2LQKA

Nmr solution structure of the n-terminal domain of the cdnl protein from thermus thermophilus
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
b'AGHMKEFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title NMR structure note: N-terminal domain of Thermus thermophilus CdnL.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription regulator
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2012-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lqkA00
2LT4A 2EYQA 4XAXB 2LQKA 4KBMB 4L5GA 2LT1A
chains in the Genus database with same CATH superfamily
4E7IA 1K73R 4RTZA 1OQKA 2E6NA 3WVEB 4C5GA 1SRLA 2PNIA 2AKLA 2VWFA 1X69A 1M2OA 3CXCA 3EGUA 4NL2A 4BE0A 2XI9A 1MNDA 2D1XA 2YXYA 3BDUA 3A8GB 1SHGA 2BUDA 2EPDA 1FMVA 2A36A 4E6RA 3QSUA 4PJOF 2I2LA 3CPWS 4HCBA 3WXMB 3HHTB 1Q82U 3DLLA 2Y4YA 1WDXA 1TOVA 2LQ8A 4JJDA 2E4HA 1K9MC 2DIQA 2CUBA 2J06A 4C92F 1W2BA 2DL8A 2VUBA 5GAOn 2E6ZA 2V8KA 1TTHB 1WHGA 1Q86C 4HXJA 3CCMQ 4E7HA 2JJ9A 2K5LA 4J83A 4C5EA 3F70A 5CQYA 2FPEA 4Q5WA 1IO6A 4PJMA 3THKA 4F17A 1K4US 1B34B 2VB6A 4BE2A 1I8FA 2KROA 1ZSGA 1JJ2S 2ZAEA 3QBYA 1YJNQ 1YCYA 4M78F 1FMWA 4XQ3A 4KRTA 2RHIA 3RKXA 2DXTA 2QGFB 4CC2A 2K5FA 3SWNC 2COYA 1TXQA 2L5QA 5LJ3e 4M75F 2OTLA 3BFMA 1KJWA 1MMGA 1PCXA 3EG2A 2G3RA 3M0RA 2RO0A 2EJ9A 2FRWA 2KE9A 1ZHIA 2CDTA 1M30A 2HZYA 3M55A 2XICA 1H3HA 2LX7A 4PJLA 4DBFA 4GY5A 3A98A 1QKWA 4AG1C 1ZUKA 4DEXA 3GOXA 4C0FA 3M56A 2JW4A 1YN8A 1VQ8A 3FIFA 2CS7A 2CP5A 2F2WA 4R0KA 3OYFA 4DOVA 1JO8A 3P8BB 2GTJA 3LGLA 1AD5A 1E7OA 3GF5A 2RK1A 1CKBA 2COWA 4RG2A 2XDPA 1X01A 1OX8A 1V76A 2KR3A 2K5IA 1RLPC 2D8JA 3HPWA 2OTLT 2K6DA 2A28A 4AG2C 5I2SA 2JT4A 5KYUB 1YBYA 3CCLQ 2CT4A 1GFDA 2MWPA 3T9NA 4OP0A 2RF0A 4J6XA 1NJIU 1WQ7A 1VYVA 3LX7A 4RTWA 4WCIA 4ZTFA 3PMIA 4X9DA 4M7DC 2KT1A 1QWFA 2CZ7B 5LJ3h 4EMKC 3CCRQ 2IIMA 4J9BA 1VQ8T 4JLIA 2JVVA 1G3TA 3RMSA 3JCMf 2QQ9A 1Q82R 1C0MA 3I55A 2F69A 3QUIA 4RG8A 3PVLA 1KHCA 2L3QA 2M02A 1B34A 1UJ0A 3QWXX 2CREA 3KUFA 2YSQA 3H41A 4M7AG 3OYGA 2FL7A 5D6WA 5LJ5j 3JSCA 5CQXA 1Y96B 1UUEA 1AZGB 1RI0A 3CCEQ 1VQ6Q 3CCVA 4BDYA 1AZEA 4HA8A 4EMHA 4IUQA 2RHYA 3OYEA 2EAYA 1T0JA 1ZX6A 3CD6Q 3OY9A 1WPYA 2JM9A 1UTIA 1G3SA 2RQWA 2A7YA 4TVRA 4PFZA 1C6VX 4IIOA 4M77G 3CC7Q 2HKNA 3JCMV 3CCUQ 3QDFA 1BIBA 2ZPBB 3I55T 4A4EA 3SWNA 1KFZA 3M58A 1BKBA 1Y71A 5AT1B 2JM8A 1KQ2A 4D8DA 1OU9A 2KRNA 3M9QA 3AHUA 2QASA 2L3PA 3CCJQ 3VV0A 4ANJA 4M7AC 2QAZA 3MP8A 1JXOA 2V8JA 1YITQ 4DOWA 4ZN3A 3EFSA 1RAEB 3M4YA 3BDLA 4AFUC 1OULA 1NEBA 1Q7YU 5IHIA 2ROTA 3C0CA 2MCNA 3CCVT 4EPCA 1M90C 1AWWA 3VS4A 3A5ZB 4HVWA 4JJNK 1WJQA 2GFUA 4C5IA 4F7UG 3L2VA 1YI2Q 2GCXA 5LJ3g 4AFZC 2CUDA 2M16A 1NJIR 2HDAA 2DO3A 2DPPB 3H0FA 4Y92A 4QW2A 2CP2A 3E9GA 1XQHA 1AWXA 1UGRB 1YJ9A 2DX1A 3SDZA 1PSEA 2ZPIB 2DKGA 5FU7C 1YHQA 1TS9A 2ATCB 1Y0MA 1IB8A 1HD3A 5KYXA 3OW2P 1NZ9A 4FSSA 2G6FX 3M0PA 1GCPA 3V8JA 2C0IA 1PHTA 4M7DA 5LJ3d 4L59A 1U1TA 2PU9B 4KGVB 1WYXA 2DD5A 2L8DA 4F04B 1QVPA 2K9GA 5GAMe 2EKOA 3EG9B 5GJVB 2PTKA 1Y96A 4CI0C 5GAOl 2GGRA 1WNLA 2HD0A 4N4HA 1VYTA 3UDCA 1GXIE 1QVFP 1JEGA 4BI4A 1YJ9T 3NGPA 1IGQA 5GAN7 2X35A 4PJOG 4B6MA 4LUEA 1YCSB 3OYMA 1YHQT 2KRSA 1B07A 2D0QB 3EH2A 1LVKA 2KVQG 2JXBA 2DETA 4LDUA 4RTTA 1VQ4A 1JQQA 1QWEA 1MV3A 3VYGA 4C92G 3E2UA 2RNAA 2M1HA 4PLLA 1MMDA 2M9UA 4XU0A 1N27A 3RUXA 3QYGB 2RI2A 3V8KA 2C0TA 1VQMQ 4JJBA 2K3BA 1WXUA 1WFWA 1IHVA 1ZSZB 5IXFA 4BACA 3HKSA 1SKUB 4M78G 1SEMA 4GBQA 2GNCA 3VS1A 2CSIA 2V8IA 3VS0A 4X9CA 1UB4A 2OJ2A 2QDLA 1RADB 2KAFA 5FW9A 4A4KA 2ZPFB 5GANg 2EQJA 3JCMc 1VQLT 1Q7YR 1WJSA 4M75G 2V26A 1PSFA 3OW2S 1PNJA 3A8HB 3S6WA 3CC4A 4XTUA 5LJ3j 1VA7A 4Z8AA 5GMKi 3OA6A 3L2RA 4PJOC 5GAMh 3FJ5A 1U3OA 1EZZB 4WTOB 2DTHA 3I35A 4MMKA 4M77D 3RKYA 1VYUA 2D6FA 4NOYA 1UGPB 1K73U 4C92C 1V29B 2KXDA 3UT1A 1VQ4T 3MPUB 2CYZB 3MKDA 3I56Q 1HSQA 4JRIA 2NUTA 5GANd 2O4XB 1YFNA 1YIJQ 1OPLA 2PZ1A 1QVFS 2OAUA 2L2PA 4M78C 1G3WA 4DEYA 2XHCA 1OOTA 5A2QE 2EJFA 1X43A 3EG9A 2KGTA 4JZ3A 3CC4T 3UPUA 2E5KA 1NJIC 4JDSA 2DZCA 3EHRA 1UECA 2EKHA 2LTOA 4HT9A 1MMNA 5CKHA 4MZPA 2QEXA 2KRMA 3FDRA 2QK0A 2LJ1A 1X6BA 4QT7A 1WHHA 1G2BA 5HK0A 1ABQA 1RI9A 1KQSP 2QA4T 5GAN6 2EVRA 4FSXA 5A0LA 1JRIA 1K76A 1MV0B 1NG2A 4FYWB 1SF9A 2FZCB 1XNIA 4BE1A 2ZCFB 2BTTA 2FZKB 3I9QA 3CPWP 4KBMB 2VGNA 2E3IA 3CCSA 2KXCA 4HT8A 2R58A 4OB1B 4E7KA 2ROLA 3JB9I 2I0NA 2C06A 2XU8A 1W4SA 2LQWA 3EAEA 1TU0B 2A08A 4II1A 1K8AR 1VQOQ 4B9XA 4BUGA 2DBMA 1VQNA 2MMPA 4C8QA 3CMAQ 2FO0A 1VQ5Q 1ZUYA 2HQHA 3VS5A 5KH6A 4HVVA 1JJ2P 2ED1A 2DEUA 2QEXT 1M5Q1 5GAMg 1AWOA 1N5ZA 2VVKA 2HKQB 4OB2B 3H6ZA 4ZGEB 3ZBDA 1WQWA 3DKMA 3UATA 4F14A 1WXTA 5HKCA 1KD1C 1M8MA 4RMOA 2RQUA 4NL3A 1WX6A 2DXBA 3X28B 1A0NB 1I07A 3JB9D 1JBMA 1R8OB 2BKDN 5GAOq 1GCQA 4EIKA 3CCST 2DLPA 1CKAA 3MP6A 2O4XA 2O31A 1WHMA 7AT1B 2KYMA 1KSWA 5GAMd 4IKFA 1GL5A 3OYJA 3A8MB 1ARKA 4C0DB 2GTOA 1VQNT 4M78D 1D0YA 2WSFE 1ZA1B 4LDYA 4DA4A 4IUPA 1KQSS 3FEOA 3SHWA 2LC4A 4FYVB 2DBKA 1F1BB 1G83A 2KEAA 3M53A 1AOJA 2KT8A 4M75D 1WI7A 3QWYA 5GJWB 2MK5A 2RJCA 1N8RU 3JB9F 1M1GA 3GBQA 2Y90A 2LJ3A 1I5OB 3TEEA 1IGUA 3RKWA 2DL5A 4KUIA 3GNGA 2FVUA 1TH7A 5C6SA 1R77A 1PD0A 2RPNA 1PKTA 3JCMQ 3KFVA 4OMNA 3TVTA 3G71A 4V2SA 3KBGA 4Z88A 1B3QA 3S3OA 1S72A 3M4GA 1UG1A 1GBRA 3G1JA 5LJ5f 2PUKB 1ZA2B 4N4GA 2MI6A 5D6XA 2RQVA 1Q81R 1G8XA 4ME7A 3JB9J 5I21A 1M4ZA 1K0SA 1HYOA 1QCNA 2HNIA 4PJNA 3MEUA 4GLKA 2CP0A 1D0ZA 4OGEA 3VRZA 2ED0A 2HQEA 2YRVA 2GBQA 4FYYB 3SEMA 1AEYA 5FWBA 1RLQC 2LQKA 3RIRA 3L2ZA 2SRCA 2WSEE 2WSCE 2D8HA 3OMGA 1VQPA 4ORZA 1OV3A 3QO3A 5GAMj 2M0YA 2HSEB 3JCMJ 1BYMA 2KBTA 2P0KA 2YRCA 2CP6A 2OTLQ 1M27C 3HTRA 2AZSA 3SWNB 2QG9B 3G71T 2ENMA 3X26B 1S72T 2XDDA 2EYQA 2M51A 2IG0A 3TQ7P 3JCMX 4AMCA 3MJXA 3OB9A 2O01E 4CC3A 5KYNA 3VS7A 3E9FA 1VQKA 4QKUA 4ELYC 5J39A 4AFQC 2CZ6B 1M2VB 3HSBA 5CO7A 1VQ8Q 5KE2A 2DVEA 1WHKA 1FXXA 2NYSA 1UGSB 4RKUE 4BB7A 2DILA 5HY6A 2DRKA 2DTIA 4ZN1A 4KUDK 4IUUA 2NUPB 1N9SA 1VQPT 3CCRA 2YLCA 1AHJB 4OMLA 1UFFA 2E12A 5KE3A 4QQ6A 4JPBW 2H3EB 3TSWA 3FLGA 4P5NA 2V1QA 1YJWA 1Z9ZA 2RHZA 3MCAB 4BI3A 2O88A 2L3RA 2R5MA 2BE9B 1N8RR 1LOJA 4FM4B 1ABOA 4D6WA 1K73C 1NPRA 5KYXB 2A0FB 1FMKA 3N5BB 3CCLT 2XIDA 1VQKT 4M7DE 2EIFA 4M7DB 2FPFA 1QW1A 5GANe 2DFUA 4IIMA 4EMKB 2DEQA 2E70A 2J7IA 2CKKA 2F2VA 5ECAA 4E7ZA 1IRXA 1VQ6A 1N6AA 2P4TA 2FPDA 1WHLA 2ZGWA 3HP9A 2CT3A 3I55Q 2JUFA 1QVGP 2FZGB 1PKSA 5IAYA 1QP3A 3CCRT 3RNJA 2DA9A 5IN1A 4AT1B 5GAN4 3M0UA 2QTVA 1VIFA 3S3MA 3QZ5B 1D0XA 1YJWT 1QVFA 1KG1A 4OGCA 2RD1A 5KCHA 2RH2A 3RERA 1NLOC 2K4YA 4JRPA 1AWJA 3H0IA 3M0SA 3X25B 2BZ8A 2HQXA 3L42A 2ECZA 3CCVQ 4XTVA 1CSKA 3BY7A 1RACB 4FCYA 2EQKA 5IT9E 2QQRA 3PT9A 2RHXA 2JS0A 3X20B 2IPOB 4J6WA 1PM3A 2DTOA 3VS3A 3EFOB 1YWPA 2EGEA 4RTUA 3CXCS 3RMQA 2DRMA 1VQ6T 1PRMC 2K2VA 3G4SA 2X3XD 2AT1B 2D9TA 1M2VA 4FT4A 1OI1A 5HCKA 2GFAA 4RUGA 2JS2A 3CPFA 5LJ3f 2AK5A 3QDRB 2EQIA 1SG5A 4C0GA 1H3ZA 2P0QA 5GANh 2NUPA 2ZPGB 1UGVA 3CCUT 3ZL7C 2MYSA 1M1KR 3CBOA 3P8HA 4M77C 5L23A 4ELZC 1W2BS 4A63B 1X6GA 3LH5A 4M7AB 1FYNA 1D1AA 4A53A 4DQ2A 5GAOr 4FT2A 1M1FA 4J9EA 4R55A 2E5QA 2MPXC 1X6OA 2P84A 3MEWA 1QVGS 1YITT 2DERA 2MIOA 2QDYB 3M0QA 4CRIA 2NUTB 1K9MU 6AT1B 3JV3A 2VV5A 1Q86U 3G7ZA 5HK3A 3G4ST 2VYTA 3UA7A 1NEGA 3EGDB 3LH0A 2X4JA 4EMKA 1RAGB 3PGGA 2XG8D 1YJ9Q 2EJGA 2R57A 1VQ9A 1U5SA 4PNOA 3E19A 1YHQQ 2DL7A 4FYXB 4F16A 3FRNA 1UDLA 5FU7B 2ZZDA 2F1LA 3TSZA 3I5SA 4E47A 2XMFA 1VQLA 3CCQA 1GRIA 1DJ7B 1WGSA 4B9WA 1SSHA 5FU6B 3LLRA 2QQBA 2O9SA 1X27A 2OTJA 3META 2LQNA 1Q82C 1WA7A 1KC8R 2XD0A 5EG2A 1T3LA 3SFMA 4M7DF 3PNWC 2LX9A 1KQSA 3JB9G 2HBPA 5LL6S 4OMFB 3PIOA 5AYFA 3FC3A 3DB3A 3BE3A 1ZSZC 3QJ6A 4QQDA 2GQVA 5D7UA 3ULRB 3CPWA 4J9DA 1K8AU 1BK2A 3EGXB 3EFOA 2DAQA 4FW2A 4OMMA 3ER0A 2L3SA 2HSPA 4JLGA 4NS5A 2K3XA 2MF2A 1VQ9T 1V1CA 2RB6A 3JRZA 4JS5A 1PWTA 2O9VA 4LN2A 1W6XA 5KCOA 3G6EA 4C8QE 2V1RA 4C8QB 3SD4A 3C95A 2EYZA 8AT1B 1O9SA 2RJEA 2VKNA 2K79A 3CCQT 1VQ4Q 3OYDA 4FL6A 2DNUA 3ME9A 1JJ2A 3M57A 2OTJT 1JU5C 3H8ZA 1VQ7A 4M7AA 3O5ZA 1UJYA 3VU3C 2E3HA 4MZTA 5GMKe 4XU1A 3H9NA 4J9CA 2JTEA 4C5HA 4DBQA 3CC2A 2COZA 3OYLA 1LPLA 2HEQA 4OB3B 4D8KA 2QA4A 1WJRA 2EQUA 3C94A 1D3BA 1RL2A 2RHUA 3CC4Q 1OEBA 3OYAA 1X75C 4M77A 1UHCA 2DM1A 4R56A 1UGQB 3EGDA 3OBYA 3V8LA 3LWIA 1K9MR 3G6ET 1TSFA 1Q86R 3OQ5A 2WACA 3A8LB 3HRTA 4M75C 4MDWA 3VJPA 1T0HA 4C92B 1HK9A 3TCJA 4VUBA 4M4ZA 3E1SA 2X4WA 2RJDA 2HL5C 1VQ7T 2CZ0B 1NYFA 3D7SB 2EQMA 4CC7A 1GBQA 3VS2A 3CC2T 3I56T 3CMEA 5KYWB 1WXBA 1KHIA 2QI2A 2DD4A 4BY6B 1X2QA 5GMKl 3V7RA 2RI5A 2VGMA 2RA2A 2BZYA 4HCZA 5CKBA 1Q81U 2YDLA 4XK8E 5GMKh 2DVJA 1YNZA 3PFSA 2OX7A 2QEXQ 4A4FA 3EGXA 3LW5E 4J9HA 2DXUA 2HMAA 1KQ1A 3GNFB 3M0TA 2PVGB 4C8QD 3FB9A 2YUQA 4O5VA 5GAMf 1UEBA 1NLPC 5GANj 1IZ6A 3OYKA 4RTVA 3OS5A 3CCSQ 4KH1B 1MHNA 2MWOA 1M9SA 1M90U 2L89A 3CQTA 5CCAA 3PTAA 3CMET 2L0AA 2LNHB 3C12A 4C0ZA 2CZ1B 1N9RA 1VQNQ 1PC0A 1QCOA 1UE9A 2XKOC 4EDUA 5KYYA 1R0BG 3NFCA 3LWHA 2E1HA 2FEIA 3JCMe 4HCCA 4JZ4A 2XDBA 1LJOA 2FYKA 2X3WD 4C8QF 3NPFA 4O6JA 3PE0A 1VQ5T 4J5YA 4PJOA 2K7AA 2LDMA 1U06A 5A0DA 1Z9QA 2EWNA 1PRLC 1ZBXA 2H3JA 1Q7YC 1M8VA 2DXCA 3MEAA 3VUBA 1I5LA 5DM7R 3OSSC 4C92A 1BI0A 5I2MA 3OYCA 3PVQA 1K0XA 3MO8A 4PFPA 5EC7A 4RCCA 1G5VA 3HFNA 4ZTJA 5I22A 2KSSA 4E7JA 1RUWA 2YUNA 3CCMA 2DIGA 2JMCA 1WZOA 4M78A 1SSFA 1AVZC 1LNXA 1ZLMA 5KYWA 3OS0A 4OMQA 3REBB 2DYBA 2CGHA 1TG0A 2EGCA 2AKKA 4ZNXA 1YJNA 2RQTA 4M75A 1YWOA 2X51A 1QQJA 3JAME 3ZEHA 4BD3A 1ACMB 4LDXA 4DBRA 3QZ9B 4XTWA 2Y4XA 1YP5A 2F5KA 2ZPEB 1U1SA 3R6NA 1D1BA 2QXFA 1K1ZA 4E2FB 2W0ZA 3JCMh 3A8OB 4OMOA 3WVDB 2QQAA 3EHQA 3G71Q 2CH4W 1QVGA 2BE7D 2KYBA 2MOXA 2LNVA 4PL6A 2F2XA 2DZ9A 1S72Q 4A54A 5IH2A 3I5RA 4N4IA 5M9OA 5LJ5g 2CSQA 3NTHA 3CCMT 4KULA 3OS2A 2LP5A 3R6OA 3OYIA 2YLBA 4PLIA 1NM7A 5A0GA 1M90R 1YJNT 5IHNA 2B8AA 2YUOA 5DY9A 1E6GA 3NTIA 3INZA 1IXDA 4FW1A 2DE0X 5GAN2 2ZPHB 4JRKA 4BDZA 1MUZA 4M7DG 3MEVA 5I11A 3J80E 1VQPQ 1NBEB 3RBBB 3CCLA 1VIEA 5LJ5d 5FRNA 1W70A 4XAXB 4QVDA 1K8AC 3PIPA 4A4HA 2E65A 1GFCA 1S1NA 3UWNA 4OB0B 1NYGA 1M1KU 4ZGDB 1R0CB 3FJPA 2EFIA 2H8HA 2JTMA 2EYYA 4L6V5 1C1AA 4ATOA 4QVZA 3GP8A 1TUGB 2DJZA 2QGGA 1J3TA 2FG0A 2FHDA 1W1FA 3CXCP 3H0HA 4KT0E 3GIBA 1VQKQ 1WIEA 4E7SA 4PFOA 4QQGA 1IHWA 2C0OA 1OPKA 2YHTA 3JCMP 3OSVA 3A1PA 3OYYA 4ESRA 4LD6A 4ZGJB 1TUDA 2KNBB 2A37A 2MAMA 1XTDA 4N0AC 2EGAA 3M5AA 4L5GA 3NMZC 2B86A 4J9IA 3VRYA 2LCLA 2PUOB 2EYXA 5FWCA 1SRMA 5GMKj 1W2BP 5CVIA 5GAOp 3OW2A 4XU2A 1BIAA 5CKFA 1M3CA 3OYHA 5CKEA 2RJFA 4MZMA 2W10A 4LE9A 1WLPB 2VXEA 1YJWQ 4J6YA 3JCMW 1RAIB 3CCEA 2LCSA 3JCMg 3VS6A 4CC4B 3J81E 3SB2A 4MMLA 3OBWA 1RAFB 1EIFA 3QYHB 3CD6A 4Z02A 5CR2A 4UC4A 3TU4K 1BB9A 2ABLA 4KGXB 3P8DA 1KC8U 4HVUA 2J05A 3EG3A 5GAN3 3DB4A 2EW3A 1QLYA 3CC7A 1JXMA 3S3NA 3CCUA 2O2OA 3M54A 3NHNA 5D6YA 4JUVA 1QMCA 3QJYA 3QKJA 4YTLA 3RESA 4X34A 3JCMd 2QQSA 1RAAB 3PMTA 1XOVA 3CCJA 1HJDA 3URGA 3CBMA 4LDWA 1KD1U 1YITA 1OZ3A 1X2KA 3NTKA 1D09B 1Q81C 1XJWB 1PG5B 2CP7A 4IUVA 3CCET 4A4GA 2LMJA 3KXTA 3QIIA 4XU3A 4JS4A 2QYZA 3CD6T 4Y91A 4K11A 2F5TX 1H8KA 2AHJB 2FRYA 1YI2A 2EYWA 1OU8A 1FWZA 3CC7T 5C0MA 4X1VA 3ZFJA 2DMOA 1LCKA 3QHSA 2GF7A 5KYUA 4M7AE 2BZXA 1B7TA 1P92A 4QVCA 1O75A 2P0PA 3G4SQ 4MDXA 2RQRA 3L2UA 3VYHB 4PKCC 5CIUA 3CCJT 2LCCA 2HAXA 4BI8B 1NE8A 2KI7A 1D3BB 2AZVA 5FLXE 2JZ2A 4M7DD 2X4YA 3EFRA 1BCMA 2GQIA 3OYBA 4M77E 2J6OA 2RI3A 5FROA 5GAN5 4M77B 1BCOA 1EX4A 5L8RE 1RABB 1JB0E 5DLQE 1WHJA 1YI2T 4C8QG 3L2QA 4HCKA 2ESWA 2VASA 4RTYA 1ZQ1A 1MMAA 4N0AA 5FU6C 1Y07A 5IXBA 1I4K1 2YWWA 2SEMA 4OVAA 1I1JA 1NPPA 4LD9K 4J9FA 2RMOA 4JJCA 4HKEA 4XTZA 3J7AF 1E6HA 1QKXA 5J26A 4WF2A 2LZ6B 1N8RC 2DK3A 3QXEB 2K3YA 5GAOm 1VQ9Q 4JRQA 2JMAA 9ATCB 4F7UE 4J8OA 1PD1A 3L2WA 1SPKA 4J9GA 4F7UB 1BBZA 2VC8A 1AT1B 1M3AA 2K2MA 1MGQA 1VQLQ 3REAB 3CCQQ 3VKIA 1VQMA 3GLXA 3OYNA 5GAN8 4C8QC 2R5AA 2OTJQ 3LYIA 1KD1R 3QG1A 1BI1A 2RK2A 3JB9H 5FRMA 1OX9A 5GANf 3L1AA 2K57A 4LUDA 3X24B 1U8RA 4J7FA 2XK0A 3UA6A 3TREA 1OZ2A 4E7LA 1MNEA 2JN0A 2YUPA 2X4XA 1IREB 1FX7A 1I81A 1H92A 1OYXA 2A3LA 1K9AA 3RDVA 4M7AD 2DF6A 2YT6A 1EFNA 3VUZA 1Y57A 4XTXA 4KH0B 1GCQC 3O8VA 1BI3A 2FB7A 3I56A 2HBWA 4KGZB 3G6EQ 5KYYB 1I0CA 2IVWA 4GLMA 4Z89A 3U23A 2JNGA 1VQMT 2RN8A 1YIJA 3V7SA 1VOMA 1D1CA 1VUBA 2X9HA 3Q1JA 5DLOA 4LXCA 2E10A 1RAHB 5CKDA 1VQ7Q 1QCFA 4PJOE 2D0NA 4FIBA 4PJOB 4FU6A 3UF4A 3CBPA 1SHFA 5LJ5e 3CC2Q 8ATCB 4M7AF 2PVDB 2QA4Q 1ZBJA 3JCMb 4C92E 1Q95G 2LVMA 2NUZA 1M1KC 1ZUUA 2HL3A 2LJ0A 2LT4A 4Y28E 5IHKA 3ASKA 2E64A 4BY6C 2LRQA 4IUTA 1UHFA 2P4RA 1H641 2JTFA 4M78E 4M78B 1G3YA 3LGFA 4M77F 5CAIA 1KIKA 3EG1A 4RTXA 3EG0A 4RCBA 1YIJT 3V7CA 4M75E 4F7UA 3CEYA 2DYIA 2CP3A 4M75B 1BU1A 2CH4A 2LT1A 1QP2A 2KY9A 2DL3A 3HRUA 2J6KA 4AFSC 1VQOA 2VXFA 5GMKm 3CMEQ 3CMAA 2OAWA 1VQ5A 4XTYA 2DJQA 3DLMA 4PK4A 2RM4A 3RR6A 1HXDA 2JOYA 2PQWA 1KK7A 2KQWA 5CK9A 2KK4A 3EH1A 2M0OA 1M3BA 2Z0WA 2YRDA 4OF1A 3HRSA 4LDVA 2BIVA 4J7IA 2PVOB 4F7UF 2QTXA 3GPLA 5LJ5h 1ZSZA 1KC8C 2EBPA 1Y7XA 3IQLA 2J6FA 3OS1A 2E41A 3HFOA 1T3SA 2DL4A 3AT1B 3BW1A 4IURA 3HL8A 2KDSA 3OMCA 3C4SA 1TWBA 2NLUA 2KMTA 2AIRB 2HCKA 3QPHA 4C0DC 2OI3A 3MP1A 5J3BA 1VQOT 3MHXA 4PJOD 4OMPA 4PJJA 3CMAT 4LNPA 1TUCA 2NWMA 4EMGA 4DBHA 3M59A 1BI2A 4C92D
chains in the Genus database with same CATH topology
4E7IA 1V29B 2FHDA 3UT1A 4A53A 1VQ4T 2CYZB 4DQ2A 5GAOr 4KT0E 4FT2A 3GIBA 1M1FA 4R55A 2E6NA 4JRIA 2E5QA 4QQGA 2YHTA 3WVEB 4C5GA 1X6OA 5GANd 3JCMP 2O4XB 3MEWA 3OSVA 3OYYA 4LD6A 4ZGJB 1YITT 1QVGS 2MAMA 1XTDA 2QDYB 4CRIA 4N0AC 3M5AA 3CXCA 1QVFS 2OAUA 4L5GA 4M78C 1K9MU 1G3WA 2XHCA 4NL2A 2XI9A 4BE0A 3BDUA 3A8GB 2LCLA 2VV5A 1Q86U 2PUOB 3G7ZA 5A2QE 2BUDA 5HK3A 3G4ST 3CCQA 2VYTA 2EJFA 3QSUA 3LH0A 4HT8A 4PJOF 5GMKj 2I2LA 2X4JA 5CVIA 4EMKA 3CPWS 4HCBA 5GAOp 3PGGA 3OW2A 2XG8D 3WXMB 4XU2A 1BIAA 3HHTB 2EJGA 1Q82U 5CKFA 2R57A 3DLLA 3CC4T 3UPUA 3OYHA 1VQ9A 4PNOA 2RJFA 5CKEA 1NJIC 4JDSA 2Y4YA 2DZCA 3E19A 4MZMA 2LQ8A 2LTOA 4HT9A 2VXEA 3CD6A 3FRNA 4J6YA 3JCMW 5CKHA 3CCEA 1K9MC 5FU7B 2DIQA 3JCMg 2ZZDA 4MZPA 4C92F 1W2BA 3J81E 3SB2A 2QEXA 3FDRA 2VUBA 5GAOn 2E6ZA 2V8KA 1Q86C 4MMLA 4E7HA 3OBWA 4E47A 1VQLA 2K5LA 4J83A 4C5EA 3F70A 1EIFA 3QYHB 5CQYA 1DJ7B 4Q5WA 1WGSA 4Z02A 5HK0A 4UC4A 4B9WA 5CR2A 3TU4K 5FU6B 3LLRA 2QQBA 2QA4T 3P8DA 5GAN6 4FSXA 5A0LA 1B34B 1JRIA 1KC8U 4BE2A 2OTJA 1I8FA 3META 5GAN3 3DB4A 1Q82C 1JJ2S 3QBYA 1XNIA 3CC7A 4BE1A 1YCYA 4M78F 2XD0A 3S3NA 2ZCFB 5EG2A 3CCUA 4XQ3A 3SFMA 4M7DF 3PNWC 3M54A 2LX9A 5D6YA 2RHIA 4KBMB 2VGNA 3RKXA 2DXTA 4JUVA 1KQSA 2K5FA 3JB9G 3CCSA 3SWNC 3QJYA 2L5QA 2HBPA 3QKJA 5LL6S 4M75F 4OMFB 2R58A 4OB1B 5LJ3e 3PIOA 5AYFA 3FC3A 4YTLA 3BFMA 3JB9I 4E7KA 2OTLA 3DB3A 3RESA 4X34A 2C06A 3JCMd 2G3RA 2QQSA 3PMTA 3QJ6A 2XU8A 1XOVA 2RO0A 4QQDA 2GQVA 3CPWA 2EJ9A 1W4SA 3CCJA 1ZHIA 1K8AU 3M55A 3URGA 3EAEA 2XICA 2DAQA 3CBMA 4II1A 4LDWA 1KD1U 1YITA 3ER0A 4JLGA 1OZ3A 4NS5A 4GY5A 3NTKA 4B9XA 2K3XA 1Q81C 2MF2A 4BUGA 1VQ9T 1VQNA 2MMPA 4C8QA 2RB6A 3JRZA 3GOXA 4JS5A 4C0FA 4IUVA 5KH6A 5KCOA 4A4GA 3G6EA 3CCET 4C8QE 3KXTA 3QIIA 1M5Q1 3M56A 4C8QB 2QEXT 4XU3A 3SD4A 3C95A 5GAMg 4JS4A 1VQ8A 1O9SA 2RJEA 3FIFA 3CCQT 2CS7A 4OB2B 4Y91A 3CD6T 3H6ZA 4ZGEB 2F5TX 3OYFA 3OYDA 2AHJB 3ZBDA 4DOVA 4FL6A 1WQWA 3P8BB 3DKMA 1YI2A 3ME9A 1JJ2A 3M57A 5HKCA 2OTJT 1KD1C 1FWZA 3LGLA 4RMOA 3H8ZA 4NL3A 3GF5A 3CC7T 2RK1A 5C0MA 1VQ7A 4M7AA 2DXBA 3X28B 3ZFJA 4RG2A 3VU3C 5GMKe 2XDPA 4MZTA 4XU1A 3JB9D 3QHSA 2GF7A 1JBMA 1R8OB 2BKDN 1X01A 4M7AE 5GAOq 4C5HA 3CCST 3CC2A 1P92A 3OYLA 2K5IA 4QVCA 1O75A 2P0PA 3MP6A 3HPWA 4OB3B 2OTLT 2QA4A 4MDXA 2O4XA 5I2SA 1YBYA 3L2UA 1WJRA 4PKCC 3VYHB 2EQUA 5CIUA 3C94A 1D3BA 3CCJT 5GAMd 1RL2A 2LCCA 2MWPA 3T9NA 4IKFA 2RHUA 4OP0A 4J6XA 1NJIU 1WQ7A 3OYJA 3A8MB 4C0DB 4BI8B 1NE8A 3OYAA 1D3BB 3LX7A 2HAXA 1X75C 1VQNT 4M78D 4M77A 2WSFE 4LDYA 5FLXE 4R56A 1UGQB 4IUPA 2JZ2A 3FEOA 3OBYA 3PMIA 4X9DA 3V8LA 3LWIA 4ZTFA 1KQSS 2LC4A 4M7DC 4M7DD 2X4YA 3EFRA 3G6ET 3OYBA 4M77E 2CZ7B 5LJ3h 2RI3A 5FROA 5GAN5 4EMKC 4M77B 3M53A 3OQ5A 2WACA 3A8LB 1VQ8T 3HRTA 5L8RE 4M75D 4M75C 4MDWA 3VJPA 4JLIA 1JB0E 5DLQE 2JVVA 1G3TA 4C92B 3RMSA 2RJCA 3JCMf 2QQ9A 1YI2T 1N8RU 4C8QG 1HK9A 3TCJA 3L2QA 4VUBA 3JB9F 3E1SA 1M1GA 2Y90A 2X4WA 1ZQ1A 2RJDA 3I55A 3TEEA 4N0AA 5FU6C 3RKWA 2F69A 1VQ7T 2CZ0B 3QUIA 1Y07A 4RG8A 1I4K1 4OVAA 2EQMA 1KHCA 4KUIA 3GNGA 1NPPA 2FVUA 4LD9K 1TH7A 5C6SA 1B34A 3CC2T 3I56T 3CMEA 4HKEA 3JCMQ 3G71A 1KHIA 3KBGA 4V2SA 2QI2A 2DD4A 3KUFA 4BY6B 4XTZA 3J7AF 5GMKl 3V7RA 3S3OA 5J26A 1S72A 3M4GA 4M7AG 2RI5A 2VGMA 2FL7A 2RA2A 4WF2A 5LJ5f 2PUKB 4HCZA 3OYGA 5D6WA 5CKBA 5LJ5j 1N8RC 2DK3A 1Q81U 3QXEB 2K3YA 4N4GA 2MI6A 5D6XA 5GAOm 3JSCA 4JRQA 5CQXA 1Y96B 4ME7A 4XK8E 4F7UE 3JB9J 4J8OA 5I21A 3L2WA 5GMKh 1M4ZA 4F7UB 1RI0A 3PFSA 2HNIA 2VC8A 3CCVA 4BDYA 4HA8A 4A4FA 4EMHA 4IUQA 3MEUA 4GLKA 2RHYA 3OYEA 1MGQA 4OGEA 3LW5E 2EAYA 2HQEA 2YRVA 2DXUA 3VKIA 3OY9A 3GLXA 1WPYA 1VQMA 3OYNA 5GAN8 1KQ1A 2LQKA 3GNFB 3RIRA 3L2ZA 2PVGB 4C8QD 4C8QC 1G3SA 2R5AA 2A7YA 2WSEE 2WSCE 3FB9A 4TVRA 3LYIA 4M77G 3QG1A 1BI1A 2RK2A 3JB9H 4O5VA 3JCMV 5FRMA 5GAMf 1BIBA 1UEBA 2ZPBB 3OMGA 5GAMj 3QO3A 3I55T 1VQPA 5GANf 3L1AA 2K57A 3SWNA 4A4EA 5GANj 1IZ6A 3OYKA 3JCMJ 3X24B 1U8RA 4J7FA 3OS5A 2XK0A 3TREA 1BYMA 1OZ2A 1BKBA 1MHNA 2P0KA 3M58A 4E7LA 2MWOA 1M9SA 1M90U 2JN0A 2L89A 2X4XA 1IREB 1FX7A 1Y71A 3SWNB 1KQ2A 5CCAA 3PTAA 3CMET 3M9QA 3AHUA 1I81A 3G71T 1OYXA 2A3LA 3C12A 4M7AD 4M7AC 3VV0A 3X26B 1S72T 3MP8A 2XDDA 2EYQA 2V8JA 4C0ZA 4DOWA 2CZ1B 3VUZA 1N9RA 2IG0A 4XTXA 4ZN3A 3JCMX 3EFSA 3O8VA 1BI3A 3M4YA 3BDLA 2XKOC 3OB9A 4EDUA 2FB7A 2O01E 1Q7YU 3NFCA 3E9FA 3I56A 3LWHA 1VQKA 2E1HA 4HCCA 4ELYC 3JCMe 3CCVT 2XDBA 1LJOA 2FYKA 4EPCA 5J39A 1M90C 2CZ6B 3HSBA 4C8QF 5CO7A 3A5ZB 5KE2A 2DVEA 2IVWA 4O6JA 2JNGA 1VQMT 4JJNK 1YIJA 1WJQA 2GFUA 3V7SA 1FXXA 4C5IA 4F7UG 1VUBA 1VQ5T 3L2VA 4J5YA 3Q1JA 1UGSB 2GCXA 4PJOA 5LJ3g 4RKUE 5DLOA 4BB7A 5HY6A 2E10A 2LDMA 2DTIA 2M16A 4ZN1A 4KUDK 5CKDA 5A0DA 4IUUA 4PJOE 2DO3A 2DPPB 4FIBA 1N9SA 1VQPT 3CCRA 2EWNA 1AHJB 2YLCA 4FU6A 4QW2A 4PJOB 1ZBXA 2H3JA 3E9GA 3CBPA 1Q7YC 1M8VA 2DXCA 3MEAA 3VUBA 2E12A 1I5LA 1XQHA 5DM7R 3OSSC 1UGRB 5LJ5e 4C92A 4QQ6A 5KE3A 1YJ9A 3SDZA 1BI0A 1PSEA 5I2MA 4M7AF 2PVDB 2ZPIB 2DKGA 3OYCA 5FU7C 1YHQA 3FLGA 3MO8A 3JCMb 4C92E 4P5NA 2LVMA 1YJWA 1M1KC 2RHZA 3MCAB 4RCCA 1G5VA 3HFNA 4BI3A 4ZTJA 2LT4A 2L3RA 4Y28E 1NZ9A 2KSSA 4E7JA 2R5MA 3CCMA 1LOJA 2DIGA 4FM4B 3ASKA 2E64A 4M78A 1SSFA 2LRQA 1LNXA 4BY6C 4D6WA 1K73C 3V8JA 3OS0A 1NPRA 4M7DA 4IUTA 5LJ3d 4L59A 2PU9B 1U1TA 2CGHA 3N5BB 1H641 2JTFA 4M78E 3CCLT 2XIDA 1VQKT 4M78B 1G3YA 4M7DE 2DD5A 1YJNA 2L8DA 2EIFA 4M7DB 1QVPA 4M75A 5GAMe 2EKOA 3LGFA 4M77F 5CAIA 1QW1A 5GANe 1Y96A 4EMKB 4RCBA 1YIJT 3JAME 2DEQA 3V7CA 4CI0C 4M75E 3ZEHA 2E70A 4BD3A 4F7UA 2CKKA 3CEYA 5GAOl 4M75B 4LDXA 1VQ6A 1WNLA 1N6AA 2P4TA 2HD0A 3QZ9B 4N4HA 2ZGWA 3HP9A 4XTWA 2Y4XA 2JUFA 3GPLA 3UDCA 2F5KA 2ZPEB 5IAYA 1U1SA 1GXIE 1QP3A 2LT1A 2QXFA 3CCRT 1QP2A 4BI4A 2KY9A 3HRUA 5IN1A 3JCMh 3A8OB 3WVDB 2QQAA 1VQOA 5GAN4 1YJ9T 2VXFA 5GMKm 5GAN7 1VIFA 3S3MA 2X35A 4PJOG 3CMAA 3OYMA 1QVGA 1VQ5A 4XTYA 1YHQT 3DLMA 3QZ5B 2LNVA 2RM4A 4PL6A 2DZ9A 1HXDA 1YJWT 1QVFA 4A54A 2JOYA 2PQWA 2D0QB 1KG1A 4OGCA 2RD1A 4N4IA 2KQWA 5KCHA 5M9OA 2RH2A 5CK9A 5LJ5g 2KVQG 2KK4A 3RERA 3NTHA 2K4YA 3CCMT 4JRPA 2M0OA 4LDUA 3X25B 2HQXA 1VQ4A 4OF1A 4C92G 3L42A 3VYGA 4KULA 3HRSA 3OS2A 4LDVA 2BIVA 4J7IA 2PVOB 4XTVA 4F7UF 2M1HA 3R6OA 2QTXA 3OYIA 2YLBA 4PLIA 3BY7A 5LJ5h 4PLLA 5A0GA 2M9UA 4XU0A 1KC8C 1N27A 2EQKA 5IT9E 1Y7XA 1YJNT 2QQRA 3RUXA 3PT9A 3QYGB 2B8AA 2RI2A 2RHXA 3V8KA 3OS1A 2E41A 3X20B 3HFOA 4J6WA 2DTOA 5DY9A 4BACA 3HKSA 3INZA 3NTIA 3CXCS 4M78G 3BW1A 5GAN2 4IURA 3RMQA 2ZPHB 4JRKA 4BDZA 1VQ6T 3HL8A 2KDSA 2V8IA 2K2VA 3OMCA 3C4SA 4X9CA 1UB4A 3G4SA 4M7DG 3MEVA 3J80E 2D9TA 2KAFA 4A4KA 4FT4A 2NLUA 1OI1A 2ZPFB 5GANg 2EQJA 3JCMc 1VQLT 3CCLA 1VIEA 5LJ5d 5FRNA 4XAXB 2GFAA 2KMTA 4QVDA 1WJSA 3QPHA 4M75G 3CPFA 1PSFA 4C0DC 1K8AC 3PIPA 3MP1A 4A4HA 3A8HB 3S6WA 2E65A 5LJ3f 3OW2S 5J3BA 3CC4A 4XTUA 3UWNA 3MHXA 3QDRB 5LJ3j 1VQOT 4PJOD 5GMKi 3OA6A 3L2RA 4PJOC 4OB0B 4C0GA 5GAMh 1H3ZA 1M1KU 2P0QA 4ZGDB 3CMAT 5GANh 4DA4A 2ZPGB 2DTHA 3FJPA 3CCUT 2EFIA 4MMKA 4M77D 2JTMA 3CBOA 3P8HA 4M77C 4L6V5 4ATOA 3RKYA 4ELZC 1W2BS 2D6FA 4EMGA 4NOYA 4M7AB 3M59A 1UGPB 4QVZA 1K73U 1BI2A 3GP8A 4C92D 4C92C 2DJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT4 A;  2EYQ A;  4XAX B;  2LQK A;  4KBM B;  4L5G A;  2LT1 A; 
#chains in the Genus database with same CATH topology
 4E7I A;  1K73 R;  4RTZ A;  1OQK A;  2E6N A;  3WVE B;  4C5G A;  1SRL A;  2PNI A;  2AKL A;  2VWF A;  1X69 A;  1M2O A;  3CXC A;  3EGU A;  4NL2 A;  4BE0 A;  2XI9 A;  1MND A;  2D1X A;  2YXY A;  3BDU A;  3A8G B;  1SHG A;  2BUD A;  2EPD A;  1FMV A;  2A36 A;  4E6R A;  3QSU A;  4PJO F;  2I2L A;  3CPW S;  4HCB A;  3WXM B;  3HHT B;  1Q82 U;  3DLL A;  2Y4Y A;  1WDX A;  1TOV A;  2LQ8 A;  4JJD A;  2E4H A;  1K9M C;  2DIQ A;  2CUB A;  2J06 A;  4C92 F;  1W2B A;  2DL8 A;  2VUB A;  5GAO n;  2E6Z A;  2V8K A;  1TTH B;  1WHG A;  1Q86 C;  4HXJ A;  3CCM Q;  4E7H A;  2JJ9 A;  2K5L A;  4J83 A;  4C5E A;  3F70 A;  5CQY A;  2FPE A;  4Q5W A;  1IO6 A;  4PJM A;  3THK A;  4F17 A;  1K4U S;  1B34 B;  2VB6 A;  4BE2 A;  1I8F A;  2KRO A;  1ZSG A;  1JJ2 S;  2ZAE A;  3QBY A;  1YJN Q;  1YCY A;  4M78 F;  1FMW A;  4XQ3 A;  4KRT A;  2RHI A;  3RKX A;  2DXT A;  2QGF B;  4CC2 A;  2K5F A;  3SWN C;  2COY A;  1TXQ A;  2L5Q A;  5LJ3 e;  4M75 F;  2OTL A;  3BFM A;  1KJW A;  1MMG A;  1PCX A;  3EG2 A;  2G3R A;  3M0R A;  2RO0 A;  2EJ9 A;  2FRW A;  2KE9 A;  1ZHI A;  2CDT A;  1M30 A;  2HZY A;  3M55 A;  2XIC A;  1H3H A;  2LX7 A;  4PJL A;  4DBF A;  4GY5 A;  3A98 A;  1QKW A;  4AG1 C;  1ZUK A;  4DEX A;  3GOX A;  4C0F A;  3M56 A;  2JW4 A;  1YN8 A;  1VQ8 A;  3FIF A;  2CS7 A;  2CP5 A;  2F2W A;  4R0K A;  3OYF A;  4DOV A;  1JO8 A;  3P8B B;  2GTJ A;  3LGL A;  1AD5 A;  1E7O A;  3GF5 A;  2RK1 A;  1CKB A;  2COW A;  4RG2 A;  2XDP A;  1X01 A;  1OX8 A;  1V76 A;  2KR3 A;  2K5I A;  1RLP C;  2D8J A;  3HPW A;  2OTL T;  2K6D A;  2A28 A;  4AG2 C;  5I2S A;  2JT4 A;  5KYU B;  1YBY A;  3CCL Q;  2CT4 A;  1GFD A;  2MWP A;  3T9N A;  4OP0 A;  2RF0 A;  4J6X A;  1NJI U;  1WQ7 A;  1VYV A;  3LX7 A;  4RTW A;  4WCI A;  4ZTF A;  3PMI A;  4X9D A;  4M7D C;  2KT1 A;  1QWF A;  2CZ7 B;  5LJ3 h;  4EMK C;  3CCR Q;  2IIM A;  4J9B A;  1VQ8 T;  4JLI A;  2JVV A;  1G3T A;  3RMS A;  3JCM f;  2QQ9 A;  1Q82 R;  1C0M A;  3I55 A;  2F69 A;  3QUI A;  4RG8 A;  3PVL A;  1KHC A;  2L3Q A;  2M02 A;  1B34 A;  1UJ0 A;  3QWX X;  2CRE A;  3KUF A;  2YSQ A;  3H41 A;  4M7A G;  3OYG A;  2FL7 A;  5D6W A;  5LJ5 j;  3JSC A;  5CQX A;  1Y96 B;  1UUE A;  1AZG B;  1RI0 A;  3CCE Q;  1VQ6 Q;  3CCV A;  4BDY A;  1AZE A;  4HA8 A;  4EMH A;  4IUQ A;  2RHY A;  3OYE A;  2EAY A;  1T0J A;  1ZX6 A;  3CD6 Q;  3OY9 A;  1WPY A;  2JM9 A;  1UTI A;  1G3S A;  2RQW A;  2A7Y A;  4TVR A;  4PFZ A;  1C6V X;  4IIO A;  4M77 G;  3CC7 Q;  2HKN A;  3JCM V;  3CCU Q;  3QDF A;  1BIB A;  2ZPB B;  3I55 T;  4A4E A;  3SWN A;  1KFZ A;  3M58 A;  1BKB A;  1Y71 A;  5AT1 B;  2JM8 A;  1KQ2 A;  4D8D A;  1OU9 A;  2KRN A;  3M9Q A;  3AHU A;  2QAS A;  2L3P A;  3CCJ Q;  3VV0 A;  4ANJ A;  4M7A C;  2QAZ A;  3MP8 A;  1JXO A;  2V8J A;  1YIT Q;  4DOW A;  4ZN3 A;  3EFS A;  1RAE B;  3M4Y A;  3BDL A;  4AFU C;  1OUL A;  1NEB A;  1Q7Y U;  5IHI A;  2ROT A;  3C0C A;  2MCN A;  3CCV T;  4EPC A;  1M90 C;  1AWW A;  3VS4 A;  3A5Z B;  4HVW A;  4JJN K;  1WJQ A;  2GFU A;  4C5I A;  4F7U G;  3L2V A;  1YI2 Q;  2GCX A;  5LJ3 g;  4AFZ C;  2CUD A;  2M16 A;  1NJI R;  2HDA A;  2DO3 A;  2DPP B;  3H0F A;  4Y92 A;  4QW2 A;  2CP2 A;  3E9G A;  1XQH A;  1AWX A;  1UGR B;  1YJ9 A;  2DX1 A;  3SDZ A;  1PSE A;  2ZPI B;  2DKG A;  5FU7 C;  1YHQ A;  1TS9 A;  2ATC B;  1Y0M A;  1IB8 A;  1HD3 A;  5KYX A;  3OW2 P;  1NZ9 A;  4FSS A;  2G6F X;  3M0P A;  1GCP A;  3V8J A;  2C0I A;  1PHT A;  4M7D A;  5LJ3 d;  4L59 A;  1U1T A;  2PU9 B;  4KGV B;  1WYX A;  2DD5 A;  2L8D A;  4F04 B;  1QVP A;  2K9G A;  5GAM e;  2EKO A;  3EG9 B;  5GJV B;  2PTK A;  1Y96 A;  4CI0 C;  5GAO l;  2GGR A;  1WNL A;  2HD0 A;  4N4H A;  1VYT A;  3UDC A;  1GXI E;  1QVF P;  1JEG A;  4BI4 A;  1YJ9 T;  3NGP A;  1IGQ A;  5GAN 7;  2X35 A;  4PJO G;  4B6M A;  4LUE A;  1YCS B;  3OYM A;  1YHQ T;  2KRS A;  1B07 A;  2D0Q B;  3EH2 A;  1LVK A;  2KVQ G;  2JXB A;  2DET A;  4LDU A;  4RTT A;  1VQ4 A;  1JQQ A;  1QWE A;  1MV3 A;  3VYG A;  4C92 G;  3E2U A;  2RNA A;  2M1H A;  4PLL A;  1MMD A;  2M9U A;  4XU0 A;  1N27 A;  3RUX A;  3QYG B;  2RI2 A;  3V8K A;  2C0T A;  1VQM Q;  4JJB A;  2K3B A;  1WXU A;  1WFW A;  1IHV A;  1ZSZ B;  5IXF A;  4BAC A;  3HKS A;  1SKU B;  4M78 G;  1SEM A;  4GBQ A;  2GNC A;  3VS1 A;  2CSI A;  2V8I A;  3VS0 A;  4X9C A;  1UB4 A;  2OJ2 A;  2QDL A;  1RAD B;  2KAF A;  5FW9 A;  4A4K A;  2ZPF B;  5GAN g;  2EQJ A;  3JCM c;  1VQL T;  1Q7Y R;  1WJS A;  4M75 G;  2V26 A;  1PSF A;  3OW2 S;  1PNJ A;  3A8H B;  3S6W A;  3CC4 A;  4XTU A;  5LJ3 j;  1VA7 A;  4Z8A A;  5GMK i;  3OA6 A;  3L2R A;  4PJO C;  5GAM h;  3FJ5 A;  1U3O A;  1EZZ B;  4WTO B;  2DTH A;  3I35 A;  4MMK A;  4M77 D;  3RKY A;  1VYU A;  2D6F A;  4NOY A;  1UGP B;  1K73 U;  4C92 C;  1V29 B;  2KXD A;  3UT1 A;  1VQ4 T;  3MPU B;  2CYZ B;  3MKD A;  3I56 Q;  1HSQ A;  4JRI A;  2NUT A;  5GAN d;  2O4X B;  1YFN A;  1YIJ Q;  1OPL A;  2PZ1 A;  1QVF S;  2OAU A;  2L2P A;  4M78 C;  1G3W A;  4DEY A;  2XHC A;  1OOT A;  5A2Q E;  2EJF A;  1X43 A;  3EG9 A;  2KGT A;  4JZ3 A;  3CC4 T;  3UPU A;  2E5K A;  1NJI C;  4JDS A;  2DZC A;  3EHR A;  1UEC A;  2EKH A;  2LTO A;  4HT9 A;  1MMN A;  5CKH A;  4MZP A;  2QEX A;  2KRM A;  3FDR A;  2QK0 A;  2LJ1 A;  1X6B A;  4QT7 A;  1WHH A;  1G2B A;  5HK0 A;  1ABQ A;  1RI9 A;  1KQS P;  2QA4 T;  5GAN 6;  2EVR A;  4FSX A;  5A0L A;  1JRI A;  1K76 A;  1MV0 B;  1NG2 A;  4FYW B;  1SF9 A;  2FZC B;  1XNI A;  4BE1 A;  2ZCF B;  2BTT A;  2FZK B;  3I9Q A;  3CPW P;  4KBM B;  2VGN A;  2E3I A;  3CCS A;  2KXC A;  4HT8 A;  2R58 A;  4OB1 B;  4E7K A;  2ROL A;  3JB9 I;  2I0N A;  2C06 A;  2XU8 A;  1W4S A;  2LQW A;  3EAE A;  1TU0 B;  2A08 A;  4II1 A;  1K8A R;  1VQO Q;  4B9X A;  4BUG A;  2DBM A;  1VQN A;  2MMP A;  4C8Q A;  3CMA Q;  2FO0 A;  1VQ5 Q;  1ZUY A;  2HQH A;  3VS5 A;  5KH6 A;  4HVV A;  1JJ2 P;  2ED1 A;  2DEU A;  2QEX T;  1M5Q 1;  5GAM g;  1AWO A;  1N5Z A;  2VVK A;  2HKQ B;  4OB2 B;  3H6Z A;  4ZGE B;  3ZBD A;  1WQW A;  3DKM A;  3UAT A;  4F14 A;  1WXT A;  5HKC A;  1KD1 C;  1M8M A;  4RMO A;  2RQU A;  4NL3 A;  1WX6 A;  2DXB A;  3X28 B;  1A0N B;  1I07 A;  3JB9 D;  1JBM A;  1R8O B;  2BKD N;  5GAO q;  1GCQ A;  4EIK A;  3CCS T;  2DLP A;  1CKA A;  3MP6 A;  2O4X A;  2O31 A;  1WHM A;  7AT1 B;  2KYM A;  1KSW A;  5GAM d;  4IKF A;  1GL5 A;  3OYJ A;  3A8M B;  1ARK A;  4C0D B;  2GTO A;  1VQN T;  4M78 D;  1D0Y A;  2WSF E;  1ZA1 B;  4LDY A;  4DA4 A;  4IUP A;  1KQS S;  3FEO A;  3SHW A;  2LC4 A;  4FYV B;  2DBK A;  1F1B B;  1G83 A;  2KEA A;  3M53 A;  1AOJ A;  2KT8 A;  4M75 D;  1WI7 A;  3QWY A;  5GJW B;  2MK5 A;  2RJC A;  1N8R U;  3JB9 F;  1M1G A;  3GBQ A;  2Y90 A;  2LJ3 A;  1I5O B;  3TEE A;  1IGU A;  3RKW A;  2DL5 A;  4KUI A;  3GNG A;  2FVU A;  1TH7 A;  5C6S A;  1R77 A;  1PD0 A;  2RPN A;  1PKT A;  3JCM Q;  3KFV A;  4OMN A;  3TVT A;  3G71 A;  4V2S A;  3KBG A;  4Z88 A;  1B3Q A;  3S3O A;  1S72 A;  3M4G A;  1UG1 A;  1GBR A;  3G1J A;  5LJ5 f;  2PUK B;  1ZA2 B;  4N4G A;  2MI6 A;  5D6X A;  2RQV A;  1Q81 R;  1G8X A;  4ME7 A;  3JB9 J;  5I21 A;  1M4Z A;  1K0S A;  1HYO A;  1QCN A;  2HNI A;  4PJN A;  3MEU A;  4GLK A;  2CP0 A;  1D0Z A;  4OGE A;  3VRZ A;  2ED0 A;  2HQE A;  2YRV A;  2GBQ A;  4FYY B;  3SEM A;  1AEY A;  5FWB A;  1RLQ C;  2LQK A;  3RIR A;  3L2Z A;  2SRC A;  2WSE E;  2WSC E;  2D8H A;  3OMG A;  1VQP A;  4ORZ A;  1OV3 A;  3QO3 A;  5GAM j;  2M0Y A;  2HSE B;  3JCM J;  1BYM A;  2KBT A;  2P0K A;  2YRC A;  2CP6 A;  2OTL Q;  1M27 C;  3HTR A;  2AZS A;  3SWN B;  2QG9 B;  3G71 T;  2ENM A;  3X26 B;  1S72 T;  2XDD A;  2EYQ A;  2M51 A;  2IG0 A;  3TQ7 P;  3JCM X;  4AMC A;  3MJX A;  3OB9 A;  2O01 E;  4CC3 A;  5KYN A;  3VS7 A;  3E9F A;  1VQK A;  4QKU A;  4ELY C;  5J39 A;  4AFQ C;  2CZ6 B;  1M2V B;  3HSB A;  5CO7 A;  1VQ8 Q;  5KE2 A;  2DVE A;  1WHK A;  1FXX A;  2NYS A;  1UGS B;  4RKU E;  4BB7 A;  2DIL A;  5HY6 A;  2DRK A;  2DTI A;  4ZN1 A;  4KUD K;  4IUU A;  2NUP B;  1N9S A;  1VQP T;  3CCR A;  2YLC A;  1AHJ B;  4OML A;  1UFF A;  2E12 A;  5KE3 A;  4QQ6 A;  4JPB W;  2H3E B;  3TSW A;  3FLG A;  4P5N A;  2V1Q A;  1YJW A;  1Z9Z A;  2RHZ A;  3MCA B;  4BI3 A;  2O88 A;  2L3R A;  2R5M A;  2BE9 B;  1N8R R;  1LOJ A;  4FM4 B;  1ABO A;  4D6W A;  1K73 C;  1NPR A;  5KYX B;  2A0F B;  1FMK A;  3N5B B;  3CCL T;  2XID A;  1VQK T;  4M7D E;  2EIF A;  4M7D B;  2FPF A;  1QW1 A;  5GAN e;  2DFU A;  4IIM A;  4EMK B;  2DEQ A;  2E70 A;  2J7I A;  2CKK A;  2F2V A;  5ECA A;  4E7Z A;  1IRX A;  1VQ6 A;  1N6A A;  2P4T A;  2FPD A;  1WHL A;  2ZGW A;  3HP9 A;  2CT3 A;  3I55 Q;  2JUF A;  1QVG P;  2FZG B;  1PKS A;  5IAY A;  1QP3 A;  3CCR T;  3RNJ A;  2DA9 A;  5IN1 A;  4AT1 B;  5GAN 4;  3M0U A;  2QTV A;  1VIF A;  3S3M A;  3QZ5 B;  1D0X A;  1YJW T;  1QVF A;  1KG1 A;  4OGC A;  2RD1 A;  5KCH A;  2RH2 A;  3RER A;  1NLO C;  2K4Y A;  4JRP A;  1AWJ A;  3H0I A;  3M0S A;  3X25 B;  2BZ8 A;  2HQX A;  3L42 A;  2ECZ A;  3CCV Q;  4XTV A;  1CSK A;  3BY7 A;  1RAC B;  4FCY A;  2EQK A;  5IT9 E;  2QQR A;  3PT9 A;  2RHX A;  2JS0 A;  3X20 B;  2IPO B;  4J6W A;  1PM3 A;  2DTO A;  3VS3 A;  3EFO B;  1YWP A;  2EGE A;  4RTU A;  3CXC S;  3RMQ A;  2DRM A;  1VQ6 T;  1PRM C;  2K2V A;  3G4S A;  2X3X D;  2AT1 B;  2D9T A;  1M2V A;  4FT4 A;  1OI1 A;  5HCK A;  2GFA A;  4RUG A;  2JS2 A;  3CPF A;  5LJ3 f;  2AK5 A;  3QDR B;  2EQI A;  1SG5 A;  4C0G A;  1H3Z A;  2P0Q A;  5GAN h;  2NUP A;  2ZPG B;  1UGV A;  3CCU T;  3ZL7 C;  2MYS A;  1M1K R;  3CBO A;  3P8H A;  4M77 C;  5L23 A;  4ELZ C;  1W2B S;  4A63 B;  1X6G A;  3LH5 A;  4M7A B;  1FYN A;  1D1A A;  4A53 A;  4DQ2 A;  5GAO r;  4FT2 A;  1M1F A;  4J9E A;  4R55 A;  2E5Q A;  2MPX C;  1X6O A;  2P84 A;  3MEW A;  1QVG S;  1YIT T;  2DER A;  2MIO A;  2QDY B;  3M0Q A;  4CRI A;  2NUT B;  1K9M U;  6AT1 B;  3JV3 A;  2VV5 A;  1Q86 U;  3G7Z A;  5HK3 A;  3G4S T;  2VYT A;  3UA7 A;  1NEG A;  3EGD B;  3LH0 A;  2X4J A;  4EMK A;  1RAG B;  3PGG A;  2XG8 D;  1YJ9 Q;  2EJG A;  2R57 A;  1VQ9 A;  1U5S A;  4PNO A;  3E19 A;  1YHQ Q;  2DL7 A;  4FYX B;  4F16 A;  3FRN A;  1UDL A;  5FU7 B;  2ZZD A;  2F1L A;  3TSZ A;  3I5S A;  4E47 A;  2XMF A;  1VQL A;  3CCQ A;  1GRI A;  1DJ7 B;  1WGS A;  4B9W A;  1SSH A;  5FU6 B;  3LLR A;  2QQB A;  2O9S A;  1X27 A;  2OTJ A;  3MET A;  2LQN A;  1Q82 C;  1WA7 A;  1KC8 R;  2XD0 A;  5EG2 A;  1T3L A;  3SFM A;  4M7D F;  3PNW C;  2LX9 A;  1KQS A;  3JB9 G;  2HBP A;  5LL6 S;  4OMF B;  3PIO A;  5AYF A;  3FC3 A;  3DB3 A;  3BE3 A;  1ZSZ C;  3QJ6 A;  4QQD A;  2GQV A;  5D7U A;  3ULR B;  3CPW A;  4J9D A;  1K8A U;  1BK2 A;  3EGX B;  3EFO A;  2DAQ A;  4FW2 A;  4OMM A;  3ER0 A;  2L3S A;  2HSP A;  4JLG A;  4NS5 A;  2K3X A;  2MF2 A;  1VQ9 T;  1V1C A;  2RB6 A;  3JRZ A;  4JS5 A;  1PWT A;  2O9V A;  4LN2 A;  1W6X A;  5KCO A;  3G6E A;  4C8Q E;  2V1R A;  4C8Q B;  3SD4 A;  3C95 A;  2EYZ A;  8AT1 B;  1O9S A;  2RJE A;  2VKN A;  2K79 A;  3CCQ T;  1VQ4 Q;  3OYD A;  4FL6 A;  2DNU A;  3ME9 A;  1JJ2 A;  3M57 A;  2OTJ T;  1JU5 C;  3H8Z A;  1VQ7 A;  4M7A A;  3O5Z A;  1UJY A;  3VU3 C;  2E3H A;  4MZT A;  5GMK e;  4XU1 A;  3H9N A;  4J9C A;  2JTE A;  4C5H A;  4DBQ A;  3CC2 A;  2COZ A;  3OYL A;  1LPL A;  2HEQ A;  4OB3 B;  4D8K A;  2QA4 A;  1WJR A;  2EQU A;  3C94 A;  1D3B A;  1RL2 A;  2RHU A;  3CC4 Q;  1OEB A;  3OYA A;  1X75 C;  4M77 A;  1UHC A;  2DM1 A;  4R56 A;  1UGQ B;  3EGD A;  3OBY A;  3V8L A;  3LWI A;  1K9M R;  3G6E T;  1TSF A;  1Q86 R;  3OQ5 A;  2WAC A;  3A8L B;  3HRT A;  4M75 C;  4MDW A;  3VJP A;  1T0H A;  4C92 B;  1HK9 A;  3TCJ A;  4VUB A;  4M4Z A;  3E1S A;  2X4W A;  2RJD A;  2HL5 C;  1VQ7 T;  2CZ0 B;  1NYF A;  3D7S B;  2EQM A;  4CC7 A;  1GBQ A;  3VS2 A;  3CC2 T;  3I56 T;  3CME A;  5KYW B;  1WXB A;  1KHI A;  2QI2 A;  2DD4 A;  4BY6 B;  1X2Q A;  5GMK l;  3V7R A;  2RI5 A;  2VGM A;  2RA2 A;  2BZY A;  4HCZ A;  5CKB A;  1Q81 U;  2YDL A;  4XK8 E;  5GMK h;  2DVJ A;  1YNZ A;  3PFS A;  2OX7 A;  2QEX Q;  4A4F A;  3EGX A;  3LW5 E;  4J9H A;  2DXU A;  2HMA A;  1KQ1 A;  3GNF B;  3M0T A;  2PVG B;  4C8Q D;  3FB9 A;  2YUQ A;  4O5V A;  5GAM f;  1UEB A;  1NLP C;  5GAN j;  1IZ6 A;  3OYK A;  4RTV A;  3OS5 A;  3CCS Q;  4KH1 B;  1MHN A;  2MWO A;  1M9S A;  1M90 U;  2L89 A;  3CQT A;  5CCA A;  3PTA A;  3CME T;  2L0A A;  2LNH B;  3C12 A;  4C0Z A;  2CZ1 B;  1N9R A;  1VQN Q;  1PC0 A;  1QCO A;  1UE9 A;  2XKO C;  4EDU A;  5KYY A;  1R0B G;  3NFC A;  3LWH A;  2E1H A;  2FEI A;  3JCM e;  4HCC A;  4JZ4 A;  2XDB A;  1LJO A;  2FYK A;  2X3W D;  4C8Q F;  3NPF A;  4O6J A;  3PE0 A;  1VQ5 T;  4J5Y A;  4PJO A;  2K7A A;  2LDM A;  1U06 A;  5A0D A;  1Z9Q A;  2EWN A;  1PRL C;  1ZBX A;  2H3J A;  1Q7Y C;  1M8V A;  2DXC A;  3MEA A;  3VUB A;  1I5L A;  5DM7 R;  3OSS C;  4C92 A;  1BI0 A;  5I2M A;  3OYC A;  3PVQ A;  1K0X A;  3MO8 A;  4PFP A;  5EC7 A;  4RCC A;  1G5V A;  3HFN A;  4ZTJ A;  5I22 A;  2KSS A;  4E7J A;  1RUW A;  2YUN A;  3CCM A;  2DIG A;  2JMC A;  1WZO A;  4M78 A;  1SSF A;  1AVZ C;  1LNX A;  1ZLM A;  5KYW A;  3OS0 A;  4OMQ A;  3REB B;  2DYB A;  2CGH A;  1TG0 A;  2EGC A;  2AKK A;  4ZNX A;  1YJN A;  2RQT A;  4M75 A;  1YWO A;  2X51 A;  1QQJ A;  3JAM E;  3ZEH A;  4BD3 A;  1ACM B;  4LDX A;  4DBR A;  3QZ9 B;  4XTW A;  2Y4X A;  1YP5 A;  2F5K A;  2ZPE B;  1U1S A;  3R6N A;  1D1B A;  2QXF A;  1K1Z A;  4E2F B;  2W0Z A;  3JCM h;  3A8O B;  4OMO A;  3WVD B;  2QQA A;  3EHQ A;  3G71 Q;  2CH4 W;  1QVG A;  2BE7 D;  2KYB A;  2MOX A;  2LNV A;  4PL6 A;  2F2X A;  2DZ9 A;  1S72 Q;  4A54 A;  5IH2 A;  3I5R A;  4N4I A;  5M9O A;  5LJ5 g;  2CSQ A;  3NTH A;  3CCM T;  4KUL A;  3OS2 A;  2LP5 A;  3R6O A;  3OYI A;  2YLB A;  4PLI A;  1NM7 A;  5A0G A;  1M90 R;  1YJN T;  5IHN A;  2B8A A;  2YUO A;  5DY9 A;  1E6G A;  3NTI A;  3INZ A;  1IXD A;  4FW1 A;  2DE0 X;  5GAN 2;  2ZPH B;  4JRK A;  4BDZ A;  1MUZ A;  4M7D G;  3MEV A;  5I11 A;  3J80 E;  1VQP Q;  1NBE B;  3RBB B;  3CCL A;  1VIE A;  5LJ5 d;  5FRN A;  1W70 A;  4XAX B;  4QVD A;  1K8A C;  3PIP A;  4A4H A;  2E65 A;  1GFC A;  1S1N A;  3UWN A;  4OB0 B;  1NYG A;  1M1K U;  4ZGD B;  1R0C B;  3FJP A;  2EFI A;  2H8H A;  2JTM A;  2EYY A;  4L6V 5;  1C1A A;  4ATO A;  4QVZ A;  3GP8 A;  1TUG B;  2DJZ A;  2QGG A;  1J3T A;  2FG0 A;  2FHD A;  1W1F A;  3CXC P;  3H0H A;  4KT0 E;  3GIB A;  1VQK Q;  1WIE A;  4E7S A;  4PFO A;  4QQG A;  1IHW A;  2C0O A;  1OPK A;  2YHT A;  3JCM P;  3OSV A;  3A1P A;  3OYY A;  4ESR A;  4LD6 A;  4ZGJ B;  1TUD A;  2KNB B;  2A37 A;  2MAM A;  1XTD A;  4N0A C;  2EGA A;  3M5A A;  4L5G A;  3NMZ C;  2B86 A;  4J9I A;  3VRY A;  2LCL A;  2PUO B;  2EYX A;  5FWC A;  1SRM A;  5GMK j;  1W2B P;  5CVI A;  5GAO p;  3OW2 A;  4XU2 A;  1BIA A;  5CKF A;  1M3C A;  3OYH A;  5CKE A;  2RJF A;  4MZM A;  2W10 A;  4LE9 A;  1WLP B;  2VXE A;  1YJW Q;  4J6Y A;  3JCM W;  1RAI B;  3CCE A;  2LCS A;  3JCM g;  3VS6 A;  4CC4 B;  3J81 E;  3SB2 A;  4MML A;  3OBW A;  1RAF B;  1EIF A;  3QYH B;  3CD6 A;  4Z02 A;  5CR2 A;  4UC4 A;  3TU4 K;  1BB9 A;  2ABL A;  4KGX B;  3P8D A;  1KC8 U;  4HVU A;  2J05 A;  3EG3 A;  5GAN 3;  3DB4 A;  2EW3 A;  1QLY A;  3CC7 A;  1JXM A;  3S3N A;  3CCU A;  2O2O A;  3M54 A;  3NHN A;  5D6Y A;  4JUV A;  1QMC A;  3QJY A;  3QKJ A;  4YTL A;  3RES A;  4X34 A;  3JCM d;  2QQS A;  1RAA B;  3PMT A;  1XOV A;  3CCJ A;  1HJD A;  3URG A;  3CBM A;  4LDW A;  1KD1 U;  1YIT A;  1OZ3 A;  1X2K A;  3NTK A;  1D09 B;  1Q81 C;  1XJW B;  1PG5 B;  2CP7 A;  4IUV A;  3CCE T;  4A4G A;  2LMJ A;  3KXT A;  3QII A;  4XU3 A;  4JS4 A;  2QYZ A;  3CD6 T;  4Y91 A;  4K11 A;  2F5T X;  1H8K A;  2AHJ B;  2FRY A;  1YI2 A;  2EYW A;  1OU8 A;  1FWZ A;  3CC7 T;  5C0M A;  4X1V A;  3ZFJ A;  2DMO A;  1LCK A;  3QHS A;  2GF7 A;  5KYU A;  4M7A E;  2BZX A;  1B7T A;  1P92 A;  4QVC A;  1O75 A;  2P0P A;  3G4S Q;  4MDX A;  2RQR A;  3L2U A;  3VYH B;  4PKC C;  5CIU A;  3CCJ T;  2LCC A;  2HAX A;  4BI8 B;  1NE8 A;  2KI7 A;  1D3B B;  2AZV A;  5FLX E;  2JZ2 A;  4M7D D;  2X4Y A;  3EFR A;  1BCM A;  2GQI A;  3OYB A;  4M77 E;  2J6O A;  2RI3 A;  5FRO A;  5GAN 5;  4M77 B;  1BCO A;  1EX4 A;  5L8R E;  1RAB B;  1JB0 E;  5DLQ E;  1WHJ A;  1YI2 T;  4C8Q G;  3L2Q A;  4HCK A;  2ESW A;  2VAS A;  4RTY A;  1ZQ1 A;  1MMA A;  4N0A A;  5FU6 C;  1Y07 A;  5IXB A;  1I4K 1;  2YWW A;  2SEM A;  4OVA A;  1I1J A;  1NPP A;  4LD9 K;  4J9F A;  2RMO A;  4JJC A;  4HKE A;  4XTZ A;  3J7A F;  1E6H A;  1QKX A;  5J26 A;  4WF2 A;  2LZ6 B;  1N8R C;  2DK3 A;  3QXE B;  2K3Y A;  5GAO m;  1VQ9 Q;  4JRQ A;  2JMA A;  9ATC B;  4F7U E;  4J8O A;  1PD1 A;  3L2W A;  1SPK A;  4J9G A;  4F7U B;  1BBZ A;  2VC8 A;  1AT1 B;  1M3A A;  2K2M A;  1MGQ A;  1VQL Q;  3REA B;  3CCQ Q;  3VKI A;  1VQM A;  3GLX A;  3OYN A;  5GAN 8;  4C8Q C;  2R5A A;  2OTJ Q;  3LYI A;  1KD1 R;  3QG1 A;  1BI1 A;  2RK2 A;  3JB9 H;  5FRM A;  1OX9 A;  5GAN f;  3L1A A;  2K57 A;  4LUD A;  3X24 B;  1U8R A;  4J7F A;  2XK0 A;  3UA6 A;  3TRE A;  1OZ2 A;  4E7L A;  1MNE A;  2JN0 A;  2YUP A;  2X4X A;  1IRE B;  1FX7 A;  1I81 A;  1H92 A;  1OYX A;  2A3L A;  1K9A A;  3RDV A;  4M7A D;  2DF6 A;  2YT6 A;  1EFN A;  3VUZ A;  1Y57 A;  4XTX A;  4KH0 B;  1GCQ C;  3O8V A;  1BI3 A;  2FB7 A;  3I56 A;  2HBW A;  4KGZ B;  3G6E Q;  5KYY B;  1I0C A;  2IVW A;  4GLM A;  4Z89 A;  3U23 A;  2JNG A;  1VQM T;  2RN8 A;  1YIJ A;  3V7S A;  1VOM A;  1D1C A;  1VUB A;  2X9H A;  3Q1J A;  5DLO A;  4LXC A;  2E10 A;  1RAH B;  5CKD A;  1VQ7 Q;  1QCF A;  4PJO E;  2D0N A;  4FIB A;  4PJO B;  4FU6 A;  3UF4 A;  3CBP A;  1SHF A;  5LJ5 e;  3CC2 Q;  8ATC B;  4M7A F;  2PVD B;  2QA4 Q;  1ZBJ A;  3JCM b;  4C92 E;  1Q95 G;  2LVM A;  2NUZ A;  1M1K C;  1ZUU A;  2HL3 A;  2LJ0 A;  2LT4 A;  4Y28 E;  5IHK A;  3ASK A;  2E64 A;  4BY6 C;  2LRQ A;  4IUT A;  1UHF A;  2P4R A;  1H64 1;  2JTF A;  4M78 E;  4M78 B;  1G3Y A;  3LGF A;  4M77 F;  5CAI A;  1KIK A;  3EG1 A;  4RTX A;  3EG0 A;  4RCB A;  1YIJ T;  3V7C A;  4M75 E;  4F7U A;  3CEY A;  2DYI A;  2CP3 A;  4M75 B;  1BU1 A;  2CH4 A;  2LT1 A;  1QP2 A;  2KY9 A;  2DL3 A;  3HRU A;  2J6K A;  4AFS C;  1VQO A;  2VXF A;  5GMK m;  3CME Q;  3CMA A;  2OAW A;  1VQ5 A;  4XTY A;  2DJQ A;  3DLM A;  4PK4 A;  2RM4 A;  3RR6 A;  1HXD A;  2JOY A;  2PQW A;  1KK7 A;  2KQW A;  5CK9 A;  2KK4 A;  3EH1 A;  2M0O A;  1M3B A;  2Z0W A;  2YRD A;  4OF1 A;  3HRS A;  4LDV A;  2BIV A;  4J7I A;  2PVO B;  4F7U F;  2QTX A;  3GPL A;  5LJ5 h;  1ZSZ A;  1KC8 C;  2EBP A;  1Y7X A;  3IQL A;  2J6F A;  3OS1 A;  2E41 A;  3HFO A;  1T3S A;  2DL4 A;  3AT1 B;  3BW1 A;  4IUR A;  3HL8 A;  2KDS A;  3OMC A;  3C4S A;  1TWB A;  2NLU A;  2KMT A;  2AIR B;  2HCK A;  3QPH A;  4C0D C;  2OI3 A;  3MP1 A;  5J3B A;  1VQO T;  3MHX A;  4PJO D;  4OMP A;  4PJJ A;  3CMA T;  4LNP A;  1TUC A;  2NWM A;  4EMG A;  4DBH A;  3M59 A;  1BI2 A;  4C92 D; 
#chains in the Genus database with same CATH homology
 4E7I A;  1V29 B;  2FHD A;  3UT1 A;  4A53 A;  1VQ4 T;  2CYZ B;  4DQ2 A;  5GAO r;  4KT0 E;  4FT2 A;  3GIB A;  1M1F A;  4R55 A;  2E6N A;  4JRI A;  2E5Q A;  4QQG A;  2YHT A;  3WVE B;  4C5G A;  1X6O A;  5GAN d;  3JCM P;  2O4X B;  3MEW A;  3OSV A;  3OYY A;  4LD6 A;  4ZGJ B;  1YIT T;  1QVG S;  2MAM A;  1XTD A;  2QDY B;  4CRI A;  4N0A C;  3M5A A;  3CXC A;  1QVF S;  2OAU A;  4L5G A;  4M78 C;  1K9M U;  1G3W A;  2XHC A;  4NL2 A;  2XI9 A;  4BE0 A;  3BDU A;  3A8G B;  2LCL A;  2VV5 A;  1Q86 U;  2PUO B;  3G7Z A;  5A2Q E;  2BUD A;  5HK3 A;  3G4S T;  3CCQ A;  2VYT A;  2EJF A;  3QSU A;  3LH0 A;  4HT8 A;  4PJO F;  5GMK j;  2I2L A;  2X4J A;  5CVI A;  4EMK A;  3CPW S;  4HCB A;  5GAO p;  3PGG A;  3OW2 A;  2XG8 D;  3WXM B;  4XU2 A;  1BIA A;  3HHT B;  2EJG A;  1Q82 U;  5CKF A;  2R57 A;  3DLL A;  3CC4 T;  3UPU A;  3OYH A;  1VQ9 A;  4PNO A;  2RJF A;  5CKE A;  1NJI C;  4JDS A;  2Y4Y A;  2DZC A;  3E19 A;  4MZM A;  2LQ8 A;  2LTO A;  4HT9 A;  2VXE A;  3CD6 A;  3FRN A;  4J6Y A;  3JCM W;  5CKH A;  3CCE A;  1K9M C;  5FU7 B;  2DIQ A;  3JCM g;  2ZZD A;  4MZP A;  4C92 F;  1W2B A;  3J81 E;  3SB2 A;  2QEX A;  3FDR A;  2VUB A;  5GAO n;  2E6Z A;  2V8K A;  1Q86 C;  4MML A;  4E7H A;  3OBW A;  4E47 A;  1VQL A;  2K5L A;  4J83 A;  4C5E A;  3F70 A;  1EIF A;  3QYH B;  5CQY A;  1DJ7 B;  4Q5W A;  1WGS A;  4Z02 A;  5HK0 A;  4UC4 A;  4B9W A;  5CR2 A;  3TU4 K;  5FU6 B;  3LLR A;  2QQB A;  2QA4 T;  3P8D A;  5GAN 6;  4FSX A;  5A0L A;  1B34 B;  1JRI A;  1KC8 U;  4BE2 A;  2OTJ A;  1I8F A;  3MET A;  5GAN 3;  3DB4 A;  1Q82 C;  1JJ2 S;  3QBY A;  1XNI A;  3CC7 A;  4BE1 A;  1YCY A;  4M78 F;  2XD0 A;  3S3N A;  2ZCF B;  5EG2 A;  3CCU A;  4XQ3 A;  3SFM A;  4M7D F;  3PNW C;  3M54 A;  2LX9 A;  5D6Y A;  2RHI A;  4KBM B;  2VGN A;  3RKX A;  2DXT A;  4JUV A;  1KQS A;  2K5F A;  3JB9 G;  3CCS A;  3SWN C;  3QJY A;  2L5Q A;  2HBP A;  3QKJ A;  5LL6 S;  4M75 F;  4OMF B;  2R58 A;  4OB1 B;  5LJ3 e;  3PIO A;  5AYF A;  3FC3 A;  4YTL A;  3BFM A;  3JB9 I;  4E7K A;  2OTL A;  3DB3 A;  3RES A;  4X34 A;  2C06 A;  3JCM d;  2G3R A;  2QQS A;  3PMT A;  3QJ6 A;  2XU8 A;  1XOV A;  2RO0 A;  4QQD A;  2GQV A;  3CPW A;  2EJ9 A;  1W4S A;  3CCJ A;  1ZHI A;  1K8A U;  3M55 A;  3URG A;  3EAE A;  2XIC A;  2DAQ A;  3CBM A;  4II1 A;  4LDW A;  1KD1 U;  1YIT A;  3ER0 A;  4JLG A;  1OZ3 A;  4NS5 A;  4GY5 A;  3NTK A;  4B9X A;  2K3X A;  1Q81 C;  2MF2 A;  4BUG A;  1VQ9 T;  1VQN A;  2MMP A;  4C8Q A;  2RB6 A;  3JRZ A;  3GOX A;  4JS5 A;  4C0F A;  4IUV A;  5KH6 A;  5KCO A;  4A4G A;  3G6E A;  3CCE T;  4C8Q E;  3KXT A;  3QII A;  1M5Q 1;  3M56 A;  4C8Q B;  2QEX T;  4XU3 A;  3SD4 A;  3C95 A;  5GAM g;  4JS4 A;  1VQ8 A;  1O9S A;  2RJE A;  3FIF A;  3CCQ T;  2CS7 A;  4OB2 B;  4Y91 A;  3CD6 T;  3H6Z A;  4ZGE B;  2F5T X;  3OYF A;  3OYD A;  2AHJ B;  3ZBD A;  4DOV A;  4FL6 A;  1WQW A;  3P8B B;  3DKM A;  1YI2 A;  3ME9 A;  1JJ2 A;  3M57 A;  5HKC A;  2OTJ T;  1KD1 C;  1FWZ A;  3LGL A;  4RMO A;  3H8Z A;  4NL3 A;  3GF5 A;  3CC7 T;  2RK1 A;  5C0M A;  1VQ7 A;  4M7A A;  2DXB A;  3X28 B;  3ZFJ A;  4RG2 A;  3VU3 C;  5GMK e;  2XDP A;  4MZT A;  4XU1 A;  3JB9 D;  3QHS A;  2GF7 A;  1JBM A;  1R8O B;  2BKD N;  1X01 A;  4M7A E;  5GAO q;  4C5H A;  3CCS T;  3CC2 A;  1P92 A;  3OYL A;  2K5I A;  4QVC A;  1O75 A;  2P0P A;  3MP6 A;  3HPW A;  4OB3 B;  2OTL T;  2QA4 A;  4MDX A;  2O4X A;  5I2S A;  1YBY A;  3L2U A;  1WJR A;  4PKC C;  3VYH B;  2EQU A;  5CIU A;  3C94 A;  1D3B A;  3CCJ T;  5GAM d;  1RL2 A;  2LCC A;  2MWP A;  3T9N A;  4IKF A;  2RHU A;  4OP0 A;  4J6X A;  1NJI U;  1WQ7 A;  3OYJ A;  3A8M B;  4C0D B;  4BI8 B;  1NE8 A;  3OYA A;  1D3B B;  3LX7 A;  2HAX A;  1X75 C;  1VQN T;  4M78 D;  4M77 A;  2WSF E;  4LDY A;  5FLX E;  4R56 A;  1UGQ B;  4IUP A;  2JZ2 A;  3FEO A;  3OBY A;  3PMI A;  4X9D A;  3V8L A;  3LWI A;  4ZTF A;  1KQS S;  2LC4 A;  4M7D C;  4M7D D;  2X4Y A;  3EFR A;  3G6E T;  3OYB A;  4M77 E;  2CZ7 B;  5LJ3 h;  2RI3 A;  5FRO A;  5GAN 5;  4EMK C;  4M77 B;  3M53 A;  3OQ5 A;  2WAC A;  3A8L B;  1VQ8 T;  3HRT A;  5L8R E;  4M75 D;  4M75 C;  4MDW A;  3VJP A;  4JLI A;  1JB0 E;  5DLQ E;  2JVV A;  1G3T A;  4C92 B;  3RMS A;  2RJC A;  3JCM f;  2QQ9 A;  1YI2 T;  1N8R U;  4C8Q G;  1HK9 A;  3TCJ A;  3L2Q A;  4VUB A;  3JB9 F;  3E1S A;  1M1G A;  2Y90 A;  2X4W A;  1ZQ1 A;  2RJD A;  3I55 A;  3TEE A;  4N0A A;  5FU6 C;  3RKW A;  2F69 A;  1VQ7 T;  2CZ0 B;  3QUI A;  1Y07 A;  4RG8 A;  1I4K 1;  4OVA A;  2EQM A;  1KHC A;  4KUI A;  3GNG A;  1NPP A;  2FVU A;  4LD9 K;  1TH7 A;  5C6S A;  1B34 A;  3CC2 T;  3I56 T;  3CME A;  4HKE A;  3JCM Q;  3G71 A;  1KHI A;  3KBG A;  4V2S A;  2QI2 A;  2DD4 A;  3KUF A;  4BY6 B;  4XTZ A;  3J7A F;  5GMK l;  3V7R A;  3S3O A;  5J26 A;  1S72 A;  3M4G A;  4M7A G;  2RI5 A;  2VGM A;  2FL7 A;  2RA2 A;  4WF2 A;  5LJ5 f;  2PUK B;  4HCZ A;  3OYG A;  5D6W A;  5CKB A;  5LJ5 j;  1N8R C;  2DK3 A;  1Q81 U;  3QXE B;  2K3Y A;  4N4G A;  2MI6 A;  5D6X A;  5GAO m;  3JSC A;  4JRQ A;  5CQX A;  1Y96 B;  4ME7 A;  4XK8 E;  4F7U E;  3JB9 J;  4J8O A;  5I21 A;  3L2W A;  5GMK h;  1M4Z A;  4F7U B;  1RI0 A;  3PFS A;  2HNI A;  2VC8 A;  3CCV A;  4BDY A;  4HA8 A;  4A4F A;  4EMH A;  4IUQ A;  3MEU A;  4GLK A;  2RHY A;  3OYE A;  1MGQ A;  4OGE A;  3LW5 E;  2EAY A;  2HQE A;  2YRV A;  2DXU A;  3VKI A;  3OY9 A;  3GLX A;  1WPY A;  1VQM A;  3OYN A;  5GAN 8;  1KQ1 A;  2LQK A;  3GNF B;  3RIR A;  3L2Z A;  2PVG B;  4C8Q D;  4C8Q C;  1G3S A;  2R5A A;  2A7Y A;  2WSE E;  2WSC E;  3FB9 A;  4TVR A;  3LYI A;  4M77 G;  3QG1 A;  1BI1 A;  2RK2 A;  3JB9 H;  4O5V A;  3JCM V;  5FRM A;  5GAM f;  1BIB A;  1UEB A;  2ZPB B;  3OMG A;  5GAM j;  3QO3 A;  3I55 T;  1VQP A;  5GAN f;  3L1A A;  2K57 A;  3SWN A;  4A4E A;  5GAN j;  1IZ6 A;  3OYK A;  3JCM J;  3X24 B;  1U8R A;  4J7F A;  3OS5 A;  2XK0 A;  3TRE A;  1BYM A;  1OZ2 A;  1BKB A;  1MHN A;  2P0K A;  3M58 A;  4E7L A;  2MWO A;  1M9S A;  1M90 U;  2JN0 A;  2L89 A;  2X4X A;  1IRE B;  1FX7 A;  1Y71 A;  3SWN B;  1KQ2 A;  5CCA A;  3PTA A;  3CME T;  3M9Q A;  3AHU A;  1I81 A;  3G71 T;  1OYX A;  2A3L A;  3C12 A;  4M7A D;  4M7A C;  3VV0 A;  3X26 B;  1S72 T;  3MP8 A;  2XDD A;  2EYQ A;  2V8J A;  4C0Z A;  4DOW A;  2CZ1 B;  3VUZ A;  1N9R A;  2IG0 A;  4XTX A;  4ZN3 A;  3JCM X;  3EFS A;  3O8V A;  1BI3 A;  3M4Y A;  3BDL A;  2XKO C;  3OB9 A;  4EDU A;  2FB7 A;  2O01 E;  1Q7Y U;  3NFC A;  3E9F A;  3I56 A;  3LWH A;  1VQK A;  2E1H A;  4HCC A;  4ELY C;  3JCM e;  3CCV T;  2XDB A;  1LJO A;  2FYK A;  4EPC A;  5J39 A;  1M90 C;  2CZ6 B;  3HSB A;  4C8Q F;  5CO7 A;  3A5Z B;  5KE2 A;  2DVE A;  2IVW A;  4O6J A;  2JNG A;  1VQM T;  4JJN K;  1YIJ A;  1WJQ A;  2GFU A;  3V7S A;  1FXX A;  4C5I A;  4F7U G;  1VUB A;  1VQ5 T;  3L2V A;  4J5Y A;  3Q1J A;  1UGS B;  2GCX A;  4PJO A;  5LJ3 g;  4RKU E;  5DLO A;  4BB7 A;  5HY6 A;  2E10 A;  2LDM A;  2DTI A;  2M16 A;  4ZN1 A;  4KUD K;  5CKD A;  5A0D A;  4IUU A;  4PJO E;  2DO3 A;  2DPP B;  4FIB A;  1N9S A;  1VQP T;  3CCR A;  2EWN A;  1AHJ B;  2YLC A;  4FU6 A;  4QW2 A;  4PJO B;  1ZBX A;  2H3J A;  3E9G A;  3CBP A;  1Q7Y C;  1M8V A;  2DXC A;  3MEA A;  3VUB A;  2E12 A;  1I5L A;  1XQH A;  5DM7 R;  3OSS C;  1UGR B;  5LJ5 e;  4C92 A;  4QQ6 A;  5KE3 A;  1YJ9 A;  3SDZ A;  1BI0 A;  1PSE A;  5I2M A;  4M7A F;  2PVD B;  2ZPI B;  2DKG A;  3OYC A;  5FU7 C;  1YHQ A;  3FLG A;  3MO8 A;  3JCM b;  4C92 E;  4P5N A;  2LVM A;  1YJW A;  1M1K C;  2RHZ A;  3MCA B;  4RCC A;  1G5V A;  3HFN A;  4BI3 A;  4ZTJ A;  2LT4 A;  2L3R A;  4Y28 E;  1NZ9 A;  2KSS A;  4E7J A;  2R5M A;  3CCM A;  1LOJ A;  2DIG A;  4FM4 B;  3ASK A;  2E64 A;  4M78 A;  1SSF A;  2LRQ A;  1LNX A;  4BY6 C;  4D6W A;  1K73 C;  3V8J A;  3OS0 A;  1NPR A;  4M7D A;  4IUT A;  5LJ3 d;  4L59 A;  2PU9 B;  1U1T A;  2CGH A;  3N5B B;  1H64 1;  2JTF A;  4M78 E;  3CCL T;  2XID A;  1VQK T;  4M78 B;  1G3Y A;  4M7D E;  2DD5 A;  1YJN A;  2L8D A;  2EIF A;  4M7D B;  1QVP A;  4M75 A;  5GAM e;  2EKO A;  3LGF A;  4M77 F;  5CAI A;  1QW1 A;  5GAN e;  1Y96 A;  4EMK B;  4RCB A;  1YIJ T;  3JAM E;  2DEQ A;  3V7C A;  4CI0 C;  4M75 E;  3ZEH A;  2E70 A;  4BD3 A;  4F7U A;  2CKK A;  3CEY A;  5GAO l;  4M75 B;  4LDX A;  1VQ6 A;  1WNL A;  1N6A A;  2P4T A;  2HD0 A;  3QZ9 B;  4N4H A;  2ZGW A;  3HP9 A;  4XTW A;  2Y4X A;  2JUF A;  3GPL A;  3UDC A;  2F5K A;  2ZPE B;  5IAY A;  1U1S A;  1GXI E;  1QP3 A;  2LT1 A;  2QXF A;  3CCR T;  1QP2 A;  4BI4 A;  2KY9 A;  3HRU A;  5IN1 A;  3JCM h;  3A8O B;  3WVD B;  2QQA A;  1VQO A;  5GAN 4;  1YJ9 T;  2VXF A;  5GMK m;  5GAN 7;  1VIF A;  3S3M A;  2X35 A;  4PJO G;  3CMA A;  3OYM A;  1QVG A;  1VQ5 A;  4XTY A;  1YHQ T;  3DLM A;  3QZ5 B;  2LNV A;  2RM4 A;  4PL6 A;  2DZ9 A;  1HXD A;  1YJW T;  1QVF A;  4A54 A;  2JOY A;  2PQW A;  2D0Q B;  1KG1 A;  4OGC A;  2RD1 A;  4N4I A;  2KQW A;  5KCH A;  5M9O A;  2RH2 A;  5CK9 A;  5LJ5 g;  2KVQ G;  2KK4 A;  3RER A;  3NTH A;  2K4Y A;  3CCM T;  4JRP A;  2M0O A;  4LDU A;  3X25 B;  2HQX A;  1VQ4 A;  4OF1 A;  4C92 G;  3L42 A;  3VYG A;  4KUL A;  3HRS A;  3OS2 A;  4LDV A;  2BIV A;  4J7I A;  2PVO B;  4XTV A;  4F7U F;  2M1H A;  3R6O A;  2QTX A;  3OYI A;  2YLB A;  4PLI A;  3BY7 A;  5LJ5 h;  4PLL A;  5A0G A;  2M9U A;  4XU0 A;  1KC8 C;  1N27 A;  2EQK A;  5IT9 E;  1Y7X A;  1YJN T;  2QQR A;  3RUX A;  3PT9 A;  3QYG B;  2B8A A;  2RI2 A;  2RHX A;  3V8K A;  3OS1 A;  2E41 A;  3X20 B;  3HFO A;  4J6W A;  2DTO A;  5DY9 A;  4BAC A;  3HKS A;  3INZ A;  3NTI A;  3CXC S;  4M78 G;  3BW1 A;  5GAN 2;  4IUR A;  3RMQ A;  2ZPH B;  4JRK A;  4BDZ A;  1VQ6 T;  3HL8 A;  2KDS A;  2V8I A;  2K2V A;  3OMC A;  3C4S A;  4X9C A;  1UB4 A;  3G4S A;  4M7D G;  3MEV A;  3J80 E;  2D9T A;  2KAF A;  4A4K A;  4FT4 A;  2NLU A;  1OI1 A;  2ZPF B;  5GAN g;  2EQJ A;  3JCM c;  1VQL T;  3CCL A;  1VIE A;  5LJ5 d;  5FRN A;  4XAX B;  2GFA A;  2KMT A;  4QVD A;  1WJS A;  3QPH A;  4M75 G;  3CPF A;  1PSF A;  4C0D C;  1K8A C;  3PIP A;  3MP1 A;  4A4H A;  3A8H B;  3S6W A;  2E65 A;  5LJ3 f;  3OW2 S;  5J3B A;  3CC4 A;  4XTU A;  3UWN A;  3MHX A;  3QDR B;  5LJ3 j;  1VQO T;  4PJO D;  5GMK i;  3OA6 A;  3L2R A;  4PJO C;  4OB0 B;  4C0G A;  5GAM h;  1H3Z A;  1M1K U;  2P0Q A;  4ZGD B;  3CMA T;  5GAN h;  4DA4 A;  2ZPG B;  2DTH A;  3FJP A;  3CCU T;  2EFI A;  4MMK A;  4M77 D;  2JTM A;  3CBO A;  3P8H A;  4M77 C;  4L6V 5;  4ATO A;  3RKY A;  4ELZ C;  1W2B S;  2D6F A;  4EMG A;  4NOY A;  4M7A B;  3M59 A;  1UGP B;  4QVZ A;  1K73 U;  1BI2 A;  3GP8 A;  4C92 D;  4C92 C;  2DJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...