5CKFA

E. coli mazf e24a form i
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
103
Chain Sequence
VSRYVPDMGDLIWVDFQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
molecule keywords Endoribonuclease MazF
total genus 24
structure length 103
sequence length 110
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ckfA00
2MF2A 1NE8A 3NFCA 5CCAA 4OF1A 5CKEA 2KMTA 2C06A 5HK3A 5CKDA 4HKEA 5DLOA 5CO7A 3HPWA 3VUBA 3G7ZA 4ME7A 5HKCA 1M1FA 5CKHA 5CKFA 4MDXA 1X75C 5CKBA 4MZMA 3JSCA 1UB4A 3TCJA 1VUBA 4MZTA 5CQXA 5CK9A 5HK0A 4ELYC 5CQYA 3JRZA 5CR2A 4VUBA 4MZPA 2VUBA 4ELZC
chains in the Genus database with same CATH superfamily
2LX9A 2RD1A 2RJCA 3E9FA 1VQPA 3H0IA 2JT4A 2K3XA 1K73C 4ZGEB 5CIUA 2QAZA 4RTYA 4J9GA 4C8QD 3H6ZA 4M7AA 1RAGB 3I5RA 1K76A 3I55A 2DXCA 3OMCA 4IUUA 5LJ3f 2O88A 3FIFA 2EJFA 3CC7A 4ZN1A 3QZ9B 1N5ZA 2QI2A 2OX7A 3F70A 4IUTA 4EPCA 2FHDA 3JB9F 2MOXA 1YJNA 2DFUA 5D6WA 2LJ3A 1OX8A 2Y90A 3QYHB 3UPUA 3I56A 1YITQ 2RJFA 1UDLA 2EKHA 5GAOp 4GLMA 3G4ST 3LH5A 4X1VA 2D8JA 3BW1A 2JZ2A 2DL3A 2A08A 2F1LA 5HCKA 4E7JA 2K6DA 4XU1A 4Z02A 1VQMQ 4J83A 1Q7YR 3HTRA 1F1BB 2EQMA 1ZUUA 2KRNA 2GF7A 4JZ4A 5L8RE 3JCMg 2H3JA 3NTKA 3EH1A 2JXBA 3CCRQ 4FM4B 1YWPA 1ZBJA 4FT4A 4JDSA 2DF6A 4XTXA 1ACMB 4N0AC 2RQRA 3LWHA 2BIVA 4PJOE 2PTKA 1YCSB 2ZPBB 1OZ2A 2W0ZA 1VOMA 1ARKA 1W1FA 3TU4K 4PKCC 3RESA 1BI1A 4MZTA 3GNGA 2MIOA 3S6WA 4DEXA 5I2SA 4M7DC 5J39A 2VVKA 1VQ7T 4DEYA 3CBMA 3ME9A 1NE8A 3LGFA 1QVGA 4DOWA 3OYEA 1WYXA 1G2BA 4C8QG 2CP2A 2DBKA 3CCJT 4E7KA 1RI9A 1U06A 2L3QA 4ZGDB 4PJMA 2IPOB 1QCFA 2AZSA 4HVUA 4C92C 4M77B 2FPEA 3G1JA 3DLMA 1WHGA 1X6BA 3I56Q 1PD1A 4C5HA 1KD1C 4PLIA 5FRMA 3CC4A 3T9NA 1HSQA 1PRLC 1B07A 3HHTB 2M9UA 3OYHA 2XDPA 2O01E 2RI5A 2IIMA 2JMAA 2K5FA 1GXIE 2YLCA 4M7AB 3CCST 3R6OA 2K9GA 1MV3A 3JB9D 1RLQC 4M78C 2YXYA 3D7SB 4OB0B 4GLKA 2J06A 1M90C 3KUFA 4JZ3A 3SDZA 1WHJA 1JJ2P 4II1A 2EGAA 1M2VB 2M02A 4BI3A 4M77D 1W6XA 2LQ8A 1D09B 3JCMX 1J3TA 4C5EA 5CKHA 4FU6A 2CP3A 3QHSA 1VUBA 3VS7A 5FU6C 5IH2A 3INZA 1WA7A 3L1AA 1Q81U 2JS0A 3MPUB 1YP5A 1SRMA 1TU0B 1TS9A 1WHKA 1IZ6A 5IT9E 2F2XA 1XQHA 1R77A 2BKDN 1KD1R 1Q82U 1RL2A 2QA4Q 2ZPEB 3UA7A 4M75C 3OY9A 3M0QA 2V8JA 4PJOF 3I35A 2WSFE 1M3AA 3PT9A 4JS5A 3I56T 4PFOA 3RKYA 2PZ1A 1OPKA 2DVJA 1KC8C 4RCCA 1UFFA 1K73R 1Y96B 4N4IA 1N8RU 1KQ1A 2YUNA 1M90R 2RK2A 4KUIA 1VQKT 1OI1A 3BFMA 4BUGA 3EG2A 2PUKB 2P84A 1RI0A 1MMDA 4QVCA 2OTLT 4XTZA 1QQJA 2C0IA 2XIDA 4C0ZA 2YUQA 3KXTA 2FYKA 3V7SA 4M7AF 3U23A 5GJVB 2DAQA 5IXFA 2M0OA 3CCVA 2MK5A 1M1KR 1HXDA 2CS7A 3META 4F7UB 2KT1A 3CCEA 1I81A 1WX6A 2J7IA 3E1SA 3QPHA 4BD3A 1TXQA 5FU7B 4BI4A 1M9SA 2E65A 4E7SA 1OU9A 5D6YA 3OS0A 4RCBA 1Q86U 6AT1B 2EJGA 2X4XA 4JLGA 2Y4XA 1I5OB 2EQJA 1LPLA 1H3ZA 2CZ1B 2DTHA 4J6YA 3L2RA 5LJ3d 3CD6T 1GL5A 2MI6A 1KHCA 2GFUA 1VQ4T 1X75C 1NEGA 4CC2A 3QG1A 2G3RA 1I8FA 5EC7A 2AIRB 2NLUA 3N5BB 3THKA 4JUVA 3OS2A 4IIOA 1ABQA 2KVQG 3DKMA 2EKOA 3EAEA 3CCSA 2LQKA 2MWOA 2Y4YA 1AZGB 1D3BA 4E7HA 4F17A 2BE7D 3ZL7C 2X9HA 5GAN3 1VYVA 2JM8A 1CKAA 3QKJA 3CCUT 3QBYA 1ZBXA 3RDVA 1UGSB 1D1AA 1I4K1 5KYUB 3EG0A 3TVTA 3MP1A 4JLIA 1UGPB 3EGXA 3GF5A 4V2SA 2K79A 2JW4A 1OYXA 1U8RA 1PNJA 5CAIA 1H641 5A2QE 3QJYA 1Y57A 3LW5E 4M78D 1VQ6Q 1U5SA 3HRSA 3OS1A 1KIKA 4ESRA 1TSFA 2JTEA 3VV0A 1D1BA 1G3TA 5M9OA 1NEBA 2K5IA 3C95A 2E3IA 4QT7A 2HCKA 1UGQB 1ZSZB 2JS2A 4PNOA 2QTVA 3CCMQ 2BE9B 2E3HA 2E6ZA 1K9MU 3CCEQ 3CMAT 3P8BB 4NL2A 1EX4A 3EG9B 2FEIA 4JS4A 4M75A 4J5YA 2LDMA 3X25B 2H8HA 1XOVA 4PLLA 2DYBA 5CKDA 2DE0X 4NL3A 1MNEA 1HD3A 2D8HA 4E2FB 3OYNA 3SHWA 5KYXA 3V7CA 1VQLA 2K3YA 1VQ8Q 3JCMV 3PMTA 2CT4A 4M75E 1Y7XA 1KQSA 3KFVA 4OB3B 3HRUA 2ZZDA 2CDTA 4F14A 1FXXA 3CCVT 4AT1B 2VGNA 3A98A 1UHFA 3DB4A 2NUTB 2KGTA 5J3BA 1WXUA 3ZEHA 4OMMA 1VQ8A 4PJOA 4E7LA 1IO6A 2MF2A 2ROLA 2I0NA 2KRMA 2XMFA 1OEBA 3WVEB 3QDRB 2ATCB 2HBPA 2DERA 1BB9A 4E47A 2HKQB 5LJ5d 2X4YA 4EMKC 5CKBA 3X28B 1NLPC 4HT8A 1YITT 1VQ5T 2HZYA 4M7AG 4OVAA 3EG9A 1PKSA 2DL4A 2KDSA 3R6NA 4F7UF 4XK8E 3OSSC 1FMWA 2H3EB 4LN2A 2AT1B 2HSEB 5GAMe 2VV5A 2HD0A 4FYVB 2FZGB 1OOTA 2RHIA 1MMNA 2J6FA 1UHCA 1Q81C 1M8VA 1K8AC 2DA9A 1RAEB 1VYTA 1NJIR 2QGFB 3JAME 2GGRA 1D0XA 1JBMA 5CQXA 3LYIA 3VUZA 1OZ3A 4PJJA 3FDRA 1Q82C 2MWPA 4M7DB 1E6HA 4R55A 1JRIA 1GRIA 3HL8A 5FRNA 2QQRA 1AWOA 4FW2A 5GANf 5AT1B 1YIJQ 4D8DA 2KXDA 2ENMA 4M77C 4C8QB 1OQKA 3CCLT 3I55T 1VIFA 2COZA 1M2VA 5LJ5j 2ZAEA 2FB7A 1WXTA 5CKEA 2EGCA 1UJYA 5C0MA 1SSHA 2QG9B 3OYKA 1BBZA 3G6EA 1YNZA 4C0GA 4C8QF 1YJNT 1Y0MA 1M1GA 1CKBA 4LDWA 2RN8A 4BB7A 1S72T 4DBFA 2R57A 3VS5A 3HRTA 1RAHB 4IUPA 4KGVB 2GNCA 1H8KA 4AFSC 3CCSQ 2X4JA 3CMAA 3M0TA 1V29B 4QQ6A 5ECAA 2JTFA 3CMEQ 4M78G 3PTAA 1VIEA 2RQUA 2RO0A 3CCQQ 1VQ4Q 1PHTA 4A53A 1VQKQ 1WLPB 5KYXB 3X20B 4GY5A 5GMKm 3I5SA 1YHQQ 1SHFA 4XTYA 2W10A 4A4KA 3QSUA 1G3SA 4JPBW 5CQYA 3H0FA 4EDUA 2ROTA 5GJWB 2PVOB 3OYMA 4C92G 3O8VA 3RR6A 3E2UA 5GAOr 3RUXA 2XKOC 2L3SA 3M54A 4AFUC 1E7OA 2KYBA 3OYJA 4UC4A 4M77E 3FJPA 2X51A 2VXFA 4ANJA 1A0NB 4OMOA 4DOVA 3A8LB 1KG1A 2DETA 4F7UG 1YHQA 4FW1A 1PG5B 2V1QA 3PFSA 3JCMh 3HSBA 2DTOA 2PUOB 2K57A 1VQ7A 5LJ5g 1VQ8T 4IKFA 3OBYA 2RI2A 4OMQA 3CCJA 4J8OA 1WHHA 3AT1B 3UA6A 2L3PA 1IGQA 3GOXA 4J9DA 3QO3A 1KC8R 4C92B 1BCMA 3SWNB 4EMGA 2DNUA 1VQ5A 1Q81R 4M78B 5GAMj 1YI2A 2WSCE 3X24B 2KRSA 1YJWT 2EW3A 4OP0A 2CKKA 2SEMA 5I11A 2CSIA 1GFDA 1Q7YU 4TVRA 5IHNA 1VQ9A 3V7RA 3PIPA 2F5TX 3MKDA 4ATOA 5FW9A 2RB6A 5IN1A 3GP8A 1SPKA 2E12A 4HVWA 4KULA 1RAAB 2P4TA 2KT8A 4Z88A 3OBWA 1BK2A 3A8OB 2KR3A 2AKLA 2L8DA 2BTTA 4CRIA 1O75A 3RMSA 5GAN8 3J80E 4AFZC 1YJ9A 2CZ6B 4CC3A 3M9QA 1UECA 3M59A 1NPPA 4QW2A 2K5LA 4RKUE 5HY6A 1BI3A 4JRPA 3CBPA 2VXEA 2YWWA 5D6XA 2LRQA 1WZOA 3VS2A 1M27C 3G6ET 4M75B 4F7UA 2L3RA 2CH4W 2AK5A 4KGZB 3V8LA 3QIIA 4PJLA 2DIGA 3OYIA 2A7YA 3JCMW 1MMAA 2K2VA 3QWXX 5GANe 2M51A 4F7UE 3SB2A 1Z9QA 1MV0B 3H41A 1VQKA 3OYYA 5A0LA 3CC4Q 2NYSA 3CCUQ 1KQSP 4J9CA 2DL8A 1VQNQ 2QQ9A 2E41A 3EFOA 1ZSZA 2WSEE 2IG0A 5GAMh 2OTJQ 2M1HA 1HK9A 2CP6A 3VS1A 1D0ZA 4BACA 3FLGA 2XHCA 3EGUA 4KRTA 3RKXA 1PD0A 4A4HA 1QP3A 1JJ2A 3JSCA 3OW2P 4NOYA 1RACB 1ZA2B 3BY7A 5GANd 2DJQA 4XAXB 2KSSA 2R5AA 4HA8A 1VQ6T 4M7DA 5D7UA 3URGA 3PIOA 3PMIA 4MMLA 2M0YA 2DX1A 3L2ZA 2EAYA 4J9EA 4KH1B 3S3MA 4KH0B 1PWTA 2FZCB 3CPWP 4QQGA 4L59A 4R0KA 1K73U 4OGCA 1YI2T 3LX7A 1YI2Q 4FSXA 2M16A 2QA4T 2VB6A 3PVQA 4DBRA 3OYLA 1X6GA 4FL6A 4LDYA 5CVIA 3HKSA 2BUDA 1ZX6A 4LD6A 3GLXA 2ZGWA 2HBWA 3OYFA 2KI7A 4HCZA 1BCOA 2JM9A 2QK0A 4LNPA 1KQ2A 1YIJA 3SD4A 3JCMf 1K1ZA 1M8MA 2G6FX 4M75G 4CI0C 1KJWA 3CCUA 1M2OA 5I2MA 2YRDA 4OB1B 3M58A 1LJOA 1RLPC 4J6WA 1XNIA 5GAN4 1M5Q1 1BIBA 3CCVQ 1M1KU 5KYYA 4ME7A 4RG8A 3RMQA 4QVZA 1KC8U 1M3CA 1YJ9T 3LWIA 5GAOl 3RBBB 2ZCFB 2HDAA 2LJ1A 1WHLA 2RI3A 3CPWS 1AHJB 2YRCA 2AKKA 2QEXA 1TUCA 1U1TA 1QWEA 3NFCA 5GAOn 3C94A 2CT3A 3C4SA 1CSKA 2EQKA 1PSEA 1WGSA 2EYZA 1NZ9A 4OB2B 2C0TA 2JTMA 2JNGA 4ZTFA 4J9HA 2EQIA 3EGDA 3JCMJ 3REAB 3CCRA 4M7AE 3JB9J 1M4ZA 2VUBA 2P0PA 4HCBA 3JB9H 4C0DC 4JJDA 2SRCA 2GTJA 4AG2C 2LT1A 1GCPA 1YJNQ 1B34A 1EIFA 2BZYA 1K0SA 1OULA 3DB3A 3VYGA 5KE2A 2RQTA 1BKBA 2EYWA 2P4RA 3FC3A 3TSWA 3UATA 3VJPA 3FJ5A 2O9SA 1UGRB 3A5ZB 4PFZA 4BE2A 4NS5A 1ZQ1A 2EYYA 3M4GA 1I5LA 1FYNA 2YT6A 2XI9A 5DLOA 1WQ7A 2RHXA 2DXTA 4KUDK 1IHWA 4JJCA 2C0OA 3VRZA 2V8KA 1V1CA 2OJ2A 3RERA 3G4SQ 2YLBA 2L2PA 2PQWA 2ZPIB 2V1RA 3OMGA 1GCQC 1Q7YC 1VQ6A 5KYYB 2L0AA 3REBB 1JJ2S 2DILA 1NBEB 3C0CA 5GANg 5GAN7 1VQOA 2AZVA 1QCNA 1PCXA 3CC2A 2EBPA 2E70A 2ECZA 3TEEA 5CR2A 1K9MR 2K7AA 1I0CA 1WPYA 2K4YA 2QA4A 4AFQC 1AD5A 3M55A 1VQNA 4M78E 2FL7A 2O4XA 5KYNA 2B86A 2RA2A 2JOYA 2EYQA 1N6AA 2D0QB 2DZ9A 4ELYC 4EIKA 1WHMA 1UG1A 4L5GA 3DLLA 1YIJT 3P8DA 4DQ2A 1VQLQ 3EG1A 2KK4A 5DM7R 3GIBA 3LGLA 3GNFB 3PVLA 3SWNA 2BZXA 3L2QA 3NTIA 5I22A 5HKCA 2YUPA 2F69A 4PJNA 2NUPB 3QWYA 3CCLA 1W2BS 4E7IA 1LOJA 1VQ9Q 2RHYA 4LDVA 2E10A 2D6FA 2J05A 3VUBA 3HFNA 4OMNA 3L2WA 1S72A 1ZA1B 3MEAA 5GAMg 1X2QA 4EMKA 4PJOC 3V8KA 3EHRA 2A3LA 2IVWA 2JVVA 3MHXA 3OW2A 1WIEA 2V8IA 4D6WA 4QVDA 4LXCA 4N4HA 3OA6A 1K9AA 1TTHB 2OAWA 5GAN2 3SFMA 3CCMT 3OS5A 2RQVA 2QQSA 1T0JA 1S72Q 3OYCA 1ZUYA 1R0BG 3QYGB 2NUTA 2DJZA 3PE0A 2DD5A 2NUZA 2QDLA 5LJ3h 3M0SA 4DBHA 1KHIA 2XK0A 2VYTA 5KYWB 1KSWA 3UWNA 4M78F 3SWNC 5GAMd 4MMKA 1YHQT 4CC7A 1GCQA 3MP8A 4XU3A 4HVVA 5IXBA 3G6EQ 1V76A 5C6SA 4JRQA 4IURA 1ZUKA 1X2KA 1WFWA 2KMTA 2EGEA 4HXJA 1GBQA 4M77A 1WDXA 3G7ZA 5FWBA 3VU3C 5CKFA 2CYZB 2FVUA 2L89A 1JB0E 5IHIA 5GAMf 1VQOT 1VQOQ 3HFOA 2KXCA 2X35A 2O9VA 3ULRB 4RTWA 2EPDA 3EFRA 2X3XD 2HKNA 2QTXA 2GQIA 4HCCA 1FMKA 1VA7A 3WVDB 2CREA 5FWCA 4LE9A 1YJWA 1C6VX 3QZ5B 3OB9A 2Z0WA 4PFPA 1AWWA 3V8JA 3QJ6A 4Y28E 3CC7Q 1MNDA 3A8GB 1VQ9T 5LL6S 1G8XA 2GQVA 4X9DA 3PNWC 3QUIA 1T3LA 1JXMA 2LVMA 3VS0A 5DLQE 3OW2S 2DD4A 3H8ZA 3SEMA 3OYBA 4N4GA 2RHUA 3G71A 2GTOA 4BY6B 2GCXA 5FU6B 1QLYA 2XU8A 9ATCB 2A36A 3CD6Q 4IIMA 2FZKB 2PVDB 2V26A 4LD9K 1K9MC 2CH4A 2CUBA 2EFIA 4OMLA 5LJ5e 4J9BA 1H3HA 2MCNA 1W70A 1WI7A 1QVGS 3NMZC 4R56A 1SHGA 3NGPA 1NLOC 3A8MB 1NPRA 5LJ3e 2D9TA 1JXOA 2RF0A 2E5QA 3OSVA 1PM3A 3OYGA 4DBQA 5HK3A 2A0FB 5GMKl 1VQ7Q 5CO7A 5GMKe 5LJ3j 4E6RA 3ER0A 5GAN5 1N8RC 3EGDB 1O9SA 4QKUA 1QKXA 3VYHB 2X3WD 3CQTA 4FYYB 3ZBDA 4M77F 4A63B 3MO8A 3ZFJA 3VS6A 2JJ9A 2JN0A 1WJRA 4A4FA 2FRYA 3MJXA 5A0DA 2COYA 2RJDA 2XD0A 1U3OA 4L6V5 4LDUA 4PK4A 1PSFA 3JCMd 4LUDA 4LDXA 2RMOA 3CCMA 1KK7A 2DMOA 3RKWA 5GAN6 2HAXA 1WXBA 3EG3A 2HQEA 3M4YA 3IQLA 1XTDA 3J81E 1IHVA 3J7AF 1LNXA 3CEYA 1TG0A 4PJOD 1PRMC 2VKNA 1QVFA 1N27A 2DL7A 4B9XA 4J7IA 2HSPA 7AT1B 2OAUA 3OYDA 4BE1A 2XG8D 3MEVA 2DIQA 3H0HA 4M75F 1EFNA 1YN8A 2RM4A 4BY6C 4EMHA 1QW1A 2OTJA 2DEQA 2J6OA 1JQQA 4Y92A 4C5IA 2CP7A 4RTVA 1NJIC 1RABB 4MZPA 2O2OA 2CZ0B 1QVFP 2R5MA 4C0DB 3RIRA 1YCYA 1G3YA 4M77G 2F2WA 3JCMe 5A0GA 4DA4A 4C0FA 3H9NA 2XDBA 1U1SA 2DM1A 5I21A 3I55Q 3NHNA 1HYOA 1FMVA 3EFSA 4J9IA 3LH0A 5HK0A 1FWZA 1OU8A 4PL6A 3JCMQ 5LJ5f 1IXDA 1RAIB 1QWFA 3VS3A 4ELZC 2J6KA 2E4HA 1QVGP 1AVZC 1C0MA 4C92A 1UGVA 1TH7A 4XQ3A 4IUQA 3JCMP 1D0YA 4WF2A 3A8HB 4C5GA 1D3BB 2LC4A 1BYMA 1WNLA 2KROA 4X9CA 1FX7A 4FSSA 3G4SA 1T0HA 2FPFA 2VGMA 3QDFA 4M78A 5KYUA 1SEMA 1I1JA 2L5QA 5IHKA 1YJ9Q 3G71Q 3CCJQ 3JCMc 4BI8B 1R8OB 1W4SA 3HPWA 3O5ZA 4MDXA 1AEYA 1VYUA 3L42A 1EZZB 2HQHA 2DXBA 2LCSA 3UT1A 1ZSGA 1YWOA 1WQWA 2QEXT 8AT1B 4MDWA 4CC4B 1Y71A 5KYWA 3RNJA 2LX7A 5GMKh 1TOVA 1UTIA 2O31A 1N9RA 2HL3A 4A4GA 4O5VA 5KH6A 1BU1A 1QVPA 1YFNA 2DLPA 2EQUA 3NTHA 1NG2A 4RTTA 3CCRT 2ESWA 4JRKA 2I2LA 3GBQA 3WXMB 1E6GA 2YHTA 3VKIA 1I07A 3A1PA 4M7DG 2PVGB 4C8QC 3FB9A 3EHQA 4P5NA 2MMPA 3BDUA 1DJ7B 1TUDA 5GANh 3S3NA 2CGHA 4B9WA 2LCCA 2RQWA 1B7TA 4C92F 5CK9A 3JRZA 4RTXA 3ASKA 4XU2A 4XTVA 1JO8A 4C8QA 1WJQA 1OV3A 1GFCA 2MPXC 3BDLA 2VASA 1SF9A 4A54A 2HEQA 4FYXB 4Z8AA 1AWXA 2FO0A 2LZ6B 2DL5A 2VWFA 4F04B 2PNIA 1VQ5Q 2LMJA 2YUOA 2OTJT 4KGXB 1T3SA 1PC0A 4QQDA 2RPNA 1SG5A 4HCKA 4PJOG 1WJSA 1KD1U 3TSZA 2NWMA 2ZPHB 4RTZA 4C92D 4WTOB 2YDLA 3M56A 2NUPA 1C1AA 1UB4A 2EYXA 2K3BA 5FROA 4F16A 3CC2T 2RH2A 2FRWA 1G83A 3MEUA 1K8AU 2HL5C 4ZNXA 2ZPGB 2KE9A 4M7DD 1M1KC 2CUDA 5L23A 3AHUA 3EFOB 4Y91A 3LLRA 2LTOA 1W2BP 3UDCA 3M0RA 1VQNT 3TREA 1QP2A 3GPLA 5GMKj 4RUGA 1M90U 2VC8A 2FG0A 2ED1A 5GAOq 2KAFA 1SKUB 1VQMT 3NPFA 4D8KA 2OI3A 3KBGA 1TWBA 3I9QA 3P8HA 1QVFS 4WCIA 4JJBA 5KCHA 1QMCA 1HJDA 2DBMA 1X43A 2HMAA 2KY9A 3JCMb 4HKEA 1NYFA 1TUGB 3EH2A 2DEUA 4HT9A 2DKGA 2E64A 1G3WA 5GANj 4XU0A 2D0NA 2CSQA 3M5AA 2OTLA 2QQBA 4PJOB 4LUEA 5LJ5h 2E5KA 1G5VA 4OF1A 4Z89A 3M53A 1NYGA 2OTLQ 4ZN3A 4RMOA 4XTUA 2XICA 3MP6A 4M7AC 2RK1A 1X6OA 4K11A 2LNVA 1M1FA 2DVEA 1NM7A 3CC2Q 3Q1JA 1ZLMA 3UF4A 1UEBA 3CXCS 1QKWA 3CMAQ 3CCET 4KBMB 2HQXA 1D1CA 1ZHIA 3X26B 2KBTA 5GAOm 2DXUA 4RG2A 4O6JA 2DYIA 1AOJA 2AHJB 2LT4A 3FEOA 3CCQA 1N8RR 3TQ7P 4FCYA 2GFAA 1Y07A 1QCOA 3CMEA 4GBQA 4JRIA 3CD6A 1BIAA 1VQ4A 1K0XA 2DTIA 2X4WA 2YRVA 4OMPA 4RTUA 2EJ9A 2B8AA 2DO3A 5FU7C 4JJNK 3CXCA 3JV3A 3M57A 3FRNA 3OYAA 1JEGA 1B34B 4IUVA 2EVRA 3M0UA 1RUWA 3QXEB 2CP5A 2KYMA 3EGXB 2XDDA 2JMCA 2DZCA 3E19A 2QXFA 2ZPFB 4E7ZA 1AT1B 1B3QA 4BDZA 2KNBB 4AMCA 2WACA 2E6NA 2A37A 4N0AA 4VUBA 1K4US 1RAFB 3CCLQ 2QYZA 1VQPT 1Q86R 4KT0E 1SSFA 2P0KA 8ATCB 1YBYA 2RNAA 2LP5A 1Z9ZA 4FYWB 2RHZA 4OMFB 1RADB 1AZEA 5GMKi 5IAYA 4MZMA 1MMGA 3HP9A 2COWA 2MYSA 3C12A 3CC7T 2E1HA 3CXCP 2ABLA 4FT2A 3BE3A 2GBQA 4ORZA 4OGEA 1KFZA 4AG1C 4M75D 1PKTA 4FIBA 4Q5WA 4M7DE 4B6MA 2QQAA 4M7AD 1VQMA 1BI2A 3TCJA 2DK3A 1GBRA 1XJWB 1UUEA 1LCKA 1LVKA 1BI0A 2QDYB 2D1XA 4C92E 1X27A 1N9SA 3MCAB 1OPLA 3G71T 4M4ZA 1P92A 1ABOA 1JU5C 2LQWA 3CPFA 2CP0A 1IGUA 5KCOA 3JB9G 1VQPQ 4M7DF 1ZSZC 5J26A 1VQLT 2LQNA 2DPPB 2F5KA 1K8AR 1MUZA 1OX9A 2R58A 5DY9A 3MEWA 3M0PA 2F2VA 2CZ7B 2PU9B 3OQ5A 1MHNA 2KQWA 4J7FA 3VS4A 5AYFA 1M30A 5KE3A 3CPWA 1Y96A 2MAMA 5LJ3g 1X69A 2QEXQ 3JB9I 1IB8A 1Q95G 2KEAA 3CBOA 4YTLA 2K2MA 3CCQT 1W2BA 5CCAA 4X34A 2C06A 1UJ0A 2DRMA 2LJ0A 3CMET 2QGGA 1KQSS 2HNIA 2RJEA 1YJWQ 2P0QA 4EMKB 4BDYA 2BZ8A 1NJIU 3VRYA 4BE0A 1YITA 1IREB 1MGQA 1X01A 5FLXE 3CC4T 4A4EA 2O4XB 1M3BA 1SRLA 2EWNA 1R0CB 3L2VA 2FPDA 4J6XA 2EIFA 1Q82R 4ZGJB 2DRKA 1UE9A 2JUFA 1H92A 1AWJA 1Q86C 2QASA 3E9GA 4XTWA 2YSQA 4ZTJA 2ED0A 3S3OA 4C8QE 3PGGA 4J9FA 3L2UA 2A28A 1IRXA 1S1NA 2LNHB 5EG2A 2LCLA
chains in the Genus database with same CATH topology
2LX9A 2MF2A 2RD1A 2RJCA 2L5QA 3E9FA 1VQPA 2LT1A 3JCMc 2K3XA 3WVEB 4BI8B 3QDRB 1K73C 2HBPA 4ZGEB 1B34A 4E47A 1R8OB 1EIFA 5LJ5d 1W4SA 3HPWA 5CIUA 3DB3A 2X4YA 3VYGA 4EMKC 5KE2A 1BKBA 4MDXA 5CKBA 3FC3A 3X28B 4C8QD 3H6ZA 3VJPA 4HT8A 1YITT 4M7AA 1VQ5T 1UGRB 3A5ZB 3L42A 4M7AG 3I55A 4OVAA 2DXCA 3OMCA 4IUUA 5LJ3f 3FIFA 2EJFA 4BE2A 4NS5A 3CC7A 1ZQ1A 2DXBA 2KDSA 3M4GA 3UT1A 4XK8E 4F7UF 1I5LA 4ZN1A 3OSSC 1WQWA 3QZ9B 2QEXT 4MDWA 5GAMe 2QI2A 2VV5A 1Y71A 2HD0A 3F70A 4IUTA 2RHIA 2XI9A 5GMKh 4EPCA 5DLOA 2FHDA 1WQ7A 1Q81C 3JB9F 2RHXA 1YJNA 1M8VA 1K8AC 1N9RA 2DXTA 5D6WA 4A4GA 4KUDK 2Y90A 4O5VA 3QYHB 3UPUA 3JAME 5KH6A 3I56A 1JBMA 2V8KA 5CQXA 3LYIA 2RJFA 3VUZA 1OZ3A 1QVPA 2EQUA 5GAOp 3RERA 3NTHA 2YLBA 3FDRA 3G4ST 1Q82C 2MWPA 3CCRT 4JRKA 4M7DB 2PQWA 3BW1A 2ZPIB 3OMGA 1Q7YC 2I2LA 4R55A 2JZ2A 1JRIA 3WXMB 1VQ6A 2YHTA 3VKIA 1W2BA 4M7DG 3HL8A 2PVGB 5FRNA 4C8QC 3FB9A 4E7JA 2QQRA 4P5NA 2MMPA 1JJ2S 4XU1A 4Z02A 5GANf 3BDUA 1DJ7B 5GANh 4J83A 3S3NA 5GANg 2CGHA 4B9WA 2LCCA 5GAN7 4M77C 1VQOA 2EQMA 3CC2A 4C92F 2E70A 4C8QB 5CK9A 3CCLT 2GF7A 3JCMg 5L8RE 3I55T 1VIFA 3JRZA 2H3JA 3TEEA 3NTKA 5CR2A 3ASKA 4XU2A 4FM4B 4XTVA 4C8QA 1WJQA 1WPYA 4FT4A 4JDSA 2K4YA 2QA4A 3BDLA 5LJ5j 4XTXA 2FB7A 3M55A 4A54A 4N0AC 5CKEA 1VQNA 3LWHA 2BIVA 2FL7A 4M78E 5C0MA 4PJOE 2ZPBB 1OZ2A 3OYKA 3G6EA 4C0GA 4C8QF 1YJNT 1M1GA 4LDWA 2O4XA 4BB7A 1S72T 2R57A 2RA2A 3TU4K 4PKCC 2JOYA 3HRTA 1BI1A 2EYQA 4IUPA 4MZTA 1N6AA 2D0QB 2DZ9A 3GNGA 3RESA 2OTJT 3S6WA 4ELYC 4L5GA 5I2SA 3DLLA 2X4JA 1YIJT 3P8DA 4M7DC 5J39A 4QQDA 4QQ6A 1V29B 3CMAA 1VQ7T 2JTFA 4DQ2A 3CBMA 3ME9A 1NE8A 3LGFA 4M78G 4PJOG 1WJSA 4DOWA 3PTAA 1QVGA 1VIEA 3OYEA 1KD1U 4C8QG 3CCJT 4E7KA 2ZPHB 2RO0A 2KK4A 5DM7R 4ZGDB 3GIBA 4A53A 3LGLA 3GNFB 4C92D 3SWNA 3L2QA 3NTIA 3X20B 4GY5A 5HKCA 4C92C 5GMKm 3M56A 4M77B 4XTYA 3DLMA 1UB4A 5FROA 4A4KA 3CC2T 2RH2A 2F69A 3QSUA 1G3SA 3MEUA 4C5HA 1KD1C 4PLIA 3CCLA 5CQYA 3CC4A 5FRMA 3T9NA 4EDUA 1K8AU 2PVOB 1W2BS 3OYMA 2ZPGB 3HHTB 4C92G 3O8VA 4E7IA 2M9UA 5GAOr 1LOJA 3RUXA 3OYHA 1M1KC 4M7DD 2XKOC 2XDPA 3M54A 3AHUA 3OYJA 4Y91A 3LLRA 2LTOA 4UC4A 2O01E 4M77E 2RI5A 3FJPA 3UDCA 1VQNT 2K5FA 3TREA 2VXFA 2RHYA 4LDVA 2E10A 1QP2A 1GXIE 2D6FA 3GPLA 5GMKj 1M90U 2YLCA 4M7AB 3CCST 3VUBA 3R6OA 2VC8A 4DOVA 5GAOq 3A8LB 3HFNA 2KAFA 3L2WA 1VQMT 1S72A 3MEAA 1KG1A 5GAMg 3KBGA 3P8HA 3JB9D 4F7UG 1YHQA 1QVFS 4EMKA 4M78C 3PFSA 3HSBA 3JCMh 5KCHA 4PJOC 3V8KA 2DTOA 2PUOB 2K57A 4OB0B 2A3LA 4GLKA 1M90C 3KUFA 2IVWA 3SDZA 2JVVA 5LJ5g 1VQ8T 1VQ7A 3MHXA 3OW2A 4IKFA 3OBYA 2RI2A 2V8IA 2KY9A 4II1A 3JCMb 3CCJA 4D6WA 4HKEA 4QVDA 4J8OA 4BI3A 4N4HA 3CD6T 4M77D 3OA6A 2LQ8A 3JCMX 3GOXA 3QO3A 4C5EA 4C92B 4HT9A 5CKHA 2DKGA 2E64A 4FU6A 5GAN2 1G3WA 3SFMA 3CCMT 5GANj 4XU0A 3QHSA 3M5AA 1VUBA 3OS5A 3SWNB 2QQSA 4EMGA 1VQ5A 2OTLA 5FU6C 3INZA 3L1AA 2QQBA 1Q81U 4M78B 4PJOB 5GAMj 3OYCA 4C0DC 1YI2A 3QYGB 5LJ5h 1IZ6A 1G5VA 2DJZA 2WSCE 5IT9E 3X24B 1XQHA 2DD5A 2BKDN 4OF1A 1YJWT 3M53A 5LJ3h 1Q82U 4ZN3A 4RMOA 1RL2A 4XTUA 2ZPEB 4OP0A 3CCUA 2CKKA 1KHIA 2XK0A 2VYTA 2XICA 3MP6A 4M7AC 4M75C 1Q7YU 2RK1A 1X6OA 4TVRA 2LNVA 3UWNA 3OY9A 1M1FA 2V8JA 2DVEA 4M78F 4PJOF 1VQ9A 2WSFE 3PT9A 3V7RA 4JS5A 3Q1JA 3PIPA 3I56T 2F5TX 3CXCS 1UEBA 3CCET 3SWNC 3RKYA 5GAMd 4MMKA 1YHQT 4ATOA 2RB6A 4KBMB 5IN1A 2HQXA 3MP8A 1ZHIA 4XU3A 3X26B 3GP8A 5GAOm 1KC8C 4RCCA 1Y96B 2DXUA 4RG2A 2E12A 5C6SA 4O6JA 4KULA 4N4IA 4JRQA 2P4TA 2AHJB 2LT4A 1KQ1A 3FEOA 1N8RU 4IURA 3CCQA 2GFAA 1Y07A 3OBWA 2KMTA 3A8OB 3CMEA 2L8DA 4CRIA 4M77A 1O75A 3RMSA 2RK2A 4JRIA 4KUIA 1VQKT 3CD6A 4PJOA 3G7ZA 3VU3C 1BIAA 1OI1A 3BFMA 4BUGA 1VQ4A 5CKFA 2CYZB 2FVUA 5GAN8 2L89A 1JB0E 2DTIA 2PUKB 2X4WA 5GAMf 3HFOA 3J80E 1VQOT 2YRVA 1RI0A 2CZ6B 1YJ9A 3M9QA 3M59A 4QVCA 1NPPA 2EJ9A 2X35A 2OTLT 2B8AA 2DO3A 2K5LA 4QW2A 4RKUE 2XIDA 4XTZA 4C0ZA 5FU7C 4JJNK 3CXCA 3EFRA 1BI3A 5HY6A 4JRPA 3M57A 3FRNA 3OYAA 2QTXA 1B34B 4HCCA 3CBPA 4IUVA 2VXEA 3KXTA 2FYKA 3WVDB 3V7SA 1YJWA 4M7AF 2LRQA 3QXEB 3QZ5B 5D6XA 2XDDA 3OB9A 2DZCA 3E19A 2DAQA 2M0OA 2QXFA 3CCVA 3V8JA 3G6ET 3QJ6A 4M75B 4Y28E 2ZPFB 4F7UA 1HXDA 3A8GB 2CS7A 2L3RA 1VQ9T 3META 4BDZA 5LL6S 2GQVA 4X9DA 3PNWC 3QUIA 4F7UB 2WACA 3CCEA 2LVMA 2E6NA 5DLQE 3V8LA 3QIIA 1I81A 3OW2S 3QPHA 3E1SA 4N0AA 4BD3A 4BI4A 5FU7B 4VUBA 1M9SA 2DD4A 2E65A 2DIGA 3H8ZA 5D6YA 3OYBA 3OYIA 2A7YA 3JCMW 3OS0A 2K2VA 4N4GA 4RCBA 5GANe 1VQPT 2RHUA 3G71A 1Q86U 2EJGA 2X4XA 4JLGA 1SSFA 2GCXA 2Y4XA 2P0KA 4KT0E 2EQJA 5FU6B 1YBYA 4BY6B 4F7UE 3SB2A 2XU8A 1H3ZA 2CZ1B 2RHZA 2DTHA 4J6YA 3L2RA 5LJ3d 1VQ8A 3OYYA 2PVDB 2MI6A 4OMFB 5A0LA 1KHCA 2GFUA 5GMKi 1VQKA 4LD9K 5IAYA 1VQ4T 1K9MC 1X75C 2EFIA 4MZMA 5LJ5e 3HP9A 3QG1A 2G3RA 2QQ9A 1I8FA 2E41A 2NLUA 1QVGS 3C12A 3CC7T 2WSEE 4R56A 2IG0A 5GAMh 2E1HA 3A8MB 3N5BB 1NPRA 4FT2A 4JUVA 2M1HA 1HK9A 5LJ3e 3OS2A 2D9TA 3OSVA 2E5QA 3OYGA 4OGEA 4BACA 5HK3A 5GMKl 4M75D 4FIBA 5CO7A 5GMKe 4Q5WA 2KVQG 3DKMA 3FLGA 2EKOA 5LJ3j 4M7DE 2XHCA 3ER0A 5GAN5 3EAEA 3CCSA 1N8RC 2QQAA 2LQKA 1O9SA 3RKXA 4A4HA 4M7AD 1QP3A 2MWOA 1JJ2A 1VQMA 3JSCA 1BI2A 2Y4YA 4NOYA 2DK3A 3TCJA 1D3BA 4E7HA 3VYHB 3BY7A 1BI0A 2QDYB 3ZBDA 4M77F 5GANd 3MO8A 4XAXB 3ZFJA 2KSSA 5GAN3 4C92E 2JN0A 1N9SA 2R5AA 1WJRA 3MCAB 3QKJA 4A4FA 3CCUT 3QBYA 4HA8A 3G71T 5A0DA 1VQ6T 4M7DA 2RJDA 1ZBXA 1UGSB 2XD0A 1I4K1 1P92A 3MP1A 4JLIA 4L6V5 4LDUA 1PSFA 3CPFA 1UGPB 3JCMd 3URGA 3PIOA 3PMIA 4MMLA 4LDXA 3GF5A 5KCOA 4V2SA 3JB9G 3L2ZA 2EAYA 3CCMA 3S3MA 1OYXA 4M7DF 1U8RA 5J26A 1VQLT 4QQGA 5CAIA 4L59A 1H641 3RKWA 2DPPB 3JB9H 1K73U 2F5KA 5GAN6 5A2QE 3QJYA 2HAXA 4OGCA 3LW5E 1YI2T 3LX7A 2HQEA 4FSXA 2M16A 3M4YA 1XTDA 3J81E 2QA4T 2R58A 3J7AF 1LNXA 3CEYA 5DY9A 3MEWA 4M78D 4PJOD 3OYLA 1QVFA 2CZ7B 3HRSA 1N27A 4FL6A 4LDYA 5CVIA 3OS1A 4B9XA 4J7IA 2PU9B 3HKSA 3OQ5A 3VV0A 2OAUA 1MHNA 2BUDA 2KQWA 3OYDA 4BE1A 4J7FA 1G3TA 2XG8D 4LD6A 3MEVA 5M9OA 2K5IA 5AYFA 2DIQA 4M75F 3C95A 3GLXA 5KE3A 2ZGWA 2RM4A 4BY6C 4EMHA 3OYFA 1UGQB 1QW1A 3CPWA 1Y96A 2OTJA 2MAMA 4PNOA 5LJ3g 2DEQA 2E6ZA 4HCZA 3JB9I 1KQ2A 1YIJA 3SD4A 4C5IA 1K9MU 3JCMf 1NJIC 3CMAT 3CBOA 3P8BB 4MZPA 2CZ0B 4NL2A 4YTLA 2R5MA 4M75G 4C0DB 4CI0C 3CCQT 4JS4A 4M75A 4M77G 1YCYA 1G3YA 2LDMA 4J5YA 5I2MA 3RIRA 3X25B 5CCAA 4OB1B 3M58A 1XOVA 3JCMe 4PLLA 1LJOA 4J6WA 4X34A 1XNIA 5A0GA 5CKDA 5GAN4 4DA4A 2C06A 3CMET 1M5Q1 1BIBA 4C0FA 1M1KU 2XDBA 1U1SA 5I21A 4NL3A 2HNIA 1KQSS 2RJEA 2P0QA 4ME7A 4RG8A 3RMQA 4EMKB 4QVZA 4BDYA 1KC8U 1NJIU 3OYNA 1YJ9T 3LWIA 5GAOl 4BE0A 1YITA 1IREB 3EFSA 1MGQA 3LH0A 3V7CA 1VQLA 5HK0A 1FWZA 1X01A 2K3YA 5FLXE 4A4EA 3CC4T 2ZCFB 2O4XB 4PL6A 3PMTA 3JCMV 3JCMQ 4M75E 2RI3A 2EWNA 5LJ5f 1Y7XA 3CPWS 1AHJB 4ELZC 2QEXA 1KQSA 1U1TA 3L2VA 4OB3B 3HRUA 2ZZDA 3NFCA 4J6XA 2EIFA 4C92A 1FXXA 4ZGJB 1TH7A 4XQ3A 5GAOn 4IUQA 2JUFA 3CCVT 3JCMP 4WF2A 3C94A 3C4SA 3A8HB 4C5GA 2EQKA 1PSEA 2VGNA 1D3BB 2LC4A 1Q86C 1BYMA 1WNLA 3E9GA 1WGSA 4XTWA 1NZ9A 4OB2B 2JTMA 2JNGA 3DB4A 4ZTFA 4ZTJA 3S3OA 4C8QE 3PGGA 4X9CA 1FX7A 3JCMJ 5J3BA 3G4SA 3L2UA 3ZEHA 3CCRA 2VGMA 4M7AE 3JB9J 1M4ZA 2VUBA 2P0PA 4HCBA 5EG2A 4M78A 2LCLA 4E7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF2 A;  1NE8 A;  3NFC A;  5CCA A;  4OF1 A;  5CKE A;  2KMT A;  2C06 A;  5HK3 A;  5CKD A;  4HKE A;  5DLO A;  5CO7 A;  3HPW A;  3VUB A;  3G7Z A;  4ME7 A;  5HKC A;  1M1F A;  5CKH A;  5CKF A;  4MDX A;  1X75 C;  5CKB A;  4MZM A;  3JSC A;  1UB4 A;  3TCJ A;  1VUB A;  4MZT A;  5CQX A;  5CK9 A;  5HK0 A;  4ELY C;  5CQY A;  3JRZ A;  5CR2 A;  4VUB A;  4MZP A;  2VUB A;  4ELZ C; 
#chains in the Genus database with same CATH topology
 2LX9 A;  2RD1 A;  2RJC A;  3E9F A;  1VQP A;  3H0I A;  2JT4 A;  2K3X A;  1K73 C;  4ZGE B;  5CIU A;  2QAZ A;  4RTY A;  4J9G A;  4C8Q D;  3H6Z A;  4M7A A;  1RAG B;  3I5R A;  1K76 A;  3I55 A;  2DXC A;  3OMC A;  4IUU A;  5LJ3 f;  2O88 A;  3FIF A;  2EJF A;  3CC7 A;  4ZN1 A;  3QZ9 B;  1N5Z A;  2QI2 A;  2OX7 A;  3F70 A;  4IUT A;  4EPC A;  2FHD A;  3JB9 F;  2MOX A;  1YJN A;  2DFU A;  5D6W A;  2LJ3 A;  1OX8 A;  2Y90 A;  3QYH B;  3UPU A;  3I56 A;  1YIT Q;  2RJF A;  1UDL A;  2EKH A;  5GAO p;  4GLM A;  3G4S T;  3LH5 A;  4X1V A;  2D8J A;  3BW1 A;  2JZ2 A;  2DL3 A;  2A08 A;  2F1L A;  5HCK A;  4E7J A;  2K6D A;  4XU1 A;  4Z02 A;  1VQM Q;  4J83 A;  1Q7Y R;  3HTR A;  1F1B B;  2EQM A;  1ZUU A;  2KRN A;  2GF7 A;  4JZ4 A;  5L8R E;  3JCM g;  2H3J A;  3NTK A;  3EH1 A;  2JXB A;  3CCR Q;  4FM4 B;  1YWP A;  1ZBJ A;  4FT4 A;  4JDS A;  2DF6 A;  4XTX A;  1ACM B;  4N0A C;  2RQR A;  3LWH A;  2BIV A;  4PJO E;  2PTK A;  1YCS B;  2ZPB B;  1OZ2 A;  2W0Z A;  1VOM A;  1ARK A;  1W1F A;  3TU4 K;  4PKC C;  3RES A;  1BI1 A;  4MZT A;  3GNG A;  2MIO A;  3S6W A;  4DEX A;  5I2S A;  4M7D C;  5J39 A;  2VVK A;  1VQ7 T;  4DEY A;  3CBM A;  3ME9 A;  1NE8 A;  3LGF A;  1QVG A;  4DOW A;  3OYE A;  1WYX A;  1G2B A;  4C8Q G;  2CP2 A;  2DBK A;  3CCJ T;  4E7K A;  1RI9 A;  1U06 A;  2L3Q A;  4ZGD B;  4PJM A;  2IPO B;  1QCF A;  2AZS A;  4HVU A;  4C92 C;  4M77 B;  2FPE A;  3G1J A;  3DLM A;  1WHG A;  1X6B A;  3I56 Q;  1PD1 A;  4C5H A;  1KD1 C;  4PLI A;  5FRM A;  3CC4 A;  3T9N A;  1HSQ A;  1PRL C;  1B07 A;  3HHT B;  2M9U A;  3OYH A;  2XDP A;  2O01 E;  2RI5 A;  2IIM A;  2JMA A;  2K5F A;  1GXI E;  2YLC A;  4M7A B;  3CCS T;  3R6O A;  2K9G A;  1MV3 A;  3JB9 D;  1RLQ C;  4M78 C;  2YXY A;  3D7S B;  4OB0 B;  4GLK A;  2J06 A;  1M90 C;  3KUF A;  4JZ3 A;  3SDZ A;  1WHJ A;  1JJ2 P;  4II1 A;  2EGA A;  1M2V B;  2M02 A;  4BI3 A;  4M77 D;  1W6X A;  2LQ8 A;  1D09 B;  3JCM X;  1J3T A;  4C5E A;  5CKH A;  4FU6 A;  2CP3 A;  3QHS A;  1VUB A;  3VS7 A;  5FU6 C;  5IH2 A;  3INZ A;  1WA7 A;  3L1A A;  1Q81 U;  2JS0 A;  3MPU B;  1YP5 A;  1SRM A;  1TU0 B;  1TS9 A;  1WHK A;  1IZ6 A;  5IT9 E;  2F2X A;  1XQH A;  1R77 A;  2BKD N;  1KD1 R;  1Q82 U;  1RL2 A;  2QA4 Q;  2ZPE B;  3UA7 A;  4M75 C;  3OY9 A;  3M0Q A;  2V8J A;  4PJO F;  3I35 A;  2WSF E;  1M3A A;  3PT9 A;  4JS5 A;  3I56 T;  4PFO A;  3RKY A;  2PZ1 A;  1OPK A;  2DVJ A;  1KC8 C;  4RCC A;  1UFF A;  1K73 R;  1Y96 B;  4N4I A;  1N8R U;  1KQ1 A;  2YUN A;  1M90 R;  2RK2 A;  4KUI A;  1VQK T;  1OI1 A;  3BFM A;  4BUG A;  3EG2 A;  2PUK B;  2P84 A;  1RI0 A;  1MMD A;  4QVC A;  2OTL T;  4XTZ A;  1QQJ A;  2C0I A;  2XID A;  4C0Z A;  2YUQ A;  3KXT A;  2FYK A;  3V7S A;  4M7A F;  3U23 A;  5GJV B;  2DAQ A;  5IXF A;  2M0O A;  3CCV A;  2MK5 A;  1M1K R;  1HXD A;  2CS7 A;  3MET A;  4F7U B;  2KT1 A;  3CCE A;  1I81 A;  1WX6 A;  2J7I A;  3E1S A;  3QPH A;  4BD3 A;  1TXQ A;  5FU7 B;  4BI4 A;  1M9S A;  2E65 A;  4E7S A;  1OU9 A;  5D6Y A;  3OS0 A;  4RCB A;  1Q86 U;  6AT1 B;  2EJG A;  2X4X A;  4JLG A;  2Y4X A;  1I5O B;  2EQJ A;  1LPL A;  1H3Z A;  2CZ1 B;  2DTH A;  4J6Y A;  3L2R A;  5LJ3 d;  3CD6 T;  1GL5 A;  2MI6 A;  1KHC A;  2GFU A;  1VQ4 T;  1X75 C;  1NEG A;  4CC2 A;  3QG1 A;  2G3R A;  1I8F A;  5EC7 A;  2AIR B;  2NLU A;  3N5B B;  3THK A;  4JUV A;  3OS2 A;  4IIO A;  1ABQ A;  2KVQ G;  3DKM A;  2EKO A;  3EAE A;  3CCS A;  2LQK A;  2MWO A;  2Y4Y A;  1AZG B;  1D3B A;  4E7H A;  4F17 A;  2BE7 D;  3ZL7 C;  2X9H A;  5GAN 3;  1VYV A;  2JM8 A;  1CKA A;  3QKJ A;  3CCU T;  3QBY A;  1ZBX A;  3RDV A;  1UGS B;  1D1A A;  1I4K 1;  5KYU B;  3EG0 A;  3TVT A;  3MP1 A;  4JLI A;  1UGP B;  3EGX A;  3GF5 A;  4V2S A;  2K79 A;  2JW4 A;  1OYX A;  1U8R A;  1PNJ A;  5CAI A;  1H64 1;  5A2Q E;  3QJY A;  1Y57 A;  3LW5 E;  4M78 D;  1VQ6 Q;  1U5S A;  3HRS A;  3OS1 A;  1KIK A;  4ESR A;  1TSF A;  2JTE A;  3VV0 A;  1D1B A;  1G3T A;  5M9O A;  1NEB A;  2K5I A;  3C95 A;  2E3I A;  4QT7 A;  2HCK A;  1UGQ B;  1ZSZ B;  2JS2 A;  4PNO A;  2QTV A;  3CCM Q;  2BE9 B;  2E3H A;  2E6Z A;  1K9M U;  3CCE Q;  3CMA T;  3P8B B;  4NL2 A;  1EX4 A;  3EG9 B;  2FEI A;  4JS4 A;  4M75 A;  4J5Y A;  2LDM A;  3X25 B;  2H8H A;  1XOV A;  4PLL A;  2DYB A;  5CKD A;  2DE0 X;  4NL3 A;  1MNE A;  1HD3 A;  2D8H A;  4E2F B;  3OYN A;  3SHW A;  5KYX A;  3V7C A;  1VQL A;  2K3Y A;  1VQ8 Q;  3JCM V;  3PMT A;  2CT4 A;  4M75 E;  1Y7X A;  1KQS A;  3KFV A;  4OB3 B;  3HRU A;  2ZZD A;  2CDT A;  4F14 A;  1FXX A;  3CCV T;  4AT1 B;  2VGN A;  3A98 A;  1UHF A;  3DB4 A;  2NUT B;  2KGT A;  5J3B A;  1WXU A;  3ZEH A;  4OMM A;  1VQ8 A;  4PJO A;  4E7L A;  1IO6 A;  2MF2 A;  2ROL A;  2I0N A;  2KRM A;  2XMF A;  1OEB A;  3WVE B;  3QDR B;  2ATC B;  2HBP A;  2DER A;  1BB9 A;  4E47 A;  2HKQ B;  5LJ5 d;  2X4Y A;  4EMK C;  5CKB A;  3X28 B;  1NLP C;  4HT8 A;  1YIT T;  1VQ5 T;  2HZY A;  4M7A G;  4OVA A;  3EG9 A;  1PKS A;  2DL4 A;  2KDS A;  3R6N A;  4F7U F;  4XK8 E;  3OSS C;  1FMW A;  2H3E B;  4LN2 A;  2AT1 B;  2HSE B;  5GAM e;  2VV5 A;  2HD0 A;  4FYV B;  2FZG B;  1OOT A;  2RHI A;  1MMN A;  2J6F A;  1UHC A;  1Q81 C;  1M8V A;  1K8A C;  2DA9 A;  1RAE B;  1VYT A;  1NJI R;  2QGF B;  3JAM E;  2GGR A;  1D0X A;  1JBM A;  5CQX A;  3LYI A;  3VUZ A;  1OZ3 A;  4PJJ A;  3FDR A;  1Q82 C;  2MWP A;  4M7D B;  1E6H A;  4R55 A;  1JRI A;  1GRI A;  3HL8 A;  5FRN A;  2QQR A;  1AWO A;  4FW2 A;  5GAN f;  5AT1 B;  1YIJ Q;  4D8D A;  2KXD A;  2ENM A;  4M77 C;  4C8Q B;  1OQK A;  3CCL T;  3I55 T;  1VIF A;  2COZ A;  1M2V A;  5LJ5 j;  2ZAE A;  2FB7 A;  1WXT A;  5CKE A;  2EGC A;  1UJY A;  5C0M A;  1SSH A;  2QG9 B;  3OYK A;  1BBZ A;  3G6E A;  1YNZ A;  4C0G A;  4C8Q F;  1YJN T;  1Y0M A;  1M1G A;  1CKB A;  4LDW A;  2RN8 A;  4BB7 A;  1S72 T;  4DBF A;  2R57 A;  3VS5 A;  3HRT A;  1RAH B;  4IUP A;  4KGV B;  2GNC A;  1H8K A;  4AFS C;  3CCS Q;  2X4J A;  3CMA A;  3M0T A;  1V29 B;  4QQ6 A;  5ECA A;  2JTF A;  3CME Q;  4M78 G;  3PTA A;  1VIE A;  2RQU A;  2RO0 A;  3CCQ Q;  1VQ4 Q;  1PHT A;  4A53 A;  1VQK Q;  1WLP B;  5KYX B;  3X20 B;  4GY5 A;  5GMK m;  3I5S A;  1YHQ Q;  1SHF A;  4XTY A;  2W10 A;  4A4K A;  3QSU A;  1G3S A;  4JPB W;  5CQY A;  3H0F A;  4EDU A;  2ROT A;  5GJW B;  2PVO B;  3OYM A;  4C92 G;  3O8V A;  3RR6 A;  3E2U A;  5GAO r;  3RUX A;  2XKO C;  2L3S A;  3M54 A;  4AFU C;  1E7O A;  2KYB A;  3OYJ A;  4UC4 A;  4M77 E;  3FJP A;  2X51 A;  2VXF A;  4ANJ A;  1A0N B;  4OMO A;  4DOV A;  3A8L B;  1KG1 A;  2DET A;  4F7U G;  1YHQ A;  4FW1 A;  1PG5 B;  2V1Q A;  3PFS A;  3JCM h;  3HSB A;  2DTO A;  2PUO B;  2K57 A;  1VQ7 A;  5LJ5 g;  1VQ8 T;  4IKF A;  3OBY A;  2RI2 A;  4OMQ A;  3CCJ A;  4J8O A;  1WHH A;  3AT1 B;  3UA6 A;  2L3P A;  1IGQ A;  3GOX A;  4J9D A;  3QO3 A;  1KC8 R;  4C92 B;  1BCM A;  3SWN B;  4EMG A;  2DNU A;  1VQ5 A;  1Q81 R;  4M78 B;  5GAM j;  1YI2 A;  2WSC E;  3X24 B;  2KRS A;  1YJW T;  2EW3 A;  4OP0 A;  2CKK A;  2SEM A;  5I11 A;  2CSI A;  1GFD A;  1Q7Y U;  4TVR A;  5IHN A;  1VQ9 A;  3V7R A;  3PIP A;  2F5T X;  3MKD A;  4ATO A;  5FW9 A;  2RB6 A;  5IN1 A;  3GP8 A;  1SPK A;  2E12 A;  4HVW A;  4KUL A;  1RAA B;  2P4T A;  2KT8 A;  4Z88 A;  3OBW A;  1BK2 A;  3A8O B;  2KR3 A;  2AKL A;  2L8D A;  2BTT A;  4CRI A;  1O75 A;  3RMS A;  5GAN 8;  3J80 E;  4AFZ C;  1YJ9 A;  2CZ6 B;  4CC3 A;  3M9Q A;  1UEC A;  3M59 A;  1NPP A;  4QW2 A;  2K5L A;  4RKU E;  5HY6 A;  1BI3 A;  4JRP A;  3CBP A;  2VXE A;  2YWW A;  5D6X A;  2LRQ A;  1WZO A;  3VS2 A;  1M27 C;  3G6E T;  4M75 B;  4F7U A;  2L3R A;  2CH4 W;  2AK5 A;  4KGZ B;  3V8L A;  3QII A;  4PJL A;  2DIG A;  3OYI A;  2A7Y A;  3JCM W;  1MMA A;  2K2V A;  3QWX X;  5GAN e;  2M51 A;  4F7U E;  3SB2 A;  1Z9Q A;  1MV0 B;  3H41 A;  1VQK A;  3OYY A;  5A0L A;  3CC4 Q;  2NYS A;  3CCU Q;  1KQS P;  4J9C A;  2DL8 A;  1VQN Q;  2QQ9 A;  2E41 A;  3EFO A;  1ZSZ A;  2WSE E;  2IG0 A;  5GAM h;  2OTJ Q;  2M1H A;  1HK9 A;  2CP6 A;  3VS1 A;  1D0Z A;  4BAC A;  3FLG A;  2XHC A;  3EGU A;  4KRT A;  3RKX A;  1PD0 A;  4A4H A;  1QP3 A;  1JJ2 A;  3JSC A;  3OW2 P;  4NOY A;  1RAC B;  1ZA2 B;  3BY7 A;  5GAN d;  2DJQ A;  4XAX B;  2KSS A;  2R5A A;  4HA8 A;  1VQ6 T;  4M7D A;  5D7U A;  3URG A;  3PIO A;  3PMI A;  4MML A;  2M0Y A;  2DX1 A;  3L2Z A;  2EAY A;  4J9E A;  4KH1 B;  3S3M A;  4KH0 B;  1PWT A;  2FZC B;  3CPW P;  4QQG A;  4L59 A;  4R0K A;  1K73 U;  4OGC A;  1YI2 T;  3LX7 A;  1YI2 Q;  4FSX A;  2M16 A;  2QA4 T;  2VB6 A;  3PVQ A;  4DBR A;  3OYL A;  1X6G A;  4FL6 A;  4LDY A;  5CVI A;  3HKS A;  2BUD A;  1ZX6 A;  4LD6 A;  3GLX A;  2ZGW A;  2HBW A;  3OYF A;  2KI7 A;  4HCZ A;  1BCO A;  2JM9 A;  2QK0 A;  4LNP A;  1KQ2 A;  1YIJ A;  3SD4 A;  3JCM f;  1K1Z A;  1M8M A;  2G6F X;  4M75 G;  4CI0 C;  1KJW A;  3CCU A;  1M2O A;  5I2M A;  2YRD A;  4OB1 B;  3M58 A;  1LJO A;  1RLP C;  4J6W A;  1XNI A;  5GAN 4;  1M5Q 1;  1BIB A;  3CCV Q;  1M1K U;  5KYY A;  4ME7 A;  4RG8 A;  3RMQ A;  4QVZ A;  1KC8 U;  1M3C A;  1YJ9 T;  3LWI A;  5GAO l;  3RBB B;  2ZCF B;  2HDA A;  2LJ1 A;  1WHL A;  2RI3 A;  3CPW S;  1AHJ B;  2YRC A;  2AKK A;  2QEX A;  1TUC A;  1U1T A;  1QWE A;  3NFC A;  5GAO n;  3C94 A;  2CT3 A;  3C4S A;  1CSK A;  2EQK A;  1PSE A;  1WGS A;  2EYZ A;  1NZ9 A;  4OB2 B;  2C0T A;  2JTM A;  2JNG A;  4ZTF A;  4J9H A;  2EQI A;  3EGD A;  3JCM J;  3REA B;  3CCR A;  4M7A E;  3JB9 J;  1M4Z A;  2VUB A;  2P0P A;  4HCB A;  3JB9 H;  4C0D C;  4JJD A;  2SRC A;  2GTJ A;  4AG2 C;  2LT1 A;  1GCP A;  1YJN Q;  1B34 A;  1EIF A;  2BZY A;  1K0S A;  1OUL A;  3DB3 A;  3VYG A;  5KE2 A;  2RQT A;  1BKB A;  2EYW A;  2P4R A;  3FC3 A;  3TSW A;  3UAT A;  3VJP A;  3FJ5 A;  2O9S A;  1UGR B;  3A5Z B;  4PFZ A;  4BE2 A;  4NS5 A;  1ZQ1 A;  2EYY A;  3M4G A;  1I5L A;  1FYN A;  2YT6 A;  2XI9 A;  5DLO A;  1WQ7 A;  2RHX A;  2DXT A;  4KUD K;  1IHW A;  4JJC A;  2C0O A;  3VRZ A;  2V8K A;  1V1C A;  2OJ2 A;  3RER A;  3G4S Q;  2YLB A;  2L2P A;  2PQW A;  2ZPI B;  2V1R A;  3OMG A;  1GCQ C;  1Q7Y C;  1VQ6 A;  5KYY B;  2L0A A;  3REB B;  1JJ2 S;  2DIL A;  1NBE B;  3C0C A;  5GAN g;  5GAN 7;  1VQO A;  2AZV A;  1QCN A;  1PCX A;  3CC2 A;  2EBP A;  2E70 A;  2ECZ A;  3TEE A;  5CR2 A;  1K9M R;  2K7A A;  1I0C A;  1WPY A;  2K4Y A;  2QA4 A;  4AFQ C;  1AD5 A;  3M55 A;  1VQN A;  4M78 E;  2FL7 A;  2O4X A;  5KYN A;  2B86 A;  2RA2 A;  2JOY A;  2EYQ A;  1N6A A;  2D0Q B;  2DZ9 A;  4ELY C;  4EIK A;  1WHM A;  1UG1 A;  4L5G A;  3DLL A;  1YIJ T;  3P8D A;  4DQ2 A;  1VQL Q;  3EG1 A;  2KK4 A;  5DM7 R;  3GIB A;  3LGL A;  3GNF B;  3PVL A;  3SWN A;  2BZX A;  3L2Q A;  3NTI A;  5I22 A;  5HKC A;  2YUP A;  2F69 A;  4PJN A;  2NUP B;  3QWY A;  3CCL A;  1W2B S;  4E7I A;  1LOJ A;  1VQ9 Q;  2RHY A;  4LDV A;  2E10 A;  2D6F A;  2J05 A;  3VUB A;  3HFN A;  4OMN A;  3L2W A;  1S72 A;  1ZA1 B;  3MEA A;  5GAM g;  1X2Q A;  4EMK A;  4PJO C;  3V8K A;  3EHR A;  2A3L A;  2IVW A;  2JVV A;  3MHX A;  3OW2 A;  1WIE A;  2V8I A;  4D6W A;  4QVD A;  4LXC A;  4N4H A;  3OA6 A;  1K9A A;  1TTH B;  2OAW A;  5GAN 2;  3SFM A;  3CCM T;  3OS5 A;  2RQV A;  2QQS A;  1T0J A;  1S72 Q;  3OYC A;  1ZUY A;  1R0B G;  3QYG B;  2NUT A;  2DJZ A;  3PE0 A;  2DD5 A;  2NUZ A;  2QDL A;  5LJ3 h;  3M0S A;  4DBH A;  1KHI A;  2XK0 A;  2VYT A;  5KYW B;  1KSW A;  3UWN A;  4M78 F;  3SWN C;  5GAM d;  4MMK A;  1YHQ T;  4CC7 A;  1GCQ A;  3MP8 A;  4XU3 A;  4HVV A;  5IXB A;  3G6E Q;  1V76 A;  5C6S A;  4JRQ A;  4IUR A;  1ZUK A;  1X2K A;  1WFW A;  2KMT A;  2EGE A;  4HXJ A;  1GBQ A;  4M77 A;  1WDX A;  3G7Z A;  5FWB A;  3VU3 C;  5CKF A;  2CYZ B;  2FVU A;  2L89 A;  1JB0 E;  5IHI A;  5GAM f;  1VQO T;  1VQO Q;  3HFO A;  2KXC A;  2X35 A;  2O9V A;  3ULR B;  4RTW A;  2EPD A;  3EFR A;  2X3X D;  2HKN A;  2QTX A;  2GQI A;  4HCC A;  1FMK A;  1VA7 A;  3WVD B;  2CRE A;  5FWC A;  4LE9 A;  1YJW A;  1C6V X;  3QZ5 B;  3OB9 A;  2Z0W A;  4PFP A;  1AWW A;  3V8J A;  3QJ6 A;  4Y28 E;  3CC7 Q;  1MND A;  3A8G B;  1VQ9 T;  5LL6 S;  1G8X A;  2GQV A;  4X9D A;  3PNW C;  3QUI A;  1T3L A;  1JXM A;  2LVM A;  3VS0 A;  5DLQ E;  3OW2 S;  2DD4 A;  3H8Z A;  3SEM A;  3OYB A;  4N4G A;  2RHU A;  3G71 A;  2GTO A;  4BY6 B;  2GCX A;  5FU6 B;  1QLY A;  2XU8 A;  9ATC B;  2A36 A;  3CD6 Q;  4IIM A;  2FZK B;  2PVD B;  2V26 A;  4LD9 K;  1K9M C;  2CH4 A;  2CUB A;  2EFI A;  4OML A;  5LJ5 e;  4J9B A;  1H3H A;  2MCN A;  1W70 A;  1WI7 A;  1QVG S;  3NMZ C;  4R56 A;  1SHG A;  3NGP A;  1NLO C;  3A8M B;  1NPR A;  5LJ3 e;  2D9T A;  1JXO A;  2RF0 A;  2E5Q A;  3OSV A;  1PM3 A;  3OYG A;  4DBQ A;  5HK3 A;  2A0F B;  5GMK l;  1VQ7 Q;  5CO7 A;  5GMK e;  5LJ3 j;  4E6R A;  3ER0 A;  5GAN 5;  1N8R C;  3EGD B;  1O9S A;  4QKU A;  1QKX A;  3VYH B;  2X3W D;  3CQT A;  4FYY B;  3ZBD A;  4M77 F;  4A63 B;  3MO8 A;  3ZFJ A;  3VS6 A;  2JJ9 A;  2JN0 A;  1WJR A;  4A4F A;  2FRY A;  3MJX A;  5A0D A;  2COY A;  2RJD A;  2XD0 A;  1U3O A;  4L6V 5;  4LDU A;  4PK4 A;  1PSF A;  3JCM d;  4LUD A;  4LDX A;  2RMO A;  3CCM A;  1KK7 A;  2DMO A;  3RKW A;  5GAN 6;  2HAX A;  1WXB A;  3EG3 A;  2HQE A;  3M4Y A;  3IQL A;  1XTD A;  3J81 E;  1IHV A;  3J7A F;  1LNX A;  3CEY A;  1TG0 A;  4PJO D;  1PRM C;  2VKN A;  1QVF A;  1N27 A;  2DL7 A;  4B9X A;  4J7I A;  2HSP A;  7AT1 B;  2OAU A;  3OYD A;  4BE1 A;  2XG8 D;  3MEV A;  2DIQ A;  3H0H A;  4M75 F;  1EFN A;  1YN8 A;  2RM4 A;  4BY6 C;  4EMH A;  1QW1 A;  2OTJ A;  2DEQ A;  2J6O A;  1JQQ A;  4Y92 A;  4C5I A;  2CP7 A;  4RTV A;  1NJI C;  1RAB B;  4MZP A;  2O2O A;  2CZ0 B;  1QVF P;  2R5M A;  4C0D B;  3RIR A;  1YCY A;  1G3Y A;  4M77 G;  2F2W A;  3JCM e;  5A0G A;  4DA4 A;  4C0F A;  3H9N A;  2XDB A;  1U1S A;  2DM1 A;  5I21 A;  3I55 Q;  3NHN A;  1HYO A;  1FMV A;  3EFS A;  4J9I A;  3LH0 A;  5HK0 A;  1FWZ A;  1OU8 A;  4PL6 A;  3JCM Q;  5LJ5 f;  1IXD A;  1RAI B;  1QWF A;  3VS3 A;  4ELZ C;  2J6K A;  2E4H A;  1QVG P;  1AVZ C;  1C0M A;  4C92 A;  1UGV A;  1TH7 A;  4XQ3 A;  4IUQ A;  3JCM P;  1D0Y A;  4WF2 A;  3A8H B;  4C5G A;  1D3B B;  2LC4 A;  1BYM A;  1WNL A;  2KRO A;  4X9C A;  1FX7 A;  4FSS A;  3G4S A;  1T0H A;  2FPF A;  2VGM A;  3QDF A;  4M78 A;  5KYU A;  1SEM A;  1I1J A;  2L5Q A;  5IHK A;  1YJ9 Q;  3G71 Q;  3CCJ Q;  3JCM c;  4BI8 B;  1R8O B;  1W4S A;  3HPW A;  3O5Z A;  4MDX A;  1AEY A;  1VYU A;  3L42 A;  1EZZ B;  2HQH A;  2DXB A;  2LCS A;  3UT1 A;  1ZSG A;  1YWO A;  1WQW A;  2QEX T;  8AT1 B;  4MDW A;  4CC4 B;  1Y71 A;  5KYW A;  3RNJ A;  2LX7 A;  5GMK h;  1TOV A;  1UTI A;  2O31 A;  1N9R A;  2HL3 A;  4A4G A;  4O5V A;  5KH6 A;  1BU1 A;  1QVP A;  1YFN A;  2DLP A;  2EQU A;  3NTH A;  1NG2 A;  4RTT A;  3CCR T;  2ESW A;  4JRK A;  2I2L A;  3GBQ A;  3WXM B;  1E6G A;  2YHT A;  3VKI A;  1I07 A;  3A1P A;  4M7D G;  2PVG B;  4C8Q C;  3FB9 A;  3EHQ A;  4P5N A;  2MMP A;  3BDU A;  1DJ7 B;  1TUD A;  5GAN h;  3S3N A;  2CGH A;  4B9W A;  2LCC A;  2RQW A;  1B7T A;  4C92 F;  5CK9 A;  3JRZ A;  4RTX A;  3ASK A;  4XU2 A;  4XTV A;  1JO8 A;  4C8Q A;  1WJQ A;  1OV3 A;  1GFC A;  2MPX C;  3BDL A;  2VAS A;  1SF9 A;  4A54 A;  2HEQ A;  4FYX B;  4Z8A A;  1AWX A;  2FO0 A;  2LZ6 B;  2DL5 A;  2VWF A;  4F04 B;  2PNI A;  1VQ5 Q;  2LMJ A;  2YUO A;  2OTJ T;  4KGX B;  1T3S A;  1PC0 A;  4QQD A;  2RPN A;  1SG5 A;  4HCK A;  4PJO G;  1WJS A;  1KD1 U;  3TSZ A;  2NWM A;  2ZPH B;  4RTZ A;  4C92 D;  4WTO B;  2YDL A;  3M56 A;  2NUP A;  1C1A A;  1UB4 A;  2EYX A;  2K3B A;  5FRO A;  4F16 A;  3CC2 T;  2RH2 A;  2FRW A;  1G83 A;  3MEU A;  1K8A U;  2HL5 C;  4ZNX A;  2ZPG B;  2KE9 A;  4M7D D;  1M1K C;  2CUD A;  5L23 A;  3AHU A;  3EFO B;  4Y91 A;  3LLR A;  2LTO A;  1W2B P;  3UDC A;  3M0R A;  1VQN T;  3TRE A;  1QP2 A;  3GPL A;  5GMK j;  4RUG A;  1M90 U;  2VC8 A;  2FG0 A;  2ED1 A;  5GAO q;  2KAF A;  1SKU B;  1VQM T;  3NPF A;  4D8K A;  2OI3 A;  3KBG A;  1TWB A;  3I9Q A;  3P8H A;  1QVF S;  4WCI A;  4JJB A;  5KCH A;  1QMC A;  1HJD A;  2DBM A;  1X43 A;  2HMA A;  2KY9 A;  3JCM b;  4HKE A;  1NYF A;  1TUG B;  3EH2 A;  2DEU A;  4HT9 A;  2DKG A;  2E64 A;  1G3W A;  5GAN j;  4XU0 A;  2D0N A;  2CSQ A;  3M5A A;  2OTL A;  2QQB A;  4PJO B;  4LUE A;  5LJ5 h;  2E5K A;  1G5V A;  4OF1 A;  4Z89 A;  3M53 A;  1NYG A;  2OTL Q;  4ZN3 A;  4RMO A;  4XTU A;  2XIC A;  3MP6 A;  4M7A C;  2RK1 A;  1X6O A;  4K11 A;  2LNV A;  1M1F A;  2DVE A;  1NM7 A;  3CC2 Q;  3Q1J A;  1ZLM A;  3UF4 A;  1UEB A;  3CXC S;  1QKW A;  3CMA Q;  3CCE T;  4KBM B;  2HQX A;  1D1C A;  1ZHI A;  3X26 B;  2KBT A;  5GAO m;  2DXU A;  4RG2 A;  4O6J A;  2DYI A;  1AOJ A;  2AHJ B;  2LT4 A;  3FEO A;  3CCQ A;  1N8R R;  3TQ7 P;  4FCY A;  2GFA A;  1Y07 A;  1QCO A;  3CME A;  4GBQ A;  4JRI A;  3CD6 A;  1BIA A;  1VQ4 A;  1K0X A;  2DTI A;  2X4W A;  2YRV A;  4OMP A;  4RTU A;  2EJ9 A;  2B8A A;  2DO3 A;  5FU7 C;  4JJN K;  3CXC A;  3JV3 A;  3M57 A;  3FRN A;  3OYA A;  1JEG A;  1B34 B;  4IUV A;  2EVR A;  3M0U A;  1RUW A;  3QXE B;  2CP5 A;  2KYM A;  3EGX B;  2XDD A;  2JMC A;  2DZC A;  3E19 A;  2QXF A;  2ZPF B;  4E7Z A;  1AT1 B;  1B3Q A;  4BDZ A;  2KNB B;  4AMC A;  2WAC A;  2E6N A;  2A37 A;  4N0A A;  4VUB A;  1K4U S;  1RAF B;  3CCL Q;  2QYZ A;  1VQP T;  1Q86 R;  4KT0 E;  1SSF A;  2P0K A;  8ATC B;  1YBY A;  2RNA A;  2LP5 A;  1Z9Z A;  4FYW B;  2RHZ A;  4OMF B;  1RAD B;  1AZE A;  5GMK i;  5IAY A;  4MZM A;  1MMG A;  3HP9 A;  2COW A;  2MYS A;  3C12 A;  3CC7 T;  2E1H A;  3CXC P;  2ABL A;  4FT2 A;  3BE3 A;  2GBQ A;  4ORZ A;  4OGE A;  1KFZ A;  4AG1 C;  4M75 D;  1PKT A;  4FIB A;  4Q5W A;  4M7D E;  4B6M A;  2QQA A;  4M7A D;  1VQM A;  1BI2 A;  3TCJ A;  2DK3 A;  1GBR A;  1XJW B;  1UUE A;  1LCK A;  1LVK A;  1BI0 A;  2QDY B;  2D1X A;  4C92 E;  1X27 A;  1N9S A;  3MCA B;  1OPL A;  3G71 T;  4M4Z A;  1P92 A;  1ABO A;  1JU5 C;  2LQW A;  3CPF A;  2CP0 A;  1IGU A;  5KCO A;  3JB9 G;  1VQP Q;  4M7D F;  1ZSZ C;  5J26 A;  1VQL T;  2LQN A;  2DPP B;  2F5K A;  1K8A R;  1MUZ A;  1OX9 A;  2R58 A;  5DY9 A;  3MEW A;  3M0P A;  2F2V A;  2CZ7 B;  2PU9 B;  3OQ5 A;  1MHN A;  2KQW A;  4J7F A;  3VS4 A;  5AYF A;  1M30 A;  5KE3 A;  3CPW A;  1Y96 A;  2MAM A;  5LJ3 g;  1X69 A;  2QEX Q;  3JB9 I;  1IB8 A;  1Q95 G;  2KEA A;  3CBO A;  4YTL A;  2K2M A;  3CCQ T;  1W2B A;  5CCA A;  4X34 A;  2C06 A;  1UJ0 A;  2DRM A;  2LJ0 A;  3CME T;  2QGG A;  1KQS S;  2HNI A;  2RJE A;  1YJW Q;  2P0Q A;  4EMK B;  4BDY A;  2BZ8 A;  1NJI U;  3VRY A;  4BE0 A;  1YIT A;  1IRE B;  1MGQ A;  1X01 A;  5FLX E;  3CC4 T;  4A4E A;  2O4X B;  1M3B A;  1SRL A;  2EWN A;  1R0C B;  3L2V A;  2FPD A;  4J6X A;  2EIF A;  1Q82 R;  4ZGJ B;  2DRK A;  1UE9 A;  2JUF A;  1H92 A;  1AWJ A;  1Q86 C;  2QAS A;  3E9G A;  4XTW A;  2YSQ A;  4ZTJ A;  2ED0 A;  3S3O A;  4C8Q E;  3PGG A;  4J9F A;  3L2U A;  2A28 A;  1IRX A;  1S1N A;  2LNH B;  5EG2 A;  2LCL A; 
#chains in the Genus database with same CATH homology
 2LX9 A;  2MF2 A;  2RD1 A;  2RJC A;  2L5Q A;  3E9F A;  1VQP A;  2LT1 A;  3JCM c;  2K3X A;  3WVE B;  4BI8 B;  3QDR B;  1K73 C;  2HBP A;  4ZGE B;  1B34 A;  4E47 A;  1R8O B;  1EIF A;  5LJ5 d;  1W4S A;  3HPW A;  5CIU A;  3DB3 A;  2X4Y A;  3VYG A;  4EMK C;  5KE2 A;  1BKB A;  4MDX A;  5CKB A;  3FC3 A;  3X28 B;  4C8Q D;  3H6Z A;  3VJP A;  4HT8 A;  1YIT T;  4M7A A;  1VQ5 T;  1UGR B;  3A5Z B;  3L42 A;  4M7A G;  3I55 A;  4OVA A;  2DXC A;  3OMC A;  4IUU A;  5LJ3 f;  3FIF A;  2EJF A;  4BE2 A;  4NS5 A;  3CC7 A;  1ZQ1 A;  2DXB A;  2KDS A;  3M4G A;  3UT1 A;  4XK8 E;  4F7U F;  1I5L A;  4ZN1 A;  3OSS C;  1WQW A;  3QZ9 B;  2QEX T;  4MDW A;  5GAM e;  2QI2 A;  2VV5 A;  1Y71 A;  2HD0 A;  3F70 A;  4IUT A;  2RHI A;  2XI9 A;  5GMK h;  4EPC A;  5DLO A;  2FHD A;  1WQ7 A;  1Q81 C;  3JB9 F;  2RHX A;  1YJN A;  1M8V A;  1K8A C;  1N9R A;  2DXT A;  5D6W A;  4A4G A;  4KUD K;  2Y90 A;  4O5V A;  3QYH B;  3UPU A;  3JAM E;  5KH6 A;  3I56 A;  1JBM A;  2V8K A;  5CQX A;  3LYI A;  2RJF A;  3VUZ A;  1OZ3 A;  1QVP A;  2EQU A;  5GAO p;  3RER A;  3NTH A;  2YLB A;  3FDR A;  3G4S T;  1Q82 C;  2MWP A;  3CCR T;  4JRK A;  4M7D B;  2PQW A;  3BW1 A;  2ZPI B;  3OMG A;  1Q7Y C;  2I2L A;  4R55 A;  2JZ2 A;  1JRI A;  3WXM B;  1VQ6 A;  2YHT A;  3VKI A;  1W2B A;  4M7D G;  3HL8 A;  2PVG B;  5FRN A;  4C8Q C;  3FB9 A;  4E7J A;  2QQR A;  4P5N A;  2MMP A;  1JJ2 S;  4XU1 A;  4Z02 A;  5GAN f;  3BDU A;  1DJ7 B;  5GAN h;  4J83 A;  3S3N A;  5GAN g;  2CGH A;  4B9W A;  2LCC A;  5GAN 7;  4M77 C;  1VQO A;  2EQM A;  3CC2 A;  4C92 F;  2E70 A;  4C8Q B;  5CK9 A;  3CCL T;  2GF7 A;  3JCM g;  5L8R E;  3I55 T;  1VIF A;  3JRZ A;  2H3J A;  3TEE A;  3NTK A;  5CR2 A;  3ASK A;  4XU2 A;  4FM4 B;  4XTV A;  4C8Q A;  1WJQ A;  1WPY A;  4FT4 A;  4JDS A;  2K4Y A;  2QA4 A;  3BDL A;  5LJ5 j;  4XTX A;  2FB7 A;  3M55 A;  4A54 A;  4N0A C;  5CKE A;  1VQN A;  3LWH A;  2BIV A;  2FL7 A;  4M78 E;  5C0M A;  4PJO E;  2ZPB B;  1OZ2 A;  3OYK A;  3G6E A;  4C0G A;  4C8Q F;  1YJN T;  1M1G A;  4LDW A;  2O4X A;  4BB7 A;  1S72 T;  2R57 A;  2RA2 A;  3TU4 K;  4PKC C;  2JOY A;  3HRT A;  1BI1 A;  2EYQ A;  4IUP A;  4MZT A;  1N6A A;  2D0Q B;  2DZ9 A;  3GNG A;  3RES A;  2OTJ T;  3S6W A;  4ELY C;  4L5G A;  5I2S A;  3DLL A;  2X4J A;  1YIJ T;  3P8D A;  4M7D C;  5J39 A;  4QQD A;  4QQ6 A;  1V29 B;  3CMA A;  1VQ7 T;  2JTF A;  4DQ2 A;  3CBM A;  3ME9 A;  1NE8 A;  3LGF A;  4M78 G;  4PJO G;  1WJS A;  4DOW A;  3PTA A;  1QVG A;  1VIE A;  3OYE A;  1KD1 U;  4C8Q G;  3CCJ T;  4E7K A;  2ZPH B;  2RO0 A;  2KK4 A;  5DM7 R;  4ZGD B;  3GIB A;  4A53 A;  3LGL A;  3GNF B;  4C92 D;  3SWN A;  3L2Q A;  3NTI A;  3X20 B;  4GY5 A;  5HKC A;  4C92 C;  5GMK m;  3M56 A;  4M77 B;  4XTY A;  3DLM A;  1UB4 A;  5FRO A;  4A4K A;  3CC2 T;  2RH2 A;  2F69 A;  3QSU A;  1G3S A;  3MEU A;  4C5H A;  1KD1 C;  4PLI A;  3CCL A;  5CQY A;  3CC4 A;  5FRM A;  3T9N A;  4EDU A;  1K8A U;  2PVO B;  1W2B S;  3OYM A;  2ZPG B;  3HHT B;  4C92 G;  3O8V A;  4E7I A;  2M9U A;  5GAO r;  1LOJ A;  3RUX A;  3OYH A;  1M1K C;  4M7D D;  2XKO C;  2XDP A;  3M54 A;  3AHU A;  3OYJ A;  4Y91 A;  3LLR A;  2LTO A;  4UC4 A;  2O01 E;  4M77 E;  2RI5 A;  3FJP A;  3UDC A;  1VQN T;  2K5F A;  3TRE A;  2VXF A;  2RHY A;  4LDV A;  2E10 A;  1QP2 A;  1GXI E;  2D6F A;  3GPL A;  5GMK j;  1M90 U;  2YLC A;  4M7A B;  3CCS T;  3VUB A;  3R6O A;  2VC8 A;  4DOV A;  5GAO q;  3A8L B;  3HFN A;  2KAF A;  3L2W A;  1VQM T;  1S72 A;  3MEA A;  1KG1 A;  5GAM g;  3KBG A;  3P8H A;  3JB9 D;  4F7U G;  1YHQ A;  1QVF S;  4EMK A;  4M78 C;  3PFS A;  3HSB A;  3JCM h;  5KCH A;  4PJO C;  3V8K A;  2DTO A;  2PUO B;  2K57 A;  4OB0 B;  2A3L A;  4GLK A;  1M90 C;  3KUF A;  2IVW A;  3SDZ A;  2JVV A;  5LJ5 g;  1VQ8 T;  1VQ7 A;  3MHX A;  3OW2 A;  4IKF A;  3OBY A;  2RI2 A;  2V8I A;  2KY9 A;  4II1 A;  3JCM b;  3CCJ A;  4D6W A;  4HKE A;  4QVD A;  4J8O A;  4BI3 A;  4N4H A;  3CD6 T;  4M77 D;  3OA6 A;  2LQ8 A;  3JCM X;  3GOX A;  3QO3 A;  4C5E A;  4C92 B;  4HT9 A;  5CKH A;  2DKG A;  2E64 A;  4FU6 A;  5GAN 2;  1G3W A;  3SFM A;  3CCM T;  5GAN j;  4XU0 A;  3QHS A;  3M5A A;  1VUB A;  3OS5 A;  3SWN B;  2QQS A;  4EMG A;  1VQ5 A;  2OTL A;  5FU6 C;  3INZ A;  3L1A A;  2QQB A;  1Q81 U;  4M78 B;  4PJO B;  5GAM j;  3OYC A;  4C0D C;  1YI2 A;  3QYG B;  5LJ5 h;  1IZ6 A;  1G5V A;  2DJZ A;  2WSC E;  5IT9 E;  3X24 B;  1XQH A;  2DD5 A;  2BKD N;  4OF1 A;  1YJW T;  3M53 A;  5LJ3 h;  1Q82 U;  4ZN3 A;  4RMO A;  1RL2 A;  4XTU A;  2ZPE B;  4OP0 A;  3CCU A;  2CKK A;  1KHI A;  2XK0 A;  2VYT A;  2XIC A;  3MP6 A;  4M7A C;  4M75 C;  1Q7Y U;  2RK1 A;  1X6O A;  4TVR A;  2LNV A;  3UWN A;  3OY9 A;  1M1F A;  2V8J A;  2DVE A;  4M78 F;  4PJO F;  1VQ9 A;  2WSF E;  3PT9 A;  3V7R A;  4JS5 A;  3Q1J A;  3PIP A;  3I56 T;  2F5T X;  3CXC S;  1UEB A;  3CCE T;  3SWN C;  3RKY A;  5GAM d;  4MMK A;  1YHQ T;  4ATO A;  2RB6 A;  4KBM B;  5IN1 A;  2HQX A;  3MP8 A;  1ZHI A;  4XU3 A;  3X26 B;  3GP8 A;  5GAO m;  1KC8 C;  4RCC A;  1Y96 B;  2DXU A;  4RG2 A;  2E12 A;  5C6S A;  4O6J A;  4KUL A;  4N4I A;  4JRQ A;  2P4T A;  2AHJ B;  2LT4 A;  1KQ1 A;  3FEO A;  1N8R U;  4IUR A;  3CCQ A;  2GFA A;  1Y07 A;  3OBW A;  2KMT A;  3A8O B;  3CME A;  2L8D A;  4CRI A;  4M77 A;  1O75 A;  3RMS A;  2RK2 A;  4JRI A;  4KUI A;  1VQK T;  3CD6 A;  4PJO A;  3G7Z A;  3VU3 C;  1BIA A;  1OI1 A;  3BFM A;  4BUG A;  1VQ4 A;  5CKF A;  2CYZ B;  2FVU A;  5GAN 8;  2L89 A;  1JB0 E;  2DTI A;  2PUK B;  2X4W A;  5GAM f;  3HFO A;  3J80 E;  1VQO T;  2YRV A;  1RI0 A;  2CZ6 B;  1YJ9 A;  3M9Q A;  3M59 A;  4QVC A;  1NPP A;  2EJ9 A;  2X35 A;  2OTL T;  2B8A A;  2DO3 A;  2K5L A;  4QW2 A;  4RKU E;  2XID A;  4XTZ A;  4C0Z A;  5FU7 C;  4JJN K;  3CXC A;  3EFR A;  1BI3 A;  5HY6 A;  4JRP A;  3M57 A;  3FRN A;  3OYA A;  2QTX A;  1B34 B;  4HCC A;  3CBP A;  4IUV A;  2VXE A;  3KXT A;  2FYK A;  3WVD B;  3V7S A;  1YJW A;  4M7A F;  2LRQ A;  3QXE B;  3QZ5 B;  5D6X A;  2XDD A;  3OB9 A;  2DZC A;  3E19 A;  2DAQ A;  2M0O A;  2QXF A;  3CCV A;  3V8J A;  3G6E T;  3QJ6 A;  4M75 B;  4Y28 E;  2ZPF B;  4F7U A;  1HXD A;  3A8G B;  2CS7 A;  2L3R A;  1VQ9 T;  3MET A;  4BDZ A;  5LL6 S;  2GQV A;  4X9D A;  3PNW C;  3QUI A;  4F7U B;  2WAC A;  3CCE A;  2LVM A;  2E6N A;  5DLQ E;  3V8L A;  3QII A;  1I81 A;  3OW2 S;  3QPH A;  3E1S A;  4N0A A;  4BD3 A;  4BI4 A;  5FU7 B;  4VUB A;  1M9S A;  2DD4 A;  2E65 A;  2DIG A;  3H8Z A;  5D6Y A;  3OYB A;  3OYI A;  2A7Y A;  3JCM W;  3OS0 A;  2K2V A;  4N4G A;  4RCB A;  5GAN e;  1VQP T;  2RHU A;  3G71 A;  1Q86 U;  2EJG A;  2X4X A;  4JLG A;  1SSF A;  2GCX A;  2Y4X A;  2P0K A;  4KT0 E;  2EQJ A;  5FU6 B;  1YBY A;  4BY6 B;  4F7U E;  3SB2 A;  2XU8 A;  1H3Z A;  2CZ1 B;  2RHZ A;  2DTH A;  4J6Y A;  3L2R A;  5LJ3 d;  1VQ8 A;  3OYY A;  2PVD B;  2MI6 A;  4OMF B;  5A0L A;  1KHC A;  2GFU A;  5GMK i;  1VQK A;  4LD9 K;  5IAY A;  1VQ4 T;  1K9M C;  1X75 C;  2EFI A;  4MZM A;  5LJ5 e;  3HP9 A;  3QG1 A;  2G3R A;  2QQ9 A;  1I8F A;  2E41 A;  2NLU A;  1QVG S;  3C12 A;  3CC7 T;  2WSE E;  4R56 A;  2IG0 A;  5GAM h;  2E1H A;  3A8M B;  3N5B B;  1NPR A;  4FT2 A;  4JUV A;  2M1H A;  1HK9 A;  5LJ3 e;  3OS2 A;  2D9T A;  3OSV A;  2E5Q A;  3OYG A;  4OGE A;  4BAC A;  5HK3 A;  5GMK l;  4M75 D;  4FIB A;  5CO7 A;  5GMK e;  4Q5W A;  2KVQ G;  3DKM A;  3FLG A;  2EKO A;  5LJ3 j;  4M7D E;  2XHC A;  3ER0 A;  5GAN 5;  3EAE A;  3CCS A;  1N8R C;  2QQA A;  2LQK A;  1O9S A;  3RKX A;  4A4H A;  4M7A D;  1QP3 A;  2MWO A;  1JJ2 A;  1VQM A;  3JSC A;  1BI2 A;  2Y4Y A;  4NOY A;  2DK3 A;  3TCJ A;  1D3B A;  4E7H A;  3VYH B;  3BY7 A;  1BI0 A;  2QDY B;  3ZBD A;  4M77 F;  5GAN d;  3MO8 A;  4XAX B;  3ZFJ A;  2KSS A;  5GAN 3;  4C92 E;  2JN0 A;  1N9S A;  2R5A A;  1WJR A;  3MCA B;  3QKJ A;  4A4F A;  3CCU T;  3QBY A;  4HA8 A;  3G71 T;  5A0D A;  1VQ6 T;  4M7D A;  2RJD A;  1ZBX A;  1UGS B;  2XD0 A;  1I4K 1;  1P92 A;  3MP1 A;  4JLI A;  4L6V 5;  4LDU A;  1PSF A;  3CPF A;  1UGP B;  3JCM d;  3URG A;  3PIO A;  3PMI A;  4MML A;  4LDX A;  3GF5 A;  5KCO A;  4V2S A;  3JB9 G;  3L2Z A;  2EAY A;  3CCM A;  3S3M A;  1OYX A;  4M7D F;  1U8R A;  5J26 A;  1VQL T;  4QQG A;  5CAI A;  4L59 A;  1H64 1;  3RKW A;  2DPP B;  3JB9 H;  1K73 U;  2F5K A;  5GAN 6;  5A2Q E;  3QJY A;  2HAX A;  4OGC A;  3LW5 E;  1YI2 T;  3LX7 A;  2HQE A;  4FSX A;  2M16 A;  3M4Y A;  1XTD A;  3J81 E;  2QA4 T;  2R58 A;  3J7A F;  1LNX A;  3CEY A;  5DY9 A;  3MEW A;  4M78 D;  4PJO D;  3OYL A;  1QVF A;  2CZ7 B;  3HRS A;  1N27 A;  4FL6 A;  4LDY A;  5CVI A;  3OS1 A;  4B9X A;  4J7I A;  2PU9 B;  3HKS A;  3OQ5 A;  3VV0 A;  2OAU A;  1MHN A;  2BUD A;  2KQW A;  3OYD A;  4BE1 A;  4J7F A;  1G3T A;  2XG8 D;  4LD6 A;  3MEV A;  5M9O A;  2K5I A;  5AYF A;  2DIQ A;  4M75 F;  3C95 A;  3GLX A;  5KE3 A;  2ZGW A;  2RM4 A;  4BY6 C;  4EMH A;  3OYF A;  1UGQ B;  1QW1 A;  3CPW A;  1Y96 A;  2OTJ A;  2MAM A;  4PNO A;  5LJ3 g;  2DEQ A;  2E6Z A;  4HCZ A;  3JB9 I;  1KQ2 A;  1YIJ A;  3SD4 A;  4C5I A;  1K9M U;  3JCM f;  1NJI C;  3CMA T;  3CBO A;  3P8B B;  4MZP A;  2CZ0 B;  4NL2 A;  4YTL A;  2R5M A;  4M75 G;  4C0D B;  4CI0 C;  3CCQ T;  4JS4 A;  4M75 A;  4M77 G;  1YCY A;  1G3Y A;  2LDM A;  4J5Y A;  5I2M A;  3RIR A;  3X25 B;  5CCA A;  4OB1 B;  3M58 A;  1XOV A;  3JCM e;  4PLL A;  1LJO A;  4J6W A;  4X34 A;  1XNI A;  5A0G A;  5CKD A;  5GAN 4;  4DA4 A;  2C06 A;  3CME T;  1M5Q 1;  1BIB A;  4C0F A;  1M1K U;  2XDB A;  1U1S A;  5I21 A;  4NL3 A;  2HNI A;  1KQS S;  2RJE A;  2P0Q A;  4ME7 A;  4RG8 A;  3RMQ A;  4EMK B;  4QVZ A;  4BDY A;  1KC8 U;  1NJI U;  3OYN A;  1YJ9 T;  3LWI A;  5GAO l;  4BE0 A;  1YIT A;  1IRE B;  3EFS A;  1MGQ A;  3LH0 A;  3V7C A;  1VQL A;  5HK0 A;  1FWZ A;  1X01 A;  2K3Y A;  5FLX E;  4A4E A;  3CC4 T;  2ZCF B;  2O4X B;  4PL6 A;  3PMT A;  3JCM V;  3JCM Q;  4M75 E;  2RI3 A;  2EWN A;  5LJ5 f;  1Y7X A;  3CPW S;  1AHJ B;  4ELZ C;  2QEX A;  1KQS A;  1U1T A;  3L2V A;  4OB3 B;  3HRU A;  2ZZD A;  3NFC A;  4J6X A;  2EIF A;  4C92 A;  1FXX A;  4ZGJ B;  1TH7 A;  4XQ3 A;  5GAO n;  4IUQ A;  2JUF A;  3CCV T;  3JCM P;  4WF2 A;  3C94 A;  3C4S A;  3A8H B;  4C5G A;  2EQK A;  1PSE A;  2VGN A;  1D3B B;  2LC4 A;  1Q86 C;  1BYM A;  1WNL A;  3E9G A;  1WGS A;  4XTW A;  1NZ9 A;  4OB2 B;  2JTM A;  2JNG A;  3DB4 A;  4ZTF A;  4ZTJ A;  3S3O A;  4C8Q E;  3PGG A;  4X9C A;  1FX7 A;  3JCM J;  5J3B A;  3G4S A;  3L2U A;  3ZEH A;  3CCR A;  2VGM A;  4M7A E;  3JB9 J;  1M4Z A;  2VUB A;  2P0P A;  4HCB A;  5EG2 A;  4M78 A;  2LCL A;  4E7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...