3I35A

Human sh3 domain of protein lasp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
KRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human SH3 domain of protein LASP1
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords LIM and SH3 domain protein 1
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i35A00
2C0IA 3EHRA 2ED0A 2RN8A 1NG2A 2X3WD 1RLQC 2MOXA 2YDLA 4AFSC 2RQWA 1YWOA 4K11A 1UDLA 3H0IA 1HJDA 2EPDA 1M27C 1E6GA 2RQRA 1BU1A 2BZYA 3I5RA 1AZGB 2GTJA 1GCPA 2FRWA 5IXFA 1T3SA 2JMAA 4FSSA 4HCKA 1M3CA 2FPDA 4JPBW 4LUEA 1M8MA 2KXCA 5I22A 2KBTA 2SRCA 1VA7A 2VKNA 3O5ZA 3REAB 2J6FA 1MUZA 1W1FA 1CKAA 1X2QA 1Z9ZA 1A0NB 2DL8A 3UF4A 2CSIA 2KNBB 1AEYA 2FEIA 1QWFA 1PRLC 4F17A 2CSQA 3NMZC 3TSZA 1AWOA 2YT6A 1VYVA 2JM8A 1K9AA 3VS3A 1NLPC 1PNJA 2ED1A 5EC7A 3VS1A 2DRKA 2DYBA 2VWFA 2DNUA 3TVTA 2GTOA 1RI9A 3M0SA 4Z88A 2JS2A 2EGEA 2K9GA 1V1CA 3LH5A 1BB9A 5IXBA 1KIKA 2AZSA 2DL7A 4J9HA 2FG0A 1ZLMA 4DEXA 1EFNA 4RTYA 3ULRB 2KE9A 1GCQC 1T0HA 1LCKA 2EQIA 1WX6A 1T3LA 2AZVA 3PVLA 2KRNA 1TUDA 2EVRA 1ZBJA 3JV3A 2LNHB 2DE0X 2K7AA 1X2KA 1FMKA 2KRMA 4HXJA 2ROTA 1UJ0A 1PHTA 2CT3A 1BBZA 1PKSA 3EHQA 1SRLA 2H8HA 3RNJA 2AKLA 2EYYA 4HVUA 1GFCA 1CSKA 4J9BA 2LJ0A 2J7IA 1GRIA 2FRYA 1SSHA 2M51A 4RUGA 2B86A 4J9CA 3VRYA 2DBMA 3FJ5A 4IIMA 1AWWA 1G83A 1UJYA 3NPFA 3M0UA 1JXOA 2DX1A 2DA9A 2DL5A 1Y57A 2VVKA 1XOVA 1YP5A 3VS4A 1SRMA 2FPEA 4J9EA 1TUCA 3KFVA 1AOJA 2PZ1A 1K0SA 2LQWA 4AFQC 2DMOA 2YSQA 3UA7A 2L3PA 1HSQA 2YUQA 4J9DA 1W6XA 2LJ1A 3R6NA 2FO0A 3I5SA 1UHFA 3IQLA 1YWPA 1VYUA 2KRSA 1YN8A 1NYGA 4CC3A 3EG2A 3VS0A 2KYMA 4ORZA 2LJ3A 2GGRA 2ENMA 2JW4A 3RBBB 2KROA 4E6RA 2MIOA 1PWTA 2O31A 3EG3A 4OMMA 2JM9A 4RTUA 1UG1A 2EYZA 2C0OA 4GBQA 2OJ2A 1K1ZA 1OEBA 4DEYA 3QWYA 2IIMA 4A63B 2EYWA 3M0PA 4F14A 1WXBA 4AFZC 2G6FX 1U3OA 4LNPA 1KJWA 2L2PA 3UA6A 1H92A 2YUPA 2ECZA 4OMPA 2A28A 1M30A 2DRMA 2JT4A 4CC7A 1GBRA 4JZ4A 4KRTA 4RTWA 3SEMA 2AK5A 2ROLA 1UUEA 4AG2C 2PNIA 3U23A 2JXBA 2RF0A 2O9SA 2K6DA 2W10A 2L3QA 1GCQA 2DJQA 4HVWA 2YUNA 2W0ZA 1JU5C 4CC2A 5IH2A 3REBB 4IIOA 2A37A 1G2BA 2YUOA 4R0KA 4ZNXA 4HVVA 4Y92A 1OV3A 1Z9QA 1PRMC 3H0FA 1I1JA 1B07A 2K79A 3VS2A 2J06A 1KFZA 4F16A 2GQIA 3SHWA 4J9IA 1U06A 2RQTA 4D8KA 3C0CA 1ZUYA 1Y0MA 2EW3A 2HBWA 4OMNA 3VRZA 1WXTA 2EKHA 1BK2A 1PKTA 2DVJA 1SPKA 2V1RA 1IO6A 2KGTA 2OAWA 2JTEA 1WDXA 5IHKA 2NWMA 2F2XA 1W70A 1NYFA 2FPFA 3H41A 2OI3A 2X3XD 4LN2A 4JJDA 4D8DA 4OMLA 2RPNA 1WFWA 2DL4A 2RQVA 1WYXA 1J3TA 2KXDA 1SHGA 2NUZA 3H0HA 2LP5A 2O88A 2LMJA 3GBQA 1UGVA 4X1VA 3A98A 2D8JA 2KEAA 3NHNA 2LCSA 1MV0B 1UTIA 1X27A 2V1QA 2CREA 2CT4A 1AD5A 2A36A 1ZUKA 2I0NA 1NM7A 2EYXA 2DBKA 1OOTA 2LQNA 4J9GA 5FWCA 5GJVB 2O9VA 4LUDA 1QLYA 5GJWB 2KT1A 1AWXA 4OMOA 1X6BA 1I0CA 1QKWA 2L3SA 2KT8A 4AG1C 1E6HA 2RQUA 2AKKA 2J6OA 2LX7A 1JO8A 4M4ZA 1GBQA 3I35A 3VS5A 1HD3A 2J05A 1S1NA 2P4RA 3THKA 2GBQA 1WLPB 4RTVA 4OMQA 2HSPA 1JEGA 1UHCA 2D0NA 1OPKA 1WA7A 2DL3A 1KSWA 1H3HA 1M3AA 1ARKA 2EGAA 2O2OA 1MV3A 2ABLA 1RLPC 4AFUC 1WXUA 1I07A 2J6KA 2DM1A 2K3BA 5L23A 2ESWA 1UFFA 1K76A 1X6GA 1B3QA 1QWEA 1UE9A 1WIEA 4GLMA 4LE9A 3UATA 1JQQA 1ABQA 5IHIA 4EIKA 3M0RA 4JJBA 1N5ZA 2XMFA 3TSWA 2HEQA 2DF6A 1NEGA 2DLPA 1ZSGA 2LZ6B 3VS7A 1K4US 3CQTA 3VS6A 5ECAA 1K0XA 2BZ8A 1TG0A 3EGUA 5HCKA 2M0YA 2D1XA 1CKBA 4Z89A 1T0JA 3NGPA 3QWXX 2SEMA 2QDLA 1GFDA 1M3BA 2KYBA 1RUWA 5I11A 2KR3A 1SEMA 2JMCA 4JJCA 2RNAA 5IHNA 3EG0A 1ZUUA 2F2WA 4J9FA 5FW9A 1AWJA 4RTTA 2CDTA 2L0AA 1U5SA 2JS0A 2PTKA 2CUBA 2CH4W 2RMOA 1AVZC 4QT7A 2A08A 3EG1A 2C0TA 1YNZA 3PE0A 2EBPA 1QKXA 2MCNA 1FYNA 2CUDA 1GL5A 4JZ3A 3M0QA 3ZL7C 4WCIA 2GNCA 5FWBA 3I9QA 1UECA 2CH4A 1E7OA 1OPLA 1WI7A 2F2VA 1QCFA 1NLOC 2K2MA 1X69A 2E5KA 2BZXA 1ZX6A 1JXMA 1AZEA 1X43A 3PVQA 1SHFA 4CC4B 2EGCA 4ESRA 2HCKA 2D8HA 2DILA 3M0TA 1VYTA 2BTTA 1YCSB 4RTZA 1ABOA 4Z8AA 2HDAA 1NEBA 4RTXA 1H8KA
chains in the Genus database with same CATH superfamily
3CCLQ 3M59A 3EHRA 3M57A 3MEAA 2ED0A 1VQ8Q 2RN8A 2D9TA 2X3WD 1RLQC 1VQPQ 4LDYA 1C0MA 1YWOA 4K11A 5CKEA 1Y71A 2H3EB 1M27C 1E6GA 5LJ3d 4JDSA 2RQRA 4KH0B 4A4GA 2FRWA 5IXFA 1TWBA 2JMAA 4FSSA 3OS0A 3ME9A 2FPDA 2E3HA 5GAN4 4OB3B 3NTIA 3O5ZA 3REAB 3SWNC 1W1FA 1CKAA 2DL8A 3G71Q 3UF4A 4XTVA 2KNBB 2EFIA 1AEYA 2FEIA 4DQ2A 3S6WA 1PRLC 4BUGA 2F1LA 4M75G 4LD6A 1AWOA 3TSZA 4PFOA 1Q82R 2YT6A 3JSCA 2E12A 3OYIA 1FWZA 3FIFA 4OF1A 4PFPA 3JCMg 4QKUA 1WJQA 3TVTA 3QYHB 2E64A 3GPLA 1RI9A 3RDVA 2KI7A 2EGEA 2KDSA 1QVFP 3L2UA 2AZSA 2QTXA 2K5FA 1M1KC 3HRSA 1XNIA 2LT1A 4FYYB 4XU1A 8AT1B 2KE9A 5J3BA 2XHCA 1S72Q 1G5VA 1WQWA 2K5IA 1UGPB 1WX6A 5CQXA 3JB9I 1YI2T 2AZVA 2KRNA 5GAMf 5CKDA 3FC3A 3QZ5B 3JV3A 2CS7A 2DE0X 1K73C 2E65A 2L8DA 5D6YA 1I81A 1PKSA 3OYCA 3FEOA 3EHQA 1IREB 4C8QB 4M7AD 2QA4A 1VQ4A 4DBFA 2LT4A 1GFCA 1CSKA 1Q81C 2LJ0A 1GRIA 2FRYA 3OYEA 2DBMA 2XIDA 3A1PA 4XTWA 2V26A 3HPWA 3CPWP 3RMSA 3CC7T 3NPFA 2Y4XA 1KG1A 3X25B 1WNLA 4FIBA 3CCUA 4BDYA 2HAXA 1BYMA 3QIIA 3EFOA 2DL5A 2VVKA 1AOJA 2PZ1A 5GAN8 1K0SA 1I5OB 3QDFA 4AFQC 4C0FA 3UA7A 2L3PA 4J9DA 4L5GA 1D1CA 2E1HA 1Q81R 1YHQQ 2ATCB 3LLRA 1UHFA 3I56T 1VYUA 4CC3A 5LJ3f 3CCLT 3CMAA 3EG2A 1KQSA 3CCVT 1X6OA 2GGRA 2ENMA 1RI0A 2O31A 2DTOA 4RTUA 6AT1B 3F70A 3V8JA 1VIFA 4M7AG 1K1ZA 3L2VA 1Y96B 4BI4A 4FL6A 2EYWA 3M0PA 4A63B 1HK9A 2X4YA 3S3NA 4J6WA 4M7DC 1UEBA 2JT4A 2CP0A 2ZCFB 4CC7A 1GBRA 5KYXA 4JZ4A 4KRTA 2JZ2A 4E7IA 1VQ6T 2AK5A 2GFUA 2KAFA 3QHSA 2PNIA 3U23A 2HZYA 2JXBA 5D7UA 1RAAB 3I56A 2L3QA 2HL3A 1JU5C 2K2VA 1WHMA 4IIOA 1G2BA 2YUOA 2VV5A 1OV3A 1PRMC 1NE8A 2K79A 3G6EA 1OQKA 7AT1B 5DLOA 5KYUA 4J9IA 3KXTA 5LJ3j 2MAMA 5CKHA 1S72A 4C92G 2LCLA 2QQAA 2FB7A 2VUBA 2I2LA 4QW2A 1LOJA 2EKHA 4KH1B 3QG1A 3H9NA 5KYUB 1IO6A 2RD1A 3WVEB 2KGTA 4MZTA 3OYDA 2DTHA 2QQSA 1X75C 3E2UA 1JB0E 2CP2A 1ACMB 4D8DA 3I55A 2KMTA 1QP3A 4PJNA 4XTXA 4OMLA 3UPUA 2PQWA 1Y96A 4A54A 2DL4A 2WACA 2YRVA 2COYA 4JUVA 2EKOA 1M9SA 1UGVA 1KD1C 3G4ST 2KEAA 1D1AA 1YHQT 4A4EA 2DEUA 2R58A 2A36A 5KYXB 1ZUKA 3PNWC 2EQJA 2LQNA 1OOTA 5FWCA 1K8AC 3PFSA 3CMET 5FU7B 2FL7A 1I0CA 4JJNK 1QKWA 4M7DD 1M90R 1OU8A 3OYFA 2LX7A 2CZ0B 2PVDB 2BE9B 4M4ZA 2GCXA 4IKFA 3J81E 5I2MA 1SKUB 2RHIA 3CPFA 3I35A 2J05A 1S1NA 3QDRB 4NL2A 1G3SA 2GBQA 4RTVA 1JEGA 1JRIA 2HSPA 3SWNB 3EGDB 2DAQA 2NUTB 2DL3A 2GQVA 2OTJT 4O6JA 4RMOA 1DJ7B 3Q1JA 3FLGA 1RLPC 1G3YA 1MNDA 2YLBA 2YXYA 5LJ3h 1MMAA 1QWEA 1VUBA 3LH0A 3P8DA 4GLMA 1JQQA 4LDXA 2B8AA 5KH6A 2E41A 2QK0A 4FT4A 4JRKA 4EIKA 2X51A 2YRCA 1N5ZA 2HEQA 2DF6A 2CP6A 1NEGA 2LZ6B 1K4US 1P92A 1VQ5Q 2CKKA 2EQMA 2VXEA 3O8VA 1K0XA 2QQ9A 3WVDB 1UGRB 1VQ5T 3GIBA 1Q7YR 4Z89A 1TU0B 4EPCA 1K73U 2ZAEA 2QDLA 3S3OA 1KC8U 3L42A 1RUWA 1V29B 2KR3A 1SEMA 4JJCA 3EAEA 2P0QA 5CCAA 4J9FA 1AWJA 4JS4A 4C8QF 3BFMA 1ZA1B 2CUBA 4C92B 2MWPA 4B6MA 2A08A 5GANh 5A0LA 1YNZA 3PE0A 4ME7A 4PLLA 5GAOm 1N6AA 4XK8E 5FWBA 3OYMA 5A0GA 4JRQA 1ZSZC 4N0AC 3LWHA 5KE2A 5KE3A 2F2VA 4NL3A 2EQKA 2XDDA 3HRUA 1ZX6A 3M53A 1VQPT 4DBQA 4LDUA 3OBWA 4EDUA 4II1A 4Z8AA 1NEBA 2BKDN 2HKNA 4M7AE 2F5TX 3CBMA 4R55A 1VQNA 1H8KA 4V2SA 2D0QB 3A5ZB 3M54A 5D6WA 1NG2A 4BDZA 2KK4A 3QZ9B 1UDLA 1VQKQ 2RI3A 2H3JA 2A3LA 2LX9A 2OAUA 4JLIA 1Y07A 3CCVQ 3I5RA 3CCUT 2GTJA 3OS2A 3MP8A 4C8QG 1KHIA 1SSFA 2K4YA 1I8FA 4M7AA 4JPBW 2KXCA 4ELYC 2DXCA 3INZA 4FCYA 1X2QA 3BW1A 3L2ZA 1YITQ 2QGGA 4E7JA 2CSIA 4F7UE 4QQ6A 5FROA 1JJ2P 1OI1A 5GAN5 2JOYA 4E7ZA 2K3XA 1BI3A 1VQKA 1SG5A 4RG2A 2DNUA 1MMGA 2GTOA 4Z88A 2IPOB 1BIBA 1KIKA 2M9UA 2WSEE 1F1BB 3VKIA 2FG0A 3X28B 4DEXA 4C8QD 4QVCA 2M0OA 1T0HA 2EQIA 3PVLA 1WJSA 1TUDA 2O4XB 3JCMQ 3MP6A 4ZN3A 2EVRA 1ZBJA 1K8AR 4WF2A 3CCMT 1BKBA 1X2KA 2BUDA 1FMKA 1M2VA 2KRMA 4HXJA 1NBEB 1TOVA 2VXFA 2NUPB 2H8HA 3MPUB 3RNJA 4F7UF 5LJ3g 4HVUA 4PFZA 1VQ7Q 4M77D 3J7AF 4M77B 2B86A 4J9CA 1BIAA 1G83A 1TS9A 1IGQA 1TTHB 3RUXA 3UDCA 5A0DA 1XOVA 1SRMA 2OTJA 2OX7A 4M77G 2X35A 1MMNA 4ZGEB 1K9MR 4VUBA 2DMOA 1HSQA 4CI0C 4HCCA 3R6NA 3PIPA 2FO0A 1G3WA 3BDLA 4N4HA 3IQLA 1VQMT 1YWPA 2KRSA 5CR2A 1YN8A 1NYGA 5DM7R 3QPHA 4BI8B 3NTHA 2CP5A 2IG0A 2AIRB 4M78A 3VS0A 2PU9B 2DIGA 2KYMA 3EFRA 3PIOA 2JW4A 2P0KA 3RBBB 3GF5A 2MIOA 1PWTA 1RAHB 3EG3A 2IVWA 2JM9A 4EMKB 2EYZA 3TU4K 3LX7A 1ZSZA 3DB3A 2P84A 4KGZB 1S72T 2G6FX 2MK5A 4N4GA 1H92A 1OX9A 2ECZA 4M75D 9ATCB 2XI9A 1SF9A 1ZBXA 2JTFA 4WTOB 2ZPIB 4RTWA 4OGEA 2LCCA 3R6OA 3G71A 2EAYA 1YJ9A 1R8OB 5J39A 1FMWA 4IUVA 2XKOC 1PSFA 2RHYA 2K6DA 2KQWA 1Q81U 2QTVA 3OYJA 2DJQA 2PVOB 4M78D 4C0ZA 4CC2A 4M7DG 3M4GA 4R0KA 1Z9QA 4FT2A 3MEWA 1BCMA 1OZ2A 1C1AA 3VS2A 5A2QE 3NTKA 3OW2S 2HD0A 4F16A 2OTLT 3SHWA 1IZ6A 3CCMA 3I55T 4D8KA 2HQEA 3QO3A 2EW3A 4M75F 5DLQE 1BK2A 5DY9A 2V1RA 3G71T 3JCMe 1D3BB 1B7TA 1WDXA 2F2XA 3JB9J 1VQMQ 2OI3A 2X3XD 4MDWA 1M1FA 3OYKA 1IB8A 2E5QA 2RPNA 4LD9K 2JTMA 2P0PA 4KGVB 1WZOA 4KULA 3PGGA 4HT9A 2LP5A 2DXTA 2PUKB 3CC4Q 1YJNQ 3A98A 1VQKT 4PJMA 3NHNA 3OYNA 3OW2P 2DPPB 1MV0B 2HSEB 1WPYA 2X4WA 2ZPHB 1YIJQ 4C92D 2CREA 1AD5A 2XICA 5FU7C 1ZA2B 2EYXA 5GAOn 3RMQA 5GAOl 1QLYA 1QVGP 1WHLA 5GJWB 2K5LA 4OMOA 5HY6A 1X6BA 1N9SA 2L3SA 2KT8A 4MZPA 2RQUA 1VQLT 4F04B 2J6OA 3VV0A 3RESA 1JO8A 1FXXA 2EQUA 5GANj 4QQDA 1N8RR 2LRQA 2P4RA 4OMQA 1OPKA 1UB4A 4DOWA 1D0YA 4FW1A 3CMEA 3T9NA 2CP3A 2AHJB 4M77C 2MF2A 1M3AA 4M7AF 4BB7A 2E4HA 4AT1B 2XK0A 4FU6A 1KQ1A 1IRXA 1I07A 1VQNT 2COZA 1JBMA 1K76A 1B3QA 3G4SA 3UATA 4Y91A 1ABQA 5IHIA 2XMFA 2DLPA 4TVRA 3CQTA 4X9CA 5CK9A 1WHGA 1TG0A 4XU0A 5HCKA 1T0JA 1IGUA 1WHHA 3QWXX 3A8MB 5GANd 3OA6A 4M75A 2DXBA 1M3BA 2KYBA 4GLKA 3VU3C 1TXQA 5GANg 1RACB 1M90C 1QP2A 3A8HB 5KYWA 3OS1A 5FW9A 2LQKA 4FYXB 2KSSA 1U5SA 2JS0A 5FLXE 5LJ5h 2OTJQ 2PTKA 3CC2T 2CH4W 1AVZC 3EG1A 4MMKA 5IT9E 2C0TA 2DZCA 5GAMj 4M7DA 1QKXA 2MCNA 1FYNA 1GL5A 2CZ1B 3CCSQ 5FU6C 3EG9B 4WCIA 1PM3A 1UECA 4BY6B 5J26A 3CCET 1HYOA 2RB6A 3CCST 1VQ7A 2C06A 1OPLA 3VUBA 2RO0A 2HQHA 2V8JA 4MZMA 1NLOC 2RK1A 3CMEQ 2E5KA 4NOYA 2BZXA 2F5KA 3CCRT 3PVQA 4CC4B 3PTAA 3G6ET 1M1KR 5I2SA 1W2BP 4ESRA 2HCKA 4X9DA 2D8HA 2DILA 3QBYA 4Z02A 1YCSB 1ABOA 1Q82C 3S3MA 1OYXA 3C12A 4XU3A 3BY7A 5HKCA 3MP1A 2E6NA 1M2OA 3VUZA 4MDXA 3TREA 4RCBA 4J6XA 5GMKe 4HKEA 5GAMd 1VIEA 1H3ZA 1M4ZA 2AT1B 2YDLA 4AFSC 2RQWA 1VQ6Q 3JCMJ 1N27A 5M9OA 2EPDA 1EX4A 2BZYA 3DKMA 1AZGB 4IUUA 5GAN6 4DOVA 3M55A 4PL6A 3DB4A 1YITA 5GMKh 4XTUA 2LC4A 2YHTA 4M77A 1M8MA 1QW1A 5I22A 5GMKj 2R57A 1VA7A 2VKNA 2J6FA 1MUZA 2E70A 2BE7D 4FYVB 2Y4YA 5GAOq 1PG5B 4ZN1A 4RKUE 1QWFA 4F17A 2CSQA 1D09B 3NMZC 4C92C 4XU2A 2GFAA 4F7UA 2RJEA 2LNVA 2EJFA 5CIUA 2QA4T 1VQ4T 1K9AA 1XJWB 1VQ6A 5EC7A 2DYBA 2VWFA 3ER0A 3QXEB 3OMGA 4XQ3A 3SDZA 2JS2A 2K9GA 2M1HA 1V1CA 2ZGWA 3LH5A 3HKSA 5IXBA 3A8GB 3QKJA 2WSFE 3CC4T 3C95A 1YJWT 5GAOp 4PJLA 4J9HA 1ZLMA 1KQSP 1GCQC 5LJ5e 1WJRA 2CGHA 1D0ZA 3RKWA 2DD4A 4F7UB 4PJOB 4E7KA 1VQMA 1YJNA 2LNHB 2RK2A 1M1GA 4EMKC 3JCMh 2DFUA 1D1BA 3MO8A 2ROTA 1UJ0A 1FMVA 1BBZA 2QEXT 3M56A 3VJPA 4UC4A 2DERA 2AKLA 2WSCE 5GAMh 2J7IA 5KCOA 1Q95G 5CKFA 3VRYA 1VQPA 4J6YA 4OGCA 3RKXA 5C6SA 1UJYA 5D6XA 2VYTA 5LJ5j 3G4SQ 1VQ8A 4M78G 4CRIA 2QQRA 2DX1A 4RG8A 3OSSC 1U8RA 1NPRA 1Y57A 1B34A 1YP5A 3VS4A 3JCMW 1TUCA 1G8XA 1QCOA 2E3IA 4PJOC 5CQYA 2LQWA 2YSQA 5KYYB 1G3TA 2YUQA 3LYIA 2DK3A 3V8KA 1W6XA 2HQXA 2LJ1A 1PD0A 1ZQ1A 3FB9A 1RL2A 4C92F 2RJFA 4X34A 5LJ5g 2PVGB 1W2BS 1VQNQ 2DEQA 4J7FA 1YITT 2LJ3A 3OB9A 4BI3A 4E6RA 2KROA 3CCQT 4E7HA 3OYAA 4GBQA 5LJ5d 3SD4A 4DEYA 3QWYA 2IIMA 4F14A 1WXBA 3SB2A 4LNPA 1KJWA 4HT8A 2K3YA 3H8ZA 3L1AA 1M30A 2DRMA 4A4HA 3QJYA 5C0MA 4KUIA 3SEMA 3EGXA 3MEUA 1MNEA 4C92A 4D6WA 1BI0A 4XTZA 1K73R 1NPPA 2O9SA 2JVVA 2W10A 1GCQA 3OYGA 4HVWA 5IH2A 2HMAA 4ZNXA 4Y92A 3FRNA 1I1JA 1B07A 3L2QA 3CCEQ 4IURA 1PC0A 1OULA 2RQTA 2V8IA 3JCMc 1Y0MA 1XTDA 2EJ9A 5KYNA 3VRZA 4AMCA 3CC2A 1M90U 4PJOF 2L5QA 1PKTA 2DVJA 1SPKA 1X01A 1RAEB 1YI2Q 1W70A 4NS5A 1QQJA 2OTLA 1TH7A 4JJDA 3CXCA 4L6V5 3V7CA 1XQHA 2NYSA 3KBGA 3JB9D 3CXCS 5LJ5f 2MMPA 5CVIA 1J3TA 2KXDA 2NUTA 2NUZA 1TUGB 3EGDA 3SWNA 3A8OB 3H0HA 5HK0A 3WXMB 2QQBA 3GLXA 3GBQA 2D6FA 2ZPBB 3CC7Q 2LCSA 1UTIA 1X27A 3EGXB 2V1QA 2DKGA 2CT4A 2EWNA 4B9WA 4L59A 3CBOA 3LW5E 4A4FA 2M16A 1NM7A 2YRDA 3G1JA 4J9GA 1Q7YC 5GAN3 3CD6A 5CO7A 4OB0B 1D3BA 1U1SA 2KT1A 3HHTB 4AG1C 1E6HA 1ZSZB 1LPLA 4M78C 1GBQA 4JRPA 3VS5A 3I56Q 1HD3A 3THKA 2D0NA 3PT9A 1WA7A 2P4TA 1KSWA 2FZGB 2Z0WA 1YJWQ 1ARKA 4Y28E 1KD1U 4OVAA 2QGFB 2JUFA 3E9FA 4LDWA 5HK3A 1WXUA 4C8QC 2J6KA 3A8LB 3X26B 2DM1A 3RKYA 1WGSA 5L23A 1Q82U 2ESWA 2QDYB 1YJ9T 3OQ5A 5KYYA 2DETA 4A53A 3CCSA 1M5Q1 2BIVA 4JJBA 4PJOA 2OTLQ 2L89A 1YJ9Q 3NFCA 4Q5WA 1ZSGA 2O01E 1UGSB 3CC2Q 5ECAA 4KUDK 3GNFB 3MCAB 1UGQB 1R77A 2D1XA 1BCOA 1O9SA 1NJIC 5GMKm 3BDUA 3FDRA 3E1SA 1GFDA 5I11A 2E6ZA 1VQ9T 2CZ7B 4B9XA 3CC7A 3GP8A 1M2VB 1ZUUA 2F2WA 4KT0E 4RTTA 3E19A 2L0AA 1N8RC 3CCQA 2LVMA 2MYSA 3CCUQ 4OB1B 2E10A 3TCJA 3AHUA 3CCRA 1KQ2A 2RA2A 4JZ3A 4DBHA 3M0QA 2QAZA 3P8BB 4PJOD 3CCJT 1YIJT 2LQ8A 3X20B 1C6VX 4N4IA 2CH4A 5FU6B 4M75C 4ZGDB 1E7OA 3CMAQ 3ZEHA 1WI7A 1KK7A 1QCFA 3ASKA 2X4JA 4R56A 3M9QA 5IN1A 1X69A 3MEVA 1LJOA 1AZEA 1Y7XA 1B34B 2EGCA 2VGNA 4LXCA 1R0CB 1VQ9A 4C5EA 3M0TA 3EFSA 2VGMA 2BTTA 1I5LA 4OB2B 1YBYA 2JJ9A 5I21A 2RM4A 2HDAA 5L8RE 3OSVA 2KVQG 3V7SA 3CCQQ 3JCMb 2ZPEB 1M8VA 2C0IA 4FW2A 4FSXA 5LL6S 1RADB 1IHWA 1IXDA 2XU8A 5GAOr 2EJGA 2MOXA 4ATOA 3OBYA 4M7AB 2XDPA 3H0IA 3L2RA 1HJDA 2EYQA 3CBPA 3OMCA 1BU1A 1QVGS 4PJOG 3GOXA 1GCPA 4E47A 1T3SA 2EIFA 2CZ6B 3HFNA 5CAIA 4HCKA 4DBRA 1M3CA 1EZZB 4LUEA 5AYFA 1PSEA 2KBTA 3G6EQ 1RAFB 3HFOA 2SRCA 1YJNT 4C8QA 4C0DC 3EG9A 1Z9ZA 5GMKi 1A0NB 1KD1R 4IUTA 1ZHIA 2VASA 4M77F 4ANJA 5FRNA 4J83A 1WQ7A 4ELZC 1VYVA 4JLGA 2JM8A 4C92E 1MMDA 3OYYA 4BE0A 5KYWB 3VS3A 3FJPA 5GMKl 2YLCA 1VQ9Q 1VOMA 2V8KA 1NLPC 3UWNA 1PNJA 2ED1A 1HXDA 3VS1A 2DRKA 3CCEA 3EH1A 3META 2QI2A 3M0SA 1YFNA 4C0GA 1Q86U 1WHJA 1BB9A 2QEXQ 3HSBA 4ZTJA 4QVZA 4XTYA 3CD6Q 2RJCA 2DL7A 3N5BB 1EFNA 4RTYA 3ULRB 4M7DB 1LCKA 4M7DE 1T3LA 5LJ3e 3OY9A 2F69A 2LTOA 3V8LA 2DYIA 1KQSS 2K7AA 4QQGA 1NJIU 4GY5A 4C5IA 2DJZA 1PHTA 4C0DB 2CT3A 1YJWA 1AT1B 1KC8C 1SRLA 2EYYA 2R5AA 3JB9H 3TQ7P 4J9BA 1KHCA 5CKBA 2M51A 2RHXA 1SSHA 4RUGA 3CCJQ 4PJOE 4C5HA 1I4K1 3FJ5A 4IIMA 1AWWA 1VQLQ 3LWIA 2A7YA 3M0UA 1GXIE 4BE1A 3V7RA 1N9RA 1JXOA 3SFMA 2DA9A 1JJ2A 2VB6A 5IAYA 1LVKA 3TEEA 2FPEA 3D7SB 4J9EA 3ZFJA 4JS5A 3KFVA 3MHXA 3CCVA 1D0XA 3RIRA 1YHQA 1VQOA 3LGFA 2QG9B 4EMHA 2NLUA 1R0BG 3I5SA 2GF7A 5GAN7 2QA4Q 1VQ4Q 3CPWA 1N8RU 3HTRA 4OP0A 3QYGB 4IUQA 2FVUA 1W4SA 3CEYA 1NJIR 4ORZA 2RI5A 4M78E 3M5AA 2QEXA 4OMMA 1UG1A 5GANf 1VQLA 2C0OA 3JB9G 2OJ2A 3KUFA 1OEBA 4J5YA 3CCJA 3J80E 4E2FB 1YIJA 1JJ2S 1W2BA 4AFZC 1U3OA 2L2PA 3UA6A 4M75B 2YUPA 3DLMA 3VYGA 2DXUA 1H641 2A28A 4OMPA 3CC4A 3HP9A 1BI2A 3UT1A 2M02A 3URGA 1QMCA 2ROLA 3RR6A 4HA8A 4N0AA 1K9MU 1UUEA 2R5MA 3JCMd 2X9HA 2RJDA 1Q7YU 2CP7A 4AG2C 4C8QE 3QUIA 2RF0A 2JN0A 3HL8A 1OX8A 2HBPA 2JNGA 3C94A 3C4SA 2YUNA 2W0ZA 3REBB 1O75A 1OU9A 4ZGJB 3MJXA 2A37A 4BE2A 4HVVA 2DVEA 2HL5C 3JCMf 1TSFA 2XG8D 3H0FA 4QVDA 2RHZA 2DO3A 2J06A 1KFZA 3MKDA 4MMLA 3AT1B 4M77E 2GQIA 1YI2A 1U06A 4FYWB 3C0CA 1ZUYA 2HBWA 4BD3A 3QJ6A 3GNGA 4OMNA 1NZ9A 3OS5A 2RH2A 1WXTA 4J8OA 2YWWA 2OAWA 2JTEA 2VC8A 3BE3A 5IHKA 4KBMB 5KCHA 2NWMA 2DZ9A 2XD0A 4KGXB 5GAN2 1NYFA 2FPFA 3H41A 4JRIA 4LN2A 1M1KU 2ZPGB 1K8AU 3M58A 2CYZB 1FX7A 1WFWA 2MWOA 1QVGA 3CMAT 1LNXA 3PMTA 2RQVA 1WYXA 1SHGA 1BI1A 2MPXC 3X24B 2O88A 3H6ZA 1YCYA 2A0FB 1MGQA 2LMJA 4FM4B 3LGLA 4M78B 4X1VA 4BACA 2HKQB 2D8JA 1PD1A 4EMGA 1OZ3A 2QYZA 3CCMQ 1Q86C 3CPWS 2MI6A 4OMFB 8ATCB 4PLIA 1WHKA 1QCNA 2KY9A 3JAME 4RCCA 3DLLA 4E7LA 3P8HA 2I0NA 2DBKA 5GJVB 3RERA 3JCMX 2O9VA 4LUDA 5EG2A 4M7DF 2DD5A 2FZKB 1AWXA 4IUPA 1VQ5A 3QSUA 2L3RA 2AKKA 1KC8R 2DIQA 3I55Q 4HCBA 4EMKA 1VQ8T 1WLPB 3OW2A 1UHCA 3JCMP 2FHDA 1RAIB 3M4YA 3CD6T 3VYHB 1H3HA 2EGAA 2O2OA 1MV3A 2ABLA 2LDMA 3JCMV 4AFUC 2NUPA 2ZZDA 3OYLA 1QVFS 2DTIA 2RHUA 2K3BA 4PK4A 2G3RA 2K57A 1U1TA 4C5GA 1UFFA 3E9GA 5FRMA 1X6GA 1UE9A 1WIEA 4LE9A 3CCRQ 1IHVA 2Y90A 2O4XA 3M0RA 3TSWA 1PCXA 4M78F 1RABB 4A4KA 3VS7A 3VS6A 3PMIA 1Q86R 1VQ7T 2BZ8A 3JRZA 3EGUA 2M0YA 4BY6C 5GAMe 1CKBA 4J7IA 4F7UG 3NGPA 2SEMA 4LDVA 1RAGB 1V76A 3L2WA 2JMCA 4YTLA 2RNAA 5IHNA 5AT1B 3EG0A 2ZPFB 1QVFA 3CCLA 3HRTA 4PKCC 2CDTA 2QASA 2FZCB 2RMOA 4E7SA 4QT7A 3EH2A 2EBPA 2CUDA 2FYKA 1VQOT 2RI2A 3ZL7C 2GNCA 1EIFA 4M75E 3I9QA 4PNOA 2HNIA 1VQOQ 3OYBA 4P5NA 4HCZA 3ZBDA 2XDBA 1K9MC 4PJJA 3OYHA 4ZTFA 2K2MA 1JXMA 5GANe 1X43A 1SHFA 4DA4A 3EFOB 1VYTA 2COWA 1AHJB 3G7ZA 4XAXB 3JB9F 5GAMg 3CXCP 4RTZA 4M7AC 4O5VA 1MHNA 1QVPA 2PUOB 4RTXA 2QXFA 2X4XA
chains in the Genus database with same CATH topology
2C0IA 3EHRA 2ED0A 2RN8A 1NG2A 2X3WD 1RLQC 2MOXA 2YDLA 4AFSC 2RQWA 1YWOA 4K11A 1UDLA 3H0IA 1HJDA 2EPDA 1M27C 1E6GA 2RQRA 1BU1A 2BZYA 3I5RA 1AZGB 2GTJA 1GCPA 2FRWA 5IXFA 1T3SA 2JMAA 4FSSA 4HCKA 1M3CA 2FPDA 4JPBW 4LUEA 1M8MA 2KXCA 5I22A 2KBTA 2SRCA 1VA7A 2VKNA 3O5ZA 3REAB 2J6FA 1MUZA 1W1FA 1CKAA 1X2QA 1Z9ZA 1A0NB 2DL8A 3UF4A 2CSIA 2KNBB 1AEYA 2FEIA 1QWFA 1PRLC 4F17A 2CSQA 3NMZC 3TSZA 1AWOA 2YT6A 1VYVA 2JM8A 1K9AA 3VS3A 1NLPC 1PNJA 2ED1A 5EC7A 3VS1A 2DRKA 2DYBA 2VWFA 2DNUA 3TVTA 2GTOA 1RI9A 3M0SA 4Z88A 2JS2A 2EGEA 2K9GA 1V1CA 3LH5A 1BB9A 5IXBA 1KIKA 2AZSA 2DL7A 4J9HA 2FG0A 1ZLMA 4DEXA 1EFNA 4RTYA 3ULRB 2KE9A 1GCQC 1T0HA 1LCKA 2EQIA 1WX6A 1T3LA 2AZVA 3PVLA 2KRNA 1TUDA 2EVRA 1ZBJA 3JV3A 2LNHB 2DE0X 2K7AA 1X2KA 1FMKA 2KRMA 4HXJA 2ROTA 1UJ0A 1PHTA 2CT3A 1BBZA 1PKSA 3EHQA 1SRLA 2H8HA 3RNJA 2AKLA 2EYYA 4HVUA 1GFCA 1CSKA 4J9BA 2LJ0A 2J7IA 1GRIA 2FRYA 1SSHA 2M51A 4RUGA 2B86A 4J9CA 3VRYA 2DBMA 3FJ5A 4IIMA 1AWWA 1G83A 1UJYA 3NPFA 3M0UA 1JXOA 2DX1A 2DA9A 2DL5A 1Y57A 2VVKA 1XOVA 1YP5A 3VS4A 1SRMA 2FPEA 4J9EA 1TUCA 3KFVA 1AOJA 2PZ1A 1K0SA 2LQWA 4AFQC 2DMOA 2YSQA 3UA7A 2L3PA 1HSQA 2YUQA 4J9DA 1W6XA 2LJ1A 3R6NA 2FO0A 3I5SA 1UHFA 3IQLA 1YWPA 1VYUA 2KRSA 1YN8A 1NYGA 4CC3A 3EG2A 3VS0A 2KYMA 4ORZA 2LJ3A 2GGRA 2ENMA 2JW4A 3RBBB 2KROA 4E6RA 2MIOA 1PWTA 2O31A 3EG3A 4OMMA 2JM9A 4RTUA 1UG1A 2EYZA 2C0OA 4GBQA 2OJ2A 1K1ZA 1OEBA 4DEYA 3QWYA 2IIMA 4A63B 2EYWA 3M0PA 4F14A 1WXBA 4AFZC 2G6FX 1U3OA 4LNPA 1KJWA 2L2PA 3UA6A 1H92A 2YUPA 2ECZA 4OMPA 2A28A 1M30A 2DRMA 2JT4A 4CC7A 1GBRA 4JZ4A 4KRTA 4RTWA 3SEMA 2AK5A 2ROLA 1UUEA 4AG2C 2PNIA 3U23A 2JXBA 2RF0A 2O9SA 2K6DA 2W10A 2L3QA 1GCQA 2DJQA 4HVWA 2YUNA 2W0ZA 1JU5C 4CC2A 5IH2A 3REBB 4IIOA 2A37A 1G2BA 2YUOA 4R0KA 4ZNXA 4HVVA 4Y92A 1OV3A 1Z9QA 1PRMC 3H0FA 1I1JA 1B07A 2K79A 3VS2A 2J06A 1KFZA 4F16A 2GQIA 3SHWA 4J9IA 1U06A 2RQTA 4D8KA 3C0CA 1ZUYA 1Y0MA 2EW3A 2HBWA 4OMNA 3VRZA 1WXTA 2EKHA 1BK2A 1PKTA 2DVJA 1SPKA 2V1RA 1IO6A 2KGTA 2OAWA 2JTEA 1WDXA 5IHKA 2NWMA 2F2XA 1W70A 1NYFA 2FPFA 3H41A 2OI3A 2X3XD 4LN2A 4JJDA 4D8DA 4OMLA 2RPNA 1WFWA 2DL4A 2RQVA 1WYXA 1J3TA 2KXDA 1SHGA 2NUZA 3H0HA 2LP5A 2O88A 2LMJA 3GBQA 1UGVA 4X1VA 3A98A 2D8JA 2KEAA 3NHNA 2LCSA 1MV0B 1UTIA 1X27A 2V1QA 2CREA 2CT4A 1AD5A 2A36A 1ZUKA 2I0NA 1NM7A 2EYXA 2DBKA 1OOTA 2LQNA 4J9GA 5FWCA 5GJVB 2O9VA 4LUDA 1QLYA 5GJWB 2KT1A 1AWXA 4OMOA 1X6BA 1I0CA 1QKWA 2L3SA 2KT8A 4AG1C 1E6HA 2RQUA 2AKKA 2J6OA 2LX7A 1JO8A 4M4ZA 1GBQA 3I35A 3VS5A 1HD3A 2J05A 1S1NA 2P4RA 3THKA 2GBQA 1WLPB 4RTVA 4OMQA 2HSPA 1JEGA 1UHCA 2D0NA 1OPKA 1WA7A 2DL3A 1KSWA 1H3HA 1M3AA 1ARKA 2EGAA 2O2OA 1MV3A 2ABLA 1RLPC 4AFUC 1WXUA 1I07A 2J6KA 2DM1A 2K3BA 5L23A 2ESWA 1UFFA 1K76A 1X6GA 1B3QA 1QWEA 1UE9A 1WIEA 4GLMA 4LE9A 3UATA 1JQQA 1ABQA 5IHIA 4EIKA 3M0RA 4JJBA 1N5ZA 2XMFA 3TSWA 2HEQA 2DF6A 1NEGA 2DLPA 1ZSGA 2LZ6B 3VS7A 1K4US 3CQTA 3VS6A 5ECAA 1K0XA 2BZ8A 1TG0A 3EGUA 5HCKA 2M0YA 2D1XA 1CKBA 4Z89A 1T0JA 3NGPA 3QWXX 2SEMA 2QDLA 1GFDA 1M3BA 2KYBA 1RUWA 5I11A 2KR3A 1SEMA 2JMCA 4JJCA 2RNAA 5IHNA 3EG0A 1ZUUA 2F2WA 4J9FA 5FW9A 1AWJA 4RTTA 2CDTA 2L0AA 1U5SA 2JS0A 2PTKA 2CUBA 2CH4W 2RMOA 1AVZC 4QT7A 2A08A 3EG1A 2C0TA 1YNZA 3PE0A 2EBPA 1QKXA 2MCNA 1FYNA 2CUDA 1GL5A 4JZ3A 3M0QA 3ZL7C 4WCIA 2GNCA 5FWBA 3I9QA 1UECA 2CH4A 1E7OA 1OPLA 1WI7A 2F2VA 1QCFA 1NLOC 2K2MA 1X69A 2E5KA 2BZXA 1ZX6A 1JXMA 1AZEA 1X43A 3PVQA 1SHFA 4CC4B 2EGCA 4ESRA 2HCKA 2D8HA 2DILA 3M0TA 1VYTA 2BTTA 1YCSB 4RTZA 1ABOA 4Z8AA 2HDAA 1NEBA 4RTXA 1H8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0I A;  3EHR A;  2ED0 A;  2RN8 A;  1NG2 A;  2X3W D;  1RLQ C;  2MOX A;  2YDL A;  4AFS C;  2RQW A;  1YWO A;  4K11 A;  1UDL A;  3H0I A;  1HJD A;  2EPD A;  1M27 C;  1E6G A;  2RQR A;  1BU1 A;  2BZY A;  3I5R A;  1AZG B;  2GTJ A;  1GCP A;  2FRW A;  5IXF A;  1T3S A;  2JMA A;  4FSS A;  4HCK A;  1M3C A;  2FPD A;  4JPB W;  4LUE A;  1M8M A;  2KXC A;  5I22 A;  2KBT A;  2SRC A;  1VA7 A;  2VKN A;  3O5Z A;  3REA B;  2J6F A;  1MUZ A;  1W1F A;  1CKA A;  1X2Q A;  1Z9Z A;  1A0N B;  2DL8 A;  3UF4 A;  2CSI A;  2KNB B;  1AEY A;  2FEI A;  1QWF A;  1PRL C;  4F17 A;  2CSQ A;  3NMZ C;  3TSZ A;  1AWO A;  2YT6 A;  1VYV A;  2JM8 A;  1K9A A;  3VS3 A;  1NLP C;  1PNJ A;  2ED1 A;  5EC7 A;  3VS1 A;  2DRK A;  2DYB A;  2VWF A;  2DNU A;  3TVT A;  2GTO A;  1RI9 A;  3M0S A;  4Z88 A;  2JS2 A;  2EGE A;  2K9G A;  1V1C A;  3LH5 A;  1BB9 A;  5IXB A;  1KIK A;  2AZS A;  2DL7 A;  4J9H A;  2FG0 A;  1ZLM A;  4DEX A;  1EFN A;  4RTY A;  3ULR B;  2KE9 A;  1GCQ C;  1T0H A;  1LCK A;  2EQI A;  1WX6 A;  1T3L A;  2AZV A;  3PVL A;  2KRN A;  1TUD A;  2EVR A;  1ZBJ A;  3JV3 A;  2LNH B;  2DE0 X;  2K7A A;  1X2K A;  1FMK A;  2KRM A;  4HXJ A;  2ROT A;  1UJ0 A;  1PHT A;  2CT3 A;  1BBZ A;  1PKS A;  3EHQ A;  1SRL A;  2H8H A;  3RNJ A;  2AKL A;  2EYY A;  4HVU A;  1GFC A;  1CSK A;  4J9B A;  2LJ0 A;  2J7I A;  1GRI A;  2FRY A;  1SSH A;  2M51 A;  4RUG A;  2B86 A;  4J9C A;  3VRY A;  2DBM A;  3FJ5 A;  4IIM A;  1AWW A;  1G83 A;  1UJY A;  3NPF A;  3M0U A;  1JXO A;  2DX1 A;  2DA9 A;  2DL5 A;  1Y57 A;  2VVK A;  1XOV A;  1YP5 A;  3VS4 A;  1SRM A;  2FPE A;  4J9E A;  1TUC A;  3KFV A;  1AOJ A;  2PZ1 A;  1K0S A;  2LQW A;  4AFQ C;  2DMO A;  2YSQ A;  3UA7 A;  2L3P A;  1HSQ A;  2YUQ A;  4J9D A;  1W6X A;  2LJ1 A;  3R6N A;  2FO0 A;  3I5S A;  1UHF A;  3IQL A;  1YWP A;  1VYU A;  2KRS A;  1YN8 A;  1NYG A;  4CC3 A;  3EG2 A;  3VS0 A;  2KYM A;  4ORZ A;  2LJ3 A;  2GGR A;  2ENM A;  2JW4 A;  3RBB B;  2KRO A;  4E6R A;  2MIO A;  1PWT A;  2O31 A;  3EG3 A;  4OMM A;  2JM9 A;  4RTU A;  1UG1 A;  2EYZ A;  2C0O A;  4GBQ A;  2OJ2 A;  1K1Z A;  1OEB A;  4DEY A;  3QWY A;  2IIM A;  4A63 B;  2EYW A;  3M0P A;  4F14 A;  1WXB A;  4AFZ C;  2G6F X;  1U3O A;  4LNP A;  1KJW A;  2L2P A;  3UA6 A;  1H92 A;  2YUP A;  2ECZ A;  4OMP A;  2A28 A;  1M30 A;  2DRM A;  2JT4 A;  4CC7 A;  1GBR A;  4JZ4 A;  4KRT A;  4RTW A;  3SEM A;  2AK5 A;  2ROL A;  1UUE A;  4AG2 C;  2PNI A;  3U23 A;  2JXB A;  2RF0 A;  2O9S A;  2K6D A;  2W10 A;  2L3Q A;  1GCQ A;  2DJQ A;  4HVW A;  2YUN A;  2W0Z A;  1JU5 C;  4CC2 A;  5IH2 A;  3REB B;  4IIO A;  2A37 A;  1G2B A;  2YUO A;  4R0K A;  4ZNX A;  4HVV A;  4Y92 A;  1OV3 A;  1Z9Q A;  1PRM C;  3H0F A;  1I1J A;  1B07 A;  2K79 A;  3VS2 A;  2J06 A;  1KFZ A;  4F16 A;  2GQI A;  3SHW A;  4J9I A;  1U06 A;  2RQT A;  4D8K A;  3C0C A;  1ZUY A;  1Y0M A;  2EW3 A;  2HBW A;  4OMN A;  3VRZ A;  1WXT A;  2EKH A;  1BK2 A;  1PKT A;  2DVJ A;  1SPK A;  2V1R A;  1IO6 A;  2KGT A;  2OAW A;  2JTE A;  1WDX A;  5IHK A;  2NWM A;  2F2X A;  1W70 A;  1NYF A;  2FPF A;  3H41 A;  2OI3 A;  2X3X D;  4LN2 A;  4JJD A;  4D8D A;  4OML A;  2RPN A;  1WFW A;  2DL4 A;  2RQV A;  1WYX A;  1J3T A;  2KXD A;  1SHG A;  2NUZ A;  3H0H A;  2LP5 A;  2O88 A;  2LMJ A;  3GBQ A;  1UGV A;  4X1V A;  3A98 A;  2D8J A;  2KEA A;  3NHN A;  2LCS A;  1MV0 B;  1UTI A;  1X27 A;  2V1Q A;  2CRE A;  2CT4 A;  1AD5 A;  2A36 A;  1ZUK A;  2I0N A;  1NM7 A;  2EYX A;  2DBK A;  1OOT A;  2LQN A;  4J9G A;  5FWC A;  5GJV B;  2O9V A;  4LUD A;  1QLY A;  5GJW B;  2KT1 A;  1AWX A;  4OMO A;  1X6B A;  1I0C A;  1QKW A;  2L3S A;  2KT8 A;  4AG1 C;  1E6H A;  2RQU A;  2AKK A;  2J6O A;  2LX7 A;  1JO8 A;  4M4Z A;  1GBQ A;  3I35 A;  3VS5 A;  1HD3 A;  2J05 A;  1S1N A;  2P4R A;  3THK A;  2GBQ A;  1WLP B;  4RTV A;  4OMQ A;  2HSP A;  1JEG A;  1UHC A;  2D0N A;  1OPK A;  1WA7 A;  2DL3 A;  1KSW A;  1H3H A;  1M3A A;  1ARK A;  2EGA A;  2O2O A;  1MV3 A;  2ABL A;  1RLP C;  4AFU C;  1WXU A;  1I07 A;  2J6K A;  2DM1 A;  2K3B A;  5L23 A;  2ESW A;  1UFF A;  1K76 A;  1X6G A;  1B3Q A;  1QWE A;  1UE9 A;  1WIE A;  4GLM A;  4LE9 A;  3UAT A;  1JQQ A;  1ABQ A;  5IHI A;  4EIK A;  3M0R A;  4JJB A;  1N5Z A;  2XMF A;  3TSW A;  2HEQ A;  2DF6 A;  1NEG A;  2DLP A;  1ZSG A;  2LZ6 B;  3VS7 A;  1K4U S;  3CQT A;  3VS6 A;  5ECA A;  1K0X A;  2BZ8 A;  1TG0 A;  3EGU A;  5HCK A;  2M0Y A;  2D1X A;  1CKB A;  4Z89 A;  1T0J A;  3NGP A;  3QWX X;  2SEM A;  2QDL A;  1GFD A;  1M3B A;  2KYB A;  1RUW A;  5I11 A;  2KR3 A;  1SEM A;  2JMC A;  4JJC A;  2RNA A;  5IHN A;  3EG0 A;  1ZUU A;  2F2W A;  4J9F A;  5FW9 A;  1AWJ A;  4RTT A;  2CDT A;  2L0A A;  1U5S A;  2JS0 A;  2PTK A;  2CUB A;  2CH4 W;  2RMO A;  1AVZ C;  4QT7 A;  2A08 A;  3EG1 A;  2C0T A;  1YNZ A;  3PE0 A;  2EBP A;  1QKX A;  2MCN A;  1FYN A;  2CUD A;  1GL5 A;  4JZ3 A;  3M0Q A;  3ZL7 C;  4WCI A;  2GNC A;  5FWB A;  3I9Q A;  1UEC A;  2CH4 A;  1E7O A;  1OPL A;  1WI7 A;  2F2V A;  1QCF A;  1NLO C;  2K2M A;  1X69 A;  2E5K A;  2BZX A;  1ZX6 A;  1JXM A;  1AZE A;  1X43 A;  3PVQ A;  1SHF A;  4CC4 B;  2EGC A;  4ESR A;  2HCK A;  2D8H A;  2DIL A;  3M0T A;  1VYT A;  2BTT A;  1YCS B;  4RTZ A;  1ABO A;  4Z8A A;  2HDA A;  1NEB A;  4RTX A;  1H8K A; 
#chains in the Genus database with same CATH topology
 3CCL Q;  3M59 A;  3EHR A;  3M57 A;  3MEA A;  2ED0 A;  1VQ8 Q;  2RN8 A;  2D9T A;  2X3W D;  1RLQ C;  1VQP Q;  4LDY A;  1C0M A;  1YWO A;  4K11 A;  5CKE A;  1Y71 A;  2H3E B;  1M27 C;  1E6G A;  5LJ3 d;  4JDS A;  2RQR A;  4KH0 B;  4A4G A;  2FRW A;  5IXF A;  1TWB A;  2JMA A;  4FSS A;  3OS0 A;  3ME9 A;  2FPD A;  2E3H A;  5GAN 4;  4OB3 B;  3NTI A;  3O5Z A;  3REA B;  3SWN C;  1W1F A;  1CKA A;  2DL8 A;  3G71 Q;  3UF4 A;  4XTV A;  2KNB B;  2EFI A;  1AEY A;  2FEI A;  4DQ2 A;  3S6W A;  1PRL C;  4BUG A;  2F1L A;  4M75 G;  4LD6 A;  1AWO A;  3TSZ A;  4PFO A;  1Q82 R;  2YT6 A;  3JSC A;  2E12 A;  3OYI A;  1FWZ A;  3FIF A;  4OF1 A;  4PFP A;  3JCM g;  4QKU A;  1WJQ A;  3TVT A;  3QYH B;  2E64 A;  3GPL A;  1RI9 A;  3RDV A;  2KI7 A;  2EGE A;  2KDS A;  1QVF P;  3L2U A;  2AZS A;  2QTX A;  2K5F A;  1M1K C;  3HRS A;  1XNI A;  2LT1 A;  4FYY B;  4XU1 A;  8AT1 B;  2KE9 A;  5J3B A;  2XHC A;  1S72 Q;  1G5V A;  1WQW A;  2K5I A;  1UGP B;  1WX6 A;  5CQX A;  3JB9 I;  1YI2 T;  2AZV A;  2KRN A;  5GAM f;  5CKD A;  3FC3 A;  3QZ5 B;  3JV3 A;  2CS7 A;  2DE0 X;  1K73 C;  2E65 A;  2L8D A;  5D6Y A;  1I81 A;  1PKS A;  3OYC A;  3FEO A;  3EHQ A;  1IRE B;  4C8Q B;  4M7A D;  2QA4 A;  1VQ4 A;  4DBF A;  2LT4 A;  1GFC A;  1CSK A;  1Q81 C;  2LJ0 A;  1GRI A;  2FRY A;  3OYE A;  2DBM A;  2XID A;  3A1P A;  4XTW A;  2V26 A;  3HPW A;  3CPW P;  3RMS A;  3CC7 T;  3NPF A;  2Y4X A;  1KG1 A;  3X25 B;  1WNL A;  4FIB A;  3CCU A;  4BDY A;  2HAX A;  1BYM A;  3QII A;  3EFO A;  2DL5 A;  2VVK A;  1AOJ A;  2PZ1 A;  5GAN 8;  1K0S A;  1I5O B;  3QDF A;  4AFQ C;  4C0F A;  3UA7 A;  2L3P A;  4J9D A;  4L5G A;  1D1C A;  2E1H A;  1Q81 R;  1YHQ Q;  2ATC B;  3LLR A;  1UHF A;  3I56 T;  1VYU A;  4CC3 A;  5LJ3 f;  3CCL T;  3CMA A;  3EG2 A;  1KQS A;  3CCV T;  1X6O A;  2GGR A;  2ENM A;  1RI0 A;  2O31 A;  2DTO A;  4RTU A;  6AT1 B;  3F70 A;  3V8J A;  1VIF A;  4M7A G;  1K1Z A;  3L2V A;  1Y96 B;  4BI4 A;  4FL6 A;  2EYW A;  3M0P A;  4A63 B;  1HK9 A;  2X4Y A;  3S3N A;  4J6W A;  4M7D C;  1UEB A;  2JT4 A;  2CP0 A;  2ZCF B;  4CC7 A;  1GBR A;  5KYX A;  4JZ4 A;  4KRT A;  2JZ2 A;  4E7I A;  1VQ6 T;  2AK5 A;  2GFU A;  2KAF A;  3QHS A;  2PNI A;  3U23 A;  2HZY A;  2JXB A;  5D7U A;  1RAA B;  3I56 A;  2L3Q A;  2HL3 A;  1JU5 C;  2K2V A;  1WHM A;  4IIO A;  1G2B A;  2YUO A;  2VV5 A;  1OV3 A;  1PRM C;  1NE8 A;  2K79 A;  3G6E A;  1OQK A;  7AT1 B;  5DLO A;  5KYU A;  4J9I A;  3KXT A;  5LJ3 j;  2MAM A;  5CKH A;  1S72 A;  4C92 G;  2LCL A;  2QQA A;  2FB7 A;  2VUB A;  2I2L A;  4QW2 A;  1LOJ A;  2EKH A;  4KH1 B;  3QG1 A;  3H9N A;  5KYU B;  1IO6 A;  2RD1 A;  3WVE B;  2KGT A;  4MZT A;  3OYD A;  2DTH A;  2QQS A;  1X75 C;  3E2U A;  1JB0 E;  2CP2 A;  1ACM B;  4D8D A;  3I55 A;  2KMT A;  1QP3 A;  4PJN A;  4XTX A;  4OML A;  3UPU A;  2PQW A;  1Y96 A;  4A54 A;  2DL4 A;  2WAC A;  2YRV A;  2COY A;  4JUV A;  2EKO A;  1M9S A;  1UGV A;  1KD1 C;  3G4S T;  2KEA A;  1D1A A;  1YHQ T;  4A4E A;  2DEU A;  2R58 A;  2A36 A;  5KYX B;  1ZUK A;  3PNW C;  2EQJ A;  2LQN A;  1OOT A;  5FWC A;  1K8A C;  3PFS A;  3CME T;  5FU7 B;  2FL7 A;  1I0C A;  4JJN K;  1QKW A;  4M7D D;  1M90 R;  1OU8 A;  3OYF A;  2LX7 A;  2CZ0 B;  2PVD B;  2BE9 B;  4M4Z A;  2GCX A;  4IKF A;  3J81 E;  5I2M A;  1SKU B;  2RHI A;  3CPF A;  3I35 A;  2J05 A;  1S1N A;  3QDR B;  4NL2 A;  1G3S A;  2GBQ A;  4RTV A;  1JEG A;  1JRI A;  2HSP A;  3SWN B;  3EGD B;  2DAQ A;  2NUT B;  2DL3 A;  2GQV A;  2OTJ T;  4O6J A;  4RMO A;  1DJ7 B;  3Q1J A;  3FLG A;  1RLP C;  1G3Y A;  1MND A;  2YLB A;  2YXY A;  5LJ3 h;  1MMA A;  1QWE A;  1VUB A;  3LH0 A;  3P8D A;  4GLM A;  1JQQ A;  4LDX A;  2B8A A;  5KH6 A;  2E41 A;  2QK0 A;  4FT4 A;  4JRK A;  4EIK A;  2X51 A;  2YRC A;  1N5Z A;  2HEQ A;  2DF6 A;  2CP6 A;  1NEG A;  2LZ6 B;  1K4U S;  1P92 A;  1VQ5 Q;  2CKK A;  2EQM A;  2VXE A;  3O8V A;  1K0X A;  2QQ9 A;  3WVD B;  1UGR B;  1VQ5 T;  3GIB A;  1Q7Y R;  4Z89 A;  1TU0 B;  4EPC A;  1K73 U;  2ZAE A;  2QDL A;  3S3O A;  1KC8 U;  3L42 A;  1RUW A;  1V29 B;  2KR3 A;  1SEM A;  4JJC A;  3EAE A;  2P0Q A;  5CCA A;  4J9F A;  1AWJ A;  4JS4 A;  4C8Q F;  3BFM A;  1ZA1 B;  2CUB A;  4C92 B;  2MWP A;  4B6M A;  2A08 A;  5GAN h;  5A0L A;  1YNZ A;  3PE0 A;  4ME7 A;  4PLL A;  5GAO m;  1N6A A;  4XK8 E;  5FWB A;  3OYM A;  5A0G A;  4JRQ A;  1ZSZ C;  4N0A C;  3LWH A;  5KE2 A;  5KE3 A;  2F2V A;  4NL3 A;  2EQK A;  2XDD A;  3HRU A;  1ZX6 A;  3M53 A;  1VQP T;  4DBQ A;  4LDU A;  3OBW A;  4EDU A;  4II1 A;  4Z8A A;  1NEB A;  2BKD N;  2HKN A;  4M7A E;  2F5T X;  3CBM A;  4R55 A;  1VQN A;  1H8K A;  4V2S A;  2D0Q B;  3A5Z B;  3M54 A;  5D6W A;  1NG2 A;  4BDZ A;  2KK4 A;  3QZ9 B;  1UDL A;  1VQK Q;  2RI3 A;  2H3J A;  2A3L A;  2LX9 A;  2OAU A;  4JLI A;  1Y07 A;  3CCV Q;  3I5R A;  3CCU T;  2GTJ A;  3OS2 A;  3MP8 A;  4C8Q G;  1KHI A;  1SSF A;  2K4Y A;  1I8F A;  4M7A A;  4JPB W;  2KXC A;  4ELY C;  2DXC A;  3INZ A;  4FCY A;  1X2Q A;  3BW1 A;  3L2Z A;  1YIT Q;  2QGG A;  4E7J A;  2CSI A;  4F7U E;  4QQ6 A;  5FRO A;  1JJ2 P;  1OI1 A;  5GAN 5;  2JOY A;  4E7Z A;  2K3X A;  1BI3 A;  1VQK A;  1SG5 A;  4RG2 A;  2DNU A;  1MMG A;  2GTO A;  4Z88 A;  2IPO B;  1BIB A;  1KIK A;  2M9U A;  2WSE E;  1F1B B;  3VKI A;  2FG0 A;  3X28 B;  4DEX A;  4C8Q D;  4QVC A;  2M0O A;  1T0H A;  2EQI A;  3PVL A;  1WJS A;  1TUD A;  2O4X B;  3JCM Q;  3MP6 A;  4ZN3 A;  2EVR A;  1ZBJ A;  1K8A R;  4WF2 A;  3CCM T;  1BKB A;  1X2K A;  2BUD A;  1FMK A;  1M2V A;  2KRM A;  4HXJ A;  1NBE B;  1TOV A;  2VXF A;  2NUP B;  2H8H A;  3MPU B;  3RNJ A;  4F7U F;  5LJ3 g;  4HVU A;  4PFZ A;  1VQ7 Q;  4M77 D;  3J7A F;  4M77 B;  2B86 A;  4J9C A;  1BIA A;  1G83 A;  1TS9 A;  1IGQ A;  1TTH B;  3RUX A;  3UDC A;  5A0D A;  1XOV A;  1SRM A;  2OTJ A;  2OX7 A;  4M77 G;  2X35 A;  1MMN A;  4ZGE B;  1K9M R;  4VUB A;  2DMO A;  1HSQ A;  4CI0 C;  4HCC A;  3R6N A;  3PIP A;  2FO0 A;  1G3W A;  3BDL A;  4N4H A;  3IQL A;  1VQM T;  1YWP A;  2KRS A;  5CR2 A;  1YN8 A;  1NYG A;  5DM7 R;  3QPH A;  4BI8 B;  3NTH A;  2CP5 A;  2IG0 A;  2AIR B;  4M78 A;  3VS0 A;  2PU9 B;  2DIG A;  2KYM A;  3EFR A;  3PIO A;  2JW4 A;  2P0K A;  3RBB B;  3GF5 A;  2MIO A;  1PWT A;  1RAH B;  3EG3 A;  2IVW A;  2JM9 A;  4EMK B;  2EYZ A;  3TU4 K;  3LX7 A;  1ZSZ A;  3DB3 A;  2P84 A;  4KGZ B;  1S72 T;  2G6F X;  2MK5 A;  4N4G A;  1H92 A;  1OX9 A;  2ECZ A;  4M75 D;  9ATC B;  2XI9 A;  1SF9 A;  1ZBX A;  2JTF A;  4WTO B;  2ZPI B;  4RTW A;  4OGE A;  2LCC A;  3R6O A;  3G71 A;  2EAY A;  1YJ9 A;  1R8O B;  5J39 A;  1FMW A;  4IUV A;  2XKO C;  1PSF A;  2RHY A;  2K6D A;  2KQW A;  1Q81 U;  2QTV A;  3OYJ A;  2DJQ A;  2PVO B;  4M78 D;  4C0Z A;  4CC2 A;  4M7D G;  3M4G A;  4R0K A;  1Z9Q A;  4FT2 A;  3MEW A;  1BCM A;  1OZ2 A;  1C1A A;  3VS2 A;  5A2Q E;  3NTK A;  3OW2 S;  2HD0 A;  4F16 A;  2OTL T;  3SHW A;  1IZ6 A;  3CCM A;  3I55 T;  4D8K A;  2HQE A;  3QO3 A;  2EW3 A;  4M75 F;  5DLQ E;  1BK2 A;  5DY9 A;  2V1R A;  3G71 T;  3JCM e;  1D3B B;  1B7T A;  1WDX A;  2F2X A;  3JB9 J;  1VQM Q;  2OI3 A;  2X3X D;  4MDW A;  1M1F A;  3OYK A;  1IB8 A;  2E5Q A;  2RPN A;  4LD9 K;  2JTM A;  2P0P A;  4KGV B;  1WZO A;  4KUL A;  3PGG A;  4HT9 A;  2LP5 A;  2DXT A;  2PUK B;  3CC4 Q;  1YJN Q;  3A98 A;  1VQK T;  4PJM A;  3NHN A;  3OYN A;  3OW2 P;  2DPP B;  1MV0 B;  2HSE B;  1WPY A;  2X4W A;  2ZPH B;  1YIJ Q;  4C92 D;  2CRE A;  1AD5 A;  2XIC A;  5FU7 C;  1ZA2 B;  2EYX A;  5GAO n;  3RMQ A;  5GAO l;  1QLY A;  1QVG P;  1WHL A;  5GJW B;  2K5L A;  4OMO A;  5HY6 A;  1X6B A;  1N9S A;  2L3S A;  2KT8 A;  4MZP A;  2RQU A;  1VQL T;  4F04 B;  2J6O A;  3VV0 A;  3RES A;  1JO8 A;  1FXX A;  2EQU A;  5GAN j;  4QQD A;  1N8R R;  2LRQ A;  2P4R A;  4OMQ A;  1OPK A;  1UB4 A;  4DOW A;  1D0Y A;  4FW1 A;  3CME A;  3T9N A;  2CP3 A;  2AHJ B;  4M77 C;  2MF2 A;  1M3A A;  4M7A F;  4BB7 A;  2E4H A;  4AT1 B;  2XK0 A;  4FU6 A;  1KQ1 A;  1IRX A;  1I07 A;  1VQN T;  2COZ A;  1JBM A;  1K76 A;  1B3Q A;  3G4S A;  3UAT A;  4Y91 A;  1ABQ A;  5IHI A;  2XMF A;  2DLP A;  4TVR A;  3CQT A;  4X9C A;  5CK9 A;  1WHG A;  1TG0 A;  4XU0 A;  5HCK A;  1T0J A;  1IGU A;  1WHH A;  3QWX X;  3A8M B;  5GAN d;  3OA6 A;  4M75 A;  2DXB A;  1M3B A;  2KYB A;  4GLK A;  3VU3 C;  1TXQ A;  5GAN g;  1RAC B;  1M90 C;  1QP2 A;  3A8H B;  5KYW A;  3OS1 A;  5FW9 A;  2LQK A;  4FYX B;  2KSS A;  1U5S A;  2JS0 A;  5FLX E;  5LJ5 h;  2OTJ Q;  2PTK A;  3CC2 T;  2CH4 W;  1AVZ C;  3EG1 A;  4MMK A;  5IT9 E;  2C0T A;  2DZC A;  5GAM j;  4M7D A;  1QKX A;  2MCN A;  1FYN A;  1GL5 A;  2CZ1 B;  3CCS Q;  5FU6 C;  3EG9 B;  4WCI A;  1PM3 A;  1UEC A;  4BY6 B;  5J26 A;  3CCE T;  1HYO A;  2RB6 A;  3CCS T;  1VQ7 A;  2C06 A;  1OPL A;  3VUB A;  2RO0 A;  2HQH A;  2V8J A;  4MZM A;  1NLO C;  2RK1 A;  3CME Q;  2E5K A;  4NOY A;  2BZX A;  2F5K A;  3CCR T;  3PVQ A;  4CC4 B;  3PTA A;  3G6E T;  1M1K R;  5I2S A;  1W2B P;  4ESR A;  2HCK A;  4X9D A;  2D8H A;  2DIL A;  3QBY A;  4Z02 A;  1YCS B;  1ABO A;  1Q82 C;  3S3M A;  1OYX A;  3C12 A;  4XU3 A;  3BY7 A;  5HKC A;  3MP1 A;  2E6N A;  1M2O A;  3VUZ A;  4MDX A;  3TRE A;  4RCB A;  4J6X A;  5GMK e;  4HKE A;  5GAM d;  1VIE A;  1H3Z A;  1M4Z A;  2AT1 B;  2YDL A;  4AFS C;  2RQW A;  1VQ6 Q;  3JCM J;  1N27 A;  5M9O A;  2EPD A;  1EX4 A;  2BZY A;  3DKM A;  1AZG B;  4IUU A;  5GAN 6;  4DOV A;  3M55 A;  4PL6 A;  3DB4 A;  1YIT A;  5GMK h;  4XTU A;  2LC4 A;  2YHT A;  4M77 A;  1M8M A;  1QW1 A;  5I22 A;  5GMK j;  2R57 A;  1VA7 A;  2VKN A;  2J6F A;  1MUZ A;  2E70 A;  2BE7 D;  4FYV B;  2Y4Y A;  5GAO q;  1PG5 B;  4ZN1 A;  4RKU E;  1QWF A;  4F17 A;  2CSQ A;  1D09 B;  3NMZ C;  4C92 C;  4XU2 A;  2GFA A;  4F7U A;  2RJE A;  2LNV A;  2EJF A;  5CIU A;  2QA4 T;  1VQ4 T;  1K9A A;  1XJW B;  1VQ6 A;  5EC7 A;  2DYB A;  2VWF A;  3ER0 A;  3QXE B;  3OMG A;  4XQ3 A;  3SDZ A;  2JS2 A;  2K9G A;  2M1H A;  1V1C A;  2ZGW A;  3LH5 A;  3HKS A;  5IXB A;  3A8G B;  3QKJ A;  2WSF E;  3CC4 T;  3C95 A;  1YJW T;  5GAO p;  4PJL A;  4J9H A;  1ZLM A;  1KQS P;  1GCQ C;  5LJ5 e;  1WJR A;  2CGH A;  1D0Z A;  3RKW A;  2DD4 A;  4F7U B;  4PJO B;  4E7K A;  1VQM A;  1YJN A;  2LNH B;  2RK2 A;  1M1G A;  4EMK C;  3JCM h;  2DFU A;  1D1B A;  3MO8 A;  2ROT A;  1UJ0 A;  1FMV A;  1BBZ A;  2QEX T;  3M56 A;  3VJP A;  4UC4 A;  2DER A;  2AKL A;  2WSC E;  5GAM h;  2J7I A;  5KCO A;  1Q95 G;  5CKF A;  3VRY A;  1VQP A;  4J6Y A;  4OGC A;  3RKX A;  5C6S A;  1UJY A;  5D6X A;  2VYT A;  5LJ5 j;  3G4S Q;  1VQ8 A;  4M78 G;  4CRI A;  2QQR A;  2DX1 A;  4RG8 A;  3OSS C;  1U8R A;  1NPR A;  1Y57 A;  1B34 A;  1YP5 A;  3VS4 A;  3JCM W;  1TUC A;  1G8X A;  1QCO A;  2E3I A;  4PJO C;  5CQY A;  2LQW A;  2YSQ A;  5KYY B;  1G3T A;  2YUQ A;  3LYI A;  2DK3 A;  3V8K A;  1W6X A;  2HQX A;  2LJ1 A;  1PD0 A;  1ZQ1 A;  3FB9 A;  1RL2 A;  4C92 F;  2RJF A;  4X34 A;  5LJ5 g;  2PVG B;  1W2B S;  1VQN Q;  2DEQ A;  4J7F A;  1YIT T;  2LJ3 A;  3OB9 A;  4BI3 A;  4E6R A;  2KRO A;  3CCQ T;  4E7H A;  3OYA A;  4GBQ A;  5LJ5 d;  3SD4 A;  4DEY A;  3QWY A;  2IIM A;  4F14 A;  1WXB A;  3SB2 A;  4LNP A;  1KJW A;  4HT8 A;  2K3Y A;  3H8Z A;  3L1A A;  1M30 A;  2DRM A;  4A4H A;  3QJY A;  5C0M A;  4KUI A;  3SEM A;  3EGX A;  3MEU A;  1MNE A;  4C92 A;  4D6W A;  1BI0 A;  4XTZ A;  1K73 R;  1NPP A;  2O9S A;  2JVV A;  2W10 A;  1GCQ A;  3OYG A;  4HVW A;  5IH2 A;  2HMA A;  4ZNX A;  4Y92 A;  3FRN A;  1I1J A;  1B07 A;  3L2Q A;  3CCE Q;  4IUR A;  1PC0 A;  1OUL A;  2RQT A;  2V8I A;  3JCM c;  1Y0M A;  1XTD A;  2EJ9 A;  5KYN A;  3VRZ A;  4AMC A;  3CC2 A;  1M90 U;  4PJO F;  2L5Q A;  1PKT A;  2DVJ A;  1SPK A;  1X01 A;  1RAE B;  1YI2 Q;  1W70 A;  4NS5 A;  1QQJ A;  2OTL A;  1TH7 A;  4JJD A;  3CXC A;  4L6V 5;  3V7C A;  1XQH A;  2NYS A;  3KBG A;  3JB9 D;  3CXC S;  5LJ5 f;  2MMP A;  5CVI A;  1J3T A;  2KXD A;  2NUT A;  2NUZ A;  1TUG B;  3EGD A;  3SWN A;  3A8O B;  3H0H A;  5HK0 A;  3WXM B;  2QQB A;  3GLX A;  3GBQ A;  2D6F A;  2ZPB B;  3CC7 Q;  2LCS A;  1UTI A;  1X27 A;  3EGX B;  2V1Q A;  2DKG A;  2CT4 A;  2EWN A;  4B9W A;  4L59 A;  3CBO A;  3LW5 E;  4A4F A;  2M16 A;  1NM7 A;  2YRD A;  3G1J A;  4J9G A;  1Q7Y C;  5GAN 3;  3CD6 A;  5CO7 A;  4OB0 B;  1D3B A;  1U1S A;  2KT1 A;  3HHT B;  4AG1 C;  1E6H A;  1ZSZ B;  1LPL A;  4M78 C;  1GBQ A;  4JRP A;  3VS5 A;  3I56 Q;  1HD3 A;  3THK A;  2D0N A;  3PT9 A;  1WA7 A;  2P4T A;  1KSW A;  2FZG B;  2Z0W A;  1YJW Q;  1ARK A;  4Y28 E;  1KD1 U;  4OVA A;  2QGF B;  2JUF A;  3E9F A;  4LDW A;  5HK3 A;  1WXU A;  4C8Q C;  2J6K A;  3A8L B;  3X26 B;  2DM1 A;  3RKY A;  1WGS A;  5L23 A;  1Q82 U;  2ESW A;  2QDY B;  1YJ9 T;  3OQ5 A;  5KYY A;  2DET A;  4A53 A;  3CCS A;  1M5Q 1;  2BIV A;  4JJB A;  4PJO A;  2OTL Q;  2L89 A;  1YJ9 Q;  3NFC A;  4Q5W A;  1ZSG A;  2O01 E;  1UGS B;  3CC2 Q;  5ECA A;  4KUD K;  3GNF B;  3MCA B;  1UGQ B;  1R77 A;  2D1X A;  1BCO A;  1O9S A;  1NJI C;  5GMK m;  3BDU A;  3FDR A;  3E1S A;  1GFD A;  5I11 A;  2E6Z A;  1VQ9 T;  2CZ7 B;  4B9X A;  3CC7 A;  3GP8 A;  1M2V B;  1ZUU A;  2F2W A;  4KT0 E;  4RTT A;  3E19 A;  2L0A A;  1N8R C;  3CCQ A;  2LVM A;  2MYS A;  3CCU Q;  4OB1 B;  2E10 A;  3TCJ A;  3AHU A;  3CCR A;  1KQ2 A;  2RA2 A;  4JZ3 A;  4DBH A;  3M0Q A;  2QAZ A;  3P8B B;  4PJO D;  3CCJ T;  1YIJ T;  2LQ8 A;  3X20 B;  1C6V X;  4N4I A;  2CH4 A;  5FU6 B;  4M75 C;  4ZGD B;  1E7O A;  3CMA Q;  3ZEH A;  1WI7 A;  1KK7 A;  1QCF A;  3ASK A;  2X4J A;  4R56 A;  3M9Q A;  5IN1 A;  1X69 A;  3MEV A;  1LJO A;  1AZE A;  1Y7X A;  1B34 B;  2EGC A;  2VGN A;  4LXC A;  1R0C B;  1VQ9 A;  4C5E A;  3M0T A;  3EFS A;  2VGM A;  2BTT A;  1I5L A;  4OB2 B;  1YBY A;  2JJ9 A;  5I21 A;  2RM4 A;  2HDA A;  5L8R E;  3OSV A;  2KVQ G;  3V7S A;  3CCQ Q;  3JCM b;  2ZPE B;  1M8V A;  2C0I A;  4FW2 A;  4FSX A;  5LL6 S;  1RAD B;  1IHW A;  1IXD A;  2XU8 A;  5GAO r;  2EJG A;  2MOX A;  4ATO A;  3OBY A;  4M7A B;  2XDP A;  3H0I A;  3L2R A;  1HJD A;  2EYQ A;  3CBP A;  3OMC A;  1BU1 A;  1QVG S;  4PJO G;  3GOX A;  1GCP A;  4E47 A;  1T3S A;  2EIF A;  2CZ6 B;  3HFN A;  5CAI A;  4HCK A;  4DBR A;  1M3C A;  1EZZ B;  4LUE A;  5AYF A;  1PSE A;  2KBT A;  3G6E Q;  1RAF B;  3HFO A;  2SRC A;  1YJN T;  4C8Q A;  4C0D C;  3EG9 A;  1Z9Z A;  5GMK i;  1A0N B;  1KD1 R;  4IUT A;  1ZHI A;  2VAS A;  4M77 F;  4ANJ A;  5FRN A;  4J83 A;  1WQ7 A;  4ELZ C;  1VYV A;  4JLG A;  2JM8 A;  4C92 E;  1MMD A;  3OYY A;  4BE0 A;  5KYW B;  3VS3 A;  3FJP A;  5GMK l;  2YLC A;  1VQ9 Q;  1VOM A;  2V8K A;  1NLP C;  3UWN A;  1PNJ A;  2ED1 A;  1HXD A;  3VS1 A;  2DRK A;  3CCE A;  3EH1 A;  3MET A;  2QI2 A;  3M0S A;  1YFN A;  4C0G A;  1Q86 U;  1WHJ A;  1BB9 A;  2QEX Q;  3HSB A;  4ZTJ A;  4QVZ A;  4XTY A;  3CD6 Q;  2RJC A;  2DL7 A;  3N5B B;  1EFN A;  4RTY A;  3ULR B;  4M7D B;  1LCK A;  4M7D E;  1T3L A;  5LJ3 e;  3OY9 A;  2F69 A;  2LTO A;  3V8L A;  2DYI A;  1KQS S;  2K7A A;  4QQG A;  1NJI U;  4GY5 A;  4C5I A;  2DJZ A;  1PHT A;  4C0D B;  2CT3 A;  1YJW A;  1AT1 B;  1KC8 C;  1SRL A;  2EYY A;  2R5A A;  3JB9 H;  3TQ7 P;  4J9B A;  1KHC A;  5CKB A;  2M51 A;  2RHX A;  1SSH A;  4RUG A;  3CCJ Q;  4PJO E;  4C5H A;  1I4K 1;  3FJ5 A;  4IIM A;  1AWW A;  1VQL Q;  3LWI A;  2A7Y A;  3M0U A;  1GXI E;  4BE1 A;  3V7R A;  1N9R A;  1JXO A;  3SFM A;  2DA9 A;  1JJ2 A;  2VB6 A;  5IAY A;  1LVK A;  3TEE A;  2FPE A;  3D7S B;  4J9E A;  3ZFJ A;  4JS5 A;  3KFV A;  3MHX A;  3CCV A;  1D0X A;  3RIR A;  1YHQ A;  1VQO A;  3LGF A;  2QG9 B;  4EMH A;  2NLU A;  1R0B G;  3I5S A;  2GF7 A;  5GAN 7;  2QA4 Q;  1VQ4 Q;  3CPW A;  1N8R U;  3HTR A;  4OP0 A;  3QYG B;  4IUQ A;  2FVU A;  1W4S A;  3CEY A;  1NJI R;  4ORZ A;  2RI5 A;  4M78 E;  3M5A A;  2QEX A;  4OMM A;  1UG1 A;  5GAN f;  1VQL A;  2C0O A;  3JB9 G;  2OJ2 A;  3KUF A;  1OEB A;  4J5Y A;  3CCJ A;  3J80 E;  4E2F B;  1YIJ A;  1JJ2 S;  1W2B A;  4AFZ C;  1U3O A;  2L2P A;  3UA6 A;  4M75 B;  2YUP A;  3DLM A;  3VYG A;  2DXU A;  1H64 1;  2A28 A;  4OMP A;  3CC4 A;  3HP9 A;  1BI2 A;  3UT1 A;  2M02 A;  3URG A;  1QMC A;  2ROL A;  3RR6 A;  4HA8 A;  4N0A A;  1K9M U;  1UUE A;  2R5M A;  3JCM d;  2X9H A;  2RJD A;  1Q7Y U;  2CP7 A;  4AG2 C;  4C8Q E;  3QUI A;  2RF0 A;  2JN0 A;  3HL8 A;  1OX8 A;  2HBP A;  2JNG A;  3C94 A;  3C4S A;  2YUN A;  2W0Z A;  3REB B;  1O75 A;  1OU9 A;  4ZGJ B;  3MJX A;  2A37 A;  4BE2 A;  4HVV A;  2DVE A;  2HL5 C;  3JCM f;  1TSF A;  2XG8 D;  3H0F A;  4QVD A;  2RHZ A;  2DO3 A;  2J06 A;  1KFZ A;  3MKD A;  4MML A;  3AT1 B;  4M77 E;  2GQI A;  1YI2 A;  1U06 A;  4FYW B;  3C0C A;  1ZUY A;  2HBW A;  4BD3 A;  3QJ6 A;  3GNG A;  4OMN A;  1NZ9 A;  3OS5 A;  2RH2 A;  1WXT A;  4J8O A;  2YWW A;  2OAW A;  2JTE A;  2VC8 A;  3BE3 A;  5IHK A;  4KBM B;  5KCH A;  2NWM A;  2DZ9 A;  2XD0 A;  4KGX B;  5GAN 2;  1NYF A;  2FPF A;  3H41 A;  4JRI A;  4LN2 A;  1M1K U;  2ZPG B;  1K8A U;  3M58 A;  2CYZ B;  1FX7 A;  1WFW A;  2MWO A;  1QVG A;  3CMA T;  1LNX A;  3PMT A;  2RQV A;  1WYX A;  1SHG A;  1BI1 A;  2MPX C;  3X24 B;  2O88 A;  3H6Z A;  1YCY A;  2A0F B;  1MGQ A;  2LMJ A;  4FM4 B;  3LGL A;  4M78 B;  4X1V A;  4BAC A;  2HKQ B;  2D8J A;  1PD1 A;  4EMG A;  1OZ3 A;  2QYZ A;  3CCM Q;  1Q86 C;  3CPW S;  2MI6 A;  4OMF B;  8ATC B;  4PLI A;  1WHK A;  1QCN A;  2KY9 A;  3JAM E;  4RCC A;  3DLL A;  4E7L A;  3P8H A;  2I0N A;  2DBK A;  5GJV B;  3RER A;  3JCM X;  2O9V A;  4LUD A;  5EG2 A;  4M7D F;  2DD5 A;  2FZK B;  1AWX A;  4IUP A;  1VQ5 A;  3QSU A;  2L3R A;  2AKK A;  1KC8 R;  2DIQ A;  3I55 Q;  4HCB A;  4EMK A;  1VQ8 T;  1WLP B;  3OW2 A;  1UHC A;  3JCM P;  2FHD A;  1RAI B;  3M4Y A;  3CD6 T;  3VYH B;  1H3H A;  2EGA A;  2O2O A;  1MV3 A;  2ABL A;  2LDM A;  3JCM V;  4AFU C;  2NUP A;  2ZZD A;  3OYL A;  1QVF S;  2DTI A;  2RHU A;  2K3B A;  4PK4 A;  2G3R A;  2K57 A;  1U1T A;  4C5G A;  1UFF A;  3E9G A;  5FRM A;  1X6G A;  1UE9 A;  1WIE A;  4LE9 A;  3CCR Q;  1IHV A;  2Y90 A;  2O4X A;  3M0R A;  3TSW A;  1PCX A;  4M78 F;  1RAB B;  4A4K A;  3VS7 A;  3VS6 A;  3PMI A;  1Q86 R;  1VQ7 T;  2BZ8 A;  3JRZ A;  3EGU A;  2M0Y A;  4BY6 C;  5GAM e;  1CKB A;  4J7I A;  4F7U G;  3NGP A;  2SEM A;  4LDV A;  1RAG B;  1V76 A;  3L2W A;  2JMC A;  4YTL A;  2RNA A;  5IHN A;  5AT1 B;  3EG0 A;  2ZPF B;  1QVF A;  3CCL A;  3HRT A;  4PKC C;  2CDT A;  2QAS A;  2FZC B;  2RMO A;  4E7S A;  4QT7 A;  3EH2 A;  2EBP A;  2CUD A;  2FYK A;  1VQO T;  2RI2 A;  3ZL7 C;  2GNC A;  1EIF A;  4M75 E;  3I9Q A;  4PNO A;  2HNI A;  1VQO Q;  3OYB A;  4P5N A;  4HCZ A;  3ZBD A;  2XDB A;  1K9M C;  4PJJ A;  3OYH A;  4ZTF A;  2K2M A;  1JXM A;  5GAN e;  1X43 A;  1SHF A;  4DA4 A;  3EFO B;  1VYT A;  2COW A;  1AHJ B;  3G7Z A;  4XAX B;  3JB9 F;  5GAM g;  3CXC P;  4RTZ A;  4M7A C;  4O5V A;  1MHN A;  1QVP A;  2PUO B;  4RTX A;  2QXF A;  2X4X A; 
#chains in the Genus database with same CATH homology
 2C0I A;  3EHR A;  2ED0 A;  2RN8 A;  1NG2 A;  2X3W D;  1RLQ C;  2MOX A;  2YDL A;  4AFS C;  2RQW A;  1YWO A;  4K11 A;  1UDL A;  3H0I A;  1HJD A;  2EPD A;  1M27 C;  1E6G A;  2RQR A;  1BU1 A;  2BZY A;  3I5R A;  1AZG B;  2GTJ A;  1GCP A;  2FRW A;  5IXF A;  1T3S A;  2JMA A;  4FSS A;  4HCK A;  1M3C A;  2FPD A;  4JPB W;  4LUE A;  1M8M A;  2KXC A;  5I22 A;  2KBT A;  2SRC A;  1VA7 A;  2VKN A;  3O5Z A;  3REA B;  2J6F A;  1MUZ A;  1W1F A;  1CKA A;  1X2Q A;  1Z9Z A;  1A0N B;  2DL8 A;  3UF4 A;  2CSI A;  2KNB B;  1AEY A;  2FEI A;  1QWF A;  1PRL C;  4F17 A;  2CSQ A;  3NMZ C;  3TSZ A;  1AWO A;  2YT6 A;  1VYV A;  2JM8 A;  1K9A A;  3VS3 A;  1NLP C;  1PNJ A;  2ED1 A;  5EC7 A;  3VS1 A;  2DRK A;  2DYB A;  2VWF A;  2DNU A;  3TVT A;  2GTO A;  1RI9 A;  3M0S A;  4Z88 A;  2JS2 A;  2EGE A;  2K9G A;  1V1C A;  3LH5 A;  1BB9 A;  5IXB A;  1KIK A;  2AZS A;  2DL7 A;  4J9H A;  2FG0 A;  1ZLM A;  4DEX A;  1EFN A;  4RTY A;  3ULR B;  2KE9 A;  1GCQ C;  1T0H A;  1LCK A;  2EQI A;  1WX6 A;  1T3L A;  2AZV A;  3PVL A;  2KRN A;  1TUD A;  2EVR A;  1ZBJ A;  3JV3 A;  2LNH B;  2DE0 X;  2K7A A;  1X2K A;  1FMK A;  2KRM A;  4HXJ A;  2ROT A;  1UJ0 A;  1PHT A;  2CT3 A;  1BBZ A;  1PKS A;  3EHQ A;  1SRL A;  2H8H A;  3RNJ A;  2AKL A;  2EYY A;  4HVU A;  1GFC A;  1CSK A;  4J9B A;  2LJ0 A;  2J7I A;  1GRI A;  2FRY A;  1SSH A;  2M51 A;  4RUG A;  2B86 A;  4J9C A;  3VRY A;  2DBM A;  3FJ5 A;  4IIM A;  1AWW A;  1G83 A;  1UJY A;  3NPF A;  3M0U A;  1JXO A;  2DX1 A;  2DA9 A;  2DL5 A;  1Y57 A;  2VVK A;  1XOV A;  1YP5 A;  3VS4 A;  1SRM A;  2FPE A;  4J9E A;  1TUC A;  3KFV A;  1AOJ A;  2PZ1 A;  1K0S A;  2LQW A;  4AFQ C;  2DMO A;  2YSQ A;  3UA7 A;  2L3P A;  1HSQ A;  2YUQ A;  4J9D A;  1W6X A;  2LJ1 A;  3R6N A;  2FO0 A;  3I5S A;  1UHF A;  3IQL A;  1YWP A;  1VYU A;  2KRS A;  1YN8 A;  1NYG A;  4CC3 A;  3EG2 A;  3VS0 A;  2KYM A;  4ORZ A;  2LJ3 A;  2GGR A;  2ENM A;  2JW4 A;  3RBB B;  2KRO A;  4E6R A;  2MIO A;  1PWT A;  2O31 A;  3EG3 A;  4OMM A;  2JM9 A;  4RTU A;  1UG1 A;  2EYZ A;  2C0O A;  4GBQ A;  2OJ2 A;  1K1Z A;  1OEB A;  4DEY A;  3QWY A;  2IIM A;  4A63 B;  2EYW A;  3M0P A;  4F14 A;  1WXB A;  4AFZ C;  2G6F X;  1U3O A;  4LNP A;  1KJW A;  2L2P A;  3UA6 A;  1H92 A;  2YUP A;  2ECZ A;  4OMP A;  2A28 A;  1M30 A;  2DRM A;  2JT4 A;  4CC7 A;  1GBR A;  4JZ4 A;  4KRT A;  4RTW A;  3SEM A;  2AK5 A;  2ROL A;  1UUE A;  4AG2 C;  2PNI A;  3U23 A;  2JXB A;  2RF0 A;  2O9S A;  2K6D A;  2W10 A;  2L3Q A;  1GCQ A;  2DJQ A;  4HVW A;  2YUN A;  2W0Z A;  1JU5 C;  4CC2 A;  5IH2 A;  3REB B;  4IIO A;  2A37 A;  1G2B A;  2YUO A;  4R0K A;  4ZNX A;  4HVV A;  4Y92 A;  1OV3 A;  1Z9Q A;  1PRM C;  3H0F A;  1I1J A;  1B07 A;  2K79 A;  3VS2 A;  2J06 A;  1KFZ A;  4F16 A;  2GQI A;  3SHW A;  4J9I A;  1U06 A;  2RQT A;  4D8K A;  3C0C A;  1ZUY A;  1Y0M A;  2EW3 A;  2HBW A;  4OMN A;  3VRZ A;  1WXT A;  2EKH A;  1BK2 A;  1PKT A;  2DVJ A;  1SPK A;  2V1R A;  1IO6 A;  2KGT A;  2OAW A;  2JTE A;  1WDX A;  5IHK A;  2NWM A;  2F2X A;  1W70 A;  1NYF A;  2FPF A;  3H41 A;  2OI3 A;  2X3X D;  4LN2 A;  4JJD A;  4D8D A;  4OML A;  2RPN A;  1WFW A;  2DL4 A;  2RQV A;  1WYX A;  1J3T A;  2KXD A;  1SHG A;  2NUZ A;  3H0H A;  2LP5 A;  2O88 A;  2LMJ A;  3GBQ A;  1UGV A;  4X1V A;  3A98 A;  2D8J A;  2KEA A;  3NHN A;  2LCS A;  1MV0 B;  1UTI A;  1X27 A;  2V1Q A;  2CRE A;  2CT4 A;  1AD5 A;  2A36 A;  1ZUK A;  2I0N A;  1NM7 A;  2EYX A;  2DBK A;  1OOT A;  2LQN A;  4J9G A;  5FWC A;  5GJV B;  2O9V A;  4LUD A;  1QLY A;  5GJW B;  2KT1 A;  1AWX A;  4OMO A;  1X6B A;  1I0C A;  1QKW A;  2L3S A;  2KT8 A;  4AG1 C;  1E6H A;  2RQU A;  2AKK A;  2J6O A;  2LX7 A;  1JO8 A;  4M4Z A;  1GBQ A;  3I35 A;  3VS5 A;  1HD3 A;  2J05 A;  1S1N A;  2P4R A;  3THK A;  2GBQ A;  1WLP B;  4RTV A;  4OMQ A;  2HSP A;  1JEG A;  1UHC A;  2D0N A;  1OPK A;  1WA7 A;  2DL3 A;  1KSW A;  1H3H A;  1M3A A;  1ARK A;  2EGA A;  2O2O A;  1MV3 A;  2ABL A;  1RLP C;  4AFU C;  1WXU A;  1I07 A;  2J6K A;  2DM1 A;  2K3B A;  5L23 A;  2ESW A;  1UFF A;  1K76 A;  1X6G A;  1B3Q A;  1QWE A;  1UE9 A;  1WIE A;  4GLM A;  4LE9 A;  3UAT A;  1JQQ A;  1ABQ A;  5IHI A;  4EIK A;  3M0R A;  4JJB A;  1N5Z A;  2XMF A;  3TSW A;  2HEQ A;  2DF6 A;  1NEG A;  2DLP A;  1ZSG A;  2LZ6 B;  3VS7 A;  1K4U S;  3CQT A;  3VS6 A;  5ECA A;  1K0X A;  2BZ8 A;  1TG0 A;  3EGU A;  5HCK A;  2M0Y A;  2D1X A;  1CKB A;  4Z89 A;  1T0J A;  3NGP A;  3QWX X;  2SEM A;  2QDL A;  1GFD A;  1M3B A;  2KYB A;  1RUW A;  5I11 A;  2KR3 A;  1SEM A;  2JMC A;  4JJC A;  2RNA A;  5IHN A;  3EG0 A;  1ZUU A;  2F2W A;  4J9F A;  5FW9 A;  1AWJ A;  4RTT A;  2CDT A;  2L0A A;  1U5S A;  2JS0 A;  2PTK A;  2CUB A;  2CH4 W;  2RMO A;  1AVZ C;  4QT7 A;  2A08 A;  3EG1 A;  2C0T A;  1YNZ A;  3PE0 A;  2EBP A;  1QKX A;  2MCN A;  1FYN A;  2CUD A;  1GL5 A;  4JZ3 A;  3M0Q A;  3ZL7 C;  4WCI A;  2GNC A;  5FWB A;  3I9Q A;  1UEC A;  2CH4 A;  1E7O A;  1OPL A;  1WI7 A;  2F2V A;  1QCF A;  1NLO C;  2K2M A;  1X69 A;  2E5K A;  2BZX A;  1ZX6 A;  1JXM A;  1AZE A;  1X43 A;  3PVQ A;  1SHF A;  4CC4 B;  2EGC A;  4ESR A;  2HCK A;  2D8H A;  2DIL A;  3M0T A;  1VYT A;  2BTT A;  1YCS B;  4RTZ A;  1ABO A;  4Z8A A;  2HDA A;  1NEB A;  4RTX A;  1H8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...