1GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
b'MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
molecule tags Complex (signal transduction/peptide)
source organism Mus musculus
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gbqA00
1OEBA 1IO6A 2D8HA 5GJVB 3UA6A 2DL4A 2GQIA 2K7AA 1QLYA 1ZUKA 1VA7A 2I0NA 1WI7A 2GTOA 2LJ3A 1NG2A 2RNAA 4AFUC 4R0KA 2DJQA 3ZL7C 2FPEA 2DRKA 2D0NA 2YUPA 4LN2A 1TG0A 2X3WD 1G2BA 1PWTA 2LNHB 4JPBW 3VS1A 3A98A 2AKLA 4DEXA 2LQWA 4E6RA 4ESRA 2D8JA 1E6HA 1SHGA 2CSIA 1W70A 1K0XA 4IIOA 1BK2A 2PNIA 1WLPB 1QKWA 1YWPA 2E5KA 4AFQC 2KT8A 1N5ZA 1AZEA 3EG1A 1JEGA 4RTUA 4JZ3A 4OMOA 1M30A 1XOVA 1ZSGA 4GLMA 2C0IA 1B3QA 3PVLA 2F2XA 2O9VA 3REAB 2BZYA 2GGRA 4RTXA 2DF6A 1T0HA 2SEMA 1UHFA 2RQUA 4GBQA 1E7OA 4ORZA 4F17A 2EGCA 2O2OA 1H92A 2DL3A 3VS2A 2EKHA 1S1NA 1WXTA 2OAWA 4CC2A 3M0QA 2CH4W 2LP5A 2CUDA 2RF0A 3TSWA 2L2PA 2FG0A 2YDLA 3VS7A 5I22A 2SRCA 3O5ZA 2YUQA 2LCSA 2KGTA 2LJ0A 1YN8A 1HD3A 2FEIA 2K9GA 4J9HA 1KJWA 2MOXA 5IHIA 2O31A 2ROLA 3VRZA 2EPDA 3H41A 2M51A 4JZ4A 1T3SA 3EGUA 1U06A 3H0IA 2EVRA 2JS0A 3RBBB 2KROA 3M0PA 3CQTA 5IH2A 1VYUA 1J3TA 4D8KA 1GCQA 1TUCA 3UF4A 1UJ0A 2DL8A 5L23A 1NM7A 2EW3A 3I9QA 2KYMA 4K11A 2EYWA 2CUBA 5GJWB 1PNJA 1UHCA 1ABQA 3I5SA 2L3SA 1UFFA 1YCSB 2DMOA 1RLQC 1GFDA 2HDAA 1A0NB 2FRYA 2HCKA 5FW9A 2A08A 1YP5A 3EG0A 1QCFA 4RTVA 1QKXA 1WXBA 5HCKA 1PKTA 4ZNXA 2J06A 1ZBJA 1UJYA 1X6GA 2PZ1A 2L3QA 4EIKA 2PTKA 1X2KA 3SEMA 4J9CA 4HVVA 1GBRA 4AFSC 4OMQA 1RLPC 4J9EA 1VYTA 2EGEA 1KSWA 1U3OA 1W1FA 2J05A 1Z9ZA 1T0JA 2KRNA 1X6BA 2EYZA 2LMJA 2C0OA 2CREA 2J7IA 1Y0MA 1B07A 1JXMA 1Z9QA 1GCPA 3VS4A 1RI9A 2J6FA 2JTEA 2KT1A 2JMAA 4Z8AA 1AEYA 1JO8A 2DA9A 2K3BA 2W0ZA 3LH5A 2DL5A 2AZSA 5IXBA 2DBMA 2FPFA 1W6XA 1GL5A 1EFNA 2RQWA 2O9SA 1CSKA 4RTYA 3VS0A 3M0RA 1BU1A 1OOTA 1ZLMA 1WX6A 4HVUA 4HVWA 2DRMA 1H3HA 1PRLC 2OJ2A 4AG1C 1SRLA 2M0YA 2EQIA 2VKNA 3QWYA 2RN8A 1VYVA 4QT7A 4F14A 2DX1A 4Y92A 2A36A 2DYBA 2MCNA 1ARKA 2AZVA 1UE9A 3H0FA 1X43A 4J9IA 1LCKA 1UGVA 3REBB 1G83A 2DE0X 2AK5A 1NLOC 1AOJA 2JW4A 1SHFA 1UG1A 1FYNA 1SRMA 2EYYA 2KRSA 1GFCA 4Z89A 2ROTA 2A37A 4D8DA 2NWMA 3EHQA 1BB9A 4DEYA 2V1QA 4HCKA 2RQVA 1Y57A 2KXCA 2F2VA 1UUEA 2F2WA 1PRMC 1MV0B 1I1JA 1KFZA 2XMFA 1K9AA 2GNCA 1K1ZA 2YUOA 2CSQA 4OMMA 4IIMA 4KRTA 1T3LA 4JJDA 1M8MA 2A28A 2RQTA 3EG2A 1WIEA 1I0CA 2ED1A 2YSQA 1CKAA 5I11A 1AWJA 2FRWA 2ABLA 5ECAA 2EGAA 4OMLA 1U5SA 2KRMA 1ABOA 3M0TA 2KEAA 1ZX6A 3I5RA 2YT6A 2C0TA 1MUZA 1UDLA 1WYXA 1FMKA 1M27C 1WDXA 2KBTA 3KFVA 2V1RA 3U23A 2D1XA 1NEBA 2HEQA 1AWOA 2JM8A 1K4US 1PKSA 4WCIA 1NEGA 3VS6A 2CDTA 3JV3A 4OMPA 3PE0A 3NGPA 4LNPA 4CC7A 1SEMA 1KIKA 3EHRA 4A63B 1JQQA 1QWFA 3EG3A 2AKKA 5IHNA 1GBQA 3M0UA 1OPLA 2QDLA 2LJ1A 1M3BA 1WXUA 3UATA 3NPFA 2KNBB 1NLPC 3TVTA 5FWBA 2GBQA 2O88A 2MIOA 1WFWA 4CC4B 2VVKA 1JXOA 5FWCA 4LE9A 4LUDA 2J6OA 2RQRA 2OI3A 2RMOA 2ESWA 1V1CA 5IHKA 4JJBA 4Z88A 2CT3A 4M4ZA 3QWXX 3GBQA 2HBWA 1NYFA 3FJ5A 3NHNA 1UECA 3H0HA 1ZUUA 2HSPA 2BZXA 1AD5A 3IQLA 4J9GA 1PHTA 1K76A 1GCQC 2W10A 4HXJA 1HJDA 2CT4A 1M3AA 4F16A 4LUEA 1OV3A 3RNJA 2LZ6B 4RTZA 2H8HA 2JT4A 2X3XD 4RTWA 2FO0A 5EC7A 1I07A 2L3PA 2LQNA 4OMNA 3ULRB 5IXFA 2JXBA 4JJCA 2FPDA 2G6FX 3TSZA 1QWEA 4CC3A 3VS3A 1OPKA 1MV3A 2EBPA 3VRYA 2BTTA 4J9FA 1E6GA 2KYBA 2LX7A 2P4RA 2ED0A 2L0AA 3THKA 2ECZA 2GTJA 2B86A 1WA7A 4X1VA 2IIMA 1H8KA 4RTTA 4J9BA 2YUNA 2DILA 2KXDA 2CH4A 1YWOA 4J9DA 3R6NA 3UA7A 1M3CA 1ZUYA 1BBZA 3I35A 2EYXA 3C0CA 2DBKA 2JS2A 1GRIA 3PVQA 2DVJA 2JMCA 1SSHA 4AFZC 2DM1A 1NYGA 1YNZA 3VS5A 1AZGB 1AVZC 1X2QA 2DLPA 2KE9A 1X69A 2K2MA 2K6DA 2RPNA 2VWFA 2J6KA 1UTIA 1K0SA 3M0SA 1AWWA 2DNUA 4FSSA 1RUWA 1TUDA 2JM9A 2BZ8A 1X27A 2NUZA 2DL7A 4RUGA 2ENMA 1JU5C 4AG2C 1HSQA 2K79A 1CKBA 1AWXA 3NMZC 3SHWA 2KR3A 1SPKA
chains in the Genus database with same CATH superfamily
2ZPIB 3CCVA 3VYGA 4LDVA 3ZEHA 3LWHA 4ANJA 3EFOB 3I56T 1QLYA 3V8LA 1ZUKA 3NFCA 1VA7A 2I0NA 1M9SA 5FU7C 1YJWA 3OYNA 2DRKA 1G3SA 3X25B 4LN2A 2X3WD 1PWTA 1NE8A 1MMGA 3JCMh 3A98A 2AKLA 4E6RA 4BI4A 2HKNA 3G71Q 1K0XA 2XDPA 1BK2A 2HSEB 1PC0A 4AFQC 2CZ6B 2HL5C 2ZPBB 4M77E 1N5ZA 2E4HA 3EG1A 1Y07A 4QVZA 4MZTA 4JZ3A 2V26A 1KC8C 1WJSA 1M30A 1YJNQ 1B3QA 3OY9A 1FWZA 2F2XA 4LDWA 1RAAB 2O9VA 4JRPA 1T0HA 1ACMB 2O2OA 1M1KC 4M7DD 1Q81C 4JDSA 2DL3A 3MCAB 4CC2A 2CUDA 1NZ9A 5KE3A 4PL6A 1KHCA 4ZN1A 1M1KR 2LT1A 2YUQA 2KGTA 1NJIC 1EX4A 4QVCA 3M9QA 2EAYA 1IZ6A 2EPDA 4MZMA 1Q82R 1T3SA 2JZ2A 2JTMA 1BYMA 3H0IA 2EVRA 2JS0A 3EGXA 2EYQA 3G71T 1I5LA 5KYUA 4DOWA 3LW5E 4C92D 3UF4A 3OYJA 3CCMA 4E7JA 2ATCB 1YJ9T 2EW3A 2KYMA 2EYWA 4FM4B 3JCMV 5GJWB 3CCLQ 3OS1A 1M2VA 2RB6A 2DMOA 3EFOA 2HDAA 4JLIA 4PLLA 5FW9A 3QG1A 1NJIR 1YP5A 3CCQT 3OYHA 3LGLA 1Y96A 4RTVA 4DA4A 3CC4Q 1PKTA 3QSUA 3LLRA 3CPWS 1AHJB 2B8AA 4CI0C 1VQOA 1VQNA 1RLPC 5FRMA 4J7IA 3QJYA 1XNIA 2EGEA 4C0ZA 1VQ5T 1VQ4A 2EYZA 3MP6A 2J7IA 1JXMA 1RI9A 2DXBA 3EH1A 2DA9A 2W0ZA 3LH5A 3OSVA 1QVFA 5KYXB 4IUQA 3CCSA 4LD9K 2K5IA 1GL5A 4C0DB 2RQWA 5CIUA 4M78D 3A8LB 3JB9J 2E3HA 2RD1A 5L8RE 2ZPEB 1BU1A 2H3EB 4C8QG 4HVWA 5GMKm 4FL6A 3MEWA 3CCLT 2E3IA 1SRLA 3M4GA 2M0YA 1VQ8A 3QWYA 4J5YA 3PMTA 4QQ6A 1JBMA 1TSFA 5GANf 3HL8A 1UGVA 3CXCA 2CZ7B 3REBB 5CKBA 5GAN7 3ASKA 2L89A 2QQSA 1AOJA 4YTLA 1FYNA 4D6WA 3HHTB 3HRSA 5IAYA 1IRXA 1WZOA 4D8DA 3HP9A 2AIRB 1BB9A 4DEYA 3V7RA 4FYXB 5LJ5h 5GAMe 1PG5B 1PRMC 3QJ6A 4ZGJB 2F5KA 3RR6A 1KFZA 3BFMA 4C8QE 1K1ZA 2X9HA 5FU6C 2DXUA 1RABB 2G3RA 1K73U 1T3LA 3HTRA 2DKGA 1M8MA 4M7AE 2ED1A 2YSQA 2CP2A 3A8HB 2LC4A 2BE9B 2R57A 2ABLA 5LJ3f 1U5SA 2KRMA 3QZ5B 3QYGB 3CD6A 2KEAA 4II1A 5KYYA 3JB9F 4M7DA 3E1SA 3SWNB 4OGEA 2CS7A 3JCMP 3RKYA 2V1RA 7AT1B 1AWOA 1K4US 1BIBA 1NEGA 5D6XA 3VS6A 3JV3A 4C8QB 3OYLA 3CC2Q 3PE0A 4IURA 4C0FA 4PLIA 2GCXA 4KGZB 1QWFA 3EH2A 2O4XA 5GAN5 1OPLA 2BIVA 3A8OB 2LJ1A 2COZA 3NPFA 1W2BS 4KUIA 5GMKl 2VXFA 1YJWT 1KD1U 4XQ3A 2OX7A 1WJQA 1VQ9T 3L2QA 1JXOA 1ZSZA 5FWCA 2OTLT 4LUDA 2ESWA 4BDYA 1V1CA 1M2VB 5IHKA 1G3WA 2KAFA 2H3JA 4X9DA 3MHXA 2CT3A 1D1AA 4M4ZA 2HBWA 5LJ3g 3PGGA 1NYFA 1YJWQ 2LT4A 5HK3A 2P0QA 3H0HA 4M7AG 4OP0A 2QI2A 2BZXA 4XU2A 4PJOA 1PHTA 5CVIA 4M75F 2DIGA 3OYKA 1HJDA 1DJ7B 1XQHA 4N4HA 4BI3A 3OQ5A 5A2QE 3GP8A 1M3AA 4RTZA 3J80E 1JJ2S 4PK4A 2YHTA 5CQXA 3P8BB 2DETA 1O9SA 5EC7A 3ULRB 2F69A 2JXBA 3G6EQ 1IXDA 1RAFB 2LX9A 4XTVA 4JS4A 4NOYA 2YXYA 3CPFA 4HA8A 1D09B 1YCYA 2DVEA 2GFAA 3HKSA 3QZ9B 3CCST 1KK7A 1MV3A 1Q86C 2EBPA 3E9FA 4HKEA 3FJPA 2LX7A 3RMSA 2P4RA 1VQOT 2L0AA 3JCMg 3THKA 4A53A 3PMIA 3CC7T 1H8KA 4RTTA 4BI8B 4FSXA 2CH4A 1Y7XA 4F7UF 2QQBA 4RKUE 4C92A 2RI3A 2F1LA 4J6WA 4XTXA 2NUPB 5I21A 4OVAA 2DVJA 3DB3A 1SSHA 1NYGA 4RCCA 1ZSZC 1WQWA 1ZQ1A 1QVFS 2KE9A 2K2MA 3PIOA 3CCVQ 1OULA 1UTIA 5CQYA 2DNUA 2BZ8A 1X27A 2NUZA 3MO8A 1VQKT 2EFIA 1JU5C 1HSQA 3I55Q 2QQAA 3NMZC 1YJ9A 1SPKA 2FHDA 2PQWA 2RA2A 1BCMA 2M1HA 3UA6A 3CD6T 1TH7A 4XK8E 1R0CB 2GQIA 3H8ZA 2K7AA 4KH0B 3CC2A 5GMKj 2GTOA 1FMWA 2LJ3A 3TCJA 4EPCA 1G8XA 2K2VA 2FPEA 4M78F 2D0NA 1EZZB 1G2BA 2QASA 4C0GA 1N8RR 4A4FA 4DEXA 1JRIA 1YJNA 1E6HA 4M75C 2CSIA 3OS2A 2P4TA 1QKWA 1Q86R 4XTUA 2KT8A 2CP6A 2R5MA 4M78B 4N0AC 5CKDA 1AZEA 5LJ3e 4LDUA 2YWWA 2JN0A 3CC2T 1NBEB 2E65A 3QUIA 1XOVA 1ZSGA 3UT1A 4GLMA 1JJ2P 3OYCA 1JB0E 3PVLA 1UGSB 4Y28E 5IT9E 3NTKA 3REAB 2BZYA 2BUDA 2GGRA 4RTXA 3VV0A 2SEMA 1UHFA 4GBQA 2OTLQ 4XTWA 4L5GA 3JCMX 3OYMA 4F7UB 5GAMj 4EDUA 4FW1A 3I55A 3RERA 1D3BA 4C92G 1VQ7T 2RHYA 3M0QA 1SKUB 2XI9A 5A0LA 4DBFA 1VQLQ 3E9GA 3TSWA 2CP3A 1PSEA 2FG0A 2L2PA 2YDLA 4A4EA 1Q82C 2HQEA 3O5ZA 4M75E 9ATCB 3CPWP 2OAUA 1KQSP 2LJ0A 4BE2A 1VQ5Q 4N0AA 2MOXA 4KBMB 3TEEA 4J6XA 2O31A 5DM7R 4Z02A 2MWOA 1G5VA 1I81A 3PIPA 2IG0A 4FYVB 2VB6A 1RAEB 3FIFA 1MMAA 2WSCE 1U06A 1N9SA 2RM4A 1TUGB 3CBMA 1QCOA 4FIBA 3RBBB 4MZPA 5IH2A 2CP5A 3TREA 5L23A 4OF1A 5C6SA 3JB9I 3L1AA 5CKHA 1YITA 3C4SA 1PNJA 1UHCA 3I5SA 4C5GA 4J83A 2GQVA 1HK9A 2FRYA 1WPYA 2HCKA 4AT1B 4C8QF 3GNGA 1W4SA 1HYOA 1WXBA 3SDZA 3HPWA 5HCKA 3OYAA 2QQRA 3CMAA 1YI2T 4ZNXA 5KH6A 4JLGA 1UJYA 2MF2A 2MYSA 2FZCB 2L3QA 2LQ8A 4EIKA 2RHUA 2P0PA 4QQGA 2DXCA 2X4YA 4JJNK 4J9CA 2C06A 5GANj 4HVVA 4BB7A 2Y90A 4OMQA 3QO3A 2D0QB 5FRNA 1KSWA 1U3OA 4KUDK 5LJ5g 3UPUA 2KRNA 1VIFA 4ZTFA 2LMJA 2C0OA 2CREA 1B07A 1GCPA 1RL2A 4EMKA 1MMDA 3INZA 4FW2A 1AEYA 1JO8A 1N8RU 2KMTA 1W6XA 4A4KA 3JSCA 2O9SA 2LNVA 1M1FA 1RADB 4RTYA 3VS0A 3M0RA 2X35A 4EMHA 5GAMg 1UB4A 5IN1A 5LJ5f 1JJ2A 4HVUA 1D0YA 4TVRA 3OSSC 1PRLC 4J6YA 4IKFA 2OJ2A 2QXFA 4AG1C 3KUFA 4M7AC 3G7ZA 4OB3B 1Q7YR 5A0GA 1YFNA 2DFUA 3CBPA 3A8GB 2DYBA 1N6AA 4F7UA 4UC4A 1KQ2A 1QVPA 2DO3A 3NTHA 1S72T 1LOJA 1UE9A 5GMKh 1K9MU 1YITQ 1P92A 3ZFJA 2JW4A 3JCMJ 2E1HA 1UG1A 1B34B 2HQXA 3AHUA 1PD0A 2EIFA 2ZPGB 3M55A 2A37A 3M57A 4M78C 3EHQA 2V1QA 4MMKA 3OMGA 4M78A 4HCKA 1V76A 2KXCA 3URGA 2DD5A 4XTYA 3PT9A 2RK1A 2WACA 4RMOA 1QVFP 3META 3MPUB 4M7AB 2GNCA 4WTOB 2YUOA 4XU0A 5LJ5j 2CSQA 2HBPA 4BDZA 5KYWA 2RQTA 3FLGA 1I8FA 5CCAA 1WIEA 4M7DG 4X34A 3OYDA 2NLUA 1ZA1B 1KQSA 2QA4T 4PFPA 2LCLA 1D0ZA 2HL3A 2AT1B 5GAOl 3EGDA 4OMLA 3PFSA 4F7UE 1Q82U 2MI6A 2YT6A 3OW2A 4C0DC 1MUZA 1WYXA 2RI5A 2DERA 2QA4A 2FYKA 3MJXA 4OGCA 3T9NA 1M27C 2KBTA 2EQKA 3KFVA 1QVGP 2HEQA 3HRTA 3GOXA 2JM8A 2MWPA 2CDTA 4EMKC 1K8AU 5GAMd 2VGNA 4J7FA 5GAN2 4ME7A 2VYTA 3CCUT 5IHNA 3M0UA 1R77A 1VQPA 1M3BA 6AT1B 3CXCP 2KNBB 1RAGB 5FWBA 3OYGA 1VQ6A 1VQ4T 1D1CA 4M77F 2O88A 4CC4B 2AHJB 4M75B 2J6OA 4FCYA 2RQRA 2OI3A 1FMVA 2CYZB 2NUTB 1K8AC 2WSFE 2X4XA 1WHJA 1YHQT 1QQJA 3M5AA 1M1KU 3NHNA 1UECA 4E7HA 1EIFA 2E41A 1YIJQ 2HSPA 4ZGEB 5EG2A 3EG9A 3Q1JA 5DY9A 1K76A 3JAME 2LTOA 3QYHB 2K5LA 3CC4A 3S3NA 1LVKA 4NS5A 2CT4A 2M02A 2X3XD 2FO0A 2LQNA 1VQOQ 2VXEA 1OU9A 3PNWC 2FPDA 4RG2A 5KCOA 1VQ4Q 2I2LA 2V8IA 3FEOA 3MEVA 2D9TA 3EAEA 2BTTA 1TOVA 1E6GA 1VUBA 1X6OA 1BKBA 4GY5A 4LXCA 3EFSA 2K4YA 4PJOE 1WA7A 3JCMf 2IIMA 3GLXA 2KXDA 4J9DA 1BI0A 3UA7A 3L2WA 4FT2A 2EYXA 2ZPHB 3C0CA 5CO7A 2RJEA 4PJOB 2L5QA 2X4JA 1RAIB 1V29B 5I2SA 3CCJQ 2GFUA 4AFZC 2DM1A 4M7DF 4EMGA 4XU1A 3OYYA 3VS5A 1AZGB 2DLPA 3DB4A 1X69A 1IGUA 2QK0A 2RPNA 4XAXB 2DZCA 2E5QA 5CR2A 1UGPB 3CPWA 3MKDA 4M7AA 4OB1B 1R8OB 4RUGA 4AG2C 5GAOm 1CKBA 3VJPA 4C92C 1AWXA 1YIJT 2KR3A 3LH0A 2L8DA 1IO6A 1WQ7A 1VQNT 3BW1A 5GJVB 1F1BB 2BE7D 1D0XA 5A0DA 2DL4A 1N8RC 2CGHA 5GAMf 3OMCA 1N9RA 1NG2A 1PD1A 2RNAA 4AFUC 1Y71A 2EQMA 4R0KA 2HQHA 2DJQA 3EFRA 2DJZA 3F70A 3VS1A 1TTHB 4JS5A 1KG1A 2LQWA 1AT1B 2LDMA 2MMPA 2D8JA 1SHGA 1W70A 4IIOA 1YWPA 1MNEA 4X9CA 3SWNA 5KYYB 3CCRT 3JCMc 2F5TX 1JEGA 2P84A 4RTUA 4OMOA 1YHQQ 2C0IA 4M78E 3OBYA 1OX8A 1OZ2A 4J8OA 1GXIE 2DF6A 2QDYB 3HFNA 4ORZA 4DBRA 1YIJA 4CRIA 4F17A 2EGCA 4HT9A 1H92A 1Q81U 2E70A 3VS2A 2L3RA 2EKHA 1RAHB 1WXTA 2PVGB 2OAWA 2M9UA 4PFZA 3LWIA 3V7CA 3X24B 2LP5A 2CKKA 2RF0A 2K5FA 3SD4A 4M7AD 3VS7A 1NPRA 1BI1A 5I22A 3QIIA 3JB9G 2LCSA 2O01E 2FB7A 2K9GA 3JRZA 2ROLA 2DTOA 3MEAA 2EJGA 1U8RA 2RHZA 2R58A 3H41A 2M51A 2FVUA 2ZGWA 3G4SQ 1WGSA 3EGUA 1QVGS 4M78G 4C5EA 1K73C 4M77A 1HXDA 2QTXA 2JNGA 2MAMA 4PNOA 1J3TA 4B9WA 1TUCA 1H641 3OBWA 1VQPQ 3I9QA 4K11A 3BE3A 2CUBA 4MDWA 2YRDA 2QAZA 1IGQA 2L3SA 1PCXA 1S72A 3I56Q 3X26B 1RLQC 1GFDA 4PJJA 2EJ9A 2A08A 5KYNA 3CC7A 1VQ9Q 3A8MB 3CCQQ 4M77D 2RI2A 2J06A 1OZ3A 1ZBJA 3EG9B 4B9XA 2PZ1A 1QMCA 2QYZA 2PTKA 1BI3A 1X2KA 3SEMA 1GBRA 2NYSA 3FB9A 3M56A 4J9EA 2CP7A 1VYTA 4KGVB 1D3BB 1T0JA 2QG9B 5GANd 5KYUB 1XJWB 1Y0MA 3VS4A 2E6NA 2J6FA 2JTEA 2KT1A 2JMAA 3VUBA 4FU6A 3CCRA 4Z8AA 8AT1B 2PUOB 1N27A 1BIAA 3M54A 3GPLA 5IXBA 2COWA 2FPFA 1TS9A 1KQSS 1VQMA 3G1JA 1CSKA 3QPHA 3UWNA 2Z0WA 1BCOA 4M7DC 3CCLA 3HFOA 4QVDA 1OOTA 5AT1B 1SG5A 1H3HA 2ZPFB 5GAN8 4LDYA 3FC3A 1VQ6Q 1VQPT 4DQ2A 2RN8A 4QT7A 4F14A 3M4YA 2DX1A 4Y92A 4FYWB 2R5AA 1SSFA 1ARKA 3S6WA 1X43A 3CCJA 1NLOC 1TWBA 1SHFA 5GAOr 3OYBA 1YJNT 2KK4A 1OYXA 2KRSA 1GFCA 4Z89A 2ROTA 3GNFB 5LJ3d 3LGFA 4IUPA 3L2RA 1M2OA 2RQVA 1Y57A 1SF9A 1UUEA 2F2VA 3M53A 3N5BB 2M16A 1K9AA 1G3TA 4ELZC 5LJ5e 4O5VA 5KYWB 1LPLA 2DTHA 3OYEA 2K3YA 2QEXQ 4OMMA 4JRQA 4IIMA 4KRTA 1R0BG 2QGFB 1VQMQ 1OI1A 5GAN4 4IUTA 4PJNA 5I11A 4M75A 4PJOF 2K3XA 1K8AR 3VU3C 4HCCA 2EGAA 1QW1A 3CCVT 2V8JA 2X4WA 1VQ7Q 3D7SB 1B34A 2YLBA 5GANg 2QQ9A 1ZX6A 3I5RA 2CZ0B 2A3LA 2MK5A 2DAQA 3JCMd 1QP3A 2D1XA 2DYIA 1NEBA 1IHWA 4C92F 4C8QC 4WCIA 1Q95G 1KC8R 3DLLA 3MEUA 3CC7Q 2JUFA 3NGPA 4LNPA 1SEMA 3TU4K 3EG3A 3CXCS 2AKKA 1KD1R 1IREB 3H9NA 5GAOp 3J81E 1GBQA 3OW2S 1U1TA 2QDLA 1WXUA 4JUVA 1NLPC 1O75A 3QHSA 3TVTA 1M90U 3EGDB 1M4ZA 1KD1C 2Y4XA 1U1SA 3CMET 2LVMA 5GAN3 1FX7A 4F7UG 5GANe 3OS5A 2HKQB 2HNIA 2Y4YA 2DZ9A 3CD6Q 2PVOB 2FZGB 3FRNA 2A0FB 3GBQA 4QQDA 2XG8D 2MPXC 3FJ5A 4KT0E 3CCMQ 5DLQE 1XTDA 4M7DE 1ZUUA 4M77B 3CCET 4XU3A 5D6WA 2OTJA 3G4ST 1GCQC 5GAN6 2V8KA 4PJMA 1Q7YC 4HXJA 1W2BP 2ZZDA 4F16A 1OV3A 3RNJA 3RESA 2LZ6B 3L42A 4BACA 4RTWA 4RG8A 4R55A 3QKJA 3CMEQ 1I07A 2L3PA 4OMNA 1M90C 4JJCA 2IVWA 5FROA 2OTLA 4CC3A 4BE0A 4DOVA 4BE1A 3E2UA 1C1AA 2XDDA 2KYBA 4P5NA 2DTIA 2GTJA 2RO0A 4LDXA 2B86A 4MDXA 3QDFA 4X1VA 4M7DB 3CCQA 4E7KA 4JRIA 1FXXA 1TU0B 1WHKA 1X01A 3C94A 3CCSQ 2E12A 3R6NA 1MGQA 1M3CA 1M5Q1 3BDLA 5HY6A 1OX9A 4V2SA 1YNZA 2EJFA 1AVZC 1MNDA 3AT1B 2K6DA 2KI7A 3G71A 2VWFA 3WVDB 2J6KA 4VUBA 1K0SA 3M0SA 4FSSA 1RUWA 5AYFA 1TUDA 4M7AF 3VYHB 2DL7A 4C5HA 1QVGA 1YI2Q 1OEBA 2D8HA 4ZN3A 3JCMe 3OYIA 3HRUA 1WI7A 2KSSA 1KQ1A 3CCUQ 1KHIA 2FZKB 4NL2A 2LQKA 2VASA 3E19A 4IUVA 3ZL7C 4A54A 2YUPA 3PTAA 4IUUA 2VC8A 1TG0A 4L6V5 2LNHB 3SB2A 4JPBW 4M77C 3UDCA 2IPOB 4ESRA 2PNIA 3ZBDA 2JOYA 1WLPB 1K73R 4AMCA 4HCZA 2E5KA 1UGRB 1WJRA 4E7IA 3ME9A 5CAIA 2XD0A 2QGGA 4R56A 4BY6C 5LJ5d 2QTVA 1RI0A 3P8HA 1VQ8Q 4PJLA 4E7ZA 2QEXA 1VQLT 2RQUA 1E7OA 5I2MA 4DBQA 1UEBA 1S1NA 1YI2A 5DLOA 1ZA2B 5GAMh 2XKOC 2PVDB 3DLMA 3A1PA 1Q86U 2CH4W 1QCNA 2YRCA 2SRCA 1VQ7A 2NUPA 4PKCC 1Q81R 5D7UA 1YN8A 1HD3A 2FEIA 2RH2A 4J9HA 1KJWA 2BKDN 5IHIA 3SWNC 4F04B 3VRZA 2QEXT 3OA6A 3L2ZA 4JZ4A 1NJIU 3C12A 1YHQA 3JB9D 4FYYB 5CKEA 4N4GA 3VKIA 1OU8A 2DPPB 2KROA 1S72Q 2HAXA 3BDUA 3CQTA 3M0PA 2YLCA 4ZGDB 4PJOC 5GAOq 1VYUA 1M90R 2VGMA 4D8KA 1GCQA 1LNXA 1G3YA 2DD4A 3QBYA 1UJ0A 2DL8A 1NM7A 4DBHA 3L2UA 2RHXA 1PM3A 2XICA 1ABQA 2XU8A 4WF2A 1UFFA 1YCSB 3EGXB 3RUXA 8ATCB 2LCCA 1A0NB 5GAOn 3FDRA 4Q5WA 1KC8U 1VQMT 3EG0A 1QCFA 2PUKB 1C6VX 1QKXA 3I55T 5HK0A 1X6GA 2GF7A 1VQKQ 3OYFA 1IB8A 4M75D 1VQ5A 3WVEB 3G4SA 3JB9H 5CKFA 3RDVA 4ELYC 4AFSC 3CBOA 2E64A 3RKWA 1WHHA 1W1FA 2J05A 1Z9ZA 3CEYA 1X6BA 1Z9QA 3SFMA 2K3BA 2DL5A 2AZSA 4C92B 2DBMA 1ZSZB 1EFNA 2VV5A 3M58A 5J39A 4LD6A 3L2VA 1OQKA 1VQ9A 3S3MA 1ZLMA 1WX6A 1MHNA 5KE2A 2DRMA 1D1BA 4MMLA 2RJCA 2EQIA 2FL7A 2VKNA 1K9MC 1VYVA 2DK3A 2EKOA 3CC4T 2A36A 4PJOG 5FLXE 1VQLA 2MCNA 2AZVA 3G6ET 3H0FA 2NUTA 4J9IA 1I5OB 1LCKA 2ZAEA 1G83A 2DE0X 2AK5A 1IHVA 5J3BA 4Y91A 4HCBA 2E10A 1VQKA 1SRMA 2EYYA 1WHGA 4NL3A 4A4GA 1YJ9Q 4BD3A 3G6EA 2NWMA 4OB2B 4C5IA 2CZ1B 2F2WA 3A5ZB 1MV0B 1I1JA 2XMFA 2P0KA 5GMKe 5KCHA 4JJDA 5CK9A 3LYIA 3MP8A 2A28A 3CCEA 3EG2A 1H3ZA 2DIQA 3V7SA 1I0CA 1PSFA 4A4HA 1CKAA 2RJDA 2EQJA 1WHMA 1AWJA 2EQUA 2FRWA 5ECAA 3GIBA 3JCMb 3R6OA 1ABOA 3M0TA 4BY6B 3QXEB 2C0TA 1Q7YU 2YRVA 3CCJT 2O4XB 1UDLA 2KVQG 1ZBXA 2D6FA 1FMKA 1WDXA 1WNLA 1TXQA 3U23A 4KULA 4KH1B 3JCMW 4EMKB 4C8QA 1C0MA 1PKSA 4PFOA 2ZCFB 5J26A 4OMPA 3H6ZA 4GLKA 2VUBA 3O8VA 4CC7A 1KIKA 2X51A 3EHRA 4A63B 1JQQA 3I56A 3ER0A 4KGXB 2DEQA 5LL6S 1VIEA 2KY9A 3UATA 3V8JA 5M9OA 4OB0B 1VOMA 4ATOA 1ZHIA 2GBQA 2MIOA 1WFWA 4N4IA 2VVKA 5GANh 2HZYA 4LE9A 5LJ3j 1QP2A 2M0OA 2RMOA 5FU7B 2XHCA 4FT4A 4JJBA 1BI2A 2LRQA 3MP1A 3KXTA 2JTFA 4JRKA 3X28B 3RMQA 1W2BA 2OTJQ 3CMEA 3KBGA 1I4K1 4Z88A 1M8VA 1MMNA 2HD0A 4BUGA 4C8QD 2DEUA 3QWXX 3X20B 3J7AF 1VQNQ 2EWNA 3CCRQ 4L59A 2JVVA 4ZTJA 3OB9A 3QDRB 2WSEE 2KDSA 3VUZA 5D6YA 1AD5A 3IQLA 4E2FB 4E7LA 4J9GA 4M75G 1LJOA 3RKXA 2RK2A 2W10A 2K57A 4QW2A 4XTZA 2DXTA 1Y96B 4LUEA 3BY7A 4E7SA 3P8DA 2OTJT 4C92E 3TQ7P 2H8HA 2JT4A 4RCBA 3CMAQ 2KQWA 1YBYA 3OS0A 5IXFA 1UGQB 2XK0A 2JJ9A 2G6FX 3GF5A 3TSZA 3CCMT 1QWEA 1B7TA 3VS3A 1X75C 1OPKA 2XDBA 4QKUA 1K9MR 3VRYA 1VQ6T 2QA4Q 4J9FA 2A7YA 4HT8A 2ED0A 4M77G 3S3OA 4E47A 3V8KA 2ECZA 1VQ8T 2XIDA 1WHLA 4J9BA 2YUNA 3NTIA 3HSBA 2DILA 1YWOA 5GMKi 2E6ZA 1ZUYA 2RHIA 5KYXA 1BBZA 3I35A 3LX7A 4O6JA 2DBKA 5LJ3h 2JS2A 1GRIA 2RJFA 3PVQA 3CCEQ 5HKCA 2JMCA 3OW2P 2COYA 2CP0A 3M59A 3CMAT 4OMFB 2PU9B 4B6MA 3CCUA 3DKMA 1X2QA 2HMAA 3C95A 1M1GA 3WXMB 1AWWA 1NPPA 2JM9A 5C0MA 1RACB 5FU6B 1YITT 4PJOD 2ENMA 3RIRA 2K79A 3SHWA 3JCMQ
chains in the Genus database with same CATH topology
1OEBA 1IO6A 2D8HA 5GJVB 3UA6A 2DL4A 2GQIA 2K7AA 1QLYA 1ZUKA 1VA7A 2I0NA 1WI7A 2GTOA 2LJ3A 1NG2A 2RNAA 4AFUC 4R0KA 2DJQA 3ZL7C 2FPEA 2DRKA 2D0NA 2YUPA 4LN2A 1TG0A 2X3WD 1G2BA 1PWTA 2LNHB 4JPBW 3VS1A 3A98A 2AKLA 4DEXA 2LQWA 4E6RA 4ESRA 2D8JA 1E6HA 1SHGA 2CSIA 1W70A 1K0XA 4IIOA 1BK2A 2PNIA 1WLPB 1QKWA 1YWPA 2E5KA 4AFQC 2KT8A 1N5ZA 1AZEA 3EG1A 1JEGA 4RTUA 4JZ3A 4OMOA 1M30A 1XOVA 1ZSGA 4GLMA 2C0IA 1B3QA 3PVLA 2F2XA 2O9VA 3REAB 2BZYA 2GGRA 4RTXA 2DF6A 1T0HA 2SEMA 1UHFA 2RQUA 4GBQA 1E7OA 4ORZA 4F17A 2EGCA 2O2OA 1H92A 2DL3A 3VS2A 2EKHA 1S1NA 1WXTA 2OAWA 4CC2A 3M0QA 2CH4W 2LP5A 2CUDA 2RF0A 3TSWA 2L2PA 2FG0A 2YDLA 3VS7A 5I22A 2SRCA 3O5ZA 2YUQA 2LCSA 2KGTA 2LJ0A 1YN8A 1HD3A 2FEIA 2K9GA 4J9HA 1KJWA 2MOXA 5IHIA 2O31A 2ROLA 3VRZA 2EPDA 3H41A 2M51A 4JZ4A 1T3SA 3EGUA 1U06A 3H0IA 2EVRA 2JS0A 3RBBB 2KROA 3M0PA 3CQTA 5IH2A 1VYUA 1J3TA 4D8KA 1GCQA 1TUCA 3UF4A 1UJ0A 2DL8A 5L23A 1NM7A 2EW3A 3I9QA 2KYMA 4K11A 2EYWA 2CUBA 5GJWB 1PNJA 1UHCA 1ABQA 3I5SA 2L3SA 1UFFA 1YCSB 2DMOA 1RLQC 1GFDA 2HDAA 1A0NB 2FRYA 2HCKA 5FW9A 2A08A 1YP5A 3EG0A 1QCFA 4RTVA 1QKXA 1WXBA 5HCKA 1PKTA 4ZNXA 2J06A 1ZBJA 1UJYA 1X6GA 2PZ1A 2L3QA 4EIKA 2PTKA 1X2KA 3SEMA 4J9CA 4HVVA 1GBRA 4AFSC 4OMQA 1RLPC 4J9EA 1VYTA 2EGEA 1KSWA 1U3OA 1W1FA 2J05A 1Z9ZA 1T0JA 2KRNA 1X6BA 2EYZA 2LMJA 2C0OA 2CREA 2J7IA 1Y0MA 1B07A 1JXMA 1Z9QA 1GCPA 3VS4A 1RI9A 2J6FA 2JTEA 2KT1A 2JMAA 4Z8AA 1AEYA 1JO8A 2DA9A 2K3BA 2W0ZA 3LH5A 2DL5A 2AZSA 5IXBA 2DBMA 2FPFA 1W6XA 1GL5A 1EFNA 2RQWA 2O9SA 1CSKA 4RTYA 3VS0A 3M0RA 1BU1A 1OOTA 1ZLMA 1WX6A 4HVUA 4HVWA 2DRMA 1H3HA 1PRLC 2OJ2A 4AG1C 1SRLA 2M0YA 2EQIA 2VKNA 3QWYA 2RN8A 1VYVA 4QT7A 4F14A 2DX1A 4Y92A 2A36A 2DYBA 2MCNA 1ARKA 2AZVA 1UE9A 3H0FA 1X43A 4J9IA 1LCKA 1UGVA 3REBB 1G83A 2DE0X 2AK5A 1NLOC 1AOJA 2JW4A 1SHFA 1UG1A 1FYNA 1SRMA 2EYYA 2KRSA 1GFCA 4Z89A 2ROTA 2A37A 4D8DA 2NWMA 3EHQA 1BB9A 4DEYA 2V1QA 4HCKA 2RQVA 1Y57A 2KXCA 2F2VA 1UUEA 2F2WA 1PRMC 1MV0B 1I1JA 1KFZA 2XMFA 1K9AA 2GNCA 1K1ZA 2YUOA 2CSQA 4OMMA 4IIMA 4KRTA 1T3LA 4JJDA 1M8MA 2A28A 2RQTA 3EG2A 1WIEA 1I0CA 2ED1A 2YSQA 1CKAA 5I11A 1AWJA 2FRWA 2ABLA 5ECAA 2EGAA 4OMLA 1U5SA 2KRMA 1ABOA 3M0TA 2KEAA 1ZX6A 3I5RA 2YT6A 2C0TA 1MUZA 1UDLA 1WYXA 1FMKA 1M27C 1WDXA 2KBTA 3KFVA 2V1RA 3U23A 2D1XA 1NEBA 2HEQA 1AWOA 2JM8A 1K4US 1PKSA 4WCIA 1NEGA 3VS6A 2CDTA 3JV3A 4OMPA 3PE0A 3NGPA 4LNPA 4CC7A 1SEMA 1KIKA 3EHRA 4A63B 1JQQA 1QWFA 3EG3A 2AKKA 5IHNA 1GBQA 3M0UA 1OPLA 2QDLA 2LJ1A 1M3BA 1WXUA 3UATA 3NPFA 2KNBB 1NLPC 3TVTA 5FWBA 2GBQA 2O88A 2MIOA 1WFWA 4CC4B 2VVKA 1JXOA 5FWCA 4LE9A 4LUDA 2J6OA 2RQRA 2OI3A 2RMOA 2ESWA 1V1CA 5IHKA 4JJBA 4Z88A 2CT3A 4M4ZA 3QWXX 3GBQA 2HBWA 1NYFA 3FJ5A 3NHNA 1UECA 3H0HA 1ZUUA 2HSPA 2BZXA 1AD5A 3IQLA 4J9GA 1PHTA 1K76A 1GCQC 2W10A 4HXJA 1HJDA 2CT4A 1M3AA 4F16A 4LUEA 1OV3A 3RNJA 2LZ6B 4RTZA 2H8HA 2JT4A 2X3XD 4RTWA 2FO0A 5EC7A 1I07A 2L3PA 2LQNA 4OMNA 3ULRB 5IXFA 2JXBA 4JJCA 2FPDA 2G6FX 3TSZA 1QWEA 4CC3A 3VS3A 1OPKA 1MV3A 2EBPA 3VRYA 2BTTA 4J9FA 1E6GA 2KYBA 2LX7A 2P4RA 2ED0A 2L0AA 3THKA 2ECZA 2GTJA 2B86A 1WA7A 4X1VA 2IIMA 1H8KA 4RTTA 4J9BA 2YUNA 2DILA 2KXDA 2CH4A 1YWOA 4J9DA 3R6NA 3UA7A 1M3CA 1ZUYA 1BBZA 3I35A 2EYXA 3C0CA 2DBKA 2JS2A 1GRIA 3PVQA 2DVJA 2JMCA 1SSHA 4AFZC 2DM1A 1NYGA 1YNZA 3VS5A 1AZGB 1AVZC 1X2QA 2DLPA 2KE9A 1X69A 2K2MA 2K6DA 2RPNA 2VWFA 2J6KA 1UTIA 1K0SA 3M0SA 1AWWA 2DNUA 4FSSA 1RUWA 1TUDA 2JM9A 2BZ8A 1X27A 2NUZA 2DL7A 4RUGA 2ENMA 1JU5C 4AG2C 1HSQA 2K79A 1CKBA 1AWXA 3NMZC 3SHWA 2KR3A 1SPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OEB A;  1IO6 A;  2D8H A;  5GJV B;  3UA6 A;  2DL4 A;  2GQI A;  2K7A A;  1QLY A;  1ZUK A;  1VA7 A;  2I0N A;  1WI7 A;  2GTO A;  2LJ3 A;  1NG2 A;  2RNA A;  4AFU C;  4R0K A;  2DJQ A;  3ZL7 C;  2FPE A;  2DRK A;  2D0N A;  2YUP A;  4LN2 A;  1TG0 A;  2X3W D;  1G2B A;  1PWT A;  2LNH B;  4JPB W;  3VS1 A;  3A98 A;  2AKL A;  4DEX A;  2LQW A;  4E6R A;  4ESR A;  2D8J A;  1E6H A;  1SHG A;  2CSI A;  1W70 A;  1K0X A;  4IIO A;  1BK2 A;  2PNI A;  1WLP B;  1QKW A;  1YWP A;  2E5K A;  4AFQ C;  2KT8 A;  1N5Z A;  1AZE A;  3EG1 A;  1JEG A;  4RTU A;  4JZ3 A;  4OMO A;  1M30 A;  1XOV A;  1ZSG A;  4GLM A;  2C0I A;  1B3Q A;  3PVL A;  2F2X A;  2O9V A;  3REA B;  2BZY A;  2GGR A;  4RTX A;  2DF6 A;  1T0H A;  2SEM A;  1UHF A;  2RQU A;  4GBQ A;  1E7O A;  4ORZ A;  4F17 A;  2EGC A;  2O2O A;  1H92 A;  2DL3 A;  3VS2 A;  2EKH A;  1S1N A;  1WXT A;  2OAW A;  4CC2 A;  3M0Q A;  2CH4 W;  2LP5 A;  2CUD A;  2RF0 A;  3TSW A;  2L2P A;  2FG0 A;  2YDL A;  3VS7 A;  5I22 A;  2SRC A;  3O5Z A;  2YUQ A;  2LCS A;  2KGT A;  2LJ0 A;  1YN8 A;  1HD3 A;  2FEI A;  2K9G A;  4J9H A;  1KJW A;  2MOX A;  5IHI A;  2O31 A;  2ROL A;  3VRZ A;  2EPD A;  3H41 A;  2M51 A;  4JZ4 A;  1T3S A;  3EGU A;  1U06 A;  3H0I A;  2EVR A;  2JS0 A;  3RBB B;  2KRO A;  3M0P A;  3CQT A;  5IH2 A;  1VYU A;  1J3T A;  4D8K A;  1GCQ A;  1TUC A;  3UF4 A;  1UJ0 A;  2DL8 A;  5L23 A;  1NM7 A;  2EW3 A;  3I9Q A;  2KYM A;  4K11 A;  2EYW A;  2CUB A;  5GJW B;  1PNJ A;  1UHC A;  1ABQ A;  3I5S A;  2L3S A;  1UFF A;  1YCS B;  2DMO A;  1RLQ C;  1GFD A;  2HDA A;  1A0N B;  2FRY A;  2HCK A;  5FW9 A;  2A08 A;  1YP5 A;  3EG0 A;  1QCF A;  4RTV A;  1QKX A;  1WXB A;  5HCK A;  1PKT A;  4ZNX A;  2J06 A;  1ZBJ A;  1UJY A;  1X6G A;  2PZ1 A;  2L3Q A;  4EIK A;  2PTK A;  1X2K A;  3SEM A;  4J9C A;  4HVV A;  1GBR A;  4AFS C;  4OMQ A;  1RLP C;  4J9E A;  1VYT A;  2EGE A;  1KSW A;  1U3O A;  1W1F A;  2J05 A;  1Z9Z A;  1T0J A;  2KRN A;  1X6B A;  2EYZ A;  2LMJ A;  2C0O A;  2CRE A;  2J7I A;  1Y0M A;  1B07 A;  1JXM A;  1Z9Q A;  1GCP A;  3VS4 A;  1RI9 A;  2J6F A;  2JTE A;  2KT1 A;  2JMA A;  4Z8A A;  1AEY A;  1JO8 A;  2DA9 A;  2K3B A;  2W0Z A;  3LH5 A;  2DL5 A;  2AZS A;  5IXB A;  2DBM A;  2FPF A;  1W6X A;  1GL5 A;  1EFN A;  2RQW A;  2O9S A;  1CSK A;  4RTY A;  3VS0 A;  3M0R A;  1BU1 A;  1OOT A;  1ZLM A;  1WX6 A;  4HVU A;  4HVW A;  2DRM A;  1H3H A;  1PRL C;  2OJ2 A;  4AG1 C;  1SRL A;  2M0Y A;  2EQI A;  2VKN A;  3QWY A;  2RN8 A;  1VYV A;  4QT7 A;  4F14 A;  2DX1 A;  4Y92 A;  2A36 A;  2DYB A;  2MCN A;  1ARK A;  2AZV A;  1UE9 A;  3H0F A;  1X43 A;  4J9I A;  1LCK A;  1UGV A;  3REB B;  1G83 A;  2DE0 X;  2AK5 A;  1NLO C;  1AOJ A;  2JW4 A;  1SHF A;  1UG1 A;  1FYN A;  1SRM A;  2EYY A;  2KRS A;  1GFC A;  4Z89 A;  2ROT A;  2A37 A;  4D8D A;  2NWM A;  3EHQ A;  1BB9 A;  4DEY A;  2V1Q A;  4HCK A;  2RQV A;  1Y57 A;  2KXC A;  2F2V A;  1UUE A;  2F2W A;  1PRM C;  1MV0 B;  1I1J A;  1KFZ A;  2XMF A;  1K9A A;  2GNC A;  1K1Z A;  2YUO A;  2CSQ A;  4OMM A;  4IIM A;  4KRT A;  1T3L A;  4JJD A;  1M8M A;  2A28 A;  2RQT A;  3EG2 A;  1WIE A;  1I0C A;  2ED1 A;  2YSQ A;  1CKA A;  5I11 A;  1AWJ A;  2FRW A;  2ABL A;  5ECA A;  2EGA A;  4OML A;  1U5S A;  2KRM A;  1ABO A;  3M0T A;  2KEA A;  1ZX6 A;  3I5R A;  2YT6 A;  2C0T A;  1MUZ A;  1UDL A;  1WYX A;  1FMK A;  1M27 C;  1WDX A;  2KBT A;  3KFV A;  2V1R A;  3U23 A;  2D1X A;  1NEB A;  2HEQ A;  1AWO A;  2JM8 A;  1K4U S;  1PKS A;  4WCI A;  1NEG A;  3VS6 A;  2CDT A;  3JV3 A;  4OMP A;  3PE0 A;  3NGP A;  4LNP A;  4CC7 A;  1SEM A;  1KIK A;  3EHR A;  4A63 B;  1JQQ A;  1QWF A;  3EG3 A;  2AKK A;  5IHN A;  1GBQ A;  3M0U A;  1OPL A;  2QDL A;  2LJ1 A;  1M3B A;  1WXU A;  3UAT A;  3NPF A;  2KNB B;  1NLP C;  3TVT A;  5FWB A;  2GBQ A;  2O88 A;  2MIO A;  1WFW A;  4CC4 B;  2VVK A;  1JXO A;  5FWC A;  4LE9 A;  4LUD A;  2J6O A;  2RQR A;  2OI3 A;  2RMO A;  2ESW A;  1V1C A;  5IHK A;  4JJB A;  4Z88 A;  2CT3 A;  4M4Z A;  3QWX X;  3GBQ A;  2HBW A;  1NYF A;  3FJ5 A;  3NHN A;  1UEC A;  3H0H A;  1ZUU A;  2HSP A;  2BZX A;  1AD5 A;  3IQL A;  4J9G A;  1PHT A;  1K76 A;  1GCQ C;  2W10 A;  4HXJ A;  1HJD A;  2CT4 A;  1M3A A;  4F16 A;  4LUE A;  1OV3 A;  3RNJ A;  2LZ6 B;  4RTZ A;  2H8H A;  2JT4 A;  2X3X D;  4RTW A;  2FO0 A;  5EC7 A;  1I07 A;  2L3P A;  2LQN A;  4OMN A;  3ULR B;  5IXF A;  2JXB A;  4JJC A;  2FPD A;  2G6F X;  3TSZ A;  1QWE A;  4CC3 A;  3VS3 A;  1OPK A;  1MV3 A;  2EBP A;  3VRY A;  2BTT A;  4J9F A;  1E6G A;  2KYB A;  2LX7 A;  2P4R A;  2ED0 A;  2L0A A;  3THK A;  2ECZ A;  2GTJ A;  2B86 A;  1WA7 A;  4X1V A;  2IIM A;  1H8K A;  4RTT A;  4J9B A;  2YUN A;  2DIL A;  2KXD A;  2CH4 A;  1YWO A;  4J9D A;  3R6N A;  3UA7 A;  1M3C A;  1ZUY A;  1BBZ A;  3I35 A;  2EYX A;  3C0C A;  2DBK A;  2JS2 A;  1GRI A;  3PVQ A;  2DVJ A;  2JMC A;  1SSH A;  4AFZ C;  2DM1 A;  1NYG A;  1YNZ A;  3VS5 A;  1AZG B;  1AVZ C;  1X2Q A;  2DLP A;  2KE9 A;  1X69 A;  2K2M A;  2K6D A;  2RPN A;  2VWF A;  2J6K A;  1UTI A;  1K0S A;  3M0S A;  1AWW A;  2DNU A;  4FSS A;  1RUW A;  1TUD A;  2JM9 A;  2BZ8 A;  1X27 A;  2NUZ A;  2DL7 A;  4RUG A;  2ENM A;  1JU5 C;  4AG2 C;  1HSQ A;  2K79 A;  1CKB A;  1AWX A;  3NMZ C;  3SHW A;  2KR3 A;  1SPK A; 
#chains in the Genus database with same CATH topology
 2ZPI B;  3CCV A;  3VYG A;  4LDV A;  3ZEH A;  3LWH A;  4ANJ A;  3EFO B;  3I56 T;  1QLY A;  3V8L A;  1ZUK A;  3NFC A;  1VA7 A;  2I0N A;  1M9S A;  5FU7 C;  1YJW A;  3OYN A;  2DRK A;  1G3S A;  3X25 B;  4LN2 A;  2X3W D;  1PWT A;  1NE8 A;  1MMG A;  3JCM h;  3A98 A;  2AKL A;  4E6R A;  4BI4 A;  2HKN A;  3G71 Q;  1K0X A;  2XDP A;  1BK2 A;  2HSE B;  1PC0 A;  4AFQ C;  2CZ6 B;  2HL5 C;  2ZPB B;  4M77 E;  1N5Z A;  2E4H A;  3EG1 A;  1Y07 A;  4QVZ A;  4MZT A;  4JZ3 A;  2V26 A;  1KC8 C;  1WJS A;  1M30 A;  1YJN Q;  1B3Q A;  3OY9 A;  1FWZ A;  2F2X A;  4LDW A;  1RAA B;  2O9V A;  4JRP A;  1T0H A;  1ACM B;  2O2O A;  1M1K C;  4M7D D;  1Q81 C;  4JDS A;  2DL3 A;  3MCA B;  4CC2 A;  2CUD A;  1NZ9 A;  5KE3 A;  4PL6 A;  1KHC A;  4ZN1 A;  1M1K R;  2LT1 A;  2YUQ A;  2KGT A;  1NJI C;  1EX4 A;  4QVC A;  3M9Q A;  2EAY A;  1IZ6 A;  2EPD A;  4MZM A;  1Q82 R;  1T3S A;  2JZ2 A;  2JTM A;  1BYM A;  3H0I A;  2EVR A;  2JS0 A;  3EGX A;  2EYQ A;  3G71 T;  1I5L A;  5KYU A;  4DOW A;  3LW5 E;  4C92 D;  3UF4 A;  3OYJ A;  3CCM A;  4E7J A;  2ATC B;  1YJ9 T;  2EW3 A;  2KYM A;  2EYW A;  4FM4 B;  3JCM V;  5GJW B;  3CCL Q;  3OS1 A;  1M2V A;  2RB6 A;  2DMO A;  3EFO A;  2HDA A;  4JLI A;  4PLL A;  5FW9 A;  3QG1 A;  1NJI R;  1YP5 A;  3CCQ T;  3OYH A;  3LGL A;  1Y96 A;  4RTV A;  4DA4 A;  3CC4 Q;  1PKT A;  3QSU A;  3LLR A;  3CPW S;  1AHJ B;  2B8A A;  4CI0 C;  1VQO A;  1VQN A;  1RLP C;  5FRM A;  4J7I A;  3QJY A;  1XNI A;  2EGE A;  4C0Z A;  1VQ5 T;  1VQ4 A;  2EYZ A;  3MP6 A;  2J7I A;  1JXM A;  1RI9 A;  2DXB A;  3EH1 A;  2DA9 A;  2W0Z A;  3LH5 A;  3OSV A;  1QVF A;  5KYX B;  4IUQ A;  3CCS A;  4LD9 K;  2K5I A;  1GL5 A;  4C0D B;  2RQW A;  5CIU A;  4M78 D;  3A8L B;  3JB9 J;  2E3H A;  2RD1 A;  5L8R E;  2ZPE B;  1BU1 A;  2H3E B;  4C8Q G;  4HVW A;  5GMK m;  4FL6 A;  3MEW A;  3CCL T;  2E3I A;  1SRL A;  3M4G A;  2M0Y A;  1VQ8 A;  3QWY A;  4J5Y A;  3PMT A;  4QQ6 A;  1JBM A;  1TSF A;  5GAN f;  3HL8 A;  1UGV A;  3CXC A;  2CZ7 B;  3REB B;  5CKB A;  5GAN 7;  3ASK A;  2L89 A;  2QQS A;  1AOJ A;  4YTL A;  1FYN A;  4D6W A;  3HHT B;  3HRS A;  5IAY A;  1IRX A;  1WZO A;  4D8D A;  3HP9 A;  2AIR B;  1BB9 A;  4DEY A;  3V7R A;  4FYX B;  5LJ5 h;  5GAM e;  1PG5 B;  1PRM C;  3QJ6 A;  4ZGJ B;  2F5K A;  3RR6 A;  1KFZ A;  3BFM A;  4C8Q E;  1K1Z A;  2X9H A;  5FU6 C;  2DXU A;  1RAB B;  2G3R A;  1K73 U;  1T3L A;  3HTR A;  2DKG A;  1M8M A;  4M7A E;  2ED1 A;  2YSQ A;  2CP2 A;  3A8H B;  2LC4 A;  2BE9 B;  2R57 A;  2ABL A;  5LJ3 f;  1U5S A;  2KRM A;  3QZ5 B;  3QYG B;  3CD6 A;  2KEA A;  4II1 A;  5KYY A;  3JB9 F;  4M7D A;  3E1S A;  3SWN B;  4OGE A;  2CS7 A;  3JCM P;  3RKY A;  2V1R A;  7AT1 B;  1AWO A;  1K4U S;  1BIB A;  1NEG A;  5D6X A;  3VS6 A;  3JV3 A;  4C8Q B;  3OYL A;  3CC2 Q;  3PE0 A;  4IUR A;  4C0F A;  4PLI A;  2GCX A;  4KGZ B;  1QWF A;  3EH2 A;  2O4X A;  5GAN 5;  1OPL A;  2BIV A;  3A8O B;  2LJ1 A;  2COZ A;  3NPF A;  1W2B S;  4KUI A;  5GMK l;  2VXF A;  1YJW T;  1KD1 U;  4XQ3 A;  2OX7 A;  1WJQ A;  1VQ9 T;  3L2Q A;  1JXO A;  1ZSZ A;  5FWC A;  2OTL T;  4LUD A;  2ESW A;  4BDY A;  1V1C A;  1M2V B;  5IHK A;  1G3W A;  2KAF A;  2H3J A;  4X9D A;  3MHX A;  2CT3 A;  1D1A A;  4M4Z A;  2HBW A;  5LJ3 g;  3PGG A;  1NYF A;  1YJW Q;  2LT4 A;  5HK3 A;  2P0Q A;  3H0H A;  4M7A G;  4OP0 A;  2QI2 A;  2BZX A;  4XU2 A;  4PJO A;  1PHT A;  5CVI A;  4M75 F;  2DIG A;  3OYK A;  1HJD A;  1DJ7 B;  1XQH A;  4N4H A;  4BI3 A;  3OQ5 A;  5A2Q E;  3GP8 A;  1M3A A;  4RTZ A;  3J80 E;  1JJ2 S;  4PK4 A;  2YHT A;  5CQX A;  3P8B B;  2DET A;  1O9S A;  5EC7 A;  3ULR B;  2F69 A;  2JXB A;  3G6E Q;  1IXD A;  1RAF B;  2LX9 A;  4XTV A;  4JS4 A;  4NOY A;  2YXY A;  3CPF A;  4HA8 A;  1D09 B;  1YCY A;  2DVE A;  2GFA A;  3HKS A;  3QZ9 B;  3CCS T;  1KK7 A;  1MV3 A;  1Q86 C;  2EBP A;  3E9F A;  4HKE A;  3FJP A;  2LX7 A;  3RMS A;  2P4R A;  1VQO T;  2L0A A;  3JCM g;  3THK A;  4A53 A;  3PMI A;  3CC7 T;  1H8K A;  4RTT A;  4BI8 B;  4FSX A;  2CH4 A;  1Y7X A;  4F7U F;  2QQB A;  4RKU E;  4C92 A;  2RI3 A;  2F1L A;  4J6W A;  4XTX A;  2NUP B;  5I21 A;  4OVA A;  2DVJ A;  3DB3 A;  1SSH A;  1NYG A;  4RCC A;  1ZSZ C;  1WQW A;  1ZQ1 A;  1QVF S;  2KE9 A;  2K2M A;  3PIO A;  3CCV Q;  1OUL A;  1UTI A;  5CQY A;  2DNU A;  2BZ8 A;  1X27 A;  2NUZ A;  3MO8 A;  1VQK T;  2EFI A;  1JU5 C;  1HSQ A;  3I55 Q;  2QQA A;  3NMZ C;  1YJ9 A;  1SPK A;  2FHD A;  2PQW A;  2RA2 A;  1BCM A;  2M1H A;  3UA6 A;  3CD6 T;  1TH7 A;  4XK8 E;  1R0C B;  2GQI A;  3H8Z A;  2K7A A;  4KH0 B;  3CC2 A;  5GMK j;  2GTO A;  1FMW A;  2LJ3 A;  3TCJ A;  4EPC A;  1G8X A;  2K2V A;  2FPE A;  4M78 F;  2D0N A;  1EZZ B;  1G2B A;  2QAS A;  4C0G A;  1N8R R;  4A4F A;  4DEX A;  1JRI A;  1YJN A;  1E6H A;  4M75 C;  2CSI A;  3OS2 A;  2P4T A;  1QKW A;  1Q86 R;  4XTU A;  2KT8 A;  2CP6 A;  2R5M A;  4M78 B;  4N0A C;  5CKD A;  1AZE A;  5LJ3 e;  4LDU A;  2YWW A;  2JN0 A;  3CC2 T;  1NBE B;  2E65 A;  3QUI A;  1XOV A;  1ZSG A;  3UT1 A;  4GLM A;  1JJ2 P;  3OYC A;  1JB0 E;  3PVL A;  1UGS B;  4Y28 E;  5IT9 E;  3NTK A;  3REA B;  2BZY A;  2BUD A;  2GGR A;  4RTX A;  3VV0 A;  2SEM A;  1UHF A;  4GBQ A;  2OTL Q;  4XTW A;  4L5G A;  3JCM X;  3OYM A;  4F7U B;  5GAM j;  4EDU A;  4FW1 A;  3I55 A;  3RER A;  1D3B A;  4C92 G;  1VQ7 T;  2RHY A;  3M0Q A;  1SKU B;  2XI9 A;  5A0L A;  4DBF A;  1VQL Q;  3E9G A;  3TSW A;  2CP3 A;  1PSE A;  2FG0 A;  2L2P A;  2YDL A;  4A4E A;  1Q82 C;  2HQE A;  3O5Z A;  4M75 E;  9ATC B;  3CPW P;  2OAU A;  1KQS P;  2LJ0 A;  4BE2 A;  1VQ5 Q;  4N0A A;  2MOX A;  4KBM B;  3TEE A;  4J6X A;  2O31 A;  5DM7 R;  4Z02 A;  2MWO A;  1G5V A;  1I81 A;  3PIP A;  2IG0 A;  4FYV B;  2VB6 A;  1RAE B;  3FIF A;  1MMA A;  2WSC E;  1U06 A;  1N9S A;  2RM4 A;  1TUG B;  3CBM A;  1QCO A;  4FIB A;  3RBB B;  4MZP A;  5IH2 A;  2CP5 A;  3TRE A;  5L23 A;  4OF1 A;  5C6S A;  3JB9 I;  3L1A A;  5CKH A;  1YIT A;  3C4S A;  1PNJ A;  1UHC A;  3I5S A;  4C5G A;  4J83 A;  2GQV A;  1HK9 A;  2FRY A;  1WPY A;  2HCK A;  4AT1 B;  4C8Q F;  3GNG A;  1W4S A;  1HYO A;  1WXB A;  3SDZ A;  3HPW A;  5HCK A;  3OYA A;  2QQR A;  3CMA A;  1YI2 T;  4ZNX A;  5KH6 A;  4JLG A;  1UJY A;  2MF2 A;  2MYS A;  2FZC B;  2L3Q A;  2LQ8 A;  4EIK A;  2RHU A;  2P0P A;  4QQG A;  2DXC A;  2X4Y A;  4JJN K;  4J9C A;  2C06 A;  5GAN j;  4HVV A;  4BB7 A;  2Y90 A;  4OMQ A;  3QO3 A;  2D0Q B;  5FRN A;  1KSW A;  1U3O A;  4KUD K;  5LJ5 g;  3UPU A;  2KRN A;  1VIF A;  4ZTF A;  2LMJ A;  2C0O A;  2CRE A;  1B07 A;  1GCP A;  1RL2 A;  4EMK A;  1MMD A;  3INZ A;  4FW2 A;  1AEY A;  1JO8 A;  1N8R U;  2KMT A;  1W6X A;  4A4K A;  3JSC A;  2O9S A;  2LNV A;  1M1F A;  1RAD B;  4RTY A;  3VS0 A;  3M0R A;  2X35 A;  4EMH A;  5GAM g;  1UB4 A;  5IN1 A;  5LJ5 f;  1JJ2 A;  4HVU A;  1D0Y A;  4TVR A;  3OSS C;  1PRL C;  4J6Y A;  4IKF A;  2OJ2 A;  2QXF A;  4AG1 C;  3KUF A;  4M7A C;  3G7Z A;  4OB3 B;  1Q7Y R;  5A0G A;  1YFN A;  2DFU A;  3CBP A;  3A8G B;  2DYB A;  1N6A A;  4F7U A;  4UC4 A;  1KQ2 A;  1QVP A;  2DO3 A;  3NTH A;  1S72 T;  1LOJ A;  1UE9 A;  5GMK h;  1K9M U;  1YIT Q;  1P92 A;  3ZFJ A;  2JW4 A;  3JCM J;  2E1H A;  1UG1 A;  1B34 B;  2HQX A;  3AHU A;  1PD0 A;  2EIF A;  2ZPG B;  3M55 A;  2A37 A;  3M57 A;  4M78 C;  3EHQ A;  2V1Q A;  4MMK A;  3OMG A;  4M78 A;  4HCK A;  1V76 A;  2KXC A;  3URG A;  2DD5 A;  4XTY A;  3PT9 A;  2RK1 A;  2WAC A;  4RMO A;  1QVF P;  3MET A;  3MPU B;  4M7A B;  2GNC A;  4WTO B;  2YUO A;  4XU0 A;  5LJ5 j;  2CSQ A;  2HBP A;  4BDZ A;  5KYW A;  2RQT A;  3FLG A;  1I8F A;  5CCA A;  1WIE A;  4M7D G;  4X34 A;  3OYD A;  2NLU A;  1ZA1 B;  1KQS A;  2QA4 T;  4PFP A;  2LCL A;  1D0Z A;  2HL3 A;  2AT1 B;  5GAO l;  3EGD A;  4OML A;  3PFS A;  4F7U E;  1Q82 U;  2MI6 A;  2YT6 A;  3OW2 A;  4C0D C;  1MUZ A;  1WYX A;  2RI5 A;  2DER A;  2QA4 A;  2FYK A;  3MJX A;  4OGC A;  3T9N A;  1M27 C;  2KBT A;  2EQK A;  3KFV A;  1QVG P;  2HEQ A;  3HRT A;  3GOX A;  2JM8 A;  2MWP A;  2CDT A;  4EMK C;  1K8A U;  5GAM d;  2VGN A;  4J7F A;  5GAN 2;  4ME7 A;  2VYT A;  3CCU T;  5IHN A;  3M0U A;  1R77 A;  1VQP A;  1M3B A;  6AT1 B;  3CXC P;  2KNB B;  1RAG B;  5FWB A;  3OYG A;  1VQ6 A;  1VQ4 T;  1D1C A;  4M77 F;  2O88 A;  4CC4 B;  2AHJ B;  4M75 B;  2J6O A;  4FCY A;  2RQR A;  2OI3 A;  1FMV A;  2CYZ B;  2NUT B;  1K8A C;  2WSF E;  2X4X A;  1WHJ A;  1YHQ T;  1QQJ A;  3M5A A;  1M1K U;  3NHN A;  1UEC A;  4E7H A;  1EIF A;  2E41 A;  1YIJ Q;  2HSP A;  4ZGE B;  5EG2 A;  3EG9 A;  3Q1J A;  5DY9 A;  1K76 A;  3JAM E;  2LTO A;  3QYH B;  2K5L A;  3CC4 A;  3S3N A;  1LVK A;  4NS5 A;  2CT4 A;  2M02 A;  2X3X D;  2FO0 A;  2LQN A;  1VQO Q;  2VXE A;  1OU9 A;  3PNW C;  2FPD A;  4RG2 A;  5KCO A;  1VQ4 Q;  2I2L A;  2V8I A;  3FEO A;  3MEV A;  2D9T A;  3EAE A;  2BTT A;  1TOV A;  1E6G A;  1VUB A;  1X6O A;  1BKB A;  4GY5 A;  4LXC A;  3EFS A;  2K4Y A;  4PJO E;  1WA7 A;  3JCM f;  2IIM A;  3GLX A;  2KXD A;  4J9D A;  1BI0 A;  3UA7 A;  3L2W A;  4FT2 A;  2EYX A;  2ZPH B;  3C0C A;  5CO7 A;  2RJE A;  4PJO B;  2L5Q A;  2X4J A;  1RAI B;  1V29 B;  5I2S A;  3CCJ Q;  2GFU A;  4AFZ C;  2DM1 A;  4M7D F;  4EMG A;  4XU1 A;  3OYY A;  3VS5 A;  1AZG B;  2DLP A;  3DB4 A;  1X69 A;  1IGU A;  2QK0 A;  2RPN A;  4XAX B;  2DZC A;  2E5Q A;  5CR2 A;  1UGP B;  3CPW A;  3MKD A;  4M7A A;  4OB1 B;  1R8O B;  4RUG A;  4AG2 C;  5GAO m;  1CKB A;  3VJP A;  4C92 C;  1AWX A;  1YIJ T;  2KR3 A;  3LH0 A;  2L8D A;  1IO6 A;  1WQ7 A;  1VQN T;  3BW1 A;  5GJV B;  1F1B B;  2BE7 D;  1D0X A;  5A0D A;  2DL4 A;  1N8R C;  2CGH A;  5GAM f;  3OMC A;  1N9R A;  1NG2 A;  1PD1 A;  2RNA A;  4AFU C;  1Y71 A;  2EQM A;  4R0K A;  2HQH A;  2DJQ A;  3EFR A;  2DJZ A;  3F70 A;  3VS1 A;  1TTH B;  4JS5 A;  1KG1 A;  2LQW A;  1AT1 B;  2LDM A;  2MMP A;  2D8J A;  1SHG A;  1W70 A;  4IIO A;  1YWP A;  1MNE A;  4X9C A;  3SWN A;  5KYY B;  3CCR T;  3JCM c;  2F5T X;  1JEG A;  2P84 A;  4RTU A;  4OMO A;  1YHQ Q;  2C0I A;  4M78 E;  3OBY A;  1OX8 A;  1OZ2 A;  4J8O A;  1GXI E;  2DF6 A;  2QDY B;  3HFN A;  4ORZ A;  4DBR A;  1YIJ A;  4CRI A;  4F17 A;  2EGC A;  4HT9 A;  1H92 A;  1Q81 U;  2E70 A;  3VS2 A;  2L3R A;  2EKH A;  1RAH B;  1WXT A;  2PVG B;  2OAW A;  2M9U A;  4PFZ A;  3LWI A;  3V7C A;  3X24 B;  2LP5 A;  2CKK A;  2RF0 A;  2K5F A;  3SD4 A;  4M7A D;  3VS7 A;  1NPR A;  1BI1 A;  5I22 A;  3QII A;  3JB9 G;  2LCS A;  2O01 E;  2FB7 A;  2K9G A;  3JRZ A;  2ROL A;  2DTO A;  3MEA A;  2EJG A;  1U8R A;  2RHZ A;  2R58 A;  3H41 A;  2M51 A;  2FVU A;  2ZGW A;  3G4S Q;  1WGS A;  3EGU A;  1QVG S;  4M78 G;  4C5E A;  1K73 C;  4M77 A;  1HXD A;  2QTX A;  2JNG A;  2MAM A;  4PNO A;  1J3T A;  4B9W A;  1TUC A;  1H64 1;  3OBW A;  1VQP Q;  3I9Q A;  4K11 A;  3BE3 A;  2CUB A;  4MDW A;  2YRD A;  2QAZ A;  1IGQ A;  2L3S A;  1PCX A;  1S72 A;  3I56 Q;  3X26 B;  1RLQ C;  1GFD A;  4PJJ A;  2EJ9 A;  2A08 A;  5KYN A;  3CC7 A;  1VQ9 Q;  3A8M B;  3CCQ Q;  4M77 D;  2RI2 A;  2J06 A;  1OZ3 A;  1ZBJ A;  3EG9 B;  4B9X A;  2PZ1 A;  1QMC A;  2QYZ A;  2PTK A;  1BI3 A;  1X2K A;  3SEM A;  1GBR A;  2NYS A;  3FB9 A;  3M56 A;  4J9E A;  2CP7 A;  1VYT A;  4KGV B;  1D3B B;  1T0J A;  2QG9 B;  5GAN d;  5KYU B;  1XJW B;  1Y0M A;  3VS4 A;  2E6N A;  2J6F A;  2JTE A;  2KT1 A;  2JMA A;  3VUB A;  4FU6 A;  3CCR A;  4Z8A A;  8AT1 B;  2PUO B;  1N27 A;  1BIA A;  3M54 A;  3GPL A;  5IXB A;  2COW A;  2FPF A;  1TS9 A;  1KQS S;  1VQM A;  3G1J A;  1CSK A;  3QPH A;  3UWN A;  2Z0W A;  1BCO A;  4M7D C;  3CCL A;  3HFO A;  4QVD A;  1OOT A;  5AT1 B;  1SG5 A;  1H3H A;  2ZPF B;  5GAN 8;  4LDY A;  3FC3 A;  1VQ6 Q;  1VQP T;  4DQ2 A;  2RN8 A;  4QT7 A;  4F14 A;  3M4Y A;  2DX1 A;  4Y92 A;  4FYW B;  2R5A A;  1SSF A;  1ARK A;  3S6W A;  1X43 A;  3CCJ A;  1NLO C;  1TWB A;  1SHF A;  5GAO r;  3OYB A;  1YJN T;  2KK4 A;  1OYX A;  2KRS A;  1GFC A;  4Z89 A;  2ROT A;  3GNF B;  5LJ3 d;  3LGF A;  4IUP A;  3L2R A;  1M2O A;  2RQV A;  1Y57 A;  1SF9 A;  1UUE A;  2F2V A;  3M53 A;  3N5B B;  2M16 A;  1K9A A;  1G3T A;  4ELZ C;  5LJ5 e;  4O5V A;  5KYW B;  1LPL A;  2DTH A;  3OYE A;  2K3Y A;  2QEX Q;  4OMM A;  4JRQ A;  4IIM A;  4KRT A;  1R0B G;  2QGF B;  1VQM Q;  1OI1 A;  5GAN 4;  4IUT A;  4PJN A;  5I11 A;  4M75 A;  4PJO F;  2K3X A;  1K8A R;  3VU3 C;  4HCC A;  2EGA A;  1QW1 A;  3CCV T;  2V8J A;  2X4W A;  1VQ7 Q;  3D7S B;  1B34 A;  2YLB A;  5GAN g;  2QQ9 A;  1ZX6 A;  3I5R A;  2CZ0 B;  2A3L A;  2MK5 A;  2DAQ A;  3JCM d;  1QP3 A;  2D1X A;  2DYI A;  1NEB A;  1IHW A;  4C92 F;  4C8Q C;  4WCI A;  1Q95 G;  1KC8 R;  3DLL A;  3MEU A;  3CC7 Q;  2JUF A;  3NGP A;  4LNP A;  1SEM A;  3TU4 K;  3EG3 A;  3CXC S;  2AKK A;  1KD1 R;  1IRE B;  3H9N A;  5GAO p;  3J81 E;  1GBQ A;  3OW2 S;  1U1T A;  2QDL A;  1WXU A;  4JUV A;  1NLP C;  1O75 A;  3QHS A;  3TVT A;  1M90 U;  3EGD B;  1M4Z A;  1KD1 C;  2Y4X A;  1U1S A;  3CME T;  2LVM A;  5GAN 3;  1FX7 A;  4F7U G;  5GAN e;  3OS5 A;  2HKQ B;  2HNI A;  2Y4Y A;  2DZ9 A;  3CD6 Q;  2PVO B;  2FZG B;  3FRN A;  2A0F B;  3GBQ A;  4QQD A;  2XG8 D;  2MPX C;  3FJ5 A;  4KT0 E;  3CCM Q;  5DLQ E;  1XTD A;  4M7D E;  1ZUU A;  4M77 B;  3CCE T;  4XU3 A;  5D6W A;  2OTJ A;  3G4S T;  1GCQ C;  5GAN 6;  2V8K A;  4PJM A;  1Q7Y C;  4HXJ A;  1W2B P;  2ZZD A;  4F16 A;  1OV3 A;  3RNJ A;  3RES A;  2LZ6 B;  3L42 A;  4BAC A;  4RTW A;  4RG8 A;  4R55 A;  3QKJ A;  3CME Q;  1I07 A;  2L3P A;  4OMN A;  1M90 C;  4JJC A;  2IVW A;  5FRO A;  2OTL A;  4CC3 A;  4BE0 A;  4DOV A;  4BE1 A;  3E2U A;  1C1A A;  2XDD A;  2KYB A;  4P5N A;  2DTI A;  2GTJ A;  2RO0 A;  4LDX A;  2B86 A;  4MDX A;  3QDF A;  4X1V A;  4M7D B;  3CCQ A;  4E7K A;  4JRI A;  1FXX A;  1TU0 B;  1WHK A;  1X01 A;  3C94 A;  3CCS Q;  2E12 A;  3R6N A;  1MGQ A;  1M3C A;  1M5Q 1;  3BDL A;  5HY6 A;  1OX9 A;  4V2S A;  1YNZ A;  2EJF A;  1AVZ C;  1MND A;  3AT1 B;  2K6D A;  2KI7 A;  3G71 A;  2VWF A;  3WVD B;  2J6K A;  4VUB A;  1K0S A;  3M0S A;  4FSS A;  1RUW A;  5AYF A;  1TUD A;  4M7A F;  3VYH B;  2DL7 A;  4C5H A;  1QVG A;  1YI2 Q;  1OEB A;  2D8H A;  4ZN3 A;  3JCM e;  3OYI A;  3HRU A;  1WI7 A;  2KSS A;  1KQ1 A;  3CCU Q;  1KHI A;  2FZK B;  4NL2 A;  2LQK A;  2VAS A;  3E19 A;  4IUV A;  3ZL7 C;  4A54 A;  2YUP A;  3PTA A;  4IUU A;  2VC8 A;  1TG0 A;  4L6V 5;  2LNH B;  3SB2 A;  4JPB W;  4M77 C;  3UDC A;  2IPO B;  4ESR A;  2PNI A;  3ZBD A;  2JOY A;  1WLP B;  1K73 R;  4AMC A;  4HCZ A;  2E5K A;  1UGR B;  1WJR A;  4E7I A;  3ME9 A;  5CAI A;  2XD0 A;  2QGG A;  4R56 A;  4BY6 C;  5LJ5 d;  2QTV A;  1RI0 A;  3P8H A;  1VQ8 Q;  4PJL A;  4E7Z A;  2QEX A;  1VQL T;  2RQU A;  1E7O A;  5I2M A;  4DBQ A;  1UEB A;  1S1N A;  1YI2 A;  5DLO A;  1ZA2 B;  5GAM h;  2XKO C;  2PVD B;  3DLM A;  3A1P A;  1Q86 U;  2CH4 W;  1QCN A;  2YRC A;  2SRC A;  1VQ7 A;  2NUP A;  4PKC C;  1Q81 R;  5D7U A;  1YN8 A;  1HD3 A;  2FEI A;  2RH2 A;  4J9H A;  1KJW A;  2BKD N;  5IHI A;  3SWN C;  4F04 B;  3VRZ A;  2QEX T;  3OA6 A;  3L2Z A;  4JZ4 A;  1NJI U;  3C12 A;  1YHQ A;  3JB9 D;  4FYY B;  5CKE A;  4N4G A;  3VKI A;  1OU8 A;  2DPP B;  2KRO A;  1S72 Q;  2HAX A;  3BDU A;  3CQT A;  3M0P A;  2YLC A;  4ZGD B;  4PJO C;  5GAO q;  1VYU A;  1M90 R;  2VGM A;  4D8K A;  1GCQ A;  1LNX A;  1G3Y A;  2DD4 A;  3QBY A;  1UJ0 A;  2DL8 A;  1NM7 A;  4DBH A;  3L2U A;  2RHX A;  1PM3 A;  2XIC A;  1ABQ A;  2XU8 A;  4WF2 A;  1UFF A;  1YCS B;  3EGX B;  3RUX A;  8ATC B;  2LCC A;  1A0N B;  5GAO n;  3FDR A;  4Q5W A;  1KC8 U;  1VQM T;  3EG0 A;  1QCF A;  2PUK B;  1C6V X;  1QKX A;  3I55 T;  5HK0 A;  1X6G A;  2GF7 A;  1VQK Q;  3OYF A;  1IB8 A;  4M75 D;  1VQ5 A;  3WVE B;  3G4S A;  3JB9 H;  5CKF A;  3RDV A;  4ELY C;  4AFS C;  3CBO A;  2E64 A;  3RKW A;  1WHH A;  1W1F A;  2J05 A;  1Z9Z A;  3CEY A;  1X6B A;  1Z9Q A;  3SFM A;  2K3B A;  2DL5 A;  2AZS A;  4C92 B;  2DBM A;  1ZSZ B;  1EFN A;  2VV5 A;  3M58 A;  5J39 A;  4LD6 A;  3L2V A;  1OQK A;  1VQ9 A;  3S3M A;  1ZLM A;  1WX6 A;  1MHN A;  5KE2 A;  2DRM A;  1D1B A;  4MML A;  2RJC A;  2EQI A;  2FL7 A;  2VKN A;  1K9M C;  1VYV A;  2DK3 A;  2EKO A;  3CC4 T;  2A36 A;  4PJO G;  5FLX E;  1VQL A;  2MCN A;  2AZV A;  3G6E T;  3H0F A;  2NUT A;  4J9I A;  1I5O B;  1LCK A;  2ZAE A;  1G83 A;  2DE0 X;  2AK5 A;  1IHV A;  5J3B A;  4Y91 A;  4HCB A;  2E10 A;  1VQK A;  1SRM A;  2EYY A;  1WHG A;  4NL3 A;  4A4G A;  1YJ9 Q;  4BD3 A;  3G6E A;  2NWM A;  4OB2 B;  4C5I A;  2CZ1 B;  2F2W A;  3A5Z B;  1MV0 B;  1I1J A;  2XMF A;  2P0K A;  5GMK e;  5KCH A;  4JJD A;  5CK9 A;  3LYI A;  3MP8 A;  2A28 A;  3CCE A;  3EG2 A;  1H3Z A;  2DIQ A;  3V7S A;  1I0C A;  1PSF A;  4A4H A;  1CKA A;  2RJD A;  2EQJ A;  1WHM A;  1AWJ A;  2EQU A;  2FRW A;  5ECA A;  3GIB A;  3JCM b;  3R6O A;  1ABO A;  3M0T A;  4BY6 B;  3QXE B;  2C0T A;  1Q7Y U;  2YRV A;  3CCJ T;  2O4X B;  1UDL A;  2KVQ G;  1ZBX A;  2D6F A;  1FMK A;  1WDX A;  1WNL A;  1TXQ A;  3U23 A;  4KUL A;  4KH1 B;  3JCM W;  4EMK B;  4C8Q A;  1C0M A;  1PKS A;  4PFO A;  2ZCF B;  5J26 A;  4OMP A;  3H6Z A;  4GLK A;  2VUB A;  3O8V A;  4CC7 A;  1KIK A;  2X51 A;  3EHR A;  4A63 B;  1JQQ A;  3I56 A;  3ER0 A;  4KGX B;  2DEQ A;  5LL6 S;  1VIE A;  2KY9 A;  3UAT A;  3V8J A;  5M9O A;  4OB0 B;  1VOM A;  4ATO A;  1ZHI A;  2GBQ A;  2MIO A;  1WFW A;  4N4I A;  2VVK A;  5GAN h;  2HZY A;  4LE9 A;  5LJ3 j;  1QP2 A;  2M0O A;  2RMO A;  5FU7 B;  2XHC A;  4FT4 A;  4JJB A;  1BI2 A;  2LRQ A;  3MP1 A;  3KXT A;  2JTF A;  4JRK A;  3X28 B;  3RMQ A;  1W2B A;  2OTJ Q;  3CME A;  3KBG A;  1I4K 1;  4Z88 A;  1M8V A;  1MMN A;  2HD0 A;  4BUG A;  4C8Q D;  2DEU A;  3QWX X;  3X20 B;  3J7A F;  1VQN Q;  2EWN A;  3CCR Q;  4L59 A;  2JVV A;  4ZTJ A;  3OB9 A;  3QDR B;  2WSE E;  2KDS A;  3VUZ A;  5D6Y A;  1AD5 A;  3IQL A;  4E2F B;  4E7L A;  4J9G A;  4M75 G;  1LJO A;  3RKX A;  2RK2 A;  2W10 A;  2K57 A;  4QW2 A;  4XTZ A;  2DXT A;  1Y96 B;  4LUE A;  3BY7 A;  4E7S A;  3P8D A;  2OTJ T;  4C92 E;  3TQ7 P;  2H8H A;  2JT4 A;  4RCB A;  3CMA Q;  2KQW A;  1YBY A;  3OS0 A;  5IXF A;  1UGQ B;  2XK0 A;  2JJ9 A;  2G6F X;  3GF5 A;  3TSZ A;  3CCM T;  1QWE A;  1B7T A;  3VS3 A;  1X75 C;  1OPK A;  2XDB A;  4QKU A;  1K9M R;  3VRY A;  1VQ6 T;  2QA4 Q;  4J9F A;  2A7Y A;  4HT8 A;  2ED0 A;  4M77 G;  3S3O A;  4E47 A;  3V8K A;  2ECZ A;  1VQ8 T;  2XID A;  1WHL A;  4J9B A;  2YUN A;  3NTI A;  3HSB A;  2DIL A;  1YWO A;  5GMK i;  2E6Z A;  1ZUY A;  2RHI A;  5KYX A;  1BBZ A;  3I35 A;  3LX7 A;  4O6J A;  2DBK A;  5LJ3 h;  2JS2 A;  1GRI A;  2RJF A;  3PVQ A;  3CCE Q;  5HKC A;  2JMC A;  3OW2 P;  2COY A;  2CP0 A;  3M59 A;  3CMA T;  4OMF B;  2PU9 B;  4B6M A;  3CCU A;  3DKM A;  1X2Q A;  2HMA A;  3C95 A;  1M1G A;  3WXM B;  1AWW A;  1NPP A;  2JM9 A;  5C0M A;  1RAC B;  5FU6 B;  1YIT T;  4PJO D;  2ENM A;  3RIR A;  2K79 A;  3SHW A;  3JCM Q; 
#chains in the Genus database with same CATH homology
 1OEB A;  1IO6 A;  2D8H A;  5GJV B;  3UA6 A;  2DL4 A;  2GQI A;  2K7A A;  1QLY A;  1ZUK A;  1VA7 A;  2I0N A;  1WI7 A;  2GTO A;  2LJ3 A;  1NG2 A;  2RNA A;  4AFU C;  4R0K A;  2DJQ A;  3ZL7 C;  2FPE A;  2DRK A;  2D0N A;  2YUP A;  4LN2 A;  1TG0 A;  2X3W D;  1G2B A;  1PWT A;  2LNH B;  4JPB W;  3VS1 A;  3A98 A;  2AKL A;  4DEX A;  2LQW A;  4E6R A;  4ESR A;  2D8J A;  1E6H A;  1SHG A;  2CSI A;  1W70 A;  1K0X A;  4IIO A;  1BK2 A;  2PNI A;  1WLP B;  1QKW A;  1YWP A;  2E5K A;  4AFQ C;  2KT8 A;  1N5Z A;  1AZE A;  3EG1 A;  1JEG A;  4RTU A;  4JZ3 A;  4OMO A;  1M30 A;  1XOV A;  1ZSG A;  4GLM A;  2C0I A;  1B3Q A;  3PVL A;  2F2X A;  2O9V A;  3REA B;  2BZY A;  2GGR A;  4RTX A;  2DF6 A;  1T0H A;  2SEM A;  1UHF A;  2RQU A;  4GBQ A;  1E7O A;  4ORZ A;  4F17 A;  2EGC A;  2O2O A;  1H92 A;  2DL3 A;  3VS2 A;  2EKH A;  1S1N A;  1WXT A;  2OAW A;  4CC2 A;  3M0Q A;  2CH4 W;  2LP5 A;  2CUD A;  2RF0 A;  3TSW A;  2L2P A;  2FG0 A;  2YDL A;  3VS7 A;  5I22 A;  2SRC A;  3O5Z A;  2YUQ A;  2LCS A;  2KGT A;  2LJ0 A;  1YN8 A;  1HD3 A;  2FEI A;  2K9G A;  4J9H A;  1KJW A;  2MOX A;  5IHI A;  2O31 A;  2ROL A;  3VRZ A;  2EPD A;  3H41 A;  2M51 A;  4JZ4 A;  1T3S A;  3EGU A;  1U06 A;  3H0I A;  2EVR A;  2JS0 A;  3RBB B;  2KRO A;  3M0P A;  3CQT A;  5IH2 A;  1VYU A;  1J3T A;  4D8K A;  1GCQ A;  1TUC A;  3UF4 A;  1UJ0 A;  2DL8 A;  5L23 A;  1NM7 A;  2EW3 A;  3I9Q A;  2KYM A;  4K11 A;  2EYW A;  2CUB A;  5GJW B;  1PNJ A;  1UHC A;  1ABQ A;  3I5S A;  2L3S A;  1UFF A;  1YCS B;  2DMO A;  1RLQ C;  1GFD A;  2HDA A;  1A0N B;  2FRY A;  2HCK A;  5FW9 A;  2A08 A;  1YP5 A;  3EG0 A;  1QCF A;  4RTV A;  1QKX A;  1WXB A;  5HCK A;  1PKT A;  4ZNX A;  2J06 A;  1ZBJ A;  1UJY A;  1X6G A;  2PZ1 A;  2L3Q A;  4EIK A;  2PTK A;  1X2K A;  3SEM A;  4J9C A;  4HVV A;  1GBR A;  4AFS C;  4OMQ A;  1RLP C;  4J9E A;  1VYT A;  2EGE A;  1KSW A;  1U3O A;  1W1F A;  2J05 A;  1Z9Z A;  1T0J A;  2KRN A;  1X6B A;  2EYZ A;  2LMJ A;  2C0O A;  2CRE A;  2J7I A;  1Y0M A;  1B07 A;  1JXM A;  1Z9Q A;  1GCP A;  3VS4 A;  1RI9 A;  2J6F A;  2JTE A;  2KT1 A;  2JMA A;  4Z8A A;  1AEY A;  1JO8 A;  2DA9 A;  2K3B A;  2W0Z A;  3LH5 A;  2DL5 A;  2AZS A;  5IXB A;  2DBM A;  2FPF A;  1W6X A;  1GL5 A;  1EFN A;  2RQW A;  2O9S A;  1CSK A;  4RTY A;  3VS0 A;  3M0R A;  1BU1 A;  1OOT A;  1ZLM A;  1WX6 A;  4HVU A;  4HVW A;  2DRM A;  1H3H A;  1PRL C;  2OJ2 A;  4AG1 C;  1SRL A;  2M0Y A;  2EQI A;  2VKN A;  3QWY A;  2RN8 A;  1VYV A;  4QT7 A;  4F14 A;  2DX1 A;  4Y92 A;  2A36 A;  2DYB A;  2MCN A;  1ARK A;  2AZV A;  1UE9 A;  3H0F A;  1X43 A;  4J9I A;  1LCK A;  1UGV A;  3REB B;  1G83 A;  2DE0 X;  2AK5 A;  1NLO C;  1AOJ A;  2JW4 A;  1SHF A;  1UG1 A;  1FYN A;  1SRM A;  2EYY A;  2KRS A;  1GFC A;  4Z89 A;  2ROT A;  2A37 A;  4D8D A;  2NWM A;  3EHQ A;  1BB9 A;  4DEY A;  2V1Q A;  4HCK A;  2RQV A;  1Y57 A;  2KXC A;  2F2V A;  1UUE A;  2F2W A;  1PRM C;  1MV0 B;  1I1J A;  1KFZ A;  2XMF A;  1K9A A;  2GNC A;  1K1Z A;  2YUO A;  2CSQ A;  4OMM A;  4IIM A;  4KRT A;  1T3L A;  4JJD A;  1M8M A;  2A28 A;  2RQT A;  3EG2 A;  1WIE A;  1I0C A;  2ED1 A;  2YSQ A;  1CKA A;  5I11 A;  1AWJ A;  2FRW A;  2ABL A;  5ECA A;  2EGA A;  4OML A;  1U5S A;  2KRM A;  1ABO A;  3M0T A;  2KEA A;  1ZX6 A;  3I5R A;  2YT6 A;  2C0T A;  1MUZ A;  1UDL A;  1WYX A;  1FMK A;  1M27 C;  1WDX A;  2KBT A;  3KFV A;  2V1R A;  3U23 A;  2D1X A;  1NEB A;  2HEQ A;  1AWO A;  2JM8 A;  1K4U S;  1PKS A;  4WCI A;  1NEG A;  3VS6 A;  2CDT A;  3JV3 A;  4OMP A;  3PE0 A;  3NGP A;  4LNP A;  4CC7 A;  1SEM A;  1KIK A;  3EHR A;  4A63 B;  1JQQ A;  1QWF A;  3EG3 A;  2AKK A;  5IHN A;  1GBQ A;  3M0U A;  1OPL A;  2QDL A;  2LJ1 A;  1M3B A;  1WXU A;  3UAT A;  3NPF A;  2KNB B;  1NLP C;  3TVT A;  5FWB A;  2GBQ A;  2O88 A;  2MIO A;  1WFW A;  4CC4 B;  2VVK A;  1JXO A;  5FWC A;  4LE9 A;  4LUD A;  2J6O A;  2RQR A;  2OI3 A;  2RMO A;  2ESW A;  1V1C A;  5IHK A;  4JJB A;  4Z88 A;  2CT3 A;  4M4Z A;  3QWX X;  3GBQ A;  2HBW A;  1NYF A;  3FJ5 A;  3NHN A;  1UEC A;  3H0H A;  1ZUU A;  2HSP A;  2BZX A;  1AD5 A;  3IQL A;  4J9G A;  1PHT A;  1K76 A;  1GCQ C;  2W10 A;  4HXJ A;  1HJD A;  2CT4 A;  1M3A A;  4F16 A;  4LUE A;  1OV3 A;  3RNJ A;  2LZ6 B;  4RTZ A;  2H8H A;  2JT4 A;  2X3X D;  4RTW A;  2FO0 A;  5EC7 A;  1I07 A;  2L3P A;  2LQN A;  4OMN A;  3ULR B;  5IXF A;  2JXB A;  4JJC A;  2FPD A;  2G6F X;  3TSZ A;  1QWE A;  4CC3 A;  3VS3 A;  1OPK A;  1MV3 A;  2EBP A;  3VRY A;  2BTT A;  4J9F A;  1E6G A;  2KYB A;  2LX7 A;  2P4R A;  2ED0 A;  2L0A A;  3THK A;  2ECZ A;  2GTJ A;  2B86 A;  1WA7 A;  4X1V A;  2IIM A;  1H8K A;  4RTT A;  4J9B A;  2YUN A;  2DIL A;  2KXD A;  2CH4 A;  1YWO A;  4J9D A;  3R6N A;  3UA7 A;  1M3C A;  1ZUY A;  1BBZ A;  3I35 A;  2EYX A;  3C0C A;  2DBK A;  2JS2 A;  1GRI A;  3PVQ A;  2DVJ A;  2JMC A;  1SSH A;  4AFZ C;  2DM1 A;  1NYG A;  1YNZ A;  3VS5 A;  1AZG B;  1AVZ C;  1X2Q A;  2DLP A;  2KE9 A;  1X69 A;  2K2M A;  2K6D A;  2RPN A;  2VWF A;  2J6K A;  1UTI A;  1K0S A;  3M0S A;  1AWW A;  2DNU A;  4FSS A;  1RUW A;  1TUD A;  2JM9 A;  2BZ8 A;  1X27 A;  2NUZ A;  2DL7 A;  4RUG A;  2ENM A;  1JU5 C;  4AG2 C;  1HSQ A;  2K79 A;  1CKB A;  1AWX A;  3NMZ C;  3SHW A;  2KR3 A;  1SPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...