4RG8 A;  1VQ7 Q;  4M75 B;  2CGH A;  4M7A B;  4BUG A;  4AG1 C;  3QDF A;  3QWX X;  3I56 Q;  4FSX A;  2RI2 A;  2DK3 A;  2DAQ A;  1BI1 A;  3CC4 T;  1UHF A;  3V8K A;  1IGQ A;  2OTL Q;  2KEA A;  3MET A;  2QA4 Q;  1GCP A;  4FT2 A;  2GGR A;  3L2Q A;  1UGQ B;  1PD1 A;  1VQ8 A;  1BK2 A;  4F16 A;  1XOV A;  1T0J A;  2YUQ A;  2CT3 A;  1SF9 A;  2QEX T;  5IHK A;  4QVC A;  2FPE A;  5M9O A;  4LDX A;  2RHY A;  5CK9 A;  1BI2 A;  2LMJ A;  3I9Q A;  4NL2 A;  5GAM g;  2ZPF B;  3CC2 Q;  2ZGW A;  1WLP B;  4J9H A;  1QVF A;  1VQ7 A;  3PVL A;  3OYG A;  4MZM A;  5A0L A;  3I56 A;  2DIG A;  4PJN A;  1T3L A;  3MP1 A;  2CP3 A;  3INZ A;  2V1Q A;  1LNX A;  5FRO A;  1VQ6 A;  5D6Y A;  5HCK A;  3FJP A;  3AHU A;  4PJO A;  2P0Q A;  1I1J A;  1X6G A;  2NYS A;  2ROL A;  2K57 A;  3S3M A;  1LCK A;  5GAN 4;  3CCV T;  1RI0 A;  2OJ2 A;  3QHS A;  3O8V A;  3WVD B;  2XHC A;  3MKD A;  1W1F A;  5HKC A;  1YWP A;  5IHN A;  4N4H A;  3H6Z A;  2KAF A;  4M78 F;  4L59 A;  3X28 B;  2LZ6 B;  2AT1 B;  2HKN A;  3ER0 A;  5A0D A;  1YWO A;  5GAO m;  2X51 A;  5CKE A;  3Q1J A;  3CC2 A;  3URG A;  3G71 A;  2DD4 A;  5LJ3 f;  1BYM A;  2GQV A;  2M0O A;  4M7A E;  1Q86 U;  5GMK l;  2VGN A;  1QVG P;  2DIQ A;  4LD9 K;  3JCM Q;  1WXB A;  1X69 A;  1IRE B;  1VOM A;  1K0S A;  4GLM A;  3E19 A;  2DX1 A;  1BI0 A;  1VQP A;  2O01 E;  5J26 A;  1Z9Z A;  1G3S A;  1RLP C;  1M30 A;  3M59 A;  1X75 C;  1ZA1 B;  2CKK A;  2FZG B;  1PWT A;  1R0C B;  1D09 B;  3GLX A;  4J9G A;  4CRI A;  2LC4 A;  2EJF A;  4ZTJ A;  2RHU A;  4KGZ B;  2RI3 A;  1VQ4 A;  5EC7 A;  1HYO A;  4J6X A;  2VAS A;  1NJI C;  2QQS A;  1VQL A;  4AFZ C;  1C0M A;  1M3B A;  4V2S A;  3VS0 A;  2EYW A;  2E65 A;  2R58 A;  3EGX A;  1X27 A;  2GFU A;  5GAN f;  4PJO F;  3D7S B;  3T9N A;  3I55 A;  1VQK T;  1BCM A;  1ZSZ B;  1KQS A;  2XU8 A;  3SFM A;  3A98 A;  2CDT A;  4J6Y A;  1NJI R;  2LX7 A;  2RQR A;  1EFN A;  2YRV A;  4MZP A;  2DRK A;  1JEG A;  2D0N A;  4FW2 A;  2ZZD A;  3UPU A;  3JCM W;  4FYV B;  2GTO A;  2HQX A;  1Q82 U;  4GBQ A;  2H8H A;  4KGX B;  2JTE A;  4PJO D;  2W0Z A;  5KYY B;  4KBM B;  5KH6 A;  3M54 A;  5A0G A;  3MO8 A;  2BZX A;  2LQK A;  3I56 T;  3SWN A;  1TTH B;  1OPL A;  3CMA Q;  3CPW A;  2YUO A;  3RDV A;  3MEA A;  1N8R U;  2OTL T;  2QA4 T;  2DL8 A;  4IIM A;  1W6X A;  3EFO A;  1W70 A;  4X9C A;  4AFU C;  1VQN Q;  4J9F A;  2EYQ A;  2HSE B;  1JXO A;  1FXX A;  3WXM B;  1HJD A;  1AEY A;  3A8M B;  4Y92 A;  5CQX A;  1M90 C;  1TUD A;  1E7O A;  2DVE A;  2MI6 A;  4M78 G;  4C8Q A;  1WQ7 A;  3EG9 A;  4MDW A;  3MP6 A;  5CAI A;  3JCM P;  2H3J A;  2QQA A;  8AT1 B;  1YJW Q;  2E1H A;  2YT6 A;  1K1Z A;  3KFV A;  1Z9Q A;  1KHI A;  2NWM A;  4OMP A;  4M77 E;  1TU0 B;  3QKJ A;  4HCB A;  5CKB A;  1D0Y A;  3CBP A;  1K73 R;  1M2V A;  3CC2 T;  1M1K R;  1NBE B;  4XTX A;  1WHL A;  4ZGD B;  2X4J A;  5FW9 A;  2MK5 A;  4LE9 A;  2F5K A;  4J6W A;  3LGF A;  3VU3 C;  3BE3 A;  3CCQ A;  2RN8 A;  1FMK A;  1RUW A;  3PMI A;  3EAE A;  4C92 B;  2V8K A;  3UWN A;  2D8J A;  2EGE A;  2LT4 A;  1PHT A;  2X3W D;  4ORZ A;  5IAY A;  3E9F A;  2IIM A;  3TVT A;  2LCL A;  3M0P A;  3P8H A;  2AIR B;  2LJ0 A;  3VJP A;  1YIJ Q;  2KSS A;  2DA9 A;  1I5O B;  1ZBJ A;  1VYV A;  1F1B B;  4PJO G;  1MUZ A;  2L5Q A;  2EAY A;  2RHZ A;  1YJW A;  3JCM h;  4KH0 B;  3LX7 A;  2F1L A;  5LJ3 h;  4CC7 A;  2MF2 A;  4OB0 B;  4M77 C;  4LUE A;  3SWN B;  4QVD A;  3JCM e;  1I5L A;  4Q5W A;  4HCC A;  4X1V A;  1U06 A;  5LJ3 e;  2EQU A;  1GL5 A;  1N5Z A;  4VUB A;  5GAM f;  1KSW A;  3OYC A;  4HCK A;  3KXT A;  3HRT A;  1DJ7 B;  1RAC B;  2VXF A;  5CO7 A;  4C8Q F;  1YJN Q;  1AWW A;  3E2U A;  5GAO n;  2O88 A;  1FYN A;  4OML A;  4D8K A;  4R56 A;  2DVJ A;  4LN2 A;  1K76 A;  1K9A A;  3EGD B;  4J83 A;  3RMQ A;  1NPR A;  1H3Z A;  1M2O A;  4WF2 A;  1TH7 A;  2LX9 A;  2DL4 A;  1XNI A;  1WJR A;  3CME Q;  1OX9 A;  1WYX A;  1BIA A;  1SG5 A;  1VIF A;  4OB3 B;  4C8Q D;  4ESR A;  2RO0 A;  1H3H A;  2XDP A;  1YIJ A;  2EQJ A;  1W4S A;  5FLX E;  5GAN h;  1M2V B;  2AK5 A;  4OMN A;  2XMF A;  2FVU A;  3GBQ A;  1RAG B;  3G4S A;  5L23 A;  5LJ5 d;  5GAN e;  5ECA A;  4DEY A;  2GCX A;  3FC3 A;  2PVO B;  4JS5 A;  2P0K A;  5CQY A;  1TWB A;  3EG1 A;  1YJN A;  2GFA A;  1FMW A;  2LCS A;  2XDD A;  2L3Q A;  2PQW A;  3LW5 E;  2JTM A;  1RAI B;  3OBY A;  2RB6 A;  1T0H A;  5GAN 6;  2QDY B;  2X4W A;  4C92 E;  2KI7 A;  3UT1 A;  2EVR A;  2DEQ A;  2DO3 A;  1PSE A;  2VVK A;  3QYG B;  4CC3 A;  1OUL A;  2KRS A;  3NTI A;  2HDA A;  3RKW A;  2HCK A;  3CME A;  4IUQ A;  5C6S A;  3J80 E;  2RNA A;  1VQ5 Q;  4AFS C;  3OYJ A;  3CMA T;  1UJY A;  1NE8 A;  3I5R A;  4GLK A;  2OTJ Q;  4Y91 A;  2DFU A;  2QYZ A;  2R5A A;  4E7I A;  4OVA A;  3JCM g;  2ZPE B;  1VQN T;  2KQW A;  3LH5 A;  2AZV A;  3FIF A;  4PLL A;  3CPF A;  5LJ3 g;  2SEM A;  4E47 A;  2F2W A;  2K7A A;  4QKU A;  2HAX A;  4FT4 A;  2Y90 A;  3OW2 P;  2DL5 A;  2AZS A;  2QGF B;  4L6V 5;  3FJ5 A;  3CXC P;  1KC8 C;  4LXC A;  4E2F B;  1Q81 C;  1WX6 A;  1QW1 A;  1YJW T;  3HL8 A;  5HY6 A;  3M5A A;  1M8V A;  2EBP A;  4C8Q G;  2BE9 B;  1TOV A;  2VV5 A;  2RA2 A;  2AKK A;  1T3S A;  1HD3 A;  2LVM A;  2MPX C;  1VQM T;  2FRY A;  1KC8 R;  1IRX A;  1Q81 R;  4AMC A;  4L5G A;  3TQ7 P;  3ME9 A;  2RH2 A;  1VQ5 A;  4M7A A;  4M7D C;  3NHN A;  1M3A A;  2K5I A;  5GAN g;  2OTJ A;  2P4T A;  2E6N A;  2YWW A;  4DOV A;  4E7S A;  1MGQ A;  1NJI U;  3QXE B;  3EG2 A;  2M51 A;  4XTU A;  1V1C A;  2J6F A;  1UEB A;  3J81 E;  4BE1 A;  2YRD A;  2L8D A;  3CCJ T;  1YIJ T;  3X25 B;  1YI2 A;  2KYB A;  1TUC A;  3H0I A;  3HPW A;  4RTU A;  5GAM h;  2CH4 A;  4PJL A;  3UAT A;  3M4G A;  3PE0 A;  2IVW A;  1Y57 A;  2KRM A;  1BB9 A;  1OI1 A;  2O4X B;  2KK4 A;  2ZPB B;  1B3Q A;  3X24 B;  1D0Z A;  2DIL A;  3PMT A;  4O5V A;  2DYB A;  3RIR A;  4ZGE B;  1OU9 A;  1YJ9 A;  2A3L A;  1UE9 A;  2ESW A;  1UGS B;  4Z89 A;  4RTY A;  1VQ8 Q;  3OS5 A;  1U8R A;  1M1G A;  2CZ7 B;  1RAH B;  2PU9 B;  1VQ9 Q;  3SEM A;  2QTV A;  3V7C A;  1WQW A;  3VRZ A;  2DER A;  2KRO A;  3OYL A;  2VGM A;  3RES A;  2WSC E;  3CME T;  4DQ2 A;  4EMK C;  1UUE A;  3GF5 A;  1K73 U;  1GCQ C;  2WAC A;  4AFQ C;  3JB9 J;  1M1K U;  4M75 F;  4M7A F;  2HL3 A;  4LUD A;  2GTJ A;  1SEM A;  2CSQ A;  4OB1 B;  3QG1 A;  3M4Y A;  2BZY A;  2NLU A;  3CCU Q;  3EFS A;  3A1P A;  1MMG A;  5GMK h;  1U5S A;  1IZ6 A;  8ATC B;  3PFS A;  3BDU A;  2QGG A;  4O6J A;  4M75 D;  1VQ6 Q;  4M7A D;  2K3X A;  4PL6 A;  1JJ2 P;  1B34 B;  5GMK e;  3BY7 A;  5FWC A;  3M0Q A;  4N0A A;  3HTR A;  3MP8 A;  3JB9 D;  2GQI A;  1VQ9 A;  2LQ8 A;  2ZCF B;  2DTI A;  1GFC A;  2OAU A;  4M77 A;  4RTW A;  3REA B;  3H9N A;  1PSF A;  3G7Z A;  1WXT A;  1ABO A;  5D7U A;  4FM4 B;  3NMZ C;  1PM3 A;  1RAB B;  3OA6 A;  2VYT A;  2M02 A;  2COW A;  1VQ5 T;  2OTJ T;  4E7L A;  4BE0 A;  3GIB A;  2RHI A;  2JTF A;  4ANJ A;  2G6F X;  2RJC A;  4R0K A;  3QBY A;  1SKU B;  1WHG A;  2EJ9 A;  4RTV A;  3CCL T;  3OMG A;  1WHK A;  1OYX A;  2C0I A;  2V1R A;  3G71 Q;  3I35 A;  3C0C A;  4HA8 A;  2K3Y A;  4C0Z A;  1C6V X;  4FU6 A;  4LDW A;  4YTL A;  3CCU A;  4OGC A;  1IHW A;  3H0H A;  1PD0 A;  1JU5 C;  2PVG B;  3UF4 A;  5LJ5 j;  1HXD A;  4KUL A;  1RAE B;  2C0O A;  1VQP Q;  1ZSZ A;  3CCS A;  3LWI A;  4F7U B;  3LH0 A;  2RJF A;  3VYH B;  2CZ0 B;  2CUB A;  3BW1 A;  3OYH A;  1H64 1;  3VKI A;  4PNO A;  1VQ4 Q;  2X3X D;  1H8K A;  2M9U A;  1VQL Q;  3G6E A;  2KT8 A;  3THK A;  5KYY A;  3A8G B;  4NOY A;  3MJX A;  2XDB A;  3VV0 A;  1QVF P;  4F17 A;  6AT1 B;  3I55 Q;  4JRP A;  1KQ1 A;  4MMK A;  4M75 G;  3RKY A;  4M7A G;  1VQO A;  3JCM f;  5CIU A;  3QZ5 B;  1AWX A;  3OSS C;  1PNJ A;  1Q7Y C;  3LGL A;  2J06 A;  4QQG A;  1ZQ1 A;  1U1S A;  3P8D A;  1NG2 A;  4HKE A;  3OYY A;  1WNL A;  2LP5 A;  2HEQ A;  2KR3 A;  4FYY B;  5I11 A;  2L0A A;  3VRY A;  1UTI A;  2QDL A;  4M77 B;  2MOX A;  2FEI A;  2JMC A;  1SHF A;  3OYM A;  4N4G A;  2GNC A;  3CD6 A;  4PFZ A;  3VS2 A;  2CP7 A;  2YLC A;  4Z8A A;  1Q7Y R;  3RER A;  4M77 D;  2C0T A;  1W2B S;  2LJ1 A;  3LYI A;  4A53 A;  2HMA A;  1VIE A;  2HQE A;  1WDX A;  2K6D A;  4CC4 B;  1VQ8 T;  1WHJ A;  4XK8 E;  3HKS A;  1Y0M A;  2JMA A;  1YNZ A;  1AZE A;  2E3H A;  1XQH A;  3L2U A;  1PRL C;  4A63 B;  2DET A;  1Y7X A;  4C92 A;  5FRN A;  2EFI A;  3OYB A;  1QKX A;  2NUP B;  4F04 B;  5GAO r;  5HK3 A;  2K4Y A;  2RF0 A;  4Z88 A;  2FL7 A;  1X01 A;  4NL3 A;  2A0F B;  1E6G A;  3U23 A;  2LT1 A;  1K9M U;  2AKL A;  1X2K A;  2ABL A;  1I07 A;  3OYD A;  1YHQ A;  3DKM A;  3CC7 Q;  2K9G A;  3EH1 A;  4F7U E;  1G3Y A;  1VQ7 T;  5A2Q E;  3J7A F;  1YCY A;  2EQM A;  4JRI A;  1M5Q 1;  3CCQ Q;  4PJM A;  2DMO A;  1ZA2 B;  1SSH A;  4F14 A;  4HVV A;  2L2P A;  4Y28 E;  4C5G A;  3CCR A;  1Y71 A;  1VQ6 T;  1AOJ A;  4OGE A;  5CKH A;  1KD1 C;  3SB2 A;  5KYW B;  1N9R A;  5LJ5 e;  2DXC A;  9ATC B;  1HK9 A;  2OAW A;  4XTW A;  1KQS P;  2CZ1 B;  3EGD A;  2YXY A;  2DBK A;  5CKF A;  3EG3 A;  3M55 A;  4QT7 A;  3QYH B;  3CBM A;  2G3R A;  4ME7 A;  1K8A C;  3HHT B;  1SSF A;  5GMK m;  1UJ0 A;  3ZEH A;  2PZ1 A;  3VS6 A;  2RJD A;  2J6K A;  3SD4 A;  1OV3 A;  1RLQ C;  1KJW A;  3CC7 A;  4GY5 A;  1M90 R;  3G71 T;  5KE2 A;  3CPW P;  3A8O B;  3PVQ A;  3OYE A;  3ZL7 C;  4M78 E;  2QXF A;  3CBO A;  4N4I A;  1WPY A;  1B7T A;  4Z02 A;  1K8A R;  2J05 A;  2XK0 A;  5GAN 8;  2A28 A;  1VQP T;  4UC4 A;  3C12 A;  5I21 A;  1IB8 A;  2DXB A;  5GAO q;  1JRI A;  4C92 D;  2P0P A;  3LWH A;  3MEU A;  1MV3 A;  2JUF A;  3FEO A;  2KY9 A;  3P8B B;  1VQ4 T;  2DD5 A;  1YIT Q;  3OYN A;  4A4E A;  4M7D B;  3ULR B;  1VQL T;  2VXE A;  1M8M A;  3CCE Q;  3IQL A;  4PFP A;  3G4S Q;  2FRW A;  2VWF A;  2EYY A;  3OMC A;  3PNW C;  1WHH A;  4A4H A;  1CKA A;  3NFC A;  2A08 A;  4C5E A;  3FDR A;  2HL5 C;  3I55 T;  5IT9 E;  4BI8 B;  3V8L A;  1C1A A;  1PCX A;  4B9W A;  3L2R A;  4M78 C;  2V8J A;  2KVQ G;  4KGV B;  4KRT A;  3CCM Q;  4BAC A;  5KYN A;  1ACM B;  1M27 C;  5LJ5 g;  4IUV A;  1M1F A;  2KYM A;  4J9E A;  4XTV A;  2BZ8 A;  3R6O A;  5FU7 C;  2CP6 A;  4DBF A;  1LVK A;  5IHI A;  3H8Z A;  4C0D C;  3HSB A;  1JBM A;  1RAD B;  4JLG A;  2KE9 A;  3L42 A;  4AG2 C;  5LL6 S;  3OY9 A;  1YIT A;  2ENM A;  2HNI A;  4IKF A;  2CZ6 B;  2DZC A;  4PFO A;  4J5Y A;  3CCE A;  3H0F A;  3X26 B;  2NUT B;  2YSQ A;  4XTZ A;  3R6N A;  4ELY C;  2EKO A;  4EMK B;  1YBY A;  3CEY A;  1SPK A;  1QVG S;  3QUI A;  2VB6 A;  2ED0 A;  4PJO C;  3L2W A;  3H41 A;  2DM1 A;  5I2M A;  2DL7 A;  2ROT A;  2KGT A;  3CCM A;  5GAM j;  1ZLM A;  1Q86 C;  2DLP A;  3QJY A;  2QQR A;  2KNB B;  3JCM V;  1OZ3 A;  3CC7 T;  1QVP A;  1P92 A;  2VUB A;  3OW2 A;  5DM7 R;  2A37 A;  1YN8 A;  2ZPI B;  3EH2 A;  4KUI A;  3CCQ T;  3X20 B;  1TXQ A;  3OS0 A;  3RR6 A;  1X43 A;  5GAN 7;  4MDX A;  1V29 B;  1N6A A;  2O4X A;  2GF7 A;  2LTO A;  3QDR B;  3ASK A;  1BBZ A;  3TSW A;  1Q86 R;  4M7D E;  3NGP A;  1UG1 A;  5CR2 A;  3PTA A;  2DTH A;  1GRI A;  4QW2 A;  3ZBD A;  2BE7 D;  4OP0 A;  4J9D A;  3C95 A;  3N5B B;  1U1T A;  3V7R A;  1YI2 Q;  2XI9 A;  2L3P A;  1W2B A;  4HXJ A;  4X34 A;  3QZ9 B;  5GAO p;  1YFN A;  1G3W A;  3L1A A;  3A8L B;  2RPN A;  4KUD K;  1ABQ A;  1RL2 A;  1UEC A;  2PUK B;  1YJ9 Q;  1WFW A;  3FRN A;  4ZNX A;  1N9S A;  1TS9 A;  1Q82 C;  3HRU A;  2DKG A;  4J8O A;  1Y07 A;  5FU6 C;  1WA7 A;  1HSQ A;  2EKH A;  2RI5 A;  2BUD A;  3S3O A;  3GP8 A;  2JS0 A;  3ZFJ A;  3WVE B;  1KHC A;  4RG2 A;  1WHM A;  4FYX B;  5LJ3 d;  2DRM A;  1N8R C;  4EPC A;  4PLI A;  2J7I A;  2RQW A;  2IPO B;  4RUG A;  5GAN 5;  4FYW B;  3BFM A;  1B34 A;  3I5S A;  3SDZ A;  1MHN A;  2QEX A;  1Q82 R;  4JJN K;  1YIT T;  3TEE A;  3EGU A;  2F5T X;  1UGP B;  1G83 A;  2BTT A;  3CCE T;  4J9C A;  3G4S T;  4B6M A;  3HRS A;  1NM7 A;  1FX7 A;  3KBG A;  2YUN A;  3QPH A;  2JT4 A;  1PC0 A;  2JJ9 A;  1CSK A;  2KBT A;  2RQU A;  2PTK A;  2JNG A;  2K2M A;  3RNJ A;  1M9S A;  1QCN A;  2QQ9 A;  3OB9 A;  1CKB A;  4RTX A;  4BI4 A;  4JJD A;  2MIO A;  4HVW A;  1YJN T;  1QCF A;  3TRE A;  2MMP A;  4BI3 A;  2EGA A;  2QQB A;  3CCM T;  3PT9 A;  5GAN d;  1QP2 A;  4C8Q C;  1IGU A;  1EZZ B;  4DBR A;  4RMO A;  1UFF A;  3QJ6 A;  4PKC C;  4CC2 A;  4JUV A;  1WIE A;  2DPP B;  4LDU A;  3EHR A;  1WJQ A;  3CCV A;  5KCH A;  4J7I A;  4E7J A;  4F7U A;  4HT8 A;  4JDS A;  3RUX A;  1QCO A;  2A36 A;  5D6X A;  3L2V A;  1RAF B;  1M4Z A;  1M90 U;  3JCM b;  3MCA B;  2BKD N;  1E6H A;  2XKO C;  3JB9 F;  4ZGJ B;  3O5Z A;  1QP3 A;  3JV3 A;  4QVZ A;  3A8H B;  4II1 A;  2RD1 A;  4JLI A;  2QAS A;  4JPB W;  2YHT A;  2KXD A;  4XQ3 A;  3JRZ A;  2YLB A;  2ED1 A;  2E10 A;  4E7Z A;  4J9B A;  3OBW A;  2P84 A;  1G3T A;  4XU2 A;  2QG9 B;  4B9X A;  2RQT A;  3DLM A;  3CCS Q;  2FPF A;  5GAO l;  3JCM X;  1PKS A;  3OYF A;  2P4R A;  3M58 A;  3DB4 A;  3VS1 A;  2E4H A;  1IHV A;  5LJ5 f;  3CQT A;  2OX7 A;  2FG0 A;  3M56 A;  2E12 A;  4IUR A;  3JSC A;  1FWZ A;  2E70 A;  3G6E Q;  4X9D A;  1OEB A;  4IUP A;  1PG5 B;  4M78 A;  5KCO A;  4ZN1 A;  4JZ4 A;  3LLR A;  5I22 A;  1BKB A;  2D9T A;  3RBB B;  3VS7 A;  1D1C A;  1ZSG A;  1GBQ A;  4HCZ A;  1VQK A;  1VQO Q;  1MMN A;  1NYG A;  5KYX A;  4QQ6 A;  1MMA A;  4BB7 A;  1AD5 A;  4D8D A;  2MWO A;  3GPL A;  1VA7 A;  4F7U F;  2FZC B;  1N27 A;  5KE3 A;  2D1X A;  1YI2 T;  1Y96 A;  2WSF E;  2LRQ A;  1UHC A;  1KFZ A;  1R77 A;  2M1H A;  1UDL A;  5EG2 A;  2FZK B;  2LDM A;  5IN1 A;  3PIP A;  3CD6 Q;  4FL6 A;  2NUP A;  2COY A;  4D6W A;  2V26 A;  2XD0 A;  4LDV A;  2O9S A;  4J9I A;  1ARK A;  2XG8 D;  2YRC A;  2JOY A;  3F70 A;  2K5L A;  1YJ9 T;  2PUO B;  2Z0W A;  2OTL A;  2QA4 A;  3VUZ A;  2DXU A;  4BY6 C;  1QVG A;  4J7F A;  1R8O B;  2QI2 A;  1WGS A;  4K11 A;  2O31 A;  2LNV A;  2KDS A;  5GAM d;  3PGG A;  3OS2 A;  4XU3 A;  3OW2 S;  3TCJ A;  2XIC A;  1ZUY A;  2RM4 A;  2VC8 A;  3CXC S;  1S72 Q;  3VYG A;  3FB9 A;  4M77 F;  4JRQ A;  5CKD A;  1FMV A;  1QKW A;  2RQV A;  5KYW A;  3M9Q A;  3JB9 G;  3C4S A;  1Q95 G;  1SRM A;  4E7H A;  5I2S A;  1V76 A;  4IIO A;  3UA7 A;  1YHQ Q;  1OOT A;  2CRE A;  2FO0 A;  2DXT A;  1KK7 A;  4M75 E;  2HSP A;  2XID A;  2DF6 A;  4M78 B;  4DEX A;  1JXM A;  2MYS A;  4XU1 A;  2QAZ A;  3L2Z A;  4OMQ A;  2COZ A;  3REB B;  4M4Z A;  4DBQ A;  3CCR Q;  1NYF A;  1QWE A;  1OX8 A;  5KYX B;  4M78 D;  2DE0 X;  1MMD A;  4OB2 B;  3QSU A;  5FU7 B;  1VYT A;  1VQ9 T;  1SHG A;  1Y96 B;  1R0B G;  2HBP A;  2JS2 A;  4C0D B;  1D3B A;  5GAN 3;  4JRK A;  1AWO A;  3M53 A;  3VS5 A;  1S72 A;  1MND A;  1OPK A;  4WTO B;  2GBQ A; 
#chains in the Genus database with same CATH homology
 2RMO A;  1BK2 A;  2FRY A;  4KRT A;  4F16 A;  1XOV A;  1RI9 A;  1T0J A;  1M27 C;  2YUQ A;  1MV0 B;  2CT3 A;  3M0T A;  1UGV A;  3VS4 A;  2KYM A;  1M3A A;  3NHN A;  2BZ8 A;  4J9E A;  5IHK A;  2FPE A;  5GJW B;  5IHI A;  2L3S A;  2DL3 A;  2JW4 A;  3EG2 A;  2LMJ A;  2M51 A;  1V1C A;  2J6F A;  2KE9 A;  3I9Q A;  4AG2 C;  1WLP B;  4J9H A;  5IH2 A;  2ENM A;  3PVL A;  2KYB A;  1TUC A;  2SRC A;  3H0F A;  3H0I A;  2O9V A;  4RTU A;  1T3L A;  1JQQ A;  2DBM A;  2YSQ A;  2CH4 A;  3M0R A;  3UAT A;  3R6N A;  2V1Q A;  3PE0 A;  1NLP C;  1Y57 A;  2KRM A;  1SPK A;  4HVU A;  4OMO A;  1BB9 A;  5HCK A;  1B3Q A;  2ED0 A;  1I1J A;  1X6G A;  2ROL A;  2DIL A;  3H41 A;  2DYB A;  2DM1 A;  2DL7 A;  2ROT A;  2KGT A;  2LQW A;  2KRN A;  1LCK A;  1ZLM A;  1UE9 A;  2ESW A;  1ZX6 A;  2DLP A;  1H92 A;  1A0N B;  2OJ2 A;  4Z89 A;  4RTY A;  2KNB B;  5FWB A;  1W1F A;  1YWP A;  5IHN A;  4LNP A;  3SEM A;  3VRZ A;  2KRO A;  2LZ6 B;  2F2X A;  2A37 A;  1YN8 A;  1YWO A;  1X43 A;  5IXF A;  1UUE A;  3M0S A;  1GCQ A;  1GCQ C;  1VYU A;  1BBZ A;  3TSW A;  4AFQ C;  3NGP A;  1UG1 A;  4LUD A;  2GTJ A;  1SEM A;  2CSQ A;  2LJ3 A;  1GRI A;  1X69 A;  1WXB A;  2I0N A;  2YUP A;  1K0S A;  4GLM A;  5IXB A;  2DX1 A;  3M0U A;  4JZ3 A;  4J9D A;  1J3T A;  1Z9Z A;  1I0C A;  2L3P A;  1RLP C;  5GJV B;  2BZY A;  1M30 A;  1PWT A;  4HXJ A;  2OI3 A;  1U5S A;  4J9G A;  2EGC A;  1BU1 A;  5EC7 A;  4OMM A;  5FWC A;  3M0Q A;  4AFZ C;  2GQI A;  2RPN A;  1M3B A;  3VS0 A;  1ABQ A;  2EYW A;  1UEC A;  1X27 A;  1GFC A;  1WFW A;  2CSI A;  4ZNX A;  4RTW A;  3REA B;  2EYX A;  1WA7 A;  1HSQ A;  1WXT A;  2EKH A;  1ABO A;  3NMZ C;  2JS0 A;  3A98 A;  2CDT A;  2LX7 A;  2DRM A;  1GBR A;  2RQR A;  2G6F X;  1EFN A;  4R0K A;  2J7I A;  2RQW A;  4RUG A;  4RTV A;  2DRK A;  1JEG A;  1K4U S;  1K0X A;  2D0N A;  3I5S A;  2C0I A;  2M0Y A;  2V1R A;  3I35 A;  3C0C A;  1QWF A;  1B07 A;  2D8H A;  2GTO A;  1AWJ A;  4GBQ A;  1SRL A;  2H8H A;  2JTE A;  1JO8 A;  2W0Z A;  3EGU A;  3EG0 A;  2BZX A;  1G83 A;  2BTT A;  2E5K A;  4J9C A;  3H0H A;  1NM7 A;  1JU5 C;  2DJQ A;  2YUN A;  2KXC A;  3UF4 A;  2JT4 A;  1OPL A;  1CSK A;  2YUO A;  2C0O A;  2KBT A;  1GFD A;  2RQU A;  2PTK A;  2DL8 A;  2K2M A;  4IIM A;  1W6X A;  3RNJ A;  1W70 A;  1CKB A;  4RTX A;  4AFU C;  4JJD A;  1AVZ C;  2CUB A;  4J9F A;  2MIO A;  4HVW A;  1JXO A;  1QCF A;  1WI7 A;  1HJD A;  2PNI A;  2EGA A;  1AEY A;  4Y92 A;  3NPF A;  2X3X D;  1H8K A;  1E7O A;  1TUD A;  4RTT A;  2KT8 A;  3THK A;  1UFF A;  2O2O A;  4CC2 A;  2K3B A;  2YT6 A;  1K1Z A;  1YCS B;  1WIE A;  3KFV A;  1Z9Q A;  4F17 A;  1ZUK A;  2JM8 A;  3EHR A;  2NWM A;  4OMP A;  1AWX A;  1PNJ A;  2A36 A;  2J06 A;  2VKN A;  2NUZ A;  3EHQ A;  1NG2 A;  5FW9 A;  1M3C A;  2LP5 A;  4LE9 A;  1E6H A;  2HEQ A;  2KR3 A;  5I11 A;  2L0A A;  2RN8 A;  1X2Q A;  3VRY A;  1G2B A;  1UTI A;  2QDL A;  1FMK A;  2MOX A;  1RUW A;  1NEB A;  2B86 A;  3O5Z A;  2FEI A;  2JMC A;  1SHF A;  3JV3 A;  2GNC A;  2D8J A;  2EGE A;  1PHT A;  2X3W D;  3VS2 A;  2LNH B;  4JPB W;  4Z8A A;  4ORZ A;  1QLY A;  2KXD A;  2IIM A;  1X6B A;  3TVT A;  2C0T A;  1PRM C;  2ED1 A;  2LJ1 A;  3M0P A;  4J9B A;  3TSZ A;  1ZUU A;  2LJ0 A;  2RQT A;  2FPF A;  2DA9 A;  1PKS A;  1ZBJ A;  2P4R A;  1WDX A;  1VYV A;  2K6D A;  1MUZ A;  3VS1 A;  4CC4 B;  3CQT A;  1Y0M A;  2JMA A;  1YNZ A;  2FG0 A;  1AZE A;  4CC7 A;  3UA6 A;  1PRL C;  4A63 B;  4LUE A;  4FSS A;  4E6R A;  1OEB A;  4X1V A;  1QKX A;  1U06 A;  1GL5 A;  1N5Z A;  1KSW A;  4HCK A;  4JZ4 A;  2RF0 A;  4Z88 A;  5I22 A;  1E6G A;  3U23 A;  1AWW A;  3RBB B;  2AKL A;  3VS7 A;  1ZSG A;  4JJB A;  1GBQ A;  1X2K A;  2ABL A;  1I07 A;  2O88 A;  1FYN A;  4OML A;  4D8K A;  2HBW A;  2DVJ A;  4LN2 A;  1S1N A;  1K76 A;  1NYG A;  1K9A A;  1WXU A;  2K9G A;  4D8D A;  1AD5 A;  2EW3 A;  1VA7 A;  2K79 A;  2D1X A;  2DL4 A;  1UHC A;  1KFZ A;  1UDL A;  2DMO A;  4F14 A;  1SSH A;  1WYX A;  4EIK A;  2JXB A;  4HVV A;  2F2V A;  4ESR A;  2L2P A;  1H3H A;  2CH4 W;  2LQN A;  1AOJ A;  2AK5 A;  4OMN A;  2XMF A;  1IO6 A;  2O9S A;  4J9I A;  1ARK A;  3GBQ A;  5L23 A;  1KIK A;  2OAW A;  5ECA A;  3QWY A;  4DEY A;  2KT1 A;  1U3O A;  4WCI A;  2DBK A;  3EG3 A;  1NEG A;  4QT7 A;  1AZG B;  2CUD A;  1PKT A;  4K11 A;  2O31 A;  3EG1 A;  1NLO C;  1UJ0 A;  2LCS A;  2L3Q A;  1TG0 A;  2EQI A;  1ZUY A;  2PZ1 A;  2YDL A;  4JJC A;  2MCN A;  1T0H A;  3VS6 A;  2J6K A;  1QKW A;  1OV3 A;  2RQV A;  1RLQ C;  1KJW A;  2EYZ A;  1YP5 A;  3PVQ A;  2EVR A;  2VVK A;  1SRM A;  3ZL7 C;  4CC3 A;  2KRS A;  2HDA A;  4IIO A;  2FPD A;  2HCK A;  3UA7 A;  2J05 A;  2DNU A;  1OOT A;  2CRE A;  2J6O A;  2RNA A;  4AFS C;  2FO0 A;  2JM9 A;  1UJY A;  3I5R A;  4RTZ A;  2A28 A;  2HSP A;  2DF6 A;  4DEX A;  1JXM A;  4OMQ A;  3LH5 A;  2AZV A;  2EPD A;  2SEM A;  3VS3 A;  1MV3 A;  2F2W A;  2ECZ A;  2K7A A;  4M4Z A;  3REB B;  1NYF A;  2W10 A;  3SHW A;  1QWE A;  2DL5 A;  2AZS A;  2CT4 A;  2DE0 X;  3FJ5 A;  3ULR B;  4AG1 C;  1M8M A;  1VYT A;  1WX6 A;  3IQL A;  3QWX X;  1SHG A;  2FRW A;  2VWF A;  2EYY A;  2JS2 A;  1CKA A;  1UHF A;  2EBP A;  2KEA A;  2A08 A;  1AWO A;  3VS5 A;  1GCP A;  2GGR A;  2AKK A;  1OPK A;  1T3S A;  1HD3 A;  2GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...