1GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
molecule keywords GRB2
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gbqA00
1XOVA 1YN8A 3EG2A 1GFCA 1M3CA 1W70A 1A0NB 2KT8A 2IIMA 1ABQA 2H8HA 3O5ZA 4A63B 1RLPC 2EYWA 1ZX6A 1VA7A 2LP5A 3SHWA 1I0CA 2J05A 3IQLA 1GCQC 1T3LA 3VS2A 2J6FA 3KFVA 1OEBA 2DL5A 2X3WD 2JMCA 1K9AA 1JXOA 2FO0A 3THKA 1QCFA 4J9BA 1K1ZA 2F2WA 1UHCA 1W1FA 1OPKA 2ECZA 2DL4A 1ZBJA 4CC4B 4CC7A 2DRMA 1MUZA 2QDLA 1B3QA 1WLPB 1JU5C 2LCSA 2C0OA 2GQIA 2A08A 2FRWA 2LJ1A 2DBKA 5EC7A 3H0IA 4F16A 4WCIA 4Y92A 3SEMA 2DJQA 2A28A 2PNIA 3EG3A 1H8KA 2DF6A 2D8HA 3VS4A 1NYFA 2KNBB 1UG1A 1AWXA 4Z88A 5IXFA 2W0ZA 1T0HA 2XMFA 3NGPA 1NM7A 2DMOA 3QWXX 2HBWA 2KROA 3RBBB 4QT7A 3REAB 4LE9A 4R0KA 1IO6A 2D0NA 1CKAA 4HVWA 2KR3A 1NLPC 2JS2A 4RTXA 1SHFA 1OV3A 3JV3A 1K76A 1QWEA 4JZ4A 2F2XA 3UA6A 2RQTA 1YWPA 2EGEA 1FYNA 2F2VA 5GJVB 3VS6A 1UFFA 2VVKA 1T0JA 3M0RA 3RNJA 2EVRA 2J6OA 3VS1A 2BZ8A 2O9SA 2JTEA 2G6FX 2RF0A 4JJBA 1B07A 3CQTA 2FG0A 2ED0A 2D8JA 3ZL7C 2PTKA 4OMMA 2V1RA 2BZXA 1WIEA 1J3TA 5ECAA 4IIOA 3TSZA 1I07A 2B86A 1AD5A 4OMNA 2J06A 1NEBA 2A36A 4JJCA 3PVQA 3M0PA 1GL5A 1WA7A 2EGCA 2RQWA 2PZ1A 1JO8A 1QWFA 1Y0MA 2YUQA 4KRTA 1PWTA 4JZ3A 1AWWA 2O31A 1GFDA 4LN2A 2RQVA 1UTIA 4J9GA 2DM1A 3EHRA 2K3BA 2FEIA 1K4US 1GRIA 1SHGA 2CUBA 2DL3A 3REBB 1U3OA 1SRMA 1VYVA 1ZLMA 1BU1A 4AFUC 5I22A 1RI9A 3I35A 3I9QA 2M51A 3I5RA 2LMJA 1NLOC 1SPKA 1NEGA 2DE0X 3EGUA 1AWOA 1KFZA 2AZSA 2JM8A 4HVUA 2CUDA 1S1NA 2ROTA 3NHNA 2NUZA 2KBTA 2C0TA 1QLYA 2O88A 2HDAA 4CC3A 1FMKA 1WXUA 2LNHB 2AKKA 2SEMA 3EHQA 1GBRA 1X69A 4DEXA 3VS7A 1CKBA 1GBQA 2L3QA 2JMAA 2EBPA 5IHIA 1PKTA 4M4ZA 2K9GA 1QKXA 1ZUKA 2GBQA 4LUEA 2BZYA 1X6BA 3FJ5A 4ZNXA 1TUDA 4J9HA 2LQNA 2A37A 2CSIA 3UATA 2NWMA 2GNCA 1E6GA 3PE0A 2X3XD 2ESWA 5IXBA 4AG1C 2GTOA 4EIKA 2YUNA 2JXBA 2D1XA 2DL7A 1BK2A 2JT4A 2DNUA 1YNZA 1M3BA 1ZSGA 3TSWA 2CT4A 1UGVA 2DILA 2SRCA 1YCSB 2KT1A 1G83A 2O9VA 3NMZC 3R6NA 1X43A 1HJDA 2AZVA 5FWCA 3U23A 4RTZA 1ZUYA 2LX7A 2I0NA 3VS5A 3NPFA 2CDTA 1SRLA 1HSQA 2GGRA 1UJYA 1QKWA 1AEYA 4LUDA 1WDXA 1ZUUA 1Z9ZA 4D8DA 2EYXA 1Z9QA 1HD3A 2EGAA 2RNAA 2L3SA 4OMQA 2FPFA 2J7IA 1YWOA 2DA9A 1E6HA 2ED1A 2BTTA 4D8KA 3I5SA 4GBQA 1UHFA 4OMLA 1PRMC 4LNPA 2RQRA 2JS0A 4Z8AA 2M0YA 2KYMA 2RN8A 4AFQC 2E5KA 3EG0A 2K6DA 1M8MA 2CH4W 2OI3A 2KE9A 1UUEA 3H0FA 1K0SA 4F17A 1WXBA 4CC2A 5IHKA 1NYGA 1GCPA 1K0XA 2YUPA 3VS0A 1RUWA 2KXCA 1PHTA 2P4RA 4JJDA 2HSPA 2CREA 1CSKA 1TG0A 4J9CA 4J9FA 4ORZA 3LH5A 2EYZA 3UA7A 2DX1A 4FSSA 3H41A 4OMOA 1WXTA 4K11A 2CT3A 1X2KA 5IH2A 1MV3A 2DBMA 1JQQA 2VWFA 1JXMA 2FPEA 2RQUA 1YP5A 2RMOA 1U5SA 2HEQA 4RTUA 2KRMA 2YT6A 1EFNA 1KSWA 4Z89A 5GJWB 1X6GA 4AG2C 5FWBA 1GCQA 2KRSA 2KXDA 1UECA 2L3PA 4J9EA 1M30A 2KGTA 2LJ0A 5IHNA 1Y57A 3H0HA 1W6XA 1E7OA 2V1QA 2YUOA 1LCKA 3QWYA 2LQWA 2K7AA 3VS3A 5L23A 4RTVA 1VYUA 1WFWA 4F14A 2K2MA 1M3AA 3VRZA 2CH4A 2VKNA 2KYBA 2EPDA 2OAWA 3EG1A 3M0TA 4X1VA 1N5ZA 1PKSA 2FRYA 1G2BA 2DLPA 3ULRB 2C0IA 5HCKA 2DRKA 1SEMA 2YSQA 1MV0B 2ENMA 1X27A 4HCKA 4GLMA 2EQIA 2HCKA 2KRNA 1TUCA 2YDLA 5I11A 1M27C 4E6RA 4DEYA 2MIOA 3VRYA 1UE9A 4RTWA 1I1JA 4J9IA 4AFZC 2DL8A 1AWJA 2LJ3A 1AOJA 2W10A 2O2OA 1ABOA 4IIMA 1H3HA 2DVJA 4OMPA 2AK5A 1KIKA 2ROLA 1AZEA 1UDLA 1WYXA 2FPDA 2DYBA 3PVLA 3C0CA 3TVTA 2LZ6B 1VYTA 1BBZA 2EYYA 1OOTA 2JW4A 2RPNA 3M0QA 2EKHA 3M0UA 4AFSC 2AKLA 2EW3A 4J9DA 1T3SA 2MOXA 2KEAA 4JPBW 4ESRA 1SSHA 1X2QA 1UJ0A 2L0AA 1RLQC 5FW9A 2MCNA 2OJ2A 4RTYA 1PNJA 1KJWA 2JM9A 1PRLC 1H92A 2L2PA 3A98A 4HVVA 4RTTA 4RUGA 1V1CA 1AZGB 1U06A 2ABLA 2K79A 1ARKA 1JEGA 1BB9A 2GTJA 1AVZC 4HXJA 2CSQA 3M0SA 3GBQA 1OPLA 1WI7A 1NG2A 1WX6A 3UF4A 2J6KA
chains in the Genus database with same CATH superfamily
1XOVA 2MMPA 1GFCA 4ZGJB 1FXXA 4J83A 1A0NB 2KT8A 4JRKA 1KQ1A 2VXFA 1ZX6A 3OMGA 4KBMB 1K9MU 1QVFP 3VS2A 3DB3A 3KFVA 1OEBA 4M77E 2C06A 1EZZB 3THKA 3OSSC 1QCNA 4M77D 2QK0A 2E12A 2ECZA 1ACMB 3OBWA 1ZBJA 4CC4B 2A0FB 3CCLT 4HCCA 2DRMA 3C94A 1MUZA 3QUIA 4M7DC 3MKDA 3EGDA 1VQKT 4PJMA 4XK8E 1UB4A 3MP8A 3OQ5A 3CMAA 2VASA 2FRWA 2QEXQ 1M90U 4WCIA 2ZPBB 3V8LA 4BB7A 5AT1B 1MNDA 3CCMQ 2PNIA 2X51A 2ZZDA 3PT9A 4QQDA 4EMKA 3CC2T 4M7AG 2GQVA 3LW5E 5GMKh 1VQ4A 1JJ2A 2YHTA 3UT1A 1VQMQ 3RMQA 4GY5A 4QT7A 4R0KA 3G6ET 2KR3A 4R55A 5A2QE 2EJFA 4PJNA 3PIPA 4OGEA 1KD1U 3OYBA 5CVIA 4ATOA 3INZA 4NOYA 2EGEA 3JCMV 5GJVB 3A5ZB 1I5LA 3M0RA 3CCUA 1B34B 2EVRA 3DLMA 4PJOE 2F1LA 2BIVA 4C92A 2H3EB 2O9SA 2G6FX 4DOVA 3CCVA 1NZ9A 4A54A 3O8VA 2PTKA 4E7SA 1VQNQ 1B7TA 1WIEA 4PJLA 2B86A 1JJ2S 3X25B 1NEBA 1Q82U 3PVQA 4JS4A 4M78D 2K2VA 2JUFA 3HRSA 1WA7A 1H3ZA 5HK0A 1QWFA 1Y0MA 2M0OA 2NUTA 1IXDA 1VQOA 1GFDA 5D6XA 1K4US 5GAOl 4JJNK 2KQWA 2QA4Q 1SRMA 6AT1B 3SFMA 4C92G 4C5HA 3G4SA 3G4SQ 3BDLA 4OMFB 4JRQA 5FU7C 1TTHB 2DXCA 3NHNA 4E2FB 5KE3A 2FYKA 1QLYA 1FMKA 2AKKA 2SEMA 1ZQ1A 4M7DD 1Q82C 1CKBA 2V8KA 3CCVQ 2JMAA 4M75A 4M7AC 5GAOr 1UEBA 3URGA 2GBQA 3JB9G 1TUDA 4QW2A 2JZ2A 2X9HA 3OYYA 2A37A 2JTFA 4L59A 1WHHA 1TH7A 2O4XB 2X3XD 3NTKA 5IXBA 4EIKA 1D1BA 1XQHA 3QYHB 2CZ7B 1K8AR 1YNZA 4FYYB 1BKBA 3PMIA 1UGVA 2SRCA 1BI0A 3J80E 2O9VA 3NMZC 4DQ2A 4PJOG 4EMKC 5LJ3g 4ZTJA 2NUPA 2LCCA 3U23A 1YJWA 4RTZA 1ZUYA 1VQLT 2MI6A 3AT1B 3RKWA 1D3BA 2KMTA 8AT1B 1TU0B 4A4EA 2NLUA 2VXEA 1N9SA 4M78E 5KYWA 3WXMB 1Z9QA 3M53A 1HD3A 2EGAA 2RNAA 1FX7A 1RAEB 5GAN4 1YI2A 4OMQA 2J7IA 1YJNQ 4IUVA 4XU2A 3SWNB 2ED1A 3JCMW 1D1CA 1SF9A 3JB9F 4LNPA 2K5FA 5D6YA 3CCJT 2RA2A 1VQOQ 5GANj 2K6DA 2CH4W 2RJDA 3JCMf 4F7UB 4M78C 1UUEA 3H0FA 3G71T 3TU4K 2CP2A 1WXBA 3LGLA 2HQEA 3M56A 3I56Q 2P4RA 4C8QB 2R58A 4OB0B 1TG0A 3LGFA 3HHTB 4ORZA 2EJGA 3LH5A 2EYZA 4A4GA 3BE3A 1KC8C 2KSSA 4OB2B 3MJXA 3RESA 3CC4T 1QW1A 3H6ZA 3JCMg 3JCMe 1LOJA 2DBMA 1JQQA 2VWFA 2FPEA 4C5IA 2RQUA 5GAMg 2PVGB 3GIBA 1YP5A 2HD0A 1U5SA 4PNOA 4QVCA 1HYOA 3JCMX 2QA4A 2KRMA 4ELZC 4BI3A 4Z89A 1M1KC 4J7FA 4AG2C 3EFRA 5FWBA 4LDUA 4KUDK 1C0MA 2E6ZA 2LDMA 1M5Q1 1UECA 1UGPB 1MMDA 3A8HB 2GFAA 2P0KA 4F7UF 4JRPA 2BKDN 2LTOA 3PFSA 2RHUA 3I55A 1KD1R 2V1QA 2PVOB 1LCKA 2YUOA 3CPWA 5L23A 3CCRA 3EGDB 3SWNC 5HKCA 3M55A 2JNGA 2DERA 4NS5A 3WVEB 2EFIA 3S3OA 2OAWA 1VQKA 3G7ZA 1D0XA 2PVDB 2RI5A 3PNWC 1OU9A 3ASKA 1G2BA 4J6XA 4OB1B 4C5EA 1VQ9A 2YSQA 4CRIA 3CCST 3EGXB 3E9GA 5GAN2 2HCKA 2D9TA 2KDSA 2DTHA 1LPLA 3BY7A 2MIOA 3VRYA 2RHYA 1VQ7T 1YI2T 4ZN1A 3CBOA 2E41A 1MHNA 3QG1A 4C92D 3LLRA 3FC3A 3RIRA 3VJPA 5GAMh 3OYNA 1M2VA 2QQRA 5FU7B 2ROLA 2RI2A 1AZEA 2COYA 4LDVA 1MNEA 4MDWA 1N8RU 2RPNA 2P4TA 4C8QF 2AKLA 1GXIE 2QGFB 3A1PA 3P8BB 1T3SA 2MOXA 2KEAA 1UJ0A 1Q86C 1VQNA 4KH1B 1N27A 2NYSA 1PNJA 4XTZA 4DBHA 4ME7A 1PRLC 3QDRB 2L2PA 2MK5A 3SDZA 4RTTA 4RUGA 3CC7T 2FZGB 4HA8A 4MMLA 3HTRA 3MCAB 3OS0A 1BB9A 3CXCS 2GFUA 4HXJA 3M0SA 1WI7A 1TWBA 2L89A 1WX6A 1Q86R 4OVAA 1YN8A 3OYKA 1W4SA 3JCMJ 4BUGA 2RH2A 1YIJT 1W70A 4MDXA 1TS9A 1S72A 3O5ZA 1RLPC 2YRCA 5GMKi 2LP5A 3SHWA 3J81E 2CGHA 1I0CA 2J05A 1T3LA 5GMKe 2J6FA 1JXOA 5D7UA 4QVZA 1QCFA 4J9BA 3X20B 1KQSA 1W1FA 2XK0A 1YBYA 2DTOA 2KY9A 5KYYA 2DXTA 1BI3A 4PJOB 2QDLA 2OX7A 1B3QA 2ATCB 2C0OA 1SG5A 2GQIA 1K73C 3JB9D 3VYGA 1PM3A 1VQ9Q 3J7AF 2DBKA 2MYSA 2VB6A 1M2VB 4M75D 3RERA 2I2LA 5M9OA 1KC8U 4Y92A 2EAYA 1TUGB 2HNIA 4EDUA 2XU8A 3MEWA 3EG3A 2D8HA 3EG9A 2DPPB 1NYFA 2ZAEA 1RACB 4C8QA 3CC7Q 2P0QA 2WSFE 3FB9A 4Z88A 5IXFA 3VYHB 3DB4A 2P0PA 3TQ7P 1RL2A 4FW2A 2R5MA 4PLIA 2GCXA 3CCQA 1Y7XA 2DAQA 3QWXX 3RBBB 1VQPQ 2IG0A 3REAB 2CP0A 2YRDA 5J26A 5GAOp 2D0NA 3CCUT 1WJQA 1ZA2B 4KH0B 2X4YA 4F7UG 2L5QA 2JOYA 4L6V5 1JRIA 4IURA 1QWEA 3CCQT 1YWPA 1WQ7A 2V8IA 1FYNA 4ZTFA 3VS6A 1KHCA 2DXUA 1T0JA 3RNJA 3FJPA 1EX4A 1FWZA 2DEQA 1QVGS 2RHIA 3CCRQ 2OTLQ 2JTEA 2RF0A 3FEOA 2EQUA 1B07A 2AIRB 3CQTA 2RK1A 2FG0A 2ED0A 3ZL7C 2QQBA 3BW1A 4O6JA 4DOWA 4L5GA 2V1RA 4AMCA 2DZ9A 5ECAA 9ATCB 1OZ3A 3TSZA 1V29B 2M9UA 2A36A 4BDZA 4LXCA 4IUUA 2E64A 3CCSQ 1Y07A 3I55Q 2PZ1A 1JO8A 2QG9B 1WGSA 1AWWA 4JZ3A 8ATCB 1QQJA 1K9MR 2RHXA 4M7DE 2E65A 4V2SA 3JB9I 2CP3A 1NJIR 2RD1A 3QKJA 1SSFA 4F7UA 4PJJA 5KE2A 2DFUA 1U3OA 4M78G 1VYVA 5I22A 1YJ9Q 3I9QA 3OYCA 2LMJA 2E3HA 4B9WA 2RM4A 1NEGA 3GP8A 1VQ4T 2AZSA 2JM8A 4TVRA 4JUVA 4FYWB 2C0TA 4XU0A 1NE8A 4C0DB 2YLCA 2LNHB 5GAN5 3V7CA 3E1SA 3EHQA 2OTLA 3RUXA 3L2VA 4GLKA 4XTXA 4Y91A 4ZGEB 1PKTA 5CR2A 4M4ZA 1ZUKA 2RHZA 1N8RC 4J9HA 1PCXA 3UATA 3P8HA 2GNCA 4C8QD 2PUKB 2ESWA 3T9NA 1YHQA 2GTOA 4M75G 3OYLA 2JXBA 2D1XA 1ZBXA 3HP9A 2Y4XA 3CC2A 1ZSGA 3NTHA 1JBMA 3TSWA 2CT4A 3TREA 1VQ4Q 2DILA 3JB9H 3CBMA 2AZVA 1VQOT 2FHDA 2K4YA 1XTDA 1IGQA 3E2UA 1AEYA 5GAN7 1I81A 1WDXA 1Z9ZA 3L2RA 2RJFA 3LH0A 2DD4A 1G3WA 3MO8A 3PGGA 3RKYA 4C0ZA 3ME9A 2FPFA 3QZ5B 2RJCA 5CKDA 4J7IA 3PIOA 2BTTA 3ZEHA 3I5SA 4D8KA 4GBQA 1PRMC 3C95A 3SWNA 1U1SA 3GNFB 2JS0A 4Z8AA 2EQKA 3L2ZA 5KYXA 2E5KA 5EG2A 4NL2A 2QYZA 3V8JA 1VQMA 4R56A 5DM7R 3CCRT 4F17A 4CC2A 1MGQA 5IHKA 2MWPA 2YUPA 1VQ7Q 3JSCA 3WVDB 5CAIA 1R77A 1D3BB 1CSKA 3OW2P 1PSEA 4J9CA 4J9FA 2FL7A 5LJ5h 2DX1A 4M7AB 1AHJB 3H41A 2XD0A 4HCBA 5GAN8 5D6WA 4A4HA 2M16A 3CCUQ 5IH2A 1VQ6A 1VQPT 2E1HA 2CZ1B 1IHVA 2HKNA 2ZGWA 3ER0A 2PUOB 2WSEE 1EFNA 1KSWA 1NPPA 1X6GA 5HK3A 4KT0E 1M1KR 1B34A 1U1TA 4FCYA 4DBRA 2KXDA 3LWIA 1W2BP 2L3PA 5GANd 2LJ0A 1PD1A 3UDCA 1D1AA 2QASA 2HBPA 1OZ2A 1VQ9T 4F14A 2QGGA 2HQXA 4OB3B 3ZBDA 1G5VA 1KHIA 4PJOD 2M02A 2K2MA 1IGUA 2KYBA 3HRTA 3QJ6A 2R57A 3OBYA 3CCJA 4FM4B 4FU6A 1N5ZA 4X1VA 5I21A 5CKHA 3FLGA 2MWOA 2AT1B 1I4K1 5GANe 2DRKA 4WF2A 4HCZA 1VQ7A 2XDPA 3OMCA 1MV0B 2ENMA 1X27A 2R5AA 5KCHA 2E5QA 4C92F 2E10A 4GLMA 2EQIA 1YJ9A 2KRNA 2OTJA 4Y28E 2YDLA 3KUFA 4E6RA 1WJSA 4BD3A 4DEYA 3FDRA 1VQNT 1WQWA 4RTWA 4C0GA 5LL6S 3VUBA 1QMCA 1XNIA 2YXYA 3CPWS 2O2OA 4IIMA 1H3HA 4FIBA 2LVMA 3OW2A 2YLBA 4MZTA 5FU6B 3GLXA 1YJ9T 2QTXA 3PVLA 1V76A 3TVTA 2LCLA 1RAAB 1VYTA 1BBZA 2KK4A 2X4WA 3DKMA 2JW4A 1PSFA 2A3LA 2L0AA 4E7JA 1C1AA 1RLQC 2MPXC 5FW9A 1MMNA 4OF1A 5HY6A 2BE7D 1X75C 1M2OA 3G1JA 2G3RA 3G6EA 1YITA 3I55T 4Q5WA 2JM9A 3A98A 3FIFA 1V1CA 3CC2Q 3I56A 1AZGB 2A7YA 1ARKA 3CCMT 1QVFA 1Q7YC 3LWHA 1AVZC 1RAFB 2CSQA 3OW2S 2CZ6B 1RI0A 1WHMA 2OTLT 2J6KA 3ULRB 4N4IA 3EG2A 1M3CA 1H641 3E19A 1ABQA 2HAXA 1VA7A 3VUZA 3CCQQ 3CMEA 3IQLA 1M90C 1GCQC 2DZCA 3MP1A 3E9FA 2YWWA 4M77B 2X3WD 2JMCA 1K9AA 3EFOB 1XJWB 2FO0A 5CKBA 1M8VA 1K1ZA 1VOMA 3G71A 1UHCA 3OYDA 4PFPA 1TXQA 5LJ5d 2ZPIB 2EKOA 1BI1A 4FW1A 1I5OB 2XDDA 1FMVA 1JU5C 1WLPB 3SD4A 2LCSA 1D09B 1Q81C 3OSVA 1UGRB 2A08A 1NBEB 4C92C 4M75E 3MPUB 2LJ1A 2EYQA 1VIEA 5EC7A 5GANf 3L2WA 5FU6C 1Q7YR 2A28A 1H8KA 1Q81R 2DF6A 3VS4A 1QP3A 1WHLA 2F5KA 5LJ3j 3EGXA 3M57A 2W0ZA 1T0HA 3NGPA 1NM7A 2CP6A 3MEUA 3A8GB 5GAN3 3S3NA 2KROA 3HRUA 4LE9A 4M7AF 1M4ZA 1IO6A 5J3BA 1CKAA 5KH6A 4J6WA 4PL6A 3CC4Q 4RTXA 1SHFA 5FRNA 3JV3A 1K76A 4JZ4A 2F2XA 3GF5A 2RQTA 3EAEA 2HQHA 4BI8B 2F2VA 2Y90A 2OAUA 1YIJQ 4LDYA 4MZMA 1N6AA 2J6OA 2QQSA 3CXCP 5GMKj 2NUTB 4JJBA 3V7SA 3S6WA 1Y96A 2D8JA 4OMMA 3FRNA 4BE1A 2CZ0B 4LD6A 5DY9A 2EIFA 5GAOq 2XKOC 3CCJQ 1AD5A 3CPWP 4OMNA 4JJCA 1K73U 2DIQA 1G3SA 1VQ8T 3CEYA 2EGCA 1YJNT 2YUQA 1IREB 1M9SA 2HSEB 1PWTA 3G6EQ 2O31A 4LN2A 2FZCB 2RQVA 4JLIA 1UTIA 4J9GA 2DM1A 1BI2A 4X9DA 1VQMT 3PTAA 2K3BA 2FEIA 1GRIA 1SHGA 2B8AA 3REBB 2WACA 3I35A 1VQLQ 2M51A 2CS7A 4DBFA 1NLOC 3JCMP 5GAMf 5LJ3d 4XU1A 5AYFA 3EGUA 5KYUB 1AWOA 1KFZA 2CUDA 1YI2Q 4IUQA 2NUZA 4J6YA 3HKSA 2DXBA 3QBYA 2EQMA 4CC3A 4A53A 3QZ9B 4FYXB 4E7IA 1X69A 2F5TX 1GBQA 1TOVA 5IHIA 4QKUA 4ZNXA 2ZPHB 4LUEA 2BZYA 3FJ5A 4PLLA 5IAYA 3CCVT 1P92A 2LQNA 5DLQE 3A8MB 5CKEA 2VYTA 3KBGA 2IVWA 1W2BS 2CSIA 1MMAA 2NWMA 1UGQB 4ZGDB 2VC8A 4AG1C 4BY6B 2XI9A 2YUNA 1KK7A 5LJ5e 2DL7A 2E6NA 5KYUA 1BK2A 2DNUA 4UC4A 1M3BA 4IUPA 1YCSB 1WHGA 3CCLA 1G83A 2V26A 4QVDA 3OYEA 1HJDA 5FWCA 2HL5C 1Q82R 2GF7A 4X9CA 3P8DA 2LX7A 3RDVA 2I0NA 4RMOA 3VS5A 3RKXA 2CDTA 2QA4T 1SRLA 2X35A 1QKWA 4LUDA 1ZUUA 1NPRA 3AHUA 2P84A 4N4GA 2EYXA 2ZPEB 3QHSA 1Q81U 1K8AU 3CMAT 2HL3A 2O01E 2L8DA 3MP6A 3ZFJA 1E6HA 4OMLA 4E7ZA 2RQRA 5KYXB 3UPUA 2KYMA 3I56T 2RN8A 1LJOA 2OI3A 2DTIA 1WHJA 3G71Q 2DKGA 1RAGB 4C8QE 2JTMA 5IN1A 2BE9B 1NYGA 1GCPA 1K0XA 3VS0A 2RI3A 1RUWA 1Q95G 2KXCA 4JJDA 2HSPA 1Q86U 3CPFA 4J8OA 1ZA1B 2X4JA 3UA7A 2LT4A 4FSSA 1X6OA 3GOXA 4OMOA 1WXTA 4K11A 3X28B 1N8RR 3M9QA 1OULA 2QTVA 5GANh 2ZCFB 1G8XA 4N4HA 1QP2A 3UWNA 3JAME 4C8QC 2DIGA 4XTUA 3MHXA 4RKUE 3OYGA 2CKKA 1VQLA 1Q7YU 1GCQA 5CKFA 2KVQG 1AT1B 1S72Q 2Z0WA 1M30A 2KGTA 3H9NA 2RO0A 5IHNA 1Y57A 2VGNA 3L1AA 4J5YA 3H0HA 1E7OA 1R8OB 2ZPGB 4OP0A 2FVUA 3QWYA 2QI2A 1G3YA 2LQWA 1Y71A 4PKCC 3VS3A 1VYUA 4BI4A 4HT9A 3PMTA 4XTWA 5A0GA 3VRZA 1SKUB 1VQKQ 2VKNA 4KGXB 4C0FA 4M7DB 2EPDA 4FL6A 3HPWA 3EG1A 4WTOB 1RAIB 3M0TA 3CCLQ 4ELYC 1PKSA 1NJIC 3LX7A 2C0IA 5HCKA 3X24B 2D6FA 5IT9E 4M77C 1BIBA 1TUCA 1UGSB 5LJ5g 4RG2A 2HZYA 1OU8A 3OS5A 1UE9A 4J9IA 4AFZC 1OX9A 1QVGP 4M75F 1X01A 1AWJA 3CC4A 1AOJA 2DYIA 3G4ST 1ABOA 4BY6C 1HK9A 1W2BA 2DVJA 2PQWA 4PFZA 1BCOA 4FT2A 3OYHA 1QVGA 7AT1B 1UDLA 2EWNA 1WYXA 5KYWB 3C0CA 3OYIA 4N0AA 2LZ6B 4F04B 3OYFA 1EIFA 2QXFA 1I8FA 2BUDA 2EYYA 1WNLA 2V8JA 1LVKA 3M0QA 2EKHA 1QCOA 2LRQA 4AFSC 3QPHA 1VUBA 1RABB 4JPBW 1JB0E 4PJOF 1VQ5T 3CCET 1D0YA 2OJ2A 4P5NA 3H8ZA 3NFCA 4RTYA 4JLGA 1DJ7B 1K8AC 2Y4YA 3C12A 1H92A 4N0AC 5GAMj 2K3YA 4XU3A 2ABLA 3JB9J 2K79A 3RMSA 4EMHA 1FMWA 1JEGA 4M75B 4KGVB 2GTJA 4M78F 4A4KA 1OPLA 1NG2A 3OS2A 2JN0A 3HFNA 2JVVA 4NL3A 3OYAA 4PJOC 3CCEA 1VQ5A 3VU3C 2IIMA 4FSXA 1IZ6A 2H8HA 4A63B 4E47A 4BDYA 2EYWA 4M77G 2IPOB 1LNXA 2LT1A 2DL5A 1U8RA 2E70A 1PG5B 2MAMA 4LD9K 2F2WA 1OPKA 5J39A 2DL4A 5CQXA 4M78A 4CC7A 4C0DC 2K3XA 3QO3A 1ZSZB 4EPCA 2DETA 3QDFA 2PU9B 5A0DA 3H0IA 3L2QA 4FT4A 4F16A 3CD6T 2QEXT 3SEMA 2DJQA 2ZPFB 3D7SB 1VQ6Q 1K73R 2CP5A 2RJEA 2QQAA 4PJOA 5FRMA 5CIUA 2KAFA 3GNGA 4EMGA 2XHCA 5C0MA 3JCMQ 1D0ZA 2KNBB 1UG1A 1AWXA 4B9XA 2XMFA 3CC7A 2OTJQ 2XG8D 2DMOA 4MZPA 2XICA 3KXTA 4O5VA 1QVPA 4RCCA 1NJIU 2LX9A 5KYYB 2HBWA 2MF2A 1VQ5Q 3CCEQ 4HVWA 1NLPC 3CMET 2JS2A 2H3JA 3Q1JA 4MMKA 1M90R 3V8KA 1OV3A 2DK3A 3UA6A 4XQ3A 1UFFA 2VVKA 4QQGA 1RADB 4C92B 1R0BG 2KI7A 3QSUA 3OYJA 3VS1A 2BZ8A 1YJNA 1WPYA 3EH1A 4HT8A 2YRVA 3QYGB 1M1FA 4YTLA 4RCBA 4LDXA 4C8QG 2BZXA 1J3TA 4IIOA 2K57A 1I07A 4HKEA 2J06A 2EJ9A 1ZHIA 4VUBA 2COZA 3M0PA 4JDSA 2WSCE 5LJ3f 1GL5A 2RQWA 4B6MA 2XDBA 4DBQA 5I2MA 3LYIA 4M77F 4KRTA 2VGMA 3OS1A 1N9RA 2VUBA 3EHRA 1YFNA 5LJ3h 3M54A 2RK2A 1WJRA 3HFOA 4FYVB 2HKQB 2XIDA 4E7HA 2CUBA 2DL3A 4C92E 5I2SA 1ZLMA 1BU1A 4AFUC 1OI1A 1RI9A 1PD0A 4M7AE 2DJZA 3I5RA 4QQ6A 5LJ3e 1IHWA 3M5AA 3M59A 1SPKA 3EG9B 4C5GA 2FZKB 2VV5A 2DE0X 1YJWQ 1KD1C 1HXDA 1KQSP 5GAMd 1BIAA 4HVUA 1S1NA 2ROTA 3L2UA 2KBTA 2O88A 4X34A 1IRXA 2HDAA 3CXCA 1WXUA 1KQSS 5CO7A 1YHQT 1VIFA 1GBRA 2D0QB 3VS7A 4DEXA 4A4FA 1KQ2A 2L3QA 2EBPA 4II1A 2K9GA 1QKXA 1X6BA 5CQYA 2QEXA 1OQKA 3M58A 3MEVA 4ZN3A 1E6GA 1C6VX 1YITQ 3PE0A 5GMKm 4XTYA 2COWA 4KUIA 4M78B 5CK9A 2JT4A 2LQ8A 4JS5A 4M7AD 5KCOA 3M4GA 3EFOA 5GMKl 2KT1A 3R6NA 3JCMh 1X43A 5C6SA 3OA6A 4RG8A 5CCAA 3V7RA 2K5LA 3NPFA 1HSQA 2GGRA 2FB7A 1UJYA 4Z02A 1O9SA 1VQ8A 3R6OA 2LNVA 5LJ5f 4IUTA 2CP7A 1VQPA 3HL8A 4D8DA 3CMAQ 1JJ2P 3X26B 4E7KA 4KULA 2L3SA 2K5IA 4XAXB 1YWOA 5LJ5j 2DA9A 1KC8R 4E7LA 1UHFA 1KG1A 4EMKB 3QIIA 5KYNA 2M0YA 2DD5A 4AFQC 1OX8A 5FLXE 4BE0A 3EG0A 2O4XA 1M8MA 2KE9A 5GAN6 1K0SA 2F69A 3N5BB 4M7DA 4PFOA 1PHTA 1QVFS 2CREA 4KGZB 4D6WA 4F7UE 2DVEA 3JRZA 3CCSA 4M7DF 3OYMA 2X4XA 3CMEQ 1YCYA 2CT3A 1YIJA 1X2KA 3L42A 2HMAA 1MV3A 5DLOA 1JXMA 3EH2A 3TEEA 3VV0A 3JCMd 1WHKA 2RMOA 4ANJA 2HEQA 4RTUA 1O75A 3OY9A 2OTJT 2YT6A 1BYMA 5GJWB 2KRSA 3QXEB 5FROA 2E4HA 4J9EA 3MEAA 1VQ6T 4JRIA 4CI0C 1W6XA 4AT1B 3CD6Q 3SB2A 1Y96B 2E3IA 3C4SA 4LDWA 2K7AA 5GAMe 3CD6A 1F1BB 4RTVA 1WFWA 1ZSZC 1S72T 4M7DG 4BE2A 1M3AA 2L3RA 1RAHB 1TSFA 2CH4A 4DA4A 2AHJB 3JCMc 1YITT 4BACA 2DEUA 2FRYA 3JCMb 2DLPA 1K9MC 1SEMA 4PK4A 1MMGA 4HCKA 1YHQQ 1VQ8Q 1M1GA 3GPLA 2JJ9A 3TCJA 3CCMA 5I11A 1M27C 2NUPB 2CYZB 1G3TA 5GAOm 3RR6A 1I1JA 1WZOA 1PC0A 2DL8A 3DLLA 5GANg 2LJ3A 1YJWT 1BCMA 2W10A 2M1HA 4M75C 4M7AA 2EQJA 2RB6A 3BFMA 4OMPA 2DO3A 2AK5A 1KIKA 2FPDA 2DYBA 3M4YA 3S3MA 1OOTA 3M0UA 3CBPA 2EW3A 3A8LB 4J9DA 5A0LA 3EFSA 3VKIA 5GAOn 4ESRA 1SSHA 1X2QA 1IB8A 2QQ9A 2MCNA 3HSBA 1ZSZA 3BDUA 5L8RE 1KJWA 3NTIA 1M1KU 2LQKA 1OYXA 1R0CB 4HVVA 4OGCA 2QAZA 2QDYB 3META 4XTVA 3F70A 3A8OB 1U06A 3OB9A 4M77A 3QJYA 3GBQA 3UF4A 4IKFA 2LC4A
chains in the Genus database with same CATH topology
1XOVA 1YN8A 3EG2A 1GFCA 1M3CA 1W70A 1A0NB 2KT8A 2IIMA 1ABQA 2H8HA 3O5ZA 4A63B 1RLPC 2EYWA 1ZX6A 1VA7A 2LP5A 3SHWA 1I0CA 2J05A 3IQLA 1GCQC 1T3LA 3VS2A 2J6FA 3KFVA 1OEBA 2DL5A 2X3WD 2JMCA 1K9AA 1JXOA 2FO0A 3THKA 1QCFA 4J9BA 1K1ZA 2F2WA 1UHCA 1W1FA 1OPKA 2ECZA 2DL4A 1ZBJA 4CC4B 4CC7A 2DRMA 1MUZA 2QDLA 1B3QA 1WLPB 1JU5C 2LCSA 2C0OA 2GQIA 2A08A 2FRWA 2LJ1A 2DBKA 5EC7A 3H0IA 4F16A 4WCIA 4Y92A 3SEMA 2DJQA 2A28A 2PNIA 3EG3A 1H8KA 2DF6A 2D8HA 3VS4A 1NYFA 2KNBB 1UG1A 1AWXA 4Z88A 5IXFA 2W0ZA 1T0HA 2XMFA 3NGPA 1NM7A 2DMOA 3QWXX 2HBWA 2KROA 3RBBB 4QT7A 3REAB 4LE9A 4R0KA 1IO6A 2D0NA 1CKAA 4HVWA 2KR3A 1NLPC 2JS2A 4RTXA 1SHFA 1OV3A 3JV3A 1K76A 1QWEA 4JZ4A 2F2XA 3UA6A 2RQTA 1YWPA 2EGEA 1FYNA 2F2VA 5GJVB 3VS6A 1UFFA 2VVKA 1T0JA 3M0RA 3RNJA 2EVRA 2J6OA 3VS1A 2BZ8A 2O9SA 2JTEA 2G6FX 2RF0A 4JJBA 1B07A 3CQTA 2FG0A 2ED0A 2D8JA 3ZL7C 2PTKA 4OMMA 2V1RA 2BZXA 1WIEA 1J3TA 5ECAA 4IIOA 3TSZA 1I07A 2B86A 1AD5A 4OMNA 2J06A 1NEBA 2A36A 4JJCA 3PVQA 3M0PA 1GL5A 1WA7A 2EGCA 2RQWA 2PZ1A 1JO8A 1QWFA 1Y0MA 2YUQA 4KRTA 1PWTA 4JZ3A 1AWWA 2O31A 1GFDA 4LN2A 2RQVA 1UTIA 4J9GA 2DM1A 3EHRA 2K3BA 2FEIA 1K4US 1GRIA 1SHGA 2CUBA 2DL3A 3REBB 1U3OA 1SRMA 1VYVA 1ZLMA 1BU1A 4AFUC 5I22A 1RI9A 3I35A 3I9QA 2M51A 3I5RA 2LMJA 1NLOC 1SPKA 1NEGA 2DE0X 3EGUA 1AWOA 1KFZA 2AZSA 2JM8A 4HVUA 2CUDA 1S1NA 2ROTA 3NHNA 2NUZA 2KBTA 2C0TA 1QLYA 2O88A 2HDAA 4CC3A 1FMKA 1WXUA 2LNHB 2AKKA 2SEMA 3EHQA 1GBRA 1X69A 4DEXA 3VS7A 1CKBA 1GBQA 2L3QA 2JMAA 2EBPA 5IHIA 1PKTA 4M4ZA 2K9GA 1QKXA 1ZUKA 2GBQA 4LUEA 2BZYA 1X6BA 3FJ5A 4ZNXA 1TUDA 4J9HA 2LQNA 2A37A 2CSIA 3UATA 2NWMA 2GNCA 1E6GA 3PE0A 2X3XD 2ESWA 5IXBA 4AG1C 2GTOA 4EIKA 2YUNA 2JXBA 2D1XA 2DL7A 1BK2A 2JT4A 2DNUA 1YNZA 1M3BA 1ZSGA 3TSWA 2CT4A 1UGVA 2DILA 2SRCA 1YCSB 2KT1A 1G83A 2O9VA 3NMZC 3R6NA 1X43A 1HJDA 2AZVA 5FWCA 3U23A 4RTZA 1ZUYA 2LX7A 2I0NA 3VS5A 3NPFA 2CDTA 1SRLA 1HSQA 2GGRA 1UJYA 1QKWA 1AEYA 4LUDA 1WDXA 1ZUUA 1Z9ZA 4D8DA 2EYXA 1Z9QA 1HD3A 2EGAA 2RNAA 2L3SA 4OMQA 2FPFA 2J7IA 1YWOA 2DA9A 1E6HA 2ED1A 2BTTA 4D8KA 3I5SA 4GBQA 1UHFA 4OMLA 1PRMC 4LNPA 2RQRA 2JS0A 4Z8AA 2M0YA 2KYMA 2RN8A 4AFQC 2E5KA 3EG0A 2K6DA 1M8MA 2CH4W 2OI3A 2KE9A 1UUEA 3H0FA 1K0SA 4F17A 1WXBA 4CC2A 5IHKA 1NYGA 1GCPA 1K0XA 2YUPA 3VS0A 1RUWA 2KXCA 1PHTA 2P4RA 4JJDA 2HSPA 2CREA 1CSKA 1TG0A 4J9CA 4J9FA 4ORZA 3LH5A 2EYZA 3UA7A 2DX1A 4FSSA 3H41A 4OMOA 1WXTA 4K11A 2CT3A 1X2KA 5IH2A 1MV3A 2DBMA 1JQQA 2VWFA 1JXMA 2FPEA 2RQUA 1YP5A 2RMOA 1U5SA 2HEQA 4RTUA 2KRMA 2YT6A 1EFNA 1KSWA 4Z89A 5GJWB 1X6GA 4AG2C 5FWBA 1GCQA 2KRSA 2KXDA 1UECA 2L3PA 4J9EA 1M30A 2KGTA 2LJ0A 5IHNA 1Y57A 3H0HA 1W6XA 1E7OA 2V1QA 2YUOA 1LCKA 3QWYA 2LQWA 2K7AA 3VS3A 5L23A 4RTVA 1VYUA 1WFWA 4F14A 2K2MA 1M3AA 3VRZA 2CH4A 2VKNA 2KYBA 2EPDA 2OAWA 3EG1A 3M0TA 4X1VA 1N5ZA 1PKSA 2FRYA 1G2BA 2DLPA 3ULRB 2C0IA 5HCKA 2DRKA 1SEMA 2YSQA 1MV0B 2ENMA 1X27A 4HCKA 4GLMA 2EQIA 2HCKA 2KRNA 1TUCA 2YDLA 5I11A 1M27C 4E6RA 4DEYA 2MIOA 3VRYA 1UE9A 4RTWA 1I1JA 4J9IA 4AFZC 2DL8A 1AWJA 2LJ3A 1AOJA 2W10A 2O2OA 1ABOA 4IIMA 1H3HA 2DVJA 4OMPA 2AK5A 1KIKA 2ROLA 1AZEA 1UDLA 1WYXA 2FPDA 2DYBA 3PVLA 3C0CA 3TVTA 2LZ6B 1VYTA 1BBZA 2EYYA 1OOTA 2JW4A 2RPNA 3M0QA 2EKHA 3M0UA 4AFSC 2AKLA 2EW3A 4J9DA 1T3SA 2MOXA 2KEAA 4JPBW 4ESRA 1SSHA 1X2QA 1UJ0A 2L0AA 1RLQC 5FW9A 2MCNA 2OJ2A 4RTYA 1PNJA 1KJWA 2JM9A 1PRLC 1H92A 2L2PA 3A98A 4HVVA 4RTTA 4RUGA 1V1CA 1AZGB 1U06A 2ABLA 2K79A 1ARKA 1JEGA 1BB9A 2GTJA 1AVZC 4HXJA 2CSQA 3M0SA 3GBQA 1OPLA 1WI7A 1NG2A 1WX6A 3UF4A 2J6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOV A;  1YN8 A;  3EG2 A;  1GFC A;  1M3C A;  1W70 A;  1A0N B;  2KT8 A;  2IIM A;  1ABQ A;  2H8H A;  3O5Z A;  4A63 B;  1RLP C;  2EYW A;  1ZX6 A;  1VA7 A;  2LP5 A;  3SHW A;  1I0C A;  2J05 A;  3IQL A;  1GCQ C;  1T3L A;  3VS2 A;  2J6F A;  3KFV A;  1OEB A;  2DL5 A;  2X3W D;  2JMC A;  1K9A A;  1JXO A;  2FO0 A;  3THK A;  1QCF A;  4J9B A;  1K1Z A;  2F2W A;  1UHC A;  1W1F A;  1OPK A;  2ECZ A;  2DL4 A;  1ZBJ A;  4CC4 B;  4CC7 A;  2DRM A;  1MUZ A;  2QDL A;  1B3Q A;  1WLP B;  1JU5 C;  2LCS A;  2C0O A;  2GQI A;  2A08 A;  2FRW A;  2LJ1 A;  2DBK A;  5EC7 A;  3H0I A;  4F16 A;  4WCI A;  4Y92 A;  3SEM A;  2DJQ A;  2A28 A;  2PNI A;  3EG3 A;  1H8K A;  2DF6 A;  2D8H A;  3VS4 A;  1NYF A;  2KNB B;  1UG1 A;  1AWX A;  4Z88 A;  5IXF A;  2W0Z A;  1T0H A;  2XMF A;  3NGP A;  1NM7 A;  2DMO A;  3QWX X;  2HBW A;  2KRO A;  3RBB B;  4QT7 A;  3REA B;  4LE9 A;  4R0K A;  1IO6 A;  2D0N A;  1CKA A;  4HVW A;  2KR3 A;  1NLP C;  2JS2 A;  4RTX A;  1SHF A;  1OV3 A;  3JV3 A;  1K76 A;  1QWE A;  4JZ4 A;  2F2X A;  3UA6 A;  2RQT A;  1YWP A;  2EGE A;  1FYN A;  2F2V A;  5GJV B;  3VS6 A;  1UFF A;  2VVK A;  1T0J A;  3M0R A;  3RNJ A;  2EVR A;  2J6O A;  3VS1 A;  2BZ8 A;  2O9S A;  2JTE A;  2G6F X;  2RF0 A;  4JJB A;  1B07 A;  3CQT A;  2FG0 A;  2ED0 A;  2D8J A;  3ZL7 C;  2PTK A;  4OMM A;  2V1R A;  2BZX A;  1WIE A;  1J3T A;  5ECA A;  4IIO A;  3TSZ A;  1I07 A;  2B86 A;  1AD5 A;  4OMN A;  2J06 A;  1NEB A;  2A36 A;  4JJC A;  3PVQ A;  3M0P A;  1GL5 A;  1WA7 A;  2EGC A;  2RQW A;  2PZ1 A;  1JO8 A;  1QWF A;  1Y0M A;  2YUQ A;  4KRT A;  1PWT A;  4JZ3 A;  1AWW A;  2O31 A;  1GFD A;  4LN2 A;  2RQV A;  1UTI A;  4J9G A;  2DM1 A;  3EHR A;  2K3B A;  2FEI A;  1K4U S;  1GRI A;  1SHG A;  2CUB A;  2DL3 A;  3REB B;  1U3O A;  1SRM A;  1VYV A;  1ZLM A;  1BU1 A;  4AFU C;  5I22 A;  1RI9 A;  3I35 A;  3I9Q A;  2M51 A;  3I5R A;  2LMJ A;  1NLO C;  1SPK A;  1NEG A;  2DE0 X;  3EGU A;  1AWO A;  1KFZ A;  2AZS A;  2JM8 A;  4HVU A;  2CUD A;  1S1N A;  2ROT A;  3NHN A;  2NUZ A;  2KBT A;  2C0T A;  1QLY A;  2O88 A;  2HDA A;  4CC3 A;  1FMK A;  1WXU A;  2LNH B;  2AKK A;  2SEM A;  3EHQ A;  1GBR A;  1X69 A;  4DEX A;  3VS7 A;  1CKB A;  1GBQ A;  2L3Q A;  2JMA A;  2EBP A;  5IHI A;  1PKT A;  4M4Z A;  2K9G A;  1QKX A;  1ZUK A;  2GBQ A;  4LUE A;  2BZY A;  1X6B A;  3FJ5 A;  4ZNX A;  1TUD A;  4J9H A;  2LQN A;  2A37 A;  2CSI A;  3UAT A;  2NWM A;  2GNC A;  1E6G A;  3PE0 A;  2X3X D;  2ESW A;  5IXB A;  4AG1 C;  2GTO A;  4EIK A;  2YUN A;  2JXB A;  2D1X A;  2DL7 A;  1BK2 A;  2JT4 A;  2DNU A;  1YNZ A;  1M3B A;  1ZSG A;  3TSW A;  2CT4 A;  1UGV A;  2DIL A;  2SRC A;  1YCS B;  2KT1 A;  1G83 A;  2O9V A;  3NMZ C;  3R6N A;  1X43 A;  1HJD A;  2AZV A;  5FWC A;  3U23 A;  4RTZ A;  1ZUY A;  2LX7 A;  2I0N A;  3VS5 A;  3NPF A;  2CDT A;  1SRL A;  1HSQ A;  2GGR A;  1UJY A;  1QKW A;  1AEY A;  4LUD A;  1WDX A;  1ZUU A;  1Z9Z A;  4D8D A;  2EYX A;  1Z9Q A;  1HD3 A;  2EGA A;  2RNA A;  2L3S A;  4OMQ A;  2FPF A;  2J7I A;  1YWO A;  2DA9 A;  1E6H A;  2ED1 A;  2BTT A;  4D8K A;  3I5S A;  4GBQ A;  1UHF A;  4OML A;  1PRM C;  4LNP A;  2RQR A;  2JS0 A;  4Z8A A;  2M0Y A;  2KYM A;  2RN8 A;  4AFQ C;  2E5K A;  3EG0 A;  2K6D A;  1M8M A;  2CH4 W;  2OI3 A;  2KE9 A;  1UUE A;  3H0F A;  1K0S A;  4F17 A;  1WXB A;  4CC2 A;  5IHK A;  1NYG A;  1GCP A;  1K0X A;  2YUP A;  3VS0 A;  1RUW A;  2KXC A;  1PHT A;  2P4R A;  4JJD A;  2HSP A;  2CRE A;  1CSK A;  1TG0 A;  4J9C A;  4J9F A;  4ORZ A;  3LH5 A;  2EYZ A;  3UA7 A;  2DX1 A;  4FSS A;  3H41 A;  4OMO A;  1WXT A;  4K11 A;  2CT3 A;  1X2K A;  5IH2 A;  1MV3 A;  2DBM A;  1JQQ A;  2VWF A;  1JXM A;  2FPE A;  2RQU A;  1YP5 A;  2RMO A;  1U5S A;  2HEQ A;  4RTU A;  2KRM A;  2YT6 A;  1EFN A;  1KSW A;  4Z89 A;  5GJW B;  1X6G A;  4AG2 C;  5FWB A;  1GCQ A;  2KRS A;  2KXD A;  1UEC A;  2L3P A;  4J9E A;  1M30 A;  2KGT A;  2LJ0 A;  5IHN A;  1Y57 A;  3H0H A;  1W6X A;  1E7O A;  2V1Q A;  2YUO A;  1LCK A;  3QWY A;  2LQW A;  2K7A A;  3VS3 A;  5L23 A;  4RTV A;  1VYU A;  1WFW A;  4F14 A;  2K2M A;  1M3A A;  3VRZ A;  2CH4 A;  2VKN A;  2KYB A;  2EPD A;  2OAW A;  3EG1 A;  3M0T A;  4X1V A;  1N5Z A;  1PKS A;  2FRY A;  1G2B A;  2DLP A;  3ULR B;  2C0I A;  5HCK A;  2DRK A;  1SEM A;  2YSQ A;  1MV0 B;  2ENM A;  1X27 A;  4HCK A;  4GLM A;  2EQI A;  2HCK A;  2KRN A;  1TUC A;  2YDL A;  5I11 A;  1M27 C;  4E6R A;  4DEY A;  2MIO A;  3VRY A;  1UE9 A;  4RTW A;  1I1J A;  4J9I A;  4AFZ C;  2DL8 A;  1AWJ A;  2LJ3 A;  1AOJ A;  2W10 A;  2O2O A;  1ABO A;  4IIM A;  1H3H A;  2DVJ A;  4OMP A;  2AK5 A;  1KIK A;  2ROL A;  1AZE A;  1UDL A;  1WYX A;  2FPD A;  2DYB A;  3PVL A;  3C0C A;  3TVT A;  2LZ6 B;  1VYT A;  1BBZ A;  2EYY A;  1OOT A;  2JW4 A;  2RPN A;  3M0Q A;  2EKH A;  3M0U A;  4AFS C;  2AKL A;  2EW3 A;  4J9D A;  1T3S A;  2MOX A;  2KEA A;  4JPB W;  4ESR A;  1SSH A;  1X2Q A;  1UJ0 A;  2L0A A;  1RLQ C;  5FW9 A;  2MCN A;  2OJ2 A;  4RTY A;  1PNJ A;  1KJW A;  2JM9 A;  1PRL C;  1H92 A;  2L2P A;  3A98 A;  4HVV A;  4RTT A;  4RUG A;  1V1C A;  1AZG B;  1U06 A;  2ABL A;  2K79 A;  1ARK A;  1JEG A;  1BB9 A;  2GTJ A;  1AVZ C;  4HXJ A;  2CSQ A;  3M0S A;  3GBQ A;  1OPL A;  1WI7 A;  1NG2 A;  1WX6 A;  3UF4 A;  2J6K A; 
#chains in the Genus database with same CATH topology
 1XOV A;  2MMP A;  1GFC A;  4ZGJ B;  1FXX A;  4J83 A;  1A0N B;  2KT8 A;  4JRK A;  1KQ1 A;  2VXF A;  1ZX6 A;  3OMG A;  4KBM B;  1K9M U;  1QVF P;  3VS2 A;  3DB3 A;  3KFV A;  1OEB A;  4M77 E;  2C06 A;  1EZZ B;  3THK A;  3OSS C;  1QCN A;  4M77 D;  2QK0 A;  2E12 A;  2ECZ A;  1ACM B;  3OBW A;  1ZBJ A;  4CC4 B;  2A0F B;  3CCL T;  4HCC A;  2DRM A;  3C94 A;  1MUZ A;  3QUI A;  4M7D C;  3MKD A;  3EGD A;  1VQK T;  4PJM A;  4XK8 E;  1UB4 A;  3MP8 A;  3OQ5 A;  3CMA A;  2VAS A;  2FRW A;  2QEX Q;  1M90 U;  4WCI A;  2ZPB B;  3V8L A;  4BB7 A;  5AT1 B;  1MND A;  3CCM Q;  2PNI A;  2X51 A;  2ZZD A;  3PT9 A;  4QQD A;  4EMK A;  3CC2 T;  4M7A G;  2GQV A;  3LW5 E;  5GMK h;  1VQ4 A;  1JJ2 A;  2YHT A;  3UT1 A;  1VQM Q;  3RMQ A;  4GY5 A;  4QT7 A;  4R0K A;  3G6E T;  2KR3 A;  4R55 A;  5A2Q E;  2EJF A;  4PJN A;  3PIP A;  4OGE A;  1KD1 U;  3OYB A;  5CVI A;  4ATO A;  3INZ A;  4NOY A;  2EGE A;  3JCM V;  5GJV B;  3A5Z B;  1I5L A;  3M0R A;  3CCU A;  1B34 B;  2EVR A;  3DLM A;  4PJO E;  2F1L A;  2BIV A;  4C92 A;  2H3E B;  2O9S A;  2G6F X;  4DOV A;  3CCV A;  1NZ9 A;  4A54 A;  3O8V A;  2PTK A;  4E7S A;  1VQN Q;  1B7T A;  1WIE A;  4PJL A;  2B86 A;  1JJ2 S;  3X25 B;  1NEB A;  1Q82 U;  3PVQ A;  4JS4 A;  4M78 D;  2K2V A;  2JUF A;  3HRS A;  1WA7 A;  1H3Z A;  5HK0 A;  1QWF A;  1Y0M A;  2M0O A;  2NUT A;  1IXD A;  1VQO A;  1GFD A;  5D6X A;  1K4U S;  5GAO l;  4JJN K;  2KQW A;  2QA4 Q;  1SRM A;  6AT1 B;  3SFM A;  4C92 G;  4C5H A;  3G4S A;  3G4S Q;  3BDL A;  4OMF B;  4JRQ A;  5FU7 C;  1TTH B;  2DXC A;  3NHN A;  4E2F B;  5KE3 A;  2FYK A;  1QLY A;  1FMK A;  2AKK A;  2SEM A;  1ZQ1 A;  4M7D D;  1Q82 C;  1CKB A;  2V8K A;  3CCV Q;  2JMA A;  4M75 A;  4M7A C;  5GAO r;  1UEB A;  3URG A;  2GBQ A;  3JB9 G;  1TUD A;  4QW2 A;  2JZ2 A;  2X9H A;  3OYY A;  2A37 A;  2JTF A;  4L59 A;  1WHH A;  1TH7 A;  2O4X B;  2X3X D;  3NTK A;  5IXB A;  4EIK A;  1D1B A;  1XQH A;  3QYH B;  2CZ7 B;  1K8A R;  1YNZ A;  4FYY B;  1BKB A;  3PMI A;  1UGV A;  2SRC A;  1BI0 A;  3J80 E;  2O9V A;  3NMZ C;  4DQ2 A;  4PJO G;  4EMK C;  5LJ3 g;  4ZTJ A;  2NUP A;  2LCC A;  3U23 A;  1YJW A;  4RTZ A;  1ZUY A;  1VQL T;  2MI6 A;  3AT1 B;  3RKW A;  1D3B A;  2KMT A;  8AT1 B;  1TU0 B;  4A4E A;  2NLU A;  2VXE A;  1N9S A;  4M78 E;  5KYW A;  3WXM B;  1Z9Q A;  3M53 A;  1HD3 A;  2EGA A;  2RNA A;  1FX7 A;  1RAE B;  5GAN 4;  1YI2 A;  4OMQ A;  2J7I A;  1YJN Q;  4IUV A;  4XU2 A;  3SWN B;  2ED1 A;  3JCM W;  1D1C A;  1SF9 A;  3JB9 F;  4LNP A;  2K5F A;  5D6Y A;  3CCJ T;  2RA2 A;  1VQO Q;  5GAN j;  2K6D A;  2CH4 W;  2RJD A;  3JCM f;  4F7U B;  4M78 C;  1UUE A;  3H0F A;  3G71 T;  3TU4 K;  2CP2 A;  1WXB A;  3LGL A;  2HQE A;  3M56 A;  3I56 Q;  2P4R A;  4C8Q B;  2R58 A;  4OB0 B;  1TG0 A;  3LGF A;  3HHT B;  4ORZ A;  2EJG A;  3LH5 A;  2EYZ A;  4A4G A;  3BE3 A;  1KC8 C;  2KSS A;  4OB2 B;  3MJX A;  3RES A;  3CC4 T;  1QW1 A;  3H6Z A;  3JCM g;  3JCM e;  1LOJ A;  2DBM A;  1JQQ A;  2VWF A;  2FPE A;  4C5I A;  2RQU A;  5GAM g;  2PVG B;  3GIB A;  1YP5 A;  2HD0 A;  1U5S A;  4PNO A;  4QVC A;  1HYO A;  3JCM X;  2QA4 A;  2KRM A;  4ELZ C;  4BI3 A;  4Z89 A;  1M1K C;  4J7F A;  4AG2 C;  3EFR A;  5FWB A;  4LDU A;  4KUD K;  1C0M A;  2E6Z A;  2LDM A;  1M5Q 1;  1UEC A;  1UGP B;  1MMD A;  3A8H B;  2GFA A;  2P0K A;  4F7U F;  4JRP A;  2BKD N;  2LTO A;  3PFS A;  2RHU A;  3I55 A;  1KD1 R;  2V1Q A;  2PVO B;  1LCK A;  2YUO A;  3CPW A;  5L23 A;  3CCR A;  3EGD B;  3SWN C;  5HKC A;  3M55 A;  2JNG A;  2DER A;  4NS5 A;  3WVE B;  2EFI A;  3S3O A;  2OAW A;  1VQK A;  3G7Z A;  1D0X A;  2PVD B;  2RI5 A;  3PNW C;  1OU9 A;  3ASK A;  1G2B A;  4J6X A;  4OB1 B;  4C5E A;  1VQ9 A;  2YSQ A;  4CRI A;  3CCS T;  3EGX B;  3E9G A;  5GAN 2;  2HCK A;  2D9T A;  2KDS A;  2DTH A;  1LPL A;  3BY7 A;  2MIO A;  3VRY A;  2RHY A;  1VQ7 T;  1YI2 T;  4ZN1 A;  3CBO A;  2E41 A;  1MHN A;  3QG1 A;  4C92 D;  3LLR A;  3FC3 A;  3RIR A;  3VJP A;  5GAM h;  3OYN A;  1M2V A;  2QQR A;  5FU7 B;  2ROL A;  2RI2 A;  1AZE A;  2COY A;  4LDV A;  1MNE A;  4MDW A;  1N8R U;  2RPN A;  2P4T A;  4C8Q F;  2AKL A;  1GXI E;  2QGF B;  3A1P A;  3P8B B;  1T3S A;  2MOX A;  2KEA A;  1UJ0 A;  1Q86 C;  1VQN A;  4KH1 B;  1N27 A;  2NYS A;  1PNJ A;  4XTZ A;  4DBH A;  4ME7 A;  1PRL C;  3QDR B;  2L2P A;  2MK5 A;  3SDZ A;  4RTT A;  4RUG A;  3CC7 T;  2FZG B;  4HA8 A;  4MML A;  3HTR A;  3MCA B;  3OS0 A;  1BB9 A;  3CXC S;  2GFU A;  4HXJ A;  3M0S A;  1WI7 A;  1TWB A;  2L89 A;  1WX6 A;  1Q86 R;  4OVA A;  1YN8 A;  3OYK A;  1W4S A;  3JCM J;  4BUG A;  2RH2 A;  1YIJ T;  1W70 A;  4MDX A;  1TS9 A;  1S72 A;  3O5Z A;  1RLP C;  2YRC A;  5GMK i;  2LP5 A;  3SHW A;  3J81 E;  2CGH A;  1I0C A;  2J05 A;  1T3L A;  5GMK e;  2J6F A;  1JXO A;  5D7U A;  4QVZ A;  1QCF A;  4J9B A;  3X20 B;  1KQS A;  1W1F A;  2XK0 A;  1YBY A;  2DTO A;  2KY9 A;  5KYY A;  2DXT A;  1BI3 A;  4PJO B;  2QDL A;  2OX7 A;  1B3Q A;  2ATC B;  2C0O A;  1SG5 A;  2GQI A;  1K73 C;  3JB9 D;  3VYG A;  1PM3 A;  1VQ9 Q;  3J7A F;  2DBK A;  2MYS A;  2VB6 A;  1M2V B;  4M75 D;  3RER A;  2I2L A;  5M9O A;  1KC8 U;  4Y92 A;  2EAY A;  1TUG B;  2HNI A;  4EDU A;  2XU8 A;  3MEW A;  3EG3 A;  2D8H A;  3EG9 A;  2DPP B;  1NYF A;  2ZAE A;  1RAC B;  4C8Q A;  3CC7 Q;  2P0Q A;  2WSF E;  3FB9 A;  4Z88 A;  5IXF A;  3VYH B;  3DB4 A;  2P0P A;  3TQ7 P;  1RL2 A;  4FW2 A;  2R5M A;  4PLI A;  2GCX A;  3CCQ A;  1Y7X A;  2DAQ A;  3QWX X;  3RBB B;  1VQP Q;  2IG0 A;  3REA B;  2CP0 A;  2YRD A;  5J26 A;  5GAO p;  2D0N A;  3CCU T;  1WJQ A;  1ZA2 B;  4KH0 B;  2X4Y A;  4F7U G;  2L5Q A;  2JOY A;  4L6V 5;  1JRI A;  4IUR A;  1QWE A;  3CCQ T;  1YWP A;  1WQ7 A;  2V8I A;  1FYN A;  4ZTF A;  3VS6 A;  1KHC A;  2DXU A;  1T0J A;  3RNJ A;  3FJP A;  1EX4 A;  1FWZ A;  2DEQ A;  1QVG S;  2RHI A;  3CCR Q;  2OTL Q;  2JTE A;  2RF0 A;  3FEO A;  2EQU A;  1B07 A;  2AIR B;  3CQT A;  2RK1 A;  2FG0 A;  2ED0 A;  3ZL7 C;  2QQB A;  3BW1 A;  4O6J A;  4DOW A;  4L5G A;  2V1R A;  4AMC A;  2DZ9 A;  5ECA A;  9ATC B;  1OZ3 A;  3TSZ A;  1V29 B;  2M9U A;  2A36 A;  4BDZ A;  4LXC A;  4IUU A;  2E64 A;  3CCS Q;  1Y07 A;  3I55 Q;  2PZ1 A;  1JO8 A;  2QG9 B;  1WGS A;  1AWW A;  4JZ3 A;  8ATC B;  1QQJ A;  1K9M R;  2RHX A;  4M7D E;  2E65 A;  4V2S A;  3JB9 I;  2CP3 A;  1NJI R;  2RD1 A;  3QKJ A;  1SSF A;  4F7U A;  4PJJ A;  5KE2 A;  2DFU A;  1U3O A;  4M78 G;  1VYV A;  5I22 A;  1YJ9 Q;  3I9Q A;  3OYC A;  2LMJ A;  2E3H A;  4B9W A;  2RM4 A;  1NEG A;  3GP8 A;  1VQ4 T;  2AZS A;  2JM8 A;  4TVR A;  4JUV A;  4FYW B;  2C0T A;  4XU0 A;  1NE8 A;  4C0D B;  2YLC A;  2LNH B;  5GAN 5;  3V7C A;  3E1S A;  3EHQ A;  2OTL A;  3RUX A;  3L2V A;  4GLK A;  4XTX A;  4Y91 A;  4ZGE B;  1PKT A;  5CR2 A;  4M4Z A;  1ZUK A;  2RHZ A;  1N8R C;  4J9H A;  1PCX A;  3UAT A;  3P8H A;  2GNC A;  4C8Q D;  2PUK B;  2ESW A;  3T9N A;  1YHQ A;  2GTO A;  4M75 G;  3OYL A;  2JXB A;  2D1X A;  1ZBX A;  3HP9 A;  2Y4X A;  3CC2 A;  1ZSG A;  3NTH A;  1JBM A;  3TSW A;  2CT4 A;  3TRE A;  1VQ4 Q;  2DIL A;  3JB9 H;  3CBM A;  2AZV A;  1VQO T;  2FHD A;  2K4Y A;  1XTD A;  1IGQ A;  3E2U A;  1AEY A;  5GAN 7;  1I81 A;  1WDX A;  1Z9Z A;  3L2R A;  2RJF A;  3LH0 A;  2DD4 A;  1G3W A;  3MO8 A;  3PGG A;  3RKY A;  4C0Z A;  3ME9 A;  2FPF A;  3QZ5 B;  2RJC A;  5CKD A;  4J7I A;  3PIO A;  2BTT A;  3ZEH A;  3I5S A;  4D8K A;  4GBQ A;  1PRM C;  3C95 A;  3SWN A;  1U1S A;  3GNF B;  2JS0 A;  4Z8A A;  2EQK A;  3L2Z A;  5KYX A;  2E5K A;  5EG2 A;  4NL2 A;  2QYZ A;  3V8J A;  1VQM A;  4R56 A;  5DM7 R;  3CCR T;  4F17 A;  4CC2 A;  1MGQ A;  5IHK A;  2MWP A;  2YUP A;  1VQ7 Q;  3JSC A;  3WVD B;  5CAI A;  1R77 A;  1D3B B;  1CSK A;  3OW2 P;  1PSE A;  4J9C A;  4J9F A;  2FL7 A;  5LJ5 h;  2DX1 A;  4M7A B;  1AHJ B;  3H41 A;  2XD0 A;  4HCB A;  5GAN 8;  5D6W A;  4A4H A;  2M16 A;  3CCU Q;  5IH2 A;  1VQ6 A;  1VQP T;  2E1H A;  2CZ1 B;  1IHV A;  2HKN A;  2ZGW A;  3ER0 A;  2PUO B;  2WSE E;  1EFN A;  1KSW A;  1NPP A;  1X6G A;  5HK3 A;  4KT0 E;  1M1K R;  1B34 A;  1U1T A;  4FCY A;  4DBR A;  2KXD A;  3LWI A;  1W2B P;  2L3P A;  5GAN d;  2LJ0 A;  1PD1 A;  3UDC A;  1D1A A;  2QAS A;  2HBP A;  1OZ2 A;  1VQ9 T;  4F14 A;  2QGG A;  2HQX A;  4OB3 B;  3ZBD A;  1G5V A;  1KHI A;  4PJO D;  2M02 A;  2K2M A;  1IGU A;  2KYB A;  3HRT A;  3QJ6 A;  2R57 A;  3OBY A;  3CCJ A;  4FM4 B;  4FU6 A;  1N5Z A;  4X1V A;  5I21 A;  5CKH A;  3FLG A;  2MWO A;  2AT1 B;  1I4K 1;  5GAN e;  2DRK A;  4WF2 A;  4HCZ A;  1VQ7 A;  2XDP A;  3OMC A;  1MV0 B;  2ENM A;  1X27 A;  2R5A A;  5KCH A;  2E5Q A;  4C92 F;  2E10 A;  4GLM A;  2EQI A;  1YJ9 A;  2KRN A;  2OTJ A;  4Y28 E;  2YDL A;  3KUF A;  4E6R A;  1WJS A;  4BD3 A;  4DEY A;  3FDR A;  1VQN T;  1WQW A;  4RTW A;  4C0G A;  5LL6 S;  3VUB A;  1QMC A;  1XNI A;  2YXY A;  3CPW S;  2O2O A;  4IIM A;  1H3H A;  4FIB A;  2LVM A;  3OW2 A;  2YLB A;  4MZT A;  5FU6 B;  3GLX A;  1YJ9 T;  2QTX A;  3PVL A;  1V76 A;  3TVT A;  2LCL A;  1RAA B;  1VYT A;  1BBZ A;  2KK4 A;  2X4W A;  3DKM A;  2JW4 A;  1PSF A;  2A3L A;  2L0A A;  4E7J A;  1C1A A;  1RLQ C;  2MPX C;  5FW9 A;  1MMN A;  4OF1 A;  5HY6 A;  2BE7 D;  1X75 C;  1M2O A;  3G1J A;  2G3R A;  3G6E A;  1YIT A;  3I55 T;  4Q5W A;  2JM9 A;  3A98 A;  3FIF A;  1V1C A;  3CC2 Q;  3I56 A;  1AZG B;  2A7Y A;  1ARK A;  3CCM T;  1QVF A;  1Q7Y C;  3LWH A;  1AVZ C;  1RAF B;  2CSQ A;  3OW2 S;  2CZ6 B;  1RI0 A;  1WHM A;  2OTL T;  2J6K A;  3ULR B;  4N4I A;  3EG2 A;  1M3C A;  1H64 1;  3E19 A;  1ABQ A;  2HAX A;  1VA7 A;  3VUZ A;  3CCQ Q;  3CME A;  3IQL A;  1M90 C;  1GCQ C;  2DZC A;  3MP1 A;  3E9F A;  2YWW A;  4M77 B;  2X3W D;  2JMC A;  1K9A A;  3EFO B;  1XJW B;  2FO0 A;  5CKB A;  1M8V A;  1K1Z A;  1VOM A;  3G71 A;  1UHC A;  3OYD A;  4PFP A;  1TXQ A;  5LJ5 d;  2ZPI B;  2EKO A;  1BI1 A;  4FW1 A;  1I5O B;  2XDD A;  1FMV A;  1JU5 C;  1WLP B;  3SD4 A;  2LCS A;  1D09 B;  1Q81 C;  3OSV A;  1UGR B;  2A08 A;  1NBE B;  4C92 C;  4M75 E;  3MPU B;  2LJ1 A;  2EYQ A;  1VIE A;  5EC7 A;  5GAN f;  3L2W A;  5FU6 C;  1Q7Y R;  2A28 A;  1H8K A;  1Q81 R;  2DF6 A;  3VS4 A;  1QP3 A;  1WHL A;  2F5K A;  5LJ3 j;  3EGX A;  3M57 A;  2W0Z A;  1T0H A;  3NGP A;  1NM7 A;  2CP6 A;  3MEU A;  3A8G B;  5GAN 3;  3S3N A;  2KRO A;  3HRU A;  4LE9 A;  4M7A F;  1M4Z A;  1IO6 A;  5J3B A;  1CKA A;  5KH6 A;  4J6W A;  4PL6 A;  3CC4 Q;  4RTX A;  1SHF A;  5FRN A;  3JV3 A;  1K76 A;  4JZ4 A;  2F2X A;  3GF5 A;  2RQT A;  3EAE A;  2HQH A;  4BI8 B;  2F2V A;  2Y90 A;  2OAU A;  1YIJ Q;  4LDY A;  4MZM A;  1N6A A;  2J6O A;  2QQS A;  3CXC P;  5GMK j;  2NUT B;  4JJB A;  3V7S A;  3S6W A;  1Y96 A;  2D8J A;  4OMM A;  3FRN A;  4BE1 A;  2CZ0 B;  4LD6 A;  5DY9 A;  2EIF A;  5GAO q;  2XKO C;  3CCJ Q;  1AD5 A;  3CPW P;  4OMN A;  4JJC A;  1K73 U;  2DIQ A;  1G3S A;  1VQ8 T;  3CEY A;  2EGC A;  1YJN T;  2YUQ A;  1IRE B;  1M9S A;  2HSE B;  1PWT A;  3G6E Q;  2O31 A;  4LN2 A;  2FZC B;  2RQV A;  4JLI A;  1UTI A;  4J9G A;  2DM1 A;  1BI2 A;  4X9D A;  1VQM T;  3PTA A;  2K3B A;  2FEI A;  1GRI A;  1SHG A;  2B8A A;  3REB B;  2WAC A;  3I35 A;  1VQL Q;  2M51 A;  2CS7 A;  4DBF A;  1NLO C;  3JCM P;  5GAM f;  5LJ3 d;  4XU1 A;  5AYF A;  3EGU A;  5KYU B;  1AWO A;  1KFZ A;  2CUD A;  1YI2 Q;  4IUQ A;  2NUZ A;  4J6Y A;  3HKS A;  2DXB A;  3QBY A;  2EQM A;  4CC3 A;  4A53 A;  3QZ9 B;  4FYX B;  4E7I A;  1X69 A;  2F5T X;  1GBQ A;  1TOV A;  5IHI A;  4QKU A;  4ZNX A;  2ZPH B;  4LUE A;  2BZY A;  3FJ5 A;  4PLL A;  5IAY A;  3CCV T;  1P92 A;  2LQN A;  5DLQ E;  3A8M B;  5CKE A;  2VYT A;  3KBG A;  2IVW A;  1W2B S;  2CSI A;  1MMA A;  2NWM A;  1UGQ B;  4ZGD B;  2VC8 A;  4AG1 C;  4BY6 B;  2XI9 A;  2YUN A;  1KK7 A;  5LJ5 e;  2DL7 A;  2E6N A;  5KYU A;  1BK2 A;  2DNU A;  4UC4 A;  1M3B A;  4IUP A;  1YCS B;  1WHG A;  3CCL A;  1G83 A;  2V26 A;  4QVD A;  3OYE A;  1HJD A;  5FWC A;  2HL5 C;  1Q82 R;  2GF7 A;  4X9C A;  3P8D A;  2LX7 A;  3RDV A;  2I0N A;  4RMO A;  3VS5 A;  3RKX A;  2CDT A;  2QA4 T;  1SRL A;  2X35 A;  1QKW A;  4LUD A;  1ZUU A;  1NPR A;  3AHU A;  2P84 A;  4N4G A;  2EYX A;  2ZPE B;  3QHS A;  1Q81 U;  1K8A U;  3CMA T;  2HL3 A;  2O01 E;  2L8D A;  3MP6 A;  3ZFJ A;  1E6H A;  4OML A;  4E7Z A;  2RQR A;  5KYX B;  3UPU A;  2KYM A;  3I56 T;  2RN8 A;  1LJO A;  2OI3 A;  2DTI A;  1WHJ A;  3G71 Q;  2DKG A;  1RAG B;  4C8Q E;  2JTM A;  5IN1 A;  2BE9 B;  1NYG A;  1GCP A;  1K0X A;  3VS0 A;  2RI3 A;  1RUW A;  1Q95 G;  2KXC A;  4JJD A;  2HSP A;  1Q86 U;  3CPF A;  4J8O A;  1ZA1 B;  2X4J A;  3UA7 A;  2LT4 A;  4FSS A;  1X6O A;  3GOX A;  4OMO A;  1WXT A;  4K11 A;  3X28 B;  1N8R R;  3M9Q A;  1OUL A;  2QTV A;  5GAN h;  2ZCF B;  1G8X A;  4N4H A;  1QP2 A;  3UWN A;  3JAM E;  4C8Q C;  2DIG A;  4XTU A;  3MHX A;  4RKU E;  3OYG A;  2CKK A;  1VQL A;  1Q7Y U;  1GCQ A;  5CKF A;  2KVQ G;  1AT1 B;  1S72 Q;  2Z0W A;  1M30 A;  2KGT A;  3H9N A;  2RO0 A;  5IHN A;  1Y57 A;  2VGN A;  3L1A A;  4J5Y A;  3H0H A;  1E7O A;  1R8O B;  2ZPG B;  4OP0 A;  2FVU A;  3QWY A;  2QI2 A;  1G3Y A;  2LQW A;  1Y71 A;  4PKC C;  3VS3 A;  1VYU A;  4BI4 A;  4HT9 A;  3PMT A;  4XTW A;  5A0G A;  3VRZ A;  1SKU B;  1VQK Q;  2VKN A;  4KGX B;  4C0F A;  4M7D B;  2EPD A;  4FL6 A;  3HPW A;  3EG1 A;  4WTO B;  1RAI B;  3M0T A;  3CCL Q;  4ELY C;  1PKS A;  1NJI C;  3LX7 A;  2C0I A;  5HCK A;  3X24 B;  2D6F A;  5IT9 E;  4M77 C;  1BIB A;  1TUC A;  1UGS B;  5LJ5 g;  4RG2 A;  2HZY A;  1OU8 A;  3OS5 A;  1UE9 A;  4J9I A;  4AFZ C;  1OX9 A;  1QVG P;  4M75 F;  1X01 A;  1AWJ A;  3CC4 A;  1AOJ A;  2DYI A;  3G4S T;  1ABO A;  4BY6 C;  1HK9 A;  1W2B A;  2DVJ A;  2PQW A;  4PFZ A;  1BCO A;  4FT2 A;  3OYH A;  1QVG A;  7AT1 B;  1UDL A;  2EWN A;  1WYX A;  5KYW B;  3C0C A;  3OYI A;  4N0A A;  2LZ6 B;  4F04 B;  3OYF A;  1EIF A;  2QXF A;  1I8F A;  2BUD A;  2EYY A;  1WNL A;  2V8J A;  1LVK A;  3M0Q A;  2EKH A;  1QCO A;  2LRQ A;  4AFS C;  3QPH A;  1VUB A;  1RAB B;  4JPB W;  1JB0 E;  4PJO F;  1VQ5 T;  3CCE T;  1D0Y A;  2OJ2 A;  4P5N A;  3H8Z A;  3NFC A;  4RTY A;  4JLG A;  1DJ7 B;  1K8A C;  2Y4Y A;  3C12 A;  1H92 A;  4N0A C;  5GAM j;  2K3Y A;  4XU3 A;  2ABL A;  3JB9 J;  2K79 A;  3RMS A;  4EMH A;  1FMW A;  1JEG A;  4M75 B;  4KGV B;  2GTJ A;  4M78 F;  4A4K A;  1OPL A;  1NG2 A;  3OS2 A;  2JN0 A;  3HFN A;  2JVV A;  4NL3 A;  3OYA A;  4PJO C;  3CCE A;  1VQ5 A;  3VU3 C;  2IIM A;  4FSX A;  1IZ6 A;  2H8H A;  4A63 B;  4E47 A;  4BDY A;  2EYW A;  4M77 G;  2IPO B;  1LNX A;  2LT1 A;  2DL5 A;  1U8R A;  2E70 A;  1PG5 B;  2MAM A;  4LD9 K;  2F2W A;  1OPK A;  5J39 A;  2DL4 A;  5CQX A;  4M78 A;  4CC7 A;  4C0D C;  2K3X A;  3QO3 A;  1ZSZ B;  4EPC A;  2DET A;  3QDF A;  2PU9 B;  5A0D A;  3H0I A;  3L2Q A;  4FT4 A;  4F16 A;  3CD6 T;  2QEX T;  3SEM A;  2DJQ A;  2ZPF B;  3D7S B;  1VQ6 Q;  1K73 R;  2CP5 A;  2RJE A;  2QQA A;  4PJO A;  5FRM A;  5CIU A;  2KAF A;  3GNG A;  4EMG A;  2XHC A;  5C0M A;  3JCM Q;  1D0Z A;  2KNB B;  1UG1 A;  1AWX A;  4B9X A;  2XMF A;  3CC7 A;  2OTJ Q;  2XG8 D;  2DMO A;  4MZP A;  2XIC A;  3KXT A;  4O5V A;  1QVP A;  4RCC A;  1NJI U;  2LX9 A;  5KYY B;  2HBW A;  2MF2 A;  1VQ5 Q;  3CCE Q;  4HVW A;  1NLP C;  3CME T;  2JS2 A;  2H3J A;  3Q1J A;  4MMK A;  1M90 R;  3V8K A;  1OV3 A;  2DK3 A;  3UA6 A;  4XQ3 A;  1UFF A;  2VVK A;  4QQG A;  1RAD B;  4C92 B;  1R0B G;  2KI7 A;  3QSU A;  3OYJ A;  3VS1 A;  2BZ8 A;  1YJN A;  1WPY A;  3EH1 A;  4HT8 A;  2YRV A;  3QYG B;  1M1F A;  4YTL A;  4RCB A;  4LDX A;  4C8Q G;  2BZX A;  1J3T A;  4IIO A;  2K57 A;  1I07 A;  4HKE A;  2J06 A;  2EJ9 A;  1ZHI A;  4VUB A;  2COZ A;  3M0P A;  4JDS A;  2WSC E;  5LJ3 f;  1GL5 A;  2RQW A;  4B6M A;  2XDB A;  4DBQ A;  5I2M A;  3LYI A;  4M77 F;  4KRT A;  2VGM A;  3OS1 A;  1N9R A;  2VUB A;  3EHR A;  1YFN A;  5LJ3 h;  3M54 A;  2RK2 A;  1WJR A;  3HFO A;  4FYV B;  2HKQ B;  2XID A;  4E7H A;  2CUB A;  2DL3 A;  4C92 E;  5I2S A;  1ZLM A;  1BU1 A;  4AFU C;  1OI1 A;  1RI9 A;  1PD0 A;  4M7A E;  2DJZ A;  3I5R A;  4QQ6 A;  5LJ3 e;  1IHW A;  3M5A A;  3M59 A;  1SPK A;  3EG9 B;  4C5G A;  2FZK B;  2VV5 A;  2DE0 X;  1YJW Q;  1KD1 C;  1HXD A;  1KQS P;  5GAM d;  1BIA A;  4HVU A;  1S1N A;  2ROT A;  3L2U A;  2KBT A;  2O88 A;  4X34 A;  1IRX A;  2HDA A;  3CXC A;  1WXU A;  1KQS S;  5CO7 A;  1YHQ T;  1VIF A;  1GBR A;  2D0Q B;  3VS7 A;  4DEX A;  4A4F A;  1KQ2 A;  2L3Q A;  2EBP A;  4II1 A;  2K9G A;  1QKX A;  1X6B A;  5CQY A;  2QEX A;  1OQK A;  3M58 A;  3MEV A;  4ZN3 A;  1E6G A;  1C6V X;  1YIT Q;  3PE0 A;  5GMK m;  4XTY A;  2COW A;  4KUI A;  4M78 B;  5CK9 A;  2JT4 A;  2LQ8 A;  4JS5 A;  4M7A D;  5KCO A;  3M4G A;  3EFO A;  5GMK l;  2KT1 A;  3R6N A;  3JCM h;  1X43 A;  5C6S A;  3OA6 A;  4RG8 A;  5CCA A;  3V7R A;  2K5L A;  3NPF A;  1HSQ A;  2GGR A;  2FB7 A;  1UJY A;  4Z02 A;  1O9S A;  1VQ8 A;  3R6O A;  2LNV A;  5LJ5 f;  4IUT A;  2CP7 A;  1VQP A;  3HL8 A;  4D8D A;  3CMA Q;  1JJ2 P;  3X26 B;  4E7K A;  4KUL A;  2L3S A;  2K5I A;  4XAX B;  1YWO A;  5LJ5 j;  2DA9 A;  1KC8 R;  4E7L A;  1UHF A;  1KG1 A;  4EMK B;  3QII A;  5KYN A;  2M0Y A;  2DD5 A;  4AFQ C;  1OX8 A;  5FLX E;  4BE0 A;  3EG0 A;  2O4X A;  1M8M A;  2KE9 A;  5GAN 6;  1K0S A;  2F69 A;  3N5B B;  4M7D A;  4PFO A;  1PHT A;  1QVF S;  2CRE A;  4KGZ B;  4D6W A;  4F7U E;  2DVE A;  3JRZ A;  3CCS A;  4M7D F;  3OYM A;  2X4X A;  3CME Q;  1YCY A;  2CT3 A;  1YIJ A;  1X2K A;  3L42 A;  2HMA A;  1MV3 A;  5DLO A;  1JXM A;  3EH2 A;  3TEE A;  3VV0 A;  3JCM d;  1WHK A;  2RMO A;  4ANJ A;  2HEQ A;  4RTU A;  1O75 A;  3OY9 A;  2OTJ T;  2YT6 A;  1BYM A;  5GJW B;  2KRS A;  3QXE B;  5FRO A;  2E4H A;  4J9E A;  3MEA A;  1VQ6 T;  4JRI A;  4CI0 C;  1W6X A;  4AT1 B;  3CD6 Q;  3SB2 A;  1Y96 B;  2E3I A;  3C4S A;  4LDW A;  2K7A A;  5GAM e;  3CD6 A;  1F1B B;  4RTV A;  1WFW A;  1ZSZ C;  1S72 T;  4M7D G;  4BE2 A;  1M3A A;  2L3R A;  1RAH B;  1TSF A;  2CH4 A;  4DA4 A;  2AHJ B;  3JCM c;  1YIT T;  4BAC A;  2DEU A;  2FRY A;  3JCM b;  2DLP A;  1K9M C;  1SEM A;  4PK4 A;  1MMG A;  4HCK A;  1YHQ Q;  1VQ8 Q;  1M1G A;  3GPL A;  2JJ9 A;  3TCJ A;  3CCM A;  5I11 A;  1M27 C;  2NUP B;  2CYZ B;  1G3T A;  5GAO m;  3RR6 A;  1I1J A;  1WZO A;  1PC0 A;  2DL8 A;  3DLL A;  5GAN g;  2LJ3 A;  1YJW T;  1BCM A;  2W10 A;  2M1H A;  4M75 C;  4M7A A;  2EQJ A;  2RB6 A;  3BFM A;  4OMP A;  2DO3 A;  2AK5 A;  1KIK A;  2FPD A;  2DYB A;  3M4Y A;  3S3M A;  1OOT A;  3M0U A;  3CBP A;  2EW3 A;  3A8L B;  4J9D A;  5A0L A;  3EFS A;  3VKI A;  5GAO n;  4ESR A;  1SSH A;  1X2Q A;  1IB8 A;  2QQ9 A;  2MCN A;  3HSB A;  1ZSZ A;  3BDU A;  5L8R E;  1KJW A;  3NTI A;  1M1K U;  2LQK A;  1OYX A;  1R0C B;  4HVV A;  4OGC A;  2QAZ A;  2QDY B;  3MET A;  4XTV A;  3F70 A;  3A8O B;  1U06 A;  3OB9 A;  4M77 A;  3QJY A;  3GBQ A;  3UF4 A;  4IKF A;  2LC4 A; 
#chains in the Genus database with same CATH homology
 1XOV A;  1YN8 A;  3EG2 A;  1GFC A;  1M3C A;  1W70 A;  1A0N B;  2KT8 A;  2IIM A;  1ABQ A;  2H8H A;  3O5Z A;  4A63 B;  1RLP C;  2EYW A;  1ZX6 A;  1VA7 A;  2LP5 A;  3SHW A;  1I0C A;  2J05 A;  3IQL A;  1GCQ C;  1T3L A;  3VS2 A;  2J6F A;  3KFV A;  1OEB A;  2DL5 A;  2X3W D;  2JMC A;  1K9A A;  1JXO A;  2FO0 A;  3THK A;  1QCF A;  4J9B A;  1K1Z A;  2F2W A;  1UHC A;  1W1F A;  1OPK A;  2ECZ A;  2DL4 A;  1ZBJ A;  4CC4 B;  4CC7 A;  2DRM A;  1MUZ A;  2QDL A;  1B3Q A;  1WLP B;  1JU5 C;  2LCS A;  2C0O A;  2GQI A;  2A08 A;  2FRW A;  2LJ1 A;  2DBK A;  5EC7 A;  3H0I A;  4F16 A;  4WCI A;  4Y92 A;  3SEM A;  2DJQ A;  2A28 A;  2PNI A;  3EG3 A;  1H8K A;  2DF6 A;  2D8H A;  3VS4 A;  1NYF A;  2KNB B;  1UG1 A;  1AWX A;  4Z88 A;  5IXF A;  2W0Z A;  1T0H A;  2XMF A;  3NGP A;  1NM7 A;  2DMO A;  3QWX X;  2HBW A;  2KRO A;  3RBB B;  4QT7 A;  3REA B;  4LE9 A;  4R0K A;  1IO6 A;  2D0N A;  1CKA A;  4HVW A;  2KR3 A;  1NLP C;  2JS2 A;  4RTX A;  1SHF A;  1OV3 A;  3JV3 A;  1K76 A;  1QWE A;  4JZ4 A;  2F2X A;  3UA6 A;  2RQT A;  1YWP A;  2EGE A;  1FYN A;  2F2V A;  5GJV B;  3VS6 A;  1UFF A;  2VVK A;  1T0J A;  3M0R A;  3RNJ A;  2EVR A;  2J6O A;  3VS1 A;  2BZ8 A;  2O9S A;  2JTE A;  2G6F X;  2RF0 A;  4JJB A;  1B07 A;  3CQT A;  2FG0 A;  2ED0 A;  2D8J A;  3ZL7 C;  2PTK A;  4OMM A;  2V1R A;  2BZX A;  1WIE A;  1J3T A;  5ECA A;  4IIO A;  3TSZ A;  1I07 A;  2B86 A;  1AD5 A;  4OMN A;  2J06 A;  1NEB A;  2A36 A;  4JJC A;  3PVQ A;  3M0P A;  1GL5 A;  1WA7 A;  2EGC A;  2RQW A;  2PZ1 A;  1JO8 A;  1QWF A;  1Y0M A;  2YUQ A;  4KRT A;  1PWT A;  4JZ3 A;  1AWW A;  2O31 A;  1GFD A;  4LN2 A;  2RQV A;  1UTI A;  4J9G A;  2DM1 A;  3EHR A;  2K3B A;  2FEI A;  1K4U S;  1GRI A;  1SHG A;  2CUB A;  2DL3 A;  3REB B;  1U3O A;  1SRM A;  1VYV A;  1ZLM A;  1BU1 A;  4AFU C;  5I22 A;  1RI9 A;  3I35 A;  3I9Q A;  2M51 A;  3I5R A;  2LMJ A;  1NLO C;  1SPK A;  1NEG A;  2DE0 X;  3EGU A;  1AWO A;  1KFZ A;  2AZS A;  2JM8 A;  4HVU A;  2CUD A;  1S1N A;  2ROT A;  3NHN A;  2NUZ A;  2KBT A;  2C0T A;  1QLY A;  2O88 A;  2HDA A;  4CC3 A;  1FMK A;  1WXU A;  2LNH B;  2AKK A;  2SEM A;  3EHQ A;  1GBR A;  1X69 A;  4DEX A;  3VS7 A;  1CKB A;  1GBQ A;  2L3Q A;  2JMA A;  2EBP A;  5IHI A;  1PKT A;  4M4Z A;  2K9G A;  1QKX A;  1ZUK A;  2GBQ A;  4LUE A;  2BZY A;  1X6B A;  3FJ5 A;  4ZNX A;  1TUD A;  4J9H A;  2LQN A;  2A37 A;  2CSI A;  3UAT A;  2NWM A;  2GNC A;  1E6G A;  3PE0 A;  2X3X D;  2ESW A;  5IXB A;  4AG1 C;  2GTO A;  4EIK A;  2YUN A;  2JXB A;  2D1X A;  2DL7 A;  1BK2 A;  2JT4 A;  2DNU A;  1YNZ A;  1M3B A;  1ZSG A;  3TSW A;  2CT4 A;  1UGV A;  2DIL A;  2SRC A;  1YCS B;  2KT1 A;  1G83 A;  2O9V A;  3NMZ C;  3R6N A;  1X43 A;  1HJD A;  2AZV A;  5FWC A;  3U23 A;  4RTZ A;  1ZUY A;  2LX7 A;  2I0N A;  3VS5 A;  3NPF A;  2CDT A;  1SRL A;  1HSQ A;  2GGR A;  1UJY A;  1QKW A;  1AEY A;  4LUD A;  1WDX A;  1ZUU A;  1Z9Z A;  4D8D A;  2EYX A;  1Z9Q A;  1HD3 A;  2EGA A;  2RNA A;  2L3S A;  4OMQ A;  2FPF A;  2J7I A;  1YWO A;  2DA9 A;  1E6H A;  2ED1 A;  2BTT A;  4D8K A;  3I5S A;  4GBQ A;  1UHF A;  4OML A;  1PRM C;  4LNP A;  2RQR A;  2JS0 A;  4Z8A A;  2M0Y A;  2KYM A;  2RN8 A;  4AFQ C;  2E5K A;  3EG0 A;  2K6D A;  1M8M A;  2CH4 W;  2OI3 A;  2KE9 A;  1UUE A;  3H0F A;  1K0S A;  4F17 A;  1WXB A;  4CC2 A;  5IHK A;  1NYG A;  1GCP A;  1K0X A;  2YUP A;  3VS0 A;  1RUW A;  2KXC A;  1PHT A;  2P4R A;  4JJD A;  2HSP A;  2CRE A;  1CSK A;  1TG0 A;  4J9C A;  4J9F A;  4ORZ A;  3LH5 A;  2EYZ A;  3UA7 A;  2DX1 A;  4FSS A;  3H41 A;  4OMO A;  1WXT A;  4K11 A;  2CT3 A;  1X2K A;  5IH2 A;  1MV3 A;  2DBM A;  1JQQ A;  2VWF A;  1JXM A;  2FPE A;  2RQU A;  1YP5 A;  2RMO A;  1U5S A;  2HEQ A;  4RTU A;  2KRM A;  2YT6 A;  1EFN A;  1KSW A;  4Z89 A;  5GJW B;  1X6G A;  4AG2 C;  5FWB A;  1GCQ A;  2KRS A;  2KXD A;  1UEC A;  2L3P A;  4J9E A;  1M30 A;  2KGT A;  2LJ0 A;  5IHN A;  1Y57 A;  3H0H A;  1W6X A;  1E7O A;  2V1Q A;  2YUO A;  1LCK A;  3QWY A;  2LQW A;  2K7A A;  3VS3 A;  5L23 A;  4RTV A;  1VYU A;  1WFW A;  4F14 A;  2K2M A;  1M3A A;  3VRZ A;  2CH4 A;  2VKN A;  2KYB A;  2EPD A;  2OAW A;  3EG1 A;  3M0T A;  4X1V A;  1N5Z A;  1PKS A;  2FRY A;  1G2B A;  2DLP A;  3ULR B;  2C0I A;  5HCK A;  2DRK A;  1SEM A;  2YSQ A;  1MV0 B;  2ENM A;  1X27 A;  4HCK A;  4GLM A;  2EQI A;  2HCK A;  2KRN A;  1TUC A;  2YDL A;  5I11 A;  1M27 C;  4E6R A;  4DEY A;  2MIO A;  3VRY A;  1UE9 A;  4RTW A;  1I1J A;  4J9I A;  4AFZ C;  2DL8 A;  1AWJ A;  2LJ3 A;  1AOJ A;  2W10 A;  2O2O A;  1ABO A;  4IIM A;  1H3H A;  2DVJ A;  4OMP A;  2AK5 A;  1KIK A;  2ROL A;  1AZE A;  1UDL A;  1WYX A;  2FPD A;  2DYB A;  3PVL A;  3C0C A;  3TVT A;  2LZ6 B;  1VYT A;  1BBZ A;  2EYY A;  1OOT A;  2JW4 A;  2RPN A;  3M0Q A;  2EKH A;  3M0U A;  4AFS C;  2AKL A;  2EW3 A;  4J9D A;  1T3S A;  2MOX A;  2KEA A;  4JPB W;  4ESR A;  1SSH A;  1X2Q A;  1UJ0 A;  2L0A A;  1RLQ C;  5FW9 A;  2MCN A;  2OJ2 A;  4RTY A;  1PNJ A;  1KJW A;  2JM9 A;  1PRL C;  1H92 A;  2L2P A;  3A98 A;  4HVV A;  4RTT A;  4RUG A;  1V1C A;  1AZG B;  1U06 A;  2ABL A;  2K79 A;  1ARK A;  1JEG A;  1BB9 A;  2GTJ A;  1AVZ C;  4HXJ A;  2CSQ A;  3M0S A;  3GBQ A;  1OPL A;  1WI7 A;  1NG2 A;  1WX6 A;  3UF4 A;  2J6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...