2LQKA

Nmr solution structure of the n-terminal domain of the cdnl protein from thermus thermophilus
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
AGHMKEFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator
publication title NMR structure note: N-terminal domain of Thermus thermophilus CdnL.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2012-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lqkA00
2LQKA 4KBMB 2LT4A 4L5GA 4XAXB 2LT1A 2EYQA
chains in the Genus database with same CATH superfamily
2E5QA 1M1KU 4RCCA 4GBQA 2DNUA 1M3AA 3CCQQ 2EWNA 2LQ8A 2C0IA 1XNIA 3META 4F7UG 4KT0E 2VVKA 1PWTA 1U8RA 1NE8A 2E3HA 4PNOA 2LJ3A 3RNJA 1XJWB 1KQ1A 1I1JA 1VQNA 2PUKB 3ME9A 3M0QA 3V8LA 2JMCA 4B9WA 4N0AA 2V1QA 4RTUA 1PC0A 5LJ3e 2QQ9A 1U1SA 1X6BA 5GAOr 2AZSA 5AYFA 1PHTA 1M8VA 1V1CA 1YI2A 3CC4Q 3EFOB 2YHTA 1BIAA 4JJBA 4DA4A 1K8AR 1D0YA 3OYKA 1FX7A 2QTVA 2ZCFB 5GAMe 1G3TA 1SHGA 2DVEA 3CCEQ 4C0DC 2QEXQ 4B6MA 3VS3A 2JN0A 1SHFA 1VYTA 2XKOC 4C5HA 5J39A 1CSKA 2F5TX 2O4XB 2RJCA 4N4HA 1M3BA 2RK1A 5GMKe 1B34B 1RI0A 2E1HA 2M51A 1UGQB 5GMKi 1NPRA 4JZ3A 2RA2A 1VQPQ 1JJ2S 2WSCE 1YIJT 2R58A 3FB9A 3FJ5A 2PNIA 1Q95G 4M78B 5GANf 4J83A 2J6OA 2RQTA 3WXMB 2HQHA 1OULA 4BACA 1MV3A 2RQUA 1UHCA 4M75D 3M9QA 2RJEA 2DM1A 3EGXB 2FEIA 4FYYB 1YWOA 5KYNA 2ROLA 1VQLT 2ZZDA 1VUBA 4F7UB 2K7AA 1S72T 3OYNA 1I5OB 1C1AA 2JVVA 3JCMg 3SFMA 4FSSA 2EKOA 2L2PA 1UGSB 2P4TA 2K2MA 4A63B 5LJ3j 4PFZA 4PJOE 3JB9H 4C8QF 3A8LB 2LJ1A 1ZQ1A 5LJ5e 1D1BA 4HVUA 1IXDA 1TUDA 3SWNA 2DMOA 2ENMA 1X43A 3CXCP 1QKXA 1QP3A 2A7YA 2D0NA 4PJOA 3PFSA 1WQ7A 1YITA 3BW1A 3OYJA 5CK9A 5IXFA 2K3YA 3JV3A 4CC4B 2L89A 2A37A 3LH5A 1UGRB 4BE0A 3CCQT 1O9SA 4R55A 4M7AD 1ZX6A 2RJDA 2LC4A 4ESRA 2HKQB 1M4ZA 3M53A 5GMKj 2FB7A 3I5SA 1K1ZA 4BY6C 1WXTA 3JCMd 3JB9D 3VYGA 4DBRA 4D6WA 3WVEB 2KMTA 1XTDA 2F2VA 2EIFA 3M56A 2XD0A 4RG2A 3UT1A 1U5SA 2V8IA 2YUOA 4M7DG 4PFPA 3O8VA 1MNDA 1AEYA 5IH2A 4C8QC 3CC4T 4XTUA 1KC8U 3MP8A 3MJXA 3VUBA 2XI9A 3NTHA 2QK0A 2DO3A 3AT1B 3NTKA 4M78C 2SRCA 2VGMA 1J3TA 2ABLA 5FWBA 1ACMB 3MEVA 4JUVA 1VQ7T 1FYNA 3G6ET 1H641 1VQ9A 9ATCB 5CVIA 1QWEA 4C92F 1K9MC 2RNAA 1GBQA 4MZTA 4A53A 1MGQA 2DD4A 4XU3A 2E64A 3MKDA 1JO8A 3LLRA 3OS1A 1PKSA 1RABB 3OYYA 1X6GA 2P4RA 3ZEHA 3GIBA 4XU0A 1YHQA 5LJ5j 3V7SA 2DZCA 3EGDB 5GANe 1VQPT 1M5Q1 3I5RA 2DBMA 2RN8A 1KC8C 2GFAA 3OBYA 2YRVA 4NS5A 3CCVQ 4XTZA 4BE2A 4J5YA 2HEQA 1Q82R 3PGGA 4F04B 2RB6A 4CC3A 8AT1B 5A0GA 3G71T 2DFUA 2HD0A 3QO3A 3V8KA 4FU6A 1BU1A 2EQUA 2FG0A 4E7KA 1ZUYA 1VQ6Q 3EHQA 3H6ZA 4K11A 2GGRA 4C92C 1M1GA 3A8MB 5KYXA 4D8DA 2DEUA 1VIFA 2DKGA 3OW2S 1TSFA 1M1FA 4BDYA 4KGVB 4OMOA 1IGQA 3M0PA 3EGUA 5GAMh 3PT9A 1TWBA 2IVWA 1QKWA 5IXBA 1QVFS 2ZPFB 4M7DB 4X9CA 3NGPA 3S6WA 3OYFA 2RI5A 3NPFA 1K0SA 1WX6A 1UUEA 2VKNA 1VQNQ 2LDMA 1VQ5A 2G6FX 4C0ZA 1D3BB 1D0XA 2V26A 1YJ9T 2KYBA 3H0HA 1JXOA 2MI6A 1X75C 1IREB 2KNBB 4EPCA 5GANj 1YJWT 1KD1U 1WHJA 3OYGA 5AT1B 1PM3A 4A4KA 1ZHIA 2DRMA 3M59A 4J9CA 2L5QA 5I2SA 3LGFA 3HRSA 1YCSB 1K76A 2LNVA 3CCEA 2AT1B 2JS0A 3NHNA 4M75E 2QEXA 4V2SA 2YUPA 1C0MA 1U1TA 1YJNA 2F1LA 1G8XA 4Z88A 3QJ6A 1I8FA 1LPLA 3GNGA 2VXEA 4M77G 1WHKA 3JCMh 3OS0A 1WZOA 2K5FA 1M2VA 5D6YA 2GCXA 1X69A 2RQVA 1X6OA 2JM9A 1VQKT 4X1VA 1KD1C 2OTJT 1VA7A 2KEAA 4F17A 1H92A 2ZPEB 4RTXA 3QXEB 2KK4A 2RH2A 3H41A 4F16A 4HT9A 1HSQA 2QA4T 1RAAB 4L6V5 2WSEE 3I9QA 4HVVA 2NUPA 1BI0A 1OI1A 4JJNK 1MMDA 1TUCA 2DK3A 2RI3A 1SKUB 3H8ZA 3QBYA 4LUEA 5DLOA 4OB3B 4PLIA 2COYA 5KYUB 5KYWA 3EAEA 1M1KR 2IIMA 2X51A 2BE7D 5GMKm 3JRZA 1HD3A 1YN8A 5LL6S 4ORZA 4FYWB 3C94A 3QWXX 2JM8A 2CP7A 1QCNA 3KBGA 1VQ6T 3OS5A 2O9VA 3JCMV 2K6DA 2K57A 3JAME 3C12A 3BDUA 3GOXA 1IHVA 4OMQA 5J3BA 1AD5A 1WJRA 2GNCA 4LDUA 1BB9A 1WHGA 2CS7A 4J9IA 2Z0WA 5GMKl 2K9GA 1GFDA 2DXCA 4J9HA 1ABOA 2L3QA 3EG9B 3CCRA 3OYDA 1AWJA 2DETA 2AKKA 5GAOq 4LDYA 3FC3A 2YLBA 3L2RA 3P8BB 3TEEA 3VU3C 4OB0B 3SD4A 2LQWA 3Q1JA 1M90C 4Z89A 1JRIA 1NLPC 3P8DA 4QQ6A 2DJQA 3GBQA 4PJOD 2KY9A 1VQNT 1M8MA 2M02A 1OEBA 3X20B 1MV0B 1W1FA 4M77B 2CGHA 5KE3A 2HSPA 4C5IA 2DYBA 2HL5C 1WIEA 2DL8A 4RTVA 5CKDA 2YRCA 2YWWA 2ATCB 1GCPA 2RD1A 4IKFA 4QT7A 3VS6A 1YI2T 1CKAA 1HXDA 1CKBA 2VV5A 2KGTA 4LDVA 1H3ZA 1Q86C 2JT4A 3MO8A 5KYYB 1QMCA 4ZN1A 2NLUA 3UATA 1VQ9Q 1SF9A 1JB0E 4QQDA 3CXCS 3EHRA 1UTIA 1AZGB 2X4WA 3MEUA 1G3WA 1NJIR 3PMIA 4Z02A 2CP6A 1NYFA 2L3PA 3ZBDA 4VUBA 2CYZB 2DYIA 1YHQQ 3EFOA 3CCJA 2RO0A 4C0DB 4RTYA 1Q7YU 3CQTA 5DM7R 4M75F 3JCMc 4FM4B 2EPDA 5FU7C 4AG2C 5J26A 2NUTB 3CCVA 3M0RA 5CQXA 2J06A 4MMLA 2K3BA 3CC2T 5C0MA 1WQWA 3OYEA 2CH4W 4EIKA 2P0KA 2LX9A 2HMAA 4DBFA 2KROA 5L23A 5FRMA 2KQWA 3KFVA 1VIEA 2O4XA 3CMAA 1KG1A 2BKDN 2QXFA 3TU4K 2CZ6B 3CC7A 1B34A 4PFOA 4QW2A 2EYYA 4C8QG 4AFUC 2XU8A 1W4SA 2D8JA 2JNGA 3RMSA 2CP2A 2JTEA 1FXXA 2A3LA 4YTLA 1Q7YC 3CCSA 4M78A 2EQJA 3PMTA 2QASA 5A0LA 2YT6A 4DQ2A 5HY6A 4BDZA 4FT2A 2FYKA 3I35A 2CSQA 4FT4A 2HZYA 4OMFB 4F7UE 1K73R 1QVGA 3EGXA 1VQOQ 1WJQA 3UA6A 4M7AF 1R8OB 3HRTA 1YITT 2WSFE 1UEBA 5CCAA 1OU8A 4F7UA 2E41A 2F2XA 3EG0A 4EMKB 4HCBA 4PJNA 1N8RC 1K4US 3GP8A 1WFWA 5LJ3g 1D09B 1VQ5Q 4LXCA 3N5BB 1WXUA 2YUQA 5IHNA 2O31A 1B07A 1KQSS 2OAWA 3GNFB 2COZA 4E47A 2BE9B 4BD3A 1UG1A 2QQBA 1WI7A 3JCMP 1KSWA 5GAMg 2JTMA 3UPUA 3CCLA 3BE3A 1PCXA 1NLOC 1NM7A 5KCHA 4LE9A 1KFZA 4C92G 2FRWA 4DEXA 4ZN3A 1YJNQ 1OZ3A 1Q81U 5HK0A 2CP0A 3WVDB 3CPWA 1WGSA 2OAUA 2Y4XA 4BY6B 1M27C 1M3CA 2M1HA 5C6SA 3M0UA 3H0IA 2CSIA 4EDUA 1G3YA 4OGEA 1SRMA 3OSSC 1Y96B 3G4SQ 5LJ3d 1IHWA 2K3XA 3MHXA 1GCQC 4C8QB 1I5LA 1QCFA 4MZPA 4ME7A 4LD9K 1RACB 3T9NA 1VYVA 5GAMd 4LUDA 4FW2A 2XDDA 1YP5A 4E7JA 4BI4A 2EYZA 3E1SA 2HAXA 3HSBA 2FZKB 4C0GA 1Q81C 3CD6Q 2LZ6B 1XOVA 3FRNA 2M16A 4ELYC 4CC7A 3LWHA 3JB9J 1WHMA 5CKBA 2CUDA 3PIOA 4J9BA 1AT1B 1RAIB 4KBMB 4XQ3A 5CIUA 3J81E 2O9SA 3MP6A 1UB4A 1VQ4Q 2CUBA 5LJ5g 1KQ2A 4EMKC 1QVGP 1RL2A 2E70A 2G3RA 4PJJA 1PD1A 1SEMA 1TTHB 3VS5A 3EGDA 1JEGA 4ZNXA 3HP9A 1P92A 2A28A 4BI3A 2CREA 4LNPA 4KUIA 3NTIA 2ZGWA 2BTTA 3QZ5B 2IG0A 1TS9A 3CCRQ 3TREA 2GQIA 4L59A 3UDCA 4LN2A 1OPLA 1XQHA 3CCMA 4C92B 1K9MU 4Z8AA 5CAIA 2EJGA 1MHNA 3TSWA 2DEQA 4FCYA 3VUZA 6AT1B 1TU0B 4O6JA 3JCMJ 1AHJB 3QHSA 3RERA 5LJ5d 4M7DE 2RI2A 2A0FB 3OMCA 1E6HA 3CPWP 2L8DA 2MK5A 1HJDA 4J6WA 4M7DA 4JLIA 5IHKA 3M54A 1ZA2B 3V7CA 1AZEA 3OYIA 1UDLA 3QUIA 1JJ2A 3A8HB 4A54A 2H3EB 3CCET 2X9HA 3RESA 2QEXT 2EBPA 3KUFA 2ED1A 3JCMQ 1YJNT 3G7ZA 3RIRA 2C06A 4ZGJB 4PL6A 3MP1A 1LVKA 1D3BA 3TSZA 2LRQA 4RKUE 5I2MA 3AHUA 4D8KA 3REBB 4M4ZA 2F2WA 3URGA 4F14A 3REAB 3CCJQ 2B8AA 1K8AU 2X4JA 1EIFA 1WXBA 4RTWA 2R57A 3JCMX 3JSCA 4XU2A 2PUOB 3OYHA 1I81A 4HXJA 3CMEQ 3QIIA 1R0CB 2OI3A 2YLCA 3OS2A 2CP3A 3PVQA 1NEBA 2QQAA 3L42A 2GBQA 4N0AC 3EH2A 2V1RA 1T0HA 3CMAQ 3PNWC 2DIGA 4HCCA 3CC7Q 2KBTA 5LJ3h 5GJVB 3DB4A 2AK5A 1NG2A 1VQLA 1BYMA 3X26B 1B7TA 2R5MA 1S72A 2YDLA 5CO7A 5GANd 1K8AC 2MAMA 2LMJA 3CCSQ 4E2FB 2QTXA 1UJ0A 1D1AA 2ED0A 2MCNA 1UJYA 1TUGB 3FEOA 1VQOA 2FZCB 4BUGA 1V29B 3PIPA 2EJ9A 2K4YA 4J7FA 4DOWA 3P8HA 3CCRT 5GMKh 2LX7A 3FJPA 4NL3A 5KYUA 4M78D 1JQQA 4PJOF 4A4GA 1FMVA 4AMCA 4NL2A 1W6XA 2HKNA 4LD6A 3J7AF 2D9TA 1QQJA 5IAYA 2EW3A 8ATCB 4BE1A 4E7IA 1MUZA 4OMNA 2DD5A 3CBOA 2DBKA 3DB3A 2DILA 3J80E 3CCLQ 5GAOn 1W2BS 2MPXC 2RQRA 1YCYA 4AFQC 2KR3A 1RAEB 3EG9A 4LDWA 3F70A 1N5ZA 2QYZA 1F1BB 4BB7A 2COWA 5CR2A 4M77E 1BCMA 2DTIA 3NMZC 5D7UA 1BI2A 1N6AA 2AHJB 2CDTA 2JOYA 3KXTA 2XDPA 3ZL7C 2OTLA 1VQ7A 3G6EA 3C95A 3G4SA 3SWNC 1G3SA 2YXYA 4QQGA 4M77A 5LJ5h 1QW1A 3SB2A 4PJOC 5GAN2 3QKJA 4M75G 4E7HA 2EGEA 3CBPA 4ZTFA 2CT3A 1SRLA 3UWNA 2VXFA 1SSFA 1RADB 3OSVA 3QPHA 1UGVA 2XMFA 3CCJT 1OPKA 3PE0A 4HKEA 2L0AA 3CD6A 1X2KA 3RKXA 5KYYA 4JS4A 4AT1B 3CCVT 3OW2A 3SEMA 4FIBA 2DL4A 2XICA 3MEAA 3QJYA 1PKTA 1AWOA 5IN1A 4MZMA 1QVFA 1M90U 1H3HA 2PU9B 2M0OA 5GAN4 2O88A 1SG5A 3CMAT 1VQ4A 1BK2A 1WLPB 4MMKA 2JS2A 1RUWA 2RHXA 4JRKA 3A1PA 5FU7B 5GAN8 1OX9A 5KE2A 2CZ0B 3MCAB 5FRNA 3I56A 1RI9A 1YFNA 3VS4A 4HCZA 2NUTA 5GAN3 3CCST 4M7AG 4J6XA 4P5NA 2CZ1B 2JMAA 5CKHA 5EG2A 1Q86U 1ZUUA 1S1NA 1W70A 4OF1A 1KK7A 5GJWB 2AKLA 4OGCA 3JB9G 1AVZC 4ATOA 2DX1A 4QVDA 3CCMQ 3VS0A 4J8OA 1GCQA 3RKWA 1BI1A 4E6RA 5FROA 1UE9A 1IZ6A 1YNZA 2MWOA 1MMGA 3VRZA 3OYAA 3FLGA 4FW1A 1NPPA 3VS1A 2E6NA 2PVDB 3PVLA 5GANh 3HKSA 2RK2A 3M57A 4RMOA 3HFNA 3VKIA 1ZBJA 4JLGA 1U06A 4M75B 4J9DA 1YJ9A 2C0TA 1LNXA 2F69A 1TXQA 2H3JA 3I55A 4GLMA 1Q82C 2WACA 3CCLT 2E12A 2M0YA 1ZSZB 1VQMA 2QGFB 5IHIA 2NYSA 2JJ9A 2KDSA 3RKYA 3X25B 2EJFA 3A8GB 1IO6A 3OBWA 3GLXA 5I22A 4E7ZA 4EMKA 2FPDA 1RAFB 4DEYA 4PJMA 2VUBA 5GAMf 2XIDA 5FW9A 2ECZA 5GAN7 4RG8A 3TVTA 2HQEA 4M7DD 5GAOp 4JJCA 2VWFA 1UECA 1E6GA 2B86A 4UC4A 1ZBXA 3OW2P 2X4YA 3E2UA 3RUXA 2KSSA 3OYCA 2LJ0A 2M9UA 3E19A 2EQIA 1WJSA 1HYOA 3E9GA 3CMEA 1YIJQ 1VQKA 1QVFP 4XTWA 2OTJA 3M0TA 3V8JA 4JRPA 2RHYA 2LTOA 2Y4YA 1GL5A 4HA8A 3LH0A 2A08A 2RPNA 3IQLA 4M7AB 1B3QA 2YRDA 2DIQA 4JJDA 3VJPA 4OMPA 4C8QE 2VASA 1YBYA 2HNIA 4XU1A 1QVPA 1OX8A 3EFRA 4M78E 1N8RU 3C0CA 2I2LA 2ZPBB 3UF4A 2DF6A 1VQLQ 1ZA1B 4C8QA 3JCMW 2HQXA 1S72Q 5EC7A 2K2VA 2EQKA 2NWMA 1K9MR 1N9SA 2DTHA 1JXMA 3QYHB 1MMAA 2MF2A 2QQRA 1VOMA 4M75C 2VGNA 3JCMf 2DJZA 3U23A 3GF5A 5CQYA 2X3WD 2E6ZA 3VYHB 4OP0A 3H9NA 5DLQE 1ZSZC 3JB9F 2I0NA 1IGUA 3EG1A 4MDWA 1KC8R 3CCMT 4QKUA 1Z9QA 1E7OA 3C4SA 1KJWA 1O75A 1WHLA 3QG1A 2FZGB 4E7LA 3QWYA 5M9OA 4CC2A 2QG9B 4JRIA 3CXCA 2O2OA 1UGPB 2KAFA 4A4FA 3THKA 2DL7A 1FMWA 3OYMA 4C92E 1A0NB 4BI8B 2VC8A 4FYXB 2LQKA 1IRXA 3LGLA 3A8OB 1QLYA 3OYBA 1WA7A 2KVQG 3JB9I 3QDRB 1PRMC 4C92A 1PSEA 1M1KC 5HCKA 2A36A 2F5KA 2E65A 2EQMA 1VQ8A 4M7AC 1VQ9T 1TOVA 2OTLQ 3A5ZB 2DLPA 1VQ7Q 3G6EQ 1KIKA 5I11A 4IUQA 3X28B 3HL8A 2JXBA 3HFOA 3M4YA 4ELZC 1PD0A 3QSUA 3HPWA 1X2QA 1YHQT 4IURA 2DE0X 4KUDK 3OB9A 2EYXA 2KRMA 2L3SA 1GXIE 2J7IA 3M55A 4JPBW 3RDVA 1OYXA 4L5GA 4M77D 2KE9A 3RMQA 3CCUA 2O01E 3ER0A 1UHFA 4KGZB 2DZ9A 7AT1B 3CC2A 1NJIU 2KI7A 3TCJA 3QZ9B 1OU9A 4R56A 4J9EA 3G71Q 2ROTA 3OQ5A 2EVRA 1I4K1 2BIVA 3CPFA 4A4EA 1R0BG 1VYUA 3S3MA 2VB6A 2R5AA 1NBEB 3I56Q 2C0OA 4OMMA 2RM4A 4Y91A 1T3LA 3EFSA 1ARKA 3S3NA 1ZUKA 3JCMe 2RHUA 1M9SA 1KQSA 4IUUA 1X27A 4PJOG 4OMLA 4M78F 1VQOT 1BI3A 3VS7A 2LQNA 1KD1R 2LVMA 2ZPHB 1NJIC 5GAMj 2HL3A 2GTJA 4C5GA 2IPOB 1LJOA 4XTVA 2GTOA 5DY9A 3A98A 5FU6B 3R6OA 4JZ4A 2MYSA 1VQ5T 3EH1A 2DERA 1PNJA 2KRNA 4F7UF 5IT9E 3L2VA 1WDXA 4EMHA 4ZTJA 1YJ9Q 1K73U 4IUPA 1D0ZA 1OOTA 3BFMA 3I55Q 4OVAA 1YJWQ 4NOYA 2KXCA 2KT1A 2GF7A 4LDXA 2DTOA 2CP5A 5GAN6 1VQMQ 3S3OA 2W0ZA 2EFIA 2RMOA 4DOVA 3INZA 1HK9A 4JDSA 4O5VA 2HBWA 3FDRA 4XTYA 1I0CA 1ZLMA 2X35A 4KH0B 5FWCA 2XDBA 4KULA 2ESWA 2E10A 1BIBA 5GANg 1Y7XA 2OTLT 1IB8A 3EG2A 4WTOB 3G4ST 2FRYA 3L2ZA 2X3XD 5L8RE 5HK3A 2D1XA 1LCKA 1WNLA 1K73C 2XG8D 1YIJA 2D8HA 2LP5A 4HVWA 1VQKQ 1M90R 4RTTA 2OTJQ 3ZFJA 2EKHA 1AWXA 2BUDA 3M0SA 3OY9A 1FWZA 4WCIA 2E3IA 1RAHB 1JBMA 1X01A 4B9XA 2XHCA 3CD6T 3SWNB 1T3SA 3HRUA 4IUTA 1G83A 2QA4Q 1T0JA 1BCOA 2DRKA 1RLQC 4PJOB 3DKMA 3JCMb 3MPUB 4J9FA 2J05A 4J9GA 2CZ7B 2V8JA 4N4IA 1Q86R 1WHHA 1BKBA 1KQSP 3H0FA 1VQ4T 2KXDA 1GBRA 2LT1A 3E9FA 5FU6C 1PG5B 4RUGA 2BZXA 4KH1B 4DBQA 2W10A 5GAOm 4J6YA 2LNHB 3I56T 4KRTA 2HDAA 3DLLA 2ZPGB 4KGXB 2DXBA 3ASKA 3HTRA 5A0DA 2KT8A 2J6FA 5D6WA 4IUVA 4C8QD 1Y07A 3O5ZA 2Y90A 5GAOl 2MWPA 3M58A 3CCQA 1I07A 3LWIA 1C6VX 1R77A 1PSFA 2K5IA 1SSHA 1Y0MA 2D6FA 2QAZA 1N9RA 4GY5A 2QGGA 2JW4A 1SPKA 1GRIA 2RF0A 1JJ2P 4TVRA 3VRYA 1QP2A 3NFCA 2BZYA 2LCCA 4JS5A 2DL5A 3MEWA 2CT4A 2RJFA 4PKCC 3OYLA 2FPEA 1NEGA 3I55T 3CC4A 2DVJA 4X9DA 1YI2Q 2QDYB 2OJ2A 1VQMT 2P0QA 3VS2A 1Q7YR 3D7SB 2FPFA 2DXUA 1VQ8Q 4M7DF 2FL7A 1ABQA 5HKCA 4J7IA 1H8KA 3BDLA 3GPLA 3X24B 3G1JA 1KHIA 4R0KA 4ZGDB 4PLLA 3M5AA 2JUFA 4M75A 4MDXA 4X34A 4C92D 3EG3A 1K0XA 2J6KA 2DA9A 2LCSA 1VQPA 1N8RR 3FIFA 1ZSZA 3CMET 5GAN5 5KYXB 2AZVA 2AIRB 4Q5WA 3CCUQ 1N27A 2PZ1A 4E7SA 1PRLC 1EX4A 1MNEA 3DLMA 3TQ7P 4AFZC 3CC2Q 2RHZA 4FYVB 2GFUA 2DL3A 5CKEA 4CI0C 2X4XA 4OB1B 1G2BA 3G71A 1QWFA 2K79A 4XAXB 2E5KA 4N4GA 3CC7T 3LYIA 2L3RA 3OA6A 4M7DC 1WPYA 1Y57A 2RHIA 3L1AA 3L2WA 1FMKA 3R6NA 3ULRB 4M7AE 1EFNA 4II1A 2MIOA 1OV3A 4A4HA 2H8HA 2JTFA 5A2QE 4ZGEB 2EGCA 3HHTB 1G5VA 1Q82U 2FO0A 4M7AA 4FSXA 2MMPA 2E4HA 2FVUA 3V7RA 3M4GA 3LW5E 1OQKA 1QCOA 4HCKA 4XTXA 4RTZA 4JRQA 4IIMA 4DBHA 2PVGB 1YITQ 1W2BA 2ZAEA 1TH7A 4GLKA 2DAQA 2GQVA 2EYWA 2V8KA 2LT4A 2YSQA 1Q81R 1OZ2A 2EAYA 2YUNA 3CBMA 4AG1C 2P0PA 1RAGB 4Y92A 2EGAA 4FL6A 1Z9ZA 4C5EA 2EYQA 1K9AA 3LX7A 2VYTA 4OB2B 2MOXA 1YJWA 1QVGS 1MMNA 3L2UA 3SDZA 4WF2A 1M2VB 3RBBB 2OX7A 5LJ3f 3RR6A 4PK4A 4QVZA 5D6XA 2CH4A 1TG0A 5KCOA 2LCLA 1M30A 3CEYA 4EMGA 2SEMA 1ZSGA 1YWPA 1VQ8T 3PTAA 2K5LA 4CRIA 2FHDA 2NUPB 1UFFA 2RQWA 5KH6A 2CKKA 2NUZA 2P84A 2PVOB 1KHCA 2QQSA 5KYWB 1NYGA 3UA7A 1RLPC 4QVCA 4PJLA 2QI2A 4M77F 2JZ2A 4ANJA 3CPWS 2PQWA 5I21A 4AFSC 2XK0A 1DJ7B 4RCBA 2QA4A 2DXTA 1AWWA 3CCUT 3SHWA 1Y96A 1GFCA 3OMGA 1Y71A 4XK8E 2ZPIB 1U3OA 3QYGB 2QDLA 1BBZA 4IIOA 4C0FA 1NZ9A 3BY7A 1AOJA 2KRSA 1WYXA 2HCKA 1JU5C 2HBPA 2KYMA 1VQ6A 4HT8A 3VV0A 2D0QB 1W2BP 1V76A 1D1CA 5ECAA 1M2OA 5CKFA 4M78G 4Y28E 1EZZB 2DPPB 1LOJA 3L2QA 2BZ8A 2HSEB 3QDFA 5LJ5f 4M77C 5FLXE 2PTKA
chains in the Genus database with same CATH topology
2DXCA 2E5QA 1M1KU 4PJOG 4BUGA 4M78F 4RCCA 1V29B 1VQOT 1BI3A 3PIPA 2EJ9A 2LVMA 2ZPHB 3CCRA 2K4YA 1NJIC 2EWNA 2LQ8A 4J7FA 5GAMj 3OYDA 4DOWA 3P8HA 4C5GA 3CCRT 1XNIA 5GMKh 5GAOq 1LJOA 4LDYA 4NL3A 3FJPA 4XTVA 3FC3A 4M78D 2YLBA 3META 4PJOF 4A4GA 4F7UG 3P8BB 4KT0E 3TEEA 3L2RA 1U8RA 5DY9A 5FU6B 3VU3C 1NE8A 4NL2A 4OB0B 3SD4A 3R6OA 3Q1JA 4PNOA 1M90C 4LD6A 3J7AF 2D9TA 5IAYA 1KQ1A 1JRIA 3P8DA 1VQ5T 1VQNA 4QQ6A 2PUKB 3ME9A 4BE1A 4PJOD 2KY9A 3V8LA 4E7IA 1VQNT 4F7UF 3X20B 5IT9E 3L2VA 4M77B 2CGHA 5KE3A 4B9WA 4EMHA 4N0AA 2DD5A 4ZTJA 3CBOA 4C5IA 1K73U 3DB3A 4IUPA 2QQ9A 1U1SA 5LJ3e 3J80E 3BFMA 4OVAA 5GAOr 5GAOn 5CKDA 4NOYA 5AYFA 1M8VA 1W2BS 2RD1A 4IKFA 1YI2A 2YHTA 1YCYA 1YI2T 1BIAA 2GF7A 4LDXA 2DTOA 5GAN6 4LDWA 1HXDA 3F70A 3S3OA 2VV5A 4DA4A 2EFIA 4LDVA 3OYKA 1H3ZA 1Q86C 4DOVA 1FX7A 2ZCFB 3MO8A 5GAMe 1G3TA 1HK9A 3INZA 4JDSA 4O5VA 4BB7A 3FDRA 4XTYA 4M77E 4ZN1A 5CR2A 2DTIA 2DVEA 4C0DC 2NLUA 1BI2A 1N6AA 2AHJB 3CXCS 1JB0E 4QQDA 2JOYA 2JN0A 2X35A 3KXTA 2XDPA 2XDBA 2OTLA 4KULA 2XKOC 1VQ7A 3G6EA 2E10A 3C95A 1BIBA 5GANg 1Y7XA 3G4SA 3SWNC 2OTLT 1G3SA 2X4WA 4QQGA 4C5HA 3MEUA 4M77A 2F5TX 2O4XB 2RJCA 5J39A 5LJ5h 3G4ST 4N4HA 1G3WA 1QW1A 3L2ZA 3PMIA 4Z02A 3SB2A 4PJOC 2RK1A 5GAN2 5GMKe 3QKJA 4M75G 1B34B 5L8RE 3ZBDA 5HK3A 1RI0A 4VUBA 4E7HA 2E1HA 3CBPA 1UGQB 1WNLA 5GMKi 4ZTFA 1K73C 2CYZB 2XG8D 3UWNA 1NPRA 1YIJA 2RA2A 2VXFA 1SSFA 1JJ2S 2WSCE 3CCJA 1YIJT 3OSVA 3QPHA 2R58A 2RO0A 4C0DB 3ZFJA 1Q7YU 3FB9A 2BUDA 4M75F 3JCMc 5DM7R 3CCJT 4FM4B 5FU7C 3OY9A 1FWZA 4HKEA 4M78B 5J26A 5GANf 1JBMA 4J83A 3CCVA 3RKXA 3CD6A 1X01A 5CQXA 2XHCA 4B9XA 4JS4A 3WXMB 4MMLA 3CCVT 3SWNB 4BACA 3CD6T 3HRUA 4IUTA 4M75D 3CC2T 3M9QA 5C0MA 3OW2A 1WQWA 3OYEA 4FIBA 2P0KA 4PJOB 2RJEA 2XICA 3DKMA 3MEAA 3JCMb 2LX9A 3QJYA 5FRMA 2KQWA 2CZ7B 5IN1A 1VIEA 4MZMA 2O4XA 2V8JA 3CMAA 1M90U 1QVFA 4N4IA 1KG1A 2PU9B 2M0OA 5GAN4 2BKDN 2QXFA 3TU4K 1VQLT 2CZ6B 3CC7A 3CMAT 1VQ4A 1BKBA 2ZZDA 1B34A 1VUBA 4MMKA 4QW2A 4F7UB 2RHXA 4C8QG 4JRKA 1S72T 3OYNA 5FU7B 1VQ4T 2XU8A 5GAN8 1W4SA 2LT1A 5KE2A 2CZ0B 2JNGA 2JVVA 3E9FA 5FU6C 3JCMg 3SFMA 3RMSA 3MCAB 2EKOA 1FXXA 1UGSB 2P4TA 2A3LA 5LJ3j 5FRNA 3I56A 5GAOm 4PJOE 3JB9H 4J6YA 4C8QF 3A8LB 4HCZA 4YTLA 1Q7YC 3I56T 3CCSA 4M78A 1ZQ1A 3DLLA 5LJ5e 2EQJA 2ZPGB 3PMTA 5GAN3 3CCST 2DXBA 4M7AG 3ASKA 4J6XA 4P5NA 3SWNA 2CZ1B 4DQ2A 5CKHA 5A0DA 5HY6A 5A0LA 4BDZA 4FT2A 5D6WA 5EG2A 2FYKA 4IUVA 1Q86U 4C8QD 1Y07A 4FT4A 4OMFB 1QP3A 2A7YA 4F7UE 4PJOA 3PFSA 4OF1A 1WQ7A 1QVGA 2Y90A 1YITA 3BW1A 3OYJA 5CK9A 5GAOl 1WJQA 4OGCA 2K3YA 2MWPA 4M7AF 1R8OB 3HRTA 3M58A 1YITT 2WSFE 3JB9G 2L89A 3CCQA 1UEBA 4ATOA 4QVDA 5CCAA 1UGRB 4BE0A 4J8OA 3LWIA 3RKWA 3CCQT 1O9SA 1PSFA 1BI1A 2K5IA 4R55A 5FROA 2D6FA 4F7UA 2E41A 1N9RA 1IZ6A 4GY5A 4EMKB 4HCBA 2MWOA 4M7AD 2RJDA 2LC4A 3FLGA 3OYAA 1NPPA 4TVRA 1N8RC 2E6NA 2PVDB 3GP8A 5LJ3g 1M4ZA 5GANh 3M53A 5GMKj 1QP2A 2FB7A 3HKSA 3N5BB 3NFCA 2RK2A 3M57A 4RMOA 2LCCA 4JS5A 3HFNA 4BY6C 1KQSS 3JCMd 3MEWA 3GNFB 3VKIA 3JB9D 4JLGA 3VYGA 4D6WA 4M75B 3WVEB 4E47A 1YJ9A 2KMTA 4BD3A 1XTDA 2RJFA 2QQBA 1LNXA 2EIFA 5GAMg 3M56A 4PKCC 2F69A 2JTMA 3I55A 2H3JA 3UPUA 2XD0A 3CCLA 4RG2A 3UT1A 3OYLA 2V8IA 3I55T 1Q82C 2WACA 4M7DG 3CC4A 3CCLT 2E12A 3O8VA 4X9DA 5KCHA 4C8QC 3CC4T 1VQMA 2QDYB 4XTUA 1KC8U 2KDSA 3MP8A 3VUBA 2XI9A 3NTHA 2DO3A 3RKYA 2EJFA 2P0QA 3A8GB 3X25B 1VQMT 4C92G 1Q81U 3OBWA 4ZN3A 3GLXA 1OZ3A 2DXUA 3NTKA 4M78C 5HK0A 4M7DF 2FL7A 4EMKA 2VGMA 3WVDB 5HKCA 3CPWA 4J7IA 3BDLA 1WGSA 2OAUA 2Y4XA 3GPLA 4BY6B 3MEVA 3X24B 4JUVA 1VQ7T 2M1HA 3G6ET 1H641 1VQ9A 5C6SA 1KHIA 2VUBA 5CVIA 2XIDA 5GAMf 4EDUA 4C92F 1G3YA 4RG8A 5GAN7 1K9MC 4M7DD 2HQEA 4MZTA 4A53A 4OGEA 5GAOp 3OSSC 1Y96B 4ZGDB 4PLLA 3M5AA 2JUFA 5LJ3d 1MGQA 2DD4A 2K3XA 4M75A 4UC4A 1ZBXA 3MHXA 4XU3A 2E64A 4X34A 2X4YA 3LLRA 4C8QB 4C92D 4MDXA 3RUXA 3OS1A 1I5LA 2KSSA 3OYCA 3OYYA 2M9UA 3E19A 4MZPA 3ZEHA 3GIBA 4XU0A 1YHQA 5LJ5j 1WJSA 4ME7A 1VQPA 3E9GA 3CMEA 4LD9K 3FIFA 3V7SA 1VQKA 2DZCA 4XTWA 3T9NA 5GANe 1VQPT 1M5Q1 2OTJA 3CMET 5GAMd 3V8JA 5GAN5 2XDDA 2RHYA 4JRPA 2LTOA 2Y4YA 4E7JA 4Q5WA 4HA8A 4BI4A 3E1SA 2GFAA 3LH0A 3OBYA 1KC8C 2HAXA 1N27A 4M7AB 2YRVA 3HSBA 4NS5A 4C0GA 1Q81C 4XTZA 2DIQA 3DLMA 4BE2A 3VJPA 2RHZA 2GFUA 5CKEA 4C8QE 4CI0C 1XOVA 1YBYA 2X4XA 3FRNA 2M16A 4ELYC 2HNIA 4J5YA 4OB1B 4XU1A 1QVPA 3LWHA 3JB9J 3PGGA 2RB6A 3G71A 5CKBA 4XAXB 3EFRA 4N4GA 4M78E 3CC7T 5A0GA 3PIOA 1N8RU 3LYIA 2I2LA 2ZPBB 3G71T 2L3RA 3OA6A 4KBMB 4XQ3A 5CIUA 2HD0A 1WPYA 4M7DC 3QO3A 3J81E 3V8KA 4C8QA 3JCMW 2RHIA 2HQXA 3L1AA 1UB4A 3MP6A 2EQUA 4FU6A 3L2WA 4E7KA 1KQ2A 5LJ5g 4EMKC 1RL2A 2E70A 4M7AE 2G3RA 3H6ZA 4II1A 4A4HA 4C92C 1M1GA 2JTFA 2K2VA 3A8MB 5A2QE 2EQKA 1P92A 3HP9A 4ZGEB 1VIFA 1N9SA 2DKGA 2DTHA 3HHTB 3OW2S 3QYHB 1M1FA 3JCMP 1G5VA 4BI3A 4BDYA 1Q82U 2MF2A 4M7AA 2QQRA 4FSXA 4KUIA 5GAMh 2MMPA 3PT9A 2FVUA 2IVWA 2VGNA 4M75C 3JCMf 2DJZA 3V7RA 3M4GA 3LW5E 3GF5A 3NTIA 2ZGWA 1QVFS 5CQYA 2ZPFB 4M7DB 3QZ5B 4XTXA 2IG0A 2E6ZA 3TREA 4JRQA 4L59A 3VYHB 4OP0A 4X9CA 2PVGB 1W2BA 5DLQE 3UDCA 1TH7A 1XQHA 4GLKA 2DAQA 3S6WA 4C92B 2RI5A 3OYFA 3CCMA 3JB9F 2GQVA 1K9MU 4MDWA 3CCMT 3C4SA 5CAIA 1O75A 1MHNA 2EJGA 2V8KA 2LT4A 1OZ2A 2EAYA 2DEQA 3CBMA 2P0PA 3QG1A 2LDMA 3VUZA 4E7LA 4O6JA 1VQ5A 5M9OA 3JCMJ 4FL6A 1AHJB 4JRIA 3QHSA 4C0ZA 5LJ5d 3RERA 2RI2A 4C5EA 2EYQA 1D3BB 3CXCA 4M7DE 3LX7A 2VYTA 3OMCA 1YJ9T 1UGPB 2KAFA 4OB2B 4A4FA 1YJWA 2MI6A 1QVGS 3L2UA 1X75C 1IREB 3SDZA 4EPCA 4WF2A 5GANj 1YJWT 3OYMA 4C92E 1KD1U 2L8DA 3OYGA 4BI8B 5LJ3f 2VC8A 4J6WA 4QVZA 5D6XA 4A4KA 4M7DA 1ZHIA 4JLIA 2LQKA 3M59A 3LGLA 2L5QA 3A8OB 3M54A 3V7CA 5KCOA 3OYBA 5I2SA 3LGFA 3HRSA 2LCLA 2KVQG 3OYIA 3JB9I 2LNVA 3QDRB 3QUIA 3CCEA 1JJ2A 4C92A 4M75E 3A8HB 1PSEA 3CEYA 4A54A 2QEXA 1M1KC 3CCET 3RESA 4V2SA 2F5KA 1U1TA 1YJNA 2E65A 2EQMA 4EMGA 2QEXT 1VQ8A 4M7AC 3KUFA 1VQ9T 3JCMQ 1YJNT 3G7ZA 3RIRA 1VQ8T 3QJ6A 3PTAA 2C06A 1I8FA 2K5LA 3A5ZB 4CRIA 4ZGJB 4PL6A 2FHDA 3GNGA 2VXEA 3MP1A 4IUQA 2CKKA 5KH6A 4M77G 1D3BA 3X28B 3HL8A 2LRQA 4RKUE 2PVOB 5I2MA 3JCMh 3OS0A 3HFOA 3AHUA 3M4YA 1KHCA 2QQSA 4ELZC 3URGA 2K5FA 3HPWA 3QSUA 5D6YA 4QVCA 2GCXA 1YHQT 1X6OA 2QI2A 4IURA 2B8AA 4M77F 1K8AU 2X4JA 1EIFA 3OB9A 1VQKT 4KUDK 1KD1C 2OTJT 2R57A 3JCMX 3JSCA 2JZ2A 4XU2A 2PUOB 3M55A 3CPWS 1GXIE 3OYHA 2PQWA 1I81A 5I21A 3QIIA 2XK0A 2ZPEB 1DJ7B 3QXEB 1OYXA 2KK4A 4L5GA 4M77D 4RCBA 2RH2A 2QA4A 2YLCA 3RMQA 3CCUA 2O01E 3OS2A 2DXTA 4HT9A 3ER0A 2QA4T 3CCUT 4L6V5 2QQAA 2DZ9A 3L42A 3CC2A 1Y96A 2WSEE 4N0AC 3OMGA 1Y71A 1BI0A 1NJIU 4XK8E 2ZPIB 1OI1A 4JJNK 3TCJA 3QZ9B 3PNWC 2DIGA 2DK3A 2RI3A 4HCCA 3H8ZA 3QYGB 4R56A 3QBYA 5LJ3h 5DLOA 3OQ5A 4OB3B 4PLIA 3DB4A 1I4K1 2BIVA 3CPFA 3EAEA 4C0FA 1VQLA 1BYMA 4A4EA 3X26B 2R5MA 1NZ9A 3BY7A 5GMKm 1S72A 3JRZA 5LL6S 3S3MA 2R5AA 2HBPA 3C94A 5CO7A 5GANd 1VQ6A 4HT8A 3VV0A 2D0QB 1K8AC 2MAMA 3KBGA 1VQ6T 2RM4A 3OS5A 3JCMV 4Y91A 2QTXA 5CKFA 4M78G 2K57A 4Y28E 3C12A 3JAME 3EFSA 3S3NA 3BDUA 3JCMe 2DPPB 1LOJA 3L2QA 3GOXA 5J3BA 5FLXE 1WJRA 4LDUA 2RHUA 1M9SA 5LJ5f 2CS7A 5GMKl 1KQSA 4M77C 4IUUA 3FEOA 1VQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQK A;  4KBM B;  2LT4 A;  4L5G A;  4XAX B;  2LT1 A;  2EYQ A; 
#chains in the Genus database with same CATH topology
 2E5Q A;  1M1K U;  4RCC A;  4GBQ A;  2DNU A;  1M3A A;  3CCQ Q;  2EWN A;  2LQ8 A;  2C0I A;  1XNI A;  3MET A;  4F7U G;  4KT0 E;  2VVK A;  1PWT A;  1U8R A;  1NE8 A;  2E3H A;  4PNO A;  2LJ3 A;  3RNJ A;  1XJW B;  1KQ1 A;  1I1J A;  1VQN A;  2PUK B;  3ME9 A;  3M0Q A;  3V8L A;  2JMC A;  4B9W A;  4N0A A;  2V1Q A;  4RTU A;  1PC0 A;  5LJ3 e;  2QQ9 A;  1U1S A;  1X6B A;  5GAO r;  2AZS A;  5AYF A;  1PHT A;  1M8V A;  1V1C A;  1YI2 A;  3CC4 Q;  3EFO B;  2YHT A;  1BIA A;  4JJB A;  4DA4 A;  1K8A R;  1D0Y A;  3OYK A;  1FX7 A;  2QTV A;  2ZCF B;  5GAM e;  1G3T A;  1SHG A;  2DVE A;  3CCE Q;  4C0D C;  2QEX Q;  4B6M A;  3VS3 A;  2JN0 A;  1SHF A;  1VYT A;  2XKO C;  4C5H A;  5J39 A;  1CSK A;  2F5T X;  2O4X B;  2RJC A;  4N4H A;  1M3B A;  2RK1 A;  5GMK e;  1B34 B;  1RI0 A;  2E1H A;  2M51 A;  1UGQ B;  5GMK i;  1NPR A;  4JZ3 A;  2RA2 A;  1VQP Q;  1JJ2 S;  2WSC E;  1YIJ T;  2R58 A;  3FB9 A;  3FJ5 A;  2PNI A;  1Q95 G;  4M78 B;  5GAN f;  4J83 A;  2J6O A;  2RQT A;  3WXM B;  2HQH A;  1OUL A;  4BAC A;  1MV3 A;  2RQU A;  1UHC A;  4M75 D;  3M9Q A;  2RJE A;  2DM1 A;  3EGX B;  2FEI A;  4FYY B;  1YWO A;  5KYN A;  2ROL A;  1VQL T;  2ZZD A;  1VUB A;  4F7U B;  2K7A A;  1S72 T;  3OYN A;  1I5O B;  1C1A A;  2JVV A;  3JCM g;  3SFM A;  4FSS A;  2EKO A;  2L2P A;  1UGS B;  2P4T A;  2K2M A;  4A63 B;  5LJ3 j;  4PFZ A;  4PJO E;  3JB9 H;  4C8Q F;  3A8L B;  2LJ1 A;  1ZQ1 A;  5LJ5 e;  1D1B A;  4HVU A;  1IXD A;  1TUD A;  3SWN A;  2DMO A;  2ENM A;  1X43 A;  3CXC P;  1QKX A;  1QP3 A;  2A7Y A;  2D0N A;  4PJO A;  3PFS A;  1WQ7 A;  1YIT A;  3BW1 A;  3OYJ A;  5CK9 A;  5IXF A;  2K3Y A;  3JV3 A;  4CC4 B;  2L89 A;  2A37 A;  3LH5 A;  1UGR B;  4BE0 A;  3CCQ T;  1O9S A;  4R55 A;  4M7A D;  1ZX6 A;  2RJD A;  2LC4 A;  4ESR A;  2HKQ B;  1M4Z A;  3M53 A;  5GMK j;  2FB7 A;  3I5S A;  1K1Z A;  4BY6 C;  1WXT A;  3JCM d;  3JB9 D;  3VYG A;  4DBR A;  4D6W A;  3WVE B;  2KMT A;  1XTD A;  2F2V A;  2EIF A;  3M56 A;  2XD0 A;  4RG2 A;  3UT1 A;  1U5S A;  2V8I A;  2YUO A;  4M7D G;  4PFP A;  3O8V A;  1MND A;  1AEY A;  5IH2 A;  4C8Q C;  3CC4 T;  4XTU A;  1KC8 U;  3MP8 A;  3MJX A;  3VUB A;  2XI9 A;  3NTH A;  2QK0 A;  2DO3 A;  3AT1 B;  3NTK A;  4M78 C;  2SRC A;  2VGM A;  1J3T A;  2ABL A;  5FWB A;  1ACM B;  3MEV A;  4JUV A;  1VQ7 T;  1FYN A;  3G6E T;  1H64 1;  1VQ9 A;  9ATC B;  5CVI A;  1QWE A;  4C92 F;  1K9M C;  2RNA A;  1GBQ A;  4MZT A;  4A53 A;  1MGQ A;  2DD4 A;  4XU3 A;  2E64 A;  3MKD A;  1JO8 A;  3LLR A;  3OS1 A;  1PKS A;  1RAB B;  3OYY A;  1X6G A;  2P4R A;  3ZEH A;  3GIB A;  4XU0 A;  1YHQ A;  5LJ5 j;  3V7S A;  2DZC A;  3EGD B;  5GAN e;  1VQP T;  1M5Q 1;  3I5R A;  2DBM A;  2RN8 A;  1KC8 C;  2GFA A;  3OBY A;  2YRV A;  4NS5 A;  3CCV Q;  4XTZ A;  4BE2 A;  4J5Y A;  2HEQ A;  1Q82 R;  3PGG A;  4F04 B;  2RB6 A;  4CC3 A;  8AT1 B;  5A0G A;  3G71 T;  2DFU A;  2HD0 A;  3QO3 A;  3V8K A;  4FU6 A;  1BU1 A;  2EQU A;  2FG0 A;  4E7K A;  1ZUY A;  1VQ6 Q;  3EHQ A;  3H6Z A;  4K11 A;  2GGR A;  4C92 C;  1M1G A;  3A8M B;  5KYX A;  4D8D A;  2DEU A;  1VIF A;  2DKG A;  3OW2 S;  1TSF A;  1M1F A;  4BDY A;  4KGV B;  4OMO A;  1IGQ A;  3M0P A;  3EGU A;  5GAM h;  3PT9 A;  1TWB A;  2IVW A;  1QKW A;  5IXB A;  1QVF S;  2ZPF B;  4M7D B;  4X9C A;  3NGP A;  3S6W A;  3OYF A;  2RI5 A;  3NPF A;  1K0S A;  1WX6 A;  1UUE A;  2VKN A;  1VQN Q;  2LDM A;  1VQ5 A;  2G6F X;  4C0Z A;  1D3B B;  1D0X A;  2V26 A;  1YJ9 T;  2KYB A;  3H0H A;  1JXO A;  2MI6 A;  1X75 C;  1IRE B;  2KNB B;  4EPC A;  5GAN j;  1YJW T;  1KD1 U;  1WHJ A;  3OYG A;  5AT1 B;  1PM3 A;  4A4K A;  1ZHI A;  2DRM A;  3M59 A;  4J9C A;  2L5Q A;  5I2S A;  3LGF A;  3HRS A;  1YCS B;  1K76 A;  2LNV A;  3CCE A;  2AT1 B;  2JS0 A;  3NHN A;  4M75 E;  2QEX A;  4V2S A;  2YUP A;  1C0M A;  1U1T A;  1YJN A;  2F1L A;  1G8X A;  4Z88 A;  3QJ6 A;  1I8F A;  1LPL A;  3GNG A;  2VXE A;  4M77 G;  1WHK A;  3JCM h;  3OS0 A;  1WZO A;  2K5F A;  1M2V A;  5D6Y A;  2GCX A;  1X69 A;  2RQV A;  1X6O A;  2JM9 A;  1VQK T;  4X1V A;  1KD1 C;  2OTJ T;  1VA7 A;  2KEA A;  4F17 A;  1H92 A;  2ZPE B;  4RTX A;  3QXE B;  2KK4 A;  2RH2 A;  3H41 A;  4F16 A;  4HT9 A;  1HSQ A;  2QA4 T;  1RAA B;  4L6V 5;  2WSE E;  3I9Q A;  4HVV A;  2NUP A;  1BI0 A;  1OI1 A;  4JJN K;  1MMD A;  1TUC A;  2DK3 A;  2RI3 A;  1SKU B;  3H8Z A;  3QBY A;  4LUE A;  5DLO A;  4OB3 B;  4PLI A;  2COY A;  5KYU B;  5KYW A;  3EAE A;  1M1K R;  2IIM A;  2X51 A;  2BE7 D;  5GMK m;  3JRZ A;  1HD3 A;  1YN8 A;  5LL6 S;  4ORZ A;  4FYW B;  3C94 A;  3QWX X;  2JM8 A;  2CP7 A;  1QCN A;  3KBG A;  1VQ6 T;  3OS5 A;  2O9V A;  3JCM V;  2K6D A;  2K57 A;  3JAM E;  3C12 A;  3BDU A;  3GOX A;  1IHV A;  4OMQ A;  5J3B A;  1AD5 A;  1WJR A;  2GNC A;  4LDU A;  1BB9 A;  1WHG A;  2CS7 A;  4J9I A;  2Z0W A;  5GMK l;  2K9G A;  1GFD A;  2DXC A;  4J9H A;  1ABO A;  2L3Q A;  3EG9 B;  3CCR A;  3OYD A;  1AWJ A;  2DET A;  2AKK A;  5GAO q;  4LDY A;  3FC3 A;  2YLB A;  3L2R A;  3P8B B;  3TEE A;  3VU3 C;  4OB0 B;  3SD4 A;  2LQW A;  3Q1J A;  1M90 C;  4Z89 A;  1JRI A;  1NLP C;  3P8D A;  4QQ6 A;  2DJQ A;  3GBQ A;  4PJO D;  2KY9 A;  1VQN T;  1M8M A;  2M02 A;  1OEB A;  3X20 B;  1MV0 B;  1W1F A;  4M77 B;  2CGH A;  5KE3 A;  2HSP A;  4C5I A;  2DYB A;  2HL5 C;  1WIE A;  2DL8 A;  4RTV A;  5CKD A;  2YRC A;  2YWW A;  2ATC B;  1GCP A;  2RD1 A;  4IKF A;  4QT7 A;  3VS6 A;  1YI2 T;  1CKA A;  1HXD A;  1CKB A;  2VV5 A;  2KGT A;  4LDV A;  1H3Z A;  1Q86 C;  2JT4 A;  3MO8 A;  5KYY B;  1QMC A;  4ZN1 A;  2NLU A;  3UAT A;  1VQ9 Q;  1SF9 A;  1JB0 E;  4QQD A;  3CXC S;  3EHR A;  1UTI A;  1AZG B;  2X4W A;  3MEU A;  1G3W A;  1NJI R;  3PMI A;  4Z02 A;  2CP6 A;  1NYF A;  2L3P A;  3ZBD A;  4VUB A;  2CYZ B;  2DYI A;  1YHQ Q;  3EFO A;  3CCJ A;  2RO0 A;  4C0D B;  4RTY A;  1Q7Y U;  3CQT A;  5DM7 R;  4M75 F;  3JCM c;  4FM4 B;  2EPD A;  5FU7 C;  4AG2 C;  5J26 A;  2NUT B;  3CCV A;  3M0R A;  5CQX A;  2J06 A;  4MML A;  2K3B A;  3CC2 T;  5C0M A;  1WQW A;  3OYE A;  2CH4 W;  4EIK A;  2P0K A;  2LX9 A;  2HMA A;  4DBF A;  2KRO A;  5L23 A;  5FRM A;  2KQW A;  3KFV A;  1VIE A;  2O4X A;  3CMA A;  1KG1 A;  2BKD N;  2QXF A;  3TU4 K;  2CZ6 B;  3CC7 A;  1B34 A;  4PFO A;  4QW2 A;  2EYY A;  4C8Q G;  4AFU C;  2XU8 A;  1W4S A;  2D8J A;  2JNG A;  3RMS A;  2CP2 A;  2JTE A;  1FXX A;  2A3L A;  4YTL A;  1Q7Y C;  3CCS A;  4M78 A;  2EQJ A;  3PMT A;  2QAS A;  5A0L A;  2YT6 A;  4DQ2 A;  5HY6 A;  4BDZ A;  4FT2 A;  2FYK A;  3I35 A;  2CSQ A;  4FT4 A;  2HZY A;  4OMF B;  4F7U E;  1K73 R;  1QVG A;  3EGX A;  1VQO Q;  1WJQ A;  3UA6 A;  4M7A F;  1R8O B;  3HRT A;  1YIT T;  2WSF E;  1UEB A;  5CCA A;  1OU8 A;  4F7U A;  2E41 A;  2F2X A;  3EG0 A;  4EMK B;  4HCB A;  4PJN A;  1N8R C;  1K4U S;  3GP8 A;  1WFW A;  5LJ3 g;  1D09 B;  1VQ5 Q;  4LXC A;  3N5B B;  1WXU A;  2YUQ A;  5IHN A;  2O31 A;  1B07 A;  1KQS S;  2OAW A;  3GNF B;  2COZ A;  4E47 A;  2BE9 B;  4BD3 A;  1UG1 A;  2QQB A;  1WI7 A;  3JCM P;  1KSW A;  5GAM g;  2JTM A;  3UPU A;  3CCL A;  3BE3 A;  1PCX A;  1NLO C;  1NM7 A;  5KCH A;  4LE9 A;  1KFZ A;  4C92 G;  2FRW A;  4DEX A;  4ZN3 A;  1YJN Q;  1OZ3 A;  1Q81 U;  5HK0 A;  2CP0 A;  3WVD B;  3CPW A;  1WGS A;  2OAU A;  2Y4X A;  4BY6 B;  1M27 C;  1M3C A;  2M1H A;  5C6S A;  3M0U A;  3H0I A;  2CSI A;  4EDU A;  1G3Y A;  4OGE A;  1SRM A;  3OSS C;  1Y96 B;  3G4S Q;  5LJ3 d;  1IHW A;  2K3X A;  3MHX A;  1GCQ C;  4C8Q B;  1I5L A;  1QCF A;  4MZP A;  4ME7 A;  4LD9 K;  1RAC B;  3T9N A;  1VYV A;  5GAM d;  4LUD A;  4FW2 A;  2XDD A;  1YP5 A;  4E7J A;  4BI4 A;  2EYZ A;  3E1S A;  2HAX A;  3HSB A;  2FZK B;  4C0G A;  1Q81 C;  3CD6 Q;  2LZ6 B;  1XOV A;  3FRN A;  2M16 A;  4ELY C;  4CC7 A;  3LWH A;  3JB9 J;  1WHM A;  5CKB A;  2CUD A;  3PIO A;  4J9B A;  1AT1 B;  1RAI B;  4KBM B;  4XQ3 A;  5CIU A;  3J81 E;  2O9S A;  3MP6 A;  1UB4 A;  1VQ4 Q;  2CUB A;  5LJ5 g;  1KQ2 A;  4EMK C;  1QVG P;  1RL2 A;  2E70 A;  2G3R A;  4PJJ A;  1PD1 A;  1SEM A;  1TTH B;  3VS5 A;  3EGD A;  1JEG A;  4ZNX A;  3HP9 A;  1P92 A;  2A28 A;  4BI3 A;  2CRE A;  4LNP A;  4KUI A;  3NTI A;  2ZGW A;  2BTT A;  3QZ5 B;  2IG0 A;  1TS9 A;  3CCR Q;  3TRE A;  2GQI A;  4L59 A;  3UDC A;  4LN2 A;  1OPL A;  1XQH A;  3CCM A;  4C92 B;  1K9M U;  4Z8A A;  5CAI A;  2EJG A;  1MHN A;  3TSW A;  2DEQ A;  4FCY A;  3VUZ A;  6AT1 B;  1TU0 B;  4O6J A;  3JCM J;  1AHJ B;  3QHS A;  3RER A;  5LJ5 d;  4M7D E;  2RI2 A;  2A0F B;  3OMC A;  1E6H A;  3CPW P;  2L8D A;  2MK5 A;  1HJD A;  4J6W A;  4M7D A;  4JLI A;  5IHK A;  3M54 A;  1ZA2 B;  3V7C A;  1AZE A;  3OYI A;  1UDL A;  3QUI A;  1JJ2 A;  3A8H B;  4A54 A;  2H3E B;  3CCE T;  2X9H A;  3RES A;  2QEX T;  2EBP A;  3KUF A;  2ED1 A;  3JCM Q;  1YJN T;  3G7Z A;  3RIR A;  2C06 A;  4ZGJ B;  4PL6 A;  3MP1 A;  1LVK A;  1D3B A;  3TSZ A;  2LRQ A;  4RKU E;  5I2M A;  3AHU A;  4D8K A;  3REB B;  4M4Z A;  2F2W A;  3URG A;  4F14 A;  3REA B;  3CCJ Q;  2B8A A;  1K8A U;  2X4J A;  1EIF A;  1WXB A;  4RTW A;  2R57 A;  3JCM X;  3JSC A;  4XU2 A;  2PUO B;  3OYH A;  1I81 A;  4HXJ A;  3CME Q;  3QII A;  1R0C B;  2OI3 A;  2YLC A;  3OS2 A;  2CP3 A;  3PVQ A;  1NEB A;  2QQA A;  3L42 A;  2GBQ A;  4N0A C;  3EH2 A;  2V1R A;  1T0H A;  3CMA Q;  3PNW C;  2DIG A;  4HCC A;  3CC7 Q;  2KBT A;  5LJ3 h;  5GJV B;  3DB4 A;  2AK5 A;  1NG2 A;  1VQL A;  1BYM A;  3X26 B;  1B7T A;  2R5M A;  1S72 A;  2YDL A;  5CO7 A;  5GAN d;  1K8A C;  2MAM A;  2LMJ A;  3CCS Q;  4E2F B;  2QTX A;  1UJ0 A;  1D1A A;  2ED0 A;  2MCN A;  1UJY A;  1TUG B;  3FEO A;  1VQO A;  2FZC B;  4BUG A;  1V29 B;  3PIP A;  2EJ9 A;  2K4Y A;  4J7F A;  4DOW A;  3P8H A;  3CCR T;  5GMK h;  2LX7 A;  3FJP A;  4NL3 A;  5KYU A;  4M78 D;  1JQQ A;  4PJO F;  4A4G A;  1FMV A;  4AMC A;  4NL2 A;  1W6X A;  2HKN A;  4LD6 A;  3J7A F;  2D9T A;  1QQJ A;  5IAY A;  2EW3 A;  8ATC B;  4BE1 A;  4E7I A;  1MUZ A;  4OMN A;  2DD5 A;  3CBO A;  2DBK A;  3DB3 A;  2DIL A;  3J80 E;  3CCL Q;  5GAO n;  1W2B S;  2MPX C;  2RQR A;  1YCY A;  4AFQ C;  2KR3 A;  1RAE B;  3EG9 A;  4LDW A;  3F70 A;  1N5Z A;  2QYZ A;  1F1B B;  4BB7 A;  2COW A;  5CR2 A;  4M77 E;  1BCM A;  2DTI A;  3NMZ C;  5D7U A;  1BI2 A;  1N6A A;  2AHJ B;  2CDT A;  2JOY A;  3KXT A;  2XDP A;  3ZL7 C;  2OTL A;  1VQ7 A;  3G6E A;  3C95 A;  3G4S A;  3SWN C;  1G3S A;  2YXY A;  4QQG A;  4M77 A;  5LJ5 h;  1QW1 A;  3SB2 A;  4PJO C;  5GAN 2;  3QKJ A;  4M75 G;  4E7H A;  2EGE A;  3CBP A;  4ZTF A;  2CT3 A;  1SRL A;  3UWN A;  2VXF A;  1SSF A;  1RAD B;  3OSV A;  3QPH A;  1UGV A;  2XMF A;  3CCJ T;  1OPK A;  3PE0 A;  4HKE A;  2L0A A;  3CD6 A;  1X2K A;  3RKX A;  5KYY A;  4JS4 A;  4AT1 B;  3CCV T;  3OW2 A;  3SEM A;  4FIB A;  2DL4 A;  2XIC A;  3MEA A;  3QJY A;  1PKT A;  1AWO A;  5IN1 A;  4MZM A;  1QVF A;  1M90 U;  1H3H A;  2PU9 B;  2M0O A;  5GAN 4;  2O88 A;  1SG5 A;  3CMA T;  1VQ4 A;  1BK2 A;  1WLP B;  4MMK A;  2JS2 A;  1RUW A;  2RHX A;  4JRK A;  3A1P A;  5FU7 B;  5GAN 8;  1OX9 A;  5KE2 A;  2CZ0 B;  3MCA B;  5FRN A;  3I56 A;  1RI9 A;  1YFN A;  3VS4 A;  4HCZ A;  2NUT A;  5GAN 3;  3CCS T;  4M7A G;  4J6X A;  4P5N A;  2CZ1 B;  2JMA A;  5CKH A;  5EG2 A;  1Q86 U;  1ZUU A;  1S1N A;  1W70 A;  4OF1 A;  1KK7 A;  5GJW B;  2AKL A;  4OGC A;  3JB9 G;  1AVZ C;  4ATO A;  2DX1 A;  4QVD A;  3CCM Q;  3VS0 A;  4J8O A;  1GCQ A;  3RKW A;  1BI1 A;  4E6R A;  5FRO A;  1UE9 A;  1IZ6 A;  1YNZ A;  2MWO A;  1MMG A;  3VRZ A;  3OYA A;  3FLG A;  4FW1 A;  1NPP A;  3VS1 A;  2E6N A;  2PVD B;  3PVL A;  5GAN h;  3HKS A;  2RK2 A;  3M57 A;  4RMO A;  3HFN A;  3VKI A;  1ZBJ A;  4JLG A;  1U06 A;  4M75 B;  4J9D A;  1YJ9 A;  2C0T A;  1LNX A;  2F69 A;  1TXQ A;  2H3J A;  3I55 A;  4GLM A;  1Q82 C;  2WAC A;  3CCL T;  2E12 A;  2M0Y A;  1ZSZ B;  1VQM A;  2QGF B;  5IHI A;  2NYS A;  2JJ9 A;  2KDS A;  3RKY A;  3X25 B;  2EJF A;  3A8G B;  1IO6 A;  3OBW A;  3GLX A;  5I22 A;  4E7Z A;  4EMK A;  2FPD A;  1RAF B;  4DEY A;  4PJM A;  2VUB A;  5GAM f;  2XID A;  5FW9 A;  2ECZ A;  5GAN 7;  4RG8 A;  3TVT A;  2HQE A;  4M7D D;  5GAO p;  4JJC A;  2VWF A;  1UEC A;  1E6G A;  2B86 A;  4UC4 A;  1ZBX A;  3OW2 P;  2X4Y A;  3E2U A;  3RUX A;  2KSS A;  3OYC A;  2LJ0 A;  2M9U A;  3E19 A;  2EQI A;  1WJS A;  1HYO A;  3E9G A;  3CME A;  1YIJ Q;  1VQK A;  1QVF P;  4XTW A;  2OTJ A;  3M0T A;  3V8J A;  4JRP A;  2RHY A;  2LTO A;  2Y4Y A;  1GL5 A;  4HA8 A;  3LH0 A;  2A08 A;  2RPN A;  3IQL A;  4M7A B;  1B3Q A;  2YRD A;  2DIQ A;  4JJD A;  3VJP A;  4OMP A;  4C8Q E;  2VAS A;  1YBY A;  2HNI A;  4XU1 A;  1QVP A;  1OX8 A;  3EFR A;  4M78 E;  1N8R U;  3C0C A;  2I2L A;  2ZPB B;  3UF4 A;  2DF6 A;  1VQL Q;  1ZA1 B;  4C8Q A;  3JCM W;  2HQX A;  1S72 Q;  5EC7 A;  2K2V A;  2EQK A;  2NWM A;  1K9M R;  1N9S A;  2DTH A;  1JXM A;  3QYH B;  1MMA A;  2MF2 A;  2QQR A;  1VOM A;  4M75 C;  2VGN A;  3JCM f;  2DJZ A;  3U23 A;  3GF5 A;  5CQY A;  2X3W D;  2E6Z A;  3VYH B;  4OP0 A;  3H9N A;  5DLQ E;  1ZSZ C;  3JB9 F;  2I0N A;  1IGU A;  3EG1 A;  4MDW A;  1KC8 R;  3CCM T;  4QKU A;  1Z9Q A;  1E7O A;  3C4S A;  1KJW A;  1O75 A;  1WHL A;  3QG1 A;  2FZG B;  4E7L A;  3QWY A;  5M9O A;  4CC2 A;  2QG9 B;  4JRI A;  3CXC A;  2O2O A;  1UGP B;  2KAF A;  4A4F A;  3THK A;  2DL7 A;  1FMW A;  3OYM A;  4C92 E;  1A0N B;  4BI8 B;  2VC8 A;  4FYX B;  2LQK A;  1IRX A;  3LGL A;  3A8O B;  1QLY A;  3OYB A;  1WA7 A;  2KVQ G;  3JB9 I;  3QDR B;  1PRM C;  4C92 A;  1PSE A;  1M1K C;  5HCK A;  2A36 A;  2F5K A;  2E65 A;  2EQM A;  1VQ8 A;  4M7A C;  1VQ9 T;  1TOV A;  2OTL Q;  3A5Z B;  2DLP A;  1VQ7 Q;  3G6E Q;  1KIK A;  5I11 A;  4IUQ A;  3X28 B;  3HL8 A;  2JXB A;  3HFO A;  3M4Y A;  4ELZ C;  1PD0 A;  3QSU A;  3HPW A;  1X2Q A;  1YHQ T;  4IUR A;  2DE0 X;  4KUD K;  3OB9 A;  2EYX A;  2KRM A;  2L3S A;  1GXI E;  2J7I A;  3M55 A;  4JPB W;  3RDV A;  1OYX A;  4L5G A;  4M77 D;  2KE9 A;  3RMQ A;  3CCU A;  2O01 E;  3ER0 A;  1UHF A;  4KGZ B;  2DZ9 A;  7AT1 B;  3CC2 A;  1NJI U;  2KI7 A;  3TCJ A;  3QZ9 B;  1OU9 A;  4R56 A;  4J9E A;  3G71 Q;  2ROT A;  3OQ5 A;  2EVR A;  1I4K 1;  2BIV A;  3CPF A;  4A4E A;  1R0B G;  1VYU A;  3S3M A;  2VB6 A;  2R5A A;  1NBE B;  3I56 Q;  2C0O A;  4OMM A;  2RM4 A;  4Y91 A;  1T3L A;  3EFS A;  1ARK A;  3S3N A;  1ZUK A;  3JCM e;  2RHU A;  1M9S A;  1KQS A;  4IUU A;  1X27 A;  4PJO G;  4OML A;  4M78 F;  1VQO T;  1BI3 A;  3VS7 A;  2LQN A;  1KD1 R;  2LVM A;  2ZPH B;  1NJI C;  5GAM j;  2HL3 A;  2GTJ A;  4C5G A;  2IPO B;  1LJO A;  4XTV A;  2GTO A;  5DY9 A;  3A98 A;  5FU6 B;  3R6O A;  4JZ4 A;  2MYS A;  1VQ5 T;  3EH1 A;  2DER A;  1PNJ A;  2KRN A;  4F7U F;  5IT9 E;  3L2V A;  1WDX A;  4EMH A;  4ZTJ A;  1YJ9 Q;  1K73 U;  4IUP A;  1D0Z A;  1OOT A;  3BFM A;  3I55 Q;  4OVA A;  1YJW Q;  4NOY A;  2KXC A;  2KT1 A;  2GF7 A;  4LDX A;  2DTO A;  2CP5 A;  5GAN 6;  1VQM Q;  3S3O A;  2W0Z A;  2EFI A;  2RMO A;  4DOV A;  3INZ A;  1HK9 A;  4JDS A;  4O5V A;  2HBW A;  3FDR A;  4XTY A;  1I0C A;  1ZLM A;  2X35 A;  4KH0 B;  5FWC A;  2XDB A;  4KUL A;  2ESW A;  2E10 A;  1BIB A;  5GAN g;  1Y7X A;  2OTL T;  1IB8 A;  3EG2 A;  4WTO B;  3G4S T;  2FRY A;  3L2Z A;  2X3X D;  5L8R E;  5HK3 A;  2D1X A;  1LCK A;  1WNL A;  1K73 C;  2XG8 D;  1YIJ A;  2D8H A;  2LP5 A;  4HVW A;  1VQK Q;  1M90 R;  4RTT A;  2OTJ Q;  3ZFJ A;  2EKH A;  1AWX A;  2BUD A;  3M0S A;  3OY9 A;  1FWZ A;  4WCI A;  2E3I A;  1RAH B;  1JBM A;  1X01 A;  4B9X A;  2XHC A;  3CD6 T;  3SWN B;  1T3S A;  3HRU A;  4IUT A;  1G83 A;  2QA4 Q;  1T0J A;  1BCO A;  2DRK A;  1RLQ C;  4PJO B;  3DKM A;  3JCM b;  3MPU B;  4J9F A;  2J05 A;  4J9G A;  2CZ7 B;  2V8J A;  4N4I A;  1Q86 R;  1WHH A;  1BKB A;  1KQS P;  3H0F A;  1VQ4 T;  2KXD A;  1GBR A;  2LT1 A;  3E9F A;  5FU6 C;  1PG5 B;  4RUG A;  2BZX A;  4KH1 B;  4DBQ A;  2W10 A;  5GAO m;  4J6Y A;  2LNH B;  3I56 T;  4KRT A;  2HDA A;  3DLL A;  2ZPG B;  4KGX B;  2DXB A;  3ASK A;  3HTR A;  5A0D A;  2KT8 A;  2J6F A;  5D6W A;  4IUV A;  4C8Q D;  1Y07 A;  3O5Z A;  2Y90 A;  5GAO l;  2MWP A;  3M58 A;  3CCQ A;  1I07 A;  3LWI A;  1C6V X;  1R77 A;  1PSF A;  2K5I A;  1SSH A;  1Y0M A;  2D6F A;  2QAZ A;  1N9R A;  4GY5 A;  2QGG A;  2JW4 A;  1SPK A;  1GRI A;  2RF0 A;  1JJ2 P;  4TVR A;  3VRY A;  1QP2 A;  3NFC A;  2BZY A;  2LCC A;  4JS5 A;  2DL5 A;  3MEW A;  2CT4 A;  2RJF A;  4PKC C;  3OYL A;  2FPE A;  1NEG A;  3I55 T;  3CC4 A;  2DVJ A;  4X9D A;  1YI2 Q;  2QDY B;  2OJ2 A;  1VQM T;  2P0Q A;  3VS2 A;  1Q7Y R;  3D7S B;  2FPF A;  2DXU A;  1VQ8 Q;  4M7D F;  2FL7 A;  1ABQ A;  5HKC A;  4J7I A;  1H8K A;  3BDL A;  3GPL A;  3X24 B;  3G1J A;  1KHI A;  4R0K A;  4ZGD B;  4PLL A;  3M5A A;  2JUF A;  4M75 A;  4MDX A;  4X34 A;  4C92 D;  3EG3 A;  1K0X A;  2J6K A;  2DA9 A;  2LCS A;  1VQP A;  1N8R R;  3FIF A;  1ZSZ A;  3CME T;  5GAN 5;  5KYX B;  2AZV A;  2AIR B;  4Q5W A;  3CCU Q;  1N27 A;  2PZ1 A;  4E7S A;  1PRL C;  1EX4 A;  1MNE A;  3DLM A;  3TQ7 P;  4AFZ C;  3CC2 Q;  2RHZ A;  4FYV B;  2GFU A;  2DL3 A;  5CKE A;  4CI0 C;  2X4X A;  4OB1 B;  1G2B A;  3G71 A;  1QWF A;  2K79 A;  4XAX B;  2E5K A;  4N4G A;  3CC7 T;  3LYI A;  2L3R A;  3OA6 A;  4M7D C;  1WPY A;  1Y57 A;  2RHI A;  3L1A A;  3L2W A;  1FMK A;  3R6N A;  3ULR B;  4M7A E;  1EFN A;  4II1 A;  2MIO A;  1OV3 A;  4A4H A;  2H8H A;  2JTF A;  5A2Q E;  4ZGE B;  2EGC A;  3HHT B;  1G5V A;  1Q82 U;  2FO0 A;  4M7A A;  4FSX A;  2MMP A;  2E4H A;  2FVU A;  3V7R A;  3M4G A;  3LW5 E;  1OQK A;  1QCO A;  4HCK A;  4XTX A;  4RTZ A;  4JRQ A;  4IIM A;  4DBH A;  2PVG B;  1YIT Q;  1W2B A;  2ZAE A;  1TH7 A;  4GLK A;  2DAQ A;  2GQV A;  2EYW A;  2V8K A;  2LT4 A;  2YSQ A;  1Q81 R;  1OZ2 A;  2EAY A;  2YUN A;  3CBM A;  4AG1 C;  2P0P A;  1RAG B;  4Y92 A;  2EGA A;  4FL6 A;  1Z9Z A;  4C5E A;  2EYQ A;  1K9A A;  3LX7 A;  2VYT A;  4OB2 B;  2MOX A;  1YJW A;  1QVG S;  1MMN A;  3L2U A;  3SDZ A;  4WF2 A;  1M2V B;  3RBB B;  2OX7 A;  5LJ3 f;  3RR6 A;  4PK4 A;  4QVZ A;  5D6X A;  2CH4 A;  1TG0 A;  5KCO A;  2LCL A;  1M30 A;  3CEY A;  4EMG A;  2SEM A;  1ZSG A;  1YWP A;  1VQ8 T;  3PTA A;  2K5L A;  4CRI A;  2FHD A;  2NUP B;  1UFF A;  2RQW A;  5KH6 A;  2CKK A;  2NUZ A;  2P84 A;  2PVO B;  1KHC A;  2QQS A;  5KYW B;  1NYG A;  3UA7 A;  1RLP C;  4QVC A;  4PJL A;  2QI2 A;  4M77 F;  2JZ2 A;  4ANJ A;  3CPW S;  2PQW A;  5I21 A;  4AFS C;  2XK0 A;  1DJ7 B;  4RCB A;  2QA4 A;  2DXT A;  1AWW A;  3CCU T;  3SHW A;  1Y96 A;  1GFC A;  3OMG A;  1Y71 A;  4XK8 E;  2ZPI B;  1U3O A;  3QYG B;  2QDL A;  1BBZ A;  4IIO A;  4C0F A;  1NZ9 A;  3BY7 A;  1AOJ A;  2KRS A;  1WYX A;  2HCK A;  1JU5 C;  2HBP A;  2KYM A;  1VQ6 A;  4HT8 A;  3VV0 A;  2D0Q B;  1W2B P;  1V76 A;  1D1C A;  5ECA A;  1M2O A;  5CKF A;  4M78 G;  4Y28 E;  1EZZ B;  2DPP B;  1LOJ A;  3L2Q A;  2BZ8 A;  2HSE B;  3QDF A;  5LJ5 f;  4M77 C;  5FLX E;  2PTK A; 
#chains in the Genus database with same CATH homology
 2DXC A;  2E5Q A;  1M1K U;  4PJO G;  4BUG A;  4M78 F;  4RCC A;  1V29 B;  1VQO T;  1BI3 A;  3PIP A;  2EJ9 A;  2LVM A;  2ZPH B;  3CCR A;  2K4Y A;  1NJI C;  2EWN A;  2LQ8 A;  4J7F A;  5GAM j;  3OYD A;  4DOW A;  3P8H A;  4C5G A;  3CCR T;  1XNI A;  5GMK h;  5GAO q;  1LJO A;  4LDY A;  4NL3 A;  3FJP A;  4XTV A;  3FC3 A;  4M78 D;  2YLB A;  3MET A;  4PJO F;  4A4G A;  4F7U G;  3P8B B;  4KT0 E;  3TEE A;  3L2R A;  1U8R A;  5DY9 A;  5FU6 B;  3VU3 C;  1NE8 A;  4NL2 A;  4OB0 B;  3SD4 A;  3R6O A;  3Q1J A;  4PNO A;  1M90 C;  4LD6 A;  3J7A F;  2D9T A;  5IAY A;  1KQ1 A;  1JRI A;  3P8D A;  1VQ5 T;  1VQN A;  4QQ6 A;  2PUK B;  3ME9 A;  4BE1 A;  4PJO D;  2KY9 A;  3V8L A;  4E7I A;  1VQN T;  4F7U F;  3X20 B;  5IT9 E;  3L2V A;  4M77 B;  2CGH A;  5KE3 A;  4B9W A;  4EMH A;  4N0A A;  2DD5 A;  4ZTJ A;  3CBO A;  4C5I A;  1K73 U;  3DB3 A;  4IUP A;  2QQ9 A;  1U1S A;  5LJ3 e;  3J80 E;  3BFM A;  4OVA A;  5GAO r;  5GAO n;  5CKD A;  4NOY A;  5AYF A;  1M8V A;  1W2B S;  2RD1 A;  4IKF A;  1YI2 A;  2YHT A;  1YCY A;  1YI2 T;  1BIA A;  2GF7 A;  4LDX A;  2DTO A;  5GAN 6;  4LDW A;  1HXD A;  3F70 A;  3S3O A;  2VV5 A;  4DA4 A;  2EFI A;  4LDV A;  3OYK A;  1H3Z A;  1Q86 C;  4DOV A;  1FX7 A;  2ZCF B;  3MO8 A;  5GAM e;  1G3T A;  1HK9 A;  3INZ A;  4JDS A;  4O5V A;  4BB7 A;  3FDR A;  4XTY A;  4M77 E;  4ZN1 A;  5CR2 A;  2DTI A;  2DVE A;  4C0D C;  2NLU A;  1BI2 A;  1N6A A;  2AHJ B;  3CXC S;  1JB0 E;  4QQD A;  2JOY A;  2JN0 A;  2X35 A;  3KXT A;  2XDP A;  2XDB A;  2OTL A;  4KUL A;  2XKO C;  1VQ7 A;  3G6E A;  2E10 A;  3C95 A;  1BIB A;  5GAN g;  1Y7X A;  3G4S A;  3SWN C;  2OTL T;  1G3S A;  2X4W A;  4QQG A;  4C5H A;  3MEU A;  4M77 A;  2F5T X;  2O4X B;  2RJC A;  5J39 A;  5LJ5 h;  3G4S T;  4N4H A;  1G3W A;  1QW1 A;  3L2Z A;  3PMI A;  4Z02 A;  3SB2 A;  4PJO C;  2RK1 A;  5GAN 2;  5GMK e;  3QKJ A;  4M75 G;  1B34 B;  5L8R E;  3ZBD A;  5HK3 A;  1RI0 A;  4VUB A;  4E7H A;  2E1H A;  3CBP A;  1UGQ B;  1WNL A;  5GMK i;  4ZTF A;  1K73 C;  2CYZ B;  2XG8 D;  3UWN A;  1NPR A;  1YIJ A;  2RA2 A;  2VXF A;  1SSF A;  1JJ2 S;  2WSC E;  3CCJ A;  1YIJ T;  3OSV A;  3QPH A;  2R58 A;  2RO0 A;  4C0D B;  3ZFJ A;  1Q7Y U;  3FB9 A;  2BUD A;  4M75 F;  3JCM c;  5DM7 R;  3CCJ T;  4FM4 B;  5FU7 C;  3OY9 A;  1FWZ A;  4HKE A;  4M78 B;  5J26 A;  5GAN f;  1JBM A;  4J83 A;  3CCV A;  3RKX A;  3CD6 A;  1X01 A;  5CQX A;  2XHC A;  4B9X A;  4JS4 A;  3WXM B;  4MML A;  3CCV T;  3SWN B;  4BAC A;  3CD6 T;  3HRU A;  4IUT A;  4M75 D;  3CC2 T;  3M9Q A;  5C0M A;  3OW2 A;  1WQW A;  3OYE A;  4FIB A;  2P0K A;  4PJO B;  2RJE A;  2XIC A;  3DKM A;  3MEA A;  3JCM b;  2LX9 A;  3QJY A;  5FRM A;  2KQW A;  2CZ7 B;  5IN1 A;  1VIE A;  4MZM A;  2O4X A;  2V8J A;  3CMA A;  1M90 U;  1QVF A;  4N4I A;  1KG1 A;  2PU9 B;  2M0O A;  5GAN 4;  2BKD N;  2QXF A;  3TU4 K;  1VQL T;  2CZ6 B;  3CC7 A;  3CMA T;  1VQ4 A;  1BKB A;  2ZZD A;  1B34 A;  1VUB A;  4MMK A;  4QW2 A;  4F7U B;  2RHX A;  4C8Q G;  4JRK A;  1S72 T;  3OYN A;  5FU7 B;  1VQ4 T;  2XU8 A;  5GAN 8;  1W4S A;  2LT1 A;  5KE2 A;  2CZ0 B;  2JNG A;  2JVV A;  3E9F A;  5FU6 C;  3JCM g;  3SFM A;  3RMS A;  3MCA B;  2EKO A;  1FXX A;  1UGS B;  2P4T A;  2A3L A;  5LJ3 j;  5FRN A;  3I56 A;  5GAO m;  4PJO E;  3JB9 H;  4J6Y A;  4C8Q F;  3A8L B;  4HCZ A;  4YTL A;  1Q7Y C;  3I56 T;  3CCS A;  4M78 A;  1ZQ1 A;  3DLL A;  5LJ5 e;  2EQJ A;  2ZPG B;  3PMT A;  5GAN 3;  3CCS T;  2DXB A;  4M7A G;  3ASK A;  4J6X A;  4P5N A;  3SWN A;  2CZ1 B;  4DQ2 A;  5CKH A;  5A0D A;  5HY6 A;  5A0L A;  4BDZ A;  4FT2 A;  5D6W A;  5EG2 A;  2FYK A;  4IUV A;  1Q86 U;  4C8Q D;  1Y07 A;  4FT4 A;  4OMF B;  1QP3 A;  2A7Y A;  4F7U E;  4PJO A;  3PFS A;  4OF1 A;  1WQ7 A;  1QVG A;  2Y90 A;  1YIT A;  3BW1 A;  3OYJ A;  5CK9 A;  5GAO l;  1WJQ A;  4OGC A;  2K3Y A;  2MWP A;  4M7A F;  1R8O B;  3HRT A;  3M58 A;  1YIT T;  2WSF E;  3JB9 G;  2L89 A;  3CCQ A;  1UEB A;  4ATO A;  4QVD A;  5CCA A;  1UGR B;  4BE0 A;  4J8O A;  3LWI A;  3RKW A;  3CCQ T;  1O9S A;  1PSF A;  1BI1 A;  2K5I A;  4R55 A;  5FRO A;  2D6F A;  4F7U A;  2E41 A;  1N9R A;  1IZ6 A;  4GY5 A;  4EMK B;  4HCB A;  2MWO A;  4M7A D;  2RJD A;  2LC4 A;  3FLG A;  3OYA A;  1NPP A;  4TVR A;  1N8R C;  2E6N A;  2PVD B;  3GP8 A;  5LJ3 g;  1M4Z A;  5GAN h;  3M53 A;  5GMK j;  1QP2 A;  2FB7 A;  3HKS A;  3N5B B;  3NFC A;  2RK2 A;  3M57 A;  4RMO A;  2LCC A;  4JS5 A;  3HFN A;  4BY6 C;  1KQS S;  3JCM d;  3MEW A;  3GNF B;  3VKI A;  3JB9 D;  4JLG A;  3VYG A;  4D6W A;  4M75 B;  3WVE B;  4E47 A;  1YJ9 A;  2KMT A;  4BD3 A;  1XTD A;  2RJF A;  2QQB A;  1LNX A;  2EIF A;  5GAM g;  3M56 A;  4PKC C;  2F69 A;  2JTM A;  3I55 A;  2H3J A;  3UPU A;  2XD0 A;  3CCL A;  4RG2 A;  3UT1 A;  3OYL A;  2V8I A;  3I55 T;  1Q82 C;  2WAC A;  4M7D G;  3CC4 A;  3CCL T;  2E12 A;  3O8V A;  4X9D A;  5KCH A;  4C8Q C;  3CC4 T;  1VQM A;  2QDY B;  4XTU A;  1KC8 U;  2KDS A;  3MP8 A;  3VUB A;  2XI9 A;  3NTH A;  2DO3 A;  3RKY A;  2EJF A;  2P0Q A;  3A8G B;  3X25 B;  1VQM T;  4C92 G;  1Q81 U;  3OBW A;  4ZN3 A;  3GLX A;  1OZ3 A;  2DXU A;  3NTK A;  4M78 C;  5HK0 A;  4M7D F;  2FL7 A;  4EMK A;  2VGM A;  3WVD B;  5HKC A;  3CPW A;  4J7I A;  3BDL A;  1WGS A;  2OAU A;  2Y4X A;  3GPL A;  4BY6 B;  3MEV A;  3X24 B;  4JUV A;  1VQ7 T;  2M1H A;  3G6E T;  1H64 1;  1VQ9 A;  5C6S A;  1KHI A;  2VUB A;  5CVI A;  2XID A;  5GAM f;  4EDU A;  4C92 F;  1G3Y A;  4RG8 A;  5GAN 7;  1K9M C;  4M7D D;  2HQE A;  4MZT A;  4A53 A;  4OGE A;  5GAO p;  3OSS C;  1Y96 B;  4ZGD B;  4PLL A;  3M5A A;  2JUF A;  5LJ3 d;  1MGQ A;  2DD4 A;  2K3X A;  4M75 A;  4UC4 A;  1ZBX A;  3MHX A;  4XU3 A;  2E64 A;  4X34 A;  2X4Y A;  3LLR A;  4C8Q B;  4C92 D;  4MDX A;  3RUX A;  3OS1 A;  1I5L A;  2KSS A;  3OYC A;  3OYY A;  2M9U A;  3E19 A;  4MZP A;  3ZEH A;  3GIB A;  4XU0 A;  1YHQ A;  5LJ5 j;  1WJS A;  4ME7 A;  1VQP A;  3E9G A;  3CME A;  4LD9 K;  3FIF A;  3V7S A;  1VQK A;  2DZC A;  4XTW A;  3T9N A;  5GAN e;  1VQP T;  1M5Q 1;  2OTJ A;  3CME T;  5GAM d;  3V8J A;  5GAN 5;  2XDD A;  2RHY A;  4JRP A;  2LTO A;  2Y4Y A;  4E7J A;  4Q5W A;  4HA8 A;  4BI4 A;  3E1S A;  2GFA A;  3LH0 A;  3OBY A;  1KC8 C;  2HAX A;  1N27 A;  4M7A B;  2YRV A;  3HSB A;  4NS5 A;  4C0G A;  1Q81 C;  4XTZ A;  2DIQ A;  3DLM A;  4BE2 A;  3VJP A;  2RHZ A;  2GFU A;  5CKE A;  4C8Q E;  4CI0 C;  1XOV A;  1YBY A;  2X4X A;  3FRN A;  2M16 A;  4ELY C;  2HNI A;  4J5Y A;  4OB1 B;  4XU1 A;  1QVP A;  3LWH A;  3JB9 J;  3PGG A;  2RB6 A;  3G71 A;  5CKB A;  4XAX B;  3EFR A;  4N4G A;  4M78 E;  3CC7 T;  5A0G A;  3PIO A;  1N8R U;  3LYI A;  2I2L A;  2ZPB B;  3G71 T;  2L3R A;  3OA6 A;  4KBM B;  4XQ3 A;  5CIU A;  2HD0 A;  1WPY A;  4M7D C;  3QO3 A;  3J81 E;  3V8K A;  4C8Q A;  3JCM W;  2RHI A;  2HQX A;  3L1A A;  1UB4 A;  3MP6 A;  2EQU A;  4FU6 A;  3L2W A;  4E7K A;  1KQ2 A;  5LJ5 g;  4EMK C;  1RL2 A;  2E70 A;  4M7A E;  2G3R A;  3H6Z A;  4II1 A;  4A4H A;  4C92 C;  1M1G A;  2JTF A;  2K2V A;  3A8M B;  5A2Q E;  2EQK A;  1P92 A;  3HP9 A;  4ZGE B;  1VIF A;  1N9S A;  2DKG A;  2DTH A;  3HHT B;  3OW2 S;  3QYH B;  1M1F A;  3JCM P;  1G5V A;  4BI3 A;  4BDY A;  1Q82 U;  2MF2 A;  4M7A A;  2QQR A;  4FSX A;  4KUI A;  5GAM h;  2MMP A;  3PT9 A;  2FVU A;  2IVW A;  2VGN A;  4M75 C;  3JCM f;  2DJZ A;  3V7R A;  3M4G A;  3LW5 E;  3GF5 A;  3NTI A;  2ZGW A;  1QVF S;  5CQY A;  2ZPF B;  4M7D B;  3QZ5 B;  4XTX A;  2IG0 A;  2E6Z A;  3TRE A;  4JRQ A;  4L59 A;  3VYH B;  4OP0 A;  4X9C A;  2PVG B;  1W2B A;  5DLQ E;  3UDC A;  1TH7 A;  1XQH A;  4GLK A;  2DAQ A;  3S6W A;  4C92 B;  2RI5 A;  3OYF A;  3CCM A;  3JB9 F;  2GQV A;  1K9M U;  4MDW A;  3CCM T;  3C4S A;  5CAI A;  1O75 A;  1MHN A;  2EJG A;  2V8K A;  2LT4 A;  1OZ2 A;  2EAY A;  2DEQ A;  3CBM A;  2P0P A;  3QG1 A;  2LDM A;  3VUZ A;  4E7L A;  4O6J A;  1VQ5 A;  5M9O A;  3JCM J;  4FL6 A;  1AHJ B;  4JRI A;  3QHS A;  4C0Z A;  5LJ5 d;  3RER A;  2RI2 A;  4C5E A;  2EYQ A;  1D3B B;  3CXC A;  4M7D E;  3LX7 A;  2VYT A;  3OMC A;  1YJ9 T;  1UGP B;  2KAF A;  4OB2 B;  4A4F A;  1YJW A;  2MI6 A;  1QVG S;  3L2U A;  1X75 C;  1IRE B;  3SDZ A;  4EPC A;  4WF2 A;  5GAN j;  1YJW T;  3OYM A;  4C92 E;  1KD1 U;  2L8D A;  3OYG A;  4BI8 B;  5LJ3 f;  2VC8 A;  4J6W A;  4QVZ A;  5D6X A;  4A4K A;  4M7D A;  1ZHI A;  4JLI A;  2LQK A;  3M59 A;  3LGL A;  2L5Q A;  3A8O B;  3M54 A;  3V7C A;  5KCO A;  3OYB A;  5I2S A;  3LGF A;  3HRS A;  2LCL A;  2KVQ G;  3OYI A;  3JB9 I;  2LNV A;  3QDR B;  3QUI A;  3CCE A;  1JJ2 A;  4C92 A;  4M75 E;  3A8H B;  1PSE A;  3CEY A;  4A54 A;  2QEX A;  1M1K C;  3CCE T;  3RES A;  4V2S A;  2F5K A;  1U1T A;  1YJN A;  2E65 A;  2EQM A;  4EMG A;  2QEX T;  1VQ8 A;  4M7A C;  3KUF A;  1VQ9 T;  3JCM Q;  1YJN T;  3G7Z A;  3RIR A;  1VQ8 T;  3QJ6 A;  3PTA A;  2C06 A;  1I8F A;  2K5L A;  3A5Z B;  4CRI A;  4ZGJ B;  4PL6 A;  2FHD A;  3GNG A;  2VXE A;  3MP1 A;  4IUQ A;  2CKK A;  5KH6 A;  4M77 G;  1D3B A;  3X28 B;  3HL8 A;  2LRQ A;  4RKU E;  2PVO B;  5I2M A;  3JCM h;  3OS0 A;  3HFO A;  3AHU A;  3M4Y A;  1KHC A;  2QQS A;  4ELZ C;  3URG A;  2K5F A;  3HPW A;  3QSU A;  5D6Y A;  4QVC A;  2GCX A;  1YHQ T;  1X6O A;  2QI2 A;  4IUR A;  2B8A A;  4M77 F;  1K8A U;  2X4J A;  1EIF A;  3OB9 A;  1VQK T;  4KUD K;  1KD1 C;  2OTJ T;  2R57 A;  3JCM X;  3JSC A;  2JZ2 A;  4XU2 A;  2PUO B;  3M55 A;  3CPW S;  1GXI E;  3OYH A;  2PQW A;  1I81 A;  5I21 A;  3QII A;  2XK0 A;  2ZPE B;  1DJ7 B;  3QXE B;  1OYX A;  2KK4 A;  4L5G A;  4M77 D;  4RCB A;  2RH2 A;  2QA4 A;  2YLC A;  3RMQ A;  3CCU A;  2O01 E;  3OS2 A;  2DXT A;  4HT9 A;  3ER0 A;  2QA4 T;  3CCU T;  4L6V 5;  2QQA A;  2DZ9 A;  3L42 A;  3CC2 A;  1Y96 A;  2WSE E;  4N0A C;  3OMG A;  1Y71 A;  1BI0 A;  1NJI U;  4XK8 E;  2ZPI B;  1OI1 A;  4JJN K;  3TCJ A;  3QZ9 B;  3PNW C;  2DIG A;  2DK3 A;  2RI3 A;  4HCC A;  3H8Z A;  3QYG B;  4R56 A;  3QBY A;  5LJ3 h;  5DLO A;  3OQ5 A;  4OB3 B;  4PLI A;  3DB4 A;  1I4K 1;  2BIV A;  3CPF A;  3EAE A;  4C0F A;  1VQL A;  1BYM A;  4A4E A;  3X26 B;  2R5M A;  1NZ9 A;  3BY7 A;  5GMK m;  1S72 A;  3JRZ A;  5LL6 S;  3S3M A;  2R5A A;  2HBP A;  3C94 A;  5CO7 A;  5GAN d;  1VQ6 A;  4HT8 A;  3VV0 A;  2D0Q B;  1K8A C;  2MAM A;  3KBG A;  1VQ6 T;  2RM4 A;  3OS5 A;  3JCM V;  4Y91 A;  2QTX A;  5CKF A;  4M78 G;  2K57 A;  4Y28 E;  3C12 A;  3JAM E;  3EFS A;  3S3N A;  3BDU A;  3JCM e;  2DPP B;  1LOJ A;  3L2Q A;  3GOX A;  5J3B A;  5FLX E;  1WJR A;  4LDU A;  2RHU A;  1M9S A;  5LJ5 f;  2CS7 A;  5GMK l;  1KQS A;  4M77 C;  4IUU A;  3FEO A;  1VQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...