3I35A

Human sh3 domain of protein lasp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
KRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIM and SH3 domain protein 1
publication title Human SH3 domain of protein LASP1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i35A00
2DE0X 2YUNA 1XOVA 2LQWA 3I35A 4RTUA 2KXDA 1JXMA 1UDLA 1OOTA 2OI3A 2MCNA 4CC7A 1AEYA 3EHQA 2F2WA 4Z89A 1W1FA 1K4US 2GGRA 2EGAA 2EVRA 1Z9QA 2HDAA 1PHTA 2JM9A 2C0OA 2K3BA 4RTZA 1AD5A 2FPFA 2ENMA 1HJDA 2CSQA 2K9GA 4DEXA 3GBQA 4D8KA 1PWTA 3QWYA 1K0XA 4R0KA 3TSZA 1W70A 1AWOA 2RN8A 2KRNA 2X3WD 1SHFA 2SEMA 2ROLA 1JO8A 2RQWA 1AZEA 1QKXA 1SRMA 1A0NB 4ZNXA 2O31A 3IQLA 1SPKA 2DL4A 2ED1A 1G83A 1TG0A 4RTWA 3TVTA 2YT6A 1K9AA 1QKWA 1SEMA 1AZGB 2ED0A 4LE9A 3H0HA 3VS7A 2JM8A 3O5ZA 2EGCA 2YUOA 1KSWA 1NLOC 1NG2A 2VKNA 2FPEA 4HXJA 2OAWA 3VS1A 1GL5A 4J9HA 1U3OA 4DEYA 1BBZA 3LH5A 1X2QA 2CH4W 2GTOA 2EGEA 1RI9A 1UJ0A 3U23A 3REBB 1YWOA 2DBMA 2K79A 4Y92A 2RF0A 1M3CA 4AFUC 4J9EA 3SEMA 1OPKA 1H92A 3ULRB 1RLQC 1JU5C 2FEIA 1VA7A 1VYVA 3H0FA 2DILA 5I22A 2MIOA 1K76A 2A08A 1AWJA 4F16A 3M0RA 4Z88A 2I0NA 1ZX6A 2KNBB 2DL8A 1CSKA 2PTKA 2GQIA 2DNUA 1YN8A 4JZ3A 5GJWB 3I5SA 1MV3A 2C0IA 1WX6A 4J9CA 1X6BA 5FW9A 2CDTA 1SRLA 2X3XD 1T3SA 1ZUYA 1UGVA 2P4RA 4F14A 3VS0A 2O9SA 4CC2A 1NEGA 2YSQA 1KFZA 4HVUA 2HEQA 2JW4A 2KYBA 2KR3A 2V1RA 4AFZC 3M0UA 2EBPA 1UUEA 3M0PA 4LUEA 2FPDA 2DVJA 2CT3A 4EIKA 2K2MA 2DL5A 1T3LA 2A36A 1RLPC 2JXBA 2XMFA 4E6RA 2E5KA 4AFQC 4Z8AA 1PNJA 2L2PA 3I5RA 1BK2A 2HSPA 2ABLA 1RUWA 2KRSA 1I07A 3TSWA 1ZUKA 1FYNA 1OPLA 4OMLA 1OV3A 3EG3A 1GRIA 2J7IA 2SRCA 3VRYA 1WA7A 1QWEA 3M0SA 2BZYA 1ZSGA 2YDLA 4KRTA 1ZBJA 2EYYA 4RTVA 1WXBA 1PKSA 2G6FX 5IXFA 2A28A 2DYBA 2KYMA 2BZXA 1GCQC 2D8JA 1X43A 2GTJA 2RNAA 1X69A 1WLPB 2F2VA 2CSIA 3NGPA 1X2KA 3NHNA 3EGUA 1ZUUA 1M30A 2K7AA 2DL7A 1UFFA 2DX1A 3VS5A 5ECAA 4JPBW 1KIKA 1WFWA 3A98A 1IO6A 2BZ8A 1U5SA 3EG2A 1NEBA 4HCKA 1H8KA 4A63B 2FRWA 3C0CA 2LX7A 1SSHA 3M0QA 1JXOA 4ORZA 4AFSC 2DLPA 3UATA 1PKTA 2EKHA 4M4ZA 2M0YA 4ESRA 1UECA 2DBKA 1UJYA 4OMPA 2FO0A 2KT1A 1BB9A 1Z9ZA 1NM7A 4OMQA 2KT8A 2OJ2A 3EG1A 2D1XA 1GFDA 2J06A 1GCPA 3H0IA 1AWWA 2O9VA 1K1ZA 4J9GA 4J9BA 4IIMA 1UTIA 4LUDA 3SHWA 2HBWA 2KEAA 2LJ3A 3REAB 5EC7A 4JJBA 2L0AA 2IIMA 3VRZA 5IH2A 2M51A 1TUDA 2AZVA 2NUZA 2PNIA 2KXCA 3VS4A 2ECZA 5HCKA 1MUZA 1Y0MA 2H8HA 5FWCA 1SHGA 4LN2A 2O2OA 1I0CA 2AK5A 4OMNA 2EYXA 3RBBB 2O88A 1LCKA 4GBQA 4OMMA 1PRLC 2RQRA 2JMAA 3I9QA 2DF6A 1WIEA 3FJ5A 3NMZC 2RPNA 2KE9A 1NLPC 3QWXX 2FRYA 4JJDA 2DL3A 2J05A 3H41A 3THKA 1J3TA 4J9IA 1V1CA 1YCSB 1UHFA 1JEGA 1WYXA 2B86A 1YP5A 2KGTA 1BU1A 1M8MA 2EW3A 1TUCA 1AOJA 2DA9A 2EYWA 3VS2A 1EFNA 1PRMC 1ABQA 1UG1A 2CUBA 1I1JA 4HVWA 1B3QA 1M3AA 5IHKA 1GBRA 1KJWA 1JQQA 4JZ4A 4RTYA 1HD3A 2AZSA 2CH4A 1B07A 2L3PA 2CT4A 4RTTA 1T0HA 2JS2A 4FSSA 1GCQA 4GLMA 2L3QA 2GNCA 1WDXA 1MV0B 1WXUA 2K6DA 2ESWA 2A37A 3NPFA 1U06A 3KFVA 4CC4B 1HSQA 1VYTA 2AKKA 4RUGA 1UHCA 1X6GA 2LQNA 1VYUA 2VVKA 2ROTA 4F17A 4J9DA 1G2BA 2NWMA 4X1VA 1FMKA 4JJCA 2EPDA 1ABOA 1ZLMA 3EG0A 1E6GA 2RQVA 2CUDA 3ZL7C 4AG2C 2QDLA 2HCKA 5GJVB 4HVVA 2FG0A 2EQIA 1AVZC 1E7OA 2LP5A 2JT4A 3VS6A 2GBQA 2C0TA 2YUQA 4AG1C 1WXTA 1OEBA 2MOXA 2D0NA 4CC3A 1WI7A 2EYZA 2RQUA 3M0TA 1X27A 4J9FA 4IIOA 5IHNA 3R6NA 1NYGA 2L3SA 2W0ZA 4QT7A 2CREA 2BTTA 2DMOA 2F2XA 3EHRA 1YNZA 1ARKA 1AWXA 5IXBA 1Y57A 2DRKA 2KBTA 1H3HA 2RMOA 2JMCA 1M27C 2JTEA 1W6XA 3PVLA 1QLYA 2J6OA 2YUPA 4K11A 2DM1A 5IHIA 1NYFA 2DRMA 2LZ6B 1CKAA 1N5ZA 3CQTA 3UF4A 5L23A 3JV3A 2LNHB 4LNPA 2LMJA 2KROA 4OMOA 1YWPA 3PVQA 1M3BA 2KRMA 4WCIA 2PZ1A 1CKBA 2RQTA 1QWFA 2LJ1A 2V1QA 3VS3A 2LCSA 3RNJA 2D8HA 2DJQA 1GFCA 5I11A 3UA7A 4D8DA 3PE0A 3UA6A 1GBQA 2JS0A 1T0JA 1E6HA 2LJ0A 4RTXA 2J6KA 1UE9A 5FWBA 1QCFA 1K0SA 2J6FA 2W10A 2AKLA 1S1NA 2VWFA
chains in the Genus database with same CATH superfamily
2DE0X 1VQOA 2LQWA 4E47A 2DTIA 2YLBA 2XDPA 1UDLA 3CXCS 4CC7A 5CAIA 2LVMA 1AEYA 4FIBA 4F7UE 5KYUB 4Z89A 3S3OA 1K4US 4E7SA 2EVRA 5KE2A 2JM9A 1PHTA 1PD1A 2K3BA 4A4EA 1BI1A 4RTZA 1AD5A 2Y90A 1YCYA 3L2UA 3MEUA 4PJOG 4DEXA 2ZAEA 1M90C 1M1FA 1ZA1B 2RN8A 2KRNA 3OMGA 2SEMA 1VQ6A 4M7DG 2KY9A 4EMKA 3RUXA 1VOMA 2O31A 4E7ZA 1TOVA 4M7AD 4PJLA 2LDMA 1R0CB 3CMEQ 4BY6B 2CP3A 2NYSA 3E2UA 1AZGB 2ED0A 4L59A 3H0HA 3CD6Q 3V8LA 4DBQA 2F1LA 3EGDB 3O5ZA 2ZPEB 2E6ZA 2DEQA 4PJMA 1D3BB 2CP2A 5DLOA 2OAWA 3PGGA 3VS1A 4V2SA 3MEVA 5LJ5g 4DEYA 3L2VA 3LH5A 1YHQQ 2CH4W 1WQWA 3MP6A 2GTOA 3FRNA 1XNIA 3KUFA 2A0FB 1MNDA 4PJNA 1X75C 2DZCA 4A4GA 2E65A 1M3CA 4J9EA 3M58A 4BE2A 3G71A 4PL6A 1H92A 4OB0B 1Y96B 2FEIA 2RD1A 1VYVA 2KVQG 5CCAA 4LDWA 1Q7YU 3G4SA 3MEAA 1YI2A 5L8RE 3ZEHA 5GAMe 2LX9A 4Z88A 2KNBB 1N9SA 2OX7A 3VJPA 2DNUA 3NFCA 1F1BB 2RHXA 3I5SA 4JRQA 1ZHIA 1RACB 1SRLA 2E5QA 4Z02A 1VQMA 1T3SA 2CZ6B 2DXTA 1K73R 3A8GB 1SKUB 3NTHA 4LDXA 5KYYA 2YSQA 1M1KC 4J6XA 2KYBA 2V1RA 1QVFS 2CT3A 1G3YA 2K2MA 2V26A 3HSBA 1T3LA 2GFAA 1UB4A 4AFQC 2O4XB 3EFRA 2Y4YA 1BK2A 1G3SA 2BE7D 2ABLA 4BDYA 2RI2A 3F70A 2DIGA 3GNFB 2QQ9A 5FU7B 3EG3A 1GRIA 1S72A 5FROA 4KH1B 1ZBXA 1QW1A 1BCMA 2KAFA 4PJOC 3M0SA 3CCRQ 1ZSGA 1IRXA 1VQ6T 4EMKB 2VYTA 2GFUA 1WXBA 2FL7A 4M7DC 2G6FX 3CXCP 3HL8A 2A28A 4ZTFA 4LD6A 1OX9A 2E64A 4C92D 1MHNA 2XG8D 2D8JA 3G1JA 3G6EQ 1IHVA 4CI0C 1ZUUA 5J39A 5KYXA 2BKDN 5ECAA 3O8VA 1WFWA 1KIKA 1VQOQ 2YRVA 1IO6A 2BZ8A 4M75C 1QQJA 1NEBA 4A54A 1H8KA 1NBEB 4A63B 3PIOA 4M75A 3GOXA 4O5VA 2HSEB 2LX7A 1WGSA 1VQKT 1SSHA 2LQKA 2YXYA 3GP8A 2DXUA 2XHCA 4M78F 3N5BB 2Z0WA 1PKTA 3OYCA 3BW1A 3DLMA 4ESRA 3CPWA 2HL3A 3MHXA 5CR2A 4M78G 2OTLT 1VQ6Q 4ZTJA 1BB9A 1NM7A 4B6MA 2KT8A 3EG1A 1GFDA 1GCPA 2RHZA 4XU0A 4J9GA 4LUDA 3OYIA 4M7AA 3OYEA 4PKCC 2PVGB 3SB2A 2QAZA 4DBFA 2DERA 5M9OA 2X4XA 2OTJT 2ZZDA 5GAN2 3CCVA 3VS4A 1HYOA 4LDVA 4M77E 3X20B 3PT9A 5FWCA 2PUOB 2AK5A 3OYJA 4OP0A 5KYYB 1M1GA 3QHSA 3RBBB 2O88A 4GBQA 2L5QA 3OYDA 2XDDA 1WIEA 3OYMA 2X51A 2FHDA 3PNWC 3CC2T 3L2WA 3G71Q 5GANj 2V8JA 4JLIA 4C0DC 1YCSB 1JEGA 1TU0B 1ZA2B 1XTDA 2V8IA 3MCAB 4KGVB 5A0DA 3SWNA 2CP7A 1RAHB 3RIRA 3G4SQ 3HFNA 1YI2Q 1S72T 2DA9A 2JVVA 2EYWA 2HBPA 2EFIA 2LT4A 2MI6A 1EFNA 2FZCB 2K2VA 3CCQA 1I1JA 2MF2A 1QCNA 1QVFP 4BUGA 1WHLA 1Q81U 1Q82R 2CT4A 2RI3A 4RTTA 1VQMQ 1T0HA 3H6ZA 4F04B 1LVKA 1SG5A 4DBRA 2FYKA 2L3QA 1TXQA 2K6DA 1U06A 3Q1JA 4CC4B 4A4FA 1HSQA 2AKKA 2X35A 3L2ZA 5CKDA 1VQ7A 2LQNA 4F17A 1VQ4T 4X1VA 3EG0A 2RQVA 2ZCFB 2CUDA 1C0MA 2QDLA 2NUTA 1Q86R 1AVZC 5GAMd 2LP5A 3OBYA 3VS6A 2EQUA 4F7UA 2C0TA 4AG1C 1OYXA 1RI0A 3OW2A 1TSFA 3X24B 2MYSA 2OAUA 1D09B 3CCUT 2D0NA 2K3XA 1FWZA 1X27A 4M7AB 5IHNA 4C92A 5KCOA 2CREA 1YNZA 5LJ5e 1ARKA 2JTEA 3EFSA 1W6XA 4LDYA 4LXCA 4IUVA 2QEXA 2DM1A 5IHIA 2M02A 4EMGA 3CQTA 1KQ2A 3UF4A 1W2BS 1NPRA 1H3ZA 4EDUA 4PJOE 2LNHB 5HY6A 4OMOA 1YWPA 3JCMX 4HCCA 1I81A 1M3BA 4M7DE 2JOYA 1NJIC 2RQTA 3LH0A 2V1QA 2QGGA 2DJQA 2CP6A 1G5VA 1GFCA 3DB4A 1K9MR 2JTMA 3FIFA 3DKMA 3J7AF 1ZSZA 2QQSA 3CCSQ 2LCCA 1K0SA 2L3RA 2QA4T 2K4YA 5DY9A 4XTYA 3PFSA 2ZPGB 3CCQT 2RK1A 2YUNA 4FYXB 4JRIA 4RTUA 1IREB 2KXDA 2MCNA 3CCVQ 3CPFA 4XTWA 2F2WA 9ATCB 3UPUA 1YJNA 1BYMA 3CCET 3QXEB 2FPFA 2ENMA 1HJDA 5IT9E 2K9GA 3X25B 1MNEA 2P0QA 1WNLA 3CCLA 1K0XA 4R0KA 1AWOA 4JLGA 1VQPA 2X3WD 5LJ5h 5FU6C 3CC7A 1R0BG 4MDWA 1QKXA 1VQ7T 3GF5A 4ZNXA 2P84A 4C5IA 5CVIA 1FXXA 1G83A 4RTWA 3TVTA 2NUTB 4MZMA 1K9AA 1QKWA 7AT1B 3T9NA 2VUBA 4A4HA 3VS7A 2JM8A 3JB9J 1KQ1A 2EGCA 5GANg 2D9TA 8AT1B 3OA6A 4GY5A 3CMAA 4C5HA 1VQNT 4HXJA 3OYBA 2HL5C 5CKEA 1JJ2A 2CYZB 1BI3A 1KQSP 1Q81R 4DBHA 4C92B 2QTVA 2EGEA 1KD1R 4C8QG 1K73U 1RI9A 3NTKA 1UGSB 1YWOA 2CZ7B 3GLXA 4NL3A 3RESA 2K79A 2XIDA 4L6V5 4JUVA 1MMDA 3OBWA 4J5YA 3SEMA 4HCZA 2F5KA 2QASA 1JU5C 1VA7A 1M9SA 2QTXA 1BIAA 3SFMA 3E19A 1K76A 5KCHA 2A08A 4F16A 2I0NA 4PJOD 1AT1B 3UT1A 3S6WA 2DO3A 5C0MA 4JZ3A 5GJWB 1B7TA 3QYHB 4M7DD 2QK0A 3E9FA 3OYFA 4IUUA 2C0IA 3LGFA 1ZSZB 5FW9A 2CDTA 2X3XD 4C5EA 3CMET 2RHYA 3V7CA 1NEGA 1KFZA 4HVUA 1RL2A 4R55A 4BDZA 2QGFB 1P92A 2EBPA 4LUEA 2MWOA 3JCMJ 4M75D 2DL5A 1LJOA 4FSXA 2QEXQ 1D0YA 2A36A 2DYIA 2XMFA 4DQ2A 3X26B 5GMKh 3EFOA 2HSPA 1YHQT 1N8RR 3OYNA 3GPLA 5GAOq 1QVGA 1ZUKA 1FYNA 3QDRB 4OMLA 4M77C 4M78E 2SRCA 3CCLT 3VRYA 5GAOn 4C0ZA 4EPCA 3H9NA 4BI4A 1ZBJA 2MAMA 2EYYA 4RTVA 2MWPA 2LT1A 1YJWA 1PKSA 3HP9A 3QKJA 2HQHA 2BZXA 2KYMA 1GCQC 1X43A 2GTJA 3V7RA 1YJ9A 1Y71A 2RNAA 3URGA 2CKKA 1X2KA 1TTHB 1M30A 4CRIA 3ASKA 2E1HA 5LJ5d 3OYLA 2COWA 3TCJA 5CK9A 3JCMc 3I56A 2KI7A 5CKBA 2GCXA 3BDLA 1EZZB 4ZGDB 1YJNQ 1D0ZA 4C8QC 4ORZA 3VYHB 5GAN5 4AFSC 2B8AA 3CCLQ 2M0YA 1UECA 1VQPQ 2DD4A 2AT1B 3FEOA 3CCJA 3M55A 3CC7Q 4QQDA 2CZ1B 4OMQA 3PMIA 2J06A 3JCMb 3H0IA 3KBGA 4ME7A 3QUIA 3OS0A 4IIMA 3SHWA 5A0GA 3P8DA 5LJ3j 2HBWA 4PNOA 3M57A 4M7AF 3CCRT 4JJBA 4PFOA 3CMAQ 1N9RA 4QVCA 3VRZA 2VC8A 1TUDA 1KHCA 2EQMA 4IUQA 5HCKA 1UGRB 4ATOA 4QVDA 1Y0MA 2R5AA 3L1AA 3MEWA 1Q82U 4LN2A 4AT1B 3G6ET 4KGXB 2DAQA 3E1SA 4OMMA 2RQRA 3I9QA 3TEEA 4C5GA 5J26A 2DF6A 1MGQA 1NE8A 2RPNA 5KH6A 1VQOT 2KE9A 3QSUA 3QWXX 5CKHA 1J3TA 3CPWS 2MK5A 4BE1A 3EFOB 3M59A 5A0LA 1UHFA 2B86A 3OSSC 3C4SA 1M8MA 2L89A 1Q86U 5AYFA 1TUCA 4QW2A 5I2SA 3VS2A 1YITA 4FCYA 1PRMC 3JCMW 1M2OA 1UG1A 1U1TA 4HVWA 1M3AA 1QCOA 1KJWA 4KUIA 1HD3A 4PJOA 2L3PA 4PFPA 3CBOA 1PSEA 1Y07A 4M7DA 2HKNA 4KGZB 4FSSA 3PMTA 4BACA 5HK3A 2DTOA 2RJDA 1WDXA 1D1BA 1MV0B 1WJQA 2WACA 2A37A 3JCMP 1K8AR 3NPFA 1W4SA 5LJ5f 5CIUA 3SD4A 1UHCA 1M1KR 1VYUA 2ROTA 4J9DA 2NWMA 1WQ7A 1ABOA 3G7ZA 4O6JA 2XK0A 2EJGA 4AG2C 2E3IA 2CP5A 2FG0A 4RMOA 5GAN8 4XU3A 1WJSA 2BUDA 1E7OA 2JT4A 2IPOB 3JCMg 3G71T 1YJWQ 1K9MU 4NS5A 4ZGEB 1OEBA 1OU8A 4J83A 5GAOr 2EYZA 3QYGB 2RQUA 5GANe 3M0TA 1YJ9Q 4IIOA 2PQWA 3G4ST 1YI2T 3CCSA 3R6NA 2W0ZA 3QZ5B 3EHRA 4C92F 3HRSA 1Y57A 2KBTA 3AT1B 3OS5A 4ZN3A 2JMCA 5HK0A 2VGNA 3I56Q 1Q7YC 4C92G 2HAXA 5D6YA 1IB8A 2EJ9A 2J6OA 3VUZA 3FC3A 1R77A 2M1HA 4E7HA 2XICA 2QI2A 1VQMT 3QJYA 1KHIA 4KBMB 4LNPA 2X4WA 3L2QA 1I8FA 3EH1A 2KRMA 3HPWA 2K5LA 3NTIA 2LJ1A 1Y7XA 1R8OB 3C94A 2LCSA 3HRUA 3RNJA 3CCJQ 2CS7A 4D8DA 5GAOm 2P4TA 3MO8A 2IG0A 4A53A 3A8HB 3QZ9B 3HHTB 1WHGA 5FWBA 2J6FA 1YITT 3A8LB 3U23A 2VWFA 2VGMA 1IGUA 1XOVA 3LWIA 4TVRA 3I35A 1OULA 4PJOB 1JXMA 1MMNA 1OOTA 2ATCB 1IZ6A 5IN1A 3GNGA 4C8QE 4E7KA 4M7DB 1W1FA 4RKUE 4B9WA 2GGRA 3UDCA 5LJ3g 1YIJQ 1KD1U 5C6SA 2C0OA 3C12A 2E12A 5GANh 5KYXB 3GBQA 4D8KA 1PWTA 2DFUA 2WSFE 3TSZA 3PIPA 1SHFA 3CC4A 1JO8A 4X9DA 1AZEA 4XK8E 1A0NB 2EKOA 3IQLA 1SPKA 4M75B 3P8HA 2DL4A 2ED1A 2ZPIB 3RKYA 1B34A 3P8BB 3CCMA 4LE9A 2CGHA 2YUOA 1YITQ 4ZN1A 2HKQB 2COYA 4Y91A 4J9HA 4M78C 5DM7R 3KXTA 1U3OA 2EQKA 1VQ5A 4FM4B 5GMKm 4PK4A 1VQ8Q 2A7YA 4JS4A 3CCST 3TREA 2NLUA 3REBB 2DBMA 3EGXA 3HFOA 2RF0A 5I21A 2P0KA 1SF9A 3JSCA 4AFUC 3CCVT 1OPKA 2O01E 2RI5A 1BCOA 1TS9A 2A3LA 1RLQC 1N8RU 2DILA 2MIOA 2DXBA 5IAYA 1AWJA 4M77D 3M0RA 4NOYA 2DL8A 1CSKA 2VB6A 2WSEE 2PTKA 3BFMA 2GQIA 3JB9D 1YN8A 3L2RA 3JAME 1OQKA 1MMAA 1MV3A 1PC0A 2DIQA 1X6BA 1JBMA 1FMVA 1JJ2S 4C0DB 3SWNB 2R57A 2K57A 1UGVA 3FB9A 5FRMA 1WHJA 2O9SA 4CC2A 1WPYA 4AFZC 1QP3A 3M0UA 4ELYC 1N6AA 3M0PA 2FPDA 2DVJA 3OS2A 2QQAA 2RHUA 4EIKA 1KQSA 3AHUA 4N4HA 4XTXA 3QBYA 5CKFA 4Z8AA 5LJ3f 1KC8R 1PNJA 2L2PA 3I5RA 2E4HA 1RUWA 2DZ9A 4QQGA 2KRSA 3HKSA 4C8QD 1JB0E 1Q81C 1U1SA 3ME9A 1QWEA 2BZYA 2R5MA 1BI2A 4N0AC 4KRTA 4BB7A 4J8OA 1V29B 1ZQ1A 4NL2A 1NJIR 3LGLA 2DYBA 4II1A 4HKEA 5FRNA 1B34B 5GANd 2P0PA 5A2QE 1X69A 1WLPB 2DL7A 3RMQA 2DX1A 3RDVA 2BE9B 3VS5A 4F7UB 3A98A 4M7AE 4E2FB 2Y4XA 5GMKe 3EG2A 4LDUA 1BKBA 2X9HA 4HCKA 4OB2B 4BY6C 4PLLA 3ZBDA 2AHJB 4IUTA 3M0QA 1JXOA 2EQJA 1UEBA 3EH2A 4ANJA 2DLPA 2EYQA 3J80E 1QVGS 2EKHA 1V76A 3EGDA 3X28B 3HRTA 1I5OB 1WHKA 4M4ZA 2DBKA 1BI0A 1UJYA 3ZFJA 2FO0A 3CC4Q 2KT1A 4JRKA 3MKDA 2QEXT 1Z9ZA 2COZA 1QP2A 2M16A 3JCMe 2O9VA 1K1ZA 4J9BA 3CCMQ 1RADB 1ACMB 2KEAA 1N8RC 3REAB 3MP1A 3OYGA 5EC7A 4Y28E 2IIMA 3QDFA 5IH2A 2M51A 2AZVA 2KXCA 2ECZA 2D6FA 1MUZA 3J81E 3OYAA 1VQ5Q 4EMHA 1I4K1 1SHGA 3LX7A 2XDBA 2YHTA 3V8JA 1W2BP 4FW2A 4MMKA 4BI8B 3DB3A 4WTOB 1LCKA 2PU9B 5FLXE 2JMAA 4C0GA 3BE3A 3NMZC 1K8AU 2PVOB 1OZ3A 4BD3A 3OYYA 2FRYA 4JJDA 2XU8A 2DL3A 5D6XA 3H41A 2NUPA 4XTVA 3THKA 3OS1A 1JRIA 1PG5B 1VQ9A 1M1KU 2DVEA 1YJNT 1JJ2P 1I5LA 1YP5A 3D7SB 2MMPA 3S3NA 3WXMB 3E9GA 4YTLA 5GAOp 3EAEA 1ABQA 2CUBA 1VQPT 4M77A 1B3QA 2XD0A 5IHKA 4JZ4A 1C6VX 4OMFB 3CC7T 2AZSA 2CH4A 1B07A 5FU6B 2O4XA 1IGQA 3RKWA 4PJOF 5FU7C 2JS2A 3M9QA 1D1AA 4M7DF 4KUDK 1GCQA 4GLMA 5GANf 1WXUA 3JCMh 3JRZA 4C92E 4EMKC 2ESWA 3CMAT 1Q95G 2ZPHB 1M4ZA 5LJ3e 3CEYA 1VYTA 5GAN3 4MZPA 1PSFA 2VVKA 2DTHA 3VV0A 1TH7A 1G2BA 1YBYA 1FMKA 4JJCA 2EPDA 2CZ0B 2HCKA 4M75F 4HVVA 4E7JA 4KH0B 2PUKB 3MP8A 2KK4A 3C95A 4J6WA 2GBQA 4FYYB 4C8QA 3OMCA 4M75G 4D6WA 2YUQA 1K73C 3INZA 2FVUA 2ZGWA 2MOXA 3V7SA 2EAYA 4CC3A 4KULA 4KT0E 1M90R 4JJNK 4J9FA 4HT8A 1G3WA 1OX8A 4HT9A 1VQKA 3OSVA 1NYGA 4QT7A 2BTTA 3VU3C 4VUBA 1QVGP 1AWXA 2RMOA 3CXCA 1M27C 2OTLA 1DJ7B 2KMTA 1QLYA 2E3HA 1LPLA 4K11A 4M7AG 2LZ6B 2M9UA 5D7UA 1N5ZA 5L23A 3JV3A 1YIJA 3MPUB 1IHWA 2LMJA 3V8KA 3I55A 4WCIA 2RO0A 1CKBA 4N4IA 1G8XA 2QYZA 5GMKi 2OTJA 2D8HA 2NUPB 1N27A 2LQ8A 5I11A 1VQ9T 2RJEA 3UA7A 5LJ3h 2KQWA 2JS0A 2RM4A 1K8AC 1RAAB 3H8ZA 1HK9A 2LJ0A 4RTXA 1UE9A 2QG9B 1QCFA 2AKLA 3RR6A 2H3JA 1RAIB 4M77B 3CC2A 2GF7A 5KE3A 2ZPFB 2OI3A 1YJWT 4M78D 3EHQA 2QDYB 3HTRA 4MZTA 2DPPB 1WHMA 2EGAA 5GAMj 1VQ8A 1YJ9T 1WZOA 1Z9QA 3FLGA 2HDAA 2HZYA 2XKOC 4PJJA 2V8KA 4FW1A 2C06A 2CSQA 3QWYA 1QVPA 5GAN6 3OYKA 1W70A 4DOVA 4IKFA 4L5GA 3I56T 2HD0A 3M4YA 4C0FA 2ROLA 2RQWA 1IXDA 1SRMA 3QG1A 1VQ9Q 3JB9I 1TG0A 2YT6A 3CBPA 1SEMA 1FX7A 3JCMd 5I2MA 4J7IA 1KSWA 4C8QB 1NLOC 5HKCA 1NG2A 5J3BA 2G3RA 1O9SA 5GAMh 2VKNA 4GLKA 2FPEA 1C1AA 3RMSA 4JDSA 4OGEA 3CCJT 3LLRA 4RCBA 1GXIE 2RK2A 1GL5A 2KSSA 2K3YA 4F7UF 1VQ4A 1BBZA 2BIVA 1X2QA 1BIBA 4F7UG 1UJ0A 3CBMA 4Y92A 1QVFA 3LWHA 1PD0A 2DD5A 2K5FA 2MPXC 5LL6S 2QQBA 3ULRB 1KC8U 4P5NA 3CCUA 5DLQE 4M7AC 3H0FA 2HQXA 2I2LA 1YIJT 1YFNA 2IVWA 5I22A 3I55T 3TU4K 1QMCA 2JNGA 1ZX6A 4R56A 1Q82C 1X01A 2YWWA 5CO7A 3VYGA 2JUFA 4MMLA 1NJIU 1WX6A 4J9CA 5KYWA 4DOWA 3OW2S 3QPHA 4XQ3A 1ZUYA 2P4RA 1VQKQ 3UWNA 4F14A 3VUBA 3VS0A 4FT2A 1O75A 4FYWB 2HEQA 2JW4A 2RA2A 2KR3A 1UUEA 2LNVA 2FZGB 2OTLQ 5LJ3d 1Q86C 2JXBA 1RLPC 3SWNC 4E6RA 2E5KA 1M5Q1 3CPWP 3DLLA 4XU1A 2E70A 1VQ8T 4E7LA 5GAN7 2JZ2A 1NPPA 4ELZC 2JTFA 1Q7YR 1I07A 3TSWA 2EWNA 1OPLA 4DA4A 1OV3A 2K5IA 3JCMQ 1M8VA 2GQVA 1H641 2J7IA 3I55Q 2QA4A 5EG2A 2DK3A 1WA7A 2LRQA 1NZ9A 4JRPA 8ATCB 2YDLA 2OTJQ 2M0OA 5AT1B 2LTOA 4ZGJB 5IXFA 2VXEA 1UGQB 4N4GA 1LNXA 4XTZA 3CCEA 2F2VA 4UC4A 2CSIA 3NGPA 3NHNA 3EGUA 4FYVB 5GAOl 2K7AA 1KG1A 1UFFA 3A1PA 3JCMf 4JPBW 2DETA 3CC2Q 2RJCA 1X6OA 4HCBA 1VQLA 1U5SA 2L8DA 1KQSS 3MJXA 1MMGA 2FRWA 1VIEA 3OY9A 3C0CA 4M78A 3EG9A 2RB6A 2E6NA 3JCMV 4Q5WA 4AMCA 1S72Q 2KDSA 1K9MC 3UATA 1KK7A 3TQ7P 2H3EB 3VKIA 3QJ6A 2YRCA 2LCLA 1VQNA 4J7FA 5GAMg 4OMPA 6AT1B 1RABB 4C92C 2OJ2A 2D1XA 3FJPA 2RJFA 4JS5A 2FB7A 1FMWA 4PFZA 1AWWA 4LD9K 2VV5A 4QQ6A 4XTUA 2E10A 1UTIA 3QIIA 1SSFA 2DXCA 1KC8C 1TWBA 3ER0A 1UGPB 2WSCE 2LJ3A 2L0AA 3M54A 3M5AA 2DJZA 2NUZA 2PNIA 3FDRA 4OVAA 1D1CA 1XQHA 5KYWB 2H8HA 2CP0A 4A4KA 1HXDA 1VQ4Q 5D6WA 2O2OA 3META 1I0CA 4OMNA 2EYXA 4FL6A 3A5ZB 1PRLC 3RKXA 1AHJB 5GMKl 3FJ5A 4X9CA 3WVDB 1NLPC 1EX4A 2J05A 1G3TA 1ZSZC 2E41A 4J9IA 1V1CA 2JJ9A 3CCUQ 1WYXA 3R6OA 3LW5E 3OW2P 5LJ5j 3CMEA 1M2VA 2KGTA 1BU1A 2EW3A 3CD6A 4FU6A 4M75E 4QKUA 1AOJA 1RAFB 3A8MB 4E7IA 1KD1C 3CC4T 1VIFA 1D0XA 1GBRA 1XJWB 1JQQA 2R58A 4RTYA 4M77F 4WF2A 4FT4A 2X4JA 4N0AA 2LC4A 1M90U 2VASA 1YHQA 5KYUA 5CQXA 4PLIA 3JB9F 1LOJA 4M77G 3CCMT 3M4GA 4BE0A 3JB9H 2HQEA 2GNCA 1TUGB 3M53A 2VXFA 3JB9G 1OZ2A 4X34A 2PVDB 2HMAA 3OYHA 1U8RA 3KFVA 2DKGA 1VQLT 3QO3A 2RHIA 4IUPA 1OI1A 4RUGA 4HA8A 2F5TX 1W2BA 1X6GA 1VQ5T 4M78B 3EG9B 1ZLMA 1E6GA 3GIBA 3ZL7C 5GJVB 3EGXB 2EQIA 2QA4Q 4OF1A 4J6YA 5GAMf 3CCQQ 3RERA 3L42A 2ZPBB 2EIFA 2EJFA 1D3BA 4C8QF 1WXTA 3WVEB 2XI9A 1RAGB 1WJRA 2QQRA 1WI7A 3CCEQ 3OQ5A 4B9XA 3BY7A 2JN0A 3BDUA 3PTAA 2L3SA 2DMOA 2F2XA 1PCXA 5IXBA 1H3HA 2DRKA 4RCCA 2QXFA 1VUBA 3PVLA 4OGCA 1VQLQ 3OB9A 4MDXA 1VQ7Q 2RH2A 2YUPA 5CQYA 3SDZA 1NYFA 2DRMA 3LYIA 1CKAA 2HNIA 1Y96A 2F69A 1OU9A 4XU2A 2D0QB 2YLCA 4OB3B 2KROA 1WHHA 3PVQA 5GMKj 2PZ1A 3A8OB 4RG2A 4XAXB 1PM3A 2AIRB 3CCRA 1QWFA 2FZKB 3VS3A 1VQNQ 3S3MA 1EIFA 4BI3A 3PE0A 3UA6A 1GBQA 5KYNA 1M2VB 1T0JA 1RAEB 3M56A 1E6HA 4IURA 3G6EA 2J6KA 2DEUA 3CD6T 4QVZA 2W10A 4OB1B 5GAN4 1S1NA 2X4YA 2YRDA 4RG8A
chains in the Genus database with same CATH topology
2DE0X 2YUNA 1XOVA 2LQWA 3I35A 4RTUA 2KXDA 1JXMA 1UDLA 1OOTA 2OI3A 2MCNA 4CC7A 1AEYA 3EHQA 2F2WA 4Z89A 1W1FA 1K4US 2GGRA 2EGAA 2EVRA 1Z9QA 2HDAA 1PHTA 2JM9A 2C0OA 2K3BA 4RTZA 1AD5A 2FPFA 2ENMA 1HJDA 2CSQA 2K9GA 4DEXA 3GBQA 4D8KA 1PWTA 3QWYA 1K0XA 4R0KA 3TSZA 1W70A 1AWOA 2RN8A 2KRNA 2X3WD 1SHFA 2SEMA 2ROLA 1JO8A 2RQWA 1AZEA 1QKXA 1SRMA 1A0NB 4ZNXA 2O31A 3IQLA 1SPKA 2DL4A 2ED1A 1G83A 1TG0A 4RTWA 3TVTA 2YT6A 1K9AA 1QKWA 1SEMA 1AZGB 2ED0A 4LE9A 3H0HA 3VS7A 2JM8A 3O5ZA 2EGCA 2YUOA 1KSWA 1NLOC 1NG2A 2VKNA 2FPEA 4HXJA 2OAWA 3VS1A 1GL5A 4J9HA 1U3OA 4DEYA 1BBZA 3LH5A 1X2QA 2CH4W 2GTOA 2EGEA 1RI9A 1UJ0A 3U23A 3REBB 1YWOA 2DBMA 2K79A 4Y92A 2RF0A 1M3CA 4AFUC 4J9EA 3SEMA 1OPKA 1H92A 3ULRB 1RLQC 1JU5C 2FEIA 1VA7A 1VYVA 3H0FA 2DILA 5I22A 2MIOA 1K76A 2A08A 1AWJA 4F16A 3M0RA 4Z88A 2I0NA 1ZX6A 2KNBB 2DL8A 1CSKA 2PTKA 2GQIA 2DNUA 1YN8A 4JZ3A 5GJWB 3I5SA 1MV3A 2C0IA 1WX6A 4J9CA 1X6BA 5FW9A 2CDTA 1SRLA 2X3XD 1T3SA 1ZUYA 1UGVA 2P4RA 4F14A 3VS0A 2O9SA 4CC2A 1NEGA 2YSQA 1KFZA 4HVUA 2HEQA 2JW4A 2KYBA 2KR3A 2V1RA 4AFZC 3M0UA 2EBPA 1UUEA 3M0PA 4LUEA 2FPDA 2DVJA 2CT3A 4EIKA 2K2MA 2DL5A 1T3LA 2A36A 1RLPC 2JXBA 2XMFA 4E6RA 2E5KA 4AFQC 4Z8AA 1PNJA 2L2PA 3I5RA 1BK2A 2HSPA 2ABLA 1RUWA 2KRSA 1I07A 3TSWA 1ZUKA 1FYNA 1OPLA 4OMLA 1OV3A 3EG3A 1GRIA 2J7IA 2SRCA 3VRYA 1WA7A 1QWEA 3M0SA 2BZYA 1ZSGA 2YDLA 4KRTA 1ZBJA 2EYYA 4RTVA 1WXBA 1PKSA 2G6FX 5IXFA 2A28A 2DYBA 2KYMA 2BZXA 1GCQC 2D8JA 1X43A 2GTJA 2RNAA 1X69A 1WLPB 2F2VA 2CSIA 3NGPA 1X2KA 3NHNA 3EGUA 1ZUUA 1M30A 2K7AA 2DL7A 1UFFA 2DX1A 3VS5A 5ECAA 4JPBW 1KIKA 1WFWA 3A98A 1IO6A 2BZ8A 1U5SA 3EG2A 1NEBA 4HCKA 1H8KA 4A63B 2FRWA 3C0CA 2LX7A 1SSHA 3M0QA 1JXOA 4ORZA 4AFSC 2DLPA 3UATA 1PKTA 2EKHA 4M4ZA 2M0YA 4ESRA 1UECA 2DBKA 1UJYA 4OMPA 2FO0A 2KT1A 1BB9A 1Z9ZA 1NM7A 4OMQA 2KT8A 2OJ2A 3EG1A 2D1XA 1GFDA 2J06A 1GCPA 3H0IA 1AWWA 2O9VA 1K1ZA 4J9GA 4J9BA 4IIMA 1UTIA 4LUDA 3SHWA 2HBWA 2KEAA 2LJ3A 3REAB 5EC7A 4JJBA 2L0AA 2IIMA 3VRZA 5IH2A 2M51A 1TUDA 2AZVA 2NUZA 2PNIA 2KXCA 3VS4A 2ECZA 5HCKA 1MUZA 1Y0MA 2H8HA 5FWCA 1SHGA 4LN2A 2O2OA 1I0CA 2AK5A 4OMNA 2EYXA 3RBBB 2O88A 1LCKA 4GBQA 4OMMA 1PRLC 2RQRA 2JMAA 3I9QA 2DF6A 1WIEA 3FJ5A 3NMZC 2RPNA 2KE9A 1NLPC 3QWXX 2FRYA 4JJDA 2DL3A 2J05A 3H41A 3THKA 1J3TA 4J9IA 1V1CA 1YCSB 1UHFA 1JEGA 1WYXA 2B86A 1YP5A 2KGTA 1BU1A 1M8MA 2EW3A 1TUCA 1AOJA 2DA9A 2EYWA 3VS2A 1EFNA 1PRMC 1ABQA 1UG1A 2CUBA 1I1JA 4HVWA 1B3QA 1M3AA 5IHKA 1GBRA 1KJWA 1JQQA 4JZ4A 4RTYA 1HD3A 2AZSA 2CH4A 1B07A 2L3PA 2CT4A 4RTTA 1T0HA 2JS2A 4FSSA 1GCQA 4GLMA 2L3QA 2GNCA 1WDXA 1MV0B 1WXUA 2K6DA 2ESWA 2A37A 3NPFA 1U06A 3KFVA 4CC4B 1HSQA 1VYTA 2AKKA 4RUGA 1UHCA 1X6GA 2LQNA 1VYUA 2VVKA 2ROTA 4F17A 4J9DA 1G2BA 2NWMA 4X1VA 1FMKA 4JJCA 2EPDA 1ABOA 1ZLMA 3EG0A 1E6GA 2RQVA 2CUDA 3ZL7C 4AG2C 2QDLA 2HCKA 5GJVB 4HVVA 2FG0A 2EQIA 1AVZC 1E7OA 2LP5A 2JT4A 3VS6A 2GBQA 2C0TA 2YUQA 4AG1C 1WXTA 1OEBA 2MOXA 2D0NA 4CC3A 1WI7A 2EYZA 2RQUA 3M0TA 1X27A 4J9FA 4IIOA 5IHNA 3R6NA 1NYGA 2L3SA 2W0ZA 4QT7A 2CREA 2BTTA 2DMOA 2F2XA 3EHRA 1YNZA 1ARKA 1AWXA 5IXBA 1Y57A 2DRKA 2KBTA 1H3HA 2RMOA 2JMCA 1M27C 2JTEA 1W6XA 3PVLA 1QLYA 2J6OA 2YUPA 4K11A 2DM1A 5IHIA 1NYFA 2DRMA 2LZ6B 1CKAA 1N5ZA 3CQTA 3UF4A 5L23A 3JV3A 2LNHB 4LNPA 2LMJA 2KROA 4OMOA 1YWPA 3PVQA 1M3BA 2KRMA 4WCIA 2PZ1A 1CKBA 2RQTA 1QWFA 2LJ1A 2V1QA 3VS3A 2LCSA 3RNJA 2D8HA 2DJQA 1GFCA 5I11A 3UA7A 4D8DA 3PE0A 3UA6A 1GBQA 2JS0A 1T0JA 1E6HA 2LJ0A 4RTXA 2J6KA 1UE9A 5FWBA 1QCFA 1K0SA 2J6FA 2W10A 2AKLA 1S1NA 2VWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE0 X;  2YUN A;  1XOV A;  2LQW A;  3I35 A;  4RTU A;  2KXD A;  1JXM A;  1UDL A;  1OOT A;  2OI3 A;  2MCN A;  4CC7 A;  1AEY A;  3EHQ A;  2F2W A;  4Z89 A;  1W1F A;  1K4U S;  2GGR A;  2EGA A;  2EVR A;  1Z9Q A;  2HDA A;  1PHT A;  2JM9 A;  2C0O A;  2K3B A;  4RTZ A;  1AD5 A;  2FPF A;  2ENM A;  1HJD A;  2CSQ A;  2K9G A;  4DEX A;  3GBQ A;  4D8K A;  1PWT A;  3QWY A;  1K0X A;  4R0K A;  3TSZ A;  1W70 A;  1AWO A;  2RN8 A;  2KRN A;  2X3W D;  1SHF A;  2SEM A;  2ROL A;  1JO8 A;  2RQW A;  1AZE A;  1QKX A;  1SRM A;  1A0N B;  4ZNX A;  2O31 A;  3IQL A;  1SPK A;  2DL4 A;  2ED1 A;  1G83 A;  1TG0 A;  4RTW A;  3TVT A;  2YT6 A;  1K9A A;  1QKW A;  1SEM A;  1AZG B;  2ED0 A;  4LE9 A;  3H0H A;  3VS7 A;  2JM8 A;  3O5Z A;  2EGC A;  2YUO A;  1KSW A;  1NLO C;  1NG2 A;  2VKN A;  2FPE A;  4HXJ A;  2OAW A;  3VS1 A;  1GL5 A;  4J9H A;  1U3O A;  4DEY A;  1BBZ A;  3LH5 A;  1X2Q A;  2CH4 W;  2GTO A;  2EGE A;  1RI9 A;  1UJ0 A;  3U23 A;  3REB B;  1YWO A;  2DBM A;  2K79 A;  4Y92 A;  2RF0 A;  1M3C A;  4AFU C;  4J9E A;  3SEM A;  1OPK A;  1H92 A;  3ULR B;  1RLQ C;  1JU5 C;  2FEI A;  1VA7 A;  1VYV A;  3H0F A;  2DIL A;  5I22 A;  2MIO A;  1K76 A;  2A08 A;  1AWJ A;  4F16 A;  3M0R A;  4Z88 A;  2I0N A;  1ZX6 A;  2KNB B;  2DL8 A;  1CSK A;  2PTK A;  2GQI A;  2DNU A;  1YN8 A;  4JZ3 A;  5GJW B;  3I5S A;  1MV3 A;  2C0I A;  1WX6 A;  4J9C A;  1X6B A;  5FW9 A;  2CDT A;  1SRL A;  2X3X D;  1T3S A;  1ZUY A;  1UGV A;  2P4R A;  4F14 A;  3VS0 A;  2O9S A;  4CC2 A;  1NEG A;  2YSQ A;  1KFZ A;  4HVU A;  2HEQ A;  2JW4 A;  2KYB A;  2KR3 A;  2V1R A;  4AFZ C;  3M0U A;  2EBP A;  1UUE A;  3M0P A;  4LUE A;  2FPD A;  2DVJ A;  2CT3 A;  4EIK A;  2K2M A;  2DL5 A;  1T3L A;  2A36 A;  1RLP C;  2JXB A;  2XMF A;  4E6R A;  2E5K A;  4AFQ C;  4Z8A A;  1PNJ A;  2L2P A;  3I5R A;  1BK2 A;  2HSP A;  2ABL A;  1RUW A;  2KRS A;  1I07 A;  3TSW A;  1ZUK A;  1FYN A;  1OPL A;  4OML A;  1OV3 A;  3EG3 A;  1GRI A;  2J7I A;  2SRC A;  3VRY A;  1WA7 A;  1QWE A;  3M0S A;  2BZY A;  1ZSG A;  2YDL A;  4KRT A;  1ZBJ A;  2EYY A;  4RTV A;  1WXB A;  1PKS A;  2G6F X;  5IXF A;  2A28 A;  2DYB A;  2KYM A;  2BZX A;  1GCQ C;  2D8J A;  1X43 A;  2GTJ A;  2RNA A;  1X69 A;  1WLP B;  2F2V A;  2CSI A;  3NGP A;  1X2K A;  3NHN A;  3EGU A;  1ZUU A;  1M30 A;  2K7A A;  2DL7 A;  1UFF A;  2DX1 A;  3VS5 A;  5ECA A;  4JPB W;  1KIK A;  1WFW A;  3A98 A;  1IO6 A;  2BZ8 A;  1U5S A;  3EG2 A;  1NEB A;  4HCK A;  1H8K A;  4A63 B;  2FRW A;  3C0C A;  2LX7 A;  1SSH A;  3M0Q A;  1JXO A;  4ORZ A;  4AFS C;  2DLP A;  3UAT A;  1PKT A;  2EKH A;  4M4Z A;  2M0Y A;  4ESR A;  1UEC A;  2DBK A;  1UJY A;  4OMP A;  2FO0 A;  2KT1 A;  1BB9 A;  1Z9Z A;  1NM7 A;  4OMQ A;  2KT8 A;  2OJ2 A;  3EG1 A;  2D1X A;  1GFD A;  2J06 A;  1GCP A;  3H0I A;  1AWW A;  2O9V A;  1K1Z A;  4J9G A;  4J9B A;  4IIM A;  1UTI A;  4LUD A;  3SHW A;  2HBW A;  2KEA A;  2LJ3 A;  3REA B;  5EC7 A;  4JJB A;  2L0A A;  2IIM A;  3VRZ A;  5IH2 A;  2M51 A;  1TUD A;  2AZV A;  2NUZ A;  2PNI A;  2KXC A;  3VS4 A;  2ECZ A;  5HCK A;  1MUZ A;  1Y0M A;  2H8H A;  5FWC A;  1SHG A;  4LN2 A;  2O2O A;  1I0C A;  2AK5 A;  4OMN A;  2EYX A;  3RBB B;  2O88 A;  1LCK A;  4GBQ A;  4OMM A;  1PRL C;  2RQR A;  2JMA A;  3I9Q A;  2DF6 A;  1WIE A;  3FJ5 A;  3NMZ C;  2RPN A;  2KE9 A;  1NLP C;  3QWX X;  2FRY A;  4JJD A;  2DL3 A;  2J05 A;  3H41 A;  3THK A;  1J3T A;  4J9I A;  1V1C A;  1YCS B;  1UHF A;  1JEG A;  1WYX A;  2B86 A;  1YP5 A;  2KGT A;  1BU1 A;  1M8M A;  2EW3 A;  1TUC A;  1AOJ A;  2DA9 A;  2EYW A;  3VS2 A;  1EFN A;  1PRM C;  1ABQ A;  1UG1 A;  2CUB A;  1I1J A;  4HVW A;  1B3Q A;  1M3A A;  5IHK A;  1GBR A;  1KJW A;  1JQQ A;  4JZ4 A;  4RTY A;  1HD3 A;  2AZS A;  2CH4 A;  1B07 A;  2L3P A;  2CT4 A;  4RTT A;  1T0H A;  2JS2 A;  4FSS A;  1GCQ A;  4GLM A;  2L3Q A;  2GNC A;  1WDX A;  1MV0 B;  1WXU A;  2K6D A;  2ESW A;  2A37 A;  3NPF A;  1U06 A;  3KFV A;  4CC4 B;  1HSQ A;  1VYT A;  2AKK A;  4RUG A;  1UHC A;  1X6G A;  2LQN A;  1VYU A;  2VVK A;  2ROT A;  4F17 A;  4J9D A;  1G2B A;  2NWM A;  4X1V A;  1FMK A;  4JJC A;  2EPD A;  1ABO A;  1ZLM A;  3EG0 A;  1E6G A;  2RQV A;  2CUD A;  3ZL7 C;  4AG2 C;  2QDL A;  2HCK A;  5GJV B;  4HVV A;  2FG0 A;  2EQI A;  1AVZ C;  1E7O A;  2LP5 A;  2JT4 A;  3VS6 A;  2GBQ A;  2C0T A;  2YUQ A;  4AG1 C;  1WXT A;  1OEB A;  2MOX A;  2D0N A;  4CC3 A;  1WI7 A;  2EYZ A;  2RQU A;  3M0T A;  1X27 A;  4J9F A;  4IIO A;  5IHN A;  3R6N A;  1NYG A;  2L3S A;  2W0Z A;  4QT7 A;  2CRE A;  2BTT A;  2DMO A;  2F2X A;  3EHR A;  1YNZ A;  1ARK A;  1AWX A;  5IXB A;  1Y57 A;  2DRK A;  2KBT A;  1H3H A;  2RMO A;  2JMC A;  1M27 C;  2JTE A;  1W6X A;  3PVL A;  1QLY A;  2J6O A;  2YUP A;  4K11 A;  2DM1 A;  5IHI A;  1NYF A;  2DRM A;  2LZ6 B;  1CKA A;  1N5Z A;  3CQT A;  3UF4 A;  5L23 A;  3JV3 A;  2LNH B;  4LNP A;  2LMJ A;  2KRO A;  4OMO A;  1YWP A;  3PVQ A;  1M3B A;  2KRM A;  4WCI A;  2PZ1 A;  1CKB A;  2RQT A;  1QWF A;  2LJ1 A;  2V1Q A;  3VS3 A;  2LCS A;  3RNJ A;  2D8H A;  2DJQ A;  1GFC A;  5I11 A;  3UA7 A;  4D8D A;  3PE0 A;  3UA6 A;  1GBQ A;  2JS0 A;  1T0J A;  1E6H A;  2LJ0 A;  4RTX A;  2J6K A;  1UE9 A;  5FWB A;  1QCF A;  1K0S A;  2J6F A;  2W10 A;  2AKL A;  1S1N A;  2VWF A; 
#chains in the Genus database with same CATH topology
 2DE0 X;  1VQO A;  2LQW A;  4E47 A;  2DTI A;  2YLB A;  2XDP A;  1UDL A;  3CXC S;  4CC7 A;  5CAI A;  2LVM A;  1AEY A;  4FIB A;  4F7U E;  5KYU B;  4Z89 A;  3S3O A;  1K4U S;  4E7S A;  2EVR A;  5KE2 A;  2JM9 A;  1PHT A;  1PD1 A;  2K3B A;  4A4E A;  1BI1 A;  4RTZ A;  1AD5 A;  2Y90 A;  1YCY A;  3L2U A;  3MEU A;  4PJO G;  4DEX A;  2ZAE A;  1M90 C;  1M1F A;  1ZA1 B;  2RN8 A;  2KRN A;  3OMG A;  2SEM A;  1VQ6 A;  4M7D G;  2KY9 A;  4EMK A;  3RUX A;  1VOM A;  2O31 A;  4E7Z A;  1TOV A;  4M7A D;  4PJL A;  2LDM A;  1R0C B;  3CME Q;  4BY6 B;  2CP3 A;  2NYS A;  3E2U A;  1AZG B;  2ED0 A;  4L59 A;  3H0H A;  3CD6 Q;  3V8L A;  4DBQ A;  2F1L A;  3EGD B;  3O5Z A;  2ZPE B;  2E6Z A;  2DEQ A;  4PJM A;  1D3B B;  2CP2 A;  5DLO A;  2OAW A;  3PGG A;  3VS1 A;  4V2S A;  3MEV A;  5LJ5 g;  4DEY A;  3L2V A;  3LH5 A;  1YHQ Q;  2CH4 W;  1WQW A;  3MP6 A;  2GTO A;  3FRN A;  1XNI A;  3KUF A;  2A0F B;  1MND A;  4PJN A;  1X75 C;  2DZC A;  4A4G A;  2E65 A;  1M3C A;  4J9E A;  3M58 A;  4BE2 A;  3G71 A;  4PL6 A;  1H92 A;  4OB0 B;  1Y96 B;  2FEI A;  2RD1 A;  1VYV A;  2KVQ G;  5CCA A;  4LDW A;  1Q7Y U;  3G4S A;  3MEA A;  1YI2 A;  5L8R E;  3ZEH A;  5GAM e;  2LX9 A;  4Z88 A;  2KNB B;  1N9S A;  2OX7 A;  3VJP A;  2DNU A;  3NFC A;  1F1B B;  2RHX A;  3I5S A;  4JRQ A;  1ZHI A;  1RAC B;  1SRL A;  2E5Q A;  4Z02 A;  1VQM A;  1T3S A;  2CZ6 B;  2DXT A;  1K73 R;  3A8G B;  1SKU B;  3NTH A;  4LDX A;  5KYY A;  2YSQ A;  1M1K C;  4J6X A;  2KYB A;  2V1R A;  1QVF S;  2CT3 A;  1G3Y A;  2K2M A;  2V26 A;  3HSB A;  1T3L A;  2GFA A;  1UB4 A;  4AFQ C;  2O4X B;  3EFR A;  2Y4Y A;  1BK2 A;  1G3S A;  2BE7 D;  2ABL A;  4BDY A;  2RI2 A;  3F70 A;  2DIG A;  3GNF B;  2QQ9 A;  5FU7 B;  3EG3 A;  1GRI A;  1S72 A;  5FRO A;  4KH1 B;  1ZBX A;  1QW1 A;  1BCM A;  2KAF A;  4PJO C;  3M0S A;  3CCR Q;  1ZSG A;  1IRX A;  1VQ6 T;  4EMK B;  2VYT A;  2GFU A;  1WXB A;  2FL7 A;  4M7D C;  2G6F X;  3CXC P;  3HL8 A;  2A28 A;  4ZTF A;  4LD6 A;  1OX9 A;  2E64 A;  4C92 D;  1MHN A;  2XG8 D;  2D8J A;  3G1J A;  3G6E Q;  1IHV A;  4CI0 C;  1ZUU A;  5J39 A;  5KYX A;  2BKD N;  5ECA A;  3O8V A;  1WFW A;  1KIK A;  1VQO Q;  2YRV A;  1IO6 A;  2BZ8 A;  4M75 C;  1QQJ A;  1NEB A;  4A54 A;  1H8K A;  1NBE B;  4A63 B;  3PIO A;  4M75 A;  3GOX A;  4O5V A;  2HSE B;  2LX7 A;  1WGS A;  1VQK T;  1SSH A;  2LQK A;  2YXY A;  3GP8 A;  2DXU A;  2XHC A;  4M78 F;  3N5B B;  2Z0W A;  1PKT A;  3OYC A;  3BW1 A;  3DLM A;  4ESR A;  3CPW A;  2HL3 A;  3MHX A;  5CR2 A;  4M78 G;  2OTL T;  1VQ6 Q;  4ZTJ A;  1BB9 A;  1NM7 A;  4B6M A;  2KT8 A;  3EG1 A;  1GFD A;  1GCP A;  2RHZ A;  4XU0 A;  4J9G A;  4LUD A;  3OYI A;  4M7A A;  3OYE A;  4PKC C;  2PVG B;  3SB2 A;  2QAZ A;  4DBF A;  2DER A;  5M9O A;  2X4X A;  2OTJ T;  2ZZD A;  5GAN 2;  3CCV A;  3VS4 A;  1HYO A;  4LDV A;  4M77 E;  3X20 B;  3PT9 A;  5FWC A;  2PUO B;  2AK5 A;  3OYJ A;  4OP0 A;  5KYY B;  1M1G A;  3QHS A;  3RBB B;  2O88 A;  4GBQ A;  2L5Q A;  3OYD A;  2XDD A;  1WIE A;  3OYM A;  2X51 A;  2FHD A;  3PNW C;  3CC2 T;  3L2W A;  3G71 Q;  5GAN j;  2V8J A;  4JLI A;  4C0D C;  1YCS B;  1JEG A;  1TU0 B;  1ZA2 B;  1XTD A;  2V8I A;  3MCA B;  4KGV B;  5A0D A;  3SWN A;  2CP7 A;  1RAH B;  3RIR A;  3G4S Q;  3HFN A;  1YI2 Q;  1S72 T;  2DA9 A;  2JVV A;  2EYW A;  2HBP A;  2EFI A;  2LT4 A;  2MI6 A;  1EFN A;  2FZC B;  2K2V A;  3CCQ A;  1I1J A;  2MF2 A;  1QCN A;  1QVF P;  4BUG A;  1WHL A;  1Q81 U;  1Q82 R;  2CT4 A;  2RI3 A;  4RTT A;  1VQM Q;  1T0H A;  3H6Z A;  4F04 B;  1LVK A;  1SG5 A;  4DBR A;  2FYK A;  2L3Q A;  1TXQ A;  2K6D A;  1U06 A;  3Q1J A;  4CC4 B;  4A4F A;  1HSQ A;  2AKK A;  2X35 A;  3L2Z A;  5CKD A;  1VQ7 A;  2LQN A;  4F17 A;  1VQ4 T;  4X1V A;  3EG0 A;  2RQV A;  2ZCF B;  2CUD A;  1C0M A;  2QDL A;  2NUT A;  1Q86 R;  1AVZ C;  5GAM d;  2LP5 A;  3OBY A;  3VS6 A;  2EQU A;  4F7U A;  2C0T A;  4AG1 C;  1OYX A;  1RI0 A;  3OW2 A;  1TSF A;  3X24 B;  2MYS A;  2OAU A;  1D09 B;  3CCU T;  2D0N A;  2K3X A;  1FWZ A;  1X27 A;  4M7A B;  5IHN A;  4C92 A;  5KCO A;  2CRE A;  1YNZ A;  5LJ5 e;  1ARK A;  2JTE A;  3EFS A;  1W6X A;  4LDY A;  4LXC A;  4IUV A;  2QEX A;  2DM1 A;  5IHI A;  2M02 A;  4EMG A;  3CQT A;  1KQ2 A;  3UF4 A;  1W2B S;  1NPR A;  1H3Z A;  4EDU A;  4PJO E;  2LNH B;  5HY6 A;  4OMO A;  1YWP A;  3JCM X;  4HCC A;  1I81 A;  1M3B A;  4M7D E;  2JOY A;  1NJI C;  2RQT A;  3LH0 A;  2V1Q A;  2QGG A;  2DJQ A;  2CP6 A;  1G5V A;  1GFC A;  3DB4 A;  1K9M R;  2JTM A;  3FIF A;  3DKM A;  3J7A F;  1ZSZ A;  2QQS A;  3CCS Q;  2LCC A;  1K0S A;  2L3R A;  2QA4 T;  2K4Y A;  5DY9 A;  4XTY A;  3PFS A;  2ZPG B;  3CCQ T;  2RK1 A;  2YUN A;  4FYX B;  4JRI A;  4RTU A;  1IRE B;  2KXD A;  2MCN A;  3CCV Q;  3CPF A;  4XTW A;  2F2W A;  9ATC B;  3UPU A;  1YJN A;  1BYM A;  3CCE T;  3QXE B;  2FPF A;  2ENM A;  1HJD A;  5IT9 E;  2K9G A;  3X25 B;  1MNE A;  2P0Q A;  1WNL A;  3CCL A;  1K0X A;  4R0K A;  1AWO A;  4JLG A;  1VQP A;  2X3W D;  5LJ5 h;  5FU6 C;  3CC7 A;  1R0B G;  4MDW A;  1QKX A;  1VQ7 T;  3GF5 A;  4ZNX A;  2P84 A;  4C5I A;  5CVI A;  1FXX A;  1G83 A;  4RTW A;  3TVT A;  2NUT B;  4MZM A;  1K9A A;  1QKW A;  7AT1 B;  3T9N A;  2VUB A;  4A4H A;  3VS7 A;  2JM8 A;  3JB9 J;  1KQ1 A;  2EGC A;  5GAN g;  2D9T A;  8AT1 B;  3OA6 A;  4GY5 A;  3CMA A;  4C5H A;  1VQN T;  4HXJ A;  3OYB A;  2HL5 C;  5CKE A;  1JJ2 A;  2CYZ B;  1BI3 A;  1KQS P;  1Q81 R;  4DBH A;  4C92 B;  2QTV A;  2EGE A;  1KD1 R;  4C8Q G;  1K73 U;  1RI9 A;  3NTK A;  1UGS B;  1YWO A;  2CZ7 B;  3GLX A;  4NL3 A;  3RES A;  2K79 A;  2XID A;  4L6V 5;  4JUV A;  1MMD A;  3OBW A;  4J5Y A;  3SEM A;  4HCZ A;  2F5K A;  2QAS A;  1JU5 C;  1VA7 A;  1M9S A;  2QTX A;  1BIA A;  3SFM A;  3E19 A;  1K76 A;  5KCH A;  2A08 A;  4F16 A;  2I0N A;  4PJO D;  1AT1 B;  3UT1 A;  3S6W A;  2DO3 A;  5C0M A;  4JZ3 A;  5GJW B;  1B7T A;  3QYH B;  4M7D D;  2QK0 A;  3E9F A;  3OYF A;  4IUU A;  2C0I A;  3LGF A;  1ZSZ B;  5FW9 A;  2CDT A;  2X3X D;  4C5E A;  3CME T;  2RHY A;  3V7C A;  1NEG A;  1KFZ A;  4HVU A;  1RL2 A;  4R55 A;  4BDZ A;  2QGF B;  1P92 A;  2EBP A;  4LUE A;  2MWO A;  3JCM J;  4M75 D;  2DL5 A;  1LJO A;  4FSX A;  2QEX Q;  1D0Y A;  2A36 A;  2DYI A;  2XMF A;  4DQ2 A;  3X26 B;  5GMK h;  3EFO A;  2HSP A;  1YHQ T;  1N8R R;  3OYN A;  3GPL A;  5GAO q;  1QVG A;  1ZUK A;  1FYN A;  3QDR B;  4OML A;  4M77 C;  4M78 E;  2SRC A;  3CCL T;  3VRY A;  5GAO n;  4C0Z A;  4EPC A;  3H9N A;  4BI4 A;  1ZBJ A;  2MAM A;  2EYY A;  4RTV A;  2MWP A;  2LT1 A;  1YJW A;  1PKS A;  3HP9 A;  3QKJ A;  2HQH A;  2BZX A;  2KYM A;  1GCQ C;  1X43 A;  2GTJ A;  3V7R A;  1YJ9 A;  1Y71 A;  2RNA A;  3URG A;  2CKK A;  1X2K A;  1TTH B;  1M30 A;  4CRI A;  3ASK A;  2E1H A;  5LJ5 d;  3OYL A;  2COW A;  3TCJ A;  5CK9 A;  3JCM c;  3I56 A;  2KI7 A;  5CKB A;  2GCX A;  3BDL A;  1EZZ B;  4ZGD B;  1YJN Q;  1D0Z A;  4C8Q C;  4ORZ A;  3VYH B;  5GAN 5;  4AFS C;  2B8A A;  3CCL Q;  2M0Y A;  1UEC A;  1VQP Q;  2DD4 A;  2AT1 B;  3FEO A;  3CCJ A;  3M55 A;  3CC7 Q;  4QQD A;  2CZ1 B;  4OMQ A;  3PMI A;  2J06 A;  3JCM b;  3H0I A;  3KBG A;  4ME7 A;  3QUI A;  3OS0 A;  4IIM A;  3SHW A;  5A0G A;  3P8D A;  5LJ3 j;  2HBW A;  4PNO A;  3M57 A;  4M7A F;  3CCR T;  4JJB A;  4PFO A;  3CMA Q;  1N9R A;  4QVC A;  3VRZ A;  2VC8 A;  1TUD A;  1KHC A;  2EQM A;  4IUQ A;  5HCK A;  1UGR B;  4ATO A;  4QVD A;  1Y0M A;  2R5A A;  3L1A A;  3MEW A;  1Q82 U;  4LN2 A;  4AT1 B;  3G6E T;  4KGX B;  2DAQ A;  3E1S A;  4OMM A;  2RQR A;  3I9Q A;  3TEE A;  4C5G A;  5J26 A;  2DF6 A;  1MGQ A;  1NE8 A;  2RPN A;  5KH6 A;  1VQO T;  2KE9 A;  3QSU A;  3QWX X;  5CKH A;  1J3T A;  3CPW S;  2MK5 A;  4BE1 A;  3EFO B;  3M59 A;  5A0L A;  1UHF A;  2B86 A;  3OSS C;  3C4S A;  1M8M A;  2L89 A;  1Q86 U;  5AYF A;  1TUC A;  4QW2 A;  5I2S A;  3VS2 A;  1YIT A;  4FCY A;  1PRM C;  3JCM W;  1M2O A;  1UG1 A;  1U1T A;  4HVW A;  1M3A A;  1QCO A;  1KJW A;  4KUI A;  1HD3 A;  4PJO A;  2L3P A;  4PFP A;  3CBO A;  1PSE A;  1Y07 A;  4M7D A;  2HKN A;  4KGZ B;  4FSS A;  3PMT A;  4BAC A;  5HK3 A;  2DTO A;  2RJD A;  1WDX A;  1D1B A;  1MV0 B;  1WJQ A;  2WAC A;  2A37 A;  3JCM P;  1K8A R;  3NPF A;  1W4S A;  5LJ5 f;  5CIU A;  3SD4 A;  1UHC A;  1M1K R;  1VYU A;  2ROT A;  4J9D A;  2NWM A;  1WQ7 A;  1ABO A;  3G7Z A;  4O6J A;  2XK0 A;  2EJG A;  4AG2 C;  2E3I A;  2CP5 A;  2FG0 A;  4RMO A;  5GAN 8;  4XU3 A;  1WJS A;  2BUD A;  1E7O A;  2JT4 A;  2IPO B;  3JCM g;  3G71 T;  1YJW Q;  1K9M U;  4NS5 A;  4ZGE B;  1OEB A;  1OU8 A;  4J83 A;  5GAO r;  2EYZ A;  3QYG B;  2RQU A;  5GAN e;  3M0T A;  1YJ9 Q;  4IIO A;  2PQW A;  3G4S T;  1YI2 T;  3CCS A;  3R6N A;  2W0Z A;  3QZ5 B;  3EHR A;  4C92 F;  3HRS A;  1Y57 A;  2KBT A;  3AT1 B;  3OS5 A;  4ZN3 A;  2JMC A;  5HK0 A;  2VGN A;  3I56 Q;  1Q7Y C;  4C92 G;  2HAX A;  5D6Y A;  1IB8 A;  2EJ9 A;  2J6O A;  3VUZ A;  3FC3 A;  1R77 A;  2M1H A;  4E7H A;  2XIC A;  2QI2 A;  1VQM T;  3QJY A;  1KHI A;  4KBM B;  4LNP A;  2X4W A;  3L2Q A;  1I8F A;  3EH1 A;  2KRM A;  3HPW A;  2K5L A;  3NTI A;  2LJ1 A;  1Y7X A;  1R8O B;  3C94 A;  2LCS A;  3HRU A;  3RNJ A;  3CCJ Q;  2CS7 A;  4D8D A;  5GAO m;  2P4T A;  3MO8 A;  2IG0 A;  4A53 A;  3A8H B;  3QZ9 B;  3HHT B;  1WHG A;  5FWB A;  2J6F A;  1YIT T;  3A8L B;  3U23 A;  2VWF A;  2VGM A;  1IGU A;  1XOV A;  3LWI A;  4TVR A;  3I35 A;  1OUL A;  4PJO B;  1JXM A;  1MMN A;  1OOT A;  2ATC B;  1IZ6 A;  5IN1 A;  3GNG A;  4C8Q E;  4E7K A;  4M7D B;  1W1F A;  4RKU E;  4B9W A;  2GGR A;  3UDC A;  5LJ3 g;  1YIJ Q;  1KD1 U;  5C6S A;  2C0O A;  3C12 A;  2E12 A;  5GAN h;  5KYX B;  3GBQ A;  4D8K A;  1PWT A;  2DFU A;  2WSF E;  3TSZ A;  3PIP A;  1SHF A;  3CC4 A;  1JO8 A;  4X9D A;  1AZE A;  4XK8 E;  1A0N B;  2EKO A;  3IQL A;  1SPK A;  4M75 B;  3P8H A;  2DL4 A;  2ED1 A;  2ZPI B;  3RKY A;  1B34 A;  3P8B B;  3CCM A;  4LE9 A;  2CGH A;  2YUO A;  1YIT Q;  4ZN1 A;  2HKQ B;  2COY A;  4Y91 A;  4J9H A;  4M78 C;  5DM7 R;  3KXT A;  1U3O A;  2EQK A;  1VQ5 A;  4FM4 B;  5GMK m;  4PK4 A;  1VQ8 Q;  2A7Y A;  4JS4 A;  3CCS T;  3TRE A;  2NLU A;  3REB B;  2DBM A;  3EGX A;  3HFO A;  2RF0 A;  5I21 A;  2P0K A;  1SF9 A;  3JSC A;  4AFU C;  3CCV T;  1OPK A;  2O01 E;  2RI5 A;  1BCO A;  1TS9 A;  2A3L A;  1RLQ C;  1N8R U;  2DIL A;  2MIO A;  2DXB A;  5IAY A;  1AWJ A;  4M77 D;  3M0R A;  4NOY A;  2DL8 A;  1CSK A;  2VB6 A;  2WSE E;  2PTK A;  3BFM A;  2GQI A;  3JB9 D;  1YN8 A;  3L2R A;  3JAM E;  1OQK A;  1MMA A;  1MV3 A;  1PC0 A;  2DIQ A;  1X6B A;  1JBM A;  1FMV A;  1JJ2 S;  4C0D B;  3SWN B;  2R57 A;  2K57 A;  1UGV A;  3FB9 A;  5FRM A;  1WHJ A;  2O9S A;  4CC2 A;  1WPY A;  4AFZ C;  1QP3 A;  3M0U A;  4ELY C;  1N6A A;  3M0P A;  2FPD A;  2DVJ A;  3OS2 A;  2QQA A;  2RHU A;  4EIK A;  1KQS A;  3AHU A;  4N4H A;  4XTX A;  3QBY A;  5CKF A;  4Z8A A;  5LJ3 f;  1KC8 R;  1PNJ A;  2L2P A;  3I5R A;  2E4H A;  1RUW A;  2DZ9 A;  4QQG A;  2KRS A;  3HKS A;  4C8Q D;  1JB0 E;  1Q81 C;  1U1S A;  3ME9 A;  1QWE A;  2BZY A;  2R5M A;  1BI2 A;  4N0A C;  4KRT A;  4BB7 A;  4J8O A;  1V29 B;  1ZQ1 A;  4NL2 A;  1NJI R;  3LGL A;  2DYB A;  4II1 A;  4HKE A;  5FRN A;  1B34 B;  5GAN d;  2P0P A;  5A2Q E;  1X69 A;  1WLP B;  2DL7 A;  3RMQ A;  2DX1 A;  3RDV A;  2BE9 B;  3VS5 A;  4F7U B;  3A98 A;  4M7A E;  4E2F B;  2Y4X A;  5GMK e;  3EG2 A;  4LDU A;  1BKB A;  2X9H A;  4HCK A;  4OB2 B;  4BY6 C;  4PLL A;  3ZBD A;  2AHJ B;  4IUT A;  3M0Q A;  1JXO A;  2EQJ A;  1UEB A;  3EH2 A;  4ANJ A;  2DLP A;  2EYQ A;  3J80 E;  1QVG S;  2EKH A;  1V76 A;  3EGD A;  3X28 B;  3HRT A;  1I5O B;  1WHK A;  4M4Z A;  2DBK A;  1BI0 A;  1UJY A;  3ZFJ A;  2FO0 A;  3CC4 Q;  2KT1 A;  4JRK A;  3MKD A;  2QEX T;  1Z9Z A;  2COZ A;  1QP2 A;  2M16 A;  3JCM e;  2O9V A;  1K1Z A;  4J9B A;  3CCM Q;  1RAD B;  1ACM B;  2KEA A;  1N8R C;  3REA B;  3MP1 A;  3OYG A;  5EC7 A;  4Y28 E;  2IIM A;  3QDF A;  5IH2 A;  2M51 A;  2AZV A;  2KXC A;  2ECZ A;  2D6F A;  1MUZ A;  3J81 E;  3OYA A;  1VQ5 Q;  4EMH A;  1I4K 1;  1SHG A;  3LX7 A;  2XDB A;  2YHT A;  3V8J A;  1W2B P;  4FW2 A;  4MMK A;  4BI8 B;  3DB3 A;  4WTO B;  1LCK A;  2PU9 B;  5FLX E;  2JMA A;  4C0G A;  3BE3 A;  3NMZ C;  1K8A U;  2PVO B;  1OZ3 A;  4BD3 A;  3OYY A;  2FRY A;  4JJD A;  2XU8 A;  2DL3 A;  5D6X A;  3H41 A;  2NUP A;  4XTV A;  3THK A;  3OS1 A;  1JRI A;  1PG5 B;  1VQ9 A;  1M1K U;  2DVE A;  1YJN T;  1JJ2 P;  1I5L A;  1YP5 A;  3D7S B;  2MMP A;  3S3N A;  3WXM B;  3E9G A;  4YTL A;  5GAO p;  3EAE A;  1ABQ A;  2CUB A;  1VQP T;  4M77 A;  1B3Q A;  2XD0 A;  5IHK A;  4JZ4 A;  1C6V X;  4OMF B;  3CC7 T;  2AZS A;  2CH4 A;  1B07 A;  5FU6 B;  2O4X A;  1IGQ A;  3RKW A;  4PJO F;  5FU7 C;  2JS2 A;  3M9Q A;  1D1A A;  4M7D F;  4KUD K;  1GCQ A;  4GLM A;  5GAN f;  1WXU A;  3JCM h;  3JRZ A;  4C92 E;  4EMK C;  2ESW A;  3CMA T;  1Q95 G;  2ZPH B;  1M4Z A;  5LJ3 e;  3CEY A;  1VYT A;  5GAN 3;  4MZP A;  1PSF A;  2VVK A;  2DTH A;  3VV0 A;  1TH7 A;  1G2B A;  1YBY A;  1FMK A;  4JJC A;  2EPD A;  2CZ0 B;  2HCK A;  4M75 F;  4HVV A;  4E7J A;  4KH0 B;  2PUK B;  3MP8 A;  2KK4 A;  3C95 A;  4J6W A;  2GBQ A;  4FYY B;  4C8Q A;  3OMC A;  4M75 G;  4D6W A;  2YUQ A;  1K73 C;  3INZ A;  2FVU A;  2ZGW A;  2MOX A;  3V7S A;  2EAY A;  4CC3 A;  4KUL A;  4KT0 E;  1M90 R;  4JJN K;  4J9F A;  4HT8 A;  1G3W A;  1OX8 A;  4HT9 A;  1VQK A;  3OSV A;  1NYG A;  4QT7 A;  2BTT A;  3VU3 C;  4VUB A;  1QVG P;  1AWX A;  2RMO A;  3CXC A;  1M27 C;  2OTL A;  1DJ7 B;  2KMT A;  1QLY A;  2E3H A;  1LPL A;  4K11 A;  4M7A G;  2LZ6 B;  2M9U A;  5D7U A;  1N5Z A;  5L23 A;  3JV3 A;  1YIJ A;  3MPU B;  1IHW A;  2LMJ A;  3V8K A;  3I55 A;  4WCI A;  2RO0 A;  1CKB A;  4N4I A;  1G8X A;  2QYZ A;  5GMK i;  2OTJ A;  2D8H A;  2NUP B;  1N27 A;  2LQ8 A;  5I11 A;  1VQ9 T;  2RJE A;  3UA7 A;  5LJ3 h;  2KQW A;  2JS0 A;  2RM4 A;  1K8A C;  1RAA B;  3H8Z A;  1HK9 A;  2LJ0 A;  4RTX A;  1UE9 A;  2QG9 B;  1QCF A;  2AKL A;  3RR6 A;  2H3J A;  1RAI B;  4M77 B;  3CC2 A;  2GF7 A;  5KE3 A;  2ZPF B;  2OI3 A;  1YJW T;  4M78 D;  3EHQ A;  2QDY B;  3HTR A;  4MZT A;  2DPP B;  1WHM A;  2EGA A;  5GAM j;  1VQ8 A;  1YJ9 T;  1WZO A;  1Z9Q A;  3FLG A;  2HDA A;  2HZY A;  2XKO C;  4PJJ A;  2V8K A;  4FW1 A;  2C06 A;  2CSQ A;  3QWY A;  1QVP A;  5GAN 6;  3OYK A;  1W70 A;  4DOV A;  4IKF A;  4L5G A;  3I56 T;  2HD0 A;  3M4Y A;  4C0F A;  2ROL A;  2RQW A;  1IXD A;  1SRM A;  3QG1 A;  1VQ9 Q;  3JB9 I;  1TG0 A;  2YT6 A;  3CBP A;  1SEM A;  1FX7 A;  3JCM d;  5I2M A;  4J7I A;  1KSW A;  4C8Q B;  1NLO C;  5HKC A;  1NG2 A;  5J3B A;  2G3R A;  1O9S A;  5GAM h;  2VKN A;  4GLK A;  2FPE A;  1C1A A;  3RMS A;  4JDS A;  4OGE A;  3CCJ T;  3LLR A;  4RCB A;  1GXI E;  2RK2 A;  1GL5 A;  2KSS A;  2K3Y A;  4F7U F;  1VQ4 A;  1BBZ A;  2BIV A;  1X2Q A;  1BIB A;  4F7U G;  1UJ0 A;  3CBM A;  4Y92 A;  1QVF A;  3LWH A;  1PD0 A;  2DD5 A;  2K5F A;  2MPX C;  5LL6 S;  2QQB A;  3ULR B;  1KC8 U;  4P5N A;  3CCU A;  5DLQ E;  4M7A C;  3H0F A;  2HQX A;  2I2L A;  1YIJ T;  1YFN A;  2IVW A;  5I22 A;  3I55 T;  3TU4 K;  1QMC A;  2JNG A;  1ZX6 A;  4R56 A;  1Q82 C;  1X01 A;  2YWW A;  5CO7 A;  3VYG A;  2JUF A;  4MML A;  1NJI U;  1WX6 A;  4J9C A;  5KYW A;  4DOW A;  3OW2 S;  3QPH A;  4XQ3 A;  1ZUY A;  2P4R A;  1VQK Q;  3UWN A;  4F14 A;  3VUB A;  3VS0 A;  4FT2 A;  1O75 A;  4FYW B;  2HEQ A;  2JW4 A;  2RA2 A;  2KR3 A;  1UUE A;  2LNV A;  2FZG B;  2OTL Q;  5LJ3 d;  1Q86 C;  2JXB A;  1RLP C;  3SWN C;  4E6R A;  2E5K A;  1M5Q 1;  3CPW P;  3DLL A;  4XU1 A;  2E70 A;  1VQ8 T;  4E7L A;  5GAN 7;  2JZ2 A;  1NPP A;  4ELZ C;  2JTF A;  1Q7Y R;  1I07 A;  3TSW A;  2EWN A;  1OPL A;  4DA4 A;  1OV3 A;  2K5I A;  3JCM Q;  1M8V A;  2GQV A;  1H64 1;  2J7I A;  3I55 Q;  2QA4 A;  5EG2 A;  2DK3 A;  1WA7 A;  2LRQ A;  1NZ9 A;  4JRP A;  8ATC B;  2YDL A;  2OTJ Q;  2M0O A;  5AT1 B;  2LTO A;  4ZGJ B;  5IXF A;  2VXE A;  1UGQ B;  4N4G A;  1LNX A;  4XTZ A;  3CCE A;  2F2V A;  4UC4 A;  2CSI A;  3NGP A;  3NHN A;  3EGU A;  4FYV B;  5GAO l;  2K7A A;  1KG1 A;  1UFF A;  3A1P A;  3JCM f;  4JPB W;  2DET A;  3CC2 Q;  2RJC A;  1X6O A;  4HCB A;  1VQL A;  1U5S A;  2L8D A;  1KQS S;  3MJX A;  1MMG A;  2FRW A;  1VIE A;  3OY9 A;  3C0C A;  4M78 A;  3EG9 A;  2RB6 A;  2E6N A;  3JCM V;  4Q5W A;  4AMC A;  1S72 Q;  2KDS A;  1K9M C;  3UAT A;  1KK7 A;  3TQ7 P;  2H3E B;  3VKI A;  3QJ6 A;  2YRC A;  2LCL A;  1VQN A;  4J7F A;  5GAM g;  4OMP A;  6AT1 B;  1RAB B;  4C92 C;  2OJ2 A;  2D1X A;  3FJP A;  2RJF A;  4JS5 A;  2FB7 A;  1FMW A;  4PFZ A;  1AWW A;  4LD9 K;  2VV5 A;  4QQ6 A;  4XTU A;  2E10 A;  1UTI A;  3QII A;  1SSF A;  2DXC A;  1KC8 C;  1TWB A;  3ER0 A;  1UGP B;  2WSC E;  2LJ3 A;  2L0A A;  3M54 A;  3M5A A;  2DJZ A;  2NUZ A;  2PNI A;  3FDR A;  4OVA A;  1D1C A;  1XQH A;  5KYW B;  2H8H A;  2CP0 A;  4A4K A;  1HXD A;  1VQ4 Q;  5D6W A;  2O2O A;  3MET A;  1I0C A;  4OMN A;  2EYX A;  4FL6 A;  3A5Z B;  1PRL C;  3RKX A;  1AHJ B;  5GMK l;  3FJ5 A;  4X9C A;  3WVD B;  1NLP C;  1EX4 A;  2J05 A;  1G3T A;  1ZSZ C;  2E41 A;  4J9I A;  1V1C A;  2JJ9 A;  3CCU Q;  1WYX A;  3R6O A;  3LW5 E;  3OW2 P;  5LJ5 j;  3CME A;  1M2V A;  2KGT A;  1BU1 A;  2EW3 A;  3CD6 A;  4FU6 A;  4M75 E;  4QKU A;  1AOJ A;  1RAF B;  3A8M B;  4E7I A;  1KD1 C;  3CC4 T;  1VIF A;  1D0X A;  1GBR A;  1XJW B;  1JQQ A;  2R58 A;  4RTY A;  4M77 F;  4WF2 A;  4FT4 A;  2X4J A;  4N0A A;  2LC4 A;  1M90 U;  2VAS A;  1YHQ A;  5KYU A;  5CQX A;  4PLI A;  3JB9 F;  1LOJ A;  4M77 G;  3CCM T;  3M4G A;  4BE0 A;  3JB9 H;  2HQE A;  2GNC A;  1TUG B;  3M53 A;  2VXF A;  3JB9 G;  1OZ2 A;  4X34 A;  2PVD B;  2HMA A;  3OYH A;  1U8R A;  3KFV A;  2DKG A;  1VQL T;  3QO3 A;  2RHI A;  4IUP A;  1OI1 A;  4RUG A;  4HA8 A;  2F5T X;  1W2B A;  1X6G A;  1VQ5 T;  4M78 B;  3EG9 B;  1ZLM A;  1E6G A;  3GIB A;  3ZL7 C;  5GJV B;  3EGX B;  2EQI A;  2QA4 Q;  4OF1 A;  4J6Y A;  5GAM f;  3CCQ Q;  3RER A;  3L42 A;  2ZPB B;  2EIF A;  2EJF A;  1D3B A;  4C8Q F;  1WXT A;  3WVE B;  2XI9 A;  1RAG B;  1WJR A;  2QQR A;  1WI7 A;  3CCE Q;  3OQ5 A;  4B9X A;  3BY7 A;  2JN0 A;  3BDU A;  3PTA A;  2L3S A;  2DMO A;  2F2X A;  1PCX A;  5IXB A;  1H3H A;  2DRK A;  4RCC A;  2QXF A;  1VUB A;  3PVL A;  4OGC A;  1VQL Q;  3OB9 A;  4MDX A;  1VQ7 Q;  2RH2 A;  2YUP A;  5CQY A;  3SDZ A;  1NYF A;  2DRM A;  3LYI A;  1CKA A;  2HNI A;  1Y96 A;  2F69 A;  1OU9 A;  4XU2 A;  2D0Q B;  2YLC A;  4OB3 B;  2KRO A;  1WHH A;  3PVQ A;  5GMK j;  2PZ1 A;  3A8O B;  4RG2 A;  4XAX B;  1PM3 A;  2AIR B;  3CCR A;  1QWF A;  2FZK B;  3VS3 A;  1VQN Q;  3S3M A;  1EIF A;  4BI3 A;  3PE0 A;  3UA6 A;  1GBQ A;  5KYN A;  1M2V B;  1T0J A;  1RAE B;  3M56 A;  1E6H A;  4IUR A;  3G6E A;  2J6K A;  2DEU A;  3CD6 T;  4QVZ A;  2W10 A;  4OB1 B;  5GAN 4;  1S1N A;  2X4Y A;  2YRD A;  4RG8 A; 
#chains in the Genus database with same CATH homology
 2DE0 X;  2YUN A;  1XOV A;  2LQW A;  3I35 A;  4RTU A;  2KXD A;  1JXM A;  1UDL A;  1OOT A;  2OI3 A;  2MCN A;  4CC7 A;  1AEY A;  3EHQ A;  2F2W A;  4Z89 A;  1W1F A;  1K4U S;  2GGR A;  2EGA A;  2EVR A;  1Z9Q A;  2HDA A;  1PHT A;  2JM9 A;  2C0O A;  2K3B A;  4RTZ A;  1AD5 A;  2FPF A;  2ENM A;  1HJD A;  2CSQ A;  2K9G A;  4DEX A;  3GBQ A;  4D8K A;  1PWT A;  3QWY A;  1K0X A;  4R0K A;  3TSZ A;  1W70 A;  1AWO A;  2RN8 A;  2KRN A;  2X3W D;  1SHF A;  2SEM A;  2ROL A;  1JO8 A;  2RQW A;  1AZE A;  1QKX A;  1SRM A;  1A0N B;  4ZNX A;  2O31 A;  3IQL A;  1SPK A;  2DL4 A;  2ED1 A;  1G83 A;  1TG0 A;  4RTW A;  3TVT A;  2YT6 A;  1K9A A;  1QKW A;  1SEM A;  1AZG B;  2ED0 A;  4LE9 A;  3H0H A;  3VS7 A;  2JM8 A;  3O5Z A;  2EGC A;  2YUO A;  1KSW A;  1NLO C;  1NG2 A;  2VKN A;  2FPE A;  4HXJ A;  2OAW A;  3VS1 A;  1GL5 A;  4J9H A;  1U3O A;  4DEY A;  1BBZ A;  3LH5 A;  1X2Q A;  2CH4 W;  2GTO A;  2EGE A;  1RI9 A;  1UJ0 A;  3U23 A;  3REB B;  1YWO A;  2DBM A;  2K79 A;  4Y92 A;  2RF0 A;  1M3C A;  4AFU C;  4J9E A;  3SEM A;  1OPK A;  1H92 A;  3ULR B;  1RLQ C;  1JU5 C;  2FEI A;  1VA7 A;  1VYV A;  3H0F A;  2DIL A;  5I22 A;  2MIO A;  1K76 A;  2A08 A;  1AWJ A;  4F16 A;  3M0R A;  4Z88 A;  2I0N A;  1ZX6 A;  2KNB B;  2DL8 A;  1CSK A;  2PTK A;  2GQI A;  2DNU A;  1YN8 A;  4JZ3 A;  5GJW B;  3I5S A;  1MV3 A;  2C0I A;  1WX6 A;  4J9C A;  1X6B A;  5FW9 A;  2CDT A;  1SRL A;  2X3X D;  1T3S A;  1ZUY A;  1UGV A;  2P4R A;  4F14 A;  3VS0 A;  2O9S A;  4CC2 A;  1NEG A;  2YSQ A;  1KFZ A;  4HVU A;  2HEQ A;  2JW4 A;  2KYB A;  2KR3 A;  2V1R A;  4AFZ C;  3M0U A;  2EBP A;  1UUE A;  3M0P A;  4LUE A;  2FPD A;  2DVJ A;  2CT3 A;  4EIK A;  2K2M A;  2DL5 A;  1T3L A;  2A36 A;  1RLP C;  2JXB A;  2XMF A;  4E6R A;  2E5K A;  4AFQ C;  4Z8A A;  1PNJ A;  2L2P A;  3I5R A;  1BK2 A;  2HSP A;  2ABL A;  1RUW A;  2KRS A;  1I07 A;  3TSW A;  1ZUK A;  1FYN A;  1OPL A;  4OML A;  1OV3 A;  3EG3 A;  1GRI A;  2J7I A;  2SRC A;  3VRY A;  1WA7 A;  1QWE A;  3M0S A;  2BZY A;  1ZSG A;  2YDL A;  4KRT A;  1ZBJ A;  2EYY A;  4RTV A;  1WXB A;  1PKS A;  2G6F X;  5IXF A;  2A28 A;  2DYB A;  2KYM A;  2BZX A;  1GCQ C;  2D8J A;  1X43 A;  2GTJ A;  2RNA A;  1X69 A;  1WLP B;  2F2V A;  2CSI A;  3NGP A;  1X2K A;  3NHN A;  3EGU A;  1ZUU A;  1M30 A;  2K7A A;  2DL7 A;  1UFF A;  2DX1 A;  3VS5 A;  5ECA A;  4JPB W;  1KIK A;  1WFW A;  3A98 A;  1IO6 A;  2BZ8 A;  1U5S A;  3EG2 A;  1NEB A;  4HCK A;  1H8K A;  4A63 B;  2FRW A;  3C0C A;  2LX7 A;  1SSH A;  3M0Q A;  1JXO A;  4ORZ A;  4AFS C;  2DLP A;  3UAT A;  1PKT A;  2EKH A;  4M4Z A;  2M0Y A;  4ESR A;  1UEC A;  2DBK A;  1UJY A;  4OMP A;  2FO0 A;  2KT1 A;  1BB9 A;  1Z9Z A;  1NM7 A;  4OMQ A;  2KT8 A;  2OJ2 A;  3EG1 A;  2D1X A;  1GFD A;  2J06 A;  1GCP A;  3H0I A;  1AWW A;  2O9V A;  1K1Z A;  4J9G A;  4J9B A;  4IIM A;  1UTI A;  4LUD A;  3SHW A;  2HBW A;  2KEA A;  2LJ3 A;  3REA B;  5EC7 A;  4JJB A;  2L0A A;  2IIM A;  3VRZ A;  5IH2 A;  2M51 A;  1TUD A;  2AZV A;  2NUZ A;  2PNI A;  2KXC A;  3VS4 A;  2ECZ A;  5HCK A;  1MUZ A;  1Y0M A;  2H8H A;  5FWC A;  1SHG A;  4LN2 A;  2O2O A;  1I0C A;  2AK5 A;  4OMN A;  2EYX A;  3RBB B;  2O88 A;  1LCK A;  4GBQ A;  4OMM A;  1PRL C;  2RQR A;  2JMA A;  3I9Q A;  2DF6 A;  1WIE A;  3FJ5 A;  3NMZ C;  2RPN A;  2KE9 A;  1NLP C;  3QWX X;  2FRY A;  4JJD A;  2DL3 A;  2J05 A;  3H41 A;  3THK A;  1J3T A;  4J9I A;  1V1C A;  1YCS B;  1UHF A;  1JEG A;  1WYX A;  2B86 A;  1YP5 A;  2KGT A;  1BU1 A;  1M8M A;  2EW3 A;  1TUC A;  1AOJ A;  2DA9 A;  2EYW A;  3VS2 A;  1EFN A;  1PRM C;  1ABQ A;  1UG1 A;  2CUB A;  1I1J A;  4HVW A;  1B3Q A;  1M3A A;  5IHK A;  1GBR A;  1KJW A;  1JQQ A;  4JZ4 A;  4RTY A;  1HD3 A;  2AZS A;  2CH4 A;  1B07 A;  2L3P A;  2CT4 A;  4RTT A;  1T0H A;  2JS2 A;  4FSS A;  1GCQ A;  4GLM A;  2L3Q A;  2GNC A;  1WDX A;  1MV0 B;  1WXU A;  2K6D A;  2ESW A;  2A37 A;  3NPF A;  1U06 A;  3KFV A;  4CC4 B;  1HSQ A;  1VYT A;  2AKK A;  4RUG A;  1UHC A;  1X6G A;  2LQN A;  1VYU A;  2VVK A;  2ROT A;  4F17 A;  4J9D A;  1G2B A;  2NWM A;  4X1V A;  1FMK A;  4JJC A;  2EPD A;  1ABO A;  1ZLM A;  3EG0 A;  1E6G A;  2RQV A;  2CUD A;  3ZL7 C;  4AG2 C;  2QDL A;  2HCK A;  5GJV B;  4HVV A;  2FG0 A;  2EQI A;  1AVZ C;  1E7O A;  2LP5 A;  2JT4 A;  3VS6 A;  2GBQ A;  2C0T A;  2YUQ A;  4AG1 C;  1WXT A;  1OEB A;  2MOX A;  2D0N A;  4CC3 A;  1WI7 A;  2EYZ A;  2RQU A;  3M0T A;  1X27 A;  4J9F A;  4IIO A;  5IHN A;  3R6N A;  1NYG A;  2L3S A;  2W0Z A;  4QT7 A;  2CRE A;  2BTT A;  2DMO A;  2F2X A;  3EHR A;  1YNZ A;  1ARK A;  1AWX A;  5IXB A;  1Y57 A;  2DRK A;  2KBT A;  1H3H A;  2RMO A;  2JMC A;  1M27 C;  2JTE A;  1W6X A;  3PVL A;  1QLY A;  2J6O A;  2YUP A;  4K11 A;  2DM1 A;  5IHI A;  1NYF A;  2DRM A;  2LZ6 B;  1CKA A;  1N5Z A;  3CQT A;  3UF4 A;  5L23 A;  3JV3 A;  2LNH B;  4LNP A;  2LMJ A;  2KRO A;  4OMO A;  1YWP A;  3PVQ A;  1M3B A;  2KRM A;  4WCI A;  2PZ1 A;  1CKB A;  2RQT A;  1QWF A;  2LJ1 A;  2V1Q A;  3VS3 A;  2LCS A;  3RNJ A;  2D8H A;  2DJQ A;  1GFC A;  5I11 A;  3UA7 A;  4D8D A;  3PE0 A;  3UA6 A;  1GBQ A;  2JS0 A;  1T0J A;  1E6H A;  2LJ0 A;  4RTX A;  2J6K A;  1UE9 A;  5FWB A;  1QCF A;  1K0S A;  2J6F A;  2W10 A;  2AKL A;  1S1N A;  2VWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...