5CKFA

E. coli mazf e24a form i
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
103
Chain Sequence
VSRYVPDMGDLIWVDFQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoribonuclease MazF
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 24
structure length 103
sequence length 110
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ckfA00
4ELYC 5CQYA 2C06A 3JSCA 4VUBA 2VUBA 1X75C 1M1FA 3HPWA 3TCJA 5CR2A 5CCAA 1NE8A 5HK0A 5CKDA 5CKHA 5HK3A 4OF1A 5CKFA 5CKBA 1VUBA 5CKEA 3VUBA 4MDXA 4MZTA 3JRZA 2MF2A 4HKEA 4MZMA 4ELZC 2KMTA 1UB4A 5CQXA 3NFCA 4MZPA 5HKCA 3G7ZA 5CO7A 4ME7A 5CK9A 5DLOA
chains in the Genus database with same CATH superfamily
3I56T 1U8RA 1T0HA 4E7IA 1V76A 2DTOA 3QG1A 1Q86C 2RJDA 5GAN2 4HCBA 1K0XA 3QYGB 2V26A 4OMNA 1BI3A 1BIBA 2GCXA 3VUZA 3VS1A 1VQ9T 2DYIA 3SWNA 1H641 5GAOr 2JM9A 3O5ZA 4M75A 1ZSZC 2FRYA 2JN0A 1MNDA 2KRNA 3ZFJA 3CMET 1KQSP 4C0ZA 2HEQA 1VIFA 3CCEA 3EH2A 2ZPHB 1KD1U 3JB9F 2FEIA 2EPDA 3I5RA 3OSSC 3EGDB 5A2QE 4IUPA 1YJNA 1KK7A 2HCKA 2HKQB 4FM4B 4AFQC 4WF2A 5LJ5d 1AWOA 2P4RA 1VQ7A 3MP1A 3M0QA 5IN1A 5GMKh 2CUBA 3JRZA 4M7AG 3SHWA 2ZPIB 2DK3A 3OBYA 1UHCA 3GF5A 1FXXA 1TXQA 1K9AA 2J6FA 2RHYA 1TU0B 3VS0A 5GJWB 1M5Q1 1VQ4T 1YBYA 2DJZA 3HTRA 4X9CA 2AZVA 4FYWB 2KI7A 4KULA 5D6WA 1Y7XA 2CP2A 4HA8A 1Q95G 3PVLA 2KXCA 1G3SA 1VQ9A 3CMAT 1Q86R 1VIEA 3OYCA 3CMEA 3G6EQ 1I07A 1K8AC 3MP8A 2JVVA 2K5FA 1SSFA 1UGVA 1YI2T 2QDLA 3P8BB 2RHUA 3DLMA 2LTOA 4IKFA 1GL5A 2MCNA 4OMPA 1VQ6Q 5KYYB 3CCLT 3Q1JA 4N4GA 2SRCA 4DQ2A 1OU9A 1JO8A 4NL3A 3E9FA 1QVFS 3JCMX 2ESWA 5LJ3d 5IT9E 2X9HA 3FEOA 3JB9H 1MNEA 1VQ4A 1EZZB 3S3NA 2M1HA 4JS4A 1VQLT 1N8RC 2E5KA 5KCOA 3T9NA 1JRIA 1H8KA 4A54A 2ED1A 3FB9A 3CMAA 4PJOB 2X51A 3WVDB 1UGQB 2RI2A 2XIDA 4KGZB 3R6NA 2A36A 1FMVA 3OYNA 1R0CB 2ED0A 2KSSA 3PE0A 1YI2A 1KQSS 4OMFB 3VKIA 4LDWA 3ULRB 2CSQA 3EGXA 4L6V5 2DLPA 4WCIA 4LDXA 3CCLA 1K8AR 5GANh 1J3TA 3S3OA 2CH4W 3UA6A 3EG9B 2CP5A 3CCEQ 1NPRA 2CREA 4Y91A 1AD5A 2CKKA 5GAOq 3I9QA 1YJNQ 4A4KA 3URGA 2CS7A 5GMKi 1BCOA 3JB9D 1VQ7Q 1D1BA 2DRKA 1BI0A 1OQKA 5FW9A 1SSHA 2QQAA 1RADB 2D0NA 2RHZA 3META 4M78B 4B6MA 1N9SA 4IUQA 3PTAA 4CC2A 5KYWA 4LXCA 1N8RR 1FX7A 2OX7A 4C5HA 4RKUE 3QHSA 2BIVA 2LMJA 2E3IA 4L59A 2HZYA 2VUBA 5L8RE 3H0FA 1Q86U 2VVKA 4NS5A 3J80E 3CMEQ 2XD0A 3ZBDA 2RQWA 3L2ZA 2NUPA 4C92F 1JEGA 4DA4A 2NYSA 2COZA 5LJ5g 1Z9ZA 4X9DA 1ABQA 3ZEHA 3KXTA 2ZGWA 2BZYA 2CZ0B 2HMAA 1G5VA 1UE9A 1IO6A 3A8MB 4CC3A 1QVGP 1X75C 4K11A 3M53A 4Z02A 3OYFA 5M9OA 2QI2A 1WQ7A 3KFVA 4M7AF 2HBPA 4OP0A 4ESRA 3H0HA 1S1NA 5FU7B 2PNIA 2PUKB 5GAOl 2YRCA 2LP5A 1RAFB 4E47A 3VS4A 1D1AA 3H6ZA 3CXCA 2EJ9A 1QMCA 2OTJT 3TEEA 4Q5WA 2EQIA 3C94A 4PJOD 2CSIA 2HL3A 4J6YA 2JUFA 3OYJA 4NL2A 3JB9I 4F17A 2LC4A 1Y71A 5LJ3g 2MIOA 4N0AA 5GAMg 2CYZB 1D3BB 3OYHA 2FYKA 3OS2A 1PCXA 1EFNA 4XU2A 1EIFA 1A0NB 2HD0A 1KQ2A 2DBKA 1HYOA 1MMNA 2QQRA 4ATOA 1C6VX 2K5LA 1I5LA 5HY6A 2P0PA 1NJIC 5GAN7 2VXEA 3GLXA 2JNGA 1QP2A 2EQMA 1PRMC 5GANf 3C0CA 3LX7A 3GNFB 1WLPB 1IRXA 1W2BA 4M78D 2CT3A 3QSUA 4FYYB 4C5IA 4MMKA 2KR3A 2E4HA 5GANe 2K6DA 4GBQA 2MYSA 2FHDA 4ME7A 4LDVA 2DAQA 2F2XA 2LCCA 5KE3A 1X43A 1VQMT 3CCRT 1HSQA 3PMTA 1RI0A 1QVGS 1PKTA 1WHGA 1Y96A 5L23A 3OBWA 4M75C 1YN8A 1KFZA 4Z88A 4C92D 3A8OB 1ACMB 2VGMA 3CCJA 3L2WA 1UG1A 2J6OA 2CGHA 2O2OA 2L89A 1K73C 5FRMA 2E10A 4JDSA 4HXJA 4VUBA 2X35A 5GJVB 1V1CA 1NJIR 3BDUA 2QAZA 3A5ZB 1ZX6A 4M7AD 4J7FA 4OF1A 3OYAA 2ROTA 4HVVA 3RR6A 2M51A 3FJ5A 1M2VA 1F1BB 1WYXA 1VYVA 4FYXB 2LQNA 1CKAA 2IIMA 1E6GA 1SPKA 2MWOA 3JCMg 3JSCA 1MMDA 3RIRA 2JS0A 4AFSC 2HBWA 3RKWA 1BIAA 4OB2B 2KGTA 1KIKA 1ZBXA 3CCMT 5KYYA 1IGQA 2YUPA 4XTWA 4J9GA 3H0IA 2HQXA 3M4GA 2LT4A 3QBYA 3I35A 5EC7A 4MZMA 3OYLA 3L2QA 1LCKA 4JRQA 1W2BP 1QCNA 3QPHA 4JZ4A 1YJ9T 1QP3A 3QXEB 1QLYA 2L3QA 2ENMA 1MGQA 1M1FA 1IREB 3HPWA 1K73R 3JCMP 4RG8A 2YWWA 1MMAA 1NM7A 4BACA 1JB0E 2E64A 4PJOA 1WJRA 2ZPFB 1T3LA 3CPWA 3G1JA 2PTKA 3L42A 4AFUC 4ZTFA 3HRTA 3NFCA 4RTVA 1ZSGA 2M9UA 4BY6C 2MAMA 2FZKB 5I2MA 2AIRB 1P92A 3CCMA 3CD6T 2LJ0A 4MDWA 5AYFA 1JU5C 3LGLA 1X2QA 3OY9A 3PT9A 3O8VA 1OYXA 1YJ9A 1BI1A 2RNAA 3SD4A 2GBQA 2A0FB 2E12A 1I1JA 5CK9A 1ZUUA 2CZ6B 1CSKA 3EFOA 3L2UA 3CCJQ 1NE8A 2XICA 3G6ET 4E7ZA 3CCUT 2D8HA 1YITT 3LWHA 2EFIA 3QZ5B 1IZ6A 2FZCB 4RCBA 4M78A 2RK2A 5I11A 4ZGJB 2KYMA 4OGCA 3MEWA 2CT4A 2C06A 2DTIA 4DEYA 3X28B 3CD6A 4PNOA 1UGPB 1BU1A 1AEYA 2XK0A 4EMKA 4RTXA 2XDDA 4M7DB 4LE9A 2LNVA 4PK4A 4C92A 2EVRA 3PVQA 3V8JA 1K4US 4DBQA 1OI1A 4PJOG 2GQVA 1GFDA 4DBRA 2RD1A 3RERA 1W2BS 3CPWP 2DXBA 2DEQA 3EHQA 2EYYA 3CCQA 4M77F 3CCUA 4Y28E 4GLMA 1D0YA 2YHTA 1YITA 1GFCA 2BUDA 3VYHB 2X3WD 5GMKl 4ZGDB 1X2KA 4MMLA 4M7AA 1UTIA 4PL6A 1JBMA 4C8QF 4OB0B 5KYUB 1QWFA 2ATCB 1W70A 2EGAA 2KY9A 4MZPA 1X01A 2E1HA 1ZHIA 2LX9A 3CCET 1AZGB 2DILA 2DIQA 2JM8A 2K2VA 3VU3C 1YJNT 3P8HA 2DIGA 2L8DA 1U5SA 3BW1A 1VQ7T 1XJWB 4DEXA 1FYNA 4M78G 3CCMQ 5ECAA 2DJQA 1K1ZA 4FSXA 2K57A 1ZSZB 1TWBA 4N4IA 4IIOA 4GLKA 1WDXA 2QDYB 1Q82C 1H3ZA 1PD0A 2K79A 3CC2A 1RI9A 4JLIA 4F7UB 1YJ9Q 3VS3A 2K2MA 4D6WA 4LD6A 4PFOA 4N0AC 1T3SA 1AOJA 3EFRA 1U1SA 4C92G 2KT1A 1VQ5A 4QW2A 1V29B 4RTTA 2HQHA 4HCZA 2AKLA 3H41A 2RI3A 3VUBA 4XTVA 1WIEA 3OYYA 5GAN5 2HL5C 1PHTA 4L5GA 3EAEA 3CD6Q 4V2SA 2V8KA 3CPWS 4HT9A 3RUXA 2ROLA 2DYBA 3OYEA 3D7SB 2ZPGB 3UPUA 2M02A 2PU9B 3M0TA 4KRTA 3FC3A 4M7DD 1Q82R 1G2BA 5HKCA 2JXBA 3CCQQ 2OI3A 3HP9A 3M59A 3CCUQ 4XU3A 4E7JA 1YITQ 5A0DA 1BBZA 2KE9A 1UUEA 1PSFA 1W1FA 1AWWA 4M77D 1XNIA 3M4YA 2GTOA 3M55A 3PGGA 4ANJA 2IPOB 3NMZC 2Y4XA 2O31A 2LQKA 4C8QD 4HKEA 5LJ5h 4XTUA 1JJ2A 2C0IA 3C95A 2K7AA 1VA7A 1Y07A 4PFPA 3WVEB 5GAMd 2RQRA 3J81E 1KC8U 4A53A 5I2SA 2J06A 4OVAA 4PJOF 2F1LA 4BI3A 1M1KC 2LDMA 1JQQA 2KYBA 1OZ2A 1QCOA 3LYIA 3H9NA 3UT1A 4XQ3A 2QQ9A 3CBOA 2L2PA 3CC2Q 2L5QA 2O4XB 4J83A 1M9SA 4XTYA 3NPFA 5LL6S 2AKKA 3LW5E 3VRYA 5IHIA 2RMOA 2KEAA 2M0OA 4FU6A 3M5AA 4AFZC 5KYXB 2NUTB 1VQ5Q 2KRMA 3A8HB 3CBPA 2QGFB 1NG2A 3QZ9B 3AHUA 4IUUA 1Q81C 3MKDA 3TREA 5LJ3h 4OMOA 1ZLMA 2HSPA 5GAMh 1KQ1A 1GRIA 2LX7A 5IAYA 2DD5A 4M78F 1BB9A 2JTEA 4PLLA 2O88A 1TSFA 5IXBA 3BY7A 2GNCA 1DJ7B 2YRVA 3JCMV 3GIBA 2LRQA 1M1KR 2QGGA 2L3RA 1GBQA 4RCCA 1B3QA 1JJ2P 1S72A 1GCQA 5FU6C 3WXMB 2L0AA 1MV3A 1XTDA 4DOWA 2OAUA 2LJ3A 1IXDA 1UDLA 4AG2C 5GAN6 2KDSA 2RQTA 4PJOE 1QKXA 1I4K1 4A4HA 3G7ZA 3GBQA 1QQJA 4HCKA 5AT1B 2VC8A 3JCMd 2RJEA 1UECA 2F5KA 2COWA 5GMKe 2EGCA 3QDRB 1VOMA 3OW2A 1UEBA 2JT4A 5CKDA 1Q81R 4HCCA 1YWPA 1OEBA 2WACA 3QJYA 3VV0A 4QQGA 4DBHA 3MEVA 1KHCA 2LCSA 1PC0A 1YIJT 2MK5A 1KG1A 3ASKA 4EMKC 4RG2A 3PMIA 4C0DC 4C92C 2ZPBB 2P4TA 3KBGA 2JJ9A 1D0ZA 1SG5A 2X3XD 2CP3A 3M0PA 1D1CA 2DKGA 4M77A 3OS5A 2EYWA 4QQDA 3INZA 3FIFA 3EG1A 1WJSA 4QT7A 5LJ5f 1I0CA 1NLPC 4C8QA 2MI6A 2DETA 4M78E 4M4ZA 4A4FA 2XG8D 1LJOA 1G83A 1K8AU 4M7AC 2CDTA 1WHMA 2EGEA 2M16A 2KNBB 2VASA 4LNPA 2DX1A 3M0SA 2EYXA 5CAIA 2L3PA 2LT1A 5GAN3 1G8XA 3LH0A 3V7SA 2DXCA 2RN8A 3CCJT 1K0SA 1YIJA 1N5ZA 3QKJA 4C92E 3GP8A 2HQEA 2FO0A 1WXUA 1SF9A 4EMGA 2AZSA 4PFZA 2G6FX 1JJ2S 2GF7A 1N8RU 1O9SA 4E6RA 1H3HA 1AHJB 3E2UA 3TU4K 3CC4A 2DF6A 2MWPA 1K9MC 3NTKA 3OW2P 2O9VA 1R77A 1R0BG 4M75B 2JTFA 2DE0X 1S72Q 2F5TX 3E19A 4M7AE 3VYGA 4M7DG 1AT1B 2BE7D 4PLIA 4AT1B 2YRDA 5LJ3f 1IHVA 2D6FA 1ZBJA 2RHIA 5GAMf 3SWNC 3EGDA 3CXCP 1ABOA 4B9WA 2EQJA 2HKNA 2K5IA 4J8OA 2XMFA 5GAOp 2J6KA 2DD4A 4M77G 2A28A 2G3RA 2H8HA 4R56A 2P84A 2A3LA 1D0XA 4C8QG 1Q81U 1WZOA 4BDZA 2YUQA 4YTLA 1YFNA 2EJGA 1WI7A 3LH5A 2EQUA 5C0MA 1VQOT 3HFOA 1E7OA 2YLCA 1WXTA 4RTYA 4ELZC 3REBB 3CCSA 2C0OA 4LDYA 1UGRB 1MUZA 1K9MR 4CC7A 2H3JA 1GBRA 2DEUA 2HAXA 2GTJA 3N5BB 4II1A 4J9HA 2J05A 4XK8E 4ZNXA 4KH1B 2E6NA 1PRLC 2LQ8A 2XKOC 3OYIA 1PWTA 1WPYA 1XOVA 2XU8A 3RBBB 3ZL7C 3X20B 4F7UG 1YP5A 1AVZC 1WXBA 2YXYA 2XI9A 5GMKj 2EBPA 1G3YA 4PKCC 2FB7A 3QUIA 4FYVB 4E7HA 1RAIB 1OX8A 3BFMA 4IIMA 4BY6B 1VQOA 1I8FA 3G71T 4X1VA 1YIJQ 4A4EA 1W4SA 3HRSA 2DVJA 3A8GB 3OMGA 1PD1A 2KMTA 3C4SA 3NTHA 2CP6A 2CUDA 1KD1C 9ATCB 3EGXB 3CC4Q 4XTXA 3EH1A 3GNGA 3UATA 4QVZA 3PNWC 5A0GA 1BI2A 2DL3A 2NLUA 3CXCS 2K3BA 2OJ2A 3EG9A 1QWEA 2NUTA 1G3WA 2DTHA 6AT1B 4C5GA 2CZ7B 4WTOB 2ECZA 2LCLA 3E9GA 3VS2A 3QJ6A 2LZ6B 4KGVB 2JMAA 2RI5A 1M3AA 3I55Q 4JRKA 3G71A 4KUDK 2EYZA 2R58A 3JAME 4LUDA 3CCQT 1M30A 3SFMA 1WHLA 2A08A 3M56A 3NHNA 2EJFA 1TS9A 2WSCE 1NJIU 2QASA 1C1AA 3JCMW 1RL2A 2NUPB 1RAEB 1M8VA 1KD1R 4B9XA 3CCSQ 3OS0A 3KUFA 4M7DF 2K3XA 2NUZA 5GANj 2EQKA 2ABLA 2ZPEB 1UB4A 4FT2A 3M54A 1YNZA 3ME9A 3MPUB 1TUDA 5A0LA 3J7AF 4OMMA 2KXDA 1UJYA 3X24B 2KROA 3F70A 1X6GA 2E3HA 3R6OA 4KH0B 2EKOA 3CC2T 2BE9B 3OYKA 1LVKA 2OTLT 3X26B 7AT1B 2QEXT 1RUWA 2WSEE 4PJLA 1Z9QA 1YHQA 4PJNA 1TH7A 2A7YA 2RJFA 1K73U 1VQOQ 1VQ5T 4C0FA 4OB1B 4J7IA 2FVUA 4IUVA 2K9GA 4E2FB 2DBMA 2XHCA 5HK0A 2LJ1A 2D1XA 1I5OB 5CKHA 5J39A 2QQBA 1FMKA 1VQPA 4OGEA 3RMQA 1KHIA 1TOVA 5CO7A 3CCVA 3QIIA 3OB9A 4M77C 3LLRA 2CH4A 1D3BA 2EWNA 4C8QC 3GOXA 4F7UF 1HXDA 2BKDN 1LPLA 1WA7A 2OTLA 2DERA 2M0YA 4HVUA 4BE2A 2QEXA 1SRLA 1Y57A 2JS2A 2JTMA 2X4XA 4J9CA 3M58A 2V8IA 3G71Q 4M7DE 5DLOA 2QTVA 3S6WA 3SEMA 4ELYC 1WQWA 4BUGA 4CRIA 1M1GA 3G4ST 3EG0A 1B34B 4J5YA 4AMCA 2I2LA 2KT8A 1WNLA 4JRPA 1WHJA 3BDLA 5KYNA 3RMSA 4EIKA 2YLBA 2E6ZA 2XDPA 1XQHA 2C0TA 4ZN1A 2OAWA 5DY9A 2FZGB 2RO0A 2E65A 4M77E 2YUNA 4KGXB 5J3BA 4JRIA 4BE1A 4LD9K 5GAOm 3U23A 4C8QE 1RAAB 2PUOB 1NEGA 4DBFA 3HL8A 2IG0A 3PIOA 1Y96B 4QKUA 3QDFA 5D6YA 3QO3A 4O6JA 3OYDA 1QW1A 4CC4B 1YCYA 4HVWA 2H3EB 1FMWA 3UWNA 1VQ8A 8AT1B 3I56A 2HSEB 1X6BA 2F2VA 3G4SA 1IGUA 3L1AA 3RNJA 1YWOA 1SHFA 3DLLA 1N9RA 2K4YA 2JW4A 2EW3A 5CCAA 4LN2A 1WGSA 4FSSA 3H8ZA 1M2VB 5HK3A 3M57A 1YHQQ 3V7CA 5EG2A 2FL7A 4F7UE 2RQUA 2B8AA 2DPPB 3M0UA 4F14A 5GANd 3SDZA 1LOJA 1N27A 3DKMA 4FL6A 3IQLA 5IHKA 3HFNA 3JV3A 5GAN8 1VQPQ 1GCPA 2R5AA 2DNUA 3CCVQ 2E5QA 4AG1C 4MZTA 4RMOA 2YUOA 1M90C 1D09B 1M8MA 3NGPA 3OA6A 3CC7T 4M75G 1I81A 5IH2A 2OTLQ 1WJQA 4BI8B 2QEXQ 1S72T 3M9QA 2AHJB 4FW1A 2VXFA 1VUBA 2RPNA 3AT1B 1B07A 2QYZA 3UDCA 1PNJA 1IHWA 4OB3B 5HCKA 1QVGA 3MEUA 1AZEA 2PVGB 4Z89A 3DB3A 1N6AA 5D6XA 4DOVA 1YCSB 5CVIA 5GAOn 2VV5A 4TVRA 2R57A 4C5EA 4PJOC 2YDLA 4BE0A 2HNIA 2V1RA 2O9SA 4JS5A 5FU6B 1TUCA 3EG2A 1VQNT 1LNXA 4J9EA 5C6SA 4MDXA 4XU1A 4JJNK 2O01E 1U06A 1Q7YC 3CC7A 2RQVA 1VQLA 3EFOB 4J9IA 3THKA 5KE2A 4IUTA 4OMLA 5GAN4 1OPLA 1M90R 5FLXE 1VQ8Q 3VS5A 4F04B 1SEMA 3JCMb 1Q82U 4J9DA 1M27C 3I56Q 2JOYA 3L2VA 1UJ0A 2DL5A 4NOYA 1OPKA 3G4SQ 2Z0WA 1NZ9A 1NEBA 1UHFA 2YSQA 2DL4A 1QVPA 2ZZDA 4QVCA 2E70A 4QVDA 1AWJA 5CQYA 1RLPC 3VS7A 1VQ9Q 2V1QA 3CBMA 1M4ZA 2F2WA 4M78C 4EMKB 4A4GA 3OS1A 2GFUA 3RKYA 1VQNA 2QA4T 4C0DB 4C0GA 4C92B 4JUVA 1NLOC 2GQIA 4OMQA 4M7DA 3HSBA 2RHXA 2RM4A 2R5MA 2DMOA 2FPEA 1RAGB 2PVDB 2W0ZA 3PIPA 3EG3A 2FRWA 1BYMA 2DL7A 1IB8A 2DVEA 1NYGA 1Q7YR 4XAXB 1M3CA 4JJDA 4M7AB 4EMHA 4BDYA 3HHTB 3TVTA 3C12A 2QTXA 1VQ4Q 1HJDA 3CC4T 1VYTA 2RF0A 1VYUA 2F69A 4KBMB 3OSVA 1SRMA 4R0KA 5KYUA 3A1PA 1VQKT 3FDRA 1E6HA 5DLQE 1WX6A 3CMAQ 1MHNA 4KT0E 2KQWA 3ER0A 5GANg 3A98A 5FU7C 5LJ5e 3A8LB 3JCMh 4XTZA 2QA4A 4RTUA 2EYQA 2K3YA 2ZCFB 2SEMA 1PKSA 1YI2Q 4BI4A 1M3BA 3QWYA 5FROA 1RACB 3I55T 1T0JA 3CCLQ 4EDUA 1FWZA 4XU0A 2RB6A 2RH2A 1CKBA 2B86A 3JCMJ 2GGRA 4X34A 1ZSZA 1UGSB 2XDBA 2RK1A 3OMCA 2FG0A 2E41A 3JB9J 3S3MA 4IURA 1HK9A 3CC7Q 4FW2A 4F7UA 3SWNB 4M75F 1VQLQ 2LVMA 1M1KU 3RDVA 1VQKA 1TTHB 2D9TA 3SB2A 1M90U 5FWCA 4RTZA 2VB6A 3CCST 3FJPA 1O75A 3LWIA 2QK0A 1OULA 1B34A 3FRNA 2OTJA 2PQWA 4ORZA 3TCJA 1U3OA 4ZTJA 1ZA2B 4UC4A 2DO3A 3VJPA 1MV0B 3DB4A 2IVWA 3I55A 2W10A 3CPFA 1RLQC 5LJ3e 2MF2A 1AWXA 1OU8A 2VYTA 1H92A 3P8DA 1BK2A 5CQXA 5GMKm 5GAMe 1YJWT 4EPCA 4QQ6A 2COYA 1OX9A 4JPBW 5DM7R 2NWMA 1VQNQ 2DRMA 2QXFA 1SHGA 4J9BA 1G3TA 2VKNA 3NTIA 5IXFA 1ZA1B 2FPFA 4Y92A 5CKBA 5CKEA 2DM1A 4E7KA 2QG9B 5J26A 2Y4YA 3X25B 2LQWA 1PSEA 4ZN3A 4FT4A 1Q7YU 2KRSA 3CQTA 2PZ1A 3UF4A 3VRZA 1W6XA 1ZQ1A 3BE3A 1QCFA 1OOTA 2DXUA 1WHKA 2KVQG 5CKFA 2AT1B 4JLGA 3I5SA 2FPDA 3MCAB 3QWXX 4PJMA 2HDAA 4O5VA 4BD3A 2DXTA 2EKHA 1YJWA 3EGUA 2BTTA 1VQMA 3CCRA 4KUIA 2QA4Q 4M75E 1RAHB 3V8LA 1NPPA 2EIFA 2ZAEA 3REAB 1TUGB 3MJXA 2J7IA 4JZ3A 3QYHB 3GPLA 1PG5B 3HKSA 2DZCA 3M0RA 3OW2S 1RABB 2JMCA 3MP6A 4F16A 1TG0A 1C0MA 2Y90A 3TSZA 4RUGA 4D8KA 1WHHA 2O4XA 4HT8A 4RTWA 3JCMf 1OV3A 1VQKQ 2WSFE 3JB9G 1OZ3A 2GFAA 4R55A 5FRNA 3RKXA 5KYXA 4M75D 3JCMe 1R8OB 2OTJQ 4FCYA 1M2OA 3FLGA 2QQSA 3V8KA 5LJ5j 1JXOA 4LDUA 1X6OA 1KJWA 3VS6A 1B7TA 3TQ7P 1KSWA 3HRUA 4GY5A 2DA9A 3JCMQ 5KYWB 1U1TA 2P0QA 2RJCA 1X69A 3E1SA 3OYBA 2CP7A 4A63B 5D7UA 2MPXC 4E7SA 3MEAA 2EAYA 4JJBA 5KH6A 3V7RA 1YHQT 5KCHA 2X4JA 5CR2A 2D0QB 1X27A 2JZ2A 2DZ9A 1QVFA 1UFFA 2CZ1B 5I22A 3EHRA 3OYMA 2DL8A 2X4YA 4BB7A 1K9MU 1GCQC 1VQ6T 1VQPT 2V8JA 1KC8C 2A37A 3CCVT 3UA7A 2LNHB 4P5NA 4J6WA 4J9FA 1YJWQ 2MOXA 1HD3A 5LJ3j 1BKBA 3PFSA 2KK4A 1VQMQ 2YT6A 1KQSA 2RA2A 4N4HA 3CCRQ 4D8DA 5I21A 1NYFA 2VGNA 5GAMj 1ZUKA 2DFUA 8ATCB 1EX4A 3MO8A 3LGFA 5IHNA 4ZGEB 2BZ8A 1NBEB 1SKUB 2CP0A 4JJCA 1BCMA 1PM3A 3G6EA 4M7DC 4J6XA 2PVOB 4M77B 4Z8AA 1ZUYA 2AK5A 1JXMA 1WFWA 4C8QB 1Y0MA 1VQ6A 1ARKA 3EFSA 4CI0C 3OQ5A 4FIBA 4PJJA 1MMGA 2MMPA 1K76A 2X4WA 2P0KA 3RESA 4E7LA 2D8JA 2VWFA 5FWBA 4LUEA 3OYGA 2L3SA 3MHXA 3CEYA 3JCMc 1KC8R 2I0NA 1QKWA 1GXIE 5CIUA 1QVFP 3TSWA 3L2RA 2KAFA 2KBTA 1VQ8T 2BZXA
chains in the Genus database with same CATH topology
2HQEA 5CVIA 2M9UA 3I56T 1U8RA 4BY6C 5GAOn 4E7IA 2MAMA 2VV5A 4TVRA 2R57A 4EMGA 4C5EA 4PJOC 2DTOA 3QG1A 1Q86C 5I2MA 4BE0A 1P92A 1JJ2S 2HNIA 2GF7A 2RJDA 3CCMA 5GAN2 1N8RU 4HCBA 3CD6T 1O9SA 3QYGB 4JS5A 1BI3A 4MDWA 1AHJB 5FU6B 3TU4K 3CC4A 2MWPA 1BIBA 2GCXA 3VUZA 1K9MC 1VQNT 3NTKA 5AYFA 1LNXA 5C6SA 1VQ9T 3LGLA 4M75B 4MDXA 3OY9A 4XU1A 3SWNA 1H641 2JTFA 3PT9A 5GAOr 4JJNK 2O01E 3O8VA 1OYXA 2JN0A 4M75A 1BI1A 2F5TX 3E19A 3SD4A 3ZFJA 3VYGA 2E12A 4C0ZA 3CC7A 1Q7YC 4M7AE 4M7DG 1VIFA 3CCEA 5CK9A 1VQLA 2ZPHB 2CZ6B 1KD1U 4PLIA 5KE2A 4IUTA 5LJ3f 3JB9F 5GAN4 2D6FA 3OSSC 2RHIA 5A2QE 3L2UA 4IUPA 5FLXE 5GAMf 1YJNA 1NE8A 2XICA 3SWNC 3G6ET 3JCMb 1Q82U 4FM4B 3CCUT 4WF2A 5LJ5d 2JOYA 3L2VA 1YITT 4NOYA 3LWHA 2EFIA 3QZ5B 1VQ7A 3MP1A 4B9WA 1IZ6A 4RCBA 5IN1A 2EQJA 1NZ9A 2K5IA 4J8OA 4M78A 5GMKh 5GAOp 3JRZA 2DD4A 2RK2A 4M77G 4M7AG 1QVPA 2ZPIB 2DK3A 4ZGJB 2G3RA 2ZZDA 3OBYA 4R56A 3GF5A 4QVCA 4OGCA 1FXXA 2A3LA 2E70A 2RHYA 4QVDA 3MEWA 5CQYA 4C8QG 1Q81U 2C06A 1M5Q1 4BDZA 1VQ4T 1YBYA 2DJZA 2DTIA 4X9CA 4YTLA 3X28B 3CBMA 1M4ZA 4KULA 3CD6A 4M78C 2EJGA 5D6WA 4PNOA 1Y7XA 2EQUA 1UGPB 4A4GA 4EMKB 3OS1A 2GFUA 4HA8A 3RKYA 1VQNA 5C0MA 2XK0A 2QA4T 3HFOA 1VQOT 4C0DB 4C0GA 1G3SA 4C92B 4EMKA 2XDDA 1VQ9A 3CMAT 4M7DB 4JUVA 2YLCA 2LNVA 4C92A 1VIEA 4M7DA 3OYCA 3CMEA 3V8JA 4ELZC 1OI1A 4PJOG 3HSBA 2GQVA 3CCSA 2RD1A 3RERA 4LDYA 1W2BS 1K8AC 3MP8A 1UGRB 2JVVA 2RHXA 2RM4A 2R5MA 2K5FA 2DXBA 1SSFA 1YI2T 2PVDB 3PIPA 3P8BB 2RHUA 2DEQA 3DLMA 2H3JA 1BYMA 2LTOA 2DVEA 2HAXA 4IKFA 3CCQA 3N5BB 4II1A 4M77F 4XAXB 4XK8E 3CCUA 2E6NA 4Y28E 3CCLT 3Q1JA 2LQ8A 2XKOC 2YHTA 4N4GA 4M7AB 2BUDA 3VYHB 4DQ2A 5GMKl 1YITA 4ZGDB 4EMHA 4MMLA 3HHTB 4BDYA 3C12A 2QTXA 3OYIA 4M7AA 4PL6A 1WPYA 1JBMA 1XOVA 2XU8A 4C8QF 3CC4T 2F69A 4KBMB 4OB0B 3X20B 3OSVA 4NL3A 3E9FA 1QVFS 2KY9A 4F7UG 3JCMX 4MZPA 5LJ3d 5IT9E 1VQKT 3FDRA 5DLQE 3FEOA 2XI9A 5GMKj 1X01A 3JB9H 2E1HA 1ZHIA 1G3YA 1VQ4A 1MHNA 3S3NA 2LX9A 4KT0E 2KQWA 4PKCC 2M1HA 3CCET 2FB7A 3ER0A 3QUIA 5GANg 4JS4A 4E7HA 1VQLT 1N8RC 2DIQA 2K2VA 5FU7C 3BFMA 3T9NA 5KCOA 3A8LB 3JCMh 4XTZA 4BY6B 1JRIA 5LJ5e 1VQOA 1I8FA 2QA4A 2EYQA 3G71T 2K3YA 2ZCFB 4A54A 4PJOB 3FB9A 3CMAA 3VU3C 1YJNT 3P8HA 4A4EA 3WVDB 1W4SA 4BI4A 1UGQB 2DIGA 2L8DA 2RI2A 2XIDA 3BW1A 3HRSA 5FROA 3A8GB 3I55T 3OMGA 1VQ7T 2KMTA 3C4SA 1YJ9A 3NTHA 3OYNA 4C92E 2KSSA 4M78G 4EDUA 1KD1C 1YI2A 1KQSS 1FWZA 4XU0A 2RB6A 2RH2A 4OMFB 4FSXA 3VKIA 4LDWA 2K57A 4N4IA 4XTXA 3JCMJ 4GLKA 4L6V5 4X34A 1UGSB 4LDXA 3GNGA 2QDYB 1Q82C 3CCLA 1H3ZA 4QVZA 3CC2A 2XDBA 3PNWC 5A0GA 5GANh 1BI2A 3S3OA 2RK1A 3OMCA 4JLIA 2E41A 4F7UB 3JB9J 3S3MA 2NLUA 4IURA 1HK9A 3CXCS 4F7UA 3SWNB 1NPRA 4M75F 4D6WA 2LVMA 4LD6A 1G3WA 1M1KU 4Y91A 4N0AC 1VQKA 2DTHA 4C5GA 2CZ7B 2CKKA 1U1SA 2D9TA 3EFRA 2LCLA 3SB2A 4C92G 5GAOq 1M90U 1VQ5A 3E9GA 3CCST 4QW2A 3FJPA 3QJ6A 4A4KA 3URGA 1O75A 2CS7A 1V29B 2RI5A 3LWIA 5GMKi 3FRNA 1B34A 3JB9D 2OTJA 2PQWA 3TCJA 4HCZA 4JRKA 1BI0A 3G71A 4ZTJA 4KUDK 4UC4A 2R58A 3JAME 2DO3A 3VJPA 3CCQT 2QQAA 2RHZA 3SFMA 3DB4A 3META 2IVWA 4M78B 3I55A 2RI3A 3CPFA 1N9SA 3VUBA 3M56A 4IUQA 4XTVA 3PTAA 5LJ3e 1FX7A 4C5HA 2EJFA 2MF2A 2VYTA 3P8DA 3OYYA 4RKUE 5CQXA 3QHSA 2BIVA 5GAN5 5GMKm 5GAMe 1YJWT 4EPCA 2WSCE 4L5GA 3EAEA 4V2SA 4QQ6A 2V8KA 4L59A 3CPWS 5DM7R 1NJIU 4HT9A 3RUXA 2VUBA 3JCMW 1RL2A 5L8RE 2QXFA 3OYEA 1G3TA 2ZPGB 1Q86U 3NTIA 4NS5A 3J80E 3UPUA 2PU9B 2XD0A 1M8VA 3ZBDA 3L2ZA 4B9XA 3OS0A 4C92F 3KUFA 3FC3A 4DA4A 5CKBA 4M7DD 4M7DF 5CKEA 2K3XA 5LJ5g 4X9DA 4E7KA 5GANj 5J26A 2Y4YA 2EQKA 3X25B 2ZPEB 4FT2A 1UB4A 3ZEHA 1PSEA 3M54A 4ZN3A 3KXTA 2ZGWA 3ME9A 2CZ0B 5HKCA 1G5VA 5A0LA 3HP9A 4FT4A 3M59A 1Q7YU 4XU3A 4E7JA 3A8MB 5A0DA 3J7AF 1ZQ1A 1X75C 3X24B 1PSFA 4Z02A 3M53A 3OYFA 5M9OA 2QI2A 1WQ7A 2DXUA 3F70A 4M7AF 2HBPA 1XNIA 3M4YA 4M77D 4OP0A 2KVQG 3M55A 3R6OA 5CKFA 2EKOA 3CC2T 3PGGA 4JLGA 5FU7B 3MCAB 3OYKA 2PUKB 4O5VA 2Y4XA 4BD3A 2DXTA 2LQKA 5GAOl 3X26B 2OTLT 4C8QD 4HKEA 1YJWA 2QEXT 4E47A 5LJ5h 4XTUA 1JJ2A 2WSEE 1YHQA 1VQMA 1TH7A 2A7YA 2RJFA 3CCRA 1K73U 3H6ZA 4KUIA 3C95A 4M75E 1Y07A 3CXCA 3WVEB 5GAMd 3V8LA 1NPPA 3J81E 1KC8U 2EIFA 1VQ5T 4A53A 4C0FA 5I2SA 2EJ9A 4OB1B 4J7IA 2FVUA 4OVAA 4IUVA 3QYHB 2XHCA 4Q5WA 3TEEA 5HK0A 2OTJT 4PJOF 3C94A 5CKHA 3GPLA 4PJOD 4BI3A 4J6YA 2QQBA 5J39A 1M1KC 3HKSA 2LDMA 2DZCA 1OZ2A 1VQPA 4OGEA 3OW2S 3LYIA 3RMQA 1KHIA 2JUFA 3MP6A 3UT1A 3OYJA 4XQ3A 4NL2A 5CO7A 3JB9I 3CCVA 2LC4A 2QQ9A 1Y71A 2Y90A 3QIIA 3CBOA 5LJ3g 2L5QA 2O4XB 4J83A 3OB9A 4M77C 1M9SA 4XTYA 4N0AA 5GAMg 2O4XA 2CYZB 1D3BB 3OYHA 4HT8A 3JCMf 3LLRA 5LL6S 3LW5E 2FYKA 1D3BA 3OS2A 2EWNA 4C8QC 2M0OA 4XU2A 3GOXA 2WSFE 1EIFA 1HXDA 2BKDN 4F7UF 3JB9G 1OZ3A 3M5AA 4FU6A 2GFAA 4R55A 2OTLA 2HD0A 1KQ2A 4BE2A 5FRNA 2QEXA 3RKXA 2QQRA 3A8HB 3CBPA 4ATOA 2K5LA 1I5LA 4M75D 3JCMe 1R8OB 2X4XA 2JTMA 5HY6A 3QZ9B 3AHUA 4IUUA 2P0PA 1NJIC 3M58A 2V8IA 5GAN7 3GP8A 3FLGA 4M7DE 2QQSA 2VXEA 5DLOA 1Q81C 3V8KA 3GLXA 3S6WA 4ELYC 2JNGA 1WQWA 4BUGA 4CRIA 3TREA 1QP2A 1M1GA 3G4ST 5LJ5j 1B34B 4LDUA 1X6OA 2EQMA 5LJ3h 4J5YA 2I2LA 1WNLA 4JRPA 3BDLA 5GANf 3LX7A 5GAMh 3GNFB 3RMSA 1KQ1A 2YLBA 2E6ZA 2XDPA 1XQHA 3HRUA 1W2BA 4GY5A 5IAYA 2DD5A 4M78F 4M78D 3JCMQ 3QSUA 1U1TA 2P0QA 4PLLA 4ZN1A 5DY9A 4C5IA 2RJCA 4MMKA 2RO0A 2E65A 3E1SA 4M77E 3BY7A 5GANe 1DJ7B 2YRVA 3JCMV 3OYBA 3GIBA 2FHDA 2LRQA 5J3BA 3MEAA 4ME7A 2EAYA 4JRIA 4LDVA 2DAQA 2LCCA 5KH6A 4BE1A 3V7RA 5KE3A 5GAOm 1YHQT 4LD9K 1VQMT 2L3RA 2X4JA 5KCHA 4C8QE 4RCCA 3CCRT 2PUOB 3HL8A 3PMTA 1S72A 1RI0A 2IG0A 5FU6C 3WXMB 3PIOA 1QVGS 1Y96B 5CR2A 1XTDA 2D0QB 4DOWA 2JZ2A 2DZ9A 1Y96A 5D6YA 3OBWA 2OAUA 3QO3A 4M75C 4O6JA 1QVFA 2CZ1B 1QW1A 3OYDA 3OYMA 1YCYA 4C92D 3A8OB 2X4YA 2VGMA 5GAN6 4BB7A 3CCJA 3UWNA 2KDSA 3L2WA 1VQ8A 1K9MU 2CGHA 2L89A 1K73C 5FRMA 1VQ6T 4PJOE 3I56A 1I4K1 4A4HA 3G7ZA 1VQPT 2V8JA 2E10A 4JDSA 3G4SA 1KC8C 2VC8A 3JCMd 3L1AA 2RJEA 3CCVT 4VUBA 2X35A 2F5KA 3DLLA 5GMKe 1N9RA 2K4YA 3QDRB 4P5NA 3OW2A 1UEBA 5CCAA 4J6WA 1WGSA 3BDUA 5CKDA 3A5ZB 3H8ZA 5LJ3j 4HCCA 5HK3A 4M7AD 3M57A 1BKBA 4J7FA 3PFSA 4OF1A 2KK4A 3OYAA 1KQSA 2RA2A 4N4HA 5I21A 5GAMj 2VGNA 2WACA 3V7CA 5EG2A 3QJYA 3VV0A 2FL7A 3MO8A 4QQGA 3LGFA 3MEVA 4F7UE 4ZGEB 2B8AA 1KHCA 2DPPB 1YIJT 2MWOA 5GANd 3JCMg 1KG1A 3ASKA 3JSCA 4EMKC 4RG2A 3PMIA 3SDZA 1LOJA 1N27A 3DKMA 4FL6A 3RIRA 4C0DC 4C92C 3G6EA 3RKWA 1BIAA 3CMET 2ZPBB 4M7DC 3HFNA 4J6XA 5GAN8 2P4TA 3KBGA 2PVOB 4OB2B 4M77B 1ZBXA 2R5AA 3CCMT 2DKGA 4M77A 3OS5A 2E5QA 4XTWA 4QQDA 3INZA 2HQXA 3M4GA 2LT4A 3QBYA 3FIFA 4MZTA 4C8QB 4RMOA 1VQ6A 1WJSA 4MZMA 5LJ5f 3OYLA 3EFSA 3L2QA 4C8QA 4CI0C 4JRQA 3OQ5A 4FIBA 1M90C 2MI6A 2MMPA 3QPHA 1YJ9T 4M78E 2X4WA 1QP3A 3QXEB 3OA6A 2P0KA 4M75G 3CC7T 4A4FA 2XG8D 1LJOA 1K8AU 1I81A 3RESA 4E7LA 1MGQA 4M7AC 1M1FA 1IREB 3HPWA 1WJQA 3MHXA 4BI8B 3OYGA 3JCMP 4RG8A 3CEYA 3JCMc 2M16A 1S72T 3M9QA 4DOVA 4BACA 2AHJB 1JB0E 1GXIE 2E64A 4PJOA 2VXFA 5CIUA 1VUBA 1WJRA 2ZPFB 5CAIA 2LT1A 3CPWA 5GAN3 3UDCA 3L2RA 3L42A 3LH0A 4OB3B 1QVGA 3V7SA 2DXCA 3CCJT 4ZTFA 2KAFA 3HRTA 3MEUA 3NFCA 1YIJA 1VQ8T 2PVGB 3QKJA 3DB3A 1N6AA 5D6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELY C;  5CQY A;  2C06 A;  3JSC A;  4VUB A;  2VUB A;  1X75 C;  1M1F A;  3HPW A;  3TCJ A;  5CR2 A;  5CCA A;  1NE8 A;  5HK0 A;  5CKD A;  5CKH A;  5HK3 A;  4OF1 A;  5CKF A;  5CKB A;  1VUB A;  5CKE A;  3VUB A;  4MDX A;  4MZT A;  3JRZ A;  2MF2 A;  4HKE A;  4MZM A;  4ELZ C;  2KMT A;  1UB4 A;  5CQX A;  3NFC A;  4MZP A;  5HKC A;  3G7Z A;  5CO7 A;  4ME7 A;  5CK9 A;  5DLO A; 
#chains in the Genus database with same CATH topology
 3I56 T;  1U8R A;  1T0H A;  4E7I A;  1V76 A;  2DTO A;  3QG1 A;  1Q86 C;  2RJD A;  5GAN 2;  4HCB A;  1K0X A;  3QYG B;  2V26 A;  4OMN A;  1BI3 A;  1BIB A;  2GCX A;  3VUZ A;  3VS1 A;  1VQ9 T;  2DYI A;  3SWN A;  1H64 1;  5GAO r;  2JM9 A;  3O5Z A;  4M75 A;  1ZSZ C;  2FRY A;  2JN0 A;  1MND A;  2KRN A;  3ZFJ A;  3CME T;  1KQS P;  4C0Z A;  2HEQ A;  1VIF A;  3CCE A;  3EH2 A;  2ZPH B;  1KD1 U;  3JB9 F;  2FEI A;  2EPD A;  3I5R A;  3OSS C;  3EGD B;  5A2Q E;  4IUP A;  1YJN A;  1KK7 A;  2HCK A;  2HKQ B;  4FM4 B;  4AFQ C;  4WF2 A;  5LJ5 d;  1AWO A;  2P4R A;  1VQ7 A;  3MP1 A;  3M0Q A;  5IN1 A;  5GMK h;  2CUB A;  3JRZ A;  4M7A G;  3SHW A;  2ZPI B;  2DK3 A;  3OBY A;  1UHC A;  3GF5 A;  1FXX A;  1TXQ A;  1K9A A;  2J6F A;  2RHY A;  1TU0 B;  3VS0 A;  5GJW B;  1M5Q 1;  1VQ4 T;  1YBY A;  2DJZ A;  3HTR A;  4X9C A;  2AZV A;  4FYW B;  2KI7 A;  4KUL A;  5D6W A;  1Y7X A;  2CP2 A;  4HA8 A;  1Q95 G;  3PVL A;  2KXC A;  1G3S A;  1VQ9 A;  3CMA T;  1Q86 R;  1VIE A;  3OYC A;  3CME A;  3G6E Q;  1I07 A;  1K8A C;  3MP8 A;  2JVV A;  2K5F A;  1SSF A;  1UGV A;  1YI2 T;  2QDL A;  3P8B B;  2RHU A;  3DLM A;  2LTO A;  4IKF A;  1GL5 A;  2MCN A;  4OMP A;  1VQ6 Q;  5KYY B;  3CCL T;  3Q1J A;  4N4G A;  2SRC A;  4DQ2 A;  1OU9 A;  1JO8 A;  4NL3 A;  3E9F A;  1QVF S;  3JCM X;  2ESW A;  5LJ3 d;  5IT9 E;  2X9H A;  3FEO A;  3JB9 H;  1MNE A;  1VQ4 A;  1EZZ B;  3S3N A;  2M1H A;  4JS4 A;  1VQL T;  1N8R C;  2E5K A;  5KCO A;  3T9N A;  1JRI A;  1H8K A;  4A54 A;  2ED1 A;  3FB9 A;  3CMA A;  4PJO B;  2X51 A;  3WVD B;  1UGQ B;  2RI2 A;  2XID A;  4KGZ B;  3R6N A;  2A36 A;  1FMV A;  3OYN A;  1R0C B;  2ED0 A;  2KSS A;  3PE0 A;  1YI2 A;  1KQS S;  4OMF B;  3VKI A;  4LDW A;  3ULR B;  2CSQ A;  3EGX A;  4L6V 5;  2DLP A;  4WCI A;  4LDX A;  3CCL A;  1K8A R;  5GAN h;  1J3T A;  3S3O A;  2CH4 W;  3UA6 A;  3EG9 B;  2CP5 A;  3CCE Q;  1NPR A;  2CRE A;  4Y91 A;  1AD5 A;  2CKK A;  5GAO q;  3I9Q A;  1YJN Q;  4A4K A;  3URG A;  2CS7 A;  5GMK i;  1BCO A;  3JB9 D;  1VQ7 Q;  1D1B A;  2DRK A;  1BI0 A;  1OQK A;  5FW9 A;  1SSH A;  2QQA A;  1RAD B;  2D0N A;  2RHZ A;  3MET A;  4M78 B;  4B6M A;  1N9S A;  4IUQ A;  3PTA A;  4CC2 A;  5KYW A;  4LXC A;  1N8R R;  1FX7 A;  2OX7 A;  4C5H A;  4RKU E;  3QHS A;  2BIV A;  2LMJ A;  2E3I A;  4L59 A;  2HZY A;  2VUB A;  5L8R E;  3H0F A;  1Q86 U;  2VVK A;  4NS5 A;  3J80 E;  3CME Q;  2XD0 A;  3ZBD A;  2RQW A;  3L2Z A;  2NUP A;  4C92 F;  1JEG A;  4DA4 A;  2NYS A;  2COZ A;  5LJ5 g;  1Z9Z A;  4X9D A;  1ABQ A;  3ZEH A;  3KXT A;  2ZGW A;  2BZY A;  2CZ0 B;  2HMA A;  1G5V A;  1UE9 A;  1IO6 A;  3A8M B;  4CC3 A;  1QVG P;  1X75 C;  4K11 A;  3M53 A;  4Z02 A;  3OYF A;  5M9O A;  2QI2 A;  1WQ7 A;  3KFV A;  4M7A F;  2HBP A;  4OP0 A;  4ESR A;  3H0H A;  1S1N A;  5FU7 B;  2PNI A;  2PUK B;  5GAO l;  2YRC A;  2LP5 A;  1RAF B;  4E47 A;  3VS4 A;  1D1A A;  3H6Z A;  3CXC A;  2EJ9 A;  1QMC A;  2OTJ T;  3TEE A;  4Q5W A;  2EQI A;  3C94 A;  4PJO D;  2CSI A;  2HL3 A;  4J6Y A;  2JUF A;  3OYJ A;  4NL2 A;  3JB9 I;  4F17 A;  2LC4 A;  1Y71 A;  5LJ3 g;  2MIO A;  4N0A A;  5GAM g;  2CYZ B;  1D3B B;  3OYH A;  2FYK A;  3OS2 A;  1PCX A;  1EFN A;  4XU2 A;  1EIF A;  1A0N B;  2HD0 A;  1KQ2 A;  2DBK A;  1HYO A;  1MMN A;  2QQR A;  4ATO A;  1C6V X;  2K5L A;  1I5L A;  5HY6 A;  2P0P A;  1NJI C;  5GAN 7;  2VXE A;  3GLX A;  2JNG A;  1QP2 A;  2EQM A;  1PRM C;  5GAN f;  3C0C A;  3LX7 A;  3GNF B;  1WLP B;  1IRX A;  1W2B A;  4M78 D;  2CT3 A;  3QSU A;  4FYY B;  4C5I A;  4MMK A;  2KR3 A;  2E4H A;  5GAN e;  2K6D A;  4GBQ A;  2MYS A;  2FHD A;  4ME7 A;  4LDV A;  2DAQ A;  2F2X A;  2LCC A;  5KE3 A;  1X43 A;  1VQM T;  3CCR T;  1HSQ A;  3PMT A;  1RI0 A;  1QVG S;  1PKT A;  1WHG A;  1Y96 A;  5L23 A;  3OBW A;  4M75 C;  1YN8 A;  1KFZ A;  4Z88 A;  4C92 D;  3A8O B;  1ACM B;  2VGM A;  3CCJ A;  3L2W A;  1UG1 A;  2J6O A;  2CGH A;  2O2O A;  2L89 A;  1K73 C;  5FRM A;  2E10 A;  4JDS A;  4HXJ A;  4VUB A;  2X35 A;  5GJV B;  1V1C A;  1NJI R;  3BDU A;  2QAZ A;  3A5Z B;  1ZX6 A;  4M7A D;  4J7F A;  4OF1 A;  3OYA A;  2ROT A;  4HVV A;  3RR6 A;  2M51 A;  3FJ5 A;  1M2V A;  1F1B B;  1WYX A;  1VYV A;  4FYX B;  2LQN A;  1CKA A;  2IIM A;  1E6G A;  1SPK A;  2MWO A;  3JCM g;  3JSC A;  1MMD A;  3RIR A;  2JS0 A;  4AFS C;  2HBW A;  3RKW A;  1BIA A;  4OB2 B;  2KGT A;  1KIK A;  1ZBX A;  3CCM T;  5KYY A;  1IGQ A;  2YUP A;  4XTW A;  4J9G A;  3H0I A;  2HQX A;  3M4G A;  2LT4 A;  3QBY A;  3I35 A;  5EC7 A;  4MZM A;  3OYL A;  3L2Q A;  1LCK A;  4JRQ A;  1W2B P;  1QCN A;  3QPH A;  4JZ4 A;  1YJ9 T;  1QP3 A;  3QXE B;  1QLY A;  2L3Q A;  2ENM A;  1MGQ A;  1M1F A;  1IRE B;  3HPW A;  1K73 R;  3JCM P;  4RG8 A;  2YWW A;  1MMA A;  1NM7 A;  4BAC A;  1JB0 E;  2E64 A;  4PJO A;  1WJR A;  2ZPF B;  1T3L A;  3CPW A;  3G1J A;  2PTK A;  3L42 A;  4AFU C;  4ZTF A;  3HRT A;  3NFC A;  4RTV A;  1ZSG A;  2M9U A;  4BY6 C;  2MAM A;  2FZK B;  5I2M A;  2AIR B;  1P92 A;  3CCM A;  3CD6 T;  2LJ0 A;  4MDW A;  5AYF A;  1JU5 C;  3LGL A;  1X2Q A;  3OY9 A;  3PT9 A;  3O8V A;  1OYX A;  1YJ9 A;  1BI1 A;  2RNA A;  3SD4 A;  2GBQ A;  2A0F B;  2E12 A;  1I1J A;  5CK9 A;  1ZUU A;  2CZ6 B;  1CSK A;  3EFO A;  3L2U A;  3CCJ Q;  1NE8 A;  2XIC A;  3G6E T;  4E7Z A;  3CCU T;  2D8H A;  1YIT T;  3LWH A;  2EFI A;  3QZ5 B;  1IZ6 A;  2FZC B;  4RCB A;  4M78 A;  2RK2 A;  5I11 A;  4ZGJ B;  2KYM A;  4OGC A;  3MEW A;  2CT4 A;  2C06 A;  2DTI A;  4DEY A;  3X28 B;  3CD6 A;  4PNO A;  1UGP B;  1BU1 A;  1AEY A;  2XK0 A;  4EMK A;  4RTX A;  2XDD A;  4M7D B;  4LE9 A;  2LNV A;  4PK4 A;  4C92 A;  2EVR A;  3PVQ A;  3V8J A;  1K4U S;  4DBQ A;  1OI1 A;  4PJO G;  2GQV A;  1GFD A;  4DBR A;  2RD1 A;  3RER A;  1W2B S;  3CPW P;  2DXB A;  2DEQ A;  3EHQ A;  2EYY A;  3CCQ A;  4M77 F;  3CCU A;  4Y28 E;  4GLM A;  1D0Y A;  2YHT A;  1YIT A;  1GFC A;  2BUD A;  3VYH B;  2X3W D;  5GMK l;  4ZGD B;  1X2K A;  4MML A;  4M7A A;  1UTI A;  4PL6 A;  1JBM A;  4C8Q F;  4OB0 B;  5KYU B;  1QWF A;  2ATC B;  1W70 A;  2EGA A;  2KY9 A;  4MZP A;  1X01 A;  2E1H A;  1ZHI A;  2LX9 A;  3CCE T;  1AZG B;  2DIL A;  2DIQ A;  2JM8 A;  2K2V A;  3VU3 C;  1YJN T;  3P8H A;  2DIG A;  2L8D A;  1U5S A;  3BW1 A;  1VQ7 T;  1XJW B;  4DEX A;  1FYN A;  4M78 G;  3CCM Q;  5ECA A;  2DJQ A;  1K1Z A;  4FSX A;  2K57 A;  1ZSZ B;  1TWB A;  4N4I A;  4IIO A;  4GLK A;  1WDX A;  2QDY B;  1Q82 C;  1H3Z A;  1PD0 A;  2K79 A;  3CC2 A;  1RI9 A;  4JLI A;  4F7U B;  1YJ9 Q;  3VS3 A;  2K2M A;  4D6W A;  4LD6 A;  4PFO A;  4N0A C;  1T3S A;  1AOJ A;  3EFR A;  1U1S A;  4C92 G;  2KT1 A;  1VQ5 A;  4QW2 A;  1V29 B;  4RTT A;  2HQH A;  4HCZ A;  2AKL A;  3H41 A;  2RI3 A;  3VUB A;  4XTV A;  1WIE A;  3OYY A;  5GAN 5;  2HL5 C;  1PHT A;  4L5G A;  3EAE A;  3CD6 Q;  4V2S A;  2V8K A;  3CPW S;  4HT9 A;  3RUX A;  2ROL A;  2DYB A;  3OYE A;  3D7S B;  2ZPG B;  3UPU A;  2M02 A;  2PU9 B;  3M0T A;  4KRT A;  3FC3 A;  4M7D D;  1Q82 R;  1G2B A;  5HKC A;  2JXB A;  3CCQ Q;  2OI3 A;  3HP9 A;  3M59 A;  3CCU Q;  4XU3 A;  4E7J A;  1YIT Q;  5A0D A;  1BBZ A;  2KE9 A;  1UUE A;  1PSF A;  1W1F A;  1AWW A;  4M77 D;  1XNI A;  3M4Y A;  2GTO A;  3M55 A;  3PGG A;  4ANJ A;  2IPO B;  3NMZ C;  2Y4X A;  2O31 A;  2LQK A;  4C8Q D;  4HKE A;  5LJ5 h;  4XTU A;  1JJ2 A;  2C0I A;  3C95 A;  2K7A A;  1VA7 A;  1Y07 A;  4PFP A;  3WVE B;  5GAM d;  2RQR A;  3J81 E;  1KC8 U;  4A53 A;  5I2S A;  2J06 A;  4OVA A;  4PJO F;  2F1L A;  4BI3 A;  1M1K C;  2LDM A;  1JQQ A;  2KYB A;  1OZ2 A;  1QCO A;  3LYI A;  3H9N A;  3UT1 A;  4XQ3 A;  2QQ9 A;  3CBO A;  2L2P A;  3CC2 Q;  2L5Q A;  2O4X B;  4J83 A;  1M9S A;  4XTY A;  3NPF A;  5LL6 S;  2AKK A;  3LW5 E;  3VRY A;  5IHI A;  2RMO A;  2KEA A;  2M0O A;  4FU6 A;  3M5A A;  4AFZ C;  5KYX B;  2NUT B;  1VQ5 Q;  2KRM A;  3A8H B;  3CBP A;  2QGF B;  1NG2 A;  3QZ9 B;  3AHU A;  4IUU A;  1Q81 C;  3MKD A;  3TRE A;  5LJ3 h;  4OMO A;  1ZLM A;  2HSP A;  5GAM h;  1KQ1 A;  1GRI A;  2LX7 A;  5IAY A;  2DD5 A;  4M78 F;  1BB9 A;  2JTE A;  4PLL A;  2O88 A;  1TSF A;  5IXB A;  3BY7 A;  2GNC A;  1DJ7 B;  2YRV A;  3JCM V;  3GIB A;  2LRQ A;  1M1K R;  2QGG A;  2L3R A;  1GBQ A;  4RCC A;  1B3Q A;  1JJ2 P;  1S72 A;  1GCQ A;  5FU6 C;  3WXM B;  2L0A A;  1MV3 A;  1XTD A;  4DOW A;  2OAU A;  2LJ3 A;  1IXD A;  1UDL A;  4AG2 C;  5GAN 6;  2KDS A;  2RQT A;  4PJO E;  1QKX A;  1I4K 1;  4A4H A;  3G7Z A;  3GBQ A;  1QQJ A;  4HCK A;  5AT1 B;  2VC8 A;  3JCM d;  2RJE A;  1UEC A;  2F5K A;  2COW A;  5GMK e;  2EGC A;  3QDR B;  1VOM A;  3OW2 A;  1UEB A;  2JT4 A;  5CKD A;  1Q81 R;  4HCC A;  1YWP A;  1OEB A;  2WAC A;  3QJY A;  3VV0 A;  4QQG A;  4DBH A;  3MEV A;  1KHC A;  2LCS A;  1PC0 A;  1YIJ T;  2MK5 A;  1KG1 A;  3ASK A;  4EMK C;  4RG2 A;  3PMI A;  4C0D C;  4C92 C;  2ZPB B;  2P4T A;  3KBG A;  2JJ9 A;  1D0Z A;  1SG5 A;  2X3X D;  2CP3 A;  3M0P A;  1D1C A;  2DKG A;  4M77 A;  3OS5 A;  2EYW A;  4QQD A;  3INZ A;  3FIF A;  3EG1 A;  1WJS A;  4QT7 A;  5LJ5 f;  1I0C A;  1NLP C;  4C8Q A;  2MI6 A;  2DET A;  4M78 E;  4M4Z A;  4A4F A;  2XG8 D;  1LJO A;  1G83 A;  1K8A U;  4M7A C;  2CDT A;  1WHM A;  2EGE A;  2M16 A;  2KNB B;  2VAS A;  4LNP A;  2DX1 A;  3M0S A;  2EYX A;  5CAI A;  2L3P A;  2LT1 A;  5GAN 3;  1G8X A;  3LH0 A;  3V7S A;  2DXC A;  2RN8 A;  3CCJ T;  1K0S A;  1YIJ A;  1N5Z A;  3QKJ A;  4C92 E;  3GP8 A;  2HQE A;  2FO0 A;  1WXU A;  1SF9 A;  4EMG A;  2AZS A;  4PFZ A;  2G6F X;  1JJ2 S;  2GF7 A;  1N8R U;  1O9S A;  4E6R A;  1H3H A;  1AHJ B;  3E2U A;  3TU4 K;  3CC4 A;  2DF6 A;  2MWP A;  1K9M C;  3NTK A;  3OW2 P;  2O9V A;  1R77 A;  1R0B G;  4M75 B;  2JTF A;  2DE0 X;  1S72 Q;  2F5T X;  3E19 A;  4M7A E;  3VYG A;  4M7D G;  1AT1 B;  2BE7 D;  4PLI A;  4AT1 B;  2YRD A;  5LJ3 f;  1IHV A;  2D6F A;  1ZBJ A;  2RHI A;  5GAM f;  3SWN C;  3EGD A;  3CXC P;  1ABO A;  4B9W A;  2EQJ A;  2HKN A;  2K5I A;  4J8O A;  2XMF A;  5GAO p;  2J6K A;  2DD4 A;  4M77 G;  2A28 A;  2G3R A;  2H8H A;  4R56 A;  2P84 A;  2A3L A;  1D0X A;  4C8Q G;  1Q81 U;  1WZO A;  4BDZ A;  2YUQ A;  4YTL A;  1YFN A;  2EJG A;  1WI7 A;  3LH5 A;  2EQU A;  5C0M A;  1VQO T;  3HFO A;  1E7O A;  2YLC A;  1WXT A;  4RTY A;  4ELZ C;  3REB B;  3CCS A;  2C0O A;  4LDY A;  1UGR B;  1MUZ A;  1K9M R;  4CC7 A;  2H3J A;  1GBR A;  2DEU A;  2HAX A;  2GTJ A;  3N5B B;  4II1 A;  4J9H A;  2J05 A;  4XK8 E;  4ZNX A;  4KH1 B;  2E6N A;  1PRL C;  2LQ8 A;  2XKO C;  3OYI A;  1PWT A;  1WPY A;  1XOV A;  2XU8 A;  3RBB B;  3ZL7 C;  3X20 B;  4F7U G;  1YP5 A;  1AVZ C;  1WXB A;  2YXY A;  2XI9 A;  5GMK j;  2EBP A;  1G3Y A;  4PKC C;  2FB7 A;  3QUI A;  4FYV B;  4E7H A;  1RAI B;  1OX8 A;  3BFM A;  4IIM A;  4BY6 B;  1VQO A;  1I8F A;  3G71 T;  4X1V A;  1YIJ Q;  4A4E A;  1W4S A;  3HRS A;  2DVJ A;  3A8G B;  3OMG A;  1PD1 A;  2KMT A;  3C4S A;  3NTH A;  2CP6 A;  2CUD A;  1KD1 C;  9ATC B;  3EGX B;  3CC4 Q;  4XTX A;  3EH1 A;  3GNG A;  3UAT A;  4QVZ A;  3PNW C;  5A0G A;  1BI2 A;  2DL3 A;  2NLU A;  3CXC S;  2K3B A;  2OJ2 A;  3EG9 A;  1QWE A;  2NUT A;  1G3W A;  2DTH A;  6AT1 B;  4C5G A;  2CZ7 B;  4WTO B;  2ECZ A;  2LCL A;  3E9G A;  3VS2 A;  3QJ6 A;  2LZ6 B;  4KGV B;  2JMA A;  2RI5 A;  1M3A A;  3I55 Q;  4JRK A;  3G71 A;  4KUD K;  2EYZ A;  2R58 A;  3JAM E;  4LUD A;  3CCQ T;  1M30 A;  3SFM A;  1WHL A;  2A08 A;  3M56 A;  3NHN A;  2EJF A;  1TS9 A;  2WSC E;  1NJI U;  2QAS A;  1C1A A;  3JCM W;  1RL2 A;  2NUP B;  1RAE B;  1M8V A;  1KD1 R;  4B9X A;  3CCS Q;  3OS0 A;  3KUF A;  4M7D F;  2K3X A;  2NUZ A;  5GAN j;  2EQK A;  2ABL A;  2ZPE B;  1UB4 A;  4FT2 A;  3M54 A;  1YNZ A;  3ME9 A;  3MPU B;  1TUD A;  5A0L A;  3J7A F;  4OMM A;  2KXD A;  1UJY A;  3X24 B;  2KRO A;  3F70 A;  1X6G A;  2E3H A;  3R6O A;  4KH0 B;  2EKO A;  3CC2 T;  2BE9 B;  3OYK A;  1LVK A;  2OTL T;  3X26 B;  7AT1 B;  2QEX T;  1RUW A;  2WSE E;  4PJL A;  1Z9Q A;  1YHQ A;  4PJN A;  1TH7 A;  2A7Y A;  2RJF A;  1K73 U;  1VQO Q;  1VQ5 T;  4C0F A;  4OB1 B;  4J7I A;  2FVU A;  4IUV A;  2K9G A;  4E2F B;  2DBM A;  2XHC A;  5HK0 A;  2LJ1 A;  2D1X A;  1I5O B;  5CKH A;  5J39 A;  2QQB A;  1FMK A;  1VQP A;  4OGE A;  3RMQ A;  1KHI A;  1TOV A;  5CO7 A;  3CCV A;  3QII A;  3OB9 A;  4M77 C;  3LLR A;  2CH4 A;  1D3B A;  2EWN A;  4C8Q C;  3GOX A;  4F7U F;  1HXD A;  2BKD N;  1LPL A;  1WA7 A;  2OTL A;  2DER A;  2M0Y A;  4HVU A;  4BE2 A;  2QEX A;  1SRL A;  1Y57 A;  2JS2 A;  2JTM A;  2X4X A;  4J9C A;  3M58 A;  2V8I A;  3G71 Q;  4M7D E;  5DLO A;  2QTV A;  3S6W A;  3SEM A;  4ELY C;  1WQW A;  4BUG A;  4CRI A;  1M1G A;  3G4S T;  3EG0 A;  1B34 B;  4J5Y A;  4AMC A;  2I2L A;  2KT8 A;  1WNL A;  4JRP A;  1WHJ A;  3BDL A;  5KYN A;  3RMS A;  4EIK A;  2YLB A;  2E6Z A;  2XDP A;  1XQH A;  2C0T A;  4ZN1 A;  2OAW A;  5DY9 A;  2FZG B;  2RO0 A;  2E65 A;  4M77 E;  2YUN A;  4KGX B;  5J3B A;  4JRI A;  4BE1 A;  4LD9 K;  5GAO m;  3U23 A;  4C8Q E;  1RAA B;  2PUO B;  1NEG A;  4DBF A;  3HL8 A;  2IG0 A;  3PIO A;  1Y96 B;  4QKU A;  3QDF A;  5D6Y A;  3QO3 A;  4O6J A;  3OYD A;  1QW1 A;  4CC4 B;  1YCY A;  4HVW A;  2H3E B;  1FMW A;  3UWN A;  1VQ8 A;  8AT1 B;  3I56 A;  2HSE B;  1X6B A;  2F2V A;  3G4S A;  1IGU A;  3L1A A;  3RNJ A;  1YWO A;  1SHF A;  3DLL A;  1N9R A;  2K4Y A;  2JW4 A;  2EW3 A;  5CCA A;  4LN2 A;  1WGS A;  4FSS A;  3H8Z A;  1M2V B;  5HK3 A;  3M57 A;  1YHQ Q;  3V7C A;  5EG2 A;  2FL7 A;  4F7U E;  2RQU A;  2B8A A;  2DPP B;  3M0U A;  4F14 A;  5GAN d;  3SDZ A;  1LOJ A;  1N27 A;  3DKM A;  4FL6 A;  3IQL A;  5IHK A;  3HFN A;  3JV3 A;  5GAN 8;  1VQP Q;  1GCP A;  2R5A A;  2DNU A;  3CCV Q;  2E5Q A;  4AG1 C;  4MZT A;  4RMO A;  2YUO A;  1M90 C;  1D09 B;  1M8M A;  3NGP A;  3OA6 A;  3CC7 T;  4M75 G;  1I81 A;  5IH2 A;  2OTL Q;  1WJQ A;  4BI8 B;  2QEX Q;  1S72 T;  3M9Q A;  2AHJ B;  4FW1 A;  2VXF A;  1VUB A;  2RPN A;  3AT1 B;  1B07 A;  2QYZ A;  3UDC A;  1PNJ A;  1IHW A;  4OB3 B;  5HCK A;  1QVG A;  3MEU A;  1AZE A;  2PVG B;  4Z89 A;  3DB3 A;  1N6A A;  5D6X A;  4DOV A;  1YCS B;  5CVI A;  5GAO n;  2VV5 A;  4TVR A;  2R57 A;  4C5E A;  4PJO C;  2YDL A;  4BE0 A;  2HNI A;  2V1R A;  2O9S A;  4JS5 A;  5FU6 B;  1TUC A;  3EG2 A;  1VQN T;  1LNX A;  4J9E A;  5C6S A;  4MDX A;  4XU1 A;  4JJN K;  2O01 E;  1U06 A;  1Q7Y C;  3CC7 A;  2RQV A;  1VQL A;  3EFO B;  4J9I A;  3THK A;  5KE2 A;  4IUT A;  4OML A;  5GAN 4;  1OPL A;  1M90 R;  5FLX E;  1VQ8 Q;  3VS5 A;  4F04 B;  1SEM A;  3JCM b;  1Q82 U;  4J9D A;  1M27 C;  3I56 Q;  2JOY A;  3L2V A;  1UJ0 A;  2DL5 A;  4NOY A;  1OPK A;  3G4S Q;  2Z0W A;  1NZ9 A;  1NEB A;  1UHF A;  2YSQ A;  2DL4 A;  1QVP A;  2ZZD A;  4QVC A;  2E70 A;  4QVD A;  1AWJ A;  5CQY A;  1RLP C;  3VS7 A;  1VQ9 Q;  2V1Q A;  3CBM A;  1M4Z A;  2F2W A;  4M78 C;  4EMK B;  4A4G A;  3OS1 A;  2GFU A;  3RKY A;  1VQN A;  2QA4 T;  4C0D B;  4C0G A;  4C92 B;  4JUV A;  1NLO C;  2GQI A;  4OMQ A;  4M7D A;  3HSB A;  2RHX A;  2RM4 A;  2R5M A;  2DMO A;  2FPE A;  1RAG B;  2PVD B;  2W0Z A;  3PIP A;  3EG3 A;  2FRW A;  1BYM A;  2DL7 A;  1IB8 A;  2DVE A;  1NYG A;  1Q7Y R;  4XAX B;  1M3C A;  4JJD A;  4M7A B;  4EMH A;  4BDY A;  3HHT B;  3TVT A;  3C12 A;  2QTX A;  1VQ4 Q;  1HJD A;  3CC4 T;  1VYT A;  2RF0 A;  1VYU A;  2F69 A;  4KBM B;  3OSV A;  1SRM A;  4R0K A;  5KYU A;  3A1P A;  1VQK T;  3FDR A;  1E6H A;  5DLQ E;  1WX6 A;  3CMA Q;  1MHN A;  4KT0 E;  2KQW A;  3ER0 A;  5GAN g;  3A98 A;  5FU7 C;  5LJ5 e;  3A8L B;  3JCM h;  4XTZ A;  2QA4 A;  4RTU A;  2EYQ A;  2K3Y A;  2ZCF B;  2SEM A;  1PKS A;  1YI2 Q;  4BI4 A;  1M3B A;  3QWY A;  5FRO A;  1RAC B;  3I55 T;  1T0J A;  3CCL Q;  4EDU A;  1FWZ A;  4XU0 A;  2RB6 A;  2RH2 A;  1CKB A;  2B86 A;  3JCM J;  2GGR A;  4X34 A;  1ZSZ A;  1UGS B;  2XDB A;  2RK1 A;  3OMC A;  2FG0 A;  2E41 A;  3JB9 J;  3S3M A;  4IUR A;  1HK9 A;  3CC7 Q;  4FW2 A;  4F7U A;  3SWN B;  4M75 F;  1VQL Q;  2LVM A;  1M1K U;  3RDV A;  1VQK A;  1TTH B;  2D9T A;  3SB2 A;  1M90 U;  5FWC A;  4RTZ A;  2VB6 A;  3CCS T;  3FJP A;  1O75 A;  3LWI A;  2QK0 A;  1OUL A;  1B34 A;  3FRN A;  2OTJ A;  2PQW A;  4ORZ A;  3TCJ A;  1U3O A;  4ZTJ A;  1ZA2 B;  4UC4 A;  2DO3 A;  3VJP A;  1MV0 B;  3DB4 A;  2IVW A;  3I55 A;  2W10 A;  3CPF A;  1RLQ C;  5LJ3 e;  2MF2 A;  1AWX A;  1OU8 A;  2VYT A;  1H92 A;  3P8D A;  1BK2 A;  5CQX A;  5GMK m;  5GAM e;  1YJW T;  4EPC A;  4QQ6 A;  2COY A;  1OX9 A;  4JPB W;  5DM7 R;  2NWM A;  1VQN Q;  2DRM A;  2QXF A;  1SHG A;  4J9B A;  1G3T A;  2VKN A;  3NTI A;  5IXF A;  1ZA1 B;  2FPF A;  4Y92 A;  5CKB A;  5CKE A;  2DM1 A;  4E7K A;  2QG9 B;  5J26 A;  2Y4Y A;  3X25 B;  2LQW A;  1PSE A;  4ZN3 A;  4FT4 A;  1Q7Y U;  2KRS A;  3CQT A;  2PZ1 A;  3UF4 A;  3VRZ A;  1W6X A;  1ZQ1 A;  3BE3 A;  1QCF A;  1OOT A;  2DXU A;  1WHK A;  2KVQ G;  5CKF A;  2AT1 B;  4JLG A;  3I5S A;  2FPD A;  3MCA B;  3QWX X;  4PJM A;  2HDA A;  4O5V A;  4BD3 A;  2DXT A;  2EKH A;  1YJW A;  3EGU A;  2BTT A;  1VQM A;  3CCR A;  4KUI A;  2QA4 Q;  4M75 E;  1RAH B;  3V8L A;  1NPP A;  2EIF A;  2ZAE A;  3REA B;  1TUG B;  3MJX A;  2J7I A;  4JZ3 A;  3QYH B;  3GPL A;  1PG5 B;  3HKS A;  2DZC A;  3M0R A;  3OW2 S;  1RAB B;  2JMC A;  3MP6 A;  4F16 A;  1TG0 A;  1C0M A;  2Y90 A;  3TSZ A;  4RUG A;  4D8K A;  1WHH A;  2O4X A;  4HT8 A;  4RTW A;  3JCM f;  1OV3 A;  1VQK Q;  2WSF E;  3JB9 G;  1OZ3 A;  2GFA A;  4R55 A;  5FRN A;  3RKX A;  5KYX A;  4M75 D;  3JCM e;  1R8O B;  2OTJ Q;  4FCY A;  1M2O A;  3FLG A;  2QQS A;  3V8K A;  5LJ5 j;  1JXO A;  4LDU A;  1X6O A;  1KJW A;  3VS6 A;  1B7T A;  3TQ7 P;  1KSW A;  3HRU A;  4GY5 A;  2DA9 A;  3JCM Q;  5KYW B;  1U1T A;  2P0Q A;  2RJC A;  1X69 A;  3E1S A;  3OYB A;  2CP7 A;  4A63 B;  5D7U A;  2MPX C;  4E7S A;  3MEA A;  2EAY A;  4JJB A;  5KH6 A;  3V7R A;  1YHQ T;  5KCH A;  2X4J A;  5CR2 A;  2D0Q B;  1X27 A;  2JZ2 A;  2DZ9 A;  1QVF A;  1UFF A;  2CZ1 B;  5I22 A;  3EHR A;  3OYM A;  2DL8 A;  2X4Y A;  4BB7 A;  1K9M U;  1GCQ C;  1VQ6 T;  1VQP T;  2V8J A;  1KC8 C;  2A37 A;  3CCV T;  3UA7 A;  2LNH B;  4P5N A;  4J6W A;  4J9F A;  1YJW Q;  2MOX A;  1HD3 A;  5LJ3 j;  1BKB A;  3PFS A;  2KK4 A;  1VQM Q;  2YT6 A;  1KQS A;  2RA2 A;  4N4H A;  3CCR Q;  4D8D A;  5I21 A;  1NYF A;  2VGN A;  5GAM j;  1ZUK A;  2DFU A;  8ATC B;  1EX4 A;  3MO8 A;  3LGF A;  5IHN A;  4ZGE B;  2BZ8 A;  1NBE B;  1SKU B;  2CP0 A;  4JJC A;  1BCM A;  1PM3 A;  3G6E A;  4M7D C;  4J6X A;  2PVO B;  4M77 B;  4Z8A A;  1ZUY A;  2AK5 A;  1JXM A;  1WFW A;  4C8Q B;  1Y0M A;  1VQ6 A;  1ARK A;  3EFS A;  4CI0 C;  3OQ5 A;  4FIB A;  4PJJ A;  1MMG A;  2MMP A;  1K76 A;  2X4W A;  2P0K A;  3RES A;  4E7L A;  2D8J A;  2VWF A;  5FWB A;  4LUE A;  3OYG A;  2L3S A;  3MHX A;  3CEY A;  3JCM c;  1KC8 R;  2I0N A;  1QKW A;  1GXI E;  5CIU A;  1QVF P;  3TSW A;  3L2R A;  2KAF A;  2KBT A;  1VQ8 T;  2BZX A; 
#chains in the Genus database with same CATH homology
 2HQE A;  5CVI A;  2M9U A;  3I56 T;  1U8R A;  4BY6 C;  5GAO n;  4E7I A;  2MAM A;  2VV5 A;  4TVR A;  2R57 A;  4EMG A;  4C5E A;  4PJO C;  2DTO A;  3QG1 A;  1Q86 C;  5I2M A;  4BE0 A;  1P92 A;  1JJ2 S;  2HNI A;  2GF7 A;  2RJD A;  3CCM A;  5GAN 2;  1N8R U;  4HCB A;  3CD6 T;  1O9S A;  3QYG B;  4JS5 A;  1BI3 A;  4MDW A;  1AHJ B;  5FU6 B;  3TU4 K;  3CC4 A;  2MWP A;  1BIB A;  2GCX A;  3VUZ A;  1K9M C;  1VQN T;  3NTK A;  5AYF A;  1LNX A;  5C6S A;  1VQ9 T;  3LGL A;  4M75 B;  4MDX A;  3OY9 A;  4XU1 A;  3SWN A;  1H64 1;  2JTF A;  3PT9 A;  5GAO r;  4JJN K;  2O01 E;  3O8V A;  1OYX A;  2JN0 A;  4M75 A;  1BI1 A;  2F5T X;  3E19 A;  3SD4 A;  3ZFJ A;  3VYG A;  2E12 A;  4C0Z A;  3CC7 A;  1Q7Y C;  4M7A E;  4M7D G;  1VIF A;  3CCE A;  5CK9 A;  1VQL A;  2ZPH B;  2CZ6 B;  1KD1 U;  4PLI A;  5KE2 A;  4IUT A;  5LJ3 f;  3JB9 F;  5GAN 4;  2D6F A;  3OSS C;  2RHI A;  5A2Q E;  3L2U A;  4IUP A;  5FLX E;  5GAM f;  1YJN A;  1NE8 A;  2XIC A;  3SWN C;  3G6E T;  3JCM b;  1Q82 U;  4FM4 B;  3CCU T;  4WF2 A;  5LJ5 d;  2JOY A;  3L2V A;  1YIT T;  4NOY A;  3LWH A;  2EFI A;  3QZ5 B;  1VQ7 A;  3MP1 A;  4B9W A;  1IZ6 A;  4RCB A;  5IN1 A;  2EQJ A;  1NZ9 A;  2K5I A;  4J8O A;  4M78 A;  5GMK h;  5GAO p;  3JRZ A;  2DD4 A;  2RK2 A;  4M77 G;  4M7A G;  1QVP A;  2ZPI B;  2DK3 A;  4ZGJ B;  2G3R A;  2ZZD A;  3OBY A;  4R56 A;  3GF5 A;  4QVC A;  4OGC A;  1FXX A;  2A3L A;  2E70 A;  2RHY A;  4QVD A;  3MEW A;  5CQY A;  4C8Q G;  1Q81 U;  2C06 A;  1M5Q 1;  4BDZ A;  1VQ4 T;  1YBY A;  2DJZ A;  2DTI A;  4X9C A;  4YTL A;  3X28 B;  3CBM A;  1M4Z A;  4KUL A;  3CD6 A;  4M78 C;  2EJG A;  5D6W A;  4PNO A;  1Y7X A;  2EQU A;  1UGP B;  4A4G A;  4EMK B;  3OS1 A;  2GFU A;  4HA8 A;  3RKY A;  1VQN A;  5C0M A;  2XK0 A;  2QA4 T;  3HFO A;  1VQO T;  4C0D B;  4C0G A;  1G3S A;  4C92 B;  4EMK A;  2XDD A;  1VQ9 A;  3CMA T;  4M7D B;  4JUV A;  2YLC A;  2LNV A;  4C92 A;  1VIE A;  4M7D A;  3OYC A;  3CME A;  3V8J A;  4ELZ C;  1OI1 A;  4PJO G;  3HSB A;  2GQV A;  3CCS A;  2RD1 A;  3RER A;  4LDY A;  1W2B S;  1K8A C;  3MP8 A;  1UGR B;  2JVV A;  2RHX A;  2RM4 A;  2R5M A;  2K5F A;  2DXB A;  1SSF A;  1YI2 T;  2PVD B;  3PIP A;  3P8B B;  2RHU A;  2DEQ A;  3DLM A;  2H3J A;  1BYM A;  2LTO A;  2DVE A;  2HAX A;  4IKF A;  3CCQ A;  3N5B B;  4II1 A;  4M77 F;  4XAX B;  4XK8 E;  3CCU A;  2E6N A;  4Y28 E;  3CCL T;  3Q1J A;  2LQ8 A;  2XKO C;  2YHT A;  4N4G A;  4M7A B;  2BUD A;  3VYH B;  4DQ2 A;  5GMK l;  1YIT A;  4ZGD B;  4EMH A;  4MML A;  3HHT B;  4BDY A;  3C12 A;  2QTX A;  3OYI A;  4M7A A;  4PL6 A;  1WPY A;  1JBM A;  1XOV A;  2XU8 A;  4C8Q F;  3CC4 T;  2F69 A;  4KBM B;  4OB0 B;  3X20 B;  3OSV A;  4NL3 A;  3E9F A;  1QVF S;  2KY9 A;  4F7U G;  3JCM X;  4MZP A;  5LJ3 d;  5IT9 E;  1VQK T;  3FDR A;  5DLQ E;  3FEO A;  2XI9 A;  5GMK j;  1X01 A;  3JB9 H;  2E1H A;  1ZHI A;  1G3Y A;  1VQ4 A;  1MHN A;  3S3N A;  2LX9 A;  4KT0 E;  2KQW A;  4PKC C;  2M1H A;  3CCE T;  2FB7 A;  3ER0 A;  3QUI A;  5GAN g;  4JS4 A;  4E7H A;  1VQL T;  1N8R C;  2DIQ A;  2K2V A;  5FU7 C;  3BFM A;  3T9N A;  5KCO A;  3A8L B;  3JCM h;  4XTZ A;  4BY6 B;  1JRI A;  5LJ5 e;  1VQO A;  1I8F A;  2QA4 A;  2EYQ A;  3G71 T;  2K3Y A;  2ZCF B;  4A54 A;  4PJO B;  3FB9 A;  3CMA A;  3VU3 C;  1YJN T;  3P8H A;  4A4E A;  3WVD B;  1W4S A;  4BI4 A;  1UGQ B;  2DIG A;  2L8D A;  2RI2 A;  2XID A;  3BW1 A;  3HRS A;  5FRO A;  3A8G B;  3I55 T;  3OMG A;  1VQ7 T;  2KMT A;  3C4S A;  1YJ9 A;  3NTH A;  3OYN A;  4C92 E;  2KSS A;  4M78 G;  4EDU A;  1KD1 C;  1YI2 A;  1KQS S;  1FWZ A;  4XU0 A;  2RB6 A;  2RH2 A;  4OMF B;  4FSX A;  3VKI A;  4LDW A;  2K57 A;  4N4I A;  4XTX A;  3JCM J;  4GLK A;  4L6V 5;  4X34 A;  1UGS B;  4LDX A;  3GNG A;  2QDY B;  1Q82 C;  3CCL A;  1H3Z A;  4QVZ A;  3CC2 A;  2XDB A;  3PNW C;  5A0G A;  5GAN h;  1BI2 A;  3S3O A;  2RK1 A;  3OMC A;  4JLI A;  2E41 A;  4F7U B;  3JB9 J;  3S3M A;  2NLU A;  4IUR A;  1HK9 A;  3CXC S;  4F7U A;  3SWN B;  1NPR A;  4M75 F;  4D6W A;  2LVM A;  4LD6 A;  1G3W A;  1M1K U;  4Y91 A;  4N0A C;  1VQK A;  2DTH A;  4C5G A;  2CZ7 B;  2CKK A;  1U1S A;  2D9T A;  3EFR A;  2LCL A;  3SB2 A;  4C92 G;  5GAO q;  1M90 U;  1VQ5 A;  3E9G A;  3CCS T;  4QW2 A;  3FJP A;  3QJ6 A;  4A4K A;  3URG A;  1O75 A;  2CS7 A;  1V29 B;  2RI5 A;  3LWI A;  5GMK i;  3FRN A;  1B34 A;  3JB9 D;  2OTJ A;  2PQW A;  3TCJ A;  4HCZ A;  4JRK A;  1BI0 A;  3G71 A;  4ZTJ A;  4KUD K;  4UC4 A;  2R58 A;  3JAM E;  2DO3 A;  3VJP A;  3CCQ T;  2QQA A;  2RHZ A;  3SFM A;  3DB4 A;  3MET A;  2IVW A;  4M78 B;  3I55 A;  2RI3 A;  3CPF A;  1N9S A;  3VUB A;  3M56 A;  4IUQ A;  4XTV A;  3PTA A;  5LJ3 e;  1FX7 A;  4C5H A;  2EJF A;  2MF2 A;  2VYT A;  3P8D A;  3OYY A;  4RKU E;  5CQX A;  3QHS A;  2BIV A;  5GAN 5;  5GMK m;  5GAM e;  1YJW T;  4EPC A;  2WSC E;  4L5G A;  3EAE A;  4V2S A;  4QQ6 A;  2V8K A;  4L59 A;  3CPW S;  5DM7 R;  1NJI U;  4HT9 A;  3RUX A;  2VUB A;  3JCM W;  1RL2 A;  5L8R E;  2QXF A;  3OYE A;  1G3T A;  2ZPG B;  1Q86 U;  3NTI A;  4NS5 A;  3J80 E;  3UPU A;  2PU9 B;  2XD0 A;  1M8V A;  3ZBD A;  3L2Z A;  4B9X A;  3OS0 A;  4C92 F;  3KUF A;  3FC3 A;  4DA4 A;  5CKB A;  4M7D D;  4M7D F;  5CKE A;  2K3X A;  5LJ5 g;  4X9D A;  4E7K A;  5GAN j;  5J26 A;  2Y4Y A;  2EQK A;  3X25 B;  2ZPE B;  4FT2 A;  1UB4 A;  3ZEH A;  1PSE A;  3M54 A;  4ZN3 A;  3KXT A;  2ZGW A;  3ME9 A;  2CZ0 B;  5HKC A;  1G5V A;  5A0L A;  3HP9 A;  4FT4 A;  3M59 A;  1Q7Y U;  4XU3 A;  4E7J A;  3A8M B;  5A0D A;  3J7A F;  1ZQ1 A;  1X75 C;  3X24 B;  1PSF A;  4Z02 A;  3M53 A;  3OYF A;  5M9O A;  2QI2 A;  1WQ7 A;  2DXU A;  3F70 A;  4M7A F;  2HBP A;  1XNI A;  3M4Y A;  4M77 D;  4OP0 A;  2KVQ G;  3M55 A;  3R6O A;  5CKF A;  2EKO A;  3CC2 T;  3PGG A;  4JLG A;  5FU7 B;  3MCA B;  3OYK A;  2PUK B;  4O5V A;  2Y4X A;  4BD3 A;  2DXT A;  2LQK A;  5GAO l;  3X26 B;  2OTL T;  4C8Q D;  4HKE A;  1YJW A;  2QEX T;  4E47 A;  5LJ5 h;  4XTU A;  1JJ2 A;  2WSE E;  1YHQ A;  1VQM A;  1TH7 A;  2A7Y A;  2RJF A;  3CCR A;  1K73 U;  3H6Z A;  4KUI A;  3C95 A;  4M75 E;  1Y07 A;  3CXC A;  3WVE B;  5GAM d;  3V8L A;  1NPP A;  3J81 E;  1KC8 U;  2EIF A;  1VQ5 T;  4A53 A;  4C0F A;  5I2S A;  2EJ9 A;  4OB1 B;  4J7I A;  2FVU A;  4OVA A;  4IUV A;  3QYH B;  2XHC A;  4Q5W A;  3TEE A;  5HK0 A;  2OTJ T;  4PJO F;  3C94 A;  5CKH A;  3GPL A;  4PJO D;  4BI3 A;  4J6Y A;  2QQB A;  5J39 A;  1M1K C;  3HKS A;  2LDM A;  2DZC A;  1OZ2 A;  1VQP A;  4OGE A;  3OW2 S;  3LYI A;  3RMQ A;  1KHI A;  2JUF A;  3MP6 A;  3UT1 A;  3OYJ A;  4XQ3 A;  4NL2 A;  5CO7 A;  3JB9 I;  3CCV A;  2LC4 A;  2QQ9 A;  1Y71 A;  2Y90 A;  3QII A;  3CBO A;  5LJ3 g;  2L5Q A;  2O4X B;  4J83 A;  3OB9 A;  4M77 C;  1M9S A;  4XTY A;  4N0A A;  5GAM g;  2O4X A;  2CYZ B;  1D3B B;  3OYH A;  4HT8 A;  3JCM f;  3LLR A;  5LL6 S;  3LW5 E;  2FYK A;  1D3B A;  3OS2 A;  2EWN A;  4C8Q C;  2M0O A;  4XU2 A;  3GOX A;  2WSF E;  1EIF A;  1HXD A;  2BKD N;  4F7U F;  3JB9 G;  1OZ3 A;  3M5A A;  4FU6 A;  2GFA A;  4R55 A;  2OTL A;  2HD0 A;  1KQ2 A;  4BE2 A;  5FRN A;  2QEX A;  3RKX A;  2QQR A;  3A8H B;  3CBP A;  4ATO A;  2K5L A;  1I5L A;  4M75 D;  3JCM e;  1R8O B;  2X4X A;  2JTM A;  5HY6 A;  3QZ9 B;  3AHU A;  4IUU A;  2P0P A;  1NJI C;  3M58 A;  2V8I A;  5GAN 7;  3GP8 A;  3FLG A;  4M7D E;  2QQS A;  2VXE A;  5DLO A;  1Q81 C;  3V8K A;  3GLX A;  3S6W A;  4ELY C;  2JNG A;  1WQW A;  4BUG A;  4CRI A;  3TRE A;  1QP2 A;  1M1G A;  3G4S T;  5LJ5 j;  1B34 B;  4LDU A;  1X6O A;  2EQM A;  5LJ3 h;  4J5Y A;  2I2L A;  1WNL A;  4JRP A;  3BDL A;  5GAN f;  3LX7 A;  5GAM h;  3GNF B;  3RMS A;  1KQ1 A;  2YLB A;  2E6Z A;  2XDP A;  1XQH A;  3HRU A;  1W2B A;  4GY5 A;  5IAY A;  2DD5 A;  4M78 F;  4M78 D;  3JCM Q;  3QSU A;  1U1T A;  2P0Q A;  4PLL A;  4ZN1 A;  5DY9 A;  4C5I A;  2RJC A;  4MMK A;  2RO0 A;  2E65 A;  3E1S A;  4M77 E;  3BY7 A;  5GAN e;  1DJ7 B;  2YRV A;  3JCM V;  3OYB A;  3GIB A;  2FHD A;  2LRQ A;  5J3B A;  3MEA A;  4ME7 A;  2EAY A;  4JRI A;  4LDV A;  2DAQ A;  2LCC A;  5KH6 A;  4BE1 A;  3V7R A;  5KE3 A;  5GAO m;  1YHQ T;  4LD9 K;  1VQM T;  2L3R A;  2X4J A;  5KCH A;  4C8Q E;  4RCC A;  3CCR T;  2PUO B;  3HL8 A;  3PMT A;  1S72 A;  1RI0 A;  2IG0 A;  5FU6 C;  3WXM B;  3PIO A;  1QVG S;  1Y96 B;  5CR2 A;  1XTD A;  2D0Q B;  4DOW A;  2JZ2 A;  2DZ9 A;  1Y96 A;  5D6Y A;  3OBW A;  2OAU A;  3QO3 A;  4M75 C;  4O6J A;  1QVF A;  2CZ1 B;  1QW1 A;  3OYD A;  3OYM A;  1YCY A;  4C92 D;  3A8O B;  2X4Y A;  2VGM A;  5GAN 6;  4BB7 A;  3CCJ A;  3UWN A;  2KDS A;  3L2W A;  1VQ8 A;  1K9M U;  2CGH A;  2L89 A;  1K73 C;  5FRM A;  1VQ6 T;  4PJO E;  3I56 A;  1I4K 1;  4A4H A;  3G7Z A;  1VQP T;  2V8J A;  2E10 A;  4JDS A;  3G4S A;  1KC8 C;  2VC8 A;  3JCM d;  3L1A A;  2RJE A;  3CCV T;  4VUB A;  2X35 A;  2F5K A;  3DLL A;  5GMK e;  1N9R A;  2K4Y A;  3QDR B;  4P5N A;  3OW2 A;  1UEB A;  5CCA A;  4J6W A;  1WGS A;  3BDU A;  5CKD A;  3A5Z B;  3H8Z A;  5LJ3 j;  4HCC A;  5HK3 A;  4M7A D;  3M57 A;  1BKB A;  4J7F A;  3PFS A;  4OF1 A;  2KK4 A;  3OYA A;  1KQS A;  2RA2 A;  4N4H A;  5I21 A;  5GAM j;  2VGN A;  2WAC A;  3V7C A;  5EG2 A;  3QJY A;  3VV0 A;  2FL7 A;  3MO8 A;  4QQG A;  3LGF A;  3MEV A;  4F7U E;  4ZGE B;  2B8A A;  1KHC A;  2DPP B;  1YIJ T;  2MWO A;  5GAN d;  3JCM g;  1KG1 A;  3ASK A;  3JSC A;  4EMK C;  4RG2 A;  3PMI A;  3SDZ A;  1LOJ A;  1N27 A;  3DKM A;  4FL6 A;  3RIR A;  4C0D C;  4C92 C;  3G6E A;  3RKW A;  1BIA A;  3CME T;  2ZPB B;  4M7D C;  3HFN A;  4J6X A;  5GAN 8;  2P4T A;  3KBG A;  2PVO B;  4OB2 B;  4M77 B;  1ZBX A;  2R5A A;  3CCM T;  2DKG A;  4M77 A;  3OS5 A;  2E5Q A;  4XTW A;  4QQD A;  3INZ A;  2HQX A;  3M4G A;  2LT4 A;  3QBY A;  3FIF A;  4MZT A;  4C8Q B;  4RMO A;  1VQ6 A;  1WJS A;  4MZM A;  5LJ5 f;  3OYL A;  3EFS A;  3L2Q A;  4C8Q A;  4CI0 C;  4JRQ A;  3OQ5 A;  4FIB A;  1M90 C;  2MI6 A;  2MMP A;  3QPH A;  1YJ9 T;  4M78 E;  2X4W A;  1QP3 A;  3QXE B;  3OA6 A;  2P0K A;  4M75 G;  3CC7 T;  4A4F A;  2XG8 D;  1LJO A;  1K8A U;  1I81 A;  3RES A;  4E7L A;  1MGQ A;  4M7A C;  1M1F A;  1IRE B;  3HPW A;  1WJQ A;  3MHX A;  4BI8 B;  3OYG A;  3JCM P;  4RG8 A;  3CEY A;  3JCM c;  2M16 A;  1S72 T;  3M9Q A;  4DOV A;  4BAC A;  2AHJ B;  1JB0 E;  1GXI E;  2E64 A;  4PJO A;  2VXF A;  5CIU A;  1VUB A;  1WJR A;  2ZPF B;  5CAI A;  2LT1 A;  3CPW A;  5GAN 3;  3UDC A;  3L2R A;  3L42 A;  3LH0 A;  4OB3 B;  1QVG A;  3V7S A;  2DXC A;  3CCJ T;  4ZTF A;  2KAF A;  3HRT A;  3MEU A;  3NFC A;  1YIJ A;  1VQ8 T;  2PVG B;  3QKJ A;  3DB3 A;  1N6A A;  5D6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...