4Y28E

The structure of plant photosystem i super-complex at 2.8 angstrom resolution.
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
PPIGPKRGAKVKILRQESYWYKGTGSVVTVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of plant photosystem I super-complex at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4y28E00
4Y28E 1V29B 3A8LB 3A8HB 3X20B 4RKUE 2DXCA 2CZ6B 2PU9B 1UGSB 3WVEB 2CZ7B 2D0QB 4XK8E 4KT0E 1AHJB 4ZGEB 2AHJB 3QZ5B 1GXIE 4OB3B 3X24B 4FM4B 4ZGDB 3A8MB 3X25B 3VYHB 4L6V5 2CZ1B 2PVOB 3LW5E 1QP3A 3WVDB 4ZGJB 2PUKB 3A8OB 1PSEA 4OB0B 3A8GB 2ZPIB 2WSFE 3VYGA 2ZPGB 1PSFA 3X26B 2WSCE 3HHTB 1IREB 2WSEE 2DXBA 1QP2A 2QDYB 2ZPHB 2PUOB 3QYGB 1UGPB 2DD5A 2DPPB 2ZZDA 3X28B 3QZ9B 2ZCFB 2DD4A 2O01E 1DJ7B 2ZPBB 1JB0E 3QYHB 1UGRB 4OB1B 2CYZB 2CZ0B 3QXEB 2ZPFB 5L8RE 4OB2B 2PVDB 2ZPEB 1UGQB 2PVGB
chains in the Genus database with same CATH superfamily
2EFIA 1OZ3A 4GLKA 3M54A 4M77F 4ME7A 4JRPA 2EIFA 1YN8A 4IIOA 5LJ3h 1KQ2A 1PM3A 1UG1A 2X4JA 4BI3A 4N4IA 2GGRA 3CMET 7AT1B 1M5Q1 4Q5WA 3OW2P 2L0AA 3CCSQ 4PJMA 3OMCA 4CRIA 4ZNXA 3OA6A 1MMGA 3RKXA 1TS9A 2QGFB 3CMEA 4DA4A 2GQIA 2C0IA 1Q86R 1NJIR 3M0QA 4F14A 1KK7A 2YRVA 1T0JA 2EGEA 4C8QE 2CP5A 2DF6A 1N8RU 1M3CA 4PJOD 1JO8A 4HKEA 4XTWA 4A4KA 1PD0A 2K57A 3CCVQ 4ZGJB 1PRLC 1PSEA 3A8GB 3C94A 2D6FA 4JPBW 3OBYA 1SF9A 3PVLA 5HK0A 2EYYA 2FL7A 1KSWA 1PSFA 2OTLT 2O4XA 1JXMA 2DA9A 4N0AA 4PLLA 4BY6B 3M59A 3PGGA 1Q7YU 1QP2A 2QDYB 2ZPHB 3N5BB 2HSEB 3QYGB 3S6WA 2OTLA 2ABLA 4M7AD 4RMOA 1QCFA 4J9DA 3GNGA 5ECAA 3ZFJA 4M7DA 4AMCA 2QA4Q 2ZZDA 4IUTA 3V7CA 4OGCA 1B34B 1OV3A 1WHHA 2KE9A 4Z02A 4RTVA 1WQ7A 4HCKA 4IIMA 2OTJQ 1HSQA 4RTXA 3ZL7C 4OB1B 1I8FA 3EG2A 2DKGA 2EVRA 5GANf 2FVUA 2C0OA 1BI2A 1R77A 1IRXA 1KJWA 2BZ8A 2R57A 3OY9A 2ZAEA 1T3LA 2DIQA 2HEQA 4BE1A 1PD1A 2DFUA 2J6OA 2K7AA 3EGXA 3GIBA 1UE9A 2PU9B 5FLXE 3C4SA 3NFCA 1ZBXA 2COYA 4PLIA 1U1SA 1NG2A 2QASA 1XTDA 2M0YA 3CC7Q 3BW1A 3PTAA 4A4HA 2NUTB 2QAZA 1D0YA 1I5LA 1MV0B 1FX7A 2CP2A 4M78C 2RHIA 4X9CA 2EWNA 2AHJB 4Z88A 2DTOA 1NLPC 4M78A 2E65A 3M0RA 4FM4B 3SEMA 2RPNA 1EIFA 1UJ0A 2HKQB 2DVJA 1WHGA 2PVOB 2F69A 2XD0A 3LGLA 1VQ9A 3EH2A 1I07A 1W1FA 2KEAA 5IXFA 2I0NA 2JMAA 2WACA 2X9HA 4M75C 1ARKA 4C92F 4M4ZA 2L3QA 5I2MA 1WGSA 1D0XA 2V8JA 2DL5A 2FYKA 3FJPA 2W10A 1M1KU 4LD9K 2L3RA 3IQLA 5A0LA 2FZKB 1YI2Q 3I5RA 1QKXA 1K9AA 1SG5A 4UC4A 3JRZA 1VQNT 2BUDA 2HKNA 1KC8R 1KHIA 3KFVA 1UECA 3JB9J 3JB9D 3C0CA 1OPLA 1YJNT 1N9RA 3VS7A 2YRCA 4FT2A 3SD4A 3QBYA 1H92A 1BCMA 2DBMA 3OYDA 3OW2A 1IGUA 2EGCA 4IUQA 5L8RE 4OMLA 4C0GA 1ZSZA 2XIDA 4PKCC 1VQLQ 4HVUA 4F7UA 2HQXA 4PFPA 3CBPA 2LC4A 3BFMA 1G3TA 4PJOE 2FPDA 4M77C 3RDVA 1M8MA 3CCRT 2LCCA 3CCSA 2DRKA 2EGAA 3MEAA 2XDPA 3JCMX 4E2FB 1MNDA 2DEQA 4QQDA 4LE9A 2EJ9A 1X27A 4DEYA 1E6GA 3NHNA 2F5KA 4P5NA 1N8RR 3V7SA 4J9BA 3A5ZB 5CIUA 1W70A 2LQWA 3QIIA 4R55A 3JCMV 3H8ZA 2FG0A 2QYZA 4C8QG 2GTJA 3T9NA 4K11A 3VUZA 3CCVA 5D6XA 1KD1C 3MEWA 1AWJA 3FEOA 2AKLA 2O31A 2K9GA 5CQYA 5C6SA 1Q7YR 4Z8AA 1AOJA 2OAUA 5FW9A 1Q82U 3E19A 2WSFE 3JCMP 5GAMj 2VGNA 4OMFB 1UTIA 1N9SA 1VQ8T 1AZEA 4A54A 3SFMA 2RI3A 1IREB 3EGDA 2YT6A 2P84A 2CH4A 2DXBA 1KFZA 4MMKA 4E6RA 3JCMf 2DZCA 4J9EA 3GP8A 2OTJT 2L5QA 2CP3A 4FIBA 1ZBJA 1EX4A 3WXMB 3M57A 3G71T 2QA4A 1AEYA 5HY6A 1U06A 4HVWA 3VJPA 2OTJA 3SWNB 1WNLA 3ER0A 1M1FA 1WJRA 2V8KA 4QT7A 2HBWA 3QYHB 2EYWA 3M0SA 2DIGA 1UB4A 2E3IA 2RQWA 4BY6C 1VQMQ 4QW2A 2MCNA 2QGGA 1WJQA 1CKBA 2JVVA 4PJJA 2KNBB 4RTTA 3CC7T 1OX8A 1UHCA 5KYWA 3LH5A 3QJ6A 2ED1A 4KGVB 3TEEA 1X6OA 1ZQ1A 2VXEA 4OMOA 1M1GA 1RUWA 1W2BS 2A3LA 1D09B 4IUVA 1YBYA 3MEVA 3UA6A 3CCMQ 1LOJA 2JNGA 3S3NA 3VS0A 1K0XA 5GMKe 1YJWT 4II1A 1VQPA 5I2SA 4L5GA 3SDZA 3G4SQ 6AT1B 4PFZA 2SEMA 5GAOm 3X25B 1NYFA 2E6NA 2O4XB 5LJ5d 1K8AU 3OQ5A 3TSZA 4J9FA 2YRDA 1WFWA 2J05A 1WHKA 2X3XD 1M1KR 3PMIA 4L59A 4B6MA 1YITQ 4B9XA 5GAMf 4OMNA 4KH0B 2F2XA 1XQHA 5D6YA 1R0CB 2RHYA 3MPUB 4HCBA 1YI2A 4E7KA 4C92C 4M7DB 2RD1A 2DM1A 1TG0A 2I2LA 4DBRA 1K9MU 2RQTA 1IB8A 2E6ZA 2O9VA 3RESA 3PVQA 2RQRA 2GTOA 2DILA 3PT9A 5FU7B 5GAN6 2XHCA 1H3HA 1WXTA 4J8OA 1TOVA 1QQJA 2ECZA 2ROLA 4F16A 3PIPA 3EGXB 2CZ0B 1VQLA 3QXEB 4C8QD 1QW1A 4BDYA 1AD5A 4Z89A 2LX9A 2MF2A 1YNZA 1JU5C 2NUZA 1VQ6T 2P0PA 2JTFA 2EPDA 1Q81U 2A0FB 3V7RA 4BACA 1N6AA 4PJOG 2BTTA 2A28A 3HFNA 4LUDA 3I9QA 1OOTA 3WVEB 2KDSA 3OSVA 3HL8A 3DLMA 2SRCA 4M78B 4XK8E 2RMOA 1GFCA 3HKSA 5CVIA 4LDYA 3I35A 2LQ8A 4AFZC 1M2OA 4EMGA 1GXIE 5CQXA 2F1LA 3R6OA 1LJOA 2QDLA 1TUCA 1Q82R 3BDUA 3MP1A 4MDWA 4HCZA 2CZ1B 4M75B 1QP3A 2CT3A 2RB6A 3J80E 3MEUA 2JW4A 2D8JA 4EDUA 3URGA 4CC3A 2YHTA 2Z0WA 2VASA 1RAFB 2J06A 3M56A 1WHJA 2MAMA 2Y4XA 3HRTA 2E64A 1RAAB 1M9SA 5KCHA 2LNVA 4RTYA 3CCJQ 1NEGA 5FWCA 4C5GA 2FZGB 4WTOB 2IPOB 1GCQC 1VQ5T 2KRSA 2LJ3A 4DBFA 5GJVB 1C6VX 1AWOA 3P8HA 1VQ7A 5GANd 4FL6A 1EZZB 4Y91A 1ZSZB 1JB0E 1QVPA 1VQMA 2OI3A 5C0MA 5IT9E 4M7AA 2DAQA 2RM4A 3JCMg 4J9GA 2QQRA 3VS5A 3FC3A 1D1AA 2PVDB 3DKMA 3OS2A 1D0ZA 2QTVA 4OF1A 4HVVA 1Y7XA 2RN8A 2COWA 4EMKC 2XU8A 3CCUT 3LX7A 4RTWA 4FT4A 2KAFA 3CCMT 3X20B 1ZUUA 2YXYA 1GFDA 4X9DA 3R6NA 4C5EA 3SWNC 3VS1A 4M77E 4F7UF 2X4YA 5GMKm 3G4ST 3QKJA 1VQNQ 3TQ7P 1AWWA 2E5QA 1FYNA 2EQIA 4RUGA 2FPFA 2JT4A 5GANj 3MKDA 1GBQA 1YJNQ 2A37A 3CPWP 1SHFA 2K2VA 3G4SA 4J83A 1M27C 1K8AR 3CD6A 5GMKi 1YITT 2KRMA 4X34A 2O2OA 4J9HA 1KQSS 3L2VA 4FSSA 1FWZA 1ABOA 2JTMA 4JDSA 1OPKA 1JJ2S 1UJYA 2YWWA 1BU1A 3M5AA 1YITA 3EGDB 2OJ2A 3JB9G 1M30A 4RG8A 3EHQA 5DLQE 1K9MR 2B86A 1SHGA 3HRSA 4AFQC 3CCRQ 4OMMA 2CP6A 2MPXC 4QKUA 5LJ5h 2V1QA 4ESRA 1G83A 3E9GA 5A2QE 5KYUB 1HJDA 1RAHB 1K73U 1QLYA 1NM7A 2LT1A 3CEYA 3E2UA 5FU6C 4LDWA 3FLGA 2HMAA 4N0AC 1WI7A 2ZCFB 4OMPA 2JOYA 5A0GA 3H0HA 4PJLA 2BE9B 3EHRA 4ELYC 2V8IA 4WCIA 5GAN7 2DXTA 1WPYA 2RJEA 2CYZB 2LVMA 4R56A 1PC0A 1Q81R 2MIOA 1I81A 4Y92A 4M7DC 3OS0A 1M3AA 1UGQB 1I1JA 3QDRB 2G3RA 3MCAB 3L2UA 1VQ8Q 3J7AF 2RHZA 3VRZA 5CKBA 1JQQA 3H9NA 5FU7C 1TXQA 3Q1JA 2MI6A 4NL2A 2D1XA 1VYVA 2GBQA 1TTHB 1QVGS 2DL4A 3E1SA 3G71Q 2DNUA 4JRQA 1JBMA 3RBBB 2MWOA 2QEXT 2MOXA 4MZMA 1I4K1 3OYKA 5D6WA 3NTHA 4XTZA 2KMTA 4M78G 1M3BA 4OB3B 8AT1B 2YLCA 3REBB 3CCJT 2EYZA 3M0TA 1G8XA 1PG5B 3VUBA 3JCMd 2K5FA 4OB0B 4DOWA 3L2WA 1X69A 5GAOn 2YUPA 3CC2T 3JB9I 3UT1A 4LD6A 3UATA 2NYSA 4BD3A 1WHLA 4C92B 3VYGA 3CCJA 1X2QA 2DL7A 4M75G 2KI7A 2WSEE 1PKSA 2EBPA 1E7OA 4PK4A 4C92E 3GF5A 3RMQA 3A1PA 2C06A 1IHVA 1K4US 3CCLT 3QO3A 3L42A 3RMSA 1VOMA 3OYBA 5CKHA 2GF7A 1YJWQ 2DD4A 2HDAA 4E7JA 5CKDA 2HBPA 2F2VA 2PQWA 3MHXA 2ENMA 2A36A 1Y96A 1QVFS 3CQTA 3REAB 3LWIA 1WXBA 4FSXA 5FROA 3KXTA 5GANh 4C0ZA 1M90C 2X4XA 1RLPC 1ABQA 3CPWA 3ZBDA 2AZVA 4AFUC 2QTXA 3I56T 2IVWA 1FXXA 1VQNA 3OS1A 1UGSB 4M77G 4XU3A 5IHKA 5LJ5g 4CC4B 2R5MA 2L8DA 3EFRA 1ZSZC 4XU2A 2GFAA 3RUXA 2ESWA 1MV3A 1OEBA 1YJNA 4F17A 4AG1C 2AT1B 2AZSA 4FYXB 1NZ9A 1ZUKA 3M4GA 2JM8A 2R5AA 2E5KA 4M7DD 2AKKA 1VIEA 2CS7A 1WIEA 1X6BA 5GAMd 4PL6A 4ZGDB 1BCOA 3V8JA 1WDXA 2KK4A 3VYHB 2L89A 1ZUYA 2O9SA 2M1HA 3CC4Q 3LW5E 1T0HA 2LZ6B 1M4ZA 1KQ1A 3CCRA 1VQ6Q 4J9CA 3G1JA 2F2WA 5IHNA 1I5OB 1K73R 1UHFA 2K5IA 4BI8B 1B7TA 4DQ2A 3CXCS 2FRYA 2DXUA 3M58A 5IXBA 3BY7A 1UFFA 2R58A 2LCLA 3ME9A 2M0OA 3FDRA 2YUNA 4PJOF 2EKHA 1Q86C 1NJIC 2KYBA 5EG2A 2VXFA 3JCMe 1DJ7B 2HNIA 1WYXA 5GAN3 3QUIA 3MJXA 3EFOA 3LWHA 3CBOA 1H8KA 1UGRB 4M78D 4DOVA 5GMKj 2QQAA 4LN2A 1FMWA 2HZYA 4EMKB 1VQ8A 4FW2A 2YDLA 4ZN3A 2PVGB 5GAOl 1WQWA 1ZSGA 4Y28E 4M7AF 1V29B 1UEBA 2MYSA 2AIRB 4FCYA 5DM7R 2DO3A 1QWFA 4BB7A 1Q95G 3G71A 4QVZA 1HYOA 4EMHA 4C8QA 2GCXA 3TCJA 2JXBA 1SSFA 1ZA1B 4PNOA 4M75D 1BKBA 2RK1A 5J3BA 1VQ5Q 1OI1A 4OGEA 1S72T 4BI4A 2W0ZA 3VS6A 3AHUA 4EPCA 1K0SA 5J39A 3QG1A 2FZCB 3OYEA 3F70A 1JRIA 1HD3A 4NL3A 1GL5A 1UGVA 1GBRA 3UF4A 1K76A 1WX6A 4BE0A 1VIFA 1B07A 3CC7A 2QG9B 2ROTA 4A63B 4L6V5 3EAEA 2MWPA 3CCUQ 2O88A 4BUGA 4FW1A 5GANg 1YIJQ 1ACMB 3JV3A 2EQUA 1GRIA 2YUOA 4CC2A 1W2BP 3S3MA 2ATCB 4GBQA 1C1AA 1BK2A 4JZ3A 3JCMh 4AG2C 1YWPA 2FB7A 4A53A 5KYXA 3GPLA 5FU6B 4C92G 3S3OA 5I22A 1TUDA 3C95A 4M77D 5CCAA 4KH1B 1YJWA 5CAIA 3E9FA 5I11A 2DZ9A 4PJNA 4D8KA 2VYTA 2LDMA 2CSIA 3SB2A 4E7LA 3TSWA 3UA7A 1UDLA 2HL3A 4JJNK 4XU1A 3D7SB 2OX7A 4WF2A 1CSKA 4VUBA 2JTEA 2JN0A 1TWBA 3CMAT 2BZXA 4M7DE 3META 3O5ZA 2KYMA 5KYYA 5LJ3j 5M9OA 5AT1B 2IIMA 3PFSA 1KD1U 3JB9F 4ZTFA 5GAOp 2HQEA 3LYIA 1KC8C 1QKWA 3QSUA 3OYYA 1V1CA 3CC4T 1NBEB 4ZGEB 1LVKA 5GAOr 2LNHB 2GNCA 2DTIA 5GJWB 3RKWA 3FIFA 4HT8A 3C12A 1VQ6A 2KSSA 5IAYA 3A8OB 2KXDA 4TVRA 4FYVB 2HQHA 2DVEA 2FEIA 5GAMh 2CP7A 3HHTB 2HSPA 3INZA 4M78E 1F1BB 4IUUA 4MDXA 5FWBA 1VQ4Q 1AT1B 2G6FX 2K6DA 1VQOQ 1RAGB 1SRLA 1LPLA 2QXFA 2JS0A 2KQWA 1N8RC 2JUFA 2QEXQ 5KE2A 2LX7A 4EIKA 4J7FA 5GMKl 1Y96B 2DE0X 2DPPB 4JLIA 1B3QA 1XOVA 2CH4W 4M75E 4PJOA 4CC7A 2QQSA 3LGFA 2A7YA 4XAXB 1Q7YC 4FYYB 3CC2Q 2A08A 3OYNA 2P0KA 2JJ9A 3PIOA 5FRMA 1WA7A 5LJ5e 5LJ3f 2LJ0A 1BB9A 1BBZA 4RKUE 2DXCA 2KY9A 1T3SA 4M7AC 1RI9A 2J6KA 4XTUA 1VQ5A 4F7UB 3PMTA 5CKEA 2JM9A 3CCLQ 2X35A 1D3BA 3GOXA 2CZ7B 2X51A 3VRYA 4C92D 1QMCA 1YP5A 4QVDA 3EG1A 3G6ET 2P0QA 2J7IA 2DJQA 4KGZB 1MHNA 2XDDA 1YIJT 3OYGA 3MO8A 1W2BA 1VQKT 4IUPA 1TSFA 1G2BA 3ASKA 5HCKA 1Y0MA 3CCUA 1MMNA 1D1CA 2DYIA 4KBMB 3ZEHA 3I55T 3CCMA 2EQKA 1VA7A 3H0FA 1RACB 1G3WA 2LT4A 3I56Q 1AWXA 3HRUA 3KUFA 1NLOC 3BE3A 2P4TA 1PHTA 1Y07A 3VS4A 2RA2A 2RK2A 1PKTA 2HCKA 2L3SA 3MP6A 2IG0A 3EFOB 3JAME 1BI1A 2DD5A 1PCXA 1N5ZA 1KQSP 1IO6A 1JXOA 2KRNA 2RF0A 3OW2S 3RR6A 5GAN4 4LDVA 5HKCA 1JJ2P 3DLLA 3JCMJ 2K3YA 3M0UA 1CKAA 1RAEB 4GLMA 1BI0A 1M2VA 1X2KA 1XNIA 1M1KC 2ED0A 2FHDA 2XK0A 4O6JA 1ZA2B 2FO0A 1WZOA 3CBMA 4C8QB 1KD1R 1KHCA 3DB4A 2PNIA 4M7DG 4KRTA 1Z9QA 2CT4A 3QPHA 4R0KA 5GAMg 3J81E 2CZ6B 4C5IA 4J5YA 3H0IA 5KYWB 3EG9A 4HXJA 2GFUA 2D0QB 1G3YA 4A4GA 2P4RA 3VV0A 3JCMc 4C8QF 3JB9H 1AHJB 5GAN5 4JJCA 2JMCA 4HT9A 2VUBA 5CO7A 2KGTA 1IHWA 3H41A 4C0FA 2RI2A 3LH0A 3NTIA 2EYXA 1MNEA 2EJGA 2LQNA 2CP0A 4JRKA 5GANe 1X75C 3M53A 2MMPA 2RQUA 2V1RA 3A8MB 4J6YA 2Y4YA 1VQ4T 1U5SA 4XTVA 1VQOT 4QVCA 2PUKB 5DLOA 2LP5A 1EFNA 2K2MA 5KYXB 3JCMW 4XTYA 2YLBA 3V8LA 1QVGP 4E7ZA 1VQ4A 3GNFB 5GAN8 1VQOA 1NEBA 1S1NA 4JLGA 1Y71A 2DRMA 2D0NA 2QEXA 1AVZC 1S72Q 2YSQA 3NMZC 1VYUA 4DBHA 2BIVA 1TH7A 3NTKA 1U3OA 1UGPB 1V76A 1O75A 2CDTA 4C0DB 2J6FA 1Q82C 5IHIA 1RL2A 2DX1A 3AT1B 1R8OB 2VC8A 5IN1A 1K1ZA 3JCMb 2XKOC 2LCSA 2RHUA 3CC2A 3KBGA 3MP8A 5FRNA 5KYYB 1UUEA 2F5TX 2K3XA 9ATCB 1BI3A 2ZPFB 4BE2A 4OB2B 1NPPA 5IH2A 4A4FA 2HD0A 3EH1A 4D8DA 4KUDK 1NE8A 1VQ9T 1LCKA 1OZ2A 2E41A 2E12A 1RADB 1H3ZA 3CCLA 2M02A 1VQPQ 2QK0A 2DLPA 2XG8D 1YFNA 4RCBA 2KT1A 1PNJA 2XDBA 2K79A 4F7UG 4LDUA 1QVFP 2QQ9A 3QZ5B 5LJ3g 4DBQA 3PE0A 2OAWA 4M75A 2GQVA 2DETA 1BIAA 2NWMA 5CK9A 1WLPB 2D8HA 3CMAQ 2RJFA 1KIKA 2NUPA 4N4GA 3RIRA 1RABB 3I56A 1KQSA 3QHSA 3EGUA 3RERA 1JJ2A 1LNXA 1SSHA 1YJ9Q 3I5SA 5KCOA 2CKKA 1QCNA 1YHQQ 4J7IA 4NS5A 3P8BB 4PJOB 3OYMA 2DMOA 3CCST 1WXUA 1K8AC 5HK3A 2EQJA 2DL8A 5CKFA 3X28B 4ATOA 1GCPA 2O01E 4RG2A 2ZPBB 1SEMA 4MMLA 4JRIA 5GAN2 4M77A 2VWFA 5DY9A 3UPUA 3OB9A 3TU4K 3NGPA 4E7HA 1K9MC 2E4HA 2KR3A 4E7IA 2H3EB 3CXCP 2EKOA 3CCVT 2RJCA 1RLQC 4M7AB 2BZYA 3LLRA 2PZ1A 1Y57A 1KG1A 1D3BB 4AT1B 4QQGA 3A8LB 3A8HB 3M55A 3JCMQ 4NOYA 5LL6S 2YUQA 2L2PA 4OMQA 1OU8A 2K5LA 2VVKA 4M7AE 3L2RA 4E47A 4KGXB 5CR2A 3G7ZA 4IKFA 3OS5A 4YTLA 4MZPA 4LUEA 3CCQQ 2LQKA 1BIBA 1J3TA 1QVGA 3EG3A 4C8QC 2QA4T 1QCOA 2EW3A 1Q81C 3X24B 1XJWB 3V8KA 2RH2A 1E6HA 2LRQA 3HP9A 3QDFA 5L23A 4ZTJA 1YCSB 2DTHA 2D9TA 4XTXA 2KROA 5KYUA 3QJYA 2WSCE 1C0MA 1S72A 1IZ6A 1VQ7Q 3OYCA 4KUIA 3QWXX 4J6WA 4XQ3A 2ZGWA 4B9WA 1OX9A 1BYMA 4GY5A 4N4HA 4A4EA 4FU6A 1YWOA 2PUOB 1M90U 3G6EQ 2XI9A 3THKA 2VKNA 1M2VB 3OYLA 4JZ4A 3QWYA 1VQKQ 1IXDA 1D1BA 3CPFA 2HAXA 2X3WD 3OYIA 2KVQG 3RNJA 1WJSA 5LJ3d 1MMAA 4RCCA 3SHWA 4O5VA 3TVTA 3I55Q 2MK5A 4ELZC 5I21A 1VQPT 1B34A 5D7UA 2DJZA 1M8VA 2VB6A 5GAMe 1HK9A 2DYBA 2L3PA 2JS2A 2LTOA 4V2SA 2LJ1A 3CCEQ 2C0TA 1FMKA 3EG9B 1QVFA 1ZX6A 1W4SA 5KE3A 1MGQA 2VV5A 3OBWA 4C0DC 3TREA 3CD6Q 2K3BA 1MMDA 3L1AA 1OULA 2NLUA 4JUVA 2KT8A 1YI2T 3EG0A 2EYQA 2XICA 2CUDA 2DBKA 2DEUA 3U23A 3OYAA 4CI0C 1TU0B 3CMEQ 2EJFA 2M16A 3OMGA 2DL3A 4RTZA 3CMAA 1RI0A 1QWEA 2X4WA 2NUTA 1A0NB 1O9SA 3VKIA 4C92A 1Q86U 1NJIU 1YJ9T 2BKDN 4X1VA 3JSCA 2DK3A 3WVDB 1YHQT 1X6GA 4HA8A 2B8AA 2QI2A 3OYJA 1U1TA 2E70A 3GLXA 1Z9ZA 3RKYA 1VQLT 2CSQA 3HSBA 1VUBA 1VYTA 2CGHA 3X26B 1YJ9A 2PTKA 2BE7D 1IGQA 4F04B 3OYFA 2KXCA 1YHQA 2EQMA 5LJ5j 4JJDA 4M7DF 1ZHIA 3CC4A 4HCCA 1MUZA 2CREA 3L2ZA 3GBQA 4IURA 3HPWA 5A0DA 4QQ6A 4DEXA 1HXDA 3CXCA 1SKUB 4J6XA 1P92A 2OTLQ 1AZGB 1OQKA 3QZ9B 3UWNA 2AK5A 4E7SA 3OSSC 1PWTA 4AFSC 2EAYA 2E10A 8ATCB 2COZA 1H641 5J26A 5KH6A 5GMKh 2H3JA 1WHMA 1ZLMA 1YCYA 2ZPEB 1K73C 2H8HA 3NPFA 4PJOC 3L2QA 2QQBA 1NYGA 3CCQT 2FRWA 1OYXA 3M4YA 4LNPA 2LMJA 4ORZA 4M7AG 1JEGA 5GAOq 2V26A 2RQVA 3DB3A 3CCQA 1SRMA 1U8RA 5LJ3e 4M78F 3H6ZA 4BDZA 4ZN1A 4KT0E 3HTRA 2RJDA 1G3SA 2DERA 5KYNA 4KULA 2Y90A 1G5VA 3M0PA 2XMFA 1I0CA 2NUPB 2K4YA 1X43A 3FB9A 3VS2A 1X01A 1SPKA 3O8VA 3UDCA 4PFOA 1NPRA 1W6XA 1VQ7T 4ANJA 1R0BG 3OYHA 4MZTA 2RO0A 4LXCA 1VQMT 4M75F 4D6WA 3HFOA 3VU3C 4F7UE 1GCQA 2ZPIB 4OVAA 1VQ9Q 2E3HA 2ZPGB 3PNWC 1OU9A 1M90R 2M51A 2RI5A 5LJ5f 1TUGB 1FMVA 3EFSA 2RHXA 4RTUA 2E1HA 2M9UA 3G6EA 2RNAA 4J9IA 1YIJA 3A98A 2VGMA 5EC7A 2HL5C 1VQKA 4M77B 2FPEA 2JZ2A 4JJBA 1RAIB 4JS5A 3CCET 4EMKA 3FRNA 3VS3A 4XU0A 3M9QA 3P8DA 4OP0A 3I55A 5AYFA 4JS4A 1KC8U 4FYWB 3CPWS 4LDXA 2KBTA 1N27A 3SWNA 2CUBA 3FJ5A 3CD6T 4C5HA 3ULRB 3CCEA 3BDLA 1PRMC
chains in the Genus database with same CATH topology
2EFIA 1OZ3A 1WQWA 4GLKA 2HD0A 3M54A 4M77F 4ME7A 4Y28E 1V29B 4JRPA 4M7AF 2EIFA 1VQ6T 2P0PA 2JTFA 1Q81U 5LJ3h 1UEBA 1KQ2A 5DM7R 2DO3A 1NE8A 4KUDK 4BB7A 3V7RA 4BACA 1N6AA 4PJOG 1OZ2A 2E41A 1VQ9T 3G71A 2E12A 4QVZA 1H3ZA 2X4JA 4BI3A 3CCLA 4EMHA 4C8QA 4N4IA 2GCXA 3HFNA 3CMET 3TCJA 1SSFA 4PNOA 1M5Q1 4M75D 1BKBA 4Q5WA 3WVEB 2RK1A 5J3BA 2KDSA 1OI1A 2XG8D 3OSVA 4OGEA 3HL8A 4BI4A 1S72T 4RCBA 3OMCA 3DLMA 4M78B 4CRIA 3OA6A 4XK8E 3RKXA 2XDBA 3AHUA 4EPCA 3CMEA 4DA4A 5J39A 4F7UG 3HKSA 4LDUA 3QG1A 3OYEA 5CVIA 3F70A 4LDYA 2QQ9A 1JRIA 2LQ8A 3QZ5B 2YRVA 4EMGA 5LJ3g 4M75A 2GQVA 4NL3A 1GXIE 5CQXA 1BIAA 4C8QE 3R6OA 1LJOA 5CK9A 4BE0A 3BDUA 1N8RU 1VIFA 4PJOD 3MP1A 3CC7A 2RJFA 4HKEA 4MDWA 4XTWA 4A4KA 4HCZA 4L6V5 2CZ1B 3EAEA 2K57A 1QP3A 4M75B 4N4GA 4ZGJB 2RB6A 3RIRA 2MWPA 3MEUA 1PSEA 3J80E 3A8GB 4BUGA 3C94A 5GANg 2D6FA 3I56A 4EDUA 3URGA 1KQSA 2YHTA 3OBYA 2EQUA 5HK0A 3QHSA 2FL7A 3M56A 1PSFA 3RERA 1JJ2A 1LNXA 2MAMA 2O4XA 2Y4XA 3HRTA 2E64A 2OTLT 4N0AA 4PLLA 4BY6B 3S3MA 1M9SA 5KCHA 2LNVA 3M59A 3PGGA 1Q7YU 5KCOA 3JCMh 1QP2A 2CKKA 2FB7A 4A53A 2QDYB 3GPLA 2ZPHB 3N5BB 5FU6B 4C5GA 4C92G 3S3OA 4J7IA 4NS5A 3P8BB 3QYGB 3C95A 3S6WA 2OTLA 3OYMA 4PJOB 4M77D 4M7AD 3CCST 5CCAA 1VQ5T 4RMOA 1K8AC 1YJWA 5HK3A 3GNGA 3ZFJA 2EQJA 5CAIA 3E9FA 2DZ9A 4M7DA 2VYTA 5CKFA 2LDMA 2ZZDA 3P8HA 3SB2A 3X28B 4IUTA 3V7CA 5GANd 4E7LA 1VQ7A 4ATOA 4FL6A 1B34B 2O01E 4OGCA 4RG2A 4Z02A 2ZPBB 4Y91A 4MMLA 1WQ7A 4JRIA 5GAN2 1JB0E 1QVPA 4JJNK 1VQMA 4XU1A 4OB1B 5C0MA 1I8FA 5IT9E 4M77A 2DKGA 4M7AA 2DAQA 5DY9A 2RM4A 3JCMg 3UPUA 2QQRA 4WF2A 4VUBA 3OB9A 3TU4K 4E7HA 1K9MC 2JN0A 3CMAT 3FC3A 4E7IA 2PVDB 5GANf 2FVUA 3DKMA 3OS2A 1BI2A 4OF1A 4M7DE 3OY9A 2EKOA 1Y7XA 2R57A 2RJCA 3CCVT 3META 4M7AB 4EMKC 2DIQA 2XU8A 3CCUT 3LLRA 3LX7A 1KG1A 1D3BB 4FT4A 2KAFA 4QQGA 3CCMT 3A8LB 5LJ3j 4BE1A 3A8HB 3X20B 3GIBA 3M55A 3JCMQ 4NOYA 4X9DA 5LL6S 5M9OA 2PU9B 5FLXE 3C4SA 2K5LA 3NFCA 3PFSA 4C5EA 1KD1U 3SWNC 3JB9F 4M77E 4M7AE 3L2RA 4ZTFA 1ZBXA 4PLIA 5GAOp 4F7UF 1U1SA 2X4YA 5GMKm 3G4ST 2HQEA 3QKJA 3LYIA 4E47A 5CR2A 1KC8C 1XTDA 3QSUA 3G7ZA 2E5QA 3BW1A 3OYYA 4IKFA 3PTAA 4A4HA 3OS5A 4YTLA 1I5LA 5GANj 4MZPA 3CC4T 2LQKA 1BIBA 1FX7A 1QVGA 4M78C 4ZGEB 2K2VA 2RHIA 3G4SA 4J83A 5GAOr 4X9CA 4C8QC 2EWNA 2AHJB 2QA4T 3CD6A 5GMKi 1YITT 4X34A 2DTOA 4M78A 1Q81C 3X24B 2DTIA 2E65A 4FM4B 3RKWA 1KQSS 3L2VA 1FWZA 3V8KA 1EIFA 3FIFA 2JTMA 4JDSA 4HT8A 3C12A 2RH2A 1JJ2S 2LRQA 1VQ6A 2PVOB 2F69A 2XD0A 2KSSA 3HP9A 3M5AA 3LGLA 5IAYA 1YITA 1VQ9A 3A8OB 3JB9G 4ZTJA 2WACA 4RG8A 2DTHA 2D9TA 4XTXA 5DLQE 4M75C 4TVRA 2DVEA 5GAMh 3HRSA 3QJYA 4C92F 3HHTB 2WSCE 5I2MA 1WGSA 3INZA 1IZ6A 4M78E 1S72A 3OYCA 2V8JA 2FYKA 3FJPA 4IUUA 5LJ5h 4KUIA 4MDXA 4J6WA 4XQ3A 1M1KU 4LD9K 2ZGWA 4B9WA 3E9GA 2L3RA 1BYMA 5A2QE 2QXFA 5A0LA 2KQWA 4GY5A 4N4HA 4A4EA 4FU6A 1K73U 1N8RC 2JUFA 2PUOB 5KE2A 1M90U 2LT1A 3CEYA 3JRZA 4UC4A 1VQNT 5FU6C 2XI9A 4J7FA 2BUDA 5GMKl 4LDWA 3OYLA 3FLGA 1Y96B 2DPPB 1KHIA 4N0AC 3JB9J 2ZCFB 4JLIA 3JB9D 2JOYA 1YJNT 5A0GA 1N9RA 1XOVA 3CPFA 4M75E 4PJOA 4ELYC 2HAXA 2V8IA 5GAN7 3OYIA 2DXTA 2KVQG 2QQSA 4FT2A 3SD4A 1WJSA 1WPYA 2RJEA 3LGFA 5LJ3d 2CYZB 3QBYA 4RCCA 2LVMA 4O5VA 4R56A 3OYDA 3OW2A 2A7YA 4XAXB 1Q7YC 4ELZC 5I21A 1I81A 4IUQA 1B34A 1VQPT 2DJZA 5L8RE 3OS0A 4M7DC 1M8VA 5GAMe 1HK9A 2XIDA 4C0GA 1UGQB 3OYNA 2LTOA 2P0KA 4V2SA 3QDRB 4PKCC 2G3RA 3MCAB 3L2UA 4F7UA 2HQXA 3PIOA 3J7AF 5FRMA 2RHZA 2LC4A 3BFMA 3CBPA 5CKBA 5LJ5e 1QVFA 5LJ3f 1G3TA 4PJOE 1W4SA 5KE3A 4RKUE 1MGQA 2DXCA 2KY9A 2VV5A 4M77C 5FU7C 4M7AC 3Q1JA 3CCRT 2LCCA 3OBWA 2MI6A 4XTUA 4C0DC 3CCSA 4NL2A 1VQ5A 3TREA 3MEAA 2XDPA 4F7UB 3JCMX 3L1AA 1QVGS 2NLUA 3E1SA 3PMTA 5CKEA 4JUVA 2DEQA 4JRQA 4QQDA 2X35A 1D3BA 3GOXA 2CZ7B 1JBMA 1YI2T 2EJ9A 2MWOA 2QEXT 4C92D 2EYQA 2XICA 4MZMA 2F5KA 1I4K1 3OYKA 4QVDA 4P5NA 5D6WA 2P0QA 3V7SA 3G6ET 3A5ZB 5CIUA 3NTHA 3OYAA 1MHNA 4CI0C 3QIIA 4R55A 4XTZA 2XDDA 3JCMV 2KMTA 3H8ZA 3OYGA 1YIJT 3MO8A 1W2BA 2EJFA 2M16A 4M78G 3OMGA 3CMAA 4OB3B 4IUPA 1VQKT 1RI0A 2X4WA 4C8QG 2YLCA 1O9SA 3T9NA 3ASKA 3VUZA 3CCVA 5D6XA 1KD1C 3VKIA 4C92A 1Q86U 3CCJT 3CCUA 1YJ9T 2BKDN 1NJIU 3MEWA 4KBMB 3JSCA 2DK3A 3FEOA 3VUBA 3ZEHA 3WVDB 2EQKA 3JCMd 3I55T 3CCMA 1YHQT 2K5FA 4HA8A 4OB0B 2B8AA 4DOWA 2QI2A 3L2WA 5GAOn 5CQYA 5C6SA 3CC2T 3JB9I 3OYJA 1Q82U 1U1TA 1G3WA 2E70A 2OAUA 3E19A 2WSFE 3GLXA 4LD6A 3RKYA 3UT1A 4BD3A 3JCMP 1VQLT 3HSBA 4C92B 5GAMj 2VGNA 1VUBA 2LT4A 1N9SA 2CGHA 4OMFB 3VYGA 3X26B 3CCJA 4A54A 1YJ9A 1VQ8T 3SFMA 4M75G 3HRUA 2RI3A 3KUFA 1IREB 2WSEE 3OYFA 1YHQA 2EQMA 2P4TA 2DXBA 5LJ5j 4MMKA 4M7DF 1ZHIA 3JCMf 1Y07A 2DZCA 3GP8A 2RA2A 3CC4A 2OTJT 2L5QA 3GF5A 4C92E 2RK2A 4HCCA 3RMQA 4FIBA 3WXMB 3MP6A 3L2ZA 2C06A 4IURA 2IG0A 3M57A 3HPWA 3JAME 3G71T 5A0DA 2QA4A 4QQ6A 3QO3A 3CCLT 1HXDA 1BI1A 2DD5A 3CXCA 3L42A 4J6XA 1P92A 5HY6A 3RMSA 3VJPA 2OTJA 3OW2S 3SWNB 3QZ9B 3UWNA 4LDVA 5CKHA 2GF7A 5GAN4 3OYBA 1WNLA 5HKCA 2DD4A 1M1FA 3ER0A 3OSSC 1WJRA 4E7JA 3DLLA 2V8KA 2K3YA 3JCMJ 5CKDA 2EAYA 2HBPA 2E10A 3QYHB 2PQWA 1H641 3MHXA 1BI0A 5J26A 2DIGA 1UB4A 5KH6A 5GMKh 1Y96A 1QVFS 1XNIA 2H3JA 4BY6C 1M1KC 4QW2A 3LWIA 1WJQA 2FHDA 2JVVA 4FSXA 2XK0A 1YCYA 2ZPEB 4O6JA 5FROA 5GANh 3KXTA 1K73C 4C8QB 3CBMA 4C0ZA 1KHCA 3DB4A 1M90C 2X4XA 4M7DG 3CC7T 4PJOC 3L2QA 2QQBA 3CPWA 3ZBDA 3CCQT 3QPHA 5GAMg 1OYXA 3M4YA 3QJ6A 3J81E 2QTXA 2CZ6B 4C5IA 3I56T 2IVWA 1FXXA 3TEEA 1X6OA 1VQNA 4J5YA 1ZQ1A 3OS1A 1UGSB 4M77G 4XU3A 5LJ5g 4M7AG 2VXEA 2R5MA 2L8DA 3EFRA 1M1GA 5GAOq 4XU2A 2GFAA 3RUXA 3DB3A 3CCQA 1W2BS 2A3LA 2GFUA 2D0QB 1G3YA 1YJNA 1U8RA 4IUVA 5LJ3e 4M78F 3H6ZA 1YBYA 4A4GA 3MEVA 3VV0A 3JCMc 4BDZA 4ZN1A 4KT0E 1NZ9A 3M4GA 2RJDA 1G3SA 2R5AA 4C8QF 3JB9H 1LOJA 1AHJB 2JNGA 5GAN5 4KULA 2Y90A 1G5VA 3S3NA 4HT9A 2VUBA 5CO7A 4M7DD 4C0FA 2RI2A 3LH0A 3NTIA 5GMKe 2K4YA 1YJWT 4II1A 1VIEA 2CS7A 3FB9A 1VQPA 5I2SA 4L5GA 2EJGA 3SDZA 1X01A 4JRKA 5GAMd 3O8VA 3UDCA 4PL6A 1NPRA 4ZGDB 3V8JA 5GANe 1X75C 5GAOm 1VQ7T 3M53A 2MMPA 3A8MB 4J6YA 3X25B 2E6NA 2Y4YA 1VQ4T 2KK4A 3VYHB 2O4XB 5LJ5d 2L89A 3OQ5A 4MZTA 2M1HA 4XTVA 3OYHA 1VQOT 1K8AU 2RO0A 3LW5E 4QVCA 1VQMT 1M4ZA 1KQ1A 2PUKB 4M75F 5DLOA 4D6WA 3HFOA 3CCRA 3VU3C 3JCMW 4XTYA 2YLBA 3PMIA 3V8LA 4L59A 2ZPIB 4F7UE 4B9XA 4OVAA 5GAMf 2ZPGB 3PNWC 1VQ4A 1XQHA 5D6YA 3GNFB 5GAN8 2K5IA 4BI8B 2RHYA 1VQOA 4HCBA 4JLGA 1YI2A 1Y71A 2RI5A 4DQ2A 5LJ5f 3CXCS 4E7KA 3EFSA 4C92C 4M7DB 2DXUA 2RHXA 3M58A 2QEXA 2RD1A 2E1HA 2I2LA 3BY7A 1K9MU 2M9UA 2R58A 2LCLA 3ME9A 3G6EA 2M0OA 2E6ZA 3RESA 3FDRA 2BIVA 1TH7A 3NTKA 1YIJA 4PJOF 1UGPB 1Q86C 1NJIC 2VGMA 1VQKA 1O75A 3PT9A 4M77B 5FU7B 4C0DB 2XHCA 5GAN6 2JZ2A 5EG2A 1Q82C 2VXFA 4J8OA 3JCMe 4JS5A 3CCET 1DJ7B 1RL2A 2HNIA 4EMKA 5GAN3 3QUIA 3FRNA 3LWHA 3CBOA 4XU0A 1R8OB 2VC8A 3M9QA 5IN1A 3P8DA 4OP0A 3I55A 3JCMb 2XKOC 5AYFA 1UGRB 4JS4A 2RHUA 3CC2A 4M78D 3KBGA 4DOVA 3MP8A 3PIPA 1KC8U 5FRNA 5GMKj 2K3XA 2F5TX 2QQAA 1N27A 1BI3A 3SWNA 3CPWS 2CZ0B 4LDXA 3CD6T 4C5HA 3QXEB 2ZPFB 4C8QD 3CCEA 1VQLA 1QW1A 4BE2A 4EMKB 4OB2B 1NPPA 4BDYA 1VQ8A 3BDLA 4ZN3A 2LX9A 2PVGB 4A4FA 2MF2A 5GAOl
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y28 E;  1V29 B;  3A8L B;  3A8H B;  3X20 B;  4RKU E;  2DXC A;  2CZ6 B;  2PU9 B;  1UGS B;  3WVE B;  2CZ7 B;  2D0Q B;  4XK8 E;  4KT0 E;  1AHJ B;  4ZGE B;  2AHJ B;  3QZ5 B;  1GXI E;  4OB3 B;  3X24 B;  4FM4 B;  4ZGD B;  3A8M B;  3X25 B;  3VYH B;  4L6V 5;  2CZ1 B;  2PVO B;  3LW5 E;  1QP3 A;  3WVD B;  4ZGJ B;  2PUK B;  3A8O B;  1PSE A;  4OB0 B;  3A8G B;  2ZPI B;  2WSF E;  3VYG A;  2ZPG B;  1PSF A;  3X26 B;  2WSC E;  3HHT B;  1IRE B;  2WSE E;  2DXB A;  1QP2 A;  2QDY B;  2ZPH B;  2PUO B;  3QYG B;  1UGP B;  2DD5 A;  2DPP B;  2ZZD A;  3X28 B;  3QZ9 B;  2ZCF B;  2DD4 A;  2O01 E;  1DJ7 B;  2ZPB B;  1JB0 E;  3QYH B;  1UGR B;  4OB1 B;  2CYZ B;  2CZ0 B;  3QXE B;  2ZPF B;  5L8R E;  4OB2 B;  2PVD B;  2ZPE B;  1UGQ B;  2PVG B; 
#chains in the Genus database with same CATH topology
 2EFI A;  1OZ3 A;  4GLK A;  3M54 A;  4M77 F;  4ME7 A;  4JRP A;  2EIF A;  1YN8 A;  4IIO A;  5LJ3 h;  1KQ2 A;  1PM3 A;  1UG1 A;  2X4J A;  4BI3 A;  4N4I A;  2GGR A;  3CME T;  7AT1 B;  1M5Q 1;  4Q5W A;  3OW2 P;  2L0A A;  3CCS Q;  4PJM A;  3OMC A;  4CRI A;  4ZNX A;  3OA6 A;  1MMG A;  3RKX A;  1TS9 A;  2QGF B;  3CME A;  4DA4 A;  2GQI A;  2C0I A;  1Q86 R;  1NJI R;  3M0Q A;  4F14 A;  1KK7 A;  2YRV A;  1T0J A;  2EGE A;  4C8Q E;  2CP5 A;  2DF6 A;  1N8R U;  1M3C A;  4PJO D;  1JO8 A;  4HKE A;  4XTW A;  4A4K A;  1PD0 A;  2K57 A;  3CCV Q;  4ZGJ B;  1PRL C;  1PSE A;  3A8G B;  3C94 A;  2D6F A;  4JPB W;  3OBY A;  1SF9 A;  3PVL A;  5HK0 A;  2EYY A;  2FL7 A;  1KSW A;  1PSF A;  2OTL T;  2O4X A;  1JXM A;  2DA9 A;  4N0A A;  4PLL A;  4BY6 B;  3M59 A;  3PGG A;  1Q7Y U;  1QP2 A;  2QDY B;  2ZPH B;  3N5B B;  2HSE B;  3QYG B;  3S6W A;  2OTL A;  2ABL A;  4M7A D;  4RMO A;  1QCF A;  4J9D A;  3GNG A;  5ECA A;  3ZFJ A;  4M7D A;  4AMC A;  2QA4 Q;  2ZZD A;  4IUT A;  3V7C A;  4OGC A;  1B34 B;  1OV3 A;  1WHH A;  2KE9 A;  4Z02 A;  4RTV A;  1WQ7 A;  4HCK A;  4IIM A;  2OTJ Q;  1HSQ A;  4RTX A;  3ZL7 C;  4OB1 B;  1I8F A;  3EG2 A;  2DKG A;  2EVR A;  5GAN f;  2FVU A;  2C0O A;  1BI2 A;  1R77 A;  1IRX A;  1KJW A;  2BZ8 A;  2R57 A;  3OY9 A;  2ZAE A;  1T3L A;  2DIQ A;  2HEQ A;  4BE1 A;  1PD1 A;  2DFU A;  2J6O A;  2K7A A;  3EGX A;  3GIB A;  1UE9 A;  2PU9 B;  5FLX E;  3C4S A;  3NFC A;  1ZBX A;  2COY A;  4PLI A;  1U1S A;  1NG2 A;  2QAS A;  1XTD A;  2M0Y A;  3CC7 Q;  3BW1 A;  3PTA A;  4A4H A;  2NUT B;  2QAZ A;  1D0Y A;  1I5L A;  1MV0 B;  1FX7 A;  2CP2 A;  4M78 C;  2RHI A;  4X9C A;  2EWN A;  2AHJ B;  4Z88 A;  2DTO A;  1NLP C;  4M78 A;  2E65 A;  3M0R A;  4FM4 B;  3SEM A;  2RPN A;  1EIF A;  1UJ0 A;  2HKQ B;  2DVJ A;  1WHG A;  2PVO B;  2F69 A;  2XD0 A;  3LGL A;  1VQ9 A;  3EH2 A;  1I07 A;  1W1F A;  2KEA A;  5IXF A;  2I0N A;  2JMA A;  2WAC A;  2X9H A;  4M75 C;  1ARK A;  4C92 F;  4M4Z A;  2L3Q A;  5I2M A;  1WGS A;  1D0X A;  2V8J A;  2DL5 A;  2FYK A;  3FJP A;  2W10 A;  1M1K U;  4LD9 K;  2L3R A;  3IQL A;  5A0L A;  2FZK B;  1YI2 Q;  3I5R A;  1QKX A;  1K9A A;  1SG5 A;  4UC4 A;  3JRZ A;  1VQN T;  2BUD A;  2HKN A;  1KC8 R;  1KHI A;  3KFV A;  1UEC A;  3JB9 J;  3JB9 D;  3C0C A;  1OPL A;  1YJN T;  1N9R A;  3VS7 A;  2YRC A;  4FT2 A;  3SD4 A;  3QBY A;  1H92 A;  1BCM A;  2DBM A;  3OYD A;  3OW2 A;  1IGU A;  2EGC A;  4IUQ A;  5L8R E;  4OML A;  4C0G A;  1ZSZ A;  2XID A;  4PKC C;  1VQL Q;  4HVU A;  4F7U A;  2HQX A;  4PFP A;  3CBP A;  2LC4 A;  3BFM A;  1G3T A;  4PJO E;  2FPD A;  4M77 C;  3RDV A;  1M8M A;  3CCR T;  2LCC A;  3CCS A;  2DRK A;  2EGA A;  3MEA A;  2XDP A;  3JCM X;  4E2F B;  1MND A;  2DEQ A;  4QQD A;  4LE9 A;  2EJ9 A;  1X27 A;  4DEY A;  1E6G A;  3NHN A;  2F5K A;  4P5N A;  1N8R R;  3V7S A;  4J9B A;  3A5Z B;  5CIU A;  1W70 A;  2LQW A;  3QII A;  4R55 A;  3JCM V;  3H8Z A;  2FG0 A;  2QYZ A;  4C8Q G;  2GTJ A;  3T9N A;  4K11 A;  3VUZ A;  3CCV A;  5D6X A;  1KD1 C;  3MEW A;  1AWJ A;  3FEO A;  2AKL A;  2O31 A;  2K9G A;  5CQY A;  5C6S A;  1Q7Y R;  4Z8A A;  1AOJ A;  2OAU A;  5FW9 A;  1Q82 U;  3E19 A;  2WSF E;  3JCM P;  5GAM j;  2VGN A;  4OMF B;  1UTI A;  1N9S A;  1VQ8 T;  1AZE A;  4A54 A;  3SFM A;  2RI3 A;  1IRE B;  3EGD A;  2YT6 A;  2P84 A;  2CH4 A;  2DXB A;  1KFZ A;  4MMK A;  4E6R A;  3JCM f;  2DZC A;  4J9E A;  3GP8 A;  2OTJ T;  2L5Q A;  2CP3 A;  4FIB A;  1ZBJ A;  1EX4 A;  3WXM B;  3M57 A;  3G71 T;  2QA4 A;  1AEY A;  5HY6 A;  1U06 A;  4HVW A;  3VJP A;  2OTJ A;  3SWN B;  1WNL A;  3ER0 A;  1M1F A;  1WJR A;  2V8K A;  4QT7 A;  2HBW A;  3QYH B;  2EYW A;  3M0S A;  2DIG A;  1UB4 A;  2E3I A;  2RQW A;  4BY6 C;  1VQM Q;  4QW2 A;  2MCN A;  2QGG A;  1WJQ A;  1CKB A;  2JVV A;  4PJJ A;  2KNB B;  4RTT A;  3CC7 T;  1OX8 A;  1UHC A;  5KYW A;  3LH5 A;  3QJ6 A;  2ED1 A;  4KGV B;  3TEE A;  1X6O A;  1ZQ1 A;  2VXE A;  4OMO A;  1M1G A;  1RUW A;  1W2B S;  2A3L A;  1D09 B;  4IUV A;  1YBY A;  3MEV A;  3UA6 A;  3CCM Q;  1LOJ A;  2JNG A;  3S3N A;  3VS0 A;  1K0X A;  5GMK e;  1YJW T;  4II1 A;  1VQP A;  5I2S A;  4L5G A;  3SDZ A;  3G4S Q;  6AT1 B;  4PFZ A;  2SEM A;  5GAO m;  3X25 B;  1NYF A;  2E6N A;  2O4X B;  5LJ5 d;  1K8A U;  3OQ5 A;  3TSZ A;  4J9F A;  2YRD A;  1WFW A;  2J05 A;  1WHK A;  2X3X D;  1M1K R;  3PMI A;  4L59 A;  4B6M A;  1YIT Q;  4B9X A;  5GAM f;  4OMN A;  4KH0 B;  2F2X A;  1XQH A;  5D6Y A;  1R0C B;  2RHY A;  3MPU B;  4HCB A;  1YI2 A;  4E7K A;  4C92 C;  4M7D B;  2RD1 A;  2DM1 A;  1TG0 A;  2I2L A;  4DBR A;  1K9M U;  2RQT A;  1IB8 A;  2E6Z A;  2O9V A;  3RES A;  3PVQ A;  2RQR A;  2GTO A;  2DIL A;  3PT9 A;  5FU7 B;  5GAN 6;  2XHC A;  1H3H A;  1WXT A;  4J8O A;  1TOV A;  1QQJ A;  2ECZ A;  2ROL A;  4F16 A;  3PIP A;  3EGX B;  2CZ0 B;  1VQL A;  3QXE B;  4C8Q D;  1QW1 A;  4BDY A;  1AD5 A;  4Z89 A;  2LX9 A;  2MF2 A;  1YNZ A;  1JU5 C;  2NUZ A;  1VQ6 T;  2P0P A;  2JTF A;  2EPD A;  1Q81 U;  2A0F B;  3V7R A;  4BAC A;  1N6A A;  4PJO G;  2BTT A;  2A28 A;  3HFN A;  4LUD A;  3I9Q A;  1OOT A;  3WVE B;  2KDS A;  3OSV A;  3HL8 A;  3DLM A;  2SRC A;  4M78 B;  4XK8 E;  2RMO A;  1GFC A;  3HKS A;  5CVI A;  4LDY A;  3I35 A;  2LQ8 A;  4AFZ C;  1M2O A;  4EMG A;  1GXI E;  5CQX A;  2F1L A;  3R6O A;  1LJO A;  2QDL A;  1TUC A;  1Q82 R;  3BDU A;  3MP1 A;  4MDW A;  4HCZ A;  2CZ1 B;  4M75 B;  1QP3 A;  2CT3 A;  2RB6 A;  3J80 E;  3MEU A;  2JW4 A;  2D8J A;  4EDU A;  3URG A;  4CC3 A;  2YHT A;  2Z0W A;  2VAS A;  1RAF B;  2J06 A;  3M56 A;  1WHJ A;  2MAM A;  2Y4X A;  3HRT A;  2E64 A;  1RAA B;  1M9S A;  5KCH A;  2LNV A;  4RTY A;  3CCJ Q;  1NEG A;  5FWC A;  4C5G A;  2FZG B;  4WTO B;  2IPO B;  1GCQ C;  1VQ5 T;  2KRS A;  2LJ3 A;  4DBF A;  5GJV B;  1C6V X;  1AWO A;  3P8H A;  1VQ7 A;  5GAN d;  4FL6 A;  1EZZ B;  4Y91 A;  1ZSZ B;  1JB0 E;  1QVP A;  1VQM A;  2OI3 A;  5C0M A;  5IT9 E;  4M7A A;  2DAQ A;  2RM4 A;  3JCM g;  4J9G A;  2QQR A;  3VS5 A;  3FC3 A;  1D1A A;  2PVD B;  3DKM A;  3OS2 A;  1D0Z A;  2QTV A;  4OF1 A;  4HVV A;  1Y7X A;  2RN8 A;  2COW A;  4EMK C;  2XU8 A;  3CCU T;  3LX7 A;  4RTW A;  4FT4 A;  2KAF A;  3CCM T;  3X20 B;  1ZUU A;  2YXY A;  1GFD A;  4X9D A;  3R6N A;  4C5E A;  3SWN C;  3VS1 A;  4M77 E;  4F7U F;  2X4Y A;  5GMK m;  3G4S T;  3QKJ A;  1VQN Q;  3TQ7 P;  1AWW A;  2E5Q A;  1FYN A;  2EQI A;  4RUG A;  2FPF A;  2JT4 A;  5GAN j;  3MKD A;  1GBQ A;  1YJN Q;  2A37 A;  3CPW P;  1SHF A;  2K2V A;  3G4S A;  4J83 A;  1M27 C;  1K8A R;  3CD6 A;  5GMK i;  1YIT T;  2KRM A;  4X34 A;  2O2O A;  4J9H A;  1KQS S;  3L2V A;  4FSS A;  1FWZ A;  1ABO A;  2JTM A;  4JDS A;  1OPK A;  1JJ2 S;  1UJY A;  2YWW A;  1BU1 A;  3M5A A;  1YIT A;  3EGD B;  2OJ2 A;  3JB9 G;  1M30 A;  4RG8 A;  3EHQ A;  5DLQ E;  1K9M R;  2B86 A;  1SHG A;  3HRS A;  4AFQ C;  3CCR Q;  4OMM A;  2CP6 A;  2MPX C;  4QKU A;  5LJ5 h;  2V1Q A;  4ESR A;  1G83 A;  3E9G A;  5A2Q E;  5KYU B;  1HJD A;  1RAH B;  1K73 U;  1QLY A;  1NM7 A;  2LT1 A;  3CEY A;  3E2U A;  5FU6 C;  4LDW A;  3FLG A;  2HMA A;  4N0A C;  1WI7 A;  2ZCF B;  4OMP A;  2JOY A;  5A0G A;  3H0H A;  4PJL A;  2BE9 B;  3EHR A;  4ELY C;  2V8I A;  4WCI A;  5GAN 7;  2DXT A;  1WPY A;  2RJE A;  2CYZ B;  2LVM A;  4R56 A;  1PC0 A;  1Q81 R;  2MIO A;  1I81 A;  4Y92 A;  4M7D C;  3OS0 A;  1M3A A;  1UGQ B;  1I1J A;  3QDR B;  2G3R A;  3MCA B;  3L2U A;  1VQ8 Q;  3J7A F;  2RHZ A;  3VRZ A;  5CKB A;  1JQQ A;  3H9N A;  5FU7 C;  1TXQ A;  3Q1J A;  2MI6 A;  4NL2 A;  2D1X A;  1VYV A;  2GBQ A;  1TTH B;  1QVG S;  2DL4 A;  3E1S A;  3G71 Q;  2DNU A;  4JRQ A;  1JBM A;  3RBB B;  2MWO A;  2QEX T;  2MOX A;  4MZM A;  1I4K 1;  3OYK A;  5D6W A;  3NTH A;  4XTZ A;  2KMT A;  4M78 G;  1M3B A;  4OB3 B;  8AT1 B;  2YLC A;  3REB B;  3CCJ T;  2EYZ A;  3M0T A;  1G8X A;  1PG5 B;  3VUB A;  3JCM d;  2K5F A;  4OB0 B;  4DOW A;  3L2W A;  1X69 A;  5GAO n;  2YUP A;  3CC2 T;  3JB9 I;  3UT1 A;  4LD6 A;  3UAT A;  2NYS A;  4BD3 A;  1WHL A;  4C92 B;  3VYG A;  3CCJ A;  1X2Q A;  2DL7 A;  4M75 G;  2KI7 A;  2WSE E;  1PKS A;  2EBP A;  1E7O A;  4PK4 A;  4C92 E;  3GF5 A;  3RMQ A;  3A1P A;  2C06 A;  1IHV A;  1K4U S;  3CCL T;  3QO3 A;  3L42 A;  3RMS A;  1VOM A;  3OYB A;  5CKH A;  2GF7 A;  1YJW Q;  2DD4 A;  2HDA A;  4E7J A;  5CKD A;  2HBP A;  2F2V A;  2PQW A;  3MHX A;  2ENM A;  2A36 A;  1Y96 A;  1QVF S;  3CQT A;  3REA B;  3LWI A;  1WXB A;  4FSX A;  5FRO A;  3KXT A;  5GAN h;  4C0Z A;  1M90 C;  2X4X A;  1RLP C;  1ABQ A;  3CPW A;  3ZBD A;  2AZV A;  4AFU C;  2QTX A;  3I56 T;  2IVW A;  1FXX A;  1VQN A;  3OS1 A;  1UGS B;  4M77 G;  4XU3 A;  5IHK A;  5LJ5 g;  4CC4 B;  2R5M A;  2L8D A;  3EFR A;  1ZSZ C;  4XU2 A;  2GFA A;  3RUX A;  2ESW A;  1MV3 A;  1OEB A;  1YJN A;  4F17 A;  4AG1 C;  2AT1 B;  2AZS A;  4FYX B;  1NZ9 A;  1ZUK A;  3M4G A;  2JM8 A;  2R5A A;  2E5K A;  4M7D D;  2AKK A;  1VIE A;  2CS7 A;  1WIE A;  1X6B A;  5GAM d;  4PL6 A;  4ZGD B;  1BCO A;  3V8J A;  1WDX A;  2KK4 A;  3VYH B;  2L89 A;  1ZUY A;  2O9S A;  2M1H A;  3CC4 Q;  3LW5 E;  1T0H A;  2LZ6 B;  1M4Z A;  1KQ1 A;  3CCR A;  1VQ6 Q;  4J9C A;  3G1J A;  2F2W A;  5IHN A;  1I5O B;  1K73 R;  1UHF A;  2K5I A;  4BI8 B;  1B7T A;  4DQ2 A;  3CXC S;  2FRY A;  2DXU A;  3M58 A;  5IXB A;  3BY7 A;  1UFF A;  2R58 A;  2LCL A;  3ME9 A;  2M0O A;  3FDR A;  2YUN A;  4PJO F;  2EKH A;  1Q86 C;  1NJI C;  2KYB A;  5EG2 A;  2VXF A;  3JCM e;  1DJ7 B;  2HNI A;  1WYX A;  5GAN 3;  3QUI A;  3MJX A;  3EFO A;  3LWH A;  3CBO A;  1H8K A;  1UGR B;  4M78 D;  4DOV A;  5GMK j;  2QQA A;  4LN2 A;  1FMW A;  2HZY A;  4EMK B;  1VQ8 A;  4FW2 A;  2YDL A;  4ZN3 A;  2PVG B;  5GAO l;  1WQW A;  1ZSG A;  4Y28 E;  4M7A F;  1V29 B;  1UEB A;  2MYS A;  2AIR B;  4FCY A;  5DM7 R;  2DO3 A;  1QWF A;  4BB7 A;  1Q95 G;  3G71 A;  4QVZ A;  1HYO A;  4EMH A;  4C8Q A;  2GCX A;  3TCJ A;  2JXB A;  1SSF A;  1ZA1 B;  4PNO A;  4M75 D;  1BKB A;  2RK1 A;  5J3B A;  1VQ5 Q;  1OI1 A;  4OGE A;  1S72 T;  4BI4 A;  2W0Z A;  3VS6 A;  3AHU A;  4EPC A;  1K0S A;  5J39 A;  3QG1 A;  2FZC B;  3OYE A;  3F70 A;  1JRI A;  1HD3 A;  4NL3 A;  1GL5 A;  1UGV A;  1GBR A;  3UF4 A;  1K76 A;  1WX6 A;  4BE0 A;  1VIF A;  1B07 A;  3CC7 A;  2QG9 B;  2ROT A;  4A63 B;  4L6V 5;  3EAE A;  2MWP A;  3CCU Q;  2O88 A;  4BUG A;  4FW1 A;  5GAN g;  1YIJ Q;  1ACM B;  3JV3 A;  2EQU A;  1GRI A;  2YUO A;  4CC2 A;  1W2B P;  3S3M A;  2ATC B;  4GBQ A;  1C1A A;  1BK2 A;  4JZ3 A;  3JCM h;  4AG2 C;  1YWP A;  2FB7 A;  4A53 A;  5KYX A;  3GPL A;  5FU6 B;  4C92 G;  3S3O A;  5I22 A;  1TUD A;  3C95 A;  4M77 D;  5CCA A;  4KH1 B;  1YJW A;  5CAI A;  3E9F A;  5I11 A;  2DZ9 A;  4PJN A;  4D8K A;  2VYT A;  2LDM A;  2CSI A;  3SB2 A;  4E7L A;  3TSW A;  3UA7 A;  1UDL A;  2HL3 A;  4JJN K;  4XU1 A;  3D7S B;  2OX7 A;  4WF2 A;  1CSK A;  4VUB A;  2JTE A;  2JN0 A;  1TWB A;  3CMA T;  2BZX A;  4M7D E;  3MET A;  3O5Z A;  2KYM A;  5KYY A;  5LJ3 j;  5M9O A;  5AT1 B;  2IIM A;  3PFS A;  1KD1 U;  3JB9 F;  4ZTF A;  5GAO p;  2HQE A;  3LYI A;  1KC8 C;  1QKW A;  3QSU A;  3OYY A;  1V1C A;  3CC4 T;  1NBE B;  4ZGE B;  1LVK A;  5GAO r;  2LNH B;  2GNC A;  2DTI A;  5GJW B;  3RKW A;  3FIF A;  4HT8 A;  3C12 A;  1VQ6 A;  2KSS A;  5IAY A;  3A8O B;  2KXD A;  4TVR A;  4FYV B;  2HQH A;  2DVE A;  2FEI A;  5GAM h;  2CP7 A;  3HHT B;  2HSP A;  3INZ A;  4M78 E;  1F1B B;  4IUU A;  4MDX A;  5FWB A;  1VQ4 Q;  1AT1 B;  2G6F X;  2K6D A;  1VQO Q;  1RAG B;  1SRL A;  1LPL A;  2QXF A;  2JS0 A;  2KQW A;  1N8R C;  2JUF A;  2QEX Q;  5KE2 A;  2LX7 A;  4EIK A;  4J7F A;  5GMK l;  1Y96 B;  2DE0 X;  2DPP B;  4JLI A;  1B3Q A;  1XOV A;  2CH4 W;  4M75 E;  4PJO A;  4CC7 A;  2QQS A;  3LGF A;  2A7Y A;  4XAX B;  1Q7Y C;  4FYY B;  3CC2 Q;  2A08 A;  3OYN A;  2P0K A;  2JJ9 A;  3PIO A;  5FRM A;  1WA7 A;  5LJ5 e;  5LJ3 f;  2LJ0 A;  1BB9 A;  1BBZ A;  4RKU E;  2DXC A;  2KY9 A;  1T3S A;  4M7A C;  1RI9 A;  2J6K A;  4XTU A;  1VQ5 A;  4F7U B;  3PMT A;  5CKE A;  2JM9 A;  3CCL Q;  2X35 A;  1D3B A;  3GOX A;  2CZ7 B;  2X51 A;  3VRY A;  4C92 D;  1QMC A;  1YP5 A;  4QVD A;  3EG1 A;  3G6E T;  2P0Q A;  2J7I A;  2DJQ A;  4KGZ B;  1MHN A;  2XDD A;  1YIJ T;  3OYG A;  3MO8 A;  1W2B A;  1VQK T;  4IUP A;  1TSF A;  1G2B A;  3ASK A;  5HCK A;  1Y0M A;  3CCU A;  1MMN A;  1D1C A;  2DYI A;  4KBM B;  3ZEH A;  3I55 T;  3CCM A;  2EQK A;  1VA7 A;  3H0F A;  1RAC B;  1G3W A;  2LT4 A;  3I56 Q;  1AWX A;  3HRU A;  3KUF A;  1NLO C;  3BE3 A;  2P4T A;  1PHT A;  1Y07 A;  3VS4 A;  2RA2 A;  2RK2 A;  1PKT A;  2HCK A;  2L3S A;  3MP6 A;  2IG0 A;  3EFO B;  3JAM E;  1BI1 A;  2DD5 A;  1PCX A;  1N5Z A;  1KQS P;  1IO6 A;  1JXO A;  2KRN A;  2RF0 A;  3OW2 S;  3RR6 A;  5GAN 4;  4LDV A;  5HKC A;  1JJ2 P;  3DLL A;  3JCM J;  2K3Y A;  3M0U A;  1CKA A;  1RAE B;  4GLM A;  1BI0 A;  1M2V A;  1X2K A;  1XNI A;  1M1K C;  2ED0 A;  2FHD A;  2XK0 A;  4O6J A;  1ZA2 B;  2FO0 A;  1WZO A;  3CBM A;  4C8Q B;  1KD1 R;  1KHC A;  3DB4 A;  2PNI A;  4M7D G;  4KRT A;  1Z9Q A;  2CT4 A;  3QPH A;  4R0K A;  5GAM g;  3J81 E;  2CZ6 B;  4C5I A;  4J5Y A;  3H0I A;  5KYW B;  3EG9 A;  4HXJ A;  2GFU A;  2D0Q B;  1G3Y A;  4A4G A;  2P4R A;  3VV0 A;  3JCM c;  4C8Q F;  3JB9 H;  1AHJ B;  5GAN 5;  4JJC A;  2JMC A;  4HT9 A;  2VUB A;  5CO7 A;  2KGT A;  1IHW A;  3H41 A;  4C0F A;  2RI2 A;  3LH0 A;  3NTI A;  2EYX A;  1MNE A;  2EJG A;  2LQN A;  2CP0 A;  4JRK A;  5GAN e;  1X75 C;  3M53 A;  2MMP A;  2RQU A;  2V1R A;  3A8M B;  4J6Y A;  2Y4Y A;  1VQ4 T;  1U5S A;  4XTV A;  1VQO T;  4QVC A;  2PUK B;  5DLO A;  2LP5 A;  1EFN A;  2K2M A;  5KYX B;  3JCM W;  4XTY A;  2YLB A;  3V8L A;  1QVG P;  4E7Z A;  1VQ4 A;  3GNF B;  5GAN 8;  1VQO A;  1NEB A;  1S1N A;  4JLG A;  1Y71 A;  2DRM A;  2D0N A;  2QEX A;  1AVZ C;  1S72 Q;  2YSQ A;  3NMZ C;  1VYU A;  4DBH A;  2BIV A;  1TH7 A;  3NTK A;  1U3O A;  1UGP B;  1V76 A;  1O75 A;  2CDT A;  4C0D B;  2J6F A;  1Q82 C;  5IHI A;  1RL2 A;  2DX1 A;  3AT1 B;  1R8O B;  2VC8 A;  5IN1 A;  1K1Z A;  3JCM b;  2XKO C;  2LCS A;  2RHU A;  3CC2 A;  3KBG A;  3MP8 A;  5FRN A;  5KYY B;  1UUE A;  2F5T X;  2K3X A;  9ATC B;  1BI3 A;  2ZPF B;  4BE2 A;  4OB2 B;  1NPP A;  5IH2 A;  4A4F A;  2HD0 A;  3EH1 A;  4D8D A;  4KUD K;  1NE8 A;  1VQ9 T;  1LCK A;  1OZ2 A;  2E41 A;  2E12 A;  1RAD B;  1H3Z A;  3CCL A;  2M02 A;  1VQP Q;  2QK0 A;  2DLP A;  2XG8 D;  1YFN A;  4RCB A;  2KT1 A;  1PNJ A;  2XDB A;  2K79 A;  4F7U G;  4LDU A;  1QVF P;  2QQ9 A;  3QZ5 B;  5LJ3 g;  4DBQ A;  3PE0 A;  2OAW A;  4M75 A;  2GQV A;  2DET A;  1BIA A;  2NWM A;  5CK9 A;  1WLP B;  2D8H A;  3CMA Q;  2RJF A;  1KIK A;  2NUP A;  4N4G A;  3RIR A;  1RAB B;  3I56 A;  1KQS A;  3QHS A;  3EGU A;  3RER A;  1JJ2 A;  1LNX A;  1SSH A;  1YJ9 Q;  3I5S A;  5KCO A;  2CKK A;  1QCN A;  1YHQ Q;  4J7I A;  4NS5 A;  3P8B B;  4PJO B;  3OYM A;  2DMO A;  3CCS T;  1WXU A;  1K8A C;  5HK3 A;  2EQJ A;  2DL8 A;  5CKF A;  3X28 B;  4ATO A;  1GCP A;  2O01 E;  4RG2 A;  2ZPB B;  1SEM A;  4MML A;  4JRI A;  5GAN 2;  4M77 A;  2VWF A;  5DY9 A;  3UPU A;  3OB9 A;  3TU4 K;  3NGP A;  4E7H A;  1K9M C;  2E4H A;  2KR3 A;  4E7I A;  2H3E B;  3CXC P;  2EKO A;  3CCV T;  2RJC A;  1RLQ C;  4M7A B;  2BZY A;  3LLR A;  2PZ1 A;  1Y57 A;  1KG1 A;  1D3B B;  4AT1 B;  4QQG A;  3A8L B;  3A8H B;  3M55 A;  3JCM Q;  4NOY A;  5LL6 S;  2YUQ A;  2L2P A;  4OMQ A;  1OU8 A;  2K5L A;  2VVK A;  4M7A E;  3L2R A;  4E47 A;  4KGX B;  5CR2 A;  3G7Z A;  4IKF A;  3OS5 A;  4YTL A;  4MZP A;  4LUE A;  3CCQ Q;  2LQK A;  1BIB A;  1J3T A;  1QVG A;  3EG3 A;  4C8Q C;  2QA4 T;  1QCO A;  2EW3 A;  1Q81 C;  3X24 B;  1XJW B;  3V8K A;  2RH2 A;  1E6H A;  2LRQ A;  3HP9 A;  3QDF A;  5L23 A;  4ZTJ A;  1YCS B;  2DTH A;  2D9T A;  4XTX A;  2KRO A;  5KYU A;  3QJY A;  2WSC E;  1C0M A;  1S72 A;  1IZ6 A;  1VQ7 Q;  3OYC A;  4KUI A;  3QWX X;  4J6W A;  4XQ3 A;  2ZGW A;  4B9W A;  1OX9 A;  1BYM A;  4GY5 A;  4N4H A;  4A4E A;  4FU6 A;  1YWO A;  2PUO B;  1M90 U;  3G6E Q;  2XI9 A;  3THK A;  2VKN A;  1M2V B;  3OYL A;  4JZ4 A;  3QWY A;  1VQK Q;  1IXD A;  1D1B A;  3CPF A;  2HAX A;  2X3W D;  3OYI A;  2KVQ G;  3RNJ A;  1WJS A;  5LJ3 d;  1MMA A;  4RCC A;  3SHW A;  4O5V A;  3TVT A;  3I55 Q;  2MK5 A;  4ELZ C;  5I21 A;  1VQP T;  1B34 A;  5D7U A;  2DJZ A;  1M8V A;  2VB6 A;  5GAM e;  1HK9 A;  2DYB A;  2L3P A;  2JS2 A;  2LTO A;  4V2S A;  2LJ1 A;  3CCE Q;  2C0T A;  1FMK A;  3EG9 B;  1QVF A;  1ZX6 A;  1W4S A;  5KE3 A;  1MGQ A;  2VV5 A;  3OBW A;  4C0D C;  3TRE A;  3CD6 Q;  2K3B A;  1MMD A;  3L1A A;  1OUL A;  2NLU A;  4JUV A;  2KT8 A;  1YI2 T;  3EG0 A;  2EYQ A;  2XIC A;  2CUD A;  2DBK A;  2DEU A;  3U23 A;  3OYA A;  4CI0 C;  1TU0 B;  3CME Q;  2EJF A;  2M16 A;  3OMG A;  2DL3 A;  4RTZ A;  3CMA A;  1RI0 A;  1QWE A;  2X4W A;  2NUT A;  1A0N B;  1O9S A;  3VKI A;  4C92 A;  1Q86 U;  1NJI U;  1YJ9 T;  2BKD N;  4X1V A;  3JSC A;  2DK3 A;  3WVD B;  1YHQ T;  1X6G A;  4HA8 A;  2B8A A;  2QI2 A;  3OYJ A;  1U1T A;  2E70 A;  3GLX A;  1Z9Z A;  3RKY A;  1VQL T;  2CSQ A;  3HSB A;  1VUB A;  1VYT A;  2CGH A;  3X26 B;  1YJ9 A;  2PTK A;  2BE7 D;  1IGQ A;  4F04 B;  3OYF A;  2KXC A;  1YHQ A;  2EQM A;  5LJ5 j;  4JJD A;  4M7D F;  1ZHI A;  3CC4 A;  4HCC A;  1MUZ A;  2CRE A;  3L2Z A;  3GBQ A;  4IUR A;  3HPW A;  5A0D A;  4QQ6 A;  4DEX A;  1HXD A;  3CXC A;  1SKU B;  4J6X A;  1P92 A;  2OTL Q;  1AZG B;  1OQK A;  3QZ9 B;  3UWN A;  2AK5 A;  4E7S A;  3OSS C;  1PWT A;  4AFS C;  2EAY A;  2E10 A;  8ATC B;  2COZ A;  1H64 1;  5J26 A;  5KH6 A;  5GMK h;  2H3J A;  1WHM A;  1ZLM A;  1YCY A;  2ZPE B;  1K73 C;  2H8H A;  3NPF A;  4PJO C;  3L2Q A;  2QQB A;  1NYG A;  3CCQ T;  2FRW A;  1OYX A;  3M4Y A;  4LNP A;  2LMJ A;  4ORZ A;  4M7A G;  1JEG A;  5GAO q;  2V26 A;  2RQV A;  3DB3 A;  3CCQ A;  1SRM A;  1U8R A;  5LJ3 e;  4M78 F;  3H6Z A;  4BDZ A;  4ZN1 A;  4KT0 E;  3HTR A;  2RJD A;  1G3S A;  2DER A;  5KYN A;  4KUL A;  2Y90 A;  1G5V A;  3M0P A;  2XMF A;  1I0C A;  2NUP B;  2K4Y A;  1X43 A;  3FB9 A;  3VS2 A;  1X01 A;  1SPK A;  3O8V A;  3UDC A;  4PFO A;  1NPR A;  1W6X A;  1VQ7 T;  4ANJ A;  1R0B G;  3OYH A;  4MZT A;  2RO0 A;  4LXC A;  1VQM T;  4M75 F;  4D6W A;  3HFO A;  3VU3 C;  4F7U E;  1GCQ A;  2ZPI B;  4OVA A;  1VQ9 Q;  2E3H A;  2ZPG B;  3PNW C;  1OU9 A;  1M90 R;  2M51 A;  2RI5 A;  5LJ5 f;  1TUG B;  1FMV A;  3EFS A;  2RHX A;  4RTU A;  2E1H A;  2M9U A;  3G6E A;  2RNA A;  4J9I A;  1YIJ A;  3A98 A;  2VGM A;  5EC7 A;  2HL5 C;  1VQK A;  4M77 B;  2FPE A;  2JZ2 A;  4JJB A;  1RAI B;  4JS5 A;  3CCE T;  4EMK A;  3FRN A;  3VS3 A;  4XU0 A;  3M9Q A;  3P8D A;  4OP0 A;  3I55 A;  5AYF A;  4JS4 A;  1KC8 U;  4FYW B;  3CPW S;  4LDX A;  2KBT A;  1N27 A;  3SWN A;  2CUB A;  3FJ5 A;  3CD6 T;  4C5H A;  3ULR B;  3CCE A;  3BDL A;  1PRM C; 
#chains in the Genus database with same CATH homology
 2EFI A;  1OZ3 A;  1WQW A;  4GLK A;  2HD0 A;  3M54 A;  4M77 F;  4ME7 A;  4Y28 E;  1V29 B;  4JRP A;  4M7A F;  2EIF A;  1VQ6 T;  2P0P A;  2JTF A;  1Q81 U;  5LJ3 h;  1UEB A;  1KQ2 A;  5DM7 R;  2DO3 A;  1NE8 A;  4KUD K;  4BB7 A;  3V7R A;  4BAC A;  1N6A A;  4PJO G;  1OZ2 A;  2E41 A;  1VQ9 T;  3G71 A;  2E12 A;  4QVZ A;  1H3Z A;  2X4J A;  4BI3 A;  3CCL A;  4EMH A;  4C8Q A;  4N4I A;  2GCX A;  3HFN A;  3CME T;  3TCJ A;  1SSF A;  4PNO A;  1M5Q 1;  4M75 D;  1BKB A;  4Q5W A;  3WVE B;  2RK1 A;  5J3B A;  2KDS A;  1OI1 A;  2XG8 D;  3OSV A;  4OGE A;  3HL8 A;  4BI4 A;  1S72 T;  4RCB A;  3OMC A;  3DLM A;  4M78 B;  4CRI A;  3OA6 A;  4XK8 E;  3RKX A;  2XDB A;  3AHU A;  4EPC A;  3CME A;  4DA4 A;  5J39 A;  4F7U G;  3HKS A;  4LDU A;  3QG1 A;  3OYE A;  5CVI A;  3F70 A;  4LDY A;  2QQ9 A;  1JRI A;  2LQ8 A;  3QZ5 B;  2YRV A;  4EMG A;  5LJ3 g;  4M75 A;  2GQV A;  4NL3 A;  1GXI E;  5CQX A;  1BIA A;  4C8Q E;  3R6O A;  1LJO A;  5CK9 A;  4BE0 A;  3BDU A;  1N8R U;  1VIF A;  4PJO D;  3MP1 A;  3CC7 A;  2RJF A;  4HKE A;  4MDW A;  4XTW A;  4A4K A;  4HCZ A;  4L6V 5;  2CZ1 B;  3EAE A;  2K57 A;  1QP3 A;  4M75 B;  4N4G A;  4ZGJ B;  2RB6 A;  3RIR A;  2MWP A;  3MEU A;  1PSE A;  3J80 E;  3A8G B;  4BUG A;  3C94 A;  5GAN g;  2D6F A;  3I56 A;  4EDU A;  3URG A;  1KQS A;  2YHT A;  3OBY A;  2EQU A;  5HK0 A;  3QHS A;  2FL7 A;  3M56 A;  1PSF A;  3RER A;  1JJ2 A;  1LNX A;  2MAM A;  2O4X A;  2Y4X A;  3HRT A;  2E64 A;  2OTL T;  4N0A A;  4PLL A;  4BY6 B;  3S3M A;  1M9S A;  5KCH A;  2LNV A;  3M59 A;  3PGG A;  1Q7Y U;  5KCO A;  3JCM h;  1QP2 A;  2CKK A;  2FB7 A;  4A53 A;  2QDY B;  3GPL A;  2ZPH B;  3N5B B;  5FU6 B;  4C5G A;  4C92 G;  3S3O A;  4J7I A;  4NS5 A;  3P8B B;  3QYG B;  3C95 A;  3S6W A;  2OTL A;  3OYM A;  4PJO B;  4M77 D;  4M7A D;  3CCS T;  5CCA A;  1VQ5 T;  4RMO A;  1K8A C;  1YJW A;  5HK3 A;  3GNG A;  3ZFJ A;  2EQJ A;  5CAI A;  3E9F A;  2DZ9 A;  4M7D A;  2VYT A;  5CKF A;  2LDM A;  2ZZD A;  3P8H A;  3SB2 A;  3X28 B;  4IUT A;  3V7C A;  5GAN d;  4E7L A;  1VQ7 A;  4ATO A;  4FL6 A;  1B34 B;  2O01 E;  4OGC A;  4RG2 A;  4Z02 A;  2ZPB B;  4Y91 A;  4MML A;  1WQ7 A;  4JRI A;  5GAN 2;  1JB0 E;  1QVP A;  4JJN K;  1VQM A;  4XU1 A;  4OB1 B;  5C0M A;  1I8F A;  5IT9 E;  4M77 A;  2DKG A;  4M7A A;  2DAQ A;  5DY9 A;  2RM4 A;  3JCM g;  3UPU A;  2QQR A;  4WF2 A;  4VUB A;  3OB9 A;  3TU4 K;  4E7H A;  1K9M C;  2JN0 A;  3CMA T;  3FC3 A;  4E7I A;  2PVD B;  5GAN f;  2FVU A;  3DKM A;  3OS2 A;  1BI2 A;  4OF1 A;  4M7D E;  3OY9 A;  2EKO A;  1Y7X A;  2R57 A;  2RJC A;  3CCV T;  3MET A;  4M7A B;  4EMK C;  2DIQ A;  2XU8 A;  3CCU T;  3LLR A;  3LX7 A;  1KG1 A;  1D3B B;  4FT4 A;  2KAF A;  4QQG A;  3CCM T;  3A8L B;  5LJ3 j;  4BE1 A;  3A8H B;  3X20 B;  3GIB A;  3M55 A;  3JCM Q;  4NOY A;  4X9D A;  5LL6 S;  5M9O A;  2PU9 B;  5FLX E;  3C4S A;  2K5L A;  3NFC A;  3PFS A;  4C5E A;  1KD1 U;  3SWN C;  3JB9 F;  4M77 E;  4M7A E;  3L2R A;  4ZTF A;  1ZBX A;  4PLI A;  5GAO p;  4F7U F;  1U1S A;  2X4Y A;  5GMK m;  3G4S T;  2HQE A;  3QKJ A;  3LYI A;  4E47 A;  5CR2 A;  1KC8 C;  1XTD A;  3QSU A;  3G7Z A;  2E5Q A;  3BW1 A;  3OYY A;  4IKF A;  3PTA A;  4A4H A;  3OS5 A;  4YTL A;  1I5L A;  5GAN j;  4MZP A;  3CC4 T;  2LQK A;  1BIB A;  1FX7 A;  1QVG A;  4M78 C;  4ZGE B;  2K2V A;  2RHI A;  3G4S A;  4J83 A;  5GAO r;  4X9C A;  4C8Q C;  2EWN A;  2AHJ B;  2QA4 T;  3CD6 A;  5GMK i;  1YIT T;  4X34 A;  2DTO A;  4M78 A;  1Q81 C;  3X24 B;  2DTI A;  2E65 A;  4FM4 B;  3RKW A;  1KQS S;  3L2V A;  1FWZ A;  3V8K A;  1EIF A;  3FIF A;  2JTM A;  4JDS A;  4HT8 A;  3C12 A;  2RH2 A;  1JJ2 S;  2LRQ A;  1VQ6 A;  2PVO B;  2F69 A;  2XD0 A;  2KSS A;  3HP9 A;  3M5A A;  3LGL A;  5IAY A;  1YIT A;  1VQ9 A;  3A8O B;  3JB9 G;  4ZTJ A;  2WAC A;  4RG8 A;  2DTH A;  2D9T A;  4XTX A;  5DLQ E;  4M75 C;  4TVR A;  2DVE A;  5GAM h;  3HRS A;  3QJY A;  4C92 F;  3HHT B;  2WSC E;  5I2M A;  1WGS A;  3INZ A;  1IZ6 A;  4M78 E;  1S72 A;  3OYC A;  2V8J A;  2FYK A;  3FJP A;  4IUU A;  5LJ5 h;  4KUI A;  4MDX A;  4J6W A;  4XQ3 A;  1M1K U;  4LD9 K;  2ZGW A;  4B9W A;  3E9G A;  2L3R A;  1BYM A;  5A2Q E;  2QXF A;  5A0L A;  2KQW A;  4GY5 A;  4N4H A;  4A4E A;  4FU6 A;  1K73 U;  1N8R C;  2JUF A;  2PUO B;  5KE2 A;  1M90 U;  2LT1 A;  3CEY A;  3JRZ A;  4UC4 A;  1VQN T;  5FU6 C;  2XI9 A;  4J7F A;  2BUD A;  5GMK l;  4LDW A;  3OYL A;  3FLG A;  1Y96 B;  2DPP B;  1KHI A;  4N0A C;  3JB9 J;  2ZCF B;  4JLI A;  3JB9 D;  2JOY A;  1YJN T;  5A0G A;  1N9R A;  1XOV A;  3CPF A;  4M75 E;  4PJO A;  4ELY C;  2HAX A;  2V8I A;  5GAN 7;  3OYI A;  2DXT A;  2KVQ G;  2QQS A;  4FT2 A;  3SD4 A;  1WJS A;  1WPY A;  2RJE A;  3LGF A;  5LJ3 d;  2CYZ B;  3QBY A;  4RCC A;  2LVM A;  4O5V A;  4R56 A;  3OYD A;  3OW2 A;  2A7Y A;  4XAX B;  1Q7Y C;  4ELZ C;  5I21 A;  1I81 A;  4IUQ A;  1B34 A;  1VQP T;  2DJZ A;  5L8R E;  3OS0 A;  4M7D C;  1M8V A;  5GAM e;  1HK9 A;  2XID A;  4C0G A;  1UGQ B;  3OYN A;  2LTO A;  2P0K A;  4V2S A;  3QDR B;  4PKC C;  2G3R A;  3MCA B;  3L2U A;  4F7U A;  2HQX A;  3PIO A;  3J7A F;  5FRM A;  2RHZ A;  2LC4 A;  3BFM A;  3CBP A;  5CKB A;  5LJ5 e;  1QVF A;  5LJ3 f;  1G3T A;  4PJO E;  1W4S A;  5KE3 A;  4RKU E;  1MGQ A;  2DXC A;  2KY9 A;  2VV5 A;  4M77 C;  5FU7 C;  4M7A C;  3Q1J A;  3CCR T;  2LCC A;  3OBW A;  2MI6 A;  4XTU A;  4C0D C;  3CCS A;  4NL2 A;  1VQ5 A;  3TRE A;  3MEA A;  2XDP A;  4F7U B;  3JCM X;  3L1A A;  1QVG S;  2NLU A;  3E1S A;  3PMT A;  5CKE A;  4JUV A;  2DEQ A;  4JRQ A;  4QQD A;  2X35 A;  1D3B A;  3GOX A;  2CZ7 B;  1JBM A;  1YI2 T;  2EJ9 A;  2MWO A;  2QEX T;  4C92 D;  2EYQ A;  2XIC A;  4MZM A;  2F5K A;  1I4K 1;  3OYK A;  4QVD A;  4P5N A;  5D6W A;  2P0Q A;  3V7S A;  3G6E T;  3A5Z B;  5CIU A;  3NTH A;  3OYA A;  1MHN A;  4CI0 C;  3QII A;  4R55 A;  4XTZ A;  2XDD A;  3JCM V;  2KMT A;  3H8Z A;  3OYG A;  1YIJ T;  3MO8 A;  1W2B A;  2EJF A;  2M16 A;  4M78 G;  3OMG A;  3CMA A;  4OB3 B;  4IUP A;  1VQK T;  1RI0 A;  2X4W A;  4C8Q G;  2YLC A;  1O9S A;  3T9N A;  3ASK A;  3VUZ A;  3CCV A;  5D6X A;  1KD1 C;  3VKI A;  4C92 A;  1Q86 U;  3CCJ T;  3CCU A;  1YJ9 T;  2BKD N;  1NJI U;  3MEW A;  4KBM B;  3JSC A;  2DK3 A;  3FEO A;  3VUB A;  3ZEH A;  3WVD B;  2EQK A;  3JCM d;  3I55 T;  3CCM A;  1YHQ T;  2K5F A;  4HA8 A;  4OB0 B;  2B8A A;  4DOW A;  2QI2 A;  3L2W A;  5GAO n;  5CQY A;  5C6S A;  3CC2 T;  3JB9 I;  3OYJ A;  1Q82 U;  1U1T A;  1G3W A;  2E70 A;  2OAU A;  3E19 A;  2WSF E;  3GLX A;  4LD6 A;  3RKY A;  3UT1 A;  4BD3 A;  3JCM P;  1VQL T;  3HSB A;  4C92 B;  5GAM j;  2VGN A;  1VUB A;  2LT4 A;  1N9S A;  2CGH A;  4OMF B;  3VYG A;  3X26 B;  3CCJ A;  4A54 A;  1YJ9 A;  1VQ8 T;  3SFM A;  4M75 G;  3HRU A;  2RI3 A;  3KUF A;  1IRE B;  2WSE E;  3OYF A;  1YHQ A;  2EQM A;  2P4T A;  2DXB A;  5LJ5 j;  4MMK A;  4M7D F;  1ZHI A;  3JCM f;  1Y07 A;  2DZC A;  3GP8 A;  2RA2 A;  3CC4 A;  2OTJ T;  2L5Q A;  3GF5 A;  4C92 E;  2RK2 A;  4HCC A;  3RMQ A;  4FIB A;  3WXM B;  3MP6 A;  3L2Z A;  2C06 A;  4IUR A;  2IG0 A;  3M57 A;  3HPW A;  3JAM E;  3G71 T;  5A0D A;  2QA4 A;  4QQ6 A;  3QO3 A;  3CCL T;  1HXD A;  1BI1 A;  2DD5 A;  3CXC A;  3L42 A;  4J6X A;  1P92 A;  5HY6 A;  3RMS A;  3VJP A;  2OTJ A;  3OW2 S;  3SWN B;  3QZ9 B;  3UWN A;  4LDV A;  5CKH A;  2GF7 A;  5GAN 4;  3OYB A;  1WNL A;  5HKC A;  2DD4 A;  1M1F A;  3ER0 A;  3OSS C;  1WJR A;  4E7J A;  3DLL A;  2V8K A;  2K3Y A;  3JCM J;  5CKD A;  2EAY A;  2HBP A;  2E10 A;  3QYH B;  2PQW A;  1H64 1;  3MHX A;  1BI0 A;  5J26 A;  2DIG A;  1UB4 A;  5KH6 A;  5GMK h;  1Y96 A;  1QVF S;  1XNI A;  2H3J A;  4BY6 C;  1M1K C;  4QW2 A;  3LWI A;  1WJQ A;  2FHD A;  2JVV A;  4FSX A;  2XK0 A;  1YCY A;  2ZPE B;  4O6J A;  5FRO A;  5GAN h;  3KXT A;  1K73 C;  4C8Q B;  3CBM A;  4C0Z A;  1KHC A;  3DB4 A;  1M90 C;  2X4X A;  4M7D G;  3CC7 T;  4PJO C;  3L2Q A;  2QQB A;  3CPW A;  3ZBD A;  3CCQ T;  3QPH A;  5GAM g;  1OYX A;  3M4Y A;  3QJ6 A;  3J81 E;  2QTX A;  2CZ6 B;  4C5I A;  3I56 T;  2IVW A;  1FXX A;  3TEE A;  1X6O A;  1VQN A;  4J5Y A;  1ZQ1 A;  3OS1 A;  1UGS B;  4M77 G;  4XU3 A;  5LJ5 g;  4M7A G;  2VXE A;  2R5M A;  2L8D A;  3EFR A;  1M1G A;  5GAO q;  4XU2 A;  2GFA A;  3RUX A;  3DB3 A;  3CCQ A;  1W2B S;  2A3L A;  2GFU A;  2D0Q B;  1G3Y A;  1YJN A;  1U8R A;  4IUV A;  5LJ3 e;  4M78 F;  3H6Z A;  1YBY A;  4A4G A;  3MEV A;  3VV0 A;  3JCM c;  4BDZ A;  4ZN1 A;  4KT0 E;  1NZ9 A;  3M4G A;  2RJD A;  1G3S A;  2R5A A;  4C8Q F;  3JB9 H;  1LOJ A;  1AHJ B;  2JNG A;  5GAN 5;  4KUL A;  2Y90 A;  1G5V A;  3S3N A;  4HT9 A;  2VUB A;  5CO7 A;  4M7D D;  4C0F A;  2RI2 A;  3LH0 A;  3NTI A;  5GMK e;  2K4Y A;  1YJW T;  4II1 A;  1VIE A;  2CS7 A;  3FB9 A;  1VQP A;  5I2S A;  4L5G A;  2EJG A;  3SDZ A;  1X01 A;  4JRK A;  5GAM d;  3O8V A;  3UDC A;  4PL6 A;  1NPR A;  4ZGD B;  3V8J A;  5GAN e;  1X75 C;  5GAO m;  1VQ7 T;  3M53 A;  2MMP A;  3A8M B;  4J6Y A;  3X25 B;  2E6N A;  2Y4Y A;  1VQ4 T;  2KK4 A;  3VYH B;  2O4X B;  5LJ5 d;  2L89 A;  3OQ5 A;  4MZT A;  2M1H A;  4XTV A;  3OYH A;  1VQO T;  1K8A U;  2RO0 A;  3LW5 E;  4QVC A;  1VQM T;  1M4Z A;  1KQ1 A;  2PUK B;  4M75 F;  5DLO A;  4D6W A;  3HFO A;  3CCR A;  3VU3 C;  3JCM W;  4XTY A;  2YLB A;  3PMI A;  3V8L A;  4L59 A;  2ZPI B;  4F7U E;  4B9X A;  4OVA A;  5GAM f;  2ZPG B;  3PNW C;  1VQ4 A;  1XQH A;  5D6Y A;  3GNF B;  5GAN 8;  2K5I A;  4BI8 B;  2RHY A;  1VQO A;  4HCB A;  4JLG A;  1YI2 A;  1Y71 A;  2RI5 A;  4DQ2 A;  5LJ5 f;  3CXC S;  4E7K A;  3EFS A;  4C92 C;  4M7D B;  2DXU A;  2RHX A;  3M58 A;  2QEX A;  2RD1 A;  2E1H A;  2I2L A;  3BY7 A;  1K9M U;  2M9U A;  2R58 A;  2LCL A;  3ME9 A;  3G6E A;  2M0O A;  2E6Z A;  3RES A;  3FDR A;  2BIV A;  1TH7 A;  3NTK A;  1YIJ A;  4PJO F;  1UGP B;  1Q86 C;  1NJI C;  2VGM A;  1VQK A;  1O75 A;  3PT9 A;  4M77 B;  5FU7 B;  4C0D B;  2XHC A;  5GAN 6;  2JZ2 A;  5EG2 A;  1Q82 C;  2VXF A;  4J8O A;  3JCM e;  4JS5 A;  3CCE T;  1DJ7 B;  1RL2 A;  2HNI A;  4EMK A;  5GAN 3;  3QUI A;  3FRN A;  3LWH A;  3CBO A;  4XU0 A;  1R8O B;  2VC8 A;  3M9Q A;  5IN1 A;  3P8D A;  4OP0 A;  3I55 A;  3JCM b;  2XKO C;  5AYF A;  1UGR B;  4JS4 A;  2RHU A;  3CC2 A;  4M78 D;  3KBG A;  4DOV A;  3MP8 A;  3PIP A;  1KC8 U;  5FRN A;  5GMK j;  2K3X A;  2F5T X;  2QQA A;  1N27 A;  1BI3 A;  3SWN A;  3CPW S;  2CZ0 B;  4LDX A;  3CD6 T;  4C5H A;  3QXE B;  2ZPF B;  4C8Q D;  3CCE A;  1VQL A;  1QW1 A;  4BE2 A;  4EMK B;  4OB2 B;  1NPP A;  4BDY A;  1VQ8 A;  3BDL A;  4ZN3 A;  2LX9 A;  2PVG B;  4A4F A;  2MF2 A;  5GAO l; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...