3I35A

Human sh3 domain of protein lasp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
KRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human SH3 domain of protein LASP1
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords LIM and SH3 domain protein 1
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3i35A00
2DA9A 1WDXA 1MUZA 2H8HA 4WCIA 2KBTA 4RTYA 1MV3A 1ZUUA 2QDLA 2GQIA 2DX1A 2FRYA 4HVVA 2KT1A 3LH5A 4E6RA 1T3SA 2VVKA 3VS2A 1T0HA 2DBMA 5ECAA 1ABOA 3VS1A 1E6HA 2V1QA 1WFWA 3CQTA 1AWXA 1T0JA 1ZUKA 3REAB 1QLYA 2ECZA 1M27C 1A0NB 1ABQA 1UHCA 1TUDA 2KE9A 3M0QA 1KFZA 4DEXA 1QWEA 1UJYA 3NHNA 1YCSB 1UGVA 2FO0A 1AZGB 1RI9A 1TG0A 2JMCA 2AK5A 2D1XA 4J9EA 1G83A 4LNPA 3VS0A 2ESWA 3A98A 1NM7A 4HVUA 2DVJA 3PE0A 2BTTA 2CSQA 4J9CA 1SHFA 1AZEA 1KIKA 2K2MA 2DF6A 1ZSGA 2D8JA 3TVTA 2RPNA 1FMKA 2O88A 1K4US 4GBQA 1OPKA 1HD3A 1M3BA 2EGCA 4RTWA 4J9HA 1H8KA 1SHGA 1HJDA 2FEIA 4QT7A 1K0XA 2P4RA 5IXFA 1QWFA 2DL5A 4AFZC 1ARKA 1Y57A 3VS4A 2DNUA 4X1VA 1B07A 1WLPB 2KNBB 1YN8A 3M0RA 2KEAA 1UG1A 4AG2C 3EG1A 1UHFA 3FJ5A 2VKNA 1E6GA 1XOVA 1AEYA 3EG2A 1NLOC 1K1ZA 3H0FA 4AFUC 1UE9A 2FRWA 2LNHB 1OV3A 1VYUA 2DMOA 2KYBA 2JT4A 1M3CA 3UA6A 2CH4A 4JJBA 1FYNA 1QKWA 4IIOA 5HCKA 2EQIA 3I5RA 2JS2A 2GGRA 2K7AA 2CUBA 1WI7A 4CC4B 1EFNA 2I0NA 2DJQA 2J6KA 2KXCA 1K9AA 1MV0B 4J9DA 2E5KA 1OEBA 1W6XA 2A37A 2RN8A 1UDLA 1U06A 1YNZA 2RF0A 2BZYA 5IHIA 2LQWA 3NMZC 2ROLA 4Z8AA 2HSPA 2LCSA 3U23A 2C0IA 2ED1A 3R6NA 4JZ3A 1K0SA 1GFDA 3SEMA 1V1CA 1GCQC 1X2KA 2L3SA 2FPFA 2KXDA 4F16A 4KRTA 2RQVA 2OI3A 4R0KA 2AZSA 1ZLMA 2D8HA 2OAWA 3KFVA 3M0TA 2DL8A 1NEBA 2YUQA 4J9BA 1SRLA 2O2OA 1I0CA 2D0NA 3I35A 5FWBA 5IH2A 3GBQA 4A63B 1BU1A 1AD5A 1AVZC 4OMPA 2L3PA 2EYZA 2JTEA 3O5ZA 1NLPC 4HCKA 2EYYA 2F2VA 2YDLA 3EHRA 3VS3A 2MIOA 3THKA 1NYFA 2L0AA 2FPEA 2V1RA 2A28A 2K79A 1GFCA 1ZUYA 4J9GA 2MOXA 1I1JA 1X69A 3SHWA 1UUEA 2YUOA 3M0SA 4OMQA 2NWMA 4IIMA 1NYGA 3UA7A 2LMJA 1WXUA 4D8KA 5GJWB 1PRMC 2J06A 1X27A 2DRKA 1U5SA 5FWCA 1BBZA 2K3BA 1GBQA 3I9QA 2GTJA 2DILA 2F2XA 1LCKA 2O9SA 3TSWA 3RBBB 1PRLC 1WXBA 4Z88A 1PKSA 1SPKA 4HXJA 2KT8A 4CC7A 4RTUA 3TSZA 1IO6A 2K6DA 1N5ZA 1M30A 2ABLA 1PHTA 2JMAA 4Z89A 1PKTA 2SEMA 1OOTA 2BZXA 4Y92A 1SEMA 1CKBA 1AOJA 1SSHA 3PVLA 1JXOA 1Z9ZA 4CC3A 2M0YA 1Y0MA 4RTXA 2PTKA 1WIEA 4LUDA 3EG0A 1E7OA 2EKHA 1G2BA 2DBKA 4RTVA 3H0IA 4ZNXA 2DM1A 2LJ0A 2CUDA 1PWTA 1T3LA 4AG1C 1Z9QA 2KRMA 3REBB 3I5SA 2CREA 2KR3A 4JJDA 2F2WA 1RUWA 2EGEA 1JU5C 2M51A 2JS0A 2XMFA 1UTIA 2C0OA 2MCNA 2ENMA 1M3AA 2J7IA 2YUNA 5FW9A 2JW4A 2AZVA 1JQQA 2EBPA 2DYBA 1JEGA 3JV3A 1SRMA 1WA7A 2YSQA 2DL3A 2ED0A 1X6BA 4FSSA 2C0TA 4RTZA 4ESRA 2SRCA 1GCPA 4CC2A 1WYXA 2CSIA 1BB9A 2EYXA 3H0HA 3UATA 1AWWA 1BK2A 2CH4W 1ZX6A 3VS7A 4AFSC 1B3QA 3EGUA 3M0PA 4AFQC 1WXTA 1GL5A 5IXBA 4J9FA 1X6GA 2LP5A 1VYVA 1KSWA 2HDAA 2NUZA 2CT3A 2DL7A 5EC7A 3EHQA 4RUGA 3IQLA 1GBRA 3H41A 4OMOA 2O9VA 2GBQA 1PNJA 1K76A 2EW3A 2IIMA 2KRSA 2AKLA 2K9GA 2LZ6B 3QWXX 4RTTA 1NG2A 4GLMA 1QKXA 1X2QA 2CT4A 1CSKA 2JM8A 1ZBJA 2A08A 2GNCA 1NEGA 3NPFA 2HEQA 1VA7A 1JXMA 2HBWA 2LQNA 2DLPA 4EIKA 4M4ZA 2GTOA 2LX7A 2YT6A 3QWYA 2VWFA 4K11A 1UJ0A 1YWOA 4DEYA 3ULRB 1CKAA 1U3OA 5I22A 1W70A 4LN2A 1KJWA 2JXBA 2X3XD 1GRIA 2LJ1A 1YWPA 2KYMA 2J6OA 2RQRA 3RNJA 2FG0A 2EGAA 5I11A 1RLQC 4OMNA 2A36A 3PVQA 5GJVB 1UFFA 3NGPA 3VS6A 1AWOA 1AWJA 3VS5A 2ROTA 5IHKA 1QCFA 1HSQA 2RMOA 2G6FX 4D8DA 2AKKA 2X3WD 2O31A 4OMMA 3VRYA 1TUCA 2RQUA 1WX6A 2HCKA 3VRZA 2B86A 2EYWA 1H92A 2RQWA 2OJ2A 2L3QA 3M0UA 1OPLA 3C0CA 2KRNA 2DRMA 2KROA 1VYTA 2PNIA 5L23A 2YUPA 2RQTA 1H3HA 1W1FA 3ZL7C 2J6FA 2KGTA 4JPBW 4F17A 4HVWA 1X43A 2L2PA 2JM9A 5IHNA 4F14A 2EPDA 2J05A 1I07A 2DE0X 2FPDA 4ORZA 1YP5A 1JO8A 2DL4A 2BZ8A 1S1NA 2CDTA 2W10A 1RLPC 2EVRA 1GCQA 2PZ1A 3EG3A 4JJCA 4LE9A 4LUEA 1UECA 2W0ZA 2RNAA 2LJ3A 1M8MA 4JZ4A 1J3TA 3UF4A 4J9IA 4OMLA
chains in the Genus database with same CATH superfamily
1C0MA 2K5IA 4RTYA 5GAN7 2GQIA 3MP6A 2PUKB 3CMAA 1QVGA 1XJWB 3ZFJA 4M7AG 1BI0A 1VIFA 5D6YA 1WQWA 3VS2A 3CCET 1T0HA 2YWWA 1VQ8A 1RAIB 1YHQA 3L2VA 3MJXA 4M77A 2E1HA 1YIJQ 2V1QA 4N4IA 3CQTA 1AWXA 3MHXA 4FT2A 3REAB 1IREB 3E19A 4N0AA 1H641 2ECZA 1QVGP 2XG8D 1S72Q 1VQ8T 3JCMX 1UHCA 4OGCA 1KFZA 4DEXA 5LJ5f 1QWEA 3OYKA 3M9QA 1UJYA 1AZGB 2E6NA 2LDMA 1TG0A 2EJ9A 2JMCA 2NLUA 4Y28E 3DLLA 1KC8R 2D6FA 3VS0A 1NM7A 4KT0E 1XNIA 2DVJA 2PVGB 1KHIA 3FJPA 1XQHA 2LC4A 3VUZA 2HNIA 3BDLA 2DEUA 4GBQA 4O6JA 1HD3A 4E7HA 4RTWA 1WNLA 5D7UA 4FT4A 4C8QA 1H8KA 4R56A 4AT1B 1ZSZC 1K0XA 5CAIA 4AFZC 1NJIR 2KSSA 4M78D 2KNBB 2KY9A 5GANd 4PJOE 2E41A 2M9UA 4AG2C 3EG1A 3FJ5A 1C1AA 2RHIA 1Q82R 2X35A 1E6GA 2LVMA 1K73C 1AEYA 3EG2A 1Y7XA 3JCMV 1Q81U 3J7AF 2EYQA 3TEEA 4PJLA 1OV3A 1YFNA 2KYBA 2JT4A 3CXCA 3UA6A 3A8GB 4FCYA 1QKWA 2G3RA 3SWNA 2EWNA 5IN1A 2QEXQ 3CXCS 2JS2A 3CEYA 2K3XA 4C8QD 3CCSA 4CC4B 1EFNA 4BUGA 2F5TX 2Y4XA 3CCSQ 1ZSZA 2RN8A 1U06A 1YJ9Q 5GAN3 3NMZC 2EIFA 2MWOA 4M77F 5LJ3g 2EQKA 4PJOC 4C92A 2LX9A 3CCQQ 4XAXB 3OB9A 1VQ5Q 2QQRA 3RUXA 3QJ6A 3OYLA 4BE2A 1YIJA 2RI3A 2Z0WA 2R58A 4C8QG 2L3SA 2RQVA 3VYHB 4R0KA 4C92E 1VQLT 3RMQA 1YIJT 2D8HA 2LRQA 3D7SB 5FLXE 4QVZA 2E6ZA 5DLOA 5CIUA 1X6OA 1I0CA 4FYWB 2COYA 3EGXA 3F70A 3M58A 3GBQA 1OX8A 3ME9A 2NYSA 1LOJA 2PU9B 2JTEA 4N4GA 4M7AB 1M4ZA 2DD5A 2P0PA 3M4YA 2F2VA 1YITT 3DKMA 1NYFA 4KGZB 4BE0A 2L0AA 4XU0A 1GFCA 5GAOq 1VQNQ 3DLMA 2CZ1B 1I1JA 3V7SA 1UUEA 2E12A 4E7JA 2ZPHB 2DAQA 2NWMA 4IIMA 4A4KA 4ZGEB 4OB0B 4FW1A 3EG9A 2ZPFB 4OB2B 2J06A 4M7DF 1TXQA 2VV5A 1RABB 2JTMA 2RO0A 3CD6Q 4AMCA 1VQPA 5J3BA 3PGGA 4IUQA 2BE7D 1NBEB 1LCKA 2O9SA 4Z88A 4NL2A 3QDFA 2EQJA 4RTUA 3CCRQ 3TSZA 4EMKC 2M1HA 3CD6T 1IO6A 1PHTA 3LYIA 4XU1A 5I21A 3E2UA 2H3EB 1AOJA 4BDZA 1JXOA 2ZAEA 4XTZA 4RTXA 2KVQG 2DJZA 2FHDA 1WIEA 4LUDA 2F69A 3M54A 4IUVA 3G4SQ 3H0IA 5L8RE 3QBYA 4X34A 1PWTA 1T3LA 1Q81C 3LGLA 1M2OA 3JCMe 4JJDA 2F2WA 1JU5C 2RI5A 2XICA 5CQYA 1I5OB 1UTIA 2C0OA 2ENMA 2FVUA 1Y96B 2L89A 2E65A 4BY6B 1JQQA 1WJRA 1JEGA 1QVFA 3JB9I 2CP2A 5FU7B 3GNFB 4JDSA 4ELZC 1D3BA 5CKFA 2DKGA 4X9DA 2DL3A 4M75A 4C5HA 4M7AA 5D6WA 5KYXA 4C0FA 4CC2A 1WYXA 3HTRA 5A2QE 3N5BB 1D1BA 2L8DA 4KULA 2EYXA 3H0HA 2F5KA 3CCVT 2CH4W 4AFSC 2QA4A 2L3RA 2LTOA 1PCXA 1WXTA 4J9FA 1MHNA 3A8OB 4FYYB 4R55A 3O8VA 4EMKB 2NUZA 5HKCA 2CT3A 2RJDA 4BDYA 4RUGA 2OAUA 4OMOA 2M16A 7AT1B 1PNJA 3FIFA 2LZ6B 3QWXX 1I81A 4OVAA 1NG2A 2CT4A 2A08A 1NEGA 1YITA 1RL2A 4B6MA 3M5AA 3LX7A 5CR2A 2OTJT 2FZGB 2O01E 2FYKA 3WVDB 3OY9A 1IHWA 2KK4A 4QW2A 1KK7A 3X24B 1VOMA 4DEYA 3CC4A 3OW2S 3VU3C 4M7AC 4B9XA 4LN2A 1TS9A 4A53A 2JXBA 1GRIA 2NUPB 5DM7R 3PT9A 1IZ6A 2FG0A 3MPUB 1FMVA 4XU3A 2ZZDA 2WSEE 3RIRA 3PVQA 2GF7A 1G5VA 1UFFA 3RKWA 1R8OB 3ASKA 1Q95G 3SWNC 3CC4Q 3VS5A 4F7UF 5IHKA 1QCFA 2VUBA 1UEBA 5GAMe 2X3WD 4GY5A 2GFUA 5LL6S 2C06A 4OMMA 2CP0A 4E7KA 1VQKA 3LW5E 3WVEB 4XTYA 4NS5A 1OPLA 2P4TA 3OMCA 4C92B 2KRNA 2KROA 1IGQA 4C0DB 2A7YA 5KYUA 4B9WA 1VYTA 2PNIA 3L2UA 3CCEA 4LDXA 1VQ6A 3V8LA 4F17A 4HVWA 5GAOm 3QYGB 2FPDA 2BZ8A 3CPWS 3EFOB 4M7DB 2PZ1A 3ZBDA 3QJYA 2RNAA 2KAFA 3FB9A 1VIEA 1M8MA 2VXFA 3UF4A 4A4HA 2LT1A 2OTJQ 4M78E 5GMKl 3EFRA 1YBYA 4BI8B 4II1A 1WDXA 1MGQA 4BI3A 4C0DC 1YJ9A 4M7AE 2PUOB 1ZUUA 2CKKA 1Q82U 4F7UE 4PJOG 3LH5A 1QP2A 1T3SA 2VVKA 3URGA 1ZA2B 2DBMA 5ECAA 4ATOA 3JRZA 1M1KR 4ZGJB 2BIVA 3E9GA 8ATCB 1WFWA 2JUFA 3G6ET 2M0OA 3LLRA 1ZUKA 1QLYA 4DOWA 3R6OA 1M27C 1ABQA 2V8IA 3OYYA 2RM4A 5I2SA 1Q7YR 2V8JA 4HCBA 3OYBA 3LH0A 2X51A 1RI9A 4Y91A 2CZ0B 2AK5A 2D1XA 3SB2A 4HVUA 3ER0A 2CP6A 1V29B 2CSQA 1PD1A 1X75C 3OW2P 2K4YA 5CO7A 2A0FB 3JCMc 4D6WA 3SWNB 2VYTA 2WACA 3OYJA 1PSFA 4XQ3A 3CCQT 5HK3A 1RAAB 4JLIA 2FEIA 1VQ7T 4M75D 4A4GA 4M7AD 3RR6A 1W2BS 1OZ2A 2ZGWA 1Y57A 1SSFA 5GAN2 1B07A 1BYMA 1WLPB 1YN8A 2KEAA 3RESA 3A8MB 1UG1A 3C94A 3MP1A 3CCQA 1PSEA 3QYHB 5GAOp 3OYCA 3SD4A 3H0FA 3ZEHA 3EH2A 4BE1A 3CCLA 2P0QA 4JJNK 2DMOA 2MAMA 5GANj 2CH4A 4PJOF 4PJOB 2ATCB 2QQSA 3AHUA 2KDSA 5HCKA 1YHQQ 4WF2A 4M77D 3C4SA 3P8BB 2RB6A 4MZMA 2EQIA 3I5RA 4EPCA 3CCUT 4M78C 2EFIA 2QQAA 4BI4A 1WI7A 4MZPA 2KXCA 3L2RA 1MV0B 2E5KA 1OEBA 1W6XA 3M56A 4E7SA 1RAFB 4M7DG 4RG8A 1YNZA 2RF0A 5GAN4 2LQWA 2QG9B 1RI0A 2ROLA 5KYNA 1RAHB 2HQEA 3U23A 5KYUB 5GANe 1K0SA 4QQGA 5KCOA 1KQSP 4C92G 1OQKA 2BUDA 1X2KA 2FPFA 2KXDA 4JRIA 3JB9H 1MMNA 2RD1A 5FU6C 2HSEB 5GAMf 1TU0B 3AT1B 1MMAA 3M0TA 2YUQA 3MCAB 4OMFB 3CC2T 4M78A 4TVRA 3L1AA 2YXYA 2D0NA 5GANh 1NZ9A 4PK4A 5IH2A 1SG5A 4E7ZA 4A63B 1AD5A 1FMWA 2L3PA 2EYZA 5LJ3h 3OYIA 2PQWA 3CC2A 1YI2Q 1BIAA 3SDZA 3OSSC 1G3SA 2OTJA 2MIOA 1IB8A 1D1AA 1LVKA 2FPEA 5GAN6 3LWHA 2A28A 1EZZB 1B7TA 4J9GA 3PFSA 1PG5B 4OMQA 3BE3A 3BW1A 1PRMC 2YLBA 4EDUA 1VQ6Q 1X27A 1UB4A 2DRKA 2JOYA 3CCLT 4QQDA 2DILA 4M75E 1VQOT 3E9FA 1QW1A 1B34A 4JRPA 3TSWA 1WXBA 3EGDB 1YJNA 4BD3A 1U1TA 1MNDA 4HXJA 1VQ9A 2VGMA 2HMAA 1V76A 4LDVA 3TCJA 3MKDA 5KE3A 4Z89A 1OOTA 5KYWA 1SEMA 1CKBA 2QAZA 3S3OA 4CC3A 1NPPA 1VQMA 1G3TA 1UGQB 2EKHA 1AHJB 3I56A 2M02A 3S6WA 1Z9QA 2KRMA 4M77C 1QVGS 1BKBA 2HQHA 3I5SA 1KD1U 3C12A 1R77A 1RUWA 5HK0A 3H9NA 4LXCA 2JS0A 1Q86C 2NUTB 1YITQ 1M8VA 2CP7A 1M3AA 1YJ9T 5FW9A 2JW4A 1M90R 3JV3A 4DA4A 1JJ2A 3EH1A 4BB7A 1KQSS 2VGNA 3BFMA 3TU4K 5C6SA 1X6BA 1NE8A 2C0TA 4RTZA 2JN0A 1GCPA 2COWA 4FM4B 1BCMA 3KBGA 5LJ3f 3JCMP 2CSIA 3CC4T 4WTOB 3UATA 5GAMh 2EJGA 4C8QC 2OTLA 1ZX6A 3VS7A 1VQ5A 3EGUA 4AFQC 1H3ZA 1GL5A 2A3LA 2LP5A 1KSWA 5KYYA 1YJNQ 3KXTA 2DL7A 1F1BB 3EHQA 5A0DA 2DXTA 4N0AC 2EW3A 1K76A 4C5EA 2KRSA 1M9SA 2K9GA 3QPHA 1M5Q1 2QI2A 4GLMA 1X2QA 3CCUQ 3HRSA 2GFAA 2DZCA 2HD0A 3QIIA 2CP3A 3EAEA 5HY6A 4RCBA 1ZBXA 3QKJA 3JCMg 1I8FA 1UJ0A 1YWOA 3ULRB 3OYHA 4KH0B 1IRXA 1W70A 3OS1A 2MYSA 1YWPA 1OI1A 3G71Q 2J6OA 3RNJA 3EG9B 1RLQC 4OMNA 2A36A 1D1CA 5GMKh 1K8AC 1VQMT 2BKDN 3NGPA 1IXDA 4E7IA 3A8HB 2AHJB 4EMGA 2ROTA 4A54A 1VQ9T 3OBYA 2RHXA 2G6FX 1VQLA 4C92C 3NTHA 2DZ9A 3I55A 2O31A 4M77E 2XU8A 2QEXT 3VRYA 3UT1A 4QQ6A 4KH1B 2CZ7B 1H92A 2RQWA 4C8QB 3M0UA 3C0CA 1XTDA 5IAYA 1H3HA 1W1FA 2J6FA 2VASA 4JPBW 4PLLA 2ZPGB 1HXDA 2L2PA 1D0ZA 5J26A 4C5GA 1I07A 4IKFA 2DL4A 4M78G 3PIPA 2CDTA 1RLPC 4LE9A 2RK2A 4LUEA 1QVFS 4JZ4A 2DD4A 1WZOA 4J9IA 4OMLA 4ELYC 1KQ2A 1U1SA 4M78B 1VQKQ 1MUZA 2OTLT 2H8HA 2RJEA 4PJOA 1KQSA 4WCIA 3HFOA 2KBTA 4N4HA 2QDLA 2QGFB 1N8RC 4HVVA 5GAMd 3BY7A 2KT1A 2R57A 2XHCA 3HKSA 4E6RA 1ACMB 3WXMB 1Y07A 1BIBA 1D0XA 2CS7A 1OYXA 3OYAA 5GMKm 3VS1A 4C8QF 2QTVA 1M90U 1E6HA 4L6V5 2K2VA 1YI2T 1WHGA 3M0QA 1TUDA 1WHHA 2QXFA 4PLIA 1TOVA 1MNEA 1ZA1B 2E3HA 1SF9A 3NHNA 1YCSB 2E64A 2FO0A 4OB3B 3HSBA 1G83A 2ESWA 3A98A 5GANf 4J9CA 1SHFA 1AZEA 1QCNA 1KIKA 2ZCFB 2D8JA 3G7ZA 4M78F 3TVTA 2RPNA 3CMEQ 3INZA 3I55Q 2O88A 5KYYB 1K4US 4DBQA 3MP8A 1M3BA 4J8OA 1Q86U 2EGCA 3CCST 1VQOQ 3GOXA 4J9HA 1VQ4T 1C6VX 1SHGA 1HJDA 4QT7A 1VQKT 2RK1A 2QA4Q 5EG2A 5IXFA 1QWFA 2DL5A 1ARKA 2VXEA 4X1VA 1QMCA 3FRNA 2E10A 3OYDA 3EFSA 4YTLA 5LJ5h 1N9RA 2V26A 2RH2A 5LJ5j 1XOVA 2XKOC 1W2BP 1UE9A 2D0QB 2LNHB 4J83A 5M9OA 4PFPA 4EMKA 1M3CA 4JJBA 2WSFE 1FYNA 4J6WA 2HZYA 4LDUA 4M75C 2JTFA 1QVPA 2XI9A 4IIOA 4F7UB 3QZ5B 1JB0E 1K8AR 3CMEA 3I56T 1VUBA 2K7AA 4HCZA 2DJQA 4IUTA 5LJ5g 3FEOA 2A37A 3MEAA 1M2VA 1UDLA 2BZYA 5IHIA 3CMET 2RHZA 2H3JA 2L5QA 2HSPA 3EFOA 4M7DA 5KYWB 4NOYA 1Q86R 1BI1A 2NUPA 3SEMA 1VQ7Q 5GANg 3DB4A 5KH6A 4HCCA 3M4GA 2OI3A 2DIQA 1VQ5T 1RADB 2DL8A 1NEBA 4FYVB 4PFOA 2FZCB 2O2OA 1TUGB 4LD6A 5GMKj 2YRDA 1VQOA 4ZTJA 4ZTFA 2FB7A 1WHMA 1N8RU 1YJNT 4MMKA 3EGDA 3CPWP 1DJ7B 5FROA 4QVCA 1TH7A 3O5ZA 2O4XA 1NLPC 1VQ7A 2HBPA 1VQNA 2YDLA 3EHRA 4M7DD 1VQ6T 3CCJA 3CC7A 3M59A 2X4XA 3OS0A 1EIFA 2CZ6B 4V2SA 2LT4A 2MOXA 3RKXA 3X20B 1TWBA 1VQNT 4L59A 4M75G 1W4SA 2MMPA 3UA7A 4J6XA 5LJ3e 4PJOD 1WXUA 4D8KA 5GJWB 4KGVB 3S3NA 4J7IA 1GBQA 2DO3A 4E2FB 2GTJA 1W2BA 3FDRA 5D6XA 1VQLQ 1O75A 2F2XA 2RJFA 4JLGA 3CCMA 4BACA 1K9MR 2DK3A 3QHSA 4UC4A 2X9HA 1SPKA 3HP9A 2E70A 3JB9F 2EQMA 2KT8A 4JRQA 3OBWA 2K6DA 4FSXA 2P0KA 4CI0C 2DXBA 2SEMA 2BZXA 4Y92A 9ATCB 1SSHA 3PVLA 2EJFA 3G6EQ 2YHTA 2CGHA 5LJ3j 1Z9ZA 2E3IA 2M0YA 1Y0MA 2FZKB 1BI3A 3PMIA 2PTKA 5FU7C 3EG0A 4FL6A 4E47A 4PFZA 2DYIA 2DBKA 4RTVA 3CCVA 2DM1A 4PL6A 3HFNA 1YJWA 2CUDA 1X01A 4F7UG 3CBMA 2P84A 2XK0A 2K5FA 2K5LA 4L5GA 2RA2A 3NTIA 3REBB 2DVEA 4DQ2A 1VQPT 3JAME 2CREA 2D9TA 2XDBA 2EGEA 2RHUA 4OB1B 3GP8A 1BCOA 1M1GA 2XMFA 3OYNA 3E1SA 3HRUA 1YJWT 2HKNA 2J7IA 3Q1JA 2QYZA 1UGRB 2AZVA 3G1JA 4ZGDB 1WA7A 4DOVA 3OS5A 2ED0A 4FSSA 4PJMA 1K73R 1LNXA 2SRCA 2DPPB 4M75F 3X25B 2F1LA 3V7CA 4ZN3A 1AT1B 1BB9A 1O9SA 2ZPBB 3MEUA 3CCJT 3CC7T 3M53A 1B3QA 3M0PA 4JS4A 2QK0A 2CP5A 5IXBA 5J39A 1X6GA 3H8ZA 4E7LA 4BY6C 3QZ9B 4DBFA 4A4EA 1VYVA 1ZHIA 5GAOr 1WQ7A 3CC2Q 5EC7A 2GBQA 2IIMA 2AKLA 4RTTA 2HL3A 3QUIA 3G4ST 5C0MA 2JM8A 5GAN8 1G8XA 2LNVA 3I55T 1IHVA 4RKUE 2HEQA 3NPFA 1JXMA 2HBWA 3CBPA 2VB6A 2LQKA 1WJSA 2OX7A 2DLPA 2GTOA 2LX7A 2DIGA 2YT6A 3QWYA 4C92D 5FRNA 1G3YA 1UGPB 2X4JA 1D0YA 2X3XD 5KCHA 1KG1A 2RQRA 3VV0A 3CPFA 4XTWA 2EKOA 5I11A 3M55A 4PNOA 5LJ3d 2HL5C 3CCMT 1D09B 5GJVB 1FX7A 3VS6A 1AWJA 3CCEQ 1OU9A 1B34B 5GAOn 3CMAQ 2RMOA 5AYFA 1Q7YC 4DBRA 3C95A 3PIOA 5A0GA 3QDRB 3EGXB 1TUCA 1WX6A 2HCKA 2FL7A 3VRZA 1MMDA 2B86A 2EYWA 2X4YA 2ZPIB 2OJ2A 3OYGA 3CCVQ 3L2QA 3JCMJ 1FXXA 3GPLA 1M1KC 2RQTA 2MK5A 2DERA 2IG0A 3I56Q 3LWIA 3G6EA 1HYOA 3BDUA 1X43A 4F14A 5GMKi 2DXUA 5CKBA 3RERA 2DE0X 2LCLA 2XIDA 1JO8A 3T9NA 3LGFA 3L2ZA 1K8AU 4XU2A 1S1NA 3OMGA 1UECA 3VKIA 1N9SA 2W0ZA 2YRVA 4Z02A 4IUUA 3L42A 1J3TA 5CCAA 2DA9A 4XTVA 3JSCA 1R0BG 3P8DA 2YRCA 1Q7YU 1VQ9Q 1MV3A 4JUVA 2DX1A 2JZ2A 4KGXB 3JCMb 2FRYA 3OW2A 3V7RA 3FC3A 1ABOA 1NPRA 3G4SA 2OTLQ 4EMHA 2Y4YA 3QG1A 4C92F 3S3MA 4KUDK 1R0CB 1T0JA 2K3YA 3DB3A 1K9MU 2KMTA 3CCJQ 1A0NB 2KE9A 2AIRB 3MEVA 2COZA 3A5ZB 3VUBA 2MF2A 2QDYB 3CCRA 1BI2A 1UGVA 1SKUB 3UWNA 3CBOA 4J9EA 4LNPA 3OS2A 3JCMQ 3PE0A 2BTTA 2K57A 2K2MA 2DF6A 1KHCA 1ZSGA 2RI2A 2ZPEB 3UPUA 1FMKA 1OPKA 1FWZA 2XDPA 2NUTA 3KUFA 3HRTA 1D3BB 2P4RA 4CRIA 5AT1B 3NTKA 3VS4A 2DNUA 1N8RR 3JCMd 4RCCA 1VQMQ 1M2VB 3M0RA 4M7AF 1UHFA 2VKNA 1OU8A 1NLOC 1K1ZA 2KI7A 4LDWA 4AFUC 2QA4T 2FRWA 3X28B 1VYUA 2MI6A 2MWPA 5LJ5d 3CC7Q 2IVWA 3TQ7P 5FRMA 1Y71A 4XTUA 2HAXA 4PJNA 2XD0A 4C5IA 4HT9A 4JRKA 2JNGA 3J81E 4KUIA 4F7UA 3P8HA 1N6AA 2GGRA 2CUBA 3RKYA 2I0NA 2J6KA 3QXEB 1K9AA 4J9DA 5KE2A 2DXCA 1K73U 2RJCA 5CKDA 1KD1C 4OF1A 4FIBA 5LJ5e 5CVIA 2QQ9A 1LJOA 4Z8AA 2LCSA 2C0IA 2ED1A 2LCCA 4JZ3A 3R6NA 3QO3A 1GFDA 2E5QA 1YI2A 4KBMB 3FLGA 1V1CA 2IPOB 1GCQC 4HT8A 2BE9B 2EQUA 2KQWA 4F16A 4KRTA 1KQ1A 1N27A 2AZSA 3CPWA 1G3WA 4C8QE 1ZLMA 2OAWA 3KFVA 2PVDB 3SFMA 3H6ZA 4J9BA 1SRLA 3MO8A 4XK8E 3I35A 2R5AA 5FWBA 1WJQA 5IT9E 1QP3A 2EAYA 1JRIA 2WSCE 3PNWC 1BU1A 1AVZC 4OMPA 1UGSB 2HQXA 4J6YA 2XDDA 4FU6A 4IUPA 4HCKA 2DTIA 4MDXA 2EYYA 3VS3A 1WGSA 1S72T 3THKA 1YJWQ 4O5VA 2V1RA 1IGUA 2K79A 2QGGA 1ZUYA 1QCOA 2Y90A 2QTXA 1X69A 1YCYA 2YUOA 3SHWA 3M0SA 1QQJA 4PKCC 4M77G 1NJIC 2LQ8A 1NYGA 5GAMj 2LMJA 4X9CA 1I4K1 2X4WA 5FWCA 1U5SA 1WHKA 1BBZA 2K3BA 3A8LB 5CKHA 3V8JA 3I9QA 8AT1B 1GXIE 1Y96A 3RDVA 1Q81R 1HK9A 2QQBA 3RBBB 4NL3A 1PRLC 3GNGA 3OYEA 4JS5A 1PKSA 1U8RA 2PVOB 3CCMQ 1RAGB 1M90C 3HL8A 3HPWA 3A1PA 1KC8C 3VYGA 4CC7A 1ZSZB 1P92A 3GF5A 1N5ZA 1M30A 2ABLA 4HA8A 2JMAA 2YLCA 1PKTA 4Q5WA 4IURA 1TSFA 4OP0A 3PMTA 3HHTB 4QKUA 1JBMA 1E7OA 3J80E 1G2BA 2RHYA 4ZNXA 1KD1R 4C0ZA 2LJ0A 2I2LA 5CQXA 3L2WA 4AG1C 3META 5DY9A 3OA6A 1OZ3A 3NFCA 2KR3A 3PTAA 3OQ5A 2M51A 1PD0A 6AT1B 2MCNA 2B8AA 2YUNA 2GQVA 3JB9J 1VQ4A 2EBPA 2DYBA 3GLXA 4RG2A 1SRMA 1VQPQ 2YSQA 4ESRA 3G71A 2GCXA 5DLQE 4M77B 4J5YA 4PJJA 3CCLQ 4OGEA 3TREA 4M7DE 4J7FA 2DFUA 1AWWA 1BK2A 1S72A 1I5LA 2CYZB 1MMGA 3OSVA 3CMAT 2HDAA 3CXCP 3V8KA 1LPLA 2DTHA 3IQLA 3CCUA 3CCRT 4FYXB 5GAOl 1GBRA 3H41A 2O9VA 1VQ8Q 1YHQT 1QKXA 2AT1B 1CSKA 1Q82C 1ZBJA 4RMOA 2QEXA 2GNCA 3JB9D 1VA7A 4ZN1A 2O4XB 4M75B 1EX4A 3M57A 1WHLA 2LQNA 3MEWA 2QASA 4EIKA 4GLKA 4M4ZA 4C0GA 1M1KU 1JJ2P 5A0LA 2VWFA 4K11A 4MMLA 1CKAA 4P5NA 1U3OA 5I22A 3QSUA 1KJWA 1JJ2S 2DETA 2LJ1A 2KYMA 3JCMf 2EGAA 4VUBA 1WPYA 4LD9K 3OYFA 4XTXA 1WHJA 2V8KA 2DEQA 2VC8A 1M1FA 1AWOA 1PC0A 5GAMg 5GAN5 3JB9G 2MPXC 1RAEB 1HSQA 1PM3A 1ZQ1A 4F04B 3OYMA 4ANJA 4D8DA 2AKKA 3RMSA 4M7DC 1TTHB 2RQUA 3CD6A 3VJPA 4HKEA 1K9MC 5CKEA 3UDCA 2E4HA 2DTOA 2L3QA 4MZTA 1NJIU 2DRMA 2HKQB 5KYXB 5I2MA 5CK9A 5L23A 2YUPA 3ZL7C 2KGTA 4MDWA 3JCMh 5FU6B 1RACB 2JVVA 2JM9A 5IHNA 4ME7A 3X26B 2EPDA 1OULA 2J05A 4QVDA 3JCMW 1QVFP 4ORZA 2JJ9A 1YP5A 4LDYA 4DBHA 3G71T 2W10A 4A4FA 2EVRA 1GCQA 4JJCA 3EG3A 2LJ3A 1VQ4Q 1OX9A 2R5MA 3GIBA 1KC8U 4FW2A 5GMKe
chains in the Genus database with same CATH topology
2DA9A 1WDXA 1MUZA 2H8HA 4WCIA 2KBTA 4RTYA 1MV3A 1ZUUA 2QDLA 2GQIA 2DX1A 2FRYA 4HVVA 2KT1A 3LH5A 4E6RA 1T3SA 2VVKA 3VS2A 1T0HA 2DBMA 5ECAA 1ABOA 3VS1A 1E6HA 2V1QA 1WFWA 3CQTA 1AWXA 1T0JA 1ZUKA 3REAB 1QLYA 2ECZA 1M27C 1A0NB 1ABQA 1UHCA 1TUDA 2KE9A 3M0QA 1KFZA 4DEXA 1QWEA 1UJYA 3NHNA 1YCSB 1UGVA 2FO0A 1AZGB 1RI9A 1TG0A 2JMCA 2AK5A 2D1XA 4J9EA 1G83A 4LNPA 3VS0A 2ESWA 3A98A 1NM7A 4HVUA 2DVJA 3PE0A 2BTTA 2CSQA 4J9CA 1SHFA 1AZEA 1KIKA 2K2MA 2DF6A 1ZSGA 2D8JA 3TVTA 2RPNA 1FMKA 2O88A 1K4US 4GBQA 1OPKA 1HD3A 1M3BA 2EGCA 4RTWA 4J9HA 1H8KA 1SHGA 1HJDA 2FEIA 4QT7A 1K0XA 2P4RA 5IXFA 1QWFA 2DL5A 4AFZC 1ARKA 1Y57A 3VS4A 2DNUA 4X1VA 1B07A 1WLPB 2KNBB 1YN8A 3M0RA 2KEAA 1UG1A 4AG2C 3EG1A 1UHFA 3FJ5A 2VKNA 1E6GA 1XOVA 1AEYA 3EG2A 1NLOC 1K1ZA 3H0FA 4AFUC 1UE9A 2FRWA 2LNHB 1OV3A 1VYUA 2DMOA 2KYBA 2JT4A 1M3CA 3UA6A 2CH4A 4JJBA 1FYNA 1QKWA 4IIOA 5HCKA 2EQIA 3I5RA 2JS2A 2GGRA 2K7AA 2CUBA 1WI7A 4CC4B 1EFNA 2I0NA 2DJQA 2J6KA 2KXCA 1K9AA 1MV0B 4J9DA 2E5KA 1OEBA 1W6XA 2A37A 2RN8A 1UDLA 1U06A 1YNZA 2RF0A 2BZYA 5IHIA 2LQWA 3NMZC 2ROLA 4Z8AA 2HSPA 2LCSA 3U23A 2C0IA 2ED1A 3R6NA 4JZ3A 1K0SA 1GFDA 3SEMA 1V1CA 1GCQC 1X2KA 2L3SA 2FPFA 2KXDA 4F16A 4KRTA 2RQVA 2OI3A 4R0KA 2AZSA 1ZLMA 2D8HA 2OAWA 3KFVA 3M0TA 2DL8A 1NEBA 2YUQA 4J9BA 1SRLA 2O2OA 1I0CA 2D0NA 3I35A 5FWBA 5IH2A 3GBQA 4A63B 1BU1A 1AD5A 1AVZC 4OMPA 2L3PA 2EYZA 2JTEA 3O5ZA 1NLPC 4HCKA 2EYYA 2F2VA 2YDLA 3EHRA 3VS3A 2MIOA 3THKA 1NYFA 2L0AA 2FPEA 2V1RA 2A28A 2K79A 1GFCA 1ZUYA 4J9GA 2MOXA 1I1JA 1X69A 3SHWA 1UUEA 2YUOA 3M0SA 4OMQA 2NWMA 4IIMA 1NYGA 3UA7A 2LMJA 1WXUA 4D8KA 5GJWB 1PRMC 2J06A 1X27A 2DRKA 1U5SA 5FWCA 1BBZA 2K3BA 1GBQA 3I9QA 2GTJA 2DILA 2F2XA 1LCKA 2O9SA 3TSWA 3RBBB 1PRLC 1WXBA 4Z88A 1PKSA 1SPKA 4HXJA 2KT8A 4CC7A 4RTUA 3TSZA 1IO6A 2K6DA 1N5ZA 1M30A 2ABLA 1PHTA 2JMAA 4Z89A 1PKTA 2SEMA 1OOTA 2BZXA 4Y92A 1SEMA 1CKBA 1AOJA 1SSHA 3PVLA 1JXOA 1Z9ZA 4CC3A 2M0YA 1Y0MA 4RTXA 2PTKA 1WIEA 4LUDA 3EG0A 1E7OA 2EKHA 1G2BA 2DBKA 4RTVA 3H0IA 4ZNXA 2DM1A 2LJ0A 2CUDA 1PWTA 1T3LA 4AG1C 1Z9QA 2KRMA 3REBB 3I5SA 2CREA 2KR3A 4JJDA 2F2WA 1RUWA 2EGEA 1JU5C 2M51A 2JS0A 2XMFA 1UTIA 2C0OA 2MCNA 2ENMA 1M3AA 2J7IA 2YUNA 5FW9A 2JW4A 2AZVA 1JQQA 2EBPA 2DYBA 1JEGA 3JV3A 1SRMA 1WA7A 2YSQA 2DL3A 2ED0A 1X6BA 4FSSA 2C0TA 4RTZA 4ESRA 2SRCA 1GCPA 4CC2A 1WYXA 2CSIA 1BB9A 2EYXA 3H0HA 3UATA 1AWWA 1BK2A 2CH4W 1ZX6A 3VS7A 4AFSC 1B3QA 3EGUA 3M0PA 4AFQC 1WXTA 1GL5A 5IXBA 4J9FA 1X6GA 2LP5A 1VYVA 1KSWA 2HDAA 2NUZA 2CT3A 2DL7A 5EC7A 3EHQA 4RUGA 3IQLA 1GBRA 3H41A 4OMOA 2O9VA 2GBQA 1PNJA 1K76A 2EW3A 2IIMA 2KRSA 2AKLA 2K9GA 2LZ6B 3QWXX 4RTTA 1NG2A 4GLMA 1QKXA 1X2QA 2CT4A 1CSKA 2JM8A 1ZBJA 2A08A 2GNCA 1NEGA 3NPFA 2HEQA 1VA7A 1JXMA 2HBWA 2LQNA 2DLPA 4EIKA 4M4ZA 2GTOA 2LX7A 2YT6A 3QWYA 2VWFA 4K11A 1UJ0A 1YWOA 4DEYA 3ULRB 1CKAA 1U3OA 5I22A 1W70A 4LN2A 1KJWA 2JXBA 2X3XD 1GRIA 2LJ1A 1YWPA 2KYMA 2J6OA 2RQRA 3RNJA 2FG0A 2EGAA 5I11A 1RLQC 4OMNA 2A36A 3PVQA 5GJVB 1UFFA 3NGPA 3VS6A 1AWOA 1AWJA 3VS5A 2ROTA 5IHKA 1QCFA 1HSQA 2RMOA 2G6FX 4D8DA 2AKKA 2X3WD 2O31A 4OMMA 3VRYA 1TUCA 2RQUA 1WX6A 2HCKA 3VRZA 2B86A 2EYWA 1H92A 2RQWA 2OJ2A 2L3QA 3M0UA 1OPLA 3C0CA 2KRNA 2DRMA 2KROA 1VYTA 2PNIA 5L23A 2YUPA 2RQTA 1H3HA 1W1FA 3ZL7C 2J6FA 2KGTA 4JPBW 4F17A 4HVWA 1X43A 2L2PA 2JM9A 5IHNA 4F14A 2EPDA 2J05A 1I07A 2DE0X 2FPDA 4ORZA 1YP5A 1JO8A 2DL4A 2BZ8A 1S1NA 2CDTA 2W10A 1RLPC 2EVRA 1GCQA 2PZ1A 3EG3A 4JJCA 4LE9A 4LUEA 1UECA 2W0ZA 2RNAA 2LJ3A 1M8MA 4JZ4A 1J3TA 3UF4A 4J9IA 4OMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA9 A;  1WDX A;  1MUZ A;  2H8H A;  4WCI A;  2KBT A;  4RTY A;  1MV3 A;  1ZUU A;  2QDL A;  2GQI A;  2DX1 A;  2FRY A;  4HVV A;  2KT1 A;  3LH5 A;  4E6R A;  1T3S A;  2VVK A;  3VS2 A;  1T0H A;  2DBM A;  5ECA A;  1ABO A;  3VS1 A;  1E6H A;  2V1Q A;  1WFW A;  3CQT A;  1AWX A;  1T0J A;  1ZUK A;  3REA B;  1QLY A;  2ECZ A;  1M27 C;  1A0N B;  1ABQ A;  1UHC A;  1TUD A;  2KE9 A;  3M0Q A;  1KFZ A;  4DEX A;  1QWE A;  1UJY A;  3NHN A;  1YCS B;  1UGV A;  2FO0 A;  1AZG B;  1RI9 A;  1TG0 A;  2JMC A;  2AK5 A;  2D1X A;  4J9E A;  1G83 A;  4LNP A;  3VS0 A;  2ESW A;  3A98 A;  1NM7 A;  4HVU A;  2DVJ A;  3PE0 A;  2BTT A;  2CSQ A;  4J9C A;  1SHF A;  1AZE A;  1KIK A;  2K2M A;  2DF6 A;  1ZSG A;  2D8J A;  3TVT A;  2RPN A;  1FMK A;  2O88 A;  1K4U S;  4GBQ A;  1OPK A;  1HD3 A;  1M3B A;  2EGC A;  4RTW A;  4J9H A;  1H8K A;  1SHG A;  1HJD A;  2FEI A;  4QT7 A;  1K0X A;  2P4R A;  5IXF A;  1QWF A;  2DL5 A;  4AFZ C;  1ARK A;  1Y57 A;  3VS4 A;  2DNU A;  4X1V A;  1B07 A;  1WLP B;  2KNB B;  1YN8 A;  3M0R A;  2KEA A;  1UG1 A;  4AG2 C;  3EG1 A;  1UHF A;  3FJ5 A;  2VKN A;  1E6G A;  1XOV A;  1AEY A;  3EG2 A;  1NLO C;  1K1Z A;  3H0F A;  4AFU C;  1UE9 A;  2FRW A;  2LNH B;  1OV3 A;  1VYU A;  2DMO A;  2KYB A;  2JT4 A;  1M3C A;  3UA6 A;  2CH4 A;  4JJB A;  1FYN A;  1QKW A;  4IIO A;  5HCK A;  2EQI A;  3I5R A;  2JS2 A;  2GGR A;  2K7A A;  2CUB A;  1WI7 A;  4CC4 B;  1EFN A;  2I0N A;  2DJQ A;  2J6K A;  2KXC A;  1K9A A;  1MV0 B;  4J9D A;  2E5K A;  1OEB A;  1W6X A;  2A37 A;  2RN8 A;  1UDL A;  1U06 A;  1YNZ A;  2RF0 A;  2BZY A;  5IHI A;  2LQW A;  3NMZ C;  2ROL A;  4Z8A A;  2HSP A;  2LCS A;  3U23 A;  2C0I A;  2ED1 A;  3R6N A;  4JZ3 A;  1K0S A;  1GFD A;  3SEM A;  1V1C A;  1GCQ C;  1X2K A;  2L3S A;  2FPF A;  2KXD A;  4F16 A;  4KRT A;  2RQV A;  2OI3 A;  4R0K A;  2AZS A;  1ZLM A;  2D8H A;  2OAW A;  3KFV A;  3M0T A;  2DL8 A;  1NEB A;  2YUQ A;  4J9B A;  1SRL A;  2O2O A;  1I0C A;  2D0N A;  3I35 A;  5FWB A;  5IH2 A;  3GBQ A;  4A63 B;  1BU1 A;  1AD5 A;  1AVZ C;  4OMP A;  2L3P A;  2EYZ A;  2JTE A;  3O5Z A;  1NLP C;  4HCK A;  2EYY A;  2F2V A;  2YDL A;  3EHR A;  3VS3 A;  2MIO A;  3THK A;  1NYF A;  2L0A A;  2FPE A;  2V1R A;  2A28 A;  2K79 A;  1GFC A;  1ZUY A;  4J9G A;  2MOX A;  1I1J A;  1X69 A;  3SHW A;  1UUE A;  2YUO A;  3M0S A;  4OMQ A;  2NWM A;  4IIM A;  1NYG A;  3UA7 A;  2LMJ A;  1WXU A;  4D8K A;  5GJW B;  1PRM C;  2J06 A;  1X27 A;  2DRK A;  1U5S A;  5FWC A;  1BBZ A;  2K3B A;  1GBQ A;  3I9Q A;  2GTJ A;  2DIL A;  2F2X A;  1LCK A;  2O9S A;  3TSW A;  3RBB B;  1PRL C;  1WXB A;  4Z88 A;  1PKS A;  1SPK A;  4HXJ A;  2KT8 A;  4CC7 A;  4RTU A;  3TSZ A;  1IO6 A;  2K6D A;  1N5Z A;  1M30 A;  2ABL A;  1PHT A;  2JMA A;  4Z89 A;  1PKT A;  2SEM A;  1OOT A;  2BZX A;  4Y92 A;  1SEM A;  1CKB A;  1AOJ A;  1SSH A;  3PVL A;  1JXO A;  1Z9Z A;  4CC3 A;  2M0Y A;  1Y0M A;  4RTX A;  2PTK A;  1WIE A;  4LUD A;  3EG0 A;  1E7O A;  2EKH A;  1G2B A;  2DBK A;  4RTV A;  3H0I A;  4ZNX A;  2DM1 A;  2LJ0 A;  2CUD A;  1PWT A;  1T3L A;  4AG1 C;  1Z9Q A;  2KRM A;  3REB B;  3I5S A;  2CRE A;  2KR3 A;  4JJD A;  2F2W A;  1RUW A;  2EGE A;  1JU5 C;  2M51 A;  2JS0 A;  2XMF A;  1UTI A;  2C0O A;  2MCN A;  2ENM A;  1M3A A;  2J7I A;  2YUN A;  5FW9 A;  2JW4 A;  2AZV A;  1JQQ A;  2EBP A;  2DYB A;  1JEG A;  3JV3 A;  1SRM A;  1WA7 A;  2YSQ A;  2DL3 A;  2ED0 A;  1X6B A;  4FSS A;  2C0T A;  4RTZ A;  4ESR A;  2SRC A;  1GCP A;  4CC2 A;  1WYX A;  2CSI A;  1BB9 A;  2EYX A;  3H0H A;  3UAT A;  1AWW A;  1BK2 A;  2CH4 W;  1ZX6 A;  3VS7 A;  4AFS C;  1B3Q A;  3EGU A;  3M0P A;  4AFQ C;  1WXT A;  1GL5 A;  5IXB A;  4J9F A;  1X6G A;  2LP5 A;  1VYV A;  1KSW A;  2HDA A;  2NUZ A;  2CT3 A;  2DL7 A;  5EC7 A;  3EHQ A;  4RUG A;  3IQL A;  1GBR A;  3H41 A;  4OMO A;  2O9V A;  2GBQ A;  1PNJ A;  1K76 A;  2EW3 A;  2IIM A;  2KRS A;  2AKL A;  2K9G A;  2LZ6 B;  3QWX X;  4RTT A;  1NG2 A;  4GLM A;  1QKX A;  1X2Q A;  2CT4 A;  1CSK A;  2JM8 A;  1ZBJ A;  2A08 A;  2GNC A;  1NEG A;  3NPF A;  2HEQ A;  1VA7 A;  1JXM A;  2HBW A;  2LQN A;  2DLP A;  4EIK A;  4M4Z A;  2GTO A;  2LX7 A;  2YT6 A;  3QWY A;  2VWF A;  4K11 A;  1UJ0 A;  1YWO A;  4DEY A;  3ULR B;  1CKA A;  1U3O A;  5I22 A;  1W70 A;  4LN2 A;  1KJW A;  2JXB A;  2X3X D;  1GRI A;  2LJ1 A;  1YWP A;  2KYM A;  2J6O A;  2RQR A;  3RNJ A;  2FG0 A;  2EGA A;  5I11 A;  1RLQ C;  4OMN A;  2A36 A;  3PVQ A;  5GJV B;  1UFF A;  3NGP A;  3VS6 A;  1AWO A;  1AWJ A;  3VS5 A;  2ROT A;  5IHK A;  1QCF A;  1HSQ A;  2RMO A;  2G6F X;  4D8D A;  2AKK A;  2X3W D;  2O31 A;  4OMM A;  3VRY A;  1TUC A;  2RQU A;  1WX6 A;  2HCK A;  3VRZ A;  2B86 A;  2EYW A;  1H92 A;  2RQW A;  2OJ2 A;  2L3Q A;  3M0U A;  1OPL A;  3C0C A;  2KRN A;  2DRM A;  2KRO A;  1VYT A;  2PNI A;  5L23 A;  2YUP A;  2RQT A;  1H3H A;  1W1F A;  3ZL7 C;  2J6F A;  2KGT A;  4JPB W;  4F17 A;  4HVW A;  1X43 A;  2L2P A;  2JM9 A;  5IHN A;  4F14 A;  2EPD A;  2J05 A;  1I07 A;  2DE0 X;  2FPD A;  4ORZ A;  1YP5 A;  1JO8 A;  2DL4 A;  2BZ8 A;  1S1N A;  2CDT A;  2W10 A;  1RLP C;  2EVR A;  1GCQ A;  2PZ1 A;  3EG3 A;  4JJC A;  4LE9 A;  4LUE A;  1UEC A;  2W0Z A;  2RNA A;  2LJ3 A;  1M8M A;  4JZ4 A;  1J3T A;  3UF4 A;  4J9I A;  4OML A; 
#chains in the Genus database with same CATH topology
 1C0M A;  2K5I A;  4RTY A;  5GAN 7;  2GQI A;  3MP6 A;  2PUK B;  3CMA A;  1QVG A;  1XJW B;  3ZFJ A;  4M7A G;  1BI0 A;  1VIF A;  5D6Y A;  1WQW A;  3VS2 A;  3CCE T;  1T0H A;  2YWW A;  1VQ8 A;  1RAI B;  1YHQ A;  3L2V A;  3MJX A;  4M77 A;  2E1H A;  1YIJ Q;  2V1Q A;  4N4I A;  3CQT A;  1AWX A;  3MHX A;  4FT2 A;  3REA B;  1IRE B;  3E19 A;  4N0A A;  1H64 1;  2ECZ A;  1QVG P;  2XG8 D;  1S72 Q;  1VQ8 T;  3JCM X;  1UHC A;  4OGC A;  1KFZ A;  4DEX A;  5LJ5 f;  1QWE A;  3OYK A;  3M9Q A;  1UJY A;  1AZG B;  2E6N A;  2LDM A;  1TG0 A;  2EJ9 A;  2JMC A;  2NLU A;  4Y28 E;  3DLL A;  1KC8 R;  2D6F A;  3VS0 A;  1NM7 A;  4KT0 E;  1XNI A;  2DVJ A;  2PVG B;  1KHI A;  3FJP A;  1XQH A;  2LC4 A;  3VUZ A;  2HNI A;  3BDL A;  2DEU A;  4GBQ A;  4O6J A;  1HD3 A;  4E7H A;  4RTW A;  1WNL A;  5D7U A;  4FT4 A;  4C8Q A;  1H8K A;  4R56 A;  4AT1 B;  1ZSZ C;  1K0X A;  5CAI A;  4AFZ C;  1NJI R;  2KSS A;  4M78 D;  2KNB B;  2KY9 A;  5GAN d;  4PJO E;  2E41 A;  2M9U A;  4AG2 C;  3EG1 A;  3FJ5 A;  1C1A A;  2RHI A;  1Q82 R;  2X35 A;  1E6G A;  2LVM A;  1K73 C;  1AEY A;  3EG2 A;  1Y7X A;  3JCM V;  1Q81 U;  3J7A F;  2EYQ A;  3TEE A;  4PJL A;  1OV3 A;  1YFN A;  2KYB A;  2JT4 A;  3CXC A;  3UA6 A;  3A8G B;  4FCY A;  1QKW A;  2G3R A;  3SWN A;  2EWN A;  5IN1 A;  2QEX Q;  3CXC S;  2JS2 A;  3CEY A;  2K3X A;  4C8Q D;  3CCS A;  4CC4 B;  1EFN A;  4BUG A;  2F5T X;  2Y4X A;  3CCS Q;  1ZSZ A;  2RN8 A;  1U06 A;  1YJ9 Q;  5GAN 3;  3NMZ C;  2EIF A;  2MWO A;  4M77 F;  5LJ3 g;  2EQK A;  4PJO C;  4C92 A;  2LX9 A;  3CCQ Q;  4XAX B;  3OB9 A;  1VQ5 Q;  2QQR A;  3RUX A;  3QJ6 A;  3OYL A;  4BE2 A;  1YIJ A;  2RI3 A;  2Z0W A;  2R58 A;  4C8Q G;  2L3S A;  2RQV A;  3VYH B;  4R0K A;  4C92 E;  1VQL T;  3RMQ A;  1YIJ T;  2D8H A;  2LRQ A;  3D7S B;  5FLX E;  4QVZ A;  2E6Z A;  5DLO A;  5CIU A;  1X6O A;  1I0C A;  4FYW B;  2COY A;  3EGX A;  3F70 A;  3M58 A;  3GBQ A;  1OX8 A;  3ME9 A;  2NYS A;  1LOJ A;  2PU9 B;  2JTE A;  4N4G A;  4M7A B;  1M4Z A;  2DD5 A;  2P0P A;  3M4Y A;  2F2V A;  1YIT T;  3DKM A;  1NYF A;  4KGZ B;  4BE0 A;  2L0A A;  4XU0 A;  1GFC A;  5GAO q;  1VQN Q;  3DLM A;  2CZ1 B;  1I1J A;  3V7S A;  1UUE A;  2E12 A;  4E7J A;  2ZPH B;  2DAQ A;  2NWM A;  4IIM A;  4A4K A;  4ZGE B;  4OB0 B;  4FW1 A;  3EG9 A;  2ZPF B;  4OB2 B;  2J06 A;  4M7D F;  1TXQ A;  2VV5 A;  1RAB B;  2JTM A;  2RO0 A;  3CD6 Q;  4AMC A;  1VQP A;  5J3B A;  3PGG A;  4IUQ A;  2BE7 D;  1NBE B;  1LCK A;  2O9S A;  4Z88 A;  4NL2 A;  3QDF A;  2EQJ A;  4RTU A;  3CCR Q;  3TSZ A;  4EMK C;  2M1H A;  3CD6 T;  1IO6 A;  1PHT A;  3LYI A;  4XU1 A;  5I21 A;  3E2U A;  2H3E B;  1AOJ A;  4BDZ A;  1JXO A;  2ZAE A;  4XTZ A;  4RTX A;  2KVQ G;  2DJZ A;  2FHD A;  1WIE A;  4LUD A;  2F69 A;  3M54 A;  4IUV A;  3G4S Q;  3H0I A;  5L8R E;  3QBY A;  4X34 A;  1PWT A;  1T3L A;  1Q81 C;  3LGL A;  1M2O A;  3JCM e;  4JJD A;  2F2W A;  1JU5 C;  2RI5 A;  2XIC A;  5CQY A;  1I5O B;  1UTI A;  2C0O A;  2ENM A;  2FVU A;  1Y96 B;  2L89 A;  2E65 A;  4BY6 B;  1JQQ A;  1WJR A;  1JEG A;  1QVF A;  3JB9 I;  2CP2 A;  5FU7 B;  3GNF B;  4JDS A;  4ELZ C;  1D3B A;  5CKF A;  2DKG A;  4X9D A;  2DL3 A;  4M75 A;  4C5H A;  4M7A A;  5D6W A;  5KYX A;  4C0F A;  4CC2 A;  1WYX A;  3HTR A;  5A2Q E;  3N5B B;  1D1B A;  2L8D A;  4KUL A;  2EYX A;  3H0H A;  2F5K A;  3CCV T;  2CH4 W;  4AFS C;  2QA4 A;  2L3R A;  2LTO A;  1PCX A;  1WXT A;  4J9F A;  1MHN A;  3A8O B;  4FYY B;  4R55 A;  3O8V A;  4EMK B;  2NUZ A;  5HKC A;  2CT3 A;  2RJD A;  4BDY A;  4RUG A;  2OAU A;  4OMO A;  2M16 A;  7AT1 B;  1PNJ A;  3FIF A;  2LZ6 B;  3QWX X;  1I81 A;  4OVA A;  1NG2 A;  2CT4 A;  2A08 A;  1NEG A;  1YIT A;  1RL2 A;  4B6M A;  3M5A A;  3LX7 A;  5CR2 A;  2OTJ T;  2FZG B;  2O01 E;  2FYK A;  3WVD B;  3OY9 A;  1IHW A;  2KK4 A;  4QW2 A;  1KK7 A;  3X24 B;  1VOM A;  4DEY A;  3CC4 A;  3OW2 S;  3VU3 C;  4M7A C;  4B9X A;  4LN2 A;  1TS9 A;  4A53 A;  2JXB A;  1GRI A;  2NUP B;  5DM7 R;  3PT9 A;  1IZ6 A;  2FG0 A;  3MPU B;  1FMV A;  4XU3 A;  2ZZD A;  2WSE E;  3RIR A;  3PVQ A;  2GF7 A;  1G5V A;  1UFF A;  3RKW A;  1R8O B;  3ASK A;  1Q95 G;  3SWN C;  3CC4 Q;  3VS5 A;  4F7U F;  5IHK A;  1QCF A;  2VUB A;  1UEB A;  5GAM e;  2X3W D;  4GY5 A;  2GFU A;  5LL6 S;  2C06 A;  4OMM A;  2CP0 A;  4E7K A;  1VQK A;  3LW5 E;  3WVE B;  4XTY A;  4NS5 A;  1OPL A;  2P4T A;  3OMC A;  4C92 B;  2KRN A;  2KRO A;  1IGQ A;  4C0D B;  2A7Y A;  5KYU A;  4B9W A;  1VYT A;  2PNI A;  3L2U A;  3CCE A;  4LDX A;  1VQ6 A;  3V8L A;  4F17 A;  4HVW A;  5GAO m;  3QYG B;  2FPD A;  2BZ8 A;  3CPW S;  3EFO B;  4M7D B;  2PZ1 A;  3ZBD A;  3QJY A;  2RNA A;  2KAF A;  3FB9 A;  1VIE A;  1M8M A;  2VXF A;  3UF4 A;  4A4H A;  2LT1 A;  2OTJ Q;  4M78 E;  5GMK l;  3EFR A;  1YBY A;  4BI8 B;  4II1 A;  1WDX A;  1MGQ A;  4BI3 A;  4C0D C;  1YJ9 A;  4M7A E;  2PUO B;  1ZUU A;  2CKK A;  1Q82 U;  4F7U E;  4PJO G;  3LH5 A;  1QP2 A;  1T3S A;  2VVK A;  3URG A;  1ZA2 B;  2DBM A;  5ECA A;  4ATO A;  3JRZ A;  1M1K R;  4ZGJ B;  2BIV A;  3E9G A;  8ATC B;  1WFW A;  2JUF A;  3G6E T;  2M0O A;  3LLR A;  1ZUK A;  1QLY A;  4DOW A;  3R6O A;  1M27 C;  1ABQ A;  2V8I A;  3OYY A;  2RM4 A;  5I2S A;  1Q7Y R;  2V8J A;  4HCB A;  3OYB A;  3LH0 A;  2X51 A;  1RI9 A;  4Y91 A;  2CZ0 B;  2AK5 A;  2D1X A;  3SB2 A;  4HVU A;  3ER0 A;  2CP6 A;  1V29 B;  2CSQ A;  1PD1 A;  1X75 C;  3OW2 P;  2K4Y A;  5CO7 A;  2A0F B;  3JCM c;  4D6W A;  3SWN B;  2VYT A;  2WAC A;  3OYJ A;  1PSF A;  4XQ3 A;  3CCQ T;  5HK3 A;  1RAA B;  4JLI A;  2FEI A;  1VQ7 T;  4M75 D;  4A4G A;  4M7A D;  3RR6 A;  1W2B S;  1OZ2 A;  2ZGW A;  1Y57 A;  1SSF A;  5GAN 2;  1B07 A;  1BYM A;  1WLP B;  1YN8 A;  2KEA A;  3RES A;  3A8M B;  1UG1 A;  3C94 A;  3MP1 A;  3CCQ A;  1PSE A;  3QYH B;  5GAO p;  3OYC A;  3SD4 A;  3H0F A;  3ZEH A;  3EH2 A;  4BE1 A;  3CCL A;  2P0Q A;  4JJN K;  2DMO A;  2MAM A;  5GAN j;  2CH4 A;  4PJO F;  4PJO B;  2ATC B;  2QQS A;  3AHU A;  2KDS A;  5HCK A;  1YHQ Q;  4WF2 A;  4M77 D;  3C4S A;  3P8B B;  2RB6 A;  4MZM A;  2EQI A;  3I5R A;  4EPC A;  3CCU T;  4M78 C;  2EFI A;  2QQA A;  4BI4 A;  1WI7 A;  4MZP A;  2KXC A;  3L2R A;  1MV0 B;  2E5K A;  1OEB A;  1W6X A;  3M56 A;  4E7S A;  1RAF B;  4M7D G;  4RG8 A;  1YNZ A;  2RF0 A;  5GAN 4;  2LQW A;  2QG9 B;  1RI0 A;  2ROL A;  5KYN A;  1RAH B;  2HQE A;  3U23 A;  5KYU B;  5GAN e;  1K0S A;  4QQG A;  5KCO A;  1KQS P;  4C92 G;  1OQK A;  2BUD A;  1X2K A;  2FPF A;  2KXD A;  4JRI A;  3JB9 H;  1MMN A;  2RD1 A;  5FU6 C;  2HSE B;  5GAM f;  1TU0 B;  3AT1 B;  1MMA A;  3M0T A;  2YUQ A;  3MCA B;  4OMF B;  3CC2 T;  4M78 A;  4TVR A;  3L1A A;  2YXY A;  2D0N A;  5GAN h;  1NZ9 A;  4PK4 A;  5IH2 A;  1SG5 A;  4E7Z A;  4A63 B;  1AD5 A;  1FMW A;  2L3P A;  2EYZ A;  5LJ3 h;  3OYI A;  2PQW A;  3CC2 A;  1YI2 Q;  1BIA A;  3SDZ A;  3OSS C;  1G3S A;  2OTJ A;  2MIO A;  1IB8 A;  1D1A A;  1LVK A;  2FPE A;  5GAN 6;  3LWH A;  2A28 A;  1EZZ B;  1B7T A;  4J9G A;  3PFS A;  1PG5 B;  4OMQ A;  3BE3 A;  3BW1 A;  1PRM C;  2YLB A;  4EDU A;  1VQ6 Q;  1X27 A;  1UB4 A;  2DRK A;  2JOY A;  3CCL T;  4QQD A;  2DIL A;  4M75 E;  1VQO T;  3E9F A;  1QW1 A;  1B34 A;  4JRP A;  3TSW A;  1WXB A;  3EGD B;  1YJN A;  4BD3 A;  1U1T A;  1MND A;  4HXJ A;  1VQ9 A;  2VGM A;  2HMA A;  1V76 A;  4LDV A;  3TCJ A;  3MKD A;  5KE3 A;  4Z89 A;  1OOT A;  5KYW A;  1SEM A;  1CKB A;  2QAZ A;  3S3O A;  4CC3 A;  1NPP A;  1VQM A;  1G3T A;  1UGQ B;  2EKH A;  1AHJ B;  3I56 A;  2M02 A;  3S6W A;  1Z9Q A;  2KRM A;  4M77 C;  1QVG S;  1BKB A;  2HQH A;  3I5S A;  1KD1 U;  3C12 A;  1R77 A;  1RUW A;  5HK0 A;  3H9N A;  4LXC A;  2JS0 A;  1Q86 C;  2NUT B;  1YIT Q;  1M8V A;  2CP7 A;  1M3A A;  1YJ9 T;  5FW9 A;  2JW4 A;  1M90 R;  3JV3 A;  4DA4 A;  1JJ2 A;  3EH1 A;  4BB7 A;  1KQS S;  2VGN A;  3BFM A;  3TU4 K;  5C6S A;  1X6B A;  1NE8 A;  2C0T A;  4RTZ A;  2JN0 A;  1GCP A;  2COW A;  4FM4 B;  1BCM A;  3KBG A;  5LJ3 f;  3JCM P;  2CSI A;  3CC4 T;  4WTO B;  3UAT A;  5GAM h;  2EJG A;  4C8Q C;  2OTL A;  1ZX6 A;  3VS7 A;  1VQ5 A;  3EGU A;  4AFQ C;  1H3Z A;  1GL5 A;  2A3L A;  2LP5 A;  1KSW A;  5KYY A;  1YJN Q;  3KXT A;  2DL7 A;  1F1B B;  3EHQ A;  5A0D A;  2DXT A;  4N0A C;  2EW3 A;  1K76 A;  4C5E A;  2KRS A;  1M9S A;  2K9G A;  3QPH A;  1M5Q 1;  2QI2 A;  4GLM A;  1X2Q A;  3CCU Q;  3HRS A;  2GFA A;  2DZC A;  2HD0 A;  3QII A;  2CP3 A;  3EAE A;  5HY6 A;  4RCB A;  1ZBX A;  3QKJ A;  3JCM g;  1I8F A;  1UJ0 A;  1YWO A;  3ULR B;  3OYH A;  4KH0 B;  1IRX A;  1W70 A;  3OS1 A;  2MYS A;  1YWP A;  1OI1 A;  3G71 Q;  2J6O A;  3RNJ A;  3EG9 B;  1RLQ C;  4OMN A;  2A36 A;  1D1C A;  5GMK h;  1K8A C;  1VQM T;  2BKD N;  3NGP A;  1IXD A;  4E7I A;  3A8H B;  2AHJ B;  4EMG A;  2ROT A;  4A54 A;  1VQ9 T;  3OBY A;  2RHX A;  2G6F X;  1VQL A;  4C92 C;  3NTH A;  2DZ9 A;  3I55 A;  2O31 A;  4M77 E;  2XU8 A;  2QEX T;  3VRY A;  3UT1 A;  4QQ6 A;  4KH1 B;  2CZ7 B;  1H92 A;  2RQW A;  4C8Q B;  3M0U A;  3C0C A;  1XTD A;  5IAY A;  1H3H A;  1W1F A;  2J6F A;  2VAS A;  4JPB W;  4PLL A;  2ZPG B;  1HXD A;  2L2P A;  1D0Z A;  5J26 A;  4C5G A;  1I07 A;  4IKF A;  2DL4 A;  4M78 G;  3PIP A;  2CDT A;  1RLP C;  4LE9 A;  2RK2 A;  4LUE A;  1QVF S;  4JZ4 A;  2DD4 A;  1WZO A;  4J9I A;  4OML A;  4ELY C;  1KQ2 A;  1U1S A;  4M78 B;  1VQK Q;  1MUZ A;  2OTL T;  2H8H A;  2RJE A;  4PJO A;  1KQS A;  4WCI A;  3HFO A;  2KBT A;  4N4H A;  2QDL A;  2QGF B;  1N8R C;  4HVV A;  5GAM d;  3BY7 A;  2KT1 A;  2R57 A;  2XHC A;  3HKS A;  4E6R A;  1ACM B;  3WXM B;  1Y07 A;  1BIB A;  1D0X A;  2CS7 A;  1OYX A;  3OYA A;  5GMK m;  3VS1 A;  4C8Q F;  2QTV A;  1M90 U;  1E6H A;  4L6V 5;  2K2V A;  1YI2 T;  1WHG A;  3M0Q A;  1TUD A;  1WHH A;  2QXF A;  4PLI A;  1TOV A;  1MNE A;  1ZA1 B;  2E3H A;  1SF9 A;  3NHN A;  1YCS B;  2E64 A;  2FO0 A;  4OB3 B;  3HSB A;  1G83 A;  2ESW A;  3A98 A;  5GAN f;  4J9C A;  1SHF A;  1AZE A;  1QCN A;  1KIK A;  2ZCF B;  2D8J A;  3G7Z A;  4M78 F;  3TVT A;  2RPN A;  3CME Q;  3INZ A;  3I55 Q;  2O88 A;  5KYY B;  1K4U S;  4DBQ A;  3MP8 A;  1M3B A;  4J8O A;  1Q86 U;  2EGC A;  3CCS T;  1VQO Q;  3GOX A;  4J9H A;  1VQ4 T;  1C6V X;  1SHG A;  1HJD A;  4QT7 A;  1VQK T;  2RK1 A;  2QA4 Q;  5EG2 A;  5IXF A;  1QWF A;  2DL5 A;  1ARK A;  2VXE A;  4X1V A;  1QMC A;  3FRN A;  2E10 A;  3OYD A;  3EFS A;  4YTL A;  5LJ5 h;  1N9R A;  2V26 A;  2RH2 A;  5LJ5 j;  1XOV A;  2XKO C;  1W2B P;  1UE9 A;  2D0Q B;  2LNH B;  4J83 A;  5M9O A;  4PFP A;  4EMK A;  1M3C A;  4JJB A;  2WSF E;  1FYN A;  4J6W A;  2HZY A;  4LDU A;  4M75 C;  2JTF A;  1QVP A;  2XI9 A;  4IIO A;  4F7U B;  3QZ5 B;  1JB0 E;  1K8A R;  3CME A;  3I56 T;  1VUB A;  2K7A A;  4HCZ A;  2DJQ A;  4IUT A;  5LJ5 g;  3FEO A;  2A37 A;  3MEA A;  1M2V A;  1UDL A;  2BZY A;  5IHI A;  3CME T;  2RHZ A;  2H3J A;  2L5Q A;  2HSP A;  3EFO A;  4M7D A;  5KYW B;  4NOY A;  1Q86 R;  1BI1 A;  2NUP A;  3SEM A;  1VQ7 Q;  5GAN g;  3DB4 A;  5KH6 A;  4HCC A;  3M4G A;  2OI3 A;  2DIQ A;  1VQ5 T;  1RAD B;  2DL8 A;  1NEB A;  4FYV B;  4PFO A;  2FZC B;  2O2O A;  1TUG B;  4LD6 A;  5GMK j;  2YRD A;  1VQO A;  4ZTJ A;  4ZTF A;  2FB7 A;  1WHM A;  1N8R U;  1YJN T;  4MMK A;  3EGD A;  3CPW P;  1DJ7 B;  5FRO A;  4QVC A;  1TH7 A;  3O5Z A;  2O4X A;  1NLP C;  1VQ7 A;  2HBP A;  1VQN A;  2YDL A;  3EHR A;  4M7D D;  1VQ6 T;  3CCJ A;  3CC7 A;  3M59 A;  2X4X A;  3OS0 A;  1EIF A;  2CZ6 B;  4V2S A;  2LT4 A;  2MOX A;  3RKX A;  3X20 B;  1TWB A;  1VQN T;  4L59 A;  4M75 G;  1W4S A;  2MMP A;  3UA7 A;  4J6X A;  5LJ3 e;  4PJO D;  1WXU A;  4D8K A;  5GJW B;  4KGV B;  3S3N A;  4J7I A;  1GBQ A;  2DO3 A;  4E2F B;  2GTJ A;  1W2B A;  3FDR A;  5D6X A;  1VQL Q;  1O75 A;  2F2X A;  2RJF A;  4JLG A;  3CCM A;  4BAC A;  1K9M R;  2DK3 A;  3QHS A;  4UC4 A;  2X9H A;  1SPK A;  3HP9 A;  2E70 A;  3JB9 F;  2EQM A;  2KT8 A;  4JRQ A;  3OBW A;  2K6D A;  4FSX A;  2P0K A;  4CI0 C;  2DXB A;  2SEM A;  2BZX A;  4Y92 A;  9ATC B;  1SSH A;  3PVL A;  2EJF A;  3G6E Q;  2YHT A;  2CGH A;  5LJ3 j;  1Z9Z A;  2E3I A;  2M0Y A;  1Y0M A;  2FZK B;  1BI3 A;  3PMI A;  2PTK A;  5FU7 C;  3EG0 A;  4FL6 A;  4E47 A;  4PFZ A;  2DYI A;  2DBK A;  4RTV A;  3CCV A;  2DM1 A;  4PL6 A;  3HFN A;  1YJW A;  2CUD A;  1X01 A;  4F7U G;  3CBM A;  2P84 A;  2XK0 A;  2K5F A;  2K5L A;  4L5G A;  2RA2 A;  3NTI A;  3REB B;  2DVE A;  4DQ2 A;  1VQP T;  3JAM E;  2CRE A;  2D9T A;  2XDB A;  2EGE A;  2RHU A;  4OB1 B;  3GP8 A;  1BCO A;  1M1G A;  2XMF A;  3OYN A;  3E1S A;  3HRU A;  1YJW T;  2HKN A;  2J7I A;  3Q1J A;  2QYZ A;  1UGR B;  2AZV A;  3G1J A;  4ZGD B;  1WA7 A;  4DOV A;  3OS5 A;  2ED0 A;  4FSS A;  4PJM A;  1K73 R;  1LNX A;  2SRC A;  2DPP B;  4M75 F;  3X25 B;  2F1L A;  3V7C A;  4ZN3 A;  1AT1 B;  1BB9 A;  1O9S A;  2ZPB B;  3MEU A;  3CCJ T;  3CC7 T;  3M53 A;  1B3Q A;  3M0P A;  4JS4 A;  2QK0 A;  2CP5 A;  5IXB A;  5J39 A;  1X6G A;  3H8Z A;  4E7L A;  4BY6 C;  3QZ9 B;  4DBF A;  4A4E A;  1VYV A;  1ZHI A;  5GAO r;  1WQ7 A;  3CC2 Q;  5EC7 A;  2GBQ A;  2IIM A;  2AKL A;  4RTT A;  2HL3 A;  3QUI A;  3G4S T;  5C0M A;  2JM8 A;  5GAN 8;  1G8X A;  2LNV A;  3I55 T;  1IHV A;  4RKU E;  2HEQ A;  3NPF A;  1JXM A;  2HBW A;  3CBP A;  2VB6 A;  2LQK A;  1WJS A;  2OX7 A;  2DLP A;  2GTO A;  2LX7 A;  2DIG A;  2YT6 A;  3QWY A;  4C92 D;  5FRN A;  1G3Y A;  1UGP B;  2X4J A;  1D0Y A;  2X3X D;  5KCH A;  1KG1 A;  2RQR A;  3VV0 A;  3CPF A;  4XTW A;  2EKO A;  5I11 A;  3M55 A;  4PNO A;  5LJ3 d;  2HL5 C;  3CCM T;  1D09 B;  5GJV B;  1FX7 A;  3VS6 A;  1AWJ A;  3CCE Q;  1OU9 A;  1B34 B;  5GAO n;  3CMA Q;  2RMO A;  5AYF A;  1Q7Y C;  4DBR A;  3C95 A;  3PIO A;  5A0G A;  3QDR B;  3EGX B;  1TUC A;  1WX6 A;  2HCK A;  2FL7 A;  3VRZ A;  1MMD A;  2B86 A;  2EYW A;  2X4Y A;  2ZPI B;  2OJ2 A;  3OYG A;  3CCV Q;  3L2Q A;  3JCM J;  1FXX A;  3GPL A;  1M1K C;  2RQT A;  2MK5 A;  2DER A;  2IG0 A;  3I56 Q;  3LWI A;  3G6E A;  1HYO A;  3BDU A;  1X43 A;  4F14 A;  5GMK i;  2DXU A;  5CKB A;  3RER A;  2DE0 X;  2LCL A;  2XID A;  1JO8 A;  3T9N A;  3LGF A;  3L2Z A;  1K8A U;  4XU2 A;  1S1N A;  3OMG A;  1UEC A;  3VKI A;  1N9S A;  2W0Z A;  2YRV A;  4Z02 A;  4IUU A;  3L42 A;  1J3T A;  5CCA A;  2DA9 A;  4XTV A;  3JSC A;  1R0B G;  3P8D A;  2YRC A;  1Q7Y U;  1VQ9 Q;  1MV3 A;  4JUV A;  2DX1 A;  2JZ2 A;  4KGX B;  3JCM b;  2FRY A;  3OW2 A;  3V7R A;  3FC3 A;  1ABO A;  1NPR A;  3G4S A;  2OTL Q;  4EMH A;  2Y4Y A;  3QG1 A;  4C92 F;  3S3M A;  4KUD K;  1R0C B;  1T0J A;  2K3Y A;  3DB3 A;  1K9M U;  2KMT A;  3CCJ Q;  1A0N B;  2KE9 A;  2AIR B;  3MEV A;  2COZ A;  3A5Z B;  3VUB A;  2MF2 A;  2QDY B;  3CCR A;  1BI2 A;  1UGV A;  1SKU B;  3UWN A;  3CBO A;  4J9E A;  4LNP A;  3OS2 A;  3JCM Q;  3PE0 A;  2BTT A;  2K57 A;  2K2M A;  2DF6 A;  1KHC A;  1ZSG A;  2RI2 A;  2ZPE B;  3UPU A;  1FMK A;  1OPK A;  1FWZ A;  2XDP A;  2NUT A;  3KUF A;  3HRT A;  1D3B B;  2P4R A;  4CRI A;  5AT1 B;  3NTK A;  3VS4 A;  2DNU A;  1N8R R;  3JCM d;  4RCC A;  1VQM Q;  1M2V B;  3M0R A;  4M7A F;  1UHF A;  2VKN A;  1OU8 A;  1NLO C;  1K1Z A;  2KI7 A;  4LDW A;  4AFU C;  2QA4 T;  2FRW A;  3X28 B;  1VYU A;  2MI6 A;  2MWP A;  5LJ5 d;  3CC7 Q;  2IVW A;  3TQ7 P;  5FRM A;  1Y71 A;  4XTU A;  2HAX A;  4PJN A;  2XD0 A;  4C5I A;  4HT9 A;  4JRK A;  2JNG A;  3J81 E;  4KUI A;  4F7U A;  3P8H A;  1N6A A;  2GGR A;  2CUB A;  3RKY A;  2I0N A;  2J6K A;  3QXE B;  1K9A A;  4J9D A;  5KE2 A;  2DXC A;  1K73 U;  2RJC A;  5CKD A;  1KD1 C;  4OF1 A;  4FIB A;  5LJ5 e;  5CVI A;  2QQ9 A;  1LJO A;  4Z8A A;  2LCS A;  2C0I A;  2ED1 A;  2LCC A;  4JZ3 A;  3R6N A;  3QO3 A;  1GFD A;  2E5Q A;  1YI2 A;  4KBM B;  3FLG A;  1V1C A;  2IPO B;  1GCQ C;  4HT8 A;  2BE9 B;  2EQU A;  2KQW A;  4F16 A;  4KRT A;  1KQ1 A;  1N27 A;  2AZS A;  3CPW A;  1G3W A;  4C8Q E;  1ZLM A;  2OAW A;  3KFV A;  2PVD B;  3SFM A;  3H6Z A;  4J9B A;  1SRL A;  3MO8 A;  4XK8 E;  3I35 A;  2R5A A;  5FWB A;  1WJQ A;  5IT9 E;  1QP3 A;  2EAY A;  1JRI A;  2WSC E;  3PNW C;  1BU1 A;  1AVZ C;  4OMP A;  1UGS B;  2HQX A;  4J6Y A;  2XDD A;  4FU6 A;  4IUP A;  4HCK A;  2DTI A;  4MDX A;  2EYY A;  3VS3 A;  1WGS A;  1S72 T;  3THK A;  1YJW Q;  4O5V A;  2V1R A;  1IGU A;  2K79 A;  2QGG A;  1ZUY A;  1QCO A;  2Y90 A;  2QTX A;  1X69 A;  1YCY A;  2YUO A;  3SHW A;  3M0S A;  1QQJ A;  4PKC C;  4M77 G;  1NJI C;  2LQ8 A;  1NYG A;  5GAM j;  2LMJ A;  4X9C A;  1I4K 1;  2X4W A;  5FWC A;  1U5S A;  1WHK A;  1BBZ A;  2K3B A;  3A8L B;  5CKH A;  3V8J A;  3I9Q A;  8AT1 B;  1GXI E;  1Y96 A;  3RDV A;  1Q81 R;  1HK9 A;  2QQB A;  3RBB B;  4NL3 A;  1PRL C;  3GNG A;  3OYE A;  4JS5 A;  1PKS A;  1U8R A;  2PVO B;  3CCM Q;  1RAG B;  1M90 C;  3HL8 A;  3HPW A;  3A1P A;  1KC8 C;  3VYG A;  4CC7 A;  1ZSZ B;  1P92 A;  3GF5 A;  1N5Z A;  1M30 A;  2ABL A;  4HA8 A;  2JMA A;  2YLC A;  1PKT A;  4Q5W A;  4IUR A;  1TSF A;  4OP0 A;  3PMT A;  3HHT B;  4QKU A;  1JBM A;  1E7O A;  3J80 E;  1G2B A;  2RHY A;  4ZNX A;  1KD1 R;  4C0Z A;  2LJ0 A;  2I2L A;  5CQX A;  3L2W A;  4AG1 C;  3MET A;  5DY9 A;  3OA6 A;  1OZ3 A;  3NFC A;  2KR3 A;  3PTA A;  3OQ5 A;  2M51 A;  1PD0 A;  6AT1 B;  2MCN A;  2B8A A;  2YUN A;  2GQV A;  3JB9 J;  1VQ4 A;  2EBP A;  2DYB A;  3GLX A;  4RG2 A;  1SRM A;  1VQP Q;  2YSQ A;  4ESR A;  3G71 A;  2GCX A;  5DLQ E;  4M77 B;  4J5Y A;  4PJJ A;  3CCL Q;  4OGE A;  3TRE A;  4M7D E;  4J7F A;  2DFU A;  1AWW A;  1BK2 A;  1S72 A;  1I5L A;  2CYZ B;  1MMG A;  3OSV A;  3CMA T;  2HDA A;  3CXC P;  3V8K A;  1LPL A;  2DTH A;  3IQL A;  3CCU A;  3CCR T;  4FYX B;  5GAO l;  1GBR A;  3H41 A;  2O9V A;  1VQ8 Q;  1YHQ T;  1QKX A;  2AT1 B;  1CSK A;  1Q82 C;  1ZBJ A;  4RMO A;  2QEX A;  2GNC A;  3JB9 D;  1VA7 A;  4ZN1 A;  2O4X B;  4M75 B;  1EX4 A;  3M57 A;  1WHL A;  2LQN A;  3MEW A;  2QAS A;  4EIK A;  4GLK A;  4M4Z A;  4C0G A;  1M1K U;  1JJ2 P;  5A0L A;  2VWF A;  4K11 A;  4MML A;  1CKA A;  4P5N A;  1U3O A;  5I22 A;  3QSU A;  1KJW A;  1JJ2 S;  2DET A;  2LJ1 A;  2KYM A;  3JCM f;  2EGA A;  4VUB A;  1WPY A;  4LD9 K;  3OYF A;  4XTX A;  1WHJ A;  2V8K A;  2DEQ A;  2VC8 A;  1M1F A;  1AWO A;  1PC0 A;  5GAM g;  5GAN 5;  3JB9 G;  2MPX C;  1RAE B;  1HSQ A;  1PM3 A;  1ZQ1 A;  4F04 B;  3OYM A;  4ANJ A;  4D8D A;  2AKK A;  3RMS A;  4M7D C;  1TTH B;  2RQU A;  3CD6 A;  3VJP A;  4HKE A;  1K9M C;  5CKE A;  3UDC A;  2E4H A;  2DTO A;  2L3Q A;  4MZT A;  1NJI U;  2DRM A;  2HKQ B;  5KYX B;  5I2M A;  5CK9 A;  5L23 A;  2YUP A;  3ZL7 C;  2KGT A;  4MDW A;  3JCM h;  5FU6 B;  1RAC B;  2JVV A;  2JM9 A;  5IHN A;  4ME7 A;  3X26 B;  2EPD A;  1OUL A;  2J05 A;  4QVD A;  3JCM W;  1QVF P;  4ORZ A;  2JJ9 A;  1YP5 A;  4LDY A;  4DBH A;  3G71 T;  2W10 A;  4A4F A;  2EVR A;  1GCQ A;  4JJC A;  3EG3 A;  2LJ3 A;  1VQ4 Q;  1OX9 A;  2R5M A;  3GIB A;  1KC8 U;  4FW2 A;  5GMK e; 
#chains in the Genus database with same CATH homology
 2DA9 A;  1WDX A;  1MUZ A;  2H8H A;  4WCI A;  2KBT A;  4RTY A;  1MV3 A;  1ZUU A;  2QDL A;  2GQI A;  2DX1 A;  2FRY A;  4HVV A;  2KT1 A;  3LH5 A;  4E6R A;  1T3S A;  2VVK A;  3VS2 A;  1T0H A;  2DBM A;  5ECA A;  1ABO A;  3VS1 A;  1E6H A;  2V1Q A;  1WFW A;  3CQT A;  1AWX A;  1T0J A;  1ZUK A;  3REA B;  1QLY A;  2ECZ A;  1M27 C;  1A0N B;  1ABQ A;  1UHC A;  1TUD A;  2KE9 A;  3M0Q A;  1KFZ A;  4DEX A;  1QWE A;  1UJY A;  3NHN A;  1YCS B;  1UGV A;  2FO0 A;  1AZG B;  1RI9 A;  1TG0 A;  2JMC A;  2AK5 A;  2D1X A;  4J9E A;  1G83 A;  4LNP A;  3VS0 A;  2ESW A;  3A98 A;  1NM7 A;  4HVU A;  2DVJ A;  3PE0 A;  2BTT A;  2CSQ A;  4J9C A;  1SHF A;  1AZE A;  1KIK A;  2K2M A;  2DF6 A;  1ZSG A;  2D8J A;  3TVT A;  2RPN A;  1FMK A;  2O88 A;  1K4U S;  4GBQ A;  1OPK A;  1HD3 A;  1M3B A;  2EGC A;  4RTW A;  4J9H A;  1H8K A;  1SHG A;  1HJD A;  2FEI A;  4QT7 A;  1K0X A;  2P4R A;  5IXF A;  1QWF A;  2DL5 A;  4AFZ C;  1ARK A;  1Y57 A;  3VS4 A;  2DNU A;  4X1V A;  1B07 A;  1WLP B;  2KNB B;  1YN8 A;  3M0R A;  2KEA A;  1UG1 A;  4AG2 C;  3EG1 A;  1UHF A;  3FJ5 A;  2VKN A;  1E6G A;  1XOV A;  1AEY A;  3EG2 A;  1NLO C;  1K1Z A;  3H0F A;  4AFU C;  1UE9 A;  2FRW A;  2LNH B;  1OV3 A;  1VYU A;  2DMO A;  2KYB A;  2JT4 A;  1M3C A;  3UA6 A;  2CH4 A;  4JJB A;  1FYN A;  1QKW A;  4IIO A;  5HCK A;  2EQI A;  3I5R A;  2JS2 A;  2GGR A;  2K7A A;  2CUB A;  1WI7 A;  4CC4 B;  1EFN A;  2I0N A;  2DJQ A;  2J6K A;  2KXC A;  1K9A A;  1MV0 B;  4J9D A;  2E5K A;  1OEB A;  1W6X A;  2A37 A;  2RN8 A;  1UDL A;  1U06 A;  1YNZ A;  2RF0 A;  2BZY A;  5IHI A;  2LQW A;  3NMZ C;  2ROL A;  4Z8A A;  2HSP A;  2LCS A;  3U23 A;  2C0I A;  2ED1 A;  3R6N A;  4JZ3 A;  1K0S A;  1GFD A;  3SEM A;  1V1C A;  1GCQ C;  1X2K A;  2L3S A;  2FPF A;  2KXD A;  4F16 A;  4KRT A;  2RQV A;  2OI3 A;  4R0K A;  2AZS A;  1ZLM A;  2D8H A;  2OAW A;  3KFV A;  3M0T A;  2DL8 A;  1NEB A;  2YUQ A;  4J9B A;  1SRL A;  2O2O A;  1I0C A;  2D0N A;  3I35 A;  5FWB A;  5IH2 A;  3GBQ A;  4A63 B;  1BU1 A;  1AD5 A;  1AVZ C;  4OMP A;  2L3P A;  2EYZ A;  2JTE A;  3O5Z A;  1NLP C;  4HCK A;  2EYY A;  2F2V A;  2YDL A;  3EHR A;  3VS3 A;  2MIO A;  3THK A;  1NYF A;  2L0A A;  2FPE A;  2V1R A;  2A28 A;  2K79 A;  1GFC A;  1ZUY A;  4J9G A;  2MOX A;  1I1J A;  1X69 A;  3SHW A;  1UUE A;  2YUO A;  3M0S A;  4OMQ A;  2NWM A;  4IIM A;  1NYG A;  3UA7 A;  2LMJ A;  1WXU A;  4D8K A;  5GJW B;  1PRM C;  2J06 A;  1X27 A;  2DRK A;  1U5S A;  5FWC A;  1BBZ A;  2K3B A;  1GBQ A;  3I9Q A;  2GTJ A;  2DIL A;  2F2X A;  1LCK A;  2O9S A;  3TSW A;  3RBB B;  1PRL C;  1WXB A;  4Z88 A;  1PKS A;  1SPK A;  4HXJ A;  2KT8 A;  4CC7 A;  4RTU A;  3TSZ A;  1IO6 A;  2K6D A;  1N5Z A;  1M30 A;  2ABL A;  1PHT A;  2JMA A;  4Z89 A;  1PKT A;  2SEM A;  1OOT A;  2BZX A;  4Y92 A;  1SEM A;  1CKB A;  1AOJ A;  1SSH A;  3PVL A;  1JXO A;  1Z9Z A;  4CC3 A;  2M0Y A;  1Y0M A;  4RTX A;  2PTK A;  1WIE A;  4LUD A;  3EG0 A;  1E7O A;  2EKH A;  1G2B A;  2DBK A;  4RTV A;  3H0I A;  4ZNX A;  2DM1 A;  2LJ0 A;  2CUD A;  1PWT A;  1T3L A;  4AG1 C;  1Z9Q A;  2KRM A;  3REB B;  3I5S A;  2CRE A;  2KR3 A;  4JJD A;  2F2W A;  1RUW A;  2EGE A;  1JU5 C;  2M51 A;  2JS0 A;  2XMF A;  1UTI A;  2C0O A;  2MCN A;  2ENM A;  1M3A A;  2J7I A;  2YUN A;  5FW9 A;  2JW4 A;  2AZV A;  1JQQ A;  2EBP A;  2DYB A;  1JEG A;  3JV3 A;  1SRM A;  1WA7 A;  2YSQ A;  2DL3 A;  2ED0 A;  1X6B A;  4FSS A;  2C0T A;  4RTZ A;  4ESR A;  2SRC A;  1GCP A;  4CC2 A;  1WYX A;  2CSI A;  1BB9 A;  2EYX A;  3H0H A;  3UAT A;  1AWW A;  1BK2 A;  2CH4 W;  1ZX6 A;  3VS7 A;  4AFS C;  1B3Q A;  3EGU A;  3M0P A;  4AFQ C;  1WXT A;  1GL5 A;  5IXB A;  4J9F A;  1X6G A;  2LP5 A;  1VYV A;  1KSW A;  2HDA A;  2NUZ A;  2CT3 A;  2DL7 A;  5EC7 A;  3EHQ A;  4RUG A;  3IQL A;  1GBR A;  3H41 A;  4OMO A;  2O9V A;  2GBQ A;  1PNJ A;  1K76 A;  2EW3 A;  2IIM A;  2KRS A;  2AKL A;  2K9G A;  2LZ6 B;  3QWX X;  4RTT A;  1NG2 A;  4GLM A;  1QKX A;  1X2Q A;  2CT4 A;  1CSK A;  2JM8 A;  1ZBJ A;  2A08 A;  2GNC A;  1NEG A;  3NPF A;  2HEQ A;  1VA7 A;  1JXM A;  2HBW A;  2LQN A;  2DLP A;  4EIK A;  4M4Z A;  2GTO A;  2LX7 A;  2YT6 A;  3QWY A;  2VWF A;  4K11 A;  1UJ0 A;  1YWO A;  4DEY A;  3ULR B;  1CKA A;  1U3O A;  5I22 A;  1W70 A;  4LN2 A;  1KJW A;  2JXB A;  2X3X D;  1GRI A;  2LJ1 A;  1YWP A;  2KYM A;  2J6O A;  2RQR A;  3RNJ A;  2FG0 A;  2EGA A;  5I11 A;  1RLQ C;  4OMN A;  2A36 A;  3PVQ A;  5GJV B;  1UFF A;  3NGP A;  3VS6 A;  1AWO A;  1AWJ A;  3VS5 A;  2ROT A;  5IHK A;  1QCF A;  1HSQ A;  2RMO A;  2G6F X;  4D8D A;  2AKK A;  2X3W D;  2O31 A;  4OMM A;  3VRY A;  1TUC A;  2RQU A;  1WX6 A;  2HCK A;  3VRZ A;  2B86 A;  2EYW A;  1H92 A;  2RQW A;  2OJ2 A;  2L3Q A;  3M0U A;  1OPL A;  3C0C A;  2KRN A;  2DRM A;  2KRO A;  1VYT A;  2PNI A;  5L23 A;  2YUP A;  2RQT A;  1H3H A;  1W1F A;  3ZL7 C;  2J6F A;  2KGT A;  4JPB W;  4F17 A;  4HVW A;  1X43 A;  2L2P A;  2JM9 A;  5IHN A;  4F14 A;  2EPD A;  2J05 A;  1I07 A;  2DE0 X;  2FPD A;  4ORZ A;  1YP5 A;  1JO8 A;  2DL4 A;  2BZ8 A;  1S1N A;  2CDT A;  2W10 A;  1RLP C;  2EVR A;  1GCQ A;  2PZ1 A;  3EG3 A;  4JJC A;  4LE9 A;  4LUE A;  1UEC A;  2W0Z A;  2RNA A;  2LJ3 A;  1M8M A;  4JZ4 A;  1J3T A;  3UF4 A;  4J9I A;  4OML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...