1GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (signal transduction/peptide)
molecule keywords GRB2
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gbqA00
3I5SA 5L23A 4M4ZA 3RBBB 2XMFA 4CC4B 2VKNA 1QWEA 1GFCA 4OMLA 2LJ1A 2K2MA 2KR3A 1CSKA 1I07A 1NEGA 3TSWA 4RTWA 1UHCA 2AKKA 2V1RA 2M0YA 4RTUA 1E6GA 4OMOA 1YWPA 3EG3A 2J6FA 3ZL7C 2HSPA 1NLOC 2LNHB 3UA6A 4K11A 1XOVA 2DRMA 1PHTA 2JMAA 1TG0A 3LH5A 2EPDA 3M0UA 2ED0A 3EHRA 1UTIA 1S1NA 1NEBA 2M51A 3QWXX 2YDLA 2NWMA 4JZ3A 4AG1C 4CC2A 1GCQA 4DEXA 1JXOA 4F14A 2YSQA 3VS0A 1GBQA 2DL5A 1H3HA 2LCSA 1WI7A 1J3TA 2KXDA 4LNPA 1NG2A 2EYWA 2RPNA 2I0NA 3UA7A 2HEQA 3VS5A 1GFDA 4ORZA 3EGUA 1JQQA 2CSIA 1UGVA 2RQRA 1I1JA 4CC3A 1X6GA 4RTTA 1GBRA 1OPKA 4DEYA 3VS7A 1VYUA 2L3PA 2EBPA 2PNIA 2C0IA 2JMCA 2RQTA 1NLPC 2CREA 2DNUA 2KYMA 2YUPA 4RUGA 1AZGB 1A0NB 1OEBA 1G2BA 1AWJA 1PWTA 2K9GA 1HSQA 1SRLA 1KJWA 2V1QA 1IO6A 2CSQA 1M8MA 2D1XA 4AFQC 4J9EA 4AFZC 2YUQA 3O5ZA 1H92A 2EYXA 1M27C 4ESRA 5IH2A 4EIKA 2ED1A 2DYBA 4IIMA 2JTEA 1RLPC 3M0PA 4HVVA 2BZXA 3RNJA 2EYYA 1T0JA 1ZLMA 2FO0A 1SRMA 3VS2A 4D8KA 1Z9QA 2DL4A 2CT3A 2KT8A 2YUOA 3M0QA 2CT4A 3U23A 1PRMC 1K0XA 5FWCA 2DVJA 2DF6A 5FW9A 4AFUC 1N5ZA 1MV3A 2C0TA 1K9AA 4Y92A 4JJCA 5IXFA 2X3WD 1WXTA 1CKBA 3SEMA 1JEGA 4LUDA 2OI3A 1VA7A 1NYGA 4JPBW 2NUZA 1YN8A 2BTTA 2KRSA 3EG1A 3VRYA 2MIOA 4X1VA 2C0OA 3EG0A 1HD3A 4J9DA 2DM1A 2GQIA 4CC7A 2J7IA 4J9CA 2CUBA 4J9GA 2KRMA 4QT7A 2O31A 2D0NA 1YWOA 3NPFA 4KRTA 1K1ZA 4LE9A 2HBWA 3GBQA 1X43A 2O2OA 4HXJA 1BBZA 1WXBA 1GRIA 1UHFA 1WFWA 1FYNA 2BZ8A 3M0TA 4F16A 1MV0B 2DL8A 1BU1A 2JW4A 2D8HA 4LN2A 4OMPA 1MUZA 2F2XA 1W6XA 3VS3A 3H0HA 1RI9A 3TSZA 2KYBA 2ESWA 2VVKA 1JU5C 1K76A 2F2VA 1AEYA 3M0SA 2LJ0A 2JT4A 3UF4A 2DBMA 5IHNA 2CH4W 2A37A 3C0CA 1PRLC 2KXCA 2O9SA 2GGRA 1PNJA 4ZNXA 1NM7A 2ROLA 2MCNA 3PVQA 2YUNA 2FPEA 2KE9A 1SPKA 1T3SA 1ZX6A 2KEAA 2RNAA 2L3SA 2CH4A 2ECZA 1UDLA 2B86A 4R0KA 5IHKA 4HCKA 1FMKA 2J06A 2RQUA 4OMQA 2PZ1A 5ECAA 1X27A 1RLQC 1V1CA 1UJ0A 1ZBJA 2G6FX 5HCKA 1W70A 5I22A 1UFFA 2OAWA 3M0RA 1TUDA 2RQVA 1AVZC 2L2PA 2LJ3A 4RTYA 4HVWA 2H8HA 2AZSA 1GL5A 2CUDA 1YP5A 2K7AA 1WX6A 2DBKA 2P4RA 1SEMA 4LUEA 2W10A 2LP5A 2FRWA 3VS6A 2O88A 1KFZA 1E7OA 3VS4A 2ABLA 4OMNA 1Y0MA 2FEIA 1AZEA 3H41A 2VWFA 2L3QA 3TVTA 3JV3A 2OJ2A 1GCQC 2DILA 4GBQA 3R6NA 1M30A 2YT6A 5I11A 1BK2A 1NYFA 1QCFA 2MOXA 2L0AA 3REAB 4E6RA 1KIKA 1QKXA 2KROA 2HDAA 2EQIA 2FRYA 4AFSC 5GJVB 2HCKA 1ABOA 2BZYA 1SHGA 1Z9ZA 2DL3A 2LMJA 2LQNA 2FG0A 2DRKA 5EC7A 1AWWA 1Y57A 2KT1A 2A36A 1VYTA 1EFNA 1K4US 4OMMA 3VS1A 1AD5A 2EKHA 5IHIA 3UATA 1OPLA 2DE0X 3IQLA 3CQTA 3NHNA 4IIOA 4A63B 1U3OA 5IXBA 2DJQA 2JS2A 1M3CA 1X2QA 4F17A 1QKWA 2K3BA 4Z88A 2A08A 4J9BA 4JZ4A 2PTKA 1UE9A 2K6DA 1X2KA 2D8JA 2KBTA 3VRZA 1B07A 2X3XD 1PKSA 2DL7A 3QWYA 1K0SA 1TUCA 2F2WA 1U06A 2JS0A 2QDLA 1ARKA 2LX7A 5GJWB 3THKA 1M3AA 2LQWA 1E6HA 2DA9A 1BB9A 1AOJA 2GBQA 3KFVA 1ABQA 1JXMA 1OOTA 1VYVA 2ROTA 3PE0A 2RF0A 3A98A 1SSHA 1AWOA 2AKLA 1RUWA 4WCIA 1GCPA 2JM9A 3REBB 1G83A 1UG1A 1YCSB 2K79A 2A28A 2LZ6B 1UUEA 4HVUA 2AK5A 1M3BA 4JJBA 1PKTA 2FPFA 3NMZC 2E5KA 1UJYA 2CDTA 2W0ZA 1QLYA 1U5SA 3FJ5A 2JXBA 3SHWA 1X6BA 1WLPB 2IIMA 1X69A 1YNZA 1QWFA 1B3QA 1WA7A 1OV3A 3ULRB 2DMOA 4GLMA 1AWXA 4RTZA 2EGEA 4FSSA 2EW3A 2RMOA 2EGAA 4JJDA 4J9IA 4J9FA 2EVRA 2J6OA 3PVLA 1WYXA 3EHQA 1W1FA 2GNCA 2GTJA 3I9QA 3H0IA 1SHFA 1WXUA 2KNBB 4Z89A 4Z8AA 3NGPA 1ZUYA 2DLPA 2AZVA 1T0HA 2O9VA 2J05A 1JO8A 1ZUKA 4RTVA 1LCKA 1KSWA 2GTOA 5FWBA 1T3LA 2SEMA 2RQWA 1H8KA 2RN8A 2J6KA 2DX1A 4D8DA 3H0FA 1WDXA 2JM8A 1ZUUA 1UECA 3I35A 1I0CA 1WIEA 3I5RA 4RTXA 1HJDA 3EG2A 2EGCA 2KGTA 4J9HA 2KRNA 2ENMA 2EYZA 2SRCA 1CKAA 1ZSGA 2FPDA 4AG2C
chains in the Genus database with same CATH superfamily
3I5SA 4XK8E 1X6OA 2DD4A 3CBPA 1VQ7A 4Z02A 4M4ZA 3VUBA 5CKBA 1KHCA 5A0DA 2LJ1A 1CSKA 2GF7A 1M1KU 2RI3A 2QQ9A 2RD1A 4WTOB 4RTWA 1VQ6T 3BW1A 4RTUA 1IGUA 3DLMA 1Q95G 2HSPA 1SSFA 1QMCA 8AT1B 1PHTA 3JCMe 2QA4Q 2MI6A 2DO3A 2E10A 3QWXX 2YDLA 4M78G 1GCQA 5L8RE 3OYEA 4JRPA 3VS0A 4C92D 3JCMc 2PVOB 2FZGB 2HQXA 3MO8A 3UA7A 5KCOA 1GFDA 3PMIA 4ORZA 3EGUA 1JQQA 1YIJQ 1UGVA 2RQRA 1I1JA 4CC3A 1GBRA 8ATCB 3QUIA 2D0QB 1VYUA 2L3PA 2EBPA 2X4YA 2JVVA 2KI7A 4PFOA 4BE0A 1YITQ 2BE7D 2JMCA 4OMFB 2QA4A 2DNUA 4C0GA 1AZGB 1AHJB 4J7IA 3OSSC 1AWJA 1VQMQ 1PWTA 3G4SQ 2YLBA 3GP8A 3CCUT 1SRLA 1FWZA 3L2WA 2EKOA 2K5FA 4QVDA 2WSEE 2D1XA 4EPCA 4AFZC 3QSUA 2YUQA 1H92A 1M27C 3CBOA 2ED1A 2JTEA 3M0PA 4ELZC 4HVVA 3RNJA 2RHIA 3QZ9B 5CKEA 2EYYA 1QVFP 1YIJA 1VQLQ 4PJOD 5GANj 1NBEB 3QIIA 2FO0A 5J26A 4MMKA 3C95A 1MHNA 1VOMA 4PLLA 2D6FA 2YUOA 2CT4A 3GF5A 4LDWA 1YITA 2DF6A 5FW9A 4AFUC 1N5ZA 3PTAA 2C0TA 1C1AA 3LX7A 4Y92A 3L2ZA 4IUPA 4JJCA 5FU7B 1VQMA 3G4SA 4DOVA 1FX7A 1CKBA 3SEMA 1RABB 1IHVA 3CCJQ 2COZA 2VUBA 4JPBW 3S3MA 5GAOl 1EZZB 4RMOA 2KRSA 1VQ7T 5GANh 4HCBA 3PT9A 2RHZA 1VQLA 3M59A 3EG0A 1HD3A 4XTUA 1YJNQ 4ZGDB 2F69A 2CUBA 2HKNA 3EGDA 4PJOA 1K1ZA 2V26A 4R55A 4M7DC 3J81E 2XDBA 3WXMB 3BDLA 4Y28E 5D6WA 2COWA 2XD0A 3J7AF 4M7AF 2F5KA 2L89A 3M0TA 4F16A 3LW5E 2DL8A 2JW4A 2X51A 4C92C 3CCJA 1MUZA 2F2XA 1W6XA 3CCLT 4LD9K 1RI9A 3TSZA 4IURA 5CKFA 5GAN8 3CPWA 2K5IA 2LJ0A 2HKQB 2DBMA 4HT9A 1YJNA 4E7HA 2XK0A 2A37A 2O9SA 1PNJA 2ROLA 2DXCA 5CR2A 3PVQA 2K2VA 1KQSA 1SPKA 3QHSA 2LCCA 1T3SA 1ZX6A 1JJ2A 2VXFA 5IHKA 1VQOQ 2J06A 2RJFA 4OMQA 2QEXQ 5ECAA 1K9MU 1MGQA 4OVAA 5HCKA 1W70A 5A0LA 3HL8A 1G3YA 3HRUA 1AVZC 3CCMT 2L2PA 2LJ3A 4A53A 2ZPGB 1G3SA 3OA6A 1YP5A 1OU8A 5LJ5j 1VIEA 3A1PA 2DYIA 1RAIB 4PJLA 2EQMA 1VQ5T 3TREA 5J39A 3MP1A 1E7OA 3BY7A 3JCMh 1V76A 2FEIA 1AZEA 2VWFA 5DY9A 3TVTA 3X26B 3CCEQ 2DILA 3R6NA 4M7AA 3BFMA 1VQOA 1Q86R 4C8QC 2QEXA 4M75F 2KQWA 4E7JA 2KROA 2FRYA 5GJVB 3G7ZA 1ABOA 2KVQG 1IREB 1UEBA 3G71Q 5LJ5d 2QQSA 3CXCP 3X20B 1Z9ZA 2DL3A 2FG0A 5EC7A 3JB9J 3CEYA 2A36A 1VYTA 1QVGA 2DIGA 4OMMA 3IQLA 2RHXA 5CK9A 2DXUA 4IIOA 4A63B 5IXBA 1M3CA 1X2QA 3CCEA 4Z88A 3I56Q 4JZ4A 2LTOA 2CP3A 4XTYA 2EFIA 3SWNA 1B07A 3VRZA 2RJEA 2X3XD 2QASA 1V29B 1NJIC 1VQNQ 1TUCA 1NPRA 3NFCA 1U06A 4JRIA 5GANf 5CQYA 2QDLA 2P84A 1ARKA 4FW2A 3OMGA 2LX7A 5GJWB 3G71A 5GAMd 2A7YA 4F7UE 2RHYA 3EGXA 1OOTA 2CKKA 2R57A 5D6YA 1YJNT 3V7CA 1VYVA 2ROTA 3A98A 3CCRT 1SSHA 4OP0A 3CMEQ 4XU1A 1GCPA 1YCSB 4Q5WA 2LZ6B 3I56A 1M3BA 4JJBA 3FEOA 2W0ZA 1QLYA 1D1CA 3CC4Q 1U5SA 2EIFA 2JXBA 2NUTA 3M9QA 3LGLA 4PLIA 3M57A 4M75A 1VQNA 3EGDB 1NE8A 3ULRB 2DMOA 4GLMA 3ER0A 2EGEA 4M77C 4PNOA 3HFOA 1RAAB 4X34A 2EVRA 1WYXA 5M9OA 3CC7T 5KCHA 1M5Q1 3H0IA 3EG9B 3CMEA 3UT1A 2KNBB 3TCJA 3JB9H 4Z89A 2QQRA 2VYTA 1PSFA 3UWNA 4KGZB 2AZVA 3ASKA 2J05A 3CC4A 2K4YA 3OYHA 1ZUKA 2BUDA 1N8RU 2SEMA 1BIAA 5FU6B 2DZ9A 3SD4A 3OS2A 1VQ6Q 3H0FA 5I2SA 4ZN3A 1HXDA 1PM3A 2RO0A 4PJOG 2VC8A 2WSCE 3I35A 3I5RA 3EG2A 2O01E 1PC0A 2KGTA 5IN1A 5GAOr 3CCQT 2KRNA 3ZFJA 2LT1A 1UGSB 4C5GA 4J83A 5L23A 4M78C 2PVDB 5GAMg 2VKNA 1QWEA 1N9RA 1GFCA 1LNXA 3LLRA 2K2MA 3DB3A 2KR3A 2QYZA 4J6WA 1I07A 3QDRB 1NEGA 5LJ3d 1VQ6A 3M5AA 3OSVA 1E6GA 4OMOA 5LJ5f 2QDYB 3EG3A 1XQHA 3FIFA 3R6OA 3ZL7C 4B6MA 4M7AB 1M1GA 1MMGA 3RKXA 9ATCB 4GLKA 1LJOA 2JMAA 3OYGA 2QXFA 4HT8A 2EYQA 1IZ6A 3PGGA 1IRXA 5D7UA 1S1NA 1NEBA 3M53A 3CCUQ 3OYIA 2M51A 4JZ3A 2NWMA 3OS5A 4F14A 4ZN1A 5GAOq 2LCSA 1WI7A 2P0KA 3DLLA 1NG2A 4BY6C 4N4IA 3VS5A 2VV5A 1Q81C 1WHGA 4DBQA 4J6YA 5GANe 1WHLA 3E9FA 2CSIA 3LH0A 4JS5A 1LOJA 1YJWQ 3QBYA 3EFRA 3MHXA 2WSFE 1KC8C 3VV0A 2RQTA 3G6ET 2EJ9A 2QGFB 1ZA2B 3A5ZB 3SWNB 1JJ2P 1Q7YC 1A0NB 3F70A 3CCUA 1BI0A 2DXTA 4C0DC 1IO6A 1M8MA 4AFQC 5FLXE 4J9EA 4QVZA 3OMCA 1QP2A 5IH2A 3EGXB 4ZTJA 2HBPA 3RESA 3E9GA 4BE2A 2HQHA 4XQ3A 1IXDA 3OS1A 3VS2A 1YJWA 3ZEHA 1KD1C 3M0QA 3U23A 1K0XA 2E6ZA 3URGA 5FWCA 2DVJA 2E6NA 3H9NA 2NUTB 2Z0WA 4OGCA 4M75B 2JNGA 2OAUA 3HPWA 5I2MA 3RKWA 5LJ3g 2MWOA 1WXTA 3TEEA 1BI3A 3QZ5B 1P92A 3E1SA 3C94A 1VA7A 4AT1B 1M1KC 3RKYA 5FRNA 5FU7C 2A0FB 4J7FA 4N0AC 4BI3A 2E1HA 4PL6A 3EG1A 5CKDA 3JB9I 4X1VA 1N27A 4KGVB 4IKFA 1QVPA 1M90U 2LQ8A 4A4HA 2KRMA 4CI0C 2O31A 1YWOA 1MNDA 5HK3A 2FL7A 4M7DF 4VUBA 2QG9B 1ZQ1A 4P5NA 2E3IA 4DBRA 2D9TA 5GAN3 1JRIA 1BBZA 5CO7A 4O6JA 1DJ7B 1WXBA 1GRIA 1LVKA 3VKIA 3CCLA 4C92F 1BU1A 2D8HA 1Y96B 3VS3A 1TUGB 3H0HA 2YRDA 4KULA 3OYNA 3LGFA 1AEYA 3LWIA 3CCMQ 4ANJA 3JB9F 1C6VX 3SDZA 1Q82U 2CH4W 4KGXB 4MMLA 2DTHA 4C0ZA 3C0CA 1PRLC 5LJ5e 3DKMA 1VQ5Q 4PJMA 2YUNA 3QPHA 4MDXA 3L1AA 1M8VA 2H3JA 3EFOA 3OS0A 3MEAA 2ECZA 3PMTA 4HCKA 1FMKA 2RQUA 2RK2A 3VYGA 3OYMA 2YLCA 1UJ0A 4EMKA 3CPWS 1ZBJA 3CCMA 5I22A 2EWNA 1OZ3A 1TUDA 1IHWA 1D3BA 3NTKA 4DQ2A 4RTYA 3OYKA 4A4GA 2CUDA 1OX9A 4X9CA 2F5TX 2DERA 1VQ5A 1WX6A 1KQSS 1SEMA 4LUEA 2W10A 1RAEB 2FYKA 3JCMV 1H3ZA 1QW1A 2DIQA 1YJWT 1JJ2S 2RA2A 2DFUA 3VS4A 4OMNA 1KQ1A 4EDUA 5KH6A 3JV3A 3HRTA 1GCQC 3GIBA 4C8QF 2E64A 2YT6A 4MZMA 2E3HA 2CP6A 1AT1B 5I11A 1M2OA 1NYFA 3OYYA 3PFSA 3REAB 2K57A 4KH1B 1QKXA 1NJIR 5GAN5 1M1FA 1R0BG 1WJQA 4JLGA 3L2QA 2HCKA 3G1JA 1VQ4Q 2M16A 4QQGA 3V7SA 3TQ7P 1K8AC 2LQNA 3QYHB 1K73U 2DRKA 2XIDA 1AWWA 3CCRQ 1AD5A 2CYZB 2DE0X 3CQTA 3S3NA 4XTVA 3META 1QKWA 2K3BA 1MMAA 2HL3A 2V8JA 4J9BA 4M7DE 1UE9A 2Y4XA 3L42A 1X2KA 2D8JA 1H641 3EG9A 1PKSA 2DL7A 1K0SA 3BE3A 2FVUA 4F7UF 1VQ4A 4C92E 4BDYA 2HQEA 3M4GA 3THKA 5FROA 3CC7Q 1VIFA 1AOJA 1QVGS 2AHJB 3UDCA 3CCRA 1JXMA 3CPFA 2RF0A 3INZA 4RCBA 1AWOA 4WCIA 3JCMP 2JM9A 4M7AD 3MEWA 1K9MC 3CMAT 2AK5A 1PKTA 3GNGA 2E4HA 4V2SA 2CDTA 2PU9B 3QG1A 3CD6T 2PUOB 3QXEB 5GAN6 1X69A 3CCST 1B3QA 4R56A 4M77F 1AWXA 3PIPA 4CRIA 4OB2B 4KUDK 4XTZA 3CC7A 4PJOC 4J9FA 2J6OA 2OTJT 5GMKj 3EHQA 1VQKT 2EQKA 1KQ2A 3AHUA 3I9QA 2DTIA 3JAME 2QGGA 1I5LA 3CCQQ 1I81A 5C6SA 5CKHA 3KBGA 3M54A 2YHTA 3NGPA 2DLPA 4HA8A 2DJZA 2M0OA 1JO8A 1YHQQ 1LCKA 2GTOA 5FWBA 1T3LA 1H8KA 2AIRB 4JRKA 3S6WA 1ZBXA 1D0ZA 2J6KA 4C8QE 4D8DA 4A4FA 1JBMA 4F7UA 2JM8A 2VB6A 3OW2A 2LVMA 3EFOB 1PSEA 2ZPFB 2NUPA 4C5EA 1ZUUA 1UECA 4RG8A 5GANg 2ZGWA 3FRNA 5LJ5h 1S72T 4A4KA 1WIEA 1TS9A 5GAMj 1HJDA 3CCQA 4J9HA 4EMKB 2ENMA 1CKAA 1ZSGA 4FCYA 4Y91A 2E5QA 5GAOp 1WNLA 4M78F 2Y90A 3UPUA 1D3BB 4CC4B 3OYCA 2LCLA 2LT4A 4M75D 4OMLA 3E19A 1D09B 3LYIA 4PJJA 1VQ9T 1PG5B 4BE1A 4M7DB 2P0PA 1Q81R 3TSWA 1UHCA 2AKKA 2M0YA 1YWPA 1WHJA 2XG8D 4KBMB 1NLOC 2CP2A 2GQVA 1ZSZA 4QKUA 2EJGA 3CC2T 1VQ4T 3UA6A 4XTXA 3G6EQ 1HK9A 4K11A 1XOVA 5FRMA 3VUZA 4NL3A 1TG0A 4PFZA 3M0UA 1YI2T 1Q7YR 1FMVA 1U8RA 3EHRA 4M7AC 1W2BA 3HSBA 3H6ZA 4CC2A 4AG1C 2JJ9A 4DEXA 3I55Q 1JXOA 2YSQA 3GLXA 1GBQA 2DL5A 2RHUA 2JTFA 1J3TA 4E7LA 1M2VA 4E47A 1RAGB 2EYWA 2I0NA 2DETA 2HEQA 4ZTFA 1O9SA 1RI0A 5DLOA 4X9DA 4NS5A 4UC4A 3P8DA 1OPKA 3VS7A 1M9SA 1KD1R 2CS7A 3G6EA 2PNIA 4M77E 3KUFA 2FZCB 4LDYA 3OYAA 1X75C 2R58A 2KYMA 1UGPB 3ME9A 5CAIA 1OEBA 5KYWB 4JLIA 3L2VA 2K9GA 1N8RC 1HSQA 2CZ6B 2GFAA 1KJWA 1R8OB 3SWNC 3JCMg 1YCYA 1M1KR 2CZ7B 2EYXA 4ESRA 1VQPT 1QVFA 4IIMA 2XU8A 3FC3A 2BZXA 3HFNA 4DA4A 1F1BB 1YJ9T 2XDPA 4D8KA 1OI1A 3QDFA 2KT8A 4L5GA 3A8HB 1PRMC 5LJ3j 4C8QB 1Y96A 4FU6A 2E70A 5I21A 1B7TA 3WVEB 2X3WD 1BCMA 2HSEB 3GOXA 2FB7A 4LUDA 3RIRA 3GPLA 2OI3A 4KH0B 5EG2A 1PCXA 2O4XA 2NUZA 1KK7A 4J6XA 2BTTA 3JCMX 4M78E 1YHQT 2MIOA 2C0OA 1TWBA 4IUUA 1EX4A 4J9DA 4LDUA 4JJNK 2DM1A 2J7IA 3C4SA 3HHTB 3H8ZA 4J9GA 4QT7A 2D0NA 4N4HA 3X25B 4KRTA 2HBWA 2DAQA 3MEUA 2LRQA 5CQXA 1Y71A 1U1TA 1FYNA 2BZ8A 4F7UB 2MYSA 3OYLA 1Q86U 1ZA1B 2NUPB 5DLQE 5CCAA 2KYBA 2ESWA 1RADB 4JRQA 2VVKA 2QK0A 1K76A 2F2VA 3MCAB 3M0SA 1X01A 4E7IA 1RACB 5IHNA 3CPWP 1O75A 2XICA 4JUVA 4BB7A 2KXCA 4ZNXA 2ATCB 1NM7A 5GAMf 4DOWA 4GY5A 2COYA 3EH2A 2FPEA 4KUIA 2DZCA 1M4ZA 2KE9A 2XKOC 4L6V5 1FMWA 1KQSP 2RNAA 2CH4A 3QYGB 1MMNA 5C0MA 2B86A 4M77B 3RMQA 3MP8A 4R0KA 4TVRA 4M7AG 3RERA 1FXXA 3MKDA 2WACA 1X27A 1BI1A 2ZCFB 4N0AA 1OULA 2AT1B 2K3XA 1WQWA 3D7SB 1ZSZB 3I55T 1UFFA 2OAWA 3M0RA 1Q81U 2ZPIB 2G3RA 4HVWA 2H8HA 2NLUA 2RI5A 1GL5A 1WJRA 1XJWB 2HNIA 2K7AA 1K8AR 2P4RA 2Y4YA 1VUBA 2LP5A 3VS6A 3OYDA 3QKJA 2LC4A 2MMPA 5D6XA 1Y0MA 4MZPA 3H41A 1M2VB 2L3QA 4DBHA 2OJ2A 3EFSA 1W4SA 1G3WA 1RAHB 4OGEA 3KXTA 4E6RA 1KIKA 1MMDA 1G3TA 2EQIA 1M90C 3CXCA 5KE2A 3M4YA 2BZYA 1SHGA 3CCVT 4NOYA 3FJPA 2LMJA 5GAOn 1WQ7A 4M78B 3X28B 1Y57A 2KT1A 1EFNA 1K4US 3VS1A 2EKHA 4PKCC 3UATA 1OPLA 2RB6A 3NHNA 3JSCA 1QVGP 1U3OA 2HAXA 2JS2A 3CMAQ 1K9MR 2DD5A 2A08A 3N5BB 4QW2A 2IPOB 3CD6Q 2KBTA 3QO3A 3CCSQ 2X4JA 3VU3C 3QWYA 4M75G 3JCMW 1Q82C 2F2WA 2JS0A 3ZBDA 2EAYA 4A54A 2E12A 2B8AA 2CP7A 2ZPBB 2OTJQ 2L5QA 5LJ3f 1E6HA 1VQKQ 5GMKe 3KFVA 4M7DD 1ABQA 3M55A 1KHIA 2FZKB 5KYNA 3Q1JA 2O4XB 3CMAA 1W2BP 1G83A 4BY6B 2A28A 2E65A 1SG5A 3JCMJ 1UUEA 2MAMA 3V8KA 2FPFA 5HK0A 1UJYA 3CD6A 3FJ5A 3CCSA 4OB1B 1WLPB 2IIMA 1IB8A 1WA7A 4MZTA 3JRZA 1D1BA 3JB9D 3OB9A 5CIUA 2EW3A 2L3RA 4PJOF 2OTJA 1OZ2A 2NYSA 1VQKA 2DPPB 4J9IA 3PVLA 1S72Q 4BI8B 1W1FA 2GNCA 2GTJA 4C0DB 5GAMe 1B34A 4BD3A 1Y07A 1SHFA 1ZHIA 4IUTA 4F04B 2BKDN 4M7DA 2M02A 4FYVB 1ZUYA 2O9VA 1QCNA 3PNWC 4RTVA 4EMGA 1NZ9A 3L2UA 4IUVA 4C92A 1VQ9Q 2X4XA 2QI2A 1GXIE 1QP3A 1WDXA 2RH2A 1TU0B 1WJSA 2R5MA 1K73C 3V8LA 5IT9E 2MK5A 4E2FB 1S72A 3CC2Q 4FYXB 3OYFA 3OBWA 2DEUA 3WVDB 1WPYA 4RTXA 4FM4B 2EGCA 2M1HA 1YI2Q 2P0QA 2H3EB 3NTIA 3RUXA 2SRCA 3OBYA 2FPDA 4C8QD 4AG2C 2KSSA 4YTLA 4E7KA 2QAZA 2PUKB 2DTOA 4XTWA 3RBBB 4OB3B 2XMFA 3MJXA 2XDDA 4EMKC 4J8OA 4NL2A 3PIOA 5GANd 2HZYA 1VQ9A 2RJDA 1U1SA 3OW2S 3EH1A 2V1RA 5KYWA 2GCXA 4LDXA 3RDVA 2K5LA 2J6FA 3CC2A 1K8AU 4QQ6A 2LNHB 2CGHA 4PJNA 1VQ8Q 1N6AA 2CP0A 2XI9A 2DRMA 1YI2A 1JB0E 3LH5A 2EPDA 2QTXA 3C12A 2ED0A 1ACMB 1UTIA 3OQ5A 1BYMA 1N9SA 4RKUE 3L2RA 1N8RR 2DKGA 4RCCA 5A0GA 1D0XA 4C8QA 1VQPQ 1H3HA 2KY9A 2ZAEA 1OQKA 2KXDA 4LNPA 2EJFA 2RPNA 3OY9A 1RL2A 1YJ9Q 1D1AA 5GAOm 2CZ0B 1X6GA 4RTTA 2V8IA 4DEYA 2LQKA 2PVGB 2QTVA 2EQJA 5LJ3e 4C5IA 2OTLQ 1VQ8A 4BUGA 1MNEA 2C0IA 2RK1A 2I2LA 4PJOE 1NLPC 2CREA 2YUPA 1W2BS 4RUGA 2QA4T 5HY6A 1G2BA 3NTHA 4LXCA 1D0YA 2KK4A 2V1QA 3V8JA 1VQPA 2CSQA 3MPUB 2KMTA 1EIFA 3O5ZA 4EIKA 3A8MB 2DYBA 4M77D 2BIVA 1RLPC 1YFNA 3DB4A 5KYUA 4DBFA 4B9WA 1YJ9A 3M56A 2X35A 1T0JA 1ZLMA 2RM4A 1SRMA 1YIJT 1Z9QA 2DL4A 2CT3A 4ATOA 2OTLA 1G5VA 5GMKh 1HYOA 4C0FA 3JCMd 5FU6C 1MV3A 5GAN7 1YITT 1K9AA 2KAFA 1TSFA 4FYWB 5IXFA 5CVIA 5GMKl 2PQWA 2GFUA 4PFPA 2RI2A 3T9NA 2LDMA 5GAN2 1VQMT 3G4ST 1JEGA 3HKSA 1QVFS 1TH7A 6AT1B 1NYGA 3LWHA 1YHQA 1YN8A 3HP9A 4N4GA 2M9UA 3VRYA 1XTDA 2LX9A 2ZZDA 3P8HA 3HRSA 1B34B 4O5VA 1VQLT 4CC7A 2GQIA 4BACA 4M77A 1WGSA 4J9CA 2L8DA 2BE9B 3NPFA 5KYXA 4LE9A 2HMAA 2JOYA 2ZPHB 4XU3A 5GAMh 3GBQA 4JDSA 1X43A 1KC8R 2O2OA 2MWPA 4HXJA 4C92B 2DXBA 4M78D 5KYYA 1UHFA 1WFWA 1UGRB 1MV0B 4LN2A 1G8XA 4OMPA 4LD6A 3SFMA 1IGQA 4M7AE 2EQUA 1WHKA 4XU2A 3CCJT 5GMKm 3VYHB 1JU5C 2X4WA 3TU4K 5AYFA 1PD0A 2RJCA 3UF4A 2JT4A 5AT1B 1NJIU 2YXYA 1I8FA 3AT1B 2XHCA 3RMSA 2GGRA 5J3BA 4E7SA 4ZGJB 2MCNA 2VASA 5DM7R 1NPPA 4M7DG 3CBMA 2KEAA 3QJYA 3M58A 4MDWA 1VQ8T 2L3SA 1C0MA 1UDLA 2JN0A 1XNIA 1UGQB 3JCMb 3FB9A 4FT4A 2PZ1A 2MPXC 4C92G 4EMHA 4PJOB 1I5OB 4M78A 3E2UA 2CP5A 1RLQC 1OU9A 3I55A 1V1CA 1BKBA 1TXQA 2G6FX 1M90R 1WHHA 4XU0A 2RQVA 3CCVQ 3JB9G 2AZSA 1ZSZC 2IVWA 2DEQA 2DK3A 2DBKA 2FRWA 2O88A 2CZ1B 1KFZA 2HL5C 2QQBA 3RR6A 3OYJA 2ABLA 4J5YA 2OTLT 5LJ5g 5A2QE 1OYXA 4GBQA 1M30A 5HKCA 1VQOT 2V8KA 3S3OA 1BK2A 1QCFA 2QEXT 2MOXA 2L0AA 2F1LA 4M75C 4HCCA 1Q82R 2HDAA 1R77A 1SF9A 2YRCA 3X24B 2FHDA 4ME7A 4AFSC 1R0CB 4JS4A 4XAXB 4M75E 4RG2A 3CCVA 4WF2A 2QQAA 4BI4A 3FLGA 2JTMA 5LJ3h 3JCMf 3EAEA 2ZPEB 5IHIA 4QVCA 2DVEA 3JCMQ 3MEVA 1LPLA 2DJQA 2LNVA 2MF2A 4BDZA 1BI2A 2HD0A 4F17A 5KYUB 1Q86C 1Y7XA 2C06A 3CCET 2PTKA 4C8QG 4PK4A 2K6DA 1SKUB 4OB0B 3J80E 2X9HA 4ELYC 2VGMA 3MP6A 4KT0E 4QQDA 3CXCS 1TTHB 3BDUA 4IUQA 1M3AA 4D6WA 2LQWA 3VJPA 3G71T 2DA9A 1BB9A 2YWWA 1I4K1 2GBQA 5IAYA 1QQJA 4OF1A 3P8BB 3PE0A 5KE3A 1TOVA 1RAFB 2AKLA 1RUWA 3REBB 1UG1A 2K79A 1QCOA 4A4EA 1KG1A 4HVUA 4C5HA 2YRVA 3NMZC 2E5KA 3I56T 4HCZA 3HTRA 2JZ2A 1BCOA 1BIBA 4HKEA 1WZOA 3SHWA 2KDSA 1X6BA 3V7RA 1YBYA 3GNFB 7AT1B 1YNZA 1QWFA 2VXEA 3QJ6A 1OV3A 2E41A 4LDVA 5KYXB 1VQNT 5GMKi 4RTZA 3O8VA 4FSSA 2RMOA 1K73R 3A8GB 4F7UG 3A8OB 2P4TA 2EGAA 4JJDA 4E7ZA 1WHMA 4FIBA 5KYYB 3SB2A 5LL6S 1KC8U 1WXUA 4ZGEB 3CMET 4FT2A 2A3LA 4Z8AA 3OYBA 1T0HA 1Q7YU 1PD1A 1VQ7Q 4B9XA 2JUFA 1KSWA 2VGNA 3CC4T 5GAN4 2OX7A 2RQWA 2RN8A 4FW1A 2DX1A 3A8LB 4FSXA 4AMCA 4FL6A 4M77G 2IG0A 4II1A 3OW2P 1UB4A 1I0CA 4L59A 2K3YA 1KD1U 3FDRA 2EYZA 3CCLQ 4FYYB 2R5AA 1OX8A
chains in the Genus database with same CATH topology
3I5SA 5L23A 4M4ZA 3RBBB 2XMFA 4CC4B 2VKNA 1QWEA 1GFCA 4OMLA 2LJ1A 2K2MA 2KR3A 1CSKA 1I07A 1NEGA 3TSWA 4RTWA 1UHCA 2AKKA 2V1RA 2M0YA 4RTUA 1E6GA 4OMOA 1YWPA 3EG3A 2J6FA 3ZL7C 2HSPA 1NLOC 2LNHB 3UA6A 4K11A 1XOVA 2DRMA 1PHTA 2JMAA 1TG0A 3LH5A 2EPDA 3M0UA 2ED0A 3EHRA 1UTIA 1S1NA 1NEBA 2M51A 3QWXX 2YDLA 2NWMA 4JZ3A 4AG1C 4CC2A 1GCQA 4DEXA 1JXOA 4F14A 2YSQA 3VS0A 1GBQA 2DL5A 1H3HA 2LCSA 1WI7A 1J3TA 2KXDA 4LNPA 1NG2A 2EYWA 2RPNA 2I0NA 3UA7A 2HEQA 3VS5A 1GFDA 4ORZA 3EGUA 1JQQA 2CSIA 1UGVA 2RQRA 1I1JA 4CC3A 1X6GA 4RTTA 1GBRA 1OPKA 4DEYA 3VS7A 1VYUA 2L3PA 2EBPA 2PNIA 2C0IA 2JMCA 2RQTA 1NLPC 2CREA 2DNUA 2KYMA 2YUPA 4RUGA 1AZGB 1A0NB 1OEBA 1G2BA 1AWJA 1PWTA 2K9GA 1HSQA 1SRLA 1KJWA 2V1QA 1IO6A 2CSQA 1M8MA 2D1XA 4AFQC 4J9EA 4AFZC 2YUQA 3O5ZA 1H92A 2EYXA 1M27C 4ESRA 5IH2A 4EIKA 2ED1A 2DYBA 4IIMA 2JTEA 1RLPC 3M0PA 4HVVA 2BZXA 3RNJA 2EYYA 1T0JA 1ZLMA 2FO0A 1SRMA 3VS2A 4D8KA 1Z9QA 2DL4A 2CT3A 2KT8A 2YUOA 3M0QA 2CT4A 3U23A 1PRMC 1K0XA 5FWCA 2DVJA 2DF6A 5FW9A 4AFUC 1N5ZA 1MV3A 2C0TA 1K9AA 4Y92A 4JJCA 5IXFA 2X3WD 1WXTA 1CKBA 3SEMA 1JEGA 4LUDA 2OI3A 1VA7A 1NYGA 4JPBW 2NUZA 1YN8A 2BTTA 2KRSA 3EG1A 3VRYA 2MIOA 4X1VA 2C0OA 3EG0A 1HD3A 4J9DA 2DM1A 2GQIA 4CC7A 2J7IA 4J9CA 2CUBA 4J9GA 2KRMA 4QT7A 2O31A 2D0NA 1YWOA 3NPFA 4KRTA 1K1ZA 4LE9A 2HBWA 3GBQA 1X43A 2O2OA 4HXJA 1BBZA 1WXBA 1GRIA 1UHFA 1WFWA 1FYNA 2BZ8A 3M0TA 4F16A 1MV0B 2DL8A 1BU1A 2JW4A 2D8HA 4LN2A 4OMPA 1MUZA 2F2XA 1W6XA 3VS3A 3H0HA 1RI9A 3TSZA 2KYBA 2ESWA 2VVKA 1JU5C 1K76A 2F2VA 1AEYA 3M0SA 2LJ0A 2JT4A 3UF4A 2DBMA 5IHNA 2CH4W 2A37A 3C0CA 1PRLC 2KXCA 2O9SA 2GGRA 1PNJA 4ZNXA 1NM7A 2ROLA 2MCNA 3PVQA 2YUNA 2FPEA 2KE9A 1SPKA 1T3SA 1ZX6A 2KEAA 2RNAA 2L3SA 2CH4A 2ECZA 1UDLA 2B86A 4R0KA 5IHKA 4HCKA 1FMKA 2J06A 2RQUA 4OMQA 2PZ1A 5ECAA 1X27A 1RLQC 1V1CA 1UJ0A 1ZBJA 2G6FX 5HCKA 1W70A 5I22A 1UFFA 2OAWA 3M0RA 1TUDA 2RQVA 1AVZC 2L2PA 2LJ3A 4RTYA 4HVWA 2H8HA 2AZSA 1GL5A 2CUDA 1YP5A 2K7AA 1WX6A 2DBKA 2P4RA 1SEMA 4LUEA 2W10A 2LP5A 2FRWA 3VS6A 2O88A 1KFZA 1E7OA 3VS4A 2ABLA 4OMNA 1Y0MA 2FEIA 1AZEA 3H41A 2VWFA 2L3QA 3TVTA 3JV3A 2OJ2A 1GCQC 2DILA 4GBQA 3R6NA 1M30A 2YT6A 5I11A 1BK2A 1NYFA 1QCFA 2MOXA 2L0AA 3REAB 4E6RA 1KIKA 1QKXA 2KROA 2HDAA 2EQIA 2FRYA 4AFSC 5GJVB 2HCKA 1ABOA 2BZYA 1SHGA 1Z9ZA 2DL3A 2LMJA 2LQNA 2FG0A 2DRKA 5EC7A 1AWWA 1Y57A 2KT1A 2A36A 1VYTA 1EFNA 1K4US 4OMMA 3VS1A 1AD5A 2EKHA 5IHIA 3UATA 1OPLA 2DE0X 3IQLA 3CQTA 3NHNA 4IIOA 4A63B 1U3OA 5IXBA 2DJQA 2JS2A 1M3CA 1X2QA 4F17A 1QKWA 2K3BA 4Z88A 2A08A 4J9BA 4JZ4A 2PTKA 1UE9A 2K6DA 1X2KA 2D8JA 2KBTA 3VRZA 1B07A 2X3XD 1PKSA 2DL7A 3QWYA 1K0SA 1TUCA 2F2WA 1U06A 2JS0A 2QDLA 1ARKA 2LX7A 5GJWB 3THKA 1M3AA 2LQWA 1E6HA 2DA9A 1BB9A 1AOJA 2GBQA 3KFVA 1ABQA 1JXMA 1OOTA 1VYVA 2ROTA 3PE0A 2RF0A 3A98A 1SSHA 1AWOA 2AKLA 1RUWA 4WCIA 1GCPA 2JM9A 3REBB 1G83A 1UG1A 1YCSB 2K79A 2A28A 2LZ6B 1UUEA 4HVUA 2AK5A 1M3BA 4JJBA 1PKTA 2FPFA 3NMZC 2E5KA 1UJYA 2CDTA 2W0ZA 1QLYA 1U5SA 3FJ5A 2JXBA 3SHWA 1X6BA 1WLPB 2IIMA 1X69A 1YNZA 1QWFA 1B3QA 1WA7A 1OV3A 3ULRB 2DMOA 4GLMA 1AWXA 4RTZA 2EGEA 4FSSA 2EW3A 2RMOA 2EGAA 4JJDA 4J9IA 4J9FA 2EVRA 2J6OA 3PVLA 1WYXA 3EHQA 1W1FA 2GNCA 2GTJA 3I9QA 3H0IA 1SHFA 1WXUA 2KNBB 4Z89A 4Z8AA 3NGPA 1ZUYA 2DLPA 2AZVA 1T0HA 2O9VA 2J05A 1JO8A 1ZUKA 4RTVA 1LCKA 1KSWA 2GTOA 5FWBA 1T3LA 2SEMA 2RQWA 1H8KA 2RN8A 2J6KA 2DX1A 4D8DA 3H0FA 1WDXA 2JM8A 1ZUUA 1UECA 3I35A 1I0CA 1WIEA 3I5RA 4RTXA 1HJDA 3EG2A 2EGCA 2KGTA 4J9HA 2KRNA 2ENMA 2EYZA 2SRCA 1CKAA 1ZSGA 2FPDA 4AG2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5S A;  5L23 A;  4M4Z A;  3RBB B;  2XMF A;  4CC4 B;  2VKN A;  1QWE A;  1GFC A;  4OML A;  2LJ1 A;  2K2M A;  2KR3 A;  1CSK A;  1I07 A;  1NEG A;  3TSW A;  4RTW A;  1UHC A;  2AKK A;  2V1R A;  2M0Y A;  4RTU A;  1E6G A;  4OMO A;  1YWP A;  3EG3 A;  2J6F A;  3ZL7 C;  2HSP A;  1NLO C;  2LNH B;  3UA6 A;  4K11 A;  1XOV A;  2DRM A;  1PHT A;  2JMA A;  1TG0 A;  3LH5 A;  2EPD A;  3M0U A;  2ED0 A;  3EHR A;  1UTI A;  1S1N A;  1NEB A;  2M51 A;  3QWX X;  2YDL A;  2NWM A;  4JZ3 A;  4AG1 C;  4CC2 A;  1GCQ A;  4DEX A;  1JXO A;  4F14 A;  2YSQ A;  3VS0 A;  1GBQ A;  2DL5 A;  1H3H A;  2LCS A;  1WI7 A;  1J3T A;  2KXD A;  4LNP A;  1NG2 A;  2EYW A;  2RPN A;  2I0N A;  3UA7 A;  2HEQ A;  3VS5 A;  1GFD A;  4ORZ A;  3EGU A;  1JQQ A;  2CSI A;  1UGV A;  2RQR A;  1I1J A;  4CC3 A;  1X6G A;  4RTT A;  1GBR A;  1OPK A;  4DEY A;  3VS7 A;  1VYU A;  2L3P A;  2EBP A;  2PNI A;  2C0I A;  2JMC A;  2RQT A;  1NLP C;  2CRE A;  2DNU A;  2KYM A;  2YUP A;  4RUG A;  1AZG B;  1A0N B;  1OEB A;  1G2B A;  1AWJ A;  1PWT A;  2K9G A;  1HSQ A;  1SRL A;  1KJW A;  2V1Q A;  1IO6 A;  2CSQ A;  1M8M A;  2D1X A;  4AFQ C;  4J9E A;  4AFZ C;  2YUQ A;  3O5Z A;  1H92 A;  2EYX A;  1M27 C;  4ESR A;  5IH2 A;  4EIK A;  2ED1 A;  2DYB A;  4IIM A;  2JTE A;  1RLP C;  3M0P A;  4HVV A;  2BZX A;  3RNJ A;  2EYY A;  1T0J A;  1ZLM A;  2FO0 A;  1SRM A;  3VS2 A;  4D8K A;  1Z9Q A;  2DL4 A;  2CT3 A;  2KT8 A;  2YUO A;  3M0Q A;  2CT4 A;  3U23 A;  1PRM C;  1K0X A;  5FWC A;  2DVJ A;  2DF6 A;  5FW9 A;  4AFU C;  1N5Z A;  1MV3 A;  2C0T A;  1K9A A;  4Y92 A;  4JJC A;  5IXF A;  2X3W D;  1WXT A;  1CKB A;  3SEM A;  1JEG A;  4LUD A;  2OI3 A;  1VA7 A;  1NYG A;  4JPB W;  2NUZ A;  1YN8 A;  2BTT A;  2KRS A;  3EG1 A;  3VRY A;  2MIO A;  4X1V A;  2C0O A;  3EG0 A;  1HD3 A;  4J9D A;  2DM1 A;  2GQI A;  4CC7 A;  2J7I A;  4J9C A;  2CUB A;  4J9G A;  2KRM A;  4QT7 A;  2O31 A;  2D0N A;  1YWO A;  3NPF A;  4KRT A;  1K1Z A;  4LE9 A;  2HBW A;  3GBQ A;  1X43 A;  2O2O A;  4HXJ A;  1BBZ A;  1WXB A;  1GRI A;  1UHF A;  1WFW A;  1FYN A;  2BZ8 A;  3M0T A;  4F16 A;  1MV0 B;  2DL8 A;  1BU1 A;  2JW4 A;  2D8H A;  4LN2 A;  4OMP A;  1MUZ A;  2F2X A;  1W6X A;  3VS3 A;  3H0H A;  1RI9 A;  3TSZ A;  2KYB A;  2ESW A;  2VVK A;  1JU5 C;  1K76 A;  2F2V A;  1AEY A;  3M0S A;  2LJ0 A;  2JT4 A;  3UF4 A;  2DBM A;  5IHN A;  2CH4 W;  2A37 A;  3C0C A;  1PRL C;  2KXC A;  2O9S A;  2GGR A;  1PNJ A;  4ZNX A;  1NM7 A;  2ROL A;  2MCN A;  3PVQ A;  2YUN A;  2FPE A;  2KE9 A;  1SPK A;  1T3S A;  1ZX6 A;  2KEA A;  2RNA A;  2L3S A;  2CH4 A;  2ECZ A;  1UDL A;  2B86 A;  4R0K A;  5IHK A;  4HCK A;  1FMK A;  2J06 A;  2RQU A;  4OMQ A;  2PZ1 A;  5ECA A;  1X27 A;  1RLQ C;  1V1C A;  1UJ0 A;  1ZBJ A;  2G6F X;  5HCK A;  1W70 A;  5I22 A;  1UFF A;  2OAW A;  3M0R A;  1TUD A;  2RQV A;  1AVZ C;  2L2P A;  2LJ3 A;  4RTY A;  4HVW A;  2H8H A;  2AZS A;  1GL5 A;  2CUD A;  1YP5 A;  2K7A A;  1WX6 A;  2DBK A;  2P4R A;  1SEM A;  4LUE A;  2W10 A;  2LP5 A;  2FRW A;  3VS6 A;  2O88 A;  1KFZ A;  1E7O A;  3VS4 A;  2ABL A;  4OMN A;  1Y0M A;  2FEI A;  1AZE A;  3H41 A;  2VWF A;  2L3Q A;  3TVT A;  3JV3 A;  2OJ2 A;  1GCQ C;  2DIL A;  4GBQ A;  3R6N A;  1M30 A;  2YT6 A;  5I11 A;  1BK2 A;  1NYF A;  1QCF A;  2MOX A;  2L0A A;  3REA B;  4E6R A;  1KIK A;  1QKX A;  2KRO A;  2HDA A;  2EQI A;  2FRY A;  4AFS C;  5GJV B;  2HCK A;  1ABO A;  2BZY A;  1SHG A;  1Z9Z A;  2DL3 A;  2LMJ A;  2LQN A;  2FG0 A;  2DRK A;  5EC7 A;  1AWW A;  1Y57 A;  2KT1 A;  2A36 A;  1VYT A;  1EFN A;  1K4U S;  4OMM A;  3VS1 A;  1AD5 A;  2EKH A;  5IHI A;  3UAT A;  1OPL A;  2DE0 X;  3IQL A;  3CQT A;  3NHN A;  4IIO A;  4A63 B;  1U3O A;  5IXB A;  2DJQ A;  2JS2 A;  1M3C A;  1X2Q A;  4F17 A;  1QKW A;  2K3B A;  4Z88 A;  2A08 A;  4J9B A;  4JZ4 A;  2PTK A;  1UE9 A;  2K6D A;  1X2K A;  2D8J A;  2KBT A;  3VRZ A;  1B07 A;  2X3X D;  1PKS A;  2DL7 A;  3QWY A;  1K0S A;  1TUC A;  2F2W A;  1U06 A;  2JS0 A;  2QDL A;  1ARK A;  2LX7 A;  5GJW B;  3THK A;  1M3A A;  2LQW A;  1E6H A;  2DA9 A;  1BB9 A;  1AOJ A;  2GBQ A;  3KFV A;  1ABQ A;  1JXM A;  1OOT A;  1VYV A;  2ROT A;  3PE0 A;  2RF0 A;  3A98 A;  1SSH A;  1AWO A;  2AKL A;  1RUW A;  4WCI A;  1GCP A;  2JM9 A;  3REB B;  1G83 A;  1UG1 A;  1YCS B;  2K79 A;  2A28 A;  2LZ6 B;  1UUE A;  4HVU A;  2AK5 A;  1M3B A;  4JJB A;  1PKT A;  2FPF A;  3NMZ C;  2E5K A;  1UJY A;  2CDT A;  2W0Z A;  1QLY A;  1U5S A;  3FJ5 A;  2JXB A;  3SHW A;  1X6B A;  1WLP B;  2IIM A;  1X69 A;  1YNZ A;  1QWF A;  1B3Q A;  1WA7 A;  1OV3 A;  3ULR B;  2DMO A;  4GLM A;  1AWX A;  4RTZ A;  2EGE A;  4FSS A;  2EW3 A;  2RMO A;  2EGA A;  4JJD A;  4J9I A;  4J9F A;  2EVR A;  2J6O A;  3PVL A;  1WYX A;  3EHQ A;  1W1F A;  2GNC A;  2GTJ A;  3I9Q A;  3H0I A;  1SHF A;  1WXU A;  2KNB B;  4Z89 A;  4Z8A A;  3NGP A;  1ZUY A;  2DLP A;  2AZV A;  1T0H A;  2O9V A;  2J05 A;  1JO8 A;  1ZUK A;  4RTV A;  1LCK A;  1KSW A;  2GTO A;  5FWB A;  1T3L A;  2SEM A;  2RQW A;  1H8K A;  2RN8 A;  2J6K A;  2DX1 A;  4D8D A;  3H0F A;  1WDX A;  2JM8 A;  1ZUU A;  1UEC A;  3I35 A;  1I0C A;  1WIE A;  3I5R A;  4RTX A;  1HJD A;  3EG2 A;  2EGC A;  2KGT A;  4J9H A;  2KRN A;  2ENM A;  2EYZ A;  2SRC A;  1CKA A;  1ZSG A;  2FPD A;  4AG2 C; 
#chains in the Genus database with same CATH topology
 3I5S A;  4XK8 E;  1X6O A;  2DD4 A;  3CBP A;  1VQ7 A;  4Z02 A;  4M4Z A;  3VUB A;  5CKB A;  1KHC A;  5A0D A;  2LJ1 A;  1CSK A;  2GF7 A;  1M1K U;  2RI3 A;  2QQ9 A;  2RD1 A;  4WTO B;  4RTW A;  1VQ6 T;  3BW1 A;  4RTU A;  1IGU A;  3DLM A;  1Q95 G;  2HSP A;  1SSF A;  1QMC A;  8AT1 B;  1PHT A;  3JCM e;  2QA4 Q;  2MI6 A;  2DO3 A;  2E10 A;  3QWX X;  2YDL A;  4M78 G;  1GCQ A;  5L8R E;  3OYE A;  4JRP A;  3VS0 A;  4C92 D;  3JCM c;  2PVO B;  2FZG B;  2HQX A;  3MO8 A;  3UA7 A;  5KCO A;  1GFD A;  3PMI A;  4ORZ A;  3EGU A;  1JQQ A;  1YIJ Q;  1UGV A;  2RQR A;  1I1J A;  4CC3 A;  1GBR A;  8ATC B;  3QUI A;  2D0Q B;  1VYU A;  2L3P A;  2EBP A;  2X4Y A;  2JVV A;  2KI7 A;  4PFO A;  4BE0 A;  1YIT Q;  2BE7 D;  2JMC A;  4OMF B;  2QA4 A;  2DNU A;  4C0G A;  1AZG B;  1AHJ B;  4J7I A;  3OSS C;  1AWJ A;  1VQM Q;  1PWT A;  3G4S Q;  2YLB A;  3GP8 A;  3CCU T;  1SRL A;  1FWZ A;  3L2W A;  2EKO A;  2K5F A;  4QVD A;  2WSE E;  2D1X A;  4EPC A;  4AFZ C;  3QSU A;  2YUQ A;  1H92 A;  1M27 C;  3CBO A;  2ED1 A;  2JTE A;  3M0P A;  4ELZ C;  4HVV A;  3RNJ A;  2RHI A;  3QZ9 B;  5CKE A;  2EYY A;  1QVF P;  1YIJ A;  1VQL Q;  4PJO D;  5GAN j;  1NBE B;  3QII A;  2FO0 A;  5J26 A;  4MMK A;  3C95 A;  1MHN A;  1VOM A;  4PLL A;  2D6F A;  2YUO A;  2CT4 A;  3GF5 A;  4LDW A;  1YIT A;  2DF6 A;  5FW9 A;  4AFU C;  1N5Z A;  3PTA A;  2C0T A;  1C1A A;  3LX7 A;  4Y92 A;  3L2Z A;  4IUP A;  4JJC A;  5FU7 B;  1VQM A;  3G4S A;  4DOV A;  1FX7 A;  1CKB A;  3SEM A;  1RAB B;  1IHV A;  3CCJ Q;  2COZ A;  2VUB A;  4JPB W;  3S3M A;  5GAO l;  1EZZ B;  4RMO A;  2KRS A;  1VQ7 T;  5GAN h;  4HCB A;  3PT9 A;  2RHZ A;  1VQL A;  3M59 A;  3EG0 A;  1HD3 A;  4XTU A;  1YJN Q;  4ZGD B;  2F69 A;  2CUB A;  2HKN A;  3EGD A;  4PJO A;  1K1Z A;  2V26 A;  4R55 A;  4M7D C;  3J81 E;  2XDB A;  3WXM B;  3BDL A;  4Y28 E;  5D6W A;  2COW A;  2XD0 A;  3J7A F;  4M7A F;  2F5K A;  2L89 A;  3M0T A;  4F16 A;  3LW5 E;  2DL8 A;  2JW4 A;  2X51 A;  4C92 C;  3CCJ A;  1MUZ A;  2F2X A;  1W6X A;  3CCL T;  4LD9 K;  1RI9 A;  3TSZ A;  4IUR A;  5CKF A;  5GAN 8;  3CPW A;  2K5I A;  2LJ0 A;  2HKQ B;  2DBM A;  4HT9 A;  1YJN A;  4E7H A;  2XK0 A;  2A37 A;  2O9S A;  1PNJ A;  2ROL A;  2DXC A;  5CR2 A;  3PVQ A;  2K2V A;  1KQS A;  1SPK A;  3QHS A;  2LCC A;  1T3S A;  1ZX6 A;  1JJ2 A;  2VXF A;  5IHK A;  1VQO Q;  2J06 A;  2RJF A;  4OMQ A;  2QEX Q;  5ECA A;  1K9M U;  1MGQ A;  4OVA A;  5HCK A;  1W70 A;  5A0L A;  3HL8 A;  1G3Y A;  3HRU A;  1AVZ C;  3CCM T;  2L2P A;  2LJ3 A;  4A53 A;  2ZPG B;  1G3S A;  3OA6 A;  1YP5 A;  1OU8 A;  5LJ5 j;  1VIE A;  3A1P A;  2DYI A;  1RAI B;  4PJL A;  2EQM A;  1VQ5 T;  3TRE A;  5J39 A;  3MP1 A;  1E7O A;  3BY7 A;  3JCM h;  1V76 A;  2FEI A;  1AZE A;  2VWF A;  5DY9 A;  3TVT A;  3X26 B;  3CCE Q;  2DIL A;  3R6N A;  4M7A A;  3BFM A;  1VQO A;  1Q86 R;  4C8Q C;  2QEX A;  4M75 F;  2KQW A;  4E7J A;  2KRO A;  2FRY A;  5GJV B;  3G7Z A;  1ABO A;  2KVQ G;  1IRE B;  1UEB A;  3G71 Q;  5LJ5 d;  2QQS A;  3CXC P;  3X20 B;  1Z9Z A;  2DL3 A;  2FG0 A;  5EC7 A;  3JB9 J;  3CEY A;  2A36 A;  1VYT A;  1QVG A;  2DIG A;  4OMM A;  3IQL A;  2RHX A;  5CK9 A;  2DXU A;  4IIO A;  4A63 B;  5IXB A;  1M3C A;  1X2Q A;  3CCE A;  4Z88 A;  3I56 Q;  4JZ4 A;  2LTO A;  2CP3 A;  4XTY A;  2EFI A;  3SWN A;  1B07 A;  3VRZ A;  2RJE A;  2X3X D;  2QAS A;  1V29 B;  1NJI C;  1VQN Q;  1TUC A;  1NPR A;  3NFC A;  1U06 A;  4JRI A;  5GAN f;  5CQY A;  2QDL A;  2P84 A;  1ARK A;  4FW2 A;  3OMG A;  2LX7 A;  5GJW B;  3G71 A;  5GAM d;  2A7Y A;  4F7U E;  2RHY A;  3EGX A;  1OOT A;  2CKK A;  2R57 A;  5D6Y A;  1YJN T;  3V7C A;  1VYV A;  2ROT A;  3A98 A;  3CCR T;  1SSH A;  4OP0 A;  3CME Q;  4XU1 A;  1GCP A;  1YCS B;  4Q5W A;  2LZ6 B;  3I56 A;  1M3B A;  4JJB A;  3FEO A;  2W0Z A;  1QLY A;  1D1C A;  3CC4 Q;  1U5S A;  2EIF A;  2JXB A;  2NUT A;  3M9Q A;  3LGL A;  4PLI A;  3M57 A;  4M75 A;  1VQN A;  3EGD B;  1NE8 A;  3ULR B;  2DMO A;  4GLM A;  3ER0 A;  2EGE A;  4M77 C;  4PNO A;  3HFO A;  1RAA B;  4X34 A;  2EVR A;  1WYX A;  5M9O A;  3CC7 T;  5KCH A;  1M5Q 1;  3H0I A;  3EG9 B;  3CME A;  3UT1 A;  2KNB B;  3TCJ A;  3JB9 H;  4Z89 A;  2QQR A;  2VYT A;  1PSF A;  3UWN A;  4KGZ B;  2AZV A;  3ASK A;  2J05 A;  3CC4 A;  2K4Y A;  3OYH A;  1ZUK A;  2BUD A;  1N8R U;  2SEM A;  1BIA A;  5FU6 B;  2DZ9 A;  3SD4 A;  3OS2 A;  1VQ6 Q;  3H0F A;  5I2S A;  4ZN3 A;  1HXD A;  1PM3 A;  2RO0 A;  4PJO G;  2VC8 A;  2WSC E;  3I35 A;  3I5R A;  3EG2 A;  2O01 E;  1PC0 A;  2KGT A;  5IN1 A;  5GAO r;  3CCQ T;  2KRN A;  3ZFJ A;  2LT1 A;  1UGS B;  4C5G A;  4J83 A;  5L23 A;  4M78 C;  2PVD B;  5GAM g;  2VKN A;  1QWE A;  1N9R A;  1GFC A;  1LNX A;  3LLR A;  2K2M A;  3DB3 A;  2KR3 A;  2QYZ A;  4J6W A;  1I07 A;  3QDR B;  1NEG A;  5LJ3 d;  1VQ6 A;  3M5A A;  3OSV A;  1E6G A;  4OMO A;  5LJ5 f;  2QDY B;  3EG3 A;  1XQH A;  3FIF A;  3R6O A;  3ZL7 C;  4B6M A;  4M7A B;  1M1G A;  1MMG A;  3RKX A;  9ATC B;  4GLK A;  1LJO A;  2JMA A;  3OYG A;  2QXF A;  4HT8 A;  2EYQ A;  1IZ6 A;  3PGG A;  1IRX A;  5D7U A;  1S1N A;  1NEB A;  3M53 A;  3CCU Q;  3OYI A;  2M51 A;  4JZ3 A;  2NWM A;  3OS5 A;  4F14 A;  4ZN1 A;  5GAO q;  2LCS A;  1WI7 A;  2P0K A;  3DLL A;  1NG2 A;  4BY6 C;  4N4I A;  3VS5 A;  2VV5 A;  1Q81 C;  1WHG A;  4DBQ A;  4J6Y A;  5GAN e;  1WHL A;  3E9F A;  2CSI A;  3LH0 A;  4JS5 A;  1LOJ A;  1YJW Q;  3QBY A;  3EFR A;  3MHX A;  2WSF E;  1KC8 C;  3VV0 A;  2RQT A;  3G6E T;  2EJ9 A;  2QGF B;  1ZA2 B;  3A5Z B;  3SWN B;  1JJ2 P;  1Q7Y C;  1A0N B;  3F70 A;  3CCU A;  1BI0 A;  2DXT A;  4C0D C;  1IO6 A;  1M8M A;  4AFQ C;  5FLX E;  4J9E A;  4QVZ A;  3OMC A;  1QP2 A;  5IH2 A;  3EGX B;  4ZTJ A;  2HBP A;  3RES A;  3E9G A;  4BE2 A;  2HQH A;  4XQ3 A;  1IXD A;  3OS1 A;  3VS2 A;  1YJW A;  3ZEH A;  1KD1 C;  3M0Q A;  3U23 A;  1K0X A;  2E6Z A;  3URG A;  5FWC A;  2DVJ A;  2E6N A;  3H9N A;  2NUT B;  2Z0W A;  4OGC A;  4M75 B;  2JNG A;  2OAU A;  3HPW A;  5I2M A;  3RKW A;  5LJ3 g;  2MWO A;  1WXT A;  3TEE A;  1BI3 A;  3QZ5 B;  1P92 A;  3E1S A;  3C94 A;  1VA7 A;  4AT1 B;  1M1K C;  3RKY A;  5FRN A;  5FU7 C;  2A0F B;  4J7F A;  4N0A C;  4BI3 A;  2E1H A;  4PL6 A;  3EG1 A;  5CKD A;  3JB9 I;  4X1V A;  1N27 A;  4KGV B;  4IKF A;  1QVP A;  1M90 U;  2LQ8 A;  4A4H A;  2KRM A;  4CI0 C;  2O31 A;  1YWO A;  1MND A;  5HK3 A;  2FL7 A;  4M7D F;  4VUB A;  2QG9 B;  1ZQ1 A;  4P5N A;  2E3I A;  4DBR A;  2D9T A;  5GAN 3;  1JRI A;  1BBZ A;  5CO7 A;  4O6J A;  1DJ7 B;  1WXB A;  1GRI A;  1LVK A;  3VKI A;  3CCL A;  4C92 F;  1BU1 A;  2D8H A;  1Y96 B;  3VS3 A;  1TUG B;  3H0H A;  2YRD A;  4KUL A;  3OYN A;  3LGF A;  1AEY A;  3LWI A;  3CCM Q;  4ANJ A;  3JB9 F;  1C6V X;  3SDZ A;  1Q82 U;  2CH4 W;  4KGX B;  4MML A;  2DTH A;  4C0Z A;  3C0C A;  1PRL C;  5LJ5 e;  3DKM A;  1VQ5 Q;  4PJM A;  2YUN A;  3QPH A;  4MDX A;  3L1A A;  1M8V A;  2H3J A;  3EFO A;  3OS0 A;  3MEA A;  2ECZ A;  3PMT A;  4HCK A;  1FMK A;  2RQU A;  2RK2 A;  3VYG A;  3OYM A;  2YLC A;  1UJ0 A;  4EMK A;  3CPW S;  1ZBJ A;  3CCM A;  5I22 A;  2EWN A;  1OZ3 A;  1TUD A;  1IHW A;  1D3B A;  3NTK A;  4DQ2 A;  4RTY A;  3OYK A;  4A4G A;  2CUD A;  1OX9 A;  4X9C A;  2F5T X;  2DER A;  1VQ5 A;  1WX6 A;  1KQS S;  1SEM A;  4LUE A;  2W10 A;  1RAE B;  2FYK A;  3JCM V;  1H3Z A;  1QW1 A;  2DIQ A;  1YJW T;  1JJ2 S;  2RA2 A;  2DFU A;  3VS4 A;  4OMN A;  1KQ1 A;  4EDU A;  5KH6 A;  3JV3 A;  3HRT A;  1GCQ C;  3GIB A;  4C8Q F;  2E64 A;  2YT6 A;  4MZM A;  2E3H A;  2CP6 A;  1AT1 B;  5I11 A;  1M2O A;  1NYF A;  3OYY A;  3PFS A;  3REA B;  2K57 A;  4KH1 B;  1QKX A;  1NJI R;  5GAN 5;  1M1F A;  1R0B G;  1WJQ A;  4JLG A;  3L2Q A;  2HCK A;  3G1J A;  1VQ4 Q;  2M16 A;  4QQG A;  3V7S A;  3TQ7 P;  1K8A C;  2LQN A;  3QYH B;  1K73 U;  2DRK A;  2XID A;  1AWW A;  3CCR Q;  1AD5 A;  2CYZ B;  2DE0 X;  3CQT A;  3S3N A;  4XTV A;  3MET A;  1QKW A;  2K3B A;  1MMA A;  2HL3 A;  2V8J A;  4J9B A;  4M7D E;  1UE9 A;  2Y4X A;  3L42 A;  1X2K A;  2D8J A;  1H64 1;  3EG9 A;  1PKS A;  2DL7 A;  1K0S A;  3BE3 A;  2FVU A;  4F7U F;  1VQ4 A;  4C92 E;  4BDY A;  2HQE A;  3M4G A;  3THK A;  5FRO A;  3CC7 Q;  1VIF A;  1AOJ A;  1QVG S;  2AHJ B;  3UDC A;  3CCR A;  1JXM A;  3CPF A;  2RF0 A;  3INZ A;  4RCB A;  1AWO A;  4WCI A;  3JCM P;  2JM9 A;  4M7A D;  3MEW A;  1K9M C;  3CMA T;  2AK5 A;  1PKT A;  3GNG A;  2E4H A;  4V2S A;  2CDT A;  2PU9 B;  3QG1 A;  3CD6 T;  2PUO B;  3QXE B;  5GAN 6;  1X69 A;  3CCS T;  1B3Q A;  4R56 A;  4M77 F;  1AWX A;  3PIP A;  4CRI A;  4OB2 B;  4KUD K;  4XTZ A;  3CC7 A;  4PJO C;  4J9F A;  2J6O A;  2OTJ T;  5GMK j;  3EHQ A;  1VQK T;  2EQK A;  1KQ2 A;  3AHU A;  3I9Q A;  2DTI A;  3JAM E;  2QGG A;  1I5L A;  3CCQ Q;  1I81 A;  5C6S A;  5CKH A;  3KBG A;  3M54 A;  2YHT A;  3NGP A;  2DLP A;  4HA8 A;  2DJZ A;  2M0O A;  1JO8 A;  1YHQ Q;  1LCK A;  2GTO A;  5FWB A;  1T3L A;  1H8K A;  2AIR B;  4JRK A;  3S6W A;  1ZBX A;  1D0Z A;  2J6K A;  4C8Q E;  4D8D A;  4A4F A;  1JBM A;  4F7U A;  2JM8 A;  2VB6 A;  3OW2 A;  2LVM A;  3EFO B;  1PSE A;  2ZPF B;  2NUP A;  4C5E A;  1ZUU A;  1UEC A;  4RG8 A;  5GAN g;  2ZGW A;  3FRN A;  5LJ5 h;  1S72 T;  4A4K A;  1WIE A;  1TS9 A;  5GAM j;  1HJD A;  3CCQ A;  4J9H A;  4EMK B;  2ENM A;  1CKA A;  1ZSG A;  4FCY A;  4Y91 A;  2E5Q A;  5GAO p;  1WNL A;  4M78 F;  2Y90 A;  3UPU A;  1D3B B;  4CC4 B;  3OYC A;  2LCL A;  2LT4 A;  4M75 D;  4OML A;  3E19 A;  1D09 B;  3LYI A;  4PJJ A;  1VQ9 T;  1PG5 B;  4BE1 A;  4M7D B;  2P0P A;  1Q81 R;  3TSW A;  1UHC A;  2AKK A;  2M0Y A;  1YWP A;  1WHJ A;  2XG8 D;  4KBM B;  1NLO C;  2CP2 A;  2GQV A;  1ZSZ A;  4QKU A;  2EJG A;  3CC2 T;  1VQ4 T;  3UA6 A;  4XTX A;  3G6E Q;  1HK9 A;  4K11 A;  1XOV A;  5FRM A;  3VUZ A;  4NL3 A;  1TG0 A;  4PFZ A;  3M0U A;  1YI2 T;  1Q7Y R;  1FMV A;  1U8R A;  3EHR A;  4M7A C;  1W2B A;  3HSB A;  3H6Z A;  4CC2 A;  4AG1 C;  2JJ9 A;  4DEX A;  3I55 Q;  1JXO A;  2YSQ A;  3GLX A;  1GBQ A;  2DL5 A;  2RHU A;  2JTF A;  1J3T A;  4E7L A;  1M2V A;  4E47 A;  1RAG B;  2EYW A;  2I0N A;  2DET A;  2HEQ A;  4ZTF A;  1O9S A;  1RI0 A;  5DLO A;  4X9D A;  4NS5 A;  4UC4 A;  3P8D A;  1OPK A;  3VS7 A;  1M9S A;  1KD1 R;  2CS7 A;  3G6E A;  2PNI A;  4M77 E;  3KUF A;  2FZC B;  4LDY A;  3OYA A;  1X75 C;  2R58 A;  2KYM A;  1UGP B;  3ME9 A;  5CAI A;  1OEB A;  5KYW B;  4JLI A;  3L2V A;  2K9G A;  1N8R C;  1HSQ A;  2CZ6 B;  2GFA A;  1KJW A;  1R8O B;  3SWN C;  3JCM g;  1YCY A;  1M1K R;  2CZ7 B;  2EYX A;  4ESR A;  1VQP T;  1QVF A;  4IIM A;  2XU8 A;  3FC3 A;  2BZX A;  3HFN A;  4DA4 A;  1F1B B;  1YJ9 T;  2XDP A;  4D8K A;  1OI1 A;  3QDF A;  2KT8 A;  4L5G A;  3A8H B;  1PRM C;  5LJ3 j;  4C8Q B;  1Y96 A;  4FU6 A;  2E70 A;  5I21 A;  1B7T A;  3WVE B;  2X3W D;  1BCM A;  2HSE B;  3GOX A;  2FB7 A;  4LUD A;  3RIR A;  3GPL A;  2OI3 A;  4KH0 B;  5EG2 A;  1PCX A;  2O4X A;  2NUZ A;  1KK7 A;  4J6X A;  2BTT A;  3JCM X;  4M78 E;  1YHQ T;  2MIO A;  2C0O A;  1TWB A;  4IUU A;  1EX4 A;  4J9D A;  4LDU A;  4JJN K;  2DM1 A;  2J7I A;  3C4S A;  3HHT B;  3H8Z A;  4J9G A;  4QT7 A;  2D0N A;  4N4H A;  3X25 B;  4KRT A;  2HBW A;  2DAQ A;  3MEU A;  2LRQ A;  5CQX A;  1Y71 A;  1U1T A;  1FYN A;  2BZ8 A;  4F7U B;  2MYS A;  3OYL A;  1Q86 U;  1ZA1 B;  2NUP B;  5DLQ E;  5CCA A;  2KYB A;  2ESW A;  1RAD B;  4JRQ A;  2VVK A;  2QK0 A;  1K76 A;  2F2V A;  3MCA B;  3M0S A;  1X01 A;  4E7I A;  1RAC B;  5IHN A;  3CPW P;  1O75 A;  2XIC A;  4JUV A;  4BB7 A;  2KXC A;  4ZNX A;  2ATC B;  1NM7 A;  5GAM f;  4DOW A;  4GY5 A;  2COY A;  3EH2 A;  2FPE A;  4KUI A;  2DZC A;  1M4Z A;  2KE9 A;  2XKO C;  4L6V 5;  1FMW A;  1KQS P;  2RNA A;  2CH4 A;  3QYG B;  1MMN A;  5C0M A;  2B86 A;  4M77 B;  3RMQ A;  3MP8 A;  4R0K A;  4TVR A;  4M7A G;  3RER A;  1FXX A;  3MKD A;  2WAC A;  1X27 A;  1BI1 A;  2ZCF B;  4N0A A;  1OUL A;  2AT1 B;  2K3X A;  1WQW A;  3D7S B;  1ZSZ B;  3I55 T;  1UFF A;  2OAW A;  3M0R A;  1Q81 U;  2ZPI B;  2G3R A;  4HVW A;  2H8H A;  2NLU A;  2RI5 A;  1GL5 A;  1WJR A;  1XJW B;  2HNI A;  2K7A A;  1K8A R;  2P4R A;  2Y4Y A;  1VUB A;  2LP5 A;  3VS6 A;  3OYD A;  3QKJ A;  2LC4 A;  2MMP A;  5D6X A;  1Y0M A;  4MZP A;  3H41 A;  1M2V B;  2L3Q A;  4DBH A;  2OJ2 A;  3EFS A;  1W4S A;  1G3W A;  1RAH B;  4OGE A;  3KXT A;  4E6R A;  1KIK A;  1MMD A;  1G3T A;  2EQI A;  1M90 C;  3CXC A;  5KE2 A;  3M4Y A;  2BZY A;  1SHG A;  3CCV T;  4NOY A;  3FJP A;  2LMJ A;  5GAO n;  1WQ7 A;  4M78 B;  3X28 B;  1Y57 A;  2KT1 A;  1EFN A;  1K4U S;  3VS1 A;  2EKH A;  4PKC C;  3UAT A;  1OPL A;  2RB6 A;  3NHN A;  3JSC A;  1QVG P;  1U3O A;  2HAX A;  2JS2 A;  3CMA Q;  1K9M R;  2DD5 A;  2A08 A;  3N5B B;  4QW2 A;  2IPO B;  3CD6 Q;  2KBT A;  3QO3 A;  3CCS Q;  2X4J A;  3VU3 C;  3QWY A;  4M75 G;  3JCM W;  1Q82 C;  2F2W A;  2JS0 A;  3ZBD A;  2EAY A;  4A54 A;  2E12 A;  2B8A A;  2CP7 A;  2ZPB B;  2OTJ Q;  2L5Q A;  5LJ3 f;  1E6H A;  1VQK Q;  5GMK e;  3KFV A;  4M7D D;  1ABQ A;  3M55 A;  1KHI A;  2FZK B;  5KYN A;  3Q1J A;  2O4X B;  3CMA A;  1W2B P;  1G83 A;  4BY6 B;  2A28 A;  2E65 A;  1SG5 A;  3JCM J;  1UUE A;  2MAM A;  3V8K A;  2FPF A;  5HK0 A;  1UJY A;  3CD6 A;  3FJ5 A;  3CCS A;  4OB1 B;  1WLP B;  2IIM A;  1IB8 A;  1WA7 A;  4MZT A;  3JRZ A;  1D1B A;  3JB9 D;  3OB9 A;  5CIU A;  2EW3 A;  2L3R A;  4PJO F;  2OTJ A;  1OZ2 A;  2NYS A;  1VQK A;  2DPP B;  4J9I A;  3PVL A;  1S72 Q;  4BI8 B;  1W1F A;  2GNC A;  2GTJ A;  4C0D B;  5GAM e;  1B34 A;  4BD3 A;  1Y07 A;  1SHF A;  1ZHI A;  4IUT A;  4F04 B;  2BKD N;  4M7D A;  2M02 A;  4FYV B;  1ZUY A;  2O9V A;  1QCN A;  3PNW C;  4RTV A;  4EMG A;  1NZ9 A;  3L2U A;  4IUV A;  4C92 A;  1VQ9 Q;  2X4X A;  2QI2 A;  1GXI E;  1QP3 A;  1WDX A;  2RH2 A;  1TU0 B;  1WJS A;  2R5M A;  1K73 C;  3V8L A;  5IT9 E;  2MK5 A;  4E2F B;  1S72 A;  3CC2 Q;  4FYX B;  3OYF A;  3OBW A;  2DEU A;  3WVD B;  1WPY A;  4RTX A;  4FM4 B;  2EGC A;  2M1H A;  1YI2 Q;  2P0Q A;  2H3E B;  3NTI A;  3RUX A;  2SRC A;  3OBY A;  2FPD A;  4C8Q D;  4AG2 C;  2KSS A;  4YTL A;  4E7K A;  2QAZ A;  2PUK B;  2DTO A;  4XTW A;  3RBB B;  4OB3 B;  2XMF A;  3MJX A;  2XDD A;  4EMK C;  4J8O A;  4NL2 A;  3PIO A;  5GAN d;  2HZY A;  1VQ9 A;  2RJD A;  1U1S A;  3OW2 S;  3EH1 A;  2V1R A;  5KYW A;  2GCX A;  4LDX A;  3RDV A;  2K5L A;  2J6F A;  3CC2 A;  1K8A U;  4QQ6 A;  2LNH B;  2CGH A;  4PJN A;  1VQ8 Q;  1N6A A;  2CP0 A;  2XI9 A;  2DRM A;  1YI2 A;  1JB0 E;  3LH5 A;  2EPD A;  2QTX A;  3C12 A;  2ED0 A;  1ACM B;  1UTI A;  3OQ5 A;  1BYM A;  1N9S A;  4RKU E;  3L2R A;  1N8R R;  2DKG A;  4RCC A;  5A0G A;  1D0X A;  4C8Q A;  1VQP Q;  1H3H A;  2KY9 A;  2ZAE A;  1OQK A;  2KXD A;  4LNP A;  2EJF A;  2RPN A;  3OY9 A;  1RL2 A;  1YJ9 Q;  1D1A A;  5GAO m;  2CZ0 B;  1X6G A;  4RTT A;  2V8I A;  4DEY A;  2LQK A;  2PVG B;  2QTV A;  2EQJ A;  5LJ3 e;  4C5I A;  2OTL Q;  1VQ8 A;  4BUG A;  1MNE A;  2C0I A;  2RK1 A;  2I2L A;  4PJO E;  1NLP C;  2CRE A;  2YUP A;  1W2B S;  4RUG A;  2QA4 T;  5HY6 A;  1G2B A;  3NTH A;  4LXC A;  1D0Y A;  2KK4 A;  2V1Q A;  3V8J A;  1VQP A;  2CSQ A;  3MPU B;  2KMT A;  1EIF A;  3O5Z A;  4EIK A;  3A8M B;  2DYB A;  4M77 D;  2BIV A;  1RLP C;  1YFN A;  3DB4 A;  5KYU A;  4DBF A;  4B9W A;  1YJ9 A;  3M56 A;  2X35 A;  1T0J A;  1ZLM A;  2RM4 A;  1SRM A;  1YIJ T;  1Z9Q A;  2DL4 A;  2CT3 A;  4ATO A;  2OTL A;  1G5V A;  5GMK h;  1HYO A;  4C0F A;  3JCM d;  5FU6 C;  1MV3 A;  5GAN 7;  1YIT T;  1K9A A;  2KAF A;  1TSF A;  4FYW B;  5IXF A;  5CVI A;  5GMK l;  2PQW A;  2GFU A;  4PFP A;  2RI2 A;  3T9N A;  2LDM A;  5GAN 2;  1VQM T;  3G4S T;  1JEG A;  3HKS A;  1QVF S;  1TH7 A;  6AT1 B;  1NYG A;  3LWH A;  1YHQ A;  1YN8 A;  3HP9 A;  4N4G A;  2M9U A;  3VRY A;  1XTD A;  2LX9 A;  2ZZD A;  3P8H A;  3HRS A;  1B34 B;  4O5V A;  1VQL T;  4CC7 A;  2GQI A;  4BAC A;  4M77 A;  1WGS A;  4J9C A;  2L8D A;  2BE9 B;  3NPF A;  5KYX A;  4LE9 A;  2HMA A;  2JOY A;  2ZPH B;  4XU3 A;  5GAM h;  3GBQ A;  4JDS A;  1X43 A;  1KC8 R;  2O2O A;  2MWP A;  4HXJ A;  4C92 B;  2DXB A;  4M78 D;  5KYY A;  1UHF A;  1WFW A;  1UGR B;  1MV0 B;  4LN2 A;  1G8X A;  4OMP A;  4LD6 A;  3SFM A;  1IGQ A;  4M7A E;  2EQU A;  1WHK A;  4XU2 A;  3CCJ T;  5GMK m;  3VYH B;  1JU5 C;  2X4W A;  3TU4 K;  5AYF A;  1PD0 A;  2RJC A;  3UF4 A;  2JT4 A;  5AT1 B;  1NJI U;  2YXY A;  1I8F A;  3AT1 B;  2XHC A;  3RMS A;  2GGR A;  5J3B A;  4E7S A;  4ZGJ B;  2MCN A;  2VAS A;  5DM7 R;  1NPP A;  4M7D G;  3CBM A;  2KEA A;  3QJY A;  3M58 A;  4MDW A;  1VQ8 T;  2L3S A;  1C0M A;  1UDL A;  2JN0 A;  1XNI A;  1UGQ B;  3JCM b;  3FB9 A;  4FT4 A;  2PZ1 A;  2MPX C;  4C92 G;  4EMH A;  4PJO B;  1I5O B;  4M78 A;  3E2U A;  2CP5 A;  1RLQ C;  1OU9 A;  3I55 A;  1V1C A;  1BKB A;  1TXQ A;  2G6F X;  1M90 R;  1WHH A;  4XU0 A;  2RQV A;  3CCV Q;  3JB9 G;  2AZS A;  1ZSZ C;  2IVW A;  2DEQ A;  2DK3 A;  2DBK A;  2FRW A;  2O88 A;  2CZ1 B;  1KFZ A;  2HL5 C;  2QQB A;  3RR6 A;  3OYJ A;  2ABL A;  4J5Y A;  2OTL T;  5LJ5 g;  5A2Q E;  1OYX A;  4GBQ A;  1M30 A;  5HKC A;  1VQO T;  2V8K A;  3S3O A;  1BK2 A;  1QCF A;  2QEX T;  2MOX A;  2L0A A;  2F1L A;  4M75 C;  4HCC A;  1Q82 R;  2HDA A;  1R77 A;  1SF9 A;  2YRC A;  3X24 B;  2FHD A;  4ME7 A;  4AFS C;  1R0C B;  4JS4 A;  4XAX B;  4M75 E;  4RG2 A;  3CCV A;  4WF2 A;  2QQA A;  4BI4 A;  3FLG A;  2JTM A;  5LJ3 h;  3JCM f;  3EAE A;  2ZPE B;  5IHI A;  4QVC A;  2DVE A;  3JCM Q;  3MEV A;  1LPL A;  2DJQ A;  2LNV A;  2MF2 A;  4BDZ A;  1BI2 A;  2HD0 A;  4F17 A;  5KYU B;  1Q86 C;  1Y7X A;  2C06 A;  3CCE T;  2PTK A;  4C8Q G;  4PK4 A;  2K6D A;  1SKU B;  4OB0 B;  3J80 E;  2X9H A;  4ELY C;  2VGM A;  3MP6 A;  4KT0 E;  4QQD A;  3CXC S;  1TTH B;  3BDU A;  4IUQ A;  1M3A A;  4D6W A;  2LQW A;  3VJP A;  3G71 T;  2DA9 A;  1BB9 A;  2YWW A;  1I4K 1;  2GBQ A;  5IAY A;  1QQJ A;  4OF1 A;  3P8B B;  3PE0 A;  5KE3 A;  1TOV A;  1RAF B;  2AKL A;  1RUW A;  3REB B;  1UG1 A;  2K79 A;  1QCO A;  4A4E A;  1KG1 A;  4HVU A;  4C5H A;  2YRV A;  3NMZ C;  2E5K A;  3I56 T;  4HCZ A;  3HTR A;  2JZ2 A;  1BCO A;  1BIB A;  4HKE A;  1WZO A;  3SHW A;  2KDS A;  1X6B A;  3V7R A;  1YBY A;  3GNF B;  7AT1 B;  1YNZ A;  1QWF A;  2VXE A;  3QJ6 A;  1OV3 A;  2E41 A;  4LDV A;  5KYX B;  1VQN T;  5GMK i;  4RTZ A;  3O8V A;  4FSS A;  2RMO A;  1K73 R;  3A8G B;  4F7U G;  3A8O B;  2P4T A;  2EGA A;  4JJD A;  4E7Z A;  1WHM A;  4FIB A;  5KYY B;  3SB2 A;  5LL6 S;  1KC8 U;  1WXU A;  4ZGE B;  3CME T;  4FT2 A;  2A3L A;  4Z8A A;  3OYB A;  1T0H A;  1Q7Y U;  1PD1 A;  1VQ7 Q;  4B9X A;  2JUF A;  1KSW A;  2VGN A;  3CC4 T;  5GAN 4;  2OX7 A;  2RQW A;  2RN8 A;  4FW1 A;  2DX1 A;  3A8L B;  4FSX A;  4AMC A;  4FL6 A;  4M77 G;  2IG0 A;  4II1 A;  3OW2 P;  1UB4 A;  1I0C A;  4L59 A;  2K3Y A;  1KD1 U;  3FDR A;  2EYZ A;  3CCL Q;  4FYY B;  2R5A A;  1OX8 A; 
#chains in the Genus database with same CATH homology
 3I5S A;  5L23 A;  4M4Z A;  3RBB B;  2XMF A;  4CC4 B;  2VKN A;  1QWE A;  1GFC A;  4OML A;  2LJ1 A;  2K2M A;  2KR3 A;  1CSK A;  1I07 A;  1NEG A;  3TSW A;  4RTW A;  1UHC A;  2AKK A;  2V1R A;  2M0Y A;  4RTU A;  1E6G A;  4OMO A;  1YWP A;  3EG3 A;  2J6F A;  3ZL7 C;  2HSP A;  1NLO C;  2LNH B;  3UA6 A;  4K11 A;  1XOV A;  2DRM A;  1PHT A;  2JMA A;  1TG0 A;  3LH5 A;  2EPD A;  3M0U A;  2ED0 A;  3EHR A;  1UTI A;  1S1N A;  1NEB A;  2M51 A;  3QWX X;  2YDL A;  2NWM A;  4JZ3 A;  4AG1 C;  4CC2 A;  1GCQ A;  4DEX A;  1JXO A;  4F14 A;  2YSQ A;  3VS0 A;  1GBQ A;  2DL5 A;  1H3H A;  2LCS A;  1WI7 A;  1J3T A;  2KXD A;  4LNP A;  1NG2 A;  2EYW A;  2RPN A;  2I0N A;  3UA7 A;  2HEQ A;  3VS5 A;  1GFD A;  4ORZ A;  3EGU A;  1JQQ A;  2CSI A;  1UGV A;  2RQR A;  1I1J A;  4CC3 A;  1X6G A;  4RTT A;  1GBR A;  1OPK A;  4DEY A;  3VS7 A;  1VYU A;  2L3P A;  2EBP A;  2PNI A;  2C0I A;  2JMC A;  2RQT A;  1NLP C;  2CRE A;  2DNU A;  2KYM A;  2YUP A;  4RUG A;  1AZG B;  1A0N B;  1OEB A;  1G2B A;  1AWJ A;  1PWT A;  2K9G A;  1HSQ A;  1SRL A;  1KJW A;  2V1Q A;  1IO6 A;  2CSQ A;  1M8M A;  2D1X A;  4AFQ C;  4J9E A;  4AFZ C;  2YUQ A;  3O5Z A;  1H92 A;  2EYX A;  1M27 C;  4ESR A;  5IH2 A;  4EIK A;  2ED1 A;  2DYB A;  4IIM A;  2JTE A;  1RLP C;  3M0P A;  4HVV A;  2BZX A;  3RNJ A;  2EYY A;  1T0J A;  1ZLM A;  2FO0 A;  1SRM A;  3VS2 A;  4D8K A;  1Z9Q A;  2DL4 A;  2CT3 A;  2KT8 A;  2YUO A;  3M0Q A;  2CT4 A;  3U23 A;  1PRM C;  1K0X A;  5FWC A;  2DVJ A;  2DF6 A;  5FW9 A;  4AFU C;  1N5Z A;  1MV3 A;  2C0T A;  1K9A A;  4Y92 A;  4JJC A;  5IXF A;  2X3W D;  1WXT A;  1CKB A;  3SEM A;  1JEG A;  4LUD A;  2OI3 A;  1VA7 A;  1NYG A;  4JPB W;  2NUZ A;  1YN8 A;  2BTT A;  2KRS A;  3EG1 A;  3VRY A;  2MIO A;  4X1V A;  2C0O A;  3EG0 A;  1HD3 A;  4J9D A;  2DM1 A;  2GQI A;  4CC7 A;  2J7I A;  4J9C A;  2CUB A;  4J9G A;  2KRM A;  4QT7 A;  2O31 A;  2D0N A;  1YWO A;  3NPF A;  4KRT A;  1K1Z A;  4LE9 A;  2HBW A;  3GBQ A;  1X43 A;  2O2O A;  4HXJ A;  1BBZ A;  1WXB A;  1GRI A;  1UHF A;  1WFW A;  1FYN A;  2BZ8 A;  3M0T A;  4F16 A;  1MV0 B;  2DL8 A;  1BU1 A;  2JW4 A;  2D8H A;  4LN2 A;  4OMP A;  1MUZ A;  2F2X A;  1W6X A;  3VS3 A;  3H0H A;  1RI9 A;  3TSZ A;  2KYB A;  2ESW A;  2VVK A;  1JU5 C;  1K76 A;  2F2V A;  1AEY A;  3M0S A;  2LJ0 A;  2JT4 A;  3UF4 A;  2DBM A;  5IHN A;  2CH4 W;  2A37 A;  3C0C A;  1PRL C;  2KXC A;  2O9S A;  2GGR A;  1PNJ A;  4ZNX A;  1NM7 A;  2ROL A;  2MCN A;  3PVQ A;  2YUN A;  2FPE A;  2KE9 A;  1SPK A;  1T3S A;  1ZX6 A;  2KEA A;  2RNA A;  2L3S A;  2CH4 A;  2ECZ A;  1UDL A;  2B86 A;  4R0K A;  5IHK A;  4HCK A;  1FMK A;  2J06 A;  2RQU A;  4OMQ A;  2PZ1 A;  5ECA A;  1X27 A;  1RLQ C;  1V1C A;  1UJ0 A;  1ZBJ A;  2G6F X;  5HCK A;  1W70 A;  5I22 A;  1UFF A;  2OAW A;  3M0R A;  1TUD A;  2RQV A;  1AVZ C;  2L2P A;  2LJ3 A;  4RTY A;  4HVW A;  2H8H A;  2AZS A;  1GL5 A;  2CUD A;  1YP5 A;  2K7A A;  1WX6 A;  2DBK A;  2P4R A;  1SEM A;  4LUE A;  2W10 A;  2LP5 A;  2FRW A;  3VS6 A;  2O88 A;  1KFZ A;  1E7O A;  3VS4 A;  2ABL A;  4OMN A;  1Y0M A;  2FEI A;  1AZE A;  3H41 A;  2VWF A;  2L3Q A;  3TVT A;  3JV3 A;  2OJ2 A;  1GCQ C;  2DIL A;  4GBQ A;  3R6N A;  1M30 A;  2YT6 A;  5I11 A;  1BK2 A;  1NYF A;  1QCF A;  2MOX A;  2L0A A;  3REA B;  4E6R A;  1KIK A;  1QKX A;  2KRO A;  2HDA A;  2EQI A;  2FRY A;  4AFS C;  5GJV B;  2HCK A;  1ABO A;  2BZY A;  1SHG A;  1Z9Z A;  2DL3 A;  2LMJ A;  2LQN A;  2FG0 A;  2DRK A;  5EC7 A;  1AWW A;  1Y57 A;  2KT1 A;  2A36 A;  1VYT A;  1EFN A;  1K4U S;  4OMM A;  3VS1 A;  1AD5 A;  2EKH A;  5IHI A;  3UAT A;  1OPL A;  2DE0 X;  3IQL A;  3CQT A;  3NHN A;  4IIO A;  4A63 B;  1U3O A;  5IXB A;  2DJQ A;  2JS2 A;  1M3C A;  1X2Q A;  4F17 A;  1QKW A;  2K3B A;  4Z88 A;  2A08 A;  4J9B A;  4JZ4 A;  2PTK A;  1UE9 A;  2K6D A;  1X2K A;  2D8J A;  2KBT A;  3VRZ A;  1B07 A;  2X3X D;  1PKS A;  2DL7 A;  3QWY A;  1K0S A;  1TUC A;  2F2W A;  1U06 A;  2JS0 A;  2QDL A;  1ARK A;  2LX7 A;  5GJW B;  3THK A;  1M3A A;  2LQW A;  1E6H A;  2DA9 A;  1BB9 A;  1AOJ A;  2GBQ A;  3KFV A;  1ABQ A;  1JXM A;  1OOT A;  1VYV A;  2ROT A;  3PE0 A;  2RF0 A;  3A98 A;  1SSH A;  1AWO A;  2AKL A;  1RUW A;  4WCI A;  1GCP A;  2JM9 A;  3REB B;  1G83 A;  1UG1 A;  1YCS B;  2K79 A;  2A28 A;  2LZ6 B;  1UUE A;  4HVU A;  2AK5 A;  1M3B A;  4JJB A;  1PKT A;  2FPF A;  3NMZ C;  2E5K A;  1UJY A;  2CDT A;  2W0Z A;  1QLY A;  1U5S A;  3FJ5 A;  2JXB A;  3SHW A;  1X6B A;  1WLP B;  2IIM A;  1X69 A;  1YNZ A;  1QWF A;  1B3Q A;  1WA7 A;  1OV3 A;  3ULR B;  2DMO A;  4GLM A;  1AWX A;  4RTZ A;  2EGE A;  4FSS A;  2EW3 A;  2RMO A;  2EGA A;  4JJD A;  4J9I A;  4J9F A;  2EVR A;  2J6O A;  3PVL A;  1WYX A;  3EHQ A;  1W1F A;  2GNC A;  2GTJ A;  3I9Q A;  3H0I A;  1SHF A;  1WXU A;  2KNB B;  4Z89 A;  4Z8A A;  3NGP A;  1ZUY A;  2DLP A;  2AZV A;  1T0H A;  2O9V A;  2J05 A;  1JO8 A;  1ZUK A;  4RTV A;  1LCK A;  1KSW A;  2GTO A;  5FWB A;  1T3L A;  2SEM A;  2RQW A;  1H8K A;  2RN8 A;  2J6K A;  2DX1 A;  4D8D A;  3H0F A;  1WDX A;  2JM8 A;  1ZUU A;  1UEC A;  3I35 A;  1I0C A;  1WIE A;  3I5R A;  4RTX A;  1HJD A;  3EG2 A;  2EGC A;  2KGT A;  4J9H A;  2KRN A;  2ENM A;  2EYZ A;  2SRC A;  1CKA A;  1ZSG A;  2FPD A;  4AG2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...