1GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
b'MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gbqA00
4AFQC 1Y0MA 2BZYA 2M51A 2RF0A 1HD3A 1QWEA 4QT7A 4ESRA 2CUBA 1GBRA 3REAB 1PKTA 2JT4A 2PZ1A 2ECZA 1TUDA 2KT8A 1AEYA 2E5KA 4OMNA 2MOXA 2RPNA 1K76A 4OMLA 1QKXA 2D8HA 2KR3A 1G2BA 5GJWB 4CC3A 1M27C 2D8JA 2KT1A 1AZGB 1WDXA 1KFZA 3NPFA 1X2KA 1GCQA 2ROLA 4KRTA 4F16A 1GFDA 2DM1A 1M30A 2DL4A 1BK2A 2IIMA 3GBQA 1OEBA 2DA9A 4J9IA 1PKSA 2O9SA 1T3SA 1J3TA 1MV0B 1BB9A 2JM9A 4Z89A 2J7IA 2NWMA 5IXFA 1VA7A 4JJCA 5FWBA 1SHGA 1AWXA 2EVRA 4OMMA 2DBMA 4AFUC 2QDLA 1CKBA 3M0TA 1WFWA 2KEAA 2YUNA 1YWOA 3CQTA 4RUGA 2A08A 4AFSC 1GFCA 2LNHB 2VKNA 1WIEA 2FPDA 1N5ZA 1AWOA 1YNZA 1AVZC 1VYUA 1H8KA 2AKKA 2ENMA 1ABOA 1MUZA 3U23A 4Z88A 3UA7A 2KBTA 2K9GA 1SSHA 3H0FA 1ZSGA 2LX7A 2GGRA 2EGEA 2KRMA 1YCSB 3PVQA 3NGPA 1K9AA 1UECA 2JXBA 1UTIA 4LUEA 1X69A 1AD5A 1NEBA 1PHTA 4DEYA 2H8HA 1ZUKA 3EG1A 5FW9A 1AWJA 2FRYA 4GBQA 4D8KA 1WXTA 3H0IA 1GCPA 1WYXA 3RBBB 1YWPA 3M0PA 2AZVA 2DBKA 5IXBA 1RI9A 4AFZC 1KIKA 1XOVA 1Z9ZA 4RTUA 1PWTA 4M4ZA 2L3QA 4DEXA 1X6GA 1EFNA 2HEQA 1TUCA 1B3QA 4ZNXA 1YN8A 1OPLA 2EQIA 1T0JA 2YUQA 5IH2A 2CSQA 2YT6A 2FPEA 2PNIA 2LJ0A 3M0SA 1M3AA 2RQUA 2HSPA 2LJ3A 1E6GA 2KXDA 4JPBW 2KROA 3UA6A 1ZLMA 4HXJA 4HCKA 2GQIA 1UGVA 1GL5A 2KRNA 2RMOA 2DRMA 2JTEA 3I35A 2LP5A 2HDAA 2XMFA 3ZL7C 2CH4A 2B86A 3NMZC 1ABQA 1UFFA 2DL7A 3TSZA 2DMOA 2X3XD 5IHNA 4FSSA 2DJQA 3VS4A 1WLPB 4D8DA 2ED1A 3VS1A 1K1ZA 3A98A 2BTTA 2HBWA 2VVKA 2EYYA 5FWCA 2DRKA 3VRYA 2X3WD 1WXBA 4OMPA 2F2VA 2K79A 3THKA 2F2WA 1SRMA 4HVVA 1E7OA 4JJBA 1HSQA 2LMJA 2CSIA 1AOJA 2HCKA 4WCIA 1NM7A 4LN2A 2O88A 4F14A 3TSWA 1SEMA 2RQWA 2JM8A 1UHFA 3EHRA 2YUPA 2DE0X 4RTXA 2DF6A 2GNCA 3IQLA 2P4RA 3VS5A 5IHKA 2EPDA 2FG0A 1K0SA 3SHWA 1W70A 1JO8A 2V1RA 1QKWA 1AZEA 2C0IA 1NLPC 2YSQA 1U5SA 2DVJA 1CKAA 1BU1A 1GRIA 2EGAA 2EGCA 1RUWA 2RQVA 1ZUUA 4J9DA 1X27A 4RTYA 4CC4B 2L0AA 3TVTA 1WI7A 1X2QA 1I07A 4E6RA 2BZ8A 2J05A 4CC7A 2DL5A 4AG2C 3VRZA 1W6XA 1U3OA 3VS6A 4J9FA 4RTVA 4RTZA 2W10A 1K0XA 1W1FA 2KXCA 1RLPC 1NG2A 3QWXX 2JMCA 1GBQA 2K3BA 2MIOA 1OV3A 4LNPA 1MV3A 1UDLA 2DL8A 1YP5A 2KNBB 2JMAA 1SHFA 1NLOC 1JU5C 1FYNA 2DILA 4HVWA 2I0NA 3I9QA 2W0ZA 1PRMC 2PTKA 2AZSA 1ZUYA 2YDLA 1UHCA 3SEMA 4JZ4A 1NYGA 2RQRA 1S1NA 2O9VA 4J9BA 2A36A 1BBZA 3C0CA 2F2XA 1VYTA 2YUOA 4LUDA 2FPFA 5I11A 3KFVA 1QCFA 4JJDA 1UJYA 2D1XA 2JS0A 2FEIA 4EIKA 1ARKA 2RNAA 2RQTA 4K11A 2V1QA 4J9GA 2LCSA 3VS3A 1PNJA 2MCNA 2J6KA 4J9EA 1LCKA 4IIMA 2VWFA 3H41A 2G6FX 5HCKA 4OMQA 3NHNA 5I22A 2AKLA 2J6OA 1UE9A 2J6FA 4HVUA 3PVLA 2CT4A 4R0KA 3LH5A 2J06A 3M0RA 2OJ2A 3JV3A 2C0OA 1FMKA 1WXUA 1H3HA 2ED0A 2JS2A 4X1VA 1QLYA 3EG3A 2GBQA 2CT3A 3RNJA 3ULRB 2EBPA 4RTTA 3EG2A 1X43A 4GLMA 1WX6A 4Y92A 5IHIA 1QWFA 4CC2A 2K7AA 3M0QA 3VS0A 1JQQA 2K6DA 5ECAA 2O31A 3EG0A 2DYBA 2OI3A 1M3BA 2FRWA 2L3PA 3H0HA 4A63B 1IO6A 1TG0A 2DNUA 1M8MA 1KSWA 4JZ3A 1JEGA 2LQWA 1GCQC 3UF4A 1T3LA 1KJWA 2ESWA 2D0NA 2DL3A 4OMOA 1NYFA 2CREA 2AK5A 2SRCA 1E6HA 2GTOA 2DLPA 1WA7A 2KYBA 2LJ1A 2OAWA 2GTJA 1SPKA 1U06A 3O5ZA 4Z8AA 1JXMA 2EYZA 3QWYA 2EYXA 4J9CA 1A0NB 1M3CA 1UUEA 5EC7A 3I5SA 1I1JA 1ZBJA 2C0TA 1ZX6A 2A37A 2KGTA 1SRLA 4IIOA 4RTWA 1OOTA 2EKHA 2M0YA 5L23A 1K4US 2LZ6B 2FO0A 2KRSA 4F17A 2NUZA 3FJ5A 1UG1A 2BZXA 1AWWA 1X6BA 2DX1A 1CSKA 2SEMA 1NEGA 2KYMA 1B07A 3PE0A 1H92A 2L2PA 1HJDA 1V1CA 4LE9A 2EYWA 1PRLC 1VYVA 2EW3A 2CH4W 2RN8A 3UATA 2LQNA 3M0UA 3VS7A 2JW4A 3EGUA 3R6NA 2L3SA 1G83A 2K2MA 3REBB 1T0HA 1JXOA 1Z9QA 2CDTA 2ROTA 2CUDA 3I5RA 3EHQA 4J9HA 1OPKA 2KE9A 1Y57A 2ABLA 2A28A 5GJVB 1I0CA 4ORZA 1UJ0A 2O2OA 4AG1C 3VS2A 1RLQC
chains in the Genus database with same CATH superfamily
3JCMJ 3EH2A 4AFQC 1Y0MA 1BIBA 2EFIA 2QQBA 1HD3A 2Y4YA 1TWBA 1YJNA 1VQ4Q 2XKOC 1TTHB 3S6WA 2C06A 2PZ1A 4OMNA 2RPNA 1K76A 4M7DE 3M53A 1KQ1A 8ATCB 1G2BA 5GJWB 4M78D 1QVPA 1R8OB 4BACA 2ZZDA 2KT1A 1AZGB 3DKMA 1YI2Q 1KFZA 5I21A 5GAN5 3MEAA 2QEXT 3E2UA 3FJPA 1C1AA 2DA9A 3HPWA 3JB9I 1K73U 3MO8A 3A8OB 4J9IA 2RHXA 1J3TA 3BW1A 1RI0A 1VQ8A 1BB9A 2QQRA 3CCQA 4ELZC 2D6FA 4FT4A 5IXFA 1VA7A 5GMKj 1SHGA 1IHWA 1AWXA 3CXCP 3N5BB 2QDLA 1CKBA 1WHJA 4XU2A 3CQTA 2D9TA 4ZTJA 4HCBA 1GFCA 2AIRB 4F7UB 5LJ5f 2MAMA 4J7FA 3LH0A 3CD6A 4LDYA 3CCSQ 4C8QA 4CI0C 3GNGA 1K9MR 2OTLA 4MZTA 1AVZC 1VYUA 1H8KA 4N4HA 4GLKA 1VQ4T 2H3JA 4EDUA 2DEQA 5L8RE 1SSHA 4GY5A 1MMDA 2LX9A 3PMIA 2K5LA 1YITA 1QCOA 3HTRA 4F7UF 3QZ5B 3NGPA 5J39A 1YI2T 1K8AU 1BYMA 4JLGA 5HK0A 4LUEA 4M7DG 1NEBA 3MP8A 1M5Q1 2R58A 3L2UA 3FB9A 3EG1A 5CIUA 3G6EA 2FRYA 3Q1JA 4D8KA 4X9DA 2ZPIB 3H0IA 1VQ9A 2JVVA 2VGMA 3H8ZA 3OYNA 1W2BS 3M0PA 1ACMB 4KUDK 4XTVA 1O9SA 4DBHA 1XOVA 5KCOA 1K9MU 1KD1C 2E4HA 2DERA 2RHUA 3OYFA 3TEEA 1YN8A 2PVOB 1OPLA 1OYXA 3QG1A 4OB0B 2OTJA 2CSQA 4YTLA 2YT6A 2PNIA 1YJWA 1KHCA 5CR2A 3M56A 2HSPA 4EMKA 4M77D 4HCKA 3LYIA 3CCUQ 1GL5A 2KRNA 1RAFB 2CZ1B 1NJIC 2LP5A 2E5QA 2CH4A 2B86A 4DQ2A 3PGGA 3OYYA 2DL7A 4OB2B 2DMOA 4FSSA 3OMCA 3CPWP 1VOMA 4D8DA 3VS1A 4M78A 2JTFA 3A98A 5CKFA 3KUFA 5CVIA 2X3WD 4BUGA 2F2VA 2K79A 1M9SA 2PVGB 1SRMA 3QPHA 1HSQA 2EJFA 4IKFA 4WCIA 2XI9A 2RQWA 4PJJA 3JB9H 5IHKA 2RHIA 1VQ7Q 2YLCA 2V1RA 1VQNQ 4RCCA 1ZSZC 3ZBDA 3CCMA 1S72Q 4M75C 2R57A 5KYYB 2EGCA 1RABB 4KBMB 3TVTA 5FRNA 4XK8E 3CCUT 1C6VX 1W6XA 2FZKB 1JB0E 4J6XA 4J9FA 4RTVA 3VUZA 1K0XA 3S3OA 5LJ5j 3OBYA 2WSCE 2KVQG 2MIOA 2KQWA 1MV3A 1VUBA 2DL8A 2ZPBB 3AHUA 1SHFA 1N8RR 1FX7A 1JU5C 1FYNA 2I0NA 5LJ3g 2YDLA 1ZUYA 3TQ7P 2L3RA 4LXCA 5LJ3d 3MEUA 3WVDB 2OX7A 4JZ4A 4LD9K 3UPUA 1PD1A 5D7UA 3QIIA 1OU8A 1M1KR 2QTXA 5J26A 4E7HA 1MMAA 1RAHB 2YUOA 3JB9D 2E3IA 3RERA 1VQ7T 1UJYA 1ARKA 2CP7A 5GANg 3LWIA 1VQNT 5LJ3h 3NTHA 5GANd 1PNJA 1KK7A 4BE0A 2RI2A 3ASKA 2MCNA 3P8HA 1TS9A 1GXIE 3H41A 2HSEB 4M78B 5HCKA 4ANJA 1Y96A 3BFMA 3NHNA 2JZ2A 2J6OA 2YRDA 3JRZA 3PVLA 4M7AE 1N8RU 3CC2Q 3P8BB 1I81A 4J5YA 5GANh 3JV3A 4F04B 3I55T 2VGNA 4Z02A 2ED0A 1KQ2A 1QLYA 3EG3A 4BI8B 5HY6A 5GAOm 4ZN3A 3QDRB 2CT3A 3SD4A 3CPFA 4CRIA 2FZCB 1VQLA 5KYXB 1M1KU 3VUBA 3BY7A 1QWFA 2DKGA 5M9OA 5GMKe 3M0QA 2VXEA 1JQQA 2X4JA 4DA4A 4DBRA 3EG0A 3A8GB 1MNDA 2FRWA 3EFOA 3H0HA 5FU7B 4HKEA 1M8MA 4E7JA 1JEGA 2LQWA 2V8JA 3RKWA 4M77C 5FU6C 2E3HA 3PIPA 2AK5A 5A2QE 2CP5A 3ZEHA 3QSUA 2GTOA 1FMWA 1N9RA 2E64A 1Q86C 2KYBA 5GAN2 1D0ZA 2HNIA 1JXMA 3MCAB 3CC4Q 3JCMb 4JS5A 3CC2T 4BDZA 1U1TA 4KGZB 3OYJA 3CMAA 1ZBJA 1W2BA 2XICA 2A37A 2KK4A 4EMGA 1OOTA 1LNXA 2EKHA 4M7AG 1F1BB 3J81E 3QKJA 2LZ6B 4QKUA 1VQMQ 1CSKA 1LVKA 4C92C 1PM3A 2O4XA 2EQKA 1PRLC 2M9UA 4ATOA 3A8HB 3OS2A 2RN8A 1OU9A 4F7UG 3M0UA 2G3RA 4UC4A 3R6NA 3V7RA 1G83A 1WHMA 2IPOB 2K2MA 3REBB 1T0HA 4BE1A 2CDTA 3I5RA 3M59A 3X26B 5EG2A 5LL6S 2KE9A 4M77B 2ABLA 1HXDA 5GJVB 1M2OA 3I55A 4PJOD 4ORZA 2O2OA 3CCVQ 4RKUE 2CP6A 1N9SA 1FMVA 2MK5A 5IT9E 2K3YA 1GBRA 3REAB 1PKTA 2JT4A 1M2VA 2ECZA 1BI3A 3EGXB 2E5KA 4OMLA 2KR3A 4J6WA 4OMFB 4KULA 4CC3A 5GMKi 4M77F 3V7SA 5CCAA 1EIFA 2D8JA 5FLXE 4DOWA 1X2KA 2ROLA 5GAMg 1IREB 1VQOQ 1TXQA 1TUGB 1Q7YR 1GFDA 1M30A 2HD0A 1Y07A 1VQMT 1OEBA 4HA8A 4PLLA 4PK4A 3T9NA 4C92B 4QQDA 1UGPB 3CMEA 1YIJT 4B9XA 2NUPA 2NWMA 2DIQA 2DTHA 3SFMA 4FYXB 4IUPA 4C8QD 4OMMA 5GAMh 6AT1B 2DETA 4AFUC 5GAOn 2NYSA 1WFWA 4AFSC 2V8KA 3L42A 1N6AA 2VKNA 1WIEA 2KSSA 2E41A 4C92F 3C94A 3CCVT 2LDMA 2FPDA 4MZPA 3FLGA 2RH2A 3CCJQ 1O75A 2AKKA 2ENMA 2CYZB 2O4XB 1Q7YU 4Z88A 5LJ5e 3UA7A 2KBTA 3L2WA 3H0FA 1ZSGA 2QI2A 3H6ZA 2VC8A 4PFZA 4C0DB 1YCSB 3G4SQ 3PVQA 1UECA 2X51A 2DEUA 3CCEQ 1VQOT 1VQKA 1UTIA 1X69A 2MI6A 1AD5A 3OSSC 1QP2A 1PHTA 2GFAA 4ME7A 5GAN3 2H8HA 1MGQA 3MHXA 1AWJA 1QVFA 5LJ3f 5DLQE 1YJ9Q 4V2SA 1WYXA 4M75E 1VQPQ 1YWPA 1V29B 2KMTA 2HL5C 1RI9A 1PG5B 2DVEA 2EQUA 3J7AF 1X6GA 3QZ9B 1M2VB 1EFNA 3DLMA 1ZA1B 1TH7A 2EQMA 4ZNXA 3PMTA 5GANf 4IURA 2RK2A 1T0JA 2YUQA 4JRIA 4MMKA 3HFNA 3LX7A 1WJQA 1PSFA 3M0SA 5C6SA 2LQKA 1WQ7A 3CCJT 3G71Q 3C95A 4FL6A 4PJOA 2KXDA 4JPBW 1G3YA 2KROA 3UA6A 1VQ6Q 1WJSA 2RMOA 4HCZA 2DRMA 2WSFE 2XDBA 2JTEA 3M9QA 2HDAA 5AT1B 3QDFA 3QO3A 1YIJA 2NUPB 2QA4A 3CBMA 1UFFA 1D3BB 3QYGB 3TSZA 3G4ST 1KC8C 2HQEA 3JCMg 1WLPB 4RCBA 2ED1A 4OF1A 1UB4A 4A53A 3S3NA 3RUXA 1UGRB 2F5TX 2HBWA 2EYYA 2QASA 2RHZA 3JCMd 3JB9J 1OZ2A 1WXBA 1KD1R 1K8AR 1WGSA 2X4XA 4B9WA 3EG9B 3OYKA 1E7OA 4XTXA 1YJ9T 1VIEA 2A0FB 2L89A 1AOJA 1VQPT 5D6WA 2Y90A 2O88A 1SEMA 4N4GA 1UHFA 2YUPA 3OS1A 4RTXA 2DF6A 3UWNA 2JJ9A 4M75G 3JCMh 2FG0A 1K0SA 4A4KA 5GAOl 1NJIR 1QKWA 2X4YA 1AZEA 2XDDA 2C0IA 1NLPC 3HRTA 3OS5A 5CAIA 2DVJA 1CKAA 1BU1A 4M7DD 1GRIA 2BUDA 4IUTA 2EGAA 2KAFA 1QVGA 2HKQB 1KG1A 4FSXA 1X27A 3G71T 2E10A 1U1SA 4CC4B 4QQ6A 2E12A 2J05A 1JBMA 2DXCA 4XTWA 4AG2C 1U3OA 2DFUA 3VS6A 1KD1U 3MKDA 3VKIA 4JS4A 3QWXX 1BIAA 1GBQA 1MHNA 2P0KA 5I2SA 1OV3A 2KDSA 4XTYA 1D0XA 1FWZA 3HL8A 5A0GA 2W0ZA 4M77E 4KH0B 2F5KA 2AZSA 3GF5A 3EH1A 2E65A 1VQ5Q 1NJIU 1UGSB 4FT2A 4QVZA 3MJXA 5CO7A 4PFPA 4J83A 1NYGA 2QG9B 1AHJB 1S1NA 2RQRA 1B7TA 3TCJA 3PTAA 4PJOB 2A36A 3C0CA 2QXFA 1VYTA 5GAN8 2D1XA 5DM7R 4L59A 3CCST 4A4HA 1RAIB 2PQWA 2L5QA 5LJ3j 3VS3A 4QVDA 2QEXA 1Q95G 2M16A 2X9HA 2F1LA 2VWFA 2RI3A 2G6FX 1QMCA 4LD6A 1JJ2S 4E47A 4XQ3A 4C92E 2CT4A 5CKHA 4E7SA 1I4K1 2OJ2A 3L2ZA 5GANj 2ZGWA 4FYWB 1H3HA 2GCXA 2JS2A 4X1VA 3M4YA 3RNJA 5GAMf 3META 4N4IA 1K9MC 1X6OA 4ZGDB 1W4SA 1ZSZA 1M90C 2EBPA 4C8QB 2DK3A 5IHIA 1WX6A 2Z0WA 2MF2A 2DTOA 1TOVA 2K6DA 3HP9A 2RI5A 2ZAEA 2OI3A 4M77G 4II1A 1VQ4A 2IVWA 4EMHA 1TG0A 2DNUA 1KSWA 4JZ3A 1GCQC 1IGQA 3X25B 2D0NA 3JCMQ 2DL3A 2LCCA 4OP0A 2CREA 5GAN7 1YI2A 1BCOA 4M78C 4C8QF 3LGFA 1JRIA 1E6HA 3QJ6A 2LJ1A 4M7DA 2GTJA 4N0AC 3O5ZA 2FZGB 2MMPA 1U8RA 2E6ZA 4XU3A 3FIFA 2EYXA 4J9CA 3X28B 1M3CA 1UUEA 3I5SA 2CP3A 2H3EB 3X20B 1MMGA 2PUOB 3RKXA 4C92G 2D0QB 1SRLA 4RTWA 5L23A 1V76A 3BE3A 3FC3A 2X35A 3SWNA 2DJZA 2BZXA 2XU8A 1D09B 4MDXA 3QJYA 1IB8A 1B07A 1BI2A 3I56Q 2RD1A 3PE0A 1N27A 3CCSA 1V1CA 3MP6A 3JSCA 4LE9A 5FU7C 4EMKB 2AT1B 4IUUA 5GMKl 3OW2P 1WHKA 2XHCA 4KH1B 4ELYC 1WQWA 2DD4A 1X75C 1WHHA 2ROTA 4C0FA 1OPKA 5HKCA 1S72T 2A28A 3A8MB 1IRXA 1YHQQ 4DBFA 1M4ZA 1I0CA 2DXBA 4JRQA 2RF0A 2QYZA 2RB6A 2GFUA 1QWEA 4QT7A 4ESRA 2CUBA 2RK1A 1SSFA 1OQKA 2KT8A 1SKUB 1AEYA 1QKXA 2D8HA 2EYQA 2O01E 3EFRA 3CCRQ 3WVEB 2R5MA 4M78F 3JCMf 2JNGA 1C0MA 2HQXA 2IIMA 4FIBA 4F7UE 3GBQA 2GF7A 1UEBA 1PKSA 1Q86U 2R5AA 1OX8A 2ZCFB 1T3SA 3I56T 2WACA 3VU3C 1W2BP 4AT1B 2JM9A 3CCLQ 2J7IA 2KY9A 3JCMP 3KXTA 1WZOA 3CCUA 5FWBA 4M7DB 2MYSA 1DJ7B 2DBMA 1KQSS 5GAMj 3QXEB 2KEAA 2YUNA 4RUGA 3JCMW 3E9GA 2LNHB 4M7AD 1YHQT 3OYDA 5AYFA 2IG0A 3JAME 1RL2A 4X34A 1WJRA 4OVAA 1N5ZA 3R6OA 1AWOA 1YNZA 3SWNB 1LPLA 2VV5A 2JTMA 1ABOA 3CC7Q 3ER0A 1MUZA 4M7DF 2EQJA 3E9FA 3RMSA 2K3XA 2PVDB 2LX7A 2GGRA 4C5HA 3S3MA 3OQ5A 3L2RA 4X9CA 3CCRT 1I8FA 1VQ7A 1VQNA 2P84A 4DEYA 3RDVA 3A1PA 1S72A 1YJNQ 4XTZA 1WXTA 1GCPA 1Y96B 5KE3A 3CCLT 4XAXB 1OI1A 2LVMA 5IXBA 4AFZC 1JJ2A 1Z9ZA 4VUBA 5KCHA 3OMGA 3OA6A 1PWTA 4M4ZA 2L3QA 4DEXA 2E1HA 3CXCS 2XK0A 5LJ3e 4LDUA 2HEQA 4QQGA 2XG8D 2LNVA 2EQIA 4PL6A 3OB9A 4ZN1A 3MEWA 2FPEA 2LC4A 2E6NA 3E19A 2LJ0A 1VQ8Q 1M3AA 4FU6A 2RQUA 3CCQQ 2LJ3A 3CC4T 1ZLMA 1HK9A 2GQIA 9ATCB 3CC7T 5GANe 3MP1A 4ZGJB 1BI1A 3EFOB 4C0DC 2ZPHB 2XMFA 1D1AA 1WHLA 3ZL7C 1Q82R 4L6V5 5GAMd 2X3XD 5IHNA 2DJQA 3CD6Q 3VS4A 4HT8A 4Y28E 4XTUA 1RADB 2OTLQ 2BTTA 2VVKA 1BI0A 2DRKA 4KGXB 3VRYA 4OMPA 3THKA 2F2WA 1YJNT 2EAYA 2LMJA 2CSIA 3HSBA 4J6YA 1NM7A 4LN2A 3TSWA 2JM8A 1YITQ 2HBPA 3EHRA 2GNCA 3CC2A 1R0CB 4JLIA 3FEOA 3VS5A 2EPDA 3SHWA 1QVFP 5KYNA 1W70A 1JO8A 3C4SA 5I2MA 2YRVA 3JCMX 3G6EQ 2PU9B 4M7AA 1Q82U 1VQ8T 1VQ9Q 1ZUUA 1NE8A 4RTYA 3CCQT 5GMKm 2L0AA 1X2QA 1I07A 1RACB 4E6RA 1Q81C 4FCYA 3L2VA 5FRMA 3OYHA 1W1FA 2KXCA 1RLPC 1OZ3A 3E1SA 2JMCA 4OB1B 4F7UA 3GNFB 2OTJQ 1UDLA 3CD6T 2JMAA 4A54A 2CZ6B 4IUVA 1YJWQ 3CPWS 1NLOC 2OTLT 2EKOA 2RJCA 3I9QA 2DZCA 4QVCA 1UHCA 4C0ZA 4A4EA 4M78E 5GAN4 2EIFA 2NLUA 2P4TA 2RJFA 4J9BA 2O9VA 1Y7XA 1YITT 2YXYA 3CC4A 2JUFA 4LUDA 3KFVA 1QCFA 1KC8U 5CKBA 1MNEA 2JS0A 5C0MA 2FEIA 2V8IA 2RNAA 2QQAA 3JB9F 4K11A 4J9GA 4Q5WA 3D7SB 2VYTA 3G6ET 2J6KA 5KYUA 2DTIA 1VQMA 4J9EA 2YLBA 4IIMA 5DLOA 1VQ9T 1FXXA 2HKNA 3HKSA 3SDZA 2ZPFB 4OMQA 4MZMA 1X01A 5CKDA 3GIBA 2AKLA 5D6XA 1UE9A 4HVUA 1D0YA 3LH5A 5KYWA 2C0OA 1FMKA 2LT4A 4M75D 3CCET 2K4YA 1QVGP 3C12A 2RA2A 2CKKA 3CCMQ 2OTJT 1BCMA 4BDYA 4BY6B 1KQSA 5CKEA 3V8LA 1YJWT 4KUIA 4RTTA 3EG2A 1X43A 4GLMA 3G7ZA 4Y92A 3ME9A 3CCVA 4CC2A 2K57A 3VS0A 3A5ZB 5ECAA 4PJOC 4HCCA 4M7AB 3RMQA 5GAMe 4KGVB 4XU0A 4M78G 4E7ZA 3HFOA 3UF4A 3OW2S 1ZA2B 1T3LA 2DAQA 1KJWA 2ZPGB 1B34A 2ESWA 3CEYA 4PLIA 3DB3A 4OMOA 1NYFA 2I2LA 3HHTB 4QW2A 1VQOA 2SRCA 2MWOA 2XD0A 1VQ6T 1K73C 2DLPA 2CP0A 2OAWA 1PD0A 4M7AF 1SPKA 1U06A 3TREA 1QCNA 1OX9A 5GAN6 3M4GA 1M90R 1I5LA 5KH6A 5EC7A 2WSEE 3M55A 1TU0B 2C0TA 4IIOA 2M0YA 3L1AA 2FO0A 3CCMT 1VIFA 4C8QC 2NUZA 1WHGA 4FW1A 1IXDA 3CXCA 1AWWA 5KYYA 2DX1A 3GPLA 1EX4A 2SEMA 4IUQA 1H92A 2DXUA 2L2PA 1HJDA 1LOJA 4C5GA 5KYUB 3CCJA 2DO3A 1VYVA 2EW3A 2CH4W 3UT1A 2Y4XA 1R0BG 2LQNA 5IN1A 3VS7A 2JW4A 3EGUA 2YHTA 2L3SA 4TVRA 1JXOA 1Z9QA 3O8VA 2CUDA 3EHQA 5KYWB 1Y57A 4KT0E 1VQLQ 3G4SA 1K8AC 1NPPA 4E7KA 1M90U 2FL7A 3CCEA 1UJ0A 2CS7A 3VYGA 4AG1C 3VS2A 2BE9B 4JJNK 4J7IA 3URGA 4LDXA 2BZYA 4PJOF 2M51A 3V8KA 3RKYA 3OYGA 2K5FA 1YJ9A 3SB2A 3UDCA 4OGCA 1VQPA 1SG5A 1TUDA 2MOXA 4XU1A 2RHYA 1M27C 2QGGA 1WDXA 4C5IA 2HL3A 3NPFA 1GCQA 4RG8A 4KRTA 4F16A 1YFNA 2DM1A 4M75A 1D1BA 2DL4A 1BK2A 3NTIA 1B34B 1VQ5T 4A4GA 2O9SA 5IAYA 4NL3A 4EMKC 3GLXA 1MV0B 2CZ7B 3P8DA 2QGFB 3X24B 4Z89A 4FM4B 3G71A 5GMKh 1VQ6A 4N0AA 3BDUA 4JJCA 2LCLA 3JCMe 3CMAQ 5DY9A 2VXFA 7AT1B 1ZHIA 2EVRA 3M0TA 1YWOA 2YWWA 3HRSA 2A08A 4C92D 1VQLT 5KYXA 3GP8A 2HZYA 2CGHA 1LJOA 1RAGB 8AT1B 3MPUB 3VV0A 4BD3A 4JRPA 3CPWA 3U23A 4ZGEB 2K9GA 1G5VA 2COZA 2EGEA 2BE7D 2KRMA 4FYVB 1K9AA 3I55Q 2JXBA 2X4WA 2KI7A 2RJEA 4OGEA 3EGDA 1YCYA 1ZUKA 1PCXA 2CZ0B 4NS5A 3BDLA 5FW9A 2JN0A 4JRKA 2FB7A 3FRNA 4GBQA 4BI4A 5CK9A 2RO0A 4M7DC 3RBBB 2AZVA 1Q86R 4D6WA 3DLLA 2DBKA 3OYCA 3CMAT 1KIKA 1RAAB 3M54A 4RTUA 1ZQ1A 2OAUA 4BI3A 3M5AA 1TUCA 1B3QA 2V26A 4P5NA 3JCMc 4Y91A 2DPPB 1D1CA 2AHJB 5IH2A 1AT1B 3SWNC 2GQVA 3MEVA 2YRCA 4OB3B 2HMAA 1QVFS 1ZSZB 2QQ9A 3OSVA 3CMEQ 4M75B 4PKCC 1E6GA 4C5EA 4HXJA 4WTOB 1UGVA 3EAEA 3LW5E 1VQ5A 1IGUA 2B8AA 3I35A 1WNLA 3JB9G 4PJLA 4O6JA 2M0OA 1M1FA 1MMNA 3NMZC 2P0PA 1ABQA 4M77A 3RR6A 2NUTA 1WPYA 2FVUA 3PNWC 2M02A 5A0DA 2RJDA 1K1ZA 2K2VA 2PUKB 5FWCA 3OW2A 4M75F 2VASA 4HVVA 3OBWA 2MWPA 4JJBA 3RIRA 2HCKA 1HYOA 2K5IA 1XQHA 4F14A 3EGXA 1XNIA 4BB7A 1N8RC 3INZA 2DE0X 3GOXA 3IQLA 2RM4A 3PFSA 3JCMV 2P4RA 4B6MA 1VQKQ 5A0LA 1Y71A 4E7IA 3M57A 5LJ5g 2ATCB 2M1HA 2YSQA 1U5SA 2CP2A 5LJ5d 3H9NA 2EJ9A 3V8JA 4C92A 3TU4K 1M1KC 1RUWA 2RQVA 3CMET 1JJ2P 4J9DA 2COWA 4PJMA 3EGDB 4R56A 1WI7A 3M58A 2XDPA 2BZ8A 4CC7A 2DL5A 1M1GA 1BKBA 3VRZA 2LRQA 4ZTFA 5LJ5h 4LDVA 4PJOE 4RTZA 2W10A 4PNOA 1R77A 1NG2A 2FHDA 1G3WA 3LLRA 3QUIA 2MPXC 2K3BA 4NOYA 4LNPA 5KE2A 5CQYA 4R55A 2HQHA 1YP5A 2KNBB 3G1JA 2FYKA 3PIOA 1QVGS 2DILA 4HVWA 4JDSA 5J3BA 1PRMC 2PTKA 3SEMA 2ZPEB 1QQJA 2LTOA 3HRUA 1YIJQ 3OYMA 2QA4Q 2P0QA 3FDRA 2QDYB 2QQSA 4LDWA 1BBZA 4MMLA 1NZ9A 3DB4A 2F2XA 4EPCA 2FPFA 4C0GA 5I11A 4JJDA 4EIKA 1VQKT 1Q81R 2RQTA 2V1QA 1EZZB 4A4FA 3NFCA 1H3ZA 2LCSA 3J80E 4PJNA 2NUTB 2LT1A 5FU6B 1LCKA 1P92A 4C8QE 5GAOr 2EWNA 3I56A 5I22A 2HAXA 2J6FA 3AT1B 1PSEA 4R0KA 3OYAA 3RESA 2J06A 2QK0A 1IZ6A 3M0RA 1WXUA 3F70A 1KHIA 3OYBA 2VB6A 2GBQA 4L5GA 3PT9A 4NL2A 3OY9A 4PJOG 1YHQA 2BIVA 3ULRB 3L2QA 3QHSA 4JUVA 2DXTA 3OYEA 2K7AA 1RAEB 1Q81U 2O31A 2DYBA 1M3BA 1ZBXA 4J8OA 2L3PA 4A63B 3ZFJA 1IO6A 2QA4T 1OULA 1G3TA 3QYHB 4RMOA 4DOVA 1NPRA 3KBGA 3LGLA 3LWHA 1D3BA 3OS0A 3CBPA 3CCRA 4RG2A 3VJPA 2E70A 1KC8R 5GAOq 3EG9A 1WA7A 1I5OB 5GAOp 2DD5A 1G8XA 4Z8AA 1XJWB 5HK3A 2EYZA 3QWYA 1PC0A 3CCLA 1A0NB 1M8VA 4C8QG 3CBOA 1I1JA 3VYHB 1H641 2QAZA 5FROA 1ZX6A 2EJGA 4FYYB 4MDWA 4BY6C 2KGTA 1SF9A 4HT9A 1UGQB 3OYIA 3WXMB 1K4US 2JOYA 2KRSA 4F17A 2QEXQ 2DYIA 1XTDA 2QTVA 3FJ5A 1UG1A 1IHVA 1X6BA 1NEGA 2KYMA 4PFOA 2F69A 4M7AC 1G3SA 4E2FB 4WF2A 5CQXA 3A8LB 2A3LA 2EYWA 4DBQA 3V7CA 4O5VA 1QP3A 2BKDN 1Q82C 1NBEB 1TSFA 5D6YA 3UATA 2VUBA 2L8DA 4E7LA 3CC7A 3QBYA 1Q7YC 4FW2A 2XIDA 1KQSP 1K73R 2DZ9A 2LQ8A 4BE2A 4J9HA 4AMCA 3OYLA 2A7YA 3NTKA 1YBYA 2DIGA 1QW1A 3EFSA 1RLQC 2COYA
chains in the Genus database with same CATH topology
4AFQC 1Y0MA 2BZYA 2M51A 2RF0A 1HD3A 1QWEA 4QT7A 4ESRA 2CUBA 1GBRA 3REAB 1PKTA 2JT4A 2PZ1A 2ECZA 1TUDA 2KT8A 1AEYA 2E5KA 4OMNA 2MOXA 2RPNA 1K76A 4OMLA 1QKXA 2D8HA 2KR3A 1G2BA 5GJWB 4CC3A 1M27C 2D8JA 2KT1A 1AZGB 1WDXA 1KFZA 3NPFA 1X2KA 1GCQA 2ROLA 4KRTA 4F16A 1GFDA 2DM1A 1M30A 2DL4A 1BK2A 2IIMA 3GBQA 1OEBA 2DA9A 4J9IA 1PKSA 2O9SA 1T3SA 1J3TA 1MV0B 1BB9A 2JM9A 4Z89A 2J7IA 2NWMA 5IXFA 1VA7A 4JJCA 5FWBA 1SHGA 1AWXA 2EVRA 4OMMA 2DBMA 4AFUC 2QDLA 1CKBA 3M0TA 1WFWA 2KEAA 2YUNA 1YWOA 3CQTA 4RUGA 2A08A 4AFSC 1GFCA 2LNHB 2VKNA 1WIEA 2FPDA 1N5ZA 1AWOA 1YNZA 1AVZC 1VYUA 1H8KA 2AKKA 2ENMA 1ABOA 1MUZA 3U23A 4Z88A 3UA7A 2KBTA 2K9GA 1SSHA 3H0FA 1ZSGA 2LX7A 2GGRA 2EGEA 2KRMA 1YCSB 3PVQA 3NGPA 1K9AA 1UECA 2JXBA 1UTIA 4LUEA 1X69A 1AD5A 1NEBA 1PHTA 4DEYA 2H8HA 1ZUKA 3EG1A 5FW9A 1AWJA 2FRYA 4GBQA 4D8KA 1WXTA 3H0IA 1GCPA 1WYXA 3RBBB 1YWPA 3M0PA 2AZVA 2DBKA 5IXBA 1RI9A 4AFZC 1KIKA 1XOVA 1Z9ZA 4RTUA 1PWTA 4M4ZA 2L3QA 4DEXA 1X6GA 1EFNA 2HEQA 1TUCA 1B3QA 4ZNXA 1YN8A 1OPLA 2EQIA 1T0JA 2YUQA 5IH2A 2CSQA 2YT6A 2FPEA 2PNIA 2LJ0A 3M0SA 1M3AA 2RQUA 2HSPA 2LJ3A 1E6GA 2KXDA 4JPBW 2KROA 3UA6A 1ZLMA 4HXJA 4HCKA 2GQIA 1UGVA 1GL5A 2KRNA 2RMOA 2DRMA 2JTEA 3I35A 2LP5A 2HDAA 2XMFA 3ZL7C 2CH4A 2B86A 3NMZC 1ABQA 1UFFA 2DL7A 3TSZA 2DMOA 2X3XD 5IHNA 4FSSA 2DJQA 3VS4A 1WLPB 4D8DA 2ED1A 3VS1A 1K1ZA 3A98A 2BTTA 2HBWA 2VVKA 2EYYA 5FWCA 2DRKA 3VRYA 2X3WD 1WXBA 4OMPA 2F2VA 2K79A 3THKA 2F2WA 1SRMA 4HVVA 1E7OA 4JJBA 1HSQA 2LMJA 2CSIA 1AOJA 2HCKA 4WCIA 1NM7A 4LN2A 2O88A 4F14A 3TSWA 1SEMA 2RQWA 2JM8A 1UHFA 3EHRA 2YUPA 2DE0X 4RTXA 2DF6A 2GNCA 3IQLA 2P4RA 3VS5A 5IHKA 2EPDA 2FG0A 1K0SA 3SHWA 1W70A 1JO8A 2V1RA 1QKWA 1AZEA 2C0IA 1NLPC 2YSQA 1U5SA 2DVJA 1CKAA 1BU1A 1GRIA 2EGAA 2EGCA 1RUWA 2RQVA 1ZUUA 4J9DA 1X27A 4RTYA 4CC4B 2L0AA 3TVTA 1WI7A 1X2QA 1I07A 4E6RA 2BZ8A 2J05A 4CC7A 2DL5A 4AG2C 3VRZA 1W6XA 1U3OA 3VS6A 4J9FA 4RTVA 4RTZA 2W10A 1K0XA 1W1FA 2KXCA 1RLPC 1NG2A 3QWXX 2JMCA 1GBQA 2K3BA 2MIOA 1OV3A 4LNPA 1MV3A 1UDLA 2DL8A 1YP5A 2KNBB 2JMAA 1SHFA 1NLOC 1JU5C 1FYNA 2DILA 4HVWA 2I0NA 3I9QA 2W0ZA 1PRMC 2PTKA 2AZSA 1ZUYA 2YDLA 1UHCA 3SEMA 4JZ4A 1NYGA 2RQRA 1S1NA 2O9VA 4J9BA 2A36A 1BBZA 3C0CA 2F2XA 1VYTA 2YUOA 4LUDA 2FPFA 5I11A 3KFVA 1QCFA 4JJDA 1UJYA 2D1XA 2JS0A 2FEIA 4EIKA 1ARKA 2RNAA 2RQTA 4K11A 2V1QA 4J9GA 2LCSA 3VS3A 1PNJA 2MCNA 2J6KA 4J9EA 1LCKA 4IIMA 2VWFA 3H41A 2G6FX 5HCKA 4OMQA 3NHNA 5I22A 2AKLA 2J6OA 1UE9A 2J6FA 4HVUA 3PVLA 2CT4A 4R0KA 3LH5A 2J06A 3M0RA 2OJ2A 3JV3A 2C0OA 1FMKA 1WXUA 1H3HA 2ED0A 2JS2A 4X1VA 1QLYA 3EG3A 2GBQA 2CT3A 3RNJA 3ULRB 2EBPA 4RTTA 3EG2A 1X43A 4GLMA 1WX6A 4Y92A 5IHIA 1QWFA 4CC2A 2K7AA 3M0QA 3VS0A 1JQQA 2K6DA 5ECAA 2O31A 3EG0A 2DYBA 2OI3A 1M3BA 2FRWA 2L3PA 3H0HA 4A63B 1IO6A 1TG0A 2DNUA 1M8MA 1KSWA 4JZ3A 1JEGA 2LQWA 1GCQC 3UF4A 1T3LA 1KJWA 2ESWA 2D0NA 2DL3A 4OMOA 1NYFA 2CREA 2AK5A 2SRCA 1E6HA 2GTOA 2DLPA 1WA7A 2KYBA 2LJ1A 2OAWA 2GTJA 1SPKA 1U06A 3O5ZA 4Z8AA 1JXMA 2EYZA 3QWYA 2EYXA 4J9CA 1A0NB 1M3CA 1UUEA 5EC7A 3I5SA 1I1JA 1ZBJA 2C0TA 1ZX6A 2A37A 2KGTA 1SRLA 4IIOA 4RTWA 1OOTA 2EKHA 2M0YA 5L23A 1K4US 2LZ6B 2FO0A 2KRSA 4F17A 2NUZA 3FJ5A 1UG1A 2BZXA 1AWWA 1X6BA 2DX1A 1CSKA 2SEMA 1NEGA 2KYMA 1B07A 3PE0A 1H92A 2L2PA 1HJDA 1V1CA 4LE9A 2EYWA 1PRLC 1VYVA 2EW3A 2CH4W 2RN8A 3UATA 2LQNA 3M0UA 3VS7A 2JW4A 3EGUA 3R6NA 2L3SA 1G83A 2K2MA 3REBB 1T0HA 1JXOA 1Z9QA 2CDTA 2ROTA 2CUDA 3I5RA 3EHQA 4J9HA 1OPKA 2KE9A 1Y57A 2ABLA 2A28A 5GJVB 1I0CA 4ORZA 1UJ0A 2O2OA 4AG1C 3VS2A 1RLQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AFQ C;  1Y0M A;  2BZY A;  2M51 A;  2RF0 A;  1HD3 A;  1QWE A;  4QT7 A;  4ESR A;  2CUB A;  1GBR A;  3REA B;  1PKT A;  2JT4 A;  2PZ1 A;  2ECZ A;  1TUD A;  2KT8 A;  1AEY A;  2E5K A;  4OMN A;  2MOX A;  2RPN A;  1K76 A;  4OML A;  1QKX A;  2D8H A;  2KR3 A;  1G2B A;  5GJW B;  4CC3 A;  1M27 C;  2D8J A;  2KT1 A;  1AZG B;  1WDX A;  1KFZ A;  3NPF A;  1X2K A;  1GCQ A;  2ROL A;  4KRT A;  4F16 A;  1GFD A;  2DM1 A;  1M30 A;  2DL4 A;  1BK2 A;  2IIM A;  3GBQ A;  1OEB A;  2DA9 A;  4J9I A;  1PKS A;  2O9S A;  1T3S A;  1J3T A;  1MV0 B;  1BB9 A;  2JM9 A;  4Z89 A;  2J7I A;  2NWM A;  5IXF A;  1VA7 A;  4JJC A;  5FWB A;  1SHG A;  1AWX A;  2EVR A;  4OMM A;  2DBM A;  4AFU C;  2QDL A;  1CKB A;  3M0T A;  1WFW A;  2KEA A;  2YUN A;  1YWO A;  3CQT A;  4RUG A;  2A08 A;  4AFS C;  1GFC A;  2LNH B;  2VKN A;  1WIE A;  2FPD A;  1N5Z A;  1AWO A;  1YNZ A;  1AVZ C;  1VYU A;  1H8K A;  2AKK A;  2ENM A;  1ABO A;  1MUZ A;  3U23 A;  4Z88 A;  3UA7 A;  2KBT A;  2K9G A;  1SSH A;  3H0F A;  1ZSG A;  2LX7 A;  2GGR A;  2EGE A;  2KRM A;  1YCS B;  3PVQ A;  3NGP A;  1K9A A;  1UEC A;  2JXB A;  1UTI A;  4LUE A;  1X69 A;  1AD5 A;  1NEB A;  1PHT A;  4DEY A;  2H8H A;  1ZUK A;  3EG1 A;  5FW9 A;  1AWJ A;  2FRY A;  4GBQ A;  4D8K A;  1WXT A;  3H0I A;  1GCP A;  1WYX A;  3RBB B;  1YWP A;  3M0P A;  2AZV A;  2DBK A;  5IXB A;  1RI9 A;  4AFZ C;  1KIK A;  1XOV A;  1Z9Z A;  4RTU A;  1PWT A;  4M4Z A;  2L3Q A;  4DEX A;  1X6G A;  1EFN A;  2HEQ A;  1TUC A;  1B3Q A;  4ZNX A;  1YN8 A;  1OPL A;  2EQI A;  1T0J A;  2YUQ A;  5IH2 A;  2CSQ A;  2YT6 A;  2FPE A;  2PNI A;  2LJ0 A;  3M0S A;  1M3A A;  2RQU A;  2HSP A;  2LJ3 A;  1E6G A;  2KXD A;  4JPB W;  2KRO A;  3UA6 A;  1ZLM A;  4HXJ A;  4HCK A;  2GQI A;  1UGV A;  1GL5 A;  2KRN A;  2RMO A;  2DRM A;  2JTE A;  3I35 A;  2LP5 A;  2HDA A;  2XMF A;  3ZL7 C;  2CH4 A;  2B86 A;  3NMZ C;  1ABQ A;  1UFF A;  2DL7 A;  3TSZ A;  2DMO A;  2X3X D;  5IHN A;  4FSS A;  2DJQ A;  3VS4 A;  1WLP B;  4D8D A;  2ED1 A;  3VS1 A;  1K1Z A;  3A98 A;  2BTT A;  2HBW A;  2VVK A;  2EYY A;  5FWC A;  2DRK A;  3VRY A;  2X3W D;  1WXB A;  4OMP A;  2F2V A;  2K79 A;  3THK A;  2F2W A;  1SRM A;  4HVV A;  1E7O A;  4JJB A;  1HSQ A;  2LMJ A;  2CSI A;  1AOJ A;  2HCK A;  4WCI A;  1NM7 A;  4LN2 A;  2O88 A;  4F14 A;  3TSW A;  1SEM A;  2RQW A;  2JM8 A;  1UHF A;  3EHR A;  2YUP A;  2DE0 X;  4RTX A;  2DF6 A;  2GNC A;  3IQL A;  2P4R A;  3VS5 A;  5IHK A;  2EPD A;  2FG0 A;  1K0S A;  3SHW A;  1W70 A;  1JO8 A;  2V1R A;  1QKW A;  1AZE A;  2C0I A;  1NLP C;  2YSQ A;  1U5S A;  2DVJ A;  1CKA A;  1BU1 A;  1GRI A;  2EGA A;  2EGC A;  1RUW A;  2RQV A;  1ZUU A;  4J9D A;  1X27 A;  4RTY A;  4CC4 B;  2L0A A;  3TVT A;  1WI7 A;  1X2Q A;  1I07 A;  4E6R A;  2BZ8 A;  2J05 A;  4CC7 A;  2DL5 A;  4AG2 C;  3VRZ A;  1W6X A;  1U3O A;  3VS6 A;  4J9F A;  4RTV A;  4RTZ A;  2W10 A;  1K0X A;  1W1F A;  2KXC A;  1RLP C;  1NG2 A;  3QWX X;  2JMC A;  1GBQ A;  2K3B A;  2MIO A;  1OV3 A;  4LNP A;  1MV3 A;  1UDL A;  2DL8 A;  1YP5 A;  2KNB B;  2JMA A;  1SHF A;  1NLO C;  1JU5 C;  1FYN A;  2DIL A;  4HVW A;  2I0N A;  3I9Q A;  2W0Z A;  1PRM C;  2PTK A;  2AZS A;  1ZUY A;  2YDL A;  1UHC A;  3SEM A;  4JZ4 A;  1NYG A;  2RQR A;  1S1N A;  2O9V A;  4J9B A;  2A36 A;  1BBZ A;  3C0C A;  2F2X A;  1VYT A;  2YUO A;  4LUD A;  2FPF A;  5I11 A;  3KFV A;  1QCF A;  4JJD A;  1UJY A;  2D1X A;  2JS0 A;  2FEI A;  4EIK A;  1ARK A;  2RNA A;  2RQT A;  4K11 A;  2V1Q A;  4J9G A;  2LCS A;  3VS3 A;  1PNJ A;  2MCN A;  2J6K A;  4J9E A;  1LCK A;  4IIM A;  2VWF A;  3H41 A;  2G6F X;  5HCK A;  4OMQ A;  3NHN A;  5I22 A;  2AKL A;  2J6O A;  1UE9 A;  2J6F A;  4HVU A;  3PVL A;  2CT4 A;  4R0K A;  3LH5 A;  2J06 A;  3M0R A;  2OJ2 A;  3JV3 A;  2C0O A;  1FMK A;  1WXU A;  1H3H A;  2ED0 A;  2JS2 A;  4X1V A;  1QLY A;  3EG3 A;  2GBQ A;  2CT3 A;  3RNJ A;  3ULR B;  2EBP A;  4RTT A;  3EG2 A;  1X43 A;  4GLM A;  1WX6 A;  4Y92 A;  5IHI A;  1QWF A;  4CC2 A;  2K7A A;  3M0Q A;  3VS0 A;  1JQQ A;  2K6D A;  5ECA A;  2O31 A;  3EG0 A;  2DYB A;  2OI3 A;  1M3B A;  2FRW A;  2L3P A;  3H0H A;  4A63 B;  1IO6 A;  1TG0 A;  2DNU A;  1M8M A;  1KSW A;  4JZ3 A;  1JEG A;  2LQW A;  1GCQ C;  3UF4 A;  1T3L A;  1KJW A;  2ESW A;  2D0N A;  2DL3 A;  4OMO A;  1NYF A;  2CRE A;  2AK5 A;  2SRC A;  1E6H A;  2GTO A;  2DLP A;  1WA7 A;  2KYB A;  2LJ1 A;  2OAW A;  2GTJ A;  1SPK A;  1U06 A;  3O5Z A;  4Z8A A;  1JXM A;  2EYZ A;  3QWY A;  2EYX A;  4J9C A;  1A0N B;  1M3C A;  1UUE A;  5EC7 A;  3I5S A;  1I1J A;  1ZBJ A;  2C0T A;  1ZX6 A;  2A37 A;  2KGT A;  1SRL A;  4IIO A;  4RTW A;  1OOT A;  2EKH A;  2M0Y A;  5L23 A;  1K4U S;  2LZ6 B;  2FO0 A;  2KRS A;  4F17 A;  2NUZ A;  3FJ5 A;  1UG1 A;  2BZX A;  1AWW A;  1X6B A;  2DX1 A;  1CSK A;  2SEM A;  1NEG A;  2KYM A;  1B07 A;  3PE0 A;  1H92 A;  2L2P A;  1HJD A;  1V1C A;  4LE9 A;  2EYW A;  1PRL C;  1VYV A;  2EW3 A;  2CH4 W;  2RN8 A;  3UAT A;  2LQN A;  3M0U A;  3VS7 A;  2JW4 A;  3EGU A;  3R6N A;  2L3S A;  1G83 A;  2K2M A;  3REB B;  1T0H A;  1JXO A;  1Z9Q A;  2CDT A;  2ROT A;  2CUD A;  3I5R A;  3EHQ A;  4J9H A;  1OPK A;  2KE9 A;  1Y57 A;  2ABL A;  2A28 A;  5GJV B;  1I0C A;  4ORZ A;  1UJ0 A;  2O2O A;  4AG1 C;  3VS2 A;  1RLQ C; 
#chains in the Genus database with same CATH topology
 3JCM J;  3EH2 A;  4AFQ C;  1Y0M A;  1BIB A;  2EFI A;  2QQB A;  1HD3 A;  2Y4Y A;  1TWB A;  1YJN A;  1VQ4 Q;  2XKO C;  1TTH B;  3S6W A;  2C06 A;  2PZ1 A;  4OMN A;  2RPN A;  1K76 A;  4M7D E;  3M53 A;  1KQ1 A;  8ATC B;  1G2B A;  5GJW B;  4M78 D;  1QVP A;  1R8O B;  4BAC A;  2ZZD A;  2KT1 A;  1AZG B;  3DKM A;  1YI2 Q;  1KFZ A;  5I21 A;  5GAN 5;  3MEA A;  2QEX T;  3E2U A;  3FJP A;  1C1A A;  2DA9 A;  3HPW A;  3JB9 I;  1K73 U;  3MO8 A;  3A8O B;  4J9I A;  2RHX A;  1J3T A;  3BW1 A;  1RI0 A;  1VQ8 A;  1BB9 A;  2QQR A;  3CCQ A;  4ELZ C;  2D6F A;  4FT4 A;  5IXF A;  1VA7 A;  5GMK j;  1SHG A;  1IHW A;  1AWX A;  3CXC P;  3N5B B;  2QDL A;  1CKB A;  1WHJ A;  4XU2 A;  3CQT A;  2D9T A;  4ZTJ A;  4HCB A;  1GFC A;  2AIR B;  4F7U B;  5LJ5 f;  2MAM A;  4J7F A;  3LH0 A;  3CD6 A;  4LDY A;  3CCS Q;  4C8Q A;  4CI0 C;  3GNG A;  1K9M R;  2OTL A;  4MZT A;  1AVZ C;  1VYU A;  1H8K A;  4N4H A;  4GLK A;  1VQ4 T;  2H3J A;  4EDU A;  2DEQ A;  5L8R E;  1SSH A;  4GY5 A;  1MMD A;  2LX9 A;  3PMI A;  2K5L A;  1YIT A;  1QCO A;  3HTR A;  4F7U F;  3QZ5 B;  3NGP A;  5J39 A;  1YI2 T;  1K8A U;  1BYM A;  4JLG A;  5HK0 A;  4LUE A;  4M7D G;  1NEB A;  3MP8 A;  1M5Q 1;  2R58 A;  3L2U A;  3FB9 A;  3EG1 A;  5CIU A;  3G6E A;  2FRY A;  3Q1J A;  4D8K A;  4X9D A;  2ZPI B;  3H0I A;  1VQ9 A;  2JVV A;  2VGM A;  3H8Z A;  3OYN A;  1W2B S;  3M0P A;  1ACM B;  4KUD K;  4XTV A;  1O9S A;  4DBH A;  1XOV A;  5KCO A;  1K9M U;  1KD1 C;  2E4H A;  2DER A;  2RHU A;  3OYF A;  3TEE A;  1YN8 A;  2PVO B;  1OPL A;  1OYX A;  3QG1 A;  4OB0 B;  2OTJ A;  2CSQ A;  4YTL A;  2YT6 A;  2PNI A;  1YJW A;  1KHC A;  5CR2 A;  3M56 A;  2HSP A;  4EMK A;  4M77 D;  4HCK A;  3LYI A;  3CCU Q;  1GL5 A;  2KRN A;  1RAF B;  2CZ1 B;  1NJI C;  2LP5 A;  2E5Q A;  2CH4 A;  2B86 A;  4DQ2 A;  3PGG A;  3OYY A;  2DL7 A;  4OB2 B;  2DMO A;  4FSS A;  3OMC A;  3CPW P;  1VOM A;  4D8D A;  3VS1 A;  4M78 A;  2JTF A;  3A98 A;  5CKF A;  3KUF A;  5CVI A;  2X3W D;  4BUG A;  2F2V A;  2K79 A;  1M9S A;  2PVG B;  1SRM A;  3QPH A;  1HSQ A;  2EJF A;  4IKF A;  4WCI A;  2XI9 A;  2RQW A;  4PJJ A;  3JB9 H;  5IHK A;  2RHI A;  1VQ7 Q;  2YLC A;  2V1R A;  1VQN Q;  4RCC A;  1ZSZ C;  3ZBD A;  3CCM A;  1S72 Q;  4M75 C;  2R57 A;  5KYY B;  2EGC A;  1RAB B;  4KBM B;  3TVT A;  5FRN A;  4XK8 E;  3CCU T;  1C6V X;  1W6X A;  2FZK B;  1JB0 E;  4J6X A;  4J9F A;  4RTV A;  3VUZ A;  1K0X A;  3S3O A;  5LJ5 j;  3OBY A;  2WSC E;  2KVQ G;  2MIO A;  2KQW A;  1MV3 A;  1VUB A;  2DL8 A;  2ZPB B;  3AHU A;  1SHF A;  1N8R R;  1FX7 A;  1JU5 C;  1FYN A;  2I0N A;  5LJ3 g;  2YDL A;  1ZUY A;  3TQ7 P;  2L3R A;  4LXC A;  5LJ3 d;  3MEU A;  3WVD B;  2OX7 A;  4JZ4 A;  4LD9 K;  3UPU A;  1PD1 A;  5D7U A;  3QII A;  1OU8 A;  1M1K R;  2QTX A;  5J26 A;  4E7H A;  1MMA A;  1RAH B;  2YUO A;  3JB9 D;  2E3I A;  3RER A;  1VQ7 T;  1UJY A;  1ARK A;  2CP7 A;  5GAN g;  3LWI A;  1VQN T;  5LJ3 h;  3NTH A;  5GAN d;  1PNJ A;  1KK7 A;  4BE0 A;  2RI2 A;  3ASK A;  2MCN A;  3P8H A;  1TS9 A;  1GXI E;  3H41 A;  2HSE B;  4M78 B;  5HCK A;  4ANJ A;  1Y96 A;  3BFM A;  3NHN A;  2JZ2 A;  2J6O A;  2YRD A;  3JRZ A;  3PVL A;  4M7A E;  1N8R U;  3CC2 Q;  3P8B B;  1I81 A;  4J5Y A;  5GAN h;  3JV3 A;  4F04 B;  3I55 T;  2VGN A;  4Z02 A;  2ED0 A;  1KQ2 A;  1QLY A;  3EG3 A;  4BI8 B;  5HY6 A;  5GAO m;  4ZN3 A;  3QDR B;  2CT3 A;  3SD4 A;  3CPF A;  4CRI A;  2FZC B;  1VQL A;  5KYX B;  1M1K U;  3VUB A;  3BY7 A;  1QWF A;  2DKG A;  5M9O A;  5GMK e;  3M0Q A;  2VXE A;  1JQQ A;  2X4J A;  4DA4 A;  4DBR A;  3EG0 A;  3A8G B;  1MND A;  2FRW A;  3EFO A;  3H0H A;  5FU7 B;  4HKE A;  1M8M A;  4E7J A;  1JEG A;  2LQW A;  2V8J A;  3RKW A;  4M77 C;  5FU6 C;  2E3H A;  3PIP A;  2AK5 A;  5A2Q E;  2CP5 A;  3ZEH A;  3QSU A;  2GTO A;  1FMW A;  1N9R A;  2E64 A;  1Q86 C;  2KYB A;  5GAN 2;  1D0Z A;  2HNI A;  1JXM A;  3MCA B;  3CC4 Q;  3JCM b;  4JS5 A;  3CC2 T;  4BDZ A;  1U1T A;  4KGZ B;  3OYJ A;  3CMA A;  1ZBJ A;  1W2B A;  2XIC A;  2A37 A;  2KK4 A;  4EMG A;  1OOT A;  1LNX A;  2EKH A;  4M7A G;  1F1B B;  3J81 E;  3QKJ A;  2LZ6 B;  4QKU A;  1VQM Q;  1CSK A;  1LVK A;  4C92 C;  1PM3 A;  2O4X A;  2EQK A;  1PRL C;  2M9U A;  4ATO A;  3A8H B;  3OS2 A;  2RN8 A;  1OU9 A;  4F7U G;  3M0U A;  2G3R A;  4UC4 A;  3R6N A;  3V7R A;  1G83 A;  1WHM A;  2IPO B;  2K2M A;  3REB B;  1T0H A;  4BE1 A;  2CDT A;  3I5R A;  3M59 A;  3X26 B;  5EG2 A;  5LL6 S;  2KE9 A;  4M77 B;  2ABL A;  1HXD A;  5GJV B;  1M2O A;  3I55 A;  4PJO D;  4ORZ A;  2O2O A;  3CCV Q;  4RKU E;  2CP6 A;  1N9S A;  1FMV A;  2MK5 A;  5IT9 E;  2K3Y A;  1GBR A;  3REA B;  1PKT A;  2JT4 A;  1M2V A;  2ECZ A;  1BI3 A;  3EGX B;  2E5K A;  4OML A;  2KR3 A;  4J6W A;  4OMF B;  4KUL A;  4CC3 A;  5GMK i;  4M77 F;  3V7S A;  5CCA A;  1EIF A;  2D8J A;  5FLX E;  4DOW A;  1X2K A;  2ROL A;  5GAM g;  1IRE B;  1VQO Q;  1TXQ A;  1TUG B;  1Q7Y R;  1GFD A;  1M30 A;  2HD0 A;  1Y07 A;  1VQM T;  1OEB A;  4HA8 A;  4PLL A;  4PK4 A;  3T9N A;  4C92 B;  4QQD A;  1UGP B;  3CME A;  1YIJ T;  4B9X A;  2NUP A;  2NWM A;  2DIQ A;  2DTH A;  3SFM A;  4FYX B;  4IUP A;  4C8Q D;  4OMM A;  5GAM h;  6AT1 B;  2DET A;  4AFU C;  5GAO n;  2NYS A;  1WFW A;  4AFS C;  2V8K A;  3L42 A;  1N6A A;  2VKN A;  1WIE A;  2KSS A;  2E41 A;  4C92 F;  3C94 A;  3CCV T;  2LDM A;  2FPD A;  4MZP A;  3FLG A;  2RH2 A;  3CCJ Q;  1O75 A;  2AKK A;  2ENM A;  2CYZ B;  2O4X B;  1Q7Y U;  4Z88 A;  5LJ5 e;  3UA7 A;  2KBT A;  3L2W A;  3H0F A;  1ZSG A;  2QI2 A;  3H6Z A;  2VC8 A;  4PFZ A;  4C0D B;  1YCS B;  3G4S Q;  3PVQ A;  1UEC A;  2X51 A;  2DEU A;  3CCE Q;  1VQO T;  1VQK A;  1UTI A;  1X69 A;  2MI6 A;  1AD5 A;  3OSS C;  1QP2 A;  1PHT A;  2GFA A;  4ME7 A;  5GAN 3;  2H8H A;  1MGQ A;  3MHX A;  1AWJ A;  1QVF A;  5LJ3 f;  5DLQ E;  1YJ9 Q;  4V2S A;  1WYX A;  4M75 E;  1VQP Q;  1YWP A;  1V29 B;  2KMT A;  2HL5 C;  1RI9 A;  1PG5 B;  2DVE A;  2EQU A;  3J7A F;  1X6G A;  3QZ9 B;  1M2V B;  1EFN A;  3DLM A;  1ZA1 B;  1TH7 A;  2EQM A;  4ZNX A;  3PMT A;  5GAN f;  4IUR A;  2RK2 A;  1T0J A;  2YUQ A;  4JRI A;  4MMK A;  3HFN A;  3LX7 A;  1WJQ A;  1PSF A;  3M0S A;  5C6S A;  2LQK A;  1WQ7 A;  3CCJ T;  3G71 Q;  3C95 A;  4FL6 A;  4PJO A;  2KXD A;  4JPB W;  1G3Y A;  2KRO A;  3UA6 A;  1VQ6 Q;  1WJS A;  2RMO A;  4HCZ A;  2DRM A;  2WSF E;  2XDB A;  2JTE A;  3M9Q A;  2HDA A;  5AT1 B;  3QDF A;  3QO3 A;  1YIJ A;  2NUP B;  2QA4 A;  3CBM A;  1UFF A;  1D3B B;  3QYG B;  3TSZ A;  3G4S T;  1KC8 C;  2HQE A;  3JCM g;  1WLP B;  4RCB A;  2ED1 A;  4OF1 A;  1UB4 A;  4A53 A;  3S3N A;  3RUX A;  1UGR B;  2F5T X;  2HBW A;  2EYY A;  2QAS A;  2RHZ A;  3JCM d;  3JB9 J;  1OZ2 A;  1WXB A;  1KD1 R;  1K8A R;  1WGS A;  2X4X A;  4B9W A;  3EG9 B;  3OYK A;  1E7O A;  4XTX A;  1YJ9 T;  1VIE A;  2A0F B;  2L89 A;  1AOJ A;  1VQP T;  5D6W A;  2Y90 A;  2O88 A;  1SEM A;  4N4G A;  1UHF A;  2YUP A;  3OS1 A;  4RTX A;  2DF6 A;  3UWN A;  2JJ9 A;  4M75 G;  3JCM h;  2FG0 A;  1K0S A;  4A4K A;  5GAO l;  1NJI R;  1QKW A;  2X4Y A;  1AZE A;  2XDD A;  2C0I A;  1NLP C;  3HRT A;  3OS5 A;  5CAI A;  2DVJ A;  1CKA A;  1BU1 A;  4M7D D;  1GRI A;  2BUD A;  4IUT A;  2EGA A;  2KAF A;  1QVG A;  2HKQ B;  1KG1 A;  4FSX A;  1X27 A;  3G71 T;  2E10 A;  1U1S A;  4CC4 B;  4QQ6 A;  2E12 A;  2J05 A;  1JBM A;  2DXC A;  4XTW A;  4AG2 C;  1U3O A;  2DFU A;  3VS6 A;  1KD1 U;  3MKD A;  3VKI A;  4JS4 A;  3QWX X;  1BIA A;  1GBQ A;  1MHN A;  2P0K A;  5I2S A;  1OV3 A;  2KDS A;  4XTY A;  1D0X A;  1FWZ A;  3HL8 A;  5A0G A;  2W0Z A;  4M77 E;  4KH0 B;  2F5K A;  2AZS A;  3GF5 A;  3EH1 A;  2E65 A;  1VQ5 Q;  1NJI U;  1UGS B;  4FT2 A;  4QVZ A;  3MJX A;  5CO7 A;  4PFP A;  4J83 A;  1NYG A;  2QG9 B;  1AHJ B;  1S1N A;  2RQR A;  1B7T A;  3TCJ A;  3PTA A;  4PJO B;  2A36 A;  3C0C A;  2QXF A;  1VYT A;  5GAN 8;  2D1X A;  5DM7 R;  4L59 A;  3CCS T;  4A4H A;  1RAI B;  2PQW A;  2L5Q A;  5LJ3 j;  3VS3 A;  4QVD A;  2QEX A;  1Q95 G;  2M16 A;  2X9H A;  2F1L A;  2VWF A;  2RI3 A;  2G6F X;  1QMC A;  4LD6 A;  1JJ2 S;  4E47 A;  4XQ3 A;  4C92 E;  2CT4 A;  5CKH A;  4E7S A;  1I4K 1;  2OJ2 A;  3L2Z A;  5GAN j;  2ZGW A;  4FYW B;  1H3H A;  2GCX A;  2JS2 A;  4X1V A;  3M4Y A;  3RNJ A;  5GAM f;  3MET A;  4N4I A;  1K9M C;  1X6O A;  4ZGD B;  1W4S A;  1ZSZ A;  1M90 C;  2EBP A;  4C8Q B;  2DK3 A;  5IHI A;  1WX6 A;  2Z0W A;  2MF2 A;  2DTO A;  1TOV A;  2K6D A;  3HP9 A;  2RI5 A;  2ZAE A;  2OI3 A;  4M77 G;  4II1 A;  1VQ4 A;  2IVW A;  4EMH A;  1TG0 A;  2DNU A;  1KSW A;  4JZ3 A;  1GCQ C;  1IGQ A;  3X25 B;  2D0N A;  3JCM Q;  2DL3 A;  2LCC A;  4OP0 A;  2CRE A;  5GAN 7;  1YI2 A;  1BCO A;  4M78 C;  4C8Q F;  3LGF A;  1JRI A;  1E6H A;  3QJ6 A;  2LJ1 A;  4M7D A;  2GTJ A;  4N0A C;  3O5Z A;  2FZG B;  2MMP A;  1U8R A;  2E6Z A;  4XU3 A;  3FIF A;  2EYX A;  4J9C A;  3X28 B;  1M3C A;  1UUE A;  3I5S A;  2CP3 A;  2H3E B;  3X20 B;  1MMG A;  2PUO B;  3RKX A;  4C92 G;  2D0Q B;  1SRL A;  4RTW A;  5L23 A;  1V76 A;  3BE3 A;  3FC3 A;  2X35 A;  3SWN A;  2DJZ A;  2BZX A;  2XU8 A;  1D09 B;  4MDX A;  3QJY A;  1IB8 A;  1B07 A;  1BI2 A;  3I56 Q;  2RD1 A;  3PE0 A;  1N27 A;  3CCS A;  1V1C A;  3MP6 A;  3JSC A;  4LE9 A;  5FU7 C;  4EMK B;  2AT1 B;  4IUU A;  5GMK l;  3OW2 P;  1WHK A;  2XHC A;  4KH1 B;  4ELY C;  1WQW A;  2DD4 A;  1X75 C;  1WHH A;  2ROT A;  4C0F A;  1OPK A;  5HKC A;  1S72 T;  2A28 A;  3A8M B;  1IRX A;  1YHQ Q;  4DBF A;  1M4Z A;  1I0C A;  2DXB A;  4JRQ A;  2RF0 A;  2QYZ A;  2RB6 A;  2GFU A;  1QWE A;  4QT7 A;  4ESR A;  2CUB A;  2RK1 A;  1SSF A;  1OQK A;  2KT8 A;  1SKU B;  1AEY A;  1QKX A;  2D8H A;  2EYQ A;  2O01 E;  3EFR A;  3CCR Q;  3WVE B;  2R5M A;  4M78 F;  3JCM f;  2JNG A;  1C0M A;  2HQX A;  2IIM A;  4FIB A;  4F7U E;  3GBQ A;  2GF7 A;  1UEB A;  1PKS A;  1Q86 U;  2R5A A;  1OX8 A;  2ZCF B;  1T3S A;  3I56 T;  2WAC A;  3VU3 C;  1W2B P;  4AT1 B;  2JM9 A;  3CCL Q;  2J7I A;  2KY9 A;  3JCM P;  3KXT A;  1WZO A;  3CCU A;  5FWB A;  4M7D B;  2MYS A;  1DJ7 B;  2DBM A;  1KQS S;  5GAM j;  3QXE B;  2KEA A;  2YUN A;  4RUG A;  3JCM W;  3E9G A;  2LNH B;  4M7A D;  1YHQ T;  3OYD A;  5AYF A;  2IG0 A;  3JAM E;  1RL2 A;  4X34 A;  1WJR A;  4OVA A;  1N5Z A;  3R6O A;  1AWO A;  1YNZ A;  3SWN B;  1LPL A;  2VV5 A;  2JTM A;  1ABO A;  3CC7 Q;  3ER0 A;  1MUZ A;  4M7D F;  2EQJ A;  3E9F A;  3RMS A;  2K3X A;  2PVD B;  2LX7 A;  2GGR A;  4C5H A;  3S3M A;  3OQ5 A;  3L2R A;  4X9C A;  3CCR T;  1I8F A;  1VQ7 A;  1VQN A;  2P84 A;  4DEY A;  3RDV A;  3A1P A;  1S72 A;  1YJN Q;  4XTZ A;  1WXT A;  1GCP A;  1Y96 B;  5KE3 A;  3CCL T;  4XAX B;  1OI1 A;  2LVM A;  5IXB A;  4AFZ C;  1JJ2 A;  1Z9Z A;  4VUB A;  5KCH A;  3OMG A;  3OA6 A;  1PWT A;  4M4Z A;  2L3Q A;  4DEX A;  2E1H A;  3CXC S;  2XK0 A;  5LJ3 e;  4LDU A;  2HEQ A;  4QQG A;  2XG8 D;  2LNV A;  2EQI A;  4PL6 A;  3OB9 A;  4ZN1 A;  3MEW A;  2FPE A;  2LC4 A;  2E6N A;  3E19 A;  2LJ0 A;  1VQ8 Q;  1M3A A;  4FU6 A;  2RQU A;  3CCQ Q;  2LJ3 A;  3CC4 T;  1ZLM A;  1HK9 A;  2GQI A;  9ATC B;  3CC7 T;  5GAN e;  3MP1 A;  4ZGJ B;  1BI1 A;  3EFO B;  4C0D C;  2ZPH B;  2XMF A;  1D1A A;  1WHL A;  3ZL7 C;  1Q82 R;  4L6V 5;  5GAM d;  2X3X D;  5IHN A;  2DJQ A;  3CD6 Q;  3VS4 A;  4HT8 A;  4Y28 E;  4XTU A;  1RAD B;  2OTL Q;  2BTT A;  2VVK A;  1BI0 A;  2DRK A;  4KGX B;  3VRY A;  4OMP A;  3THK A;  2F2W A;  1YJN T;  2EAY A;  2LMJ A;  2CSI A;  3HSB A;  4J6Y A;  1NM7 A;  4LN2 A;  3TSW A;  2JM8 A;  1YIT Q;  2HBP A;  3EHR A;  2GNC A;  3CC2 A;  1R0C B;  4JLI A;  3FEO A;  3VS5 A;  2EPD A;  3SHW A;  1QVF P;  5KYN A;  1W70 A;  1JO8 A;  3C4S A;  5I2M A;  2YRV A;  3JCM X;  3G6E Q;  2PU9 B;  4M7A A;  1Q82 U;  1VQ8 T;  1VQ9 Q;  1ZUU A;  1NE8 A;  4RTY A;  3CCQ T;  5GMK m;  2L0A A;  1X2Q A;  1I07 A;  1RAC B;  4E6R A;  1Q81 C;  4FCY A;  3L2V A;  5FRM A;  3OYH A;  1W1F A;  2KXC A;  1RLP C;  1OZ3 A;  3E1S A;  2JMC A;  4OB1 B;  4F7U A;  3GNF B;  2OTJ Q;  1UDL A;  3CD6 T;  2JMA A;  4A54 A;  2CZ6 B;  4IUV A;  1YJW Q;  3CPW S;  1NLO C;  2OTL T;  2EKO A;  2RJC A;  3I9Q A;  2DZC A;  4QVC A;  1UHC A;  4C0Z A;  4A4E A;  4M78 E;  5GAN 4;  2EIF A;  2NLU A;  2P4T A;  2RJF A;  4J9B A;  2O9V A;  1Y7X A;  1YIT T;  2YXY A;  3CC4 A;  2JUF A;  4LUD A;  3KFV A;  1QCF A;  1KC8 U;  5CKB A;  1MNE A;  2JS0 A;  5C0M A;  2FEI A;  2V8I A;  2RNA A;  2QQA A;  3JB9 F;  4K11 A;  4J9G A;  4Q5W A;  3D7S B;  2VYT A;  3G6E T;  2J6K A;  5KYU A;  2DTI A;  1VQM A;  4J9E A;  2YLB A;  4IIM A;  5DLO A;  1VQ9 T;  1FXX A;  2HKN A;  3HKS A;  3SDZ A;  2ZPF B;  4OMQ A;  4MZM A;  1X01 A;  5CKD A;  3GIB A;  2AKL A;  5D6X A;  1UE9 A;  4HVU A;  1D0Y A;  3LH5 A;  5KYW A;  2C0O A;  1FMK A;  2LT4 A;  4M75 D;  3CCE T;  2K4Y A;  1QVG P;  3C12 A;  2RA2 A;  2CKK A;  3CCM Q;  2OTJ T;  1BCM A;  4BDY A;  4BY6 B;  1KQS A;  5CKE A;  3V8L A;  1YJW T;  4KUI A;  4RTT A;  3EG2 A;  1X43 A;  4GLM A;  3G7Z A;  4Y92 A;  3ME9 A;  3CCV A;  4CC2 A;  2K57 A;  3VS0 A;  3A5Z B;  5ECA A;  4PJO C;  4HCC A;  4M7A B;  3RMQ A;  5GAM e;  4KGV B;  4XU0 A;  4M78 G;  4E7Z A;  3HFO A;  3UF4 A;  3OW2 S;  1ZA2 B;  1T3L A;  2DAQ A;  1KJW A;  2ZPG B;  1B34 A;  2ESW A;  3CEY A;  4PLI A;  3DB3 A;  4OMO A;  1NYF A;  2I2L A;  3HHT B;  4QW2 A;  1VQO A;  2SRC A;  2MWO A;  2XD0 A;  1VQ6 T;  1K73 C;  2DLP A;  2CP0 A;  2OAW A;  1PD0 A;  4M7A F;  1SPK A;  1U06 A;  3TRE A;  1QCN A;  1OX9 A;  5GAN 6;  3M4G A;  1M90 R;  1I5L A;  5KH6 A;  5EC7 A;  2WSE E;  3M55 A;  1TU0 B;  2C0T A;  4IIO A;  2M0Y A;  3L1A A;  2FO0 A;  3CCM T;  1VIF A;  4C8Q C;  2NUZ A;  1WHG A;  4FW1 A;  1IXD A;  3CXC A;  1AWW A;  5KYY A;  2DX1 A;  3GPL A;  1EX4 A;  2SEM A;  4IUQ A;  1H92 A;  2DXU A;  2L2P A;  1HJD A;  1LOJ A;  4C5G A;  5KYU B;  3CCJ A;  2DO3 A;  1VYV A;  2EW3 A;  2CH4 W;  3UT1 A;  2Y4X A;  1R0B G;  2LQN A;  5IN1 A;  3VS7 A;  2JW4 A;  3EGU A;  2YHT A;  2L3S A;  4TVR A;  1JXO A;  1Z9Q A;  3O8V A;  2CUD A;  3EHQ A;  5KYW B;  1Y57 A;  4KT0 E;  1VQL Q;  3G4S A;  1K8A C;  1NPP A;  4E7K A;  1M90 U;  2FL7 A;  3CCE A;  1UJ0 A;  2CS7 A;  3VYG A;  4AG1 C;  3VS2 A;  2BE9 B;  4JJN K;  4J7I A;  3URG A;  4LDX A;  2BZY A;  4PJO F;  2M51 A;  3V8K A;  3RKY A;  3OYG A;  2K5F A;  1YJ9 A;  3SB2 A;  3UDC A;  4OGC A;  1VQP A;  1SG5 A;  1TUD A;  2MOX A;  4XU1 A;  2RHY A;  1M27 C;  2QGG A;  1WDX A;  4C5I A;  2HL3 A;  3NPF A;  1GCQ A;  4RG8 A;  4KRT A;  4F16 A;  1YFN A;  2DM1 A;  4M75 A;  1D1B A;  2DL4 A;  1BK2 A;  3NTI A;  1B34 B;  1VQ5 T;  4A4G A;  2O9S A;  5IAY A;  4NL3 A;  4EMK C;  3GLX A;  1MV0 B;  2CZ7 B;  3P8D A;  2QGF B;  3X24 B;  4Z89 A;  4FM4 B;  3G71 A;  5GMK h;  1VQ6 A;  4N0A A;  3BDU A;  4JJC A;  2LCL A;  3JCM e;  3CMA Q;  5DY9 A;  2VXF A;  7AT1 B;  1ZHI A;  2EVR A;  3M0T A;  1YWO A;  2YWW A;  3HRS A;  2A08 A;  4C92 D;  1VQL T;  5KYX A;  3GP8 A;  2HZY A;  2CGH A;  1LJO A;  1RAG B;  8AT1 B;  3MPU B;  3VV0 A;  4BD3 A;  4JRP A;  3CPW A;  3U23 A;  4ZGE B;  2K9G A;  1G5V A;  2COZ A;  2EGE A;  2BE7 D;  2KRM A;  4FYV B;  1K9A A;  3I55 Q;  2JXB A;  2X4W A;  2KI7 A;  2RJE A;  4OGE A;  3EGD A;  1YCY A;  1ZUK A;  1PCX A;  2CZ0 B;  4NS5 A;  3BDL A;  5FW9 A;  2JN0 A;  4JRK A;  2FB7 A;  3FRN A;  4GBQ A;  4BI4 A;  5CK9 A;  2RO0 A;  4M7D C;  3RBB B;  2AZV A;  1Q86 R;  4D6W A;  3DLL A;  2DBK A;  3OYC A;  3CMA T;  1KIK A;  1RAA B;  3M54 A;  4RTU A;  1ZQ1 A;  2OAU A;  4BI3 A;  3M5A A;  1TUC A;  1B3Q A;  2V26 A;  4P5N A;  3JCM c;  4Y91 A;  2DPP B;  1D1C A;  2AHJ B;  5IH2 A;  1AT1 B;  3SWN C;  2GQV A;  3MEV A;  2YRC A;  4OB3 B;  2HMA A;  1QVF S;  1ZSZ B;  2QQ9 A;  3OSV A;  3CME Q;  4M75 B;  4PKC C;  1E6G A;  4C5E A;  4HXJ A;  4WTO B;  1UGV A;  3EAE A;  3LW5 E;  1VQ5 A;  1IGU A;  2B8A A;  3I35 A;  1WNL A;  3JB9 G;  4PJL A;  4O6J A;  2M0O A;  1M1F A;  1MMN A;  3NMZ C;  2P0P A;  1ABQ A;  4M77 A;  3RR6 A;  2NUT A;  1WPY A;  2FVU A;  3PNW C;  2M02 A;  5A0D A;  2RJD A;  1K1Z A;  2K2V A;  2PUK B;  5FWC A;  3OW2 A;  4M75 F;  2VAS A;  4HVV A;  3OBW A;  2MWP A;  4JJB A;  3RIR A;  2HCK A;  1HYO A;  2K5I A;  1XQH A;  4F14 A;  3EGX A;  1XNI A;  4BB7 A;  1N8R C;  3INZ A;  2DE0 X;  3GOX A;  3IQL A;  2RM4 A;  3PFS A;  3JCM V;  2P4R A;  4B6M A;  1VQK Q;  5A0L A;  1Y71 A;  4E7I A;  3M57 A;  5LJ5 g;  2ATC B;  2M1H A;  2YSQ A;  1U5S A;  2CP2 A;  5LJ5 d;  3H9N A;  2EJ9 A;  3V8J A;  4C92 A;  3TU4 K;  1M1K C;  1RUW A;  2RQV A;  3CME T;  1JJ2 P;  4J9D A;  2COW A;  4PJM A;  3EGD B;  4R56 A;  1WI7 A;  3M58 A;  2XDP A;  2BZ8 A;  4CC7 A;  2DL5 A;  1M1G A;  1BKB A;  3VRZ A;  2LRQ A;  4ZTF A;  5LJ5 h;  4LDV A;  4PJO E;  4RTZ A;  2W10 A;  4PNO A;  1R77 A;  1NG2 A;  2FHD A;  1G3W A;  3LLR A;  3QUI A;  2MPX C;  2K3B A;  4NOY A;  4LNP A;  5KE2 A;  5CQY A;  4R55 A;  2HQH A;  1YP5 A;  2KNB B;  3G1J A;  2FYK A;  3PIO A;  1QVG S;  2DIL A;  4HVW A;  4JDS A;  5J3B A;  1PRM C;  2PTK A;  3SEM A;  2ZPE B;  1QQJ A;  2LTO A;  3HRU A;  1YIJ Q;  3OYM A;  2QA4 Q;  2P0Q A;  3FDR A;  2QDY B;  2QQS A;  4LDW A;  1BBZ A;  4MML A;  1NZ9 A;  3DB4 A;  2F2X A;  4EPC A;  2FPF A;  4C0G A;  5I11 A;  4JJD A;  4EIK A;  1VQK T;  1Q81 R;  2RQT A;  2V1Q A;  1EZZ B;  4A4F A;  3NFC A;  1H3Z A;  2LCS A;  3J80 E;  4PJN A;  2NUT B;  2LT1 A;  5FU6 B;  1LCK A;  1P92 A;  4C8Q E;  5GAO r;  2EWN A;  3I56 A;  5I22 A;  2HAX A;  2J6F A;  3AT1 B;  1PSE A;  4R0K A;  3OYA A;  3RES A;  2J06 A;  2QK0 A;  1IZ6 A;  3M0R A;  1WXU A;  3F70 A;  1KHI A;  3OYB A;  2VB6 A;  2GBQ A;  4L5G A;  3PT9 A;  4NL2 A;  3OY9 A;  4PJO G;  1YHQ A;  2BIV A;  3ULR B;  3L2Q A;  3QHS A;  4JUV A;  2DXT A;  3OYE A;  2K7A A;  1RAE B;  1Q81 U;  2O31 A;  2DYB A;  1M3B A;  1ZBX A;  4J8O A;  2L3P A;  4A63 B;  3ZFJ A;  1IO6 A;  2QA4 T;  1OUL A;  1G3T A;  3QYH B;  4RMO A;  4DOV A;  1NPR A;  3KBG A;  3LGL A;  3LWH A;  1D3B A;  3OS0 A;  3CBP A;  3CCR A;  4RG2 A;  3VJP A;  2E70 A;  1KC8 R;  5GAO q;  3EG9 A;  1WA7 A;  1I5O B;  5GAO p;  2DD5 A;  1G8X A;  4Z8A A;  1XJW B;  5HK3 A;  2EYZ A;  3QWY A;  1PC0 A;  3CCL A;  1A0N B;  1M8V A;  4C8Q G;  3CBO A;  1I1J A;  3VYH B;  1H64 1;  2QAZ A;  5FRO A;  1ZX6 A;  2EJG A;  4FYY B;  4MDW A;  4BY6 C;  2KGT A;  1SF9 A;  4HT9 A;  1UGQ B;  3OYI A;  3WXM B;  1K4U S;  2JOY A;  2KRS A;  4F17 A;  2QEX Q;  2DYI A;  1XTD A;  2QTV A;  3FJ5 A;  1UG1 A;  1IHV A;  1X6B A;  1NEG A;  2KYM A;  4PFO A;  2F69 A;  4M7A C;  1G3S A;  4E2F B;  4WF2 A;  5CQX A;  3A8L B;  2A3L A;  2EYW A;  4DBQ A;  3V7C A;  4O5V A;  1QP3 A;  2BKD N;  1Q82 C;  1NBE B;  1TSF A;  5D6Y A;  3UAT A;  2VUB A;  2L8D A;  4E7L A;  3CC7 A;  3QBY A;  1Q7Y C;  4FW2 A;  2XID A;  1KQS P;  1K73 R;  2DZ9 A;  2LQ8 A;  4BE2 A;  4J9H A;  4AMC A;  3OYL A;  2A7Y A;  3NTK A;  1YBY A;  2DIG A;  1QW1 A;  3EFS A;  1RLQ C;  2COY A; 
#chains in the Genus database with same CATH homology
 4AFQ C;  1Y0M A;  2BZY A;  2M51 A;  2RF0 A;  1HD3 A;  1QWE A;  4QT7 A;  4ESR A;  2CUB A;  1GBR A;  3REA B;  1PKT A;  2JT4 A;  2PZ1 A;  2ECZ A;  1TUD A;  2KT8 A;  1AEY A;  2E5K A;  4OMN A;  2MOX A;  2RPN A;  1K76 A;  4OML A;  1QKX A;  2D8H A;  2KR3 A;  1G2B A;  5GJW B;  4CC3 A;  1M27 C;  2D8J A;  2KT1 A;  1AZG B;  1WDX A;  1KFZ A;  3NPF A;  1X2K A;  1GCQ A;  2ROL A;  4KRT A;  4F16 A;  1GFD A;  2DM1 A;  1M30 A;  2DL4 A;  1BK2 A;  2IIM A;  3GBQ A;  1OEB A;  2DA9 A;  4J9I A;  1PKS A;  2O9S A;  1T3S A;  1J3T A;  1MV0 B;  1BB9 A;  2JM9 A;  4Z89 A;  2J7I A;  2NWM A;  5IXF A;  1VA7 A;  4JJC A;  5FWB A;  1SHG A;  1AWX A;  2EVR A;  4OMM A;  2DBM A;  4AFU C;  2QDL A;  1CKB A;  3M0T A;  1WFW A;  2KEA A;  2YUN A;  1YWO A;  3CQT A;  4RUG A;  2A08 A;  4AFS C;  1GFC A;  2LNH B;  2VKN A;  1WIE A;  2FPD A;  1N5Z A;  1AWO A;  1YNZ A;  1AVZ C;  1VYU A;  1H8K A;  2AKK A;  2ENM A;  1ABO A;  1MUZ A;  3U23 A;  4Z88 A;  3UA7 A;  2KBT A;  2K9G A;  1SSH A;  3H0F A;  1ZSG A;  2LX7 A;  2GGR A;  2EGE A;  2KRM A;  1YCS B;  3PVQ A;  3NGP A;  1K9A A;  1UEC A;  2JXB A;  1UTI A;  4LUE A;  1X69 A;  1AD5 A;  1NEB A;  1PHT A;  4DEY A;  2H8H A;  1ZUK A;  3EG1 A;  5FW9 A;  1AWJ A;  2FRY A;  4GBQ A;  4D8K A;  1WXT A;  3H0I A;  1GCP A;  1WYX A;  3RBB B;  1YWP A;  3M0P A;  2AZV A;  2DBK A;  5IXB A;  1RI9 A;  4AFZ C;  1KIK A;  1XOV A;  1Z9Z A;  4RTU A;  1PWT A;  4M4Z A;  2L3Q A;  4DEX A;  1X6G A;  1EFN A;  2HEQ A;  1TUC A;  1B3Q A;  4ZNX A;  1YN8 A;  1OPL A;  2EQI A;  1T0J A;  2YUQ A;  5IH2 A;  2CSQ A;  2YT6 A;  2FPE A;  2PNI A;  2LJ0 A;  3M0S A;  1M3A A;  2RQU A;  2HSP A;  2LJ3 A;  1E6G A;  2KXD A;  4JPB W;  2KRO A;  3UA6 A;  1ZLM A;  4HXJ A;  4HCK A;  2GQI A;  1UGV A;  1GL5 A;  2KRN A;  2RMO A;  2DRM A;  2JTE A;  3I35 A;  2LP5 A;  2HDA A;  2XMF A;  3ZL7 C;  2CH4 A;  2B86 A;  3NMZ C;  1ABQ A;  1UFF A;  2DL7 A;  3TSZ A;  2DMO A;  2X3X D;  5IHN A;  4FSS A;  2DJQ A;  3VS4 A;  1WLP B;  4D8D A;  2ED1 A;  3VS1 A;  1K1Z A;  3A98 A;  2BTT A;  2HBW A;  2VVK A;  2EYY A;  5FWC A;  2DRK A;  3VRY A;  2X3W D;  1WXB A;  4OMP A;  2F2V A;  2K79 A;  3THK A;  2F2W A;  1SRM A;  4HVV A;  1E7O A;  4JJB A;  1HSQ A;  2LMJ A;  2CSI A;  1AOJ A;  2HCK A;  4WCI A;  1NM7 A;  4LN2 A;  2O88 A;  4F14 A;  3TSW A;  1SEM A;  2RQW A;  2JM8 A;  1UHF A;  3EHR A;  2YUP A;  2DE0 X;  4RTX A;  2DF6 A;  2GNC A;  3IQL A;  2P4R A;  3VS5 A;  5IHK A;  2EPD A;  2FG0 A;  1K0S A;  3SHW A;  1W70 A;  1JO8 A;  2V1R A;  1QKW A;  1AZE A;  2C0I A;  1NLP C;  2YSQ A;  1U5S A;  2DVJ A;  1CKA A;  1BU1 A;  1GRI A;  2EGA A;  2EGC A;  1RUW A;  2RQV A;  1ZUU A;  4J9D A;  1X27 A;  4RTY A;  4CC4 B;  2L0A A;  3TVT A;  1WI7 A;  1X2Q A;  1I07 A;  4E6R A;  2BZ8 A;  2J05 A;  4CC7 A;  2DL5 A;  4AG2 C;  3VRZ A;  1W6X A;  1U3O A;  3VS6 A;  4J9F A;  4RTV A;  4RTZ A;  2W10 A;  1K0X A;  1W1F A;  2KXC A;  1RLP C;  1NG2 A;  3QWX X;  2JMC A;  1GBQ A;  2K3B A;  2MIO A;  1OV3 A;  4LNP A;  1MV3 A;  1UDL A;  2DL8 A;  1YP5 A;  2KNB B;  2JMA A;  1SHF A;  1NLO C;  1JU5 C;  1FYN A;  2DIL A;  4HVW A;  2I0N A;  3I9Q A;  2W0Z A;  1PRM C;  2PTK A;  2AZS A;  1ZUY A;  2YDL A;  1UHC A;  3SEM A;  4JZ4 A;  1NYG A;  2RQR A;  1S1N A;  2O9V A;  4J9B A;  2A36 A;  1BBZ A;  3C0C A;  2F2X A;  1VYT A;  2YUO A;  4LUD A;  2FPF A;  5I11 A;  3KFV A;  1QCF A;  4JJD A;  1UJY A;  2D1X A;  2JS0 A;  2FEI A;  4EIK A;  1ARK A;  2RNA A;  2RQT A;  4K11 A;  2V1Q A;  4J9G A;  2LCS A;  3VS3 A;  1PNJ A;  2MCN A;  2J6K A;  4J9E A;  1LCK A;  4IIM A;  2VWF A;  3H41 A;  2G6F X;  5HCK A;  4OMQ A;  3NHN A;  5I22 A;  2AKL A;  2J6O A;  1UE9 A;  2J6F A;  4HVU A;  3PVL A;  2CT4 A;  4R0K A;  3LH5 A;  2J06 A;  3M0R A;  2OJ2 A;  3JV3 A;  2C0O A;  1FMK A;  1WXU A;  1H3H A;  2ED0 A;  2JS2 A;  4X1V A;  1QLY A;  3EG3 A;  2GBQ A;  2CT3 A;  3RNJ A;  3ULR B;  2EBP A;  4RTT A;  3EG2 A;  1X43 A;  4GLM A;  1WX6 A;  4Y92 A;  5IHI A;  1QWF A;  4CC2 A;  2K7A A;  3M0Q A;  3VS0 A;  1JQQ A;  2K6D A;  5ECA A;  2O31 A;  3EG0 A;  2DYB A;  2OI3 A;  1M3B A;  2FRW A;  2L3P A;  3H0H A;  4A63 B;  1IO6 A;  1TG0 A;  2DNU A;  1M8M A;  1KSW A;  4JZ3 A;  1JEG A;  2LQW A;  1GCQ C;  3UF4 A;  1T3L A;  1KJW A;  2ESW A;  2D0N A;  2DL3 A;  4OMO A;  1NYF A;  2CRE A;  2AK5 A;  2SRC A;  1E6H A;  2GTO A;  2DLP A;  1WA7 A;  2KYB A;  2LJ1 A;  2OAW A;  2GTJ A;  1SPK A;  1U06 A;  3O5Z A;  4Z8A A;  1JXM A;  2EYZ A;  3QWY A;  2EYX A;  4J9C A;  1A0N B;  1M3C A;  1UUE A;  5EC7 A;  3I5S A;  1I1J A;  1ZBJ A;  2C0T A;  1ZX6 A;  2A37 A;  2KGT A;  1SRL A;  4IIO A;  4RTW A;  1OOT A;  2EKH A;  2M0Y A;  5L23 A;  1K4U S;  2LZ6 B;  2FO0 A;  2KRS A;  4F17 A;  2NUZ A;  3FJ5 A;  1UG1 A;  2BZX A;  1AWW A;  1X6B A;  2DX1 A;  1CSK A;  2SEM A;  1NEG A;  2KYM A;  1B07 A;  3PE0 A;  1H92 A;  2L2P A;  1HJD A;  1V1C A;  4LE9 A;  2EYW A;  1PRL C;  1VYV A;  2EW3 A;  2CH4 W;  2RN8 A;  3UAT A;  2LQN A;  3M0U A;  3VS7 A;  2JW4 A;  3EGU A;  3R6N A;  2L3S A;  1G83 A;  2K2M A;  3REB B;  1T0H A;  1JXO A;  1Z9Q A;  2CDT A;  2ROT A;  2CUD A;  3I5R A;  3EHQ A;  4J9H A;  1OPK A;  2KE9 A;  1Y57 A;  2ABL A;  2A28 A;  5GJV B;  1I0C A;  4ORZ A;  1UJ0 A;  2O2O A;  4AG1 C;  3VS2 A;  1RLQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...