4Y28E

The structure of plant photosystem i super-complex at 2.8 angstrom resolution.
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
b'PPIGPKRGAKVKILRQESYWYKGTGSVVTVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of plant photosystem I super-complex at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4y28E00
2CYZB 2DPPB 2PVDB 3A8HB 2CZ0B 5L8RE 2WSCE 2D0QB 3QZ9B 3QZ5B 3A8GB 2CZ6B 1IREB 2DXCA 2O01E 3QYGB 2DD5A 3X26B 4ZGDB 3X20B 2DD4A 2PU9B 4ZGEB 2DXBA 3VYGA 3A8MB 1QP3A 2ZPEB 1UGPB 2ZPIB 2PUKB 1AHJB 4KT0E 3A8OB 2ZPHB 4OB3B 2QDYB 4RKUE 4ZGJB 2PVOB 3LW5E 3WVEB 2CZ7B 1DJ7B 3WVDB 2ZPBB 1UGSB 2ZPGB 1JB0E 4OB2B 2WSEE 2ZZDA 3A8LB 4L6V5 3X25B 3X24B 2CZ1B 1PSFA 3QXEB 1QP2A 3VYHB 1UGRB 4XK8E 2AHJB 3QYHB 2PUOB 1PSEA 1V29B 4Y28E 4FM4B 4OB1B 2ZPFB 2ZCFB 1GXIE 1UGQB 3X28B 4OB0B 3HHTB 2WSFE 2PVGB
chains in the Genus database with same CATH superfamily
2PTKA 1ZUUA 1XNIA 2HL3A 5GAN4 2KGTA 3MEAA 1ABOA 2CSQA 4C5EA 1K9MR 3JCMb 1WX6A 2QDLA 3OYMA 2KR3A 2AT1B 3O5ZA 2QTXA 5CKFA 2YRVA 5DM7R 3URGA 4BDZA 4JZ3A 4MMLA 1Y7XA 1ZX6A 5GANg 1Q95G 4CI0C 1NJIR 1IGUA 4OMNA 2JTMA 4CC4B 3MCAB 1HK9A 3CXCA 1PHTA 1ZHIA 1YJ9A 2FZGB 1G3TA 1CKAA 1UJYA 4LD6A 3L2UA 2EJGA 4HCBA 4E7HA 1AVZC 3WVEB 2QQSA 2D6FA 2P0KA 3C94A 3QHSA 2XK0A 5A0GA 2RQUA 3I56Q 2WSEE 2J6KA 5DY9A 3SEMA 3FDRA 4OP0A 3AHUA 3GBQA 2L89A 1WIEA 4EMKB 2JZ2A 3VV0A 2L3QA 3QYHB 3CCUA 3G6EA 2E10A 2K5IA 3JCMJ 2HBPA 5CQXA 5AT1B 1X43A 2QK0A 7AT1B 4RG2A 1UB4A 1C1AA 4OB0B 1B07A 2QAZA 2PVGB 2EQKA 3LX7A 1W2BA 3EFSA 4C8QD 1KHIA 4OMLA 1M1KC 3TREA 3A8HB 1YCYA 1Q86C 3CCET 2XDPA 2JTEA 1NE8A 2DTHA 4HXJA 1QVGS 4DEYA 2F5TX 1U5SA 2RO0A 1RLPC 2KT8A 3QG1A 2OTLA 5IHIA 2A08A 5J3BA 5KYUB 4KH0B 2O4XB 3M54A 1IHWA 2E3IA 2JOYA 1VQ8Q 4PFPA 1IREB 4E7LA 1YIJT 1ZBXA 2QXFA 4BE2A 1D1BA 5IHKA 1LVKA 3G7ZA 1BK2A 4C0FA 5IXBA 2F2WA 1BCOA 1SRMA 2B86A 4KRTA 2KRNA 4JLGA 1N27A 3ZFJA 2CH4W 1OPKA 2RJCA 1G3YA 3BDLA 1X6BA 3QDFA 4LDWA 2HL5C 3A8OB 5IH2A 2ZPHB 2KK4A 2HQEA 2YHTA 5HCKA 1K73U 2LNHB 2RI3A 2J6OA 3MEUA 5FU7C 3WVDB 3OYAA 1Z9ZA 5LJ3d 3CCSA 1Q81R 2LZ6B 2ZPBB 1JB0E 1BI1A 2W0ZA 3JB9H 3OY9A 2JN0A 4R0KA 2FEIA 4L6V5 4KGXB 4N4GA 1QW1A 1YWOA 4C92E 2AKLA 1TS9A 1Y96A 5FU6B 3EFOB 2JT4A 3CPWP 3SWNB 1FX7A 1D1AA 4HVVA 2VVKA 1F1BB 2HQHA 1KC8C 1QCNA 4LE9A 1BBZA 2J06A 4PKCC 3BFMA 4PJJA 1WGSA 3CCLT 2CP5A 3RKWA 1GXIE 4LDUA 1UFFA 2RJEA 3TCJA 2XDDA 1M1FA 3MP8A 4CC3A 1U1TA 2RK2A 2EKHA 1E6GA 1RAEB 1QWFA 4KGZB 1WI7A 2F1LA 5I2SA 2E1HA 4WTOB 2L3PA 5LJ5d 1GFDA 2QI2A 2LJ3A 3JCMd 1OOTA 2Z0WA 4M7AE 3I56A 2P0QA 1WHLA 3CCVT 4D8KA 5CQYA 4Y92A 2ABLA 3CCEQ 4J6XA 2GF7A 3M53A 4QKUA 3CMAQ 2DXCA 4M7DG 2JM8A 4J9DA 3ZL7C 2DL3A 2LRQA 1FMWA 4IIMA 2DO3A 4QW2A 2ED1A 2KSSA 4FCYA 4JJCA 4FIBA 4II1A 1YIJQ 1YWPA 1M8MA 2V26A 4M7DF 1U1SA 1K76A 3MO8A 1UECA 2ZPIB 3UA7A 4J9IA 2DJZA 4M77D 1SEMA 2FB7A 4E47A 2RPNA 1H641 3O8VA 2V8IA 4FYVB 4M78B 5GMKh 4C8QA 4X9CA 1V76A 2KROA 4BE1A 4GY5A 1K0XA 2R5MA 3OYYA 2M0OA 3A8LB 3UF4A 3QWXX 2L5QA 5CR2A 3I5RA 1VQ8A 5CKEA 3CD6T 5I2MA 4XK8E 4IUTA 2VC8A 3M9QA 4A4EA 1JJ2S 1WXUA 2NUTB 1EIFA 3GPLA 1OQKA 3FLGA 3REBB 4EIKA 1HJDA 4WCIA 3D7SB 3V7SA 5FWCA 4PJOD 3CCMT 2K3YA 1RABB 2E3HA 4XTYA 2JNGA 3KXTA 1W4SA 2MIOA 4E7JA 1ZSZB 4IUVA 3C4SA 1TWBA 3TU4K 2CT3A 3RESA 2LQNA 1M1GA 2V8KA 3C12A 3MPUB 1GCPA 1M2VB 1VOMA 2BZ8A 4B9WA 3BW1A 2PQWA 4AFZC 3LGLA 1M8VA 4LUDA 1WA7A 4E6RA 1M9SA 4R55A 1M5Q1 4M7DC 5GMKm 3JSCA 5GANd 5LL6S 3RNJA 1YITQ 3RKXA 2RHIA 4PFZA 5KYWB 1LCKA 5ECAA 2MWPA 5CK9A 1QP3A 4J9BA 3M0SA 4PLIA 3FB9A 1AEYA 1KJWA 4MZPA 1VQ7Q 1I5LA 2Y4XA 3OQ5A 2DLPA 2YUQA 3ME9A 2LQWA 1K8AC 3H6ZA 3SHWA 1MHNA 2E64A 1Q7YR 5A0DA 1ZSGA 2LP5A 1MV3A 2QA4Q 3EAEA 5GAN8 1JXMA 4JS4A 4BACA 1T0HA 2R58A 4CRIA 1GCQA 3EG9A 1QCFA 1RADB 3UA6A 2V8JA 3CCEA 3CC7T 3M5AA 2YRDA 2CZ1B 3EG3A 1PSFA 3RIRA 3CMAA 1QP2A 4BE0A 2DA9A 2V1RA 2CT4A 4JDSA 3MEWA 1WJRA 1WHKA 4HT8A 2EQUA 1H8KA 3U23A 2KQWA 3GNFB 1G5VA 2JUFA 1N8RR 1VQMT 3CD6Q 1WHMA 1YIJA 2RF0A 4FYYB 5FU6C 2PZ1A 1SSHA 3QJ6A 2KXDA 1SF9A 4DEXA 3X28B 2HSPA 1R0CB 5KCHA 1Y0MA 4E2FB 3TEEA 2RHZA 1ACMB 4M77A 4C8QG 2YLBA 3CCMQ 2L3RA 3A1PA 2A0FB 2MI6A 2JS2A 4RTVA 4JJNK 2MWOA 2HKNA 1VQ4T 1WZOA 4RCCA 4C8QF 1RAGB 2VASA 1SPKA 1Y71A 3H8ZA 4RUGA 1MMDA 3JV3A 2MCNA 3J7AF 3CC2Q 3RR6A 4M75D 5D7UA 4QQDA 3Q1JA 2DXTA 4M4ZA 1MV0B 1T0JA 3HRSA 1D09B 1NM7A 4PJOA 1JXOA 4J83A 2LT1A 1X69A 5FRNA 5GAOm 1NLOC 1S72T 2K3BA 2VYTA 4RTYA 2LQ8A 2NUPB 1LPLA 2D8HA 1KD1U 2DYIA 2RMOA 4XU2A 1PM3A 3RBBB 1KQ1A 2K4YA 2NLUA 2VGMA 2YRCA 1BB9A 1JRIA 2H8HA 2OTJT 3BDUA 3LGFA 1MGQA 4ZNXA 5FU7B 3VUZA 2RI2A 1NBEB 3VKIA 2YUNA 3OYGA 1YJNT 2KYBA 1PRMC 3OYCA 2DBKA 4JRKA 1AD5A 4C92B 9ATCB 1YITA 4FU6A 2EGAA 4HT9A 4FM4B 1SSFA 2QGFB 1UHCA 1IGQA 2HKQB 3OB9A 1ZA1B 2WACA 4O5VA 5HK0A 2GTJA 2OJ2A 2FPDA 1VQ7A 3QKJA 4Z89A 4DOVA 4PJMA 1BI0A 4A63B 3CQTA 3LWHA 4C0DB 4C8QC 5KE3A 5C0MA 2KT1A 5I22A 2H3JA 1G3SA 2QA4A 1QVGP 1NJIC 3M59A 2AZSA 5HK3A 5LJ3e 1KD1C 4X34A 1KFZA 1JJ2A 5GAN6 5KYYA 3S3OA 2E70A 3JAME 4EDUA 2CP2A 1ZUYA 2FVUA 1UEBA 2ZAEA 1VYVA 1B34B 1NPRA 3LLRA 1KG1A 3DB4A 1VQ4Q 4XTWA 4ZGEB 1MMAA 3CCSQ 2GGRA 3META 2J6FA 5J26A 3CD6A 4J6WA 2K2MA 1Q82R 5KH6A 4TVRA 2A36A 2DJQA 4F04B 3HPWA 5GAOp 4B9XA 4B6MA 1VQKT 2ROTA 4RCBA 1ZBJA 1YJWT 2RNAA 5L23A 1ZQ1A 3EGDB 3CCMA 2DAQA 3SFMA 4E7KA 2KDSA 2X3XD 5LJ5e 2EAYA 4UC4A 3RKYA 2ZPGB 3JCMe 1OV3A 4J9HA 4C5GA 3JB9J 4BUGA 3CC4T 3CBMA 5GAMg 2F5KA 3T9NA 1GBQA 1M1KU 2H3EB 2HEQA 1Q86U 4Y28E 3CC2A 3OA6A 2M0YA 4YTLA 2QG9B 1I07A 4M75A 4EMKA 3MP6A 2RJFA 3ASKA 1PCXA 2E5KA 2SEMA 2ZCFB 3MKDA 2VUBA 1TUGB 3QIIA 4C92G 1RAFB 5IT9E 2A3LA 2E41A 1VQNQ 2HZYA 3P8DA 2NWMA 1HYOA 4RMOA 2X9HA 3JCMW 4FSSA 4C92F 4PJOF 3H0IA 4M78D 1FMVA 2WSCE 5C6SA 1NEGA 2HQXA 4J9FA 1QMCA 1LOJA 3QZ9B 1D3BA 3CCRT 1K0SA 2ED0A 2ATCB 1GRIA 2MYSA 4OMPA 4XU0A 2X4WA 4N0AA 1N5ZA 1CSKA 2O4XA 1BIAA 4M7AG 1KQSS 3CMET 3HRUA 1M27C 3CCJT 5EC7A 3S3MA 4OMOA 1WJSA 4M7DB 2E65A 4RTWA 2X4JA 2AZVA 4DBQA 4ATOA 2RQRA 4E7IA 3JB9I 1G2BA 4M7AF 1JO8A 3OS2A 2K5FA 1UG1A 3DLMA 1KC8U 1I0CA 1VQKQ 2MPXC 5A0LA 4M77E 1YHQT 1NEBA 1VQ9T 2DRKA 3NFCA 2ENMA 2KI7A 1QVFP 3X25B 3RMSA 2QYZA 5GMKi 2X35A 2RI5A 2HCKA 1OZ2A 2YDLA 2AHJB 2DBMA 4RTZA 2YT6A 1H92A 3OYIA 1WYXA 5GANe 1VQ4A 4X1VA 4PL6A 1YI2T 2EYYA 4OB1B 4KUIA 1MNDA 2K7AA 1RAAB 2RHUA 1W1FA 2PNIA 4AT1B 3REAB 1XOVA 3RERA 4C92C 2RM4A 2D8JA 3OYFA 2D9TA 3JCMP 1OX8A 2VXEA 3GF5A 1YN8A 1M1KR 4AFSC 1Q86R 3OW2A 1WQWA 4PJOE 2C0TA 3QDRB 1B3QA 1R0BG 1LJOA 1PD1A 1QQJA 3QJYA 2P84A 1TU0B 2G6FX 4J7FA 3EGXB 2EVRA 4C0DC 1I81A 1TSFA 1RACB 1KQ2A 3R6NA 3OMGA 2CZ6B 4F16A 2KMTA 1VIEA 3CXCP 3RDVA 4ELYC 3NMZC 3CCRQ 4M7AC 3M58A 2EFIA 4JPBW 2JTFA 3LH0A 3CBPA 4C0ZA 3RMQA 2QGGA 2DNUA 1JU5C 2AKKA 1BYMA 4XU3A 3THKA 2DILA 3CMEQ 2MMPA 3M4GA 5D6XA 1VQNA 2FZKB 2QDYB 3S3NA 4M75F 3VS4A 1XTDA 2M1HA 5GAN5 5FROA 2DE0X 1YFNA 3PVQA 2A28A 2CZ7B 4FL6A 2B8AA 1X2KA 5EG2A 3G4ST 1IO6A 4EMGA 2ROLA 1VA7A 2M02A 1SHFA 4J8OA 1OU8A 2CDTA 2ZZDA 2EKOA 2M16A 2CP0A 2DTIA 1X75C 5IN1A 1I8FA 3G71T 1WLPB 4V2SA 2QTVA 1KC8R 1FYNA 1PNJA 5KYXA 4D6WA 3EHQA 1RI9A 1PWTA 1PC0A 2BIVA 3GP8A 4BY6C 2DYBA 2ZPFB 5CVIA 3TSZA 2EW3A 1EZZB 4OMFB 3EH2A 1RUWA 3I35A 4J9CA 2NUTA 2GFUA 2WSFE 1YI2Q 1W2BP 5HKCA 1OULA 3FEOA 2F2XA 3QUIA 3VJPA 1K73R 1IRXA 2DPPB 5GMKj 3M0TA 4ZTFA 3V8JA 1X6GA 2ZGWA 1VQKA 1ZSZA 2XKOC 2XIDA 2RJDA 1WHJA 2DXUA 3V7RA 2COZA 4AFQC 4C8QB 2EBPA 4AG2C 2VV5A 3A8GB 1K8AU 4NOYA 2HD0A 2C06A 4FT4A 4OMMA 5IAYA 3CCLQ 1PG5B 1K1ZA 1H3HA 2O88A 1U3OA 2Y90A 1KK7A 2MOXA 4QQ6A 3I9QA 4M75E 2L2PA 3M0UA 3DB3A 2L3SA 4VUBA 3ZBDA 2OAWA 3NPFA 2RN8A 4QVZA 5LJ3h 5LJ3f 1NZ9A 3CPWS 3CCVQ 4AFUC 3JB9D 5FRMA 1D0YA 4HA8A 2JMCA 4Q5WA 1XQHA 1E7OA 5CKHA 3P8HA 2VWFA 3GIBA 1KQSA 3HSBA 2K57A 2BE7D 4BI8B 3OBWA 3VS1A 4C5IA 4F7UA 5LJ3j 2FPEA 5GAMd 3G4SQ 2AK5A 1PD0A 1N9RA 4IIOA 3EH1A 1AWWA 4FSXA 4NS5A 5GAOq 5KE2A 3CCRA 1NYFA 2E6ZA 3AT1B 4PJNA 3NTKA 3G6ET 5HY6A 1J3TA 1K9AA 2EJ9A 2CKKA 4FYXB 5LJ5h 6AT1B 1PKSA 3CMEA 4HVUA 5LJ5f 1Z9QA 1PRLC 3OMCA 4JLIA 3JCMh 3MHXA 5CIUA 3JCMf 4OMQA 3C95A 1VQOT 3M4YA 1ZA2B 3UWNA 2FRYA 2XU8A 4LD9K 1C6VX 4FW1A 2KXCA 4LNPA 3OSVA 4HCCA 2QQ9A 1WDXA 1RAIB 2LTOA 2LDMA 5CAIA 3HP9A 2OTLT 3PE0A 2EGCA 3QPHA 3EG9B 4Y91A 1XJWB 3A98A 3BE3A 1M90U 1AWXA 3A8MB 1KHCA 1WNLA 2E4HA 2D1XA 4FW2A 1VQLT 3KFVA 4JZ4A 2EYWA 2CP6A 1W6XA 2LQKA 1K8AR 1YI2A 4QT7A 4FT2A 2DTOA 2HBWA 2LCLA 2COWA 4EMHA 3OYEA 1IHVA 1WXTA 2CS7A 3MEVA 2BTTA 2QEXT 4C0GA 1X01A 2QQAA 3LH5A 5KCOA 3JRZA 2RK1A 1ARKA 2LC4A 2NUPA 2OX7A 3CBOA 2KRMA 4M77B 1BIBA 3MP1A 4HCKA 5FWBA 2X4XA 3UT1A 3CCLA 4LDXA 1PSEA 1NJIU 1QKXA 8ATCB 4Z88A 3PIOA 1OYXA 2RQTA 4ORZA 2BKDN 3PMIA 4MZMA 1M90C 4HVWA 2R5AA 2RHXA 3VU3C 2P4RA 1A0NB 1UGQB 3OW2S 4KBMB 3VS5A 4M7DD 5I21A 4A4GA 5IHNA 4BB7A 1N6AA 2YUOA 4ME7A 1HD3A 3L2WA 3QWYA 1KSWA 3CCVA 1NLPC 3L42A 4PJOB 4FYWB 2DVEA 2MAMA 2DRMA 3CC7Q 4E7SA 2NYSA 3H0HA 2DM1A 1K9MC 4Z8AA 3QZ5B 3SB2A 1VQOQ 3OYLA 1YNZA 1VQ5T 2K79A 4J9EA 3PVLA 4M78E 3VS2A 5GANh 1Q82C 5GANf 4DBHA 3G4SA 2CREA 3HRTA 5GAOn 4DA4A 2LCCA 1IZ6A 1VQMQ 1RI0A 4P5NA 4Z02A 1QVPA 1R77A 2DXBA 3VYGA 1WHGA 2GQVA 1ZLMA 2AIRB 4F7UF 3BY7A 4JS5A 5GANj 2KBTA 1ZUKA 2K2VA 3TSWA 4M7AB 1AHJB 4KGVB 2QQBA 3F70A 3I5SA 4OB3B 1VQLQ 5GJWB 4C5HA 2YSQA 2PVOB 2EYXA 3LW5E 2VXFA 1AT1B 1TOVA 2VB6A 3FRNA 2DL8A 2HSEB 5D6WA 1RLQC 3E2UA 4PLLA 4MZTA 1UDLA 2O31A 1K4US 2RD1A 2E5QA 4CC7A 2VKNA 4JUVA 2QEXQ 1WHHA 2OI3A 3A5ZB 2LMJA 4X9DA 2A7YA 4JJDA 5KYYB 4M77G 3PMTA 4DBFA 1VQ8T 2MK5A 3INZA 1I4K1 3PNWC 5KYNA 3CPWA 3VRZA 1S72Q 1I1JA 1TXQA 1CKBA 2DZCA 2L0AA 2FYKA 2GNCA 2M9UA 1S1NA 1WFWA 3HHTB 4M77F 3VRYA 3KUFA 4BY6B 3OS1A 3NTHA 1UJ0A 1KD1R 3VS7A 2OTJQ 4XAXB 4LN2A 1Q81U 1HXDA 2E6NA 1X6OA 1YJNQ 3DLLA 2DL5A 4XQ3A 1G83A 4PJOG 3V8LA 5GAN7 1YBYA 1OI1A 2RQVA 3CCQT 2IPOB 4F7UE 3C0CA 5DLOA 3V8KA 1VQ5Q 1VIFA 1AWOA 2GFAA 3PFSA 3OYBA 4WF2A 3JCMX 1VYUA 3R6OA 2CH4A 4A4FA 2RQWA 3J80E 1GCQC 1O75A 2K5LA 1R8OB 1H3ZA 1WPYA 4KT0E 2YLCA 4M75B 4M7DA 1U06A 1UUEA 3EG1A 4O6JA 3KBGA 1M4ZA 5GAN2 1GL5A 1AOJA 4F14A 2JVVA 1V1CA 4PNOA 1NYGA 3PIPA 5KYUA 1GFCA 1DJ7B 3JB9G 2YWWA 1M3BA 3M56A 3CC7A 1UGSB 4AMCA 2DF6A 5FW9A 2XD0A 5CKDA 2OAUA 4GLMA 1Q81C 4OVAA 1AWJA 4IURA 1VQOA 3X24B 1B7TA 1VQ6T 2F69A 4ELZC 3JB9F 5GMKl 2L8DA 2W10A 2R57A 4L5GA 2RA2A 3HTRA 3L2ZA 3L2QA 4M77C 1VQMA 2QQRA 2C0OA 2LX7A 2HMAA 1D3BB 2KY9A 3VS0A 3DKMA 3FIFA 3L2VA 3CMAT 4MDXA 1OU9A 1W70A 1HSQA 1YJWQ 1NPPA 4K11A 2JM9A 2DX1A 1KIKA 1YP5A 3G1JA 5D6YA 2XMFA 5GJVB 4BI4A 2COYA 2LJ1A 3QO3A 2X3WD 1P92A 1O9SA 1VQLA 1TTHB 3LYIA 1VUBA 3E19A 3EFRA 4DQ2A 3CC4Q 4MMKA 1JJ2P 1BI2A 1OX9A 4ZN1A 2DEUA 2DL7A 1UE9A 3V7CA 2JW4A 2X4YA 3EFOA 4RTUA 3SWNA 1OZ3A 3J81E 2KEAA 1WXBA 4PJOC 2QEXA 3H0FA 1JBMA 2V1QA 1M30A 1IB8A 4QQGA 3RUXA 2K6DA 3EGXA 4ZN3A 2ECZA 2EGEA 5GAMe 3PT9A 2CUBA 1BKBA 5CO7A 1N9SA 3OS0A 4XU1A 1VYTA 2JMAA 2DETA 1TG0A 1UGVA 4RG8A 3CCQQ 5I11A 1VQPT 1S72A 2DIQA 1QKWA 2EIFA 5GAN3 4PK4A 2X51A 3ER0A 1TUCA 3EGUA 4CC2A 4OF1A 2CP7A 5FLXE 3L1AA 4PJLA 4QVCA 1MNEA 2OTJA 2XG8D 2CSIA 2LNVA 4M75G 2KVQG 1YJNA 1Y96B 4PFOA 1MMNA 4NL2A 3ZEHA 3N5BB 4RTTA 3CCJQ 4NL3A 3CEYA 3QBYA 1TH7A 4XTVA 1K73C 2EQJA 1VQ5A 3FJPA 1VQ6Q 3ULRB 1UTIA 3SD4A 1EFNA 2C0IA 1YITT 4M78A 1YCSB 4XTZA 3UPUA 2VGNA 2KRSA 2YUPA 1QLYA 1M2OA 4J6YA 4F17A 2BE9B 2DIGA 3MJXA 4KULA 5DLQE 2P0PA 4IUQA 5GAOl 1YHQQ 1VQ9Q 3I55T 4A4HA 2PVDB 1Q7YU 2IIMA 2CZ0B 1VQ7T 2HAXA 1NG2A 3GNGA 1OEBA 4DOWA 4N4HA 2KAFA 2A37A 3OYNA 1E6HA 1JQQA 2QA4T 1X27A 4OGEA 8AT1B 2NUZA 1SHGA 3EG0A 1ABQA 2O01E 2KYMA 2DERA 2XI9A 1T3LA 3VUBA 3TVTA 5J39A 2D0NA 1EX4A 3NTIA 2PU9B 4OGCA 2DK3A 1YJWA 1D0ZA 1N8RU 4A4KA 2FHDA 5KYXB 1QVFS 2FPFA 5CCAA 1M2VA 3JCMc 2EYQA 3VS6A 1SG5A 2CP3A 4ZGJB 1VQPQ 3PGGA 1QCOA 3CC4A 4QVDA 1FXXA 2Y4YA 1Q7YC 2BUDA 4M75C 4EMKC 4C92D 4ZTJA 4A54A 4KH1B 5KYWA 3PTAA 1YJ9T 2RH2A 3L2RA 2I2LA 2LX9A 1D0XA 2CUDA 3OS5A 2HDAA 4L59A 2PUOB 1SKUB 1V29B 3E9GA 5GAOr 2XDBA 3UATA 3E9FA 3OYDA 3TQ7P 2DVJA 1RAHB 3CC2T 3CCQA 4GLKA 2I0NA 3OW2P 3EHRA 1N8RC 3GOXA 2EJFA 1G8XA 3CXCS 2JJ9A 3OYHA 5AYFA 4N0AC 4R56A 4M7AD 4M7DE 3UDCA 2DKGA 2ESWA 4N4IA 1BU1A 2P4TA 5L8RE 3G71Q 2EQMA 3I55Q 3EG2A 1QVGA 1OPLA 1AZEA 1WQ7A 3CCUT 4J7IA 2EWNA 4XTUA 1M3AA 2RB6A 1AZGB 4LXCA 1JEGA 2O9VA 1IXDA 3CCJA 4ANJA 3X26B 4ZGDB 2BZYA 1BCMA 3GLXA 2E12A 2KNBB 4A53A 2DD4A 1MMGA 2BZXA 4DBRA 4F7UB 1VQ6A 2ZPEB 2GBQA 2YXYA 1LNXA 4LDVA 4HKEA 1WJQA 4M78G 3LWIA 3HFOA 3OSSC 3HL8A 4EPCA 1BI3A 2FL7A 5LJ5j 3VS3A 2LJ0A 4XTXA 3P8BB 2MF2A 3JCMQ 1YHQA 1VQ9A 4ESRA 1UHFA 2EQIA 4E7ZA 5LJ3g 4M78F 1SRLA 3S6WA 5A2QE 4IKFA 4IUUA 4D8DA 3SWNC 5IXFA 1W2BS 2DFUA 3QXEB 4J5YA 2LCSA 3VYHB 1UGRB 2J7IA 2DMOA 2KE9A 3QSUA 2J05A 3OYJA 3JCMV 2XICA 1YJ9Q 2XHCA 2M51A 4BI3A 1K9MU 2O9SA 4GBQA 2IG0A 1FMKA 1Q82U 2FRWA 4AG1C 3CCST 5LJ5g 2CYZB 1I5OB 1GBRA 2DL4A 3JCMg 1VQPA 1D1CA 2CGHA 1Y07A 1G3WA 4JJBA 2DEQA 5CKBA 1U8RA 2D0QB 4MDWA 5GMKe 4C92A 2EPDA 3OBYA 2DZ9A 3QYGB 4RTXA 2DD5A 3CCUQ 3X20B 3G6EQ 4BD3A 2IVWA 2LT4A 1C0MA 3NGPA 3FC3A 2GTOA 2G3RA 1T3SA 4M78C 1UGPB 4JRIA 2PUKB 2GQIA 4IUPA 4F7UG 3I56T 4JRQA 3HKSA 2LVMA 4RKUE 2FG0A 2K3XA 3M55A 1TUDA 4M7AA 1Y57A 1KQSP 5M9OA 1VQNT 4HCZA 2SRCA 3M57A 4OB2B 1PKTA 3G71A 1B34A 3I55A 2OTLQ 5GAMh 5GAMf 3IQLA 2FO0A 3WXMB 2O2OA 2EYZA 1QVFA 1X2QA 1FWZA 4LUEA 3HFNA 4BDYA 3H41A 3H9NA 1RL2A 4LDYA 3CPFA 4JRPA 3M0QA 2JXBA 4J9GA 1MUZA 1M90R 3NHNA 1ZSZC 4C8QE 3E1SA 5GAMj 4KUDK 2K9GA 1M3CA 3SDZA 2GCXA 1QWEA 3M0RA 2JS0A 3EGDA 2FZCB 3FJ5A 2HNIA 3OYKA 2QASA 2F2VA 3M0PA 2RHYA
chains in the Genus database with same CATH topology
1O9SA 2RHZA 3QUIA 1XNIA 3OYAA 3VJPA 1VQLA 2DPPB 5GMKj 3LYIA 5GAN4 4M77A 1VUBA 4ZTFA 3E19A 3MEAA 3V8JA 4C8QG 2YLBA 3CCSA 3EFRA 4DQ2A 2L3RA 2ZGWA 4C5EA 1VQKA 4MMKA 3JCMb 1BI2A 4ZN1A 2MI6A 2XKOC 3V7CA 3OYMA 2X4YA 2XIDA 2RJDA 2DXUA 3V7RA 2QTXA 5CKFA 2YRVA 1OZ3A 3SWNA 3J81E 4JJNK 2MWOA 4C8QB 5DM7R 1VQ4T 4PJOC 3URGA 2QEXA 4BDZA 4MMLA 4RCCA 4C8QF 2VV5A 3A8GB 1JBMA 1K8AU 1Y7XA 5GANg 4QQGA 3RUXA 4NOYA 1Y71A 3H8ZA 2HD0A 2C06A 4ZN3A 4FT4A 5GAMe 5IAYA 4CI0C 3PT9A 3J7AF 2JTMA 1BKBA 5CO7A 1N9SA 4M75D 3MCAB 1HK9A 3OS0A 4XU1A 3CXCA 1ZHIA 1YJ9A 3CC4A 4QQDA 1G3TA 3Q1JA 2Y90A 2DXTA 4QQ6A 4RG8A 1VQPT 1S72A 2DIQA 3HRSA 4M75E 2EIFA 3DB3A 4PJOA 4VUBA 5GAN3 4LD6A 3L2UA 3ZBDA 4J83A 3ER0A 2LT1A 5FRNA 5GAOm 2EJGA 4QVZA 4HCBA 5LJ3h 4E7HA 4OF1A 1S72T 2VYTA 5FLXE 5LJ3f 2LQ8A 1NZ9A 3CPWS 3L1AA 3WVEB 4QVCA 3JB9D 5FRMA 4HA8A 4Q5WA 1XQHA 2QQSA 1KD1U 2D6FA 2OTJA 2P0KA 3C94A 2XG8D 3QHSA 4XU2A 2XK0A 3P8HA 5CKHA 1KQ1A 2K4YA 2LNVA 4M75G 5A0GA 2KVQG 2NLUA 2WSEE 3GIBA 4E7KA 1KQSA 3HSBA 2K57A 5DY9A 2VGMA 4BI8B 1YJNA 3OBWA 1Y96B 1JRIA 2OTJT 3BDUA 3FDRA 1MGQA 3LGFA 4C5IA 4NL2A 5FU7B 3ZEHA 3VUZA 4F7UA 3N5BB 4OP0A 5LJ3j 3AHUA 2RI2A 3VKIA 5GAMd 2L89A 3OYGA 1YJNT 4NL3A 4EMKB 2JZ2A 3CEYA 1N9RA 3QBYA 3VV0A 1TH7A 3OYCA 3QYHB 4JRKA 4C92B 3CCUA 1YITA 4FSXA 4NS5A 3G6EA 5GAOq 4FU6A 5KE2A 2E10A 2K5IA 4XTVA 3CCRA 1K73C 4HT9A 2EQJA 4FM4B 1VQ5A 3JCMJ 2E6ZA 2HBPA 1SSFA 3FJPA 5CQXA 3SD4A 3NTKA 1YITT 3OB9A 3G6ET 4M78A 4XTZA 5HY6A 2WACA 4RG2A 3UPUA 2VGNA 1UB4A 2EJ9A 4O5VA 5HK0A 1Q7YC 2CKKA 4OB0B 4J6YA 2DIGA 5LJ5h 1VQ7A 3CMEA 3QKJA 4KULA 5DLQE 2P0PA 4DOVA 5LJ5f 2PVGB 4IUQA 2EQKA 3LX7A 3OMCA 4JLIA 3JCMh 1BI0A 5GAOl 3I55T 3MHXA 5CIUA 1W2BA 3EFSA 3JCMf 4C8QD 3LWHA 1KHIA 4A4HA 2PVDB 1M1KC 4C0DB 3TREA 1Q7YU 4C8QC 5KE3A 3A8HB 1YCYA 3C95A 5C0MA 1VQOT 2CZ0B 1Q86C 3M4YA 1VQ7T 3UWNA 2H3JA 2XDPA 1G3SA 2XU8A 2QA4A 1NE8A 2HAXA 3CCET 4LD9K 2DTHA 3GNGA 1QVGS 1NJIC 3M59A 4DOWA 4N4HA 2F5TX 2KAFA 5HK3A 5LJ3e 3OYNA 2RO0A 1KD1C 4X34A 3OSVA 4HCCA 2QQ9A 3QG1A 5GAN6 1JJ2A 2OTLA 3S3OA 2LTOA 2QA4T 2LDMA 2E70A 5J3BA 4OGEA 2O4XB 3JAME 4EDUA 3M54A 5CAIA 2JOYA 3HP9A 1IREB 2FVUA 4E7LA 2OTLT 1YIJT 2O01E 1UEBA 1ZBXA 1B34B 2QXFA 4BE2A 2XI9A 3QPHA 1NPRA 3VUBA 5J39A 3LLRA 4Y91A 3DB4A 1KG1A 3NTIA 3G7ZA 4C0FA 4XTWA 2PU9B 4OGCA 4ZGEB 1M90U 2DK3A 3A8MB 1KHCA 1WNLA 3META 1VQLT 4JLGA 1YJWA 1N27A 5J26A 1N8RU 3ZFJA 3CD6A 4J6WA 2RJCA 4A4KA 2FHDA 1G3YA 3BDLA 4TVRA 5KH6A 3HPWA 5GAOp 1QVFS 2LQKA 4B9XA 1VQKT 4LDWA 5CCAA 4RCBA 3JCMc 2EYQA 1YI2A 3A8OB 4FT2A 1YJWT 2DTOA 2ZPHB 2KK4A 2HQEA 2LCLA 2YHTA 4EMHA 3OYEA 4ZGJB 1K73U 2CS7A 3MEVA 2RI3A 1ZQ1A 3PGGA 3MEUA 3CCMA 2DAQA 5FU7C 4C0GA 2QEXT 1X01A 2QQAA 3SFMA 3WVDB 4QVDA 5KCOA 3JRZA 2KDSA 1FXXA 5LJ3d 2Y4YA 5LJ5e 2RK1A 2BUDA 2EAYA 2ZPBB 4UC4A 4M75C 3RKYA 2ZPGB 1JB0E 1BI1A 4EMKC 3JCMe 4C92D 2LC4A 4C5GA 4ZTJA 3JB9J 3JB9H 3CBOA 4A54A 4M77B 4BUGA 1BIBA 3OY9A 3CC4T 3CBMA 3MP1A 2JN0A 5GAMg 3PTAA 2F5KA 4L6V5 3T9NA 4N4GA 2RH2A 1YJ9T 1QW1A 3L2RA 2I2LA 2LX9A 4C92E 2X4XA 3OS5A 1M1KU 1Q86U 1Y96A 5FU6B 3UT1A 4L59A 3CCLA 2PUOB 4LDXA 1PSEA 1V29B 3SWNB 1NJIU 1FX7A 3E9GA 4Y28E 3CC2A 3OA6A 4YTLA 3PIOA 5GAOr 1KC8C 2XDBA 1OYXA 4M75A 4PKCC 3BFMA 4EMKA 2BKDN 3MP6A 2RJFA 3PMIA 3E9FA 4MZMA 3OYDA 1WGSA 3ASKA 3CCLT 2ZCFB 3RKWA 1M90C 3CC2T 1GXIE 4LDUA 3CCQA 2R5AA 2RHXA 2VUBA 3VU3C 3QIIA 4C92G 4GLKA 2RJEA 1UGQB 3TCJA 3OW2S 4KBMB 1M1FA 2XDDA 3MP8A 5IT9E 1U1TA 1N8RC 2RK2A 4M7DD 5I21A 4A4GA 2E41A 2A3LA 3GOXA 4BB7A 1N6AA 2EJFA 5I2SA 4ME7A 3P8DA 2E1HA 3CXCS 3L2WA 3OYHA 4M7AD 5AYFA 4N0AC 4RMOA 4R56A 3JCMW 3CCVA 4M7DE 5LJ5d 3UDCA 3L42A 2DKGA 2QI2A 4PJOB 4N4IA 4C92F 3JCMd 2DVEA 2MAMA 4PJOF 4M78D 2P4TA 2WSCE 5L8RE 5C6SA 4M7AE 2EQMA 3I56A 2HQXA 2P0QA 1QVGA 3CCVT 1WQ7A 3CCUT 1K9MC 1LOJA 3QZ9B 4J7IA 3QZ5B 5CQYA 2EWNA 1D3BA 4XTUA 3SB2A 3CCRT 3OYLA 2RB6A 1VQ5T 5GANh 4J6XA 2GF7A 3M53A 4M78E 1Q82C 5GANf 4XU0A 3G4SA 2DXCA 3HRTA 4M7DG 2X4WA 5GAOn 3CCJA 4DA4A 2LCCA 1IZ6A 2LRQA 1RI0A 2DO3A 4N0AA 4P5NA 3X26B 4ZGDB 4QW2A 3GLXA 2E12A 2O4XA 4Z02A 1QVPA 2DD4A 4A53A 2KSSA 1BIAA 4M7AG 1KQSS 3CMET 2DXBA 3HRUA 3VYGA 2GQVA 4FIBA 4F7UB 4II1A 3CCJT 1VQ6A 3S3MA 2ZPEB 4F7UF 1WJSA 4M7DB 2E65A 1LNXA 2X4JA 4LDVA 4HKEA 1WJQA 4M78G 3LWIA 4ATOA 3BY7A 3HFOA 4M7DF 1U1SA 4JS5A 3OSSC 3MO8A 5GANj 3HL8A 4EPCA 1BI3A 2FL7A 2K2VA 2ZPIB 5LJ5j 3JB9I 4E7IA 4M7AB 1AHJB 4XTXA 2DJZA 3P8BB 2QQBA 3F70A 4M7AF 4OB3B 2MF2A 4M77D 3JCMQ 3OS2A 1YHQA 1VQ9A 2K5FA 2FB7A 4C5HA 3DLMA 1H641 3O8VA 4E47A 2V8IA 4M78B 5GMKh 2PVOB 3LW5E 5LJ3g 1KC8U 4C8QA 2VXFA 4X9CA 4M78F 3TEEA 3FRNA 5A0LA 4M77E 3S6WA 1YHQT 1VQ9T 4BE1A 4GY5A 5A2QE 5D6WA 2R5MA 4PLLA 4IKFA 4MZTA 3NFCA 2M0OA 3A8LB 3OYYA 4IUUA 3SWNC 2RD1A 2E5QA 3X25B 4JUVA 2L5QA 5CR2A 3A5ZB 1W2BS 3RMSA 1VQ8A 3QXEB 5GMKi 4J5YA 5CKEA 4X9DA 2X35A 1UGRB 2A7YA 2RI5A 3VYHB 3CD6T 5I2MA 3QSUA 4XK8E 1OZ2A 2AHJB 3OYJA 4M77G 3JCMV 2XICA 4IUTA 3PMTA 3OYIA 2VC8A 3M9QA 5GANe 1VQ4A 3INZA 4PL6A 1YI2T 1VQ8T 4A4EA 2XHCA 1I4K1 3PNWC 3CPWA 1JJ2S 4KUIA 4OB1B 1EIFA 4BI3A 3GPLA 3FLGA 1K9MU 2RHUA 2IG0A 3V7SA 4PJOD 1XOVA 3RERA 1Q82U 4C92C 2RM4A 3CCMT 2DZCA 2K3YA 2FYKA 3OYFA 2D9TA 4XTYA 2M9UA 3JCMP 3HHTB 2JNGA 2VXEA 3GF5A 4M77F 3KXTA 1W4SA 3CCST 3KUFA 4E7JA 3OW2A 1WQWA 4PJOE 4IUVA 5LJ5g 4BY6B 3C4SA 2CYZB 3NTHA 3OS1A 3TU4K 3RESA 3JCMg 1VQPA 3QDRB 1M1GA 2V8KA 2CGHA 3C12A 1Y07A 1LJOA 4XAXB 3QJYA 1G3WA 1Q81U 1HXDA 2E6NA 4B9WA 2DEQA 5CKBA 1U8RA 1X6OA 2D0QB 2PQWA 3BW1A 4J7FA 4MDWA 3DLLA 4C0DC 4C92A 1I81A 5GMKe 3LGLA 1KQ2A 1M8VA 4XQ3A 4PJOG 3V8LA 3OMGA 5GAN7 1M9SA 4R55A 3OBYA 1YBYA 2CZ6B 2DZ9A 1M5Q1 1OI1A 2KMTA 5GMKm 4M7DC 3QYGB 1VIEA 2DD5A 3CCQT 3JSCA 4F7UE 5GANd 5LL6S 5DLOA 3RKXA 3X20B 2RHIA 3V8KA 4BD3A 4ELYC 2IVWA 2LT4A 4M7AC 1VIFA 2MWPA 3M58A 2GFAA 3PFSA 5CK9A 2EFIA 4WF2A 3JCMX 3OYBA 3R6OA 3FC3A 1QP3A 2JTFA 4A4FA 3LH0A 3CBPA 2G3RA 4C0ZA 3RMQA 3J80E 4M78C 1O75A 4PLIA 2K5LA 1UGPB 3FB9A 1R8OB 4JRIA 1BYMA 4MZPA 4XU3A 1H3ZA 2PUKB 1WPYA 4KT0E 2YLCA 2MMPA 4IUPA 3M4GA 1I5LA 4F7UG 2Y4XA 3OQ5A 4M75B 5D6XA 3I56T 1VQNA 4JRQA 4O6JA 4M7DA 3HKSA 2QDYB 3ME9A 3S3NA 1K8AC 2LVMA 3KBGA 3H6ZA 1M4ZA 1MHNA 4M75F 2E64A 2K3XA 4RKUE 1XTDA 2M1HA 5GAN2 2JVVA 3M55A 5A0DA 5GAN5 4PNOA 5FROA 3PIPA 4M7AA 3EAEA 2CZ7B 4FL6A 3JB9G 1DJ7B 5GAN8 2B8AA 5EG2A 5M9OA 1VQNT 4HCZA 4JS4A 3M56A 3G4ST 4BACA 3CC7A 1UGSB 3M57A 2R58A 4OB2B 4CRIA 2XD0A 3G71A 4EMGA 5CKDA 1B34A 3I55A 4J8OA 2ZZDA 2OAUA 5GAMh 1Q81C 5GAMf 2EKOA 2M16A 4OVAA 4IURA 1VQOA 3WXMB 2V8JA 3CCEA 3CC7T 3M5AA 2DTIA 1X75C 5IN1A 3X24B 1I8FA 1VQ6T 2CZ1B 3G71T 1PSFA 3RIRA 3CMAA 2F69A 4ELZC 1QVFA 1QP2A 1FWZA 4BE0A 5GMKl 2L8DA 3JB9F 4V2SA 2R57A 3HFNA 4L5GA 4BDYA 2RA2A 3MEWA 4JDSA 1RL2A 1WJRA 3L2ZA 4LDYA 4M77C 3L2QA 2QQRA 4D6WA 1VQMA 3CPFA 4HT8A 2EQUA 1D3BB 2KQWA 2KY9A 4JRPA 3GNFB 1G5VA 3DKMA 2JUFA 3FIFA 3L2VA 3CMAT 4MDXA 2BIVA 4C8QE 3GP8A 3E1SA 4BY6C 2ZPFB 5GAMj 4KUDK 1NPPA 3SDZA 5CVIA 2GCXA 1VQMT 1YIJA 5FU6C 3QJ6A 4OMFB 5D6YA 4BI4A 3X28B 2WSFE 3QO3A 2HNIA 5KCHA 5HKCA 3OYKA 3FEOA 1P92A 2GFUA 2RHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CYZ B;  2DPP B;  2PVD B;  3A8H B;  2CZ0 B;  5L8R E;  2WSC E;  2D0Q B;  3QZ9 B;  3QZ5 B;  3A8G B;  2CZ6 B;  1IRE B;  2DXC A;  2O01 E;  3QYG B;  2DD5 A;  3X26 B;  4ZGD B;  3X20 B;  2DD4 A;  2PU9 B;  4ZGE B;  2DXB A;  3VYG A;  3A8M B;  1QP3 A;  2ZPE B;  1UGP B;  2ZPI B;  2PUK B;  1AHJ B;  4KT0 E;  3A8O B;  2ZPH B;  4OB3 B;  2QDY B;  4RKU E;  4ZGJ B;  2PVO B;  3LW5 E;  3WVE B;  2CZ7 B;  1DJ7 B;  3WVD B;  2ZPB B;  1UGS B;  2ZPG B;  1JB0 E;  4OB2 B;  2WSE E;  2ZZD A;  3A8L B;  4L6V 5;  3X25 B;  3X24 B;  2CZ1 B;  1PSF A;  3QXE B;  1QP2 A;  3VYH B;  1UGR B;  4XK8 E;  2AHJ B;  3QYH B;  2PUO B;  1PSE A;  1V29 B;  4Y28 E;  4FM4 B;  4OB1 B;  2ZPF B;  2ZCF B;  1GXI E;  1UGQ B;  3X28 B;  4OB0 B;  3HHT B;  2WSF E;  2PVG B; 
#chains in the Genus database with same CATH topology
 2PTK A;  1ZUU A;  1XNI A;  2HL3 A;  5GAN 4;  2KGT A;  3MEA A;  1ABO A;  2CSQ A;  4C5E A;  1K9M R;  3JCM b;  1WX6 A;  2QDL A;  3OYM A;  2KR3 A;  2AT1 B;  3O5Z A;  2QTX A;  5CKF A;  2YRV A;  5DM7 R;  3URG A;  4BDZ A;  4JZ3 A;  4MML A;  1Y7X A;  1ZX6 A;  5GAN g;  1Q95 G;  4CI0 C;  1NJI R;  1IGU A;  4OMN A;  2JTM A;  4CC4 B;  3MCA B;  1HK9 A;  3CXC A;  1PHT A;  1ZHI A;  1YJ9 A;  2FZG B;  1G3T A;  1CKA A;  1UJY A;  4LD6 A;  3L2U A;  2EJG A;  4HCB A;  4E7H A;  1AVZ C;  3WVE B;  2QQS A;  2D6F A;  2P0K A;  3C94 A;  3QHS A;  2XK0 A;  5A0G A;  2RQU A;  3I56 Q;  2WSE E;  2J6K A;  5DY9 A;  3SEM A;  3FDR A;  4OP0 A;  3AHU A;  3GBQ A;  2L89 A;  1WIE A;  4EMK B;  2JZ2 A;  3VV0 A;  2L3Q A;  3QYH B;  3CCU A;  3G6E A;  2E10 A;  2K5I A;  3JCM J;  2HBP A;  5CQX A;  5AT1 B;  1X43 A;  2QK0 A;  7AT1 B;  4RG2 A;  1UB4 A;  1C1A A;  4OB0 B;  1B07 A;  2QAZ A;  2PVG B;  2EQK A;  3LX7 A;  1W2B A;  3EFS A;  4C8Q D;  1KHI A;  4OML A;  1M1K C;  3TRE A;  3A8H B;  1YCY A;  1Q86 C;  3CCE T;  2XDP A;  2JTE A;  1NE8 A;  2DTH A;  4HXJ A;  1QVG S;  4DEY A;  2F5T X;  1U5S A;  2RO0 A;  1RLP C;  2KT8 A;  3QG1 A;  2OTL A;  5IHI A;  2A08 A;  5J3B A;  5KYU B;  4KH0 B;  2O4X B;  3M54 A;  1IHW A;  2E3I A;  2JOY A;  1VQ8 Q;  4PFP A;  1IRE B;  4E7L A;  1YIJ T;  1ZBX A;  2QXF A;  4BE2 A;  1D1B A;  5IHK A;  1LVK A;  3G7Z A;  1BK2 A;  4C0F A;  5IXB A;  2F2W A;  1BCO A;  1SRM A;  2B86 A;  4KRT A;  2KRN A;  4JLG A;  1N27 A;  3ZFJ A;  2CH4 W;  1OPK A;  2RJC A;  1G3Y A;  3BDL A;  1X6B A;  3QDF A;  4LDW A;  2HL5 C;  3A8O B;  5IH2 A;  2ZPH B;  2KK4 A;  2HQE A;  2YHT A;  5HCK A;  1K73 U;  2LNH B;  2RI3 A;  2J6O A;  3MEU A;  5FU7 C;  3WVD B;  3OYA A;  1Z9Z A;  5LJ3 d;  3CCS A;  1Q81 R;  2LZ6 B;  2ZPB B;  1JB0 E;  1BI1 A;  2W0Z A;  3JB9 H;  3OY9 A;  2JN0 A;  4R0K A;  2FEI A;  4L6V 5;  4KGX B;  4N4G A;  1QW1 A;  1YWO A;  4C92 E;  2AKL A;  1TS9 A;  1Y96 A;  5FU6 B;  3EFO B;  2JT4 A;  3CPW P;  3SWN B;  1FX7 A;  1D1A A;  4HVV A;  2VVK A;  1F1B B;  2HQH A;  1KC8 C;  1QCN A;  4LE9 A;  1BBZ A;  2J06 A;  4PKC C;  3BFM A;  4PJJ A;  1WGS A;  3CCL T;  2CP5 A;  3RKW A;  1GXI E;  4LDU A;  1UFF A;  2RJE A;  3TCJ A;  2XDD A;  1M1F A;  3MP8 A;  4CC3 A;  1U1T A;  2RK2 A;  2EKH A;  1E6G A;  1RAE B;  1QWF A;  4KGZ B;  1WI7 A;  2F1L A;  5I2S A;  2E1H A;  4WTO B;  2L3P A;  5LJ5 d;  1GFD A;  2QI2 A;  2LJ3 A;  3JCM d;  1OOT A;  2Z0W A;  4M7A E;  3I56 A;  2P0Q A;  1WHL A;  3CCV T;  4D8K A;  5CQY A;  4Y92 A;  2ABL A;  3CCE Q;  4J6X A;  2GF7 A;  3M53 A;  4QKU A;  3CMA Q;  2DXC A;  4M7D G;  2JM8 A;  4J9D A;  3ZL7 C;  2DL3 A;  2LRQ A;  1FMW A;  4IIM A;  2DO3 A;  4QW2 A;  2ED1 A;  2KSS A;  4FCY A;  4JJC A;  4FIB A;  4II1 A;  1YIJ Q;  1YWP A;  1M8M A;  2V26 A;  4M7D F;  1U1S A;  1K76 A;  3MO8 A;  1UEC A;  2ZPI B;  3UA7 A;  4J9I A;  2DJZ A;  4M77 D;  1SEM A;  2FB7 A;  4E47 A;  2RPN A;  1H64 1;  3O8V A;  2V8I A;  4FYV B;  4M78 B;  5GMK h;  4C8Q A;  4X9C A;  1V76 A;  2KRO A;  4BE1 A;  4GY5 A;  1K0X A;  2R5M A;  3OYY A;  2M0O A;  3A8L B;  3UF4 A;  3QWX X;  2L5Q A;  5CR2 A;  3I5R A;  1VQ8 A;  5CKE A;  3CD6 T;  5I2M A;  4XK8 E;  4IUT A;  2VC8 A;  3M9Q A;  4A4E A;  1JJ2 S;  1WXU A;  2NUT B;  1EIF A;  3GPL A;  1OQK A;  3FLG A;  3REB B;  4EIK A;  1HJD A;  4WCI A;  3D7S B;  3V7S A;  5FWC A;  4PJO D;  3CCM T;  2K3Y A;  1RAB B;  2E3H A;  4XTY A;  2JNG A;  3KXT A;  1W4S A;  2MIO A;  4E7J A;  1ZSZ B;  4IUV A;  3C4S A;  1TWB A;  3TU4 K;  2CT3 A;  3RES A;  2LQN A;  1M1G A;  2V8K A;  3C12 A;  3MPU B;  1GCP A;  1M2V B;  1VOM A;  2BZ8 A;  4B9W A;  3BW1 A;  2PQW A;  4AFZ C;  3LGL A;  1M8V A;  4LUD A;  1WA7 A;  4E6R A;  1M9S A;  4R55 A;  1M5Q 1;  4M7D C;  5GMK m;  3JSC A;  5GAN d;  5LL6 S;  3RNJ A;  1YIT Q;  3RKX A;  2RHI A;  4PFZ A;  5KYW B;  1LCK A;  5ECA A;  2MWP A;  5CK9 A;  1QP3 A;  4J9B A;  3M0S A;  4PLI A;  3FB9 A;  1AEY A;  1KJW A;  4MZP A;  1VQ7 Q;  1I5L A;  2Y4X A;  3OQ5 A;  2DLP A;  2YUQ A;  3ME9 A;  2LQW A;  1K8A C;  3H6Z A;  3SHW A;  1MHN A;  2E64 A;  1Q7Y R;  5A0D A;  1ZSG A;  2LP5 A;  1MV3 A;  2QA4 Q;  3EAE A;  5GAN 8;  1JXM A;  4JS4 A;  4BAC A;  1T0H A;  2R58 A;  4CRI A;  1GCQ A;  3EG9 A;  1QCF A;  1RAD B;  3UA6 A;  2V8J A;  3CCE A;  3CC7 T;  3M5A A;  2YRD A;  2CZ1 B;  3EG3 A;  1PSF A;  3RIR A;  3CMA A;  1QP2 A;  4BE0 A;  2DA9 A;  2V1R A;  2CT4 A;  4JDS A;  3MEW A;  1WJR A;  1WHK A;  4HT8 A;  2EQU A;  1H8K A;  3U23 A;  2KQW A;  3GNF B;  1G5V A;  2JUF A;  1N8R R;  1VQM T;  3CD6 Q;  1WHM A;  1YIJ A;  2RF0 A;  4FYY B;  5FU6 C;  2PZ1 A;  1SSH A;  3QJ6 A;  2KXD A;  1SF9 A;  4DEX A;  3X28 B;  2HSP A;  1R0C B;  5KCH A;  1Y0M A;  4E2F B;  3TEE A;  2RHZ A;  1ACM B;  4M77 A;  4C8Q G;  2YLB A;  3CCM Q;  2L3R A;  3A1P A;  2A0F B;  2MI6 A;  2JS2 A;  4RTV A;  4JJN K;  2MWO A;  2HKN A;  1VQ4 T;  1WZO A;  4RCC A;  4C8Q F;  1RAG B;  2VAS A;  1SPK A;  1Y71 A;  3H8Z A;  4RUG A;  1MMD A;  3JV3 A;  2MCN A;  3J7A F;  3CC2 Q;  3RR6 A;  4M75 D;  5D7U A;  4QQD A;  3Q1J A;  2DXT A;  4M4Z A;  1MV0 B;  1T0J A;  3HRS A;  1D09 B;  1NM7 A;  4PJO A;  1JXO A;  4J83 A;  2LT1 A;  1X69 A;  5FRN A;  5GAO m;  1NLO C;  1S72 T;  2K3B A;  2VYT A;  4RTY A;  2LQ8 A;  2NUP B;  1LPL A;  2D8H A;  1KD1 U;  2DYI A;  2RMO A;  4XU2 A;  1PM3 A;  3RBB B;  1KQ1 A;  2K4Y A;  2NLU A;  2VGM A;  2YRC A;  1BB9 A;  1JRI A;  2H8H A;  2OTJ T;  3BDU A;  3LGF A;  1MGQ A;  4ZNX A;  5FU7 B;  3VUZ A;  2RI2 A;  1NBE B;  3VKI A;  2YUN A;  3OYG A;  1YJN T;  2KYB A;  1PRM C;  3OYC A;  2DBK A;  4JRK A;  1AD5 A;  4C92 B;  9ATC B;  1YIT A;  4FU6 A;  2EGA A;  4HT9 A;  4FM4 B;  1SSF A;  2QGF B;  1UHC A;  1IGQ A;  2HKQ B;  3OB9 A;  1ZA1 B;  2WAC A;  4O5V A;  5HK0 A;  2GTJ A;  2OJ2 A;  2FPD A;  1VQ7 A;  3QKJ A;  4Z89 A;  4DOV A;  4PJM A;  1BI0 A;  4A63 B;  3CQT A;  3LWH A;  4C0D B;  4C8Q C;  5KE3 A;  5C0M A;  2KT1 A;  5I22 A;  2H3J A;  1G3S A;  2QA4 A;  1QVG P;  1NJI C;  3M59 A;  2AZS A;  5HK3 A;  5LJ3 e;  1KD1 C;  4X34 A;  1KFZ A;  1JJ2 A;  5GAN 6;  5KYY A;  3S3O A;  2E70 A;  3JAM E;  4EDU A;  2CP2 A;  1ZUY A;  2FVU A;  1UEB A;  2ZAE A;  1VYV A;  1B34 B;  1NPR A;  3LLR A;  1KG1 A;  3DB4 A;  1VQ4 Q;  4XTW A;  4ZGE B;  1MMA A;  3CCS Q;  2GGR A;  3MET A;  2J6F A;  5J26 A;  3CD6 A;  4J6W A;  2K2M A;  1Q82 R;  5KH6 A;  4TVR A;  2A36 A;  2DJQ A;  4F04 B;  3HPW A;  5GAO p;  4B9X A;  4B6M A;  1VQK T;  2ROT A;  4RCB A;  1ZBJ A;  1YJW T;  2RNA A;  5L23 A;  1ZQ1 A;  3EGD B;  3CCM A;  2DAQ A;  3SFM A;  4E7K A;  2KDS A;  2X3X D;  5LJ5 e;  2EAY A;  4UC4 A;  3RKY A;  2ZPG B;  3JCM e;  1OV3 A;  4J9H A;  4C5G A;  3JB9 J;  4BUG A;  3CC4 T;  3CBM A;  5GAM g;  2F5K A;  3T9N A;  1GBQ A;  1M1K U;  2H3E B;  2HEQ A;  1Q86 U;  4Y28 E;  3CC2 A;  3OA6 A;  2M0Y A;  4YTL A;  2QG9 B;  1I07 A;  4M75 A;  4EMK A;  3MP6 A;  2RJF A;  3ASK A;  1PCX A;  2E5K A;  2SEM A;  2ZCF B;  3MKD A;  2VUB A;  1TUG B;  3QII A;  4C92 G;  1RAF B;  5IT9 E;  2A3L A;  2E41 A;  1VQN Q;  2HZY A;  3P8D A;  2NWM A;  1HYO A;  4RMO A;  2X9H A;  3JCM W;  4FSS A;  4C92 F;  4PJO F;  3H0I A;  4M78 D;  1FMV A;  2WSC E;  5C6S A;  1NEG A;  2HQX A;  4J9F A;  1QMC A;  1LOJ A;  3QZ9 B;  1D3B A;  3CCR T;  1K0S A;  2ED0 A;  2ATC B;  1GRI A;  2MYS A;  4OMP A;  4XU0 A;  2X4W A;  4N0A A;  1N5Z A;  1CSK A;  2O4X A;  1BIA A;  4M7A G;  1KQS S;  3CME T;  3HRU A;  1M27 C;  3CCJ T;  5EC7 A;  3S3M A;  4OMO A;  1WJS A;  4M7D B;  2E65 A;  4RTW A;  2X4J A;  2AZV A;  4DBQ A;  4ATO A;  2RQR A;  4E7I A;  3JB9 I;  1G2B A;  4M7A F;  1JO8 A;  3OS2 A;  2K5F A;  1UG1 A;  3DLM A;  1KC8 U;  1I0C A;  1VQK Q;  2MPX C;  5A0L A;  4M77 E;  1YHQ T;  1NEB A;  1VQ9 T;  2DRK A;  3NFC A;  2ENM A;  2KI7 A;  1QVF P;  3X25 B;  3RMS A;  2QYZ A;  5GMK i;  2X35 A;  2RI5 A;  2HCK A;  1OZ2 A;  2YDL A;  2AHJ B;  2DBM A;  4RTZ A;  2YT6 A;  1H92 A;  3OYI A;  1WYX A;  5GAN e;  1VQ4 A;  4X1V A;  4PL6 A;  1YI2 T;  2EYY A;  4OB1 B;  4KUI A;  1MND A;  2K7A A;  1RAA B;  2RHU A;  1W1F A;  2PNI A;  4AT1 B;  3REA B;  1XOV A;  3RER A;  4C92 C;  2RM4 A;  2D8J A;  3OYF A;  2D9T A;  3JCM P;  1OX8 A;  2VXE A;  3GF5 A;  1YN8 A;  1M1K R;  4AFS C;  1Q86 R;  3OW2 A;  1WQW A;  4PJO E;  2C0T A;  3QDR B;  1B3Q A;  1R0B G;  1LJO A;  1PD1 A;  1QQJ A;  3QJY A;  2P84 A;  1TU0 B;  2G6F X;  4J7F A;  3EGX B;  2EVR A;  4C0D C;  1I81 A;  1TSF A;  1RAC B;  1KQ2 A;  3R6N A;  3OMG A;  2CZ6 B;  4F16 A;  2KMT A;  1VIE A;  3CXC P;  3RDV A;  4ELY C;  3NMZ C;  3CCR Q;  4M7A C;  3M58 A;  2EFI A;  4JPB W;  2JTF A;  3LH0 A;  3CBP A;  4C0Z A;  3RMQ A;  2QGG A;  2DNU A;  1JU5 C;  2AKK A;  1BYM A;  4XU3 A;  3THK A;  2DIL A;  3CME Q;  2MMP A;  3M4G A;  5D6X A;  1VQN A;  2FZK B;  2QDY B;  3S3N A;  4M75 F;  3VS4 A;  1XTD A;  2M1H A;  5GAN 5;  5FRO A;  2DE0 X;  1YFN A;  3PVQ A;  2A28 A;  2CZ7 B;  4FL6 A;  2B8A A;  1X2K A;  5EG2 A;  3G4S T;  1IO6 A;  4EMG A;  2ROL A;  1VA7 A;  2M02 A;  1SHF A;  4J8O A;  1OU8 A;  2CDT A;  2ZZD A;  2EKO A;  2M16 A;  2CP0 A;  2DTI A;  1X75 C;  5IN1 A;  1I8F A;  3G71 T;  1WLP B;  4V2S A;  2QTV A;  1KC8 R;  1FYN A;  1PNJ A;  5KYX A;  4D6W A;  3EHQ A;  1RI9 A;  1PWT A;  1PC0 A;  2BIV A;  3GP8 A;  4BY6 C;  2DYB A;  2ZPF B;  5CVI A;  3TSZ A;  2EW3 A;  1EZZ B;  4OMF B;  3EH2 A;  1RUW A;  3I35 A;  4J9C A;  2NUT A;  2GFU A;  2WSF E;  1YI2 Q;  1W2B P;  5HKC A;  1OUL A;  3FEO A;  2F2X A;  3QUI A;  3VJP A;  1K73 R;  1IRX A;  2DPP B;  5GMK j;  3M0T A;  4ZTF A;  3V8J A;  1X6G A;  2ZGW A;  1VQK A;  1ZSZ A;  2XKO C;  2XID A;  2RJD A;  1WHJ A;  2DXU A;  3V7R A;  2COZ A;  4AFQ C;  4C8Q B;  2EBP A;  4AG2 C;  2VV5 A;  3A8G B;  1K8A U;  4NOY A;  2HD0 A;  2C06 A;  4FT4 A;  4OMM A;  5IAY A;  3CCL Q;  1PG5 B;  1K1Z A;  1H3H A;  2O88 A;  1U3O A;  2Y90 A;  1KK7 A;  2MOX A;  4QQ6 A;  3I9Q A;  4M75 E;  2L2P A;  3M0U A;  3DB3 A;  2L3S A;  4VUB A;  3ZBD A;  2OAW A;  3NPF A;  2RN8 A;  4QVZ A;  5LJ3 h;  5LJ3 f;  1NZ9 A;  3CPW S;  3CCV Q;  4AFU C;  3JB9 D;  5FRM A;  1D0Y A;  4HA8 A;  2JMC A;  4Q5W A;  1XQH A;  1E7O A;  5CKH A;  3P8H A;  2VWF A;  3GIB A;  1KQS A;  3HSB A;  2K57 A;  2BE7 D;  4BI8 B;  3OBW A;  3VS1 A;  4C5I A;  4F7U A;  5LJ3 j;  2FPE A;  5GAM d;  3G4S Q;  2AK5 A;  1PD0 A;  1N9R A;  4IIO A;  3EH1 A;  1AWW A;  4FSX A;  4NS5 A;  5GAO q;  5KE2 A;  3CCR A;  1NYF A;  2E6Z A;  3AT1 B;  4PJN A;  3NTK A;  3G6E T;  5HY6 A;  1J3T A;  1K9A A;  2EJ9 A;  2CKK A;  4FYX B;  5LJ5 h;  6AT1 B;  1PKS A;  3CME A;  4HVU A;  5LJ5 f;  1Z9Q A;  1PRL C;  3OMC A;  4JLI A;  3JCM h;  3MHX A;  5CIU A;  3JCM f;  4OMQ A;  3C95 A;  1VQO T;  3M4Y A;  1ZA2 B;  3UWN A;  2FRY A;  2XU8 A;  4LD9 K;  1C6V X;  4FW1 A;  2KXC A;  4LNP A;  3OSV A;  4HCC A;  2QQ9 A;  1WDX A;  1RAI B;  2LTO A;  2LDM A;  5CAI A;  3HP9 A;  2OTL T;  3PE0 A;  2EGC A;  3QPH A;  3EG9 B;  4Y91 A;  1XJW B;  3A98 A;  3BE3 A;  1M90 U;  1AWX A;  3A8M B;  1KHC A;  1WNL A;  2E4H A;  2D1X A;  4FW2 A;  1VQL T;  3KFV A;  4JZ4 A;  2EYW A;  2CP6 A;  1W6X A;  2LQK A;  1K8A R;  1YI2 A;  4QT7 A;  4FT2 A;  2DTO A;  2HBW A;  2LCL A;  2COW A;  4EMH A;  3OYE A;  1IHV A;  1WXT A;  2CS7 A;  3MEV A;  2BTT A;  2QEX T;  4C0G A;  1X01 A;  2QQA A;  3LH5 A;  5KCO A;  3JRZ A;  2RK1 A;  1ARK A;  2LC4 A;  2NUP A;  2OX7 A;  3CBO A;  2KRM A;  4M77 B;  1BIB A;  3MP1 A;  4HCK A;  5FWB A;  2X4X A;  3UT1 A;  3CCL A;  4LDX A;  1PSE A;  1NJI U;  1QKX A;  8ATC B;  4Z88 A;  3PIO A;  1OYX A;  2RQT A;  4ORZ A;  2BKD N;  3PMI A;  4MZM A;  1M90 C;  4HVW A;  2R5A A;  2RHX A;  3VU3 C;  2P4R A;  1A0N B;  1UGQ B;  3OW2 S;  4KBM B;  3VS5 A;  4M7D D;  5I21 A;  4A4G A;  5IHN A;  4BB7 A;  1N6A A;  2YUO A;  4ME7 A;  1HD3 A;  3L2W A;  3QWY A;  1KSW A;  3CCV A;  1NLP C;  3L42 A;  4PJO B;  4FYW B;  2DVE A;  2MAM A;  2DRM A;  3CC7 Q;  4E7S A;  2NYS A;  3H0H A;  2DM1 A;  1K9M C;  4Z8A A;  3QZ5 B;  3SB2 A;  1VQO Q;  3OYL A;  1YNZ A;  1VQ5 T;  2K79 A;  4J9E A;  3PVL A;  4M78 E;  3VS2 A;  5GAN h;  1Q82 C;  5GAN f;  4DBH A;  3G4S A;  2CRE A;  3HRT A;  5GAO n;  4DA4 A;  2LCC A;  1IZ6 A;  1VQM Q;  1RI0 A;  4P5N A;  4Z02 A;  1QVP A;  1R77 A;  2DXB A;  3VYG A;  1WHG A;  2GQV A;  1ZLM A;  2AIR B;  4F7U F;  3BY7 A;  4JS5 A;  5GAN j;  2KBT A;  1ZUK A;  2K2V A;  3TSW A;  4M7A B;  1AHJ B;  4KGV B;  2QQB A;  3F70 A;  3I5S A;  4OB3 B;  1VQL Q;  5GJW B;  4C5H A;  2YSQ A;  2PVO B;  2EYX A;  3LW5 E;  2VXF A;  1AT1 B;  1TOV A;  2VB6 A;  3FRN A;  2DL8 A;  2HSE B;  5D6W A;  1RLQ C;  3E2U A;  4PLL A;  4MZT A;  1UDL A;  2O31 A;  1K4U S;  2RD1 A;  2E5Q A;  4CC7 A;  2VKN A;  4JUV A;  2QEX Q;  1WHH A;  2OI3 A;  3A5Z B;  2LMJ A;  4X9D A;  2A7Y A;  4JJD A;  5KYY B;  4M77 G;  3PMT A;  4DBF A;  1VQ8 T;  2MK5 A;  3INZ A;  1I4K 1;  3PNW C;  5KYN A;  3CPW A;  3VRZ A;  1S72 Q;  1I1J A;  1TXQ A;  1CKB A;  2DZC A;  2L0A A;  2FYK A;  2GNC A;  2M9U A;  1S1N A;  1WFW A;  3HHT B;  4M77 F;  3VRY A;  3KUF A;  4BY6 B;  3OS1 A;  3NTH A;  1UJ0 A;  1KD1 R;  3VS7 A;  2OTJ Q;  4XAX B;  4LN2 A;  1Q81 U;  1HXD A;  2E6N A;  1X6O A;  1YJN Q;  3DLL A;  2DL5 A;  4XQ3 A;  1G83 A;  4PJO G;  3V8L A;  5GAN 7;  1YBY A;  1OI1 A;  2RQV A;  3CCQ T;  2IPO B;  4F7U E;  3C0C A;  5DLO A;  3V8K A;  1VQ5 Q;  1VIF A;  1AWO A;  2GFA A;  3PFS A;  3OYB A;  4WF2 A;  3JCM X;  1VYU A;  3R6O A;  2CH4 A;  4A4F A;  2RQW A;  3J80 E;  1GCQ C;  1O75 A;  2K5L A;  1R8O B;  1H3Z A;  1WPY A;  4KT0 E;  2YLC A;  4M75 B;  4M7D A;  1U06 A;  1UUE A;  3EG1 A;  4O6J A;  3KBG A;  1M4Z A;  5GAN 2;  1GL5 A;  1AOJ A;  4F14 A;  2JVV A;  1V1C A;  4PNO A;  1NYG A;  3PIP A;  5KYU A;  1GFC A;  1DJ7 B;  3JB9 G;  2YWW A;  1M3B A;  3M56 A;  3CC7 A;  1UGS B;  4AMC A;  2DF6 A;  5FW9 A;  2XD0 A;  5CKD A;  2OAU A;  4GLM A;  1Q81 C;  4OVA A;  1AWJ A;  4IUR A;  1VQO A;  3X24 B;  1B7T A;  1VQ6 T;  2F69 A;  4ELZ C;  3JB9 F;  5GMK l;  2L8D A;  2W10 A;  2R57 A;  4L5G A;  2RA2 A;  3HTR A;  3L2Z A;  3L2Q A;  4M77 C;  1VQM A;  2QQR A;  2C0O A;  2LX7 A;  2HMA A;  1D3B B;  2KY9 A;  3VS0 A;  3DKM A;  3FIF A;  3L2V A;  3CMA T;  4MDX A;  1OU9 A;  1W70 A;  1HSQ A;  1YJW Q;  1NPP A;  4K11 A;  2JM9 A;  2DX1 A;  1KIK A;  1YP5 A;  3G1J A;  5D6Y A;  2XMF A;  5GJV B;  4BI4 A;  2COY A;  2LJ1 A;  3QO3 A;  2X3W D;  1P92 A;  1O9S A;  1VQL A;  1TTH B;  3LYI A;  1VUB A;  3E19 A;  3EFR A;  4DQ2 A;  3CC4 Q;  4MMK A;  1JJ2 P;  1BI2 A;  1OX9 A;  4ZN1 A;  2DEU A;  2DL7 A;  1UE9 A;  3V7C A;  2JW4 A;  2X4Y A;  3EFO A;  4RTU A;  3SWN A;  1OZ3 A;  3J81 E;  2KEA A;  1WXB A;  4PJO C;  2QEX A;  3H0F A;  1JBM A;  2V1Q A;  1M30 A;  1IB8 A;  4QQG A;  3RUX A;  2K6D A;  3EGX A;  4ZN3 A;  2ECZ A;  2EGE A;  5GAM e;  3PT9 A;  2CUB A;  1BKB A;  5CO7 A;  1N9S A;  3OS0 A;  4XU1 A;  1VYT A;  2JMA A;  2DET A;  1TG0 A;  1UGV A;  4RG8 A;  3CCQ Q;  5I11 A;  1VQP T;  1S72 A;  2DIQ A;  1QKW A;  2EIF A;  5GAN 3;  4PK4 A;  2X51 A;  3ER0 A;  1TUC A;  3EGU A;  4CC2 A;  4OF1 A;  2CP7 A;  5FLX E;  3L1A A;  4PJL A;  4QVC A;  1MNE A;  2OTJ A;  2XG8 D;  2CSI A;  2LNV A;  4M75 G;  2KVQ G;  1YJN A;  1Y96 B;  4PFO A;  1MMN A;  4NL2 A;  3ZEH A;  3N5B B;  4RTT A;  3CCJ Q;  4NL3 A;  3CEY A;  3QBY A;  1TH7 A;  4XTV A;  1K73 C;  2EQJ A;  1VQ5 A;  3FJP A;  1VQ6 Q;  3ULR B;  1UTI A;  3SD4 A;  1EFN A;  2C0I A;  1YIT T;  4M78 A;  1YCS B;  4XTZ A;  3UPU A;  2VGN A;  2KRS A;  2YUP A;  1QLY A;  1M2O A;  4J6Y A;  4F17 A;  2BE9 B;  2DIG A;  3MJX A;  4KUL A;  5DLQ E;  2P0P A;  4IUQ A;  5GAO l;  1YHQ Q;  1VQ9 Q;  3I55 T;  4A4H A;  2PVD B;  1Q7Y U;  2IIM A;  2CZ0 B;  1VQ7 T;  2HAX A;  1NG2 A;  3GNG A;  1OEB A;  4DOW A;  4N4H A;  2KAF A;  2A37 A;  3OYN A;  1E6H A;  1JQQ A;  2QA4 T;  1X27 A;  4OGE A;  8AT1 B;  2NUZ A;  1SHG A;  3EG0 A;  1ABQ A;  2O01 E;  2KYM A;  2DER A;  2XI9 A;  1T3L A;  3VUB A;  3TVT A;  5J39 A;  2D0N A;  1EX4 A;  3NTI A;  2PU9 B;  4OGC A;  2DK3 A;  1YJW A;  1D0Z A;  1N8R U;  4A4K A;  2FHD A;  5KYX B;  1QVF S;  2FPF A;  5CCA A;  1M2V A;  3JCM c;  2EYQ A;  3VS6 A;  1SG5 A;  2CP3 A;  4ZGJ B;  1VQP Q;  3PGG A;  1QCO A;  3CC4 A;  4QVD A;  1FXX A;  2Y4Y A;  1Q7Y C;  2BUD A;  4M75 C;  4EMK C;  4C92 D;  4ZTJ A;  4A54 A;  4KH1 B;  5KYW A;  3PTA A;  1YJ9 T;  2RH2 A;  3L2R A;  2I2L A;  2LX9 A;  1D0X A;  2CUD A;  3OS5 A;  2HDA A;  4L59 A;  2PUO B;  1SKU B;  1V29 B;  3E9G A;  5GAO r;  2XDB A;  3UAT A;  3E9F A;  3OYD A;  3TQ7 P;  2DVJ A;  1RAH B;  3CC2 T;  3CCQ A;  4GLK A;  2I0N A;  3OW2 P;  3EHR A;  1N8R C;  3GOX A;  2EJF A;  1G8X A;  3CXC S;  2JJ9 A;  3OYH A;  5AYF A;  4N0A C;  4R56 A;  4M7A D;  4M7D E;  3UDC A;  2DKG A;  2ESW A;  4N4I A;  1BU1 A;  2P4T A;  5L8R E;  3G71 Q;  2EQM A;  3I55 Q;  3EG2 A;  1QVG A;  1OPL A;  1AZE A;  1WQ7 A;  3CCU T;  4J7I A;  2EWN A;  4XTU A;  1M3A A;  2RB6 A;  1AZG B;  4LXC A;  1JEG A;  2O9V A;  1IXD A;  3CCJ A;  4ANJ A;  3X26 B;  4ZGD B;  2BZY A;  1BCM A;  3GLX A;  2E12 A;  2KNB B;  4A53 A;  2DD4 A;  1MMG A;  2BZX A;  4DBR A;  4F7U B;  1VQ6 A;  2ZPE B;  2GBQ A;  2YXY A;  1LNX A;  4LDV A;  4HKE A;  1WJQ A;  4M78 G;  3LWI A;  3HFO A;  3OSS C;  3HL8 A;  4EPC A;  1BI3 A;  2FL7 A;  5LJ5 j;  3VS3 A;  2LJ0 A;  4XTX A;  3P8B B;  2MF2 A;  3JCM Q;  1YHQ A;  1VQ9 A;  4ESR A;  1UHF A;  2EQI A;  4E7Z A;  5LJ3 g;  4M78 F;  1SRL A;  3S6W A;  5A2Q E;  4IKF A;  4IUU A;  4D8D A;  3SWN C;  5IXF A;  1W2B S;  2DFU A;  3QXE B;  4J5Y A;  2LCS A;  3VYH B;  1UGR B;  2J7I A;  2DMO A;  2KE9 A;  3QSU A;  2J05 A;  3OYJ A;  3JCM V;  2XIC A;  1YJ9 Q;  2XHC A;  2M51 A;  4BI3 A;  1K9M U;  2O9S A;  4GBQ A;  2IG0 A;  1FMK A;  1Q82 U;  2FRW A;  4AG1 C;  3CCS T;  5LJ5 g;  2CYZ B;  1I5O B;  1GBR A;  2DL4 A;  3JCM g;  1VQP A;  1D1C A;  2CGH A;  1Y07 A;  1G3W A;  4JJB A;  2DEQ A;  5CKB A;  1U8R A;  2D0Q B;  4MDW A;  5GMK e;  4C92 A;  2EPD A;  3OBY A;  2DZ9 A;  3QYG B;  4RTX A;  2DD5 A;  3CCU Q;  3X20 B;  3G6E Q;  4BD3 A;  2IVW A;  2LT4 A;  1C0M A;  3NGP A;  3FC3 A;  2GTO A;  2G3R A;  1T3S A;  4M78 C;  1UGP B;  4JRI A;  2PUK B;  2GQI A;  4IUP A;  4F7U G;  3I56 T;  4JRQ A;  3HKS A;  2LVM A;  4RKU E;  2FG0 A;  2K3X A;  3M55 A;  1TUD A;  4M7A A;  1Y57 A;  1KQS P;  5M9O A;  1VQN T;  4HCZ A;  2SRC A;  3M57 A;  4OB2 B;  1PKT A;  3G71 A;  1B34 A;  3I55 A;  2OTL Q;  5GAM h;  5GAM f;  3IQL A;  2FO0 A;  3WXM B;  2O2O A;  2EYZ A;  1QVF A;  1X2Q A;  1FWZ A;  4LUE A;  3HFN A;  4BDY A;  3H41 A;  3H9N A;  1RL2 A;  4LDY A;  3CPF A;  4JRP A;  3M0Q A;  2JXB A;  4J9G A;  1MUZ A;  1M90 R;  3NHN A;  1ZSZ C;  4C8Q E;  3E1S A;  5GAM j;  4KUD K;  2K9G A;  1M3C A;  3SDZ A;  2GCX A;  1QWE A;  3M0R A;  2JS0 A;  3EGD A;  2FZC B;  3FJ5 A;  2HNI A;  3OYK A;  2QAS A;  2F2V A;  3M0P A;  2RHY A; 
#chains in the Genus database with same CATH homology
 1O9S A;  2RHZ A;  3QUI A;  1XNI A;  3OYA A;  3VJP A;  1VQL A;  2DPP B;  5GMK j;  3LYI A;  5GAN 4;  4M77 A;  1VUB A;  4ZTF A;  3E19 A;  3MEA A;  3V8J A;  4C8Q G;  2YLB A;  3CCS A;  3EFR A;  4DQ2 A;  2L3R A;  2ZGW A;  4C5E A;  1VQK A;  4MMK A;  3JCM b;  1BI2 A;  4ZN1 A;  2MI6 A;  2XKO C;  3V7C A;  3OYM A;  2X4Y A;  2XID A;  2RJD A;  2DXU A;  3V7R A;  2QTX A;  5CKF A;  2YRV A;  1OZ3 A;  3SWN A;  3J81 E;  4JJN K;  2MWO A;  4C8Q B;  5DM7 R;  1VQ4 T;  4PJO C;  3URG A;  2QEX A;  4BDZ A;  4MML A;  4RCC A;  4C8Q F;  2VV5 A;  3A8G B;  1JBM A;  1K8A U;  1Y7X A;  5GAN g;  4QQG A;  3RUX A;  4NOY A;  1Y71 A;  3H8Z A;  2HD0 A;  2C06 A;  4ZN3 A;  4FT4 A;  5GAM e;  5IAY A;  4CI0 C;  3PT9 A;  3J7A F;  2JTM A;  1BKB A;  5CO7 A;  1N9S A;  4M75 D;  3MCA B;  1HK9 A;  3OS0 A;  4XU1 A;  3CXC A;  1ZHI A;  1YJ9 A;  3CC4 A;  4QQD A;  1G3T A;  3Q1J A;  2Y90 A;  2DXT A;  4QQ6 A;  4RG8 A;  1VQP T;  1S72 A;  2DIQ A;  3HRS A;  4M75 E;  2EIF A;  3DB3 A;  4PJO A;  4VUB A;  5GAN 3;  4LD6 A;  3L2U A;  3ZBD A;  4J83 A;  3ER0 A;  2LT1 A;  5FRN A;  5GAO m;  2EJG A;  4QVZ A;  4HCB A;  5LJ3 h;  4E7H A;  4OF1 A;  1S72 T;  2VYT A;  5FLX E;  5LJ3 f;  2LQ8 A;  1NZ9 A;  3CPW S;  3L1A A;  3WVE B;  4QVC A;  3JB9 D;  5FRM A;  4HA8 A;  4Q5W A;  1XQH A;  2QQS A;  1KD1 U;  2D6F A;  2OTJ A;  2P0K A;  3C94 A;  2XG8 D;  3QHS A;  4XU2 A;  2XK0 A;  3P8H A;  5CKH A;  1KQ1 A;  2K4Y A;  2LNV A;  4M75 G;  5A0G A;  2KVQ G;  2NLU A;  2WSE E;  3GIB A;  4E7K A;  1KQS A;  3HSB A;  2K57 A;  5DY9 A;  2VGM A;  4BI8 B;  1YJN A;  3OBW A;  1Y96 B;  1JRI A;  2OTJ T;  3BDU A;  3FDR A;  1MGQ A;  3LGF A;  4C5I A;  4NL2 A;  5FU7 B;  3ZEH A;  3VUZ A;  4F7U A;  3N5B B;  4OP0 A;  5LJ3 j;  3AHU A;  2RI2 A;  3VKI A;  5GAM d;  2L89 A;  3OYG A;  1YJN T;  4NL3 A;  4EMK B;  2JZ2 A;  3CEY A;  1N9R A;  3QBY A;  3VV0 A;  1TH7 A;  3OYC A;  3QYH B;  4JRK A;  4C92 B;  3CCU A;  1YIT A;  4FSX A;  4NS5 A;  3G6E A;  5GAO q;  4FU6 A;  5KE2 A;  2E10 A;  2K5I A;  4XTV A;  3CCR A;  1K73 C;  4HT9 A;  2EQJ A;  4FM4 B;  1VQ5 A;  3JCM J;  2E6Z A;  2HBP A;  1SSF A;  3FJP A;  5CQX A;  3SD4 A;  3NTK A;  1YIT T;  3OB9 A;  3G6E T;  4M78 A;  4XTZ A;  5HY6 A;  2WAC A;  4RG2 A;  3UPU A;  2VGN A;  1UB4 A;  2EJ9 A;  4O5V A;  5HK0 A;  1Q7Y C;  2CKK A;  4OB0 B;  4J6Y A;  2DIG A;  5LJ5 h;  1VQ7 A;  3CME A;  3QKJ A;  4KUL A;  5DLQ E;  2P0P A;  4DOV A;  5LJ5 f;  2PVG B;  4IUQ A;  2EQK A;  3LX7 A;  3OMC A;  4JLI A;  3JCM h;  1BI0 A;  5GAO l;  3I55 T;  3MHX A;  5CIU A;  1W2B A;  3EFS A;  3JCM f;  4C8Q D;  3LWH A;  1KHI A;  4A4H A;  2PVD B;  1M1K C;  4C0D B;  3TRE A;  1Q7Y U;  4C8Q C;  5KE3 A;  3A8H B;  1YCY A;  3C95 A;  5C0M A;  1VQO T;  2CZ0 B;  1Q86 C;  3M4Y A;  1VQ7 T;  3UWN A;  2H3J A;  2XDP A;  1G3S A;  2XU8 A;  2QA4 A;  1NE8 A;  2HAX A;  3CCE T;  4LD9 K;  2DTH A;  3GNG A;  1QVG S;  1NJI C;  3M59 A;  4DOW A;  4N4H A;  2F5T X;  2KAF A;  5HK3 A;  5LJ3 e;  3OYN A;  2RO0 A;  1KD1 C;  4X34 A;  3OSV A;  4HCC A;  2QQ9 A;  3QG1 A;  5GAN 6;  1JJ2 A;  2OTL A;  3S3O A;  2LTO A;  2QA4 T;  2LDM A;  2E70 A;  5J3B A;  4OGE A;  2O4X B;  3JAM E;  4EDU A;  3M54 A;  5CAI A;  2JOY A;  3HP9 A;  1IRE B;  2FVU A;  4E7L A;  2OTL T;  1YIJ T;  2O01 E;  1UEB A;  1ZBX A;  1B34 B;  2QXF A;  4BE2 A;  2XI9 A;  3QPH A;  1NPR A;  3VUB A;  5J39 A;  3LLR A;  4Y91 A;  3DB4 A;  1KG1 A;  3NTI A;  3G7Z A;  4C0F A;  4XTW A;  2PU9 B;  4OGC A;  4ZGE B;  1M90 U;  2DK3 A;  3A8M B;  1KHC A;  1WNL A;  3MET A;  1VQL T;  4JLG A;  1YJW A;  1N27 A;  5J26 A;  1N8R U;  3ZFJ A;  3CD6 A;  4J6W A;  2RJC A;  4A4K A;  2FHD A;  1G3Y A;  3BDL A;  4TVR A;  5KH6 A;  3HPW A;  5GAO p;  1QVF S;  2LQK A;  4B9X A;  1VQK T;  4LDW A;  5CCA A;  4RCB A;  3JCM c;  2EYQ A;  1YI2 A;  3A8O B;  4FT2 A;  1YJW T;  2DTO A;  2ZPH B;  2KK4 A;  2HQE A;  2LCL A;  2YHT A;  4EMH A;  3OYE A;  4ZGJ B;  1K73 U;  2CS7 A;  3MEV A;  2RI3 A;  1ZQ1 A;  3PGG A;  3MEU A;  3CCM A;  2DAQ A;  5FU7 C;  4C0G A;  2QEX T;  1X01 A;  2QQA A;  3SFM A;  3WVD B;  4QVD A;  5KCO A;  3JRZ A;  2KDS A;  1FXX A;  5LJ3 d;  2Y4Y A;  5LJ5 e;  2RK1 A;  2BUD A;  2EAY A;  2ZPB B;  4UC4 A;  4M75 C;  3RKY A;  2ZPG B;  1JB0 E;  1BI1 A;  4EMK C;  3JCM e;  4C92 D;  2LC4 A;  4C5G A;  4ZTJ A;  3JB9 J;  3JB9 H;  3CBO A;  4A54 A;  4M77 B;  4BUG A;  1BIB A;  3OY9 A;  3CC4 T;  3CBM A;  3MP1 A;  2JN0 A;  5GAM g;  3PTA A;  2F5K A;  4L6V 5;  3T9N A;  4N4G A;  2RH2 A;  1YJ9 T;  1QW1 A;  3L2R A;  2I2L A;  2LX9 A;  4C92 E;  2X4X A;  3OS5 A;  1M1K U;  1Q86 U;  1Y96 A;  5FU6 B;  3UT1 A;  4L59 A;  3CCL A;  2PUO B;  4LDX A;  1PSE A;  1V29 B;  3SWN B;  1NJI U;  1FX7 A;  3E9G A;  4Y28 E;  3CC2 A;  3OA6 A;  4YTL A;  3PIO A;  5GAO r;  1KC8 C;  2XDB A;  1OYX A;  4M75 A;  4PKC C;  3BFM A;  4EMK A;  2BKD N;  3MP6 A;  2RJF A;  3PMI A;  3E9F A;  4MZM A;  3OYD A;  1WGS A;  3ASK A;  3CCL T;  2ZCF B;  3RKW A;  1M90 C;  3CC2 T;  1GXI E;  4LDU A;  3CCQ A;  2R5A A;  2RHX A;  2VUB A;  3VU3 C;  3QII A;  4C92 G;  4GLK A;  2RJE A;  1UGQ B;  3TCJ A;  3OW2 S;  4KBM B;  1M1F A;  2XDD A;  3MP8 A;  5IT9 E;  1U1T A;  1N8R C;  2RK2 A;  4M7D D;  5I21 A;  4A4G A;  2E41 A;  2A3L A;  3GOX A;  4BB7 A;  1N6A A;  2EJF A;  5I2S A;  4ME7 A;  3P8D A;  2E1H A;  3CXC S;  3L2W A;  3OYH A;  4M7A D;  5AYF A;  4N0A C;  4RMO A;  4R56 A;  3JCM W;  3CCV A;  4M7D E;  5LJ5 d;  3UDC A;  3L42 A;  2DKG A;  2QI2 A;  4PJO B;  4N4I A;  4C92 F;  3JCM d;  2DVE A;  2MAM A;  4PJO F;  4M78 D;  2P4T A;  2WSC E;  5L8R E;  5C6S A;  4M7A E;  2EQM A;  3I56 A;  2HQX A;  2P0Q A;  1QVG A;  3CCV T;  1WQ7 A;  3CCU T;  1K9M C;  1LOJ A;  3QZ9 B;  4J7I A;  3QZ5 B;  5CQY A;  2EWN A;  1D3B A;  4XTU A;  3SB2 A;  3CCR T;  3OYL A;  2RB6 A;  1VQ5 T;  5GAN h;  4J6X A;  2GF7 A;  3M53 A;  4M78 E;  1Q82 C;  5GAN f;  4XU0 A;  3G4S A;  2DXC A;  3HRT A;  4M7D G;  2X4W A;  5GAO n;  3CCJ A;  4DA4 A;  2LCC A;  1IZ6 A;  2LRQ A;  1RI0 A;  2DO3 A;  4N0A A;  4P5N A;  3X26 B;  4ZGD B;  4QW2 A;  3GLX A;  2E12 A;  2O4X A;  4Z02 A;  1QVP A;  2DD4 A;  4A53 A;  2KSS A;  1BIA A;  4M7A G;  1KQS S;  3CME T;  2DXB A;  3HRU A;  3VYG A;  2GQV A;  4FIB A;  4F7U B;  4II1 A;  3CCJ T;  1VQ6 A;  3S3M A;  2ZPE B;  4F7U F;  1WJS A;  4M7D B;  2E65 A;  1LNX A;  2X4J A;  4LDV A;  4HKE A;  1WJQ A;  4M78 G;  3LWI A;  4ATO A;  3BY7 A;  3HFO A;  4M7D F;  1U1S A;  4JS5 A;  3OSS C;  3MO8 A;  5GAN j;  3HL8 A;  4EPC A;  1BI3 A;  2FL7 A;  2K2V A;  2ZPI B;  5LJ5 j;  3JB9 I;  4E7I A;  4M7A B;  1AHJ B;  4XTX A;  2DJZ A;  3P8B B;  2QQB A;  3F70 A;  4M7A F;  4OB3 B;  2MF2 A;  4M77 D;  3JCM Q;  3OS2 A;  1YHQ A;  1VQ9 A;  2K5F A;  2FB7 A;  4C5H A;  3DLM A;  1H64 1;  3O8V A;  4E47 A;  2V8I A;  4M78 B;  5GMK h;  2PVO B;  3LW5 E;  5LJ3 g;  1KC8 U;  4C8Q A;  2VXF A;  4X9C A;  4M78 F;  3TEE A;  3FRN A;  5A0L A;  4M77 E;  3S6W A;  1YHQ T;  1VQ9 T;  4BE1 A;  4GY5 A;  5A2Q E;  5D6W A;  2R5M A;  4PLL A;  4IKF A;  4MZT A;  3NFC A;  2M0O A;  3A8L B;  3OYY A;  4IUU A;  3SWN C;  2RD1 A;  2E5Q A;  3X25 B;  4JUV A;  2L5Q A;  5CR2 A;  3A5Z B;  1W2B S;  3RMS A;  1VQ8 A;  3QXE B;  5GMK i;  4J5Y A;  5CKE A;  4X9D A;  2X35 A;  1UGR B;  2A7Y A;  2RI5 A;  3VYH B;  3CD6 T;  5I2M A;  3QSU A;  4XK8 E;  1OZ2 A;  2AHJ B;  3OYJ A;  4M77 G;  3JCM V;  2XIC A;  4IUT A;  3PMT A;  3OYI A;  2VC8 A;  3M9Q A;  5GAN e;  1VQ4 A;  3INZ A;  4PL6 A;  1YI2 T;  1VQ8 T;  4A4E A;  2XHC A;  1I4K 1;  3PNW C;  3CPW A;  1JJ2 S;  4KUI A;  4OB1 B;  1EIF A;  4BI3 A;  3GPL A;  3FLG A;  1K9M U;  2RHU A;  2IG0 A;  3V7S A;  4PJO D;  1XOV A;  3RER A;  1Q82 U;  4C92 C;  2RM4 A;  3CCM T;  2DZC A;  2K3Y A;  2FYK A;  3OYF A;  2D9T A;  4XTY A;  2M9U A;  3JCM P;  3HHT B;  2JNG A;  2VXE A;  3GF5 A;  4M77 F;  3KXT A;  1W4S A;  3CCS T;  3KUF A;  4E7J A;  3OW2 A;  1WQW A;  4PJO E;  4IUV A;  5LJ5 g;  4BY6 B;  3C4S A;  2CYZ B;  3NTH A;  3OS1 A;  3TU4 K;  3RES A;  3JCM g;  1VQP A;  3QDR B;  1M1G A;  2V8K A;  2CGH A;  3C12 A;  1Y07 A;  1LJO A;  4XAX B;  3QJY A;  1G3W A;  1Q81 U;  1HXD A;  2E6N A;  4B9W A;  2DEQ A;  5CKB A;  1U8R A;  1X6O A;  2D0Q B;  2PQW A;  3BW1 A;  4J7F A;  4MDW A;  3DLL A;  4C0D C;  4C92 A;  1I81 A;  5GMK e;  3LGL A;  1KQ2 A;  1M8V A;  4XQ3 A;  4PJO G;  3V8L A;  3OMG A;  5GAN 7;  1M9S A;  4R55 A;  3OBY A;  1YBY A;  2CZ6 B;  2DZ9 A;  1M5Q 1;  1OI1 A;  2KMT A;  5GMK m;  4M7D C;  3QYG B;  1VIE A;  2DD5 A;  3CCQ T;  3JSC A;  4F7U E;  5GAN d;  5LL6 S;  5DLO A;  3RKX A;  3X20 B;  2RHI A;  3V8K A;  4BD3 A;  4ELY C;  2IVW A;  2LT4 A;  4M7A C;  1VIF A;  2MWP A;  3M58 A;  2GFA A;  3PFS A;  5CK9 A;  2EFI A;  4WF2 A;  3JCM X;  3OYB A;  3R6O A;  3FC3 A;  1QP3 A;  2JTF A;  4A4F A;  3LH0 A;  3CBP A;  2G3R A;  4C0Z A;  3RMQ A;  3J80 E;  4M78 C;  1O75 A;  4PLI A;  2K5L A;  1UGP B;  3FB9 A;  1R8O B;  4JRI A;  1BYM A;  4MZP A;  4XU3 A;  1H3Z A;  2PUK B;  1WPY A;  4KT0 E;  2YLC A;  2MMP A;  4IUP A;  3M4G A;  1I5L A;  4F7U G;  2Y4X A;  3OQ5 A;  4M75 B;  5D6X A;  3I56 T;  1VQN A;  4JRQ A;  4O6J A;  4M7D A;  3HKS A;  2QDY B;  3ME9 A;  3S3N A;  1K8A C;  2LVM A;  3KBG A;  3H6Z A;  1M4Z A;  1MHN A;  4M75 F;  2E64 A;  2K3X A;  4RKU E;  1XTD A;  2M1H A;  5GAN 2;  2JVV A;  3M55 A;  5A0D A;  5GAN 5;  4PNO A;  5FRO A;  3PIP A;  4M7A A;  3EAE A;  2CZ7 B;  4FL6 A;  3JB9 G;  1DJ7 B;  5GAN 8;  2B8A A;  5EG2 A;  5M9O A;  1VQN T;  4HCZ A;  4JS4 A;  3M56 A;  3G4S T;  4BAC A;  3CC7 A;  1UGS B;  3M57 A;  2R58 A;  4OB2 B;  4CRI A;  2XD0 A;  3G71 A;  4EMG A;  5CKD A;  1B34 A;  3I55 A;  4J8O A;  2ZZD A;  2OAU A;  5GAM h;  1Q81 C;  5GAM f;  2EKO A;  2M16 A;  4OVA A;  4IUR A;  1VQO A;  3WXM B;  2V8J A;  3CCE A;  3CC7 T;  3M5A A;  2DTI A;  1X75 C;  5IN1 A;  3X24 B;  1I8F A;  1VQ6 T;  2CZ1 B;  3G71 T;  1PSF A;  3RIR A;  3CMA A;  2F69 A;  4ELZ C;  1QVF A;  1QP2 A;  1FWZ A;  4BE0 A;  5GMK l;  2L8D A;  3JB9 F;  4V2S A;  2R57 A;  3HFN A;  4L5G A;  4BDY A;  2RA2 A;  3MEW A;  4JDS A;  1RL2 A;  1WJR A;  3L2Z A;  4LDY A;  4M77 C;  3L2Q A;  2QQR A;  4D6W A;  1VQM A;  3CPF A;  4HT8 A;  2EQU A;  1D3B B;  2KQW A;  2KY9 A;  4JRP A;  3GNF B;  1G5V A;  3DKM A;  2JUF A;  3FIF A;  3L2V A;  3CMA T;  4MDX A;  2BIV A;  4C8Q E;  3GP8 A;  3E1S A;  4BY6 C;  2ZPF B;  5GAM j;  4KUD K;  1NPP A;  3SDZ A;  5CVI A;  2GCX A;  1VQM T;  1YIJ A;  5FU6 C;  3QJ6 A;  4OMF B;  5D6Y A;  4BI4 A;  3X28 B;  2WSF E;  3QO3 A;  2HNI A;  5KCH A;  5HKC A;  3OYK A;  3FEO A;  1P92 A;  2GFU A;  2RHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...