3M0QA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 5.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
ELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0qA00
2GBQA 2H8HA 2J05A 2RMOA 1CSKA 2KR3A 1TG0A 1NLPC 3GBQA 4AG1C 1RLQC 1K1ZA 1UECA 2PTKA 1BK2A 1U5SA 3UA6A 3VS7A 3THKA 1G83A 4IIMA 3VS6A 2A37A 1JXOA 1Z9QA 2L3QA 1Y0MA 2RQTA 2W0ZA 5IHNA 2NWMA 1ZX6A 5HCKA 2DL3A 1JEGA 1NYFA 3PVLA 5I11A 2RNAA 1YWPA 2KRMA 3VRYA 2YT6A 1WA7A 2DBKA 1K9AA 1VYUA 1GRIA 2NUZA 1UUEA 2DVJA 1AD5A 1GFDA 4LUEA 4OMOA 1B07A 1EFNA 2CUBA 1N5ZA 4AFQC 2M51A 3A98A 1K0SA 1E7OA 1KSWA 2RF0A 4RTUA 1X27A 1A0NB 4RTWA 1GBRA 4Z8AA 1W6XA 2K79A 1H92A 1OEBA 1NM7A 1ZSGA 2YUNA 1K76A 2L3SA 2J6KA 4J9BA 3I5SA 2DE0X 1I0CA 2B86A 1SHFA 4LNPA 1M27C 1S1NA 2DL4A 1LCKA 2EGEA 2JS0A 1M3AA 1GCQC 3C0CA 1AVZC 3QWYA 2FPEA 2CDTA 2A08A 1PKSA 3RBBB 1H3HA 3TSWA 1YP5A 2DILA 1GFCA 1ABOA 1PHTA 4K11A 1FYNA 1AEYA 3H41A 2CSIA 3ULRB 1JXMA 2OI3A 2BTTA 2EBPA 1FMKA 1H8KA 2JTEA 1WYXA 4J9IA 4RTXA 2CT3A 2X3WD 4OMQA 4JZ4A 3EG3A 1M3BA 1UHCA 1WX6A 3H0IA 2JM8A 1BB9A 2LMJA 2O88A 1QWEA 1GL5A 4HVUA 2BZXA 1YNZA 1UTIA 1WDXA 3NMZC 4FSSA 1ZLMA 2GTOA 4ORZA 4CC3A 2KRSA 4M4ZA 2CT4A 1SRLA 4D8KA 4HVWA 2DF6A 2A28A 4Y92A 2SRCA 1MV3A 3M0PA 4JJDA 2SEMA 2L0AA 3TSZA 3TVTA 3R6NA 4RTTA 3ZL7C 5IHIA 4OMPA 4GLMA 2DMOA 1UE9A 1WIEA 2W10A 1RUWA 2CSQA 3RNJA 1NEGA 2ED1A 2O9VA 2EW3A 1BBZA 3VS0A 2ROTA 5IHKA 1X2KA 2KT1A 2EPDA 1WFWA 4LN2A 1NYGA 1JO8A 2EYWA 2L3PA 2C0TA 2OJ2A 2XMFA 3PE0A 2YSQA 1QKWA 2CUDA 1X6GA 2G6FX 2GNCA 3PVQA 2GGRA 3M0TA 2KROA 2KXDA 1PRLC 1UJYA 2DM1A 2KYMA 4IIOA 2O2OA 1WXBA 1CKBA 2DL5A 2FEIA 4A63B 1GCPA 2FPFA 1M8MA 1I07A 2K2MA 4RTZA 1AWXA 2EQIA 1T3LA 2FPDA 4RTYA 3UA7A 1ARKA 2DYBA 1M3CA 2YUQA 1QLYA 2F2WA 4R0KA 3FJ5A 1WI7A 2GTJA 2ABLA 1QWFA 1ZBJA 2RQUA 2KT8A 4WCIA 2CREA 3I35A 1JQQA 3EG1A 2DRMA 2DLPA 4GBQA 1PNJA 1T0JA 2JS2A 3JV3A 4CC2A 1VYTA 1AWJA 1UGVA 1BU1A 1JU5C 2AKLA 4JPBW 2MIOA 3VRZA 1E6GA 1MUZA 4X1VA 2KEAA 1NLOC 2LP5A 2P4RA 2AZSA 1OOTA 4LUDA 1PKTA 4Z89A 2HEQA 3SEMA 2YUOA 1UFFA 4J9EA 4HCKA 2D1XA 1OPKA 3VS1A 1X6BA 2EYYA 1YWOA 2YUPA 1NG2A 1ZUKA 2K9GA 3I9QA 2MOXA 1HD3A 1PRMC 4AFSC 2RPNA 3M0QA 2LJ3A 3EGUA 1U06A 5I22A 3VS3A 4J9FA 1RI9A 3REAB 1W1FA 2DL8A 2KBTA 2ROLA 3VS2A 1E6HA 2V1QA 3CQTA 1ZUUA 4F14A 1SRMA 2J7IA 5ECAA 4OMLA 2DX1A 2HSPA 2JMCA 2MCNA 3NHNA 2FO0A 2D0NA 1WXTA 3H0HA 2KYBA 2KNBB 1CKAA 2VVKA 1T0HA 1WXUA 1IO6A 2EYZA 1SSHA 1X69A 2CH4W 1SHGA 3IQLA 1M30A 4DEYA 2JW4A 2K6DA 1OV3A 2V1RA 2VKNA 3EG2A 1V1CA 2RQWA 2KXCA 3REBB 1AZGB 2D8JA 2PNIA 3UATA 1UG1A 2OAWA 3NPFA 3NGPA 2RQRA 1UDLA 4JZ3A 1SPKA 2EYXA 2LNHB 1U3OA 2LCSA 1HSQA 1KIKA 2HBWA 4OMMA 1G2BA 2D8HA 3H0FA 2ECZA 1K0XA 2DJQA 3I5RA 1NEBA 4D8DA 2VWFA 1TUDA 1KJWA 1GBQA 1I1JA 2QDLA 2O9SA 1T3SA 2O31A 1QCFA 2A36A 2DL7A 4HVVA 2EKHA 2EVRA 1PWTA 4Z88A 4F17A 1KFZA 4KRTA 1XOVA 4F16A 1Z9ZA 5FWCA 2EGCA 2HDAA 3SHWA 1AWOA 1X2QA 4E6RA 4JJBA 2HCKA 1X43A 1RLPC 2LZ6B 2X3XD 1AZEA 3M0UA 4ESRA 2KRNA 4LE9A 2F2VA 2DNUA 2F2XA 3KFVA 5FW9A 2BZ8A 2K7AA 3O5ZA 2PZ1A 2BZYA 1VYVA 4J9HA 4QT7A 5IH2A 1K4US 3U23A 2J6FA 2L2PA 1OPLA 2FRYA 5L23A 1GCQA 2C0OA 5IXBA 2FG0A 2JMAA 4HXJA 2EGAA 3UF4A 1UHFA 1YN8A 2JXBA 2GQIA 4CC7A 4J9DA 2LJ1A 3M0RA 2KE9A 1B3QA 1WLPB 2DA9A 2LX7A 2AKKA 5GJVB 4AG2C 1ABQA 3QWXX 2ENMA 2LQNA 4JJCA 2JT4A 1ZUYA 2YDLA 1TUCA 1QKXA 4EIKA 1J3TA 2J06A 5EC7A 4RUGA 1UJ0A 4CC4B 3EHRA 1SEMA 5IXFA 2K3BA 2ESWA 1AWWA 2J6OA 2FRWA 2JM9A 2LJ0A 3VS4A 4DEXA 5FWBA 2C0IA 2RN8A 1MV0B 4AFUC 1HJDA 1YCSB 4J9CA 2KGTA 2I0NA 3VS5A 2DBMA 5GJWB 2DRKA 4RTVA 1AOJA 2M0YA 4ZNXA 2CH4A 1W70A 1Y57A 3LH5A 2E5KA 2AZVA 3M0SA 4OMNA 2ED0A 4J9GA 4AFZC 3EG0A 2AK5A 2LQWA 1VA7A 2RQVA 3EHQA 2IIMA
chains in the Genus database with same CATH superfamily
2FHDA 4C92F 4XTVA 1CSKA 1WHKA 2ZGWA 1VQ8A 1S72T 4AG1C 3GBQA 2GFAA 4HCBA 2CKKA 3UA6A 2QQSA 3THKA 1G83A 3VS6A 1N27A 5IHNA 4XAXB 3OYDA 1QVGP 2DL3A 4M7DE 2RNAA 2QEXT 1K9AA 1VYUA 1YI2T 3LW5E 1Y07A 3OW2S 2DTIA 4KT0E 1SSFA 4ZN1A 3EH1A 3CXCA 2YHTA 1QW1A 4AFQC 2M51A 3A98A 1VQ9T 1YIJT 3V8JA 1E7OA 3JCMW 1AT1B 1GBRA 4A4EA 3G71Q 3CCRT 2F1LA 1OYXA 4C5HA 2MAMA 1NM7A 1ZSGA 2XI9A 2L5QA 4XK8E 5GMKh 2CYZB 1D0XA 1VQ6A 3RUXA 5GANj 2MWOA 1VQ4T 5GAMf 3KUFA 1S1NA 3RMSA 4JRKA 3WVDB 1QCNA 2EGEA 2JS0A 2ZZDA 3RDVA 2AHJB 4FYXB 2VYTA 5GAN4 4PJNA 2E10A 2CDTA 2DPPB 3RBBB 1I81A 1H3HA 1YP5A 2DILA 1ABOA 4XTZA 3RMQA 4M78E 3H41A 3VUBA 2E65A 2XG8D 3OW2A 2OI3A 2EBPA 4DBHA 4C92B 4ELZC 1Q82U 2FZCB 2CT3A 2K5IA 4JZ4A 2P84A 1M3BA 4ELYC 3QXEB 3CC7T 2O88A 1QWEA 3CCVQ 1GL5A 5HK3A 3JCMe 1QP2A 1LPLA 4QVCA 2QXFA 2E4HA 4M4ZA 2CT4A 3S3MA 1KD1C 4IUTA 3OS1A 4ME7A 3L2QA 2KK4A 1BCMA 2SRCA 1O75A 4JJDA 4DOVA 4DBQA 5GAMj 4IUPA 3TSZA 2IPOB 4RTTA 2PUOB 1OZ3A 5FU6C 1WIEA 2CP5A 3RNJA 3META 3VS0A 2HQEA 5IHKA 2EPDA 2ZPEB 5C6SA 4LN2A 1M2OA 2C0TA 5A0GA 3QYHB 2AT1B 1W2BP 2GNCA 3PVQA 1K8AR 3OMCA 2XKOC 3HFNA 3GIBA 4MMLA 4IIOA 1X75C 3A8GB 1NPRA 2DL5A 4PL6A 5M9OA 2K2MA 3FIFA 2DXBA 2F5TX 1T3LA 4E7SA 4M7AF 2E5QA 1OU9A 1ARKA 3TCJA 2DYBA 2COZA 1QLYA 4KGZB 3M5AA 3G1JA 1C1AA 4HCZA 4QQGA 4KH1B 1KHCA 4PK4A 4JJNK 1Y96A 2HQXA 3I35A 3EFRA 1JQQA 3M4YA 4C92D 3OYNA 1YJWA 2NLUA 4BY6C 2MYSA 1BU1A 1JU5C 3L2RA 4IURA 1E6GA 2WSFE 4DBFA 3QBYA 4J6XA 2D0QB 3KBGA 1PG5B 2P4RA 1OOTA 5HK0A 1VQ4A 1UFFA 1Y7XA 3OB9A 2D1XA 3VS1A 2RD1A 1X6BA 3OW2P 1YWOA 4V2SA 2FZGB 4RCBA 1V29B 4Q5WA 3M59A 2V8JA 3I9QA 2CZ1B 1U06A 2ATCB 1TS9A 5GANd 3JB9I 2RO0A 2KBTA 4KBMB 1YI2A 4KUIA 1VQ7Q 3CD6Q 3QG1A 5CK9A 4J83A 5GAN8 2VGMA 3CC4Q 1MNDA 4HT9A 1SRMA 3MCAB 2R5AA 4FW2A 4OMLA 2HSPA 2JMCA 3V8KA 4PLIA 1KG1A 1TXQA 3X20B 3V7RA 4LDVA 2O01E 3UDCA 2A3LA 1Q82C 4C0DC 3M56A 2ZPIB 1X69A 1X6OA 3IQLA 2RI5A 2JW4A 1K9MR 2RQWA 2KXCA 1AZGB 1VQLQ 2KY9A 1G3TA 2PNIA 3UATA 4E7ZA 3BFMA 5I2MA 1LJOA 2BKDN 3D7SB 2EWNA 1UDLA 2RK1A 4M75D 2DYIA 2EYXA 2LNHB 2LCSA 1KIKA 3H0FA 5D7UA 2MI6A 1K0XA 1BIAA 4M7DG 1Q86C 4X34A 1B34B 3A1PA 4JLGA 3QO3A 2L8DA 1JBMA 2RHUA 2O31A 2DL7A 1BCOA 2EKHA 1NE8A 2EVRA 1PWTA 4MZMA 3GOXA 1BIBA 1WHMA 3OMGA 1YHQQ 2M16A 1VQ7T 1ZSZC 3J80E 2XDDA 3SHWA 3C4SA 2QQRA 3OYEA 2VC8A 2HCKA 1RLPC 2HD0A 4C8QA 3M0UA 1M1KR 2FL7A 2QQBA 2YLBA 1G3YA 2DNUA 3CCEA 3O5ZA 1U8RA 4JRIA 5GAOn 3ASKA 4J9HA 5GANe 3MEWA 4N4HA 3AHUA 2FRYA 2P0KA 1M9SA 4BUGA 2C0OA 2LCLA 2FG0A 4HXJA 1QP3A 5GAN6 4FM4B 2JXBA 4LDWA 4OB2B 5J3BA 2EQMA 3M0RA 3CCMA 1H641 1VQOQ 1G3SA 3SD4A 2E12A 4PLLA 1FMVA 1R8OB 4JJCA 4A4GA 1R0BG 1NJIC 5D6XA 4EIKA 4MDWA 1F1BB 3I55Q 1KD1U 2ESWA 5IT9E 1QVPA 2FRWA 2LJ0A 2XDPA 3VS4A 2C0IA 1HJDA 4J9CA 1JJ2P 3VS5A 1MNEA 1Q86U 3CCQQ 2DRKA 2XIDA 1WZOA 5KYNA 1N8RU 2M0YA 1Y57A 3S6WA 1VQMA 3LH5A 1MGQA 2E5KA 3OYIA 2Y90A 3TU4K 4OMNA 2ED0A 2QK0A 4J9GA 5LJ5h 2A0FB 4WTOB 2AK5A 3CCMT 2DFUA 2DIQA 3PMTA 3OA6A 1K9MC 4OGCA 3OYYA 1UECA 4JRQA 3CCJQ 1JXOA 1Z9QA 1Y0MA 5FROA 2K2VA 2G3RA 1ZX6A 3EAEA 5CKDA 2K3YA 1JEGA 1NYFA 4ZGJB 3PVLA 3MEAA 5I11A 2KRMA 1FXXA 5J39A 2RHIA 4E7LA 3ZEHA 4KGXB 1EFNA 2X4WA 1TSFA 4OGEA 3HRTA 2M9UA 2HKQB 1G8XA 2OTJT 1VQMQ 1X27A 1HYOA 2R5MA 2X4XA 1VQKA 1BYMA 1Q81C 1W6XA 4BD3A 2KDSA 4M7AE 5CKFA 1FX7A 1M90R 2L3SA 2J6KA 3I5SA 2FYKA 4LNPA 1ZSZB 1M27C 3I55A 2DL4A 1DJ7B 2JOYA 2DD5A 2NUPB 1KC8R 3OYAA 2RJCA 4O6JA 3OYHA 1VQPQ 4N0AC 1W2BA 2K3XA 3C0CA 1LVKA 3QWYA 5KYXB 1VQOT 4LD6A 3JCMf 4KH0B 2E3HA 4JRPA 2E6NA 3LLRA 1PHTA 4K11A 1AEYA 2CZ0B 2DEQA 3HL8A 2LQ8A 4N4IA 3QDFA 3CCET 5FRMA 1FMKA 2DD4A 1WJRA 2JTEA 3HKSA 3QSUA 1WYXA 4J9IA 4C92E 1K8AU 3G4SA 4BY6B 4PJOD 1UHCA 3TEEA 3QDRB 3EGXA 2LMJA 5KH6A 1UGQB 2BZXA 1MMGA 4EPCA 4D6WA 5KE3A 4FSSA 4CC3A 4A54A 3CC4T 1TU0B 4BE1A 2FZKB 3BDLA 3L2VA 3PFSA 5DM7R 2YXYA 2DF6A 4QVZA 2A28A 1MV3A 3M0PA 1UGSB 5GMKi 3JRZA 4XTYA 2L0AA 3R6NA 1VQKQ 2VXEA 2XU8A 4A4HA 5IHIA 4PJOB 4OMPA 8AT1B 1D1AA 1UE9A 1NEGA 2NYSA 2LT1A 1D3BB 4J8OA 2ROTA 3SB2A 2XMFA 1JO8A 3QHSA 2LT4A 3PE0A 2YSQA 1NJIR 2VGNA 3A5ZB 4C5GA 2RH2A 1MMAA 4C8QD 2KXDA 3OS0A 1OX9A 2CZ6B 2KYMA 4M78F 1YJNA 1Y96B 1JJ2S 1VQLA 1WXBA 1CKBA 4EMHA 1U1TA 1M8MA 1I07A 4RTZA 4A4KA 3OYFA 1UEBA 4RTYA 3UA7A 3CCJA 1YJ9Q 5GAN7 2XK0A 2F2WA 3OQ5A 1RAAB 2QTVA 3JCMP 2PUKB 4M7DB 1H3ZA 2ABLA 4FYWB 5LJ5g 2KT8A 5C0MA 4WCIA 2QA4T 3HHTB 3UT1A 1D0ZA 5FU7C 2QTXA 3DLMA 1JJ2A 3HTRA 4M75A 1PNJA 2JS2A 2ZPBB 4X9CA 1OQKA 5GAN2 1D09B 3ZBDA 3OYLA 2OTLQ 3J81E 3OSSC 2MIOA 4X1VA 5KYYA 1VQLT 1P92A 2KEAA 2LP5A 4BB7A 2JN0A 4Z89A 1YJWQ 2HMAA 2L3RA 2PVOB 3M58A 2JZ2A 3CCST 4HCKA 4PJJA 4J7FA 1KQ2A 1PD1A 5GAMh 1NJIU 2L89A 1M1FA 1C6VX 1B34A 4E7JA 4M78A 1K73R 1PRMC 3CBMA 2XHCA 3J7AF 2A7YA 1VQNQ 1RI9A 1W1FA 4XU2A 3CC7Q 1IGQA 2M02A 3G4SQ 3VS2A 1E6HA 4KULA 1WJSA 8ATCB 2DERA 4C8QB 2DX1A 1S72A 1W4SA 2C06A 5LJ5f 3R6OA 2EJGA 4NL2A 3DLLA 3CCLA 4NOYA 5CAIA 2KNBB 1T0HA 1VUBA 1N9SA 1SSHA 5CCAA 2K4YA 1M30A 3VYHB 3JB9H 2ZPHB 2V1RA 2VKNA 3CBOA 3EG2A 2Y4YA 2M0OA 3REBB 4F7UG 3PIOA 1S72Q 5A0LA 1HK9A 1UG1A 3NPFA 1ZHIA 3JCMb 2QYZA 2CP3A 1SPKA 3RESA 1IGUA 3CCSQ 1XJWB 3CC7A 2HAXA 3OYJA 4OMMA 3I56Q 3EFSA 2D8HA 2X35A 1IXDA 2DJQA 2OTLA 3OYKA 4M75G 3GF5A 1WJQA 4IKFA 3VU3C 1RI0A 5GAMe 3EGXB 4OB1B 3P8HA 3M55A 1QCFA 3G6EA 2E3IA 3GNFB 4Z88A 4M7AA 4F16A 3CD6T 4OP0A 4FT4A 4O5VA 3PGGA 4FU6A 5FWCA 5FLXE 1YIJQ 2HDAA 1VQ9Q 1AWOA 4QVDA 2V8KA 3CMEA 1X43A 1YBYA 2LZ6B 3G71T 2KRNA 3KFVA 2F2XA 4ZGDB 3CPFA 5IN1A 2BZYA 4QT7A 3FLGA 2L2PA 2VB6A 2OTJA 3SWNA 3BE3A 1GCQA 4EMKA 1RL2A 2JMAA 2EGAA 1KC8C 1YN8A 3X28B 1V76A 4PFZA 1UGRB 2KE9A 3EGDA 2DZ9A 4DQ2A 2DA9A 3G71A 4BI4A 1YJ9A 1QVFA 2M1HA 2AKKA 3OYMA 4C0DB 1ABQA 2RM4A 2O4XB 1IRXA 2ENMA 1ZUYA 9ATCB 7AT1B 3GPLA 2EQJA 4QQDA 1J3TA 2J06A 4L59A 4RUGA 1UJ0A 1WGSA 5LJ3g 3TQ7P 4M78C 3AT1B 1SEMA 3CCSA 2K3BA 1AWWA 2CZ7B 2GFUA 4DEXA 1WHGA 1LOJA 3G4ST 1MV0B 3MKDA 3EFOA 2DBMA 3L42A 2COWA 1W2BS 1RACB 5FU6B 4F7UA 2COYA 3MHXA 2AZVA 3M0SA 2ZCFB 4E7KA 4M7DA 5LJ5j 4AFZC 3EG0A 4XU1A 2QA4A 4OB3B 1BI1A 2GBQA 3MO8A 2PVDB 2LTOA 3WXMB 2KR3A 1TG0A 1NLPC 3TREA 1RLQC 5LJ5d 3PIPA 3KXTA 1U5SA 1VQ5Q 4IIMA 2YRVA 1YCYA 1M1KC 2NWMA 1K73C 3L1AA 2JNGA 1IHVA 1GXIE 4C5IA 4Z02A 1N6AA 3QZ9B 3VRYA 4M77C 4XTXA 1PCXA 4WF2A 1TUGB 2JTMA 5CQYA 1UUEA 2DVJA 3QZ5B 1AD5A 3EGDB 2YRDA 5LJ3f 4OMOA 1TOVA 5I2SA 2D6FA 2DZCA 1B07A 3CCVT 4QQ6A 3HFOA 4EDUA 1K0SA 1PD0A 1SF9A 3JB9J 4C92G 4RTUA 1A0NB 5GAMd 4RTWA 1VQPA 4Z8AA 1ZSZA 5KYUA 4HT8A 2K79A 4J5YA 3X26B 4M7DF 1H92A 1OEBA 1WQWA 2YUNA 3OBYA 1K76A 4J9BA 3MEUA 4PJOE 3EG9B 4PFOA 1LCKA 2PQWA 1OULA 2QAZA 4OB0B 1IHWA 4M77G 4C5EA 4PJMA 3OBWA 2FPEA 5LJ5e 2RI2A 5GMKl 2A08A 4IUQA 3ME9A 4M77A 4M7DD 2KAFA 2PVGB 3TSWA 4FCYA 3UPUA 3CMAA 1GFCA 2E6ZA 1YIJA 1VQ9A 1WHJA 3N5BB 2CGHA 2P0QA 3QYGB 1QVGA 3ULRB 1JXMA 1H8KA 4E7IA 5GANf 1YI2Q 1VQ7A 2WSCE 4GY5A 1PC0A 3EG3A 3EFOB 3JCMV 1RAEB 1WX6A 3H0IA 4FIBA 5D6YA 1Q7YU 2DEUA 2P0PA 4HVUA 3CCQT 1N8RC 4LDYA 4DOWA 5IAYA 1ZLMA 2GTOA 4ORZA 3X24B 1SRLA 4HVWA 3JAME 4Y92A 4IUUA 5GAOm 4B9XA 2MWPA 2DO3A 2RHXA 4LDUA 1VQ4Q 3ZL7C 4GLMA 2DMOA 2W10A 3CMET 4RMOA 1XTDA 2B8AA 2ED1A 4J6WA 2EW3A 1VQ5T 1BBZA 3FB9A 1VQPT 4MZTA 1X2KA 2KT1A 1WFWA 1M2VA 1NYGA 2EYWA 2EQKA 4XU0A 3JCMJ 1QKWA 2G6FX 3INZA 2D9TA 3M0TA 2QEXQ 1EIFA 2DM1A 1KQ1A 3MP6A 1ACMB 1BI2A 3MP1A 2FEIA 3CCEQ 4M75E 4ATOA 2EQIA 5KCOA 1M1GA 3A8OB 1Q82R 4L5GA 4FYYB 3RR6A 3CPWS 3FJ5A 1WI7A 6AT1B 3CPWA 1QWFA 2RQUA 2YRCA 2DVEA 5GANh 1VIFA 5GMKj 2RHYA 3M4GA 5LJ3d 5DLOA 3JB9D 5L8RE 2DRMA 1WHLA 2DLPA 1T0JA 2MK5A 1VYTA 2ZAEA 4OMFB 2RJEA 4F7UB 3GP8A 2RB6A 3VRZA 2X9HA 2BUDA 5LJ3h 1NLOC 4GLKA 1YITA 1PKTA 1Q7YR 2BE7D 1M90U 1LNXA 3SEMA 2NUPA 4FYVB 4ZN3A 3DKMA 1UB4A 3WVEB 1FWZA 3CCRA 3JB9F 5KE2A 4JS5A 2EYYA 3QJYA 2DTHA 1NG2A 3P8BB 3CC2Q 1KK7A 4AFSC 1HD3A 2RPNA 2VUBA 3M0QA 3E19A 2DXTA 1SG5A 3MEVA 5GAN5 2RHZA 1ZA2B 4BI8B 4J9FA 3REAB 4RG8A 2LC4A 2DL8A 3OYCA 2ROLA 1KQSP 2XD0A 3A8LB 4M7AD 5DLQE 1YJ9T 1Q81R 2V1QA 3CQTA 4F14A 4MDXA 4IUVA 5ECAA 1I4K1 4M75B 2MCNA 3NHNA 3HPWA 2LCCA 3CMAT 2D0NA 1MHNA 2KYBA 1FMWA 4C92A 2VVKA 4CRIA 2XICA 1IO6A 2QGFB 1SHGA 1EZZB 3M53A 4DEYA 3PMIA 4M7AB 4M75F 4RCCA 2D8JA 2EFIA 1K9MU 4PFPA 2OAWA 1D3BA 3X25B 3NGPA 3LYIA 4JZ3A 2QG9B 3G6EQ 2QI2A 4JS4A 1VQ6Q 1RADB 1U3OA 2CP7A 3OY9A 5KYWA 4PJOC 2QQAA 1G2BA 1D1BA 2RK2A 2ECZA 3I5RA 1RAHB 2KI7A 4F7UF 5LJ3j 2JVVA 1TUDA 2VWFA 3EH2A 1KJWA 1GBQA 2O9SA 1T3SA 2A36A 3CCUA 2JJ9A 4HVVA 4BDZA 1RAIB 5HY6A 5CKBA 4M7AG 4F17A 1KFZA 1XOVA 2E1HA 2EGCA 4II1A 1D0YA 2XDBA 4E6RA 4JJBA 3L2ZA 3MP8A 4NS5A 2CP6A 4R56A 2E64A 2X3XD 1KQSA 4LE9A 3CCMQ 2IVWA 1K73U 2K7AA 2DKGA 4BE2A 4PJOG 1OPLA 3A8MB 3URGA 3LH0A 3VUZA 1YJWT 4C8QC 4F04B 1UHFA 3M54A 4QW2A 2KQWA 2EIFA 4CC7A 4QKUA 3FEOA 4J9DA 2LJ1A 4OF1A 1VQNA 1WLPB 1VQ6T 1JB0E 5J26A 3VV0A 1Y71A 4OVAA 1KQSS 3FDRA 3H8ZA 4L6V5 2RA2A 4R55A 1IREB 2LQNA 3JCMh 1M2VB 1TUCA 1QKXA 2EKOA 2IG0A 5EC7A 4J6YA 4TVRA 5DY9A 1YHQA 5KYXA 3EHRA 4M77D 5CVIA 2CS7A 5IXFA 1M5Q1 2LDMA 2J6OA 1M90C 2JM9A 1B7TA 3O8VA 2RN8A 3CXCP 4Y91A 1YCSB 4E7HA 2KGTA 3OYGA 1M8VA 4RTVA 3L2UA 4ZNXA 1W70A 3CCVA 2X4JA 3MJXA 3T9NA 3VYGA 1NBEB 5LJ3e 1WHHA 1ZA1B 4B6MA 1PSEA 4E47A 3EG9A 2RQVA 3EHQA 2IIMA 2H8HA 3LWHA 5GAOl 4XTUA 1TH7A 2J05A 2RMOA 1TWBA 4C0GA 3E1SA 2WSEE 4JDSA 1RABB 2HQHA 2LX9A 1IZ6A 3CXCS 1K1ZA 3HP9A 2PTKA 1BK2A 3SWNB 3VS7A 3C94A 5FRNA 1G3WA 2FB7A 3JSCA 2ZPGB 2A37A 2L3QA 2VASA 2RQTA 1QMCA 2W0ZA 2GF7A 3RIRA 3M9QA 5HCKA 3I56T 2VV5A 2X4YA 3M57A 2DXUA 1M1KU 3SDZA 1YWPA 1ZBXA 3CC2A 1TTHB 2YT6A 1WA7A 2KMTA 2DBKA 3RERA 1GRIA 4DBRA 3OYBA 2NUZA 1G5VA 3VKIA 1GFDA 4RKUE 3H6ZA 4LUEA 2EJ9A 3LGLA 4FT2A 1RAGB 4HKEA 2QASA 2CUBA 1N5ZA 1M4ZA 4C8QE 1YHQT 3E9GA 2X51A 4ZTFA 4XU3A 1KSWA 2DXCA 1QVFS 2RF0A 1R0CB 2F69A 2QDYB 3S3NA 4B9WA 3CCQA 5A0DA 4M78B 2HBPA 5GMKe 4XQ3A 3A8HB 3JCMg 2BE9B 2H3JA 2DE0X 1I0CA 1K8AC 2B86A 2H3EB 1SHFA 3H9NA 1YITQ 3LGFA 2OTLT 2YLCA 5HKCA 3OS5A 3DB4A 4PJLA 1M3AA 1GCQC 2HZYA 1AVZC 4PNOA 3E2UA 1BI3A 5AYFA 2PU9B 1PKSA 4N0AA 5GANg 3UWNA 4BE0A 3PNWC 1FYNA 3S3OA 5EG2A 2EQUA 2K5FA 2CSIA 4JLIA 2QEXA 1AHJB 3C95A 3CPWP 2BTTA 3JCMQ 3CCUQ 4RTXA 5GAOp 2O4XA 2X3WD 4OMQA 4FSXA 4EMKB 2JM8A 3OSVA 1BB9A 1YNZA 1UTIA 1Q81U 1WDXA 3NMZC 4PJOF 1YJNT 4HA8A 5GAOr 2KRSA 3CBPA 1XQHA 1VQ8T 4NL3A 4D8KA 4ANJA 4JUVA 2Z0WA 1QVGS 1O9SA 2SEMA 2K5LA 3TVTA 4AMCA 1I5OB 2QQ9A 3F70A 1RUWA 2CSQA 3ER0A 3V8LA 2LNVA 2O9VA 3NTIA 2OX7A 3FRNA 3CCJT 1R77A 1I5LA 2BIVA 2K57A 4C8QF 2L3PA 2OJ2A 3NTHA 4M78D 3G6ET 2KVQG 2CUDA 1X6GA 2F5KA 2GGRA 4ZGEB 2KROA 4EMGA 1PRLC 1UJYA 1X01A 3CD6A 2O2OA 1U1SA 3GNGA 3GLXA 4A63B 1GCPA 2DAQA 2FPFA 1VQNT 1AWXA 1NPPA 4FL6A 2FPDA 4FW1A 1Q95G 4YTLA 1NZ9A 1M3CA 2YUQA 4R0KA 2RI3A 5GAOq 4HCCA 3BW1A 2GTJA 2LRQA 3QJ6A 4M7AC 3RKWA 1BI0A 1OZ2A 1ZBJA 3PTAA 4F7UE 3CCRQ 4N4GA 1YJNQ 2HKNA 3CMAQ 2CREA 3E9FA 4MZPA 4MMKA 3EG1A 1N9RA 3DB3A 3QUIA 4GBQA 3JV3A 2QGGA 4CC2A 4RG2A 4LDXA 1AWJA 1UGVA 4EMKC 1QQJA 2P4TA 4M78G 2MF2A 2AKLA 4UC4A 1Q86R 4JPBW 1VQKT 1MUZA 2DK3A 1WNLA 2EJFA 3VJPA 2AZSA 2CP0A 2DJZA 4LUDA 3CMEQ 1PM3A 2HEQA 2EYQA 5CKEA 2YUOA 4J9EA 4A4FA 2NUTA 1OPKA 1WQ7A 1KC8U 1UGPB 2YUPA 1ZUKA 2K9GA 4LXCA 2MOXA 2LJ3A 3QKJA 3EGUA 3LX7A 1C0MA 3V7CA 2RJFA 1VQOA 2HL5C 2CP2A 5I22A 3I55T 3VS3A 1BKBA 1SKUB 1Q7YC 4DA4A 4PKCC 2ZPFB 3PT9A 3BY7A 1QCOA 1WPYA 1ZUUA 2J7IA 5CIUA 3JCMd 1VQ8Q 5KCHA 1KD1R 4C92C 2FO0A 4VUBA 1HXDA 3SWNC 2QA4Q 3JCMX 3RKYA 1XNIA 1WXTA 3H0HA 1CKAA 1N8RR 2EAYA 1WXUA 1RAFB 2EYZA 2CH4W 2GQVA 3CCLQ 4BACA 2K6DA 1OV3A 1EX4A 1V1CA 4M7DC 3FJPA 4M77B 3P8DA 2HSEB 1D1CA 5D6WA 2LQKA 3SFMA 5A2QE 4ZTJA 1VIEA 2RQRA 3HRUA 5KYWB 4AT1B 2YWWA 2KSSA 1PSFA 5GMKm 4BI3A 3OS2A 4KUDK 1OI1A 1HSQA 5CO7A 2HBWA 1OU8A 4A53A 4LD9K 2OAUA 2R57A 3QPHA 5KYUB 5CR2A 1OX8A 4BDYA 1NEBA 4XTWA 4D8DA 4P5NA 5GAMg 1I1JA 2QDLA 2DETA 2NUTB 5KYYB 3RKXA 5GAN3 3G7ZA 2DIGA 3FC3A 4KRTA 1Z9ZA 3JCMc 2VXFA 3ZFJA 4X9DA 2OTJQ 1X2QA 1VQMT 5LL6S 2V26A 2R58A 1AZEA 4ESRA 2F2VA 4J7IA 4M77E 5FW9A 1ZQ1A 2V8IA 4KGVB 2BZ8A 2PZ1A 1VYVA 4C8QG 2MPXC 5IH2A 2I2LA 1K4US 2DTOA 3U23A 2J6FA 3CCLT 5CQXA 1YITT 5L23A 3CC4A 3HRSA 4C0FA 5IXBA 3BDUA 3MPUB 3UF4A 3HSBA 5FU7B 4M75C 2RJDA 2GQIA 1IB8A 1MMDA 1QVFP 1MMNA 1I8FA 4PJOA 4CI0C 1B3QA 1JRIA 2LX7A 2E41A 3NFCA 1YFNA 5GJVB 3L2WA 4AG2C 5I21A 3QWXX 3JB9G 3CC2T 2Y4XA 3NTKA 3V7SA 2JT4A 2YDLA 2HNIA 4Y28E 3Q1JA 4CC4B 3I56A 3LWIA 2FVUA 2JTFA 3CCUT 2WACA 5FWBA 2LVMA 5CKHA 4AFUC 2JUFA 1VOMA 4M77F 2I0NA 3C12A 4C0ZA 3QIIA 5GJWB 2E70A 5AT1B 1AOJA 2CH4A 2MMPA 4E2FB 3CEYA 1KHIA 2HL3A 1VQ5A 2LQWA 2GCXA 1VA7A 2AIRB
chains in the Genus database with same CATH topology
2GBQA 2H8HA 2J05A 2RMOA 1CSKA 2KR3A 1TG0A 1NLPC 3GBQA 4AG1C 1RLQC 1K1ZA 1UECA 2PTKA 1BK2A 1U5SA 3UA6A 3VS7A 3THKA 1G83A 4IIMA 3VS6A 2A37A 1JXOA 1Z9QA 2L3QA 1Y0MA 2RQTA 2W0ZA 5IHNA 2NWMA 1ZX6A 5HCKA 2DL3A 1JEGA 1NYFA 3PVLA 5I11A 2RNAA 1YWPA 2KRMA 3VRYA 2YT6A 1WA7A 2DBKA 1K9AA 1VYUA 1GRIA 2NUZA 1UUEA 2DVJA 1AD5A 1GFDA 4LUEA 4OMOA 1B07A 1EFNA 2CUBA 1N5ZA 4AFQC 2M51A 3A98A 1K0SA 1E7OA 1KSWA 2RF0A 4RTUA 1X27A 1A0NB 4RTWA 1GBRA 4Z8AA 1W6XA 2K79A 1H92A 1OEBA 1NM7A 1ZSGA 2YUNA 1K76A 2L3SA 2J6KA 4J9BA 3I5SA 2DE0X 1I0CA 2B86A 1SHFA 4LNPA 1M27C 1S1NA 2DL4A 1LCKA 2EGEA 2JS0A 1M3AA 1GCQC 3C0CA 1AVZC 3QWYA 2FPEA 2CDTA 2A08A 1PKSA 3RBBB 1H3HA 3TSWA 1YP5A 2DILA 1GFCA 1ABOA 1PHTA 4K11A 1FYNA 1AEYA 3H41A 2CSIA 3ULRB 1JXMA 2OI3A 2BTTA 2EBPA 1FMKA 1H8KA 2JTEA 1WYXA 4J9IA 4RTXA 2CT3A 2X3WD 4OMQA 4JZ4A 3EG3A 1M3BA 1UHCA 1WX6A 3H0IA 2JM8A 1BB9A 2LMJA 2O88A 1QWEA 1GL5A 4HVUA 2BZXA 1YNZA 1UTIA 1WDXA 3NMZC 4FSSA 1ZLMA 2GTOA 4ORZA 4CC3A 2KRSA 4M4ZA 2CT4A 1SRLA 4D8KA 4HVWA 2DF6A 2A28A 4Y92A 2SRCA 1MV3A 3M0PA 4JJDA 2SEMA 2L0AA 3TSZA 3TVTA 3R6NA 4RTTA 3ZL7C 5IHIA 4OMPA 4GLMA 2DMOA 1UE9A 1WIEA 2W10A 1RUWA 2CSQA 3RNJA 1NEGA 2ED1A 2O9VA 2EW3A 1BBZA 3VS0A 2ROTA 5IHKA 1X2KA 2KT1A 2EPDA 1WFWA 4LN2A 1NYGA 1JO8A 2EYWA 2L3PA 2C0TA 2OJ2A 2XMFA 3PE0A 2YSQA 1QKWA 2CUDA 1X6GA 2G6FX 2GNCA 3PVQA 2GGRA 3M0TA 2KROA 2KXDA 1PRLC 1UJYA 2DM1A 2KYMA 4IIOA 2O2OA 1WXBA 1CKBA 2DL5A 2FEIA 4A63B 1GCPA 2FPFA 1M8MA 1I07A 2K2MA 4RTZA 1AWXA 2EQIA 1T3LA 2FPDA 4RTYA 3UA7A 1ARKA 2DYBA 1M3CA 2YUQA 1QLYA 2F2WA 4R0KA 3FJ5A 1WI7A 2GTJA 2ABLA 1QWFA 1ZBJA 2RQUA 2KT8A 4WCIA 2CREA 3I35A 1JQQA 3EG1A 2DRMA 2DLPA 4GBQA 1PNJA 1T0JA 2JS2A 3JV3A 4CC2A 1VYTA 1AWJA 1UGVA 1BU1A 1JU5C 2AKLA 4JPBW 2MIOA 3VRZA 1E6GA 1MUZA 4X1VA 2KEAA 1NLOC 2LP5A 2P4RA 2AZSA 1OOTA 4LUDA 1PKTA 4Z89A 2HEQA 3SEMA 2YUOA 1UFFA 4J9EA 4HCKA 2D1XA 1OPKA 3VS1A 1X6BA 2EYYA 1YWOA 2YUPA 1NG2A 1ZUKA 2K9GA 3I9QA 2MOXA 1HD3A 1PRMC 4AFSC 2RPNA 3M0QA 2LJ3A 3EGUA 1U06A 5I22A 3VS3A 4J9FA 1RI9A 3REAB 1W1FA 2DL8A 2KBTA 2ROLA 3VS2A 1E6HA 2V1QA 3CQTA 1ZUUA 4F14A 1SRMA 2J7IA 5ECAA 4OMLA 2DX1A 2HSPA 2JMCA 2MCNA 3NHNA 2FO0A 2D0NA 1WXTA 3H0HA 2KYBA 2KNBB 1CKAA 2VVKA 1T0HA 1WXUA 1IO6A 2EYZA 1SSHA 1X69A 2CH4W 1SHGA 3IQLA 1M30A 4DEYA 2JW4A 2K6DA 1OV3A 2V1RA 2VKNA 3EG2A 1V1CA 2RQWA 2KXCA 3REBB 1AZGB 2D8JA 2PNIA 3UATA 1UG1A 2OAWA 3NPFA 3NGPA 2RQRA 1UDLA 4JZ3A 1SPKA 2EYXA 2LNHB 1U3OA 2LCSA 1HSQA 1KIKA 2HBWA 4OMMA 1G2BA 2D8HA 3H0FA 2ECZA 1K0XA 2DJQA 3I5RA 1NEBA 4D8DA 2VWFA 1TUDA 1KJWA 1GBQA 1I1JA 2QDLA 2O9SA 1T3SA 2O31A 1QCFA 2A36A 2DL7A 4HVVA 2EKHA 2EVRA 1PWTA 4Z88A 4F17A 1KFZA 4KRTA 1XOVA 4F16A 1Z9ZA 5FWCA 2EGCA 2HDAA 3SHWA 1AWOA 1X2QA 4E6RA 4JJBA 2HCKA 1X43A 1RLPC 2LZ6B 2X3XD 1AZEA 3M0UA 4ESRA 2KRNA 4LE9A 2F2VA 2DNUA 2F2XA 3KFVA 5FW9A 2BZ8A 2K7AA 3O5ZA 2PZ1A 2BZYA 1VYVA 4J9HA 4QT7A 5IH2A 1K4US 3U23A 2J6FA 2L2PA 1OPLA 2FRYA 5L23A 1GCQA 2C0OA 5IXBA 2FG0A 2JMAA 4HXJA 2EGAA 3UF4A 1UHFA 1YN8A 2JXBA 2GQIA 4CC7A 4J9DA 2LJ1A 3M0RA 2KE9A 1B3QA 1WLPB 2DA9A 2LX7A 2AKKA 5GJVB 4AG2C 1ABQA 3QWXX 2ENMA 2LQNA 4JJCA 2JT4A 1ZUYA 2YDLA 1TUCA 1QKXA 4EIKA 1J3TA 2J06A 5EC7A 4RUGA 1UJ0A 4CC4B 3EHRA 1SEMA 5IXFA 2K3BA 2ESWA 1AWWA 2J6OA 2FRWA 2JM9A 2LJ0A 3VS4A 4DEXA 5FWBA 2C0IA 2RN8A 1MV0B 4AFUC 1HJDA 1YCSB 4J9CA 2KGTA 2I0NA 3VS5A 2DBMA 5GJWB 2DRKA 4RTVA 1AOJA 2M0YA 4ZNXA 2CH4A 1W70A 1Y57A 3LH5A 2E5KA 2AZVA 3M0SA 4OMNA 2ED0A 4J9GA 4AFZC 3EG0A 2AK5A 2LQWA 1VA7A 2RQVA 3EHQA 2IIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBQ A;  2H8H A;  2J05 A;  2RMO A;  1CSK A;  2KR3 A;  1TG0 A;  1NLP C;  3GBQ A;  4AG1 C;  1RLQ C;  1K1Z A;  1UEC A;  2PTK A;  1BK2 A;  1U5S A;  3UA6 A;  3VS7 A;  3THK A;  1G83 A;  4IIM A;  3VS6 A;  2A37 A;  1JXO A;  1Z9Q A;  2L3Q A;  1Y0M A;  2RQT A;  2W0Z A;  5IHN A;  2NWM A;  1ZX6 A;  5HCK A;  2DL3 A;  1JEG A;  1NYF A;  3PVL A;  5I11 A;  2RNA A;  1YWP A;  2KRM A;  3VRY A;  2YT6 A;  1WA7 A;  2DBK A;  1K9A A;  1VYU A;  1GRI A;  2NUZ A;  1UUE A;  2DVJ A;  1AD5 A;  1GFD A;  4LUE A;  4OMO A;  1B07 A;  1EFN A;  2CUB A;  1N5Z A;  4AFQ C;  2M51 A;  3A98 A;  1K0S A;  1E7O A;  1KSW A;  2RF0 A;  4RTU A;  1X27 A;  1A0N B;  4RTW A;  1GBR A;  4Z8A A;  1W6X A;  2K79 A;  1H92 A;  1OEB A;  1NM7 A;  1ZSG A;  2YUN A;  1K76 A;  2L3S A;  2J6K A;  4J9B A;  3I5S A;  2DE0 X;  1I0C A;  2B86 A;  1SHF A;  4LNP A;  1M27 C;  1S1N A;  2DL4 A;  1LCK A;  2EGE A;  2JS0 A;  1M3A A;  1GCQ C;  3C0C A;  1AVZ C;  3QWY A;  2FPE A;  2CDT A;  2A08 A;  1PKS A;  3RBB B;  1H3H A;  3TSW A;  1YP5 A;  2DIL A;  1GFC A;  1ABO A;  1PHT A;  4K11 A;  1FYN A;  1AEY A;  3H41 A;  2CSI A;  3ULR B;  1JXM A;  2OI3 A;  2BTT A;  2EBP A;  1FMK A;  1H8K A;  2JTE A;  1WYX A;  4J9I A;  4RTX A;  2CT3 A;  2X3W D;  4OMQ A;  4JZ4 A;  3EG3 A;  1M3B A;  1UHC A;  1WX6 A;  3H0I A;  2JM8 A;  1BB9 A;  2LMJ A;  2O88 A;  1QWE A;  1GL5 A;  4HVU A;  2BZX A;  1YNZ A;  1UTI A;  1WDX A;  3NMZ C;  4FSS A;  1ZLM A;  2GTO A;  4ORZ A;  4CC3 A;  2KRS A;  4M4Z A;  2CT4 A;  1SRL A;  4D8K A;  4HVW A;  2DF6 A;  2A28 A;  4Y92 A;  2SRC A;  1MV3 A;  3M0P A;  4JJD A;  2SEM A;  2L0A A;  3TSZ A;  3TVT A;  3R6N A;  4RTT A;  3ZL7 C;  5IHI A;  4OMP A;  4GLM A;  2DMO A;  1UE9 A;  1WIE A;  2W10 A;  1RUW A;  2CSQ A;  3RNJ A;  1NEG A;  2ED1 A;  2O9V A;  2EW3 A;  1BBZ A;  3VS0 A;  2ROT A;  5IHK A;  1X2K A;  2KT1 A;  2EPD A;  1WFW A;  4LN2 A;  1NYG A;  1JO8 A;  2EYW A;  2L3P A;  2C0T A;  2OJ2 A;  2XMF A;  3PE0 A;  2YSQ A;  1QKW A;  2CUD A;  1X6G A;  2G6F X;  2GNC A;  3PVQ A;  2GGR A;  3M0T A;  2KRO A;  2KXD A;  1PRL C;  1UJY A;  2DM1 A;  2KYM A;  4IIO A;  2O2O A;  1WXB A;  1CKB A;  2DL5 A;  2FEI A;  4A63 B;  1GCP A;  2FPF A;  1M8M A;  1I07 A;  2K2M A;  4RTZ A;  1AWX A;  2EQI A;  1T3L A;  2FPD A;  4RTY A;  3UA7 A;  1ARK A;  2DYB A;  1M3C A;  2YUQ A;  1QLY A;  2F2W A;  4R0K A;  3FJ5 A;  1WI7 A;  2GTJ A;  2ABL A;  1QWF A;  1ZBJ A;  2RQU A;  2KT8 A;  4WCI A;  2CRE A;  3I35 A;  1JQQ A;  3EG1 A;  2DRM A;  2DLP A;  4GBQ A;  1PNJ A;  1T0J A;  2JS2 A;  3JV3 A;  4CC2 A;  1VYT A;  1AWJ A;  1UGV A;  1BU1 A;  1JU5 C;  2AKL A;  4JPB W;  2MIO A;  3VRZ A;  1E6G A;  1MUZ A;  4X1V A;  2KEA A;  1NLO C;  2LP5 A;  2P4R A;  2AZS A;  1OOT A;  4LUD A;  1PKT A;  4Z89 A;  2HEQ A;  3SEM A;  2YUO A;  1UFF A;  4J9E A;  4HCK A;  2D1X A;  1OPK A;  3VS1 A;  1X6B A;  2EYY A;  1YWO A;  2YUP A;  1NG2 A;  1ZUK A;  2K9G A;  3I9Q A;  2MOX A;  1HD3 A;  1PRM C;  4AFS C;  2RPN A;  3M0Q A;  2LJ3 A;  3EGU A;  1U06 A;  5I22 A;  3VS3 A;  4J9F A;  1RI9 A;  3REA B;  1W1F A;  2DL8 A;  2KBT A;  2ROL A;  3VS2 A;  1E6H A;  2V1Q A;  3CQT A;  1ZUU A;  4F14 A;  1SRM A;  2J7I A;  5ECA A;  4OML A;  2DX1 A;  2HSP A;  2JMC A;  2MCN A;  3NHN A;  2FO0 A;  2D0N A;  1WXT A;  3H0H A;  2KYB A;  2KNB B;  1CKA A;  2VVK A;  1T0H A;  1WXU A;  1IO6 A;  2EYZ A;  1SSH A;  1X69 A;  2CH4 W;  1SHG A;  3IQL A;  1M30 A;  4DEY A;  2JW4 A;  2K6D A;  1OV3 A;  2V1R A;  2VKN A;  3EG2 A;  1V1C A;  2RQW A;  2KXC A;  3REB B;  1AZG B;  2D8J A;  2PNI A;  3UAT A;  1UG1 A;  2OAW A;  3NPF A;  3NGP A;  2RQR A;  1UDL A;  4JZ3 A;  1SPK A;  2EYX A;  2LNH B;  1U3O A;  2LCS A;  1HSQ A;  1KIK A;  2HBW A;  4OMM A;  1G2B A;  2D8H A;  3H0F A;  2ECZ A;  1K0X A;  2DJQ A;  3I5R A;  1NEB A;  4D8D A;  2VWF A;  1TUD A;  1KJW A;  1GBQ A;  1I1J A;  2QDL A;  2O9S A;  1T3S A;  2O31 A;  1QCF A;  2A36 A;  2DL7 A;  4HVV A;  2EKH A;  2EVR A;  1PWT A;  4Z88 A;  4F17 A;  1KFZ A;  4KRT A;  1XOV A;  4F16 A;  1Z9Z A;  5FWC A;  2EGC A;  2HDA A;  3SHW A;  1AWO A;  1X2Q A;  4E6R A;  4JJB A;  2HCK A;  1X43 A;  1RLP C;  2LZ6 B;  2X3X D;  1AZE A;  3M0U A;  4ESR A;  2KRN A;  4LE9 A;  2F2V A;  2DNU A;  2F2X A;  3KFV A;  5FW9 A;  2BZ8 A;  2K7A A;  3O5Z A;  2PZ1 A;  2BZY A;  1VYV A;  4J9H A;  4QT7 A;  5IH2 A;  1K4U S;  3U23 A;  2J6F A;  2L2P A;  1OPL A;  2FRY A;  5L23 A;  1GCQ A;  2C0O A;  5IXB A;  2FG0 A;  2JMA A;  4HXJ A;  2EGA A;  3UF4 A;  1UHF A;  1YN8 A;  2JXB A;  2GQI A;  4CC7 A;  4J9D A;  2LJ1 A;  3M0R A;  2KE9 A;  1B3Q A;  1WLP B;  2DA9 A;  2LX7 A;  2AKK A;  5GJV B;  4AG2 C;  1ABQ A;  3QWX X;  2ENM A;  2LQN A;  4JJC A;  2JT4 A;  1ZUY A;  2YDL A;  1TUC A;  1QKX A;  4EIK A;  1J3T A;  2J06 A;  5EC7 A;  4RUG A;  1UJ0 A;  4CC4 B;  3EHR A;  1SEM A;  5IXF A;  2K3B A;  2ESW A;  1AWW A;  2J6O A;  2FRW A;  2JM9 A;  2LJ0 A;  3VS4 A;  4DEX A;  5FWB A;  2C0I A;  2RN8 A;  1MV0 B;  4AFU C;  1HJD A;  1YCS B;  4J9C A;  2KGT A;  2I0N A;  3VS5 A;  2DBM A;  5GJW B;  2DRK A;  4RTV A;  1AOJ A;  2M0Y A;  4ZNX A;  2CH4 A;  1W70 A;  1Y57 A;  3LH5 A;  2E5K A;  2AZV A;  3M0S A;  4OMN A;  2ED0 A;  4J9G A;  4AFZ C;  3EG0 A;  2AK5 A;  2LQW A;  1VA7 A;  2RQV A;  3EHQ A;  2IIM A; 
#chains in the Genus database with same CATH topology
 2FHD A;  4C92 F;  4XTV A;  1CSK A;  1WHK A;  2ZGW A;  1VQ8 A;  1S72 T;  4AG1 C;  3GBQ A;  2GFA A;  4HCB A;  2CKK A;  3UA6 A;  2QQS A;  3THK A;  1G83 A;  3VS6 A;  1N27 A;  5IHN A;  4XAX B;  3OYD A;  1QVG P;  2DL3 A;  4M7D E;  2RNA A;  2QEX T;  1K9A A;  1VYU A;  1YI2 T;  3LW5 E;  1Y07 A;  3OW2 S;  2DTI A;  4KT0 E;  1SSF A;  4ZN1 A;  3EH1 A;  3CXC A;  2YHT A;  1QW1 A;  4AFQ C;  2M51 A;  3A98 A;  1VQ9 T;  1YIJ T;  3V8J A;  1E7O A;  3JCM W;  1AT1 B;  1GBR A;  4A4E A;  3G71 Q;  3CCR T;  2F1L A;  1OYX A;  4C5H A;  2MAM A;  1NM7 A;  1ZSG A;  2XI9 A;  2L5Q A;  4XK8 E;  5GMK h;  2CYZ B;  1D0X A;  1VQ6 A;  3RUX A;  5GAN j;  2MWO A;  1VQ4 T;  5GAM f;  3KUF A;  1S1N A;  3RMS A;  4JRK A;  3WVD B;  1QCN A;  2EGE A;  2JS0 A;  2ZZD A;  3RDV A;  2AHJ B;  4FYX B;  2VYT A;  5GAN 4;  4PJN A;  2E10 A;  2CDT A;  2DPP B;  3RBB B;  1I81 A;  1H3H A;  1YP5 A;  2DIL A;  1ABO A;  4XTZ A;  3RMQ A;  4M78 E;  3H41 A;  3VUB A;  2E65 A;  2XG8 D;  3OW2 A;  2OI3 A;  2EBP A;  4DBH A;  4C92 B;  4ELZ C;  1Q82 U;  2FZC B;  2CT3 A;  2K5I A;  4JZ4 A;  2P84 A;  1M3B A;  4ELY C;  3QXE B;  3CC7 T;  2O88 A;  1QWE A;  3CCV Q;  1GL5 A;  5HK3 A;  3JCM e;  1QP2 A;  1LPL A;  4QVC A;  2QXF A;  2E4H A;  4M4Z A;  2CT4 A;  3S3M A;  1KD1 C;  4IUT A;  3OS1 A;  4ME7 A;  3L2Q A;  2KK4 A;  1BCM A;  2SRC A;  1O75 A;  4JJD A;  4DOV A;  4DBQ A;  5GAM j;  4IUP A;  3TSZ A;  2IPO B;  4RTT A;  2PUO B;  1OZ3 A;  5FU6 C;  1WIE A;  2CP5 A;  3RNJ A;  3MET A;  3VS0 A;  2HQE A;  5IHK A;  2EPD A;  2ZPE B;  5C6S A;  4LN2 A;  1M2O A;  2C0T A;  5A0G A;  3QYH B;  2AT1 B;  1W2B P;  2GNC A;  3PVQ A;  1K8A R;  3OMC A;  2XKO C;  3HFN A;  3GIB A;  4MML A;  4IIO A;  1X75 C;  3A8G B;  1NPR A;  2DL5 A;  4PL6 A;  5M9O A;  2K2M A;  3FIF A;  2DXB A;  2F5T X;  1T3L A;  4E7S A;  4M7A F;  2E5Q A;  1OU9 A;  1ARK A;  3TCJ A;  2DYB A;  2COZ A;  1QLY A;  4KGZ B;  3M5A A;  3G1J A;  1C1A A;  4HCZ A;  4QQG A;  4KH1 B;  1KHC A;  4PK4 A;  4JJN K;  1Y96 A;  2HQX A;  3I35 A;  3EFR A;  1JQQ A;  3M4Y A;  4C92 D;  3OYN A;  1YJW A;  2NLU A;  4BY6 C;  2MYS A;  1BU1 A;  1JU5 C;  3L2R A;  4IUR A;  1E6G A;  2WSF E;  4DBF A;  3QBY A;  4J6X A;  2D0Q B;  3KBG A;  1PG5 B;  2P4R A;  1OOT A;  5HK0 A;  1VQ4 A;  1UFF A;  1Y7X A;  3OB9 A;  2D1X A;  3VS1 A;  2RD1 A;  1X6B A;  3OW2 P;  1YWO A;  4V2S A;  2FZG B;  4RCB A;  1V29 B;  4Q5W A;  3M59 A;  2V8J A;  3I9Q A;  2CZ1 B;  1U06 A;  2ATC B;  1TS9 A;  5GAN d;  3JB9 I;  2RO0 A;  2KBT A;  4KBM B;  1YI2 A;  4KUI A;  1VQ7 Q;  3CD6 Q;  3QG1 A;  5CK9 A;  4J83 A;  5GAN 8;  2VGM A;  3CC4 Q;  1MND A;  4HT9 A;  1SRM A;  3MCA B;  2R5A A;  4FW2 A;  4OML A;  2HSP A;  2JMC A;  3V8K A;  4PLI A;  1KG1 A;  1TXQ A;  3X20 B;  3V7R A;  4LDV A;  2O01 E;  3UDC A;  2A3L A;  1Q82 C;  4C0D C;  3M56 A;  2ZPI B;  1X69 A;  1X6O A;  3IQL A;  2RI5 A;  2JW4 A;  1K9M R;  2RQW A;  2KXC A;  1AZG B;  1VQL Q;  2KY9 A;  1G3T A;  2PNI A;  3UAT A;  4E7Z A;  3BFM A;  5I2M A;  1LJO A;  2BKD N;  3D7S B;  2EWN A;  1UDL A;  2RK1 A;  4M75 D;  2DYI A;  2EYX A;  2LNH B;  2LCS A;  1KIK A;  3H0F A;  5D7U A;  2MI6 A;  1K0X A;  1BIA A;  4M7D G;  1Q86 C;  4X34 A;  1B34 B;  3A1P A;  4JLG A;  3QO3 A;  2L8D A;  1JBM A;  2RHU A;  2O31 A;  2DL7 A;  1BCO A;  2EKH A;  1NE8 A;  2EVR A;  1PWT A;  4MZM A;  3GOX A;  1BIB A;  1WHM A;  3OMG A;  1YHQ Q;  2M16 A;  1VQ7 T;  1ZSZ C;  3J80 E;  2XDD A;  3SHW A;  3C4S A;  2QQR A;  3OYE A;  2VC8 A;  2HCK A;  1RLP C;  2HD0 A;  4C8Q A;  3M0U A;  1M1K R;  2FL7 A;  2QQB A;  2YLB A;  1G3Y A;  2DNU A;  3CCE A;  3O5Z A;  1U8R A;  4JRI A;  5GAO n;  3ASK A;  4J9H A;  5GAN e;  3MEW A;  4N4H A;  3AHU A;  2FRY A;  2P0K A;  1M9S A;  4BUG A;  2C0O A;  2LCL A;  2FG0 A;  4HXJ A;  1QP3 A;  5GAN 6;  4FM4 B;  2JXB A;  4LDW A;  4OB2 B;  5J3B A;  2EQM A;  3M0R A;  3CCM A;  1H64 1;  1VQO Q;  1G3S A;  3SD4 A;  2E12 A;  4PLL A;  1FMV A;  1R8O B;  4JJC A;  4A4G A;  1R0B G;  1NJI C;  5D6X A;  4EIK A;  4MDW A;  1F1B B;  3I55 Q;  1KD1 U;  2ESW A;  5IT9 E;  1QVP A;  2FRW A;  2LJ0 A;  2XDP A;  3VS4 A;  2C0I A;  1HJD A;  4J9C A;  1JJ2 P;  3VS5 A;  1MNE A;  1Q86 U;  3CCQ Q;  2DRK A;  2XID A;  1WZO A;  5KYN A;  1N8R U;  2M0Y A;  1Y57 A;  3S6W A;  1VQM A;  3LH5 A;  1MGQ A;  2E5K A;  3OYI A;  2Y90 A;  3TU4 K;  4OMN A;  2ED0 A;  2QK0 A;  4J9G A;  5LJ5 h;  2A0F B;  4WTO B;  2AK5 A;  3CCM T;  2DFU A;  2DIQ A;  3PMT A;  3OA6 A;  1K9M C;  4OGC A;  3OYY A;  1UEC A;  4JRQ A;  3CCJ Q;  1JXO A;  1Z9Q A;  1Y0M A;  5FRO A;  2K2V A;  2G3R A;  1ZX6 A;  3EAE A;  5CKD A;  2K3Y A;  1JEG A;  1NYF A;  4ZGJ B;  3PVL A;  3MEA A;  5I11 A;  2KRM A;  1FXX A;  5J39 A;  2RHI A;  4E7L A;  3ZEH A;  4KGX B;  1EFN A;  2X4W A;  1TSF A;  4OGE A;  3HRT A;  2M9U A;  2HKQ B;  1G8X A;  2OTJ T;  1VQM Q;  1X27 A;  1HYO A;  2R5M A;  2X4X A;  1VQK A;  1BYM A;  1Q81 C;  1W6X A;  4BD3 A;  2KDS A;  4M7A E;  5CKF A;  1FX7 A;  1M90 R;  2L3S A;  2J6K A;  3I5S A;  2FYK A;  4LNP A;  1ZSZ B;  1M27 C;  3I55 A;  2DL4 A;  1DJ7 B;  2JOY A;  2DD5 A;  2NUP B;  1KC8 R;  3OYA A;  2RJC A;  4O6J A;  3OYH A;  1VQP Q;  4N0A C;  1W2B A;  2K3X A;  3C0C A;  1LVK A;  3QWY A;  5KYX B;  1VQO T;  4LD6 A;  3JCM f;  4KH0 B;  2E3H A;  4JRP A;  2E6N A;  3LLR A;  1PHT A;  4K11 A;  1AEY A;  2CZ0 B;  2DEQ A;  3HL8 A;  2LQ8 A;  4N4I A;  3QDF A;  3CCE T;  5FRM A;  1FMK A;  2DD4 A;  1WJR A;  2JTE A;  3HKS A;  3QSU A;  1WYX A;  4J9I A;  4C92 E;  1K8A U;  3G4S A;  4BY6 B;  4PJO D;  1UHC A;  3TEE A;  3QDR B;  3EGX A;  2LMJ A;  5KH6 A;  1UGQ B;  2BZX A;  1MMG A;  4EPC A;  4D6W A;  5KE3 A;  4FSS A;  4CC3 A;  4A54 A;  3CC4 T;  1TU0 B;  4BE1 A;  2FZK B;  3BDL A;  3L2V A;  3PFS A;  5DM7 R;  2YXY A;  2DF6 A;  4QVZ A;  2A28 A;  1MV3 A;  3M0P A;  1UGS B;  5GMK i;  3JRZ A;  4XTY A;  2L0A A;  3R6N A;  1VQK Q;  2VXE A;  2XU8 A;  4A4H A;  5IHI A;  4PJO B;  4OMP A;  8AT1 B;  1D1A A;  1UE9 A;  1NEG A;  2NYS A;  2LT1 A;  1D3B B;  4J8O A;  2ROT A;  3SB2 A;  2XMF A;  1JO8 A;  3QHS A;  2LT4 A;  3PE0 A;  2YSQ A;  1NJI R;  2VGN A;  3A5Z B;  4C5G A;  2RH2 A;  1MMA A;  4C8Q D;  2KXD A;  3OS0 A;  1OX9 A;  2CZ6 B;  2KYM A;  4M78 F;  1YJN A;  1Y96 B;  1JJ2 S;  1VQL A;  1WXB A;  1CKB A;  4EMH A;  1U1T A;  1M8M A;  1I07 A;  4RTZ A;  4A4K A;  3OYF A;  1UEB A;  4RTY A;  3UA7 A;  3CCJ A;  1YJ9 Q;  5GAN 7;  2XK0 A;  2F2W A;  3OQ5 A;  1RAA B;  2QTV A;  3JCM P;  2PUK B;  4M7D B;  1H3Z A;  2ABL A;  4FYW B;  5LJ5 g;  2KT8 A;  5C0M A;  4WCI A;  2QA4 T;  3HHT B;  3UT1 A;  1D0Z A;  5FU7 C;  2QTX A;  3DLM A;  1JJ2 A;  3HTR A;  4M75 A;  1PNJ A;  2JS2 A;  2ZPB B;  4X9C A;  1OQK A;  5GAN 2;  1D09 B;  3ZBD A;  3OYL A;  2OTL Q;  3J81 E;  3OSS C;  2MIO A;  4X1V A;  5KYY A;  1VQL T;  1P92 A;  2KEA A;  2LP5 A;  4BB7 A;  2JN0 A;  4Z89 A;  1YJW Q;  2HMA A;  2L3R A;  2PVO B;  3M58 A;  2JZ2 A;  3CCS T;  4HCK A;  4PJJ A;  4J7F A;  1KQ2 A;  1PD1 A;  5GAM h;  1NJI U;  2L89 A;  1M1F A;  1C6V X;  1B34 A;  4E7J A;  4M78 A;  1K73 R;  1PRM C;  3CBM A;  2XHC A;  3J7A F;  2A7Y A;  1VQN Q;  1RI9 A;  1W1F A;  4XU2 A;  3CC7 Q;  1IGQ A;  2M02 A;  3G4S Q;  3VS2 A;  1E6H A;  4KUL A;  1WJS A;  8ATC B;  2DER A;  4C8Q B;  2DX1 A;  1S72 A;  1W4S A;  2C06 A;  5LJ5 f;  3R6O A;  2EJG A;  4NL2 A;  3DLL A;  3CCL A;  4NOY A;  5CAI A;  2KNB B;  1T0H A;  1VUB A;  1N9S A;  1SSH A;  5CCA A;  2K4Y A;  1M30 A;  3VYH B;  3JB9 H;  2ZPH B;  2V1R A;  2VKN A;  3CBO A;  3EG2 A;  2Y4Y A;  2M0O A;  3REB B;  4F7U G;  3PIO A;  1S72 Q;  5A0L A;  1HK9 A;  1UG1 A;  3NPF A;  1ZHI A;  3JCM b;  2QYZ A;  2CP3 A;  1SPK A;  3RES A;  1IGU A;  3CCS Q;  1XJW B;  3CC7 A;  2HAX A;  3OYJ A;  4OMM A;  3I56 Q;  3EFS A;  2D8H A;  2X35 A;  1IXD A;  2DJQ A;  2OTL A;  3OYK A;  4M75 G;  3GF5 A;  1WJQ A;  4IKF A;  3VU3 C;  1RI0 A;  5GAM e;  3EGX B;  4OB1 B;  3P8H A;  3M55 A;  1QCF A;  3G6E A;  2E3I A;  3GNF B;  4Z88 A;  4M7A A;  4F16 A;  3CD6 T;  4OP0 A;  4FT4 A;  4O5V A;  3PGG A;  4FU6 A;  5FWC A;  5FLX E;  1YIJ Q;  2HDA A;  1VQ9 Q;  1AWO A;  4QVD A;  2V8K A;  3CME A;  1X43 A;  1YBY A;  2LZ6 B;  3G71 T;  2KRN A;  3KFV A;  2F2X A;  4ZGD B;  3CPF A;  5IN1 A;  2BZY A;  4QT7 A;  3FLG A;  2L2P A;  2VB6 A;  2OTJ A;  3SWN A;  3BE3 A;  1GCQ A;  4EMK A;  1RL2 A;  2JMA A;  2EGA A;  1KC8 C;  1YN8 A;  3X28 B;  1V76 A;  4PFZ A;  1UGR B;  2KE9 A;  3EGD A;  2DZ9 A;  4DQ2 A;  2DA9 A;  3G71 A;  4BI4 A;  1YJ9 A;  1QVF A;  2M1H A;  2AKK A;  3OYM A;  4C0D B;  1ABQ A;  2RM4 A;  2O4X B;  1IRX A;  2ENM A;  1ZUY A;  9ATC B;  7AT1 B;  3GPL A;  2EQJ A;  4QQD A;  1J3T A;  2J06 A;  4L59 A;  4RUG A;  1UJ0 A;  1WGS A;  5LJ3 g;  3TQ7 P;  4M78 C;  3AT1 B;  1SEM A;  3CCS A;  2K3B A;  1AWW A;  2CZ7 B;  2GFU A;  4DEX A;  1WHG A;  1LOJ A;  3G4S T;  1MV0 B;  3MKD A;  3EFO A;  2DBM A;  3L42 A;  2COW A;  1W2B S;  1RAC B;  5FU6 B;  4F7U A;  2COY A;  3MHX A;  2AZV A;  3M0S A;  2ZCF B;  4E7K A;  4M7D A;  5LJ5 j;  4AFZ C;  3EG0 A;  4XU1 A;  2QA4 A;  4OB3 B;  1BI1 A;  2GBQ A;  3MO8 A;  2PVD B;  2LTO A;  3WXM B;  2KR3 A;  1TG0 A;  1NLP C;  3TRE A;  1RLQ C;  5LJ5 d;  3PIP A;  3KXT A;  1U5S A;  1VQ5 Q;  4IIM A;  2YRV A;  1YCY A;  1M1K C;  2NWM A;  1K73 C;  3L1A A;  2JNG A;  1IHV A;  1GXI E;  4C5I A;  4Z02 A;  1N6A A;  3QZ9 B;  3VRY A;  4M77 C;  4XTX A;  1PCX A;  4WF2 A;  1TUG B;  2JTM A;  5CQY A;  1UUE A;  2DVJ A;  3QZ5 B;  1AD5 A;  3EGD B;  2YRD A;  5LJ3 f;  4OMO A;  1TOV A;  5I2S A;  2D6F A;  2DZC A;  1B07 A;  3CCV T;  4QQ6 A;  3HFO A;  4EDU A;  1K0S A;  1PD0 A;  1SF9 A;  3JB9 J;  4C92 G;  4RTU A;  1A0N B;  5GAM d;  4RTW A;  1VQP A;  4Z8A A;  1ZSZ A;  5KYU A;  4HT8 A;  2K79 A;  4J5Y A;  3X26 B;  4M7D F;  1H92 A;  1OEB A;  1WQW A;  2YUN A;  3OBY A;  1K76 A;  4J9B A;  3MEU A;  4PJO E;  3EG9 B;  4PFO A;  1LCK A;  2PQW A;  1OUL A;  2QAZ A;  4OB0 B;  1IHW A;  4M77 G;  4C5E A;  4PJM A;  3OBW A;  2FPE A;  5LJ5 e;  2RI2 A;  5GMK l;  2A08 A;  4IUQ A;  3ME9 A;  4M77 A;  4M7D D;  2KAF A;  2PVG B;  3TSW A;  4FCY A;  3UPU A;  3CMA A;  1GFC A;  2E6Z A;  1YIJ A;  1VQ9 A;  1WHJ A;  3N5B B;  2CGH A;  2P0Q A;  3QYG B;  1QVG A;  3ULR B;  1JXM A;  1H8K A;  4E7I A;  5GAN f;  1YI2 Q;  1VQ7 A;  2WSC E;  4GY5 A;  1PC0 A;  3EG3 A;  3EFO B;  3JCM V;  1RAE B;  1WX6 A;  3H0I A;  4FIB A;  5D6Y A;  1Q7Y U;  2DEU A;  2P0P A;  4HVU A;  3CCQ T;  1N8R C;  4LDY A;  4DOW A;  5IAY A;  1ZLM A;  2GTO A;  4ORZ A;  3X24 B;  1SRL A;  4HVW A;  3JAM E;  4Y92 A;  4IUU A;  5GAO m;  4B9X A;  2MWP A;  2DO3 A;  2RHX A;  4LDU A;  1VQ4 Q;  3ZL7 C;  4GLM A;  2DMO A;  2W10 A;  3CME T;  4RMO A;  1XTD A;  2B8A A;  2ED1 A;  4J6W A;  2EW3 A;  1VQ5 T;  1BBZ A;  3FB9 A;  1VQP T;  4MZT A;  1X2K A;  2KT1 A;  1WFW A;  1M2V A;  1NYG A;  2EYW A;  2EQK A;  4XU0 A;  3JCM J;  1QKW A;  2G6F X;  3INZ A;  2D9T A;  3M0T A;  2QEX Q;  1EIF A;  2DM1 A;  1KQ1 A;  3MP6 A;  1ACM B;  1BI2 A;  3MP1 A;  2FEI A;  3CCE Q;  4M75 E;  4ATO A;  2EQI A;  5KCO A;  1M1G A;  3A8O B;  1Q82 R;  4L5G A;  4FYY B;  3RR6 A;  3CPW S;  3FJ5 A;  1WI7 A;  6AT1 B;  3CPW A;  1QWF A;  2RQU A;  2YRC A;  2DVE A;  5GAN h;  1VIF A;  5GMK j;  2RHY A;  3M4G A;  5LJ3 d;  5DLO A;  3JB9 D;  5L8R E;  2DRM A;  1WHL A;  2DLP A;  1T0J A;  2MK5 A;  1VYT A;  2ZAE A;  4OMF B;  2RJE A;  4F7U B;  3GP8 A;  2RB6 A;  3VRZ A;  2X9H A;  2BUD A;  5LJ3 h;  1NLO C;  4GLK A;  1YIT A;  1PKT A;  1Q7Y R;  2BE7 D;  1M90 U;  1LNX A;  3SEM A;  2NUP A;  4FYV B;  4ZN3 A;  3DKM A;  1UB4 A;  3WVE B;  1FWZ A;  3CCR A;  3JB9 F;  5KE2 A;  4JS5 A;  2EYY A;  3QJY A;  2DTH A;  1NG2 A;  3P8B B;  3CC2 Q;  1KK7 A;  4AFS C;  1HD3 A;  2RPN A;  2VUB A;  3M0Q A;  3E19 A;  2DXT A;  1SG5 A;  3MEV A;  5GAN 5;  2RHZ A;  1ZA2 B;  4BI8 B;  4J9F A;  3REA B;  4RG8 A;  2LC4 A;  2DL8 A;  3OYC A;  2ROL A;  1KQS P;  2XD0 A;  3A8L B;  4M7A D;  5DLQ E;  1YJ9 T;  1Q81 R;  2V1Q A;  3CQT A;  4F14 A;  4MDX A;  4IUV A;  5ECA A;  1I4K 1;  4M75 B;  2MCN A;  3NHN A;  3HPW A;  2LCC A;  3CMA T;  2D0N A;  1MHN A;  2KYB A;  1FMW A;  4C92 A;  2VVK A;  4CRI A;  2XIC A;  1IO6 A;  2QGF B;  1SHG A;  1EZZ B;  3M53 A;  4DEY A;  3PMI A;  4M7A B;  4M75 F;  4RCC A;  2D8J A;  2EFI A;  1K9M U;  4PFP A;  2OAW A;  1D3B A;  3X25 B;  3NGP A;  3LYI A;  4JZ3 A;  2QG9 B;  3G6E Q;  2QI2 A;  4JS4 A;  1VQ6 Q;  1RAD B;  1U3O A;  2CP7 A;  3OY9 A;  5KYW A;  4PJO C;  2QQA A;  1G2B A;  1D1B A;  2RK2 A;  2ECZ A;  3I5R A;  1RAH B;  2KI7 A;  4F7U F;  5LJ3 j;  2JVV A;  1TUD A;  2VWF A;  3EH2 A;  1KJW A;  1GBQ A;  2O9S A;  1T3S A;  2A36 A;  3CCU A;  2JJ9 A;  4HVV A;  4BDZ A;  1RAI B;  5HY6 A;  5CKB A;  4M7A G;  4F17 A;  1KFZ A;  1XOV A;  2E1H A;  2EGC A;  4II1 A;  1D0Y A;  2XDB A;  4E6R A;  4JJB A;  3L2Z A;  3MP8 A;  4NS5 A;  2CP6 A;  4R56 A;  2E64 A;  2X3X D;  1KQS A;  4LE9 A;  3CCM Q;  2IVW A;  1K73 U;  2K7A A;  2DKG A;  4BE2 A;  4PJO G;  1OPL A;  3A8M B;  3URG A;  3LH0 A;  3VUZ A;  1YJW T;  4C8Q C;  4F04 B;  1UHF A;  3M54 A;  4QW2 A;  2KQW A;  2EIF A;  4CC7 A;  4QKU A;  3FEO A;  4J9D A;  2LJ1 A;  4OF1 A;  1VQN A;  1WLP B;  1VQ6 T;  1JB0 E;  5J26 A;  3VV0 A;  1Y71 A;  4OVA A;  1KQS S;  3FDR A;  3H8Z A;  4L6V 5;  2RA2 A;  4R55 A;  1IRE B;  2LQN A;  3JCM h;  1M2V B;  1TUC A;  1QKX A;  2EKO A;  2IG0 A;  5EC7 A;  4J6Y A;  4TVR A;  5DY9 A;  1YHQ A;  5KYX A;  3EHR A;  4M77 D;  5CVI A;  2CS7 A;  5IXF A;  1M5Q 1;  2LDM A;  2J6O A;  1M90 C;  2JM9 A;  1B7T A;  3O8V A;  2RN8 A;  3CXC P;  4Y91 A;  1YCS B;  4E7H A;  2KGT A;  3OYG A;  1M8V A;  4RTV A;  3L2U A;  4ZNX A;  1W70 A;  3CCV A;  2X4J A;  3MJX A;  3T9N A;  3VYG A;  1NBE B;  5LJ3 e;  1WHH A;  1ZA1 B;  4B6M A;  1PSE A;  4E47 A;  3EG9 A;  2RQV A;  3EHQ A;  2IIM A;  2H8H A;  3LWH A;  5GAO l;  4XTU A;  1TH7 A;  2J05 A;  2RMO A;  1TWB A;  4C0G A;  3E1S A;  2WSE E;  4JDS A;  1RAB B;  2HQH A;  2LX9 A;  1IZ6 A;  3CXC S;  1K1Z A;  3HP9 A;  2PTK A;  1BK2 A;  3SWN B;  3VS7 A;  3C94 A;  5FRN A;  1G3W A;  2FB7 A;  3JSC A;  2ZPG B;  2A37 A;  2L3Q A;  2VAS A;  2RQT A;  1QMC A;  2W0Z A;  2GF7 A;  3RIR A;  3M9Q A;  5HCK A;  3I56 T;  2VV5 A;  2X4Y A;  3M57 A;  2DXU A;  1M1K U;  3SDZ A;  1YWP A;  1ZBX A;  3CC2 A;  1TTH B;  2YT6 A;  1WA7 A;  2KMT A;  2DBK A;  3RER A;  1GRI A;  4DBR A;  3OYB A;  2NUZ A;  1G5V A;  3VKI A;  1GFD A;  4RKU E;  3H6Z A;  4LUE A;  2EJ9 A;  3LGL A;  4FT2 A;  1RAG B;  4HKE A;  2QAS A;  2CUB A;  1N5Z A;  1M4Z A;  4C8Q E;  1YHQ T;  3E9G A;  2X51 A;  4ZTF A;  4XU3 A;  1KSW A;  2DXC A;  1QVF S;  2RF0 A;  1R0C B;  2F69 A;  2QDY B;  3S3N A;  4B9W A;  3CCQ A;  5A0D A;  4M78 B;  2HBP A;  5GMK e;  4XQ3 A;  3A8H B;  3JCM g;  2BE9 B;  2H3J A;  2DE0 X;  1I0C A;  1K8A C;  2B86 A;  2H3E B;  1SHF A;  3H9N A;  1YIT Q;  3LGF A;  2OTL T;  2YLC A;  5HKC A;  3OS5 A;  3DB4 A;  4PJL A;  1M3A A;  1GCQ C;  2HZY A;  1AVZ C;  4PNO A;  3E2U A;  1BI3 A;  5AYF A;  2PU9 B;  1PKS A;  4N0A A;  5GAN g;  3UWN A;  4BE0 A;  3PNW C;  1FYN A;  3S3O A;  5EG2 A;  2EQU A;  2K5F A;  2CSI A;  4JLI A;  2QEX A;  1AHJ B;  3C95 A;  3CPW P;  2BTT A;  3JCM Q;  3CCU Q;  4RTX A;  5GAO p;  2O4X A;  2X3W D;  4OMQ A;  4FSX A;  4EMK B;  2JM8 A;  3OSV A;  1BB9 A;  1YNZ A;  1UTI A;  1Q81 U;  1WDX A;  3NMZ C;  4PJO F;  1YJN T;  4HA8 A;  5GAO r;  2KRS A;  3CBP A;  1XQH A;  1VQ8 T;  4NL3 A;  4D8K A;  4ANJ A;  4JUV A;  2Z0W A;  1QVG S;  1O9S A;  2SEM A;  2K5L A;  3TVT A;  4AMC A;  1I5O B;  2QQ9 A;  3F70 A;  1RUW A;  2CSQ A;  3ER0 A;  3V8L A;  2LNV A;  2O9V A;  3NTI A;  2OX7 A;  3FRN A;  3CCJ T;  1R77 A;  1I5L A;  2BIV A;  2K57 A;  4C8Q F;  2L3P A;  2OJ2 A;  3NTH A;  4M78 D;  3G6E T;  2KVQ G;  2CUD A;  1X6G A;  2F5K A;  2GGR A;  4ZGE B;  2KRO A;  4EMG A;  1PRL C;  1UJY A;  1X01 A;  3CD6 A;  2O2O A;  1U1S A;  3GNG A;  3GLX A;  4A63 B;  1GCP A;  2DAQ A;  2FPF A;  1VQN T;  1AWX A;  1NPP A;  4FL6 A;  2FPD A;  4FW1 A;  1Q95 G;  4YTL A;  1NZ9 A;  1M3C A;  2YUQ A;  4R0K A;  2RI3 A;  5GAO q;  4HCC A;  3BW1 A;  2GTJ A;  2LRQ A;  3QJ6 A;  4M7A C;  3RKW A;  1BI0 A;  1OZ2 A;  1ZBJ A;  3PTA A;  4F7U E;  3CCR Q;  4N4G A;  1YJN Q;  2HKN A;  3CMA Q;  2CRE A;  3E9F A;  4MZP A;  4MMK A;  3EG1 A;  1N9R A;  3DB3 A;  3QUI A;  4GBQ A;  3JV3 A;  2QGG A;  4CC2 A;  4RG2 A;  4LDX A;  1AWJ A;  1UGV A;  4EMK C;  1QQJ A;  2P4T A;  4M78 G;  2MF2 A;  2AKL A;  4UC4 A;  1Q86 R;  4JPB W;  1VQK T;  1MUZ A;  2DK3 A;  1WNL A;  2EJF A;  3VJP A;  2AZS A;  2CP0 A;  2DJZ A;  4LUD A;  3CME Q;  1PM3 A;  2HEQ A;  2EYQ A;  5CKE A;  2YUO A;  4J9E A;  4A4F A;  2NUT A;  1OPK A;  1WQ7 A;  1KC8 U;  1UGP B;  2YUP A;  1ZUK A;  2K9G A;  4LXC A;  2MOX A;  2LJ3 A;  3QKJ A;  3EGU A;  3LX7 A;  1C0M A;  3V7C A;  2RJF A;  1VQO A;  2HL5 C;  2CP2 A;  5I22 A;  3I55 T;  3VS3 A;  1BKB A;  1SKU B;  1Q7Y C;  4DA4 A;  4PKC C;  2ZPF B;  3PT9 A;  3BY7 A;  1QCO A;  1WPY A;  1ZUU A;  2J7I A;  5CIU A;  3JCM d;  1VQ8 Q;  5KCH A;  1KD1 R;  4C92 C;  2FO0 A;  4VUB A;  1HXD A;  3SWN C;  2QA4 Q;  3JCM X;  3RKY A;  1XNI A;  1WXT A;  3H0H A;  1CKA A;  1N8R R;  2EAY A;  1WXU A;  1RAF B;  2EYZ A;  2CH4 W;  2GQV A;  3CCL Q;  4BAC A;  2K6D A;  1OV3 A;  1EX4 A;  1V1C A;  4M7D C;  3FJP A;  4M77 B;  3P8D A;  2HSE B;  1D1C A;  5D6W A;  2LQK A;  3SFM A;  5A2Q E;  4ZTJ A;  1VIE A;  2RQR A;  3HRU A;  5KYW B;  4AT1 B;  2YWW A;  2KSS A;  1PSF A;  5GMK m;  4BI3 A;  3OS2 A;  4KUD K;  1OI1 A;  1HSQ A;  5CO7 A;  2HBW A;  1OU8 A;  4A53 A;  4LD9 K;  2OAU A;  2R57 A;  3QPH A;  5KYU B;  5CR2 A;  1OX8 A;  4BDY A;  1NEB A;  4XTW A;  4D8D A;  4P5N A;  5GAM g;  1I1J A;  2QDL A;  2DET A;  2NUT B;  5KYY B;  3RKX A;  5GAN 3;  3G7Z A;  2DIG A;  3FC3 A;  4KRT A;  1Z9Z A;  3JCM c;  2VXF A;  3ZFJ A;  4X9D A;  2OTJ Q;  1X2Q A;  1VQM T;  5LL6 S;  2V26 A;  2R58 A;  1AZE A;  4ESR A;  2F2V A;  4J7I A;  4M77 E;  5FW9 A;  1ZQ1 A;  2V8I A;  4KGV B;  2BZ8 A;  2PZ1 A;  1VYV A;  4C8Q G;  2MPX C;  5IH2 A;  2I2L A;  1K4U S;  2DTO A;  3U23 A;  2J6F A;  3CCL T;  5CQX A;  1YIT T;  5L23 A;  3CC4 A;  3HRS A;  4C0F A;  5IXB A;  3BDU A;  3MPU B;  3UF4 A;  3HSB A;  5FU7 B;  4M75 C;  2RJD A;  2GQI A;  1IB8 A;  1MMD A;  1QVF P;  1MMN A;  1I8F A;  4PJO A;  4CI0 C;  1B3Q A;  1JRI A;  2LX7 A;  2E41 A;  3NFC A;  1YFN A;  5GJV B;  3L2W A;  4AG2 C;  5I21 A;  3QWX X;  3JB9 G;  3CC2 T;  2Y4X A;  3NTK A;  3V7S A;  2JT4 A;  2YDL A;  2HNI A;  4Y28 E;  3Q1J A;  4CC4 B;  3I56 A;  3LWI A;  2FVU A;  2JTF A;  3CCU T;  2WAC A;  5FWB A;  2LVM A;  5CKH A;  4AFU C;  2JUF A;  1VOM A;  4M77 F;  2I0N A;  3C12 A;  4C0Z A;  3QII A;  5GJW B;  2E70 A;  5AT1 B;  1AOJ A;  2CH4 A;  2MMP A;  4E2F B;  3CEY A;  1KHI A;  2HL3 A;  1VQ5 A;  2LQW A;  2GCX A;  1VA7 A;  2AIR B; 
#chains in the Genus database with same CATH homology
 2GBQ A;  2H8H A;  2J05 A;  2RMO A;  1CSK A;  2KR3 A;  1TG0 A;  1NLP C;  3GBQ A;  4AG1 C;  1RLQ C;  1K1Z A;  1UEC A;  2PTK A;  1BK2 A;  1U5S A;  3UA6 A;  3VS7 A;  3THK A;  1G83 A;  4IIM A;  3VS6 A;  2A37 A;  1JXO A;  1Z9Q A;  2L3Q A;  1Y0M A;  2RQT A;  2W0Z A;  5IHN A;  2NWM A;  1ZX6 A;  5HCK A;  2DL3 A;  1JEG A;  1NYF A;  3PVL A;  5I11 A;  2RNA A;  1YWP A;  2KRM A;  3VRY A;  2YT6 A;  1WA7 A;  2DBK A;  1K9A A;  1VYU A;  1GRI A;  2NUZ A;  1UUE A;  2DVJ A;  1AD5 A;  1GFD A;  4LUE A;  4OMO A;  1B07 A;  1EFN A;  2CUB A;  1N5Z A;  4AFQ C;  2M51 A;  3A98 A;  1K0S A;  1E7O A;  1KSW A;  2RF0 A;  4RTU A;  1X27 A;  1A0N B;  4RTW A;  1GBR A;  4Z8A A;  1W6X A;  2K79 A;  1H92 A;  1OEB A;  1NM7 A;  1ZSG A;  2YUN A;  1K76 A;  2L3S A;  2J6K A;  4J9B A;  3I5S A;  2DE0 X;  1I0C A;  2B86 A;  1SHF A;  4LNP A;  1M27 C;  1S1N A;  2DL4 A;  1LCK A;  2EGE A;  2JS0 A;  1M3A A;  1GCQ C;  3C0C A;  1AVZ C;  3QWY A;  2FPE A;  2CDT A;  2A08 A;  1PKS A;  3RBB B;  1H3H A;  3TSW A;  1YP5 A;  2DIL A;  1GFC A;  1ABO A;  1PHT A;  4K11 A;  1FYN A;  1AEY A;  3H41 A;  2CSI A;  3ULR B;  1JXM A;  2OI3 A;  2BTT A;  2EBP A;  1FMK A;  1H8K A;  2JTE A;  1WYX A;  4J9I A;  4RTX A;  2CT3 A;  2X3W D;  4OMQ A;  4JZ4 A;  3EG3 A;  1M3B A;  1UHC A;  1WX6 A;  3H0I A;  2JM8 A;  1BB9 A;  2LMJ A;  2O88 A;  1QWE A;  1GL5 A;  4HVU A;  2BZX A;  1YNZ A;  1UTI A;  1WDX A;  3NMZ C;  4FSS A;  1ZLM A;  2GTO A;  4ORZ A;  4CC3 A;  2KRS A;  4M4Z A;  2CT4 A;  1SRL A;  4D8K A;  4HVW A;  2DF6 A;  2A28 A;  4Y92 A;  2SRC A;  1MV3 A;  3M0P A;  4JJD A;  2SEM A;  2L0A A;  3TSZ A;  3TVT A;  3R6N A;  4RTT A;  3ZL7 C;  5IHI A;  4OMP A;  4GLM A;  2DMO A;  1UE9 A;  1WIE A;  2W10 A;  1RUW A;  2CSQ A;  3RNJ A;  1NEG A;  2ED1 A;  2O9V A;  2EW3 A;  1BBZ A;  3VS0 A;  2ROT A;  5IHK A;  1X2K A;  2KT1 A;  2EPD A;  1WFW A;  4LN2 A;  1NYG A;  1JO8 A;  2EYW A;  2L3P A;  2C0T A;  2OJ2 A;  2XMF A;  3PE0 A;  2YSQ A;  1QKW A;  2CUD A;  1X6G A;  2G6F X;  2GNC A;  3PVQ A;  2GGR A;  3M0T A;  2KRO A;  2KXD A;  1PRL C;  1UJY A;  2DM1 A;  2KYM A;  4IIO A;  2O2O A;  1WXB A;  1CKB A;  2DL5 A;  2FEI A;  4A63 B;  1GCP A;  2FPF A;  1M8M A;  1I07 A;  2K2M A;  4RTZ A;  1AWX A;  2EQI A;  1T3L A;  2FPD A;  4RTY A;  3UA7 A;  1ARK A;  2DYB A;  1M3C A;  2YUQ A;  1QLY A;  2F2W A;  4R0K A;  3FJ5 A;  1WI7 A;  2GTJ A;  2ABL A;  1QWF A;  1ZBJ A;  2RQU A;  2KT8 A;  4WCI A;  2CRE A;  3I35 A;  1JQQ A;  3EG1 A;  2DRM A;  2DLP A;  4GBQ A;  1PNJ A;  1T0J A;  2JS2 A;  3JV3 A;  4CC2 A;  1VYT A;  1AWJ A;  1UGV A;  1BU1 A;  1JU5 C;  2AKL A;  4JPB W;  2MIO A;  3VRZ A;  1E6G A;  1MUZ A;  4X1V A;  2KEA A;  1NLO C;  2LP5 A;  2P4R A;  2AZS A;  1OOT A;  4LUD A;  1PKT A;  4Z89 A;  2HEQ A;  3SEM A;  2YUO A;  1UFF A;  4J9E A;  4HCK A;  2D1X A;  1OPK A;  3VS1 A;  1X6B A;  2EYY A;  1YWO A;  2YUP A;  1NG2 A;  1ZUK A;  2K9G A;  3I9Q A;  2MOX A;  1HD3 A;  1PRM C;  4AFS C;  2RPN A;  3M0Q A;  2LJ3 A;  3EGU A;  1U06 A;  5I22 A;  3VS3 A;  4J9F A;  1RI9 A;  3REA B;  1W1F A;  2DL8 A;  2KBT A;  2ROL A;  3VS2 A;  1E6H A;  2V1Q A;  3CQT A;  1ZUU A;  4F14 A;  1SRM A;  2J7I A;  5ECA A;  4OML A;  2DX1 A;  2HSP A;  2JMC A;  2MCN A;  3NHN A;  2FO0 A;  2D0N A;  1WXT A;  3H0H A;  2KYB A;  2KNB B;  1CKA A;  2VVK A;  1T0H A;  1WXU A;  1IO6 A;  2EYZ A;  1SSH A;  1X69 A;  2CH4 W;  1SHG A;  3IQL A;  1M30 A;  4DEY A;  2JW4 A;  2K6D A;  1OV3 A;  2V1R A;  2VKN A;  3EG2 A;  1V1C A;  2RQW A;  2KXC A;  3REB B;  1AZG B;  2D8J A;  2PNI A;  3UAT A;  1UG1 A;  2OAW A;  3NPF A;  3NGP A;  2RQR A;  1UDL A;  4JZ3 A;  1SPK A;  2EYX A;  2LNH B;  1U3O A;  2LCS A;  1HSQ A;  1KIK A;  2HBW A;  4OMM A;  1G2B A;  2D8H A;  3H0F A;  2ECZ A;  1K0X A;  2DJQ A;  3I5R A;  1NEB A;  4D8D A;  2VWF A;  1TUD A;  1KJW A;  1GBQ A;  1I1J A;  2QDL A;  2O9S A;  1T3S A;  2O31 A;  1QCF A;  2A36 A;  2DL7 A;  4HVV A;  2EKH A;  2EVR A;  1PWT A;  4Z88 A;  4F17 A;  1KFZ A;  4KRT A;  1XOV A;  4F16 A;  1Z9Z A;  5FWC A;  2EGC A;  2HDA A;  3SHW A;  1AWO A;  1X2Q A;  4E6R A;  4JJB A;  2HCK A;  1X43 A;  1RLP C;  2LZ6 B;  2X3X D;  1AZE A;  3M0U A;  4ESR A;  2KRN A;  4LE9 A;  2F2V A;  2DNU A;  2F2X A;  3KFV A;  5FW9 A;  2BZ8 A;  2K7A A;  3O5Z A;  2PZ1 A;  2BZY A;  1VYV A;  4J9H A;  4QT7 A;  5IH2 A;  1K4U S;  3U23 A;  2J6F A;  2L2P A;  1OPL A;  2FRY A;  5L23 A;  1GCQ A;  2C0O A;  5IXB A;  2FG0 A;  2JMA A;  4HXJ A;  2EGA A;  3UF4 A;  1UHF A;  1YN8 A;  2JXB A;  2GQI A;  4CC7 A;  4J9D A;  2LJ1 A;  3M0R A;  2KE9 A;  1B3Q A;  1WLP B;  2DA9 A;  2LX7 A;  2AKK A;  5GJV B;  4AG2 C;  1ABQ A;  3QWX X;  2ENM A;  2LQN A;  4JJC A;  2JT4 A;  1ZUY A;  2YDL A;  1TUC A;  1QKX A;  4EIK A;  1J3T A;  2J06 A;  5EC7 A;  4RUG A;  1UJ0 A;  4CC4 B;  3EHR A;  1SEM A;  5IXF A;  2K3B A;  2ESW A;  1AWW A;  2J6O A;  2FRW A;  2JM9 A;  2LJ0 A;  3VS4 A;  4DEX A;  5FWB A;  2C0I A;  2RN8 A;  1MV0 B;  4AFU C;  1HJD A;  1YCS B;  4J9C A;  2KGT A;  2I0N A;  3VS5 A;  2DBM A;  5GJW B;  2DRK A;  4RTV A;  1AOJ A;  2M0Y A;  4ZNX A;  2CH4 A;  1W70 A;  1Y57 A;  3LH5 A;  2E5K A;  2AZV A;  3M0S A;  4OMN A;  2ED0 A;  4J9G A;  4AFZ C;  3EG0 A;  2AK5 A;  2LQW A;  1VA7 A;  2RQV A;  3EHQ A;  2IIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...