1GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gbqA00
5I22A 2RQRA 1M30A 2JMAA 5I11A 1WIEA 2V1QA 2BZ8A 1H8KA 2FRWA 4RTZA 4D8KA 4RTUA 2EGCA 2EYZA 1YWOA 1K76A 2KYMA 2EKHA 4JJBA 1RLPC 1X2KA 2DJQA 1M3CA 1BU1A 1AVZC 2DL5A 5IXFA 2KT1A 1HSQA 1BB9A 2CDTA 1UG1A 3VS6A 3TSZA 1SRLA 3KFVA 1UUEA 1T0HA 2DVJA 1BBZA 4JJCA 1ZSGA 2ENMA 3R6NA 1GCQA 2J6KA 4CC4B 1A0NB 2A08A 2LJ1A 2K2MA 2K3BA 1PRMC 1VYTA 2J06A 4OMLA 1UECA 3VRZA 5GJWB 2MCNA 1JXOA 2RNAA 1PNJA 1VA7A 2FRYA 2EW3A 2L0AA 2CT4A 3A98A 1AWWA 2GNCA 4EIKA 1J3TA 1K4US 1SRMA 1W1FA 1Z9QA 3C0CA 2O88A 5IHKA 3H0FA 2PTKA 2DF6A 3NGPA 1JU5C 2ESWA 2BZYA 3REAB 4DEYA 1ABQA 4DEXA 1W6XA 2RF0A 2BZXA 1K1ZA 2EGAA 2V1RA 2DMOA 1NG2A 2VVKA 4JZ3A 2B86A 1AWJA 2IIMA 2K6DA 2H8HA 3RBBB 4Z89A 2GTOA 4JZ4A 1V1CA 2DX1A 2LQNA 2DM1A 2W0ZA 1SSHA 1QWEA 4AFZC 2SEMA 3TSWA 3EGUA 2YT6A 4IIOA 1G2BA 1Y57A 2EYWA 2KRMA 4GLMA 3H0IA 4LNPA 2HDAA 4HCKA 2DRMA 2VWFA 2OAWA 1K0XA 2F2VA 3SEMA 1E6HA 1U3OA 3LH5A 2DYBA 1AWXA 1S1NA 1X43A 3JV3A 1GRIA 2FPDA 4Z88A 1T3LA 2LJ3A 1JQQA 3THKA 2C0TA 1NEGA 4J9CA 2D8JA 1GCQC 4OMPA 4CC7A 1U5SA 2LP5A 4R0KA 4RTWA 2JT4A 3NPFA 1WLPB 1XOVA 2RQUA 2JM9A 2OJ2A 1VYVA 1UTIA 1AEYA 1CKBA 1CSKA 1H92A 2D8HA 1ZUKA 2O2OA 3VS0A 2EYXA 4LUEA 2FEIA 1LCKA 3EG1A 3REBB 1AZGB 4AFUC 3RNJA 1I07A 2C0OA 3VS7A 3GBQA 4HVWA 1ZX6A 1PKSA 1KFZA 2X3WD 3I5RA 3U23A 2FPEA 1QLYA 2PZ1A 4AFSC 2AKKA 2P4RA 1WFWA 3QWYA 2J05A 4RTYA 1UJYA 2GBQA 2CUDA 4Z8AA 3I35A 3NMZC 1WDXA 4JJDA 1UHFA 2BTTA 4J9FA 4RTXA 1K9AA 1UHCA 2DNUA 1PKTA 2CT3A 1FYNA 5FW9A 2LNHB 2JMCA 1JO8A 3H41A 1B3QA 1Y0MA 2KT8A 2JW4A 1KIKA 1M3AA 2ECZA 4CC3A 4J9BA 2L3PA 2ABLA 2EBPA 2KNBB 2GGRA 1GFDA 2XMFA 2FG0A 1UDLA 1VYUA 3UA7A 3PVLA 1AD5A 2HBWA 3QWXX 2PNIA 3UATA 1CKAA 2RQTA 1SHFA 1FMKA 1UJ0A 2L3SA 2DL4A 1WXTA 2D0NA 2J6OA 1K0SA 1HD3A 2ROLA 4GBQA 1NLOC 1UFFA 4HVVA 4OMMA 2ED0A 1ZUYA 2NUZA 3M0SA 2KYBA 1JEGA 1T3SA 2KE9A 2K7AA 1NLPC 4F14A 4CC2A 2RPNA 4OMNA 1SHGA 1HJDA 2KBTA 1NM7A 2KRSA 4RTVA 2HCKA 3M0PA 3PVQA 2G6FX 2KR3A 1EFNA 2DRKA 2MIOA 3UA6A 1AZEA 2K79A 1OPKA 2JM8A 3M0RA 2YUOA 2KROA 1MV3A 2FO0A 4J9GA 1X69A 1W70A 2M0YA 1WXUA 1ZUUA 1OPLA 2MOXA 4RTTA 2EVRA 2AKLA 1IO6A 2W10A 4KRTA 2DBKA 1YCSB 2SRCA 2AK5A 2YDLA 4OMQA 2X3XD 1GL5A 3M0QA 4JPBW 2YUPA 2DL3A 2CSIA 2EYYA 1BK2A 1WYXA 2JS0A 2YUQA 1ZLMA 1QKWA 2KXDA 4ZNXA 1RLQC 2CSQA 3ZL7C 2O9VA 2KGTA 3UF4A 5FWBA 2M51A 4M4ZA 2EPDA 1PWTA 1TUCA 2KEAA 1WI7A 2FPFA 4LUDA 1I0CA 1OOTA 1OV3A 1X2QA 4WCIA 1WA7A 4Y92A 2HEQA 5L23A 2DE0X 1YWPA 2RN8A 1AOJA 1X6BA 2E5KA 1GBRA 2YSQA 3FJ5A 2QDLA 4J9DA 1E6GA 3VRYA 1SPKA 4AG1C 4J9IA 5IH2A 3I9QA 4D8DA 4ESRA 3EG0A 3TVTA 1WX6A 1X6GA 1JXMA 1YN8A 1X27A 5IXBA 2LJ0A 1T0JA 1B07A 3PE0A 1SEMA 1AWOA 3M0TA 2EQIA 1KJWA 2JTEA 1G83A 2JXBA 4FSSA 5ECAA 2RQVA 4HVUA 2L3QA 1GBQA 2DBMA 4E6RA 2F2WA 1QWFA 2DILA 1KSWA 1UGVA 2O31A 2L2PA 5EC7A 3VS1A 2KXCA 2LX7A 2HSPA 1QCFA 1ABOA 2A28A 1M8MA 2GTJA 1NYGA 1TG0A 1Z9ZA 5IHIA 5IHNA 2F2XA 2CH4W 3VS2A 4OMOA 1MUZA 5GJVB 2AZVA 3I5SA 4AG2C 2KRNA 4LE9A 1UE9A 2CH4A 4F16A 4F17A 4HXJA 1MV0B 1E7OA 4X1VA 4RUGA 2ED1A 1H3HA 2DA9A 2DL8A 3EHQA 1RUWA 1NYFA 4J9HA 1ARKA 2LZ6B 2CUBA 3EHRA 4IIMA 1YP5A 2LQWA 1NEBA 2A36A 4LN2A 2RMOA 3SHWA 1U06A 2J6FA 4A63B 4J9EA 3O5ZA 1YNZA 2JS2A 1QKXA 2OI3A 3EG3A 3CQTA 1M27C 1ZBJA 2O9SA 3ULRB 2GQIA 2ROTA 3EG2A 1PRLC 2CREA 3NHNA 5HCKA 1PHTA 5FWCA 2J7IA 1I1JA 4K11A 3VS5A 2YUNA 2RQWA 3VS3A 2D1XA 2LMJA 1GFCA 2C0IA 3H0HA 2I0NA 1N5ZA 4QT7A 3VS4A 2LCSA 1M3BA 2AZSA 1OEBA 2VKNA 4ORZA 2A37A 1RI9A 2NWMA 1TUDA 1WXBA 4AFQC 2EGEA 2DLPA 2DL7A 3M0UA 2K9GA 3IQLA 1GCPA
chains in the Genus database with same CATH superfamily
5I22A 4A4FA 3SWNA 4DOWA 2DEUA 3X20B 3CXCA 1S72T 1WIEA 5FROA 2BZ8A 1HYOA 1M5Q1 5CIUA 1H8KA 2EGCA 2EQMA 4M75F 2VYTA 2QEXT 3CC7A 4XU2A 5FU7B 2DJQA 1Y07A 4O6JA 4GLKA 4M7DE 5IXFA 4XU1A 4RKUE 1RAHB 4C92C 5CKHA 3FLGA 2K5LA 2QGGA 1T0HA 1BBZA 3CCQA 3OYMA 1A0NB 1VQ6A 1QVFS 2YLBA 1PRMC 4M7DF 3JRZA 3MPUB 4C0DB 3BE3A 1JXOA 2HQHA 2RNAA 4ELYC 1KD1C 2FRYA 4NL2A 3VYGA 1QP3A 3A98A 5FU6C 3HL8A 4EIKA 1J3TA 3HKSA 1K4US 5GMKl 1W1FA 4OF1A 2OX7A 4KUDK 5IHKA 2X35A 4QQ6A 4N0AC 3V8JA 2QQAA 3CC7T 5LJ5d 4L5GA 5LJ3h 4C5GA 4DEXA 2XICA 3QDRB 3EG9A 2PQWA 1NG2A 1S72Q 1VQ8Q 3M53A 3CC2A 4RG2A 4Z89A 1K73C 1W2BP 2DX1A 3G71A 4IUVA 4AT1B 4WF2A 1QWEA 3SD4A 2QEXQ 4BE1A 1WNLA 5GAMj 3CCQT 4AFZC 2SEMA 3X24B 2QASA 1VQ6T 5HY6A 2GQVA 1PD0A 1ZQ1A 2OAWA 3CPWP 3HP9A 4B9WA 1U3OA 4V2SA 4ME7A 1AWXA 2FPDA 3GPLA 2LJ3A 1O9SA 3MEVA 2YRDA 5GAN3 1I8FA 3THKA 2C0TA 4OMPA 1D0ZA 4CC7A 4MZTA 3QUIA 2JT4A 2VASA 4XTWA 3TREA 2RQUA 3E9GA 1M8VA 4R56A 3CC2T 1XJWB 3VUBA 1AEYA 2ZPGB 3HRTA 3G71T 1CSKA 1ZHIA 4QVCA 1ZUKA 1QVFA 3VS0A 4M7DG 1G3TA 4JUVA 4LUEA 1G5VA 2EJFA 2PU9B 1LCKA 2CP2A 3EG1A 1FWZA 3OS1A 4JLIA 2ZGWA 2MWPA 1I07A 1BIBA 1N27A 4M77B 4R55A 4N4HA 4M75D 2EYQA 1FX7A 1XNIA 2X3WD 3V8LA 1M90R 5I2SA 4KGZB 3CMAT 4M77A 2PZ1A 3QWYA 1ZSZB 3CBMA 5CQYA 5D6YA 1QVGS 5GANf 1IHWA 3QPHA 4OVAA 4RTXA 4XQ3A 3S3NA 3HHTB 4LDUA 2OTJA 1WHGA 1V29B 1Y96A 5GAMe 3CCJA 1YJNQ 2CT3A 1FYNA 4F7UB 2M02A 2L8DA 4XTUA 3FC3A 3M5AA 1IGQA 2V8IA 3H41A 1Y0MA 4F7UA 3OYJA 1KIKA 2HNIA 2M1HA 1M90C 4M7DD 4OB3B 2L3PA 4O5VA 1IZ6A 2XMFA 2A3LA 2FG0A 3UA7A 5C0MA 5L8RE 2HBWA 2PNIA 3CC2Q 4FYVB 2M16A 1CKAA 2CP6A 2WSEE 5GMKm 3JCMd 1SF9A 2DL4A 3G71Q 4PNOA 3HPWA 2GFAA 2ZPBB 4NOYA 3DB3A 3OBYA 4EDUA 1FMWA 1M2VB 2NUZA 4JLGA 4BDZA 2P0PA 3T9NA 2OTJT 4M7AC 1KG1A 4F14A 4HA8A 4OMNA 1SHGA 1HJDA 2KBTA 1NM7A 1N6AA 1WHLA 3M56A 3CCJT 4LDWA 5LJ5j 1VIEA 2RK1A 3CMAQ 2P4TA 1PSFA 5A2QE 2MIOA 3QZ5B 5GAOp 2FHDA 5CKDA 4PJOF 1MMAA 2KROA 5GAN2 3RMQA 2KVQG 2M0YA 1IXDA 3S3MA 2MI6A 3C4SA 5KYWB 2MOXA 4N4GA 1BKBA 2AKLA 1IO6A 1IHVA 2YDLA 3P8BB 1UGRB 1B34B 3M0QA 2EYYA 1Q82R 1QVGA 1WYXA 1ZLMA 3V7CA 3G6EA 4BY6C 4XAXB 2E65A 2KXDA 1I5OB 4M75B 4BI8B 1RLQC 5KCOA 2CSQA 3AT1B 5A0LA 3PMIA 2KGTA 2BIVA 5M9OA 3OW2S 1IGUA 1AT1B 4M75A 2JUFA 1PWTA 3QO3A 1JJ2P 1D0YA 1WI7A 2DTOA 1OOTA 1OV3A 2FPFA 3META 3OA6A 4II1A 1X2QA 4WCIA 4Y92A 1EIFA 5CQXA 3TQ7P 1X6BA 1Q82C 4J9DA 4ZGJB 4ZTJA 3I9QA 1YCYA 4X9CA 1LPLA 3TVTA 1IRXA 4A53A 3CCJQ 1RABB 2LJ0A 5KYXA 3PE0A 1NJIC 1AWOA 2QAZA 3LW5E 4C8QC 4M7DA 2ZPHB 1OYXA 2JTEA 3OS0A 3G6ET 5LJ5e 1G83A 2JXBA 3INZA 4BI3A 4FSSA 3GNFB 2L3QA 2DBMA 3OBWA 4E6RA 2O31A 3HTRA 5EC7A 2Y4XA 2Z0WA 3QYGB 2COWA 2GTJA 5IHIA 5IHNA 2YHTA 2F2XA 4OMOA 5GJVB 2KRNA 4PFOA 5GANh 3CMEQ 4C5HA 1VOMA 5DLQE 2KY9A 4F17A 3OYBA 4F04B 2LCCA 2HAXA 1VQ7A 2ED1A 2LNVA 4FSXA 2DL8A 2LCLA 3PIOA 3SWNC 2QA4A 4J9HA 3QZ9B 4RCBA 2LZ6B 4Y28E 2FYKA 4IIMA 2CKKA 4ANJA 2P0KA 1NEBA 4LN2A 3QJYA 1U06A 4A63B 1YNZA 3HFNA 3LGFA 2ZPEB 1KHIA 2ZCFB 1JRIA 1Q86C 2GQIA 1M4ZA 2J7IA 4J6YA 3VS3A 2RQWA 1LJOA 1WHKA 2QQ9A 3TU4K 2DK3A 3AHUA 2DIGA 3JB9H 2XIDA 2AT1B 2H3EB 5EG2A 2ZPIB 3DLMA 1OEBA 2VKNA 4ORZA 2FB7A 3UPUA 3G6EQ 2D6FA 2CP0A 2IPOB 3NTKA 1TUDA 4BACA 1KQSS 4YTLA 4M77E 4MMLA 1VQ7T 2K9GA 3IQLA 2X9HA 1YITA 2RQRA 2QA4T 1M30A 2JMAA 5KCHA 2V1QA 4KULA 2Y4YA 3SDZA 4RTZA 1EX4A 1TUGB 1YWOA 2DTHA 3JCMg 2EKHA 4XK8E 4M78B 2EKOA 4JJBA 1MMDA 1M3CA 4RG8A 3MEAA 3QJ6A 1AVZC 1P92A 2DL5A 4F7UE 4M77F 4HT8A 2E10A 2K3XA 1BB9A 3JCMc 4FU6A 5LJ3f 2P0QA 3VS6A 3TSZA 2VGNA 1UB4A 1SRLA 4KT0E 3KFVA 3A5ZB 2YWWA 1UUEA 3WVDB 1K9MR 1RI0A 2DVJA 4B9XA 3PT9A 5DM7R 4OB1B 4Y91A 2CP5A 1GCQA 2J6KA 5KH6A 3OQ5A 3V7SA 3PFSA 4DQ2A 4F7UF 5J3BA 1YITT 2RK2A 1VA7A 1M1FA 2EW3A 4C5IA 3JCMe 3M57A 2CT4A 1QVPA 2RH2A 3C0CA 4C92E 4BI4A 3OY9A 1K9MC 2DF6A 3NGPA 4KGVB 3REAB 3VKIA 1ABQA 1M9SA 2RF0A 3UT1A 2COZA 2XDPA 2QA4Q 2V8JA 4JRIA 4JZ3A 1AWJA 2IIMA 2K6DA 3RBBB 3OYIA 1RAFB 1V1CA 3JCMV 3CCSA 4X34A 1KQSA 4ATOA 3I55A 2LTOA 5CO7A 4C92F 2DERA 1BI2A 1OX8A 1C0MA 2D0QB 4AMCA 4J5YA 4PJOB 1Y71A 2EYWA 2B8AA 3H0IA 4LNPA 4HCKA 3RIRA 2DRMA 1K0XA 4PJOA 3LH5A 2KSSA 1AHJB 2DYBA 2K2VA 3JV3A 3RESA 1M1GA 1JQQA 4M75E 1Q95G 3QKJA 4M77G 1NEGA 1QMCA 1QW1A 2GCXA 3CCEA 2DZCA 1U5SA 2LT1A 4EMKA 2F1LA 1PM3A 2LP5A 3ER0A 1K73U 1YITQ 4FYWB 2YRCA 3CXCP 2JM9A 2OJ2A 2X4XA 1VQ5Q 1TSFA 3CCST 1W2BS 2DJZA 2O4XB 2D8HA 5D6XA 4F7UG 3CCLA 1V76A 3I55T 1AZGB 2O4XA 1WGSA 1ZBXA 5CKEA 1KD1R 3P8HA 5AT1B 4EMHA 2E4HA 2FL7A 2G3RA 3CPWS 4A4GA 1QLYA 4PJMA 4AFSC 2JJ9A 4RTYA 4M77D 1I5LA 3JCMb 2GBQA 4A4HA 3CCET 2CUDA 3I35A 1WDXA 4JJDA 2BTTA 3WXMB 4LDYA 1MNEA 1Q7YC 1K9AA 3CCRQ 1H3ZA 1UHCA 1K73R 2VC8A 1NPRA 2QQBA 1KQ1A 3URGA 5J39A 4C92G 2JMCA 1TH7A 2XDBA 3UWNA 2JW4A 1M3AA 2JN0A 4CC3A 3CCLT 4J9BA 2KNBB 1OZ3A 4KBMB 4L59A 4OMFB 1AD5A 3QWXX 4IUPA 3UATA 4BUGA 2RQTA 1SHFA 5IT9E 1TU0B 3CCSQ 3CCVA 1HD3A 5GAN6 1KC8C 4XU0A 2HSEB 1NLOC 4FYYB 2XK0A 3M55A 2OTLA 2ED0A 1ZUYA 3L1AA 1NLPC 5KE3A 2RPNA 4LD9K 4HCZA 4M75G 3PVQA 5A0DA 4C92D 1JB0E 1M90U 1EFNA 5GAN4 2DXCA 5D7UA 3E19A 5GAMf 2E12A 3KUFA 4RMOA 1OPKA 3GP8A 3L2WA 3M0RA 4E7KA 3CCEQ 1MV3A 3QIIA 4LDVA 1WXUA 3J81E 4RTTA 3OYHA 2DTIA 4E7LA 3CCUA 3CPWA 1X01A 2W10A 1W4SA 2SRCA 3DLLA 1D1CA 2RJFA 1D1AA 1GL5A 4M78E 4OGEA 1BK2A 5GAMg 3OYEA 3CCVT 3JCMX 1SG5A 3OYGA 4E7IA 4OB0B 3CCLQ 4ELZC 2LX9A 3JB9F 2BUDA 3CC7Q 2X4YA 2OTLT 3ZL7C 1UGPB 2O9VA 3UF4A 4PL6A 5FWBA 3V8KA 6AT1B 2EPDA 2K4YA 3MKDA 4GY5A 4DBRA 3EFSA 4WTOB 4LUDA 5KYUB 2L3RA 3C94A 2Y90A 4M78F 1VQ4A 1YWPA 3CCQQ 5KYUA 2K5FA 2E5KA 3OSSC 2HMAA 3RDVA 5GANj 1VQ6Q 1ZSZA 1VUBA 1WJQA 1Q81R 3EG0A 1WX6A 3CCUT 3BDUA 1X27A 2QG9B 4JRPA 1T0JA 4Q5WA 3LX7A 4B6MA 1SEMA 2RA2A 5CKFA 1QCOA 1C6VX 2EQIA 2HQEA 3O8VA 2QQSA 2NLUA 2FZGB 2QYZA 1HK9A 3VU3C 5HK3A 1NPPA 5D6WA 1GBQA 2F2WA 4IKFA 2MPXC 1QWFA 2DILA 3VJPA 2L2PA 2MK5A 2KXCA 2HSPA 1M8MA 1YBYA 2M0OA 1Q81C 3I5SA 1JJ2S 1Q82U 4FIBA 3A1PA 4PJOE 2CH4A 1VQLA 3MP6A 2BE9B 4HXJA 1VQ4T 1N8RC 4BE2A 2DA9A 4C92B 3L2QA 1TXQA 2YLCA 2LQKA 3LLRA 1NJIU 2XD0A 3VUZA 3EH2A 2RJDA 1M2VA 1RAGB 4C92A 4HT9A 2LQWA 3HFOA 4IUQA 3CBPA 3MP8A 4PJJA 3EG3A 4BD3A 2DPPB 1M27C 2LQ8A 2O9SA 3ULRB 5J26A 1YJ9A 2VXEA 3HSBA 3EG2A 3NHNA 4K11A 1I1JA 5GMKj 3EFOB 3VS5A 5FU6B 3CCUQ 2CZ7B 2LMJA 1MMGA 4M78G 1F1BB 1R0BG 5LJ5f 3H0HA 2I0NA 3NTHA 3EFOA 5KYWA 4QT7A 2E41A 2LCSA 2RB6A 2AZSA 3GLXA 1OI1A 1R8OB 4OP0A 2NWMA 5LJ3d 4N0AA 1VQLT 4ZGDB 4XTYA 4AFQC 1B34A 2DLPA 2DL7A 3EH1A 4PFZA 3OYAA 1RAEB 5FWCA 3V7RA 1NJIR 5LJ5g 3OS5A 1IREB 5I11A 3PMTA 5GAMh 2FRWA 3JB9D 3MO8A 4D8KA 1WHMA 3M58A 1Q86U 1VQ4Q 3L2VA 3S3OA 1RL2A 1RLPC 5FRMA 1YJ9T 1N9SA 4CI0C 2OTJQ 3M59A 1HSQA 1SKUB 1UG1A 4M78D 3E9FA 3EAEA 2L5QA 4C0GA 5IN1A 3BW1A 1XQHA 2XI9A 2LVMA 1ZSGA 2FZKB 2C06A 3G4SA 3FIFA 2EJGA 3FB9A 2A08A 1TOVA 4JS5A 1VYTA 2CYZB 3VRZA 5C6SA 5GJWB 4JS4A 4MMKA 1X6OA 2L0AA 4PJOG 4E2FB 5GMKe 1KHCA 2GNCA 2MMPA 4A54A 1SRMA 3ZEHA 1Q86R 3G7ZA 2P84A 1VQLQ 2EAYA 2A0FB 2BZYA 3H9NA 4MZPA 4EMKC 4DEYA 2HKNA 4JJNK 4E7SA 2VVKA 3OB9A 3RKYA 3RKWA 2HKQB 3MJXA 4JZ4A 1K8AR 3TEEA 2LQNA 2XKOC 2X51A 1MGQA 2DM1A 4RCCA 4BE0A 1SSHA 2XHCA 3FRNA 3TSWA 3G4ST 3OYNA 4J8OA 3SFMA 3OW2A 2WSCE 2YT6A 4IIOA 1Y57A 4PLIA 1MMNA 3A8OB 1VQPA 4GLMA 1OU9A 4IURA 5FU7C 3X28B 2HDAA 1R0CB 2VWFA 5DLOA 1QP2A 3SEMA 1S1NA 4PJOD 1GRIA 4Z88A 1T3LA 1K9MU 1K8AC 4J9CA 1RADB 3JCMf 3QSUA 2VGMA 5GAOq 3QDFA 2E64A 2PVOB 4R0KA 1H641 4RTWA 3NPFA 1WLPB 1XOVA 3PIPA 1VYVA 2XG8D 1CKBA 1R77A 2D9TA 1H92A 1MHNA 2NUPB 2EYXA 2RM4A 1PCXA 4M7AB 2M9UA 1I4K1 3REBB 4AFUC 4L6V5 5LJ5h 2E5QA 3M9QA 2HQXA 2C0OA 2R5AA 3M4GA 3VS7A 4M7AA 1VQPT 4M78A 3GBQA 1ZX6A 5LJ3j 1KFZA 3I5RA 3U23A 2FPEA 3PGGA 2MYSA 1M1KR 1WFWA 2J05A 2DAQA 1UJYA 1D1BA 3LH0A 2NYSA 1OULA 3M4YA 1YIJA 2F69A 2RHUA 2RHZA 1UHFA 4J9FA 1YHQA 1FXXA 3RUXA 1M2OA 2DNUA 1QCNA 4E7ZA 1PKTA 1YI2A 5FW9A 4MDWA 3RKXA 4BY6B 1JO8A 3CXCS 4HKEA 1U1TA 3C12A 5CCAA 1WJRA 4DBHA 1M1KC 3RMSA 2ABLA 2EBPA 3E1SA 2GGRA 1VQ9A 1VQ7Q 2E3HA 3SB2A 1UDLA 1VYUA 2EQJA 2QTXA 3PVLA 3EGDB 2DZ9A 2EWNA 3BFMA 2DYIA 4MZMA 1UJ0A 2D0NA 2J6OA 3EGDA 2YRVA 4XTVA 2ROLA 3OYDA 1RACB 2DKGA 1VIFA 1Q7YU 4HVVA 5DY9A 4QVZA 1LOJA 1YIJT 3M0SA 2KYBA 1JEGA 3WVEB 1T3SA 2KE9A 1YHQT 2K7AA 1VQPQ 1ZA2B 1TS9A 4CC2A 1KD1U 1VQ8A 2QQRA 5I2MA 2KRSA 2HCKA 1YI2T 4C8QB 4E7JA 3CCMA 1C1AA 2G6FX 4JRKA 2E3IA 4M77C 3X26B 4KUIA 4J6WA 2DRKA 4QW2A 1G3SA 2JM8A 3CPFA 4ZN1A 1YJWA 4LXCA 2YUOA 2FO0A 4J9GA 1WHHA 3LYIA 1X69A 3QBYA 4LD6A 1W70A 1ACMB 2WSFE 4FW1A 1ZSZC 1VQ9T 1OPLA 2EVRA 1UGSB 2DEQA 3LWIA 2R58A 2CP7A 4E47A 4EPCA 5FRNA 4KRTA 1YCSB 4OB2B 2AK5A 2DXTA 4OMQA 4CRIA 1KC8U 4FYXB 3A8LB 2X3XD 2RI2A 5GANd 4JPBW 2YUPA 3ZFJA 2JS0A 2QGFB 5CAIA 1Q7YR 1KK7A 2XU8A 4ZNXA 3SWNB 4LDXA 2MWOA 5FLXE 1VQ8T 1TUCA 2LT4A 3CD6A 4PLLA 2JZ2A 4OGCA 2V26A 3CCMT 3FDRA 3ME9A 4J7IA 3JCMh 2BKDN 2DE0X 4KH1B 1TWBA 2K3YA 4PJNA 1YJWT 2JVVA 1GBRA 2RJCA 2YSQA 1YIJQ 2QDLA 3VRYA 1E6GA 1YHQQ 2FZCB 2K57A 2HBPA 4D8DA 2RHIA 2RHXA 1YN8A 1YI2Q 2CS7A 2X4WA 2CZ6B 1B07A 1KC8R 4HCBA 1RAAB 1NBEB 3JCMW 5KYNA 3I56A 1KJWA 3L2UA 4FW2A 3CC4A 1N9RA 1VQ9Q 5ECAA 4HVUA 3ZBDA 3QYHB 1KSWA 1YJNA 1QCFA 2A28A 2FVUA 3CD6T 1IB8A 2CH4W 3VS2A 2X4JA 3OMCA 1MUZA 2AZVA 3EG9B 2ZPFB 4XTXA 4LE9A 1OZ2A 4F16A 1MV0B 4X1VA 3I55Q 3JCMJ 4RUGA 3VYHB 3P8DA 1VQOA 2YXYA 3MEWA 3BDLA 3EHQA 2IVWA 1EZZB 3MP1A 3A8GB 4NS5A 4M75C 3EHRA 1BCOA 5A0GA 1YP5A 1MNDA 3CCMQ 3A8MB 1W2BA 3R6OA 2A36A 3SHWA 4J9EA 3O5ZA 3I56T 2OI3A 1QKXA 8AT1B 3OYCA 3CQTA 3KBGA 1YJWQ 1WQWA 3N5BB 4FT2A 5GAOm 1G3WA 2ROTA 3CC4T 4DOVA 5HCKA 3OYFA 4MDXA 3GIBA 3OMGA 3DB4A 1ZA1B 2D1XA 3NTIA 1Q81U 4J6XA 1YJNT 2C0IA 3CMAA 3VS4A 1M3BA 2CP3A 4M7AE 1N8RU 3PNWC 4M7DC 2A37A 1RI9A 1WXBA 1QVFP 2F5KA 1VQOT 3C95A 2MF2A 2E1HA 3CD6Q 3JSCA 3A8HB 2HD0A 4ZTFA 1WPYA 1FMVA 1D0XA 4RTUA 2EYZA 1K76A 1U1SA 4M7AF 2KYMA 2IG0A 2VV5A 1TTHB 2DETA 1X2KA 2DXBA 1BU1A 3FJPA 3MCAB 2RO0A 2KT1A 2E6NA 2CDTA 3QHSA 2KQWA 3DKMA 1OU8A 2JOYA 2LDMA 3JB9I 2ATCB 1N8RR 3I56Q 1PG5B 2CGHA 4IUUA 4FM4B 4JJCA 3MEUA 1Y96B 2ENMA 5HK0A 3R6NA 3G1JA 4CC4B 1VQNA 2VB6A 3JCMP 3CC4Q 2HL3A 2LJ1A 2K2MA 2K3BA 3VV0A 2J06A 4OMLA 1UECA 2MCNA 1PNJA 3H8ZA 1RAIB 1AWWA 4N4IA 2KK4A 1KQ2A 3CCVQ 4BDYA 1Z9QA 1VQKA 2O88A 4ZGEB 3H0FA 2PTKA 5GANg 1JU5C 5LL6S 2ESWA 2OTLQ 1VQOQ 2ZAEA 1W6XA 1BIAA 2BZXA 2EIFA 4C8QE 1K1ZA 2EGAA 2V1RA 4X9DA 2DMOA 2B86A 2H8HA 3OYKA 2GTOA 2ZZDA 1OQKA 2R5MA 3JB9G 5GAOr 3CMEA 2W0ZA 2KAFA 2QK0A 4FCYA 2WACA 3EGUA 1VQNT 4NL3A 1G2BA 2QDYB 2DXUA 2KRMA 2QXFA 4M78C 4QQDA 4C8QF 4M7AG 1QQJA 2F2VA 3TCJA 1E6HA 1X43A 5GANe 1QVGP 1VQKT 1X75C 2D8JA 1GCQC 4QVDA 3CBOA 3KXTA 3EFRA 4IUTA 2NUTB 4PKCC 2L89A 2KMTA 1U8RA 1OX9A 2NUTA 1UTIA 2PVDB 2DIQA 3S6WA 3HRUA 1LVKA 3CMET 2O2OA 2GF7A 4FT4A 2FEIA 2LC4A 1BCMA 4DBFA 2E70A 3RNJA 2DO3A 1D3BB 3L42A 1WHJA 3X25B 2RI3A 2KDSA 4HVWA 4M7AD 1PKSA 3JB9J 1JJ2A 1K8AU 1D3BA 2AKKA 2P4RA 2DD4A 1VQNQ 4PFPA 3JCMQ 4Z8AA 3NMZC 1BI0A 3GF5A 1NZ9A 5KYXB 5HKCA 3L2ZA 4XU3A 2QI2A 3CEYA 4EMGA 2I2LA 2CZ1B 4M7DB 4PJOC 5GAN7 2LNHB 3QG1A 2XDDA 7AT1B 5CK9A 1B3QA 4A4KA 2KT8A 1VQKQ 2ECZA 1UGQB 4C8QG 3HRSA 2CZ0B 1I81A 3OYLA 1VQMA 1GFDA 3QXEB 4Z02A 5CVIA 4KGXB 4XTZA 5KE2A 5KYYB 1LNXA 1FMKA 2L3SA 1XTDA 3OS2A 4HCCA 2JNGA 1WXTA 1O75A 1K0SA 2LRQA 4GBQA 3FEOA 5KYYA 1UFFA 1YFNA 4OMMA 2A7YA 2OAUA 2GFUA 3OW2P 4J83A 1YJ9Q 3E2UA 4D6WA 2HL5C 5GAN5 4RTVA 3M0PA 3EGXB 2KR3A 1B7TA 3UA6A 1M1KU 1AZEA 2K79A 1PSEA 3EGXA 4C8QD 3OYYA 1G8XA 3GNGA 1ZUUA 1DJ7B 1VQMT 1GXIE 2AHJB 1WZOA 2DBKA 2DFUA 4C0ZA 3RERA 2VUBA 4KH0B 5CKBA 3M54A 4VUBA 2DL3A 4E7HA 4JRQA 2CSIA 2YUQA 4C0DC 2O01E 4C0FA 1QKWA 3MHXA 4BB7A 4J7FA 4DBQA 3D7SB 2M51A 4M4ZA 2NUPA 4ZN3A 3LWHA 2EJ9A 2KEAA 4QQGA 5GMKi 1I0CA 2HZYA 1VQ5A 3UDCA 1WA7A 2HEQA 5L23A 2K5IA 2RN8A 2V8KA 5GMKh 3G4SQ 2RHYA 1AOJA 3FJ5A 2COYA 1SPKA 4AG1C 4J9IA 5IH2A 4DA4A 2VXFA 4ESRA 3F70A 8ATCB 3JAME 1NE8A 4P5NA 1X6GA 1JXMA 3PTAA 5IXBA 4A4EA 2JTMA 3NFCA 2DD5A 3M0TA 4FL6A 2DVEA 1PD1A 2PUOB 1BYMA 3H6ZA 2RQVA 1VQMQ 4C5EA 2E6ZA 3CCRA 1UGVA 5LJ3g 2AIRB 3RR6A 3VS1A 2LX7A 3BY7A 5GAMd 1ABOA 3Q1JA 3J80E 1NYGA 2MAMA 1TG0A 1Z9ZA 2R57A 3LGLA 1BI3A 1VQ5T 4AG2C 4PJLA 5GAOn 1KQSP 1UE9A 2RI5A 1E7OA 4PK4A 2F5TX 2EFIA 2JTFA 1H3HA 4QKUA 2RJEA 1RUWA 5GAOl 1WJSA 1NYFA 4TVRA 1ARKA 1S72A 2CUBA 2PUKB 1WQ7A 3OSVA 9ATCB 2RMOA 2J6FA 5CR2A 1JBMA 2JS2A 2KI7A 2QEXA 1G3YA 4C8QA 5LJ3e 1ZBJA 1SSFA 1PRLC 2CREA 3J7AF 1PHTA 4JDSA 4UC4A 3CCRT 3GOXA 5IAYA 2YUNA 2H3JA 2EQUA 1GFCA 1Y7XA 1N5ZA 1BI1A 2PVGB 2BE7D 5GAN8 4EMKB 5AYFA 2RD1A 3L2RA 3ASKA 1D09B 1PC0A 2EGEA 2QTVA 5I21A 2EQKA 3M0UA 1HXDA 1UEBA 1GCPA
chains in the Genus database with same CATH topology
5I22A 2RQRA 1M30A 2JMAA 5I11A 1WIEA 2V1QA 2BZ8A 1H8KA 2FRWA 4RTZA 4D8KA 4RTUA 2EGCA 2EYZA 1YWOA 1K76A 2KYMA 2EKHA 4JJBA 1RLPC 1X2KA 2DJQA 1M3CA 1BU1A 1AVZC 2DL5A 5IXFA 2KT1A 1HSQA 1BB9A 2CDTA 1UG1A 3VS6A 3TSZA 1SRLA 3KFVA 1UUEA 1T0HA 2DVJA 1BBZA 4JJCA 1ZSGA 2ENMA 3R6NA 1GCQA 2J6KA 4CC4B 1A0NB 2A08A 2LJ1A 2K2MA 2K3BA 1PRMC 1VYTA 2J06A 4OMLA 1UECA 3VRZA 5GJWB 2MCNA 1JXOA 2RNAA 1PNJA 1VA7A 2FRYA 2EW3A 2L0AA 2CT4A 3A98A 1AWWA 2GNCA 4EIKA 1J3TA 1K4US 1SRMA 1W1FA 1Z9QA 3C0CA 2O88A 5IHKA 3H0FA 2PTKA 2DF6A 3NGPA 1JU5C 2ESWA 2BZYA 3REAB 4DEYA 1ABQA 4DEXA 1W6XA 2RF0A 2BZXA 1K1ZA 2EGAA 2V1RA 2DMOA 1NG2A 2VVKA 4JZ3A 2B86A 1AWJA 2IIMA 2K6DA 2H8HA 3RBBB 4Z89A 2GTOA 4JZ4A 1V1CA 2DX1A 2LQNA 2DM1A 2W0ZA 1SSHA 1QWEA 4AFZC 2SEMA 3TSWA 3EGUA 2YT6A 4IIOA 1G2BA 1Y57A 2EYWA 2KRMA 4GLMA 3H0IA 4LNPA 2HDAA 4HCKA 2DRMA 2VWFA 2OAWA 1K0XA 2F2VA 3SEMA 1E6HA 1U3OA 3LH5A 2DYBA 1AWXA 1S1NA 1X43A 3JV3A 1GRIA 2FPDA 4Z88A 1T3LA 2LJ3A 1JQQA 3THKA 2C0TA 1NEGA 4J9CA 2D8JA 1GCQC 4OMPA 4CC7A 1U5SA 2LP5A 4R0KA 4RTWA 2JT4A 3NPFA 1WLPB 1XOVA 2RQUA 2JM9A 2OJ2A 1VYVA 1UTIA 1AEYA 1CKBA 1CSKA 1H92A 2D8HA 1ZUKA 2O2OA 3VS0A 2EYXA 4LUEA 2FEIA 1LCKA 3EG1A 3REBB 1AZGB 4AFUC 3RNJA 1I07A 2C0OA 3VS7A 3GBQA 4HVWA 1ZX6A 1PKSA 1KFZA 2X3WD 3I5RA 3U23A 2FPEA 1QLYA 2PZ1A 4AFSC 2AKKA 2P4RA 1WFWA 3QWYA 2J05A 4RTYA 1UJYA 2GBQA 2CUDA 4Z8AA 3I35A 3NMZC 1WDXA 4JJDA 1UHFA 2BTTA 4J9FA 4RTXA 1K9AA 1UHCA 2DNUA 1PKTA 2CT3A 1FYNA 5FW9A 2LNHB 2JMCA 1JO8A 3H41A 1B3QA 1Y0MA 2KT8A 2JW4A 1KIKA 1M3AA 2ECZA 4CC3A 4J9BA 2L3PA 2ABLA 2EBPA 2KNBB 2GGRA 1GFDA 2XMFA 2FG0A 1UDLA 1VYUA 3UA7A 3PVLA 1AD5A 2HBWA 3QWXX 2PNIA 3UATA 1CKAA 2RQTA 1SHFA 1FMKA 1UJ0A 2L3SA 2DL4A 1WXTA 2D0NA 2J6OA 1K0SA 1HD3A 2ROLA 4GBQA 1NLOC 1UFFA 4HVVA 4OMMA 2ED0A 1ZUYA 2NUZA 3M0SA 2KYBA 1JEGA 1T3SA 2KE9A 2K7AA 1NLPC 4F14A 4CC2A 2RPNA 4OMNA 1SHGA 1HJDA 2KBTA 1NM7A 2KRSA 4RTVA 2HCKA 3M0PA 3PVQA 2G6FX 2KR3A 1EFNA 2DRKA 2MIOA 3UA6A 1AZEA 2K79A 1OPKA 2JM8A 3M0RA 2YUOA 2KROA 1MV3A 2FO0A 4J9GA 1X69A 1W70A 2M0YA 1WXUA 1ZUUA 1OPLA 2MOXA 4RTTA 2EVRA 2AKLA 1IO6A 2W10A 4KRTA 2DBKA 1YCSB 2SRCA 2AK5A 2YDLA 4OMQA 2X3XD 1GL5A 3M0QA 4JPBW 2YUPA 2DL3A 2CSIA 2EYYA 1BK2A 1WYXA 2JS0A 2YUQA 1ZLMA 1QKWA 2KXDA 4ZNXA 1RLQC 2CSQA 3ZL7C 2O9VA 2KGTA 3UF4A 5FWBA 2M51A 4M4ZA 2EPDA 1PWTA 1TUCA 2KEAA 1WI7A 2FPFA 4LUDA 1I0CA 1OOTA 1OV3A 1X2QA 4WCIA 1WA7A 4Y92A 2HEQA 5L23A 2DE0X 1YWPA 2RN8A 1AOJA 1X6BA 2E5KA 1GBRA 2YSQA 3FJ5A 2QDLA 4J9DA 1E6GA 3VRYA 1SPKA 4AG1C 4J9IA 5IH2A 3I9QA 4D8DA 4ESRA 3EG0A 3TVTA 1WX6A 1X6GA 1JXMA 1YN8A 1X27A 5IXBA 2LJ0A 1T0JA 1B07A 3PE0A 1SEMA 1AWOA 3M0TA 2EQIA 1KJWA 2JTEA 1G83A 2JXBA 4FSSA 5ECAA 2RQVA 4HVUA 2L3QA 1GBQA 2DBMA 4E6RA 2F2WA 1QWFA 2DILA 1KSWA 1UGVA 2O31A 2L2PA 5EC7A 3VS1A 2KXCA 2LX7A 2HSPA 1QCFA 1ABOA 2A28A 1M8MA 2GTJA 1NYGA 1TG0A 1Z9ZA 5IHIA 5IHNA 2F2XA 2CH4W 3VS2A 4OMOA 1MUZA 5GJVB 2AZVA 3I5SA 4AG2C 2KRNA 4LE9A 1UE9A 2CH4A 4F16A 4F17A 4HXJA 1MV0B 1E7OA 4X1VA 4RUGA 2ED1A 1H3HA 2DA9A 2DL8A 3EHQA 1RUWA 1NYFA 4J9HA 1ARKA 2LZ6B 2CUBA 3EHRA 4IIMA 1YP5A 2LQWA 1NEBA 2A36A 4LN2A 2RMOA 3SHWA 1U06A 2J6FA 4A63B 4J9EA 3O5ZA 1YNZA 2JS2A 1QKXA 2OI3A 3EG3A 3CQTA 1M27C 1ZBJA 2O9SA 3ULRB 2GQIA 2ROTA 3EG2A 1PRLC 2CREA 3NHNA 5HCKA 1PHTA 5FWCA 2J7IA 1I1JA 4K11A 3VS5A 2YUNA 2RQWA 3VS3A 2D1XA 2LMJA 1GFCA 2C0IA 3H0HA 2I0NA 1N5ZA 4QT7A 3VS4A 2LCSA 1M3BA 2AZSA 1OEBA 2VKNA 4ORZA 2A37A 1RI9A 2NWMA 1TUDA 1WXBA 4AFQC 2EGEA 2DLPA 2DL7A 3M0UA 2K9GA 3IQLA 1GCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I22 A;  2RQR A;  1M30 A;  2JMA A;  5I11 A;  1WIE A;  2V1Q A;  2BZ8 A;  1H8K A;  2FRW A;  4RTZ A;  4D8K A;  4RTU A;  2EGC A;  2EYZ A;  1YWO A;  1K76 A;  2KYM A;  2EKH A;  4JJB A;  1RLP C;  1X2K A;  2DJQ A;  1M3C A;  1BU1 A;  1AVZ C;  2DL5 A;  5IXF A;  2KT1 A;  1HSQ A;  1BB9 A;  2CDT A;  1UG1 A;  3VS6 A;  3TSZ A;  1SRL A;  3KFV A;  1UUE A;  1T0H A;  2DVJ A;  1BBZ A;  4JJC A;  1ZSG A;  2ENM A;  3R6N A;  1GCQ A;  2J6K A;  4CC4 B;  1A0N B;  2A08 A;  2LJ1 A;  2K2M A;  2K3B A;  1PRM C;  1VYT A;  2J06 A;  4OML A;  1UEC A;  3VRZ A;  5GJW B;  2MCN A;  1JXO A;  2RNA A;  1PNJ A;  1VA7 A;  2FRY A;  2EW3 A;  2L0A A;  2CT4 A;  3A98 A;  1AWW A;  2GNC A;  4EIK A;  1J3T A;  1K4U S;  1SRM A;  1W1F A;  1Z9Q A;  3C0C A;  2O88 A;  5IHK A;  3H0F A;  2PTK A;  2DF6 A;  3NGP A;  1JU5 C;  2ESW A;  2BZY A;  3REA B;  4DEY A;  1ABQ A;  4DEX A;  1W6X A;  2RF0 A;  2BZX A;  1K1Z A;  2EGA A;  2V1R A;  2DMO A;  1NG2 A;  2VVK A;  4JZ3 A;  2B86 A;  1AWJ A;  2IIM A;  2K6D A;  2H8H A;  3RBB B;  4Z89 A;  2GTO A;  4JZ4 A;  1V1C A;  2DX1 A;  2LQN A;  2DM1 A;  2W0Z A;  1SSH A;  1QWE A;  4AFZ C;  2SEM A;  3TSW A;  3EGU A;  2YT6 A;  4IIO A;  1G2B A;  1Y57 A;  2EYW A;  2KRM A;  4GLM A;  3H0I A;  4LNP A;  2HDA A;  4HCK A;  2DRM A;  2VWF A;  2OAW A;  1K0X A;  2F2V A;  3SEM A;  1E6H A;  1U3O A;  3LH5 A;  2DYB A;  1AWX A;  1S1N A;  1X43 A;  3JV3 A;  1GRI A;  2FPD A;  4Z88 A;  1T3L A;  2LJ3 A;  1JQQ A;  3THK A;  2C0T A;  1NEG A;  4J9C A;  2D8J A;  1GCQ C;  4OMP A;  4CC7 A;  1U5S A;  2LP5 A;  4R0K A;  4RTW A;  2JT4 A;  3NPF A;  1WLP B;  1XOV A;  2RQU A;  2JM9 A;  2OJ2 A;  1VYV A;  1UTI A;  1AEY A;  1CKB A;  1CSK A;  1H92 A;  2D8H A;  1ZUK A;  2O2O A;  3VS0 A;  2EYX A;  4LUE A;  2FEI A;  1LCK A;  3EG1 A;  3REB B;  1AZG B;  4AFU C;  3RNJ A;  1I07 A;  2C0O A;  3VS7 A;  3GBQ A;  4HVW A;  1ZX6 A;  1PKS A;  1KFZ A;  2X3W D;  3I5R A;  3U23 A;  2FPE A;  1QLY A;  2PZ1 A;  4AFS C;  2AKK A;  2P4R A;  1WFW A;  3QWY A;  2J05 A;  4RTY A;  1UJY A;  2GBQ A;  2CUD A;  4Z8A A;  3I35 A;  3NMZ C;  1WDX A;  4JJD A;  1UHF A;  2BTT A;  4J9F A;  4RTX A;  1K9A A;  1UHC A;  2DNU A;  1PKT A;  2CT3 A;  1FYN A;  5FW9 A;  2LNH B;  2JMC A;  1JO8 A;  3H41 A;  1B3Q A;  1Y0M A;  2KT8 A;  2JW4 A;  1KIK A;  1M3A A;  2ECZ A;  4CC3 A;  4J9B A;  2L3P A;  2ABL A;  2EBP A;  2KNB B;  2GGR A;  1GFD A;  2XMF A;  2FG0 A;  1UDL A;  1VYU A;  3UA7 A;  3PVL A;  1AD5 A;  2HBW A;  3QWX X;  2PNI A;  3UAT A;  1CKA A;  2RQT A;  1SHF A;  1FMK A;  1UJ0 A;  2L3S A;  2DL4 A;  1WXT A;  2D0N A;  2J6O A;  1K0S A;  1HD3 A;  2ROL A;  4GBQ A;  1NLO C;  1UFF A;  4HVV A;  4OMM A;  2ED0 A;  1ZUY A;  2NUZ A;  3M0S A;  2KYB A;  1JEG A;  1T3S A;  2KE9 A;  2K7A A;  1NLP C;  4F14 A;  4CC2 A;  2RPN A;  4OMN A;  1SHG A;  1HJD A;  2KBT A;  1NM7 A;  2KRS A;  4RTV A;  2HCK A;  3M0P A;  3PVQ A;  2G6F X;  2KR3 A;  1EFN A;  2DRK A;  2MIO A;  3UA6 A;  1AZE A;  2K79 A;  1OPK A;  2JM8 A;  3M0R A;  2YUO A;  2KRO A;  1MV3 A;  2FO0 A;  4J9G A;  1X69 A;  1W70 A;  2M0Y A;  1WXU A;  1ZUU A;  1OPL A;  2MOX A;  4RTT A;  2EVR A;  2AKL A;  1IO6 A;  2W10 A;  4KRT A;  2DBK A;  1YCS B;  2SRC A;  2AK5 A;  2YDL A;  4OMQ A;  2X3X D;  1GL5 A;  3M0Q A;  4JPB W;  2YUP A;  2DL3 A;  2CSI A;  2EYY A;  1BK2 A;  1WYX A;  2JS0 A;  2YUQ A;  1ZLM A;  1QKW A;  2KXD A;  4ZNX A;  1RLQ C;  2CSQ A;  3ZL7 C;  2O9V A;  2KGT A;  3UF4 A;  5FWB A;  2M51 A;  4M4Z A;  2EPD A;  1PWT A;  1TUC A;  2KEA A;  1WI7 A;  2FPF A;  4LUD A;  1I0C A;  1OOT A;  1OV3 A;  1X2Q A;  4WCI A;  1WA7 A;  4Y92 A;  2HEQ A;  5L23 A;  2DE0 X;  1YWP A;  2RN8 A;  1AOJ A;  1X6B A;  2E5K A;  1GBR A;  2YSQ A;  3FJ5 A;  2QDL A;  4J9D A;  1E6G A;  3VRY A;  1SPK A;  4AG1 C;  4J9I A;  5IH2 A;  3I9Q A;  4D8D A;  4ESR A;  3EG0 A;  3TVT A;  1WX6 A;  1X6G A;  1JXM A;  1YN8 A;  1X27 A;  5IXB A;  2LJ0 A;  1T0J A;  1B07 A;  3PE0 A;  1SEM A;  1AWO A;  3M0T A;  2EQI A;  1KJW A;  2JTE A;  1G83 A;  2JXB A;  4FSS A;  5ECA A;  2RQV A;  4HVU A;  2L3Q A;  1GBQ A;  2DBM A;  4E6R A;  2F2W A;  1QWF A;  2DIL A;  1KSW A;  1UGV A;  2O31 A;  2L2P A;  5EC7 A;  3VS1 A;  2KXC A;  2LX7 A;  2HSP A;  1QCF A;  1ABO A;  2A28 A;  1M8M A;  2GTJ A;  1NYG A;  1TG0 A;  1Z9Z A;  5IHI A;  5IHN A;  2F2X A;  2CH4 W;  3VS2 A;  4OMO A;  1MUZ A;  5GJV B;  2AZV A;  3I5S A;  4AG2 C;  2KRN A;  4LE9 A;  1UE9 A;  2CH4 A;  4F16 A;  4F17 A;  4HXJ A;  1MV0 B;  1E7O A;  4X1V A;  4RUG A;  2ED1 A;  1H3H A;  2DA9 A;  2DL8 A;  3EHQ A;  1RUW A;  1NYF A;  4J9H A;  1ARK A;  2LZ6 B;  2CUB A;  3EHR A;  4IIM A;  1YP5 A;  2LQW A;  1NEB A;  2A36 A;  4LN2 A;  2RMO A;  3SHW A;  1U06 A;  2J6F A;  4A63 B;  4J9E A;  3O5Z A;  1YNZ A;  2JS2 A;  1QKX A;  2OI3 A;  3EG3 A;  3CQT A;  1M27 C;  1ZBJ A;  2O9S A;  3ULR B;  2GQI A;  2ROT A;  3EG2 A;  1PRL C;  2CRE A;  3NHN A;  5HCK A;  1PHT A;  5FWC A;  2J7I A;  1I1J A;  4K11 A;  3VS5 A;  2YUN A;  2RQW A;  3VS3 A;  2D1X A;  2LMJ A;  1GFC A;  2C0I A;  3H0H A;  2I0N A;  1N5Z A;  4QT7 A;  3VS4 A;  2LCS A;  1M3B A;  2AZS A;  1OEB A;  2VKN A;  4ORZ A;  2A37 A;  1RI9 A;  2NWM A;  1TUD A;  1WXB A;  4AFQ C;  2EGE A;  2DLP A;  2DL7 A;  3M0U A;  2K9G A;  3IQL A;  1GCP A; 
#chains in the Genus database with same CATH topology
 5I22 A;  4A4F A;  3SWN A;  4DOW A;  2DEU A;  3X20 B;  3CXC A;  1S72 T;  1WIE A;  5FRO A;  2BZ8 A;  1HYO A;  1M5Q 1;  5CIU A;  1H8K A;  2EGC A;  2EQM A;  4M75 F;  2VYT A;  2QEX T;  3CC7 A;  4XU2 A;  5FU7 B;  2DJQ A;  1Y07 A;  4O6J A;  4GLK A;  4M7D E;  5IXF A;  4XU1 A;  4RKU E;  1RAH B;  4C92 C;  5CKH A;  3FLG A;  2K5L A;  2QGG A;  1T0H A;  1BBZ A;  3CCQ A;  3OYM A;  1A0N B;  1VQ6 A;  1QVF S;  2YLB A;  1PRM C;  4M7D F;  3JRZ A;  3MPU B;  4C0D B;  3BE3 A;  1JXO A;  2HQH A;  2RNA A;  4ELY C;  1KD1 C;  2FRY A;  4NL2 A;  3VYG A;  1QP3 A;  3A98 A;  5FU6 C;  3HL8 A;  4EIK A;  1J3T A;  3HKS A;  1K4U S;  5GMK l;  1W1F A;  4OF1 A;  2OX7 A;  4KUD K;  5IHK A;  2X35 A;  4QQ6 A;  4N0A C;  3V8J A;  2QQA A;  3CC7 T;  5LJ5 d;  4L5G A;  5LJ3 h;  4C5G A;  4DEX A;  2XIC A;  3QDR B;  3EG9 A;  2PQW A;  1NG2 A;  1S72 Q;  1VQ8 Q;  3M53 A;  3CC2 A;  4RG2 A;  4Z89 A;  1K73 C;  1W2B P;  2DX1 A;  3G71 A;  4IUV A;  4AT1 B;  4WF2 A;  1QWE A;  3SD4 A;  2QEX Q;  4BE1 A;  1WNL A;  5GAM j;  3CCQ T;  4AFZ C;  2SEM A;  3X24 B;  2QAS A;  1VQ6 T;  5HY6 A;  2GQV A;  1PD0 A;  1ZQ1 A;  2OAW A;  3CPW P;  3HP9 A;  4B9W A;  1U3O A;  4V2S A;  4ME7 A;  1AWX A;  2FPD A;  3GPL A;  2LJ3 A;  1O9S A;  3MEV A;  2YRD A;  5GAN 3;  1I8F A;  3THK A;  2C0T A;  4OMP A;  1D0Z A;  4CC7 A;  4MZT A;  3QUI A;  2JT4 A;  2VAS A;  4XTW A;  3TRE A;  2RQU A;  3E9G A;  1M8V A;  4R56 A;  3CC2 T;  1XJW B;  3VUB A;  1AEY A;  2ZPG B;  3HRT A;  3G71 T;  1CSK A;  1ZHI A;  4QVC A;  1ZUK A;  1QVF A;  3VS0 A;  4M7D G;  1G3T A;  4JUV A;  4LUE A;  1G5V A;  2EJF A;  2PU9 B;  1LCK A;  2CP2 A;  3EG1 A;  1FWZ A;  3OS1 A;  4JLI A;  2ZGW A;  2MWP A;  1I07 A;  1BIB A;  1N27 A;  4M77 B;  4R55 A;  4N4H A;  4M75 D;  2EYQ A;  1FX7 A;  1XNI A;  2X3W D;  3V8L A;  1M90 R;  5I2S A;  4KGZ B;  3CMA T;  4M77 A;  2PZ1 A;  3QWY A;  1ZSZ B;  3CBM A;  5CQY A;  5D6Y A;  1QVG S;  5GAN f;  1IHW A;  3QPH A;  4OVA A;  4RTX A;  4XQ3 A;  3S3N A;  3HHT B;  4LDU A;  2OTJ A;  1WHG A;  1V29 B;  1Y96 A;  5GAM e;  3CCJ A;  1YJN Q;  2CT3 A;  1FYN A;  4F7U B;  2M02 A;  2L8D A;  4XTU A;  3FC3 A;  3M5A A;  1IGQ A;  2V8I A;  3H41 A;  1Y0M A;  4F7U A;  3OYJ A;  1KIK A;  2HNI A;  2M1H A;  1M90 C;  4M7D D;  4OB3 B;  2L3P A;  4O5V A;  1IZ6 A;  2XMF A;  2A3L A;  2FG0 A;  3UA7 A;  5C0M A;  5L8R E;  2HBW A;  2PNI A;  3CC2 Q;  4FYV B;  2M16 A;  1CKA A;  2CP6 A;  2WSE E;  5GMK m;  3JCM d;  1SF9 A;  2DL4 A;  3G71 Q;  4PNO A;  3HPW A;  2GFA A;  2ZPB B;  4NOY A;  3DB3 A;  3OBY A;  4EDU A;  1FMW A;  1M2V B;  2NUZ A;  4JLG A;  4BDZ A;  2P0P A;  3T9N A;  2OTJ T;  4M7A C;  1KG1 A;  4F14 A;  4HA8 A;  4OMN A;  1SHG A;  1HJD A;  2KBT A;  1NM7 A;  1N6A A;  1WHL A;  3M56 A;  3CCJ T;  4LDW A;  5LJ5 j;  1VIE A;  2RK1 A;  3CMA Q;  2P4T A;  1PSF A;  5A2Q E;  2MIO A;  3QZ5 B;  5GAO p;  2FHD A;  5CKD A;  4PJO F;  1MMA A;  2KRO A;  5GAN 2;  3RMQ A;  2KVQ G;  2M0Y A;  1IXD A;  3S3M A;  2MI6 A;  3C4S A;  5KYW B;  2MOX A;  4N4G A;  1BKB A;  2AKL A;  1IO6 A;  1IHV A;  2YDL A;  3P8B B;  1UGR B;  1B34 B;  3M0Q A;  2EYY A;  1Q82 R;  1QVG A;  1WYX A;  1ZLM A;  3V7C A;  3G6E A;  4BY6 C;  4XAX B;  2E65 A;  2KXD A;  1I5O B;  4M75 B;  4BI8 B;  1RLQ C;  5KCO A;  2CSQ A;  3AT1 B;  5A0L A;  3PMI A;  2KGT A;  2BIV A;  5M9O A;  3OW2 S;  1IGU A;  1AT1 B;  4M75 A;  2JUF A;  1PWT A;  3QO3 A;  1JJ2 P;  1D0Y A;  1WI7 A;  2DTO A;  1OOT A;  1OV3 A;  2FPF A;  3MET A;  3OA6 A;  4II1 A;  1X2Q A;  4WCI A;  4Y92 A;  1EIF A;  5CQX A;  3TQ7 P;  1X6B A;  1Q82 C;  4J9D A;  4ZGJ B;  4ZTJ A;  3I9Q A;  1YCY A;  4X9C A;  1LPL A;  3TVT A;  1IRX A;  4A53 A;  3CCJ Q;  1RAB B;  2LJ0 A;  5KYX A;  3PE0 A;  1NJI C;  1AWO A;  2QAZ A;  3LW5 E;  4C8Q C;  4M7D A;  2ZPH B;  1OYX A;  2JTE A;  3OS0 A;  3G6E T;  5LJ5 e;  1G83 A;  2JXB A;  3INZ A;  4BI3 A;  4FSS A;  3GNF B;  2L3Q A;  2DBM A;  3OBW A;  4E6R A;  2O31 A;  3HTR A;  5EC7 A;  2Y4X A;  2Z0W A;  3QYG B;  2COW A;  2GTJ A;  5IHI A;  5IHN A;  2YHT A;  2F2X A;  4OMO A;  5GJV B;  2KRN A;  4PFO A;  5GAN h;  3CME Q;  4C5H A;  1VOM A;  5DLQ E;  2KY9 A;  4F17 A;  3OYB A;  4F04 B;  2LCC A;  2HAX A;  1VQ7 A;  2ED1 A;  2LNV A;  4FSX A;  2DL8 A;  2LCL A;  3PIO A;  3SWN C;  2QA4 A;  4J9H A;  3QZ9 B;  4RCB A;  2LZ6 B;  4Y28 E;  2FYK A;  4IIM A;  2CKK A;  4ANJ A;  2P0K A;  1NEB A;  4LN2 A;  3QJY A;  1U06 A;  4A63 B;  1YNZ A;  3HFN A;  3LGF A;  2ZPE B;  1KHI A;  2ZCF B;  1JRI A;  1Q86 C;  2GQI A;  1M4Z A;  2J7I A;  4J6Y A;  3VS3 A;  2RQW A;  1LJO A;  1WHK A;  2QQ9 A;  3TU4 K;  2DK3 A;  3AHU A;  2DIG A;  3JB9 H;  2XID A;  2AT1 B;  2H3E B;  5EG2 A;  2ZPI B;  3DLM A;  1OEB A;  2VKN A;  4ORZ A;  2FB7 A;  3UPU A;  3G6E Q;  2D6F A;  2CP0 A;  2IPO B;  3NTK A;  1TUD A;  4BAC A;  1KQS S;  4YTL A;  4M77 E;  4MML A;  1VQ7 T;  2K9G A;  3IQL A;  2X9H A;  1YIT A;  2RQR A;  2QA4 T;  1M30 A;  2JMA A;  5KCH A;  2V1Q A;  4KUL A;  2Y4Y A;  3SDZ A;  4RTZ A;  1EX4 A;  1TUG B;  1YWO A;  2DTH A;  3JCM g;  2EKH A;  4XK8 E;  4M78 B;  2EKO A;  4JJB A;  1MMD A;  1M3C A;  4RG8 A;  3MEA A;  3QJ6 A;  1AVZ C;  1P92 A;  2DL5 A;  4F7U E;  4M77 F;  4HT8 A;  2E10 A;  2K3X A;  1BB9 A;  3JCM c;  4FU6 A;  5LJ3 f;  2P0Q A;  3VS6 A;  3TSZ A;  2VGN A;  1UB4 A;  1SRL A;  4KT0 E;  3KFV A;  3A5Z B;  2YWW A;  1UUE A;  3WVD B;  1K9M R;  1RI0 A;  2DVJ A;  4B9X A;  3PT9 A;  5DM7 R;  4OB1 B;  4Y91 A;  2CP5 A;  1GCQ A;  2J6K A;  5KH6 A;  3OQ5 A;  3V7S A;  3PFS A;  4DQ2 A;  4F7U F;  5J3B A;  1YIT T;  2RK2 A;  1VA7 A;  1M1F A;  2EW3 A;  4C5I A;  3JCM e;  3M57 A;  2CT4 A;  1QVP A;  2RH2 A;  3C0C A;  4C92 E;  4BI4 A;  3OY9 A;  1K9M C;  2DF6 A;  3NGP A;  4KGV B;  3REA B;  3VKI A;  1ABQ A;  1M9S A;  2RF0 A;  3UT1 A;  2COZ A;  2XDP A;  2QA4 Q;  2V8J A;  4JRI A;  4JZ3 A;  1AWJ A;  2IIM A;  2K6D A;  3RBB B;  3OYI A;  1RAF B;  1V1C A;  3JCM V;  3CCS A;  4X34 A;  1KQS A;  4ATO A;  3I55 A;  2LTO A;  5CO7 A;  4C92 F;  2DER A;  1BI2 A;  1OX8 A;  1C0M A;  2D0Q B;  4AMC A;  4J5Y A;  4PJO B;  1Y71 A;  2EYW A;  2B8A A;  3H0I A;  4LNP A;  4HCK A;  3RIR A;  2DRM A;  1K0X A;  4PJO A;  3LH5 A;  2KSS A;  1AHJ B;  2DYB A;  2K2V A;  3JV3 A;  3RES A;  1M1G A;  1JQQ A;  4M75 E;  1Q95 G;  3QKJ A;  4M77 G;  1NEG A;  1QMC A;  1QW1 A;  2GCX A;  3CCE A;  2DZC A;  1U5S A;  2LT1 A;  4EMK A;  2F1L A;  1PM3 A;  2LP5 A;  3ER0 A;  1K73 U;  1YIT Q;  4FYW B;  2YRC A;  3CXC P;  2JM9 A;  2OJ2 A;  2X4X A;  1VQ5 Q;  1TSF A;  3CCS T;  1W2B S;  2DJZ A;  2O4X B;  2D8H A;  5D6X A;  4F7U G;  3CCL A;  1V76 A;  3I55 T;  1AZG B;  2O4X A;  1WGS A;  1ZBX A;  5CKE A;  1KD1 R;  3P8H A;  5AT1 B;  4EMH A;  2E4H A;  2FL7 A;  2G3R A;  3CPW S;  4A4G A;  1QLY A;  4PJM A;  4AFS C;  2JJ9 A;  4RTY A;  4M77 D;  1I5L A;  3JCM b;  2GBQ A;  4A4H A;  3CCE T;  2CUD A;  3I35 A;  1WDX A;  4JJD A;  2BTT A;  3WXM B;  4LDY A;  1MNE A;  1Q7Y C;  1K9A A;  3CCR Q;  1H3Z A;  1UHC A;  1K73 R;  2VC8 A;  1NPR A;  2QQB A;  1KQ1 A;  3URG A;  5J39 A;  4C92 G;  2JMC A;  1TH7 A;  2XDB A;  3UWN A;  2JW4 A;  1M3A A;  2JN0 A;  4CC3 A;  3CCL T;  4J9B A;  2KNB B;  1OZ3 A;  4KBM B;  4L59 A;  4OMF B;  1AD5 A;  3QWX X;  4IUP A;  3UAT A;  4BUG A;  2RQT A;  1SHF A;  5IT9 E;  1TU0 B;  3CCS Q;  3CCV A;  1HD3 A;  5GAN 6;  1KC8 C;  4XU0 A;  2HSE B;  1NLO C;  4FYY B;  2XK0 A;  3M55 A;  2OTL A;  2ED0 A;  1ZUY A;  3L1A A;  1NLP C;  5KE3 A;  2RPN A;  4LD9 K;  4HCZ A;  4M75 G;  3PVQ A;  5A0D A;  4C92 D;  1JB0 E;  1M90 U;  1EFN A;  5GAN 4;  2DXC A;  5D7U A;  3E19 A;  5GAM f;  2E12 A;  3KUF A;  4RMO A;  1OPK A;  3GP8 A;  3L2W A;  3M0R A;  4E7K A;  3CCE Q;  1MV3 A;  3QII A;  4LDV A;  1WXU A;  3J81 E;  4RTT A;  3OYH A;  2DTI A;  4E7L A;  3CCU A;  3CPW A;  1X01 A;  2W10 A;  1W4S A;  2SRC A;  3DLL A;  1D1C A;  2RJF A;  1D1A A;  1GL5 A;  4M78 E;  4OGE A;  1BK2 A;  5GAM g;  3OYE A;  3CCV T;  3JCM X;  1SG5 A;  3OYG A;  4E7I A;  4OB0 B;  3CCL Q;  4ELZ C;  2LX9 A;  3JB9 F;  2BUD A;  3CC7 Q;  2X4Y A;  2OTL T;  3ZL7 C;  1UGP B;  2O9V A;  3UF4 A;  4PL6 A;  5FWB A;  3V8K A;  6AT1 B;  2EPD A;  2K4Y A;  3MKD A;  4GY5 A;  4DBR A;  3EFS A;  4WTO B;  4LUD A;  5KYU B;  2L3R A;  3C94 A;  2Y90 A;  4M78 F;  1VQ4 A;  1YWP A;  3CCQ Q;  5KYU A;  2K5F A;  2E5K A;  3OSS C;  2HMA A;  3RDV A;  5GAN j;  1VQ6 Q;  1ZSZ A;  1VUB A;  1WJQ A;  1Q81 R;  3EG0 A;  1WX6 A;  3CCU T;  3BDU A;  1X27 A;  2QG9 B;  4JRP A;  1T0J A;  4Q5W A;  3LX7 A;  4B6M A;  1SEM A;  2RA2 A;  5CKF A;  1QCO A;  1C6V X;  2EQI A;  2HQE A;  3O8V A;  2QQS A;  2NLU A;  2FZG B;  2QYZ A;  1HK9 A;  3VU3 C;  5HK3 A;  1NPP A;  5D6W A;  1GBQ A;  2F2W A;  4IKF A;  2MPX C;  1QWF A;  2DIL A;  3VJP A;  2L2P A;  2MK5 A;  2KXC A;  2HSP A;  1M8M A;  1YBY A;  2M0O A;  1Q81 C;  3I5S A;  1JJ2 S;  1Q82 U;  4FIB A;  3A1P A;  4PJO E;  2CH4 A;  1VQL A;  3MP6 A;  2BE9 B;  4HXJ A;  1VQ4 T;  1N8R C;  4BE2 A;  2DA9 A;  4C92 B;  3L2Q A;  1TXQ A;  2YLC A;  2LQK A;  3LLR A;  1NJI U;  2XD0 A;  3VUZ A;  3EH2 A;  2RJD A;  1M2V A;  1RAG B;  4C92 A;  4HT9 A;  2LQW A;  3HFO A;  4IUQ A;  3CBP A;  3MP8 A;  4PJJ A;  3EG3 A;  4BD3 A;  2DPP B;  1M27 C;  2LQ8 A;  2O9S A;  3ULR B;  5J26 A;  1YJ9 A;  2VXE A;  3HSB A;  3EG2 A;  3NHN A;  4K11 A;  1I1J A;  5GMK j;  3EFO B;  3VS5 A;  5FU6 B;  3CCU Q;  2CZ7 B;  2LMJ A;  1MMG A;  4M78 G;  1F1B B;  1R0B G;  5LJ5 f;  3H0H A;  2I0N A;  3NTH A;  3EFO A;  5KYW A;  4QT7 A;  2E41 A;  2LCS A;  2RB6 A;  2AZS A;  3GLX A;  1OI1 A;  1R8O B;  4OP0 A;  2NWM A;  5LJ3 d;  4N0A A;  1VQL T;  4ZGD B;  4XTY A;  4AFQ C;  1B34 A;  2DLP A;  2DL7 A;  3EH1 A;  4PFZ A;  3OYA A;  1RAE B;  5FWC A;  3V7R A;  1NJI R;  5LJ5 g;  3OS5 A;  1IRE B;  5I11 A;  3PMT A;  5GAM h;  2FRW A;  3JB9 D;  3MO8 A;  4D8K A;  1WHM A;  3M58 A;  1Q86 U;  1VQ4 Q;  3L2V A;  3S3O A;  1RL2 A;  1RLP C;  5FRM A;  1YJ9 T;  1N9S A;  4CI0 C;  2OTJ Q;  3M59 A;  1HSQ A;  1SKU B;  1UG1 A;  4M78 D;  3E9F A;  3EAE A;  2L5Q A;  4C0G A;  5IN1 A;  3BW1 A;  1XQH A;  2XI9 A;  2LVM A;  1ZSG A;  2FZK B;  2C06 A;  3G4S A;  3FIF A;  2EJG A;  3FB9 A;  2A08 A;  1TOV A;  4JS5 A;  1VYT A;  2CYZ B;  3VRZ A;  5C6S A;  5GJW B;  4JS4 A;  4MMK A;  1X6O A;  2L0A A;  4PJO G;  4E2F B;  5GMK e;  1KHC A;  2GNC A;  2MMP A;  4A54 A;  1SRM A;  3ZEH A;  1Q86 R;  3G7Z A;  2P84 A;  1VQL Q;  2EAY A;  2A0F B;  2BZY A;  3H9N A;  4MZP A;  4EMK C;  4DEY A;  2HKN A;  4JJN K;  4E7S A;  2VVK A;  3OB9 A;  3RKY A;  3RKW A;  2HKQ B;  3MJX A;  4JZ4 A;  1K8A R;  3TEE A;  2LQN A;  2XKO C;  2X51 A;  1MGQ A;  2DM1 A;  4RCC A;  4BE0 A;  1SSH A;  2XHC A;  3FRN A;  3TSW A;  3G4S T;  3OYN A;  4J8O A;  3SFM A;  3OW2 A;  2WSC E;  2YT6 A;  4IIO A;  1Y57 A;  4PLI A;  1MMN A;  3A8O B;  1VQP A;  4GLM A;  1OU9 A;  4IUR A;  5FU7 C;  3X28 B;  2HDA A;  1R0C B;  2VWF A;  5DLO A;  1QP2 A;  3SEM A;  1S1N A;  4PJO D;  1GRI A;  4Z88 A;  1T3L A;  1K9M U;  1K8A C;  4J9C A;  1RAD B;  3JCM f;  3QSU A;  2VGM A;  5GAO q;  3QDF A;  2E64 A;  2PVO B;  4R0K A;  1H64 1;  4RTW A;  3NPF A;  1WLP B;  1XOV A;  3PIP A;  1VYV A;  2XG8 D;  1CKB A;  1R77 A;  2D9T A;  1H92 A;  1MHN A;  2NUP B;  2EYX A;  2RM4 A;  1PCX A;  4M7A B;  2M9U A;  1I4K 1;  3REB B;  4AFU C;  4L6V 5;  5LJ5 h;  2E5Q A;  3M9Q A;  2HQX A;  2C0O A;  2R5A A;  3M4G A;  3VS7 A;  4M7A A;  1VQP T;  4M78 A;  3GBQ A;  1ZX6 A;  5LJ3 j;  1KFZ A;  3I5R A;  3U23 A;  2FPE A;  3PGG A;  2MYS A;  1M1K R;  1WFW A;  2J05 A;  2DAQ A;  1UJY A;  1D1B A;  3LH0 A;  2NYS A;  1OUL A;  3M4Y A;  1YIJ A;  2F69 A;  2RHU A;  2RHZ A;  1UHF A;  4J9F A;  1YHQ A;  1FXX A;  3RUX A;  1M2O A;  2DNU A;  1QCN A;  4E7Z A;  1PKT A;  1YI2 A;  5FW9 A;  4MDW A;  3RKX A;  4BY6 B;  1JO8 A;  3CXC S;  4HKE A;  1U1T A;  3C12 A;  5CCA A;  1WJR A;  4DBH A;  1M1K C;  3RMS A;  2ABL A;  2EBP A;  3E1S A;  2GGR A;  1VQ9 A;  1VQ7 Q;  2E3H A;  3SB2 A;  1UDL A;  1VYU A;  2EQJ A;  2QTX A;  3PVL A;  3EGD B;  2DZ9 A;  2EWN A;  3BFM A;  2DYI A;  4MZM A;  1UJ0 A;  2D0N A;  2J6O A;  3EGD A;  2YRV A;  4XTV A;  2ROL A;  3OYD A;  1RAC B;  2DKG A;  1VIF A;  1Q7Y U;  4HVV A;  5DY9 A;  4QVZ A;  1LOJ A;  1YIJ T;  3M0S A;  2KYB A;  1JEG A;  3WVE B;  1T3S A;  2KE9 A;  1YHQ T;  2K7A A;  1VQP Q;  1ZA2 B;  1TS9 A;  4CC2 A;  1KD1 U;  1VQ8 A;  2QQR A;  5I2M A;  2KRS A;  2HCK A;  1YI2 T;  4C8Q B;  4E7J A;  3CCM A;  1C1A A;  2G6F X;  4JRK A;  2E3I A;  4M77 C;  3X26 B;  4KUI A;  4J6W A;  2DRK A;  4QW2 A;  1G3S A;  2JM8 A;  3CPF A;  4ZN1 A;  1YJW A;  4LXC A;  2YUO A;  2FO0 A;  4J9G A;  1WHH A;  3LYI A;  1X69 A;  3QBY A;  4LD6 A;  1W70 A;  1ACM B;  2WSF E;  4FW1 A;  1ZSZ C;  1VQ9 T;  1OPL A;  2EVR A;  1UGS B;  2DEQ A;  3LWI A;  2R58 A;  2CP7 A;  4E47 A;  4EPC A;  5FRN A;  4KRT A;  1YCS B;  4OB2 B;  2AK5 A;  2DXT A;  4OMQ A;  4CRI A;  1KC8 U;  4FYX B;  3A8L B;  2X3X D;  2RI2 A;  5GAN d;  4JPB W;  2YUP A;  3ZFJ A;  2JS0 A;  2QGF B;  5CAI A;  1Q7Y R;  1KK7 A;  2XU8 A;  4ZNX A;  3SWN B;  4LDX A;  2MWO A;  5FLX E;  1VQ8 T;  1TUC A;  2LT4 A;  3CD6 A;  4PLL A;  2JZ2 A;  4OGC A;  2V26 A;  3CCM T;  3FDR A;  3ME9 A;  4J7I A;  3JCM h;  2BKD N;  2DE0 X;  4KH1 B;  1TWB A;  2K3Y A;  4PJN A;  1YJW T;  2JVV A;  1GBR A;  2RJC A;  2YSQ A;  1YIJ Q;  2QDL A;  3VRY A;  1E6G A;  1YHQ Q;  2FZC B;  2K57 A;  2HBP A;  4D8D A;  2RHI A;  2RHX A;  1YN8 A;  1YI2 Q;  2CS7 A;  2X4W A;  2CZ6 B;  1B07 A;  1KC8 R;  4HCB A;  1RAA B;  1NBE B;  3JCM W;  5KYN A;  3I56 A;  1KJW A;  3L2U A;  4FW2 A;  3CC4 A;  1N9R A;  1VQ9 Q;  5ECA A;  4HVU A;  3ZBD A;  3QYH B;  1KSW A;  1YJN A;  1QCF A;  2A28 A;  2FVU A;  3CD6 T;  1IB8 A;  2CH4 W;  3VS2 A;  2X4J A;  3OMC A;  1MUZ A;  2AZV A;  3EG9 B;  2ZPF B;  4XTX A;  4LE9 A;  1OZ2 A;  4F16 A;  1MV0 B;  4X1V A;  3I55 Q;  3JCM J;  4RUG A;  3VYH B;  3P8D A;  1VQO A;  2YXY A;  3MEW A;  3BDL A;  3EHQ A;  2IVW A;  1EZZ B;  3MP1 A;  3A8G B;  4NS5 A;  4M75 C;  3EHR A;  1BCO A;  5A0G A;  1YP5 A;  1MND A;  3CCM Q;  3A8M B;  1W2B A;  3R6O A;  2A36 A;  3SHW A;  4J9E A;  3O5Z A;  3I56 T;  2OI3 A;  1QKX A;  8AT1 B;  3OYC A;  3CQT A;  3KBG A;  1YJW Q;  1WQW A;  3N5B B;  4FT2 A;  5GAO m;  1G3W A;  2ROT A;  3CC4 T;  4DOV A;  5HCK A;  3OYF A;  4MDX A;  3GIB A;  3OMG A;  3DB4 A;  1ZA1 B;  2D1X A;  3NTI A;  1Q81 U;  4J6X A;  1YJN T;  2C0I A;  3CMA A;  3VS4 A;  1M3B A;  2CP3 A;  4M7A E;  1N8R U;  3PNW C;  4M7D C;  2A37 A;  1RI9 A;  1WXB A;  1QVF P;  2F5K A;  1VQO T;  3C95 A;  2MF2 A;  2E1H A;  3CD6 Q;  3JSC A;  3A8H B;  2HD0 A;  4ZTF A;  1WPY A;  1FMV A;  1D0X A;  4RTU A;  2EYZ A;  1K76 A;  1U1S A;  4M7A F;  2KYM A;  2IG0 A;  2VV5 A;  1TTH B;  2DET A;  1X2K A;  2DXB A;  1BU1 A;  3FJP A;  3MCA B;  2RO0 A;  2KT1 A;  2E6N A;  2CDT A;  3QHS A;  2KQW A;  3DKM A;  1OU8 A;  2JOY A;  2LDM A;  3JB9 I;  2ATC B;  1N8R R;  3I56 Q;  1PG5 B;  2CGH A;  4IUU A;  4FM4 B;  4JJC A;  3MEU A;  1Y96 B;  2ENM A;  5HK0 A;  3R6N A;  3G1J A;  4CC4 B;  1VQN A;  2VB6 A;  3JCM P;  3CC4 Q;  2HL3 A;  2LJ1 A;  2K2M A;  2K3B A;  3VV0 A;  2J06 A;  4OML A;  1UEC A;  2MCN A;  1PNJ A;  3H8Z A;  1RAI B;  1AWW A;  4N4I A;  2KK4 A;  1KQ2 A;  3CCV Q;  4BDY A;  1Z9Q A;  1VQK A;  2O88 A;  4ZGE B;  3H0F A;  2PTK A;  5GAN g;  1JU5 C;  5LL6 S;  2ESW A;  2OTL Q;  1VQO Q;  2ZAE A;  1W6X A;  1BIA A;  2BZX A;  2EIF A;  4C8Q E;  1K1Z A;  2EGA A;  2V1R A;  4X9D A;  2DMO A;  2B86 A;  2H8H A;  3OYK A;  2GTO A;  2ZZD A;  1OQK A;  2R5M A;  3JB9 G;  5GAO r;  3CME A;  2W0Z A;  2KAF A;  2QK0 A;  4FCY A;  2WAC A;  3EGU A;  1VQN T;  4NL3 A;  1G2B A;  2QDY B;  2DXU A;  2KRM A;  2QXF A;  4M78 C;  4QQD A;  4C8Q F;  4M7A G;  1QQJ A;  2F2V A;  3TCJ A;  1E6H A;  1X43 A;  5GAN e;  1QVG P;  1VQK T;  1X75 C;  2D8J A;  1GCQ C;  4QVD A;  3CBO A;  3KXT A;  3EFR A;  4IUT A;  2NUT B;  4PKC C;  2L89 A;  2KMT A;  1U8R A;  1OX9 A;  2NUT A;  1UTI A;  2PVD B;  2DIQ A;  3S6W A;  3HRU A;  1LVK A;  3CME T;  2O2O A;  2GF7 A;  4FT4 A;  2FEI A;  2LC4 A;  1BCM A;  4DBF A;  2E70 A;  3RNJ A;  2DO3 A;  1D3B B;  3L42 A;  1WHJ A;  3X25 B;  2RI3 A;  2KDS A;  4HVW A;  4M7A D;  1PKS A;  3JB9 J;  1JJ2 A;  1K8A U;  1D3B A;  2AKK A;  2P4R A;  2DD4 A;  1VQN Q;  4PFP A;  3JCM Q;  4Z8A A;  3NMZ C;  1BI0 A;  3GF5 A;  1NZ9 A;  5KYX B;  5HKC A;  3L2Z A;  4XU3 A;  2QI2 A;  3CEY A;  4EMG A;  2I2L A;  2CZ1 B;  4M7D B;  4PJO C;  5GAN 7;  2LNH B;  3QG1 A;  2XDD A;  7AT1 B;  5CK9 A;  1B3Q A;  4A4K A;  2KT8 A;  1VQK Q;  2ECZ A;  1UGQ B;  4C8Q G;  3HRS A;  2CZ0 B;  1I81 A;  3OYL A;  1VQM A;  1GFD A;  3QXE B;  4Z02 A;  5CVI A;  4KGX B;  4XTZ A;  5KE2 A;  5KYY B;  1LNX A;  1FMK A;  2L3S A;  1XTD A;  3OS2 A;  4HCC A;  2JNG A;  1WXT A;  1O75 A;  1K0S A;  2LRQ A;  4GBQ A;  3FEO A;  5KYY A;  1UFF A;  1YFN A;  4OMM A;  2A7Y A;  2OAU A;  2GFU A;  3OW2 P;  4J83 A;  1YJ9 Q;  3E2U A;  4D6W A;  2HL5 C;  5GAN 5;  4RTV A;  3M0P A;  3EGX B;  2KR3 A;  1B7T A;  3UA6 A;  1M1K U;  1AZE A;  2K79 A;  1PSE A;  3EGX A;  4C8Q D;  3OYY A;  1G8X A;  3GNG A;  1ZUU A;  1DJ7 B;  1VQM T;  1GXI E;  2AHJ B;  1WZO A;  2DBK A;  2DFU A;  4C0Z A;  3RER A;  2VUB A;  4KH0 B;  5CKB A;  3M54 A;  4VUB A;  2DL3 A;  4E7H A;  4JRQ A;  2CSI A;  2YUQ A;  4C0D C;  2O01 E;  4C0F A;  1QKW A;  3MHX A;  4BB7 A;  4J7F A;  4DBQ A;  3D7S B;  2M51 A;  4M4Z A;  2NUP A;  4ZN3 A;  3LWH A;  2EJ9 A;  2KEA A;  4QQG A;  5GMK i;  1I0C A;  2HZY A;  1VQ5 A;  3UDC A;  1WA7 A;  2HEQ A;  5L23 A;  2K5I A;  2RN8 A;  2V8K A;  5GMK h;  3G4S Q;  2RHY A;  1AOJ A;  3FJ5 A;  2COY A;  1SPK A;  4AG1 C;  4J9I A;  5IH2 A;  4DA4 A;  2VXF A;  4ESR A;  3F70 A;  8ATC B;  3JAM E;  1NE8 A;  4P5N A;  1X6G A;  1JXM A;  3PTA A;  5IXB A;  4A4E A;  2JTM A;  3NFC A;  2DD5 A;  3M0T A;  4FL6 A;  2DVE A;  1PD1 A;  2PUO B;  1BYM A;  3H6Z A;  2RQV A;  1VQM Q;  4C5E A;  2E6Z A;  3CCR A;  1UGV A;  5LJ3 g;  2AIR B;  3RR6 A;  3VS1 A;  2LX7 A;  3BY7 A;  5GAM d;  1ABO A;  3Q1J A;  3J80 E;  1NYG A;  2MAM A;  1TG0 A;  1Z9Z A;  2R57 A;  3LGL A;  1BI3 A;  1VQ5 T;  4AG2 C;  4PJL A;  5GAO n;  1KQS P;  1UE9 A;  2RI5 A;  1E7O A;  4PK4 A;  2F5T X;  2EFI A;  2JTF A;  1H3H A;  4QKU A;  2RJE A;  1RUW A;  5GAO l;  1WJS A;  1NYF A;  4TVR A;  1ARK A;  1S72 A;  2CUB A;  2PUK B;  1WQ7 A;  3OSV A;  9ATC B;  2RMO A;  2J6F A;  5CR2 A;  1JBM A;  2JS2 A;  2KI7 A;  2QEX A;  1G3Y A;  4C8Q A;  5LJ3 e;  1ZBJ A;  1SSF A;  1PRL C;  2CRE A;  3J7A F;  1PHT A;  4JDS A;  4UC4 A;  3CCR T;  3GOX A;  5IAY A;  2YUN A;  2H3J A;  2EQU A;  1GFC A;  1Y7X A;  1N5Z A;  1BI1 A;  2PVG B;  2BE7 D;  5GAN 8;  4EMK B;  5AYF A;  2RD1 A;  3L2R A;  3ASK A;  1D09 B;  1PC0 A;  2EGE A;  2QTV A;  5I21 A;  2EQK A;  3M0U A;  1HXD A;  1UEB A;  1GCP A; 
#chains in the Genus database with same CATH homology
 5I22 A;  2RQR A;  1M30 A;  2JMA A;  5I11 A;  1WIE A;  2V1Q A;  2BZ8 A;  1H8K A;  2FRW A;  4RTZ A;  4D8K A;  4RTU A;  2EGC A;  2EYZ A;  1YWO A;  1K76 A;  2KYM A;  2EKH A;  4JJB A;  1RLP C;  1X2K A;  2DJQ A;  1M3C A;  1BU1 A;  1AVZ C;  2DL5 A;  5IXF A;  2KT1 A;  1HSQ A;  1BB9 A;  2CDT A;  1UG1 A;  3VS6 A;  3TSZ A;  1SRL A;  3KFV A;  1UUE A;  1T0H A;  2DVJ A;  1BBZ A;  4JJC A;  1ZSG A;  2ENM A;  3R6N A;  1GCQ A;  2J6K A;  4CC4 B;  1A0N B;  2A08 A;  2LJ1 A;  2K2M A;  2K3B A;  1PRM C;  1VYT A;  2J06 A;  4OML A;  1UEC A;  3VRZ A;  5GJW B;  2MCN A;  1JXO A;  2RNA A;  1PNJ A;  1VA7 A;  2FRY A;  2EW3 A;  2L0A A;  2CT4 A;  3A98 A;  1AWW A;  2GNC A;  4EIK A;  1J3T A;  1K4U S;  1SRM A;  1W1F A;  1Z9Q A;  3C0C A;  2O88 A;  5IHK A;  3H0F A;  2PTK A;  2DF6 A;  3NGP A;  1JU5 C;  2ESW A;  2BZY A;  3REA B;  4DEY A;  1ABQ A;  4DEX A;  1W6X A;  2RF0 A;  2BZX A;  1K1Z A;  2EGA A;  2V1R A;  2DMO A;  1NG2 A;  2VVK A;  4JZ3 A;  2B86 A;  1AWJ A;  2IIM A;  2K6D A;  2H8H A;  3RBB B;  4Z89 A;  2GTO A;  4JZ4 A;  1V1C A;  2DX1 A;  2LQN A;  2DM1 A;  2W0Z A;  1SSH A;  1QWE A;  4AFZ C;  2SEM A;  3TSW A;  3EGU A;  2YT6 A;  4IIO A;  1G2B A;  1Y57 A;  2EYW A;  2KRM A;  4GLM A;  3H0I A;  4LNP A;  2HDA A;  4HCK A;  2DRM A;  2VWF A;  2OAW A;  1K0X A;  2F2V A;  3SEM A;  1E6H A;  1U3O A;  3LH5 A;  2DYB A;  1AWX A;  1S1N A;  1X43 A;  3JV3 A;  1GRI A;  2FPD A;  4Z88 A;  1T3L A;  2LJ3 A;  1JQQ A;  3THK A;  2C0T A;  1NEG A;  4J9C A;  2D8J A;  1GCQ C;  4OMP A;  4CC7 A;  1U5S A;  2LP5 A;  4R0K A;  4RTW A;  2JT4 A;  3NPF A;  1WLP B;  1XOV A;  2RQU A;  2JM9 A;  2OJ2 A;  1VYV A;  1UTI A;  1AEY A;  1CKB A;  1CSK A;  1H92 A;  2D8H A;  1ZUK A;  2O2O A;  3VS0 A;  2EYX A;  4LUE A;  2FEI A;  1LCK A;  3EG1 A;  3REB B;  1AZG B;  4AFU C;  3RNJ A;  1I07 A;  2C0O A;  3VS7 A;  3GBQ A;  4HVW A;  1ZX6 A;  1PKS A;  1KFZ A;  2X3W D;  3I5R A;  3U23 A;  2FPE A;  1QLY A;  2PZ1 A;  4AFS C;  2AKK A;  2P4R A;  1WFW A;  3QWY A;  2J05 A;  4RTY A;  1UJY A;  2GBQ A;  2CUD A;  4Z8A A;  3I35 A;  3NMZ C;  1WDX A;  4JJD A;  1UHF A;  2BTT A;  4J9F A;  4RTX A;  1K9A A;  1UHC A;  2DNU A;  1PKT A;  2CT3 A;  1FYN A;  5FW9 A;  2LNH B;  2JMC A;  1JO8 A;  3H41 A;  1B3Q A;  1Y0M A;  2KT8 A;  2JW4 A;  1KIK A;  1M3A A;  2ECZ A;  4CC3 A;  4J9B A;  2L3P A;  2ABL A;  2EBP A;  2KNB B;  2GGR A;  1GFD A;  2XMF A;  2FG0 A;  1UDL A;  1VYU A;  3UA7 A;  3PVL A;  1AD5 A;  2HBW A;  3QWX X;  2PNI A;  3UAT A;  1CKA A;  2RQT A;  1SHF A;  1FMK A;  1UJ0 A;  2L3S A;  2DL4 A;  1WXT A;  2D0N A;  2J6O A;  1K0S A;  1HD3 A;  2ROL A;  4GBQ A;  1NLO C;  1UFF A;  4HVV A;  4OMM A;  2ED0 A;  1ZUY A;  2NUZ A;  3M0S A;  2KYB A;  1JEG A;  1T3S A;  2KE9 A;  2K7A A;  1NLP C;  4F14 A;  4CC2 A;  2RPN A;  4OMN A;  1SHG A;  1HJD A;  2KBT A;  1NM7 A;  2KRS A;  4RTV A;  2HCK A;  3M0P A;  3PVQ A;  2G6F X;  2KR3 A;  1EFN A;  2DRK A;  2MIO A;  3UA6 A;  1AZE A;  2K79 A;  1OPK A;  2JM8 A;  3M0R A;  2YUO A;  2KRO A;  1MV3 A;  2FO0 A;  4J9G A;  1X69 A;  1W70 A;  2M0Y A;  1WXU A;  1ZUU A;  1OPL A;  2MOX A;  4RTT A;  2EVR A;  2AKL A;  1IO6 A;  2W10 A;  4KRT A;  2DBK A;  1YCS B;  2SRC A;  2AK5 A;  2YDL A;  4OMQ A;  2X3X D;  1GL5 A;  3M0Q A;  4JPB W;  2YUP A;  2DL3 A;  2CSI A;  2EYY A;  1BK2 A;  1WYX A;  2JS0 A;  2YUQ A;  1ZLM A;  1QKW A;  2KXD A;  4ZNX A;  1RLQ C;  2CSQ A;  3ZL7 C;  2O9V A;  2KGT A;  3UF4 A;  5FWB A;  2M51 A;  4M4Z A;  2EPD A;  1PWT A;  1TUC A;  2KEA A;  1WI7 A;  2FPF A;  4LUD A;  1I0C A;  1OOT A;  1OV3 A;  1X2Q A;  4WCI A;  1WA7 A;  4Y92 A;  2HEQ A;  5L23 A;  2DE0 X;  1YWP A;  2RN8 A;  1AOJ A;  1X6B A;  2E5K A;  1GBR A;  2YSQ A;  3FJ5 A;  2QDL A;  4J9D A;  1E6G A;  3VRY A;  1SPK A;  4AG1 C;  4J9I A;  5IH2 A;  3I9Q A;  4D8D A;  4ESR A;  3EG0 A;  3TVT A;  1WX6 A;  1X6G A;  1JXM A;  1YN8 A;  1X27 A;  5IXB A;  2LJ0 A;  1T0J A;  1B07 A;  3PE0 A;  1SEM A;  1AWO A;  3M0T A;  2EQI A;  1KJW A;  2JTE A;  1G83 A;  2JXB A;  4FSS A;  5ECA A;  2RQV A;  4HVU A;  2L3Q A;  1GBQ A;  2DBM A;  4E6R A;  2F2W A;  1QWF A;  2DIL A;  1KSW A;  1UGV A;  2O31 A;  2L2P A;  5EC7 A;  3VS1 A;  2KXC A;  2LX7 A;  2HSP A;  1QCF A;  1ABO A;  2A28 A;  1M8M A;  2GTJ A;  1NYG A;  1TG0 A;  1Z9Z A;  5IHI A;  5IHN A;  2F2X A;  2CH4 W;  3VS2 A;  4OMO A;  1MUZ A;  5GJV B;  2AZV A;  3I5S A;  4AG2 C;  2KRN A;  4LE9 A;  1UE9 A;  2CH4 A;  4F16 A;  4F17 A;  4HXJ A;  1MV0 B;  1E7O A;  4X1V A;  4RUG A;  2ED1 A;  1H3H A;  2DA9 A;  2DL8 A;  3EHQ A;  1RUW A;  1NYF A;  4J9H A;  1ARK A;  2LZ6 B;  2CUB A;  3EHR A;  4IIM A;  1YP5 A;  2LQW A;  1NEB A;  2A36 A;  4LN2 A;  2RMO A;  3SHW A;  1U06 A;  2J6F A;  4A63 B;  4J9E A;  3O5Z A;  1YNZ A;  2JS2 A;  1QKX A;  2OI3 A;  3EG3 A;  3CQT A;  1M27 C;  1ZBJ A;  2O9S A;  3ULR B;  2GQI A;  2ROT A;  3EG2 A;  1PRL C;  2CRE A;  3NHN A;  5HCK A;  1PHT A;  5FWC A;  2J7I A;  1I1J A;  4K11 A;  3VS5 A;  2YUN A;  2RQW A;  3VS3 A;  2D1X A;  2LMJ A;  1GFC A;  2C0I A;  3H0H A;  2I0N A;  1N5Z A;  4QT7 A;  3VS4 A;  2LCS A;  1M3B A;  2AZS A;  1OEB A;  2VKN A;  4ORZ A;  2A37 A;  1RI9 A;  2NWM A;  1TUD A;  1WXB A;  4AFQ C;  2EGE A;  2DLP A;  2DL7 A;  3M0U A;  2K9G A;  3IQL A;  1GCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...