3I35A

Human sh3 domain of protein lasp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
KRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords LIM and SH3 domain protein 1
publication title Human SH3 domain of protein LASP1
rcsb
source organism Homo sapiens
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i35A00
2DL5A 2ESWA 1J3TA 2RF0A 1V1CA 4M4ZA 2L0AA 2FPDA 1FMKA 2DRMA 1KIKA 4J9BA 1ZX6A 2KYMA 1CKBA 4RTYA 1UJYA 2RQTA 2KYBA 1YCSB 1SRMA 2DL4A 1GCQA 1UHFA 2BZYA 2CT3A 2DM1A 2HBWA 4J9GA 2K9GA 2JM8A 2O31A 2F2VA 2JMAA 2EKHA 1PKTA 2DL7A 3VS2A 2LX7A 1CKAA 2GBQA 2BZXA 4ZNXA 2LP5A 2RQUA 2KXDA 2K3BA 4J9DA 1KSWA 4Z88A 1Z9ZA 3UATA 2O9VA 1QCFA 4OMMA 1VA7A 3R6NA 2NUZA 2MIOA 1K0XA 1AEYA 3VS5A 1BB9A 1RLQC 2XMFA 1YWPA 3I9QA 4AFZC 4RTWA 2A36A 4CC4B 2J05A 3CQTA 3VS7A 3QWYA 2KE9A 4D8KA 2YUNA 4R0KA 1K76A 2FEIA 2IIMA 2LJ3A 1OEBA 2JMCA 2RPNA 1I07A 1HJDA 2VKNA 1B07A 1T0HA 2V1RA 4RTUA 2D0NA 4AG2C 2AK5A 2AZVA 1BU1A 1QLYA 1EFNA 2DLPA 1ZUUA 2J7IA 4HVUA 2YSQA 5IHNA 2DRKA 2RQVA 3NGPA 5ECAA 2JW4A 1M30A 1T3SA 3O5ZA 3EG0A 2FRYA 5FW9A 1Y57A 4CC2A 2JS0A 2CH4W 2NWMA 5IXBA 3SEMA 1YP5A 2LQNA 2DE0X 3I35A 1OV3A 1OOTA 4LE9A 1ZUKA 2RQWA 3M0QA 1KFZA 2D8JA 2EW3A 4D8DA 3VS4A 1ZSGA 2W10A 4K11A 3H0HA 1ARKA 1S1NA 1ZUYA 4OMNA 3SHWA 1NEGA 2KEAA 4KRTA 1VYTA 2EPDA 1BK2A 4JZ3A 1CSKA 1NYFA 2B86A 4FSSA 1WA7A 1M3AA 1SEMA 1RLPC 1AWXA 2GQIA 3LH5A 1NEBA 5FWBA 1LCKA 5L23A 2F2WA 1QWFA 2KRSA 2J6FA 2OAWA 2O9SA 3VRYA 2VWFA 1K0SA 1AWJA 4AFUC 3EG1A 3H41A 1B3QA 4F14A 2YUOA 1UDLA 2K6DA 4RUGA 2HSPA 1K1ZA 2CH4A 2RN8A 2ROTA 1UJ0A 2A37A 1X27A 4AFSC 1E6GA 1TG0A 1GBRA 1W1FA 2I0NA 4RTZA 2EBPA 4JZ4A 3A98A 2CT4A 3NHNA 1ABOA 1VYVA 1W6XA 1H3HA 2CUDA 2CREA 2D1XA 1UECA 1X6BA 2FO0A 3EHRA 3VS3A 5IHIA 4CC7A 1YWOA 3RNJA 1PHTA 1PRLC 1WYXA 4CC3A 2BZ8A 4JJBA 2JS2A 1VYUA 2J06A 2J6KA 2FPFA 1XOVA 2D8HA 4RTTA 1Y0MA 4OMPA 1WX6A 1U5SA 1JQQA 1GCQC 2FG0A 2LQWA 1U3OA 3M0TA 3NPFA 3TVTA 2W0ZA 2RNAA 4WCIA 2PZ1A 2ABLA 1MV3A 1X6GA 1WI7A 2SRCA 1K4US 2G6FX 1HD3A 2YUPA 2DILA 1W70A 2K2MA 4HCKA 3JV3A 4X1VA 1PWTA 1PRMC 1UFFA 2CUBA 3VRZA 1ZLMA 2C0TA 1A0NB 2EYYA 2EYXA 2V1QA 2O88A 1PNJA 2C0IA 2P4RA 2DBKA 2GNCA 3GBQA 3REAB 1M27C 1UGVA 2KGTA 2CDTA 2DYBA 3PE0A 4ESRA 3M0RA 3H0IA 4JJDA 4Z89A 1X43A 2X3XD 2RQRA 1JEGA 2KR3A 4Z8AA 4LNPA 4OMLA 1UTIA 2HCKA 4J9HA 4DEXA 3I5RA 1YN8A 2LMJA 2YT6A 1NG2A 2EGEA 4LUEA 2KT1A 1FYNA 3ULRB 2M51A 2RMOA 3TSWA 1M3CA 1ABQA 1M3BA 1UHCA 2AKLA 2JTEA 2EYZA 1ZBJA 2ROLA 2FPEA 1GFCA 2KXCA 2EVRA 1TUDA 1AVZC 3C0CA 1GL5A 5HCKA 1GCPA 2K7AA 2MCNA 4Y92A 2BTTA 2EGCA 1TUCA 1QKXA 1RUWA 1HSQA 2E5KA 1JO8A 3QWXX 1X2KA 1N5ZA 2DNUA 2SEMA 2VVKA 4ORZA 1AZGB 2KROA 1SSHA 2DF6A 1AD5A 2DMOA 3FJ5A 4QT7A 4HVVA 3I5SA 1I0CA 1NM7A 1T0JA 1QKWA 2M0YA 4J9EA 1I1JA 1U06A 4HXJA 4E6RA 3THKA 2AKKA 2DX1A 4AG1C 1GFDA 1G83A 2J6OA 4JJCA 1UE9A 3RBBB 5FWCA 3REBB 2DBMA 2DL8A 1AZEA 1WIEA 2GTOA 3EHQA 1SHFA 5I22A 3EGUA 3M0SA 1NLPC 1QWEA 2AZSA 2ECZA 2O2OA 4RTXA 4DEYA 2JM9A 4J9CA 1M8MA 4OMOA 3UA6A 3EG2A 4J9IA 1MUZA 4JPBW 2X3WD 1JXOA 2DVJA 2QDLA 2EYWA 2KT8A 3M0PA 2EQIA 2LNHB 4OMQA 1WDXA 5I11A 1UUEA 1Z9QA 3VS0A 1H8KA 2CSQA 5GJVB 2C0OA 1GRIA 1SHGA 2DA9A 1SRLA 2A08A 2KNBB 4IIMA 1MV0B 3PVLA 1G2BA 2CSIA 3ZL7C 5IXFA 4EIKA 2OJ2A 4LN2A 4RTVA 2EGAA 1H92A 3KFVA 2JXBA 5GJWB 3VS6A 5EC7A 3VS1A 1NYGA 1AWOA 2YUQA 2F2XA 2L3QA 2GTJA 3TSZA 2LJ1A 2A28A 4AFQC 2LJ0A 3M0UA 5IH2A 1E7OA 2LCSA 3UA7A 3U23A 4J9FA 2HEQA 1JU5C 2LZ6B 2OI3A 2PNIA 2YDLA 4GBQA 2H8HA 3H0FA 1WFWA 1RI9A 1K9AA 4A63B 1BBZA 2DJQA 2L2PA 1JXMA 1IO6A 3EG3A 2ED0A 4GLMA 1KJWA 1AOJA 2KBTA 1OPKA 1AWWA 1WXTA 1X2QA 1PKSA 1E6HA 2KRMA 1UG1A 4F16A 3PVQA 3UF4A 2ED1A 2GGRA 1WXBA 2L3PA 1SPKA 2KRNA 1WLPB 1YNZA 2L3SA 2DL3A 2MOXA 2FRWA 1GBQA 1WXUA 4F17A 2HDAA 2ENMA 5IHKA 2JT4A 2K79A 1NLOC 1OPLA 4LUDA 2PTKA 1T3LA 1X69A 3IQLA 4HVWA 3NMZC 4IIOA
chains in the Genus database with same CATH superfamily
6AT1B 2DL5A 2ESWA 1VQMA 1I5OB 2L0AA 2DRMA 5GANh 4JS4A 4HKEA 5IN1A 1TU0B 1V29B 1ZX6A 4C92E 2JZ2A 3EG9A 2ZAEA 1VQ8T 3QZ9B 4M77F 2X9HA 4WTOB 1M90C 3DB4A 2EFIA 4ANJA 1VQPT 3OYKA 1UHFA 1QCOA 5FLXE 4M7AE 2DM1A 2HBWA 2P0PA 2XDDA 2DL7A 3L2RA 3VS2A 2LNVA 1CKAA 2GBQA 1OI1A 1LPLA 2JUFA 3CBMA 3META 4J9DA 3OS0A 4OB0B 3HHTB 3TCJA 1O75A 4XTUA 1Z9ZA 3UATA 2MWPA 3R6NA 2NUZA 1K0XA 2DVEA 1U1SA 3QYGB 3VS5A 1WGSA 4BI4A 1G3WA 3I9QA 4AFZC 1ACMB 2LRQA 2WACA 4CC4B 4DBRA 2J05A 3VS7A 3M57A 5LJ3f 2YUNA 2LJ3A 3EGXA 5GAN8 2ZPGB 4IURA 3OYHA 4AG2C 1VQ5T 4MDWA 3ER0A 4J5YA 1BU1A 1ZUUA 2GFUA 3HPWA 3I55T 1BI2A 1WNLA 3CXCA 3NGPA 3JB9G 1Q7YC 1T3SA 4M78F 4A4HA 3JCMQ 2A3LA 2RK2A 1KD1R 3SEMA 2DO3A 3I35A 2HKNA 2NUPA 2YRDA 1FMWA 3OYBA 2FB7A 4J83A 4PKCC 1WHLA 1KFZA 3CMEQ 2QQAA 4XQ3A 1K73R 3HTRA 2EW3A 2COZA 4FSXA 1VQ7Q 4M7DC 1ZUYA 4M78A 2DPPB 4PFOA 2KEAA 4N0AA 4Y28E 1YJWQ 1RAFB 1VYTA 3KUFA 1N8RC 3G4ST 2AHJB 4PJOB 5D6XA 2RO0A 2GQIA 3LH5A 5FWBA 1VQNT 1QWFA 5KE3A 2VWFA 3FIFA 1AWJA 3EG1A 3H41A 2YUOA 4RUGA 5HY6A 2CP7A 3CCUQ 2M02A 2HSPA 1TTHB 4FYXB 3M5AA 1UJ0A 1M90R 3VYHB 2WSFE 2MPXC 1E6GA 3QZ5B 3QDFA 2QEXA 1VQ9Q 1W1FA 2I0NA 2EBPA 2E4HA 3C95A 1ZSZC 4J6YA 4RMOA 5GAN5 5A0GA 2LTOA 2CREA 2OTJQ 5GMKh 1D1CA 5KYWB 7AT1B 5GAOr 2BUDA 3EHRA 1VQOA 1WQ7A 3CCLQ 4ZGJB 2JN0A 3G6EQ 3CC2Q 3CC7A 2IPOB 2BZ8A 2BE9B 2BKDN 1VYUA 2FPFA 3JB9J 1Y0MA 3JCMX 4EDUA 3X20B 3PNWC 4KH1B 4XU1A 4FT2A 2RNAA 2CP0A 3CCJA 2ZPIB 1X6GA 4OB2B 1K4US 2DILA 5KCOA 3L2UA 2RH2A 3MP1A 4UC4A 1PRMC 2CUBA 4M77C 3VRZA 2C0TA 1JJ2P 2JTMA 4ZTFA 1B7TA 5CR2A 5GAMe 1NJIR 2LDMA 2DTIA 2C06A 2V1QA 1RAHB 2FL7A 1H3ZA 1M1KC 3GBQA 3HL8A 2CDTA 1I81A 3M59A 2YLBA 4Z89A 1X43A 2RQRA 3MHXA 2KQWA 4TVRA 2AT1B 4C92F 2LMJA 3QHSA 3GPLA 3ULRB 1QVGA 3EFOB 3TSWA 4BB7A 2QA4A 4M7AF 1QVFS 4BI3A 3A8MB 2ROLA 4LDYA 5A0LA 2EVRA 1QP3A 3P8HA 1N8RR 1M1FA 1GL5A 2K7AA 4OB1B 4Y92A 2MCNA 2EGCA 1TUCA 5FRNA 1QKXA 1RUWA 1X2KA 1YITQ 4GLKA 1YHQA 1JJ2S 3URGA 3TREA 4M7AA 3LX7A 3OYLA 3OYDA 4HVVA 1W4SA 1VIFA 3CEYA 4QKUA 1OU8A 4PJOE 3PIPA 1I1JA 1U06A 4JJNK 1M1GA 2HSEB 4JRQA 2AKKA 1MMGA 4M78C 4ATOA 2DX1A 4AG1C 4HT9A 3CCSA 3CMET 4N0AC 1Q81C 3A5ZB 1YIJT 4E7SA 4QQGA 1VQ7T 3EGUA 3M0SA 1NLPC 5LJ5f 4BY6C 4GY5A 1KHCA 1ZBXA 4RKUE 4J9CA 1YJWT 4OMOA 2K5LA 3JB9I 3EG2A 1IHWA 4E7LA 2RI2A 4JPBW 1JXOA 3OSSC 2EYWA 3M0PA 4RCCA 1UUEA 1WHJA 3VS0A 4M78G 4BUGA 1K9MU 4M77E 1EX4A 1RADB 1OZ2A 5J3BA 2DA9A 3HRUA 1MV0B 3PVLA 1XNIA 1G3YA 2FYKA 1IHVA 1KQ1A 4EIKA 2OJ2A 1X6OA 4RTVA 3BE3A 2EGAA 3ZBDA 5J26A 1RAEB 3TQ7P 1Q7YU 5C0MA 4X9CA 1VQ8A 5GJWB 4XTXA 2OTJT 1VQPA 4XK8E 3JCMJ 5A0DA 3DLMA 3VS1A 4MZTA 3VUZA 3G71Q 2GTJA 2MYSA 3M0UA 1BKBA 1F1BB 2LQKA 1E7OA 3OYCA 3UA7A 4NOYA 4J9FA 2MAMA 3CCLT 3QG1A 3WVDB 4XU3A 3JB9D 3CC2T 2XICA 2EAYA 2VXEA 1RI9A 2JVVA 3LGLA 2PUKB 4MZPA 2RHZA 3CCMQ 4V2SA 5IAYA 4C8QG 2ED0A 4ZGDB 1VUBA 2KBTA 4DOVA 3OW2P 5DLQE 4PJNA 5LJ3g 1MMAA 3X25B 4KH0B 1U1TA 1C6VX 1M4ZA 3L2WA 2ZPEB 1E6HA 2KRMA 3JB9H 3NTKA 3PVQA 3UF4A 4J7FA 3OB9A 3JCMf 2DK3A 1JRIA 3CC4Q 1WXBA 2X4JA 5EG2A 1PC0A 1WLPB 4C0FA 3KXTA 2DETA 2XI9A 4N4IA 2CS7A 2MOXA 2FRWA 1GBQA 1C1AA 2JJ9A 4ZN1A 1KQSP 4LUDA 2QGGA 1VQ5A 1Q86U 1J3TA 1S72Q 2FPDA 1FMKA 1KIKA 2PQWA 4M75D 3I55A 1SSFA 4XU0A 2KMTA 2KYMA 5GANe 1UJYA 2KYBA 1D3BB 1I8FA 3FDRA 1DJ7B 2K9GA 4II1A 1HK9A 2F2VA 3CCET 3RKWA 3I56Q 3P8BB 2LX7A 2DKGA 1QQJA 2ZPHB 2QTXA 4C92C 2ZPBB 4JLIA 3V8LA 2L8DA 3SD4A 3CMAQ 1BIAA 2EJGA 4M7AC 1KSWA 1YITT 2YHTA 1VA7A 2M1HA 4J6WA 2MIOA 4YTLA 3G4SA 5FRMA 1BB9A 3OYEA 1KQSS 2YRVA 1D0ZA 2E6NA 4RTWA 1VQNA 2A36A 1VQLT 2QI2A 1G3TA 3CQTA 3QWYA 2KE9A 2Y4YA 4R0KA 2FEIA 2HMAA 1LJOA 4M7AG 2JMCA 2RPNA 4F7UA 2DZCA 4BE2A 1M1KU 3J7AF 1HJDA 4PJLA 2QAZA 2HL5C 2D0NA 3MJXA 1EFNA 1X75C 5GAN6 1G5VA 2HQHA 2CKKA 2F5KA 2KSSA 2HZYA 5GAN7 1RAAB 1Y71A 2FRYA 5FW9A 4DOWA 3VYGA 5IXBA 2LQNA 2DE0X 1OV3A 2WSCE 4LE9A 2CP3A 2RQWA 4O5VA 4PJOF 2QK0A 3SWNB 5CK9A 4O6JA 4K11A 3M54A 3H0HA 1G8XA 1ZSZA 3RMSA 1BI1A 3R6OA 4LDUA 2LVMA 4KUIA 2VC8A 4KRTA 2LQ8A 2EPDA 3HRSA 4FSSA 2DEUA 5I21A 3JCMV 5KYNA 4XTYA 5KYYA 1WPYA 5L23A 2F2WA 1OU9A 3VRYA 4PJOA 1K0SA 1HYOA 4MMLA 3CXCP 4BDZA 3PT9A 1PG5B 3CCRT 2E64A 4PNOA 5LJ3e 5DY9A 1BYMA 1QVPA 1Q81U 1K1ZA 1Q82C 1VQ4T 2ROTA 4LD9K 1QCNA 5KYXA 1TG0A 3MEWA 2RJEA 2AIRB 1HXDA 4RTZA 2NUTA 2LX9A 4LDWA 2CYZB 3L2QA 1VYVA 2MK5A 1H3HA 3EFRA 3VU3C 2ZZDA 2M9UA 4KGXB 3UDCA 4M77A 3GF5A 5AYFA 2X4YA 5GMKe 1VQMQ 2RI5A 3VS3A 2K57A 5IHIA 4A4KA 1W2BS 5KYWA 5GAMg 1PRLC 2QQ9A 4B9WA 4JJBA 1BIBA 5I2MA 1M2VA 1JQQA 2FG0A 2LQWA 2XU8A 4E47A 1U3OA 4L5GA 4BACA 1K9MC 2PVGB 4WCIA 3L42A 4LXCA 3E19A 2X4WA 1NPPA 3ZFJA 2KDSA 3DB3A 1OYXA 3GLXA 2CZ0B 2E41A 1HD3A 4M75B 3C4SA 5LJ5g 4RG2A 3I56T 1QW1A 1Y96B 2D0QB 1RL2A 4EMKB 4BE0A 2DJZA 1ZLMA 2RD1A 3RKXA 1TS9A 3CMEA 1U8RA 4C0ZA 1B34B 5GMKi 2C0IA 4JUVA 2DBKA 1YIJA 2VASA 2GNCA 1VQ7A 3TU4K 2Y90A 4A4EA 1YJWA 2PUOB 4ESRA 3H0IA 1RAIB 1JEGA 2KR3A 3VUBA 1WHGA 4L59A 3V8JA 4DEXA 1YJNQ 1YN8A 2YT6A 2EGEA 1FYNA 4C8QD 3S6WA 2AKLA 5IT9E 2QASA 2FPEA 3EFOA 3VJPA 3G7ZA 5KYUB 1KC8C 1GCPA 2EQKA 3RR6A 3OS5A 1HSQA 2HKQB 2P4TA 4IUTA 2DNUA 1VQ9A 2SEMA 2V8IA 2V8JA 1BI3A 2KROA 4C5GA 1AHJB 1SSHA 5HK3A 4M7DG 4F7UG 1AD5A 4E7ZA 3RESA 3EGDB 1YI2T 2OTJA 4QT7A 1NM7A 1T0JA 4DBHA 3EG9B 1Q86C 3J80E 4HXJA 3AHUA 3CCLA 3RIRA 3G6EA 3CC2A 2J6OA 1QVGP 3M53A 4LDVA 3QXEB 1AZEA 4MDXA 3JCMg 2DIQA 3CCQQ 3EHQA 1SHFA 5I22A 4PL6A 5CQYA 4RTXA 3CD6T 1IGUA 2JM9A 4PJOC 1M8MA 3UA6A 3JRZA 3OYMA 2X3WD 1RI0A 3MO8A 3GP8A 2CZ1B 1D0XA 2VV5A 1PD0A 1H8KA 2V26A 1UGSB 2YWWA 5GJVB 3QBYA 2C0OA 1GRIA 3QYHB 2OTLQ 1SHGA 1K9MR 2K3YA 3A1PA 3MP6A 3V7CA 4RG8A 1SRLA 2A08A 2DXBA 4QQ6A 4E7IA 2F5TX 2XK0A 1G2BA 3H9NA 3HFOA 3ZL7C 2P0QA 4LN2A 3EGXB 2IVWA 1VQOQ 1QVGS 1Q7YR 3NTHA 3O8VA 4E7HA 2JOYA 3RUXA 5EC7A 1NYGA 1VIEA 2YUQA 1R8OB 2F2XA 3CCEA 3TSZA 2A28A 4AFQC 2DFUA 1VOMA 2HEQA 3OYGA 2LZ6B 4OB3B 4M75E 1WFWA 5CKDA 2EQMA 1OQKA 3LH0A 1BBZA 4M77G 2L2PA 2NUPB 1IO6A 1SG5A 5LJ5e 1EIFA 1OPKA 2EJFA 2XIDA 4VUBA 1YITA 4PK4A 2EIFA 5GANg 3QJYA 1MNDA 5CAIA 2PVDB 1UG1A 3X26B 2M0OA 4F16A 1NPRA 3PIOA 3OYYA 2M16A 2H3EB 2L3PA 1VQLA 4C92A 4OF1A 2KK4A 1Q82U 2LCCA 3FRNA 1TUGB 4FYYB 5DM7R 4F17A 2HDAA 2K79A 1OPLA 3GIBA 2RF0A 4M4ZA 2V8KA 2QA4Q 1Q86R 2Z0WA 1YFNA 1CKBA 4XAXB 2R5MA 2RQTA 1YCSB 1SRMA 2O4XB 2LC4A 3SDZA 3PFSA 2CT3A 4J9GA 1NBEB 2Y4XA 3C94A 2EKHA 5CKHA 2FHDA 2GFAA 2COWA 3MKDA 4Y91A 4ZGEB 1XJWB 1YHQQ 1WHKA 3H6ZA 2GQVA 2RQUA 3UPUA 3GOXA 2K3BA 4C8QB 4ME7A 1WJSA 4QQDA 1OX9A 3N5BB 5GAMd 5L8RE 1RAGB 2X4XA 4Z88A 2O9VA 3CCUT 4N4GA 2RHYA 2HAXA 4KGVB 3GNGA 2HQEA 3CCSQ 1Q95G 2KI7A 3JCMe 4J7IA 1VQ9T 3QPHA 3CCRA 5GAOq 3CCVQ 3E2UA 2IIMA 1PSEA 2MI6A 4CI0C 3BY7A 4DQ2A 1VQ4A 1I07A 5LL6S 3CCQT 2NYSA 1B07A 1T0HA 3CCMA 5CKFA 4DBQA 1M1KR 2AK5A 4FW1A 2AZVA 2R58A 1QLYA 3M55A 2K3XA 3LWHA 2J7IA 3S3NA 4HVUA 5CKEA 4PJMA 2DXTA 3G6ET 4KULA 2QQBA 1M30A 9ATCB 3O5ZA 2QXFA 3EG0A 1Y57A 1MNEA 4CC2A 2JS0A 2E70A 2NWMA 3V8KA 3EAEA 2OTLT 4N4HA 5FU7B 2A0FB 2QDYB 1ZUKA 2DTHA 3D7SB 1KC8U 4JDSA 2D8JA 3QIIA 4IUVA 1VQPQ 1ZSGA 4XTZA 1UGPB 1S72A 1NEGA 5KCHA 3MEAA 4J8OA 1CSKA 1NYFA 1WA7A 1M3AA 1OZ3A 1SEMA 4JRKA 1RLPC 4A4FA 1NEBA 1LCKA 2KRSA 2J6FA 2OAWA 2O9SA 3HKSA 2GF7A 4AFUC 4QVZA 3OA6A 3I56A 3JB9F 4EPCA 4KT0E 1UDLA 1WQWA 2RHXA 2CH4A 4M7DD 3X24B 1MMDA 1YJ9Q 1Q81R 3CMAA 4AFSC 3CPWP 3JCMW 2LT1A 1AT1B 1GBRA 3OW2S 1ZA2B 4IUPA 1TWBA 1ZQ1A 3EFSA 3A98A 2CT4A 4KGZB 1ABOA 3L1AA 2YLCA 1W6XA 1QP2A 5M9OA 3M4GA 2KVQG 2FVUA 5HK0A 1UECA 3J81E 1VQ5Q 2E65A 3M4YA 3JSCA 1YWOA 3I55Q 4CC3A 2J06A 2J6KA 4FU6A 3FC3A 3M56A 4JLGA 1XOVA 2D8HA 4RTTA 4M75F 4C0DB 1SKUB 4C92G 2X51A 3M0TA 5GAN2 3NPFA 4D6WA 2W0ZA 4C8QE 4F04B 2ABLA 2L89A 1MV3A 1YI2A 5GAMj 3QUIA 4E7JA 2SRCA 2EWNA 2G6FX 3MEUA 1VQKQ 1W70A 3ASKA 2E10A 3LGFA 3VKIA 2K2MA 2RK1A 1PWTA 4M75A 1A0NB 2EYYA 2EYXA 1LOJA 2DIGA 2MMPA 4EMKA 2HD0A 4IUUA 2QQSA 3A8HB 4Q5WA 2PU9B 1UGRB 2QYZA 1VQ6Q 3HSBA 4FL6A 1VQNQ 1TSFA 1UGVA 2KGTA 2RM4A 3CD6A 2L3RA 3CPWA 5FU6B 4FCYA 2DYBA 2XDPA 3H8ZA 3E1SA 3MEVA 5CKBA 3OYIA 4JJDA 4HA8A 4LNPA 1UGQB 2HCKA 3I5RA 2DZ9A 4C5HA 1NG2A 5GANd 1MGQA 3L2VA 4PJJA 2M51A 2RMOA 1M3CA 1ABQA 3AT1B 1KD1C 2JTEA 2P84A 1MHNA 4P5NA 5C6SA 3CCVT 2RA2A 3JCMP 1GFCA 4OP0A 2KXCA 2DD4A 1TUDA 4RCBA 1K73C 3RERA 3QJ6A 4FYWB 3G71T 1KG1A 4ZN3A 4FM4B 4EMGA 5GAN3 3OYNA 2EKOA 5KYUA 3QWXX 2VVKA 1AZGB 3S3OA 5FROA 1R77A 1PD1A 3FJ5A 3CCMT 3I5SA 1I0CA 2M0YA 1QKWA 3EGDA 1P92A 4QVDA 4KUDK 4BDYA 1WHMA 4E6RA 3A8OB 1XQHA 3SWNC 1KK7A 4JJCA 1UE9A 3RBBB 2DEQA 3CC4T 2E3IA 1KHIA 1Y07A 2O2OA 4DEYA 2O01E 4B9XA 5GAOm 1MUZA 3L2ZA 1FMVA 2E6ZA 2QDLA 5GAN4 4OMQA 3ZEHA 1WDXA 5I11A 2PVOB 4M78D 3CXCS 1S72T 3RMQA 2CSQA 3WVEB 2G3RA 1LNXA 2NLUA 2L5QA 2FZKB 2YRCA 4OMFB 3RKYA 4LDXA 3OMGA 4HCBA 1YJ9T 1K8AU 1BCMA 4IIMA 3X28B 1OULA 4J6XA 2CSIA 5IXFA 3Q1JA 2E12A 1M2OA 3DLLA 4M7DB 4HT8A 2VUBA 4F7UB 4AMCA 3KFVA 1YJNA 3CMAT 1W2BA 2LJ1A 2LJ0A 5KH6A 5IH2A 1C0MA 2LCSA 3OS2A 3U23A 1JU5C 2OI3A 2PNIA 1NJIC 2H8HA 3EH1A 5D6WA 2EQUA 3QO3A 5LJ3d 2DXCA 2E1HA 1K9AA 4A63B 4JRPA 2DJQA 1JXMA 3S3MA 1AOJA 2OX7A 2E5QA 3MPUB 1AWWA 1PSFA 3CCUA 1X2QA 5GAOp 3E9GA 2XG8D 1ZSZB 4M75C 1VQKT 3BDUA 1XTDA 4EMKC 1YIJQ 1D1BA 1SPKA 2F69A 3HP9A 4KBMB 2B8AA 5GMKm 1YNZA 2CP2A 2DD5A 4JRIA 2DL3A 5KYYB 4C0GA 3QSUA 3SFMA 8AT1B 5GANj 1WJQA 1Q82R 4CRIA 5IHKA 2JT4A 1VQ6T 3CCQA 3KBGA 2PTKA 3IQLA 4HVWA 3OYFA 3NMZC 2VGMA 4IIOA 1V1CA 2XKOC 4BI8B 2VB6A 4XTWA 5LJ3h 4J9BA 4M75G 5GAOl 1Y7XA 3LLRA 4NL2A 4RTYA 5KYXB 1FX7A 3VV0A 2DL4A 4XTVA 4C8QF 1GCQA 4OGCA 3LW5E 2BZYA 3BDLA 5AT1B 2JTFA 2JM8A 4QW2A 2O31A 2JMAA 2XDBA 2O4XA 1PKTA 2NUTB 3EH2A 4MMKA 4R56A 2RJFA 2OTLA 2BZXA 4ZNXA 2OAUA 2LP5A 3OQ5A 2KXDA 4M77B 1WJRA 2DERA 2ZGWA 4C8QA 3P8DA 3PMIA 3V7SA 4C5EA 2QEXQ 1EZZB 1QCFA 4OMMA 1IGQA 3CBPA 3A8LB 1AEYA 1M2VB 2DTOA 2FZCB 1R0CB 1RLQC 2XMFA 1YWPA 4PJOG 2GCXA 2K2VA 4A53A 1N6AA 4C92D 2RI3A 4D8KA 1QVFP 1K76A 2XHCA 4M7AD 4LD6A 1OEBA 3CC7Q 1TH7A 2VKNA 2VXFA 2V1RA 3FJPA 4RTUA 3OYAA 4PFZA 1VQMT 1MMNA 2CP6A 2HQXA 2DLPA 3OBYA 2YSQA 2HL3A 5IHNA 2DRKA 2RQVA 1JBMA 2IG0A 5ECAA 2JW4A 5I2SA 3CCJQ 1N9RA 1KD1U 4M7DE 1UB4A 2CH4W 3HRTA 4F7UE 1BCOA 1FXXA 1YP5A 5GMKl 5CIUA 1OOTA 4DBFA 3GNFB 1K73U 2MF2A 1N9SA 1NZ9A 3NTIA 3M0QA 1G3SA 4X34A 3UT1A 3V7RA 4M78B 4D8DA 1KC8R 2DAQA 3VS4A 2W10A 4NL3A 5CCAA 1ARKA 1FWZA 1S1NA 5A2QE 3CCEQ 4OMNA 3SHWA 1X01A 4BY6B 1BK2A 1SF9A 4JZ3A 5LJ3j 2B86A 2EQJA 4IKFA 1AWXA 4R55A 1M5Q1 1B3QA 4F14A 8ATCB 1D0YA 4L6V5 2K6DA 1IRXA 4AT1B 2CZ7B 1M90U 5GAMf 1YJNT 1QVFA 2RJCA 1YCYA 2RN8A 1RACB 4EMHA 2R57A 2A37A 2EJ9A 4PLLA 1X27A 1D3BA 3NFCA 1VQLQ 3M9QA 3QDRB 2KY9A 5GMKj 4OVAA 4FT4A 4JZ4A 3NHNA 1JJ2A 2CUDA 4Z02A 2FZGB 2D1XA 1X6BA 2FO0A 2XD0A 1H641 2QTVA 2R5AA 4B6MA 4CC7A 3CBOA 3CCVA 4JS5A 3RNJA 1PHTA 1WZOA 1WYXA 2JS2A 1BI0A 3G71A 4OMPA 3LWIA 1WX6A 2DYIA 1U5SA 4QVCA 1GCQC 2RHIA 3TVTA 2PZ1A 5LJ5d 4C5IA 1OX8A 2K5FA 4PLIA 4E7KA 1O9SA 1WI7A 1K8AC 1QMCA 2YUPA 3OSVA 2RB6A 2LCLA 3F70A 4HCKA 4ELYC 3JV3A 4X1VA 4BD3A 1UFFA 1NJIU 5GAMh 4C8QC 2D6FA 2A7YA 1NE8A 2O88A 1PNJA 1D09B 3OBWA 2P4RA 4PFPA 3CC4A 3OY9A 1RABB 3REAB 1M27C 3MCAB 2WSEE 2QEXT 2MWOA 3PE0A 3A8GB 2RHUA 3CCRQ 3M0RA 3WXMB 4A54A 2QGFB 2X3XD 2QQRA 3FLGA 4OMLA 1JB0E 4Z8AA 5D6YA 1VQ8Q 1UTIA 4J9HA 4HCCA 1VQ4Q 1IZ6A 4LUEA 2BIVA 2CP5A 2D9TA 2KT1A 5LJ5h 3SWNA 1M3BA 4BE1A 1UHCA 1LVKA 3JCMc 1VQOT 2EYZA 3ME9A 1ZBJA 1N8RU 3CC7T 1AVZC 3C0CA 1YJ9A 5HCKA 1TXQA 2K5IA 4C92B 2LT4A 2BTTA 4E2FB 5DLOA 2E5KA 1JO8A 1N5ZA 4M7AB 2E3HA 1I4K1 2ATCB 4M78E 4ORZA 3OMCA 3SB2A 1M9SA 3CCJT 2DF6A 2P0KA 4DA4A 2DMOA 1D1AA 3UWNA 2YXYA 2HBPA 4J9EA 3TEEA 1GXIE 5FU7C 2JNGA 3JCMd 4ZTJA 3THKA 3E9FA 1R0BG 1M8VA 4MZMA 1GFDA 1G83A 5FWCA 3REBB 2DBMA 2DL8A 4HCZA 3PTAA 3M58A 1PCXA 1WIEA 2GTOA 4NS5A 1YBYA 1QWEA 2AZSA 2ECZA 2BE7D 3PMTA 4WF2A 3QKJA 3MP8A 2KAFA 1ZA1B 4J9IA 2H3JA 2RJDA 2DVJA 2KT8A 4FIBA 2EQIA 2LNHB 1VQKA 2ZCFB 3DKMA 1Z9QA 2COYA 3BW1A 2QA4T 4FYVB 4M7DF 4F7UF 3BFMA 3OW2A 2KNBB 3JCMh 5GAOn 1VQ6A 4X9DA 3CPWS 4PJOD 1K8AR 1KQ2A 1WHHA 3JAME 1N27A 1YHQT 2CGHA 1H92A 1Y96A 5GANf 3HFNA 2JXBA 3G4SQ 3FEOA 1V76A 3T9NA 3LYIA 4M7DA 3INZA 3VS6A 2K4YA 5D7UA 1AWOA 1IREB 2L3QA 1KQSA 1B34A 5CQXA 2X35A 5LJ5j 2VGNA 1ZHIA 2QG9B 1IXDA 5J39A 2YDLA 4GBQA 3CCST 3H0FA 4OGEA 5CO7A 4C0DC 4A4GA 1YI2Q 1IB8A 4M77D 2DXUA 3EG3A 3FB9A 4GLMA 2F1LA 1KJWA 2EYQA 3JCMb 4ELZC 2ZPFB 1WXTA 2I2LA 1I5LA 5KE2A 1PKSA 1UEBA 2ED1A 3RDVA 1PM3A 2GGRA 2HNIA 2CZ6B 2KRNA 3CPFA 3CD6Q 3G1JA 4IUQA 5CVIA 2VYTA 2L3SA 3PGGA 1W2BP 1WXUA 3OS1A 5HKCA 4XU2A 3OYJA 2ENMA 4FW2A 1NLOC 1TOVA 1T3LA 1X69A 5FU6C 3C12A
chains in the Genus database with same CATH topology
2DL5A 2ESWA 1J3TA 2RF0A 1V1CA 4M4ZA 2L0AA 2FPDA 1FMKA 2DRMA 1KIKA 4J9BA 1ZX6A 2KYMA 1CKBA 4RTYA 1UJYA 2RQTA 2KYBA 1YCSB 1SRMA 2DL4A 1GCQA 1UHFA 2BZYA 2CT3A 2DM1A 2HBWA 4J9GA 2K9GA 2JM8A 2O31A 2F2VA 2JMAA 2EKHA 1PKTA 2DL7A 3VS2A 2LX7A 1CKAA 2GBQA 2BZXA 4ZNXA 2LP5A 2RQUA 2KXDA 2K3BA 4J9DA 1KSWA 4Z88A 1Z9ZA 3UATA 2O9VA 1QCFA 4OMMA 1VA7A 3R6NA 2NUZA 2MIOA 1K0XA 1AEYA 3VS5A 1BB9A 1RLQC 2XMFA 1YWPA 3I9QA 4AFZC 4RTWA 2A36A 4CC4B 2J05A 3CQTA 3VS7A 3QWYA 2KE9A 4D8KA 2YUNA 4R0KA 1K76A 2FEIA 2IIMA 2LJ3A 1OEBA 2JMCA 2RPNA 1I07A 1HJDA 2VKNA 1B07A 1T0HA 2V1RA 4RTUA 2D0NA 4AG2C 2AK5A 2AZVA 1BU1A 1QLYA 1EFNA 2DLPA 1ZUUA 2J7IA 4HVUA 2YSQA 5IHNA 2DRKA 2RQVA 3NGPA 5ECAA 2JW4A 1M30A 1T3SA 3O5ZA 3EG0A 2FRYA 5FW9A 1Y57A 4CC2A 2JS0A 2CH4W 2NWMA 5IXBA 3SEMA 1YP5A 2LQNA 2DE0X 3I35A 1OV3A 1OOTA 4LE9A 1ZUKA 2RQWA 3M0QA 1KFZA 2D8JA 2EW3A 4D8DA 3VS4A 1ZSGA 2W10A 4K11A 3H0HA 1ARKA 1S1NA 1ZUYA 4OMNA 3SHWA 1NEGA 2KEAA 4KRTA 1VYTA 2EPDA 1BK2A 4JZ3A 1CSKA 1NYFA 2B86A 4FSSA 1WA7A 1M3AA 1SEMA 1RLPC 1AWXA 2GQIA 3LH5A 1NEBA 5FWBA 1LCKA 5L23A 2F2WA 1QWFA 2KRSA 2J6FA 2OAWA 2O9SA 3VRYA 2VWFA 1K0SA 1AWJA 4AFUC 3EG1A 3H41A 1B3QA 4F14A 2YUOA 1UDLA 2K6DA 4RUGA 2HSPA 1K1ZA 2CH4A 2RN8A 2ROTA 1UJ0A 2A37A 1X27A 4AFSC 1E6GA 1TG0A 1GBRA 1W1FA 2I0NA 4RTZA 2EBPA 4JZ4A 3A98A 2CT4A 3NHNA 1ABOA 1VYVA 1W6XA 1H3HA 2CUDA 2CREA 2D1XA 1UECA 1X6BA 2FO0A 3EHRA 3VS3A 5IHIA 4CC7A 1YWOA 3RNJA 1PHTA 1PRLC 1WYXA 4CC3A 2BZ8A 4JJBA 2JS2A 1VYUA 2J06A 2J6KA 2FPFA 1XOVA 2D8HA 4RTTA 1Y0MA 4OMPA 1WX6A 1U5SA 1JQQA 1GCQC 2FG0A 2LQWA 1U3OA 3M0TA 3NPFA 3TVTA 2W0ZA 2RNAA 4WCIA 2PZ1A 2ABLA 1MV3A 1X6GA 1WI7A 2SRCA 1K4US 2G6FX 1HD3A 2YUPA 2DILA 1W70A 2K2MA 4HCKA 3JV3A 4X1VA 1PWTA 1PRMC 1UFFA 2CUBA 3VRZA 1ZLMA 2C0TA 1A0NB 2EYYA 2EYXA 2V1QA 2O88A 1PNJA 2C0IA 2P4RA 2DBKA 2GNCA 3GBQA 3REAB 1M27C 1UGVA 2KGTA 2CDTA 2DYBA 3PE0A 4ESRA 3M0RA 3H0IA 4JJDA 4Z89A 1X43A 2X3XD 2RQRA 1JEGA 2KR3A 4Z8AA 4LNPA 4OMLA 1UTIA 2HCKA 4J9HA 4DEXA 3I5RA 1YN8A 2LMJA 2YT6A 1NG2A 2EGEA 4LUEA 2KT1A 1FYNA 3ULRB 2M51A 2RMOA 3TSWA 1M3CA 1ABQA 1M3BA 1UHCA 2AKLA 2JTEA 2EYZA 1ZBJA 2ROLA 2FPEA 1GFCA 2KXCA 2EVRA 1TUDA 1AVZC 3C0CA 1GL5A 5HCKA 1GCPA 2K7AA 2MCNA 4Y92A 2BTTA 2EGCA 1TUCA 1QKXA 1RUWA 1HSQA 2E5KA 1JO8A 3QWXX 1X2KA 1N5ZA 2DNUA 2SEMA 2VVKA 4ORZA 1AZGB 2KROA 1SSHA 2DF6A 1AD5A 2DMOA 3FJ5A 4QT7A 4HVVA 3I5SA 1I0CA 1NM7A 1T0JA 1QKWA 2M0YA 4J9EA 1I1JA 1U06A 4HXJA 4E6RA 3THKA 2AKKA 2DX1A 4AG1C 1GFDA 1G83A 2J6OA 4JJCA 1UE9A 3RBBB 5FWCA 3REBB 2DBMA 2DL8A 1AZEA 1WIEA 2GTOA 3EHQA 1SHFA 5I22A 3EGUA 3M0SA 1NLPC 1QWEA 2AZSA 2ECZA 2O2OA 4RTXA 4DEYA 2JM9A 4J9CA 1M8MA 4OMOA 3UA6A 3EG2A 4J9IA 1MUZA 4JPBW 2X3WD 1JXOA 2DVJA 2QDLA 2EYWA 2KT8A 3M0PA 2EQIA 2LNHB 4OMQA 1WDXA 5I11A 1UUEA 1Z9QA 3VS0A 1H8KA 2CSQA 5GJVB 2C0OA 1GRIA 1SHGA 2DA9A 1SRLA 2A08A 2KNBB 4IIMA 1MV0B 3PVLA 1G2BA 2CSIA 3ZL7C 5IXFA 4EIKA 2OJ2A 4LN2A 4RTVA 2EGAA 1H92A 3KFVA 2JXBA 5GJWB 3VS6A 5EC7A 3VS1A 1NYGA 1AWOA 2YUQA 2F2XA 2L3QA 2GTJA 3TSZA 2LJ1A 2A28A 4AFQC 2LJ0A 3M0UA 5IH2A 1E7OA 2LCSA 3UA7A 3U23A 4J9FA 2HEQA 1JU5C 2LZ6B 2OI3A 2PNIA 2YDLA 4GBQA 2H8HA 3H0FA 1WFWA 1RI9A 1K9AA 4A63B 1BBZA 2DJQA 2L2PA 1JXMA 1IO6A 3EG3A 2ED0A 4GLMA 1KJWA 1AOJA 2KBTA 1OPKA 1AWWA 1WXTA 1X2QA 1PKSA 1E6HA 2KRMA 1UG1A 4F16A 3PVQA 3UF4A 2ED1A 2GGRA 1WXBA 2L3PA 1SPKA 2KRNA 1WLPB 1YNZA 2L3SA 2DL3A 2MOXA 2FRWA 1GBQA 1WXUA 4F17A 2HDAA 2ENMA 5IHKA 2JT4A 2K79A 1NLOC 1OPLA 4LUDA 2PTKA 1T3LA 1X69A 3IQLA 4HVWA 3NMZC 4IIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL5 A;  2ESW A;  1J3T A;  2RF0 A;  1V1C A;  4M4Z A;  2L0A A;  2FPD A;  1FMK A;  2DRM A;  1KIK A;  4J9B A;  1ZX6 A;  2KYM A;  1CKB A;  4RTY A;  1UJY A;  2RQT A;  2KYB A;  1YCS B;  1SRM A;  2DL4 A;  1GCQ A;  1UHF A;  2BZY A;  2CT3 A;  2DM1 A;  2HBW A;  4J9G A;  2K9G A;  2JM8 A;  2O31 A;  2F2V A;  2JMA A;  2EKH A;  1PKT A;  2DL7 A;  3VS2 A;  2LX7 A;  1CKA A;  2GBQ A;  2BZX A;  4ZNX A;  2LP5 A;  2RQU A;  2KXD A;  2K3B A;  4J9D A;  1KSW A;  4Z88 A;  1Z9Z A;  3UAT A;  2O9V A;  1QCF A;  4OMM A;  1VA7 A;  3R6N A;  2NUZ A;  2MIO A;  1K0X A;  1AEY A;  3VS5 A;  1BB9 A;  1RLQ C;  2XMF A;  1YWP A;  3I9Q A;  4AFZ C;  4RTW A;  2A36 A;  4CC4 B;  2J05 A;  3CQT A;  3VS7 A;  3QWY A;  2KE9 A;  4D8K A;  2YUN A;  4R0K A;  1K76 A;  2FEI A;  2IIM A;  2LJ3 A;  1OEB A;  2JMC A;  2RPN A;  1I07 A;  1HJD A;  2VKN A;  1B07 A;  1T0H A;  2V1R A;  4RTU A;  2D0N A;  4AG2 C;  2AK5 A;  2AZV A;  1BU1 A;  1QLY A;  1EFN A;  2DLP A;  1ZUU A;  2J7I A;  4HVU A;  2YSQ A;  5IHN A;  2DRK A;  2RQV A;  3NGP A;  5ECA A;  2JW4 A;  1M30 A;  1T3S A;  3O5Z A;  3EG0 A;  2FRY A;  5FW9 A;  1Y57 A;  4CC2 A;  2JS0 A;  2CH4 W;  2NWM A;  5IXB A;  3SEM A;  1YP5 A;  2LQN A;  2DE0 X;  3I35 A;  1OV3 A;  1OOT A;  4LE9 A;  1ZUK A;  2RQW A;  3M0Q A;  1KFZ A;  2D8J A;  2EW3 A;  4D8D A;  3VS4 A;  1ZSG A;  2W10 A;  4K11 A;  3H0H A;  1ARK A;  1S1N A;  1ZUY A;  4OMN A;  3SHW A;  1NEG A;  2KEA A;  4KRT A;  1VYT A;  2EPD A;  1BK2 A;  4JZ3 A;  1CSK A;  1NYF A;  2B86 A;  4FSS A;  1WA7 A;  1M3A A;  1SEM A;  1RLP C;  1AWX A;  2GQI A;  3LH5 A;  1NEB A;  5FWB A;  1LCK A;  5L23 A;  2F2W A;  1QWF A;  2KRS A;  2J6F A;  2OAW A;  2O9S A;  3VRY A;  2VWF A;  1K0S A;  1AWJ A;  4AFU C;  3EG1 A;  3H41 A;  1B3Q A;  4F14 A;  2YUO A;  1UDL A;  2K6D A;  4RUG A;  2HSP A;  1K1Z A;  2CH4 A;  2RN8 A;  2ROT A;  1UJ0 A;  2A37 A;  1X27 A;  4AFS C;  1E6G A;  1TG0 A;  1GBR A;  1W1F A;  2I0N A;  4RTZ A;  2EBP A;  4JZ4 A;  3A98 A;  2CT4 A;  3NHN A;  1ABO A;  1VYV A;  1W6X A;  1H3H A;  2CUD A;  2CRE A;  2D1X A;  1UEC A;  1X6B A;  2FO0 A;  3EHR A;  3VS3 A;  5IHI A;  4CC7 A;  1YWO A;  3RNJ A;  1PHT A;  1PRL C;  1WYX A;  4CC3 A;  2BZ8 A;  4JJB A;  2JS2 A;  1VYU A;  2J06 A;  2J6K A;  2FPF A;  1XOV A;  2D8H A;  4RTT A;  1Y0M A;  4OMP A;  1WX6 A;  1U5S A;  1JQQ A;  1GCQ C;  2FG0 A;  2LQW A;  1U3O A;  3M0T A;  3NPF A;  3TVT A;  2W0Z A;  2RNA A;  4WCI A;  2PZ1 A;  2ABL A;  1MV3 A;  1X6G A;  1WI7 A;  2SRC A;  1K4U S;  2G6F X;  1HD3 A;  2YUP A;  2DIL A;  1W70 A;  2K2M A;  4HCK A;  3JV3 A;  4X1V A;  1PWT A;  1PRM C;  1UFF A;  2CUB A;  3VRZ A;  1ZLM A;  2C0T A;  1A0N B;  2EYY A;  2EYX A;  2V1Q A;  2O88 A;  1PNJ A;  2C0I A;  2P4R A;  2DBK A;  2GNC A;  3GBQ A;  3REA B;  1M27 C;  1UGV A;  2KGT A;  2CDT A;  2DYB A;  3PE0 A;  4ESR A;  3M0R A;  3H0I A;  4JJD A;  4Z89 A;  1X43 A;  2X3X D;  2RQR A;  1JEG A;  2KR3 A;  4Z8A A;  4LNP A;  4OML A;  1UTI A;  2HCK A;  4J9H A;  4DEX A;  3I5R A;  1YN8 A;  2LMJ A;  2YT6 A;  1NG2 A;  2EGE A;  4LUE A;  2KT1 A;  1FYN A;  3ULR B;  2M51 A;  2RMO A;  3TSW A;  1M3C A;  1ABQ A;  1M3B A;  1UHC A;  2AKL A;  2JTE A;  2EYZ A;  1ZBJ A;  2ROL A;  2FPE A;  1GFC A;  2KXC A;  2EVR A;  1TUD A;  1AVZ C;  3C0C A;  1GL5 A;  5HCK A;  1GCP A;  2K7A A;  2MCN A;  4Y92 A;  2BTT A;  2EGC A;  1TUC A;  1QKX A;  1RUW A;  1HSQ A;  2E5K A;  1JO8 A;  3QWX X;  1X2K A;  1N5Z A;  2DNU A;  2SEM A;  2VVK A;  4ORZ A;  1AZG B;  2KRO A;  1SSH A;  2DF6 A;  1AD5 A;  2DMO A;  3FJ5 A;  4QT7 A;  4HVV A;  3I5S A;  1I0C A;  1NM7 A;  1T0J A;  1QKW A;  2M0Y A;  4J9E A;  1I1J A;  1U06 A;  4HXJ A;  4E6R A;  3THK A;  2AKK A;  2DX1 A;  4AG1 C;  1GFD A;  1G83 A;  2J6O A;  4JJC A;  1UE9 A;  3RBB B;  5FWC A;  3REB B;  2DBM A;  2DL8 A;  1AZE A;  1WIE A;  2GTO A;  3EHQ A;  1SHF A;  5I22 A;  3EGU A;  3M0S A;  1NLP C;  1QWE A;  2AZS A;  2ECZ A;  2O2O A;  4RTX A;  4DEY A;  2JM9 A;  4J9C A;  1M8M A;  4OMO A;  3UA6 A;  3EG2 A;  4J9I A;  1MUZ A;  4JPB W;  2X3W D;  1JXO A;  2DVJ A;  2QDL A;  2EYW A;  2KT8 A;  3M0P A;  2EQI A;  2LNH B;  4OMQ A;  1WDX A;  5I11 A;  1UUE A;  1Z9Q A;  3VS0 A;  1H8K A;  2CSQ A;  5GJV B;  2C0O A;  1GRI A;  1SHG A;  2DA9 A;  1SRL A;  2A08 A;  2KNB B;  4IIM A;  1MV0 B;  3PVL A;  1G2B A;  2CSI A;  3ZL7 C;  5IXF A;  4EIK A;  2OJ2 A;  4LN2 A;  4RTV A;  2EGA A;  1H92 A;  3KFV A;  2JXB A;  5GJW B;  3VS6 A;  5EC7 A;  3VS1 A;  1NYG A;  1AWO A;  2YUQ A;  2F2X A;  2L3Q A;  2GTJ A;  3TSZ A;  2LJ1 A;  2A28 A;  4AFQ C;  2LJ0 A;  3M0U A;  5IH2 A;  1E7O A;  2LCS A;  3UA7 A;  3U23 A;  4J9F A;  2HEQ A;  1JU5 C;  2LZ6 B;  2OI3 A;  2PNI A;  2YDL A;  4GBQ A;  2H8H A;  3H0F A;  1WFW A;  1RI9 A;  1K9A A;  4A63 B;  1BBZ A;  2DJQ A;  2L2P A;  1JXM A;  1IO6 A;  3EG3 A;  2ED0 A;  4GLM A;  1KJW A;  1AOJ A;  2KBT A;  1OPK A;  1AWW A;  1WXT A;  1X2Q A;  1PKS A;  1E6H A;  2KRM A;  1UG1 A;  4F16 A;  3PVQ A;  3UF4 A;  2ED1 A;  2GGR A;  1WXB A;  2L3P A;  1SPK A;  2KRN A;  1WLP B;  1YNZ A;  2L3S A;  2DL3 A;  2MOX A;  2FRW A;  1GBQ A;  1WXU A;  4F17 A;  2HDA A;  2ENM A;  5IHK A;  2JT4 A;  2K79 A;  1NLO C;  1OPL A;  4LUD A;  2PTK A;  1T3L A;  1X69 A;  3IQL A;  4HVW A;  3NMZ C;  4IIO A; 
#chains in the Genus database with same CATH topology
 6AT1 B;  2DL5 A;  2ESW A;  1VQM A;  1I5O B;  2L0A A;  2DRM A;  5GAN h;  4JS4 A;  4HKE A;  5IN1 A;  1TU0 B;  1V29 B;  1ZX6 A;  4C92 E;  2JZ2 A;  3EG9 A;  2ZAE A;  1VQ8 T;  3QZ9 B;  4M77 F;  2X9H A;  4WTO B;  1M90 C;  3DB4 A;  2EFI A;  4ANJ A;  1VQP T;  3OYK A;  1UHF A;  1QCO A;  5FLX E;  4M7A E;  2DM1 A;  2HBW A;  2P0P A;  2XDD A;  2DL7 A;  3L2R A;  3VS2 A;  2LNV A;  1CKA A;  2GBQ A;  1OI1 A;  1LPL A;  2JUF A;  3CBM A;  3MET A;  4J9D A;  3OS0 A;  4OB0 B;  3HHT B;  3TCJ A;  1O75 A;  4XTU A;  1Z9Z A;  3UAT A;  2MWP A;  3R6N A;  2NUZ A;  1K0X A;  2DVE A;  1U1S A;  3QYG B;  3VS5 A;  1WGS A;  4BI4 A;  1G3W A;  3I9Q A;  4AFZ C;  1ACM B;  2LRQ A;  2WAC A;  4CC4 B;  4DBR A;  2J05 A;  3VS7 A;  3M57 A;  5LJ3 f;  2YUN A;  2LJ3 A;  3EGX A;  5GAN 8;  2ZPG B;  4IUR A;  3OYH A;  4AG2 C;  1VQ5 T;  4MDW A;  3ER0 A;  4J5Y A;  1BU1 A;  1ZUU A;  2GFU A;  3HPW A;  3I55 T;  1BI2 A;  1WNL A;  3CXC A;  3NGP A;  3JB9 G;  1Q7Y C;  1T3S A;  4M78 F;  4A4H A;  3JCM Q;  2A3L A;  2RK2 A;  1KD1 R;  3SEM A;  2DO3 A;  3I35 A;  2HKN A;  2NUP A;  2YRD A;  1FMW A;  3OYB A;  2FB7 A;  4J83 A;  4PKC C;  1WHL A;  1KFZ A;  3CME Q;  2QQA A;  4XQ3 A;  1K73 R;  3HTR A;  2EW3 A;  2COZ A;  4FSX A;  1VQ7 Q;  4M7D C;  1ZUY A;  4M78 A;  2DPP B;  4PFO A;  2KEA A;  4N0A A;  4Y28 E;  1YJW Q;  1RAF B;  1VYT A;  3KUF A;  1N8R C;  3G4S T;  2AHJ B;  4PJO B;  5D6X A;  2RO0 A;  2GQI A;  3LH5 A;  5FWB A;  1VQN T;  1QWF A;  5KE3 A;  2VWF A;  3FIF A;  1AWJ A;  3EG1 A;  3H41 A;  2YUO A;  4RUG A;  5HY6 A;  2CP7 A;  3CCU Q;  2M02 A;  2HSP A;  1TTH B;  4FYX B;  3M5A A;  1UJ0 A;  1M90 R;  3VYH B;  2WSF E;  2MPX C;  1E6G A;  3QZ5 B;  3QDF A;  2QEX A;  1VQ9 Q;  1W1F A;  2I0N A;  2EBP A;  2E4H A;  3C95 A;  1ZSZ C;  4J6Y A;  4RMO A;  5GAN 5;  5A0G A;  2LTO A;  2CRE A;  2OTJ Q;  5GMK h;  1D1C A;  5KYW B;  7AT1 B;  5GAO r;  2BUD A;  3EHR A;  1VQO A;  1WQ7 A;  3CCL Q;  4ZGJ B;  2JN0 A;  3G6E Q;  3CC2 Q;  3CC7 A;  2IPO B;  2BZ8 A;  2BE9 B;  2BKD N;  1VYU A;  2FPF A;  3JB9 J;  1Y0M A;  3JCM X;  4EDU A;  3X20 B;  3PNW C;  4KH1 B;  4XU1 A;  4FT2 A;  2RNA A;  2CP0 A;  3CCJ A;  2ZPI B;  1X6G A;  4OB2 B;  1K4U S;  2DIL A;  5KCO A;  3L2U A;  2RH2 A;  3MP1 A;  4UC4 A;  1PRM C;  2CUB A;  4M77 C;  3VRZ A;  2C0T A;  1JJ2 P;  2JTM A;  4ZTF A;  1B7T A;  5CR2 A;  5GAM e;  1NJI R;  2LDM A;  2DTI A;  2C06 A;  2V1Q A;  1RAH B;  2FL7 A;  1H3Z A;  1M1K C;  3GBQ A;  3HL8 A;  2CDT A;  1I81 A;  3M59 A;  2YLB A;  4Z89 A;  1X43 A;  2RQR A;  3MHX A;  2KQW A;  4TVR A;  2AT1 B;  4C92 F;  2LMJ A;  3QHS A;  3GPL A;  3ULR B;  1QVG A;  3EFO B;  3TSW A;  4BB7 A;  2QA4 A;  4M7A F;  1QVF S;  4BI3 A;  3A8M B;  2ROL A;  4LDY A;  5A0L A;  2EVR A;  1QP3 A;  3P8H A;  1N8R R;  1M1F A;  1GL5 A;  2K7A A;  4OB1 B;  4Y92 A;  2MCN A;  2EGC A;  1TUC A;  5FRN A;  1QKX A;  1RUW A;  1X2K A;  1YIT Q;  4GLK A;  1YHQ A;  1JJ2 S;  3URG A;  3TRE A;  4M7A A;  3LX7 A;  3OYL A;  3OYD A;  4HVV A;  1W4S A;  1VIF A;  3CEY A;  4QKU A;  1OU8 A;  4PJO E;  3PIP A;  1I1J A;  1U06 A;  4JJN K;  1M1G A;  2HSE B;  4JRQ A;  2AKK A;  1MMG A;  4M78 C;  4ATO A;  2DX1 A;  4AG1 C;  4HT9 A;  3CCS A;  3CME T;  4N0A C;  1Q81 C;  3A5Z B;  1YIJ T;  4E7S A;  4QQG A;  1VQ7 T;  3EGU A;  3M0S A;  1NLP C;  5LJ5 f;  4BY6 C;  4GY5 A;  1KHC A;  1ZBX A;  4RKU E;  4J9C A;  1YJW T;  4OMO A;  2K5L A;  3JB9 I;  3EG2 A;  1IHW A;  4E7L A;  2RI2 A;  4JPB W;  1JXO A;  3OSS C;  2EYW A;  3M0P A;  4RCC A;  1UUE A;  1WHJ A;  3VS0 A;  4M78 G;  4BUG A;  1K9M U;  4M77 E;  1EX4 A;  1RAD B;  1OZ2 A;  5J3B A;  2DA9 A;  3HRU A;  1MV0 B;  3PVL A;  1XNI A;  1G3Y A;  2FYK A;  1IHV A;  1KQ1 A;  4EIK A;  2OJ2 A;  1X6O A;  4RTV A;  3BE3 A;  2EGA A;  3ZBD A;  5J26 A;  1RAE B;  3TQ7 P;  1Q7Y U;  5C0M A;  4X9C A;  1VQ8 A;  5GJW B;  4XTX A;  2OTJ T;  1VQP A;  4XK8 E;  3JCM J;  5A0D A;  3DLM A;  3VS1 A;  4MZT A;  3VUZ A;  3G71 Q;  2GTJ A;  2MYS A;  3M0U A;  1BKB A;  1F1B B;  2LQK A;  1E7O A;  3OYC A;  3UA7 A;  4NOY A;  4J9F A;  2MAM A;  3CCL T;  3QG1 A;  3WVD B;  4XU3 A;  3JB9 D;  3CC2 T;  2XIC A;  2EAY A;  2VXE A;  1RI9 A;  2JVV A;  3LGL A;  2PUK B;  4MZP A;  2RHZ A;  3CCM Q;  4V2S A;  5IAY A;  4C8Q G;  2ED0 A;  4ZGD B;  1VUB A;  2KBT A;  4DOV A;  3OW2 P;  5DLQ E;  4PJN A;  5LJ3 g;  1MMA A;  3X25 B;  4KH0 B;  1U1T A;  1C6V X;  1M4Z A;  3L2W A;  2ZPE B;  1E6H A;  2KRM A;  3JB9 H;  3NTK A;  3PVQ A;  3UF4 A;  4J7F A;  3OB9 A;  3JCM f;  2DK3 A;  1JRI A;  3CC4 Q;  1WXB A;  2X4J A;  5EG2 A;  1PC0 A;  1WLP B;  4C0F A;  3KXT A;  2DET A;  2XI9 A;  4N4I A;  2CS7 A;  2MOX A;  2FRW A;  1GBQ A;  1C1A A;  2JJ9 A;  4ZN1 A;  1KQS P;  4LUD A;  2QGG A;  1VQ5 A;  1Q86 U;  1J3T A;  1S72 Q;  2FPD A;  1FMK A;  1KIK A;  2PQW A;  4M75 D;  3I55 A;  1SSF A;  4XU0 A;  2KMT A;  2KYM A;  5GAN e;  1UJY A;  2KYB A;  1D3B B;  1I8F A;  3FDR A;  1DJ7 B;  2K9G A;  4II1 A;  1HK9 A;  2F2V A;  3CCE T;  3RKW A;  3I56 Q;  3P8B B;  2LX7 A;  2DKG A;  1QQJ A;  2ZPH B;  2QTX A;  4C92 C;  2ZPB B;  4JLI A;  3V8L A;  2L8D A;  3SD4 A;  3CMA Q;  1BIA A;  2EJG A;  4M7A C;  1KSW A;  1YIT T;  2YHT A;  1VA7 A;  2M1H A;  4J6W A;  2MIO A;  4YTL A;  3G4S A;  5FRM A;  1BB9 A;  3OYE A;  1KQS S;  2YRV A;  1D0Z A;  2E6N A;  4RTW A;  1VQN A;  2A36 A;  1VQL T;  2QI2 A;  1G3T A;  3CQT A;  3QWY A;  2KE9 A;  2Y4Y A;  4R0K A;  2FEI A;  2HMA A;  1LJO A;  4M7A G;  2JMC A;  2RPN A;  4F7U A;  2DZC A;  4BE2 A;  1M1K U;  3J7A F;  1HJD A;  4PJL A;  2QAZ A;  2HL5 C;  2D0N A;  3MJX A;  1EFN A;  1X75 C;  5GAN 6;  1G5V A;  2HQH A;  2CKK A;  2F5K A;  2KSS A;  2HZY A;  5GAN 7;  1RAA B;  1Y71 A;  2FRY A;  5FW9 A;  4DOW A;  3VYG A;  5IXB A;  2LQN A;  2DE0 X;  1OV3 A;  2WSC E;  4LE9 A;  2CP3 A;  2RQW A;  4O5V A;  4PJO F;  2QK0 A;  3SWN B;  5CK9 A;  4O6J A;  4K11 A;  3M54 A;  3H0H A;  1G8X A;  1ZSZ A;  3RMS A;  1BI1 A;  3R6O A;  4LDU A;  2LVM A;  4KUI A;  2VC8 A;  4KRT A;  2LQ8 A;  2EPD A;  3HRS A;  4FSS A;  2DEU A;  5I21 A;  3JCM V;  5KYN A;  4XTY A;  5KYY A;  1WPY A;  5L23 A;  2F2W A;  1OU9 A;  3VRY A;  4PJO A;  1K0S A;  1HYO A;  4MML A;  3CXC P;  4BDZ A;  3PT9 A;  1PG5 B;  3CCR T;  2E64 A;  4PNO A;  5LJ3 e;  5DY9 A;  1BYM A;  1QVP A;  1Q81 U;  1K1Z A;  1Q82 C;  1VQ4 T;  2ROT A;  4LD9 K;  1QCN A;  5KYX A;  1TG0 A;  3MEW A;  2RJE A;  2AIR B;  1HXD A;  4RTZ A;  2NUT A;  2LX9 A;  4LDW A;  2CYZ B;  3L2Q A;  1VYV A;  2MK5 A;  1H3H A;  3EFR A;  3VU3 C;  2ZZD A;  2M9U A;  4KGX B;  3UDC A;  4M77 A;  3GF5 A;  5AYF A;  2X4Y A;  5GMK e;  1VQM Q;  2RI5 A;  3VS3 A;  2K57 A;  5IHI A;  4A4K A;  1W2B S;  5KYW A;  5GAM g;  1PRL C;  2QQ9 A;  4B9W A;  4JJB A;  1BIB A;  5I2M A;  1M2V A;  1JQQ A;  2FG0 A;  2LQW A;  2XU8 A;  4E47 A;  1U3O A;  4L5G A;  4BAC A;  1K9M C;  2PVG B;  4WCI A;  3L42 A;  4LXC A;  3E19 A;  2X4W A;  1NPP A;  3ZFJ A;  2KDS A;  3DB3 A;  1OYX A;  3GLX A;  2CZ0 B;  2E41 A;  1HD3 A;  4M75 B;  3C4S A;  5LJ5 g;  4RG2 A;  3I56 T;  1QW1 A;  1Y96 B;  2D0Q B;  1RL2 A;  4EMK B;  4BE0 A;  2DJZ A;  1ZLM A;  2RD1 A;  3RKX A;  1TS9 A;  3CME A;  1U8R A;  4C0Z A;  1B34 B;  5GMK i;  2C0I A;  4JUV A;  2DBK A;  1YIJ A;  2VAS A;  2GNC A;  1VQ7 A;  3TU4 K;  2Y90 A;  4A4E A;  1YJW A;  2PUO B;  4ESR A;  3H0I A;  1RAI B;  1JEG A;  2KR3 A;  3VUB A;  1WHG A;  4L59 A;  3V8J A;  4DEX A;  1YJN Q;  1YN8 A;  2YT6 A;  2EGE A;  1FYN A;  4C8Q D;  3S6W A;  2AKL A;  5IT9 E;  2QAS A;  2FPE A;  3EFO A;  3VJP A;  3G7Z A;  5KYU B;  1KC8 C;  1GCP A;  2EQK A;  3RR6 A;  3OS5 A;  1HSQ A;  2HKQ B;  2P4T A;  4IUT A;  2DNU A;  1VQ9 A;  2SEM A;  2V8I A;  2V8J A;  1BI3 A;  2KRO A;  4C5G A;  1AHJ B;  1SSH A;  5HK3 A;  4M7D G;  4F7U G;  1AD5 A;  4E7Z A;  3RES A;  3EGD B;  1YI2 T;  2OTJ A;  4QT7 A;  1NM7 A;  1T0J A;  4DBH A;  3EG9 B;  1Q86 C;  3J80 E;  4HXJ A;  3AHU A;  3CCL A;  3RIR A;  3G6E A;  3CC2 A;  2J6O A;  1QVG P;  3M53 A;  4LDV A;  3QXE B;  1AZE A;  4MDX A;  3JCM g;  2DIQ A;  3CCQ Q;  3EHQ A;  1SHF A;  5I22 A;  4PL6 A;  5CQY A;  4RTX A;  3CD6 T;  1IGU A;  2JM9 A;  4PJO C;  1M8M A;  3UA6 A;  3JRZ A;  3OYM A;  2X3W D;  1RI0 A;  3MO8 A;  3GP8 A;  2CZ1 B;  1D0X A;  2VV5 A;  1PD0 A;  1H8K A;  2V26 A;  1UGS B;  2YWW A;  5GJV B;  3QBY A;  2C0O A;  1GRI A;  3QYH B;  2OTL Q;  1SHG A;  1K9M R;  2K3Y A;  3A1P A;  3MP6 A;  3V7C A;  4RG8 A;  1SRL A;  2A08 A;  2DXB A;  4QQ6 A;  4E7I A;  2F5T X;  2XK0 A;  1G2B A;  3H9N A;  3HFO A;  3ZL7 C;  2P0Q A;  4LN2 A;  3EGX B;  2IVW A;  1VQO Q;  1QVG S;  1Q7Y R;  3NTH A;  3O8V A;  4E7H A;  2JOY A;  3RUX A;  5EC7 A;  1NYG A;  1VIE A;  2YUQ A;  1R8O B;  2F2X A;  3CCE A;  3TSZ A;  2A28 A;  4AFQ C;  2DFU A;  1VOM A;  2HEQ A;  3OYG A;  2LZ6 B;  4OB3 B;  4M75 E;  1WFW A;  5CKD A;  2EQM A;  1OQK A;  3LH0 A;  1BBZ A;  4M77 G;  2L2P A;  2NUP B;  1IO6 A;  1SG5 A;  5LJ5 e;  1EIF A;  1OPK A;  2EJF A;  2XID A;  4VUB A;  1YIT A;  4PK4 A;  2EIF A;  5GAN g;  3QJY A;  1MND A;  5CAI A;  2PVD B;  1UG1 A;  3X26 B;  2M0O A;  4F16 A;  1NPR A;  3PIO A;  3OYY A;  2M16 A;  2H3E B;  2L3P A;  1VQL A;  4C92 A;  4OF1 A;  2KK4 A;  1Q82 U;  2LCC A;  3FRN A;  1TUG B;  4FYY B;  5DM7 R;  4F17 A;  2HDA A;  2K79 A;  1OPL A;  3GIB A;  2RF0 A;  4M4Z A;  2V8K A;  2QA4 Q;  1Q86 R;  2Z0W A;  1YFN A;  1CKB A;  4XAX B;  2R5M A;  2RQT A;  1YCS B;  1SRM A;  2O4X B;  2LC4 A;  3SDZ A;  3PFS A;  2CT3 A;  4J9G A;  1NBE B;  2Y4X A;  3C94 A;  2EKH A;  5CKH A;  2FHD A;  2GFA A;  2COW A;  3MKD A;  4Y91 A;  4ZGE B;  1XJW B;  1YHQ Q;  1WHK A;  3H6Z A;  2GQV A;  2RQU A;  3UPU A;  3GOX A;  2K3B A;  4C8Q B;  4ME7 A;  1WJS A;  4QQD A;  1OX9 A;  3N5B B;  5GAM d;  5L8R E;  1RAG B;  2X4X A;  4Z88 A;  2O9V A;  3CCU T;  4N4G A;  2RHY A;  2HAX A;  4KGV B;  3GNG A;  2HQE A;  3CCS Q;  1Q95 G;  2KI7 A;  3JCM e;  4J7I A;  1VQ9 T;  3QPH A;  3CCR A;  5GAO q;  3CCV Q;  3E2U A;  2IIM A;  1PSE A;  2MI6 A;  4CI0 C;  3BY7 A;  4DQ2 A;  1VQ4 A;  1I07 A;  5LL6 S;  3CCQ T;  2NYS A;  1B07 A;  1T0H A;  3CCM A;  5CKF A;  4DBQ A;  1M1K R;  2AK5 A;  4FW1 A;  2AZV A;  2R58 A;  1QLY A;  3M55 A;  2K3X A;  3LWH A;  2J7I A;  3S3N A;  4HVU A;  5CKE A;  4PJM A;  2DXT A;  3G6E T;  4KUL A;  2QQB A;  1M30 A;  9ATC B;  3O5Z A;  2QXF A;  3EG0 A;  1Y57 A;  1MNE A;  4CC2 A;  2JS0 A;  2E70 A;  2NWM A;  3V8K A;  3EAE A;  2OTL T;  4N4H A;  5FU7 B;  2A0F B;  2QDY B;  1ZUK A;  2DTH A;  3D7S B;  1KC8 U;  4JDS A;  2D8J A;  3QII A;  4IUV A;  1VQP Q;  1ZSG A;  4XTZ A;  1UGP B;  1S72 A;  1NEG A;  5KCH A;  3MEA A;  4J8O A;  1CSK A;  1NYF A;  1WA7 A;  1M3A A;  1OZ3 A;  1SEM A;  4JRK A;  1RLP C;  4A4F A;  1NEB A;  1LCK A;  2KRS A;  2J6F A;  2OAW A;  2O9S A;  3HKS A;  2GF7 A;  4AFU C;  4QVZ A;  3OA6 A;  3I56 A;  3JB9 F;  4EPC A;  4KT0 E;  1UDL A;  1WQW A;  2RHX A;  2CH4 A;  4M7D D;  3X24 B;  1MMD A;  1YJ9 Q;  1Q81 R;  3CMA A;  4AFS C;  3CPW P;  3JCM W;  2LT1 A;  1AT1 B;  1GBR A;  3OW2 S;  1ZA2 B;  4IUP A;  1TWB A;  1ZQ1 A;  3EFS A;  3A98 A;  2CT4 A;  4KGZ B;  1ABO A;  3L1A A;  2YLC A;  1W6X A;  1QP2 A;  5M9O A;  3M4G A;  2KVQ G;  2FVU A;  5HK0 A;  1UEC A;  3J81 E;  1VQ5 Q;  2E65 A;  3M4Y A;  3JSC A;  1YWO A;  3I55 Q;  4CC3 A;  2J06 A;  2J6K A;  4FU6 A;  3FC3 A;  3M56 A;  4JLG A;  1XOV A;  2D8H A;  4RTT A;  4M75 F;  4C0D B;  1SKU B;  4C92 G;  2X51 A;  3M0T A;  5GAN 2;  3NPF A;  4D6W A;  2W0Z A;  4C8Q E;  4F04 B;  2ABL A;  2L89 A;  1MV3 A;  1YI2 A;  5GAM j;  3QUI A;  4E7J A;  2SRC A;  2EWN A;  2G6F X;  3MEU A;  1VQK Q;  1W70 A;  3ASK A;  2E10 A;  3LGF A;  3VKI A;  2K2M A;  2RK1 A;  1PWT A;  4M75 A;  1A0N B;  2EYY A;  2EYX A;  1LOJ A;  2DIG A;  2MMP A;  4EMK A;  2HD0 A;  4IUU A;  2QQS A;  3A8H B;  4Q5W A;  2PU9 B;  1UGR B;  2QYZ A;  1VQ6 Q;  3HSB A;  4FL6 A;  1VQN Q;  1TSF A;  1UGV A;  2KGT A;  2RM4 A;  3CD6 A;  2L3R A;  3CPW A;  5FU6 B;  4FCY A;  2DYB A;  2XDP A;  3H8Z A;  3E1S A;  3MEV A;  5CKB A;  3OYI A;  4JJD A;  4HA8 A;  4LNP A;  1UGQ B;  2HCK A;  3I5R A;  2DZ9 A;  4C5H A;  1NG2 A;  5GAN d;  1MGQ A;  3L2V A;  4PJJ A;  2M51 A;  2RMO A;  1M3C A;  1ABQ A;  3AT1 B;  1KD1 C;  2JTE A;  2P84 A;  1MHN A;  4P5N A;  5C6S A;  3CCV T;  2RA2 A;  3JCM P;  1GFC A;  4OP0 A;  2KXC A;  2DD4 A;  1TUD A;  4RCB A;  1K73 C;  3RER A;  3QJ6 A;  4FYW B;  3G71 T;  1KG1 A;  4ZN3 A;  4FM4 B;  4EMG A;  5GAN 3;  3OYN A;  2EKO A;  5KYU A;  3QWX X;  2VVK A;  1AZG B;  3S3O A;  5FRO A;  1R77 A;  1PD1 A;  3FJ5 A;  3CCM T;  3I5S A;  1I0C A;  2M0Y A;  1QKW A;  3EGD A;  1P92 A;  4QVD A;  4KUD K;  4BDY A;  1WHM A;  4E6R A;  3A8O B;  1XQH A;  3SWN C;  1KK7 A;  4JJC A;  1UE9 A;  3RBB B;  2DEQ A;  3CC4 T;  2E3I A;  1KHI A;  1Y07 A;  2O2O A;  4DEY A;  2O01 E;  4B9X A;  5GAO m;  1MUZ A;  3L2Z A;  1FMV A;  2E6Z A;  2QDL A;  5GAN 4;  4OMQ A;  3ZEH A;  1WDX A;  5I11 A;  2PVO B;  4M78 D;  3CXC S;  1S72 T;  3RMQ A;  2CSQ A;  3WVE B;  2G3R A;  1LNX A;  2NLU A;  2L5Q A;  2FZK B;  2YRC A;  4OMF B;  3RKY A;  4LDX A;  3OMG A;  4HCB A;  1YJ9 T;  1K8A U;  1BCM A;  4IIM A;  3X28 B;  1OUL A;  4J6X A;  2CSI A;  5IXF A;  3Q1J A;  2E12 A;  1M2O A;  3DLL A;  4M7D B;  4HT8 A;  2VUB A;  4F7U B;  4AMC A;  3KFV A;  1YJN A;  3CMA T;  1W2B A;  2LJ1 A;  2LJ0 A;  5KH6 A;  5IH2 A;  1C0M A;  2LCS A;  3OS2 A;  3U23 A;  1JU5 C;  2OI3 A;  2PNI A;  1NJI C;  2H8H A;  3EH1 A;  5D6W A;  2EQU A;  3QO3 A;  5LJ3 d;  2DXC A;  2E1H A;  1K9A A;  4A63 B;  4JRP A;  2DJQ A;  1JXM A;  3S3M A;  1AOJ A;  2OX7 A;  2E5Q A;  3MPU B;  1AWW A;  1PSF A;  3CCU A;  1X2Q A;  5GAO p;  3E9G A;  2XG8 D;  1ZSZ B;  4M75 C;  1VQK T;  3BDU A;  1XTD A;  4EMK C;  1YIJ Q;  1D1B A;  1SPK A;  2F69 A;  3HP9 A;  4KBM B;  2B8A A;  5GMK m;  1YNZ A;  2CP2 A;  2DD5 A;  4JRI A;  2DL3 A;  5KYY B;  4C0G A;  3QSU A;  3SFM A;  8AT1 B;  5GAN j;  1WJQ A;  1Q82 R;  4CRI A;  5IHK A;  2JT4 A;  1VQ6 T;  3CCQ A;  3KBG A;  2PTK A;  3IQL A;  4HVW A;  3OYF A;  3NMZ C;  2VGM A;  4IIO A;  1V1C A;  2XKO C;  4BI8 B;  2VB6 A;  4XTW A;  5LJ3 h;  4J9B A;  4M75 G;  5GAO l;  1Y7X A;  3LLR A;  4NL2 A;  4RTY A;  5KYX B;  1FX7 A;  3VV0 A;  2DL4 A;  4XTV A;  4C8Q F;  1GCQ A;  4OGC A;  3LW5 E;  2BZY A;  3BDL A;  5AT1 B;  2JTF A;  2JM8 A;  4QW2 A;  2O31 A;  2JMA A;  2XDB A;  2O4X A;  1PKT A;  2NUT B;  3EH2 A;  4MMK A;  4R56 A;  2RJF A;  2OTL A;  2BZX A;  4ZNX A;  2OAU A;  2LP5 A;  3OQ5 A;  2KXD A;  4M77 B;  1WJR A;  2DER A;  2ZGW A;  4C8Q A;  3P8D A;  3PMI A;  3V7S A;  4C5E A;  2QEX Q;  1EZZ B;  1QCF A;  4OMM A;  1IGQ A;  3CBP A;  3A8L B;  1AEY A;  1M2V B;  2DTO A;  2FZC B;  1R0C B;  1RLQ C;  2XMF A;  1YWP A;  4PJO G;  2GCX A;  2K2V A;  4A53 A;  1N6A A;  4C92 D;  2RI3 A;  4D8K A;  1QVF P;  1K76 A;  2XHC A;  4M7A D;  4LD6 A;  1OEB A;  3CC7 Q;  1TH7 A;  2VKN A;  2VXF A;  2V1R A;  3FJP A;  4RTU A;  3OYA A;  4PFZ A;  1VQM T;  1MMN A;  2CP6 A;  2HQX A;  2DLP A;  3OBY A;  2YSQ A;  2HL3 A;  5IHN A;  2DRK A;  2RQV A;  1JBM A;  2IG0 A;  5ECA A;  2JW4 A;  5I2S A;  3CCJ Q;  1N9R A;  1KD1 U;  4M7D E;  1UB4 A;  2CH4 W;  3HRT A;  4F7U E;  1BCO A;  1FXX A;  1YP5 A;  5GMK l;  5CIU A;  1OOT A;  4DBF A;  3GNF B;  1K73 U;  2MF2 A;  1N9S A;  1NZ9 A;  3NTI A;  3M0Q A;  1G3S A;  4X34 A;  3UT1 A;  3V7R A;  4M78 B;  4D8D A;  1KC8 R;  2DAQ A;  3VS4 A;  2W10 A;  4NL3 A;  5CCA A;  1ARK A;  1FWZ A;  1S1N A;  5A2Q E;  3CCE Q;  4OMN A;  3SHW A;  1X01 A;  4BY6 B;  1BK2 A;  1SF9 A;  4JZ3 A;  5LJ3 j;  2B86 A;  2EQJ A;  4IKF A;  1AWX A;  4R55 A;  1M5Q 1;  1B3Q A;  4F14 A;  8ATC B;  1D0Y A;  4L6V 5;  2K6D A;  1IRX A;  4AT1 B;  2CZ7 B;  1M90 U;  5GAM f;  1YJN T;  1QVF A;  2RJC A;  1YCY A;  2RN8 A;  1RAC B;  4EMH A;  2R57 A;  2A37 A;  2EJ9 A;  4PLL A;  1X27 A;  1D3B A;  3NFC A;  1VQL Q;  3M9Q A;  3QDR B;  2KY9 A;  5GMK j;  4OVA A;  4FT4 A;  4JZ4 A;  3NHN A;  1JJ2 A;  2CUD A;  4Z02 A;  2FZG B;  2D1X A;  1X6B A;  2FO0 A;  2XD0 A;  1H64 1;  2QTV A;  2R5A A;  4B6M A;  4CC7 A;  3CBO A;  3CCV A;  4JS5 A;  3RNJ A;  1PHT A;  1WZO A;  1WYX A;  2JS2 A;  1BI0 A;  3G71 A;  4OMP A;  3LWI A;  1WX6 A;  2DYI A;  1U5S A;  4QVC A;  1GCQ C;  2RHI A;  3TVT A;  2PZ1 A;  5LJ5 d;  4C5I A;  1OX8 A;  2K5F A;  4PLI A;  4E7K A;  1O9S A;  1WI7 A;  1K8A C;  1QMC A;  2YUP A;  3OSV A;  2RB6 A;  2LCL A;  3F70 A;  4HCK A;  4ELY C;  3JV3 A;  4X1V A;  4BD3 A;  1UFF A;  1NJI U;  5GAM h;  4C8Q C;  2D6F A;  2A7Y A;  1NE8 A;  2O88 A;  1PNJ A;  1D09 B;  3OBW A;  2P4R A;  4PFP A;  3CC4 A;  3OY9 A;  1RAB B;  3REA B;  1M27 C;  3MCA B;  2WSE E;  2QEX T;  2MWO A;  3PE0 A;  3A8G B;  2RHU A;  3CCR Q;  3M0R A;  3WXM B;  4A54 A;  2QGF B;  2X3X D;  2QQR A;  3FLG A;  4OML A;  1JB0 E;  4Z8A A;  5D6Y A;  1VQ8 Q;  1UTI A;  4J9H A;  4HCC A;  1VQ4 Q;  1IZ6 A;  4LUE A;  2BIV A;  2CP5 A;  2D9T A;  2KT1 A;  5LJ5 h;  3SWN A;  1M3B A;  4BE1 A;  1UHC A;  1LVK A;  3JCM c;  1VQO T;  2EYZ A;  3ME9 A;  1ZBJ A;  1N8R U;  3CC7 T;  1AVZ C;  3C0C A;  1YJ9 A;  5HCK A;  1TXQ A;  2K5I A;  4C92 B;  2LT4 A;  2BTT A;  4E2F B;  5DLO A;  2E5K A;  1JO8 A;  1N5Z A;  4M7A B;  2E3H A;  1I4K 1;  2ATC B;  4M78 E;  4ORZ A;  3OMC A;  3SB2 A;  1M9S A;  3CCJ T;  2DF6 A;  2P0K A;  4DA4 A;  2DMO A;  1D1A A;  3UWN A;  2YXY A;  2HBP A;  4J9E A;  3TEE A;  1GXI E;  5FU7 C;  2JNG A;  3JCM d;  4ZTJ A;  3THK A;  3E9F A;  1R0B G;  1M8V A;  4MZM A;  1GFD A;  1G83 A;  5FWC A;  3REB B;  2DBM A;  2DL8 A;  4HCZ A;  3PTA A;  3M58 A;  1PCX A;  1WIE A;  2GTO A;  4NS5 A;  1YBY A;  1QWE A;  2AZS A;  2ECZ A;  2BE7 D;  3PMT A;  4WF2 A;  3QKJ A;  3MP8 A;  2KAF A;  1ZA1 B;  4J9I A;  2H3J A;  2RJD A;  2DVJ A;  2KT8 A;  4FIB A;  2EQI A;  2LNH B;  1VQK A;  2ZCF B;  3DKM A;  1Z9Q A;  2COY A;  3BW1 A;  2QA4 T;  4FYV B;  4M7D F;  4F7U F;  3BFM A;  3OW2 A;  2KNB B;  3JCM h;  5GAO n;  1VQ6 A;  4X9D A;  3CPW S;  4PJO D;  1K8A R;  1KQ2 A;  1WHH A;  3JAM E;  1N27 A;  1YHQ T;  2CGH A;  1H92 A;  1Y96 A;  5GAN f;  3HFN A;  2JXB A;  3G4S Q;  3FEO A;  1V76 A;  3T9N A;  3LYI A;  4M7D A;  3INZ A;  3VS6 A;  2K4Y A;  5D7U A;  1AWO A;  1IRE B;  2L3Q A;  1KQS A;  1B34 A;  5CQX A;  2X35 A;  5LJ5 j;  2VGN A;  1ZHI A;  2QG9 B;  1IXD A;  5J39 A;  2YDL A;  4GBQ A;  3CCS T;  3H0F A;  4OGE A;  5CO7 A;  4C0D C;  4A4G A;  1YI2 Q;  1IB8 A;  4M77 D;  2DXU A;  3EG3 A;  3FB9 A;  4GLM A;  2F1L A;  1KJW A;  2EYQ A;  3JCM b;  4ELZ C;  2ZPF B;  1WXT A;  2I2L A;  1I5L A;  5KE2 A;  1PKS A;  1UEB A;  2ED1 A;  3RDV A;  1PM3 A;  2GGR A;  2HNI A;  2CZ6 B;  2KRN A;  3CPF A;  3CD6 Q;  3G1J A;  4IUQ A;  5CVI A;  2VYT A;  2L3S A;  3PGG A;  1W2B P;  1WXU A;  3OS1 A;  5HKC A;  4XU2 A;  3OYJ A;  2ENM A;  4FW2 A;  1NLO C;  1TOV A;  1T3L A;  1X69 A;  5FU6 C;  3C12 A; 
#chains in the Genus database with same CATH homology
 2DL5 A;  2ESW A;  1J3T A;  2RF0 A;  1V1C A;  4M4Z A;  2L0A A;  2FPD A;  1FMK A;  2DRM A;  1KIK A;  4J9B A;  1ZX6 A;  2KYM A;  1CKB A;  4RTY A;  1UJY A;  2RQT A;  2KYB A;  1YCS B;  1SRM A;  2DL4 A;  1GCQ A;  1UHF A;  2BZY A;  2CT3 A;  2DM1 A;  2HBW A;  4J9G A;  2K9G A;  2JM8 A;  2O31 A;  2F2V A;  2JMA A;  2EKH A;  1PKT A;  2DL7 A;  3VS2 A;  2LX7 A;  1CKA A;  2GBQ A;  2BZX A;  4ZNX A;  2LP5 A;  2RQU A;  2KXD A;  2K3B A;  4J9D A;  1KSW A;  4Z88 A;  1Z9Z A;  3UAT A;  2O9V A;  1QCF A;  4OMM A;  1VA7 A;  3R6N A;  2NUZ A;  2MIO A;  1K0X A;  1AEY A;  3VS5 A;  1BB9 A;  1RLQ C;  2XMF A;  1YWP A;  3I9Q A;  4AFZ C;  4RTW A;  2A36 A;  4CC4 B;  2J05 A;  3CQT A;  3VS7 A;  3QWY A;  2KE9 A;  4D8K A;  2YUN A;  4R0K A;  1K76 A;  2FEI A;  2IIM A;  2LJ3 A;  1OEB A;  2JMC A;  2RPN A;  1I07 A;  1HJD A;  2VKN A;  1B07 A;  1T0H A;  2V1R A;  4RTU A;  2D0N A;  4AG2 C;  2AK5 A;  2AZV A;  1BU1 A;  1QLY A;  1EFN A;  2DLP A;  1ZUU A;  2J7I A;  4HVU A;  2YSQ A;  5IHN A;  2DRK A;  2RQV A;  3NGP A;  5ECA A;  2JW4 A;  1M30 A;  1T3S A;  3O5Z A;  3EG0 A;  2FRY A;  5FW9 A;  1Y57 A;  4CC2 A;  2JS0 A;  2CH4 W;  2NWM A;  5IXB A;  3SEM A;  1YP5 A;  2LQN A;  2DE0 X;  3I35 A;  1OV3 A;  1OOT A;  4LE9 A;  1ZUK A;  2RQW A;  3M0Q A;  1KFZ A;  2D8J A;  2EW3 A;  4D8D A;  3VS4 A;  1ZSG A;  2W10 A;  4K11 A;  3H0H A;  1ARK A;  1S1N A;  1ZUY A;  4OMN A;  3SHW A;  1NEG A;  2KEA A;  4KRT A;  1VYT A;  2EPD A;  1BK2 A;  4JZ3 A;  1CSK A;  1NYF A;  2B86 A;  4FSS A;  1WA7 A;  1M3A A;  1SEM A;  1RLP C;  1AWX A;  2GQI A;  3LH5 A;  1NEB A;  5FWB A;  1LCK A;  5L23 A;  2F2W A;  1QWF A;  2KRS A;  2J6F A;  2OAW A;  2O9S A;  3VRY A;  2VWF A;  1K0S A;  1AWJ A;  4AFU C;  3EG1 A;  3H41 A;  1B3Q A;  4F14 A;  2YUO A;  1UDL A;  2K6D A;  4RUG A;  2HSP A;  1K1Z A;  2CH4 A;  2RN8 A;  2ROT A;  1UJ0 A;  2A37 A;  1X27 A;  4AFS C;  1E6G A;  1TG0 A;  1GBR A;  1W1F A;  2I0N A;  4RTZ A;  2EBP A;  4JZ4 A;  3A98 A;  2CT4 A;  3NHN A;  1ABO A;  1VYV A;  1W6X A;  1H3H A;  2CUD A;  2CRE A;  2D1X A;  1UEC A;  1X6B A;  2FO0 A;  3EHR A;  3VS3 A;  5IHI A;  4CC7 A;  1YWO A;  3RNJ A;  1PHT A;  1PRL C;  1WYX A;  4CC3 A;  2BZ8 A;  4JJB A;  2JS2 A;  1VYU A;  2J06 A;  2J6K A;  2FPF A;  1XOV A;  2D8H A;  4RTT A;  1Y0M A;  4OMP A;  1WX6 A;  1U5S A;  1JQQ A;  1GCQ C;  2FG0 A;  2LQW A;  1U3O A;  3M0T A;  3NPF A;  3TVT A;  2W0Z A;  2RNA A;  4WCI A;  2PZ1 A;  2ABL A;  1MV3 A;  1X6G A;  1WI7 A;  2SRC A;  1K4U S;  2G6F X;  1HD3 A;  2YUP A;  2DIL A;  1W70 A;  2K2M A;  4HCK A;  3JV3 A;  4X1V A;  1PWT A;  1PRM C;  1UFF A;  2CUB A;  3VRZ A;  1ZLM A;  2C0T A;  1A0N B;  2EYY A;  2EYX A;  2V1Q A;  2O88 A;  1PNJ A;  2C0I A;  2P4R A;  2DBK A;  2GNC A;  3GBQ A;  3REA B;  1M27 C;  1UGV A;  2KGT A;  2CDT A;  2DYB A;  3PE0 A;  4ESR A;  3M0R A;  3H0I A;  4JJD A;  4Z89 A;  1X43 A;  2X3X D;  2RQR A;  1JEG A;  2KR3 A;  4Z8A A;  4LNP A;  4OML A;  1UTI A;  2HCK A;  4J9H A;  4DEX A;  3I5R A;  1YN8 A;  2LMJ A;  2YT6 A;  1NG2 A;  2EGE A;  4LUE A;  2KT1 A;  1FYN A;  3ULR B;  2M51 A;  2RMO A;  3TSW A;  1M3C A;  1ABQ A;  1M3B A;  1UHC A;  2AKL A;  2JTE A;  2EYZ A;  1ZBJ A;  2ROL A;  2FPE A;  1GFC A;  2KXC A;  2EVR A;  1TUD A;  1AVZ C;  3C0C A;  1GL5 A;  5HCK A;  1GCP A;  2K7A A;  2MCN A;  4Y92 A;  2BTT A;  2EGC A;  1TUC A;  1QKX A;  1RUW A;  1HSQ A;  2E5K A;  1JO8 A;  3QWX X;  1X2K A;  1N5Z A;  2DNU A;  2SEM A;  2VVK A;  4ORZ A;  1AZG B;  2KRO A;  1SSH A;  2DF6 A;  1AD5 A;  2DMO A;  3FJ5 A;  4QT7 A;  4HVV A;  3I5S A;  1I0C A;  1NM7 A;  1T0J A;  1QKW A;  2M0Y A;  4J9E A;  1I1J A;  1U06 A;  4HXJ A;  4E6R A;  3THK A;  2AKK A;  2DX1 A;  4AG1 C;  1GFD A;  1G83 A;  2J6O A;  4JJC A;  1UE9 A;  3RBB B;  5FWC A;  3REB B;  2DBM A;  2DL8 A;  1AZE A;  1WIE A;  2GTO A;  3EHQ A;  1SHF A;  5I22 A;  3EGU A;  3M0S A;  1NLP C;  1QWE A;  2AZS A;  2ECZ A;  2O2O A;  4RTX A;  4DEY A;  2JM9 A;  4J9C A;  1M8M A;  4OMO A;  3UA6 A;  3EG2 A;  4J9I A;  1MUZ A;  4JPB W;  2X3W D;  1JXO A;  2DVJ A;  2QDL A;  2EYW A;  2KT8 A;  3M0P A;  2EQI A;  2LNH B;  4OMQ A;  1WDX A;  5I11 A;  1UUE A;  1Z9Q A;  3VS0 A;  1H8K A;  2CSQ A;  5GJV B;  2C0O A;  1GRI A;  1SHG A;  2DA9 A;  1SRL A;  2A08 A;  2KNB B;  4IIM A;  1MV0 B;  3PVL A;  1G2B A;  2CSI A;  3ZL7 C;  5IXF A;  4EIK A;  2OJ2 A;  4LN2 A;  4RTV A;  2EGA A;  1H92 A;  3KFV A;  2JXB A;  5GJW B;  3VS6 A;  5EC7 A;  3VS1 A;  1NYG A;  1AWO A;  2YUQ A;  2F2X A;  2L3Q A;  2GTJ A;  3TSZ A;  2LJ1 A;  2A28 A;  4AFQ C;  2LJ0 A;  3M0U A;  5IH2 A;  1E7O A;  2LCS A;  3UA7 A;  3U23 A;  4J9F A;  2HEQ A;  1JU5 C;  2LZ6 B;  2OI3 A;  2PNI A;  2YDL A;  4GBQ A;  2H8H A;  3H0F A;  1WFW A;  1RI9 A;  1K9A A;  4A63 B;  1BBZ A;  2DJQ A;  2L2P A;  1JXM A;  1IO6 A;  3EG3 A;  2ED0 A;  4GLM A;  1KJW A;  1AOJ A;  2KBT A;  1OPK A;  1AWW A;  1WXT A;  1X2Q A;  1PKS A;  1E6H A;  2KRM A;  1UG1 A;  4F16 A;  3PVQ A;  3UF4 A;  2ED1 A;  2GGR A;  1WXB A;  2L3P A;  1SPK A;  2KRN A;  1WLP B;  1YNZ A;  2L3S A;  2DL3 A;  2MOX A;  2FRW A;  1GBQ A;  1WXU A;  4F17 A;  2HDA A;  2ENM A;  5IHK A;  2JT4 A;  2K79 A;  1NLO C;  1OPL A;  4LUD A;  2PTK A;  1T3L A;  1X69 A;  3IQL A;  4HVW A;  3NMZ C;  4IIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...