4Y28E

The structure of plant photosystem i super-complex at 2.8 angstrom resolution.
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
PPIGPKRGAKVKILRQESYWYKGTGSVVTVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of plant photosystem I super-complex at 2.8 angstrom resolution.
pubmed doi rcsb
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4y28E00
2D0QB 3X26B 2DPPB 1V29B 2ZPEB 2WSEE 1GXIE 4XK8E 3QYGB 2DXCA 2WSCE 1UGRB 3X25B 2ZPGB 2ZCFB 1JB0E 3QZ5B 2CZ7B 3A8LB 2PVGB 3QYHB 2DXBA 4Y28E 2CYZB 4KT0E 3QXEB 3QZ9B 3HHTB 1UGPB 3X24B 3A8GB 4OB3B 2DD4A 2DD5A 1PSEA 3X20B 1AHJB 3X28B 1QP3A 3A8OB 3LW5E 4ZGJB 2WSFE 3WVDB 1QP2A 2AHJB 2ZPHB 4L6V5 4OB2B 3VYGA 4ZGEB 1IREB 1UGQB 2CZ6B 2PUOB 4FM4B 1UGSB 2CZ1B 2CZ0B 2ZPIB 2PVOB 4OB1B 2ZPFB 3A8HB 3VYHB 1PSFA 2ZZDA 2PU9B 4OB0B 2PUKB 2ZPBB 1DJ7B 2PVDB 4ZGDB 3A8MB 2O01E 2QDYB 4RKUE 5L8RE 3WVEB
chains in the Genus database with same CATH superfamily
3EG9A 3MEUA 2L89A 1GCQA 1V29B 3L42A 5KE2A 4AMCA 2GF7A 3LGFA 2K3YA 3QYGB 1YJNT 3PVLA 2LP5A 4M77F 2CP0A 1VQLQ 1M2VA 1U1SA 5GAN5 1IO6A 1YJ9Q 2ZPGB 4M7DC 4FSXA 2KSSA 1SPKA 2LT4A 4A4KA 1NG2A 4C8QF 1YHQT 1AZGB 1VQLA 2K3XA 1QWEA 1TUDA 3BDUA 3JB9D 2HL3A 3TSZA 4EMKA 1YJ9A 5GANf 4PLLA 5FROA 3P8BB 3J7AF 1A0NB 5GAN6 5C6SA 2ED0A 3M53A 3X24B 4LD9K 2ABLA 4B9XA 2NYSA 1U5SA 2K5FA 5FRNA 1D3BA 3C4SA 1VQ6T 3O8VA 2RQWA 4C92A 2A37A 5KYNA 2BTTA 4M75G 2C0OA 4LXCA 4C0FA 3OS1A 1WXTA 2YT6A 1JU5C 2RN8A 3I55T 4M7DF 2AKKA 1NLPC 2EJFA 3RMSA 5KYUB 5GAMf 1KC8C 1D0YA 3GBQA 4II1A 4LE9A 4BI3A 3OS0A 2RQTA 2M1HA 2JN0A 2QGGA 1N8RR 2X9HA 1PSFA 5LJ3g 4NS5A 2PUKB 4JLGA 2QAZA 1B3QA 4CC2A 1WGSA 2COWA 3NFCA 3CCRA 5GAN2 2VV5A 4OMOA 2P4TA 2MI6A 3A5ZB 4FYYB 5D6WA 2CREA 1U3OA 1OEBA 1K0XA 4JS5A 2EVRA 1MMNA 2RNAA 1ACMB 1BI3A 1ZUYA 1LPLA 4M75A 4XQ3A 1Q95G 2M51A 3VKIA 1M1KU 3KFVA 2X51A 2OJ2A 4MZMA 1WXUA 3CQTA 2O31A 5GAN3 1W70A 3S3NA 1X2QA 2P4RA 4DBFA 2Y4YA 3CCJA 2E70A 5LJ5d 4M77B 3SWNC 4D8DA 4F7UF 5L23A 3MKDA 1TU0B 2BE9B 4GBQA 3RESA 1OYXA 5I22A 3Q1JA 2KT8A 1RLPC 2HEQA 3MEVA 1NZ9A 4AG1C 1E6HA 4C8QB 1AWXA 2CH4W 2KQWA 1SSHA 1YJWQ 3ZEHA 2NWMA 3CCLT 3GP8A 1Q86U 3NHNA 4M7AA 3TREA 1KQSA 2DLPA 2JT4A 3JCMJ 2K79A 3ZFJA 1QVGA 1K9MC 5CVIA 2DRKA 2L2PA 3CCVT 2J06A 2NUTA 5HKCA 3PVQA 1NE8A 1NPPA 1YJWA 1FYNA 4IURA 4BB7A 2AIRB 3G6ET 3UA6A 4AFSC 2KROA 4JRKA 4XTZA 2LCSA 4C8QE 2LT1A 2GQVA 3VYHB 2PU9B 2RJFA 1NM7A 2DO3A 2O01E 2QYZA 2LJ3A 2EJGA 2YHTA 1AWJA 1X27A 1ZBJA 1LOJA 3HRUA 5D6YA 1ZA1B 4QT7A 3PE0A 4C0DB 5FWCA 1M9SA 1MV3A 4JJCA 1M3CA 5KYYA 3S3OA 4Z88A 2ZPEB 2FB7A 1K0SA 3JCMc 3JCMP 1JJ2P 4XK8E 2JW4A 1JRIA 2L3QA 2HBPA 3DB3A 4M7DE 1I5LA 4IUVA 1VQLT 4QW2A 3OSVA 1YJ9T 1M8MA 4IUQA 3MO8A 2W0ZA 3RKYA 3VUBA 2YLBA 1Q86C 3LYIA 1YN8A 3HTRA 5J3BA 1SHGA 1Y71A 2KDSA 1J3TA 3JCMd 5GAN4 1OZ3A 2KE9A 4ORZA 2ROTA 1BU1A 1K73R 3UATA 4ATOA 5CK9A 2BIVA 4MZPA 3E9FA 4C5GA 1N9SA 1MMAA 4QKUA 1UJ0A 4JRIA 1LCKA 4L6V5 5FU6C 1GBRA 1T3SA 1UTIA 5J26A 4F04B 3IQLA 4RCCA 1RI9A 3EHRA 2AK5A 1YI2Q 4OVAA 4OMMA 1AEYA 2RHXA 3CCRT 3M0RA 2DJZA 3CCUA 1Q82U 3ULRB 2EYXA 1KSWA 1M5Q1 1VQKQ 4F7UE 2M02A 4OMFB 2QDYB 2RJEA 2OI3A 2X3WD 3V7SA 4E47A 1VQ9A 1VQ4Q 4M77G 2HCKA 4PLIA 3CPWP 4BE0A 2ZGWA 3SWNB 1R0BG 1TOVA 1O9SA 2DBKA 4UC4A 4PK4A 4E7HA 1GFDA 1KD1U 3M54A 1OU8A 1OULA 4F16A 1ZSZA 2RPNA 1ZA2B 3OYNA 1VQ4A 4C8QG 4M7AD 1UGRB 3OS2A 3PNWC 1ABOA 3PTAA 1G3YA 1NJIC 2LCLA 4L59A 3CCJT 3EGDB 4FW2A 2E12A 2LX7A 1SG5A 1Y57A 3QYHB 4NL2A 4XAXB 2D8HA 4M4ZA 2JS2A 1Q81C 2E5QA 2ATCB 2EYQA 4Y28E 3PMTA 4N4HA 2EWNA 4RCBA 4FYVB 2KYMA 1WHJA 3EH1A 4ELYC 1KHIA 2DTIA 2DEUA 1Q82C 1QP3A 5D7UA 5GAOm 4D6WA 4M7DG 2OTLA 2MK5A 3WVDB 5GMKe 4ZGEB 4JJNK 4JRPA 4N0AC 3OS5A 1TXQA 1UGQB 4A4EA 1VQ7A 2G6FX 2JNGA 2VASA 1AZEA 2OX7A 2R58A 1UECA 2HDAA 2DL7A 5GMKl 4FCYA 5LJ5g 3CC2Q 3CCSQ 3FDRA 3REBB 1IZ6A 1WJRA 1KD1C 2A08A 2I0NA 2KMTA 1VQPT 4AG2C 3CC7Q 4CC7A 2M0YA 3OBWA 2OTJQ 4GY5A 2MIOA 3CC2A 1Y7XA 1BCOA 3CMAT 5HK3A 1OOTA 3CCSA 4QVCA 5GAOn 2K57A 3JSCA 3CC7A 3QUIA 2A0FB 3RKXA 4M7DA 1XNIA 3VS5A 2OTJA 4E7KA 1BBZA 5GANg 1HJDA 4BI4A 2J6KA 1JQQA 3C94A 3CC4A 4RTTA 3G7ZA 1K73U 4XTUA 4C5HA 3EG1A 4LDWA 4IUUA 1XTDA 1TSFA 3RMQA 2EW3A 5FU6B 4F7UG 4E2FB 1KQ2A 3MCAB 2CP5A 4HCZA 3OYFA 4E6RA 4BY6C 5FWBA 2COZA 2DE0X 2DXUA 2X35A 1K9AA 3E19A 4DOWA 4PFOA 1B7TA 3HHTB 2MF2A 4KGVB 3EG0A 2QA4Q 1K4US 5GAMg 3R6NA 3CXCA 2DL3A 1QW1A 3X28B 3OYMA 2GTOA 2JZ2A 5DM7R 3CCMA 2QA4A 2O9VA 2KNBB 3JCMW 3CCUT 1UEBA 5KCHA 1K9MR 1QVPA 2VUBA 2EPDA 2E5KA 5DLOA 5GANe 1ZSGA 4IKFA 2LJ0A 2QI2A 2GQIA 4F14A 4F7UA 5GAOp 1NYGA 4ZTFA 2P0PA 1R0CB 1DJ7B 3CEYA 1VQ9T 5LJ3h 1VQOA 5GAOr 1Z9ZA 3EAEA 3T9NA 1EIFA 2JUFA 4QVZA 4LN2A 4DEXA 5A0GA 4BE1A 1O75A 3M59A 3VU3C 5GJWB 3CCQT 2RQVA 4M77C 1VQMQ 2K5LA 3WVEB 2D0QB 3QIIA 1H92A 2FYKA 2AZSA 2AT1B 3RDVA 3URGA 1K8AR 4KGXB 3TVTA 2HQXA 1UDLA 3EG3A 1VQMA 2WSCE 4AFQC 2QTXA 2DL5A 3PIPA 2VXFA 3VS0A 3M0QA 4RTXA 1OV3A 2EIFA 2DXBA 2KGTA 1X69A 1ZHIA 2GGRA 1YBYA 1OQKA 1GFCA 4RTYA 2FRYA 1D1BA 3JCMb 2ENMA 1GL5A 2OTLT 2D6FA 2GTJA 1WQ7A 2QQAA 2YUPA 2HBWA 2DILA 2YLCA 1JBMA 2A3LA 3EFOB 4Z8AA 1WHGA 1ZUUA 4J9FA 1QWFA 1RAAB 5DY9A 3OW2S 1VQ7T 2E64A 1RAGB 2JJ9A 1QCFA 1JJ2A 4N4GA 2EAYA 3UWNA 4EPCA 1AWWA 1IHVA 4C0DC 5KCOA 3JB9J 4FT4A 3OB9A 2PUOB 3JB9I 1Q7YU 1WQWA 1KQSS 3ER0A 1FMWA 1C0MA 2CZ0B 1QVGS 5GAN8 2IPOB 4FIBA 2YUNA 2JXBA 1RABB 3CC2T 3MP1A 2ZZDA 2H8HA 4CC4B 4MMKA 3OYLA 4PJOF 2KK4A 3R6OA 1WI7A 1U06A 2B86A 4KH1B 3CC7T 4CRIA 3L2VA 2IIMA 4VUBA 1I0CA 4RTWA 3GNGA 1PWTA 4KBMB 1YWOA 4ANJA 2XU8A 5HCKA 4BY6B 3C12A 4FW1A 3TEEA 5KYXA 3EGXB 3I5SA 4XU3A 4IUTA 3CC4T 2BE7D 2CS7A 2DKGA 4JZ3A 4AT1B 3GIBA 1S1NA 4A54A 2EKOA 1VYUA 5A2QE 3JB9F 4R0KA 3E1SA 2LVMA 1UGVA 2FO0A 1BIBA 3KUFA 4PJMA 2NUZA 1VYVA 1W2BA 3NPFA 4J6WA 2P0KA 3WXMB 4DBQA 4J7IA 3MEAA 3G71Q 3JCMf 1S72Q 3OYHA 1HSQA 3QO3A 1Q7YC 3OYGA 1WJSA 5C0MA 2BZXA 4PJNA 1ZBXA 1M90U 4X34A 2EGAA 1UGPB 2KT1A 1KQ1A 2CSIA 2CP6A 3CCMT 2QA4T 3G71A 3CPWA 2XDBA 1QVFP 3VUZA 1X43A 1B07A 4XTVA 2JTFA 4L5GA 1WJQA 3VS7A 1BB9A 1V1CA 4M78D 4F17A 1XQHA 1M3AA 2RI5A 2F5KA 3H41A 4AFZC 5LJ3e 4JRQA 1QKXA 3CD6Q 3OW2A 5IT9E 1VQOT 1ABQA 3M58A 4ESRA 1NPRA 4DQ2A 2DETA 2LDMA 1B34B 3P8DA 1JEGA 2RB6A 2EJ9A 1YITQ 5IXBA 3LLRA 3RKWA 3CD6A 4K11A 4M77E 3M0SA 2FZGB 1N9RA 2JVVA 1GCQC 4BDYA 1MNEA 1NBEB 5GMKh 3U23A 1YITA 5IH2A 2EYYA 4J83A 4OGCA 1VQMT 1NLOC 4WCIA 4PJOB 2DK3A 3I56T 2HNIA 1PD0A 1UUEA 2QGFB 3E2UA 5GAN7 1JXOA 4A4GA 1M1KC 3TQ7P 2E1HA 2BKDN 2EQIA 1RI0A 3EFSA 1NEBA 5KYWA 1BCMA 4OMPA 2CZ7B 5GMKj 2NUPA 4Y91A 4X9CA 5CQYA 4EMKC 2QK0A 3SDZA 2CP7A 3AT1B 4TVRA 1WNLA 4C92D 3UPUA 4B9WA 2HQHA 1TUCA 3BY7A 4JDSA 4RUGA 1FWZA 2DX1A 3KBGA 5CKDA 1YWPA 2Y90A 3CPFA 5IHNA 1RADB 3CBOA 1MUZA 3GPLA 1G3TA 5I2MA 2VGNA 2VKNA 3OA6A 2LNVA 3MEWA 5CKEA 3UT1A 2RM4A 1OI1A 4HVUA 2DVEA 5FW9A 2M9UA 1FMKA 2YRCA 3QDFA 4JJDA 2E41A 2FG0A 1I5OB 2V1RA 2WACA 2CH4A 2QG9B 5I2SA 3G4SQ 3OQ5A 2RH2A 2V8KA 2DTHA 4HT8A 1N8RU 2DZ9A 1KJWA 3VS3A 4D8KA 2MWPA 1RLQC 5LJ5h 1X75C 3EH2A 5HK0A 2DM1A 4C0ZA 5IHIA 1WDXA 1WLPB 2RHUA 1AVZC 1VQ5Q 4M75D 4E7JA 3N5BB 2O4XB 1G2BA 2MPXC 2KY9A 1UHFA 3MP8A 3I9QA 2PTKA 2KRMA 1VQ5A 1LVKA 2D8JA 1TS9A 3H0IA 2KAFA 1YI2A 5KYUA 5GANh 4QQ6A 3VV0A 3BE3A 2K2MA 3FEOA 4Y92A 4XTWA 5CR2A 1AOJA 3RR6A 5M9OA 3HL8A 1VQKA 3SFMA 1BYMA 3OYDA 1OPLA 2LQKA 4M78B 4RTUA 2FZCB 1HYOA 2DYIA 4LD6A 1Z9QA 4PKCC 1UHCA 1VQ8Q 2CSQA 1PD1A 2OAWA 1YIJQ 3GNFB 1PKSA 4M75F 1IGQA 2QDLA 3J80E 3FJ5A 2QEXQ 1IRXA 1N8RC 5GAMh 3M4GA 3DLLA 2GFAA 2E3IA 3CXCS 4HCKA 2HZYA 1BKBA 2WSFE 5CQXA 3L2WA 4M7AC 2DL8A 4XTYA 1VQ8A 4LNPA 1H3HA 1I81A 2X4XA 2Z0WA 3EG9B 3VJPA 2HL5C 2QEXA 4LDVA 2XI9A 4PJOG 2KXCA 1RAEB 1PRLC 1M2VB 3BW1A 4LDXA 2HMAA 1W6XA 2M16A 1HXDA 2DFUA 4M77A 2JM8A 4BACA 4BD3A 2PVDB 3TCJA 1TG0A 5GAOl 3HPWA 1JO8A 1M8VA 1ARKA 1YJWT 2DYBA 3KXTA 2J6OA 5CAIA 2RJCA 1KQSP 4J9GA 4DBRA 4EMKB 1Y07A 4C8QA 2GFUA 3NTIA 4M7AF 3OYCA 4IIOA 1WXBA 1C6VX 2CT3A 3DKMA 1KC8R 3JB9G 1YHQQ 1HD3A 2FHDA 1Y96A 3QPHA 2GNCA 2XICA 3TU4K 3OYAA 1D3BB 2DRMA 4C92B 2R5AA 4CI0C 1E7OA 1NEGA 4MZTA 2H3JA 2RHYA 2RMOA 4KUIA 2Y4XA 4Z89A 3ZBDA 4HVWA 2ZCFB 3QHSA 1VQ6Q 3BFMA 2RI2A 3S3MA 2K3BA 1XOVA 2CYZB 3OYBA 2YRDA 3I55Q 2LJ1A 2J7IA 4J9HA 3QZ9B 2VYTA 1VQ6A 1MNDA 1T3LA 2YRVA 4EMHA 5FU7B 7AT1B 2V8IA 2P0QA 1D0XA 3VS1A 1QP2A 1RL2A 4OB2B 4KUDK 1JJ2S 1YNZA 5LJ5e 1IXDA 4HCCA 4M75B 2LCCA 1GRIA 2D9TA 2LQWA 5EG2A 3GF5A 3INZA 1VIFA 4HCBA 3H0FA 4KH0B 2V1QA 4QQDA 1RAHB 4JPBW 2K4YA 3HKSA 4LUDA 3L2UA 4ZTJA 3RIRA 5FLXE 2XG8D 1TTHB 2FEIA 3M0UA 3NMZC 1OZ2A 3M56A 1QVFA 4EDUA 1YI2T 3RNJA 1X6BA 1ZSZC 3JCMg 3OYIA 2VVKA 3JV3A 4FT2A 4A4HA 2JMCA 9ATCB 2AKLA 2KRSA 8AT1B 1QCNA 3JCMV 2RQRA 1K73C 1VQKT 1M3BA 2QASA 4M7AB 3X25B 3LH5A 3PIOA 3QZ5B 1PNJA 2DIQA 2I2LA 1GCPA 1T0HA 2COYA 2EFIA 3EFRA 3ZL7C 2NUTB 1LNXA 1W2BS 1VQ4T 2DXTA 2E6NA 3PFSA 3V7CA 2VWFA 2BUDA 4AFUC 3D7SB 4BUGA 2KBTA 5GAMe 5CKFA 1GBQA 1RUWA 5LJ3j 4XU2A 3L2RA 2CT4A 1BK2A 2BZ8A 3G6EQ 1I07A 2RI3A 3SWNA 4M7AE 5GJVB 1UFFA 2KR3A 1PSEA 4C8QD 4JLIA 3A8OB 2KXDA 3LW5E 3EGUA 2EGEA 3CPWS 2MOXA 3FJPA 3M55A 1R8OB 2ZPHB 1IHWA 2NUPB 4OMNA 2EYWA 4EIKA 1Q86R 2ECZA 3PT9A 3G6EA 3GLXA 5KYYB 2SRCA 1WYXA 1SKUB 4PJOC 1WIEA 3EGDA 1D1AA 1X6GA 2OAUA 3JCMQ 1UGSB 3JCMe 4FL6A 3MHXA 1I4K1 2YUOA 4ME7A 3UDCA 4BI8B 3A8HB 4J9DA 1OX8A 2E3HA 3LGLA 2YWWA 3OMCA 4ZNXA 4ZGDB 3QWYA 4M7DD 2LRQA 4GLKA 3FLGA 1VA7A 5IHKA 2E65A 2PNIA 2VB6A 4NOYA 2YDLA 2RHIA 4JS4A 1WHMA 2FRWA 1U8RA 1QKWA 1FXXA 3I5RA 3SD4A 3HRSA 3QJ6A 3CCST 2WSEE 2C06A 1UB4A 2V8JA 4X1VA 3H8ZA 2ROLA 2DMOA 2EQJA 1W1FA 2L3RA 2O9SA 3FIFA 2OTJT 4J6YA 4O6JA 3HRTA 4KULA 1VQNQ 1OU9A 2RF0A 2RJDA 4OP0A 3C95A 1PHTA 3VS6A 2J05A 3M57A 3META 1BI2A 3HP9A 5AYFA 2LZ6B 2EBPA 2IVWA 2RK1A 3V8JA 2E4HA 3CBPA 1VQNA 3CCRQ 2RK2A 2EQMA 3NGPA 4OB3B 4LDYA 4J9BA 4J5YA 3MJXA 2X4WA 1NJIR 4A63B 3SB2A 3PMIA 2X4JA 4NL3A 1Q81R 2FZKB 3M0PA 3VS4A 2NLUA 2RQUA 1H3ZA 2QXFA 2D1XA 3LWIA 1UE9A 1YCSB 2R57A 3H0HA 3M9QA 4C5IA 1SF9A 1K9MU 4FSSA 3CCEQ 1ZSZB 4FU6A 1C1AA 4OB1B 2X3XD 3CXCP 3UA7A 1VIEA 1S72A 2ZPFB 1Q82R 2B8AA 1SRLA 4Q5WA 1AT1B 2RO0A 2ZPBB 4M7AG 4V2SA 1PRMC 2CP3A 3CCEA 1OX9A 1RAIB 4FYWB 1QCOA 2F5TX 3RUXA 3VRZA 4QVDA 2XHCA 5CO7A 3CCJQ 2KYBA 2DVJA 4M78C 2DZCA 1SSFA 4MMLA 2FPDA 3V7RA 1QLYA 2L3PA 1EX4A 1GXIE 1KD1R 2XK0A 2JTMA 3JRZA 1K8AU 2FL7A 1FX7A 1BI1A 2DXCA 3L2ZA 1AD5A 2L5QA 1IGUA 3JCMX 3QSUA 1MGQA 3M5AA 3A8LB 2PZ1A 2K6DA 4MDXA 2MCNA 1E6GA 4DOVA 4KT0E 2RD1A 2XDDA 1CSKA 1Y96B 2LQNA 5CKHA 1KIKA 3LWHA 2A28A 4BDZA 1M90C 4M78F 2CDTA 3ASKA 3OY9A 2XDPA 1N27A 1W4SA 2DL4A 5GANd 3CMEQ 2HQEA 2CUBA 1AHJB 1NYFA 4ZGJB 2VGMA 1BIAA 3GOXA 2EQKA 3VRYA 2QTVA 3E9GA 5CIUA 1VQPQ 2YXYA 2AHJB 4PJOE 2LQ8A 3OSSC 1U1TA 1PCXA 4OMLA 2HSEB 4M7DB 2DBMA 2QQRA 3CMEA 1PKTA 2CZ6B 2KRNA 3OBYA 3CMAQ 5D6XA 4FM4B 2RHZA 4N0AA 1KG1A 2EYZA 4LDUA 1EFNA 2CKKA 1VQPA 1M30A 4C92C 3OYKA 4LUEA 2FPFA 3RBBB 1D0ZA 1P92A 4RG8A 5CKBA 3CMAA 4ZN1A 4E7LA 2CGHA 5GAMd 1ZUKA 1CKAA 2CP2A 1K8AC 4A4FA 4E7ZA 4FYXB 1OPKA 3EFOA 5J39A 3M4YA 1CKBA 5HY6A 2L0AA 4JJBA 2GCXA 4J9EA 1TUGB 2ESWA 5I21A 1WHKA 2A7YA 2F2WA 4ELZC 1WZOA 5LJ3f 1M2OA 2XIDA 2H3EB 5FU7C 2ED1A 5GAOq 1SHFA 3AHUA 4C92F 4PFPA 3G4SA 4E7IA 1WHHA 4RG2A 1MMGA 1JB0E 1NJIU 4PFZA 4RTZA 3P8HA 2K9GA 4CC3A 2LNHB 4M75C 1PG5B 2E10A 1VQNT 1PC0A 1Q81U 2HD0A 5LJ5j 8ATCB 3QDRB 3CCUQ 4F7UB 1X2KA 2YSQA 5FRMA 3A1PA 2YUQA 2KI7A 2QQBA 3TSWA 1T0JA 5GMKi 4DA4A 2F2VA 4PJJA 1I8FA 2E6ZA 2MMPA 3EGXA 3QKJA 4RTVA 2L8DA 1VOMA 1YCYA 2A36A 2DTOA 4HA8A 1W2BP 3V8KA 2O88A 2JTEA 1N5ZA 1VQ9Q 2LX9A 2MAMA 3L2QA 3G71T 2PQWA 1S72T 3RERA 4X9DA 3CCQQ 1D1CA 5GANj 2LC4A 2ZPIB 3DB4A 3CCET 4PL6A 2EQUA 3MPUB 1V76A 1WPYA 3HFOA 3EHQA 4PJLA 3A98A 4OB0B 3CCQA 2JM9A 3OYJA 1WFWA 3I35A 2XKOC 1AWOA 5A0DA 3A8MB 1YIJA 4MDWA 1LJOA 1F1BB 3VS2A 2KEAA 2HKNA 4M78E 3JB9H 1G5VA 4RKUE 4WTOB 3LH0A 2M0OA 3BDLA 5L8RE 4GLMA 4O5VA 4QQGA 3M0TA 2JOYA 3S6WA 3OW2P 5GAMj 1QVFS 3CD6T 2XD0A 3X26B 3OMGA 2DNUA 4KGZB 2DPPB 1YJNQ 4JUVA 2OTLQ 3JCMh 2ZAEA 2MYSA 1KK7A 1KHCA 1VUBA 1YITT 3MP6A 4R55A 2IG0A 1QVGP 1X01A 2F69A 1BI0A 2DERA 2F1LA 2K2VA 2LMJA 1VQ7Q 1YJNA 1B34A 4XTXA 1G3SA 1R77A 4J6XA 2P84A 4HKEA 4OF1A 3O5ZA 2C0TA 2HAXA 2DJQA 3QXEB 4HVVA 4WF2A 4OGEA 2AZVA 5GMKm 3H6ZA 4J9IA 5LJ3d 2O2OA 2C0IA 3A8GB 1YHQA 2DEQA 2DD4A 4J8OA 3UF4A 3QJYA 4PJOA 2DD5A 1K1ZA 2BZYA 4BE2A 3CMET 4J7FA 3F70A 4YTLA 1SRMA 3J81E 3VYGA 5KYXB 1EZZB 2EGCA 2JMAA 1JXMA 5IN1A 1Q7YR 4C92E 2FPEA 2GBQA 2FVUA 2CZ1B 4EMGA 2QQ9A 3CC4Q 1H641 3QWXX 3I55A 3SEMA 1G3WA 1YP5A 1RACB 1IB8A 4A53A 1QMCA 3G1JA 2XMFA 5I11A 3SHWA 2K7AA 2MWOA 1MMDA 1X6OA 3FB9A 3QG1A 2G3RA 4XU0A 2X4YA 3NTHA 3QBYA 6AT1B 3G4ST 4N4IA 3LX7A 1M1GA 1VYTA 1TH7A 1UJYA 1G8XA 2VC8A 2DIGA 2L3SA 4IIMA 5DLQE 2DF6A 3CCMQ 2HSPA 1KFZA 2F2XA 4E7SA 3PGGA 5KE3A 1VQ5T 4M75E 1TWBA 4JZ4A 4XU1A 1WX6A 4C5EA 2PVGB 4M78G 4Z02A 2LTOA 1M4ZA 2HKQB 4HXJA 5LL6S 1PM3A 4B6MA 2JS0A 2CUDA 1M27C 5A0LA 3ME9A 1MV0B 1I1JA 3H9NA 2O4XA 1RAFB 1M1KR 1SEMA 3REAB 1M90R 2RA2A 2DA9A 3OYEA 1VQOQ 3V8LA 5CCAA 2EKHA 2VXEA 3X20B 3EG2A 1ZX6A 4KRTA 5ECAA 3FRNA 2D0NA 5KH6A 3CCLQ 1D09B 1ZQ1A 3THKA 3NTKA 1IREB 2V26A 3JAME 3C0CA 4M77D 3CBMA 1N6AA 5AT1B 3CCVQ 3DLMA 4DEYA 3FC3A 2K5IA 2DAQA 4ZN3A 4C0GA 1VQ8T 4J9CA 4OMQA 3CCLA 2PVOB 1WHLA 5EC7A 2W10A 4RMOA 1YIJT 4IUPA 1K76A 1YFNA 3I56Q 2J6FA 1G83A 4M78A 5KYWB 2SEMA 3OYYA 4R56A 2QEXT 3CCVA 1ZLMA 1QQJA 1HK9A 1MHNA 1XJWB 4C8QC 1Y0MA 1WA7A 1FMVA 4DBHA 1UG1A 1M1FA 5IXFA 2QQSA 3I56A 5IAYA 3L1AA 2KVQG 4PNOA 4HT9A 1H8KA 3HSBA 4P5NA 1KC8U 3HFNA 2R5MA 4PJOD 4C92G 5LJ5f
chains in the Genus database with same CATH topology
3MEUA 2L89A 3RKXA 1XNIA 4M7DA 2OTJA 4E7KA 1VQ5A 1V29B 3L42A 5KE2A 1GXIE 2GF7A 5GANg 2XK0A 2JTMA 4BI4A 3LGFA 3JRZA 2K3YA 1K8AU 2KAFA 3QYGB 3C94A 1YI2A 2FL7A 1YJNT 1FX7A 5GANh 1BI1A 3CC4A 4M77F 2DXCA 4QQ6A 3G7ZA 3L2ZA 3VV0A 1U1SA 1K73U 5GAN5 4XTUA 4C5HA 2L5QA 3FEOA 3JCMX 2ZPGB 4LDWA 4IUUA 1XTDA 3QSUA 1MGQA 4FSXA 3M5AA 2KSSA 4XTWA 2LT4A 3A8LB 5FU6B 3RMQA 4F7UG 5CR2A 4A4KA 1KQ2A 4MDXA 3MCAB 5M9OA 4HCZA 3HL8A 3OYFA 4C8QF 1VQKA 3SFMA 4DOVA 1BYMA 4BY6C 1YHQT 1VQLA 4KT0E 2K3XA 3OYDA 2RD1A 3BDUA 2XDDA 3JB9D 2LQKA 4M78B 4EMKA 1YJ9A 5GANf 2DXUA 1Y96B 2X35A 3E19A 4PLLA 3P8BB 5CKHA 5FROA 3LWHA 3J7AF 4DOWA 4LD6A 4BDZA 1M90C 4M78F 4PKCC 3ASKA 2MF2A 3HHTB 5GAN6 5C6SA 3OY9A 2XDPA 1N27A 1W4SA 3M53A 3X24B 3GNFB 5GANd 4M75F 5GAMg 4LD9K 3CXCA 2HQEA 3J80E 1QW1A 1AHJB 3X28B 4B9XA 3OYMA 1N8RC 5GAMh 2K5FA 3M4GA 2GFAA 2VGMA 4ZGJB 1BIAA 3CXCS 1D3BA 3C4SA 3DLLA 3O8VA 3GOXA 1VQ6T 2EQKA 1BKBA 2WSFE 3E9GA 5CQXA 4C92A 5CIUA 3L2WA 4M7AC 4XTYA 2AHJB 1VQ8A 4M75G 2JZ2A 4PJOE 1I81A 2LQ8A 2X4XA 5DM7R 3OSSC 3CCMA 1U1TA 4C0FA 3OS1A 2QA4A 4M7DB 2QQRA 3JCMW 3VJPA 3CMEA 2CZ6B 3OBYA 3CCUT 5D6XA 1UEBA 4FM4B 3I55T 2RHZA 4LDVA 2QEXA 4M7DF 5KCHA 2XI9A 1QVPA 4PJOG 2VUBA 2EJFA 4N0AA 1KG1A 4LDUA 3RMSA 2CKKA 1VQPA 5DLOA 4C92C 5GAMf 5GANe 1KC8C 4II1A 3OYKA 4BI3A 4IKFA 3OS0A 2QI2A 3BW1A 4F7UA 2M1HA 4LDXA 5GAOp 1P92A 2JN0A 2M16A 1HXDA 4RG8A 4ZTFA 2P0PA 5CKBA 1PSFA 3CMAA 4M77A 4ZN1A 2CGHA 4NS5A 5LJ3g 5GAMd 4E7LA 4BACA 2PUKB 4BD3A 1DJ7B 2PVDB 3CEYA 4JLGA 3TCJA 5GAOl 4A4FA 3HPWA 1VQ9T 1K8AC 1M8VA 5LJ3h 1WGSA 3NFCA 1YJWT 3CCRA 5GAN2 3KXTA 1VQOA 5GAOr 3T9NA 2VV5A 3EAEA 1EIFA 2JUFA 2RJCA 5CAIA 4QVZA 4BE1A 5A0GA 3M4YA 2P4TA 5J39A 2MI6A 1Y07A 4EMKB 1O75A 5HY6A 4C8QA 3M59A 2GFUA 3A5ZB 2GCXA 5D6WA 3VU3C 3CCQT 3NTIA 4M7AF 5I21A 3OYCA 4M77C 2A7YA 3DKMA 2K5LA 4JS5A 3WVEB 3JB9G 2D0QB 3QIIA 1BI3A 2FHDA 4ELZC 1Y96A 3QPHA 2XICA 3TU4K 2FYKA 5LJ3f 3OYAA 2XIDA 4M75A 5FU7C 1D3BB 4XQ3A 4C92B 3URGA 2R5AA 3VKIA 4CI0C 2HQXA 5GAOq 1M1KU 4MZTA 3AHUA 4C92F 1VQMA 2H3JA 2RHYA 2WSCE 4KUIA 3G4SA 2Y4XA 4E7IA 2QTXA 3PIPA 4RG2A 2VXFA 4MZMA 3ZBDA 2ZCFB 1JB0E 3QHSA 1NJIU 3BFMA 3P8HA 2RI2A 2EIFA 2DXBA 3S3MA 4M75C 5GAN3 2E10A 1VQNT 1ZHIA 1Q81U 2HD0A 3S3NA 1YBYA 5LJ5j 1XOVA 2CYZB 3OYBA 3QDRB 4F7UB 2Y4YA 3CCJA 5FRMA 2E70A 3QZ9B 5LJ5d 3JCMb 4M77B 2VYTA 2QQBA 3SWNC 4F7UF 1VQ6A 2OTLT 2D6FA 5GMKi 4DA4A 3RESA 1OYXA 3Q1JA 1WQ7A 1I8FA 2E6ZA 2MMPA 2QQAA 3QKJA 2YRVA 2YLCA 1JBMA 2L8DA 2A3LA 4EMHA 1YCYA 2DTOA 3MEVA 1NZ9A 5FU7B 4HA8A 3V8KA 2V8IA 4C8QB 2KQWA 2P0QA 5DY9A 3OW2S 1VQ7T 2E64A 1QP2A 3ZEHA 1RL2A 4OB2B 3CCLT 2LX9A 2EAYA 4N4GA 3UWNA 4EPCA 3GP8A 5KCOA 4C0DC 1Q86U 2MAMA 3L2QA 3JB9J 4KUDK 3G71T 2PQWA 3TREA 4FT4A 1KQSA 4M7AA 1S72T 3OB9A 2PUOB 3JB9I 1Q7YU 3JCMJ 1JJ2S 3ZFJA 3RERA 1WQWA 5LJ5e 4X9DA 1QVGA 1K9MC 5CVIA 5GANj 4HCCA 4M75B 3ER0A 3CCVT 1KQSS 2LCCA 2D9TA 5EG2A 2LC4A 3GF5A 5HKCA 2CZ0B 2ZPIB 1QVGS 3DB4A 1NE8A 3INZA 5GAN8 4FIBA 3CCET 4PL6A 1NPPA 1YJWA 1VIFA 2EQUA 4IURA 4BB7A 4HCBA 3G6ET 4XTZA 1WPYA 3HFOA 4JRKA 4QQDA 3CC2T 4C8QE 2LT1A 3MP1A 2GQVA 3VYHB 2ZZDA 2PU9B 4OB0B 2K4YA 2RJFA 4MMKA 3OYLA 3OYJA 4PJOF 3CCQA 2XKOC 3HKSA 2KK4A 5A0DA 3A8MB 2DO3A 3R6OA 3L2UA 4ZTJA 1YIJA 4MDWA 1LJOA 2O01E 3RIRA 5FLXE 2EJGA 4M78E 3CC7T 3JB9H 4CRIA 2YHTA 1G5VA 3L2VA 4VUBA 2XG8D 4RKUE 1LOJA 3GNGA 1JJ2A 3HRUA 3LH0A 1OZ2A 3M56A 4KBMB 5D6YA 1QVFA 2XU8A 2M0OA 3BDLA 5L8RE 4BY6B 3C12A 4C0DB 4O5VA 4EDUA 4QQGA 1YI2T 1M9SA 3TEEA 2JOYA 3S6WA 4XU3A 4IUTA 5GAMj 3CC4T 1QVFS 2XD0A 3CD6T 2CS7A 2DKGA 3X26B 3JCMg 3S3OA 3OMGA 3OYIA 2DPPB 4FT2A 2ZPEB 2FB7A 4A4HA 3GIBA 4JUVA 3JCMh 3JCMc 3JCMP 4XK8E 1JRIA 2HBPA 3DB3A 4A54A 2EKOA 1KHCA 1VUBA 4M7DE 5A2QE 3JCMV 3MP6A 1YITT 3JB9F 4R55A 1K73C 1I5LA 1VQKT 2IG0A 3E1SA 2LVMA 4M7AB 1X01A 3X25B 4IUVA 2F69A 1VQLT 1BI0A 3PIOA 1BIBA 3KUFA 2K2VA 3QZ5B 4QW2A 2DIQA 3OSVA 1YJ9T 1W2BA 2I2LA 4IUQA 1YJNA 3MO8A 4J6WA 2P0KA 2EFIA 1B34A 3EFRA 4XTXA 3RKYA 1G3SA 1LNXA 3WXMB 1VQ4T 1W2BS 3VUBA 4J7IA 4J6XA 2DXTA 4HKEA 4OF1A 2E6NA 3PFSA 3MEAA 3V7CA 2YLBA 2BUDA 1Q86C 3JCMf 3LYIA 2HAXA 3OYHA 3QXEB 4BUGA 5J3BA 3QO3A 4WF2A 5GAMe 1Q7YC 3OYGA 5CKFA 1WJSA 5LJ3j 1Y71A 5C0MA 4OGEA 2KDSA 1ZBXA 4XU2A 3JCMd 5GMKm 5GAN4 1OZ3A 3L2RA 1M90U 3H6ZA 4X34A 5LJ3d 1UGPB 1KQ1A 3A8GB 1YHQA 5FRNA 3CCMT 2DEQA 2DD4A 2RI3A 4J8OA 3QJYA 3SWNA 5CK9A 2DD5A 2QA4T 4ATOA 3G71A 1PSEA 4C8QD 4PJOA 4JLIA 2BIVA 3A8OB 3CPWA 4BE2A 3CMET 2XDBA 4MZPA 3E9FA 3VUZA 3LW5E 4C5GA 1N9SA 4J7FA 4XTVA 4JRIA 2JTFA 3CPWS 3M55A 3F70A 3FJPA 1R8OB 1WJQA 4L5GA 2ZPHB 4M7DC 4YTLA 4L6V5 3J81E 5FU6C 3VYGA 4M78D 5J26A 3PT9A 3G6EA 3GLXA 1XQHA 5IN1A 2RI5A 2F5KA 4RCCA 4C92E 4PJOC 2FVUA 2OAUA 3JCMQ 1UGSB 3JCMe 4FL6A 2CZ1B 4OVAA 4EMGA 5LJ3e 3MHXA 4JRQA 1I4K1 2QQ9A 1H641 4ME7A 2RHXA 3UDCA 3CCRT 3OW2A 5IT9E 2DJZA 1VQOT 3CCUA 1Q82U 3M58A 4BI8B 3A8HB 3I55A 1G3WA 1NPRA 3LGLA 4DQ2A 2LDMA 3OMCA 4ZGDB 1B34B 4A53A 3P8DA 1M5Q1 4M7DD 2RB6A 2LRQA 2EJ9A 4GLKA 4F7UE 4OMFB 3LLRA 3RKWA 2QDYB 3CD6A 3FLGA 4M77E 2RJEA 2E65A 2MWOA 3V7SA 4E47A 1X6OA 1N9RA 2JVVA 3FB9A 4NOYA 1VQ9A 4BDYA 5GMKh 3QG1A 2RHIA 2G3RA 4XU0A 4JS4A 2X4YA 3NTHA 4M77G 4PLIA 3QBYA 1FXXA 1YITA 1U8RA 4J83A 4OGCA 2ZGWA 3HRSA 3SD4A 3SWNB 4BE0A 1VQMT 4M7AE 4PJOB 3G4ST 1O9SA 2DK3A 3I56T 3QJ6A 3LX7A 4N4IA 4UC4A 2HNIA 4E7HA 1M1GA 3CCST 2WSEE 2C06A 1UB4A 2V8JA 1KD1U 1TH7A 3M54A 3H8ZA 3CC7A 5GAN7 2VC8A 4A4GA 1M1KC 2E1HA 2DIGA 2EQJA 3OYNA 1VQ4A 5DLQE 2BKDN 4C8QG 4M7AD 1RI0A 2L3RA 1UGRB 3FIFA 3OS2A 3EFSA 2OTJT 3PGGA 5KE3A 3PNWC 4J6YA 4M75E 1VQ5T 3PTAA 1G3YA 4O6JA 4XU1A 2LCLA 4L59A 3CCJT 2CZ7B 1NJIC 5GMKj 4C5EA 3HRTA 2E12A 2PVGB 3QYHB 4KULA 4M78G 2LTOA 4X9CA 1M4ZA 4Z02A 5CQYA 2RJDA 4NL2A 4OP0A 4EMKC 4XAXB 3C95A 1Q81C 3SDZA 5LL6S 2E5QA 2EYQA 4Y28E 3M57A 3PMTA 1WNLA 3META 1BI2A 4N4HA 4TVRA 4C92D 3UPUA 4B9WA 3HP9A 5A0LA 2EWNA 3ME9A 4RCBA 5AYFA 3BY7A 2RK1A 2O4XA 2IVWA 3V8JA 3CBPA 4Y91A 4ELYC 1VQNA 2RA2A 4JDSA 1FWZA 1KHIA 2RK2A 2EQMA 3OYEA 3KBGA 4OB3B 3V8LA 4LDYA 5CCAA 2DTIA 4J5YA 2X4WA 5CKDA 2VXEA 3X20B 1Q82C 1QP3A 3FRNA 5GAOm 4D6WA 2Y90A 4M7DG 2OTLA 3CPFA 5KH6A 3WVDB 3CBOA 3GPLA 3SB2A 3PMIA 2X4JA 1G3TA 1ZQ1A 5I2MA 5GMKe 4NL3A 2VGNA 3NTKA 4ZGEB 2LNVA 3OA6A 1IREB 2NLUA 3MEWA 5CKEA 4JJNK 3JAME 4JRPA 4M77D 3CBMA 1N6AA 4N0AC 3UT1A 3OS5A 2RM4A 2QXFA 1OI1A 1H3ZA 1UGQB 2DVEA 3LWIA 2R57A 3DLMA 3M9QA 4A4EA 4C5IA 2M9UA 1K9MU 1VQ7A 2JNGA 2K5IA 3FC3A 2DAQA 4ZN3A 4C0GA 2E41A 1VQ8T 3CCLA 4FU6A 2R58A 2PVOB 4OB1B 2WACA 1YIJT 5GMKl 4RMOA 4IUPA 5I2SA 5LJ5g 1VIEA 3OQ5A 2RH2A 1S72A 2ZPFB 2V8KA 2DTHA 4HT8A 2B8AA 3FDRA 4Q5WA 2DZ9A 4M78A 1N8RU 2MWPA 2QEXT 3OYYA 4R56A 5LJ5h 3CCVA 1X75C 1IZ6A 1WJRA 1KD1C 2RO0A 1HK9A 1MHNA 5HK0A 2ZPBB 4M7AG 2KMTA 4C0ZA 4V2SA 3CCEA 1VQPT 4C8QC 3OBWA 2F5TX 3RUXA 2RHUA 4QVDA 4M75D 4GY5A 2XHCA 1M1FA 1Y7XA 3CC2A 2QQSA 3I56A 4E7JA 5CO7A 5IAYA 3L1AA 2KVQG 3CMAT 3N5BB 5HK3A 3CCSA 4PNOA 4QVCA 4HT9A 2O4XB 4M78C 5GAOn 2DZCA 2K57A 3JSCA 1SSFA 3HSBA 2KY9A 4MMLA 4P5NA 1KC8U 3HFNA 3MP8A 2R5MA 4PJOD 3V7RA 4C92G 5LJ5f 3QUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0Q B;  3X26 B;  2DPP B;  1V29 B;  2ZPE B;  2WSE E;  1GXI E;  4XK8 E;  3QYG B;  2DXC A;  2WSC E;  1UGR B;  3X25 B;  2ZPG B;  2ZCF B;  1JB0 E;  3QZ5 B;  2CZ7 B;  3A8L B;  2PVG B;  3QYH B;  2DXB A;  4Y28 E;  2CYZ B;  4KT0 E;  3QXE B;  3QZ9 B;  3HHT B;  1UGP B;  3X24 B;  3A8G B;  4OB3 B;  2DD4 A;  2DD5 A;  1PSE A;  3X20 B;  1AHJ B;  3X28 B;  1QP3 A;  3A8O B;  3LW5 E;  4ZGJ B;  2WSF E;  3WVD B;  1QP2 A;  2AHJ B;  2ZPH B;  4L6V 5;  4OB2 B;  3VYG A;  4ZGE B;  1IRE B;  1UGQ B;  2CZ6 B;  2PUO B;  4FM4 B;  1UGS B;  2CZ1 B;  2CZ0 B;  2ZPI B;  2PVO B;  4OB1 B;  2ZPF B;  3A8H B;  3VYH B;  1PSF A;  2ZZD A;  2PU9 B;  4OB0 B;  2PUK B;  2ZPB B;  1DJ7 B;  2PVD B;  4ZGD B;  3A8M B;  2O01 E;  2QDY B;  4RKU E;  5L8R E;  3WVE B; 
#chains in the Genus database with same CATH topology
 3EG9 A;  3MEU A;  2L89 A;  1GCQ A;  1V29 B;  3L42 A;  5KE2 A;  4AMC A;  2GF7 A;  3LGF A;  2K3Y A;  3QYG B;  1YJN T;  3PVL A;  2LP5 A;  4M77 F;  2CP0 A;  1VQL Q;  1M2V A;  1U1S A;  5GAN 5;  1IO6 A;  1YJ9 Q;  2ZPG B;  4M7D C;  4FSX A;  2KSS A;  1SPK A;  2LT4 A;  4A4K A;  1NG2 A;  4C8Q F;  1YHQ T;  1AZG B;  1VQL A;  2K3X A;  1QWE A;  1TUD A;  3BDU A;  3JB9 D;  2HL3 A;  3TSZ A;  4EMK A;  1YJ9 A;  5GAN f;  4PLL A;  5FRO A;  3P8B B;  3J7A F;  1A0N B;  5GAN 6;  5C6S A;  2ED0 A;  3M53 A;  3X24 B;  4LD9 K;  2ABL A;  4B9X A;  2NYS A;  1U5S A;  2K5F A;  5FRN A;  1D3B A;  3C4S A;  1VQ6 T;  3O8V A;  2RQW A;  4C92 A;  2A37 A;  5KYN A;  2BTT A;  4M75 G;  2C0O A;  4LXC A;  4C0F A;  3OS1 A;  1WXT A;  2YT6 A;  1JU5 C;  2RN8 A;  3I55 T;  4M7D F;  2AKK A;  1NLP C;  2EJF A;  3RMS A;  5KYU B;  5GAM f;  1KC8 C;  1D0Y A;  3GBQ A;  4II1 A;  4LE9 A;  4BI3 A;  3OS0 A;  2RQT A;  2M1H A;  2JN0 A;  2QGG A;  1N8R R;  2X9H A;  1PSF A;  5LJ3 g;  4NS5 A;  2PUK B;  4JLG A;  2QAZ A;  1B3Q A;  4CC2 A;  1WGS A;  2COW A;  3NFC A;  3CCR A;  5GAN 2;  2VV5 A;  4OMO A;  2P4T A;  2MI6 A;  3A5Z B;  4FYY B;  5D6W A;  2CRE A;  1U3O A;  1OEB A;  1K0X A;  4JS5 A;  2EVR A;  1MMN A;  2RNA A;  1ACM B;  1BI3 A;  1ZUY A;  1LPL A;  4M75 A;  4XQ3 A;  1Q95 G;  2M51 A;  3VKI A;  1M1K U;  3KFV A;  2X51 A;  2OJ2 A;  4MZM A;  1WXU A;  3CQT A;  2O31 A;  5GAN 3;  1W70 A;  3S3N A;  1X2Q A;  2P4R A;  4DBF A;  2Y4Y A;  3CCJ A;  2E70 A;  5LJ5 d;  4M77 B;  3SWN C;  4D8D A;  4F7U F;  5L23 A;  3MKD A;  1TU0 B;  2BE9 B;  4GBQ A;  3RES A;  1OYX A;  5I22 A;  3Q1J A;  2KT8 A;  1RLP C;  2HEQ A;  3MEV A;  1NZ9 A;  4AG1 C;  1E6H A;  4C8Q B;  1AWX A;  2CH4 W;  2KQW A;  1SSH A;  1YJW Q;  3ZEH A;  2NWM A;  3CCL T;  3GP8 A;  1Q86 U;  3NHN A;  4M7A A;  3TRE A;  1KQS A;  2DLP A;  2JT4 A;  3JCM J;  2K79 A;  3ZFJ A;  1QVG A;  1K9M C;  5CVI A;  2DRK A;  2L2P A;  3CCV T;  2J06 A;  2NUT A;  5HKC A;  3PVQ A;  1NE8 A;  1NPP A;  1YJW A;  1FYN A;  4IUR A;  4BB7 A;  2AIR B;  3G6E T;  3UA6 A;  4AFS C;  2KRO A;  4JRK A;  4XTZ A;  2LCS A;  4C8Q E;  2LT1 A;  2GQV A;  3VYH B;  2PU9 B;  2RJF A;  1NM7 A;  2DO3 A;  2O01 E;  2QYZ A;  2LJ3 A;  2EJG A;  2YHT A;  1AWJ A;  1X27 A;  1ZBJ A;  1LOJ A;  3HRU A;  5D6Y A;  1ZA1 B;  4QT7 A;  3PE0 A;  4C0D B;  5FWC A;  1M9S A;  1MV3 A;  4JJC A;  1M3C A;  5KYY A;  3S3O A;  4Z88 A;  2ZPE B;  2FB7 A;  1K0S A;  3JCM c;  3JCM P;  1JJ2 P;  4XK8 E;  2JW4 A;  1JRI A;  2L3Q A;  2HBP A;  3DB3 A;  4M7D E;  1I5L A;  4IUV A;  1VQL T;  4QW2 A;  3OSV A;  1YJ9 T;  1M8M A;  4IUQ A;  3MO8 A;  2W0Z A;  3RKY A;  3VUB A;  2YLB A;  1Q86 C;  3LYI A;  1YN8 A;  3HTR A;  5J3B A;  1SHG A;  1Y71 A;  2KDS A;  1J3T A;  3JCM d;  5GAN 4;  1OZ3 A;  2KE9 A;  4ORZ A;  2ROT A;  1BU1 A;  1K73 R;  3UAT A;  4ATO A;  5CK9 A;  2BIV A;  4MZP A;  3E9F A;  4C5G A;  1N9S A;  1MMA A;  4QKU A;  1UJ0 A;  4JRI A;  1LCK A;  4L6V 5;  5FU6 C;  1GBR A;  1T3S A;  1UTI A;  5J26 A;  4F04 B;  3IQL A;  4RCC A;  1RI9 A;  3EHR A;  2AK5 A;  1YI2 Q;  4OVA A;  4OMM A;  1AEY A;  2RHX A;  3CCR T;  3M0R A;  2DJZ A;  3CCU A;  1Q82 U;  3ULR B;  2EYX A;  1KSW A;  1M5Q 1;  1VQK Q;  4F7U E;  2M02 A;  4OMF B;  2QDY B;  2RJE A;  2OI3 A;  2X3W D;  3V7S A;  4E47 A;  1VQ9 A;  1VQ4 Q;  4M77 G;  2HCK A;  4PLI A;  3CPW P;  4BE0 A;  2ZGW A;  3SWN B;  1R0B G;  1TOV A;  1O9S A;  2DBK A;  4UC4 A;  4PK4 A;  4E7H A;  1GFD A;  1KD1 U;  3M54 A;  1OU8 A;  1OUL A;  4F16 A;  1ZSZ A;  2RPN A;  1ZA2 B;  3OYN A;  1VQ4 A;  4C8Q G;  4M7A D;  1UGR B;  3OS2 A;  3PNW C;  1ABO A;  3PTA A;  1G3Y A;  1NJI C;  2LCL A;  4L59 A;  3CCJ T;  3EGD B;  4FW2 A;  2E12 A;  2LX7 A;  1SG5 A;  1Y57 A;  3QYH B;  4NL2 A;  4XAX B;  2D8H A;  4M4Z A;  2JS2 A;  1Q81 C;  2E5Q A;  2ATC B;  2EYQ A;  4Y28 E;  3PMT A;  4N4H A;  2EWN A;  4RCB A;  4FYV B;  2KYM A;  1WHJ A;  3EH1 A;  4ELY C;  1KHI A;  2DTI A;  2DEU A;  1Q82 C;  1QP3 A;  5D7U A;  5GAO m;  4D6W A;  4M7D G;  2OTL A;  2MK5 A;  3WVD B;  5GMK e;  4ZGE B;  4JJN K;  4JRP A;  4N0A C;  3OS5 A;  1TXQ A;  1UGQ B;  4A4E A;  1VQ7 A;  2G6F X;  2JNG A;  2VAS A;  1AZE A;  2OX7 A;  2R58 A;  1UEC A;  2HDA A;  2DL7 A;  5GMK l;  4FCY A;  5LJ5 g;  3CC2 Q;  3CCS Q;  3FDR A;  3REB B;  1IZ6 A;  1WJR A;  1KD1 C;  2A08 A;  2I0N A;  2KMT A;  1VQP T;  4AG2 C;  3CC7 Q;  4CC7 A;  2M0Y A;  3OBW A;  2OTJ Q;  4GY5 A;  2MIO A;  3CC2 A;  1Y7X A;  1BCO A;  3CMA T;  5HK3 A;  1OOT A;  3CCS A;  4QVC A;  5GAO n;  2K57 A;  3JSC A;  3CC7 A;  3QUI A;  2A0F B;  3RKX A;  4M7D A;  1XNI A;  3VS5 A;  2OTJ A;  4E7K A;  1BBZ A;  5GAN g;  1HJD A;  4BI4 A;  2J6K A;  1JQQ A;  3C94 A;  3CC4 A;  4RTT A;  3G7Z A;  1K73 U;  4XTU A;  4C5H A;  3EG1 A;  4LDW A;  4IUU A;  1XTD A;  1TSF A;  3RMQ A;  2EW3 A;  5FU6 B;  4F7U G;  4E2F B;  1KQ2 A;  3MCA B;  2CP5 A;  4HCZ A;  3OYF A;  4E6R A;  4BY6 C;  5FWB A;  2COZ A;  2DE0 X;  2DXU A;  2X35 A;  1K9A A;  3E19 A;  4DOW A;  4PFO A;  1B7T A;  3HHT B;  2MF2 A;  4KGV B;  3EG0 A;  2QA4 Q;  1K4U S;  5GAM g;  3R6N A;  3CXC A;  2DL3 A;  1QW1 A;  3X28 B;  3OYM A;  2GTO A;  2JZ2 A;  5DM7 R;  3CCM A;  2QA4 A;  2O9V A;  2KNB B;  3JCM W;  3CCU T;  1UEB A;  5KCH A;  1K9M R;  1QVP A;  2VUB A;  2EPD A;  2E5K A;  5DLO A;  5GAN e;  1ZSG A;  4IKF A;  2LJ0 A;  2QI2 A;  2GQI A;  4F14 A;  4F7U A;  5GAO p;  1NYG A;  4ZTF A;  2P0P A;  1R0C B;  1DJ7 B;  3CEY A;  1VQ9 T;  5LJ3 h;  1VQO A;  5GAO r;  1Z9Z A;  3EAE A;  3T9N A;  1EIF A;  2JUF A;  4QVZ A;  4LN2 A;  4DEX A;  5A0G A;  4BE1 A;  1O75 A;  3M59 A;  3VU3 C;  5GJW B;  3CCQ T;  2RQV A;  4M77 C;  1VQM Q;  2K5L A;  3WVE B;  2D0Q B;  3QII A;  1H92 A;  2FYK A;  2AZS A;  2AT1 B;  3RDV A;  3URG A;  1K8A R;  4KGX B;  3TVT A;  2HQX A;  1UDL A;  3EG3 A;  1VQM A;  2WSC E;  4AFQ C;  2QTX A;  2DL5 A;  3PIP A;  2VXF A;  3VS0 A;  3M0Q A;  4RTX A;  1OV3 A;  2EIF A;  2DXB A;  2KGT A;  1X69 A;  1ZHI A;  2GGR A;  1YBY A;  1OQK A;  1GFC A;  4RTY A;  2FRY A;  1D1B A;  3JCM b;  2ENM A;  1GL5 A;  2OTL T;  2D6F A;  2GTJ A;  1WQ7 A;  2QQA A;  2YUP A;  2HBW A;  2DIL A;  2YLC A;  1JBM A;  2A3L A;  3EFO B;  4Z8A A;  1WHG A;  1ZUU A;  4J9F A;  1QWF A;  1RAA B;  5DY9 A;  3OW2 S;  1VQ7 T;  2E64 A;  1RAG B;  2JJ9 A;  1QCF A;  1JJ2 A;  4N4G A;  2EAY A;  3UWN A;  4EPC A;  1AWW A;  1IHV A;  4C0D C;  5KCO A;  3JB9 J;  4FT4 A;  3OB9 A;  2PUO B;  3JB9 I;  1Q7Y U;  1WQW A;  1KQS S;  3ER0 A;  1FMW A;  1C0M A;  2CZ0 B;  1QVG S;  5GAN 8;  2IPO B;  4FIB A;  2YUN A;  2JXB A;  1RAB B;  3CC2 T;  3MP1 A;  2ZZD A;  2H8H A;  4CC4 B;  4MMK A;  3OYL A;  4PJO F;  2KK4 A;  3R6O A;  1WI7 A;  1U06 A;  2B86 A;  4KH1 B;  3CC7 T;  4CRI A;  3L2V A;  2IIM A;  4VUB A;  1I0C A;  4RTW A;  3GNG A;  1PWT A;  4KBM B;  1YWO A;  4ANJ A;  2XU8 A;  5HCK A;  4BY6 B;  3C12 A;  4FW1 A;  3TEE A;  5KYX A;  3EGX B;  3I5S A;  4XU3 A;  4IUT A;  3CC4 T;  2BE7 D;  2CS7 A;  2DKG A;  4JZ3 A;  4AT1 B;  3GIB A;  1S1N A;  4A54 A;  2EKO A;  1VYU A;  5A2Q E;  3JB9 F;  4R0K A;  3E1S A;  2LVM A;  1UGV A;  2FO0 A;  1BIB A;  3KUF A;  4PJM A;  2NUZ A;  1VYV A;  1W2B A;  3NPF A;  4J6W A;  2P0K A;  3WXM B;  4DBQ A;  4J7I A;  3MEA A;  3G71 Q;  3JCM f;  1S72 Q;  3OYH A;  1HSQ A;  3QO3 A;  1Q7Y C;  3OYG A;  1WJS A;  5C0M A;  2BZX A;  4PJN A;  1ZBX A;  1M90 U;  4X34 A;  2EGA A;  1UGP B;  2KT1 A;  1KQ1 A;  2CSI A;  2CP6 A;  3CCM T;  2QA4 T;  3G71 A;  3CPW A;  2XDB A;  1QVF P;  3VUZ A;  1X43 A;  1B07 A;  4XTV A;  2JTF A;  4L5G A;  1WJQ A;  3VS7 A;  1BB9 A;  1V1C A;  4M78 D;  4F17 A;  1XQH A;  1M3A A;  2RI5 A;  2F5K A;  3H41 A;  4AFZ C;  5LJ3 e;  4JRQ A;  1QKX A;  3CD6 Q;  3OW2 A;  5IT9 E;  1VQO T;  1ABQ A;  3M58 A;  4ESR A;  1NPR A;  4DQ2 A;  2DET A;  2LDM A;  1B34 B;  3P8D A;  1JEG A;  2RB6 A;  2EJ9 A;  1YIT Q;  5IXB A;  3LLR A;  3RKW A;  3CD6 A;  4K11 A;  4M77 E;  3M0S A;  2FZG B;  1N9R A;  2JVV A;  1GCQ C;  4BDY A;  1MNE A;  1NBE B;  5GMK h;  3U23 A;  1YIT A;  5IH2 A;  2EYY A;  4J83 A;  4OGC A;  1VQM T;  1NLO C;  4WCI A;  4PJO B;  2DK3 A;  3I56 T;  2HNI A;  1PD0 A;  1UUE A;  2QGF B;  3E2U A;  5GAN 7;  1JXO A;  4A4G A;  1M1K C;  3TQ7 P;  2E1H A;  2BKD N;  2EQI A;  1RI0 A;  3EFS A;  1NEB A;  5KYW A;  1BCM A;  4OMP A;  2CZ7 B;  5GMK j;  2NUP A;  4Y91 A;  4X9C A;  5CQY A;  4EMK C;  2QK0 A;  3SDZ A;  2CP7 A;  3AT1 B;  4TVR A;  1WNL A;  4C92 D;  3UPU A;  4B9W A;  2HQH A;  1TUC A;  3BY7 A;  4JDS A;  4RUG A;  1FWZ A;  2DX1 A;  3KBG A;  5CKD A;  1YWP A;  2Y90 A;  3CPF A;  5IHN A;  1RAD B;  3CBO A;  1MUZ A;  3GPL A;  1G3T A;  5I2M A;  2VGN A;  2VKN A;  3OA6 A;  2LNV A;  3MEW A;  5CKE A;  3UT1 A;  2RM4 A;  1OI1 A;  4HVU A;  2DVE A;  5FW9 A;  2M9U A;  1FMK A;  2YRC A;  3QDF A;  4JJD A;  2E41 A;  2FG0 A;  1I5O B;  2V1R A;  2WAC A;  2CH4 A;  2QG9 B;  5I2S A;  3G4S Q;  3OQ5 A;  2RH2 A;  2V8K A;  2DTH A;  4HT8 A;  1N8R U;  2DZ9 A;  1KJW A;  3VS3 A;  4D8K A;  2MWP A;  1RLQ C;  5LJ5 h;  1X75 C;  3EH2 A;  5HK0 A;  2DM1 A;  4C0Z A;  5IHI A;  1WDX A;  1WLP B;  2RHU A;  1AVZ C;  1VQ5 Q;  4M75 D;  4E7J A;  3N5B B;  2O4X B;  1G2B A;  2MPX C;  2KY9 A;  1UHF A;  3MP8 A;  3I9Q A;  2PTK A;  2KRM A;  1VQ5 A;  1LVK A;  2D8J A;  1TS9 A;  3H0I A;  2KAF A;  1YI2 A;  5KYU A;  5GAN h;  4QQ6 A;  3VV0 A;  3BE3 A;  2K2M A;  3FEO A;  4Y92 A;  4XTW A;  5CR2 A;  1AOJ A;  3RR6 A;  5M9O A;  3HL8 A;  1VQK A;  3SFM A;  1BYM A;  3OYD A;  1OPL A;  2LQK A;  4M78 B;  4RTU A;  2FZC B;  1HYO A;  2DYI A;  4LD6 A;  1Z9Q A;  4PKC C;  1UHC A;  1VQ8 Q;  2CSQ A;  1PD1 A;  2OAW A;  1YIJ Q;  3GNF B;  1PKS A;  4M75 F;  1IGQ A;  2QDL A;  3J80 E;  3FJ5 A;  2QEX Q;  1IRX A;  1N8R C;  5GAM h;  3M4G A;  3DLL A;  2GFA A;  2E3I A;  3CXC S;  4HCK A;  2HZY A;  1BKB A;  2WSF E;  5CQX A;  3L2W A;  4M7A C;  2DL8 A;  4XTY A;  1VQ8 A;  4LNP A;  1H3H A;  1I81 A;  2X4X A;  2Z0W A;  3EG9 B;  3VJP A;  2HL5 C;  2QEX A;  4LDV A;  2XI9 A;  4PJO G;  2KXC A;  1RAE B;  1PRL C;  1M2V B;  3BW1 A;  4LDX A;  2HMA A;  1W6X A;  2M16 A;  1HXD A;  2DFU A;  4M77 A;  2JM8 A;  4BAC A;  4BD3 A;  2PVD B;  3TCJ A;  1TG0 A;  5GAO l;  3HPW A;  1JO8 A;  1M8V A;  1ARK A;  1YJW T;  2DYB A;  3KXT A;  2J6O A;  5CAI A;  2RJC A;  1KQS P;  4J9G A;  4DBR A;  4EMK B;  1Y07 A;  4C8Q A;  2GFU A;  3NTI A;  4M7A F;  3OYC A;  4IIO A;  1WXB A;  1C6V X;  2CT3 A;  3DKM A;  1KC8 R;  3JB9 G;  1YHQ Q;  1HD3 A;  2FHD A;  1Y96 A;  3QPH A;  2GNC A;  2XIC A;  3TU4 K;  3OYA A;  1D3B B;  2DRM A;  4C92 B;  2R5A A;  4CI0 C;  1E7O A;  1NEG A;  4MZT A;  2H3J A;  2RHY A;  2RMO A;  4KUI A;  2Y4X A;  4Z89 A;  3ZBD A;  4HVW A;  2ZCF B;  3QHS A;  1VQ6 Q;  3BFM A;  2RI2 A;  3S3M A;  2K3B A;  1XOV A;  2CYZ B;  3OYB A;  2YRD A;  3I55 Q;  2LJ1 A;  2J7I A;  4J9H A;  3QZ9 B;  2VYT A;  1VQ6 A;  1MND A;  1T3L A;  2YRV A;  4EMH A;  5FU7 B;  7AT1 B;  2V8I A;  2P0Q A;  1D0X A;  3VS1 A;  1QP2 A;  1RL2 A;  4OB2 B;  4KUD K;  1JJ2 S;  1YNZ A;  5LJ5 e;  1IXD A;  4HCC A;  4M75 B;  2LCC A;  1GRI A;  2D9T A;  2LQW A;  5EG2 A;  3GF5 A;  3INZ A;  1VIF A;  4HCB A;  3H0F A;  4KH0 B;  2V1Q A;  4QQD A;  1RAH B;  4JPB W;  2K4Y A;  3HKS A;  4LUD A;  3L2U A;  4ZTJ A;  3RIR A;  5FLX E;  2XG8 D;  1TTH B;  2FEI A;  3M0U A;  3NMZ C;  1OZ2 A;  3M56 A;  1QVF A;  4EDU A;  1YI2 T;  3RNJ A;  1X6B A;  1ZSZ C;  3JCM g;  3OYI A;  2VVK A;  3JV3 A;  4FT2 A;  4A4H A;  2JMC A;  9ATC B;  2AKL A;  2KRS A;  8AT1 B;  1QCN A;  3JCM V;  2RQR A;  1K73 C;  1VQK T;  1M3B A;  2QAS A;  4M7A B;  3X25 B;  3LH5 A;  3PIO A;  3QZ5 B;  1PNJ A;  2DIQ A;  2I2L A;  1GCP A;  1T0H A;  2COY A;  2EFI A;  3EFR A;  3ZL7 C;  2NUT B;  1LNX A;  1W2B S;  1VQ4 T;  2DXT A;  2E6N A;  3PFS A;  3V7C A;  2VWF A;  2BUD A;  4AFU C;  3D7S B;  4BUG A;  2KBT A;  5GAM e;  5CKF A;  1GBQ A;  1RUW A;  5LJ3 j;  4XU2 A;  3L2R A;  2CT4 A;  1BK2 A;  2BZ8 A;  3G6E Q;  1I07 A;  2RI3 A;  3SWN A;  4M7A E;  5GJV B;  1UFF A;  2KR3 A;  1PSE A;  4C8Q D;  4JLI A;  3A8O B;  2KXD A;  3LW5 E;  3EGU A;  2EGE A;  3CPW S;  2MOX A;  3FJP A;  3M55 A;  1R8O B;  2ZPH B;  1IHW A;  2NUP B;  4OMN A;  2EYW A;  4EIK A;  1Q86 R;  2ECZ A;  3PT9 A;  3G6E A;  3GLX A;  5KYY B;  2SRC A;  1WYX A;  1SKU B;  4PJO C;  1WIE A;  3EGD A;  1D1A A;  1X6G A;  2OAU A;  3JCM Q;  1UGS B;  3JCM e;  4FL6 A;  3MHX A;  1I4K 1;  2YUO A;  4ME7 A;  3UDC A;  4BI8 B;  3A8H B;  4J9D A;  1OX8 A;  2E3H A;  3LGL A;  2YWW A;  3OMC A;  4ZNX A;  4ZGD B;  3QWY A;  4M7D D;  2LRQ A;  4GLK A;  3FLG A;  1VA7 A;  5IHK A;  2E65 A;  2PNI A;  2VB6 A;  4NOY A;  2YDL A;  2RHI A;  4JS4 A;  1WHM A;  2FRW A;  1U8R A;  1QKW A;  1FXX A;  3I5R A;  3SD4 A;  3HRS A;  3QJ6 A;  3CCS T;  2WSE E;  2C06 A;  1UB4 A;  2V8J A;  4X1V A;  3H8Z A;  2ROL A;  2DMO A;  2EQJ A;  1W1F A;  2L3R A;  2O9S A;  3FIF A;  2OTJ T;  4J6Y A;  4O6J A;  3HRT A;  4KUL A;  1VQN Q;  1OU9 A;  2RF0 A;  2RJD A;  4OP0 A;  3C95 A;  1PHT A;  3VS6 A;  2J05 A;  3M57 A;  3MET A;  1BI2 A;  3HP9 A;  5AYF A;  2LZ6 B;  2EBP A;  2IVW A;  2RK1 A;  3V8J A;  2E4H A;  3CBP A;  1VQN A;  3CCR Q;  2RK2 A;  2EQM A;  3NGP A;  4OB3 B;  4LDY A;  4J9B A;  4J5Y A;  3MJX A;  2X4W A;  1NJI R;  4A63 B;  3SB2 A;  3PMI A;  2X4J A;  4NL3 A;  1Q81 R;  2FZK B;  3M0P A;  3VS4 A;  2NLU A;  2RQU A;  1H3Z A;  2QXF A;  2D1X A;  3LWI A;  1UE9 A;  1YCS B;  2R57 A;  3H0H A;  3M9Q A;  4C5I A;  1SF9 A;  1K9M U;  4FSS A;  3CCE Q;  1ZSZ B;  4FU6 A;  1C1A A;  4OB1 B;  2X3X D;  3CXC P;  3UA7 A;  1VIE A;  1S72 A;  2ZPF B;  1Q82 R;  2B8A A;  1SRL A;  4Q5W A;  1AT1 B;  2RO0 A;  2ZPB B;  4M7A G;  4V2S A;  1PRM C;  2CP3 A;  3CCE A;  1OX9 A;  1RAI B;  4FYW B;  1QCO A;  2F5T X;  3RUX A;  3VRZ A;  4QVD A;  2XHC A;  5CO7 A;  3CCJ Q;  2KYB A;  2DVJ A;  4M78 C;  2DZC A;  1SSF A;  4MML A;  2FPD A;  3V7R A;  1QLY A;  2L3P A;  1EX4 A;  1GXI E;  1KD1 R;  2XK0 A;  2JTM A;  3JRZ A;  1K8A U;  2FL7 A;  1FX7 A;  1BI1 A;  2DXC A;  3L2Z A;  1AD5 A;  2L5Q A;  1IGU A;  3JCM X;  3QSU A;  1MGQ A;  3M5A A;  3A8L B;  2PZ1 A;  2K6D A;  4MDX A;  2MCN A;  1E6G A;  4DOV A;  4KT0 E;  2RD1 A;  2XDD A;  1CSK A;  1Y96 B;  2LQN A;  5CKH A;  1KIK A;  3LWH A;  2A28 A;  4BDZ A;  1M90 C;  4M78 F;  2CDT A;  3ASK A;  3OY9 A;  2XDP A;  1N27 A;  1W4S A;  2DL4 A;  5GAN d;  3CME Q;  2HQE A;  2CUB A;  1AHJ B;  1NYF A;  4ZGJ B;  2VGM A;  1BIA A;  3GOX A;  2EQK A;  3VRY A;  2QTV A;  3E9G A;  5CIU A;  1VQP Q;  2YXY A;  2AHJ B;  4PJO E;  2LQ8 A;  3OSS C;  1U1T A;  1PCX A;  4OML A;  2HSE B;  4M7D B;  2DBM A;  2QQR A;  3CME A;  1PKT A;  2CZ6 B;  2KRN A;  3OBY A;  3CMA Q;  5D6X A;  4FM4 B;  2RHZ A;  4N0A A;  1KG1 A;  2EYZ A;  4LDU A;  1EFN A;  2CKK A;  1VQP A;  1M30 A;  4C92 C;  3OYK A;  4LUE A;  2FPF A;  3RBB B;  1D0Z A;  1P92 A;  4RG8 A;  5CKB A;  3CMA A;  4ZN1 A;  4E7L A;  2CGH A;  5GAM d;  1ZUK A;  1CKA A;  2CP2 A;  1K8A C;  4A4F A;  4E7Z A;  4FYX B;  1OPK A;  3EFO A;  5J39 A;  3M4Y A;  1CKB A;  5HY6 A;  2L0A A;  4JJB A;  2GCX A;  4J9E A;  1TUG B;  2ESW A;  5I21 A;  1WHK A;  2A7Y A;  2F2W A;  4ELZ C;  1WZO A;  5LJ3 f;  1M2O A;  2XID A;  2H3E B;  5FU7 C;  2ED1 A;  5GAO q;  1SHF A;  3AHU A;  4C92 F;  4PFP A;  3G4S A;  4E7I A;  1WHH A;  4RG2 A;  1MMG A;  1JB0 E;  1NJI U;  4PFZ A;  4RTZ A;  3P8H A;  2K9G A;  4CC3 A;  2LNH B;  4M75 C;  1PG5 B;  2E10 A;  1VQN T;  1PC0 A;  1Q81 U;  2HD0 A;  5LJ5 j;  8ATC B;  3QDR B;  3CCU Q;  4F7U B;  1X2K A;  2YSQ A;  5FRM A;  3A1P A;  2YUQ A;  2KI7 A;  2QQB A;  3TSW A;  1T0J A;  5GMK i;  4DA4 A;  2F2V A;  4PJJ A;  1I8F A;  2E6Z A;  2MMP A;  3EGX A;  3QKJ A;  4RTV A;  2L8D A;  1VOM A;  1YCY A;  2A36 A;  2DTO A;  4HA8 A;  1W2B P;  3V8K A;  2O88 A;  2JTE A;  1N5Z A;  1VQ9 Q;  2LX9 A;  2MAM A;  3L2Q A;  3G71 T;  2PQW A;  1S72 T;  3RER A;  4X9D A;  3CCQ Q;  1D1C A;  5GAN j;  2LC4 A;  2ZPI B;  3DB4 A;  3CCE T;  4PL6 A;  2EQU A;  3MPU B;  1V76 A;  1WPY A;  3HFO A;  3EHQ A;  4PJL A;  3A98 A;  4OB0 B;  3CCQ A;  2JM9 A;  3OYJ A;  1WFW A;  3I35 A;  2XKO C;  1AWO A;  5A0D A;  3A8M B;  1YIJ A;  4MDW A;  1LJO A;  1F1B B;  3VS2 A;  2KEA A;  2HKN A;  4M78 E;  3JB9 H;  1G5V A;  4RKU E;  4WTO B;  3LH0 A;  2M0O A;  3BDL A;  5L8R E;  4GLM A;  4O5V A;  4QQG A;  3M0T A;  2JOY A;  3S6W A;  3OW2 P;  5GAM j;  1QVF S;  3CD6 T;  2XD0 A;  3X26 B;  3OMG A;  2DNU A;  4KGZ B;  2DPP B;  1YJN Q;  4JUV A;  2OTL Q;  3JCM h;  2ZAE A;  2MYS A;  1KK7 A;  1KHC A;  1VUB A;  1YIT T;  3MP6 A;  4R55 A;  2IG0 A;  1QVG P;  1X01 A;  2F69 A;  1BI0 A;  2DER A;  2F1L A;  2K2V A;  2LMJ A;  1VQ7 Q;  1YJN A;  1B34 A;  4XTX A;  1G3S A;  1R77 A;  4J6X A;  2P84 A;  4HKE A;  4OF1 A;  3O5Z A;  2C0T A;  2HAX A;  2DJQ A;  3QXE B;  4HVV A;  4WF2 A;  4OGE A;  2AZV A;  5GMK m;  3H6Z A;  4J9I A;  5LJ3 d;  2O2O A;  2C0I A;  3A8G B;  1YHQ A;  2DEQ A;  2DD4 A;  4J8O A;  3UF4 A;  3QJY A;  4PJO A;  2DD5 A;  1K1Z A;  2BZY A;  4BE2 A;  3CME T;  4J7F A;  3F70 A;  4YTL A;  1SRM A;  3J81 E;  3VYG A;  5KYX B;  1EZZ B;  2EGC A;  2JMA A;  1JXM A;  5IN1 A;  1Q7Y R;  4C92 E;  2FPE A;  2GBQ A;  2FVU A;  2CZ1 B;  4EMG A;  2QQ9 A;  3CC4 Q;  1H64 1;  3QWX X;  3I55 A;  3SEM A;  1G3W A;  1YP5 A;  1RAC B;  1IB8 A;  4A53 A;  1QMC A;  3G1J A;  2XMF A;  5I11 A;  3SHW A;  2K7A A;  2MWO A;  1MMD A;  1X6O A;  3FB9 A;  3QG1 A;  2G3R A;  4XU0 A;  2X4Y A;  3NTH A;  3QBY A;  6AT1 B;  3G4S T;  4N4I A;  3LX7 A;  1M1G A;  1VYT A;  1TH7 A;  1UJY A;  1G8X A;  2VC8 A;  2DIG A;  2L3S A;  4IIM A;  5DLQ E;  2DF6 A;  3CCM Q;  2HSP A;  1KFZ A;  2F2X A;  4E7S A;  3PGG A;  5KE3 A;  1VQ5 T;  4M75 E;  1TWB A;  4JZ4 A;  4XU1 A;  1WX6 A;  4C5E A;  2PVG B;  4M78 G;  4Z02 A;  2LTO A;  1M4Z A;  2HKQ B;  4HXJ A;  5LL6 S;  1PM3 A;  4B6M A;  2JS0 A;  2CUD A;  1M27 C;  5A0L A;  3ME9 A;  1MV0 B;  1I1J A;  3H9N A;  2O4X A;  1RAF B;  1M1K R;  1SEM A;  3REA B;  1M90 R;  2RA2 A;  2DA9 A;  3OYE A;  1VQO Q;  3V8L A;  5CCA A;  2EKH A;  2VXE A;  3X20 B;  3EG2 A;  1ZX6 A;  4KRT A;  5ECA A;  3FRN A;  2D0N A;  5KH6 A;  3CCL Q;  1D09 B;  1ZQ1 A;  3THK A;  3NTK A;  1IRE B;  2V26 A;  3JAM E;  3C0C A;  4M77 D;  3CBM A;  1N6A A;  5AT1 B;  3CCV Q;  3DLM A;  4DEY A;  3FC3 A;  2K5I A;  2DAQ A;  4ZN3 A;  4C0G A;  1VQ8 T;  4J9C A;  4OMQ A;  3CCL A;  2PVO B;  1WHL A;  5EC7 A;  2W10 A;  4RMO A;  1YIJ T;  4IUP A;  1K76 A;  1YFN A;  3I56 Q;  2J6F A;  1G83 A;  4M78 A;  5KYW B;  2SEM A;  3OYY A;  4R56 A;  2QEX T;  3CCV A;  1ZLM A;  1QQJ A;  1HK9 A;  1MHN A;  1XJW B;  4C8Q C;  1Y0M A;  1WA7 A;  1FMV A;  4DBH A;  1UG1 A;  1M1F A;  5IXF A;  2QQS A;  3I56 A;  5IAY A;  3L1A A;  2KVQ G;  4PNO A;  4HT9 A;  1H8K A;  3HSB A;  4P5N A;  1KC8 U;  3HFN A;  2R5M A;  4PJO D;  4C92 G;  5LJ5 f; 
#chains in the Genus database with same CATH homology
 3MEU A;  2L89 A;  3RKX A;  1XNI A;  4M7D A;  2OTJ A;  4E7K A;  1VQ5 A;  1V29 B;  3L42 A;  5KE2 A;  1GXI E;  2GF7 A;  5GAN g;  2XK0 A;  2JTM A;  4BI4 A;  3LGF A;  3JRZ A;  2K3Y A;  1K8A U;  2KAF A;  3QYG B;  3C94 A;  1YI2 A;  2FL7 A;  1YJN T;  1FX7 A;  5GAN h;  1BI1 A;  3CC4 A;  4M77 F;  2DXC A;  4QQ6 A;  3G7Z A;  3L2Z A;  3VV0 A;  1U1S A;  1K73 U;  5GAN 5;  4XTU A;  4C5H A;  2L5Q A;  3FEO A;  3JCM X;  2ZPG B;  4LDW A;  4IUU A;  1XTD A;  3QSU A;  1MGQ A;  4FSX A;  3M5A A;  2KSS A;  4XTW A;  2LT4 A;  3A8L B;  5FU6 B;  3RMQ A;  4F7U G;  5CR2 A;  4A4K A;  1KQ2 A;  4MDX A;  3MCA B;  5M9O A;  4HCZ A;  3HL8 A;  3OYF A;  4C8Q F;  1VQK A;  3SFM A;  4DOV A;  1BYM A;  4BY6 C;  1YHQ T;  1VQL A;  4KT0 E;  2K3X A;  3OYD A;  2RD1 A;  3BDU A;  2XDD A;  3JB9 D;  2LQK A;  4M78 B;  4EMK A;  1YJ9 A;  5GAN f;  2DXU A;  1Y96 B;  2X35 A;  3E19 A;  4PLL A;  3P8B B;  5CKH A;  5FRO A;  3LWH A;  3J7A F;  4DOW A;  4LD6 A;  4BDZ A;  1M90 C;  4M78 F;  4PKC C;  3ASK A;  2MF2 A;  3HHT B;  5GAN 6;  5C6S A;  3OY9 A;  2XDP A;  1N27 A;  1W4S A;  3M53 A;  3X24 B;  3GNF B;  5GAN d;  4M75 F;  5GAM g;  4LD9 K;  3CXC A;  2HQE A;  3J80 E;  1QW1 A;  1AHJ B;  3X28 B;  4B9X A;  3OYM A;  1N8R C;  5GAM h;  2K5F A;  3M4G A;  2GFA A;  2VGM A;  4ZGJ B;  1BIA A;  3CXC S;  1D3B A;  3C4S A;  3DLL A;  3O8V A;  3GOX A;  1VQ6 T;  2EQK A;  1BKB A;  2WSF E;  3E9G A;  5CQX A;  4C92 A;  5CIU A;  3L2W A;  4M7A C;  4XTY A;  2AHJ B;  1VQ8 A;  4M75 G;  2JZ2 A;  4PJO E;  1I81 A;  2LQ8 A;  2X4X A;  5DM7 R;  3OSS C;  3CCM A;  1U1T A;  4C0F A;  3OS1 A;  2QA4 A;  4M7D B;  2QQR A;  3JCM W;  3VJP A;  3CME A;  2CZ6 B;  3OBY A;  3CCU T;  5D6X A;  1UEB A;  4FM4 B;  3I55 T;  2RHZ A;  4LDV A;  2QEX A;  4M7D F;  5KCH A;  2XI9 A;  1QVP A;  4PJO G;  2VUB A;  2EJF A;  4N0A A;  1KG1 A;  4LDU A;  3RMS A;  2CKK A;  1VQP A;  5DLO A;  4C92 C;  5GAM f;  5GAN e;  1KC8 C;  4II1 A;  3OYK A;  4BI3 A;  4IKF A;  3OS0 A;  2QI2 A;  3BW1 A;  4F7U A;  2M1H A;  4LDX A;  5GAO p;  1P92 A;  2JN0 A;  2M16 A;  1HXD A;  4RG8 A;  4ZTF A;  2P0P A;  5CKB A;  1PSF A;  3CMA A;  4M77 A;  4ZN1 A;  2CGH A;  4NS5 A;  5LJ3 g;  5GAM d;  4E7L A;  4BAC A;  2PUK B;  4BD3 A;  1DJ7 B;  2PVD B;  3CEY A;  4JLG A;  3TCJ A;  5GAO l;  4A4F A;  3HPW A;  1VQ9 T;  1K8A C;  1M8V A;  5LJ3 h;  1WGS A;  3NFC A;  1YJW T;  3CCR A;  5GAN 2;  3KXT A;  1VQO A;  5GAO r;  3T9N A;  2VV5 A;  3EAE A;  1EIF A;  2JUF A;  2RJC A;  5CAI A;  4QVZ A;  4BE1 A;  5A0G A;  3M4Y A;  2P4T A;  5J39 A;  2MI6 A;  1Y07 A;  4EMK B;  1O75 A;  5HY6 A;  4C8Q A;  3M59 A;  2GFU A;  3A5Z B;  2GCX A;  5D6W A;  3VU3 C;  3CCQ T;  3NTI A;  4M7A F;  5I21 A;  3OYC A;  4M77 C;  2A7Y A;  3DKM A;  2K5L A;  4JS5 A;  3WVE B;  3JB9 G;  2D0Q B;  3QII A;  1BI3 A;  2FHD A;  4ELZ C;  1Y96 A;  3QPH A;  2XIC A;  3TU4 K;  2FYK A;  5LJ3 f;  3OYA A;  2XID A;  4M75 A;  5FU7 C;  1D3B B;  4XQ3 A;  4C92 B;  3URG A;  2R5A A;  3VKI A;  4CI0 C;  2HQX A;  5GAO q;  1M1K U;  4MZT A;  3AHU A;  4C92 F;  1VQM A;  2H3J A;  2RHY A;  2WSC E;  4KUI A;  3G4S A;  2Y4X A;  4E7I A;  2QTX A;  3PIP A;  4RG2 A;  2VXF A;  4MZM A;  3ZBD A;  2ZCF B;  1JB0 E;  3QHS A;  1NJI U;  3BFM A;  3P8H A;  2RI2 A;  2EIF A;  2DXB A;  3S3M A;  4M75 C;  5GAN 3;  2E10 A;  1VQN T;  1ZHI A;  1Q81 U;  2HD0 A;  3S3N A;  1YBY A;  5LJ5 j;  1XOV A;  2CYZ B;  3OYB A;  3QDR B;  4F7U B;  2Y4Y A;  3CCJ A;  5FRM A;  2E70 A;  3QZ9 B;  5LJ5 d;  3JCM b;  4M77 B;  2VYT A;  2QQB A;  3SWN C;  4F7U F;  1VQ6 A;  2OTL T;  2D6F A;  5GMK i;  4DA4 A;  3RES A;  1OYX A;  3Q1J A;  1WQ7 A;  1I8F A;  2E6Z A;  2MMP A;  2QQA A;  3QKJ A;  2YRV A;  2YLC A;  1JBM A;  2L8D A;  2A3L A;  4EMH A;  1YCY A;  2DTO A;  3MEV A;  1NZ9 A;  5FU7 B;  4HA8 A;  3V8K A;  2V8I A;  4C8Q B;  2KQW A;  2P0Q A;  5DY9 A;  3OW2 S;  1VQ7 T;  2E64 A;  1QP2 A;  3ZEH A;  1RL2 A;  4OB2 B;  3CCL T;  2LX9 A;  2EAY A;  4N4G A;  3UWN A;  4EPC A;  3GP8 A;  5KCO A;  4C0D C;  1Q86 U;  2MAM A;  3L2Q A;  3JB9 J;  4KUD K;  3G71 T;  2PQW A;  3TRE A;  4FT4 A;  1KQS A;  4M7A A;  1S72 T;  3OB9 A;  2PUO B;  3JB9 I;  1Q7Y U;  3JCM J;  1JJ2 S;  3ZFJ A;  3RER A;  1WQW A;  5LJ5 e;  4X9D A;  1QVG A;  1K9M C;  5CVI A;  5GAN j;  4HCC A;  4M75 B;  3ER0 A;  3CCV T;  1KQS S;  2LCC A;  2D9T A;  5EG2 A;  2LC4 A;  3GF5 A;  5HKC A;  2CZ0 B;  2ZPI B;  1QVG S;  3DB4 A;  1NE8 A;  3INZ A;  5GAN 8;  4FIB A;  3CCE T;  4PL6 A;  1NPP A;  1YJW A;  1VIF A;  2EQU A;  4IUR A;  4BB7 A;  4HCB A;  3G6E T;  4XTZ A;  1WPY A;  3HFO A;  4JRK A;  4QQD A;  3CC2 T;  4C8Q E;  2LT1 A;  3MP1 A;  2GQV A;  3VYH B;  2ZZD A;  2PU9 B;  4OB0 B;  2K4Y A;  2RJF A;  4MMK A;  3OYL A;  3OYJ A;  4PJO F;  3CCQ A;  2XKO C;  3HKS A;  2KK4 A;  5A0D A;  3A8M B;  2DO3 A;  3R6O A;  3L2U A;  4ZTJ A;  1YIJ A;  4MDW A;  1LJO A;  2O01 E;  3RIR A;  5FLX E;  2EJG A;  4M78 E;  3CC7 T;  3JB9 H;  4CRI A;  2YHT A;  1G5V A;  3L2V A;  4VUB A;  2XG8 D;  4RKU E;  1LOJ A;  3GNG A;  1JJ2 A;  3HRU A;  3LH0 A;  1OZ2 A;  3M56 A;  4KBM B;  5D6Y A;  1QVF A;  2XU8 A;  2M0O A;  3BDL A;  5L8R E;  4BY6 B;  3C12 A;  4C0D B;  4O5V A;  4EDU A;  4QQG A;  1YI2 T;  1M9S A;  3TEE A;  2JOY A;  3S6W A;  4XU3 A;  4IUT A;  5GAM j;  3CC4 T;  1QVF S;  2XD0 A;  3CD6 T;  2CS7 A;  2DKG A;  3X26 B;  3JCM g;  3S3O A;  3OMG A;  3OYI A;  2DPP B;  4FT2 A;  2ZPE B;  2FB7 A;  4A4H A;  3GIB A;  4JUV A;  3JCM h;  3JCM c;  3JCM P;  4XK8 E;  1JRI A;  2HBP A;  3DB3 A;  4A54 A;  2EKO A;  1KHC A;  1VUB A;  4M7D E;  5A2Q E;  3JCM V;  3MP6 A;  1YIT T;  3JB9 F;  4R55 A;  1K73 C;  1I5L A;  1VQK T;  2IG0 A;  3E1S A;  2LVM A;  4M7A B;  1X01 A;  3X25 B;  4IUV A;  2F69 A;  1VQL T;  1BI0 A;  3PIO A;  1BIB A;  3KUF A;  2K2V A;  3QZ5 B;  4QW2 A;  2DIQ A;  3OSV A;  1YJ9 T;  1W2B A;  2I2L A;  4IUQ A;  1YJN A;  3MO8 A;  4J6W A;  2P0K A;  2EFI A;  1B34 A;  3EFR A;  4XTX A;  3RKY A;  1G3S A;  1LNX A;  3WXM B;  1VQ4 T;  1W2B S;  3VUB A;  4J7I A;  4J6X A;  2DXT A;  4HKE A;  4OF1 A;  2E6N A;  3PFS A;  3MEA A;  3V7C A;  2YLB A;  2BUD A;  1Q86 C;  3JCM f;  3LYI A;  2HAX A;  3OYH A;  3QXE B;  4BUG A;  5J3B A;  3QO3 A;  4WF2 A;  5GAM e;  1Q7Y C;  3OYG A;  5CKF A;  1WJS A;  5LJ3 j;  1Y71 A;  5C0M A;  4OGE A;  2KDS A;  1ZBX A;  4XU2 A;  3JCM d;  5GMK m;  5GAN 4;  1OZ3 A;  3L2R A;  1M90 U;  3H6Z A;  4X34 A;  5LJ3 d;  1UGP B;  1KQ1 A;  3A8G B;  1YHQ A;  5FRN A;  3CCM T;  2DEQ A;  2DD4 A;  2RI3 A;  4J8O A;  3QJY A;  3SWN A;  5CK9 A;  2DD5 A;  2QA4 T;  4ATO A;  3G71 A;  1PSE A;  4C8Q D;  4PJO A;  4JLI A;  2BIV A;  3A8O B;  3CPW A;  4BE2 A;  3CME T;  2XDB A;  4MZP A;  3E9F A;  3VUZ A;  3LW5 E;  4C5G A;  1N9S A;  4J7F A;  4XTV A;  4JRI A;  2JTF A;  3CPW S;  3M55 A;  3F70 A;  3FJP A;  1R8O B;  1WJQ A;  4L5G A;  2ZPH B;  4M7D C;  4YTL A;  4L6V 5;  3J81 E;  5FU6 C;  3VYG A;  4M78 D;  5J26 A;  3PT9 A;  3G6E A;  3GLX A;  1XQH A;  5IN1 A;  2RI5 A;  2F5K A;  4RCC A;  4C92 E;  4PJO C;  2FVU A;  2OAU A;  3JCM Q;  1UGS B;  3JCM e;  4FL6 A;  2CZ1 B;  4OVA A;  4EMG A;  5LJ3 e;  3MHX A;  4JRQ A;  1I4K 1;  2QQ9 A;  1H64 1;  4ME7 A;  2RHX A;  3UDC A;  3CCR T;  3OW2 A;  5IT9 E;  2DJZ A;  1VQO T;  3CCU A;  1Q82 U;  3M58 A;  4BI8 B;  3A8H B;  3I55 A;  1G3W A;  1NPR A;  3LGL A;  4DQ2 A;  2LDM A;  3OMC A;  4ZGD B;  1B34 B;  4A53 A;  3P8D A;  1M5Q 1;  4M7D D;  2RB6 A;  2LRQ A;  2EJ9 A;  4GLK A;  4F7U E;  4OMF B;  3LLR A;  3RKW A;  2QDY B;  3CD6 A;  3FLG A;  4M77 E;  2RJE A;  2E65 A;  2MWO A;  3V7S A;  4E47 A;  1X6O A;  1N9R A;  2JVV A;  3FB9 A;  4NOY A;  1VQ9 A;  4BDY A;  5GMK h;  3QG1 A;  2RHI A;  2G3R A;  4XU0 A;  4JS4 A;  2X4Y A;  3NTH A;  4M77 G;  4PLI A;  3QBY A;  1FXX A;  1YIT A;  1U8R A;  4J83 A;  4OGC A;  2ZGW A;  3HRS A;  3SD4 A;  3SWN B;  4BE0 A;  1VQM T;  4M7A E;  4PJO B;  3G4S T;  1O9S A;  2DK3 A;  3I56 T;  3QJ6 A;  3LX7 A;  4N4I A;  4UC4 A;  2HNI A;  4E7H A;  1M1G A;  3CCS T;  2WSE E;  2C06 A;  1UB4 A;  2V8J A;  1KD1 U;  1TH7 A;  3M54 A;  3H8Z A;  3CC7 A;  5GAN 7;  2VC8 A;  4A4G A;  1M1K C;  2E1H A;  2DIG A;  2EQJ A;  3OYN A;  1VQ4 A;  5DLQ E;  2BKD N;  4C8Q G;  4M7A D;  1RI0 A;  2L3R A;  1UGR B;  3FIF A;  3OS2 A;  3EFS A;  2OTJ T;  3PGG A;  5KE3 A;  3PNW C;  4J6Y A;  4M75 E;  1VQ5 T;  3PTA A;  1G3Y A;  4O6J A;  4XU1 A;  2LCL A;  4L59 A;  3CCJ T;  2CZ7 B;  1NJI C;  5GMK j;  4C5E A;  3HRT A;  2E12 A;  2PVG B;  3QYH B;  4KUL A;  4M78 G;  2LTO A;  4X9C A;  1M4Z A;  4Z02 A;  5CQY A;  2RJD A;  4NL2 A;  4OP0 A;  4EMK C;  4XAX B;  3C95 A;  1Q81 C;  3SDZ A;  5LL6 S;  2E5Q A;  2EYQ A;  4Y28 E;  3M57 A;  3PMT A;  1WNL A;  3MET A;  1BI2 A;  4N4H A;  4TVR A;  4C92 D;  3UPU A;  4B9W A;  3HP9 A;  5A0L A;  2EWN A;  3ME9 A;  4RCB A;  5AYF A;  3BY7 A;  2RK1 A;  2O4X A;  2IVW A;  3V8J A;  3CBP A;  4Y91 A;  4ELY C;  1VQN A;  2RA2 A;  4JDS A;  1FWZ A;  1KHI A;  2RK2 A;  2EQM A;  3OYE A;  3KBG A;  4OB3 B;  3V8L A;  4LDY A;  5CCA A;  2DTI A;  4J5Y A;  2X4W A;  5CKD A;  2VXE A;  3X20 B;  1Q82 C;  1QP3 A;  3FRN A;  5GAO m;  4D6W A;  2Y90 A;  4M7D G;  2OTL A;  3CPF A;  5KH6 A;  3WVD B;  3CBO A;  3GPL A;  3SB2 A;  3PMI A;  2X4J A;  1G3T A;  1ZQ1 A;  5I2M A;  5GMK e;  4NL3 A;  2VGN A;  3NTK A;  4ZGE B;  2LNV A;  3OA6 A;  1IRE B;  2NLU A;  3MEW A;  5CKE A;  4JJN K;  3JAM E;  4JRP A;  4M77 D;  3CBM A;  1N6A A;  4N0A C;  3UT1 A;  3OS5 A;  2RM4 A;  2QXF A;  1OI1 A;  1H3Z A;  1UGQ B;  2DVE A;  3LWI A;  2R57 A;  3DLM A;  3M9Q A;  4A4E A;  4C5I A;  2M9U A;  1K9M U;  1VQ7 A;  2JNG A;  2K5I A;  3FC3 A;  2DAQ A;  4ZN3 A;  4C0G A;  2E41 A;  1VQ8 T;  3CCL A;  4FU6 A;  2R58 A;  2PVO B;  4OB1 B;  2WAC A;  1YIJ T;  5GMK l;  4RMO A;  4IUP A;  5I2S A;  5LJ5 g;  1VIE A;  3OQ5 A;  2RH2 A;  1S72 A;  2ZPF B;  2V8K A;  2DTH A;  4HT8 A;  2B8A A;  3FDR A;  4Q5W A;  2DZ9 A;  4M78 A;  1N8R U;  2MWP A;  2QEX T;  3OYY A;  4R56 A;  5LJ5 h;  3CCV A;  1X75 C;  1IZ6 A;  1WJR A;  1KD1 C;  2RO0 A;  1HK9 A;  1MHN A;  5HK0 A;  2ZPB B;  4M7A G;  2KMT A;  4C0Z A;  4V2S A;  3CCE A;  1VQP T;  4C8Q C;  3OBW A;  2F5T X;  3RUX A;  2RHU A;  4QVD A;  4M75 D;  4GY5 A;  2XHC A;  1M1F A;  1Y7X A;  3CC2 A;  2QQS A;  3I56 A;  4E7J A;  5CO7 A;  5IAY A;  3L1A A;  2KVQ G;  3CMA T;  3N5B B;  5HK3 A;  3CCS A;  4PNO A;  4QVC A;  4HT9 A;  2O4X B;  4M78 C;  5GAO n;  2DZC A;  2K57 A;  3JSC A;  1SSF A;  3HSB A;  2KY9 A;  4MML A;  4P5N A;  1KC8 U;  3HFN A;  3MP8 A;  2R5M A;  4PJO D;  3V7R A;  4C92 G;  5LJ5 f;  3QUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...