3M0QA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 5.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
b'ELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0qA00
1CSKA 4DEXA 3NGPA 2HEQA 5L23A 3H0IA 1T3LA 2J06A 1WI7A 2HSPA 2VWFA 1GL5A 1AEYA 1YWPA 3C0CA 2EVRA 2DE0X 2A37A 2FRYA 1AWOA 3H0FA 1H3HA 2KXDA 4AG1C 2JS0A 2D8HA 1MUZA 2DBKA 1XOVA 1H92A 2BTTA 4LNPA 3ULRB 3H41A 1M27C 1GBQA 4LN2A 4FSSA 2W0ZA 3KFVA 2GNCA 1UDLA 2DL3A 2EQIA 3I35A 2JMAA 2D1XA 5IHNA 1JEGA 2W10A 1BU1A 2RMOA 1PWTA 2FPFA 1K0XA 3VRYA 2VVKA 1KJWA 1BBZA 2C0TA 1IO6A 1WYXA 2F2VA 1RLPC 1AD5A 1M30A 1RUWA 4JJCA 2FG0A 4LE9A 1WDXA 3UF4A 1KSWA 1UJ0A 3VS0A 1NEGA 2YSQA 4AFQC 1HD3A 2J6KA 2V1QA 1VYUA 2DMOA 1V1CA 2EGCA 3I9QA 1NLOC 2BZXA 1QKWA 1X43A 1KIKA 5IH2A 1QLYA 2CH4W 3REBB 2O2OA 4JPBW 1Y57A 2K3BA 1PRLC 1SHFA 5I11A 2AZSA 1M3AA 1ZBJA 1UHFA 5I22A 3EHQA 1AOJA 2PTKA 2MCNA 4OMMA 2GTOA 4HVVA 1UHCA 1OEBA 1NEBA 1YCSB 2LMJA 2LNHB 2DM1A 2GQIA 4J9BA 3QWXX 2FRWA 2I0NA 2L0AA 3M0RA 4X1VA 5FWCA 2O88A 1E6GA 1OPKA 1VA7A 2CUBA 2KGTA 4RTTA 1K76A 2J6OA 2OAWA 1W6XA 1TG0A 1PKSA 1X6GA 4OMLA 3VS4A 1I07A 2FO0A 2ED0A 3UA7A 3JV3A 3THKA 3A98A 2NWMA 2LQNA 1JU5C 1QWFA 4WCIA 5IHIA 1K9AA 2MIOA 2MOXA 4J9CA 4LUDA 1H8KA 2AK5A 4M4ZA 1QKXA 2FEIA 1X6BA 2L2PA 3UA6A 1BK2A 2CREA 1MV3A 1S1NA 2HDAA 1VYVA 2YUNA 2DL5A 2NUZA 2BZYA 1YNZA 4QT7A 4RTVA 2JW4A 4AFUC 1ABQA 4ZNXA 1AWWA 2DL7A 1UJYA 2LJ1A 1UUEA 1WXTA 2P4RA 1GCQA 2GTJA 2PZ1A 1YP5A 3VS7A 2DRMA 4HXJA 2VKNA 1Z9ZA 2KROA 2EYYA 1W1FA 1ZX6A 2L3SA 2KYBA 2B86A 2KNBB 5IHKA 1E7OA 1PRMC 5HCKA 1TUCA 2LZ6B 2DNUA 1JO8A 3UATA 2LCSA 1JXMA 1U5SA 2JMCA 1M3BA 2EYXA 1WX6A 2RPNA 2HCKA 4K11A 4J9DA 1UFFA 1ZUUA 1AVZC 1WFWA 4F16A 1ZUKA 4F17A 1QCFA 1QWEA 1PHTA 1GFDA 2K6DA 3PE0A 4Y92A 2RNAA 4LUEA 2GGRA 2A36A 1ZSGA 2EGAA 1U06A 4AFZC 1U3OA 4AFSC 2RQUA 2CSIA 1ABOA 2DVJA 2O9SA 1YN8A 1YWOA 3H0HA 4CC3A 1GCPA 1Y0MA 2RF0A 2JM8A 1SPKA 4J9IA 4D8KA 2DJQA 2JTEA 2GBQA 4JZ4A 4RTZA 1T0JA 2C0IA 1UECA 2EKHA 3VS2A 2SEMA 2CDTA 4OMNA 4OMQA 1UE9A 2JS2A 3EGUA 2KR3A 1GRIA 1WLPB 2D0NA 2OI3A 4J9FA 1MV0B 3REAB 2DX1A 2AKKA 3QWYA 1M8MA 3EHRA 3I5SA 3GBQA 5IXFA 4ORZA 2BZ8A 4RTXA 2ROLA 3TSZA 3R6NA 2A08A 1A0NB 1RI9A 2YUPA 2ECZA 3VS6A 2LJ0A 2KXCA 2DL4A 1SRMA 1B3QA 2LQWA 1J3TA 3VRZA 1JQQA 2KRSA 2ENMA 1I0CA 3TVTA 2LP5A 3EG0A 1W70A 4EIKA 2KT1A 3SEMA 2EPDA 2DYBA 5FWBA 4J9EA 4CC4B 3RNJA 2J05A 5GJVB 4JZ3A 1BB9A 2SRCA 2IIMA 4HCKA 4D8DA 2ESWA 2DA9A 4R0KA 2DBMA 1EFNA 2YDLA 2ROTA 2DF6A 1X2QA 1NYFA 3PVQA 2JXBA 1NM7A 4CC2A 2F2XA 2CH4A 2HBWA 2ABLA 4J9HA 1UGVA 1SHGA 1TUDA 4AG2C 4A63B 3M0UA 1PKTA 1FMKA 2EYZA 2CUDA 3M0SA 1OOTA 3RBBB 2K79A 1T3SA 2EYWA 5EC7A 2X3WD 1I1JA 2RQWA 3TSWA 4HVWA 2E5KA 2FPEA 2M51A 1AZGB 2DLPA 1PNJA 3VS3A 3NMZC 3ZL7C 3PVLA 1OPLA 4JJDA 1JXOA 2FPDA 2G6FX 2LJ3A 1Z9QA 2RQVA 3LH5A 1G2BA 2JM9A 4RTWA 1RLQC 4OMPA 1UTIA 1NG2A 2CT3A 2JT4A 1KFZA 1GCQC 1NLPC 2F2WA 4Z88A 2RN8A 2KRNA 2AKLA 2AZVA 1SSHA 4GLMA 4J9GA 4RTUA 1WA7A 2A28A 1WXUA 2XMFA 2D8JA 3I5RA 5ECAA 4E6RA 1G83A 2M0YA 4HVUA 2KBTA 1GFCA 3IQLA 1X27A 3O5ZA 3VS5A 2YUOA 1HJDA 4GBQA 2L3PA 2C0OA 1E6HA 2H8HA 1T0HA 1X69A 1AWXA 1HSQA 1K1ZA 1OV3A 2RQRA 1WXBA 4RUGA 2EBPA 1LCKA 3CQTA 3VS1A 2X3XD 1CKAA 3SHWA 3M0QA 4JJBA 2CT4A 4Z89A 1X2KA 2V1RA 1K0SA 4OMOA 1B07A 2J6FA 2YT6A 3U23A 2RQTA 3EG1A 2O31A 4KRTA 2K2MA 2PNIA 2K9GA 5IXBA 2DRKA 4RTYA 2EGEA 1ZUYA 5GJWB 3NPFA 4F14A 2ED1A 3M0PA 1ARKA 3EG3A 2QDLA 2KE9A 2KEAA 1AZEA 1SRLA 1UG1A 4Z8AA 1AWJA 4CC7A 1VYTA 1ZLMA 2OJ2A 2DL8A 1GBRA 1CKBA 2LX7A 4DEYA 5FW9A 4ESRA 1FYNA 1NYGA 2KRMA 2YUQA 3NHNA 1N5ZA 2KT8A 1SEMA 2J7IA 3EG2A 1K4US 2CSQA 2K7AA 4IIOA 2EW3A 3FJ5A 3M0TA 1M3CA 4IIMA 2O9VA 2KYMA 2L3QA 1WIEA 2DILA
chains in the Genus database with same CATH superfamily
2QEXT 3MP6A 2HEQA 5KYXB 2CZ7B 2VWFA 1VIFA 4JDSA 4C92A 1XTDA 1YWPA 2EVRA 3CBPA 2A37A 3WVDB 2FRYA 1H3HA 1BI0A 2KXDA 4AG1C 4P5NA 1MUZA 2RM4A 4QW2A 4C92E 4D6WA 1WQ7A 4ZN1A 3H41A 4LN2A 4FSSA 3KFVA 2E5QA 2QA4Q 4UC4A 1SG5A 2WSCE 3QZ5B 5IHNA 3MJXA 2MI6A 2K3YA 2W10A 1W2BP 3VKIA 5GAN6 2X4JA 3M53A 3VRYA 1VQ9T 2O4XA 1IO6A 1RUWA 1D3BA 2KDSA 1VQKQ 2YLBA 3UF4A 1KSWA 4WF2A 1UJ0A 2QDYB 4KUIA 2E3HA 1VQ6Q 4F7UA 2CKKA 1HD3A 3M9QA 3RESA 2RJEA 2DMOA 2EGCA 3I9QA 2BZXA 1QKWA 1X43A 3JAME 2JOYA 1Q81C 1S72T 4F7UE 2GFUA 2DTHA 4C8QG 1M3AA 3UT1A 1VQOQ 3DB3A 4PJOB 2PTKA 1R0BG 2MCNA 5GMKe 3VYHB 1UHCA 1VQ7T 2ZCFB 4FYVB 1QVFS 4OVAA 2GQIA 4J9BA 2FRWA 3PMTA 2K2VA 5GAOr 1O75A 1E6GA 1WZOA 2OTLT 4RTTA 1K8AU 1R8OB 2J6OA 5A0DA 2DXBA 2F1LA 1RAGB 4OMLA 1IRXA 3QO3A 3UA7A 1NPRA 2JTFA 3JCMe 2DXCA 2R57A 3OSVA 5DY9A 3HRTA 2LQNA 5KCHA 4XTVA 7AT1B 3RUXA 3JCMc 2P0KA 4DBFA 4WCIA 5CKHA 1M9SA 2MIOA 3OYIA 3VU3C 4M78F 4PNOA 3OW2A 1X6BA 1KQ2A 1BK2A 2V8KA 3OYEA 2LNVA 3OBYA 1RAHB 2DL5A 2NUZA 3A8LB 5D6YA 5D6XA 1VQPA 1YIJA 4E2FB 4L5GA 3N5BB 2E6ZA 4DBRA 2KK4A 4AFUC 3ZEHA 2CP3A 1WHLA 4KGVB 2M16A 1WXTA 3CMAT 5GANf 2L89A 4HXJA 4M7AD 3TREA 2VKNA 2FZGB 4KGZB 1TWBA 3MEAA 4ZN3A 2CGHA 1W1FA 3L2RA 1LOJA 3J81E 1KQSS 3SWNA 5KYUA 5IHKA 1E7OA 2NLUA 3CCVA 3OYBA 3INZA 5HCKA 1YJWQ 2LCSA 1JXMA 3GLXA 2JMCA 2A7YA 3D7SB 5LJ3j 4C92C 5GAMj 5A2QE 1QVPA 3QHSA 3CCUT 1KK7A 1JJ2P 3M57A 4F17A 3NTIA 2CZ0B 1PHTA 3CCJA 3PE0A 1U06A 3CD6Q 5CO7A 2DIGA 3RIRA 1ABOA 4C0GA 1YHQT 5GAOl 4M75F 1YWOA 4JLGA 1GCPA 5CK9A 4FCYA 3L2ZA 4KBMB 1B34B 3CPWA 2DJQA 2JTEA 3AHUA 3EGXA 1BI2A 2XHCA 3LH0A 2DEQA 2DJZA 4BE1A 2KR3A 8AT1B 3G71A 4QQDA 3FB9A 1VUBA 2PUOB 2RI2A 2X35A 3FIFA 1N8RR 3R6NA 1Q7YU 1PSEA 2DK3A 3OW2P 2YUPA 3VS6A 2LJ0A 4QQGA 4JS5A 2DL4A 1B3QA 1VQ5T 1J3TA 3VRZA 5KYYB 1JQQA 2WACA 2RHUA 4GLKA 3P8BB 1W70A 4EIKA 3RKWA 5GAOn 2HKQB 4MDWA 4XU2A 1KG1A 1ZBXA 3META 1BB9A 4IKFA 2IIMA 4HCKA 4PFZA 2ESWA 2DIQA 2DA9A 9ATCB 2DBMA 3GIBA 1KQ1A 1YJNA 3QDRB 2HKNA 3GNGA 2HBWA 2ABLA 4IUTA 2RJFA 4J9HA 1D09B 1W4SA 4IUVA 4OB1B 4A63B 1K73R 3M0UA 3X24B 4M77G 2LC4A 3HRUA 2CUDA 1GXIE 2DFUA 2COWA 3VUZA 1IB8A 2VB6A 2K79A 1T3SA 4XTYA 2PU9B 2ZPFB 3FLGA 4M78A 3DKMA 2E5KA 2FPEA 5GANe 3CMET 2WSFE 3OMCA 3NMZC 2DPPB 1D1CA 1NPPA 3CCQA 5CKEA 5LL6S 2LJ3A 4M78E 3CPWP 4ZGEB 1WNLA 2JM9A 1KFZA 4OMPA 2DEUA 2KRNA 2AZVA 5J3BA 4J9GA 2X4XA 4JUVA 3TEEA 3C94A 2Z0WA 2RD1A 3E9FA 3SWNC 5CKFA 4ZTFA 2KBTA 4XU3A 4AMCA 3V8JA 4BE2A 3SDZA 3O5ZA 1WGSA 2E41A 1NZ9A 2CYZB 4QKUA 2YUOA 3OYGA 5KH6A 3EG9A 1D0ZA 1X69A 1JBMA 3OS5A 1AWXA 2JJ9A 2RQRA 3CCSQ 1VQPT 1YIJT 4E7SA 1WXBA 4C5IA 2VXFA 4RUGA 2ZPHB 3RMQA 1LCKA 5DLQE 1MMNA 2EFIA 2X3XD 1Q95G 4C92B 4LD6A 4BD3A 4QVDA 2IG0A 4BDYA 4FYWB 3MPUB 1N27A 2E70A 1M90U 4M75A 1BI3A 1B07A 2VGMA 2YT6A 2JZ2A 2O31A 3CC2Q 2PNIA 4M75E 3TU4K 5GMKm 4Y91A 4E7HA 3CCRA 1SKUB 2WSEE 3CC4Q 2QDLA 5HK3A 2KEAA 1AZEA 1R77A 1WJSA 1UG1A 2BKDN 1AWJA 4OP0A 1Q86U 2E65A 1VQMA 3CCJT 2O4XB 4XAXB 4O5VA 4JRQA 5FW9A 4EDUA 1D3BB 3G7ZA 3MO8A 1NYGA 1YI2Q 1K8AC 1ZSZA 1SEMA 1JB0E 3JSCA 3H8ZA 4F7UB 4IUUA 2K7AA 4IIOA 3FJ5A 4BE0A 2XU8A 3BY7A 4C0DC 2CDTA 2DVEA 3X25B 3G4SA 4KULA 5AYFA 1O9SA 1T3LA 3H0IA 3G6EA 1WI7A 2D0QB 2HSPA 2KSSA 4J8OA 2DTOA 1QVGA 1GL5A 3QBYA 2NUPB 2DE0X 3PFSA 4DBHA 3LWIA 2JS0A 2D8HA 1EIFA 1D0XA 2DBKA 5GAOp 2BTTA 5LJ3d 5GAMd 2NUTB 2PQWA 2W0ZA 1X01A 3M58A 1UDLA 1Q82C 4O6JA 3FRNA 2EQIA 3I35A 1MNEA 4XK8E 5D7UA 3E19A 2JMAA 3CBMA 2D1XA 3LWHA 1VQ8A 5CIUA 1JEGA 4MDXA 3CCLA 5FLXE 1IZ6A 4M78C 4HA8A 1VQLT 1PWTA 2HD0A 3CCEQ 1RI0A 1YJ9Q 2ZAEA 2EWNA 4C5GA 2R5MA 3X20B 2PVGB 3QPHA 1YITQ 1M30A 2DAQA 1WDXA 5LJ5f 3JCMV 5I21A 3ASKA 4OGEA 2V1QA 2K5LA 1R0CB 1W2BA 4JPBW 2K3BA 1PRLC 3MHXA 2OAUA 3GP8A 1SHFA 5I11A 2AZSA 2QEXQ 3HL8A 3EHQA 2ZPBB 1AOJA 3I56Q 2K5IA 4LXCA 4R56A 1RAFB 2GTOA 1WQWA 1PD0A 4HVVA 2ZGWA 4B6MA 2QGFB 2Y4XA 3SWNB 1VOMA 3C12A 3CCQT 1YCSB 3CC7T 4BI3A 1MGQA 2O01E 1KD1R 2VC8A 4DA4A 4JLIA 1BYMA 3GF5A 4A53A 4E7JA 3M0RA 4FW1A 4X1VA 3J7AF 1YITT 5FWCA 1OPKA 5LJ5h 4BACA 4JRIA 1K76A 1TG0A 3OYYA 1PKSA 3M59A 4M75C 1X6GA 3RKYA 3EFOA 1QVGP 3VS4A 2DD4A 4IUPA 3JCMX 3JV3A 2KI7A 2LCCA 3THKA 4M7DG 3HPWA 3T9NA 1G3WA 1JU5C 2V8JA 1VQ9Q 2MOXA 4M4ZA 1QKXA 2VGNA 3JRZA 4OMFB 2DXUA 1AHJB 1S1NA 5GMKi 2HDAA 5IN1A 4ELZC 1VYVA 3I56T 1K9MC 2QAZA 4M77D 4M7AA 2EQMA 2L8DA 4FIBA 4LDYA 4AT1B 1ABQA 4ZNXA 1AWWA 2DL7A 3HKSA 2LT1A 2LJ1A 1S72Q 1GCQA 1ZSZC 2QQSA 2RK1A 2PZ1A 2DRMA 4M7AE 3X28B 2VUBA 2RK2A 5CKBA 2XI9A 2EYYA 1ZX6A 2FL7A 1RL2A 3M5AA 4L59A 1PRMC 1VQ7Q 2LZ6B 1JO8A 4WTOB 4L6V5 3V8LA 3UATA 1FWZA 4C8QF 2E1HA 1M3BA 2EYXA 4J83A 2RPNA 4C0DB 2V8IA 4J9DA 1AVZC 3V7CA 4F16A 2R58A 2OTLQ 2K6DA 4PL6A 3X26B 4Y92A 2RNAA 4FL6A 4B9XA 2MK5A 2XDPA 3CD6A 2X4WA 2RQUA 2DVJA 3BFMA 3I55A 3ZFJA 2QQBA 2RHYA 3CCMA 2JM8A 2MYSA 5LJ5e 2XG8D 2GQVA 2HQHA 4RTZA 2DXTA 1TH7A 2C0IA 3ER0A 4RMOA 1JJ2A 3SD4A 3EFSA 2F69A 4ANJA 1EZZB 1QVFP 2EKHA 3VS2A 2PVOB 2BE9B 3G6ET 2QQRA 3L2VA 2SEMA 4OMNA 4OMQA 1UE9A 3EGUA 1WLPB 4OF1A 5GANj 1PSFA 2OI3A 4VUBA 3S3OA 4M78B 3EHRA 3CMAQ 4RG8A 3GBQA 1VQ4A 1IXDA 2BZ8A 4RTXA 4LDXA 1XNIA 4DBQA 2A08A 3E9GA 2LTOA 1VIEA 1M90C 3OBWA 2OTJT 1VQ8T 4X9DA 3EG0A 4A4EA 3CCLT 1U8RA 2KT1A 4J6YA 3SEMA 1LNXA 5FWBA 4DOVA 3QZ9B 3CCUQ 2J05A 1N8RU 3EFRA 2ATCB 3OYNA 5J26A 1EFNA 2YDLA 1N9SA 2ROTA 1WHMA 1Q86C 3OS2A 3PVQA 1YHQQ 2DETA 4IURA 1X75C 1PM3A 1KQSP 1FMKA 1F1BB 1Q82U 1I8FA 3M0SA 1OOTA 3KUFA 2ZPIB 5EG2A 1VQNA 2EYWA 2KVQG 4M75B 1I1JA 3E1SA 3C95A 1KD1C 1KC8C 3MEWA 2CP0A 1Y96A 2EKOA 1AT1B 3VS3A 3ZL7C 3JCMd 1JXOA 2G6FX 4PJOG 4M7AC 2RQVA 3GOXA 2GFAA 3ZBDA 1K73U 2EQUA 4RTWA 1RLQC 4MZMA 1MMAA 3VV0A 1GCQC 2QYZA 1BCOA 1NLPC 1MMDA 1BCMA 2RN8A 3LYIA 1QMCA 5CR2A 1PD1A 2JUFA 1VQ5Q 2MPXC 4V2SA 4FW2A 2X4YA 4RTUA 2QXFA 1WA7A 1WXUA 4ME7A 2XMFA 4Z02A 2E4HA 2L5QA 4A4FA 2QK0A 4E6RA 1G83A 3OYCA 2IVWA 4HVUA 1ZSZB 1GFCA 4LDVA 1X27A 4BI4A 5LJ3g 5GAN8 3H6ZA 5GAMg 2RHZA 3MKDA 1M4ZA 4C8QA 2L3PA 8ATCB 4N0AA 1T0HA 3WVEB 1WHGA 2LQKA 3OMGA 3QKJA 4C8QE 4KH0B 3L42A 2LT4A 2EBPA 4N4HA 2QG9B 3QYHB 1CKAA 4HCCA 2X51A 4JJBA 5KYNA 1KHIA 4BUGA 4HCZA 5KYXA 3EH2A 2V1RA 2J6FA 5GAN3 3OYKA 2RQTA 4MZTA 2DRKA 3QYGB 1P92A 3CMEQ 4RTYA 1M2VB 5GAN4 4M77F 4F14A 1TU0B 3EG3A 4XU1A 4N4GA 1IHWA 1K9MU 1VYTA 1WJRA 1ZLMA 4M7DD 2DL8A 1GBRA 1CKBA 2LX7A 4ESRA 2DYIA 1YI2A 2QQ9A 4QVCA 1N5ZA 3I55T 1K4US 4ZGDB 5GAN7 1TSFA 4GY5A 3L2WA 3CCMT 5GAN5 4X9CA 2M0OA 2L3QA 1NJIR 1CSKA 1RAIB 1C0MA 5CVIA 2J06A 1VQPQ 1YIJQ 1AEYA 1RABB 4N4IA 4DOWA 2PUKB 3UPUA 2E10A 4Y28E 3H0FA 2VV5A 4J7IA 4PKCC 1I81A 1XOVA 3ME9A 4LNPA 1G3TA 3ULRB 3OYFA 2XKOC 1GBQA 3QJYA 2RH2A 3URGA 2GNCA 3SB2A 4F04B 3PNWC 4OB3B 2K5FA 1OX8A 2M1HA 5FRNA 3EFOB 2RMOA 1U1TA 4LDWA 5CQYA 1K0XA 2VVKA 1YJ9A 1BBZA 2C0TA 2YLCA 2KMTA 2XK0A 2F2VA 1RLPC 4JJCA 2CS7A 3OSSC 2EQKA 4LE9A 1U1SA 3VS0A 3CCJQ 2YSQA 1M1KR 5KE2A 5HKCA 4C8QD 1V29B 2EAYA 3OYJA 1KIKA 4E7KA 3L1AA 5IH2A 2CH4W 5GANd 2RHIA 4M7AB 2IPOB 2O2OA 1Q7YR 1Y57A 2DZCA 2JN0A 3CXCS 5I2MA 1WHHA 2RA2A 2QEXA 1UHFA 1ZHIA 2LCLA 1VQNT 3PGGA 4E7LA 5I2SA 4XQ3A 2P0PA 1FXXA 3CCVT 2F5KA 3A8HB 4DQ2A 3JCMb 1OEBA 1NEBA 2DM1A 1D1AA 3QWXX 3F70A 2COZA 2EJGA 2I0NA 2L0AA 4J6XA 2O88A 1VA7A 2CUBA 2KGTA 2OAWA 4B9WA 2H3EB 2DTIA 3H9NA 3M4GA 2A3LA 1I07A 3OY9A 2COYA 1C1AA 3A98A 5A0LA 2NWMA 3A8MB 1YFNA 5IHIA 1VQLQ 2Y90A 5LJ5j 1VQ9A 4LUDA 4J9CA 4FU6A 2QI2A 4M77A 1H8KA 3HFOA 1ZQ1A 1KD1U 1KC8U 4JRKA 1XJWB 4NOYA 2L2PA 4Q5WA 3UA6A 3OA6A 1MV3A 2MWPA 2FZKB 2YUNA 1YJNQ 2BZYA 4PJMA 5KYWA 5GMKj 4M77E 3JB9J 1N8RC 1YNZA 2HMAA 4QT7A 4RTVA 3G71T 1JRIA 1UJYA 3M54A 2BE7D 2CP5A 2GTJA 1YP5A 3SFMA 1RAEB 1G8XA 1RAAB 3QIIA 1Z9ZA 4XTWA 1QCNA 4IUQA 1Q81R 2QA4A 2KNBB 4C92G 4PJOD 2YRDA 3DLMA 3HHTB 1TUCA 3C4SA 3JCMQ 4EMKA 3CC7Q 3CCQQ 2P4TA 2FYKA 4EMGA 1I4K1 4K11A 2OX7A 1ZUUA 4F7UF 4HT9A 1WFWA 1ZUKA 4XTXA 3KXTA 1HK9A 1QWEA 4J6WA 1VQKA 1UGPB 1D1BA 4PFPA 4LUEA 1ACMB 2GGRA 1K73C 1DJ7B 1VQ6A 2EYQA 1ZSGA 2EJ9A 4AFZC 1YJNT 3V7RA 3CBOA 3UWNA 4A4HA 4FYYB 1LPLA 2O9SA 1HYOA 1G3SA 3JCMg 3JB9F 1Y0MA 2RF0A 1XQHA 4J9IA 3WXMB 1T0JA 1VQOA 2RJCA 1UECA 1EX4A 4F7UG 5D6WA 1IHVA 4FT4A 4M7DF 2JS2A 3CEYA 1GRIA 2MWOA 4J9FA 1MV0B 3REAB 5KYUB 3QWYA 1M8MA 2GCXA 3RERA 3I5SA 4XU0A 3MCAB 3JB9G 2DERA 3PMIA 4BI8B 1IREB 1A0NB 1RI9A 1QVFA 2KXCA 3EAEA 2F5TX 1SRMA 2LQWA 3LLRA 2QGGA 4YTLA 2KRSA 3AT1B 2ENMA 1I0CA 4KT0E 3TVTA 3R6OA 1SF9A 4NL3A 5GAOm 1HXDA 2EPDA 3KBGA 1M1KC 4FT2A 4OGCA 4CC4B 2PVDB 2AHJB 3RNJA 1N6AA 4HKEA 1VQMQ 4R0KA 2YRCA 2LRQA 4NS5A 1M8VA 2DF6A 1X2QA 3EGXB 1UGRB 1NYFA 2H3JA 3QDFA 1NM7A 1ZA2B 3A8GB 2F2XA 4AG2C 2E6NA 1N9RA 3VJPA 2AT1B 1PKTA 1RACB 4JJNK 3GNFB 2BIVA 3RBBB 3G4SQ 3JB9I 1QW1A 3G6EQ 4M77C 3OB9A 2RQWA 3A1PA 3M56A 2HAXA 3RMSA 3CCRT 1YJWA 1OPLA 3JCMh 4FSXA 2XDBA 1Z9QA 4BDZA 5IT9E 1KQSA 3LH5A 1G2BA 1M2OA 1NG2A 2CT3A 2JT4A 1VQMT 2K57A 3NTHA 4KGXB 3OYDA 2CP2A 5DLOA 2EQJA 2AKLA 1YBYA 2C06A 1VQ5A 2ZPGB 3S3MA 2OTJQ 4GLMA 1VQ8Q 5GMKl 2A28A 3EGDA 3CCLQ 1M1FA 2HSEB 5ECAA 2M0YA 3IQLA 4EMKC 3BW1A 2V26A 3VS5A 3FEOA 4GBQA 4RCBA 4FM4B 1HJDA 4J7FA 2C0OA 1E6HA 2H8HA 3G1JA 3FC3A 1W2BS 3G4ST 2LVMA 3LW5E 1OV3A 2EJFA 1OI1A 4PJNA 3CQTA 3VS1A 1G5VA 1KHCA 3M0QA 1Y07A 3QSUA 3MEUA 2Y4YA 5GAN2 3JCMJ 4ZTJA 2NYSA 1OU9A 1M5Q1 3MP8A 4R55A 1X2KA 1K0SA 4OMOA 2QA4T 2NUPA 2HZYA 5M9OA 3EG1A 2R5AA 3M55A 4RKUE 3O8VA 4MZPA 3CMEA 2EGEA 5GANg 5GJWB 4M7DA 2NUTA 1BIBA 2ED1A 3RR6A 1ARKA 1SRLA 2RJDA 5LJ5d 1VQKT 4M7DE 2GF7A 1VQ6T 3J80E 1FYNA 2MF2A 3EG9B 2A0FB 2KT8A 2QTVA 4C5EA 2J7IA 4PJOF 2CSQA 2EW3A 3M0TA 5CCAA 4MMKA 4IIMA 2KYMA 1WIEA 2DILA 4A4KA 1VQOT 1QCOA 1OZ3A 4DEXA 3NGPA 1C6VX 2DO3A 1WPYA 5L23A 5L8RE 2HL5C 3C0CA 2HL3A 5C0MA 3QXEB 3VYGA 1AWOA 2E12A 1OULA 4KUDK 1I5LA 4RCCA 5CKDA 4C92D 2G3RA 1H92A 5AT1B 1M27C 2YRVA 1NJIU 3JB9H 1TTHB 3HTRA 4TVRA 1UGSB 2DL3A 4M78G 1BIAA 4LD9K 5CQXA 4PJLA 2I2LA 2RB6A 2RI3A 2D9TA 1BU1A 1M1GA 2YXYA 2FPFA 1OQKA 1KJWA 4A54A 2KQWA 1WYXA 3P8HA 1AD5A 2FG0A 5FU7C 1FX7A 1UEBA 2CP7A 4M77B 1NEGA 5HK0A 4AFQC 2J6KA 3CCSA 1JJ2S 1VYUA 1V1CA 1NLOC 3I55Q 3DLLA 3BE3A 2CP6A 1I5OB 1PG5B 5KYWB 5GANh 1QLYA 3CCMQ 3REBB 3L2QA 1TUGB 1K8AR 1D0YA 4PFOA 1ZBJA 5I22A 4XTUA 3HSBA 2HQEA 3CC2A 4OMMA 3V8KA 3CXCA 3JB9D 1M1KU 4FYXB 1YJWT 2QQAA 2LMJA 1MHNA 2LNHB 3JCMW 3S6WA 3OYMA 4EMKB 3FDRA 3CC4A 1VQ4Q 4M75G 5LJ3f 5A0GA 5GAMf 5DM7R 4ATOA 1W6XA 3HP9A 1TXQA 2QASA 5FRMA 3CD6T 4BY6C 2FO0A 2ED0A 1Y7XA 4II1A 3OQ5A 3OW2S 2LDMA 1Q82R 2M02A 1QWFA 1VQLA 4XTZA 1K9AA 2JNGA 4M7DC 2AK5A 1ZA1B 2FEIA 2P0QA 4JRPA 2CREA 4PK4A 2XDDA 3OYLA 1FMWA 2KY9A 2JW4A 2RO0A 2X9HA 1X6OA 1UUEA 2P4RA 5KCOA 1VQ4T 4PJOA 3VS7A 3OYAA 4QVZA 5LJ3h 4MMLA 5GAMh 2KROA 4KH1B 1VQNQ 3LGFA 2YWWA 1OX9A 2ZPEB 2L3SA 2KYBA 3V7SA 2B86A 4PJOE 3CCVQ 2DNUA 3CC7A 1NBEB 2XICA 1U5SA 1WX6A 2HCKA 2HBPA 4NL2A 3CCEA 1UFFA 1BI1A 5FROA 1YITA 1QCFA 1UGQB 4CRIA 1OZ2A 1GFDA 3CPFA 2MMPA 2A36A 3CPWS 2EGAA 1Q81U 1U3OA 4AFSC 3CXCP 2CSIA 1YN8A 5IAYA 4CC3A 3H0HA 4PJJA 2BUDA 1SPKA 4D8KA 2GBQA 4JZ4A 2VYTA 3NFCA 4QQ6A 1LVKA 2FHDA 3I56A 3QJ6A 1WHKA 4C8QC 2B8AA 2D0NA 4N0AC 5FU6C 3G71Q 2DX1A 2CZ1B 1IGUA 1PC0A 2AKKA 4C0FA 2ZZDA 2YHTA 5IXFA 3RDVA 4EPCA 4ORZA 1K9MR 1H3ZA 2ROLA 3TSZA 4HT8A 2VASA 5FU7B 1SSFA 2MAMA 2ECZA 1QP3A 3OS1A 2M9UA 2KAFA 4ELYC 2RHXA 2LP5A 2HQXA 2VXEA 3HRSA 4E7IA 5LJ3e 3NTKA 5GAMe 1RADB 2FZCB 4OB0B 2DYBA 3EGDB 4J9EA 1YCYA 1OYXA 5GJVB 4JZ3A 4RG2A 2SRCA 3P8DA 5GAOq 4C92F 4D8DA 4M7AF 2JVVA 4ZGJB 5CAIA 3OYHA 4HCBA 2LQ8A 3CCST 3GPLA 3JCMP 2JXBA 4CC2A 2CZ6B 1B34A 2CH4A 1UGVA 1SHGA 1TUDA 3PIOA 1S72A 2EYZA 5LJ5g 4LDUA 2XD0A 2RI5A 5KE3A 2E64A 5EC7A 2X3WD 3CC2T 4BY6B 3TSWA 4HVWA 3PTAA 4M7AG 2M51A 1VQ7A 1AZGB 2DLPA 1PNJA 3PVLA 4JJDA 3BDUA 3CC4T 3UDCA 1OU8A 2FPDA 2DD5A 1Y71A 2XIDA 4M78D 2K3XA 4OB2B 4M7DB 1UTIA 1V76A 5KYYA 1TOVA 2F2WA 2OTLA 3M4YA 4PJOC 4Z88A 1H641 1M2VA 1SSHA 1IGQA 3MP1A 1NJIC 1YI2T 2OTJA 4CI0C 3RKXA 2FB7A 2JTMA 2LX9A 3A8OB 3TCJA 3VUBA 3L2UA 2D8JA 3I5RA 2L3RA 4PLIA 1QQJA 1M90R 4C0ZA 2P84A 4PLLA 3FJPA 1B7TA 6AT1B 3HFNA 1HSQA 1K1ZA 4X34A 2HNIA 2AIRB 1UB4A 3QG1A 1G3YA 1WJQA 2FVUA 5J39A 2K4YA 3SHWA 3CMAA 1Y96B 5C6SA 1Q86R 2CT4A 4Z89A 4BB7A 3A5ZB 3MEVA 3TQ7P 2E3IA 1BKBA 4E47A 2QTXA 3U23A 4KRTA 2K2MA 4JS4A 2K9GA 4A4GA 1TS9A 5HY6A 5IXBA 4M75D 4EMHA 1QP2A 1ZUYA 1NE8A 3S3NA 3PT9A 3CCRQ 3NPFA 3M0PA 3JCMf 3CCET 1KC8R 1YJ9T 2KE9A 2D6FA 3CCUA 3EH1A 4Z8AA 4CC7A 2OJ2A 3BDLA 1PCXA 2DZ9A 2EIFA 3QUIA 3LX7A 4C5HA 4DEYA 1FMVA 3DB4A 4E7ZA 4C8QB 2DKGA 1Q7YC 2KRMA 2YUQA 3E2UA 3NHNA 5FU6B 1MMGA 1MNDA 3PIPA 3EG2A 3Q1JA 5GMKh 1YHQA 3LGLA 4J5YA 1M3CA 2O9VA 1QVGS 1LJOA 1WHJA 3OS0A
chains in the Genus database with same CATH topology
1CSKA 4DEXA 3NGPA 2HEQA 5L23A 3H0IA 1T3LA 2J06A 1WI7A 2HSPA 2VWFA 1GL5A 1AEYA 1YWPA 3C0CA 2EVRA 2DE0X 2A37A 2FRYA 1AWOA 3H0FA 1H3HA 2KXDA 4AG1C 2JS0A 2D8HA 1MUZA 2DBKA 1XOVA 1H92A 2BTTA 4LNPA 3ULRB 3H41A 1M27C 1GBQA 4LN2A 4FSSA 2W0ZA 3KFVA 2GNCA 1UDLA 2DL3A 2EQIA 3I35A 2JMAA 2D1XA 5IHNA 1JEGA 2W10A 1BU1A 2RMOA 1PWTA 2FPFA 1K0XA 3VRYA 2VVKA 1KJWA 1BBZA 2C0TA 1IO6A 1WYXA 2F2VA 1RLPC 1AD5A 1M30A 1RUWA 4JJCA 2FG0A 4LE9A 1WDXA 3UF4A 1KSWA 1UJ0A 3VS0A 1NEGA 2YSQA 4AFQC 1HD3A 2J6KA 2V1QA 1VYUA 2DMOA 1V1CA 2EGCA 3I9QA 1NLOC 2BZXA 1QKWA 1X43A 1KIKA 5IH2A 1QLYA 2CH4W 3REBB 2O2OA 4JPBW 1Y57A 2K3BA 1PRLC 1SHFA 5I11A 2AZSA 1M3AA 1ZBJA 1UHFA 5I22A 3EHQA 1AOJA 2PTKA 2MCNA 4OMMA 2GTOA 4HVVA 1UHCA 1OEBA 1NEBA 1YCSB 2LMJA 2LNHB 2DM1A 2GQIA 4J9BA 3QWXX 2FRWA 2I0NA 2L0AA 3M0RA 4X1VA 5FWCA 2O88A 1E6GA 1OPKA 1VA7A 2CUBA 2KGTA 4RTTA 1K76A 2J6OA 2OAWA 1W6XA 1TG0A 1PKSA 1X6GA 4OMLA 3VS4A 1I07A 2FO0A 2ED0A 3UA7A 3JV3A 3THKA 3A98A 2NWMA 2LQNA 1JU5C 1QWFA 4WCIA 5IHIA 1K9AA 2MIOA 2MOXA 4J9CA 4LUDA 1H8KA 2AK5A 4M4ZA 1QKXA 2FEIA 1X6BA 2L2PA 3UA6A 1BK2A 2CREA 1MV3A 1S1NA 2HDAA 1VYVA 2YUNA 2DL5A 2NUZA 2BZYA 1YNZA 4QT7A 4RTVA 2JW4A 4AFUC 1ABQA 4ZNXA 1AWWA 2DL7A 1UJYA 2LJ1A 1UUEA 1WXTA 2P4RA 1GCQA 2GTJA 2PZ1A 1YP5A 3VS7A 2DRMA 4HXJA 2VKNA 1Z9ZA 2KROA 2EYYA 1W1FA 1ZX6A 2L3SA 2KYBA 2B86A 2KNBB 5IHKA 1E7OA 1PRMC 5HCKA 1TUCA 2LZ6B 2DNUA 1JO8A 3UATA 2LCSA 1JXMA 1U5SA 2JMCA 1M3BA 2EYXA 1WX6A 2RPNA 2HCKA 4K11A 4J9DA 1UFFA 1ZUUA 1AVZC 1WFWA 4F16A 1ZUKA 4F17A 1QCFA 1QWEA 1PHTA 1GFDA 2K6DA 3PE0A 4Y92A 2RNAA 4LUEA 2GGRA 2A36A 1ZSGA 2EGAA 1U06A 4AFZC 1U3OA 4AFSC 2RQUA 2CSIA 1ABOA 2DVJA 2O9SA 1YN8A 1YWOA 3H0HA 4CC3A 1GCPA 1Y0MA 2RF0A 2JM8A 1SPKA 4J9IA 4D8KA 2DJQA 2JTEA 2GBQA 4JZ4A 4RTZA 1T0JA 2C0IA 1UECA 2EKHA 3VS2A 2SEMA 2CDTA 4OMNA 4OMQA 1UE9A 2JS2A 3EGUA 2KR3A 1GRIA 1WLPB 2D0NA 2OI3A 4J9FA 1MV0B 3REAB 2DX1A 2AKKA 3QWYA 1M8MA 3EHRA 3I5SA 3GBQA 5IXFA 4ORZA 2BZ8A 4RTXA 2ROLA 3TSZA 3R6NA 2A08A 1A0NB 1RI9A 2YUPA 2ECZA 3VS6A 2LJ0A 2KXCA 2DL4A 1SRMA 1B3QA 2LQWA 1J3TA 3VRZA 1JQQA 2KRSA 2ENMA 1I0CA 3TVTA 2LP5A 3EG0A 1W70A 4EIKA 2KT1A 3SEMA 2EPDA 2DYBA 5FWBA 4J9EA 4CC4B 3RNJA 2J05A 5GJVB 4JZ3A 1BB9A 2SRCA 2IIMA 4HCKA 4D8DA 2ESWA 2DA9A 4R0KA 2DBMA 1EFNA 2YDLA 2ROTA 2DF6A 1X2QA 1NYFA 3PVQA 2JXBA 1NM7A 4CC2A 2F2XA 2CH4A 2HBWA 2ABLA 4J9HA 1UGVA 1SHGA 1TUDA 4AG2C 4A63B 3M0UA 1PKTA 1FMKA 2EYZA 2CUDA 3M0SA 1OOTA 3RBBB 2K79A 1T3SA 2EYWA 5EC7A 2X3WD 1I1JA 2RQWA 3TSWA 4HVWA 2E5KA 2FPEA 2M51A 1AZGB 2DLPA 1PNJA 3VS3A 3NMZC 3ZL7C 3PVLA 1OPLA 4JJDA 1JXOA 2FPDA 2G6FX 2LJ3A 1Z9QA 2RQVA 3LH5A 1G2BA 2JM9A 4RTWA 1RLQC 4OMPA 1UTIA 1NG2A 2CT3A 2JT4A 1KFZA 1GCQC 1NLPC 2F2WA 4Z88A 2RN8A 2KRNA 2AKLA 2AZVA 1SSHA 4GLMA 4J9GA 4RTUA 1WA7A 2A28A 1WXUA 2XMFA 2D8JA 3I5RA 5ECAA 4E6RA 1G83A 2M0YA 4HVUA 2KBTA 1GFCA 3IQLA 1X27A 3O5ZA 3VS5A 2YUOA 1HJDA 4GBQA 2L3PA 2C0OA 1E6HA 2H8HA 1T0HA 1X69A 1AWXA 1HSQA 1K1ZA 1OV3A 2RQRA 1WXBA 4RUGA 2EBPA 1LCKA 3CQTA 3VS1A 2X3XD 1CKAA 3SHWA 3M0QA 4JJBA 2CT4A 4Z89A 1X2KA 2V1RA 1K0SA 4OMOA 1B07A 2J6FA 2YT6A 3U23A 2RQTA 3EG1A 2O31A 4KRTA 2K2MA 2PNIA 2K9GA 5IXBA 2DRKA 4RTYA 2EGEA 1ZUYA 5GJWB 3NPFA 4F14A 2ED1A 3M0PA 1ARKA 3EG3A 2QDLA 2KE9A 2KEAA 1AZEA 1SRLA 1UG1A 4Z8AA 1AWJA 4CC7A 1VYTA 1ZLMA 2OJ2A 2DL8A 1GBRA 1CKBA 2LX7A 4DEYA 5FW9A 4ESRA 1FYNA 1NYGA 2KRMA 2YUQA 3NHNA 1N5ZA 2KT8A 1SEMA 2J7IA 3EG2A 1K4US 2CSQA 2K7AA 4IIOA 2EW3A 3FJ5A 3M0TA 1M3CA 4IIMA 2O9VA 2KYMA 2L3QA 1WIEA 2DILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSK A;  4DEX A;  3NGP A;  2HEQ A;  5L23 A;  3H0I A;  1T3L A;  2J06 A;  1WI7 A;  2HSP A;  2VWF A;  1GL5 A;  1AEY A;  1YWP A;  3C0C A;  2EVR A;  2DE0 X;  2A37 A;  2FRY A;  1AWO A;  3H0F A;  1H3H A;  2KXD A;  4AG1 C;  2JS0 A;  2D8H A;  1MUZ A;  2DBK A;  1XOV A;  1H92 A;  2BTT A;  4LNP A;  3ULR B;  3H41 A;  1M27 C;  1GBQ A;  4LN2 A;  4FSS A;  2W0Z A;  3KFV A;  2GNC A;  1UDL A;  2DL3 A;  2EQI A;  3I35 A;  2JMA A;  2D1X A;  5IHN A;  1JEG A;  2W10 A;  1BU1 A;  2RMO A;  1PWT A;  2FPF A;  1K0X A;  3VRY A;  2VVK A;  1KJW A;  1BBZ A;  2C0T A;  1IO6 A;  1WYX A;  2F2V A;  1RLP C;  1AD5 A;  1M30 A;  1RUW A;  4JJC A;  2FG0 A;  4LE9 A;  1WDX A;  3UF4 A;  1KSW A;  1UJ0 A;  3VS0 A;  1NEG A;  2YSQ A;  4AFQ C;  1HD3 A;  2J6K A;  2V1Q A;  1VYU A;  2DMO A;  1V1C A;  2EGC A;  3I9Q A;  1NLO C;  2BZX A;  1QKW A;  1X43 A;  1KIK A;  5IH2 A;  1QLY A;  2CH4 W;  3REB B;  2O2O A;  4JPB W;  1Y57 A;  2K3B A;  1PRL C;  1SHF A;  5I11 A;  2AZS A;  1M3A A;  1ZBJ A;  1UHF A;  5I22 A;  3EHQ A;  1AOJ A;  2PTK A;  2MCN A;  4OMM A;  2GTO A;  4HVV A;  1UHC A;  1OEB A;  1NEB A;  1YCS B;  2LMJ A;  2LNH B;  2DM1 A;  2GQI A;  4J9B A;  3QWX X;  2FRW A;  2I0N A;  2L0A A;  3M0R A;  4X1V A;  5FWC A;  2O88 A;  1E6G A;  1OPK A;  1VA7 A;  2CUB A;  2KGT A;  4RTT A;  1K76 A;  2J6O A;  2OAW A;  1W6X A;  1TG0 A;  1PKS A;  1X6G A;  4OML A;  3VS4 A;  1I07 A;  2FO0 A;  2ED0 A;  3UA7 A;  3JV3 A;  3THK A;  3A98 A;  2NWM A;  2LQN A;  1JU5 C;  1QWF A;  4WCI A;  5IHI A;  1K9A A;  2MIO A;  2MOX A;  4J9C A;  4LUD A;  1H8K A;  2AK5 A;  4M4Z A;  1QKX A;  2FEI A;  1X6B A;  2L2P A;  3UA6 A;  1BK2 A;  2CRE A;  1MV3 A;  1S1N A;  2HDA A;  1VYV A;  2YUN A;  2DL5 A;  2NUZ A;  2BZY A;  1YNZ A;  4QT7 A;  4RTV A;  2JW4 A;  4AFU C;  1ABQ A;  4ZNX A;  1AWW A;  2DL7 A;  1UJY A;  2LJ1 A;  1UUE A;  1WXT A;  2P4R A;  1GCQ A;  2GTJ A;  2PZ1 A;  1YP5 A;  3VS7 A;  2DRM A;  4HXJ A;  2VKN A;  1Z9Z A;  2KRO A;  2EYY A;  1W1F A;  1ZX6 A;  2L3S A;  2KYB A;  2B86 A;  2KNB B;  5IHK A;  1E7O A;  1PRM C;  5HCK A;  1TUC A;  2LZ6 B;  2DNU A;  1JO8 A;  3UAT A;  2LCS A;  1JXM A;  1U5S A;  2JMC A;  1M3B A;  2EYX A;  1WX6 A;  2RPN A;  2HCK A;  4K11 A;  4J9D A;  1UFF A;  1ZUU A;  1AVZ C;  1WFW A;  4F16 A;  1ZUK A;  4F17 A;  1QCF A;  1QWE A;  1PHT A;  1GFD A;  2K6D A;  3PE0 A;  4Y92 A;  2RNA A;  4LUE A;  2GGR A;  2A36 A;  1ZSG A;  2EGA A;  1U06 A;  4AFZ C;  1U3O A;  4AFS C;  2RQU A;  2CSI A;  1ABO A;  2DVJ A;  2O9S A;  1YN8 A;  1YWO A;  3H0H A;  4CC3 A;  1GCP A;  1Y0M A;  2RF0 A;  2JM8 A;  1SPK A;  4J9I A;  4D8K A;  2DJQ A;  2JTE A;  2GBQ A;  4JZ4 A;  4RTZ A;  1T0J A;  2C0I A;  1UEC A;  2EKH A;  3VS2 A;  2SEM A;  2CDT A;  4OMN A;  4OMQ A;  1UE9 A;  2JS2 A;  3EGU A;  2KR3 A;  1GRI A;  1WLP B;  2D0N A;  2OI3 A;  4J9F A;  1MV0 B;  3REA B;  2DX1 A;  2AKK A;  3QWY A;  1M8M A;  3EHR A;  3I5S A;  3GBQ A;  5IXF A;  4ORZ A;  2BZ8 A;  4RTX A;  2ROL A;  3TSZ A;  3R6N A;  2A08 A;  1A0N B;  1RI9 A;  2YUP A;  2ECZ A;  3VS6 A;  2LJ0 A;  2KXC A;  2DL4 A;  1SRM A;  1B3Q A;  2LQW A;  1J3T A;  3VRZ A;  1JQQ A;  2KRS A;  2ENM A;  1I0C A;  3TVT A;  2LP5 A;  3EG0 A;  1W70 A;  4EIK A;  2KT1 A;  3SEM A;  2EPD A;  2DYB A;  5FWB A;  4J9E A;  4CC4 B;  3RNJ A;  2J05 A;  5GJV B;  4JZ3 A;  1BB9 A;  2SRC A;  2IIM A;  4HCK A;  4D8D A;  2ESW A;  2DA9 A;  4R0K A;  2DBM A;  1EFN A;  2YDL A;  2ROT A;  2DF6 A;  1X2Q A;  1NYF A;  3PVQ A;  2JXB A;  1NM7 A;  4CC2 A;  2F2X A;  2CH4 A;  2HBW A;  2ABL A;  4J9H A;  1UGV A;  1SHG A;  1TUD A;  4AG2 C;  4A63 B;  3M0U A;  1PKT A;  1FMK A;  2EYZ A;  2CUD A;  3M0S A;  1OOT A;  3RBB B;  2K79 A;  1T3S A;  2EYW A;  5EC7 A;  2X3W D;  1I1J A;  2RQW A;  3TSW A;  4HVW A;  2E5K A;  2FPE A;  2M51 A;  1AZG B;  2DLP A;  1PNJ A;  3VS3 A;  3NMZ C;  3ZL7 C;  3PVL A;  1OPL A;  4JJD A;  1JXO A;  2FPD A;  2G6F X;  2LJ3 A;  1Z9Q A;  2RQV A;  3LH5 A;  1G2B A;  2JM9 A;  4RTW A;  1RLQ C;  4OMP A;  1UTI A;  1NG2 A;  2CT3 A;  2JT4 A;  1KFZ A;  1GCQ C;  1NLP C;  2F2W A;  4Z88 A;  2RN8 A;  2KRN A;  2AKL A;  2AZV A;  1SSH A;  4GLM A;  4J9G A;  4RTU A;  1WA7 A;  2A28 A;  1WXU A;  2XMF A;  2D8J A;  3I5R A;  5ECA A;  4E6R A;  1G83 A;  2M0Y A;  4HVU A;  2KBT A;  1GFC A;  3IQL A;  1X27 A;  3O5Z A;  3VS5 A;  2YUO A;  1HJD A;  4GBQ A;  2L3P A;  2C0O A;  1E6H A;  2H8H A;  1T0H A;  1X69 A;  1AWX A;  1HSQ A;  1K1Z A;  1OV3 A;  2RQR A;  1WXB A;  4RUG A;  2EBP A;  1LCK A;  3CQT A;  3VS1 A;  2X3X D;  1CKA A;  3SHW A;  3M0Q A;  4JJB A;  2CT4 A;  4Z89 A;  1X2K A;  2V1R A;  1K0S A;  4OMO A;  1B07 A;  2J6F A;  2YT6 A;  3U23 A;  2RQT A;  3EG1 A;  2O31 A;  4KRT A;  2K2M A;  2PNI A;  2K9G A;  5IXB A;  2DRK A;  4RTY A;  2EGE A;  1ZUY A;  5GJW B;  3NPF A;  4F14 A;  2ED1 A;  3M0P A;  1ARK A;  3EG3 A;  2QDL A;  2KE9 A;  2KEA A;  1AZE A;  1SRL A;  1UG1 A;  4Z8A A;  1AWJ A;  4CC7 A;  1VYT A;  1ZLM A;  2OJ2 A;  2DL8 A;  1GBR A;  1CKB A;  2LX7 A;  4DEY A;  5FW9 A;  4ESR A;  1FYN A;  1NYG A;  2KRM A;  2YUQ A;  3NHN A;  1N5Z A;  2KT8 A;  1SEM A;  2J7I A;  3EG2 A;  1K4U S;  2CSQ A;  2K7A A;  4IIO A;  2EW3 A;  3FJ5 A;  3M0T A;  1M3C A;  4IIM A;  2O9V A;  2KYM A;  2L3Q A;  1WIE A;  2DIL A; 
#chains in the Genus database with same CATH topology
 2QEX T;  3MP6 A;  2HEQ A;  5KYX B;  2CZ7 B;  2VWF A;  1VIF A;  4JDS A;  4C92 A;  1XTD A;  1YWP A;  2EVR A;  3CBP A;  2A37 A;  3WVD B;  2FRY A;  1H3H A;  1BI0 A;  2KXD A;  4AG1 C;  4P5N A;  1MUZ A;  2RM4 A;  4QW2 A;  4C92 E;  4D6W A;  1WQ7 A;  4ZN1 A;  3H41 A;  4LN2 A;  4FSS A;  3KFV A;  2E5Q A;  2QA4 Q;  4UC4 A;  1SG5 A;  2WSC E;  3QZ5 B;  5IHN A;  3MJX A;  2MI6 A;  2K3Y A;  2W10 A;  1W2B P;  3VKI A;  5GAN 6;  2X4J A;  3M53 A;  3VRY A;  1VQ9 T;  2O4X A;  1IO6 A;  1RUW A;  1D3B A;  2KDS A;  1VQK Q;  2YLB A;  3UF4 A;  1KSW A;  4WF2 A;  1UJ0 A;  2QDY B;  4KUI A;  2E3H A;  1VQ6 Q;  4F7U A;  2CKK A;  1HD3 A;  3M9Q A;  3RES A;  2RJE A;  2DMO A;  2EGC A;  3I9Q A;  2BZX A;  1QKW A;  1X43 A;  3JAM E;  2JOY A;  1Q81 C;  1S72 T;  4F7U E;  2GFU A;  2DTH A;  4C8Q G;  1M3A A;  3UT1 A;  1VQO Q;  3DB3 A;  4PJO B;  2PTK A;  1R0B G;  2MCN A;  5GMK e;  3VYH B;  1UHC A;  1VQ7 T;  2ZCF B;  4FYV B;  1QVF S;  4OVA A;  2GQI A;  4J9B A;  2FRW A;  3PMT A;  2K2V A;  5GAO r;  1O75 A;  1E6G A;  1WZO A;  2OTL T;  4RTT A;  1K8A U;  1R8O B;  2J6O A;  5A0D A;  2DXB A;  2F1L A;  1RAG B;  4OML A;  1IRX A;  3QO3 A;  3UA7 A;  1NPR A;  2JTF A;  3JCM e;  2DXC A;  2R57 A;  3OSV A;  5DY9 A;  3HRT A;  2LQN A;  5KCH A;  4XTV A;  7AT1 B;  3RUX A;  3JCM c;  2P0K A;  4DBF A;  4WCI A;  5CKH A;  1M9S A;  2MIO A;  3OYI A;  3VU3 C;  4M78 F;  4PNO A;  3OW2 A;  1X6B A;  1KQ2 A;  1BK2 A;  2V8K A;  3OYE A;  2LNV A;  3OBY A;  1RAH B;  2DL5 A;  2NUZ A;  3A8L B;  5D6Y A;  5D6X A;  1VQP A;  1YIJ A;  4E2F B;  4L5G A;  3N5B B;  2E6Z A;  4DBR A;  2KK4 A;  4AFU C;  3ZEH A;  2CP3 A;  1WHL A;  4KGV B;  2M16 A;  1WXT A;  3CMA T;  5GAN f;  2L89 A;  4HXJ A;  4M7A D;  3TRE A;  2VKN A;  2FZG B;  4KGZ B;  1TWB A;  3MEA A;  4ZN3 A;  2CGH A;  1W1F A;  3L2R A;  1LOJ A;  3J81 E;  1KQS S;  3SWN A;  5KYU A;  5IHK A;  1E7O A;  2NLU A;  3CCV A;  3OYB A;  3INZ A;  5HCK A;  1YJW Q;  2LCS A;  1JXM A;  3GLX A;  2JMC A;  2A7Y A;  3D7S B;  5LJ3 j;  4C92 C;  5GAM j;  5A2Q E;  1QVP A;  3QHS A;  3CCU T;  1KK7 A;  1JJ2 P;  3M57 A;  4F17 A;  3NTI A;  2CZ0 B;  1PHT A;  3CCJ A;  3PE0 A;  1U06 A;  3CD6 Q;  5CO7 A;  2DIG A;  3RIR A;  1ABO A;  4C0G A;  1YHQ T;  5GAO l;  4M75 F;  1YWO A;  4JLG A;  1GCP A;  5CK9 A;  4FCY A;  3L2Z A;  4KBM B;  1B34 B;  3CPW A;  2DJQ A;  2JTE A;  3AHU A;  3EGX A;  1BI2 A;  2XHC A;  3LH0 A;  2DEQ A;  2DJZ A;  4BE1 A;  2KR3 A;  8AT1 B;  3G71 A;  4QQD A;  3FB9 A;  1VUB A;  2PUO B;  2RI2 A;  2X35 A;  3FIF A;  1N8R R;  3R6N A;  1Q7Y U;  1PSE A;  2DK3 A;  3OW2 P;  2YUP A;  3VS6 A;  2LJ0 A;  4QQG A;  4JS5 A;  2DL4 A;  1B3Q A;  1VQ5 T;  1J3T A;  3VRZ A;  5KYY B;  1JQQ A;  2WAC A;  2RHU A;  4GLK A;  3P8B B;  1W70 A;  4EIK A;  3RKW A;  5GAO n;  2HKQ B;  4MDW A;  4XU2 A;  1KG1 A;  1ZBX A;  3MET A;  1BB9 A;  4IKF A;  2IIM A;  4HCK A;  4PFZ A;  2ESW A;  2DIQ A;  2DA9 A;  9ATC B;  2DBM A;  3GIB A;  1KQ1 A;  1YJN A;  3QDR B;  2HKN A;  3GNG A;  2HBW A;  2ABL A;  4IUT A;  2RJF A;  4J9H A;  1D09 B;  1W4S A;  4IUV A;  4OB1 B;  4A63 B;  1K73 R;  3M0U A;  3X24 B;  4M77 G;  2LC4 A;  3HRU A;  2CUD A;  1GXI E;  2DFU A;  2COW A;  3VUZ A;  1IB8 A;  2VB6 A;  2K79 A;  1T3S A;  4XTY A;  2PU9 B;  2ZPF B;  3FLG A;  4M78 A;  3DKM A;  2E5K A;  2FPE A;  5GAN e;  3CME T;  2WSF E;  3OMC A;  3NMZ C;  2DPP B;  1D1C A;  1NPP A;  3CCQ A;  5CKE A;  5LL6 S;  2LJ3 A;  4M78 E;  3CPW P;  4ZGE B;  1WNL A;  2JM9 A;  1KFZ A;  4OMP A;  2DEU A;  2KRN A;  2AZV A;  5J3B A;  4J9G A;  2X4X A;  4JUV A;  3TEE A;  3C94 A;  2Z0W A;  2RD1 A;  3E9F A;  3SWN C;  5CKF A;  4ZTF A;  2KBT A;  4XU3 A;  4AMC A;  3V8J A;  4BE2 A;  3SDZ A;  3O5Z A;  1WGS A;  2E41 A;  1NZ9 A;  2CYZ B;  4QKU A;  2YUO A;  3OYG A;  5KH6 A;  3EG9 A;  1D0Z A;  1X69 A;  1JBM A;  3OS5 A;  1AWX A;  2JJ9 A;  2RQR A;  3CCS Q;  1VQP T;  1YIJ T;  4E7S A;  1WXB A;  4C5I A;  2VXF A;  4RUG A;  2ZPH B;  3RMQ A;  1LCK A;  5DLQ E;  1MMN A;  2EFI A;  2X3X D;  1Q95 G;  4C92 B;  4LD6 A;  4BD3 A;  4QVD A;  2IG0 A;  4BDY A;  4FYW B;  3MPU B;  1N27 A;  2E70 A;  1M90 U;  4M75 A;  1BI3 A;  1B07 A;  2VGM A;  2YT6 A;  2JZ2 A;  2O31 A;  3CC2 Q;  2PNI A;  4M75 E;  3TU4 K;  5GMK m;  4Y91 A;  4E7H A;  3CCR A;  1SKU B;  2WSE E;  3CC4 Q;  2QDL A;  5HK3 A;  2KEA A;  1AZE A;  1R77 A;  1WJS A;  1UG1 A;  2BKD N;  1AWJ A;  4OP0 A;  1Q86 U;  2E65 A;  1VQM A;  3CCJ T;  2O4X B;  4XAX B;  4O5V A;  4JRQ A;  5FW9 A;  4EDU A;  1D3B B;  3G7Z A;  3MO8 A;  1NYG A;  1YI2 Q;  1K8A C;  1ZSZ A;  1SEM A;  1JB0 E;  3JSC A;  3H8Z A;  4F7U B;  4IUU A;  2K7A A;  4IIO A;  3FJ5 A;  4BE0 A;  2XU8 A;  3BY7 A;  4C0D C;  2CDT A;  2DVE A;  3X25 B;  3G4S A;  4KUL A;  5AYF A;  1O9S A;  1T3L A;  3H0I A;  3G6E A;  1WI7 A;  2D0Q B;  2HSP A;  2KSS A;  4J8O A;  2DTO A;  1QVG A;  1GL5 A;  3QBY A;  2NUP B;  2DE0 X;  3PFS A;  4DBH A;  3LWI A;  2JS0 A;  2D8H A;  1EIF A;  1D0X A;  2DBK A;  5GAO p;  2BTT A;  5LJ3 d;  5GAM d;  2NUT B;  2PQW A;  2W0Z A;  1X01 A;  3M58 A;  1UDL A;  1Q82 C;  4O6J A;  3FRN A;  2EQI A;  3I35 A;  1MNE A;  4XK8 E;  5D7U A;  3E19 A;  2JMA A;  3CBM A;  2D1X A;  3LWH A;  1VQ8 A;  5CIU A;  1JEG A;  4MDX A;  3CCL A;  5FLX E;  1IZ6 A;  4M78 C;  4HA8 A;  1VQL T;  1PWT A;  2HD0 A;  3CCE Q;  1RI0 A;  1YJ9 Q;  2ZAE A;  2EWN A;  4C5G A;  2R5M A;  3X20 B;  2PVG B;  3QPH A;  1YIT Q;  1M30 A;  2DAQ A;  1WDX A;  5LJ5 f;  3JCM V;  5I21 A;  3ASK A;  4OGE A;  2V1Q A;  2K5L A;  1R0C B;  1W2B A;  4JPB W;  2K3B A;  1PRL C;  3MHX A;  2OAU A;  3GP8 A;  1SHF A;  5I11 A;  2AZS A;  2QEX Q;  3HL8 A;  3EHQ A;  2ZPB B;  1AOJ A;  3I56 Q;  2K5I A;  4LXC A;  4R56 A;  1RAF B;  2GTO A;  1WQW A;  1PD0 A;  4HVV A;  2ZGW A;  4B6M A;  2QGF B;  2Y4X A;  3SWN B;  1VOM A;  3C12 A;  3CCQ T;  1YCS B;  3CC7 T;  4BI3 A;  1MGQ A;  2O01 E;  1KD1 R;  2VC8 A;  4DA4 A;  4JLI A;  1BYM A;  3GF5 A;  4A53 A;  4E7J A;  3M0R A;  4FW1 A;  4X1V A;  3J7A F;  1YIT T;  5FWC A;  1OPK A;  5LJ5 h;  4BAC A;  4JRI A;  1K76 A;  1TG0 A;  3OYY A;  1PKS A;  3M59 A;  4M75 C;  1X6G A;  3RKY A;  3EFO A;  1QVG P;  3VS4 A;  2DD4 A;  4IUP A;  3JCM X;  3JV3 A;  2KI7 A;  2LCC A;  3THK A;  4M7D G;  3HPW A;  3T9N A;  1G3W A;  1JU5 C;  2V8J A;  1VQ9 Q;  2MOX A;  4M4Z A;  1QKX A;  2VGN A;  3JRZ A;  4OMF B;  2DXU A;  1AHJ B;  1S1N A;  5GMK i;  2HDA A;  5IN1 A;  4ELZ C;  1VYV A;  3I56 T;  1K9M C;  2QAZ A;  4M77 D;  4M7A A;  2EQM A;  2L8D A;  4FIB A;  4LDY A;  4AT1 B;  1ABQ A;  4ZNX A;  1AWW A;  2DL7 A;  3HKS A;  2LT1 A;  2LJ1 A;  1S72 Q;  1GCQ A;  1ZSZ C;  2QQS A;  2RK1 A;  2PZ1 A;  2DRM A;  4M7A E;  3X28 B;  2VUB A;  2RK2 A;  5CKB A;  2XI9 A;  2EYY A;  1ZX6 A;  2FL7 A;  1RL2 A;  3M5A A;  4L59 A;  1PRM C;  1VQ7 Q;  2LZ6 B;  1JO8 A;  4WTO B;  4L6V 5;  3V8L A;  3UAT A;  1FWZ A;  4C8Q F;  2E1H A;  1M3B A;  2EYX A;  4J83 A;  2RPN A;  4C0D B;  2V8I A;  4J9D A;  1AVZ C;  3V7C A;  4F16 A;  2R58 A;  2OTL Q;  2K6D A;  4PL6 A;  3X26 B;  4Y92 A;  2RNA A;  4FL6 A;  4B9X A;  2MK5 A;  2XDP A;  3CD6 A;  2X4W A;  2RQU A;  2DVJ A;  3BFM A;  3I55 A;  3ZFJ A;  2QQB A;  2RHY A;  3CCM A;  2JM8 A;  2MYS A;  5LJ5 e;  2XG8 D;  2GQV A;  2HQH A;  4RTZ A;  2DXT A;  1TH7 A;  2C0I A;  3ER0 A;  4RMO A;  1JJ2 A;  3SD4 A;  3EFS A;  2F69 A;  4ANJ A;  1EZZ B;  1QVF P;  2EKH A;  3VS2 A;  2PVO B;  2BE9 B;  3G6E T;  2QQR A;  3L2V A;  2SEM A;  4OMN A;  4OMQ A;  1UE9 A;  3EGU A;  1WLP B;  4OF1 A;  5GAN j;  1PSF A;  2OI3 A;  4VUB A;  3S3O A;  4M78 B;  3EHR A;  3CMA Q;  4RG8 A;  3GBQ A;  1VQ4 A;  1IXD A;  2BZ8 A;  4RTX A;  4LDX A;  1XNI A;  4DBQ A;  2A08 A;  3E9G A;  2LTO A;  1VIE A;  1M90 C;  3OBW A;  2OTJ T;  1VQ8 T;  4X9D A;  3EG0 A;  4A4E A;  3CCL T;  1U8R A;  2KT1 A;  4J6Y A;  3SEM A;  1LNX A;  5FWB A;  4DOV A;  3QZ9 B;  3CCU Q;  2J05 A;  1N8R U;  3EFR A;  2ATC B;  3OYN A;  5J26 A;  1EFN A;  2YDL A;  1N9S A;  2ROT A;  1WHM A;  1Q86 C;  3OS2 A;  3PVQ A;  1YHQ Q;  2DET A;  4IUR A;  1X75 C;  1PM3 A;  1KQS P;  1FMK A;  1F1B B;  1Q82 U;  1I8F A;  3M0S A;  1OOT A;  3KUF A;  2ZPI B;  5EG2 A;  1VQN A;  2EYW A;  2KVQ G;  4M75 B;  1I1J A;  3E1S A;  3C95 A;  1KD1 C;  1KC8 C;  3MEW A;  2CP0 A;  1Y96 A;  2EKO A;  1AT1 B;  3VS3 A;  3ZL7 C;  3JCM d;  1JXO A;  2G6F X;  4PJO G;  4M7A C;  2RQV A;  3GOX A;  2GFA A;  3ZBD A;  1K73 U;  2EQU A;  4RTW A;  1RLQ C;  4MZM A;  1MMA A;  3VV0 A;  1GCQ C;  2QYZ A;  1BCO A;  1NLP C;  1MMD A;  1BCM A;  2RN8 A;  3LYI A;  1QMC A;  5CR2 A;  1PD1 A;  2JUF A;  1VQ5 Q;  2MPX C;  4V2S A;  4FW2 A;  2X4Y A;  4RTU A;  2QXF A;  1WA7 A;  1WXU A;  4ME7 A;  2XMF A;  4Z02 A;  2E4H A;  2L5Q A;  4A4F A;  2QK0 A;  4E6R A;  1G83 A;  3OYC A;  2IVW A;  4HVU A;  1ZSZ B;  1GFC A;  4LDV A;  1X27 A;  4BI4 A;  5LJ3 g;  5GAN 8;  3H6Z A;  5GAM g;  2RHZ A;  3MKD A;  1M4Z A;  4C8Q A;  2L3P A;  8ATC B;  4N0A A;  1T0H A;  3WVE B;  1WHG A;  2LQK A;  3OMG A;  3QKJ A;  4C8Q E;  4KH0 B;  3L42 A;  2LT4 A;  2EBP A;  4N4H A;  2QG9 B;  3QYH B;  1CKA A;  4HCC A;  2X51 A;  4JJB A;  5KYN A;  1KHI A;  4BUG A;  4HCZ A;  5KYX A;  3EH2 A;  2V1R A;  2J6F A;  5GAN 3;  3OYK A;  2RQT A;  4MZT A;  2DRK A;  3QYG B;  1P92 A;  3CME Q;  4RTY A;  1M2V B;  5GAN 4;  4M77 F;  4F14 A;  1TU0 B;  3EG3 A;  4XU1 A;  4N4G A;  1IHW A;  1K9M U;  1VYT A;  1WJR A;  1ZLM A;  4M7D D;  2DL8 A;  1GBR A;  1CKB A;  2LX7 A;  4ESR A;  2DYI A;  1YI2 A;  2QQ9 A;  4QVC A;  1N5Z A;  3I55 T;  1K4U S;  4ZGD B;  5GAN 7;  1TSF A;  4GY5 A;  3L2W A;  3CCM T;  5GAN 5;  4X9C A;  2M0O A;  2L3Q A;  1NJI R;  1CSK A;  1RAI B;  1C0M A;  5CVI A;  2J06 A;  1VQP Q;  1YIJ Q;  1AEY A;  1RAB B;  4N4I A;  4DOW A;  2PUK B;  3UPU A;  2E10 A;  4Y28 E;  3H0F A;  2VV5 A;  4J7I A;  4PKC C;  1I81 A;  1XOV A;  3ME9 A;  4LNP A;  1G3T A;  3ULR B;  3OYF A;  2XKO C;  1GBQ A;  3QJY A;  2RH2 A;  3URG A;  2GNC A;  3SB2 A;  4F04 B;  3PNW C;  4OB3 B;  2K5F A;  1OX8 A;  2M1H A;  5FRN A;  3EFO B;  2RMO A;  1U1T A;  4LDW A;  5CQY A;  1K0X A;  2VVK A;  1YJ9 A;  1BBZ A;  2C0T A;  2YLC A;  2KMT A;  2XK0 A;  2F2V A;  1RLP C;  4JJC A;  2CS7 A;  3OSS C;  2EQK A;  4LE9 A;  1U1S A;  3VS0 A;  3CCJ Q;  2YSQ A;  1M1K R;  5KE2 A;  5HKC A;  4C8Q D;  1V29 B;  2EAY A;  3OYJ A;  1KIK A;  4E7K A;  3L1A A;  5IH2 A;  2CH4 W;  5GAN d;  2RHI A;  4M7A B;  2IPO B;  2O2O A;  1Q7Y R;  1Y57 A;  2DZC A;  2JN0 A;  3CXC S;  5I2M A;  1WHH A;  2RA2 A;  2QEX A;  1UHF A;  1ZHI A;  2LCL A;  1VQN T;  3PGG A;  4E7L A;  5I2S A;  4XQ3 A;  2P0P A;  1FXX A;  3CCV T;  2F5K A;  3A8H B;  4DQ2 A;  3JCM b;  1OEB A;  1NEB A;  2DM1 A;  1D1A A;  3QWX X;  3F70 A;  2COZ A;  2EJG A;  2I0N A;  2L0A A;  4J6X A;  2O88 A;  1VA7 A;  2CUB A;  2KGT A;  2OAW A;  4B9W A;  2H3E B;  2DTI A;  3H9N A;  3M4G A;  2A3L A;  1I07 A;  3OY9 A;  2COY A;  1C1A A;  3A98 A;  5A0L A;  2NWM A;  3A8M B;  1YFN A;  5IHI A;  1VQL Q;  2Y90 A;  5LJ5 j;  1VQ9 A;  4LUD A;  4J9C A;  4FU6 A;  2QI2 A;  4M77 A;  1H8K A;  3HFO A;  1ZQ1 A;  1KD1 U;  1KC8 U;  4JRK A;  1XJW B;  4NOY A;  2L2P A;  4Q5W A;  3UA6 A;  3OA6 A;  1MV3 A;  2MWP A;  2FZK B;  2YUN A;  1YJN Q;  2BZY A;  4PJM A;  5KYW A;  5GMK j;  4M77 E;  3JB9 J;  1N8R C;  1YNZ A;  2HMA A;  4QT7 A;  4RTV A;  3G71 T;  1JRI A;  1UJY A;  3M54 A;  2BE7 D;  2CP5 A;  2GTJ A;  1YP5 A;  3SFM A;  1RAE B;  1G8X A;  1RAA B;  3QII A;  1Z9Z A;  4XTW A;  1QCN A;  4IUQ A;  1Q81 R;  2QA4 A;  2KNB B;  4C92 G;  4PJO D;  2YRD A;  3DLM A;  3HHT B;  1TUC A;  3C4S A;  3JCM Q;  4EMK A;  3CC7 Q;  3CCQ Q;  2P4T A;  2FYK A;  4EMG A;  1I4K 1;  4K11 A;  2OX7 A;  1ZUU A;  4F7U F;  4HT9 A;  1WFW A;  1ZUK A;  4XTX A;  3KXT A;  1HK9 A;  1QWE A;  4J6W A;  1VQK A;  1UGP B;  1D1B A;  4PFP A;  4LUE A;  1ACM B;  2GGR A;  1K73 C;  1DJ7 B;  1VQ6 A;  2EYQ A;  1ZSG A;  2EJ9 A;  4AFZ C;  1YJN T;  3V7R A;  3CBO A;  3UWN A;  4A4H A;  4FYY B;  1LPL A;  2O9S A;  1HYO A;  1G3S A;  3JCM g;  3JB9 F;  1Y0M A;  2RF0 A;  1XQH A;  4J9I A;  3WXM B;  1T0J A;  1VQO A;  2RJC A;  1UEC A;  1EX4 A;  4F7U G;  5D6W A;  1IHV A;  4FT4 A;  4M7D F;  2JS2 A;  3CEY A;  1GRI A;  2MWO A;  4J9F A;  1MV0 B;  3REA B;  5KYU B;  3QWY A;  1M8M A;  2GCX A;  3RER A;  3I5S A;  4XU0 A;  3MCA B;  3JB9 G;  2DER A;  3PMI A;  4BI8 B;  1IRE B;  1A0N B;  1RI9 A;  1QVF A;  2KXC A;  3EAE A;  2F5T X;  1SRM A;  2LQW A;  3LLR A;  2QGG A;  4YTL A;  2KRS A;  3AT1 B;  2ENM A;  1I0C A;  4KT0 E;  3TVT A;  3R6O A;  1SF9 A;  4NL3 A;  5GAO m;  1HXD A;  2EPD A;  3KBG A;  1M1K C;  4FT2 A;  4OGC A;  4CC4 B;  2PVD B;  2AHJ B;  3RNJ A;  1N6A A;  4HKE A;  1VQM Q;  4R0K A;  2YRC A;  2LRQ A;  4NS5 A;  1M8V A;  2DF6 A;  1X2Q A;  3EGX B;  1UGR B;  1NYF A;  2H3J A;  3QDF A;  1NM7 A;  1ZA2 B;  3A8G B;  2F2X A;  4AG2 C;  2E6N A;  1N9R A;  3VJP A;  2AT1 B;  1PKT A;  1RAC B;  4JJN K;  3GNF B;  2BIV A;  3RBB B;  3G4S Q;  3JB9 I;  1QW1 A;  3G6E Q;  4M77 C;  3OB9 A;  2RQW A;  3A1P A;  3M56 A;  2HAX A;  3RMS A;  3CCR T;  1YJW A;  1OPL A;  3JCM h;  4FSX A;  2XDB A;  1Z9Q A;  4BDZ A;  5IT9 E;  1KQS A;  3LH5 A;  1G2B A;  1M2O A;  1NG2 A;  2CT3 A;  2JT4 A;  1VQM T;  2K57 A;  3NTH A;  4KGX B;  3OYD A;  2CP2 A;  5DLO A;  2EQJ A;  2AKL A;  1YBY A;  2C06 A;  1VQ5 A;  2ZPG B;  3S3M A;  2OTJ Q;  4GLM A;  1VQ8 Q;  5GMK l;  2A28 A;  3EGD A;  3CCL Q;  1M1F A;  2HSE B;  5ECA A;  2M0Y A;  3IQL A;  4EMK C;  3BW1 A;  2V26 A;  3VS5 A;  3FEO A;  4GBQ A;  4RCB A;  4FM4 B;  1HJD A;  4J7F A;  2C0O A;  1E6H A;  2H8H A;  3G1J A;  3FC3 A;  1W2B S;  3G4S T;  2LVM A;  3LW5 E;  1OV3 A;  2EJF A;  1OI1 A;  4PJN A;  3CQT A;  3VS1 A;  1G5V A;  1KHC A;  3M0Q A;  1Y07 A;  3QSU A;  3MEU A;  2Y4Y A;  5GAN 2;  3JCM J;  4ZTJ A;  2NYS A;  1OU9 A;  1M5Q 1;  3MP8 A;  4R55 A;  1X2K A;  1K0S A;  4OMO A;  2QA4 T;  2NUP A;  2HZY A;  5M9O A;  3EG1 A;  2R5A A;  3M55 A;  4RKU E;  3O8V A;  4MZP A;  3CME A;  2EGE A;  5GAN g;  5GJW B;  4M7D A;  2NUT A;  1BIB A;  2ED1 A;  3RR6 A;  1ARK A;  1SRL A;  2RJD A;  5LJ5 d;  1VQK T;  4M7D E;  2GF7 A;  1VQ6 T;  3J80 E;  1FYN A;  2MF2 A;  3EG9 B;  2A0F B;  2KT8 A;  2QTV A;  4C5E A;  2J7I A;  4PJO F;  2CSQ A;  2EW3 A;  3M0T A;  5CCA A;  4MMK A;  4IIM A;  2KYM A;  1WIE A;  2DIL A;  4A4K A;  1VQO T;  1QCO A;  1OZ3 A;  4DEX A;  3NGP A;  1C6V X;  2DO3 A;  1WPY A;  5L23 A;  5L8R E;  2HL5 C;  3C0C A;  2HL3 A;  5C0M A;  3QXE B;  3VYG A;  1AWO A;  2E12 A;  1OUL A;  4KUD K;  1I5L A;  4RCC A;  5CKD A;  4C92 D;  2G3R A;  1H92 A;  5AT1 B;  1M27 C;  2YRV A;  1NJI U;  3JB9 H;  1TTH B;  3HTR A;  4TVR A;  1UGS B;  2DL3 A;  4M78 G;  1BIA A;  4LD9 K;  5CQX A;  4PJL A;  2I2L A;  2RB6 A;  2RI3 A;  2D9T A;  1BU1 A;  1M1G A;  2YXY A;  2FPF A;  1OQK A;  1KJW A;  4A54 A;  2KQW A;  1WYX A;  3P8H A;  1AD5 A;  2FG0 A;  5FU7 C;  1FX7 A;  1UEB A;  2CP7 A;  4M77 B;  1NEG A;  5HK0 A;  4AFQ C;  2J6K A;  3CCS A;  1JJ2 S;  1VYU A;  1V1C A;  1NLO C;  3I55 Q;  3DLL A;  3BE3 A;  2CP6 A;  1I5O B;  1PG5 B;  5KYW B;  5GAN h;  1QLY A;  3CCM Q;  3REB B;  3L2Q A;  1TUG B;  1K8A R;  1D0Y A;  4PFO A;  1ZBJ A;  5I22 A;  4XTU A;  3HSB A;  2HQE A;  3CC2 A;  4OMM A;  3V8K A;  3CXC A;  3JB9 D;  1M1K U;  4FYX B;  1YJW T;  2QQA A;  2LMJ A;  1MHN A;  2LNH B;  3JCM W;  3S6W A;  3OYM A;  4EMK B;  3FDR A;  3CC4 A;  1VQ4 Q;  4M75 G;  5LJ3 f;  5A0G A;  5GAM f;  5DM7 R;  4ATO A;  1W6X A;  3HP9 A;  1TXQ A;  2QAS A;  5FRM A;  3CD6 T;  4BY6 C;  2FO0 A;  2ED0 A;  1Y7X A;  4II1 A;  3OQ5 A;  3OW2 S;  2LDM A;  1Q82 R;  2M02 A;  1QWF A;  1VQL A;  4XTZ A;  1K9A A;  2JNG A;  4M7D C;  2AK5 A;  1ZA1 B;  2FEI A;  2P0Q A;  4JRP A;  2CRE A;  4PK4 A;  2XDD A;  3OYL A;  1FMW A;  2KY9 A;  2JW4 A;  2RO0 A;  2X9H A;  1X6O A;  1UUE A;  2P4R A;  5KCO A;  1VQ4 T;  4PJO A;  3VS7 A;  3OYA A;  4QVZ A;  5LJ3 h;  4MML A;  5GAM h;  2KRO A;  4KH1 B;  1VQN Q;  3LGF A;  2YWW A;  1OX9 A;  2ZPE B;  2L3S A;  2KYB A;  3V7S A;  2B86 A;  4PJO E;  3CCV Q;  2DNU A;  3CC7 A;  1NBE B;  2XIC A;  1U5S A;  1WX6 A;  2HCK A;  2HBP A;  4NL2 A;  3CCE A;  1UFF A;  1BI1 A;  5FRO A;  1YIT A;  1QCF A;  1UGQ B;  4CRI A;  1OZ2 A;  1GFD A;  3CPF A;  2MMP A;  2A36 A;  3CPW S;  2EGA A;  1Q81 U;  1U3O A;  4AFS C;  3CXC P;  2CSI A;  1YN8 A;  5IAY A;  4CC3 A;  3H0H A;  4PJJ A;  2BUD A;  1SPK A;  4D8K A;  2GBQ A;  4JZ4 A;  2VYT A;  3NFC A;  4QQ6 A;  1LVK A;  2FHD A;  3I56 A;  3QJ6 A;  1WHK A;  4C8Q C;  2B8A A;  2D0N A;  4N0A C;  5FU6 C;  3G71 Q;  2DX1 A;  2CZ1 B;  1IGU A;  1PC0 A;  2AKK A;  4C0F A;  2ZZD A;  2YHT A;  5IXF A;  3RDV A;  4EPC A;  4ORZ A;  1K9M R;  1H3Z A;  2ROL A;  3TSZ A;  4HT8 A;  2VAS A;  5FU7 B;  1SSF A;  2MAM A;  2ECZ A;  1QP3 A;  3OS1 A;  2M9U A;  2KAF A;  4ELY C;  2RHX A;  2LP5 A;  2HQX A;  2VXE A;  3HRS A;  4E7I A;  5LJ3 e;  3NTK A;  5GAM e;  1RAD B;  2FZC B;  4OB0 B;  2DYB A;  3EGD B;  4J9E A;  1YCY A;  1OYX A;  5GJV B;  4JZ3 A;  4RG2 A;  2SRC A;  3P8D A;  5GAO q;  4C92 F;  4D8D A;  4M7A F;  2JVV A;  4ZGJ B;  5CAI A;  3OYH A;  4HCB A;  2LQ8 A;  3CCS T;  3GPL A;  3JCM P;  2JXB A;  4CC2 A;  2CZ6 B;  1B34 A;  2CH4 A;  1UGV A;  1SHG A;  1TUD A;  3PIO A;  1S72 A;  2EYZ A;  5LJ5 g;  4LDU A;  2XD0 A;  2RI5 A;  5KE3 A;  2E64 A;  5EC7 A;  2X3W D;  3CC2 T;  4BY6 B;  3TSW A;  4HVW A;  3PTA A;  4M7A G;  2M51 A;  1VQ7 A;  1AZG B;  2DLP A;  1PNJ A;  3PVL A;  4JJD A;  3BDU A;  3CC4 T;  3UDC A;  1OU8 A;  2FPD A;  2DD5 A;  1Y71 A;  2XID A;  4M78 D;  2K3X A;  4OB2 B;  4M7D B;  1UTI A;  1V76 A;  5KYY A;  1TOV A;  2F2W A;  2OTL A;  3M4Y A;  4PJO C;  4Z88 A;  1H64 1;  1M2V A;  1SSH A;  1IGQ A;  3MP1 A;  1NJI C;  1YI2 T;  2OTJ A;  4CI0 C;  3RKX A;  2FB7 A;  2JTM A;  2LX9 A;  3A8O B;  3TCJ A;  3VUB A;  3L2U A;  2D8J A;  3I5R A;  2L3R A;  4PLI A;  1QQJ A;  1M90 R;  4C0Z A;  2P84 A;  4PLL A;  3FJP A;  1B7T A;  6AT1 B;  3HFN A;  1HSQ A;  1K1Z A;  4X34 A;  2HNI A;  2AIR B;  1UB4 A;  3QG1 A;  1G3Y A;  1WJQ A;  2FVU A;  5J39 A;  2K4Y A;  3SHW A;  3CMA A;  1Y96 B;  5C6S A;  1Q86 R;  2CT4 A;  4Z89 A;  4BB7 A;  3A5Z B;  3MEV A;  3TQ7 P;  2E3I A;  1BKB A;  4E47 A;  2QTX A;  3U23 A;  4KRT A;  2K2M A;  4JS4 A;  2K9G A;  4A4G A;  1TS9 A;  5HY6 A;  5IXB A;  4M75 D;  4EMH A;  1QP2 A;  1ZUY A;  1NE8 A;  3S3N A;  3PT9 A;  3CCR Q;  3NPF A;  3M0P A;  3JCM f;  3CCE T;  1KC8 R;  1YJ9 T;  2KE9 A;  2D6F A;  3CCU A;  3EH1 A;  4Z8A A;  4CC7 A;  2OJ2 A;  3BDL A;  1PCX A;  2DZ9 A;  2EIF A;  3QUI A;  3LX7 A;  4C5H A;  4DEY A;  1FMV A;  3DB4 A;  4E7Z A;  4C8Q B;  2DKG A;  1Q7Y C;  2KRM A;  2YUQ A;  3E2U A;  3NHN A;  5FU6 B;  1MMG A;  1MND A;  3PIP A;  3EG2 A;  3Q1J A;  5GMK h;  1YHQ A;  3LGL A;  4J5Y A;  1M3C A;  2O9V A;  1QVG S;  1LJO A;  1WHJ A;  3OS0 A; 
#chains in the Genus database with same CATH homology
 1CSK A;  4DEX A;  3NGP A;  2HEQ A;  5L23 A;  3H0I A;  1T3L A;  2J06 A;  1WI7 A;  2HSP A;  2VWF A;  1GL5 A;  1AEY A;  1YWP A;  3C0C A;  2EVR A;  2DE0 X;  2A37 A;  2FRY A;  1AWO A;  3H0F A;  1H3H A;  2KXD A;  4AG1 C;  2JS0 A;  2D8H A;  1MUZ A;  2DBK A;  1XOV A;  1H92 A;  2BTT A;  4LNP A;  3ULR B;  3H41 A;  1M27 C;  1GBQ A;  4LN2 A;  4FSS A;  2W0Z A;  3KFV A;  2GNC A;  1UDL A;  2DL3 A;  2EQI A;  3I35 A;  2JMA A;  2D1X A;  5IHN A;  1JEG A;  2W10 A;  1BU1 A;  2RMO A;  1PWT A;  2FPF A;  1K0X A;  3VRY A;  2VVK A;  1KJW A;  1BBZ A;  2C0T A;  1IO6 A;  1WYX A;  2F2V A;  1RLP C;  1AD5 A;  1M30 A;  1RUW A;  4JJC A;  2FG0 A;  4LE9 A;  1WDX A;  3UF4 A;  1KSW A;  1UJ0 A;  3VS0 A;  1NEG A;  2YSQ A;  4AFQ C;  1HD3 A;  2J6K A;  2V1Q A;  1VYU A;  2DMO A;  1V1C A;  2EGC A;  3I9Q A;  1NLO C;  2BZX A;  1QKW A;  1X43 A;  1KIK A;  5IH2 A;  1QLY A;  2CH4 W;  3REB B;  2O2O A;  4JPB W;  1Y57 A;  2K3B A;  1PRL C;  1SHF A;  5I11 A;  2AZS A;  1M3A A;  1ZBJ A;  1UHF A;  5I22 A;  3EHQ A;  1AOJ A;  2PTK A;  2MCN A;  4OMM A;  2GTO A;  4HVV A;  1UHC A;  1OEB A;  1NEB A;  1YCS B;  2LMJ A;  2LNH B;  2DM1 A;  2GQI A;  4J9B A;  3QWX X;  2FRW A;  2I0N A;  2L0A A;  3M0R A;  4X1V A;  5FWC A;  2O88 A;  1E6G A;  1OPK A;  1VA7 A;  2CUB A;  2KGT A;  4RTT A;  1K76 A;  2J6O A;  2OAW A;  1W6X A;  1TG0 A;  1PKS A;  1X6G A;  4OML A;  3VS4 A;  1I07 A;  2FO0 A;  2ED0 A;  3UA7 A;  3JV3 A;  3THK A;  3A98 A;  2NWM A;  2LQN A;  1JU5 C;  1QWF A;  4WCI A;  5IHI A;  1K9A A;  2MIO A;  2MOX A;  4J9C A;  4LUD A;  1H8K A;  2AK5 A;  4M4Z A;  1QKX A;  2FEI A;  1X6B A;  2L2P A;  3UA6 A;  1BK2 A;  2CRE A;  1MV3 A;  1S1N A;  2HDA A;  1VYV A;  2YUN A;  2DL5 A;  2NUZ A;  2BZY A;  1YNZ A;  4QT7 A;  4RTV A;  2JW4 A;  4AFU C;  1ABQ A;  4ZNX A;  1AWW A;  2DL7 A;  1UJY A;  2LJ1 A;  1UUE A;  1WXT A;  2P4R A;  1GCQ A;  2GTJ A;  2PZ1 A;  1YP5 A;  3VS7 A;  2DRM A;  4HXJ A;  2VKN A;  1Z9Z A;  2KRO A;  2EYY A;  1W1F A;  1ZX6 A;  2L3S A;  2KYB A;  2B86 A;  2KNB B;  5IHK A;  1E7O A;  1PRM C;  5HCK A;  1TUC A;  2LZ6 B;  2DNU A;  1JO8 A;  3UAT A;  2LCS A;  1JXM A;  1U5S A;  2JMC A;  1M3B A;  2EYX A;  1WX6 A;  2RPN A;  2HCK A;  4K11 A;  4J9D A;  1UFF A;  1ZUU A;  1AVZ C;  1WFW A;  4F16 A;  1ZUK A;  4F17 A;  1QCF A;  1QWE A;  1PHT A;  1GFD A;  2K6D A;  3PE0 A;  4Y92 A;  2RNA A;  4LUE A;  2GGR A;  2A36 A;  1ZSG A;  2EGA A;  1U06 A;  4AFZ C;  1U3O A;  4AFS C;  2RQU A;  2CSI A;  1ABO A;  2DVJ A;  2O9S A;  1YN8 A;  1YWO A;  3H0H A;  4CC3 A;  1GCP A;  1Y0M A;  2RF0 A;  2JM8 A;  1SPK A;  4J9I A;  4D8K A;  2DJQ A;  2JTE A;  2GBQ A;  4JZ4 A;  4RTZ A;  1T0J A;  2C0I A;  1UEC A;  2EKH A;  3VS2 A;  2SEM A;  2CDT A;  4OMN A;  4OMQ A;  1UE9 A;  2JS2 A;  3EGU A;  2KR3 A;  1GRI A;  1WLP B;  2D0N A;  2OI3 A;  4J9F A;  1MV0 B;  3REA B;  2DX1 A;  2AKK A;  3QWY A;  1M8M A;  3EHR A;  3I5S A;  3GBQ A;  5IXF A;  4ORZ A;  2BZ8 A;  4RTX A;  2ROL A;  3TSZ A;  3R6N A;  2A08 A;  1A0N B;  1RI9 A;  2YUP A;  2ECZ A;  3VS6 A;  2LJ0 A;  2KXC A;  2DL4 A;  1SRM A;  1B3Q A;  2LQW A;  1J3T A;  3VRZ A;  1JQQ A;  2KRS A;  2ENM A;  1I0C A;  3TVT A;  2LP5 A;  3EG0 A;  1W70 A;  4EIK A;  2KT1 A;  3SEM A;  2EPD A;  2DYB A;  5FWB A;  4J9E A;  4CC4 B;  3RNJ A;  2J05 A;  5GJV B;  4JZ3 A;  1BB9 A;  2SRC A;  2IIM A;  4HCK A;  4D8D A;  2ESW A;  2DA9 A;  4R0K A;  2DBM A;  1EFN A;  2YDL A;  2ROT A;  2DF6 A;  1X2Q A;  1NYF A;  3PVQ A;  2JXB A;  1NM7 A;  4CC2 A;  2F2X A;  2CH4 A;  2HBW A;  2ABL A;  4J9H A;  1UGV A;  1SHG A;  1TUD A;  4AG2 C;  4A63 B;  3M0U A;  1PKT A;  1FMK A;  2EYZ A;  2CUD A;  3M0S A;  1OOT A;  3RBB B;  2K79 A;  1T3S A;  2EYW A;  5EC7 A;  2X3W D;  1I1J A;  2RQW A;  3TSW A;  4HVW A;  2E5K A;  2FPE A;  2M51 A;  1AZG B;  2DLP A;  1PNJ A;  3VS3 A;  3NMZ C;  3ZL7 C;  3PVL A;  1OPL A;  4JJD A;  1JXO A;  2FPD A;  2G6F X;  2LJ3 A;  1Z9Q A;  2RQV A;  3LH5 A;  1G2B A;  2JM9 A;  4RTW A;  1RLQ C;  4OMP A;  1UTI A;  1NG2 A;  2CT3 A;  2JT4 A;  1KFZ A;  1GCQ C;  1NLP C;  2F2W A;  4Z88 A;  2RN8 A;  2KRN A;  2AKL A;  2AZV A;  1SSH A;  4GLM A;  4J9G A;  4RTU A;  1WA7 A;  2A28 A;  1WXU A;  2XMF A;  2D8J A;  3I5R A;  5ECA A;  4E6R A;  1G83 A;  2M0Y A;  4HVU A;  2KBT A;  1GFC A;  3IQL A;  1X27 A;  3O5Z A;  3VS5 A;  2YUO A;  1HJD A;  4GBQ A;  2L3P A;  2C0O A;  1E6H A;  2H8H A;  1T0H A;  1X69 A;  1AWX A;  1HSQ A;  1K1Z A;  1OV3 A;  2RQR A;  1WXB A;  4RUG A;  2EBP A;  1LCK A;  3CQT A;  3VS1 A;  2X3X D;  1CKA A;  3SHW A;  3M0Q A;  4JJB A;  2CT4 A;  4Z89 A;  1X2K A;  2V1R A;  1K0S A;  4OMO A;  1B07 A;  2J6F A;  2YT6 A;  3U23 A;  2RQT A;  3EG1 A;  2O31 A;  4KRT A;  2K2M A;  2PNI A;  2K9G A;  5IXB A;  2DRK A;  4RTY A;  2EGE A;  1ZUY A;  5GJW B;  3NPF A;  4F14 A;  2ED1 A;  3M0P A;  1ARK A;  3EG3 A;  2QDL A;  2KE9 A;  2KEA A;  1AZE A;  1SRL A;  1UG1 A;  4Z8A A;  1AWJ A;  4CC7 A;  1VYT A;  1ZLM A;  2OJ2 A;  2DL8 A;  1GBR A;  1CKB A;  2LX7 A;  4DEY A;  5FW9 A;  4ESR A;  1FYN A;  1NYG A;  2KRM A;  2YUQ A;  3NHN A;  1N5Z A;  2KT8 A;  1SEM A;  2J7I A;  3EG2 A;  1K4U S;  2CSQ A;  2K7A A;  4IIO A;  2EW3 A;  3FJ5 A;  3M0T A;  1M3C A;  4IIM A;  2O9V A;  2KYM A;  2L3Q A;  1WIE A;  2DIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...