4R55A

The crystal structure of a cren7 mutant protein gr and dsdna complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
SGKKPVKVKTPAGKEAELVPEKVWALGRVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin protein Cren7
publication title Insights into the interaction between Cren7 and DNA: the role of loop beta 3-beta 4
pubmed doi rcsb
source organism Sulfolobus solfataricus p2
molecule tags Dna binding protein/dna
total genus 8
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4r55A00
4R55A 3KXTA 2JTMA 4R56A 3LWIA 3LWHA
chains in the Genus database with same CATH superfamily
3CPFA 3CC2T 1PG5B 1ZSZA 2RI3A 2KT1A 2KDSA 3TREA 2LZ6B 2DO3A 4R0KA 1TUGB 2ENMA 1X01A 4O6JA 4FSSA 1N8RR 2VGNA 3DB3A 5CKEA 4EDUA 4HKEA 2DYIA 1PC0A 1YITQ 2IPOB 1GXIE 4NL3A 2ZGWA 2DX1A 2QXFA 1VQ5T 3HRTA 4HCBA 3RKYA 2QA4A 2QDYB 5GMKl 1ZA2B 1M2OA 3M0SA 2PU9B 1MUZA 3VS1A 1VQ6A 2HKQB 3SWNA 1YJNQ 5KYYA 3GPLA 4RMOA 2M0OA 2MK5A 2RQUA 1VQPA 1PSEA 2J05A 4LDWA 2AZSA 2HQHA 3EG9B 4KULA 2EYXA 3HFNA 3I9QA 4J5YA 4OMQA 1WDXA 2M0YA 3CMEA 3HRUA 1VQKQ 2FPDA 4PJJA 1WJRA 4JZ4A 3L2RA 3GIBA 1Q81R 1M30A 2DXTA 1Q82U 3SB2A 4HVVA 2M16A 2P0KA 3VRYA 4C5HA 3P8DA 1UGRB 2OTJQ 2PZ1A 2ZCFB 2EYYA 2KI7A 1M1KC 3A98A 2O31A 3OQ5A 2DRKA 1SG5A 3X26B 1G83A 5LJ3j 7AT1B 2MIOA 1SHFA 2RK2A 1BYMA 4XU2A 4M7AF 1AEYA 5GANg 1C6VX 5CQXA 1K8AR 1N27A 2LJ3A 2XDDA 1BIBA 1YJWA 4M7AD 2XKOC 2FO0A 2CYZB 3MEUA 1SHGA 1UHCA 1ZBXA 1LJOA 1UG1A 3EFSA 4AMCA 4F7UE 2YLCA 2K7AA 5IT9E 2F2VA 4C5EA 1MMAA 2XG8D 3QYGB 2QGFB 2VXFA 3Q1JA 4KBMB 4MZTA 1NLPC 4EIKA 3EGXB 2C0IA 3RDVA 4BI8B 4F16A 2RF0A 4A4HA 1GBRA 3M59A 2KRNA 2G3RA 5GAN6 1GCPA 4EMKB 1D09B 3OYNA 2M51A 5GJVB 3OYYA 3NHNA 1KK7A 1R0CB 1YCYA 2RHIA 3OYDA 4M78C 3KFVA 1YWPA 4A63B 4AFSC 3SHWA 1B7TA 2CP0A 1IZ6A 2LJ1A 2I0NA 2EYZA 1G3TA 1K8AC 1WXTA 4PFOA 5GAOn 1K76A 2LT1A 5IH2A 4FYVB 4MDXA 3SWNC 4M78F 5LJ5d 3MJXA 1K9MU 1ZX6A 4HVUA 1Q82R 1SEMA 1Q7YU 3VV0A 3OYAA 1UECA 5AYFA 2OJ2A 3R6OA 3BE3A 3OYHA 1NPRA 4M78D 1AWXA 2I2LA 1JEGA 5I2MA 4M77G 2JZ2A 3LWIA 2KBTA 4PFZA 3ER0A 3UPUA 2GQVA 2NYSA 3P8BB 3V7SA 4BACA 1QCNA 3EFRA 2K5FA 1QVFS 5GANh 3GBQA 5GANj 5J3BA 3FRNA 4OB1B 3BY7A 4FW2A 1VQMT 1UGVA 3VS7A 2IIMA 1QWFA 5GJWB 5GAMf 1U1TA 5GMKj 2HSEB 8ATCB 2DVJA 2DLPA 3EAEA 3NGPA 3RKWA 1M90R 2MOXA 2E5KA 1T3SA 2M9UA 4J83A 3MEWA 2QQSA 2RQTA 1OI1A 3NTKA 5IXBA 1PWTA 2ED0A 3E19A 4A4EA 5LJ5e 3OYMA 1Q82C 1VQ8T 2KYMA 1QWEA 2QTVA 3R6NA 3EG2A 2HNIA 1AWJA 4WF2A 4JUVA 4C92F 1YHQA 2CZ6B 4ESRA 1BI3A 1WNLA 2RD1A 4NOYA 3M4YA 3A8OB 2V26A 3EFOA 4OB3B 2CZ1B 1Y7XA 2O4XA 4WCIA 3HFOA 4C92D 4C0DB 3KXTA 1WZOA 1YWOA 1OZ2A 3L2QA 2DD5A 3JCMW 1N9SA 4J9IA 4RKUE 2DL5A 1HJDA 1KG1A 3KBGA 5KYNA 4IKFA 2QA4T 1N9RA 4PLLA 4OMOA 1Q7YR 3PFSA 1R0BG 4KGXB 1VQ6T 4A4GA 3VJPA 3FJPA 2EAYA 1M90C 2DYBA 1VQPT 1NG2A 2KXDA 2QG9B 2P0QA 1WJSA 1XJWB 4M7DA 2VGMA 5AT1B 3CCMQ 1BI2A 3G1JA 1XNIA 2LRQA 2W0ZA 3H0IA 3RESA 3CMET 2WSFE 4IUVA 3O8VA 2RQRA 2QI2A 4LNPA 1K4US 3CC2A 5A0DA 1B34B 2F5TX 2QA4Q 3RIRA 2DF6A 2LNHB 1VQ6Q 3ZEHA 4CI0C 1R77A 2RJDA 2LJ0A 4XAXB 1VQPQ 4ZTFA 1EZZB 2YT6A 4BE2A 3QWYA 1RUWA 1VQ5A 1YP5A 2V1RA 4IUUA 3M0QA 3EHRA 1K9MC 1VQOA 2XDPA 1Q7YC 3JCMd 1V1CA 3CMEQ 2Z0WA 3OB9A 5KYXA 1YJWT 3S3NA 1YJ9A 1D3BB 3DB4A 4J7IA 1J3TA 1IHVA 2P4TA 5HK0A 1W1FA 4FW1A 2HZYA 4C8QA 5DY9A 3QZ9B 2VASA 3MHXA 2O9SA 3OSVA 1JB0E 1I0CA 3JV3A 2K3XA 1VQ9Q 3RR6A 3HTRA 5KYUA 3G7ZA 2JW4A 1HXDA 2BE9B 2JOYA 5HKCA 2MMPA 1IO6A 1YJWQ 3N5BB 2P0PA 2EJ9A 4JJCA 3ME9A 3O5ZA 1G3YA 2JNGA 2LCSA 1WQWA 1I8FA 4V2SA 2VC8A 3C94A 4A4FA 3E9FA 5FU6B 2YXYA 1V29B 1CSKA 2HDAA 2RB6A 4E7ZA 2J6KA 5KCOA 2NUTB 3JCMe 1AD5A 1VA7A 4JDSA 2NUPB 4RTYA 2YUOA 3S3OA 3EGDB 4DEXA 4P5NA 4N4IA 2FB7A 1OU9A 2LDMA 2K9GA 4M7DC 4PJOG 3E9GA 3PMTA 2OTLQ 2DBKA 1S1NA 2K2MA 3G4SQ 1DJ7B 4ZN3A 1Y96B 1JJ2P 5HCKA 3META 2LC4A 1I5OB 4FYWB 3A1PA 5I21A 2ZPGB 2CP7A 5LL6S 2DM1A 4XU1A 2Y90A 3JCMh 4F7UF 2FZGB 1EX4A 1CKBA 4E6RA 1BCOA 1SSHA 1X6OA 1K73R 4OMFB 4M7DD 2EGCA 1YIJA 3OY9A 2CH4A 2RJEA 4DBFA 3QIIA 2VB6A 3VUZA 1KC8R 2E6ZA 2EPDA 2L3SA 2PVGB 3A8HB 4J7FA 3CCUQ 3M53A 3TQ7P 3QUIA 2E70A 3M54A 3EG1A 4E7HA 3M4GA 4LD9K 1YHQT 1KQSS 3L2WA 1GCQA 4M7AA 3JB9H 2HBWA 3VUBA 2MF2A 1JXMA 4EMGA 1SPKA 3L2ZA 3RMQA 2D0NA 1AVZC 1TWBA 2L8DA 1D1BA 3UT1A 2Y4XA 4FU6A 3UF4A 3ZFJA 3KUFA 3E2UA 2DAQA 1ZHIA 2GFUA 3REAB 2JMAA 5A0LA 3CCVA 2DXUA 2WSEE 5KH6A 1MMDA 4AFZC 1U06A 5GAOr 2BZXA 1K1ZA 3MP6A 4A54A 1YHQQ 1ZSZB 4AFQC 5LJ3d 2HQEA 3VS0A 1YN8A 4M77E 1OU8A 2DBMA 1O75A 5LJ3g 2JM8A 3RBBB 1MNDA 3CCET 3SFMA 4M75C 1LCKA 4ELYC 4BI3A 4AG2C 5KYWA 3VS3A 1SRLA 2AIRB 2CDTA 3H41A 2RN8A 5FWCA 3MPUB 8AT1B 1X6BA 2XHCA 3BDUA 4VUBA 4CC4B 4PJNA 5KYYB 3PTAA 4M75F 5FRNA 4M78A 1YFNA 3JCMP 1M1KR 3JB9J 1PD0A 1M3BA 4ZGEB 3I56A 1MV0B 2DETA 1OOTA 5GAMj 4M75D 3BDLA 5GMKi 5FU7B 4CRIA 1WHGA 5CKFA 1VQOT 1Y57A 1VQNQ 4JJNK 3LH5A 1SKUB 1ZLMA 4FT2A 4QKUA 2QEXT 2C0OA 1YJ9T 3CMAA 5IHIA 3CC2Q 1G8XA 2E41A 1W70A 3E1SA 5LJ3e 4HT8A 4DOVA 4QW2A 3UWNA 3L2UA 1WIEA 2AT1B 2YUPA 3JSCA 3M57A 5D7UA 1OV3A 3UATA 2DNUA 3NFCA 2JMCA 2GTOA 5CVIA 1X2KA 4Z02A 4BY6B 4RTUA 2LT4A 1PD1A 1M3AA 3GNGA 1YNZA 1VQ5Q 4IIMA 1M1FA 1GCQC 4M7AC 6AT1B 3CCJA 4IIOA 4HCZA 2K2VA 2X4WA 4YTLA 3X25B 3QWXX 2FEIA 4J9HA 1VQLA 2JTFA 3OYEA 1YJ9Q 4XTVA 1QW1A 1OULA 4QVCA 1KJWA 1BIAA 1MGQA 4FYYB 5LJ3h 5GANd 4C92A 4AG1C 2L3PA 1V76A 4E7IA 4R55A 1U8RA 3CD6A 1ZUKA 1RABB 3HHTB 1I07A 2CT3A 4HVWA 2CP2A 1QVFA 3ASKA 4QQDA 4ME7A 4RTVA 4KT0E 3L2VA 1ZSGA 2P4RA 2EIFA 5IXFA 2DEQA 2L2PA 4M77B 2YLBA 4C0ZA 2HEQA 2X4JA 1VQ7A 3JB9F 4DA4A 2EQJA 2DTIA 2LX7A 1QKWA 2PQWA 1N5ZA 2EBPA 2ABLA 1GFCA 3URGA 1VQ4A 3EH2A 3JB9D 2X4XA 2LVMA 2DA9A 2K3YA 2KMTA 4KH0B 1M2VA 1NYFA 1OPLA 1GBQA 2COWA 2DZCA 4J6XA 2HSPA 2D0QB 4IUQA 1TXQA 1H8KA 2DFUA 1E6HA 2A3LA 2XIDA 1GFDA 2KE9A 5C6SA 1SF9A 2YWWA 4TVRA 1YIJT 5GANe 1WXUA 2EGAA 2CGHA 4LN2A 2MAMA 3OW2P 1UEBA 3QDFA 2EFIA 2IG0A 2O2OA 5GMKe 1WLPB 1KQSP 4RCCA 3EGXA 2JS2A 5C0MA 1I81A 1MMGA 2DJQA 2ZPHB 3VS4A 3SD4A 4B6MA 1ZUUA 3LWHA 2IVWA 4Y91A 1LPLA 3PT9A 2DRMA 1RAAB 2EYQA 1YIJQ 5ECAA 2HL3A 1JJ2S 2F69A 2CUDA 2DD4A 1UGQB 1AWWA 2H3EB 2X4YA 3CXCP 4LUEA 1PSFA 3LGFA 1XQHA 5CIUA 3MP8A 3CCVT 1BBZA 2FYKA 5GMKh 2YRCA 4J9FA 3LX7A 4PJOE 3AHUA 3OYCA 4C92C 3EFOB 4LDUA 4KGVB 2COYA 1WXBA 1NEBA 2BZ8A 2LP5A 3TEEA 4PFPA 2QYZA 1Q86U 4RTZA 2RI2A 2PVDB 1VQMQ 3A8LB 3H6ZA 3M0UA 1KQ1A 3LLRA 2AKLA 2RO0A 2COZA 2KAFA 2E64A 3V7RA 3CCLT 1SSFA 2QQ9A 1OPKA 1IGUA 3VS5A 4M7DB 4HA8A 3I56T 1FMVA 2J06A 2L5QA 1K9MR 3MEAA 1ZQ1A 2BIVA 1H3HA 1RADB 1VQ8Q 3JCMX 4J8OA 1YCSB 1D0XA 2RI5A 1LVKA 3G6EA 3CCSA 3VYGA 3CMAT 3VKIA 2A36A 1QCOA 1X2QA 2XICA 3JAME 2CT4A 4IUTA 4C5GA 3JCMJ 4FT4A 3S3MA 2DVEA 1W2BP 3NTHA 3OBWA 3CCEA 4XTZA 4F7UA 1VIEA 3OBYA 3HL8A 3C95A 1I1JA 1UTIA 1ARKA 4JLGA 2EQMA 1F1BB 1UFFA 1LOJA 1PKSA 3CCJT 1NZ9A 2HD0A 4ELZC 4Z88A 5KYXB 5GAOm 4B9XA 2RJFA 1MNEA 2K57A 5IHNA 2ZPEB 1VQLT 2KQWA 2YDLA 3FLGA 3DLLA 3CMAQ 3RERA 2RHZA 3REBB 4C8QB 4M7DG 4KRTA 3CD6T 2PVOB 4ATOA 3L1AA 5D6YA 2DL3A 2QEXA 2XD0A 2XMFA 2CREA 4PJOB 5KYUB 1I4K1 3A8MB 1VQKA 1KFZA 1UJ0A 2DJZA 3CC7T 4RTXA 3CCJQ 1IXDA 2JN0A 4GLKA 4L6V5 2EJFA 4DBHA 1G5VA 1JXOA 1VQ7T 2CZ0B 2RPNA 1VQLQ 1OEBA 1RI9A 1AT1B 4KH1B 3OA6A 1Y0MA 3EHQA 2KT8A 1VQ4T 1KD1U 3QKJA 2AHJB 2PUOB 3CD6Q 1KSWA 2RK1A 4PNOA 1BU1A 2K79A 2GFAA 3JCMb 4F14A 9ATCB 2GCXA 1WJQA 1Z9QA 5GAN4 1KQSA 5FW9A 4UC4A 2JT4A 5CCAA 1D0ZA 1VQ7Q 1UE9A 4RCBA 4KUIA 1CKAA 3OS5A 2VUBA 1ACMB 3OSSC 3PNWC 1M4ZA 1Q86C 1T3LA 1MV3A 4M75A 3V8KA 3MCAB 4C8QG 1UDLA 2JXBA 3I35A 1RAFB 1SRMA 1RAEB 3DKMA 4FL6A 2KGTA 4OMLA 1OZ3A 3CBPA 3OYGA 1NBEB 3JCMc 1O9SA 3M56A 2NWMA 2A37A 5GAOq 3SDZA 3U23A 3PIPA 2H8HA 2A7YA 2DE0X 1B3QA 3ZBDA 2FVUA 4C0DC 2JM9A 4PJMA 2E3HA 5CKHA 4O5VA 1PM3A 1OX9A 4F04B 4B9WA 1M8VA 5M9OA 3F70A 2CUBA 3QJ6A 4M4ZA 4ORZA 5GAOl 2K5LA 1E6GA 1WYXA 4AFUC 1TOVA 4M75G 1OYXA 1QP2A 4XTXA 3WXMB 4M7AB 4J9GA 2LNVA 2EVRA 2DMOA 1QVGP 1WI7A 2V8JA 3EGDA 3X28B 2DL7A 2J6FA 3TU4K 5GAMg 2LQWA 2BKDN 3J80E 1IHWA 5CO7A 3M0PA 1UGSB 1XTDA 3SEMA 3OW2S 3DLMA 1BI1A 4XTWA 1RLPC 2LX9A 1QMCA 2EJGA 3WVDB 4D6WA 5LJ5f 2HBPA 1AHJB 1N8RU 2L3QA 4X9DA 2MPXC 1K0SA 1WFWA 3CC4A 2D1XA 2WSCE 3H8ZA 5FROA 2ATCB 3ULRB 2O88A 4JRKA 2ESWA 2QGGA 2RQVA 2NLUA 4BUGA 2DZ9A 4JZ3A 5CR2A 3V8LA 5EG2A 1WA7A 5D6WA 2FHDA 2GGRA 4OMMA 3CXCS 3QDRB 4RG8A 2D9TA 4RTWA 2F2XA 3JCMQ 1B07A 3I5SA 3CPWS 4D8KA 1C0MA 1VUBA 2X3XD 3G6ET 3CCST 2CP3A 2M1HA 1UB4A 2LQ8A 2BZYA 2FG0A 4M7AG 4M78B 1G3SA 1JU5C 2SRCA 1JBMA 1FX7A 2C0TA 3M58A 1KD1C 3RKXA 1Q81U 1NLOC 2KXCA 3FC3A 2DL4A 4X1VA 1RACB 1FYNA 3L42A 4BE1A 1BCMA 1YITT 1H3ZA 4OB0B 1KHCA 2RHXA 3SWNB 4LD6A 3JB9G 3CCLA 1VIFA 2KRSA 1NPPA 4Q5WA 1RAGB 4ZTJA 5GAN5 4PK4A 2K6DA 2JJ9A 3G6EQ 3CCSQ 1X27A 2DKGA 3VS6A 2ZZDA 4ANJA 1MMNA 2DTOA 2HKNA 3CCQA 3HP9A 4XU0A 4JJDA 1TH7A 3EGUA 1WPYA 5GAMh 2D6FA 2LQNA 3CCEQ 4KGZB 3UA7A 2OX7A 1M3CA 2QQAA 1IB8A 1VOMA 5FU6C 3CCMA 1H641 1X6GA 3C0CA 5CK9A 4IURA 2G6FX 4LDXA 4JLIA 1TUCA 5GAN3 1GL5A 1VQKT 3HPWA 5FLXE 4C0GA 3A5ZB 2ZPIB 1RI0A 2B86A 2RH2A 2QTXA 3G71A 2GQIA 2KY9A 4PJLA 1W2BS 2RMOA 2K4YA 2L89A 3OYJA 2VKNA 3M9QA 4RTTA 4C92B 2OTJT 2YHTA 3CBOA 4M78G 2WACA 4OB2B 2CP5A 1WHJA 4C0FA 1NEGA 2KYBA 3PVQA 4AT1B 2HMAA 2O9VA 2KROA 2BTTA 2YUQA 2YUNA 1YBYA 1VQOQ 1N6AA 2R58A 2ROTA 4RUGA 5J39A 2E5QA 2HL5C 1GRIA 2QEXQ 2FPFA 3M0TA 4QQ6A 2E3IA 2CS7A 1M8MA 5GAN8 1M5Q1 1AWOA 4BD3A 5D6XA 3LW5E 4RG2A 1TUDA 3OMGA 1AZGB 1UUEA 3NTIA 4ZNXA 1FMKA 5GAN7 3FB9A 3EG9A 1N8RC 1W4SA 3JCMf 1M2VB 1WX6A 5KE2A 1JJ2A 1M1GA 1TS9A 1FWZA 4CC2A 3CC7A 3A8GB 1BB9A 2K5IA 2C06A 1VQ9A 4QQGA 1JQQA 5A0GA 2A08A 2CP6A 2QQBA 3HSBA 1U5SA 2KSSA 3CQTA 2DXBA 3GLXA 4M7DE 2CSIA 5IN1A 3P8HA 1QVGA 2MYSA 4C92G 4DOWA 2JTMA 2X51A 5CQYA 3PIOA 4MMKA 1IGQA 2VYTA 1M90U 4OGCA 1Y07A 2F1LA 4F17A 2EGEA 2H3JA 4CC3A 3QHSA 2JUFA 3EG3A 2A28A 3VYHB 5IAYA 4Y92A 2V1QA 5DLQE 1T0HA 4FM4B 3QBYA 1Q81C 3INZA 4K11A 1ZSZC 4R56A 4BI4A 3J81E 3GOXA 4E7KA 4ZGDB 3H9NA 4M77A 3X20B 4DBQA 2D8JA 2XU8A 2OTLA 1M27C 4BB7A 3G4SA 2YRDA 5CKBA 2OAWA 4XTUA 1R8OB 2LMJA 1BKBA 2J6OA 2DIGA 4JRPA 3OMCA 3RNJA 5KCHA 1WHKA 4EMKA 3CC4T 1ABQA 3C12A 5I11A 3AT1B 4LE9A 1EFNA 4N0AA 1X75C 4EPCA 3QYHB 1ZBJA 2XI9A 3BW1A 3CCRA 2ECZA 5LJ5g 4MMLA 4EMHA 5L8RE 2E65A 2QDLA 4C8QE 1C1AA 3CBMA 2Y4YA 2ED1A 1HD3A 2LCLA 5CAIA 2E4HA 3CPWP 2V8KA 4ZGJB 3EH1A 3X24B 5FU7C 4LUDA 1G3WA 3PGGA 3PMIA 1RLQC 3CCUA 3M5AA 1UGPB 2LQKA 1G2BA 4DEYA 4J9BA 2PUKB 2SEMA 2W10A 3I55A 1Y71A 2O4XB 4OP0A 1QVGS 4N4GA 3CC4Q 4J9CA 4X34A 2QK0A 2ZAEA 4XTYA 2F2WA 1I5LA 3EG0A 4CC7A 4JJBA 1X69A 1PKTA 1YI2A 2CKKA 4BY6C 3FIFA 4FYXB 3OYIA 4DQ2A 4C5IA 4M75E 4GY5A 3CCVQ 1ZA1B 2VV5A 1FXXA 2KRMA 4II1A 5HK3A 5FWBA 4NL2A 3S6WA 4OF1A 2GF7A 1AOJA 1HK9A 2DIQA 2BE7D 2FRWA 1NM7A 1S72A 3JRZA 3CCQT 4J6YA 2RJCA 4F7UB 4E7SA 1IRXA 4L5GA 2KNBB 1W6XA 2VVKA 3TSWA 3CCMT 4XU3A 3M0RA 4IUPA 2ZPBB 2FRYA 4Z89A 3HRSA 1VYUA 2YRVA 4PL6A 5IHKA 1PHTA 3JCMV 1PRMC 4D8DA 2V8IA 5LJ3f 3D7SB 1IREB 4M77C 3CCLQ 2DEUA 3G71T 1TU0B 2L3RA 1WHMA 3QZ5B 2EWNA 5LJ5h 5LJ5j 4OMPA 3I56Q 3CCQQ 1YITA 3T9NA 2VXEA 2VWFA 1D1CA 4FIBA 1TSFA 1RAIB 4EMKC 4M77F 5HY6A 2XDBA 2R5AA 3VU3C 1VQNA 3FEOA 4N0AC 4OMNA 3H0FA 2ROLA 4JS4A 1YJNA 4M7AE 2AK5A 1WHHA 1RL2A 4M77D 5GAOp 2E10A 4E7LA 3G71Q 2HCKA 3OYFA 4E47A 2KK4A 1Q86R 2GBQA 4LXCA 5KE3A 3JB9I 4F7UG 5J26A 5DLOA 4GBQA 4JPBW 1VYTA 3MEVA 1ABOA 2KR3A 3VRZA 1AZEA 1HSQA 2XK0A 2QASA 1QQJA 5L23A 1VQ9T 3OS0A 3GF5A 2F5KA 2JS0A 2OAUA 3LGLA 1B34A 1H92A 3OYLA 1OQKA 3CEYA 2OTJA 3JCMg 4BDZA 5A2QE 4HCCA 3TCJA 1KIKA 2RQWA 3I5RA 1ZUYA 2JTEA 4M75B 2FZCB 2R57A 2CSQA 1K73U 2ZPFB 4E7JA 4PKCC 2RHYA 3V8JA 4KUDK 4X9CA 2D8HA 2K3BA 4OVAA 3OW2A 2LTOA 1UJYA 5FRMA 2E12A 2EQIA 3UDCA 1NJIU 2RHUA 4FCYA 2YSQA 3CC7Q 1KC8U 1TTHB 1A0NB 2J7IA 3QSUA 1Z9ZA 3MKDA 4BDYA 1Q95G 1LNXA 1KHIA 4HCKA 1X43A 4PJOA 1TG0A 1D3BA 1QVPA 5GANf 4M78E 3HKSA 4MZMA 4GLMA 2O01E 1OX8A 2NUZA 4E2FB 3GNFB 3OS1A 3UA6A 2RNAA 2OTLT 1D0YA 1VQ4Q 3QO3A 3G4ST 5GAN2 2PTKA 2OI3A 3QJYA 2AKKA 2X3WD 4N4HA 5DM7R 1RAHB 3OYKA 3CXCA 3V7CA 2EW3A 1K0XA 3NMZC 4LDYA 1VYVA 2GTJA 4QVDA 4DBRA 2X9HA 5CKDA 3M55A 3CPWA 1D1AA 1PRLC 2EKOA 1NYGA 2AZVA 3J7AF 3FJ5A 4MZPA 3ZL7C 3CCRT 1QKXA 3VS2A 4QT7A 3THKA 1JO8A 4HT9A 4XK8E 1FMWA 2MWOA 1QP3A 1U1SA 1QVFP 2FL7A 3CCUT 1QCFA 2DXCA 2EQKA 2NUTA 1PCXA 1HYOA 2NUPA 3OYBA 4JS5A 5EC7A 1JRIA 4JRQA 5GAMd 3LYIA 3BFMA 3I55T 4M7DF 4FSXA 4HXJA 3TVTA 2A0FB 1WQ7A 5GMKm 2R5MA 2GNCA 2EKHA 5I2SA 1KD1R 1QLYA 2FZKB 4C92E 3CCRQ 2DILA 4JRIA 1YI2T 2DK3A 1Y96A 3MP1A 2CZ7B 1M1KU 4WTOB 3RMSA 1NJIR 2KVQG 1T0JA 3FDRA 4L59A 4OGEA 3OS2A 3PE0A 1WGSA 2MWPA 3WVEB 1UHFA 1BI0A 2DL8A 4J6WA 2M02A 1K9AA 4MDWA 3H0HA 3I55Q 2FPEA 1S72T 4Y28E 4LDVA 2RM4A 1P92A 2DTHA 2EQUA 2RA2A 2CH4W 1W2BA 4Z8AA 5KYWB 2PNIA 2B8AA 3GP8A 2LCCA 3NPFA 4C8QC 1E7OA 2BUDA 1PNJA 3LH0A 3PVLA 1YI2Q 2EYWA 3RUXA 1WHLA 4PJOC 1XOVA 2E6NA 2JVVA 4J9EA 5GAMe 1VQMA 4QVZA 2HAXA 1KQ2A 3TSZA 4C8QF 1MHNA 1EIFA 4J9DA 4BE0A 4A4KA 3IQLA 1K73C 3QG1A 2QQRA 2X35A 1S72Q 4NS5A 2L0AA 4PJOF 2P84A 3QXEB 2MCNA 4C8QD 1NJIC 1M9SA 5I22A 2DPPB 4PLIA 1KC8C 3MO8A 2KEAA 2QAZA 4ZN1A 3C4SA 2E1HA 1BK2A 1NE8A 2MI6A 4A53A 3QPHA 2DERA 2HQXA 1VQNT 4XQ3A 1K8AU 1VQ8A 1U3OA 4PJOD 1YJNT
chains in the Genus database with same CATH topology
3CPFA 2XICA 3JAME 2LDMA 3CC2T 3INZA 4IUTA 4R56A 4C5GA 4PJOG 4BI4A 3J81E 2RI3A 3GOXA 4FT4A 3E9GA 4E7KA 4ZGDB 3JCMJ 3S3MA 2DVEA 2KDSA 3NTHA 3OBWA 3CCEA 4XTZA 3TREA 4M77A 3X20B 2DO3A 1VIEA 4F7UA 3PMTA 2XU8A 3OBYA 3HL8A 3C95A 1X01A 4O6JA 2OTLA 4BB7A 2VGNA 3DB3A 5CKEA 4EDUA 3G4SA 4HKEA 1DJ7B 5CKBA 4ZN3A 1Y96B 4XTUA 1R8OB 1BKBA 3META 3UPUA 4JLGA 2LC4A 1GXIE 2EQMA 2DIGA 4NL3A 2ZGWA 4JRPA 3OMCA 2QXFA 1VQ5T 3HRTA 4HCBA 5I21A 2ZPGB 1LOJA 5LL6S 3RKYA 3CCJT 2QA4A 1NZ9A 2HD0A 2QDYB 4XU1A 5KCHA 4ELZC 5GMKl 5GAOm 2Y90A 4EMKA 3CC4T 3JCMh 4F7UF 2PU9B 4B9XA 2RJFA 2K57A 3C12A 1VQ6A 2ZPEB 1VQLT 3SWNA 2KQWA 4N0AA 1X75C 4EPCA 3QYHB 2XI9A 3BW1A 3FLGA 3GPLA 1X6OA 4RMOA 3DLLA 3CCRA 2M0OA 3RERA 4OMFB 5LJ5g 4M7DD 1VQPA 1PSEA 1YIJA 4MMLA 4EMHA 4LDWA 3OY9A 5L8RE 2RJEA 2RHZA 2E65A 4C8QE 4C8QB 3CBMA 2Y4YA 4M7DG 3QIIA 3CD6T 4KULA 2PVOB 2LCLA 3VUZA 3HFNA 3L1AA 5CAIA 4ATOA 2E6ZA 4J5YA 2PVGB 2V8KA 5D6YA 4ZGJB 3A8HB 4J7FA 3X24B 5FU7C 3M53A 3CMEA 1G3WA 3PGGA 3PMIA 3CCUA 2QEXA 3HRUA 3M5AA 3QUIA 1UGPB 2LQKA 2XD0A 4PJOB 1I4K1 2E70A 3A8MB 1VQKA 1WJRA 3L2RA 3M54A 4E7HA 2DJZA 2PUKB 3M4GA 3CC7T 4LD9K 3GIBA 1YHQT 2JN0A 3I55A 3L2WA 1Y71A 1KQSS 4M7AA 2DXTA 4GLKA 2O4XB 4L6V5 4OP0A 1QVGS 3JB9H 4N4GA 3VUBA 2EJFA 2MF2A 1Q82U 3SB2A 1G5VA 2M16A 1VQ7T 2CZ0B 2P0KA 4X34A 4C5HA 3P8DA 4XTYA 1UGRB 4EMGA 1I5LA 3L2ZA 2ZCFB 3RMQA 4M7DC 2L8DA 1M1KC 3OA6A 3OQ5A 3UT1A 2Y4XA 4FU6A 3ZFJA 1YI2A 3X26B 1VQ4T 5LJ3j 1KD1U 2CKKA 3QKJA 3FIFA 3KUFA 2RK2A 2AHJB 4BY6C 4DQ2A 4XU2A 2PUOB 1ZHIA 2DAQA 4C5IA 4M7AF 1BYMA 2GFUA 4M75E 4GY5A 5GANg 2VV5A 5CQXA 5A0LA 3CCVA 1FXXA 2DXUA 4II1A 2RK1A 4PNOA 5HK3A 2WSEE 2GFAA 5KH6A 4NL2A 3S6WA 4OF1A 1N27A 3JCMb 2XDDA 1BIBA 2GF7A 1YJWA 5GAOr 4M7AD 3MP6A 2GCXA 1WJQA 1HK9A 2DIQA 2XKOC 4A54A 2CYZB 3MEUA 5GAN4 1KQSA 5LJ3d 1S72A 3JRZA 1ZBXA 1LJOA 2HQEA 3EFSA 4M77E 4UC4A 3CCQT 4F7UE 2YLCA 4J6YA 2RJCA 4F7UB 5CCAA 5IT9E 5LJ3g 1O75A 4C5EA 2XG8D 4RCBA 4KUIA 3OS5A 2VUBA 3QYGB 3PNWC 3OSSC 1M4ZA 2VXFA 4L5GA 3Q1JA 3CCET 3SFMA 1Q86C 4M75C 4M75A 4BI3A 4KBMB 4MZTA 3V8KA 4ELYC 3CCMT 3MCAB 4XU3A 4C8QG 4IUPA 4BI8B 2ZPBB 3HRSA 2YRVA 4A4HA 3M59A 4PL6A 3JCMV 2G3RA 5GAN6 4EMKB 3DKMA 4FL6A 3OYNA 2V8IA 5LJ3f 1IREB 2XHCA 3BDUA 1OZ3A 3OYYA 4M77C 4VUBA 3CBPA 3OYGA 3G71T 3PTAA 3JCMc 2L3RA 1O9SA 4M75F 1YCYA 3M56A 2RHIA 3QZ5B 3OYDA 2EWNA 4M78C 5FRNA 4M78A 5LJ5h 5LJ5j 3JCMP 5GAOq 3SDZA 3PIPA 2A7YA 3JB9J 3ZBDA 2FVUA 4C0DC 4ZGEB 1YITA 5CKHA 1IZ6A 4O5VA 3T9NA 3I56A 2VXEA 4B9WA 3JB9F 5GAMj 1G3TA 4M75D 1M8VA 1K8AC 5M9OA 3BDLA 4FIBA 3F70A 5GMKi 5FU7B 3QJ6A 4CRIA 5GAOn 5GAOl 4EMKC 2K5LA 4M77F 5CKFA 5HY6A 1VQOT 2LT1A 2XDBA 2R5AA 3VU3C 4MDXA 1VQNA 3SWNC 4M78F 4JJNK 3FEOA 4M75G 4N0AC 1OYXA 1QP2A 5LJ5d 4XTXA 4FT2A 3WXMB 1K9MU 4JS4A 2QEXT 1YJNA 4M7AE 4M7AB 1YJ9T 2LNVA 3CMAA 1Q7YU 3VV0A 2E41A 3OYAA 3E1SA 1RL2A 4M77D 5LJ3e 5GAOp 4HT8A 5AYFA 4DOVA 2E10A 3R6OA 4QW2A 4E7LA 3UWNA 3OYHA 2V8JA 3L2UA 1NPRA 4M78D 3X28B 3TU4K 3JSCA 2I2LA 5GAMg 3OYFA 4E47A 3M57A 2KK4A 2BKDN 3J80E 5I2MA 4M77G 5CO7A 1UGSB 1XTDA 3NFCA 4F7UG 5KE3A 2JZ2A 3JB9I 3LWIA 5J26A 5CVIA 5DLOA 3OW2S 3DLMA 1BI1A 3ER0A 4Z02A 2GQVA 3MEVA 3P8BB 4XTWA 3V7SA 2LT4A 4BY6B 4BACA 2LX9A 1QVFS 3EFRA 2K5FA 2EJGA 3WVDB 4D6WA 3GNGA 5LJ5f 5GANh 5GANj 2HBPA 1AHJB 2XK0A 1M1FA 1N8RU 4M7AC 4X9DA 1VQ9T 3OS0A 3CCJA 3GF5A 2F5KA 5J3BA 3FRNA 4HCZA 4OB1B 3BY7A 2OAUA 1VQMT 3CC4A 2K2VA 2X4WA 4YTLA 3LGLA 1B34A 3X25B 5GAMf 2WSCE 3OYLA 3H8ZA 5FROA 3CEYA 1VQLA 1U1TA 2JTFA 3OYEA 2OTJA 5GMKj 4XTVA 3JCMg 1QW1A 4QVCA 4JRKA 3EAEA 2NLUA 4BUGA 1BIAA 1MGQA 3RKWA 5A2QE 4BDZA 2DZ9A 5LJ3h 4HCCA 5GANd 4C92A 3TCJA 5CR2A 4E7IA 3V8LA 5EG2A 2M9UA 4J83A 4R55A 1U8RA 4M75B 2R57A 5D6WA 1K73U 3MEWA 2FHDA 2ZPFB 4E7JA 2QQSA 3CXCS 3CD6A 1OI1A 3HHTB 3NTKA 3QDRB 2RHYA 4PKCC 4RG8A 4X9CA 3V8JA 4KUDK 4OVAA 3OW2A 2D9TA 2LTOA 5FRMA 3JCMQ 2E12A 3E19A 3UDCA 1QVFA 4A4EA 1NJIU 3CPWS 2RHUA 3ASKA 4QQDA 4ME7A 5LJ5e 3OYMA 1Q82C 1VQ8T 1VUBA 1KC8U 3QSUA 4KT0E 3G6ET 3L2VA 2HNIA 3CCST 4BDYA 4WF2A 4JUVA 4C92F 1YHQA 2EIFA 2M1HA 1LNXA 1KHIA 2CZ6B 1UB4A 2DEQA 2LQ8A 1BI3A 2YLBA 4M77B 4PJOA 4C0ZA 1D3BA 1WNLA 2RD1A 1QVPA 2X4JA 4M7AG 5GANf 4NOYA 1VQ7A 4M78E 3HKSA 3M4YA 3A8OB 2EQJA 4M78B 4MZMA 1G3SA 2DTIA 2O01E 4OB3B 2CZ1B 1Y7XA 2PQWA 1JBMA 1FX7A 2O4XA 3M58A 3RKXA 1KD1C 3HFOA 1Q81U 3GNFB 3OS1A 4C92D 4C0DB 2OTLT 3KXTA 3URGA 3FC3A 3QO3A 3G4ST 1OZ2A 5GAN2 2DD5A 3L2QA 3QJYA 1VQ4A 3JB9D 2X4XA 3L42A 4BE1A 2LVMA 3JCMW 2K3YA 1YITT 2KMTA 4N4HA 1N9SA 4OB0B 4RKUE 5DM7R 1H3ZA 2DZCA 4J6XA 3OYKA 3CXCA 1KHCA 3V7CA 1KG1A 3KBGA 2RHXA 4IKFA 2D0QB 3SWNB 2QA4T 4IUQA 1N9RA 4LD6A 4PLLA 3JB9G 4LDYA 3CCLA 1VIFA 4QVDA 5CKDA 1NPPA 3M55A 3PFSA 3CPWA 1VQ6T 2A3LA 2XIDA 2EKOA 4Q5WA 4A4GA 4ZTJA 5GAN5 3J7AF 3VJPA 5C6SA 3FJPA 2EAYA 2DKGA 4MZPA 3CCRT 1M90C 2ZZDA 2DTOA 1VQPT 3CCQA 4TVRA 3HP9A 1YIJT 4XU0A 1TH7A 5GANe 1WPYA 5GAMh 2D6FA 2P0QA 1WJSA 4M7DA 2CGHA 2VGMA 4HT9A 2MAMA 2QQAA 4XK8E 5FU6C 3CCMA 1BI2A 1H641 1UEBA 2MWOA 1XNIA 1QP3A 4FM4B 2EFIA 1U1SA 2IG0A 2LRQA 5CK9A 4IURA 2FL7A 3RESA 3CMET 5GMKe 3CCUT 4LDXA 4JLIA 2WSFE 5GAN3 2DXCA 2EQKA 4IUVA 1VQKT 3O8VA 4RCCA 2QI2A 3HPWA 5FLXE 3OYBA 4C0GA 4JS5A 3CC2A 5A0DA 5C0MA 1B34B 1JRIA 2F5TX 1I81A 4JRQA 5GAMd 3LYIA 3BFMA 3RIRA 3I55T 2ZPHB 3A5ZB 2ZPIB 4FSXA 1RI0A 4M7DF 2RH2A 3SD4A 2QTXA 1WQ7A 3G71A 2KY9A 5GMKm 2R5MA 3ZEHA 1W2BS 5I2SA 4CI0C 3LWHA 2IVWA 2K4YA 4Y91A 2L89A 4C92E 3OYJA 3M9QA 3PT9A 4C92B 2OTJT 2YHTA 3CBOA 4M78G 2RJDA 2WACA 4JRIA 4OB2B 4XAXB 4ZTFA 2EYQA 4C0FA 4BE2A 1JJ2S 1YI2T 2F69A 2DD4A 1UGQB 2DK3A 1Y96A 1VQ5A 2X4YA 4IUUA 3MP1A 2CZ7B 1M1KU 3RMSA 1PSFA 1YBYA 3LGFA 2KVQG 1K9MC 1N6AA 1XQHA 2R58A 3MP8A 5CIUA 3CCVT 1VQOA 2XDPA 5J39A 3FDRA 4L59A 1Q7YC 4OGEA 3JCMd 2E5QA 3OS2A 2FYKA 5GMKh 1WGSA 2MWPA 3OB9A 3WVEB 4QQ6A 1YJWT 3S3NA 3LX7A 1YJ9A 4PJOE 1BI0A 2CS7A 4J6WA 3AHUA 1D3BB 4MDWA 3OYCA 4C92C 5GAN8 3DB4A 1S72T 1M5Q1 1Q81C 4BD3A 4J7IA 5D6XA 3LW5E 4RG2A 4LDUA 4Y28E 2P4TA 4LDVA 3OMGA 2RM4A 1P92A 2DTHA 2EQUA 2RA2A 5HK0A 1W2BA 3NTIA 2B8AA 3GP8A 2LCCA 4C8QC 4C8QA 5GAN7 3FB9A 5DY9A 1N8RC 1W4SA 2BUDA 4DA4A 3QZ9B 3LH0A 3JCMf 3MHXA 5KE2A 3OSVA 1JB0E 3TEEA 1JJ2A 1M1GA 1FWZA 3RUXA 3CC7A 2K3XA 1Q86U 3A8GB 2K5IA 2C06A 3OYIA 1VQ9A 4PJOC 4QQGA 3G7ZA 2RI2A 2PVDB 5A0GA 1XOVA 2E6NA 2JVVA 3A8LB 3H6ZA 5GAMe 1KQ1A 3LLRA 1HXDA 1VQMA 4QVZA 2JOYA 2RO0A 5HKCA 2HAXA 1KQ2A 2KAFA 2MMPA 2E64A 2QQBA 3V7RA 4C8QF 3N5BB 3VKIA 3CCLT 3HSBA 1SSFA 2P0PA 2EJ9A 1MHNA 3ME9A 1EIFA 4BE0A 4A4KA 2KSSA 1K73C 2QQ9A 1G3YA 2JNGA 2QQRA 2DXBA 1WQWA 1I8FA 2X35A 3GLXA 3QG1A 4V2SA 4M7DE 4M7DB 4HA8A 4NS5A 2VC8A 5IN1A 3P8HA 3I56T 1QVGA 3C94A 4PJOF 4A4FA 4C92G 3QXEB 3E9FA 5FU6B 4DOWA 4C8QD 2JTMA 1NJIC 1M9SA 2L5QA 1V29B 2DPPB 4PLIA 5CQYA 3MEAA 1ZQ1A 4MMKA 3PIOA 2VYTA 1KC8C 1M90U 3MO8A 2RB6A 1Y07A 4OGCA 2BIVA 5KCOA 4ZN1A 3C4SA 2E1HA 1NE8A 2H3JA 2MI6A 4A53A 3JCMe 3QPHA 4JDSA 3JCMX 4J8OA 2HQXA 1VQNT 4XQ3A 1K8AU 1VQ8A 3QHSA 2JUFA 4PJOD 2RI5A 3VYHB 5IAYA 3G6EA 1YJNT 3CCSA 3S3OA 3VYGA 3CMAT 4P5NA 4N4IA 5DLQE 3QBYA 2FB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R55 A;  3KXT A;  2JTM A;  4R56 A;  3LWI A;  3LWH A; 
#chains in the Genus database with same CATH topology
 3CPF A;  3CC2 T;  1PG5 B;  1ZSZ A;  2RI3 A;  2KT1 A;  2KDS A;  3TRE A;  2LZ6 B;  2DO3 A;  4R0K A;  1TUG B;  2ENM A;  1X01 A;  4O6J A;  4FSS A;  1N8R R;  2VGN A;  3DB3 A;  5CKE A;  4EDU A;  4HKE A;  2DYI A;  1PC0 A;  1YIT Q;  2IPO B;  1GXI E;  4NL3 A;  2ZGW A;  2DX1 A;  2QXF A;  1VQ5 T;  3HRT A;  4HCB A;  3RKY A;  2QA4 A;  2QDY B;  5GMK l;  1ZA2 B;  1M2O A;  3M0S A;  2PU9 B;  1MUZ A;  3VS1 A;  1VQ6 A;  2HKQ B;  3SWN A;  1YJN Q;  5KYY A;  3GPL A;  4RMO A;  2M0O A;  2MK5 A;  2RQU A;  1VQP A;  1PSE A;  2J05 A;  4LDW A;  2AZS A;  2HQH A;  3EG9 B;  4KUL A;  2EYX A;  3HFN A;  3I9Q A;  4J5Y A;  4OMQ A;  1WDX A;  2M0Y A;  3CME A;  3HRU A;  1VQK Q;  2FPD A;  4PJJ A;  1WJR A;  4JZ4 A;  3L2R A;  3GIB A;  1Q81 R;  1M30 A;  2DXT A;  1Q82 U;  3SB2 A;  4HVV A;  2M16 A;  2P0K A;  3VRY A;  4C5H A;  3P8D A;  1UGR B;  2OTJ Q;  2PZ1 A;  2ZCF B;  2EYY A;  2KI7 A;  1M1K C;  3A98 A;  2O31 A;  3OQ5 A;  2DRK A;  1SG5 A;  3X26 B;  1G83 A;  5LJ3 j;  7AT1 B;  2MIO A;  1SHF A;  2RK2 A;  1BYM A;  4XU2 A;  4M7A F;  1AEY A;  5GAN g;  1C6V X;  5CQX A;  1K8A R;  1N27 A;  2LJ3 A;  2XDD A;  1BIB A;  1YJW A;  4M7A D;  2XKO C;  2FO0 A;  2CYZ B;  3MEU A;  1SHG A;  1UHC A;  1ZBX A;  1LJO A;  1UG1 A;  3EFS A;  4AMC A;  4F7U E;  2YLC A;  2K7A A;  5IT9 E;  2F2V A;  4C5E A;  1MMA A;  2XG8 D;  3QYG B;  2QGF B;  2VXF A;  3Q1J A;  4KBM B;  4MZT A;  1NLP C;  4EIK A;  3EGX B;  2C0I A;  3RDV A;  4BI8 B;  4F16 A;  2RF0 A;  4A4H A;  1GBR A;  3M59 A;  2KRN A;  2G3R A;  5GAN 6;  1GCP A;  4EMK B;  1D09 B;  3OYN A;  2M51 A;  5GJV B;  3OYY A;  3NHN A;  1KK7 A;  1R0C B;  1YCY A;  2RHI A;  3OYD A;  4M78 C;  3KFV A;  1YWP A;  4A63 B;  4AFS C;  3SHW A;  1B7T A;  2CP0 A;  1IZ6 A;  2LJ1 A;  2I0N A;  2EYZ A;  1G3T A;  1K8A C;  1WXT A;  4PFO A;  5GAO n;  1K76 A;  2LT1 A;  5IH2 A;  4FYV B;  4MDX A;  3SWN C;  4M78 F;  5LJ5 d;  3MJX A;  1K9M U;  1ZX6 A;  4HVU A;  1Q82 R;  1SEM A;  1Q7Y U;  3VV0 A;  3OYA A;  1UEC A;  5AYF A;  2OJ2 A;  3R6O A;  3BE3 A;  3OYH A;  1NPR A;  4M78 D;  1AWX A;  2I2L A;  1JEG A;  5I2M A;  4M77 G;  2JZ2 A;  3LWI A;  2KBT A;  4PFZ A;  3ER0 A;  3UPU A;  2GQV A;  2NYS A;  3P8B B;  3V7S A;  4BAC A;  1QCN A;  3EFR A;  2K5F A;  1QVF S;  5GAN h;  3GBQ A;  5GAN j;  5J3B A;  3FRN A;  4OB1 B;  3BY7 A;  4FW2 A;  1VQM T;  1UGV A;  3VS7 A;  2IIM A;  1QWF A;  5GJW B;  5GAM f;  1U1T A;  5GMK j;  2HSE B;  8ATC B;  2DVJ A;  2DLP A;  3EAE A;  3NGP A;  3RKW A;  1M90 R;  2MOX A;  2E5K A;  1T3S A;  2M9U A;  4J83 A;  3MEW A;  2QQS A;  2RQT A;  1OI1 A;  3NTK A;  5IXB A;  1PWT A;  2ED0 A;  3E19 A;  4A4E A;  5LJ5 e;  3OYM A;  1Q82 C;  1VQ8 T;  2KYM A;  1QWE A;  2QTV A;  3R6N A;  3EG2 A;  2HNI A;  1AWJ A;  4WF2 A;  4JUV A;  4C92 F;  1YHQ A;  2CZ6 B;  4ESR A;  1BI3 A;  1WNL A;  2RD1 A;  4NOY A;  3M4Y A;  3A8O B;  2V26 A;  3EFO A;  4OB3 B;  2CZ1 B;  1Y7X A;  2O4X A;  4WCI A;  3HFO A;  4C92 D;  4C0D B;  3KXT A;  1WZO A;  1YWO A;  1OZ2 A;  3L2Q A;  2DD5 A;  3JCM W;  1N9S A;  4J9I A;  4RKU E;  2DL5 A;  1HJD A;  1KG1 A;  3KBG A;  5KYN A;  4IKF A;  2QA4 T;  1N9R A;  4PLL A;  4OMO A;  1Q7Y R;  3PFS A;  1R0B G;  4KGX B;  1VQ6 T;  4A4G A;  3VJP A;  3FJP A;  2EAY A;  1M90 C;  2DYB A;  1VQP T;  1NG2 A;  2KXD A;  2QG9 B;  2P0Q A;  1WJS A;  1XJW B;  4M7D A;  2VGM A;  5AT1 B;  3CCM Q;  1BI2 A;  3G1J A;  1XNI A;  2LRQ A;  2W0Z A;  3H0I A;  3RES A;  3CME T;  2WSF E;  4IUV A;  3O8V A;  2RQR A;  2QI2 A;  4LNP A;  1K4U S;  3CC2 A;  5A0D A;  1B34 B;  2F5T X;  2QA4 Q;  3RIR A;  2DF6 A;  2LNH B;  1VQ6 Q;  3ZEH A;  4CI0 C;  1R77 A;  2RJD A;  2LJ0 A;  4XAX B;  1VQP Q;  4ZTF A;  1EZZ B;  2YT6 A;  4BE2 A;  3QWY A;  1RUW A;  1VQ5 A;  1YP5 A;  2V1R A;  4IUU A;  3M0Q A;  3EHR A;  1K9M C;  1VQO A;  2XDP A;  1Q7Y C;  3JCM d;  1V1C A;  3CME Q;  2Z0W A;  3OB9 A;  5KYX A;  1YJW T;  3S3N A;  1YJ9 A;  1D3B B;  3DB4 A;  4J7I A;  1J3T A;  1IHV A;  2P4T A;  5HK0 A;  1W1F A;  4FW1 A;  2HZY A;  4C8Q A;  5DY9 A;  3QZ9 B;  2VAS A;  3MHX A;  2O9S A;  3OSV A;  1JB0 E;  1I0C A;  3JV3 A;  2K3X A;  1VQ9 Q;  3RR6 A;  3HTR A;  5KYU A;  3G7Z A;  2JW4 A;  1HXD A;  2BE9 B;  2JOY A;  5HKC A;  2MMP A;  1IO6 A;  1YJW Q;  3N5B B;  2P0P A;  2EJ9 A;  4JJC A;  3ME9 A;  3O5Z A;  1G3Y A;  2JNG A;  2LCS A;  1WQW A;  1I8F A;  4V2S A;  2VC8 A;  3C94 A;  4A4F A;  3E9F A;  5FU6 B;  2YXY A;  1V29 B;  1CSK A;  2HDA A;  2RB6 A;  4E7Z A;  2J6K A;  5KCO A;  2NUT B;  3JCM e;  1AD5 A;  1VA7 A;  4JDS A;  2NUP B;  4RTY A;  2YUO A;  3S3O A;  3EGD B;  4DEX A;  4P5N A;  4N4I A;  2FB7 A;  1OU9 A;  2LDM A;  2K9G A;  4M7D C;  4PJO G;  3E9G A;  3PMT A;  2OTL Q;  2DBK A;  1S1N A;  2K2M A;  3G4S Q;  1DJ7 B;  4ZN3 A;  1Y96 B;  1JJ2 P;  5HCK A;  3MET A;  2LC4 A;  1I5O B;  4FYW B;  3A1P A;  5I21 A;  2ZPG B;  2CP7 A;  5LL6 S;  2DM1 A;  4XU1 A;  2Y90 A;  3JCM h;  4F7U F;  2FZG B;  1EX4 A;  1CKB A;  4E6R A;  1BCO A;  1SSH A;  1X6O A;  1K73 R;  4OMF B;  4M7D D;  2EGC A;  1YIJ A;  3OY9 A;  2CH4 A;  2RJE A;  4DBF A;  3QII A;  2VB6 A;  3VUZ A;  1KC8 R;  2E6Z A;  2EPD A;  2L3S A;  2PVG B;  3A8H B;  4J7F A;  3CCU Q;  3M53 A;  3TQ7 P;  3QUI A;  2E70 A;  3M54 A;  3EG1 A;  4E7H A;  3M4G A;  4LD9 K;  1YHQ T;  1KQS S;  3L2W A;  1GCQ A;  4M7A A;  3JB9 H;  2HBW A;  3VUB A;  2MF2 A;  1JXM A;  4EMG A;  1SPK A;  3L2Z A;  3RMQ A;  2D0N A;  1AVZ C;  1TWB A;  2L8D A;  1D1B A;  3UT1 A;  2Y4X A;  4FU6 A;  3UF4 A;  3ZFJ A;  3KUF A;  3E2U A;  2DAQ A;  1ZHI A;  2GFU A;  3REA B;  2JMA A;  5A0L A;  3CCV A;  2DXU A;  2WSE E;  5KH6 A;  1MMD A;  4AFZ C;  1U06 A;  5GAO r;  2BZX A;  1K1Z A;  3MP6 A;  4A54 A;  1YHQ Q;  1ZSZ B;  4AFQ C;  5LJ3 d;  2HQE A;  3VS0 A;  1YN8 A;  4M77 E;  1OU8 A;  2DBM A;  1O75 A;  5LJ3 g;  2JM8 A;  3RBB B;  1MND A;  3CCE T;  3SFM A;  4M75 C;  1LCK A;  4ELY C;  4BI3 A;  4AG2 C;  5KYW A;  3VS3 A;  1SRL A;  2AIR B;  2CDT A;  3H41 A;  2RN8 A;  5FWC A;  3MPU B;  8AT1 B;  1X6B A;  2XHC A;  3BDU A;  4VUB A;  4CC4 B;  4PJN A;  5KYY B;  3PTA A;  4M75 F;  5FRN A;  4M78 A;  1YFN A;  3JCM P;  1M1K R;  3JB9 J;  1PD0 A;  1M3B A;  4ZGE B;  3I56 A;  1MV0 B;  2DET A;  1OOT A;  5GAM j;  4M75 D;  3BDL A;  5GMK i;  5FU7 B;  4CRI A;  1WHG A;  5CKF A;  1VQO T;  1Y57 A;  1VQN Q;  4JJN K;  3LH5 A;  1SKU B;  1ZLM A;  4FT2 A;  4QKU A;  2QEX T;  2C0O A;  1YJ9 T;  3CMA A;  5IHI A;  3CC2 Q;  1G8X A;  2E41 A;  1W70 A;  3E1S A;  5LJ3 e;  4HT8 A;  4DOV A;  4QW2 A;  3UWN A;  3L2U A;  1WIE A;  2AT1 B;  2YUP A;  3JSC A;  3M57 A;  5D7U A;  1OV3 A;  3UAT A;  2DNU A;  3NFC A;  2JMC A;  2GTO A;  5CVI A;  1X2K A;  4Z02 A;  4BY6 B;  4RTU A;  2LT4 A;  1PD1 A;  1M3A A;  3GNG A;  1YNZ A;  1VQ5 Q;  4IIM A;  1M1F A;  1GCQ C;  4M7A C;  6AT1 B;  3CCJ A;  4IIO A;  4HCZ A;  2K2V A;  2X4W A;  4YTL A;  3X25 B;  3QWX X;  2FEI A;  4J9H A;  1VQL A;  2JTF A;  3OYE A;  1YJ9 Q;  4XTV A;  1QW1 A;  1OUL A;  4QVC A;  1KJW A;  1BIA A;  1MGQ A;  4FYY B;  5LJ3 h;  5GAN d;  4C92 A;  4AG1 C;  2L3P A;  1V76 A;  4E7I A;  4R55 A;  1U8R A;  3CD6 A;  1ZUK A;  1RAB B;  3HHT B;  1I07 A;  2CT3 A;  4HVW A;  2CP2 A;  1QVF A;  3ASK A;  4QQD A;  4ME7 A;  4RTV A;  4KT0 E;  3L2V A;  1ZSG A;  2P4R A;  2EIF A;  5IXF A;  2DEQ A;  2L2P A;  4M77 B;  2YLB A;  4C0Z A;  2HEQ A;  2X4J A;  1VQ7 A;  3JB9 F;  4DA4 A;  2EQJ A;  2DTI A;  2LX7 A;  1QKW A;  2PQW A;  1N5Z A;  2EBP A;  2ABL A;  1GFC A;  3URG A;  1VQ4 A;  3EH2 A;  3JB9 D;  2X4X A;  2LVM A;  2DA9 A;  2K3Y A;  2KMT A;  4KH0 B;  1M2V A;  1NYF A;  1OPL A;  1GBQ A;  2COW A;  2DZC A;  4J6X A;  2HSP A;  2D0Q B;  4IUQ A;  1TXQ A;  1H8K A;  2DFU A;  1E6H A;  2A3L A;  2XID A;  1GFD A;  2KE9 A;  5C6S A;  1SF9 A;  2YWW A;  4TVR A;  1YIJ T;  5GAN e;  1WXU A;  2EGA A;  2CGH A;  4LN2 A;  2MAM A;  3OW2 P;  1UEB A;  3QDF A;  2EFI A;  2IG0 A;  2O2O A;  5GMK e;  1WLP B;  1KQS P;  4RCC A;  3EGX A;  2JS2 A;  5C0M A;  1I81 A;  1MMG A;  2DJQ A;  2ZPH B;  3VS4 A;  3SD4 A;  4B6M A;  1ZUU A;  3LWH A;  2IVW A;  4Y91 A;  1LPL A;  3PT9 A;  2DRM A;  1RAA B;  2EYQ A;  1YIJ Q;  5ECA A;  2HL3 A;  1JJ2 S;  2F69 A;  2CUD A;  2DD4 A;  1UGQ B;  1AWW A;  2H3E B;  2X4Y A;  3CXC P;  4LUE A;  1PSF A;  3LGF A;  1XQH A;  5CIU A;  3MP8 A;  3CCV T;  1BBZ A;  2FYK A;  5GMK h;  2YRC A;  4J9F A;  3LX7 A;  4PJO E;  3AHU A;  3OYC A;  4C92 C;  3EFO B;  4LDU A;  4KGV B;  2COY A;  1WXB A;  1NEB A;  2BZ8 A;  2LP5 A;  3TEE A;  4PFP A;  2QYZ A;  1Q86 U;  4RTZ A;  2RI2 A;  2PVD B;  1VQM Q;  3A8L B;  3H6Z A;  3M0U A;  1KQ1 A;  3LLR A;  2AKL A;  2RO0 A;  2COZ A;  2KAF A;  2E64 A;  3V7R A;  3CCL T;  1SSF A;  2QQ9 A;  1OPK A;  1IGU A;  3VS5 A;  4M7D B;  4HA8 A;  3I56 T;  1FMV A;  2J06 A;  2L5Q A;  1K9M R;  3MEA A;  1ZQ1 A;  2BIV A;  1H3H A;  1RAD B;  1VQ8 Q;  3JCM X;  4J8O A;  1YCS B;  1D0X A;  2RI5 A;  1LVK A;  3G6E A;  3CCS A;  3VYG A;  3CMA T;  3VKI A;  2A36 A;  1QCO A;  1X2Q A;  2XIC A;  3JAM E;  2CT4 A;  4IUT A;  4C5G A;  3JCM J;  4FT4 A;  3S3M A;  2DVE A;  1W2B P;  3NTH A;  3OBW A;  3CCE A;  4XTZ A;  4F7U A;  1VIE A;  3OBY A;  3HL8 A;  3C95 A;  1I1J A;  1UTI A;  1ARK A;  4JLG A;  2EQM A;  1F1B B;  1UFF A;  1LOJ A;  1PKS A;  3CCJ T;  1NZ9 A;  2HD0 A;  4ELZ C;  4Z88 A;  5KYX B;  5GAO m;  4B9X A;  2RJF A;  1MNE A;  2K57 A;  5IHN A;  2ZPE B;  1VQL T;  2KQW A;  2YDL A;  3FLG A;  3DLL A;  3CMA Q;  3RER A;  2RHZ A;  3REB B;  4C8Q B;  4M7D G;  4KRT A;  3CD6 T;  2PVO B;  4ATO A;  3L1A A;  5D6Y A;  2DL3 A;  2QEX A;  2XD0 A;  2XMF A;  2CRE A;  4PJO B;  5KYU B;  1I4K 1;  3A8M B;  1VQK A;  1KFZ A;  1UJ0 A;  2DJZ A;  3CC7 T;  4RTX A;  3CCJ Q;  1IXD A;  2JN0 A;  4GLK A;  4L6V 5;  2EJF A;  4DBH A;  1G5V A;  1JXO A;  1VQ7 T;  2CZ0 B;  2RPN A;  1VQL Q;  1OEB A;  1RI9 A;  1AT1 B;  4KH1 B;  3OA6 A;  1Y0M A;  3EHQ A;  2KT8 A;  1VQ4 T;  1KD1 U;  3QKJ A;  2AHJ B;  2PUO B;  3CD6 Q;  1KSW A;  2RK1 A;  4PNO A;  1BU1 A;  2K79 A;  2GFA A;  3JCM b;  4F14 A;  9ATC B;  2GCX A;  1WJQ A;  1Z9Q A;  5GAN 4;  1KQS A;  5FW9 A;  4UC4 A;  2JT4 A;  5CCA A;  1D0Z A;  1VQ7 Q;  1UE9 A;  4RCB A;  4KUI A;  1CKA A;  3OS5 A;  2VUB A;  1ACM B;  3OSS C;  3PNW C;  1M4Z A;  1Q86 C;  1T3L A;  1MV3 A;  4M75 A;  3V8K A;  3MCA B;  4C8Q G;  1UDL A;  2JXB A;  3I35 A;  1RAF B;  1SRM A;  1RAE B;  3DKM A;  4FL6 A;  2KGT A;  4OML A;  1OZ3 A;  3CBP A;  3OYG A;  1NBE B;  3JCM c;  1O9S A;  3M56 A;  2NWM A;  2A37 A;  5GAO q;  3SDZ A;  3U23 A;  3PIP A;  2H8H A;  2A7Y A;  2DE0 X;  1B3Q A;  3ZBD A;  2FVU A;  4C0D C;  2JM9 A;  4PJM A;  2E3H A;  5CKH A;  4O5V A;  1PM3 A;  1OX9 A;  4F04 B;  4B9W A;  1M8V A;  5M9O A;  3F70 A;  2CUB A;  3QJ6 A;  4M4Z A;  4ORZ A;  5GAO l;  2K5L A;  1E6G A;  1WYX A;  4AFU C;  1TOV A;  4M75 G;  1OYX A;  1QP2 A;  4XTX A;  3WXM B;  4M7A B;  4J9G A;  2LNV A;  2EVR A;  2DMO A;  1QVG P;  1WI7 A;  2V8J A;  3EGD A;  3X28 B;  2DL7 A;  2J6F A;  3TU4 K;  5GAM g;  2LQW A;  2BKD N;  3J80 E;  1IHW A;  5CO7 A;  3M0P A;  1UGS B;  1XTD A;  3SEM A;  3OW2 S;  3DLM A;  1BI1 A;  4XTW A;  1RLP C;  2LX9 A;  1QMC A;  2EJG A;  3WVD B;  4D6W A;  5LJ5 f;  2HBP A;  1AHJ B;  1N8R U;  2L3Q A;  4X9D A;  2MPX C;  1K0S A;  1WFW A;  3CC4 A;  2D1X A;  2WSC E;  3H8Z A;  5FRO A;  2ATC B;  3ULR B;  2O88 A;  4JRK A;  2ESW A;  2QGG A;  2RQV A;  2NLU A;  4BUG A;  2DZ9 A;  4JZ3 A;  5CR2 A;  3V8L A;  5EG2 A;  1WA7 A;  5D6W A;  2FHD A;  2GGR A;  4OMM A;  3CXC S;  3QDR B;  4RG8 A;  2D9T A;  4RTW A;  2F2X A;  3JCM Q;  1B07 A;  3I5S A;  3CPW S;  4D8K A;  1C0M A;  1VUB A;  2X3X D;  3G6E T;  3CCS T;  2CP3 A;  2M1H A;  1UB4 A;  2LQ8 A;  2BZY A;  2FG0 A;  4M7A G;  4M78 B;  1G3S A;  1JU5 C;  2SRC A;  1JBM A;  1FX7 A;  2C0T A;  3M58 A;  1KD1 C;  3RKX A;  1Q81 U;  1NLO C;  2KXC A;  3FC3 A;  2DL4 A;  4X1V A;  1RAC B;  1FYN A;  3L42 A;  4BE1 A;  1BCM A;  1YIT T;  1H3Z A;  4OB0 B;  1KHC A;  2RHX A;  3SWN B;  4LD6 A;  3JB9 G;  3CCL A;  1VIF A;  2KRS A;  1NPP A;  4Q5W A;  1RAG B;  4ZTJ A;  5GAN 5;  4PK4 A;  2K6D A;  2JJ9 A;  3G6E Q;  3CCS Q;  1X27 A;  2DKG A;  3VS6 A;  2ZZD A;  4ANJ A;  1MMN A;  2DTO A;  2HKN A;  3CCQ A;  3HP9 A;  4XU0 A;  4JJD A;  1TH7 A;  3EGU A;  1WPY A;  5GAM h;  2D6F A;  2LQN A;  3CCE Q;  4KGZ B;  3UA7 A;  2OX7 A;  1M3C A;  2QQA A;  1IB8 A;  1VOM A;  5FU6 C;  3CCM A;  1H64 1;  1X6G A;  3C0C A;  5CK9 A;  4IUR A;  2G6F X;  4LDX A;  4JLI A;  1TUC A;  5GAN 3;  1GL5 A;  1VQK T;  3HPW A;  5FLX E;  4C0G A;  3A5Z B;  2ZPI B;  1RI0 A;  2B86 A;  2RH2 A;  2QTX A;  3G71 A;  2GQI A;  2KY9 A;  4PJL A;  1W2B S;  2RMO A;  2K4Y A;  2L89 A;  3OYJ A;  2VKN A;  3M9Q A;  4RTT A;  4C92 B;  2OTJ T;  2YHT A;  3CBO A;  4M78 G;  2WAC A;  4OB2 B;  2CP5 A;  1WHJ A;  4C0F A;  1NEG A;  2KYB A;  3PVQ A;  4AT1 B;  2HMA A;  2O9V A;  2KRO A;  2BTT A;  2YUQ A;  2YUN A;  1YBY A;  1VQO Q;  1N6A A;  2R58 A;  2ROT A;  4RUG A;  5J39 A;  2E5Q A;  2HL5 C;  1GRI A;  2QEX Q;  2FPF A;  3M0T A;  4QQ6 A;  2E3I A;  2CS7 A;  1M8M A;  5GAN 8;  1M5Q 1;  1AWO A;  4BD3 A;  5D6X A;  3LW5 E;  4RG2 A;  1TUD A;  3OMG A;  1AZG B;  1UUE A;  3NTI A;  4ZNX A;  1FMK A;  5GAN 7;  3FB9 A;  3EG9 A;  1N8R C;  1W4S A;  3JCM f;  1M2V B;  1WX6 A;  5KE2 A;  1JJ2 A;  1M1G A;  1TS9 A;  1FWZ A;  4CC2 A;  3CC7 A;  3A8G B;  1BB9 A;  2K5I A;  2C06 A;  1VQ9 A;  4QQG A;  1JQQ A;  5A0G A;  2A08 A;  2CP6 A;  2QQB A;  3HSB A;  1U5S A;  2KSS A;  3CQT A;  2DXB A;  3GLX A;  4M7D E;  2CSI A;  5IN1 A;  3P8H A;  1QVG A;  2MYS A;  4C92 G;  4DOW A;  2JTM A;  2X51 A;  5CQY A;  3PIO A;  4MMK A;  1IGQ A;  2VYT A;  1M90 U;  4OGC A;  1Y07 A;  2F1L A;  4F17 A;  2EGE A;  2H3J A;  4CC3 A;  3QHS A;  2JUF A;  3EG3 A;  2A28 A;  3VYH B;  5IAY A;  4Y92 A;  2V1Q A;  5DLQ E;  1T0H A;  4FM4 B;  3QBY A;  1Q81 C;  3INZ A;  4K11 A;  1ZSZ C;  4R56 A;  4BI4 A;  3J81 E;  3GOX A;  4E7K A;  4ZGD B;  3H9N A;  4M77 A;  3X20 B;  4DBQ A;  2D8J A;  2XU8 A;  2OTL A;  1M27 C;  4BB7 A;  3G4S A;  2YRD A;  5CKB A;  2OAW A;  4XTU A;  1R8O B;  2LMJ A;  1BKB A;  2J6O A;  2DIG A;  4JRP A;  3OMC A;  3RNJ A;  5KCH A;  1WHK A;  4EMK A;  3CC4 T;  1ABQ A;  3C12 A;  5I11 A;  3AT1 B;  4LE9 A;  1EFN A;  4N0A A;  1X75 C;  4EPC A;  3QYH B;  1ZBJ A;  2XI9 A;  3BW1 A;  3CCR A;  2ECZ A;  5LJ5 g;  4MML A;  4EMH A;  5L8R E;  2E65 A;  2QDL A;  4C8Q E;  1C1A A;  3CBM A;  2Y4Y A;  2ED1 A;  1HD3 A;  2LCL A;  5CAI A;  2E4H A;  3CPW P;  2V8K A;  4ZGJ B;  3EH1 A;  3X24 B;  5FU7 C;  4LUD A;  1G3W A;  3PGG A;  3PMI A;  1RLQ C;  3CCU A;  3M5A A;  1UGP B;  2LQK A;  1G2B A;  4DEY A;  4J9B A;  2PUK B;  2SEM A;  2W10 A;  3I55 A;  1Y71 A;  2O4X B;  4OP0 A;  1QVG S;  4N4G A;  3CC4 Q;  4J9C A;  4X34 A;  2QK0 A;  2ZAE A;  4XTY A;  2F2W A;  1I5L A;  3EG0 A;  4CC7 A;  4JJB A;  1X69 A;  1PKT A;  1YI2 A;  2CKK A;  4BY6 C;  3FIF A;  4FYX B;  3OYI A;  4DQ2 A;  4C5I A;  4M75 E;  4GY5 A;  3CCV Q;  1ZA1 B;  2VV5 A;  1FXX A;  2KRM A;  4II1 A;  5HK3 A;  5FWB A;  4NL2 A;  3S6W A;  4OF1 A;  2GF7 A;  1AOJ A;  1HK9 A;  2DIQ A;  2BE7 D;  2FRW A;  1NM7 A;  1S72 A;  3JRZ A;  3CCQ T;  4J6Y A;  2RJC A;  4F7U B;  4E7S A;  1IRX A;  4L5G A;  2KNB B;  1W6X A;  2VVK A;  3TSW A;  3CCM T;  4XU3 A;  3M0R A;  4IUP A;  2ZPB B;  2FRY A;  4Z89 A;  3HRS A;  1VYU A;  2YRV A;  4PL6 A;  5IHK A;  1PHT A;  3JCM V;  1PRM C;  4D8D A;  2V8I A;  5LJ3 f;  3D7S B;  1IRE B;  4M77 C;  3CCL Q;  2DEU A;  3G71 T;  1TU0 B;  2L3R A;  1WHM A;  3QZ5 B;  2EWN A;  5LJ5 h;  5LJ5 j;  4OMP A;  3I56 Q;  3CCQ Q;  1YIT A;  3T9N A;  2VXE A;  2VWF A;  1D1C A;  4FIB A;  1TSF A;  1RAI B;  4EMK C;  4M77 F;  5HY6 A;  2XDB A;  2R5A A;  3VU3 C;  1VQN A;  3FEO A;  4N0A C;  4OMN A;  3H0F A;  2ROL A;  4JS4 A;  1YJN A;  4M7A E;  2AK5 A;  1WHH A;  1RL2 A;  4M77 D;  5GAO p;  2E10 A;  4E7L A;  3G71 Q;  2HCK A;  3OYF A;  4E47 A;  2KK4 A;  1Q86 R;  2GBQ A;  4LXC A;  5KE3 A;  3JB9 I;  4F7U G;  5J26 A;  5DLO A;  4GBQ A;  4JPB W;  1VYT A;  3MEV A;  1ABO A;  2KR3 A;  3VRZ A;  1AZE A;  1HSQ A;  2XK0 A;  2QAS A;  1QQJ A;  5L23 A;  1VQ9 T;  3OS0 A;  3GF5 A;  2F5K A;  2JS0 A;  2OAU A;  3LGL A;  1B34 A;  1H92 A;  3OYL A;  1OQK A;  3CEY A;  2OTJ A;  3JCM g;  4BDZ A;  5A2Q E;  4HCC A;  3TCJ A;  1KIK A;  2RQW A;  3I5R A;  1ZUY A;  2JTE A;  4M75 B;  2FZC B;  2R57 A;  2CSQ A;  1K73 U;  2ZPF B;  4E7J A;  4PKC C;  2RHY A;  3V8J A;  4KUD K;  4X9C A;  2D8H A;  2K3B A;  4OVA A;  3OW2 A;  2LTO A;  1UJY A;  5FRM A;  2E12 A;  2EQI A;  3UDC A;  1NJI U;  2RHU A;  4FCY A;  2YSQ A;  3CC7 Q;  1KC8 U;  1TTH B;  1A0N B;  2J7I A;  3QSU A;  1Z9Z A;  3MKD A;  4BDY A;  1Q95 G;  1LNX A;  1KHI A;  4HCK A;  1X43 A;  4PJO A;  1TG0 A;  1D3B A;  1QVP A;  5GAN f;  4M78 E;  3HKS A;  4MZM A;  4GLM A;  2O01 E;  1OX8 A;  2NUZ A;  4E2F B;  3GNF B;  3OS1 A;  3UA6 A;  2RNA A;  2OTL T;  1D0Y A;  1VQ4 Q;  3QO3 A;  3G4S T;  5GAN 2;  2PTK A;  2OI3 A;  3QJY A;  2AKK A;  2X3W D;  4N4H A;  5DM7 R;  1RAH B;  3OYK A;  3CXC A;  3V7C A;  2EW3 A;  1K0X A;  3NMZ C;  4LDY A;  1VYV A;  2GTJ A;  4QVD A;  4DBR A;  2X9H A;  5CKD A;  3M55 A;  3CPW A;  1D1A A;  1PRL C;  2EKO A;  1NYG A;  2AZV A;  3J7A F;  3FJ5 A;  4MZP A;  3ZL7 C;  3CCR T;  1QKX A;  3VS2 A;  4QT7 A;  3THK A;  1JO8 A;  4HT9 A;  4XK8 E;  1FMW A;  2MWO A;  1QP3 A;  1U1S A;  1QVF P;  2FL7 A;  3CCU T;  1QCF A;  2DXC A;  2EQK A;  2NUT A;  1PCX A;  1HYO A;  2NUP A;  3OYB A;  4JS5 A;  5EC7 A;  1JRI A;  4JRQ A;  5GAM d;  3LYI A;  3BFM A;  3I55 T;  4M7D F;  4FSX A;  4HXJ A;  3TVT A;  2A0F B;  1WQ7 A;  5GMK m;  2R5M A;  2GNC A;  2EKH A;  5I2S A;  1KD1 R;  1QLY A;  2FZK B;  4C92 E;  3CCR Q;  2DIL A;  4JRI A;  1YI2 T;  2DK3 A;  1Y96 A;  3MP1 A;  2CZ7 B;  1M1K U;  4WTO B;  3RMS A;  1NJI R;  2KVQ G;  1T0J A;  3FDR A;  4L59 A;  4OGE A;  3OS2 A;  3PE0 A;  1WGS A;  2MWP A;  3WVE B;  1UHF A;  1BI0 A;  2DL8 A;  4J6W A;  2M02 A;  1K9A A;  4MDW A;  3H0H A;  3I55 Q;  2FPE A;  1S72 T;  4Y28 E;  4LDV A;  2RM4 A;  1P92 A;  2DTH A;  2EQU A;  2RA2 A;  2CH4 W;  1W2B A;  4Z8A A;  5KYW B;  2PNI A;  2B8A A;  3GP8 A;  2LCC A;  3NPF A;  4C8Q C;  1E7O A;  2BUD A;  1PNJ A;  3LH0 A;  3PVL A;  1YI2 Q;  2EYW A;  3RUX A;  1WHL A;  4PJO C;  1XOV A;  2E6N A;  2JVV A;  4J9E A;  5GAM e;  1VQM A;  4QVZ A;  2HAX A;  1KQ2 A;  3TSZ A;  4C8Q F;  1MHN A;  1EIF A;  4J9D A;  4BE0 A;  4A4K A;  3IQL A;  1K73 C;  3QG1 A;  2QQR A;  2X35 A;  1S72 Q;  4NS5 A;  2L0A A;  4PJO F;  2P84 A;  3QXE B;  2MCN A;  4C8Q D;  1NJI C;  1M9S A;  5I22 A;  2DPP B;  4PLI A;  1KC8 C;  3MO8 A;  2KEA A;  2QAZ A;  4ZN1 A;  3C4S A;  2E1H A;  1BK2 A;  1NE8 A;  2MI6 A;  4A53 A;  3QPH A;  2DER A;  2HQX A;  1VQN T;  4XQ3 A;  1K8A U;  1VQ8 A;  1U3O A;  4PJO D;  1YJN T; 
#chains in the Genus database with same CATH homology
 3CPF A;  2XIC A;  3JAM E;  2LDM A;  3CC2 T;  3INZ A;  4IUT A;  4R56 A;  4C5G A;  4PJO G;  4BI4 A;  3J81 E;  2RI3 A;  3GOX A;  4FT4 A;  3E9G A;  4E7K A;  4ZGD B;  3JCM J;  3S3M A;  2DVE A;  2KDS A;  3NTH A;  3OBW A;  3CCE A;  4XTZ A;  3TRE A;  4M77 A;  3X20 B;  2DO3 A;  1VIE A;  4F7U A;  3PMT A;  2XU8 A;  3OBY A;  3HL8 A;  3C95 A;  1X01 A;  4O6J A;  2OTL A;  4BB7 A;  2VGN A;  3DB3 A;  5CKE A;  4EDU A;  3G4S A;  4HKE A;  1DJ7 B;  5CKB A;  4ZN3 A;  1Y96 B;  4XTU A;  1R8O B;  1BKB A;  3MET A;  3UPU A;  4JLG A;  2LC4 A;  1GXI E;  2EQM A;  2DIG A;  4NL3 A;  2ZGW A;  4JRP A;  3OMC A;  2QXF A;  1VQ5 T;  3HRT A;  4HCB A;  5I21 A;  2ZPG B;  1LOJ A;  5LL6 S;  3RKY A;  3CCJ T;  2QA4 A;  1NZ9 A;  2HD0 A;  2QDY B;  4XU1 A;  5KCH A;  4ELZ C;  5GMK l;  5GAO m;  2Y90 A;  4EMK A;  3CC4 T;  3JCM h;  4F7U F;  2PU9 B;  4B9X A;  2RJF A;  2K57 A;  3C12 A;  1VQ6 A;  2ZPE B;  1VQL T;  3SWN A;  2KQW A;  4N0A A;  1X75 C;  4EPC A;  3QYH B;  2XI9 A;  3BW1 A;  3FLG A;  3GPL A;  1X6O A;  4RMO A;  3DLL A;  3CCR A;  2M0O A;  3RER A;  4OMF B;  5LJ5 g;  4M7D D;  1VQP A;  1PSE A;  1YIJ A;  4MML A;  4EMH A;  4LDW A;  3OY9 A;  5L8R E;  2RJE A;  2RHZ A;  2E65 A;  4C8Q E;  4C8Q B;  3CBM A;  2Y4Y A;  4M7D G;  3QII A;  3CD6 T;  4KUL A;  2PVO B;  2LCL A;  3VUZ A;  3HFN A;  3L1A A;  5CAI A;  4ATO A;  2E6Z A;  4J5Y A;  2PVG B;  2V8K A;  5D6Y A;  4ZGJ B;  3A8H B;  4J7F A;  3X24 B;  5FU7 C;  3M53 A;  3CME A;  1G3W A;  3PGG A;  3PMI A;  3CCU A;  2QEX A;  3HRU A;  3M5A A;  3QUI A;  1UGP B;  2LQK A;  2XD0 A;  4PJO B;  1I4K 1;  2E70 A;  3A8M B;  1VQK A;  1WJR A;  3L2R A;  3M54 A;  4E7H A;  2DJZ A;  2PUK B;  3M4G A;  3CC7 T;  4LD9 K;  3GIB A;  1YHQ T;  2JN0 A;  3I55 A;  3L2W A;  1Y71 A;  1KQS S;  4M7A A;  2DXT A;  4GLK A;  2O4X B;  4L6V 5;  4OP0 A;  1QVG S;  3JB9 H;  4N4G A;  3VUB A;  2EJF A;  2MF2 A;  1Q82 U;  3SB2 A;  1G5V A;  2M16 A;  1VQ7 T;  2CZ0 B;  2P0K A;  4X34 A;  4C5H A;  3P8D A;  4XTY A;  1UGR B;  4EMG A;  1I5L A;  3L2Z A;  2ZCF B;  3RMQ A;  4M7D C;  2L8D A;  1M1K C;  3OA6 A;  3OQ5 A;  3UT1 A;  2Y4X A;  4FU6 A;  3ZFJ A;  1YI2 A;  3X26 B;  1VQ4 T;  5LJ3 j;  1KD1 U;  2CKK A;  3QKJ A;  3FIF A;  3KUF A;  2RK2 A;  2AHJ B;  4BY6 C;  4DQ2 A;  4XU2 A;  2PUO B;  1ZHI A;  2DAQ A;  4C5I A;  4M7A F;  1BYM A;  2GFU A;  4M75 E;  4GY5 A;  5GAN g;  2VV5 A;  5CQX A;  5A0L A;  3CCV A;  1FXX A;  2DXU A;  4II1 A;  2RK1 A;  4PNO A;  5HK3 A;  2WSE E;  2GFA A;  5KH6 A;  4NL2 A;  3S6W A;  4OF1 A;  1N27 A;  3JCM b;  2XDD A;  1BIB A;  2GF7 A;  1YJW A;  5GAO r;  4M7A D;  3MP6 A;  2GCX A;  1WJQ A;  1HK9 A;  2DIQ A;  2XKO C;  4A54 A;  2CYZ B;  3MEU A;  5GAN 4;  1KQS A;  5LJ3 d;  1S72 A;  3JRZ A;  1ZBX A;  1LJO A;  2HQE A;  3EFS A;  4M77 E;  4UC4 A;  3CCQ T;  4F7U E;  2YLC A;  4J6Y A;  2RJC A;  4F7U B;  5CCA A;  5IT9 E;  5LJ3 g;  1O75 A;  4C5E A;  2XG8 D;  4RCB A;  4KUI A;  3OS5 A;  2VUB A;  3QYG B;  3PNW C;  3OSS C;  1M4Z A;  2VXF A;  4L5G A;  3Q1J A;  3CCE T;  3SFM A;  1Q86 C;  4M75 C;  4M75 A;  4BI3 A;  4KBM B;  4MZT A;  3V8K A;  4ELY C;  3CCM T;  3MCA B;  4XU3 A;  4C8Q G;  4IUP A;  4BI8 B;  2ZPB B;  3HRS A;  2YRV A;  4A4H A;  3M59 A;  4PL6 A;  3JCM V;  2G3R A;  5GAN 6;  4EMK B;  3DKM A;  4FL6 A;  3OYN A;  2V8I A;  5LJ3 f;  1IRE B;  2XHC A;  3BDU A;  1OZ3 A;  3OYY A;  4M77 C;  4VUB A;  3CBP A;  3OYG A;  3G71 T;  3PTA A;  3JCM c;  2L3R A;  1O9S A;  4M75 F;  1YCY A;  3M56 A;  2RHI A;  3QZ5 B;  3OYD A;  2EWN A;  4M78 C;  5FRN A;  4M78 A;  5LJ5 h;  5LJ5 j;  3JCM P;  5GAO q;  3SDZ A;  3PIP A;  2A7Y A;  3JB9 J;  3ZBD A;  2FVU A;  4C0D C;  4ZGE B;  1YIT A;  5CKH A;  1IZ6 A;  4O5V A;  3T9N A;  3I56 A;  2VXE A;  4B9W A;  3JB9 F;  5GAM j;  1G3T A;  4M75 D;  1M8V A;  1K8A C;  5M9O A;  3BDL A;  4FIB A;  3F70 A;  5GMK i;  5FU7 B;  3QJ6 A;  4CRI A;  5GAO n;  5GAO l;  4EMK C;  2K5L A;  4M77 F;  5CKF A;  5HY6 A;  1VQO T;  2LT1 A;  2XDB A;  2R5A A;  3VU3 C;  4MDX A;  1VQN A;  3SWN C;  4M78 F;  4JJN K;  3FEO A;  4M75 G;  4N0A C;  1OYX A;  1QP2 A;  5LJ5 d;  4XTX A;  4FT2 A;  3WXM B;  1K9M U;  4JS4 A;  2QEX T;  1YJN A;  4M7A E;  4M7A B;  1YJ9 T;  2LNV A;  3CMA A;  1Q7Y U;  3VV0 A;  2E41 A;  3OYA A;  3E1S A;  1RL2 A;  4M77 D;  5LJ3 e;  5GAO p;  4HT8 A;  5AYF A;  4DOV A;  2E10 A;  3R6O A;  4QW2 A;  4E7L A;  3UWN A;  3OYH A;  2V8J A;  3L2U A;  1NPR A;  4M78 D;  3X28 B;  3TU4 K;  3JSC A;  2I2L A;  5GAM g;  3OYF A;  4E47 A;  3M57 A;  2KK4 A;  2BKD N;  3J80 E;  5I2M A;  4M77 G;  5CO7 A;  1UGS B;  1XTD A;  3NFC A;  4F7U G;  5KE3 A;  2JZ2 A;  3JB9 I;  3LWI A;  5J26 A;  5CVI A;  5DLO A;  3OW2 S;  3DLM A;  1BI1 A;  3ER0 A;  4Z02 A;  2GQV A;  3MEV A;  3P8B B;  4XTW A;  3V7S A;  2LT4 A;  4BY6 B;  4BAC A;  2LX9 A;  1QVF S;  3EFR A;  2K5F A;  2EJG A;  3WVD B;  4D6W A;  3GNG A;  5LJ5 f;  5GAN h;  5GAN j;  2HBP A;  1AHJ B;  2XK0 A;  1M1F A;  1N8R U;  4M7A C;  4X9D A;  1VQ9 T;  3OS0 A;  3CCJ A;  3GF5 A;  2F5K A;  5J3B A;  3FRN A;  4HCZ A;  4OB1 B;  3BY7 A;  2OAU A;  1VQM T;  3CC4 A;  2K2V A;  2X4W A;  4YTL A;  3LGL A;  1B34 A;  3X25 B;  5GAM f;  2WSC E;  3OYL A;  3H8Z A;  5FRO A;  3CEY A;  1VQL A;  1U1T A;  2JTF A;  3OYE A;  2OTJ A;  5GMK j;  4XTV A;  3JCM g;  1QW1 A;  4QVC A;  4JRK A;  3EAE A;  2NLU A;  4BUG A;  1BIA A;  1MGQ A;  3RKW A;  5A2Q E;  4BDZ A;  2DZ9 A;  5LJ3 h;  4HCC A;  5GAN d;  4C92 A;  3TCJ A;  5CR2 A;  4E7I A;  3V8L A;  5EG2 A;  2M9U A;  4J83 A;  4R55 A;  1U8R A;  4M75 B;  2R57 A;  5D6W A;  1K73 U;  3MEW A;  2FHD A;  2ZPF B;  4E7J A;  2QQS A;  3CXC S;  3CD6 A;  1OI1 A;  3HHT B;  3NTK A;  3QDR B;  2RHY A;  4PKC C;  4RG8 A;  4X9C A;  3V8J A;  4KUD K;  4OVA A;  3OW2 A;  2D9T A;  2LTO A;  5FRM A;  3JCM Q;  2E12 A;  3E19 A;  3UDC A;  1QVF A;  4A4E A;  1NJI U;  3CPW S;  2RHU A;  3ASK A;  4QQD A;  4ME7 A;  5LJ5 e;  3OYM A;  1Q82 C;  1VQ8 T;  1VUB A;  1KC8 U;  3QSU A;  4KT0 E;  3G6E T;  3L2V A;  2HNI A;  3CCS T;  4BDY A;  4WF2 A;  4JUV A;  4C92 F;  1YHQ A;  2EIF A;  2M1H A;  1LNX A;  1KHI A;  2CZ6 B;  1UB4 A;  2DEQ A;  2LQ8 A;  1BI3 A;  2YLB A;  4M77 B;  4PJO A;  4C0Z A;  1D3B A;  1WNL A;  2RD1 A;  1QVP A;  2X4J A;  4M7A G;  5GAN f;  4NOY A;  1VQ7 A;  4M78 E;  3HKS A;  3M4Y A;  3A8O B;  2EQJ A;  4M78 B;  4MZM A;  1G3S A;  2DTI A;  2O01 E;  4OB3 B;  2CZ1 B;  1Y7X A;  2PQW A;  1JBM A;  1FX7 A;  2O4X A;  3M58 A;  3RKX A;  1KD1 C;  3HFO A;  1Q81 U;  3GNF B;  3OS1 A;  4C92 D;  4C0D B;  2OTL T;  3KXT A;  3URG A;  3FC3 A;  3QO3 A;  3G4S T;  1OZ2 A;  5GAN 2;  2DD5 A;  3L2Q A;  3QJY A;  1VQ4 A;  3JB9 D;  2X4X A;  3L42 A;  4BE1 A;  2LVM A;  3JCM W;  2K3Y A;  1YIT T;  2KMT A;  4N4H A;  1N9S A;  4OB0 B;  4RKU E;  5DM7 R;  1H3Z A;  2DZC A;  4J6X A;  3OYK A;  3CXC A;  1KHC A;  3V7C A;  1KG1 A;  3KBG A;  2RHX A;  4IKF A;  2D0Q B;  3SWN B;  2QA4 T;  4IUQ A;  1N9R A;  4LD6 A;  4PLL A;  3JB9 G;  4LDY A;  3CCL A;  1VIF A;  4QVD A;  5CKD A;  1NPP A;  3M55 A;  3PFS A;  3CPW A;  1VQ6 T;  2A3L A;  2XID A;  2EKO A;  4Q5W A;  4A4G A;  4ZTJ A;  5GAN 5;  3J7A F;  3VJP A;  5C6S A;  3FJP A;  2EAY A;  2DKG A;  4MZP A;  3CCR T;  1M90 C;  2ZZD A;  2DTO A;  1VQP T;  3CCQ A;  4TVR A;  3HP9 A;  1YIJ T;  4XU0 A;  1TH7 A;  5GAN e;  1WPY A;  5GAM h;  2D6F A;  2P0Q A;  1WJS A;  4M7D A;  2CGH A;  2VGM A;  4HT9 A;  2MAM A;  2QQA A;  4XK8 E;  5FU6 C;  3CCM A;  1BI2 A;  1H64 1;  1UEB A;  2MWO A;  1XNI A;  1QP3 A;  4FM4 B;  2EFI A;  1U1S A;  2IG0 A;  2LRQ A;  5CK9 A;  4IUR A;  2FL7 A;  3RES A;  3CME T;  5GMK e;  3CCU T;  4LDX A;  4JLI A;  2WSF E;  5GAN 3;  2DXC A;  2EQK A;  4IUV A;  1VQK T;  3O8V A;  4RCC A;  2QI2 A;  3HPW A;  5FLX E;  3OYB A;  4C0G A;  4JS5 A;  3CC2 A;  5A0D A;  5C0M A;  1B34 B;  1JRI A;  2F5T X;  1I81 A;  4JRQ A;  5GAM d;  3LYI A;  3BFM A;  3RIR A;  3I55 T;  2ZPH B;  3A5Z B;  2ZPI B;  4FSX A;  1RI0 A;  4M7D F;  2RH2 A;  3SD4 A;  2QTX A;  1WQ7 A;  3G71 A;  2KY9 A;  5GMK m;  2R5M A;  3ZEH A;  1W2B S;  5I2S A;  4CI0 C;  3LWH A;  2IVW A;  2K4Y A;  4Y91 A;  2L89 A;  4C92 E;  3OYJ A;  3M9Q A;  3PT9 A;  4C92 B;  2OTJ T;  2YHT A;  3CBO A;  4M78 G;  2RJD A;  2WAC A;  4JRI A;  4OB2 B;  4XAX B;  4ZTF A;  2EYQ A;  4C0F A;  4BE2 A;  1JJ2 S;  1YI2 T;  2F69 A;  2DD4 A;  1UGQ B;  2DK3 A;  1Y96 A;  1VQ5 A;  2X4Y A;  4IUU A;  3MP1 A;  2CZ7 B;  1M1K U;  3RMS A;  1PSF A;  1YBY A;  3LGF A;  2KVQ G;  1K9M C;  1N6A A;  1XQH A;  2R58 A;  3MP8 A;  5CIU A;  3CCV T;  1VQO A;  2XDP A;  5J39 A;  3FDR A;  4L59 A;  1Q7Y C;  4OGE A;  3JCM d;  2E5Q A;  3OS2 A;  2FYK A;  5GMK h;  1WGS A;  2MWP A;  3OB9 A;  3WVE B;  4QQ6 A;  1YJW T;  3S3N A;  3LX7 A;  1YJ9 A;  4PJO E;  1BI0 A;  2CS7 A;  4J6W A;  3AHU A;  1D3B B;  4MDW A;  3OYC A;  4C92 C;  5GAN 8;  3DB4 A;  1S72 T;  1M5Q 1;  1Q81 C;  4BD3 A;  4J7I A;  5D6X A;  3LW5 E;  4RG2 A;  4LDU A;  4Y28 E;  2P4T A;  4LDV A;  3OMG A;  2RM4 A;  1P92 A;  2DTH A;  2EQU A;  2RA2 A;  5HK0 A;  1W2B A;  3NTI A;  2B8A A;  3GP8 A;  2LCC A;  4C8Q C;  4C8Q A;  5GAN 7;  3FB9 A;  5DY9 A;  1N8R C;  1W4S A;  2BUD A;  4DA4 A;  3QZ9 B;  3LH0 A;  3JCM f;  3MHX A;  5KE2 A;  3OSV A;  1JB0 E;  3TEE A;  1JJ2 A;  1M1G A;  1FWZ A;  3RUX A;  3CC7 A;  2K3X A;  1Q86 U;  3A8G B;  2K5I A;  2C06 A;  3OYI A;  1VQ9 A;  4PJO C;  4QQG A;  3G7Z A;  2RI2 A;  2PVD B;  5A0G A;  1XOV A;  2E6N A;  2JVV A;  3A8L B;  3H6Z A;  5GAM e;  1KQ1 A;  3LLR A;  1HXD A;  1VQM A;  4QVZ A;  2JOY A;  2RO0 A;  5HKC A;  2HAX A;  1KQ2 A;  2KAF A;  2MMP A;  2E64 A;  2QQB A;  3V7R A;  4C8Q F;  3N5B B;  3VKI A;  3CCL T;  3HSB A;  1SSF A;  2P0P A;  2EJ9 A;  1MHN A;  3ME9 A;  1EIF A;  4BE0 A;  4A4K A;  2KSS A;  1K73 C;  2QQ9 A;  1G3Y A;  2JNG A;  2QQR A;  2DXB A;  1WQW A;  1I8F A;  2X35 A;  3GLX A;  3QG1 A;  4V2S A;  4M7D E;  4M7D B;  4HA8 A;  4NS5 A;  2VC8 A;  5IN1 A;  3P8H A;  3I56 T;  1QVG A;  3C94 A;  4PJO F;  4A4F A;  4C92 G;  3QXE B;  3E9F A;  5FU6 B;  4DOW A;  4C8Q D;  2JTM A;  1NJI C;  1M9S A;  2L5Q A;  1V29 B;  2DPP B;  4PLI A;  5CQY A;  3MEA A;  1ZQ1 A;  4MMK A;  3PIO A;  2VYT A;  1KC8 C;  1M90 U;  3MO8 A;  2RB6 A;  1Y07 A;  4OGC A;  2BIV A;  5KCO A;  4ZN1 A;  3C4S A;  2E1H A;  1NE8 A;  2H3J A;  2MI6 A;  4A53 A;  3JCM e;  3QPH A;  4JDS A;  3JCM X;  4J8O A;  2HQX A;  1VQN T;  4XQ3 A;  1K8A U;  1VQ8 A;  3QHS A;  2JUF A;  4PJO D;  2RI5 A;  3VYH B;  5IAY A;  3G6E A;  1YJN T;  3CCS A;  3S3O A;  3VYG A;  3CMA T;  4P5N A;  4N4I A;  5DLQ E;  3QBY A;  2FB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...