3M0QA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 5.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
ELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0qA00
3EG3A 2HEQA 4JZ3A 2E5KA 4Y92A 2DRKA 1VYVA 2VWFA 1W70A 2JS2A 2MCNA 4RTUA 1M3AA 1UHCA 2ROLA 4JJBA 4F17A 2CUBA 2AKKA 4M4ZA 2FRYA 2C0OA 2JMAA 1KIKA 1NYFA 2DRMA 1BBZA 2K2MA 1U5SA 1BK2A 1ZUKA 2KROA 3UA7A 1U06A 1AWOA 1E6GA 2J7IA 2CDTA 1MUZA 2A36A 1QKXA 1QWFA 2H8HA 4FSSA 1NM7A 1G2BA 1SHGA 2JM9A 1U3OA 3M0RA 4HVWA 1AD5A 1BU1A 1X43A 5FWBA 2EYZA 1SSHA 2CSIA 2O9SA 3H0FA 4ORZA 1TUCA 2DL5A 1YCSB 3I35A 4HXJA 4J9EA 4OMLA 4AFQC 2HBWA 4X1VA 1J3TA 3REBB 1WDXA 1YNZA 4J9FA 1UTIA 1CKAA 3RNJA 2KXDA 3VS1A 1WLPB 4Z8AA 3FJ5A 1W1FA 2RF0A 1H3HA 2KRSA 2RPNA 5IHKA 1WXBA 1K76A 4J9HA 1MV0B 2C0IA 1Z9ZA 4LE9A 2JXBA 1UHFA 3IQLA 3EG2A 4LN2A 1X2QA 2D8HA 4WCIA 2DF6A 4GLMA 3QWYA 1T0HA 2DL3A 4J9GA 2J6OA 2CT4A 2SEMA 3A98A 1FMKA 2DMOA 1GBRA 2EGEA 1GFCA 2EQIA 3CQTA 2ROTA 3O5ZA 3VS6A 2W10A 1M8MA 2CREA 2RQTA 2KGTA 2JS0A 1UG1A 5IXFA 2KR3A 2JMCA 2ABLA 1WIEA 3EGUA 4R0KA 1EFNA 1AWWA 2MOXA 3UATA 4LUEA 1UUEA 4CC7A 1FYNA 2A28A 2F2XA 2OI3A 3SHWA 2D8JA 1SRMA 1B3QA 2QDLA 2AZSA 2LNHB 1OOTA 2EPDA 2KEAA 2FO0A 2L3PA 5I22A 1M3CA 3TVTA 3THKA 4K11A 2DX1A 2YSQA 2CH4A 2GBQA 4RTVA 1RI9A 3NMZC 4CC4B 4OMMA 1K0SA 1ZX6A 1SEMA 1QLYA 4AFSC 1JU5C 4RTYA 1GCQC 4OMOA 1KFZA 3H41A 4AFZC 4GBQA 5FW9A 2KYMA 1LCKA 4LUDA 2KNBB 2OAWA 3UA6A 1A0NB 1OPKA 2CT3A 1K0XA 1VYTA 2J6KA 3M0SA 1NLOC 1GL5A 1WYXA 2YT6A 4ESRA 2LMJA 3SEMA 2IIMA 2KT1A 1MV3A 2DYBA 2YUPA 3U23A 1TUDA 2F2WA 2EYXA 2EYWA 2YUOA 1W6XA 3PVLA 3RBBB 1PKSA 1XOVA 1AZGB 3VS4A 3EG1A 1KSWA 2C0TA 2RQRA 2AZVA 2LJ3A 4OMNA 1GFDA 2XMFA 2BTTA 2DJQA 1NG2A 1VYUA 3GBQA 2LP5A 1X2KA 1B07A 2L3QA 3M0QA 3M0TA 1WXTA 2YDLA 3I9QA 1X6GA 2EBPA 1TG0A 3VS5A 5I11A 2PTKA 2EKHA 4RTZA 2JT4A 2GGRA 1PNJA 2EVRA 2KRMA 2FPFA 3ZL7C 2O9VA 5EC7A 3VS2A 3ULRB 3REAB 5L23A 2FPEA 4RTXA 1YWPA 2LJ1A 4J9BA 1NEBA 1AEYA 1T0JA 1GBQA 2DL7A 1V1CA 2CUDA 1RLPC 2ED1A 2A08A 2X3XD 1IO6A 1JXOA 5ECAA 2RN8A 2KRNA 1JO8A 1PRMC 1ZBJA 1UJYA 2DBMA 2NWMA 1JXMA 4QT7A 1UDLA 4OMPA 2RMOA 1T3SA 1HSQA 2DE0X 1RUWA 2BZXA 2F2VA 2LQNA 2PZ1A 1E7OA 1WXUA 3VRYA 2EYYA 2DNUA 3H0HA 4JPBW 1HJDA 1GRIA 3VS0A 2DVJA 4JJDA 1UFFA 2K9GA 2DM1A 2HSPA 2PNIA 2M51A 4RTWA 2B86A 2HDAA 1H92A 1WX6A 1X69A 2DLPA 1SRLA 4F16A 3LH5A 2YUQA 4E6RA 4CC2A 4RUGA 2EGAA 2DL8A 2GTOA 4AFUC 2BZ8A 4JJCA 1JEGA 2L3SA 5IHNA 1AWXA 2I0NA 1I07A 2J05A 1WI7A 1WA7A 1SHFA 1KJWA 4DEYA 2W0ZA 4CC3A 2D0NA 3UF4A 5IHIA 2KBTA 2LX7A 2KXCA 1ZUYA 5HCKA 2LCSA 1ZLMA 1BB9A 4J9DA 2HCKA 1WFWA 1ABOA 3R6NA 1ABQA 1QWEA 1X27A 3VS3A 4JZ4A 2J06A 1OEBA 2LQWA 1CSKA 1K4US 1JQQA 2EGCA 1S1NA 1M27C 3EHRA 1Z9QA 1Y57A 2RQWA 2KE9A 1YP5A 3EG0A 2EW3A 3C0CA 1RLQC 2JW4A 2GNCA 4IIOA 1GCPA 4D8DA 2O31A 2DBKA 4RTTA 1VA7A 5IH2A 5GJVB 3H0IA 1NYGA 4D8KA 2K3BA 1I0CA 2MIOA 1OV3A 2BZYA 2J6FA 3M0PA 2ENMA 2O2OA 3NGPA 4F14A 2O88A 3JV3A 4KRTA 2VVKA 5IXBA 4IIMA 2DL4A 2P4RA 1ZSGA 2ECZA 2DA9A 2K6DA 2NUZA 1I1JA 2L2PA 2KT8A 2A37A 1X6BA 2K79A 2M0YA 1PHTA 5FWCA 1QCFA 2V1RA 1HD3A 3QWXX 1QKWA 1T3LA 2AKLA 3EHQA 4HVVA 2RNAA 1E6HA 1UE9A 2FG0A 2KYBA 1K9AA 1H8KA 2ESWA 2FPDA 1PWTA 4A63B 4DEXA 2FRWA 2GTJA 2ED0A 1AZEA 3PVQA 3NPFA 2JTEA 4AG1C 2RQUA 3VS7A 1YWOA 3M0UA 1ZUUA 4LNPA 2LZ6B 1SPKA 4HVUA 4HCKA 4J9IA 3PE0A 1N5ZA 4ZNXA 1ARKA 1AOJA 4Z88A 1M30A 1Y0MA 1NLPC 2DILA 4EIKA 1K1ZA 3I5RA 2YUNA 3TSWA 2K7AA 1UJ0A 4J9CA 3NHNA 2JM8A 1PKTA 1AWJA 1UECA 1PRLC 2L0AA 1YN8A 2V1QA 2G6FX 2X3WD 2GQIA 1NEGA 1OPLA 4Z89A 2RQVA 1UGVA 1GCQA 2CSQA 1M3BA 3TSZA 4AG2C 2CH4W 2OJ2A 4OMQA 3KFVA 2SRCA 5GJWB 1CKBA 1AVZC 3VRZA 2AK5A 1G83A 2FEIA 2D1XA 2LJ0A 2VKNA 3I5SA
chains in the Genus database with same CATH superfamily
4Y92A 2LQ8A 2CGHA 2DRKA 4PK4A 2L5QA 1BCOA 5KE3A 2VASA 1M90R 3UT1A 1UHCA 2ROLA 4F17A 1FX7A 2CUBA 4QVCA 2ZPGB 2LCLA 2C0OA 1BYMA 1BBZA 2K2MA 3EFSA 3L1AA 2QDYB 1QCNA 1FXXA 3VU3C 1IREB 2HZYA 1ZUKA 3LWHA 3JB9H 2CDTA 3MP8A 1MUZA 1YJNT 1QKXA 3HHTB 4X9CA 1M1FA 4GLKA 4JRPA 1KD1C 2EJ9A 5GANe 3M0RA 4HVWA 4N4IA 1IB8A 4PFOA 1BU1A 1M9SA 4WF2A 4DOWA 5LJ5d 3CXCP 4B9XA 1TUCA 4M77A 3I35A 1YCSB 4J9EA 2X9HA 1X01A 4OMLA 3JCMX 2HBWA 2AIRB 3PFSA 1O75A 3X25B 1VQ9A 4EMGA 2L3RA 1KQSA 1WLPB 2FZCB 4M75A 4Z8AA 3FJ5A 5D6YA 1H3HA 1XTDA 3V7RA 1VQ6T 5IHKA 4M7DG 4J9HA 4VUBA 3MEVA 2BUDA 1KQ2A 5C6SA 3I56A 1BI3A 4LE9A 3MEWA 3WVDB 2PUKB 3IQLA 3BW1A 1C6VX 4M78C 1LOJA 4GLMA 4E2FB 3CD6T 2HQEA 2SEMA 1FMKA 1GBRA 2EGEA 4JDSA 2DK3A 2HQHA 2ZPIB 4NOYA 3G6ET 3CQTA 5CKBA 2HL3A 2R5MA 4XU2A 3VS6A 2W10A 2NUPB 1ZSZA 3OYEA 3G1JA 2JS0A 2XIDA 2K5LA 1KK7A 3E19A 2LQKA 4R0KA 1EFNA 3UATA 3CCLT 1UUEA 2PQWA 2MAMA 2RJDA 2OI3A 4M75B 4HT9A 5CIUA 2LNHB 1OOTA 2EPDA 2OTJT 2FO0A 4DBFA 3RERA 2L3PA 1W2BA 3THKA 3C12A 3CCST 1LVKA 1RI9A 4XU3A 2L8DA 3BDLA 1PC0A 2JN0A 3X20B 4RTYA 1RACB 3H41A 5KE2A 4GBQA 2KYMA 1LCKA 2KNBB 2OAWA 5M9OA 1OPKA 3I55A 4M78D 2J6KA 5FU7B 3M0SA 3HL8A 3FRNA 4NS5A 1VQ9Q 1NLOC 2RK2A 4M77E 3EGXB 3E9FA 4PJOC 5I2SA 2CZ1B 2LMJA 5CCAA 5KYYA 1VQ8A 4M75E 5A0DA 4ME7A 2DYBA 3GNFB 3I56Q 1BKBA 4Z02A 4BUGA 5GMKe 3MEUA 2EYWA 2YUOA 3SWNA 5KCOA 1XOVA 2K3XA 1M2VA 2KI7A 1AZGB 3VS4A 4RKUE 4C92F 3NTKA 4EMKC 1QVGA 4BDZA 1M2OA 2BTTA 2LP5A 1S72A 1X2KA 3EAEA 2ZPBB 2H3JA 3A8MB 2EBPA 4RG2A 1UB4A 3FDRA 2R57A 3HKSA 3FJPA 1PNJA 2FPFA 2DEQA 1D0XA 4BB7A 2CP6A 4C0GA 5CAIA 5GAMf 2O9VA 5KH6A 2JTMA 5EC7A 3VS2A 4OMFB 4F04B 4RTXA 2QQRA 1UGPB 2CS7A 1N9RA 2QI2A 1YWPA 1LJOA 4QVDA 2LJ1A 4J9BA 1MMNA 2EYQA 3META 3J81E 3V8KA 5DLOA 1GBQA 1V1CA 4PJOD 3TCJA 2VXEA 2COWA 1OYXA 5LJ5h 4FCYA 3CC4T 1FMVA 3CC2A 2X3XD 2PVGB 1JXOA 1KC8R 5ECAA 3OW2P 1VQ4T 2RN8A 1U1SA 2NWMA 1Q81C 4QT7A 2EIFA 4FW1A 2RMOA 1HSQA 3I55Q 1RUWA 2F2VA 2YRDA 2FL7A 3ZEHA 2P0PA 2KVQG 5FLXE 4FT4A 2EKOA 1YHQA 3QUIA 4BD3A 1Q82R 1JB0E 1GRIA 4JJDA 4BI8B 1JJ2P 1BI2A 3QZ9B 4F7UF 4KBMB 2HSPA 1QP2A 2PNIA 1ZA2B 1VQ8Q 2MPXC 4RTWA 4J6YA 2B86A 2HDAA 5C0MA 2DLPA 5HK0A 3LH5A 3CC7A 2E1HA 2YUQA 5GANh 1YIJT 1YJWA 2VB6A 3VUBA 2GTOA 3HSBA 1K8AR 4M7DC 4OGEA 1JEGA 3A8LB 2CP7A 2GFUA 1I07A 3M57A 1PCXA 1UGQB 2JZ2A 1VQ4Q 1TH7A 1SF9A 4J6WA 1D1CA 4BY6C 2M1HA 4V2SA 1ABOA 1ABQA 1QWEA 3O8VA 2RI5A 2XG8D 2QASA 3G4ST 3UPUA 1OEBA 1WJRA 1LPLA 4PLIA 5LJ3h 1YI2A 1JQQA 2EGCA 2EJGA 4KUIA 5CO7A 5GMKi 1M1KC 1G3TA 3EHRA 1NPPA 3CXCA 3OS5A 4FW2A 1W4SA 4HA8A 1XQHA 1YP5A 2X51A 1F1BB 1V76A 4C92B 1YIJQ 1M1GA 2JW4A 4J7FA 3X24B 2GNCA 2YLBA 3M53A 2QA4A 3V7SA 1GCPA 3CMAA 1U8RA 3CC2Q 3MJXA 1OULA 3C95A 3CBOA 2LCCA 5CKHA 5LJ5j 5IAYA 3OYHA 1OV3A 4M7DD 3RESA 3OB9A 2M9UA 2XDBA 4JUVA 2O2OA 4F14A 3JV3A 1YHQQ 4IIMA 3F70A 2P4RA 4M78A 4C5HA 4C92G 2LNVA 2K6DA 3M9QA 2A37A 8ATCB 3HFNA 2E6NA 2V1RA 5GMKl 2HL5C 1T3LA 4FU6A 1RAAB 1RAIB 1H8KA 4C92E 1VQMT 1NJIR 2E64A 4FIBA 4A63B 4EDUA 4ZGEB 3CCRT 4IKFA 3MP1A 5D7UA 3NPFA 2RJCA 3URGA 3OYCA 5GAOr 2CZ0B 4JLGA 3DKMA 3QSUA 4J9IA 1ARKA 1Y0MA 2RHIA 5GAMd 4C0FA 5EG2A 3I5RA 2YUNA 3TSWA 4F7UB 1UJ0A 4J9CA 2JM8A 1SG5A 2QEXT 3JCMW 3DB3A 3JCMg 1YI2Q 1PRLC 2L0AA 1YN8A 6AT1B 2X3WD 1W2BP 2CH4W 5LJ3j 4OMQA 2YRVA 1CKBA 4KT0E 1VQLA 2D1XA 4C0DC 2QA4Q 2HEQA 4JZ3A 2E5KA 3CCMT 1VQMQ 5KCHA 1NZ9A 1TXQA 1VQNA 2DZ9A 3PIPA 1W70A 3OMCA 2JS2A 4PJOA 2JUFA 5IT9E 2LX9A 2DPPB 1PG5B 2YXYA 2AKKA 4RCCA 2FRYA 2JMAA 1KIKA 4A54A 3SDZA 2M16A 5D6XA 5KYWA 1U06A 4NL3A 1WJSA 2H8HA 4FSSA 4KGVB 4C8QC 5KYXB 1G2BA 1SHGA 4F7UE 1U3OA 4MMLA 1VQKT 1AD5A 2CP2A 2VUBA 1M90C 1X43A 4EMKA 2KQWA 4M78E 4ORZA 2O4XA 3VJPA 4A4KA 4HXJA 4AFQC 2LT1A 4X1VA 4XTZA 4PFPA 2Y4YA 4J9FA 3RNJA 4A4EA 3VS1A 2D6FA 1RAEB 5KYUB 4QQGA 1M1KU 2KRSA 1K76A 1M4ZA 2KMTA 3L2ZA 5GAN8 2WSEE 3S3MA 3G71T 2OX7A 2CKKA 2JNGA 1UHFA 3EG2A 4PJNA 2GF7A 2V8JA 4RG8A 1BIBA 5CKEA 2D8HA 4WCIA 2J6OA 2CT4A 4EMKB 5CQYA 4C8QD 3HTRA 4M77F 2GQVA 2O4XB 1M8MA 2CREA 1VQLQ 3CCVA 2KGTA 1UG1A 3EGDA 2KR3A 3EFOA 2JMCA 2ABLA 1WIEA 1VQNQ 2YWWA 2KY9A 2OTLA 2LVMA 1JJ2A 3OYNA 5CKDA 2AT1B 3PGGA 4CC7A 3FIFA 1C1AA 3CCEA 3SHWA 2RHZA 4LDUA 1Y07A 5J3BA 2M0OA 4PJOE 2AZSA 2HKQB 1WHMA 2LDMA 5LJ5e 2VGMA 2IPOB 4XTUA 3OSSC 5I22A 3TVTA 1Y96B 4K11A 4M7DA 1N27A 3NMZC 4CC4B 3S6WA 2JOYA 3S3OA 4M7AC 2ZGWA 1GCQC 2WACA 2K2VA 4ATOA 2EQJA 4AFZC 5FW9A 1WHKA 3VUZA 2CZ7B 4X9DA 1K9MU 3PT9A 3ASKA 1GL5A 3LGFA 4ESRA 2DXUA 2ZPFB 1WJQA 5GAMh 2FVUA 1NE8A 5J39A 3CCUA 1KHCA 2KT1A 2YUPA 1PD1A 2DO3A 3QYHB 2B8AA 2HAXA 2EAYA 2F2WA 5GANg 2EYXA 2QQSA 3PVLA 4QQ6A 3JB9G 4WTOB 5HY6A 1R0CB 1B34A 4JLIA 2KSSA 1KSWA 3EG9B 3L2UA 2AZVA 3OYKA 1OQKA 2K5FA 3OBYA 1GFDA 2DJQA 1NG2A 3GBQA 2QAZA 1MMAA 3M0TA 3M0QA 1B07A 3MEAA 1WXTA 3CD6A 3GNGA 2DD4A 3OS2A 2QGFB 1X6GA 5LJ3e 4LDWA 3CCVQ 3CEYA 5J26A 3VS5A 4RTZA 2JT4A 4M7AD 4II1A 2BKDN 2OTLQ 3RUXA 3ZL7C 1Q95G 5LJ3g 3ULRB 1VIFA 1M90U 3CCEQ 2ATCB 1HXDA 2ZCFB 1WQ7A 2MWOA 1T0JA 2DL7A 4P5NA 3LYIA 2I2LA 1AT1B 2CUDA 2A08A 2QQBA 3ZBDA 4M77B 1VQ9T 1B34B 2GFAA 5GAN6 1UDLA 4UC4A 1TUGB 3OYDA 3UWNA 2PZ1A 1D0ZA 4Q5WA 1WXUA 2EYYA 4BACA 2VGNA 3GOXA 1IRXA 3I56T 1VQ5A 4QKUA 1OI1A 4JPBW 2A7YA 4ZGDB 1MNDA 3VS0A 5I21A 2RHUA 4O6JA 5GAOp 1UGRB 2QK0A 3JCMV 3CCUQ 2COYA 2ZPHB 5IN1A 1QVFP 1H92A 4KGZB 4M77G 1SRLA 5GAMj 4E6RA 4CC2A 3OYLA 2EGAA 3JCMb 3CCQA 2FB7A 4M75G 1Q82C 1SHFA 3QDFA 1ZSZB 4CC3A 4DEYA 2D0NA 4A4FA 4A4GA 2KBTA 1D0YA 5HCKA 1ZLMA 1KD1R 4J9DA 2RA2A 1WFWA 4ZN3A 3C94A 1WHLA 3L2QA 3KBGA 4HT8A 4JZ4A 4C8QA 2J06A 1K8AC 3M56A 2LQWA 1CSKA 2XU8A 1K4US 1S1NA 1M27C 7AT1B 2QTXA 4JRKA 8AT1B 2KAFA 1I4K1 2MYSA 1Y57A 2RQWA 2D0QB 4DBHA 2EW3A 4FYVB 3X26B 2P84A 2CP3A 4D8DA 3I55T 3CPWP 1IGUA 4J83A 2DBKA 2BIVA 5GJVB 1NYGA 3HPWA 2RHYA 4D8KA 4DA4A 3E9GA 2ZAEA 4LD6A 4JRIA 4E7ZA 2DZCA 3FC3A 1VQ7A 2Y4XA 2MIOA 3D7SB 1G5VA 3QKJA 3V7CA 2MK5A 3HRUA 3CMEA 3CCJA 1C0MA 1QCOA 1VQ8T 3NGPA 2IVWA 5KYYB 3OW2S 2MF2A 2VVKA 1VQ5Q 1ZSGA 3VYGA 4PFZA 2NUZA 2L2PA 4OVAA 4QQDA 2M0YA 1DJ7B 1PHTA 5FWCA 3SWNB 1HD3A 4J7IA 1M2VB 4MDWA 1QKWA 2AKLA 2YHTA 3TREA 4XTXA 2RNAA 1E6HA 1K9AA 3QO3A 1VQOA 2HD0A 3QDRB 1S72T 3S3NA 1YJ9A 4BE0A 3CCQQ 2NLUA 2DXBA 1WNLA 5DM7R 4DEXA 2FRWA 1IZ6A 2WSCE 5FU6C 1Q7YR 2JTEA 3VS7A 1YWOA 3M0UA 3AHUA 4LNPA 2LZ6B 3PE0A 3ZFJA 4IURA 1NLPC 1D3BA 3OSVA 1NJIC 4M78F 3L2WA 2PUOB 1AWJA 2L89A 4CRIA 3OYAA 3JRZA 3G4SA 4C8QE 2GQIA 4ZTJA 4M7AA 2HMAA 1UGVA 3CC2T 1GCQA 2CSQA 1M3BA 4E7HA 3JCMf 2F5TX 3PMIA 1AVZC 2AK5A 3LLRA 2LJ0A 1S72Q 3EG3A 1VYVA 3TU4K 2VWFA 2CZ6B 2MCNA 4RTUA 1N9SA 3QXEB 1YHQT 1KC8U 2EQUA 3RKYA 3N5BB 4M4ZA 1NYFA 2DRMA 1U5SA 2X4XA 4J6XA 1BK2A 3UA7A 3CCJQ 1E6GA 2J7IA 3MCAB 4LDYA 1NM7A 2QTVA 1YJWT 3OYGA 3HRSA 4E7IA 1ZHIA 2HSEB 1RI0A 1Q82U 3JB9D 1KQSS 1FWZA 1SSHA 2E12A 2EYZA 4YTLA 1NPRA 3H0FA 2DVEA 2DL5A 3RKWA 4KGXB 4HCZA 1WDXA 1VQOQ 5GAMe 1QMCA 1YJ9Q 2X4WA 2E5QA 3NFCA 2KK4A 3M4GA 2FZKB 4BE2A 2XI9A 1K8AU 4PJOF 4FL6A 3KXTA 1W1FA 5GAMg 1TU0B 2RPNA 4E7KA 1YI2T 2C0IA 1GXIE 2JXBA 4FM4B 3PIOA 1PSFA 1MHNA 1MMGA 1BIAA 4PJLA 3E1SA 4LN2A 4ZTFA 3RMSA 3OYJA 4TVRA 3CC7Q 1YJWQ 1WGSA 3QWYA 2QA4T 3BFMA 1T0HA 2DL3A 4J9GA 3CMAT 2X4JA 3A98A 3QIIA 1GFCA 5CVIA 2ROTA 3O5ZA 4O5VA 2EQMA 4M7AE 2RQTA 3ME9A 1K9MC 4XTYA 3EGUA 1WHJA 2MOXA 5GAOm 4LUEA 3A8OB 1W2BS 5FU7C 2KDSA 3H9NA 2F2XA 2XDPA 2D8JA 2DFUA 3OY9A 1QVFA 1SRMA 1HYOA 1OZ3A 4M78B 1WZOA 2KEAA 1N8RR 1VOMA 1PM3A 5GAN4 2R58A 4XTVA 3BDUA 1ZA1B 2FHDA 4N0AC 2JJ9A 2EWNA 4A4HA 2DX1A 2YSQA 2CH4A 1YCYA 2COZA 2E6ZA 3QHSA 2DTOA 3QYGB 1SEMA 1N6AA 4BI4A 1JU5C 3CMAQ 4OMOA 4M75D 1UEBA 3HRTA 4LUDA 4KULA 3UA6A 1A0NB 4N4HA 4F7UG 1K0XA 3JCMJ 4QW2A 4ZGJB 1U1TA 1WYXA 2YT6A 4M78G 1NJIU 3EH1A 3P8BB 3SEMA 2HBPA 2PVOB 1AHJB 4OGCA 1QVGS 1LNXA 3LWIA 3J7AF 4L6V5 3OQ5A 1I8FA 1Q86R 3CPWA 1K73R 3RBBB 1YITA 1WHGA 3P8DA 3VKIA 3JCMd 4M7DF 2DEUA 1VQLT 2RQRA 4OMNA 4FYYB 1VQNT 5KYNA 1N8RU 1VYUA 1QVPA 2F69A 2RI2A 2CP5A 4GY5A 3I9QA 4PJOB 5I2MA 4X34A 4JS4A 5I11A 2PTKA 4OB1B 2EVRA 1VQPA 2IG0A 3V8LA 5LL6S 1M8VA 1TTHB 3REAB 5KYWB 3G7ZA 4AMCA 2FPEA 4ELYC 3R6OA 2GCXA 3LGLA 3A8GB 5CKFA 2DAQA 4J8OA 3CBMA 4IUPA 4PKCC 4C5GA 3A1PA 2DXCA 4BI3A 1H3ZA 2XHCA 3EFRA 2QG9B 4PJOG 3LH0A 2K57A 2ZPEB 1P92A 2DE0X 4ZN1A 4KH0B 2BZXA 1Q86U 4L59A 3JAME 3OYFA 3RDVA 3VRYA 2DNUA 3OS0A 3RMQA 3QZ5B 1HJDA 2DVJA 3KUFA 3OYIA 2K5IA 2PU9B 5LJ5g 2XDDA 1YJNA 1IHVA 1X69A 4B6MA 3L2VA 1QQJA 1OU9A 1X75C 4LXCA 4PJMA 4RUGA 2LC4A 1IGQA 2DL8A 1XJWB 2BZ8A 3GF5A 4JJCA 1YITQ 1RABB 5IHNA 4C92C 1AWXA 2J05A 3RIRA 3CCVT 1WI7A 4Y91A 4D6WA 1KJWA 2DJZA 5A0LA 3EGDB 2OTLT 3EFOB 1BB9A 3CXCS 2HCKA 3CCET 2DERA 1OU8A 3MPUB 5AT1B 1VQPQ 1VQ6A 3WXMB 3OYBA 2HKNA 3JSCA 2V8IA 2KE9A 3M4YA 4M7DB 1Y71A 4BE1A 1JRIA 1RLQC 2VC8A 4J5YA 2RO0A 4IIOA 2RJEA 2DTIA 5GAOl 1KHIA 2NUPA 3G6EA 3A8HB 3P8HA 4BY6B 4XAXB 5IH2A 3OBWA 4CI0C 3ER0A 4BDYA 3HFOA 2BZYA 5D6WA 3CCUT 3CCLA 3Q1JA 4C92D 1UGSB 2O88A 2E65A 1HK9A 4C8QF 1V29B 1FMWA 2ECZA 2JVVA 2P4TA 2DA9A 2DIQA 1I5LA 5CK9A 1I1JA 2OTJA 2Y90A 4PLLA 2K79A 1QCFA 4E7LA 1YJNQ 1G8XA 2C06A 3JCMh 2AHJB 3LX7A 4L5GA 3CCSA 3TEEA 1H641 2FG0A 4M7DE 5GANd 2RK1A 4IUVA 2ESWA 1PWTA 5GAOn 2DXTA 3PVQA 1QVFS 2RQUA 4MZMA 1ACMB 1G3YA 5DY9A 3EGXA 1JBMA 4ZNXA 1KC8C 1PSEA 4HCCA 4N4GA 4EIKA 1K1ZA 2K7AA 1MMDA 3QPHA 4MZPA 3NHNA 4IUUA 1VQ6Q 4N0AA 5AYFA 3QG1A 4C5EA 1TSFA 3JCMP 1UECA 5LJ3d 3SB2A 2G6FX 1Q7YC 3DLLA 2FZGB 4Z89A 2MWPA 3LW5E 1OZ2A 4DBQA 3KFVA 5GJWB 1G83A 4OB0B 5FRNA 1QW1A 3CD6Q 1X6OA 3MKDA 2O01E 3X28B 3G6EQ 1M3AA 5GMKm 4JJBA 1VQ5T 4NL2A 3A5ZB 1EIFA 1VUBA 2R5AA 3NTIA 2KROA 3QJYA 3CPWS 2RB6A 3CCLQ 3GIBA 1AWOA 1RAFB 2X4YA 2A36A 1QWFA 5FRMA 2A0FB 5DLQE 1R0BG 2JM9A 3MHXA 1Y7XA 3OYMA 2MI6A 2OTJQ 5FWBA 2E41A 2CSIA 1MNEA 3CCQT 2O9SA 4M7AF 2QQ9A 4C0DB 4ANJA 1NBEB 2NYSA 3TQ7P 3MP6A 2E10A 1J3TA 3CC4A 1PD0A 3EH2A 3REBB 3CCSQ 4OB2B 1YNZA 4HKEA 1UTIA 4R56A 2M02A 1CKAA 1VQ4A 4OB3B 1BI0A 2EJFA 5GAN7 2KXDA 3DLMA 3H6ZA 2OAUA 4PJJA 3FEOA 2YLCA 2RF0A 2ZZDA 4E47A 1G3WA 1WXBA 4C8QB 1MV0B 4JRQA 1Z9ZA 1KD1U 3M54A 1R8OB 4XU0A 2E3IA 2DIGA 3L42A 4C0ZA 2NUTA 3NTHA 3BY7A 1X2QA 5L8RE 2DF6A 3VV0A 1YBYA 3J80E 2P0KA 1BI1A 1JJ2S 1YIJA 1SSFA 1R77A 2QYZA 2DMOA 4JJNK 2EQIA 4B9WA 3SFMA 5FROA 5IXFA 1VQ7T 4C8QG 1RL2A 2PVDB 1AWWA 3CMET 3CCJT 2RHXA 1FYNA 2A28A 3GLXA 1WQWA 3CBPA 3QJ6A 3GPLA 1B3QA 4C5IA 4FT2A 2QDLA 3INZA 2EQKA 2RI3A 1BCMA 3GP8A 3HP9A 4DOVA 1M3CA 2E3HA 4RTVA 2GBQA 1O9SA 4KUDK 4C92A 2NUTB 1VQOT 4OMMA 1K0SA 3M55A 1ZX6A 1YJ9T 2XICA 1QLYA 4AFSC 1OX8A 2LT4A 2LRQA 1KFZA 1XNIA 4IUTA 2EFIA 3CC4Q 2CT3A 1N8RC 1VYTA 3PNWC 3VYHB 1VQ7Q 4E7SA 3CMEQ 1D09B 2IIMA 1WHHA 1D3BB 3CC7T 1Q7YU 1MV3A 2XD0A 2VYTA 1SKUB 3U23A 1TWBA 1TUDA 2FYKA 4PNOA 3PMTA 3QBYA 1QP3A 4M7AB 2E70A 1W6XA 2V26A 4RCBA 3L2RA 1PKSA 3JB9I 1ZBXA 4E7JA 3EG1A 2C0TA 4XTWA 3OYYA 2LJ3A 5HKCA 2XMFA 2BE7D 4AT1B 3OMGA 4M77C 4LDVA 2L3QA 1VQMA 2YDLA 2Z0WA 1TG0A 3C4SA 2RJFA 3CCRA 1Q86C 4R55A 2EKHA 2GGRA 1K73C 2KRMA 2CYZB 4M75C 1MGQA 1KQSP 5L23A 4F7UA 1Q81R 4M7AG 4XK8E 1NEBA 4A53A 4ELZC 3G4SQ 5GAN5 1AEYA 2QEXA 3BE3A 2WSFE 5GAN3 3OS1A 1RLPC 2ED1A 3RR6A 1IO6A 1I81A 4MMKA 2KRNA 1JO8A 1PRMC 1ZBJA 1UJYA 2DBMA 5A2QE 1JXMA 4OMPA 1T3SA 3M5AA 4HCBA 3CCMA 1ZSZC 4DBRA 3UDCA 2LQNA 5A0GA 1E7OA 4LD9K 2K3YA 3WVEB 5GANj 2HNIA 1ZQ1A 3H0HA 2CP0A 1RAGB 4EPCA 4EMHA 2QGGA 4M77D 3JCMe 3PTAA 1UFFA 2K9GA 2DM1A 5KYXA 2M51A 3CPFA 2P0QA 4DQ2A 4XU1A 1WX6A 2VXFA 4LDXA 2F1LA 4F16A 1VQKA 4QVZA 5LJ5f 2V8KA 4AFUC 1EX4A 2L3SA 5HK3A 2G3RA 2QQAA 2I0NA 1Q81U 1M1KR 1WA7A 5GMKh 1M5Q1 2RH2A 3FLGA 2W0ZA 3UF4A 3OA6A 1KG1A 5IHIA 9ATCB 2LX7A 2KXCA 1ZUYA 2LCSA 2XKOC 3RKXA 3JB9F 5KYUA 3R6NA 1OX9A 3M59A 2E4HA 2DETA 3CCRQ 3MO8A 1IXDA 1X27A 3VS3A 4XQ3A 2LTOA 4KH1B 2DKGA 2D9TA 2H3EB 3G71A 1Z9QA 2DD5A 2RM4A 4PL6A 4FYXB 3EG0A 5GANf 2A3LA 3V8JA 2K4YA 3C0CA 2QEXQ 1KQ1A 3SWNC 2O31A 5CR2A 2VV5A 4FYWB 4RTTA 1VA7A 3H0IA 1QVGP 4RMOA 2K3BA 1I0CA 2MMPA 3CCMQ 1WPYA 2F5KA 2DYIA 2J6FA 3M0PA 1RAHB 2ENMA 1G3SA 2X35A 4KRTA 3JCMQ 5IXBA 3SD4A 2DL4A 5LJ3f 5GAOq 4OF1A 4OP0A 2KT8A 1YITT 1RADB 1X6BA 4MDXA 1Y96A 3FB9A 1TS9A 3JCMc 1I5OB 1K9MR 3QWXX 2JTFA 5GAN2 3EHQA 4HVVA 3OW2A 1UE9A 1VQKQ 2KYBA 3M58A 1IHWA 2RD1A 2FPDA 1TOVA 1K73U 4JS5A 2HQXA 2GTJA 2ED0A 4MZTA 1AZEA 4AG1C 2YRCA 1VQPT 1ZUUA 1SPKA 4HVUA 4HCKA 1N5ZA 2QXFA 1AOJA 4IUQA 4Z88A 1M30A 5GMKj 2BE9B 2DILA 4M75F 4Y28E 3AT1B 1PKTA 2DTHA 1D1AA 1B7TA 2V1QA 1VIEA 3JB9J 3H8ZA 3G71Q 1D1BA 1NEGA 1OPLA 4FSXA 2RQVA 1EZZB 3TSZA 1YFNA 4AG2C 2OJ2A 2XK0A 2SRCA 3EG9A 3T9NA 3VRZA 2FEIA 2VKNA 3DB4A 3I5SA 5FU6B 3E2UA 5CQXA
chains in the Genus database with same CATH topology
3EG3A 2HEQA 4JZ3A 2E5KA 4Y92A 2DRKA 1VYVA 2VWFA 1W70A 2JS2A 2MCNA 4RTUA 1M3AA 1UHCA 2ROLA 4JJBA 4F17A 2CUBA 2AKKA 4M4ZA 2FRYA 2C0OA 2JMAA 1KIKA 1NYFA 2DRMA 1BBZA 2K2MA 1U5SA 1BK2A 1ZUKA 2KROA 3UA7A 1U06A 1AWOA 1E6GA 2J7IA 2CDTA 1MUZA 2A36A 1QKXA 1QWFA 2H8HA 4FSSA 1NM7A 1G2BA 1SHGA 2JM9A 1U3OA 3M0RA 4HVWA 1AD5A 1BU1A 1X43A 5FWBA 2EYZA 1SSHA 2CSIA 2O9SA 3H0FA 4ORZA 1TUCA 2DL5A 1YCSB 3I35A 4HXJA 4J9EA 4OMLA 4AFQC 2HBWA 4X1VA 1J3TA 3REBB 1WDXA 1YNZA 4J9FA 1UTIA 1CKAA 3RNJA 2KXDA 3VS1A 1WLPB 4Z8AA 3FJ5A 1W1FA 2RF0A 1H3HA 2KRSA 2RPNA 5IHKA 1WXBA 1K76A 4J9HA 1MV0B 2C0IA 1Z9ZA 4LE9A 2JXBA 1UHFA 3IQLA 3EG2A 4LN2A 1X2QA 2D8HA 4WCIA 2DF6A 4GLMA 3QWYA 1T0HA 2DL3A 4J9GA 2J6OA 2CT4A 2SEMA 3A98A 1FMKA 2DMOA 1GBRA 2EGEA 1GFCA 2EQIA 3CQTA 2ROTA 3O5ZA 3VS6A 2W10A 1M8MA 2CREA 2RQTA 2KGTA 2JS0A 1UG1A 5IXFA 2KR3A 2JMCA 2ABLA 1WIEA 3EGUA 4R0KA 1EFNA 1AWWA 2MOXA 3UATA 4LUEA 1UUEA 4CC7A 1FYNA 2A28A 2F2XA 2OI3A 3SHWA 2D8JA 1SRMA 1B3QA 2QDLA 2AZSA 2LNHB 1OOTA 2EPDA 2KEAA 2FO0A 2L3PA 5I22A 1M3CA 3TVTA 3THKA 4K11A 2DX1A 2YSQA 2CH4A 2GBQA 4RTVA 1RI9A 3NMZC 4CC4B 4OMMA 1K0SA 1ZX6A 1SEMA 1QLYA 4AFSC 1JU5C 4RTYA 1GCQC 4OMOA 1KFZA 3H41A 4AFZC 4GBQA 5FW9A 2KYMA 1LCKA 4LUDA 2KNBB 2OAWA 3UA6A 1A0NB 1OPKA 2CT3A 1K0XA 1VYTA 2J6KA 3M0SA 1NLOC 1GL5A 1WYXA 2YT6A 4ESRA 2LMJA 3SEMA 2IIMA 2KT1A 1MV3A 2DYBA 2YUPA 3U23A 1TUDA 2F2WA 2EYXA 2EYWA 2YUOA 1W6XA 3PVLA 3RBBB 1PKSA 1XOVA 1AZGB 3VS4A 3EG1A 1KSWA 2C0TA 2RQRA 2AZVA 2LJ3A 4OMNA 1GFDA 2XMFA 2BTTA 2DJQA 1NG2A 1VYUA 3GBQA 2LP5A 1X2KA 1B07A 2L3QA 3M0QA 3M0TA 1WXTA 2YDLA 3I9QA 1X6GA 2EBPA 1TG0A 3VS5A 5I11A 2PTKA 2EKHA 4RTZA 2JT4A 2GGRA 1PNJA 2EVRA 2KRMA 2FPFA 3ZL7C 2O9VA 5EC7A 3VS2A 3ULRB 3REAB 5L23A 2FPEA 4RTXA 1YWPA 2LJ1A 4J9BA 1NEBA 1AEYA 1T0JA 1GBQA 2DL7A 1V1CA 2CUDA 1RLPC 2ED1A 2A08A 2X3XD 1IO6A 1JXOA 5ECAA 2RN8A 2KRNA 1JO8A 1PRMC 1ZBJA 1UJYA 2DBMA 2NWMA 1JXMA 4QT7A 1UDLA 4OMPA 2RMOA 1T3SA 1HSQA 2DE0X 1RUWA 2BZXA 2F2VA 2LQNA 2PZ1A 1E7OA 1WXUA 3VRYA 2EYYA 2DNUA 3H0HA 4JPBW 1HJDA 1GRIA 3VS0A 2DVJA 4JJDA 1UFFA 2K9GA 2DM1A 2HSPA 2PNIA 2M51A 4RTWA 2B86A 2HDAA 1H92A 1WX6A 1X69A 2DLPA 1SRLA 4F16A 3LH5A 2YUQA 4E6RA 4CC2A 4RUGA 2EGAA 2DL8A 2GTOA 4AFUC 2BZ8A 4JJCA 1JEGA 2L3SA 5IHNA 1AWXA 2I0NA 1I07A 2J05A 1WI7A 1WA7A 1SHFA 1KJWA 4DEYA 2W0ZA 4CC3A 2D0NA 3UF4A 5IHIA 2KBTA 2LX7A 2KXCA 1ZUYA 5HCKA 2LCSA 1ZLMA 1BB9A 4J9DA 2HCKA 1WFWA 1ABOA 3R6NA 1ABQA 1QWEA 1X27A 3VS3A 4JZ4A 2J06A 1OEBA 2LQWA 1CSKA 1K4US 1JQQA 2EGCA 1S1NA 1M27C 3EHRA 1Z9QA 1Y57A 2RQWA 2KE9A 1YP5A 3EG0A 2EW3A 3C0CA 1RLQC 2JW4A 2GNCA 4IIOA 1GCPA 4D8DA 2O31A 2DBKA 4RTTA 1VA7A 5IH2A 5GJVB 3H0IA 1NYGA 4D8KA 2K3BA 1I0CA 2MIOA 1OV3A 2BZYA 2J6FA 3M0PA 2ENMA 2O2OA 3NGPA 4F14A 2O88A 3JV3A 4KRTA 2VVKA 5IXBA 4IIMA 2DL4A 2P4RA 1ZSGA 2ECZA 2DA9A 2K6DA 2NUZA 1I1JA 2L2PA 2KT8A 2A37A 1X6BA 2K79A 2M0YA 1PHTA 5FWCA 1QCFA 2V1RA 1HD3A 3QWXX 1QKWA 1T3LA 2AKLA 3EHQA 4HVVA 2RNAA 1E6HA 1UE9A 2FG0A 2KYBA 1K9AA 1H8KA 2ESWA 2FPDA 1PWTA 4A63B 4DEXA 2FRWA 2GTJA 2ED0A 1AZEA 3PVQA 3NPFA 2JTEA 4AG1C 2RQUA 3VS7A 1YWOA 3M0UA 1ZUUA 4LNPA 2LZ6B 1SPKA 4HVUA 4HCKA 4J9IA 3PE0A 1N5ZA 4ZNXA 1ARKA 1AOJA 4Z88A 1M30A 1Y0MA 1NLPC 2DILA 4EIKA 1K1ZA 3I5RA 2YUNA 3TSWA 2K7AA 1UJ0A 4J9CA 3NHNA 2JM8A 1PKTA 1AWJA 1UECA 1PRLC 2L0AA 1YN8A 2V1QA 2G6FX 2X3WD 2GQIA 1NEGA 1OPLA 4Z89A 2RQVA 1UGVA 1GCQA 2CSQA 1M3BA 3TSZA 4AG2C 2CH4W 2OJ2A 4OMQA 3KFVA 2SRCA 5GJWB 1CKBA 1AVZC 3VRZA 2AK5A 1G83A 2FEIA 2D1XA 2LJ0A 2VKNA 3I5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG3 A;  2HEQ A;  4JZ3 A;  2E5K A;  4Y92 A;  2DRK A;  1VYV A;  2VWF A;  1W70 A;  2JS2 A;  2MCN A;  4RTU A;  1M3A A;  1UHC A;  2ROL A;  4JJB A;  4F17 A;  2CUB A;  2AKK A;  4M4Z A;  2FRY A;  2C0O A;  2JMA A;  1KIK A;  1NYF A;  2DRM A;  1BBZ A;  2K2M A;  1U5S A;  1BK2 A;  1ZUK A;  2KRO A;  3UA7 A;  1U06 A;  1AWO A;  1E6G A;  2J7I A;  2CDT A;  1MUZ A;  2A36 A;  1QKX A;  1QWF A;  2H8H A;  4FSS A;  1NM7 A;  1G2B A;  1SHG A;  2JM9 A;  1U3O A;  3M0R A;  4HVW A;  1AD5 A;  1BU1 A;  1X43 A;  5FWB A;  2EYZ A;  1SSH A;  2CSI A;  2O9S A;  3H0F A;  4ORZ A;  1TUC A;  2DL5 A;  1YCS B;  3I35 A;  4HXJ A;  4J9E A;  4OML A;  4AFQ C;  2HBW A;  4X1V A;  1J3T A;  3REB B;  1WDX A;  1YNZ A;  4J9F A;  1UTI A;  1CKA A;  3RNJ A;  2KXD A;  3VS1 A;  1WLP B;  4Z8A A;  3FJ5 A;  1W1F A;  2RF0 A;  1H3H A;  2KRS A;  2RPN A;  5IHK A;  1WXB A;  1K76 A;  4J9H A;  1MV0 B;  2C0I A;  1Z9Z A;  4LE9 A;  2JXB A;  1UHF A;  3IQL A;  3EG2 A;  4LN2 A;  1X2Q A;  2D8H A;  4WCI A;  2DF6 A;  4GLM A;  3QWY A;  1T0H A;  2DL3 A;  4J9G A;  2J6O A;  2CT4 A;  2SEM A;  3A98 A;  1FMK A;  2DMO A;  1GBR A;  2EGE A;  1GFC A;  2EQI A;  3CQT A;  2ROT A;  3O5Z A;  3VS6 A;  2W10 A;  1M8M A;  2CRE A;  2RQT A;  2KGT A;  2JS0 A;  1UG1 A;  5IXF A;  2KR3 A;  2JMC A;  2ABL A;  1WIE A;  3EGU A;  4R0K A;  1EFN A;  1AWW A;  2MOX A;  3UAT A;  4LUE A;  1UUE A;  4CC7 A;  1FYN A;  2A28 A;  2F2X A;  2OI3 A;  3SHW A;  2D8J A;  1SRM A;  1B3Q A;  2QDL A;  2AZS A;  2LNH B;  1OOT A;  2EPD A;  2KEA A;  2FO0 A;  2L3P A;  5I22 A;  1M3C A;  3TVT A;  3THK A;  4K11 A;  2DX1 A;  2YSQ A;  2CH4 A;  2GBQ A;  4RTV A;  1RI9 A;  3NMZ C;  4CC4 B;  4OMM A;  1K0S A;  1ZX6 A;  1SEM A;  1QLY A;  4AFS C;  1JU5 C;  4RTY A;  1GCQ C;  4OMO A;  1KFZ A;  3H41 A;  4AFZ C;  4GBQ A;  5FW9 A;  2KYM A;  1LCK A;  4LUD A;  2KNB B;  2OAW A;  3UA6 A;  1A0N B;  1OPK A;  2CT3 A;  1K0X A;  1VYT A;  2J6K A;  3M0S A;  1NLO C;  1GL5 A;  1WYX A;  2YT6 A;  4ESR A;  2LMJ A;  3SEM A;  2IIM A;  2KT1 A;  1MV3 A;  2DYB A;  2YUP A;  3U23 A;  1TUD A;  2F2W A;  2EYX A;  2EYW A;  2YUO A;  1W6X A;  3PVL A;  3RBB B;  1PKS A;  1XOV A;  1AZG B;  3VS4 A;  3EG1 A;  1KSW A;  2C0T A;  2RQR A;  2AZV A;  2LJ3 A;  4OMN A;  1GFD A;  2XMF A;  2BTT A;  2DJQ A;  1NG2 A;  1VYU A;  3GBQ A;  2LP5 A;  1X2K A;  1B07 A;  2L3Q A;  3M0Q A;  3M0T A;  1WXT A;  2YDL A;  3I9Q A;  1X6G A;  2EBP A;  1TG0 A;  3VS5 A;  5I11 A;  2PTK A;  2EKH A;  4RTZ A;  2JT4 A;  2GGR A;  1PNJ A;  2EVR A;  2KRM A;  2FPF A;  3ZL7 C;  2O9V A;  5EC7 A;  3VS2 A;  3ULR B;  3REA B;  5L23 A;  2FPE A;  4RTX A;  1YWP A;  2LJ1 A;  4J9B A;  1NEB A;  1AEY A;  1T0J A;  1GBQ A;  2DL7 A;  1V1C A;  2CUD A;  1RLP C;  2ED1 A;  2A08 A;  2X3X D;  1IO6 A;  1JXO A;  5ECA A;  2RN8 A;  2KRN A;  1JO8 A;  1PRM C;  1ZBJ A;  1UJY A;  2DBM A;  2NWM A;  1JXM A;  4QT7 A;  1UDL A;  4OMP A;  2RMO A;  1T3S A;  1HSQ A;  2DE0 X;  1RUW A;  2BZX A;  2F2V A;  2LQN A;  2PZ1 A;  1E7O A;  1WXU A;  3VRY A;  2EYY A;  2DNU A;  3H0H A;  4JPB W;  1HJD A;  1GRI A;  3VS0 A;  2DVJ A;  4JJD A;  1UFF A;  2K9G A;  2DM1 A;  2HSP A;  2PNI A;  2M51 A;  4RTW A;  2B86 A;  2HDA A;  1H92 A;  1WX6 A;  1X69 A;  2DLP A;  1SRL A;  4F16 A;  3LH5 A;  2YUQ A;  4E6R A;  4CC2 A;  4RUG A;  2EGA A;  2DL8 A;  2GTO A;  4AFU C;  2BZ8 A;  4JJC A;  1JEG A;  2L3S A;  5IHN A;  1AWX A;  2I0N A;  1I07 A;  2J05 A;  1WI7 A;  1WA7 A;  1SHF A;  1KJW A;  4DEY A;  2W0Z A;  4CC3 A;  2D0N A;  3UF4 A;  5IHI A;  2KBT A;  2LX7 A;  2KXC A;  1ZUY A;  5HCK A;  2LCS A;  1ZLM A;  1BB9 A;  4J9D A;  2HCK A;  1WFW A;  1ABO A;  3R6N A;  1ABQ A;  1QWE A;  1X27 A;  3VS3 A;  4JZ4 A;  2J06 A;  1OEB A;  2LQW A;  1CSK A;  1K4U S;  1JQQ A;  2EGC A;  1S1N A;  1M27 C;  3EHR A;  1Z9Q A;  1Y57 A;  2RQW A;  2KE9 A;  1YP5 A;  3EG0 A;  2EW3 A;  3C0C A;  1RLQ C;  2JW4 A;  2GNC A;  4IIO A;  1GCP A;  4D8D A;  2O31 A;  2DBK A;  4RTT A;  1VA7 A;  5IH2 A;  5GJV B;  3H0I A;  1NYG A;  4D8K A;  2K3B A;  1I0C A;  2MIO A;  1OV3 A;  2BZY A;  2J6F A;  3M0P A;  2ENM A;  2O2O A;  3NGP A;  4F14 A;  2O88 A;  3JV3 A;  4KRT A;  2VVK A;  5IXB A;  4IIM A;  2DL4 A;  2P4R A;  1ZSG A;  2ECZ A;  2DA9 A;  2K6D A;  2NUZ A;  1I1J A;  2L2P A;  2KT8 A;  2A37 A;  1X6B A;  2K79 A;  2M0Y A;  1PHT A;  5FWC A;  1QCF A;  2V1R A;  1HD3 A;  3QWX X;  1QKW A;  1T3L A;  2AKL A;  3EHQ A;  4HVV A;  2RNA A;  1E6H A;  1UE9 A;  2FG0 A;  2KYB A;  1K9A A;  1H8K A;  2ESW A;  2FPD A;  1PWT A;  4A63 B;  4DEX A;  2FRW A;  2GTJ A;  2ED0 A;  1AZE A;  3PVQ A;  3NPF A;  2JTE A;  4AG1 C;  2RQU A;  3VS7 A;  1YWO A;  3M0U A;  1ZUU A;  4LNP A;  2LZ6 B;  1SPK A;  4HVU A;  4HCK A;  4J9I A;  3PE0 A;  1N5Z A;  4ZNX A;  1ARK A;  1AOJ A;  4Z88 A;  1M30 A;  1Y0M A;  1NLP C;  2DIL A;  4EIK A;  1K1Z A;  3I5R A;  2YUN A;  3TSW A;  2K7A A;  1UJ0 A;  4J9C A;  3NHN A;  2JM8 A;  1PKT A;  1AWJ A;  1UEC A;  1PRL C;  2L0A A;  1YN8 A;  2V1Q A;  2G6F X;  2X3W D;  2GQI A;  1NEG A;  1OPL A;  4Z89 A;  2RQV A;  1UGV A;  1GCQ A;  2CSQ A;  1M3B A;  3TSZ A;  4AG2 C;  2CH4 W;  2OJ2 A;  4OMQ A;  3KFV A;  2SRC A;  5GJW B;  1CKB A;  1AVZ C;  3VRZ A;  2AK5 A;  1G83 A;  2FEI A;  2D1X A;  2LJ0 A;  2VKN A;  3I5S A; 
#chains in the Genus database with same CATH topology
 4Y92 A;  2LQ8 A;  2CGH A;  2DRK A;  4PK4 A;  2L5Q A;  1BCO A;  5KE3 A;  2VAS A;  1M90 R;  3UT1 A;  1UHC A;  2ROL A;  4F17 A;  1FX7 A;  2CUB A;  4QVC A;  2ZPG B;  2LCL A;  2C0O A;  1BYM A;  1BBZ A;  2K2M A;  3EFS A;  3L1A A;  2QDY B;  1QCN A;  1FXX A;  3VU3 C;  1IRE B;  2HZY A;  1ZUK A;  3LWH A;  3JB9 H;  2CDT A;  3MP8 A;  1MUZ A;  1YJN T;  1QKX A;  3HHT B;  4X9C A;  1M1F A;  4GLK A;  4JRP A;  1KD1 C;  2EJ9 A;  5GAN e;  3M0R A;  4HVW A;  4N4I A;  1IB8 A;  4PFO A;  1BU1 A;  1M9S A;  4WF2 A;  4DOW A;  5LJ5 d;  3CXC P;  4B9X A;  1TUC A;  4M77 A;  3I35 A;  1YCS B;  4J9E A;  2X9H A;  1X01 A;  4OML A;  3JCM X;  2HBW A;  2AIR B;  3PFS A;  1O75 A;  3X25 B;  1VQ9 A;  4EMG A;  2L3R A;  1KQS A;  1WLP B;  2FZC B;  4M75 A;  4Z8A A;  3FJ5 A;  5D6Y A;  1H3H A;  1XTD A;  3V7R A;  1VQ6 T;  5IHK A;  4M7D G;  4J9H A;  4VUB A;  3MEV A;  2BUD A;  1KQ2 A;  5C6S A;  3I56 A;  1BI3 A;  4LE9 A;  3MEW A;  3WVD B;  2PUK B;  3IQL A;  3BW1 A;  1C6V X;  4M78 C;  1LOJ A;  4GLM A;  4E2F B;  3CD6 T;  2HQE A;  2SEM A;  1FMK A;  1GBR A;  2EGE A;  4JDS A;  2DK3 A;  2HQH A;  2ZPI B;  4NOY A;  3G6E T;  3CQT A;  5CKB A;  2HL3 A;  2R5M A;  4XU2 A;  3VS6 A;  2W10 A;  2NUP B;  1ZSZ A;  3OYE A;  3G1J A;  2JS0 A;  2XID A;  2K5L A;  1KK7 A;  3E19 A;  2LQK A;  4R0K A;  1EFN A;  3UAT A;  3CCL T;  1UUE A;  2PQW A;  2MAM A;  2RJD A;  2OI3 A;  4M75 B;  4HT9 A;  5CIU A;  2LNH B;  1OOT A;  2EPD A;  2OTJ T;  2FO0 A;  4DBF A;  3RER A;  2L3P A;  1W2B A;  3THK A;  3C12 A;  3CCS T;  1LVK A;  1RI9 A;  4XU3 A;  2L8D A;  3BDL A;  1PC0 A;  2JN0 A;  3X20 B;  4RTY A;  1RAC B;  3H41 A;  5KE2 A;  4GBQ A;  2KYM A;  1LCK A;  2KNB B;  2OAW A;  5M9O A;  1OPK A;  3I55 A;  4M78 D;  2J6K A;  5FU7 B;  3M0S A;  3HL8 A;  3FRN A;  4NS5 A;  1VQ9 Q;  1NLO C;  2RK2 A;  4M77 E;  3EGX B;  3E9F A;  4PJO C;  5I2S A;  2CZ1 B;  2LMJ A;  5CCA A;  5KYY A;  1VQ8 A;  4M75 E;  5A0D A;  4ME7 A;  2DYB A;  3GNF B;  3I56 Q;  1BKB A;  4Z02 A;  4BUG A;  5GMK e;  3MEU A;  2EYW A;  2YUO A;  3SWN A;  5KCO A;  1XOV A;  2K3X A;  1M2V A;  2KI7 A;  1AZG B;  3VS4 A;  4RKU E;  4C92 F;  3NTK A;  4EMK C;  1QVG A;  4BDZ A;  1M2O A;  2BTT A;  2LP5 A;  1S72 A;  1X2K A;  3EAE A;  2ZPB B;  2H3J A;  3A8M B;  2EBP A;  4RG2 A;  1UB4 A;  3FDR A;  2R57 A;  3HKS A;  3FJP A;  1PNJ A;  2FPF A;  2DEQ A;  1D0X A;  4BB7 A;  2CP6 A;  4C0G A;  5CAI A;  5GAM f;  2O9V A;  5KH6 A;  2JTM A;  5EC7 A;  3VS2 A;  4OMF B;  4F04 B;  4RTX A;  2QQR A;  1UGP B;  2CS7 A;  1N9R A;  2QI2 A;  1YWP A;  1LJO A;  4QVD A;  2LJ1 A;  4J9B A;  1MMN A;  2EYQ A;  3MET A;  3J81 E;  3V8K A;  5DLO A;  1GBQ A;  1V1C A;  4PJO D;  3TCJ A;  2VXE A;  2COW A;  1OYX A;  5LJ5 h;  4FCY A;  3CC4 T;  1FMV A;  3CC2 A;  2X3X D;  2PVG B;  1JXO A;  1KC8 R;  5ECA A;  3OW2 P;  1VQ4 T;  2RN8 A;  1U1S A;  2NWM A;  1Q81 C;  4QT7 A;  2EIF A;  4FW1 A;  2RMO A;  1HSQ A;  3I55 Q;  1RUW A;  2F2V A;  2YRD A;  2FL7 A;  3ZEH A;  2P0P A;  2KVQ G;  5FLX E;  4FT4 A;  2EKO A;  1YHQ A;  3QUI A;  4BD3 A;  1Q82 R;  1JB0 E;  1GRI A;  4JJD A;  4BI8 B;  1JJ2 P;  1BI2 A;  3QZ9 B;  4F7U F;  4KBM B;  2HSP A;  1QP2 A;  2PNI A;  1ZA2 B;  1VQ8 Q;  2MPX C;  4RTW A;  4J6Y A;  2B86 A;  2HDA A;  5C0M A;  2DLP A;  5HK0 A;  3LH5 A;  3CC7 A;  2E1H A;  2YUQ A;  5GAN h;  1YIJ T;  1YJW A;  2VB6 A;  3VUB A;  2GTO A;  3HSB A;  1K8A R;  4M7D C;  4OGE A;  1JEG A;  3A8L B;  2CP7 A;  2GFU A;  1I07 A;  3M57 A;  1PCX A;  1UGQ B;  2JZ2 A;  1VQ4 Q;  1TH7 A;  1SF9 A;  4J6W A;  1D1C A;  4BY6 C;  2M1H A;  4V2S A;  1ABO A;  1ABQ A;  1QWE A;  3O8V A;  2RI5 A;  2XG8 D;  2QAS A;  3G4S T;  3UPU A;  1OEB A;  1WJR A;  1LPL A;  4PLI A;  5LJ3 h;  1YI2 A;  1JQQ A;  2EGC A;  2EJG A;  4KUI A;  5CO7 A;  5GMK i;  1M1K C;  1G3T A;  3EHR A;  1NPP A;  3CXC A;  3OS5 A;  4FW2 A;  1W4S A;  4HA8 A;  1XQH A;  1YP5 A;  2X51 A;  1F1B B;  1V76 A;  4C92 B;  1YIJ Q;  1M1G A;  2JW4 A;  4J7F A;  3X24 B;  2GNC A;  2YLB A;  3M53 A;  2QA4 A;  3V7S A;  1GCP A;  3CMA A;  1U8R A;  3CC2 Q;  3MJX A;  1OUL A;  3C95 A;  3CBO A;  2LCC A;  5CKH A;  5LJ5 j;  5IAY A;  3OYH A;  1OV3 A;  4M7D D;  3RES A;  3OB9 A;  2M9U A;  2XDB A;  4JUV A;  2O2O A;  4F14 A;  3JV3 A;  1YHQ Q;  4IIM A;  3F70 A;  2P4R A;  4M78 A;  4C5H A;  4C92 G;  2LNV A;  2K6D A;  3M9Q A;  2A37 A;  8ATC B;  3HFN A;  2E6N A;  2V1R A;  5GMK l;  2HL5 C;  1T3L A;  4FU6 A;  1RAA B;  1RAI B;  1H8K A;  4C92 E;  1VQM T;  1NJI R;  2E64 A;  4FIB A;  4A63 B;  4EDU A;  4ZGE B;  3CCR T;  4IKF A;  3MP1 A;  5D7U A;  3NPF A;  2RJC A;  3URG A;  3OYC A;  5GAO r;  2CZ0 B;  4JLG A;  3DKM A;  3QSU A;  4J9I A;  1ARK A;  1Y0M A;  2RHI A;  5GAM d;  4C0F A;  5EG2 A;  3I5R A;  2YUN A;  3TSW A;  4F7U B;  1UJ0 A;  4J9C A;  2JM8 A;  1SG5 A;  2QEX T;  3JCM W;  3DB3 A;  3JCM g;  1YI2 Q;  1PRL C;  2L0A A;  1YN8 A;  6AT1 B;  2X3W D;  1W2B P;  2CH4 W;  5LJ3 j;  4OMQ A;  2YRV A;  1CKB A;  4KT0 E;  1VQL A;  2D1X A;  4C0D C;  2QA4 Q;  2HEQ A;  4JZ3 A;  2E5K A;  3CCM T;  1VQM Q;  5KCH A;  1NZ9 A;  1TXQ A;  1VQN A;  2DZ9 A;  3PIP A;  1W70 A;  3OMC A;  2JS2 A;  4PJO A;  2JUF A;  5IT9 E;  2LX9 A;  2DPP B;  1PG5 B;  2YXY A;  2AKK A;  4RCC A;  2FRY A;  2JMA A;  1KIK A;  4A54 A;  3SDZ A;  2M16 A;  5D6X A;  5KYW A;  1U06 A;  4NL3 A;  1WJS A;  2H8H A;  4FSS A;  4KGV B;  4C8Q C;  5KYX B;  1G2B A;  1SHG A;  4F7U E;  1U3O A;  4MML A;  1VQK T;  1AD5 A;  2CP2 A;  2VUB A;  1M90 C;  1X43 A;  4EMK A;  2KQW A;  4M78 E;  4ORZ A;  2O4X A;  3VJP A;  4A4K A;  4HXJ A;  4AFQ C;  2LT1 A;  4X1V A;  4XTZ A;  4PFP A;  2Y4Y A;  4J9F A;  3RNJ A;  4A4E A;  3VS1 A;  2D6F A;  1RAE B;  5KYU B;  4QQG A;  1M1K U;  2KRS A;  1K76 A;  1M4Z A;  2KMT A;  3L2Z A;  5GAN 8;  2WSE E;  3S3M A;  3G71 T;  2OX7 A;  2CKK A;  2JNG A;  1UHF A;  3EG2 A;  4PJN A;  2GF7 A;  2V8J A;  4RG8 A;  1BIB A;  5CKE A;  2D8H A;  4WCI A;  2J6O A;  2CT4 A;  4EMK B;  5CQY A;  4C8Q D;  3HTR A;  4M77 F;  2GQV A;  2O4X B;  1M8M A;  2CRE A;  1VQL Q;  3CCV A;  2KGT A;  1UG1 A;  3EGD A;  2KR3 A;  3EFO A;  2JMC A;  2ABL A;  1WIE A;  1VQN Q;  2YWW A;  2KY9 A;  2OTL A;  2LVM A;  1JJ2 A;  3OYN A;  5CKD A;  2AT1 B;  3PGG A;  4CC7 A;  3FIF A;  1C1A A;  3CCE A;  3SHW A;  2RHZ A;  4LDU A;  1Y07 A;  5J3B A;  2M0O A;  4PJO E;  2AZS A;  2HKQ B;  1WHM A;  2LDM A;  5LJ5 e;  2VGM A;  2IPO B;  4XTU A;  3OSS C;  5I22 A;  3TVT A;  1Y96 B;  4K11 A;  4M7D A;  1N27 A;  3NMZ C;  4CC4 B;  3S6W A;  2JOY A;  3S3O A;  4M7A C;  2ZGW A;  1GCQ C;  2WAC A;  2K2V A;  4ATO A;  2EQJ A;  4AFZ C;  5FW9 A;  1WHK A;  3VUZ A;  2CZ7 B;  4X9D A;  1K9M U;  3PT9 A;  3ASK A;  1GL5 A;  3LGF A;  4ESR A;  2DXU A;  2ZPF B;  1WJQ A;  5GAM h;  2FVU A;  1NE8 A;  5J39 A;  3CCU A;  1KHC A;  2KT1 A;  2YUP A;  1PD1 A;  2DO3 A;  3QYH B;  2B8A A;  2HAX A;  2EAY A;  2F2W A;  5GAN g;  2EYX A;  2QQS A;  3PVL A;  4QQ6 A;  3JB9 G;  4WTO B;  5HY6 A;  1R0C B;  1B34 A;  4JLI A;  2KSS A;  1KSW A;  3EG9 B;  3L2U A;  2AZV A;  3OYK A;  1OQK A;  2K5F A;  3OBY A;  1GFD A;  2DJQ A;  1NG2 A;  3GBQ A;  2QAZ A;  1MMA A;  3M0T A;  3M0Q A;  1B07 A;  3MEA A;  1WXT A;  3CD6 A;  3GNG A;  2DD4 A;  3OS2 A;  2QGF B;  1X6G A;  5LJ3 e;  4LDW A;  3CCV Q;  3CEY A;  5J26 A;  3VS5 A;  4RTZ A;  2JT4 A;  4M7A D;  4II1 A;  2BKD N;  2OTL Q;  3RUX A;  3ZL7 C;  1Q95 G;  5LJ3 g;  3ULR B;  1VIF A;  1M90 U;  3CCE Q;  2ATC B;  1HXD A;  2ZCF B;  1WQ7 A;  2MWO A;  1T0J A;  2DL7 A;  4P5N A;  3LYI A;  2I2L A;  1AT1 B;  2CUD A;  2A08 A;  2QQB A;  3ZBD A;  4M77 B;  1VQ9 T;  1B34 B;  2GFA A;  5GAN 6;  1UDL A;  4UC4 A;  1TUG B;  3OYD A;  3UWN A;  2PZ1 A;  1D0Z A;  4Q5W A;  1WXU A;  2EYY A;  4BAC A;  2VGN A;  3GOX A;  1IRX A;  3I56 T;  1VQ5 A;  4QKU A;  1OI1 A;  4JPB W;  2A7Y A;  4ZGD B;  1MND A;  3VS0 A;  5I21 A;  2RHU A;  4O6J A;  5GAO p;  1UGR B;  2QK0 A;  3JCM V;  3CCU Q;  2COY A;  2ZPH B;  5IN1 A;  1QVF P;  1H92 A;  4KGZ B;  4M77 G;  1SRL A;  5GAM j;  4E6R A;  4CC2 A;  3OYL A;  2EGA A;  3JCM b;  3CCQ A;  2FB7 A;  4M75 G;  1Q82 C;  1SHF A;  3QDF A;  1ZSZ B;  4CC3 A;  4DEY A;  2D0N A;  4A4F A;  4A4G A;  2KBT A;  1D0Y A;  5HCK A;  1ZLM A;  1KD1 R;  4J9D A;  2RA2 A;  1WFW A;  4ZN3 A;  3C94 A;  1WHL A;  3L2Q A;  3KBG A;  4HT8 A;  4JZ4 A;  4C8Q A;  2J06 A;  1K8A C;  3M56 A;  2LQW A;  1CSK A;  2XU8 A;  1K4U S;  1S1N A;  1M27 C;  7AT1 B;  2QTX A;  4JRK A;  8AT1 B;  2KAF A;  1I4K 1;  2MYS A;  1Y57 A;  2RQW A;  2D0Q B;  4DBH A;  2EW3 A;  4FYV B;  3X26 B;  2P84 A;  2CP3 A;  4D8D A;  3I55 T;  3CPW P;  1IGU A;  4J83 A;  2DBK A;  2BIV A;  5GJV B;  1NYG A;  3HPW A;  2RHY A;  4D8K A;  4DA4 A;  3E9G A;  2ZAE A;  4LD6 A;  4JRI A;  4E7Z A;  2DZC A;  3FC3 A;  1VQ7 A;  2Y4X A;  2MIO A;  3D7S B;  1G5V A;  3QKJ A;  3V7C A;  2MK5 A;  3HRU A;  3CME A;  3CCJ A;  1C0M A;  1QCO A;  1VQ8 T;  3NGP A;  2IVW A;  5KYY B;  3OW2 S;  2MF2 A;  2VVK A;  1VQ5 Q;  1ZSG A;  3VYG A;  4PFZ A;  2NUZ A;  2L2P A;  4OVA A;  4QQD A;  2M0Y A;  1DJ7 B;  1PHT A;  5FWC A;  3SWN B;  1HD3 A;  4J7I A;  1M2V B;  4MDW A;  1QKW A;  2AKL A;  2YHT A;  3TRE A;  4XTX A;  2RNA A;  1E6H A;  1K9A A;  3QO3 A;  1VQO A;  2HD0 A;  3QDR B;  1S72 T;  3S3N A;  1YJ9 A;  4BE0 A;  3CCQ Q;  2NLU A;  2DXB A;  1WNL A;  5DM7 R;  4DEX A;  2FRW A;  1IZ6 A;  2WSC E;  5FU6 C;  1Q7Y R;  2JTE A;  3VS7 A;  1YWO A;  3M0U A;  3AHU A;  4LNP A;  2LZ6 B;  3PE0 A;  3ZFJ A;  4IUR A;  1NLP C;  1D3B A;  3OSV A;  1NJI C;  4M78 F;  3L2W A;  2PUO B;  1AWJ A;  2L89 A;  4CRI A;  3OYA A;  3JRZ A;  3G4S A;  4C8Q E;  2GQI A;  4ZTJ A;  4M7A A;  2HMA A;  1UGV A;  3CC2 T;  1GCQ A;  2CSQ A;  1M3B A;  4E7H A;  3JCM f;  2F5T X;  3PMI A;  1AVZ C;  2AK5 A;  3LLR A;  2LJ0 A;  1S72 Q;  3EG3 A;  1VYV A;  3TU4 K;  2VWF A;  2CZ6 B;  2MCN A;  4RTU A;  1N9S A;  3QXE B;  1YHQ T;  1KC8 U;  2EQU A;  3RKY A;  3N5B B;  4M4Z A;  1NYF A;  2DRM A;  1U5S A;  2X4X A;  4J6X A;  1BK2 A;  3UA7 A;  3CCJ Q;  1E6G A;  2J7I A;  3MCA B;  4LDY A;  1NM7 A;  2QTV A;  1YJW T;  3OYG A;  3HRS A;  4E7I A;  1ZHI A;  2HSE B;  1RI0 A;  1Q82 U;  3JB9 D;  1KQS S;  1FWZ A;  1SSH A;  2E12 A;  2EYZ A;  4YTL A;  1NPR A;  3H0F A;  2DVE A;  2DL5 A;  3RKW A;  4KGX B;  4HCZ A;  1WDX A;  1VQO Q;  5GAM e;  1QMC A;  1YJ9 Q;  2X4W A;  2E5Q A;  3NFC A;  2KK4 A;  3M4G A;  2FZK B;  4BE2 A;  2XI9 A;  1K8A U;  4PJO F;  4FL6 A;  3KXT A;  1W1F A;  5GAM g;  1TU0 B;  2RPN A;  4E7K A;  1YI2 T;  2C0I A;  1GXI E;  2JXB A;  4FM4 B;  3PIO A;  1PSF A;  1MHN A;  1MMG A;  1BIA A;  4PJL A;  3E1S A;  4LN2 A;  4ZTF A;  3RMS A;  3OYJ A;  4TVR A;  3CC7 Q;  1YJW Q;  1WGS A;  3QWY A;  2QA4 T;  3BFM A;  1T0H A;  2DL3 A;  4J9G A;  3CMA T;  2X4J A;  3A98 A;  3QII A;  1GFC A;  5CVI A;  2ROT A;  3O5Z A;  4O5V A;  2EQM A;  4M7A E;  2RQT A;  3ME9 A;  1K9M C;  4XTY A;  3EGU A;  1WHJ A;  2MOX A;  5GAO m;  4LUE A;  3A8O B;  1W2B S;  5FU7 C;  2KDS A;  3H9N A;  2F2X A;  2XDP A;  2D8J A;  2DFU A;  3OY9 A;  1QVF A;  1SRM A;  1HYO A;  1OZ3 A;  4M78 B;  1WZO A;  2KEA A;  1N8R R;  1VOM A;  1PM3 A;  5GAN 4;  2R58 A;  4XTV A;  3BDU A;  1ZA1 B;  2FHD A;  4N0A C;  2JJ9 A;  2EWN A;  4A4H A;  2DX1 A;  2YSQ A;  2CH4 A;  1YCY A;  2COZ A;  2E6Z A;  3QHS A;  2DTO A;  3QYG B;  1SEM A;  1N6A A;  4BI4 A;  1JU5 C;  3CMA Q;  4OMO A;  4M75 D;  1UEB A;  3HRT A;  4LUD A;  4KUL A;  3UA6 A;  1A0N B;  4N4H A;  4F7U G;  1K0X A;  3JCM J;  4QW2 A;  4ZGJ B;  1U1T A;  1WYX A;  2YT6 A;  4M78 G;  1NJI U;  3EH1 A;  3P8B B;  3SEM A;  2HBP A;  2PVO B;  1AHJ B;  4OGC A;  1QVG S;  1LNX A;  3LWI A;  3J7A F;  4L6V 5;  3OQ5 A;  1I8F A;  1Q86 R;  3CPW A;  1K73 R;  3RBB B;  1YIT A;  1WHG A;  3P8D A;  3VKI A;  3JCM d;  4M7D F;  2DEU A;  1VQL T;  2RQR A;  4OMN A;  4FYY B;  1VQN T;  5KYN A;  1N8R U;  1VYU A;  1QVP A;  2F69 A;  2RI2 A;  2CP5 A;  4GY5 A;  3I9Q A;  4PJO B;  5I2M A;  4X34 A;  4JS4 A;  5I11 A;  2PTK A;  4OB1 B;  2EVR A;  1VQP A;  2IG0 A;  3V8L A;  5LL6 S;  1M8V A;  1TTH B;  3REA B;  5KYW B;  3G7Z A;  4AMC A;  2FPE A;  4ELY C;  3R6O A;  2GCX A;  3LGL A;  3A8G B;  5CKF A;  2DAQ A;  4J8O A;  3CBM A;  4IUP A;  4PKC C;  4C5G A;  3A1P A;  2DXC A;  4BI3 A;  1H3Z A;  2XHC A;  3EFR A;  2QG9 B;  4PJO G;  3LH0 A;  2K57 A;  2ZPE B;  1P92 A;  2DE0 X;  4ZN1 A;  4KH0 B;  2BZX A;  1Q86 U;  4L59 A;  3JAM E;  3OYF A;  3RDV A;  3VRY A;  2DNU A;  3OS0 A;  3RMQ A;  3QZ5 B;  1HJD A;  2DVJ A;  3KUF A;  3OYI A;  2K5I A;  2PU9 B;  5LJ5 g;  2XDD A;  1YJN A;  1IHV A;  1X69 A;  4B6M A;  3L2V A;  1QQJ A;  1OU9 A;  1X75 C;  4LXC A;  4PJM A;  4RUG A;  2LC4 A;  1IGQ A;  2DL8 A;  1XJW B;  2BZ8 A;  3GF5 A;  4JJC A;  1YIT Q;  1RAB B;  5IHN A;  4C92 C;  1AWX A;  2J05 A;  3RIR A;  3CCV T;  1WI7 A;  4Y91 A;  4D6W A;  1KJW A;  2DJZ A;  5A0L A;  3EGD B;  2OTL T;  3EFO B;  1BB9 A;  3CXC S;  2HCK A;  3CCE T;  2DER A;  1OU8 A;  3MPU B;  5AT1 B;  1VQP Q;  1VQ6 A;  3WXM B;  3OYB A;  2HKN A;  3JSC A;  2V8I A;  2KE9 A;  3M4Y A;  4M7D B;  1Y71 A;  4BE1 A;  1JRI A;  1RLQ C;  2VC8 A;  4J5Y A;  2RO0 A;  4IIO A;  2RJE A;  2DTI A;  5GAO l;  1KHI A;  2NUP A;  3G6E A;  3A8H B;  3P8H A;  4BY6 B;  4XAX B;  5IH2 A;  3OBW A;  4CI0 C;  3ER0 A;  4BDY A;  3HFO A;  2BZY A;  5D6W A;  3CCU T;  3CCL A;  3Q1J A;  4C92 D;  1UGS B;  2O88 A;  2E65 A;  1HK9 A;  4C8Q F;  1V29 B;  1FMW A;  2ECZ A;  2JVV A;  2P4T A;  2DA9 A;  2DIQ A;  1I5L A;  5CK9 A;  1I1J A;  2OTJ A;  2Y90 A;  4PLL A;  2K79 A;  1QCF A;  4E7L A;  1YJN Q;  1G8X A;  2C06 A;  3JCM h;  2AHJ B;  3LX7 A;  4L5G A;  3CCS A;  3TEE A;  1H64 1;  2FG0 A;  4M7D E;  5GAN d;  2RK1 A;  4IUV A;  2ESW A;  1PWT A;  5GAO n;  2DXT A;  3PVQ A;  1QVF S;  2RQU A;  4MZM A;  1ACM B;  1G3Y A;  5DY9 A;  3EGX A;  1JBM A;  4ZNX A;  1KC8 C;  1PSE A;  4HCC A;  4N4G A;  4EIK A;  1K1Z A;  2K7A A;  1MMD A;  3QPH A;  4MZP A;  3NHN A;  4IUU A;  1VQ6 Q;  4N0A A;  5AYF A;  3QG1 A;  4C5E A;  1TSF A;  3JCM P;  1UEC A;  5LJ3 d;  3SB2 A;  2G6F X;  1Q7Y C;  3DLL A;  2FZG B;  4Z89 A;  2MWP A;  3LW5 E;  1OZ2 A;  4DBQ A;  3KFV A;  5GJW B;  1G83 A;  4OB0 B;  5FRN A;  1QW1 A;  3CD6 Q;  1X6O A;  3MKD A;  2O01 E;  3X28 B;  3G6E Q;  1M3A A;  5GMK m;  4JJB A;  1VQ5 T;  4NL2 A;  3A5Z B;  1EIF A;  1VUB A;  2R5A A;  3NTI A;  2KRO A;  3QJY A;  3CPW S;  2RB6 A;  3CCL Q;  3GIB A;  1AWO A;  1RAF B;  2X4Y A;  2A36 A;  1QWF A;  5FRM A;  2A0F B;  5DLQ E;  1R0B G;  2JM9 A;  3MHX A;  1Y7X A;  3OYM A;  2MI6 A;  2OTJ Q;  5FWB A;  2E41 A;  2CSI A;  1MNE A;  3CCQ T;  2O9S A;  4M7A F;  2QQ9 A;  4C0D B;  4ANJ A;  1NBE B;  2NYS A;  3TQ7 P;  3MP6 A;  2E10 A;  1J3T A;  3CC4 A;  1PD0 A;  3EH2 A;  3REB B;  3CCS Q;  4OB2 B;  1YNZ A;  4HKE A;  1UTI A;  4R56 A;  2M02 A;  1CKA A;  1VQ4 A;  4OB3 B;  1BI0 A;  2EJF A;  5GAN 7;  2KXD A;  3DLM A;  3H6Z A;  2OAU A;  4PJJ A;  3FEO A;  2YLC A;  2RF0 A;  2ZZD A;  4E47 A;  1G3W A;  1WXB A;  4C8Q B;  1MV0 B;  4JRQ A;  1Z9Z A;  1KD1 U;  3M54 A;  1R8O B;  4XU0 A;  2E3I A;  2DIG A;  3L42 A;  4C0Z A;  2NUT A;  3NTH A;  3BY7 A;  1X2Q A;  5L8R E;  2DF6 A;  3VV0 A;  1YBY A;  3J80 E;  2P0K A;  1BI1 A;  1JJ2 S;  1YIJ A;  1SSF A;  1R77 A;  2QYZ A;  2DMO A;  4JJN K;  2EQI A;  4B9W A;  3SFM A;  5FRO A;  5IXF A;  1VQ7 T;  4C8Q G;  1RL2 A;  2PVD B;  1AWW A;  3CME T;  3CCJ T;  2RHX A;  1FYN A;  2A28 A;  3GLX A;  1WQW A;  3CBP A;  3QJ6 A;  3GPL A;  1B3Q A;  4C5I A;  4FT2 A;  2QDL A;  3INZ A;  2EQK A;  2RI3 A;  1BCM A;  3GP8 A;  3HP9 A;  4DOV A;  1M3C A;  2E3H A;  4RTV A;  2GBQ A;  1O9S A;  4KUD K;  4C92 A;  2NUT B;  1VQO T;  4OMM A;  1K0S A;  3M55 A;  1ZX6 A;  1YJ9 T;  2XIC A;  1QLY A;  4AFS C;  1OX8 A;  2LT4 A;  2LRQ A;  1KFZ A;  1XNI A;  4IUT A;  2EFI A;  3CC4 Q;  2CT3 A;  1N8R C;  1VYT A;  3PNW C;  3VYH B;  1VQ7 Q;  4E7S A;  3CME Q;  1D09 B;  2IIM A;  1WHH A;  1D3B B;  3CC7 T;  1Q7Y U;  1MV3 A;  2XD0 A;  2VYT A;  1SKU B;  3U23 A;  1TWB A;  1TUD A;  2FYK A;  4PNO A;  3PMT A;  3QBY A;  1QP3 A;  4M7A B;  2E70 A;  1W6X A;  2V26 A;  4RCB A;  3L2R A;  1PKS A;  3JB9 I;  1ZBX A;  4E7J A;  3EG1 A;  2C0T A;  4XTW A;  3OYY A;  2LJ3 A;  5HKC A;  2XMF A;  2BE7 D;  4AT1 B;  3OMG A;  4M77 C;  4LDV A;  2L3Q A;  1VQM A;  2YDL A;  2Z0W A;  1TG0 A;  3C4S A;  2RJF A;  3CCR A;  1Q86 C;  4R55 A;  2EKH A;  2GGR A;  1K73 C;  2KRM A;  2CYZ B;  4M75 C;  1MGQ A;  1KQS P;  5L23 A;  4F7U A;  1Q81 R;  4M7A G;  4XK8 E;  1NEB A;  4A53 A;  4ELZ C;  3G4S Q;  5GAN 5;  1AEY A;  2QEX A;  3BE3 A;  2WSF E;  5GAN 3;  3OS1 A;  1RLP C;  2ED1 A;  3RR6 A;  1IO6 A;  1I81 A;  4MMK A;  2KRN A;  1JO8 A;  1PRM C;  1ZBJ A;  1UJY A;  2DBM A;  5A2Q E;  1JXM A;  4OMP A;  1T3S A;  3M5A A;  4HCB A;  3CCM A;  1ZSZ C;  4DBR A;  3UDC A;  2LQN A;  5A0G A;  1E7O A;  4LD9 K;  2K3Y A;  3WVE B;  5GAN j;  2HNI A;  1ZQ1 A;  3H0H A;  2CP0 A;  1RAG B;  4EPC A;  4EMH A;  2QGG A;  4M77 D;  3JCM e;  3PTA A;  1UFF A;  2K9G A;  2DM1 A;  5KYX A;  2M51 A;  3CPF A;  2P0Q A;  4DQ2 A;  4XU1 A;  1WX6 A;  2VXF A;  4LDX A;  2F1L A;  4F16 A;  1VQK A;  4QVZ A;  5LJ5 f;  2V8K A;  4AFU C;  1EX4 A;  2L3S A;  5HK3 A;  2G3R A;  2QQA A;  2I0N A;  1Q81 U;  1M1K R;  1WA7 A;  5GMK h;  1M5Q 1;  2RH2 A;  3FLG A;  2W0Z A;  3UF4 A;  3OA6 A;  1KG1 A;  5IHI A;  9ATC B;  2LX7 A;  2KXC A;  1ZUY A;  2LCS A;  2XKO C;  3RKX A;  3JB9 F;  5KYU A;  3R6N A;  1OX9 A;  3M59 A;  2E4H A;  2DET A;  3CCR Q;  3MO8 A;  1IXD A;  1X27 A;  3VS3 A;  4XQ3 A;  2LTO A;  4KH1 B;  2DKG A;  2D9T A;  2H3E B;  3G71 A;  1Z9Q A;  2DD5 A;  2RM4 A;  4PL6 A;  4FYX B;  3EG0 A;  5GAN f;  2A3L A;  3V8J A;  2K4Y A;  3C0C A;  2QEX Q;  1KQ1 A;  3SWN C;  2O31 A;  5CR2 A;  2VV5 A;  4FYW B;  4RTT A;  1VA7 A;  3H0I A;  1QVG P;  4RMO A;  2K3B A;  1I0C A;  2MMP A;  3CCM Q;  1WPY A;  2F5K A;  2DYI A;  2J6F A;  3M0P A;  1RAH B;  2ENM A;  1G3S A;  2X35 A;  4KRT A;  3JCM Q;  5IXB A;  3SD4 A;  2DL4 A;  5LJ3 f;  5GAO q;  4OF1 A;  4OP0 A;  2KT8 A;  1YIT T;  1RAD B;  1X6B A;  4MDX A;  1Y96 A;  3FB9 A;  1TS9 A;  3JCM c;  1I5O B;  1K9M R;  3QWX X;  2JTF A;  5GAN 2;  3EHQ A;  4HVV A;  3OW2 A;  1UE9 A;  1VQK Q;  2KYB A;  3M58 A;  1IHW A;  2RD1 A;  2FPD A;  1TOV A;  1K73 U;  4JS5 A;  2HQX A;  2GTJ A;  2ED0 A;  4MZT A;  1AZE A;  4AG1 C;  2YRC A;  1VQP T;  1ZUU A;  1SPK A;  4HVU A;  4HCK A;  1N5Z A;  2QXF A;  1AOJ A;  4IUQ A;  4Z88 A;  1M30 A;  5GMK j;  2BE9 B;  2DIL A;  4M75 F;  4Y28 E;  3AT1 B;  1PKT A;  2DTH A;  1D1A A;  1B7T A;  2V1Q A;  1VIE A;  3JB9 J;  3H8Z A;  3G71 Q;  1D1B A;  1NEG A;  1OPL A;  4FSX A;  2RQV A;  1EZZ B;  3TSZ A;  1YFN A;  4AG2 C;  2OJ2 A;  2XK0 A;  2SRC A;  3EG9 A;  3T9N A;  3VRZ A;  2FEI A;  2VKN A;  3DB4 A;  3I5S A;  5FU6 B;  3E2U A;  5CQX A; 
#chains in the Genus database with same CATH homology
 3EG3 A;  2HEQ A;  4JZ3 A;  2E5K A;  4Y92 A;  2DRK A;  1VYV A;  2VWF A;  1W70 A;  2JS2 A;  2MCN A;  4RTU A;  1M3A A;  1UHC A;  2ROL A;  4JJB A;  4F17 A;  2CUB A;  2AKK A;  4M4Z A;  2FRY A;  2C0O A;  2JMA A;  1KIK A;  1NYF A;  2DRM A;  1BBZ A;  2K2M A;  1U5S A;  1BK2 A;  1ZUK A;  2KRO A;  3UA7 A;  1U06 A;  1AWO A;  1E6G A;  2J7I A;  2CDT A;  1MUZ A;  2A36 A;  1QKX A;  1QWF A;  2H8H A;  4FSS A;  1NM7 A;  1G2B A;  1SHG A;  2JM9 A;  1U3O A;  3M0R A;  4HVW A;  1AD5 A;  1BU1 A;  1X43 A;  5FWB A;  2EYZ A;  1SSH A;  2CSI A;  2O9S A;  3H0F A;  4ORZ A;  1TUC A;  2DL5 A;  1YCS B;  3I35 A;  4HXJ A;  4J9E A;  4OML A;  4AFQ C;  2HBW A;  4X1V A;  1J3T A;  3REB B;  1WDX A;  1YNZ A;  4J9F A;  1UTI A;  1CKA A;  3RNJ A;  2KXD A;  3VS1 A;  1WLP B;  4Z8A A;  3FJ5 A;  1W1F A;  2RF0 A;  1H3H A;  2KRS A;  2RPN A;  5IHK A;  1WXB A;  1K76 A;  4J9H A;  1MV0 B;  2C0I A;  1Z9Z A;  4LE9 A;  2JXB A;  1UHF A;  3IQL A;  3EG2 A;  4LN2 A;  1X2Q A;  2D8H A;  4WCI A;  2DF6 A;  4GLM A;  3QWY A;  1T0H A;  2DL3 A;  4J9G A;  2J6O A;  2CT4 A;  2SEM A;  3A98 A;  1FMK A;  2DMO A;  1GBR A;  2EGE A;  1GFC A;  2EQI A;  3CQT A;  2ROT A;  3O5Z A;  3VS6 A;  2W10 A;  1M8M A;  2CRE A;  2RQT A;  2KGT A;  2JS0 A;  1UG1 A;  5IXF A;  2KR3 A;  2JMC A;  2ABL A;  1WIE A;  3EGU A;  4R0K A;  1EFN A;  1AWW A;  2MOX A;  3UAT A;  4LUE A;  1UUE A;  4CC7 A;  1FYN A;  2A28 A;  2F2X A;  2OI3 A;  3SHW A;  2D8J A;  1SRM A;  1B3Q A;  2QDL A;  2AZS A;  2LNH B;  1OOT A;  2EPD A;  2KEA A;  2FO0 A;  2L3P A;  5I22 A;  1M3C A;  3TVT A;  3THK A;  4K11 A;  2DX1 A;  2YSQ A;  2CH4 A;  2GBQ A;  4RTV A;  1RI9 A;  3NMZ C;  4CC4 B;  4OMM A;  1K0S A;  1ZX6 A;  1SEM A;  1QLY A;  4AFS C;  1JU5 C;  4RTY A;  1GCQ C;  4OMO A;  1KFZ A;  3H41 A;  4AFZ C;  4GBQ A;  5FW9 A;  2KYM A;  1LCK A;  4LUD A;  2KNB B;  2OAW A;  3UA6 A;  1A0N B;  1OPK A;  2CT3 A;  1K0X A;  1VYT A;  2J6K A;  3M0S A;  1NLO C;  1GL5 A;  1WYX A;  2YT6 A;  4ESR A;  2LMJ A;  3SEM A;  2IIM A;  2KT1 A;  1MV3 A;  2DYB A;  2YUP A;  3U23 A;  1TUD A;  2F2W A;  2EYX A;  2EYW A;  2YUO A;  1W6X A;  3PVL A;  3RBB B;  1PKS A;  1XOV A;  1AZG B;  3VS4 A;  3EG1 A;  1KSW A;  2C0T A;  2RQR A;  2AZV A;  2LJ3 A;  4OMN A;  1GFD A;  2XMF A;  2BTT A;  2DJQ A;  1NG2 A;  1VYU A;  3GBQ A;  2LP5 A;  1X2K A;  1B07 A;  2L3Q A;  3M0Q A;  3M0T A;  1WXT A;  2YDL A;  3I9Q A;  1X6G A;  2EBP A;  1TG0 A;  3VS5 A;  5I11 A;  2PTK A;  2EKH A;  4RTZ A;  2JT4 A;  2GGR A;  1PNJ A;  2EVR A;  2KRM A;  2FPF A;  3ZL7 C;  2O9V A;  5EC7 A;  3VS2 A;  3ULR B;  3REA B;  5L23 A;  2FPE A;  4RTX A;  1YWP A;  2LJ1 A;  4J9B A;  1NEB A;  1AEY A;  1T0J A;  1GBQ A;  2DL7 A;  1V1C A;  2CUD A;  1RLP C;  2ED1 A;  2A08 A;  2X3X D;  1IO6 A;  1JXO A;  5ECA A;  2RN8 A;  2KRN A;  1JO8 A;  1PRM C;  1ZBJ A;  1UJY A;  2DBM A;  2NWM A;  1JXM A;  4QT7 A;  1UDL A;  4OMP A;  2RMO A;  1T3S A;  1HSQ A;  2DE0 X;  1RUW A;  2BZX A;  2F2V A;  2LQN A;  2PZ1 A;  1E7O A;  1WXU A;  3VRY A;  2EYY A;  2DNU A;  3H0H A;  4JPB W;  1HJD A;  1GRI A;  3VS0 A;  2DVJ A;  4JJD A;  1UFF A;  2K9G A;  2DM1 A;  2HSP A;  2PNI A;  2M51 A;  4RTW A;  2B86 A;  2HDA A;  1H92 A;  1WX6 A;  1X69 A;  2DLP A;  1SRL A;  4F16 A;  3LH5 A;  2YUQ A;  4E6R A;  4CC2 A;  4RUG A;  2EGA A;  2DL8 A;  2GTO A;  4AFU C;  2BZ8 A;  4JJC A;  1JEG A;  2L3S A;  5IHN A;  1AWX A;  2I0N A;  1I07 A;  2J05 A;  1WI7 A;  1WA7 A;  1SHF A;  1KJW A;  4DEY A;  2W0Z A;  4CC3 A;  2D0N A;  3UF4 A;  5IHI A;  2KBT A;  2LX7 A;  2KXC A;  1ZUY A;  5HCK A;  2LCS A;  1ZLM A;  1BB9 A;  4J9D A;  2HCK A;  1WFW A;  1ABO A;  3R6N A;  1ABQ A;  1QWE A;  1X27 A;  3VS3 A;  4JZ4 A;  2J06 A;  1OEB A;  2LQW A;  1CSK A;  1K4U S;  1JQQ A;  2EGC A;  1S1N A;  1M27 C;  3EHR A;  1Z9Q A;  1Y57 A;  2RQW A;  2KE9 A;  1YP5 A;  3EG0 A;  2EW3 A;  3C0C A;  1RLQ C;  2JW4 A;  2GNC A;  4IIO A;  1GCP A;  4D8D A;  2O31 A;  2DBK A;  4RTT A;  1VA7 A;  5IH2 A;  5GJV B;  3H0I A;  1NYG A;  4D8K A;  2K3B A;  1I0C A;  2MIO A;  1OV3 A;  2BZY A;  2J6F A;  3M0P A;  2ENM A;  2O2O A;  3NGP A;  4F14 A;  2O88 A;  3JV3 A;  4KRT A;  2VVK A;  5IXB A;  4IIM A;  2DL4 A;  2P4R A;  1ZSG A;  2ECZ A;  2DA9 A;  2K6D A;  2NUZ A;  1I1J A;  2L2P A;  2KT8 A;  2A37 A;  1X6B A;  2K79 A;  2M0Y A;  1PHT A;  5FWC A;  1QCF A;  2V1R A;  1HD3 A;  3QWX X;  1QKW A;  1T3L A;  2AKL A;  3EHQ A;  4HVV A;  2RNA A;  1E6H A;  1UE9 A;  2FG0 A;  2KYB A;  1K9A A;  1H8K A;  2ESW A;  2FPD A;  1PWT A;  4A63 B;  4DEX A;  2FRW A;  2GTJ A;  2ED0 A;  1AZE A;  3PVQ A;  3NPF A;  2JTE A;  4AG1 C;  2RQU A;  3VS7 A;  1YWO A;  3M0U A;  1ZUU A;  4LNP A;  2LZ6 B;  1SPK A;  4HVU A;  4HCK A;  4J9I A;  3PE0 A;  1N5Z A;  4ZNX A;  1ARK A;  1AOJ A;  4Z88 A;  1M30 A;  1Y0M A;  1NLP C;  2DIL A;  4EIK A;  1K1Z A;  3I5R A;  2YUN A;  3TSW A;  2K7A A;  1UJ0 A;  4J9C A;  3NHN A;  2JM8 A;  1PKT A;  1AWJ A;  1UEC A;  1PRL C;  2L0A A;  1YN8 A;  2V1Q A;  2G6F X;  2X3W D;  2GQI A;  1NEG A;  1OPL A;  4Z89 A;  2RQV A;  1UGV A;  1GCQ A;  2CSQ A;  1M3B A;  3TSZ A;  4AG2 C;  2CH4 W;  2OJ2 A;  4OMQ A;  3KFV A;  2SRC A;  5GJW B;  1CKB A;  1AVZ C;  3VRZ A;  2AK5 A;  1G83 A;  2FEI A;  2D1X A;  2LJ0 A;  2VKN A;  3I5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...