3I35A

Human sh3 domain of protein lasp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
KRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIM and SH3 domain protein 1
publication title Human SH3 domain of protein LASP1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i35A00
2A08A 3NMZC 1OPKA 2JMAA 1JEGA 4HXJA 1FYNA 1T3SA 3NPFA 2D8JA 2O9VA 2PZ1A 1QWFA 1RI9A 3LH5A 2A37A 1PRMC 1UECA 2ENMA 3M0UA 2AZVA 2YUPA 1GCQC 2KT8A 2C0OA 2FRWA 2K9GA 2L3PA 1WYXA 1WA7A 4ESRA 2FEIA 1SSHA 1QKWA 4JJDA 2ECZA 1PHTA 5HCKA 1GBRA 1M3BA 2DF6A 2BTTA 1KSWA 4AFQC 2CDTA 1I07A 1UUEA 1AZGB 3THKA 2DM1A 1YNZA 2D8HA 1SRMA 1UGVA 4D8KA 2OAWA 2EGAA 1U3OA 2YUNA 2DBKA 1YCSB 2EW3A 4DEXA 1NYGA 2DILA 2JS0A 2PTKA 3M0PA 2VKNA 4DEYA 2KT1A 1MV3A 2CH4A 2CSIA 3I35A 1UG1A 2O88A 1H8KA 2LNHB 2J6KA 1VYTA 2YT6A 3TSWA 3FJ5A 1X27A 1H3HA 2K79A 4FSSA 2K3BA 4LNPA 1N5ZA 1ZUYA 2DL4A 1AZEA 5EC7A 2M51A 2E5KA 1IO6A 1YN8A 2I0NA 1ZUKA 3ZL7C 2JXBA 1HJDA 1BB9A 2F2XA 4R0KA 2YDLA 4RTXA 4J9HA 1GL5A 2QDLA 1E6GA 2FRYA 4KRTA 2EGCA 2KEAA 3UF4A 1U06A 1YWOA 4Z89A 2ED0A 2CUDA 1I1JA 3H0FA 5ECAA 2LZ6B 3A98A 1UFFA 3EHQA 4LUEA 2LMJA 2X3WD 1GCPA 2P4RA 1W1FA 2DL3A 2CT3A 2CREA 1NEBA 2KBTA 1GFCA 2M0YA 4LUDA 4RTUA 1QCFA 1E6HA 2AK5A 4OMMA 4RTTA 2VWFA 2HCKA 2YUOA 1NLPC 1VA7A 2CH4W 3EGUA 4F16A 2J6FA 1SHGA 3VS6A 2JTEA 2JMCA 4OMPA 5FWCA 2EGEA 1ZSGA 2KXDA 1K9AA 1X2QA 1M8MA 5FW9A 1WI7A 2LX7A 1MUZA 2GGRA 2KGTA 2XMFA 1Z9ZA 2RQUA 2SRCA 2ROLA 2HEQA 3TSZA 5IXBA 4OMQA 2CSQA 4JJBA 4WCIA 2CUBA 1B3QA 3M0TA 2DMOA 1RLQC 3H0HA 3JV3A 4RUGA 1GRIA 4HCKA 2A36A 2W0ZA 1SEMA 1FMKA 5IH2A 4K11A 2ED1A 4F17A 3NGPA 1WXBA 3VRYA 1X6BA 2A28A 4A63B 2L0AA 1TG0A 4Y92A 1E7OA 1W70A 1BU1A 4J9DA 4RTVA 2X3XD 4EIKA 1U5SA 1G2BA 1BBZA 2L3QA 2MIOA 4LE9A 1AD5A 2GQIA 1VYUA 2EPDA 4AFUC 5L23A 3SEMA 1NG2A 3M0RA 1X2KA 4GBQA 4RTWA 4AFSC 3EG2A 3UA7A 1Y0MA 4M4ZA 1K1ZA 4J9GA 2O31A 2NWMA 3RBBB 4CC2A 1CKBA 4J9EA 1ABOA 1JXOA 2BZ8A 2K6DA 2FG0A 4IIMA 2LQNA 1QKXA 2RQTA 5IHIA 1W6XA 4OMNA 3RNJA 3UATA 1JXMA 2KR3A 1SPKA 4J9IA 3M0SA 2KXCA 1NEGA 3ULRB 1HSQA 2AZSA 1B07A 2H8HA 2D0NA 1ABQA 1UE9A 1T0JA 2EKHA 1M3CA 1RUWA 1YWPA 1NM7A 4OMOA 1ARKA 1WDXA 1H92A 4RTZA 4JPBW 2DL5A 2JS2A 4QT7A 1UDLA 1AWJA 1WX6A 2DA9A 5I22A 2JM8A 2RPNA 3VS7A 2YUQA 1X43A 4JJCA 3VS2A 3R6NA 1ZUUA 1OEBA 1JU5C 4IIOA 5IHNA 2GNCA 1ZBJA 2PNIA 1OPLA 4AG1C 3EG1A 2OI3A 3VS5A 1K4US 3GBQA 4RTYA 1AWWA 2RMOA 3VRZA 2IIMA 3PVQA 4J9BA 4F14A 2RQWA 1M3AA 2JT4A 5FWBA 1X6GA 2W10A 2ABLA 1UJYA 5IXFA 2J06A 1GBQA 2DRKA 1OV3A 2LJ0A 1WXTA 1PNJA 1SRLA 3H0IA 1QWEA 4LN2A 3SHWA 1JQQA 2C0IA 3VS0A 2DE0X 2DNUA 2ESWA 4HVWA 2F2VA 2MCNA 2FPDA 1MV0B 2J7IA 2RN8A 2HBWA 3I5RA 3VS1A 1UHCA 1WIEA 2VVKA 4J9CA 2CT4A 2OJ2A 1BK2A 3M0QA 2L2PA 2L3SA 1UHFA 1ZLMA 2FO0A 2SEMA 1M30A 4ZNXA 2RF0A 1HD3A 1UJ0A 1T0HA 5IHKA 1KJWA 1CKAA 2F2WA 2KNBB 1PKSA 2KRMA 1CSKA 3PE0A 4AG2C 2C0TA 2EYYA 2DRMA 2KRSA 2DL7A 1GFDA 1K0SA 2DBMA 3VS3A 2EVRA 4CC3A 1V1CA 3EG3A 2DLPA 1PRLC 3KFVA 5GJWB 4JZ3A 4ORZA 3U23A 2KE9A 2V1QA 1AOJA 3VS4A 3I9QA 2YSQA 3O5ZA 2AKLA 2EQIA 2LJ3A 2HDAA 1NYFA 2BZXA 1ZX6A 1X69A 5I11A 2G6FX 3REBB 3CQTA 4Z88A 2EBPA 2KRNA 4HVUA 4E6RA 1K0XA 4D8DA 1YP5A 2D1XA 2LP5A 1AWOA 2RQVA 4OMLA 1AVZC 2J6OA 2ROTA 2GTJA 3REAB 3EG0A 1WFWA 2B86A 4GLMA 2V1RA 1Z9QA 2DL8A 2LQWA 2LCSA 1I0CA 1VYVA 3QWXX 1RLPC 1XOVA 1OOTA 2EYZA 2K7AA 4J9FA 1G83A 2RNAA 2EYXA 1EFNA 2KYBA 1UTIA 2LJ1A 4JZ4A 2JW4A 3UA6A 2DVJA 2GTOA 1KIKA 2KROA 4CC7A 2KYMA 2DJQA 1TUDA 2NUZA 1M27C 2O9SA 3I5SA 4X1VA 1NLOC 1TUCA 2DYBA 3C0CA 2K2MA 3EHRA 3NHNA 4Z8AA 1WLPB 1S1NA 1JO8A 2DX1A 2RQRA 3IQLA 1J3TA 1AEYA 4HVVA 3PVLA 1SHFA 1KFZA 2FPFA 1PKTA 5GJVB 1T3LA 2FPEA 1AWXA 3H41A 1Y57A 2JM9A 2HSPA 1A0NB 1LCKA 3QWYA 2MOXA 3TVTA 2BZYA 2EYWA 1GCQA 2AKKA 2O2OA 4AFZC 1PWTA 1K76A 4CC4B 1QLYA 1WXUA 2J05A 2GBQA
chains in the Genus database with same CATH superfamily
1ZHIA 2A08A 2RJDA 2XIDA 1OPKA 1Q82C 1QVFA 3KBGA 5A2QE 1FYNA 2O9VA 2WACA 2RJFA 3MKDA 2PZ1A 2V8KA 4M7AB 3PTAA 5D6YA 1UECA 3NFCA 3M0UA 2AZVA 3OW2P 2D6FA 2L3PA 1YJ9T 2OTLA 4A4KA 3N5BB 2DF6A 3MPUB 1KSWA 3BDUA 2BUDA 2CDTA 4KGVB 1NE8A 1I07A 3THKA 1YNZA 2XI9A 2D8HA 4D8KA 2M1HA 3G6EQ 4BY6B 1M5Q1 2HQEA 1VQ5T 3G6ET 3OYBA 2CSIA 1O75A 4M75G 1NJIU 2FB7A 1UG1A 4E7IA 2QI2A 2HL5C 2V26A 2O88A 3QSUA 1H8KA 2LNHB 3CPWP 1S72Q 5GAMf 4LNPA 1N5ZA 2DL4A 3HFNA 2XKOC 2M51A 1IO6A 2ZPBB 5DM7R 5FU7C 4X34A 2P84A 5KE2A 1BCOA 4RTXA 4M7AG 1VQ8Q 1GL5A 2IG0A 3OY9A 2CYZB 5AT1B 4KRTA 2EGCA 1YWOA 1KD1R 3H0FA 4XU1A 2LZ6B 3L2RA 1KQSA 4LUEA 2AIRB 4M77F 1GCPA 2P4RA 3INZA 1VIFA 3I55Q 1VQ8T 2KBTA 4RTUA 3J7AF 1QCFA 4PJOF 3CXCA 5KCOA 3QIIA 2RJCA 3OYFA 2YUOA 1NLPC 3EGUA 4F16A 2LQKA 4F04B 2RI5A 3I55T 2DTIA 2VGMA 2QTVA 1ZSGA 1VUBA 2HMAA 1X2QA 3E1SA 4DBHA 2QQSA 3QDFA 2KGTA 4M75A 1KD1C 1N27A 4LXCA 1LOJA 2C06A 2DIGA 2HEQA 3TSZA 4KULA 2CSQA 4JJBA 4WCIA 1YI2T 1B3QA 5FU6C 1RLQC 2JJ9A 1BI3A 2LT4A 4IUQA 1FMKA 5HKCA 1MMAA 2DEUA 1PCXA 4PFPA 4A54A 1YJNA 4M75C 2A28A 4M7AA 2MMPA 2L0AA 1Y96A 1TG0A 4Y92A 2OAUA 4M78F 3GP8A 1E7OA 2K3YA 1PD0A 2LRQA 2QGFB 4BI3A 2X3XD 4LDWA 3CCET 1BBZA 1X75C 1K9MR 3GPLA 1AD5A 1KHIA 5CQYA 2X4XA 1NG2A 1VQOA 4WTOB 4HCBA 3M0RA 4M7AC 1H3ZA 5M9OA 4M4ZA 4J9GA 3RBBB 4CC2A 1CKBA 1ABOA 2BZ8A 3VUZA 4MDWA 4KGXB 4LD9K 3RMSA 4A53A 2KSSA 2L5QA 1QKXA 2RQTA 5IHIA 1VQ9A 3L2QA 1K9MC 2LDMA 1SPKA 4J9IA 3M0SA 2KXCA 1WJRA 2EQUA 4BY6C 3ULRB 2FVUA 4C8QF 1P92A 1B07A 2H8HA 2D0NA 3JCMW 1VQMT 2DPPB 1M3CA 4QQGA 1YWPA 4C92F 1NM7A 4OMOA 2HD0A 1M90U 1OZ2A 4EDUA 4QT7A 3VJPA 1WX6A 2DA9A 4QVZA 2QDYB 2NLUA 2X51A 1JB0E 3PT9A 1JU5C 2ZPEB 4IIOA 3CBPA 3OQ5A 1MNEA 5GAN8 1RAIB 3EG1A 3LH0A 1K4US 1VQ7Q 5GAN4 4RTYA 2ATCB 1OI1A 3JCMg 2IIMA 2M0OA 4C8QE 3PVQA 1EX4A 2MWPA 3JB9I 1O9SA 4C92E 1TU0B 4OB3B 2ABLA 2HSEB 1S72A 3UPUA 2J06A 3QYGB 3FEOA 1PNJA 1QWEA 4LN2A 1JQQA 2CGHA 4M77B 2O01E 4CRIA 2DE0X 1BYMA 4HVWA 5GANg 5CQXA 1WNLA 5GAMh 3ZEHA 3JCMX 2HBWA 3I5RA 4PJOB 3V8KA 3GF5A 5GAN5 3OYEA 1UHCA 3EFSA 1U1SA 3RKXA 3GNFB 1M1FA 3CCUQ 5LJ5j 1VQ4Q 2L3SA 3E9GA 1Q86R 3DLMA 1VQ6Q 5CR2A 5KCHA 1ZLMA 2SEMA 2K5IA 3CCSQ 1LNXA 3CCUT 5IHKA 1YJWA 4E47A 2F2WA 1VQ4T 1VQ6T 1NBEB 3HPWA 2Y90A 3PNWC 4C0ZA 1B7TA 1D0XA 1WPYA 4AG2C 3RDVA 4QVDA 3QKJA 2C0TA 1FXXA 4ZGJB 2EVRA 3EG3A 3URGA 2VXFA 3LWIA 1W4SA 2HNIA 1AOJA 4X9DA 1W2BS 3TEEA 3FJPA 2YSQA 2HDAA 3V7RA 2YLCA 1VQPA 4OB0B 3MEAA 4M78B 3QBYA 2FZKB 1EZZB 1C0MA 3CCLA 2JOYA 3A8MB 2R58A 2JVVA 2DD4A 1QVGP 1IB8A 4M77G 3OYJA 1RAGB 2J6OA 2DEQA 1OX8A 2GTJA 4PJOG 3CCJQ 3FIFA 4JUVA 2DL8A 1N6AA 2F5TX 1RAHB 1OU8A 3OMCA 4PKCC 2JW4A 3LGFA 2E3IA 4NL2A 1KK7A 5GAOl 4LDXA 2DVJA 1MGQA 2KROA 1Q7YU 3JCMP 2RHUA 2DJQA 4FIBA 4BDYA 4C8QB 3HTRA 5A0GA 5GANj 1NLOC 2K2MA 3EHRA 4ZTJA 3L42A 2LCLA 2DXCA 4B9WA 1KQSS 1S1NA 2P0PA 2DZCA 2RJEA 4M7DE 3PVLA 2WSCE 1ZQ1A 1SHFA 3SD4A 2FPFA 3RUXA 3CXCS 4MMKA 3G71A 2VC8A 1TOVA 3D7SB 3CMAQ 1WQ7A 2JM9A 3OS2A 4M78G 1Q82U 3A8HB 4R55A 2V8JA 4M77A 5GAN6 5GMKj 3QYHB 1EIFA 4QKUA 4AFZC 3CEYA 1YITA 4PJOA 5CKEA 3CMAT 3JB9F 1WXUA 1D0ZA 2J05A 2KVQG 2GBQA 3JCMJ 2JMAA 2QASA 1PM3A 1VQ7A 4HXJA 3NPFA 1X6OA 4XTXA 2QG9B 4C5IA 3QJYA 4ZGDB 3LH5A 1RABB 1RAEB 2LT1A 2FZGB 4M77C 2ZPHB 2ZPIB 3BY7A 2KT8A 3M4YA 2HBPA 1WYXA 2X9HA 1WHKA 4PJOC 5D6WA 2DTHA 4JJDA 2ECZA 3RESA 2E10A 3RR6A 1GBRA 4F7UF 3C95A 5CKFA 4AFQC 1VQNA 4PFZA 3GNGA 2RB6A 5LJ3g 2VXEA 3MP1A 4C8QG 1UGVA 5FLXE 1QP2A 2F1LA 2EKOA 5FU7B 3VUBA 3QO3A 1SKUB 3CC4A 1U3OA 2DBKA 1YCSB 3NTKA 2CP5A 4M78A 3CCVA 4M78D 2PTKA 3M0PA 2H3JA 4P5NA 2MYSA 3CCSA 1M2VB 2VKNA 4DEYA 4F7UE 2CH4A 2XD0A 3M58A 1WJSA 2FZCB 3OS1A 1FMWA 3E9FA 3HRTA 2J6KA 1MMDA 3M56A 3TSWA 3FJ5A 1H3HA 2K3BA 1JJ2S 4R56A 3Q1JA 4M78C 3KUFA 1WHHA 1OZ3A 2E5KA 2I0NA 1ZUKA 2OTJA 2JXBA 1HJDA 1BI0A 2F2XA 1SG5A 3OYGA 2YDLA 1GXIE 3CCRQ 3DLLA 4BE2A 2FRYA 4V2SA 4Z89A 3PFSA 5CVIA 2ED0A 2CUDA 1I1JA 5ECAA 3A98A 2OX7A 1W1FA 2DL3A 2HQHA 1NEBA 2M0YA 3CCRT 1Q95G 4C8QA 1E6HA 2YRCA 3A5ZB 2AK5A 4RTTA 2L89A 4C92A 3R6OA 6AT1B 1KD1U 2MI6A 2CH4W 3OSVA 2J6FA 1R77A 2JMCA 1PC0A 2KXDA 1YIJA 1XJWB 1M8MA 5FRNA 4JRKA 1V76A 4MZTA 1WI7A 4IURA 2XMFA 3LGLA 4VUBA 4C8QC 2KAFA 4FCYA 2L8DA 3JCMQ 2ROLA 2E6ZA 4OGCA 4XU0A 4C92C 4ZN1A 5L8RE 1D0YA 3M0TA 5DLOA 1YJ9Q 5FRMA 3X26B 3H0HA 4KH0B 2YLBA 3RIRA 3WVDB 3QDRB 1Y96B 5LJ3j 3CMEA 1SEMA 4ZGEB 5IH2A 5GAN2 3OYYA 3CCMQ 1W2BA 1AHJB 4C0GA 4JS4A 1VQOT 2E4HA 4JRPA 1TWBA 2COWA 2M02A 2DXBA 4J9DA 4RTVA 5HY6A 1VQ5Q 3CCMT 4TVRA 3A8GB 2DTOA 3M59A 2HZYA 4OMFB 5KYYA 1VYUA 2R5AA 3MEWA 3SEMA 1VQKA 4E7LA 3TQ7P 1K8AR 3C4SA 3TU4K 1M2OA 2KDSA 2NUTB 4RTWA 3EG2A 3FLGA 3UA7A 1Y0MA 1WZOA 1VQ9T 2NWMA 4J9EA 1K9MU 4MDXA 2ZZDA 3JCMe 3EFRA 2FG0A 1RL2A 4BB7A 4IIMA 2YXYA 3JB9H 1H641 1M2VA 2XICA 2L3RA 1I4K1 2A3LA 1K73R 2KR3A 5C6SA 1G3WA 3OYAA 1K8AC 1HSQA 3QHSA 1G3TA 5GANe 4B9XA 1HXDA 4A4HA 4JPBW 3X24B 2WSEE 3EGDA 2JZ2A 2JM8A 2RPNA 2YUQA 1VQLA 3DB4A 2E41A 1ZUUA 4Y28E 5IHNA 2GNCA 1D09B 3J81E 2PNIA 3CCQA 1BIBA 2VASA 4AG1C 3EAEA 4KT0E 3GBQA 4DBQA 3JB9G 1WQWA 3VRZA 2PVGB 3QXEB 4MMLA 3MP6A 2XDPA 4RKUE 5FWBA 4EMHA 2W10A 2QA4Q 3OW2S 4A4GA 2KMTA 5IXFA 1OX9A 2JNGA 1IGUA 1YI2Q 4PJNA 2LCCA 2LJ0A 4DOVA 3BFMA 2X4YA 4JRQA 1SRLA 5KYUB 4J5YA 5I2SA 4M75D 1QP3A 4BACA 3HKSA 2AHJB 2QA4T 1I5LA 3PIPA 2MCNA 1R0BG 2F5KA 1MV0B 2RN8A 3OBYA 2VGNA 2EQJA 1WIEA 4C5EA 5HK3A 3FC3A 1NZ9A 2RHZA 3PGGA 4J8OA 4BI8B 4XTUA 3KXTA 3CCEQ 3G4SA 3CC2Q 2QYZA 4M7AD 2NYSA 2RF0A 1HD3A 1UJ0A 2LVMA 4JDSA 2RK2A 2BIVA 3QG1A 5IT9E 1CKAA 2EIFA 2KNBB 2VV5A 1Q86U 5GMKm 5LJ5g 3CC2T 3PE0A 2EYYA 2LQ8A 4XK8E 2KRSA 2R57A 3EH1A 1GFDA 4CC3A 2QAZA 1HYOA 2KY9A 4J6XA 2DLPA 5GJWB 2QEXA 4ORZA 1KHCA 3OYHA 2YRDA 3CCLT 2XDBA 2P0KA 3O5ZA 4C5HA 4LDYA 2LJ3A 1YJ9A 2NUTA 3AHUA 2V8IA 4FL6A 3CPFA 3CD6T 3CQTA 1UGRB 4ANJA 1KG1A 2EBPA 1JJ2A 1VQMQ 2FYKA 2KRNA 4HVUA 4EMGA 4L6V5 1K0XA 4F7UA 1YP5A 2D1XA 4HA8A 1AWOA 2RQVA 4OMLA 2P4TA 1U1TA 2CP7A 4FU6A 2ROTA 1QVFP 1MHNA 3EG0A 1VQ5A 3G1JA 3TREA 2YWWA 2A0FB 4GLMA 1G3YA 1Z9QA 2LQWA 2LCSA 1I0CA 4L59A 3G6EA 3QWXX 2JTFA 4LD6A 1XOVA 4YTLA 2A7YA 2EYZA 2EYXA 3GLXA 2DFUA 1KIKA 4A4EA 2E5QA 3A8OB 2NUZA 1OQKA 1N8RR 1M27C 2BE7D 5D6XA 2DYBA 3C0CA 2DYIA 4AT1B 1YCYA 2CP2A 1J3TA 3I56T 2RI2A 4HVVA 4AMCA 4KH1B 3ASKA 1KFZA 1PKTA 5GJVB 4E7JA 1F1BB 1R8OB 5LJ3e 3H41A 5GAMj 1Y57A 1G3SA 2EJGA 4GLKA 1VQ8A 5KYUA 3OYKA 4BUGA 3TVTA 2BZYA 2EYWA 4LDUA 2AKKA 2E65A 4QQ6A 4CC4B 1QLYA 2K5LA 3L2ZA 3I55A 2XU8A 1KQ2A 4A4FA 3NMZC 3G7ZA 1T3SA 2D8JA 2COYA 4RG2A 1QWFA 5KYNA 5DLQE 1PRMC 2ENMA 2C0OA 3EG9B 1V29B 2FRWA 1KQSP 4KUIA 3WVEB 2DK3A 1YHQQ 1PHTA 4BE0A 1M3BA 3ZFJA 4DOWA 2BTTA 3CC4T 3CXCP 1Q86C 3CC7Q 2QQAA 1BCMA 1WHGA 2BE9B 2DM1A 3CCVT 4XAXB 1TSFA 1SRMA 2FL7A 1YHQT 5KE3A 1ZA2B 4XTWA 2OAWA 1IXDA 3C12A 2EGAA 3CC7T 2EW3A 1NYGA 4CI0C 3CCEA 2DILA 2JS0A 1I5OB 1QW1A 2EJ9A 4RG8A 2KQWA 3I35A 5KYWB 4IUPA 3FB9A 3A8LB 1QCNA 1VYTA 2YT6A 4C0FA 1X27A 4FSSA 1RAFB 4M7DF 2M16A 3OYNA 1KQ1A 1RI0A 1ZUYA 4J83A 3H6ZA 5EC7A 2K3XA 1YN8A 2EAYA 5I21A 1IRXA 2P0QA 3ZBDA 4WF2A 4PFOA 4D6WA 1E6GA 2HQXA 2LC4A 1U06A 5EG2A 3OW2A 2CZ6B 2MWOA 1N9SA 3EHQA 3L2UA 4C92B 2LMJA 1M8VA 3MEUA 2CREA 3P8BB 4LUDA 3JCMV 4E2FB 4OMMA 2VWFA 2HCKA 2AT1B 4JLIA 1RAAB 1SHGA 3OYLA 3VS6A 2JTEA 5GANh 1Y71A 3NTIA 4ME7A 2EGEA 1FWZA 4FYWB 4BI4A 1TH7A 2LX7A 4M77D 1OU9A 5J3BA 1MUZA 3QZ9B 2GGRA 1Z9ZA 3JCMc 4PJOD 2RI3A 5CKDA 2SRCA 3CMET 5IXBA 5GAOr 1ZSZB 3JAME 2OTLT 2RK1A 3UT1A 3SFMA 4RUGA 5LJ5d 1ZA1B 1GRIA 5CIUA 3CPWA 5J39A 2A36A 2CZ0B 4EPCA 1M9SA 2W0ZA 2ZCFB 3GOXA 1B34B 2ED1A 1ACMB 1WHMA 3NGPA 2CS7A 3UDCA 3M9QA 2DO3A 3V7SA 2NUPB 4A63B 3LX7A 4FM4B 3S3OA 5KH6A 2PUKB 5KYYB 2MAMA 3EG9A 1BU1A 2CP3A 4XTVA 7AT1B 4EIKA 1U5SA 2L3QA 2WSFE 4LE9A 4N4HA 4XU2A 3RMQA 4IUUA 2RHIA 4AFUC 2HL3A 4C92G 3V7CA 3CCUA 1FMVA 1VQ4A 1VQ6A 1X2KA 4AFSC 2ZAEA 5DY9A 3M57A 1K1ZA 2O31A 4FT4A 2GFAA 4XQ3A 1JXOA 2K6DA 2Y4YA 5D7UA 1K8AU 2JTMA 2EJFA 1Y7XA 2H3EB 3RNJA 3V8LA 1JXMA 5KYWA 1M1KR 1NEGA 1VQLT 1D1BA 4N4IA 8AT1B 3EGDB 3MCAB 2EKHA 3LW5E 5CAIA 1ARKA 3JCMd 2IVWA 5A0LA 2JS2A 4FYYB 1K73U 1AWJA 2RH2A 2X4JA 5I22A 3VS7A 4JJCA 3R6NA 1BKBA 1XQHA 1OEBA 1OPLA 1KC8R 1WHJA 4C8QD 1YFNA 3VS5A 4M7DB 2X35A 4JLGA 4IUTA 4QQDA 1AWWA 4C92D 5GANd 1M1KC 2MF2A 2HAXA 5LJ5e 3FRNA 3OYCA 4J9BA 1YBYA 2HKQB 4F14A 3CCJA 1M3AA 4Z02A 2ZPFB 2GQVA 2JT4A 4E7ZA 3WXMB 1GBQA 2DRKA 1G5VA 2DVEA 3EH2A 2YHTA 4MZMA 3VS0A 4II1A 1JBMA 2CP6A 2DNUA 2FPDA 1YJNT 5KYXB 2Z0WA 4FW2A 4QW2A 1U8RA 2CT4A 2OJ2A 1BK2A 4ELZC 1VQOQ 2L2PA 1ZSZA 1UHFA 4FYXB 4RCBA 1JRIA 1M30A 3HRUA 1TS9A 3NTHA 1T0HA 2QEXT 1B34A 2EQMA 2NUPA 4OVAA 3CMAA 1VQ9Q 2M9UA 2DZ9A 5LJ3h 4J7IA 1K0SA 2DBMA 5GAOp 1ZSZC 1V1CA 3KFVA 1PRLC 4PLIA 4JZ3A 1Q81R 2D9TA 4B6MA 2V1QA 1N9RA 3VS4A 4M7DG 3BW1A 3MP8A 1OULA 1BI1A 1NYFA 4DA4A 1ZX6A 1X69A 2FHDA 4F7UB 1ZBXA 3FDRA 3QUIA 3UWNA 1XTDA 3REBB 4XTYA 1I8FA 3O8VA 3VU3C 1R0CB 2MPXC 2X4WA 1UGQB 4HT9A 2XG8D 1AVZC 3VV0A 1Q81C 2QXFA 4JRIA 3RERA 4X9CA 4JJNK 5A0DA 4E7KA 3REAB 2O4XB 4ELYC 2VYTA 2QTXA 3LYIA 4DBRA 2RO0A 3GIBA 1C1AA 1I81A 3VKIA 4J9FA 2RNAA 2KYBA 1EFNA 1UTIA 4L5GA 2DKGA 3UA6A 5LJ5f 1S72T 2QQRA 2GTOA 4PK4A 3X25B 4CC7A 2KYMA 1K73C 1TUDA 5GMKe 4IUVA 1BIAA 1TXQA 2O9SA 4QVCA 5AYFA 4M7DA 3M4GA 4M7DD 1WLPB 4BE1A 4GY5A 2DX1A 2K57A 2ZGWA 2DXUA 4HCZA 3S6WA 1N8RU 1YJWQ 1QVPA 5C0MA 5J26A 4C5GA 1T3LA 2FPEA 3HL8A 2K5FA 4F7UG 2HSPA 1Y07A 1A0NB 3CCRA 2DERA 3BE3A 2RHYA 3QWYA 3V8JA 1WJQA 3OB9A 3BDLA 4E7HA 1YJWT 4M7DC 1GCQA 2O2OA 5CCAA 2E6NA 5KYXA 3ME9A 1QVGA 4M77E 2EYQA 3C94A 5GAMg 1D3BB 4PJOE 3MJXA 4N4GA 4ZTFA 1JEGA 1VQPQ 4NOYA 1RI9A 5LJ3d 2A37A 4FSXA 3PMIA 2PVDB 3CCLQ 2YUPA 3CPWS 1GCQC 2K9GA 3SWNB 1WA7A 1VQPT 4ESRA 1UB4A 2B8AA 2FEIA 1SSHA 2KK4A 4PJMA 1QKWA 4J7FA 2XK0A 3JB9D 3OMGA 5HCKA 3JCMf 1PSEA 3CD6Q 1UUEA 1AZGB 3EGXB 3H8ZA 3QZ5B 1NJIR 2CZ7B 2YUNA 3L2WA 4DEXA 5GANf 2K4YA 3CCMA 5GAOn 1PD1A 3OYMA 2KT1A 1MV3A 3TCJA 4M78E 1M1GA 2GF7A 3LLRA 4OB2B 1PSFA 3MHXA 2JN0A 4MZPA 3LWHA 4NS5A 2EWNA 2K79A 5CKBA 2K2VA 4HT8A 5GMKl 3VYGA 3AT1B 2O4XA 1AZEA 2RD1A 4KBMB 3ZL7C 1W2BP 1NJIC 2RA2A 3J80E 2GFUA 3HFOA 1BB9A 2I2LA 3G71Q 1UEBA 2DD5A 4R0KA 4J9HA 2QDLA 4Q5WA 3I56Q 3JSCA 2KEAA 3UF4A 1FX7A 3L2VA 3M53A 1C6VX 1UFFA 2X3WD 2R5MA 3G71T 1YITQ 1IHWA 1MNDA 2CKKA 4RCCA 3QPHA 2CT3A 4JS5A 1GFCA 2QK0A 4PL6A 5LL6S 3JCMb 5CK9A 4EMKB 2YRVA 1IHVA 1VA7A 4BD3A 1YITT 3OBWA 4LDVA 4OMPA 2PUOB 3HRSA 5FWCA 4XTZA 3HHTB 1K9AA 2DJZA 1VQ7T 1LVKA 5FW9A 4PLLA 1N8RC 3RKYA 4XU3A 2RQUA 1VQNQ 4OMQA 2CP0A 2CUBA 1SSFA 2DMOA 2DIQA 3JV3A 4UC4A 5GAOq 4HCKA 3P8DA 2PVOB 1IZ6A 1VQNT 3CC4Q 1D3BA 5LJ5h 2QA4A 4KUDK 4K11A 4F17A 1WXBA 2EQKA 3CCVQ 3VRYA 1YI2A 1X6BA 1DJ7B 2JUFA 1LJOA 1W70A 1WHLA 1QVFS 2E64A 3SWNA 5CKHA 1VOMA 3PMTA 1G2BA 3SDZA 2MIOA 1OYXA 1LPLA 2GQIA 3CCST 2PU9B 2EPDA 5L23A 5GAOm 3OYDA 2MK5A 3EGXA 4GBQA 1D1AA 2HKNA 3CC2A 2OTJQ 3ER0A 4PJLA 1AT1B 3DKMA 5IN1A 3SWNC 4OGEA 3M55A 2KI7A 4HCCA 3OSSC 1IGQA 5HK0A 2LQNA 1IREB 2OTJT 1W6XA 4OMNA 3UATA 1M90R 1RACB 4J6YA 1D1CA 3E2UA 2AZSA 3CD6A 1ABQA 1UE9A 1T0JA 1TUGB 1RUWA 3CBMA 1RADB 1WDXA 1H92A 4RTZA 3X20B 3H9NA 2DL5A 1YIJQ 1UDLA 2VUBA 3JCMh 1M1KU 4C0DB 1X43A 3VS2A 3X28B 2LX9A 3CCJT 1VQMA 3M5AA 1ZBJA 2CZ1B 1YIJT 4M75F 5LJ3f 2OI3A 1M90C 2QQ9A 4N0AA 4PJJA 3VYHB 3CBOA 2RMOA 2LTOA 3EFOB 3P8HA 2RQWA 4E7SA 1BI2A 3CMEQ 1X6GA 1UJYA 1KC8U 4EMKA 2OTLQ 2E70A 3OYIA 1OV3A 1JJ2P 1WXTA 4BDZA 3H0IA 3OS5A 3SHWA 2C0IA 4M7AF 9ATCB 5GAMd 4N0AC 2QGGA 2ESWA 2F2VA 5GMKi 4M75E 2J7IA 3VS1A 1NPRA 3T9NA 4OF1A 2VVKA 3I56A 3L1AA 4FT2A 4J9CA 1VQKQ 3DB3A 5GMKh 3M0QA 4EMKC 2E12A 3JB9J 5GAN3 2XDDA 2FO0A 4DBFA 4ZNXA 1QVGS 3HP9A 1VQKT 2RM4A 1KJWA 4M7AE 8ATCB 4KGZB 2ZPGB 1PKSA 1SF9A 4O5VA 4PNOA 2KRMA 1CSKA 2LNVA 2DRMA 2DL7A 3VS3A 1M4ZA 3SB2A 4HKEA 1VIEA 3U23A 2KE9A 3I9QA 4ZN3A 2AKLA 2EQIA 3OA6A 2BZXA 5I11A 2G6FX 2E3HA 3MEVA 1Q81U 1VQLQ 1QQJA 3A1PA 4RMOA 4Z88A 2RHXA 2BKDN 3F70A 4E6RA 4D8DA 3CCQQ 1X01A 4FYVB 1TTHB 2LP5A 1YHQA 2QQBA 2EFIA 3M54A 2F69A 5I2MA 4NL3A 2IPOB 3CC7A 1HK9A 4FW1A 3QJ6A 1QMCA 3CCQT 1WFWA 2B86A 4Y91A 2V1RA 3PIOA 2COZA 1Q7YR 1VYVA 1RLPC 2VB6A 1OOTA 4OB1B 2E1HA 2K7AA 1UGPB 1G83A 2GCXA 2LJ1A 4JZ4A 4DQ2A 5GAMe 2G3RA 2XHCA 1XNIA 1NPPA 5FROA 3RKWA 4OP0A 3I5SA 4X1VA 1TUCA 2DXTA 1G8XA 3NHNA 3E19A 4IKFA 4Z8AA 2Y4XA 1Q82R 5IAYA 3G4SQ 1YJNQ 5FU6B 1JO8A 2RQRA 3EFOA 3IQLA 1AEYA 4O6JA 1Q7YC 3OS0A 3JRZA 4C0DC 2PQWA 5GAN7 3S3MA 1MMNA 4ATOA 1PG5B 1AWXA 2D0QB 3G4ST 5CO7A 4M75B 4J6WA 1KC8C 1LCKA 1MMGA 1WGSA 2MOXA 3META 1QCOA 2QEXQ 3HSBA 1UGSB 1PWTA 1K76A 3S3NA 2DAQA 2DETA 3MO8A
chains in the Genus database with same CATH topology
2A08A 3NMZC 1OPKA 2JMAA 1JEGA 4HXJA 1FYNA 1T3SA 3NPFA 2D8JA 2O9VA 2PZ1A 1QWFA 1RI9A 3LH5A 2A37A 1PRMC 1UECA 2ENMA 3M0UA 2AZVA 2YUPA 1GCQC 2KT8A 2C0OA 2FRWA 2K9GA 2L3PA 1WYXA 1WA7A 4ESRA 2FEIA 1SSHA 1QKWA 4JJDA 2ECZA 1PHTA 5HCKA 1GBRA 1M3BA 2DF6A 2BTTA 1KSWA 4AFQC 2CDTA 1I07A 1UUEA 1AZGB 3THKA 2DM1A 1YNZA 2D8HA 1SRMA 1UGVA 4D8KA 2OAWA 2EGAA 1U3OA 2YUNA 2DBKA 1YCSB 2EW3A 4DEXA 1NYGA 2DILA 2JS0A 2PTKA 3M0PA 2VKNA 4DEYA 2KT1A 1MV3A 2CH4A 2CSIA 3I35A 1UG1A 2O88A 1H8KA 2LNHB 2J6KA 1VYTA 2YT6A 3TSWA 3FJ5A 1X27A 1H3HA 2K79A 4FSSA 2K3BA 4LNPA 1N5ZA 1ZUYA 2DL4A 1AZEA 5EC7A 2M51A 2E5KA 1IO6A 1YN8A 2I0NA 1ZUKA 3ZL7C 2JXBA 1HJDA 1BB9A 2F2XA 4R0KA 2YDLA 4RTXA 4J9HA 1GL5A 2QDLA 1E6GA 2FRYA 4KRTA 2EGCA 2KEAA 3UF4A 1U06A 1YWOA 4Z89A 2ED0A 2CUDA 1I1JA 3H0FA 5ECAA 2LZ6B 3A98A 1UFFA 3EHQA 4LUEA 2LMJA 2X3WD 1GCPA 2P4RA 1W1FA 2DL3A 2CT3A 2CREA 1NEBA 2KBTA 1GFCA 2M0YA 4LUDA 4RTUA 1QCFA 1E6HA 2AK5A 4OMMA 4RTTA 2VWFA 2HCKA 2YUOA 1NLPC 1VA7A 2CH4W 3EGUA 4F16A 2J6FA 1SHGA 3VS6A 2JTEA 2JMCA 4OMPA 5FWCA 2EGEA 1ZSGA 2KXDA 1K9AA 1X2QA 1M8MA 5FW9A 1WI7A 2LX7A 1MUZA 2GGRA 2KGTA 2XMFA 1Z9ZA 2RQUA 2SRCA 2ROLA 2HEQA 3TSZA 5IXBA 4OMQA 2CSQA 4JJBA 4WCIA 2CUBA 1B3QA 3M0TA 2DMOA 1RLQC 3H0HA 3JV3A 4RUGA 1GRIA 4HCKA 2A36A 2W0ZA 1SEMA 1FMKA 5IH2A 4K11A 2ED1A 4F17A 3NGPA 1WXBA 3VRYA 1X6BA 2A28A 4A63B 2L0AA 1TG0A 4Y92A 1E7OA 1W70A 1BU1A 4J9DA 4RTVA 2X3XD 4EIKA 1U5SA 1G2BA 1BBZA 2L3QA 2MIOA 4LE9A 1AD5A 2GQIA 1VYUA 2EPDA 4AFUC 5L23A 3SEMA 1NG2A 3M0RA 1X2KA 4GBQA 4RTWA 4AFSC 3EG2A 3UA7A 1Y0MA 4M4ZA 1K1ZA 4J9GA 2O31A 2NWMA 3RBBB 4CC2A 1CKBA 4J9EA 1ABOA 1JXOA 2BZ8A 2K6DA 2FG0A 4IIMA 2LQNA 1QKXA 2RQTA 5IHIA 1W6XA 4OMNA 3RNJA 3UATA 1JXMA 2KR3A 1SPKA 4J9IA 3M0SA 2KXCA 1NEGA 3ULRB 1HSQA 2AZSA 1B07A 2H8HA 2D0NA 1ABQA 1UE9A 1T0JA 2EKHA 1M3CA 1RUWA 1YWPA 1NM7A 4OMOA 1ARKA 1WDXA 1H92A 4RTZA 4JPBW 2DL5A 2JS2A 4QT7A 1UDLA 1AWJA 1WX6A 2DA9A 5I22A 2JM8A 2RPNA 3VS7A 2YUQA 1X43A 4JJCA 3VS2A 3R6NA 1ZUUA 1OEBA 1JU5C 4IIOA 5IHNA 2GNCA 1ZBJA 2PNIA 1OPLA 4AG1C 3EG1A 2OI3A 3VS5A 1K4US 3GBQA 4RTYA 1AWWA 2RMOA 3VRZA 2IIMA 3PVQA 4J9BA 4F14A 2RQWA 1M3AA 2JT4A 5FWBA 1X6GA 2W10A 2ABLA 1UJYA 5IXFA 2J06A 1GBQA 2DRKA 1OV3A 2LJ0A 1WXTA 1PNJA 1SRLA 3H0IA 1QWEA 4LN2A 3SHWA 1JQQA 2C0IA 3VS0A 2DE0X 2DNUA 2ESWA 4HVWA 2F2VA 2MCNA 2FPDA 1MV0B 2J7IA 2RN8A 2HBWA 3I5RA 3VS1A 1UHCA 1WIEA 2VVKA 4J9CA 2CT4A 2OJ2A 1BK2A 3M0QA 2L2PA 2L3SA 1UHFA 1ZLMA 2FO0A 2SEMA 1M30A 4ZNXA 2RF0A 1HD3A 1UJ0A 1T0HA 5IHKA 1KJWA 1CKAA 2F2WA 2KNBB 1PKSA 2KRMA 1CSKA 3PE0A 4AG2C 2C0TA 2EYYA 2DRMA 2KRSA 2DL7A 1GFDA 1K0SA 2DBMA 3VS3A 2EVRA 4CC3A 1V1CA 3EG3A 2DLPA 1PRLC 3KFVA 5GJWB 4JZ3A 4ORZA 3U23A 2KE9A 2V1QA 1AOJA 3VS4A 3I9QA 2YSQA 3O5ZA 2AKLA 2EQIA 2LJ3A 2HDAA 1NYFA 2BZXA 1ZX6A 1X69A 5I11A 2G6FX 3REBB 3CQTA 4Z88A 2EBPA 2KRNA 4HVUA 4E6RA 1K0XA 4D8DA 1YP5A 2D1XA 2LP5A 1AWOA 2RQVA 4OMLA 1AVZC 2J6OA 2ROTA 2GTJA 3REAB 3EG0A 1WFWA 2B86A 4GLMA 2V1RA 1Z9QA 2DL8A 2LQWA 2LCSA 1I0CA 1VYVA 3QWXX 1RLPC 1XOVA 1OOTA 2EYZA 2K7AA 4J9FA 1G83A 2RNAA 2EYXA 1EFNA 2KYBA 1UTIA 2LJ1A 4JZ4A 2JW4A 3UA6A 2DVJA 2GTOA 1KIKA 2KROA 4CC7A 2KYMA 2DJQA 1TUDA 2NUZA 1M27C 2O9SA 3I5SA 4X1VA 1NLOC 1TUCA 2DYBA 3C0CA 2K2MA 3EHRA 3NHNA 4Z8AA 1WLPB 1S1NA 1JO8A 2DX1A 2RQRA 3IQLA 1J3TA 1AEYA 4HVVA 3PVLA 1SHFA 1KFZA 2FPFA 1PKTA 5GJVB 1T3LA 2FPEA 1AWXA 3H41A 1Y57A 2JM9A 2HSPA 1A0NB 1LCKA 3QWYA 2MOXA 3TVTA 2BZYA 2EYWA 1GCQA 2AKKA 2O2OA 4AFZC 1PWTA 1K76A 4CC4B 1QLYA 1WXUA 2J05A 2GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A08 A;  3NMZ C;  1OPK A;  2JMA A;  1JEG A;  4HXJ A;  1FYN A;  1T3S A;  3NPF A;  2D8J A;  2O9V A;  2PZ1 A;  1QWF A;  1RI9 A;  3LH5 A;  2A37 A;  1PRM C;  1UEC A;  2ENM A;  3M0U A;  2AZV A;  2YUP A;  1GCQ C;  2KT8 A;  2C0O A;  2FRW A;  2K9G A;  2L3P A;  1WYX A;  1WA7 A;  4ESR A;  2FEI A;  1SSH A;  1QKW A;  4JJD A;  2ECZ A;  1PHT A;  5HCK A;  1GBR A;  1M3B A;  2DF6 A;  2BTT A;  1KSW A;  4AFQ C;  2CDT A;  1I07 A;  1UUE A;  1AZG B;  3THK A;  2DM1 A;  1YNZ A;  2D8H A;  1SRM A;  1UGV A;  4D8K A;  2OAW A;  2EGA A;  1U3O A;  2YUN A;  2DBK A;  1YCS B;  2EW3 A;  4DEX A;  1NYG A;  2DIL A;  2JS0 A;  2PTK A;  3M0P A;  2VKN A;  4DEY A;  2KT1 A;  1MV3 A;  2CH4 A;  2CSI A;  3I35 A;  1UG1 A;  2O88 A;  1H8K A;  2LNH B;  2J6K A;  1VYT A;  2YT6 A;  3TSW A;  3FJ5 A;  1X27 A;  1H3H A;  2K79 A;  4FSS A;  2K3B A;  4LNP A;  1N5Z A;  1ZUY A;  2DL4 A;  1AZE A;  5EC7 A;  2M51 A;  2E5K A;  1IO6 A;  1YN8 A;  2I0N A;  1ZUK A;  3ZL7 C;  2JXB A;  1HJD A;  1BB9 A;  2F2X A;  4R0K A;  2YDL A;  4RTX A;  4J9H A;  1GL5 A;  2QDL A;  1E6G A;  2FRY A;  4KRT A;  2EGC A;  2KEA A;  3UF4 A;  1U06 A;  1YWO A;  4Z89 A;  2ED0 A;  2CUD A;  1I1J A;  3H0F A;  5ECA A;  2LZ6 B;  3A98 A;  1UFF A;  3EHQ A;  4LUE A;  2LMJ A;  2X3W D;  1GCP A;  2P4R A;  1W1F A;  2DL3 A;  2CT3 A;  2CRE A;  1NEB A;  2KBT A;  1GFC A;  2M0Y A;  4LUD A;  4RTU A;  1QCF A;  1E6H A;  2AK5 A;  4OMM A;  4RTT A;  2VWF A;  2HCK A;  2YUO A;  1NLP C;  1VA7 A;  2CH4 W;  3EGU A;  4F16 A;  2J6F A;  1SHG A;  3VS6 A;  2JTE A;  2JMC A;  4OMP A;  5FWC A;  2EGE A;  1ZSG A;  2KXD A;  1K9A A;  1X2Q A;  1M8M A;  5FW9 A;  1WI7 A;  2LX7 A;  1MUZ A;  2GGR A;  2KGT A;  2XMF A;  1Z9Z A;  2RQU A;  2SRC A;  2ROL A;  2HEQ A;  3TSZ A;  5IXB A;  4OMQ A;  2CSQ A;  4JJB A;  4WCI A;  2CUB A;  1B3Q A;  3M0T A;  2DMO A;  1RLQ C;  3H0H A;  3JV3 A;  4RUG A;  1GRI A;  4HCK A;  2A36 A;  2W0Z A;  1SEM A;  1FMK A;  5IH2 A;  4K11 A;  2ED1 A;  4F17 A;  3NGP A;  1WXB A;  3VRY A;  1X6B A;  2A28 A;  4A63 B;  2L0A A;  1TG0 A;  4Y92 A;  1E7O A;  1W70 A;  1BU1 A;  4J9D A;  4RTV A;  2X3X D;  4EIK A;  1U5S A;  1G2B A;  1BBZ A;  2L3Q A;  2MIO A;  4LE9 A;  1AD5 A;  2GQI A;  1VYU A;  2EPD A;  4AFU C;  5L23 A;  3SEM A;  1NG2 A;  3M0R A;  1X2K A;  4GBQ A;  4RTW A;  4AFS C;  3EG2 A;  3UA7 A;  1Y0M A;  4M4Z A;  1K1Z A;  4J9G A;  2O31 A;  2NWM A;  3RBB B;  4CC2 A;  1CKB A;  4J9E A;  1ABO A;  1JXO A;  2BZ8 A;  2K6D A;  2FG0 A;  4IIM A;  2LQN A;  1QKX A;  2RQT A;  5IHI A;  1W6X A;  4OMN A;  3RNJ A;  3UAT A;  1JXM A;  2KR3 A;  1SPK A;  4J9I A;  3M0S A;  2KXC A;  1NEG A;  3ULR B;  1HSQ A;  2AZS A;  1B07 A;  2H8H A;  2D0N A;  1ABQ A;  1UE9 A;  1T0J A;  2EKH A;  1M3C A;  1RUW A;  1YWP A;  1NM7 A;  4OMO A;  1ARK A;  1WDX A;  1H92 A;  4RTZ A;  4JPB W;  2DL5 A;  2JS2 A;  4QT7 A;  1UDL A;  1AWJ A;  1WX6 A;  2DA9 A;  5I22 A;  2JM8 A;  2RPN A;  3VS7 A;  2YUQ A;  1X43 A;  4JJC A;  3VS2 A;  3R6N A;  1ZUU A;  1OEB A;  1JU5 C;  4IIO A;  5IHN A;  2GNC A;  1ZBJ A;  2PNI A;  1OPL A;  4AG1 C;  3EG1 A;  2OI3 A;  3VS5 A;  1K4U S;  3GBQ A;  4RTY A;  1AWW A;  2RMO A;  3VRZ A;  2IIM A;  3PVQ A;  4J9B A;  4F14 A;  2RQW A;  1M3A A;  2JT4 A;  5FWB A;  1X6G A;  2W10 A;  2ABL A;  1UJY A;  5IXF A;  2J06 A;  1GBQ A;  2DRK A;  1OV3 A;  2LJ0 A;  1WXT A;  1PNJ A;  1SRL A;  3H0I A;  1QWE A;  4LN2 A;  3SHW A;  1JQQ A;  2C0I A;  3VS0 A;  2DE0 X;  2DNU A;  2ESW A;  4HVW A;  2F2V A;  2MCN A;  2FPD A;  1MV0 B;  2J7I A;  2RN8 A;  2HBW A;  3I5R A;  3VS1 A;  1UHC A;  1WIE A;  2VVK A;  4J9C A;  2CT4 A;  2OJ2 A;  1BK2 A;  3M0Q A;  2L2P A;  2L3S A;  1UHF A;  1ZLM A;  2FO0 A;  2SEM A;  1M30 A;  4ZNX A;  2RF0 A;  1HD3 A;  1UJ0 A;  1T0H A;  5IHK A;  1KJW A;  1CKA A;  2F2W A;  2KNB B;  1PKS A;  2KRM A;  1CSK A;  3PE0 A;  4AG2 C;  2C0T A;  2EYY A;  2DRM A;  2KRS A;  2DL7 A;  1GFD A;  1K0S A;  2DBM A;  3VS3 A;  2EVR A;  4CC3 A;  1V1C A;  3EG3 A;  2DLP A;  1PRL C;  3KFV A;  5GJW B;  4JZ3 A;  4ORZ A;  3U23 A;  2KE9 A;  2V1Q A;  1AOJ A;  3VS4 A;  3I9Q A;  2YSQ A;  3O5Z A;  2AKL A;  2EQI A;  2LJ3 A;  2HDA A;  1NYF A;  2BZX A;  1ZX6 A;  1X69 A;  5I11 A;  2G6F X;  3REB B;  3CQT A;  4Z88 A;  2EBP A;  2KRN A;  4HVU A;  4E6R A;  1K0X A;  4D8D A;  1YP5 A;  2D1X A;  2LP5 A;  1AWO A;  2RQV A;  4OML A;  1AVZ C;  2J6O A;  2ROT A;  2GTJ A;  3REA B;  3EG0 A;  1WFW A;  2B86 A;  4GLM A;  2V1R A;  1Z9Q A;  2DL8 A;  2LQW A;  2LCS A;  1I0C A;  1VYV A;  3QWX X;  1RLP C;  1XOV A;  1OOT A;  2EYZ A;  2K7A A;  4J9F A;  1G83 A;  2RNA A;  2EYX A;  1EFN A;  2KYB A;  1UTI A;  2LJ1 A;  4JZ4 A;  2JW4 A;  3UA6 A;  2DVJ A;  2GTO A;  1KIK A;  2KRO A;  4CC7 A;  2KYM A;  2DJQ A;  1TUD A;  2NUZ A;  1M27 C;  2O9S A;  3I5S A;  4X1V A;  1NLO C;  1TUC A;  2DYB A;  3C0C A;  2K2M A;  3EHR A;  3NHN A;  4Z8A A;  1WLP B;  1S1N A;  1JO8 A;  2DX1 A;  2RQR A;  3IQL A;  1J3T A;  1AEY A;  4HVV A;  3PVL A;  1SHF A;  1KFZ A;  2FPF A;  1PKT A;  5GJV B;  1T3L A;  2FPE A;  1AWX A;  3H41 A;  1Y57 A;  2JM9 A;  2HSP A;  1A0N B;  1LCK A;  3QWY A;  2MOX A;  3TVT A;  2BZY A;  2EYW A;  1GCQ A;  2AKK A;  2O2O A;  4AFZ C;  1PWT A;  1K76 A;  4CC4 B;  1QLY A;  1WXU A;  2J05 A;  2GBQ A; 
#chains in the Genus database with same CATH topology
 1ZHI A;  2A08 A;  2RJD A;  2XID A;  1OPK A;  1Q82 C;  1QVF A;  3KBG A;  5A2Q E;  1FYN A;  2O9V A;  2WAC A;  2RJF A;  3MKD A;  2PZ1 A;  2V8K A;  4M7A B;  3PTA A;  5D6Y A;  1UEC A;  3NFC A;  3M0U A;  2AZV A;  3OW2 P;  2D6F A;  2L3P A;  1YJ9 T;  2OTL A;  4A4K A;  3N5B B;  2DF6 A;  3MPU B;  1KSW A;  3BDU A;  2BUD A;  2CDT A;  4KGV B;  1NE8 A;  1I07 A;  3THK A;  1YNZ A;  2XI9 A;  2D8H A;  4D8K A;  2M1H A;  3G6E Q;  4BY6 B;  1M5Q 1;  2HQE A;  1VQ5 T;  3G6E T;  3OYB A;  2CSI A;  1O75 A;  4M75 G;  1NJI U;  2FB7 A;  1UG1 A;  4E7I A;  2QI2 A;  2HL5 C;  2V26 A;  2O88 A;  3QSU A;  1H8K A;  2LNH B;  3CPW P;  1S72 Q;  5GAM f;  4LNP A;  1N5Z A;  2DL4 A;  3HFN A;  2XKO C;  2M51 A;  1IO6 A;  2ZPB B;  5DM7 R;  5FU7 C;  4X34 A;  2P84 A;  5KE2 A;  1BCO A;  4RTX A;  4M7A G;  1VQ8 Q;  1GL5 A;  2IG0 A;  3OY9 A;  2CYZ B;  5AT1 B;  4KRT A;  2EGC A;  1YWO A;  1KD1 R;  3H0F A;  4XU1 A;  2LZ6 B;  3L2R A;  1KQS A;  4LUE A;  2AIR B;  4M77 F;  1GCP A;  2P4R A;  3INZ A;  1VIF A;  3I55 Q;  1VQ8 T;  2KBT A;  4RTU A;  3J7A F;  1QCF A;  4PJO F;  3CXC A;  5KCO A;  3QII A;  2RJC A;  3OYF A;  2YUO A;  1NLP C;  3EGU A;  4F16 A;  2LQK A;  4F04 B;  2RI5 A;  3I55 T;  2DTI A;  2VGM A;  2QTV A;  1ZSG A;  1VUB A;  2HMA A;  1X2Q A;  3E1S A;  4DBH A;  2QQS A;  3QDF A;  2KGT A;  4M75 A;  1KD1 C;  1N27 A;  4LXC A;  1LOJ A;  2C06 A;  2DIG A;  2HEQ A;  3TSZ A;  4KUL A;  2CSQ A;  4JJB A;  4WCI A;  1YI2 T;  1B3Q A;  5FU6 C;  1RLQ C;  2JJ9 A;  1BI3 A;  2LT4 A;  4IUQ A;  1FMK A;  5HKC A;  1MMA A;  2DEU A;  1PCX A;  4PFP A;  4A54 A;  1YJN A;  4M75 C;  2A28 A;  4M7A A;  2MMP A;  2L0A A;  1Y96 A;  1TG0 A;  4Y92 A;  2OAU A;  4M78 F;  3GP8 A;  1E7O A;  2K3Y A;  1PD0 A;  2LRQ A;  2QGF B;  4BI3 A;  2X3X D;  4LDW A;  3CCE T;  1BBZ A;  1X75 C;  1K9M R;  3GPL A;  1AD5 A;  1KHI A;  5CQY A;  2X4X A;  1NG2 A;  1VQO A;  4WTO B;  4HCB A;  3M0R A;  4M7A C;  1H3Z A;  5M9O A;  4M4Z A;  4J9G A;  3RBB B;  4CC2 A;  1CKB A;  1ABO A;  2BZ8 A;  3VUZ A;  4MDW A;  4KGX B;  4LD9 K;  3RMS A;  4A53 A;  2KSS A;  2L5Q A;  1QKX A;  2RQT A;  5IHI A;  1VQ9 A;  3L2Q A;  1K9M C;  2LDM A;  1SPK A;  4J9I A;  3M0S A;  2KXC A;  1WJR A;  2EQU A;  4BY6 C;  3ULR B;  2FVU A;  4C8Q F;  1P92 A;  1B07 A;  2H8H A;  2D0N A;  3JCM W;  1VQM T;  2DPP B;  1M3C A;  4QQG A;  1YWP A;  4C92 F;  1NM7 A;  4OMO A;  2HD0 A;  1M90 U;  1OZ2 A;  4EDU A;  4QT7 A;  3VJP A;  1WX6 A;  2DA9 A;  4QVZ A;  2QDY B;  2NLU A;  2X51 A;  1JB0 E;  3PT9 A;  1JU5 C;  2ZPE B;  4IIO A;  3CBP A;  3OQ5 A;  1MNE A;  5GAN 8;  1RAI B;  3EG1 A;  3LH0 A;  1K4U S;  1VQ7 Q;  5GAN 4;  4RTY A;  2ATC B;  1OI1 A;  3JCM g;  2IIM A;  2M0O A;  4C8Q E;  3PVQ A;  1EX4 A;  2MWP A;  3JB9 I;  1O9S A;  4C92 E;  1TU0 B;  4OB3 B;  2ABL A;  2HSE B;  1S72 A;  3UPU A;  2J06 A;  3QYG B;  3FEO A;  1PNJ A;  1QWE A;  4LN2 A;  1JQQ A;  2CGH A;  4M77 B;  2O01 E;  4CRI A;  2DE0 X;  1BYM A;  4HVW A;  5GAN g;  5CQX A;  1WNL A;  5GAM h;  3ZEH A;  3JCM X;  2HBW A;  3I5R A;  4PJO B;  3V8K A;  3GF5 A;  5GAN 5;  3OYE A;  1UHC A;  3EFS A;  1U1S A;  3RKX A;  3GNF B;  1M1F A;  3CCU Q;  5LJ5 j;  1VQ4 Q;  2L3S A;  3E9G A;  1Q86 R;  3DLM A;  1VQ6 Q;  5CR2 A;  5KCH A;  1ZLM A;  2SEM A;  2K5I A;  3CCS Q;  1LNX A;  3CCU T;  5IHK A;  1YJW A;  4E47 A;  2F2W A;  1VQ4 T;  1VQ6 T;  1NBE B;  3HPW A;  2Y90 A;  3PNW C;  4C0Z A;  1B7T A;  1D0X A;  1WPY A;  4AG2 C;  3RDV A;  4QVD A;  3QKJ A;  2C0T A;  1FXX A;  4ZGJ B;  2EVR A;  3EG3 A;  3URG A;  2VXF A;  3LWI A;  1W4S A;  2HNI A;  1AOJ A;  4X9D A;  1W2B S;  3TEE A;  3FJP A;  2YSQ A;  2HDA A;  3V7R A;  2YLC A;  1VQP A;  4OB0 B;  3MEA A;  4M78 B;  3QBY A;  2FZK B;  1EZZ B;  1C0M A;  3CCL A;  2JOY A;  3A8M B;  2R58 A;  2JVV A;  2DD4 A;  1QVG P;  1IB8 A;  4M77 G;  3OYJ A;  1RAG B;  2J6O A;  2DEQ A;  1OX8 A;  2GTJ A;  4PJO G;  3CCJ Q;  3FIF A;  4JUV A;  2DL8 A;  1N6A A;  2F5T X;  1RAH B;  1OU8 A;  3OMC A;  4PKC C;  2JW4 A;  3LGF A;  2E3I A;  4NL2 A;  1KK7 A;  5GAO l;  4LDX A;  2DVJ A;  1MGQ A;  2KRO A;  1Q7Y U;  3JCM P;  2RHU A;  2DJQ A;  4FIB A;  4BDY A;  4C8Q B;  3HTR A;  5A0G A;  5GAN j;  1NLO C;  2K2M A;  3EHR A;  4ZTJ A;  3L42 A;  2LCL A;  2DXC A;  4B9W A;  1KQS S;  1S1N A;  2P0P A;  2DZC A;  2RJE A;  4M7D E;  3PVL A;  2WSC E;  1ZQ1 A;  1SHF A;  3SD4 A;  2FPF A;  3RUX A;  3CXC S;  4MMK A;  3G71 A;  2VC8 A;  1TOV A;  3D7S B;  3CMA Q;  1WQ7 A;  2JM9 A;  3OS2 A;  4M78 G;  1Q82 U;  3A8H B;  4R55 A;  2V8J A;  4M77 A;  5GAN 6;  5GMK j;  3QYH B;  1EIF A;  4QKU A;  4AFZ C;  3CEY A;  1YIT A;  4PJO A;  5CKE A;  3CMA T;  3JB9 F;  1WXU A;  1D0Z A;  2J05 A;  2KVQ G;  2GBQ A;  3JCM J;  2JMA A;  2QAS A;  1PM3 A;  1VQ7 A;  4HXJ A;  3NPF A;  1X6O A;  4XTX A;  2QG9 B;  4C5I A;  3QJY A;  4ZGD B;  3LH5 A;  1RAB B;  1RAE B;  2LT1 A;  2FZG B;  4M77 C;  2ZPH B;  2ZPI B;  3BY7 A;  2KT8 A;  3M4Y A;  2HBP A;  1WYX A;  2X9H A;  1WHK A;  4PJO C;  5D6W A;  2DTH A;  4JJD A;  2ECZ A;  3RES A;  2E10 A;  3RR6 A;  1GBR A;  4F7U F;  3C95 A;  5CKF A;  4AFQ C;  1VQN A;  4PFZ A;  3GNG A;  2RB6 A;  5LJ3 g;  2VXE A;  3MP1 A;  4C8Q G;  1UGV A;  5FLX E;  1QP2 A;  2F1L A;  2EKO A;  5FU7 B;  3VUB A;  3QO3 A;  1SKU B;  3CC4 A;  1U3O A;  2DBK A;  1YCS B;  3NTK A;  2CP5 A;  4M78 A;  3CCV A;  4M78 D;  2PTK A;  3M0P A;  2H3J A;  4P5N A;  2MYS A;  3CCS A;  1M2V B;  2VKN A;  4DEY A;  4F7U E;  2CH4 A;  2XD0 A;  3M58 A;  1WJS A;  2FZC B;  3OS1 A;  1FMW A;  3E9F A;  3HRT A;  2J6K A;  1MMD A;  3M56 A;  3TSW A;  3FJ5 A;  1H3H A;  2K3B A;  1JJ2 S;  4R56 A;  3Q1J A;  4M78 C;  3KUF A;  1WHH A;  1OZ3 A;  2E5K A;  2I0N A;  1ZUK A;  2OTJ A;  2JXB A;  1HJD A;  1BI0 A;  2F2X A;  1SG5 A;  3OYG A;  2YDL A;  1GXI E;  3CCR Q;  3DLL A;  4BE2 A;  2FRY A;  4V2S A;  4Z89 A;  3PFS A;  5CVI A;  2ED0 A;  2CUD A;  1I1J A;  5ECA A;  3A98 A;  2OX7 A;  1W1F A;  2DL3 A;  2HQH A;  1NEB A;  2M0Y A;  3CCR T;  1Q95 G;  4C8Q A;  1E6H A;  2YRC A;  3A5Z B;  2AK5 A;  4RTT A;  2L89 A;  4C92 A;  3R6O A;  6AT1 B;  1KD1 U;  2MI6 A;  2CH4 W;  3OSV A;  2J6F A;  1R77 A;  2JMC A;  1PC0 A;  2KXD A;  1YIJ A;  1XJW B;  1M8M A;  5FRN A;  4JRK A;  1V76 A;  4MZT A;  1WI7 A;  4IUR A;  2XMF A;  3LGL A;  4VUB A;  4C8Q C;  2KAF A;  4FCY A;  2L8D A;  3JCM Q;  2ROL A;  2E6Z A;  4OGC A;  4XU0 A;  4C92 C;  4ZN1 A;  5L8R E;  1D0Y A;  3M0T A;  5DLO A;  1YJ9 Q;  5FRM A;  3X26 B;  3H0H A;  4KH0 B;  2YLB A;  3RIR A;  3WVD B;  3QDR B;  1Y96 B;  5LJ3 j;  3CME A;  1SEM A;  4ZGE B;  5IH2 A;  5GAN 2;  3OYY A;  3CCM Q;  1W2B A;  1AHJ B;  4C0G A;  4JS4 A;  1VQO T;  2E4H A;  4JRP A;  1TWB A;  2COW A;  2M02 A;  2DXB A;  4J9D A;  4RTV A;  5HY6 A;  1VQ5 Q;  3CCM T;  4TVR A;  3A8G B;  2DTO A;  3M59 A;  2HZY A;  4OMF B;  5KYY A;  1VYU A;  2R5A A;  3MEW A;  3SEM A;  1VQK A;  4E7L A;  3TQ7 P;  1K8A R;  3C4S A;  3TU4 K;  1M2O A;  2KDS A;  2NUT B;  4RTW A;  3EG2 A;  3FLG A;  3UA7 A;  1Y0M A;  1WZO A;  1VQ9 T;  2NWM A;  4J9E A;  1K9M U;  4MDX A;  2ZZD A;  3JCM e;  3EFR A;  2FG0 A;  1RL2 A;  4BB7 A;  4IIM A;  2YXY A;  3JB9 H;  1H64 1;  1M2V A;  2XIC A;  2L3R A;  1I4K 1;  2A3L A;  1K73 R;  2KR3 A;  5C6S A;  1G3W A;  3OYA A;  1K8A C;  1HSQ A;  3QHS A;  1G3T A;  5GAN e;  4B9X A;  1HXD A;  4A4H A;  4JPB W;  3X24 B;  2WSE E;  3EGD A;  2JZ2 A;  2JM8 A;  2RPN A;  2YUQ A;  1VQL A;  3DB4 A;  2E41 A;  1ZUU A;  4Y28 E;  5IHN A;  2GNC A;  1D09 B;  3J81 E;  2PNI A;  3CCQ A;  1BIB A;  2VAS A;  4AG1 C;  3EAE A;  4KT0 E;  3GBQ A;  4DBQ A;  3JB9 G;  1WQW A;  3VRZ A;  2PVG B;  3QXE B;  4MML A;  3MP6 A;  2XDP A;  4RKU E;  5FWB A;  4EMH A;  2W10 A;  2QA4 Q;  3OW2 S;  4A4G A;  2KMT A;  5IXF A;  1OX9 A;  2JNG A;  1IGU A;  1YI2 Q;  4PJN A;  2LCC A;  2LJ0 A;  4DOV A;  3BFM A;  2X4Y A;  4JRQ A;  1SRL A;  5KYU B;  4J5Y A;  5I2S A;  4M75 D;  1QP3 A;  4BAC A;  3HKS A;  2AHJ B;  2QA4 T;  1I5L A;  3PIP A;  2MCN A;  1R0B G;  2F5K A;  1MV0 B;  2RN8 A;  3OBY A;  2VGN A;  2EQJ A;  1WIE A;  4C5E A;  5HK3 A;  3FC3 A;  1NZ9 A;  2RHZ A;  3PGG A;  4J8O A;  4BI8 B;  4XTU A;  3KXT A;  3CCE Q;  3G4S A;  3CC2 Q;  2QYZ A;  4M7A D;  2NYS A;  2RF0 A;  1HD3 A;  1UJ0 A;  2LVM A;  4JDS A;  2RK2 A;  2BIV A;  3QG1 A;  5IT9 E;  1CKA A;  2EIF A;  2KNB B;  2VV5 A;  1Q86 U;  5GMK m;  5LJ5 g;  3CC2 T;  3PE0 A;  2EYY A;  2LQ8 A;  4XK8 E;  2KRS A;  2R57 A;  3EH1 A;  1GFD A;  4CC3 A;  2QAZ A;  1HYO A;  2KY9 A;  4J6X A;  2DLP A;  5GJW B;  2QEX A;  4ORZ A;  1KHC A;  3OYH A;  2YRD A;  3CCL T;  2XDB A;  2P0K A;  3O5Z A;  4C5H A;  4LDY A;  2LJ3 A;  1YJ9 A;  2NUT A;  3AHU A;  2V8I A;  4FL6 A;  3CPF A;  3CD6 T;  3CQT A;  1UGR B;  4ANJ A;  1KG1 A;  2EBP A;  1JJ2 A;  1VQM Q;  2FYK A;  2KRN A;  4HVU A;  4EMG A;  4L6V 5;  1K0X A;  4F7U A;  1YP5 A;  2D1X A;  4HA8 A;  1AWO A;  2RQV A;  4OML A;  2P4T A;  1U1T A;  2CP7 A;  4FU6 A;  2ROT A;  1QVF P;  1MHN A;  3EG0 A;  1VQ5 A;  3G1J A;  3TRE A;  2YWW A;  2A0F B;  4GLM A;  1G3Y A;  1Z9Q A;  2LQW A;  2LCS A;  1I0C A;  4L59 A;  3G6E A;  3QWX X;  2JTF A;  4LD6 A;  1XOV A;  4YTL A;  2A7Y A;  2EYZ A;  2EYX A;  3GLX A;  2DFU A;  1KIK A;  4A4E A;  2E5Q A;  3A8O B;  2NUZ A;  1OQK A;  1N8R R;  1M27 C;  2BE7 D;  5D6X A;  2DYB A;  3C0C A;  2DYI A;  4AT1 B;  1YCY A;  2CP2 A;  1J3T A;  3I56 T;  2RI2 A;  4HVV A;  4AMC A;  4KH1 B;  3ASK A;  1KFZ A;  1PKT A;  5GJV B;  4E7J A;  1F1B B;  1R8O B;  5LJ3 e;  3H41 A;  5GAM j;  1Y57 A;  1G3S A;  2EJG A;  4GLK A;  1VQ8 A;  5KYU A;  3OYK A;  4BUG A;  3TVT A;  2BZY A;  2EYW A;  4LDU A;  2AKK A;  2E65 A;  4QQ6 A;  4CC4 B;  1QLY A;  2K5L A;  3L2Z A;  3I55 A;  2XU8 A;  1KQ2 A;  4A4F A;  3NMZ C;  3G7Z A;  1T3S A;  2D8J A;  2COY A;  4RG2 A;  1QWF A;  5KYN A;  5DLQ E;  1PRM C;  2ENM A;  2C0O A;  3EG9 B;  1V29 B;  2FRW A;  1KQS P;  4KUI A;  3WVE B;  2DK3 A;  1YHQ Q;  1PHT A;  4BE0 A;  1M3B A;  3ZFJ A;  4DOW A;  2BTT A;  3CC4 T;  3CXC P;  1Q86 C;  3CC7 Q;  2QQA A;  1BCM A;  1WHG A;  2BE9 B;  2DM1 A;  3CCV T;  4XAX B;  1TSF A;  1SRM A;  2FL7 A;  1YHQ T;  5KE3 A;  1ZA2 B;  4XTW A;  2OAW A;  1IXD A;  3C12 A;  2EGA A;  3CC7 T;  2EW3 A;  1NYG A;  4CI0 C;  3CCE A;  2DIL A;  2JS0 A;  1I5O B;  1QW1 A;  2EJ9 A;  4RG8 A;  2KQW A;  3I35 A;  5KYW B;  4IUP A;  3FB9 A;  3A8L B;  1QCN A;  1VYT A;  2YT6 A;  4C0F A;  1X27 A;  4FSS A;  1RAF B;  4M7D F;  2M16 A;  3OYN A;  1KQ1 A;  1RI0 A;  1ZUY A;  4J83 A;  3H6Z A;  5EC7 A;  2K3X A;  1YN8 A;  2EAY A;  5I21 A;  1IRX A;  2P0Q A;  3ZBD A;  4WF2 A;  4PFO A;  4D6W A;  1E6G A;  2HQX A;  2LC4 A;  1U06 A;  5EG2 A;  3OW2 A;  2CZ6 B;  2MWO A;  1N9S A;  3EHQ A;  3L2U A;  4C92 B;  2LMJ A;  1M8V A;  3MEU A;  2CRE A;  3P8B B;  4LUD A;  3JCM V;  4E2F B;  4OMM A;  2VWF A;  2HCK A;  2AT1 B;  4JLI A;  1RAA B;  1SHG A;  3OYL A;  3VS6 A;  2JTE A;  5GAN h;  1Y71 A;  3NTI A;  4ME7 A;  2EGE A;  1FWZ A;  4FYW B;  4BI4 A;  1TH7 A;  2LX7 A;  4M77 D;  1OU9 A;  5J3B A;  1MUZ A;  3QZ9 B;  2GGR A;  1Z9Z A;  3JCM c;  4PJO D;  2RI3 A;  5CKD A;  2SRC A;  3CME T;  5IXB A;  5GAO r;  1ZSZ B;  3JAM E;  2OTL T;  2RK1 A;  3UT1 A;  3SFM A;  4RUG A;  5LJ5 d;  1ZA1 B;  1GRI A;  5CIU A;  3CPW A;  5J39 A;  2A36 A;  2CZ0 B;  4EPC A;  1M9S A;  2W0Z A;  2ZCF B;  3GOX A;  1B34 B;  2ED1 A;  1ACM B;  1WHM A;  3NGP A;  2CS7 A;  3UDC A;  3M9Q A;  2DO3 A;  3V7S A;  2NUP B;  4A63 B;  3LX7 A;  4FM4 B;  3S3O A;  5KH6 A;  2PUK B;  5KYY B;  2MAM A;  3EG9 A;  1BU1 A;  2CP3 A;  4XTV A;  7AT1 B;  4EIK A;  1U5S A;  2L3Q A;  2WSF E;  4LE9 A;  4N4H A;  4XU2 A;  3RMQ A;  4IUU A;  2RHI A;  4AFU C;  2HL3 A;  4C92 G;  3V7C A;  3CCU A;  1FMV A;  1VQ4 A;  1VQ6 A;  1X2K A;  4AFS C;  2ZAE A;  5DY9 A;  3M57 A;  1K1Z A;  2O31 A;  4FT4 A;  2GFA A;  4XQ3 A;  1JXO A;  2K6D A;  2Y4Y A;  5D7U A;  1K8A U;  2JTM A;  2EJF A;  1Y7X A;  2H3E B;  3RNJ A;  3V8L A;  1JXM A;  5KYW A;  1M1K R;  1NEG A;  1VQL T;  1D1B A;  4N4I A;  8AT1 B;  3EGD B;  3MCA B;  2EKH A;  3LW5 E;  5CAI A;  1ARK A;  3JCM d;  2IVW A;  5A0L A;  2JS2 A;  4FYY B;  1K73 U;  1AWJ A;  2RH2 A;  2X4J A;  5I22 A;  3VS7 A;  4JJC A;  3R6N A;  1BKB A;  1XQH A;  1OEB A;  1OPL A;  1KC8 R;  1WHJ A;  4C8Q D;  1YFN A;  3VS5 A;  4M7D B;  2X35 A;  4JLG A;  4IUT A;  4QQD A;  1AWW A;  4C92 D;  5GAN d;  1M1K C;  2MF2 A;  2HAX A;  5LJ5 e;  3FRN A;  3OYC A;  4J9B A;  1YBY A;  2HKQ B;  4F14 A;  3CCJ A;  1M3A A;  4Z02 A;  2ZPF B;  2GQV A;  2JT4 A;  4E7Z A;  3WXM B;  1GBQ A;  2DRK A;  1G5V A;  2DVE A;  3EH2 A;  2YHT A;  4MZM A;  3VS0 A;  4II1 A;  1JBM A;  2CP6 A;  2DNU A;  2FPD A;  1YJN T;  5KYX B;  2Z0W A;  4FW2 A;  4QW2 A;  1U8R A;  2CT4 A;  2OJ2 A;  1BK2 A;  4ELZ C;  1VQO Q;  2L2P A;  1ZSZ A;  1UHF A;  4FYX B;  4RCB A;  1JRI A;  1M30 A;  3HRU A;  1TS9 A;  3NTH A;  1T0H A;  2QEX T;  1B34 A;  2EQM A;  2NUP A;  4OVA A;  3CMA A;  1VQ9 Q;  2M9U A;  2DZ9 A;  5LJ3 h;  4J7I A;  1K0S A;  2DBM A;  5GAO p;  1ZSZ C;  1V1C A;  3KFV A;  1PRL C;  4PLI A;  4JZ3 A;  1Q81 R;  2D9T A;  4B6M A;  2V1Q A;  1N9R A;  3VS4 A;  4M7D G;  3BW1 A;  3MP8 A;  1OUL A;  1BI1 A;  1NYF A;  4DA4 A;  1ZX6 A;  1X69 A;  2FHD A;  4F7U B;  1ZBX A;  3FDR A;  3QUI A;  3UWN A;  1XTD A;  3REB B;  4XTY A;  1I8F A;  3O8V A;  3VU3 C;  1R0C B;  2MPX C;  2X4W A;  1UGQ B;  4HT9 A;  2XG8 D;  1AVZ C;  3VV0 A;  1Q81 C;  2QXF A;  4JRI A;  3RER A;  4X9C A;  4JJN K;  5A0D A;  4E7K A;  3REA B;  2O4X B;  4ELY C;  2VYT A;  2QTX A;  3LYI A;  4DBR A;  2RO0 A;  3GIB A;  1C1A A;  1I81 A;  3VKI A;  4J9F A;  2RNA A;  2KYB A;  1EFN A;  1UTI A;  4L5G A;  2DKG A;  3UA6 A;  5LJ5 f;  1S72 T;  2QQR A;  2GTO A;  4PK4 A;  3X25 B;  4CC7 A;  2KYM A;  1K73 C;  1TUD A;  5GMK e;  4IUV A;  1BIA A;  1TXQ A;  2O9S A;  4QVC A;  5AYF A;  4M7D A;  3M4G A;  4M7D D;  1WLP B;  4BE1 A;  4GY5 A;  2DX1 A;  2K57 A;  2ZGW A;  2DXU A;  4HCZ A;  3S6W A;  1N8R U;  1YJW Q;  1QVP A;  5C0M A;  5J26 A;  4C5G A;  1T3L A;  2FPE A;  3HL8 A;  2K5F A;  4F7U G;  2HSP A;  1Y07 A;  1A0N B;  3CCR A;  2DER A;  3BE3 A;  2RHY A;  3QWY A;  3V8J A;  1WJQ A;  3OB9 A;  3BDL A;  4E7H A;  1YJW T;  4M7D C;  1GCQ A;  2O2O A;  5CCA A;  2E6N A;  5KYX A;  3ME9 A;  1QVG A;  4M77 E;  2EYQ A;  3C94 A;  5GAM g;  1D3B B;  4PJO E;  3MJX A;  4N4G A;  4ZTF A;  1JEG A;  1VQP Q;  4NOY A;  1RI9 A;  5LJ3 d;  2A37 A;  4FSX A;  3PMI A;  2PVD B;  3CCL Q;  2YUP A;  3CPW S;  1GCQ C;  2K9G A;  3SWN B;  1WA7 A;  1VQP T;  4ESR A;  1UB4 A;  2B8A A;  2FEI A;  1SSH A;  2KK4 A;  4PJM A;  1QKW A;  4J7F A;  2XK0 A;  3JB9 D;  3OMG A;  5HCK A;  3JCM f;  1PSE A;  3CD6 Q;  1UUE A;  1AZG B;  3EGX B;  3H8Z A;  3QZ5 B;  1NJI R;  2CZ7 B;  2YUN A;  3L2W A;  4DEX A;  5GAN f;  2K4Y A;  3CCM A;  5GAO n;  1PD1 A;  3OYM A;  2KT1 A;  1MV3 A;  3TCJ A;  4M78 E;  1M1G A;  2GF7 A;  3LLR A;  4OB2 B;  1PSF A;  3MHX A;  2JN0 A;  4MZP A;  3LWH A;  4NS5 A;  2EWN A;  2K79 A;  5CKB A;  2K2V A;  4HT8 A;  5GMK l;  3VYG A;  3AT1 B;  2O4X A;  1AZE A;  2RD1 A;  4KBM B;  3ZL7 C;  1W2B P;  1NJI C;  2RA2 A;  3J80 E;  2GFU A;  3HFO A;  1BB9 A;  2I2L A;  3G71 Q;  1UEB A;  2DD5 A;  4R0K A;  4J9H A;  2QDL A;  4Q5W A;  3I56 Q;  3JSC A;  2KEA A;  3UF4 A;  1FX7 A;  3L2V A;  3M53 A;  1C6V X;  1UFF A;  2X3W D;  2R5M A;  3G71 T;  1YIT Q;  1IHW A;  1MND A;  2CKK A;  4RCC A;  3QPH A;  2CT3 A;  4JS5 A;  1GFC A;  2QK0 A;  4PL6 A;  5LL6 S;  3JCM b;  5CK9 A;  4EMK B;  2YRV A;  1IHV A;  1VA7 A;  4BD3 A;  1YIT T;  3OBW A;  4LDV A;  4OMP A;  2PUO B;  3HRS A;  5FWC A;  4XTZ A;  3HHT B;  1K9A A;  2DJZ A;  1VQ7 T;  1LVK A;  5FW9 A;  4PLL A;  1N8R C;  3RKY A;  4XU3 A;  2RQU A;  1VQN Q;  4OMQ A;  2CP0 A;  2CUB A;  1SSF A;  2DMO A;  2DIQ A;  3JV3 A;  4UC4 A;  5GAO q;  4HCK A;  3P8D A;  2PVO B;  1IZ6 A;  1VQN T;  3CC4 Q;  1D3B A;  5LJ5 h;  2QA4 A;  4KUD K;  4K11 A;  4F17 A;  1WXB A;  2EQK A;  3CCV Q;  3VRY A;  1YI2 A;  1X6B A;  1DJ7 B;  2JUF A;  1LJO A;  1W70 A;  1WHL A;  1QVF S;  2E64 A;  3SWN A;  5CKH A;  1VOM A;  3PMT A;  1G2B A;  3SDZ A;  2MIO A;  1OYX A;  1LPL A;  2GQI A;  3CCS T;  2PU9 B;  2EPD A;  5L23 A;  5GAO m;  3OYD A;  2MK5 A;  3EGX A;  4GBQ A;  1D1A A;  2HKN A;  3CC2 A;  2OTJ Q;  3ER0 A;  4PJL A;  1AT1 B;  3DKM A;  5IN1 A;  3SWN C;  4OGE A;  3M55 A;  2KI7 A;  4HCC A;  3OSS C;  1IGQ A;  5HK0 A;  2LQN A;  1IRE B;  2OTJ T;  1W6X A;  4OMN A;  3UAT A;  1M90 R;  1RAC B;  4J6Y A;  1D1C A;  3E2U A;  2AZS A;  3CD6 A;  1ABQ A;  1UE9 A;  1T0J A;  1TUG B;  1RUW A;  3CBM A;  1RAD B;  1WDX A;  1H92 A;  4RTZ A;  3X20 B;  3H9N A;  2DL5 A;  1YIJ Q;  1UDL A;  2VUB A;  3JCM h;  1M1K U;  4C0D B;  1X43 A;  3VS2 A;  3X28 B;  2LX9 A;  3CCJ T;  1VQM A;  3M5A A;  1ZBJ A;  2CZ1 B;  1YIJ T;  4M75 F;  5LJ3 f;  2OI3 A;  1M90 C;  2QQ9 A;  4N0A A;  4PJJ A;  3VYH B;  3CBO A;  2RMO A;  2LTO A;  3EFO B;  3P8H A;  2RQW A;  4E7S A;  1BI2 A;  3CME Q;  1X6G A;  1UJY A;  1KC8 U;  4EMK A;  2OTL Q;  2E70 A;  3OYI A;  1OV3 A;  1JJ2 P;  1WXT A;  4BDZ A;  3H0I A;  3OS5 A;  3SHW A;  2C0I A;  4M7A F;  9ATC B;  5GAM d;  4N0A C;  2QGG A;  2ESW A;  2F2V A;  5GMK i;  4M75 E;  2J7I A;  3VS1 A;  1NPR A;  3T9N A;  4OF1 A;  2VVK A;  3I56 A;  3L1A A;  4FT2 A;  4J9C A;  1VQK Q;  3DB3 A;  5GMK h;  3M0Q A;  4EMK C;  2E12 A;  3JB9 J;  5GAN 3;  2XDD A;  2FO0 A;  4DBF A;  4ZNX A;  1QVG S;  3HP9 A;  1VQK T;  2RM4 A;  1KJW A;  4M7A E;  8ATC B;  4KGZ B;  2ZPG B;  1PKS A;  1SF9 A;  4O5V A;  4PNO A;  2KRM A;  1CSK A;  2LNV A;  2DRM A;  2DL7 A;  3VS3 A;  1M4Z A;  3SB2 A;  4HKE A;  1VIE A;  3U23 A;  2KE9 A;  3I9Q A;  4ZN3 A;  2AKL A;  2EQI A;  3OA6 A;  2BZX A;  5I11 A;  2G6F X;  2E3H A;  3MEV A;  1Q81 U;  1VQL Q;  1QQJ A;  3A1P A;  4RMO A;  4Z88 A;  2RHX A;  2BKD N;  3F70 A;  4E6R A;  4D8D A;  3CCQ Q;  1X01 A;  4FYV B;  1TTH B;  2LP5 A;  1YHQ A;  2QQB A;  2EFI A;  3M54 A;  2F69 A;  5I2M A;  4NL3 A;  2IPO B;  3CC7 A;  1HK9 A;  4FW1 A;  3QJ6 A;  1QMC A;  3CCQ T;  1WFW A;  2B86 A;  4Y91 A;  2V1R A;  3PIO A;  2COZ A;  1Q7Y R;  1VYV A;  1RLP C;  2VB6 A;  1OOT A;  4OB1 B;  2E1H A;  2K7A A;  1UGP B;  1G83 A;  2GCX A;  2LJ1 A;  4JZ4 A;  4DQ2 A;  5GAM e;  2G3R A;  2XHC A;  1XNI A;  1NPP A;  5FRO A;  3RKW A;  4OP0 A;  3I5S A;  4X1V A;  1TUC A;  2DXT A;  1G8X A;  3NHN A;  3E19 A;  4IKF A;  4Z8A A;  2Y4X A;  1Q82 R;  5IAY A;  3G4S Q;  1YJN Q;  5FU6 B;  1JO8 A;  2RQR A;  3EFO A;  3IQL A;  1AEY A;  4O6J A;  1Q7Y C;  3OS0 A;  3JRZ A;  4C0D C;  2PQW A;  5GAN 7;  3S3M A;  1MMN A;  4ATO A;  1PG5 B;  1AWX A;  2D0Q B;  3G4S T;  5CO7 A;  4M75 B;  4J6W A;  1KC8 C;  1LCK A;  1MMG A;  1WGS A;  2MOX A;  3MET A;  1QCO A;  2QEX Q;  3HSB A;  1UGS B;  1PWT A;  1K76 A;  3S3N A;  2DAQ A;  2DET A;  3MO8 A; 
#chains in the Genus database with same CATH homology
 2A08 A;  3NMZ C;  1OPK A;  2JMA A;  1JEG A;  4HXJ A;  1FYN A;  1T3S A;  3NPF A;  2D8J A;  2O9V A;  2PZ1 A;  1QWF A;  1RI9 A;  3LH5 A;  2A37 A;  1PRM C;  1UEC A;  2ENM A;  3M0U A;  2AZV A;  2YUP A;  1GCQ C;  2KT8 A;  2C0O A;  2FRW A;  2K9G A;  2L3P A;  1WYX A;  1WA7 A;  4ESR A;  2FEI A;  1SSH A;  1QKW A;  4JJD A;  2ECZ A;  1PHT A;  5HCK A;  1GBR A;  1M3B A;  2DF6 A;  2BTT A;  1KSW A;  4AFQ C;  2CDT A;  1I07 A;  1UUE A;  1AZG B;  3THK A;  2DM1 A;  1YNZ A;  2D8H A;  1SRM A;  1UGV A;  4D8K A;  2OAW A;  2EGA A;  1U3O A;  2YUN A;  2DBK A;  1YCS B;  2EW3 A;  4DEX A;  1NYG A;  2DIL A;  2JS0 A;  2PTK A;  3M0P A;  2VKN A;  4DEY A;  2KT1 A;  1MV3 A;  2CH4 A;  2CSI A;  3I35 A;  1UG1 A;  2O88 A;  1H8K A;  2LNH B;  2J6K A;  1VYT A;  2YT6 A;  3TSW A;  3FJ5 A;  1X27 A;  1H3H A;  2K79 A;  4FSS A;  2K3B A;  4LNP A;  1N5Z A;  1ZUY A;  2DL4 A;  1AZE A;  5EC7 A;  2M51 A;  2E5K A;  1IO6 A;  1YN8 A;  2I0N A;  1ZUK A;  3ZL7 C;  2JXB A;  1HJD A;  1BB9 A;  2F2X A;  4R0K A;  2YDL A;  4RTX A;  4J9H A;  1GL5 A;  2QDL A;  1E6G A;  2FRY A;  4KRT A;  2EGC A;  2KEA A;  3UF4 A;  1U06 A;  1YWO A;  4Z89 A;  2ED0 A;  2CUD A;  1I1J A;  3H0F A;  5ECA A;  2LZ6 B;  3A98 A;  1UFF A;  3EHQ A;  4LUE A;  2LMJ A;  2X3W D;  1GCP A;  2P4R A;  1W1F A;  2DL3 A;  2CT3 A;  2CRE A;  1NEB A;  2KBT A;  1GFC A;  2M0Y A;  4LUD A;  4RTU A;  1QCF A;  1E6H A;  2AK5 A;  4OMM A;  4RTT A;  2VWF A;  2HCK A;  2YUO A;  1NLP C;  1VA7 A;  2CH4 W;  3EGU A;  4F16 A;  2J6F A;  1SHG A;  3VS6 A;  2JTE A;  2JMC A;  4OMP A;  5FWC A;  2EGE A;  1ZSG A;  2KXD A;  1K9A A;  1X2Q A;  1M8M A;  5FW9 A;  1WI7 A;  2LX7 A;  1MUZ A;  2GGR A;  2KGT A;  2XMF A;  1Z9Z A;  2RQU A;  2SRC A;  2ROL A;  2HEQ A;  3TSZ A;  5IXB A;  4OMQ A;  2CSQ A;  4JJB A;  4WCI A;  2CUB A;  1B3Q A;  3M0T A;  2DMO A;  1RLQ C;  3H0H A;  3JV3 A;  4RUG A;  1GRI A;  4HCK A;  2A36 A;  2W0Z A;  1SEM A;  1FMK A;  5IH2 A;  4K11 A;  2ED1 A;  4F17 A;  3NGP A;  1WXB A;  3VRY A;  1X6B A;  2A28 A;  4A63 B;  2L0A A;  1TG0 A;  4Y92 A;  1E7O A;  1W70 A;  1BU1 A;  4J9D A;  4RTV A;  2X3X D;  4EIK A;  1U5S A;  1G2B A;  1BBZ A;  2L3Q A;  2MIO A;  4LE9 A;  1AD5 A;  2GQI A;  1VYU A;  2EPD A;  4AFU C;  5L23 A;  3SEM A;  1NG2 A;  3M0R A;  1X2K A;  4GBQ A;  4RTW A;  4AFS C;  3EG2 A;  3UA7 A;  1Y0M A;  4M4Z A;  1K1Z A;  4J9G A;  2O31 A;  2NWM A;  3RBB B;  4CC2 A;  1CKB A;  4J9E A;  1ABO A;  1JXO A;  2BZ8 A;  2K6D A;  2FG0 A;  4IIM A;  2LQN A;  1QKX A;  2RQT A;  5IHI A;  1W6X A;  4OMN A;  3RNJ A;  3UAT A;  1JXM A;  2KR3 A;  1SPK A;  4J9I A;  3M0S A;  2KXC A;  1NEG A;  3ULR B;  1HSQ A;  2AZS A;  1B07 A;  2H8H A;  2D0N A;  1ABQ A;  1UE9 A;  1T0J A;  2EKH A;  1M3C A;  1RUW A;  1YWP A;  1NM7 A;  4OMO A;  1ARK A;  1WDX A;  1H92 A;  4RTZ A;  4JPB W;  2DL5 A;  2JS2 A;  4QT7 A;  1UDL A;  1AWJ A;  1WX6 A;  2DA9 A;  5I22 A;  2JM8 A;  2RPN A;  3VS7 A;  2YUQ A;  1X43 A;  4JJC A;  3VS2 A;  3R6N A;  1ZUU A;  1OEB A;  1JU5 C;  4IIO A;  5IHN A;  2GNC A;  1ZBJ A;  2PNI A;  1OPL A;  4AG1 C;  3EG1 A;  2OI3 A;  3VS5 A;  1K4U S;  3GBQ A;  4RTY A;  1AWW A;  2RMO A;  3VRZ A;  2IIM A;  3PVQ A;  4J9B A;  4F14 A;  2RQW A;  1M3A A;  2JT4 A;  5FWB A;  1X6G A;  2W10 A;  2ABL A;  1UJY A;  5IXF A;  2J06 A;  1GBQ A;  2DRK A;  1OV3 A;  2LJ0 A;  1WXT A;  1PNJ A;  1SRL A;  3H0I A;  1QWE A;  4LN2 A;  3SHW A;  1JQQ A;  2C0I A;  3VS0 A;  2DE0 X;  2DNU A;  2ESW A;  4HVW A;  2F2V A;  2MCN A;  2FPD A;  1MV0 B;  2J7I A;  2RN8 A;  2HBW A;  3I5R A;  3VS1 A;  1UHC A;  1WIE A;  2VVK A;  4J9C A;  2CT4 A;  2OJ2 A;  1BK2 A;  3M0Q A;  2L2P A;  2L3S A;  1UHF A;  1ZLM A;  2FO0 A;  2SEM A;  1M30 A;  4ZNX A;  2RF0 A;  1HD3 A;  1UJ0 A;  1T0H A;  5IHK A;  1KJW A;  1CKA A;  2F2W A;  2KNB B;  1PKS A;  2KRM A;  1CSK A;  3PE0 A;  4AG2 C;  2C0T A;  2EYY A;  2DRM A;  2KRS A;  2DL7 A;  1GFD A;  1K0S A;  2DBM A;  3VS3 A;  2EVR A;  4CC3 A;  1V1C A;  3EG3 A;  2DLP A;  1PRL C;  3KFV A;  5GJW B;  4JZ3 A;  4ORZ A;  3U23 A;  2KE9 A;  2V1Q A;  1AOJ A;  3VS4 A;  3I9Q A;  2YSQ A;  3O5Z A;  2AKL A;  2EQI A;  2LJ3 A;  2HDA A;  1NYF A;  2BZX A;  1ZX6 A;  1X69 A;  5I11 A;  2G6F X;  3REB B;  3CQT A;  4Z88 A;  2EBP A;  2KRN A;  4HVU A;  4E6R A;  1K0X A;  4D8D A;  1YP5 A;  2D1X A;  2LP5 A;  1AWO A;  2RQV A;  4OML A;  1AVZ C;  2J6O A;  2ROT A;  2GTJ A;  3REA B;  3EG0 A;  1WFW A;  2B86 A;  4GLM A;  2V1R A;  1Z9Q A;  2DL8 A;  2LQW A;  2LCS A;  1I0C A;  1VYV A;  3QWX X;  1RLP C;  1XOV A;  1OOT A;  2EYZ A;  2K7A A;  4J9F A;  1G83 A;  2RNA A;  2EYX A;  1EFN A;  2KYB A;  1UTI A;  2LJ1 A;  4JZ4 A;  2JW4 A;  3UA6 A;  2DVJ A;  2GTO A;  1KIK A;  2KRO A;  4CC7 A;  2KYM A;  2DJQ A;  1TUD A;  2NUZ A;  1M27 C;  2O9S A;  3I5S A;  4X1V A;  1NLO C;  1TUC A;  2DYB A;  3C0C A;  2K2M A;  3EHR A;  3NHN A;  4Z8A A;  1WLP B;  1S1N A;  1JO8 A;  2DX1 A;  2RQR A;  3IQL A;  1J3T A;  1AEY A;  4HVV A;  3PVL A;  1SHF A;  1KFZ A;  2FPF A;  1PKT A;  5GJV B;  1T3L A;  2FPE A;  1AWX A;  3H41 A;  1Y57 A;  2JM9 A;  2HSP A;  1A0N B;  1LCK A;  3QWY A;  2MOX A;  3TVT A;  2BZY A;  2EYW A;  1GCQ A;  2AKK A;  2O2O A;  4AFZ C;  1PWT A;  1K76 A;  4CC4 B;  1QLY A;  1WXU A;  2J05 A;  2GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...