4Z88A

Sh3-ii of drosophila rim-binding protein with aplip1 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
RYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGELRGRRGYVPHNMVSEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rim-binding protein
molecule keywords RIM-binding protein, isoform F
publication title A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 14
structure length 65
sequence length 65
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4z88A00
1QWEA 3I9QA 2ED0A 2HBWA 2L0AA 2EQIA 3LH5A 1WDXA 2OJ2A 4D8KA 2NWMA 4EIKA 4OMQA 1Y0MA 2B86A 2AKLA 5IHNA 2A36A 2CDTA 2K2MA 2MOXA 1OEBA 2GTOA 1H8KA 4OMMA 1HD3A 2YDLA 1K0XA 1VA7A 3FJ5A 1T0JA 1K0SA 5IHKA 2RPNA 1PKSA 1U3OA 1X6BA 2YUQA 2HCKA 1Y57A 2BTTA 4WCIA 2BZXA 1W6XA 2DVJA 5FWBA 1GBQA 4K11A 2LX7A 2CT3A 3RNJA 1KSWA 2DM1A 1M3AA 2J7IA 2CH4W 2CH4A 2RN8A 4LUDA 2PTKA 1X69A 5IXBA 3NHNA 1ZUYA 2RF0A 5I22A 4Z8AA 2M51A 4HCKA 4RTTA 4HVUA 1UFFA 2AK5A 2KRNA 2O9VA 2V1RA 2YSQA 1H92A 1XOVA 4GBQA 2M0YA 3QWXX 2LNHB 2W0ZA 2JS2A 4FSSA 3EG2A 1WXUA 2JMAA 1OPKA 1X43A 4R0KA 3M0SA 2EW3A 2ECZA 1ZUKA 2D8JA 4DEXA 1AWOA 4IIOA 1EFNA 1M27C 4OMNA 1QKWA 1PRMC 1GRIA 2EGEA 3NPFA 1WX6A 2K7AA 1KJWA 1YNZA 1M30A 1TG0A 2CUBA 2FG0A 1YWOA 1JXOA 3M0QA 4AFZC 3PVQA 4J9GA 4J9EA 4CC2A 4GLMA 1UHCA 5FW9A 2L2PA 4KRTA 3EG1A 3REBB 1E6HA 2KNBB 3GBQA 1SSHA 2FO0A 2RQRA 2LCSA 1T3LA 2P4RA 1GCPA 2J05A 4RTYA 3TVTA 2ROTA 2DRKA 2O88A 2YUPA 2JT4A 1CKAA 4AG2C 3UF4A 2E5KA 3UA7A 1QWFA 1W1FA 1QCFA 1PRLC 1RLPC 2JS0A 4M4ZA 1BK2A 4CC4B 2EYZA 1VYVA 2EKHA 5GJVB 5HCKA 2O2OA 1FMKA 1ABQA 1U06A 2VKNA 1UJ0A 1ZX6A 2EYYA 2ENMA 2KR3A 4OMOA 1AZEA 3PVLA 1WXTA 3VS0A 1K9AA 3VS5A 2KT8A 2GQIA 2DA9A 1RUWA 3QWYA 1OOTA 1WYXA 1VYTA 1WIEA 4AFUC 1PKTA 5L23A 2DL5A 1E7OA 2KEAA 2IIMA 1Z9ZA 4JZ4A 2CSIA 3VS1A 2L3SA 4J9CA 1V1CA 2J6KA 2K9GA 2HEQA 4AFQC 2A28A 2G6FX 1X6GA 1RLQC 2D8HA 1S1NA 3H0IA 1PNJA 1NM7A 3VS6A 2DL4A 1JO8A 1FYNA 2RMOA 3UA6A 1JXMA 1U5SA 5IHIA 2F2XA 5GJWB 4DEYA 1IO6A 3ULRB 1BBZA 1NEBA 1WLPB 2DE0X 3H0FA 3KFVA 4HXJA 2PZ1A 2DBKA 1CKBA 1I1JA 4LNPA 2OI3A 3VRZA 3JV3A 2J6FA 2KE9A 1KIKA 2FPEA 2CT4A 4HVVA 5I11A 1UUEA 4RUGA 2KYMA 2AKKA 2JM8A 2YUOA 1ZUUA 2DBMA 2EPDA 1NYFA 1X2QA 2SEMA 4ZNXA 4X1VA 3H41A 2FPDA 2A08A 2EGCA 1H3HA 2BZ8A 4Y92A 2DMOA 2D0NA 1UJYA 2KYBA 2GGRA 3TSZA 2KBTA 1SRLA 3VS4A 1M3CA 2FRWA 1UECA 1GBRA 1YP5A 2LJ1A 1HSQA 3C0CA 2DYBA 2YUNA 4A63B 4JJCA 2MIOA 2GTJA 1AOJA 4Z88A 3EGUA 2LJ3A 5EC7A 2KXCA 1GCQC 2C0OA 1Z9QA 3M0UA 4Z89A 2GBQA 2PNIA 2V1QA 3O5ZA 2KRMA 2C0TA 4AFSC 1HJDA 1K4US 2DNUA 1YN8A 1GFCA 1GFDA 1AZGB 1GCQA 1JU5C 2KT1A 1I07A 3ZL7C 2AZSA 1K1ZA 2A37A 1LCKA 1UE9A 3TSWA 4F14A 2KRSA 5IH2A 2C0IA 3U23A 3UATA 1G83A 2JTEA 1ABOA 2K3BA 4JPBW 3RBBB 4CC7A 2VVKA 4F17A 4RTVA 2LP5A 1I0CA 3H0HA 2LJ0A 4J9DA 4F16A 2EYXA 1MV3A 4LN2A 1W70A 3I5SA 1TUDA 1QKXA 3VRYA 2L3PA 4J9HA 2FPFA 1WFWA 4ORZA 2O9SA 2SRCA 2LQNA 4E6RA 1NG2A 2DL3A 1B07A 2ED1A 1PHTA 1T0HA 1OV3A 2ABLA 1BB9A 1AWWA 2LMJA 1WA7A 2EYWA 4RTZA 1UG1A 1AWXA 4RTXA 1TUCA 1ZSGA 2W10A 4JJDA 2OAWA 2CSQA 2RQVA 2DRMA 2RQWA 1UDLA 4RTWA 2HDAA 2X3XD 2JMCA 1UGVA 3SHWA 2RQUA 2RNAA 4RTUA 4OMPA 3I35A 1SRMA 2X3WD 4AG1C 2DF6A 2L3QA 2NUZA 1BU1A 1ZBJA 3REAB 3EG0A 1MUZA 3NGPA 5FWCA 3THKA 2F2WA 2KXDA 2J06A 3EHRA 2LQWA 3M0PA 4QT7A 2FEIA 4JZ3A 1NYGA 2KROA 1M3BA 2MCNA 1MV0B 2DILA 1T3SA 1SHGA 3NMZC 2GNCA 2JXBA 1CSKA 2YT6A 1OPLA 2FRYA 3M0TA 1JEGA 2HSPA 2D1XA 5ECAA 5IXFA 1ARKA 2ROLA 4HVWA 1NLOC 4CC3A 1ZLMA 3I5RA 3A98A 3PE0A 1A0NB 2JM9A 2AZVA 1WI7A 1GL5A 2DL8A 1UHFA 2EBPA 1B3QA 1YCSB 1UTIA 3CQTA 1E6GA 4OMLA 4ESRA 1AVZC 2EVRA 2K79A 2I0NA 2XMFA 2KGTA 3R6NA 1VYUA 4J9IA 1AD5A 1SPKA 2LZ6B 4J9BA 1N5ZA 3EG3A 4D8DA 2BZYA 2CREA 2RQTA 4LUEA 3SEMA 1K76A 2DL7A 2VWFA 1AWJA 1QLYA 3IQLA 1X2KA 3VS3A 1J3TA 2EGAA 3M0RA 1YWPA 2J6OA 1SHFA 3EHQA 4J9FA 4LE9A 2DX1A 3VS7A 1JQQA 1PWTA 2ESWA 1KFZA 1RI9A 1NEGA 1M8MA 3VS2A 1WXBA 2QDLA 2F2VA 1AEYA 1X27A 1G2BA 1SEMA 4IIMA 2K6DA 2DLPA 1NLPC 2JW4A 4JJBA 2CUDA 2O31A 2DJQA 2H8HA
chains in the Genus database with same CATH superfamily
1QWEA 3I9QA 3CCJT 2HBWA 1TSFA 1ZQ1A 4XU3A 4E7HA 3RMQA 5CKBA 2OJ2A 4PLIA 1M1KR 4M7DC 2VXEA 2NWMA 4OMQA 2ZCFB 1VQPQ 3OBYA 5IHNA 2K2MA 4PK4A 1BKBA 3BFMA 3JCMb 2ZAEA 1OQKA 2QEXT 1N8RR 3JCMc 2RPNA 4M78C 1PKSA 1U3OA 5CAIA 2YUQA 3BDUA 2BTTA 2Y4XA 1V76A 2BZXA 4HA8A 2DVJA 1WQ7A 2CT3A 4EMHA 2HL5C 2DTOA 3RNJA 4C92E 1M3AA 1WHGA 2CH4W 2E70A 1RAGB 3A1PA 4LUDA 4RCCA 3MP6A 2YRDA 1IB8A 2DTHA 1P92A 2M51A 2VC8A 5DY9A 3ZEHA 4RTTA 3WVDB 2LRQA 1YJNA 3JCMQ 5FU7C 5CK9A 4GBQA 3V8JA 1N9RA 2M0YA 2LNHB 2JS2A 4A54A 3E2UA 3CCMA 5C6SA 2WSFE 1KD1C 2JMAA 1NBEB 1X43A 4QQ6A 2HBPA 2Y4YA 3CBPA 3M0SA 2D8JA 3CD6Q 2V8IA 1M27C 1M1GA 2HNIA 2JN0A 4PJOF 4X34A 2YXYA 1GRIA 4JS4A 1D0YA 2NLUA 4KGVB 1WX6A 2WSCE 3GPLA 3PMTA 3CMAQ 3CCRA 1G3SA 3X26B 1BCMA 4J9GA 4OB1B 4GLMA 2QYZA 2EYQA 2KNBB 1SSHA 4J83A 4M7AC 2DXTA 1WQWA 3CMEQ 3EFRA 4XAXB 3X28B 3FRNA 2P4RA 3VYHB 1GCPA 2J05A 3J80E 2A7YA 2R5MA 4E7KA 2RJFA 2O88A 2YUPA 2JOYA 4QQGA 5D6YA 1VQNQ 2E5KA 2FHDA 3FDRA 3OYCA 4IUQA 1KHIA 5C0MA 1D1CA 1QCFA 5AT1B 1RLPC 4M4ZA 2RI5A 1WJSA 4C0DC 3CCLT 2O2OA 1U06A 5LJ3d 1ZX6A 5GMKm 4M75E 2LTOA 1M1KU 1I8FA 3M59A 3VS0A 1K9AA 1TTHB 1BI0A 2DA9A 1OOTA 3SD4A 4RG8A 3CC4T 1AHJB 2DL5A 5CKDA 1E7OA 1QW1A 2IIMA 3URGA 1YIJA 3VS1A 3L2ZA 3LYIA 5CKFA 1PD1A 2LCLA 2MWPA 1WGSA 2PVOB 3HRTA 1M90C 4M7DD 1D3BB 2ATCB 5FROA 2MYSA 3CCUA 1IHWA 3M57A 1QQJA 1YJWA 1OX9A 3VS6A 2DL4A 1DJ7B 1JO8A 1FYNA 3A8OB 3RERA 2QQBA 3GOXA 3UA6A 2DIQA 5GMKh 4M78D 3ME9A 1U5SA 5IHIA 5KYWA 4IUPA 5A2QE 3I56A 3SB2A 1WLPB 2DD4A 2NUTB 2PZ1A 1FXXA 3TEEA 3CCVT 2J6FA 2KE9A 1RABB 3JCMP 2FPEA 4RCBA 1VUBA 2DIGA 5KYYB 4X9DA 3OW2S 4JRQA 3FLGA 3CPWA 3M4GA 1VQ4A 2NYSA 2AKKA 2JM8A 1ZUUA 1VOMA 2EPDA 3OSVA 4PJJA 3RIRA 4C8QF 3G4SQ 2LQKA 3Q1JA 4D6WA 3OS2A 4Y92A 2PU9B 2D0NA 2XIDA 2PQWA 2KYBA 2DYIA 2KBTA 1KQ1A 2VXFA 1SRLA 5LJ3e 1Q81R 1M3CA 1UECA 1KG1A 5CR2A 3CXCS 2DYBA 3EAEA 3JCMd 4JJCA 1FMVA 2MIOA 4Z88A 4BDZA 2BE9B 2KXCA 3MCAB 3PIOA 5GAMg 2LCCA 3H9NA 3OS5A 2AHJB 3O5ZA 4CI0C 2DEUA 1Y07A 4RG2A 1HJDA 3QJYA 1K4US 2DNUA 2DXCA 2CP2A 1Y71A 3D7SB 1JU5C 1I07A 1YHQA 4M7AD 2OTLQ 3OYIA 5KCHA 2VGMA 5IH2A 2LX9A 3U23A 3M54A 1G83A 3EGXB 4M77A 3ASKA 1IHVA 4M75F 2LP5A 2YRVA 4M7DG 1YJNT 3C95A 1UB4A 2EQKA 4L5GA 2PVGB 4JRKA 5GMKj 1TUDA 1O75A 3CCMT 1WFWA 1JBMA 2SRCA 4DOWA 5LJ3j 1JJ2S 4MMLA 4A4EA 4PL6A 2AIRB 5CQYA 1T0HA 4M78G 1UGQB 3VUZA 3FC3A 1QVGP 1LNXA 1VQ9Q 3MO8A 4DBRA 4RTZA 1UG1A 2V26A 3JB9D 4WTOB 3OYEA 1ZSGA 1N27A 1R0BG 2K5FA 4LD9K 2RQVA 1MNDA 2DRMA 4ZGJB 3CCRT 1W4SA 5A0GA 2QG9B 4BUGA 4OMPA 1I5LA 2JVVA 2DAQA 3JCMe 1B34B 2LNVA 4BI4A 2F2WA 2BKDN 1G3TA 2FEIA 1G5VA 4JZ3A 3VKIA 3C94A 4F7UB 2QQAA 3GIBA 2MCNA 3G71A 1MV0B 2X51A 3OYHA 1KQSP 3RDVA 2YT6A 1OPLA 2FRYA 3CPFA 3EGDA 2NUPB 4LDUA 2ROLA 4NOYA 3VUBA 3OQ5A 2QASA 3ER0A 4CC3A 3EG9A 3A98A 3PE0A 4P5NA 5GANd 1WI7A 1Q95G 2K5IA 1QVFA 4BE2A 3JB9J 4LDWA 3QSUA 1TOVA 4N0AA 1RADB 2KI7A 4XQ3A 5GAOq 1YIJT 2FYKA 2IG0A 4WF2A 4QW2A 2QXFA 3MP1A 4J7FA 1AD5A 2RO0A 4J9BA 4LUEA 3CCUT 3SEMA 1K76A 1QLYA 3QPHA 1YJWT 1NZ9A 4LDXA 2RK1A 4A4GA 4NL3A 2CP6A 4HKEA 5D6XA 4GY5A 1YWPA 2J6OA 1HK9A 3L2QA 2GF7A 2CP7A 1PWTA 1PSFA 3I56T 4Q5WA 1NPPA 2XICA 3R6OA 4XTVA 1QP2A 1OZ3A 3JB9G 1B7TA 4HT8A 1ZBXA 1PM3A 1YJ9A 3CCJQ 1VQ4T 2CZ1B 4JJBA 1WHLA 2E12A 2VB6A 2RI3A 2R5AA 4KGXB 2L0AA 2F5TX 3LH5A 5GAMd 3ZFJA 3VU3C 4LDYA 4JRIA 4Z02A 2B86A 4C92B 1NE8A 1NPRA 2CDTA 5CQXA 2QEXQ 2GTOA 1H8KA 2JUFA 2RA2A 3HFOA 1FX7A 4UC4A 5GANe 4M7DA 1ACMB 3FJ5A 1KC8U 1K0SA 5IHKA 3TQ7P 2HCKA 2E3HA 3QXEB 3OW2A 2JTFA 3M9QA 1GBQA 4E7SA 1YI2A 1RL2A 2X4YA 3JB9I 4M78A 3UPUA 2RN8A 1X69A 3A8HB 1YHQT 4C0FA 4ZN3A 4ZN1A 3NHNA 5I22A 4Z8AA 4C5EA 1IREB 4HCKA 4KBMB 4HVUA 2V1RA 1H92A 4LD6A 5M9OA 3QWXX 2ZPFB 3CXCA 1R0CB 3EG2A 5KYNA 3CC2A 3HHTB 3CPWS 1K9MU 1QCNA 1NJIC 3A8MB 3LGFA 2E65A 1ZUKA 4PJOC 5FU6C 1K8AC 4DEXA 1EFNA 3M4YA 1Q82C 4C5IA 5LJ3g 1VQLA 1PRMC 2ZPBB 5GANj 3E9GA 1U8RA 1M90R 2HQEA 5GAN5 3GNGA 2CZ6B 3M0QA 3OYFA 1OX8A 4DA4A 4J9EA 2FZGB 4PLLA 4FYYB 3MEAA 4PJLA 2CP0A 1UHCA 2RI2A 1MMDA 1E6HA 3GBQA 2FO0A 2HAXA 4RKUE 1HYOA 2KDSA 5GAN6 3OMCA 3JRZA 4RTYA 4FYVB 3S3OA 2ROTA 1WJQA 4M7AA 4MZTA 2CKKA 2FL7A 2H3EB 2KQWA 1QWFA 3CCLQ 1O9SA 3E19A 1VQ8A 1W1FA 3G71T 1WZOA 1PRLC 3OY9A 2JS0A 1BK2A 2D6FA 1VYVA 2QA4A 5J3BA 5KE3A 1UJ0A 2XDPA 3QKJA 1MMNA 2EYYA 4LDVA 2ENMA 3DLMA 4ELYC 3CC4Q 4J5YA 2O4XA 3VS5A 2CP3A 1VYTA 1WIEA 2BIVA 4AFUC 3PTAA 1PKTA 5L23A 3CCEA 1IGUA 2KEAA 4QQDA 2YRCA 4ELZC 4J9CA 5GMKl 1MGQA 2E3IA 4FIBA 1EZZB 3CC7A 5GAMj 2J6KA 4ANJA 2K9GA 1W2BA 2HEQA 4AFQC 2A28A 2G6FX 2RHXA 2GQVA 5GAN3 1RLQC 1S1NA 2COZA 3H0IA 4PKCC 3G6EA 1PC0A 1ZA2B 5GAN7 2XDDA 5EG2A 2GFAA 4V2SA 5HK3A 5GJWB 3JCMg 3WVEB 4DEYA 1BBZA 3L1AA 3CCVQ 4B6MA 3QYHB 2KY9A 3H0FA 3NFCA 1Q7YR 4EMKC 4XU0A 1CKBA 1X75C 3JV3A 2RD1A 5KE2A 5GAOn 1KIKA 2CZ0B 2CT4A 4HVVA 5GAMf 4PFZA 1D0ZA 4Y91A 2KYMA 3PGGA 2XG8D 4C8QC 4B9WA 4F7UF 1NYFA 3CCQA 1YJ9T 1X2QA 2EWNA 2E6ZA 1M2VB 1XNIA 3H41A 1QCOA 5CVIA 1IXDA 3M55A 3L2UA 1EX4A 2YLBA 1YBYA 1OI1A 3VS4A 1M90U 2FRWA 2XU8A 4M77G 1GBRA 3BDLA 2LJ1A 4FW1A 4N4HA 1HSQA 2X4WA 4PJOD 4VUBA 4B9XA 1SG5A 1QVFS 3RUXA 1D09B 5EC7A 3N5BB 2DJZA 1Q86R 3T9NA 1GCQC 2GBQA 2V1QA 1ZHIA 2C0TA 2KRMA 4AFSC 2M9UA 1MMAA 2DK3A 1YN8A 2K5LA 1YI2T 1GFCA 4HCBA 2EQMA 2AZSA 2RM4A 1LCKA 3TSWA 3AT1B 4PFPA 1ZSZC 3JCMV 3UATA 2JTEA 1YJNQ 3JB9H 4E7JA 4M75C 2XKOC 4F17A 4PNOA 4J9DA 2LJ0A 4F16A 2EYXA 3CCMQ 4LN2A 1W70A 2XHCA 1VIEA 3CC2T 2FPFA 3FB9A 2CYZB 2O9SA 3V7SA 3M56A 5KYUA 4E6RA 2DL3A 1FMWA 1B07A 1PHTA 1OV3A 1N8RU 2L5QA 2GCXA 1BB9A 3CCRQ 1WA7A 4DBQA 1VQLT 2PUOB 3ZBDA 2O01E 5GANg 4RTWA 2MAMA 2HDAA 1M9SA 1UGVA 4C92F 3SHWA 2RNAA 4RTUA 2QI2A 2DD5A 1U1TA 3QHSA 1SRMA 5GAN4 2QK0A 4QVDA 2DZ9A 1Q7YU 3QZ9B 1ZBJA 2PUKB 5LJ3h 3THKA 5GAOp 2EAYA 2J06A 5L8RE 3CEYA 3A8GB 2X4JA 1M3BA 2K57A 1JJ2P 3RKWA 5CCAA 3SWNB 1CSKA 3PIPA 1VQ8T 3M0TA 2HKQB 3H8ZA 5ECAA 4PJOG 2RHIA 2QA4T 1ARKA 4PJNA 1WHKA 2ZPGB 3I5RA 4MMKA 1A0NB 4C8QD 2AZVA 1GL5A 2M02A 1YIJQ 2A3LA 3OYLA 2EBPA 3M58A 1B3QA 3TU4K 3CCET 3NTIA 3H6ZA 3QO3A 1Q86U 2E5QA 2XMFA 2I0NA 2KGTA 3CCUQ 3CC7T 4MDXA 1PG5B 1YJWQ 1SPKA 3KUFA 3EG3A 4D8DA 2BZYA 2CREA 1QMCA 4KH0B 1UGRB 2EIFA 3G6ET 1UGSB 1J3TA 3I56Q 1Y96B 5DLQE 1SHFA 4LE9A 5IT9E 2MK5A 3VS7A 4KULA 4J6WA 2ESWA 1WNLA 1VQ5T 2XI9A 1KFZA 1TS9A 3VS2A 5GAN8 1WXBA 3DB3A 4AMCA 2QDLA 7AT1B 3NTHA 4BY6B 3X20B 1VQ4Q 2DKGA 2JZ2A 3OA6A 1R77A 4A53A 3JCMh 3OYYA 4M75D 2O31A 2OTJA 5LJ5d 3CCQT 3MPUB 3QDFA 2ED0A 2EQIA 5J26A 5KYXA 1D0XA 1NJIR 4D8KA 3L2RA 4EIKA 1BIBA 3J81E 1K8AR 4NS5A 2HQHA 2AKLA 2A36A 1OEBA 1WJRA 4OMMA 2DERA 2F5KA 1VA7A 3QYGB 3WXMB 3QBYA 1X6BA 1KK7A 2FVUA 2MI6A 3C12A 4WCIA 3EGDB 2VYTA 1W2BS 5LJ3f 1YHQQ 3LGLA 1KSWA 4R56A 2KAFA 3FJPA 1I81A 2QTVA 4C8QG 2PTKA 4BI8B 3A8LB 2QQSA 2RF0A 3HPWA 2BE7D 2I2LA 3PMIA 3JCMJ 2RB6A 1UFFA 4MZPA 1BI3A 3DKMA 2C06A 2YSQA 2VV5A 1PD0A 3EFOA 4A4HA 3QJ6A 4FSSA 1Q81U 1VQ6A 1YITT 3SWNC 4FYWB 3VV0A 2M1HA 3RR6A 2EW3A 4E7ZA 4BE0A 2VGNA 2MWOA 4M7AG 4OMNA 3P8BB 3I55A 1QKWA 3HTRA 1M4ZA 2YLCA 5LJ5e 2K7AA 3OYKA 1KJWA 4PJOA 1M30A 2CUBA 3AHUA 1YWOA 3QIIA 4J7IA 2DXUA 1PSEA 1K73C 2L2PA 2RJDA 2COWA 3S6WA 3EG1A 4KGZB 3PFSA 2DZCA 1VQMA 4M75G 2LCSA 1T3LA 4FSXA 2Z0WA 5I2SA 4MDWA 1S72A 1QVGS 2DRKA 3G71Q 8ATCB 2JT4A 1CKAA 4AG2C 5GANh 3CPWP 3UF4A 2P0QA 4M77E 3UA7A 4DQ2A 4ATOA 2CP5A 3INZA 4CC4B 3BY7A 2EYZA 2EKHA 5GJVB 5A0LA 2EJGA 1FMKA 1ABQA 3JCMf 4N4IA 1KD1R 2KR3A 4OMOA 5GAOm 3PVLA 1VQ6Q 4M7DB 1WXTA 1AZEA 4XU2A 3RKXA 4X9CA 1RI0A 2KT8A 1G8XA 1SKUB 1RAIB 4XTXA 2A0FB 4JZ4A 1TUGB 2L3SA 3JAME 4M78B 2E1HA 3G7ZA 2QDYB 2AT1B 4OF1A 2D8HA 4ZGEB 3TREA 2LT1A 2F69A 3KBGA 1IGQA 2MMPA 4O6JA 1M5Q1 1JXMA 2MF2A 4E7LA 8AT1B 1N6AA 3QZ5B 1R8OB 1M1FA 3DB4A 1NEBA 3GLXA 3KFVA 4HXJA 1I1JA 2ZGWA 4ZTJA 1WHJA 4N4GA 2OI3A 3VRZA 2X9HA 5GAMh 3OYJA 1TH7A 1VQ7A 5IAYA 2L89A 1OU8A 2QAZA 1YJ9Q 3CCSA 3F70A 4EMKA 4RUGA 1G3YA 4FU6A 1RACB 3E9FA 1RAFB 3VJPA 2V8KA 5I21A 2SEMA 2QQRA 4OB3B 2P0PA 1VQOA 2FPDA 2A08A 2OTJT 2HZYA 4C8QA 4E47A 2IVWA 2GGRA 3TSZA 2HL3A 3DLLA 2E41A 2DTIA 3VYGA 1YP5A 2X35A 4A63B 1VQPA 4XTYA 4IUTA 2GTJA 1AOJA 1XTDA 4C0GA 5D6WA 5CIUA 4PJOE 3M53A 4II1A 2WSEE 5I2MA 3L2VA 2C0OA 1Z9QA 1IZ6A 4Z89A 2L3RA 4KUIA 1YI2Q 4GLKA 4FL6A 1EIFA 1XJWB 4OGCA 1KC8C 1GCQA 3PNWC 4LXCA 2KT1A 3ZL7C 4M77F 5GANf 1K1ZA 2A37A 6AT1B 2O4XB 3G1JA 4C0DB 1C1AA 2C0IA 3O8VA 1ABOA 4ZTFA 4JPBW 2EQUA 4CC7A 3LWIA 3OYAA 3L2WA 3S3NA 1KD1U 1YCYA 3MEWA 3SDZA 3CC2Q 3H0HA 1BYMA 1MV3A 1M2OA 1ZSZA 3A5ZB 1QVFP 3I5SA 3J7AF 2L3PA 1F1BB 4M75A 1VQ6T 2LQNA 1NG2A 2YHTA 1VQLQ 2ED1A 2ABLA 1G3WA 1AWWA 3CD6A 2HSEB 3I55T 1AWXA 3OBWA 2E4HA 3E1SA 1K9MC 2CGHA 4M7DE 2W10A 4FT4A 4JJDA 5AYFA 1LPLA 2CSQA 2RQWA 1UDLA 1OYXA 3M5AA 4C92C 1WHHA 2K4YA 4A4FA 3CMAA 2JNGA 4IUVA 2RQUA 4XTUA 2EFIA 3I35A 2ZPHB 1ZA1B 2X3WD 4AG1C 2G3RA 1VQ5A 1BU1A 5GMKi 4M78E 2COYA 1VQMT 5FWCA 3TCJA 1JRIA 3CMEA 4FM4B 2DEQA 2P0KA 2LQWA 3M0PA 9ATCB 2PVDB 1BI1A 1NYGA 1S72T 1VQ8Q 2KROA 1H641 2DILA 1BIAA 2QA4Q 2OX7A 1SHGA 3NMZC 2GNCA 1VQNA 2JXBA 1D1AA 4J8OA 1LOJA 2XD0A 1JEGA 2HSPA 3GNFB 2KK4A 4IKFA 2D1XA 5IXFA 3OYNA 2LQ8A 1NLOC 1ZLMA 1VQKT 2L8DA 2V8JA 4OVAA 4FCYA 3CCEQ 2DO3A 2RHYA 4OMFB 4NL2A 1UHFA 4C8QE 3CC7Q 2XDBA 1YCSB 1UTIA 3CQTA 1FWZA 1WPYA 3UT1A 1E6GA 1KHCA 4OMLA 2EJ9A 5LJ5g 3L42A 3R6NA 3OYGA 1QVGA 1AT1B 1KQ2A 3OW2P 2LZ6B 1N5ZA 3G6EQ 2RQTA 4HCCA 3UDCA 1M2VA 2DPPB 2VWFA 1SF9A 4C5HA 4JRPA 1HXDA 3VS3A 3M0RA 5KH6A 2HD0A 2M0OA 1VQ5Q 3EHQA 4J9FA 1JQQA 4OB2B 4QKUA 4M7AE 5GAN2 5FRMA 1M8MA 4AT1B 5LL6S 3OYDA 5KYUB 3MP8A 3CXCP 2DETA 1X27A 1VQ7T 1G2BA 4A4KA 1YITA 3CCQQ 1RAEB 3CCST 2RHZA 2K6DA 1NLPC 1KQSA 3RMSA 3HRUA 5HK0A 2CUDA 3HP9A 1MHNA 2DJQA 2H8HA 4OGEA 5D7UA 3G4SA 4JJNK 1VQOT 2RJCA 1WDXA 5KYWB 3HFNA 1Y0MA 4M7DF 2MOXA 1M8VA 1X01A 1VQPT 5DM7R 1HD3A 2R58A 2YDLA 4OP0A 1K0XA 1T0JA 2CZ7B 2QTXA 1Y57A 1K73R 4C92D 4M78F 4EPCA 1W6XA 4BDYA 5FWBA 4K11A 2LX7A 2X4XA 2DM1A 2J7IA 4XU1A 2CH4A 4F7UG 1U1SA 3RESA 1LVKA 1D3BA 5IXBA 2D0QB 1UGPB 2E6NA 3OYMA 1ZUYA 3X24B 3NTKA 3JSCA 2OTLA 2HKNA 2AK5A 2O9VA 2KRNA 3V8KA 3MEVA 2R57A 4HCZA 1XOVA 1YITQ 2W0ZA 2YWWA 3LLRA 1WXUA 2HMAA 2NUTA 1JB0E 3MEUA 4XTZA 1OPKA 3CBMA 4R0KA 1M1KC 4R55A 2ECZA 3HRSA 1AWOA 1C0MA 3QUIA 4IIOA 5KYYA 5GMKe 2M16A 4C5GA 1W2BP 5HY6A 1V29B 3UWNA 2K3YA 3MJXA 3SWNA 2EGEA 3CD6T 3HKSA 2E10A 5HKCA 3NPFA 3MKDA 2B8AA 4PJMA 1VQ9A 4JLIA 1YNZA 1TG0A 4JLGA 2FG0A 4M77B 4BD3A 4MZMA 1N8RC 1JXOA 4AFZC 3PVQA 3CMAT 4CC2A 4J6YA 5FW9A 4KRTA 3REBB 2RQRA 2ZPIB 4M7AF 3CBOA 3TVTA 3OB9A 3CMET 2DFUA 4BI3A 5J39A 4BACA 1Q7YC 3MHXA 5KYXB 3LW5E 2LDMA 1VQNT 5HCKA 3GP8A 1X6OA 3FEOA 2VKNA 4EMGA 3V7RA 1Y96A 2BUDA 2K2VA 2GQIA 1RUWA 2P4TA 1WHMA 2DVEA 3QWYA 4C92G 1RAHB 1WYXA 1Q82R 4L6V5 3EGXA 1SSFA 3JB9F 2FZKB 1Z9ZA 2CSIA 3OMGA 4QVZA 1YFNA 2ZZDA 1TU0B 1V1CA 2RHUA 5GAOl 2JTMA 3OS1A 1RAAB 1K73U 4O5VA 4YTLA 1X6GA 1Q86C 1PNJA 1NM7A 2RMOA 1I5OB 1UEBA 3EFOB 3EG9B 2F2XA 2CS7A 1IO6A 2FZCB 3ULRB 4BB7A 3LH0A 1KC8R 5FRNA 2DE0X 4QVCA 5LJ5h 3EH1A 3BW1A 2DBKA 1OZ2A 4LNPA 4E7IA 1XQHA 4OB0B 3LX7A 5FLXE 4KUDK 1BCOA 5I11A 1UUEA 3V8LA 3X25B 5CKHA 2OTJQ 4L59A 1B34A 2RJEA 2YUOA 2DBMA 1D1BA 3PT9A 4PJOB 5FU6B 4ZNXA 3CCJA 4KH1B 4X1VA 2EGCA 2OAUA 4FYXB 3JCMX 4F7UA 1LJOA 1OULA 2BZ8A 1TXQA 2DMOA 1H3HA 3BE3A 4FW2A 3G4ST 2JJ9A 3SFMA 3EFSA 2FB7A 1UJYA 4Y28E 3LWHA 2NUPA 3V7CA 2VUBA 1N9SA 3C0CA 2YUNA 1IRXA 2KMTA 1K9MR 3EGUA 2QEXA 1QVPA 2LJ3A 2QGGA 4KT0E 5KCOA 2ZPEB 3M0UA 2E64A 2KVQG 2K3XA 2PNIA 1QP3A 4M77C 1MNEA 1GFDA 1AZGB 4JUVA 1UE9A 4F14A 2KRSA 5DLOA 2WACA 2OTLT 1OU9A 2K3BA 3RBBB 5A0DA 1VQKA 2VVKA 4RTVA 1I0CA 3QG1A 1NJIU 4BY6C 3JCMW 1K8AU 1Q82U 3P8DA 4TVRA 1QKXA 3VRYA 2XK0A 4JDSA 4J9HA 4FT2A 1BI2A 4ORZA 2IPOB 5LJ5j 1I4K1 2KSSA 3GF5A 4E2FB 3I55Q 1KQSS 4IUUA 1Q81C 2LC4A 2LMJA 2EYWA 2RH2A 4RTXA 2QQ9A 1TUCA 4JS5A 2OAWA 4F04B 1VQ9T 1TWBA 2X3XD 2JMCA 4ZGDB 4DOVA 2RK2A 4C0ZA 4J6XA 1VQMQ 3HSBA 2DF6A 2L3QA 4EMKB 4C92A 2NUZA 2P84A 1S72Q 3REAB 3EG0A 2MPXC 4EDUA 1MUZA 5FU7B 3NGPA 4XK8E 5LJ5f 2EQJA 2KXDA 3EHRA 3P8HA 4QT7A 2LT4A 5CO7A 4RMOA 4C8QB 2QGFB 1Y7XA 2EKOA 1T3SA 4PFOA 4DBFA 4ME7A 3CCLA 1VQKQ 4HVWA 4DBHA 4N0AC 5CKEA 4HT9A 3OS0A 2JM9A 1VIFA 2DL8A 3CC4A 3EH2A 1GXIE 4F7UE 3HL8A 1PCXA 3OSSC 5GAOr 3OYBA 2Y90A 2GFUA 4IURA 4ESRA 4M7AB 4XTWA 1AVZC 2EVRA 2VASA 2K79A 1MMGA 3S3MA 1VYUA 4J9IA 2LVMA 2D9TA 3RKYA 3FIFA 5GAMe 2DL7A 1AWJA 3IQLA 1X2KA 2EGAA 2HQXA 2DX1A 1ZSZB 5IN1A 2EJFA 4M75B 2DXBA 3QDRB 1VQ7Q 1RI9A 1NEGA 3CCVA 3META 4M77D 1H3ZA 2H3JA 3CCSQ 3C4SA 2F2VA 1AEYA 1SEMA 3KXTA 4IIMA 2F1LA 4CRIA 2DLPA 1JJ2A 1C6VX 2JW4A 1VQOQ 4BE1A
chains in the Genus database with same CATH topology
1QWEA 3I9QA 2ED0A 2HBWA 2L0AA 2EQIA 3LH5A 1WDXA 2OJ2A 4D8KA 2NWMA 4EIKA 4OMQA 1Y0MA 2B86A 2AKLA 5IHNA 2A36A 2CDTA 2K2MA 2MOXA 1OEBA 2GTOA 1H8KA 4OMMA 1HD3A 2YDLA 1K0XA 1VA7A 3FJ5A 1T0JA 1K0SA 5IHKA 2RPNA 1PKSA 1U3OA 1X6BA 2YUQA 2HCKA 1Y57A 2BTTA 4WCIA 2BZXA 1W6XA 2DVJA 5FWBA 1GBQA 4K11A 2LX7A 2CT3A 3RNJA 1KSWA 2DM1A 1M3AA 2J7IA 2CH4W 2CH4A 2RN8A 4LUDA 2PTKA 1X69A 5IXBA 3NHNA 1ZUYA 2RF0A 5I22A 4Z8AA 2M51A 4HCKA 4RTTA 4HVUA 1UFFA 2AK5A 2KRNA 2O9VA 2V1RA 2YSQA 1H92A 1XOVA 4GBQA 2M0YA 3QWXX 2LNHB 2W0ZA 2JS2A 4FSSA 3EG2A 1WXUA 2JMAA 1OPKA 1X43A 4R0KA 3M0SA 2EW3A 2ECZA 1ZUKA 2D8JA 4DEXA 1AWOA 4IIOA 1EFNA 1M27C 4OMNA 1QKWA 1PRMC 1GRIA 2EGEA 3NPFA 1WX6A 2K7AA 1KJWA 1YNZA 1M30A 1TG0A 2CUBA 2FG0A 1YWOA 1JXOA 3M0QA 4AFZC 3PVQA 4J9GA 4J9EA 4CC2A 4GLMA 1UHCA 5FW9A 2L2PA 4KRTA 3EG1A 3REBB 1E6HA 2KNBB 3GBQA 1SSHA 2FO0A 2RQRA 2LCSA 1T3LA 2P4RA 1GCPA 2J05A 4RTYA 3TVTA 2ROTA 2DRKA 2O88A 2YUPA 2JT4A 1CKAA 4AG2C 3UF4A 2E5KA 3UA7A 1QWFA 1W1FA 1QCFA 1PRLC 1RLPC 2JS0A 4M4ZA 1BK2A 4CC4B 2EYZA 1VYVA 2EKHA 5GJVB 5HCKA 2O2OA 1FMKA 1ABQA 1U06A 2VKNA 1UJ0A 1ZX6A 2EYYA 2ENMA 2KR3A 4OMOA 1AZEA 3PVLA 1WXTA 3VS0A 1K9AA 3VS5A 2KT8A 2GQIA 2DA9A 1RUWA 3QWYA 1OOTA 1WYXA 1VYTA 1WIEA 4AFUC 1PKTA 5L23A 2DL5A 1E7OA 2KEAA 2IIMA 1Z9ZA 4JZ4A 2CSIA 3VS1A 2L3SA 4J9CA 1V1CA 2J6KA 2K9GA 2HEQA 4AFQC 2A28A 2G6FX 1X6GA 1RLQC 2D8HA 1S1NA 3H0IA 1PNJA 1NM7A 3VS6A 2DL4A 1JO8A 1FYNA 2RMOA 3UA6A 1JXMA 1U5SA 5IHIA 2F2XA 5GJWB 4DEYA 1IO6A 3ULRB 1BBZA 1NEBA 1WLPB 2DE0X 3H0FA 3KFVA 4HXJA 2PZ1A 2DBKA 1CKBA 1I1JA 4LNPA 2OI3A 3VRZA 3JV3A 2J6FA 2KE9A 1KIKA 2FPEA 2CT4A 4HVVA 5I11A 1UUEA 4RUGA 2KYMA 2AKKA 2JM8A 2YUOA 1ZUUA 2DBMA 2EPDA 1NYFA 1X2QA 2SEMA 4ZNXA 4X1VA 3H41A 2FPDA 2A08A 2EGCA 1H3HA 2BZ8A 4Y92A 2DMOA 2D0NA 1UJYA 2KYBA 2GGRA 3TSZA 2KBTA 1SRLA 3VS4A 1M3CA 2FRWA 1UECA 1GBRA 1YP5A 2LJ1A 1HSQA 3C0CA 2DYBA 2YUNA 4A63B 4JJCA 2MIOA 2GTJA 1AOJA 4Z88A 3EGUA 2LJ3A 5EC7A 2KXCA 1GCQC 2C0OA 1Z9QA 3M0UA 4Z89A 2GBQA 2PNIA 2V1QA 3O5ZA 2KRMA 2C0TA 4AFSC 1HJDA 1K4US 2DNUA 1YN8A 1GFCA 1GFDA 1AZGB 1GCQA 1JU5C 2KT1A 1I07A 3ZL7C 2AZSA 1K1ZA 2A37A 1LCKA 1UE9A 3TSWA 4F14A 2KRSA 5IH2A 2C0IA 3U23A 3UATA 1G83A 2JTEA 1ABOA 2K3BA 4JPBW 3RBBB 4CC7A 2VVKA 4F17A 4RTVA 2LP5A 1I0CA 3H0HA 2LJ0A 4J9DA 4F16A 2EYXA 1MV3A 4LN2A 1W70A 3I5SA 1TUDA 1QKXA 3VRYA 2L3PA 4J9HA 2FPFA 1WFWA 4ORZA 2O9SA 2SRCA 2LQNA 4E6RA 1NG2A 2DL3A 1B07A 2ED1A 1PHTA 1T0HA 1OV3A 2ABLA 1BB9A 1AWWA 2LMJA 1WA7A 2EYWA 4RTZA 1UG1A 1AWXA 4RTXA 1TUCA 1ZSGA 2W10A 4JJDA 2OAWA 2CSQA 2RQVA 2DRMA 2RQWA 1UDLA 4RTWA 2HDAA 2X3XD 2JMCA 1UGVA 3SHWA 2RQUA 2RNAA 4RTUA 4OMPA 3I35A 1SRMA 2X3WD 4AG1C 2DF6A 2L3QA 2NUZA 1BU1A 1ZBJA 3REAB 3EG0A 1MUZA 3NGPA 5FWCA 3THKA 2F2WA 2KXDA 2J06A 3EHRA 2LQWA 3M0PA 4QT7A 2FEIA 4JZ3A 1NYGA 2KROA 1M3BA 2MCNA 1MV0B 2DILA 1T3SA 1SHGA 3NMZC 2GNCA 2JXBA 1CSKA 2YT6A 1OPLA 2FRYA 3M0TA 1JEGA 2HSPA 2D1XA 5ECAA 5IXFA 1ARKA 2ROLA 4HVWA 1NLOC 4CC3A 1ZLMA 3I5RA 3A98A 3PE0A 1A0NB 2JM9A 2AZVA 1WI7A 1GL5A 2DL8A 1UHFA 2EBPA 1B3QA 1YCSB 1UTIA 3CQTA 1E6GA 4OMLA 4ESRA 1AVZC 2EVRA 2K79A 2I0NA 2XMFA 2KGTA 3R6NA 1VYUA 4J9IA 1AD5A 1SPKA 2LZ6B 4J9BA 1N5ZA 3EG3A 4D8DA 2BZYA 2CREA 2RQTA 4LUEA 3SEMA 1K76A 2DL7A 2VWFA 1AWJA 1QLYA 3IQLA 1X2KA 3VS3A 1J3TA 2EGAA 3M0RA 1YWPA 2J6OA 1SHFA 3EHQA 4J9FA 4LE9A 2DX1A 3VS7A 1JQQA 1PWTA 2ESWA 1KFZA 1RI9A 1NEGA 1M8MA 3VS2A 1WXBA 2QDLA 2F2VA 1AEYA 1X27A 1G2BA 1SEMA 4IIMA 2K6DA 2DLPA 1NLPC 2JW4A 4JJBA 2CUDA 2O31A 2DJQA 2H8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QWE A;  3I9Q A;  2ED0 A;  2HBW A;  2L0A A;  2EQI A;  3LH5 A;  1WDX A;  2OJ2 A;  4D8K A;  2NWM A;  4EIK A;  4OMQ A;  1Y0M A;  2B86 A;  2AKL A;  5IHN A;  2A36 A;  2CDT A;  2K2M A;  2MOX A;  1OEB A;  2GTO A;  1H8K A;  4OMM A;  1HD3 A;  2YDL A;  1K0X A;  1VA7 A;  3FJ5 A;  1T0J A;  1K0S A;  5IHK A;  2RPN A;  1PKS A;  1U3O A;  1X6B A;  2YUQ A;  2HCK A;  1Y57 A;  2BTT A;  4WCI A;  2BZX A;  1W6X A;  2DVJ A;  5FWB A;  1GBQ A;  4K11 A;  2LX7 A;  2CT3 A;  3RNJ A;  1KSW A;  2DM1 A;  1M3A A;  2J7I A;  2CH4 W;  2CH4 A;  2RN8 A;  4LUD A;  2PTK A;  1X69 A;  5IXB A;  3NHN A;  1ZUY A;  2RF0 A;  5I22 A;  4Z8A A;  2M51 A;  4HCK A;  4RTT A;  4HVU A;  1UFF A;  2AK5 A;  2KRN A;  2O9V A;  2V1R A;  2YSQ A;  1H92 A;  1XOV A;  4GBQ A;  2M0Y A;  3QWX X;  2LNH B;  2W0Z A;  2JS2 A;  4FSS A;  3EG2 A;  1WXU A;  2JMA A;  1OPK A;  1X43 A;  4R0K A;  3M0S A;  2EW3 A;  2ECZ A;  1ZUK A;  2D8J A;  4DEX A;  1AWO A;  4IIO A;  1EFN A;  1M27 C;  4OMN A;  1QKW A;  1PRM C;  1GRI A;  2EGE A;  3NPF A;  1WX6 A;  2K7A A;  1KJW A;  1YNZ A;  1M30 A;  1TG0 A;  2CUB A;  2FG0 A;  1YWO A;  1JXO A;  3M0Q A;  4AFZ C;  3PVQ A;  4J9G A;  4J9E A;  4CC2 A;  4GLM A;  1UHC A;  5FW9 A;  2L2P A;  4KRT A;  3EG1 A;  3REB B;  1E6H A;  2KNB B;  3GBQ A;  1SSH A;  2FO0 A;  2RQR A;  2LCS A;  1T3L A;  2P4R A;  1GCP A;  2J05 A;  4RTY A;  3TVT A;  2ROT A;  2DRK A;  2O88 A;  2YUP A;  2JT4 A;  1CKA A;  4AG2 C;  3UF4 A;  2E5K A;  3UA7 A;  1QWF A;  1W1F A;  1QCF A;  1PRL C;  1RLP C;  2JS0 A;  4M4Z A;  1BK2 A;  4CC4 B;  2EYZ A;  1VYV A;  2EKH A;  5GJV B;  5HCK A;  2O2O A;  1FMK A;  1ABQ A;  1U06 A;  2VKN A;  1UJ0 A;  1ZX6 A;  2EYY A;  2ENM A;  2KR3 A;  4OMO A;  1AZE A;  3PVL A;  1WXT A;  3VS0 A;  1K9A A;  3VS5 A;  2KT8 A;  2GQI A;  2DA9 A;  1RUW A;  3QWY A;  1OOT A;  1WYX A;  1VYT A;  1WIE A;  4AFU C;  1PKT A;  5L23 A;  2DL5 A;  1E7O A;  2KEA A;  2IIM A;  1Z9Z A;  4JZ4 A;  2CSI A;  3VS1 A;  2L3S A;  4J9C A;  1V1C A;  2J6K A;  2K9G A;  2HEQ A;  4AFQ C;  2A28 A;  2G6F X;  1X6G A;  1RLQ C;  2D8H A;  1S1N A;  3H0I A;  1PNJ A;  1NM7 A;  3VS6 A;  2DL4 A;  1JO8 A;  1FYN A;  2RMO A;  3UA6 A;  1JXM A;  1U5S A;  5IHI A;  2F2X A;  5GJW B;  4DEY A;  1IO6 A;  3ULR B;  1BBZ A;  1NEB A;  1WLP B;  2DE0 X;  3H0F A;  3KFV A;  4HXJ A;  2PZ1 A;  2DBK A;  1CKB A;  1I1J A;  4LNP A;  2OI3 A;  3VRZ A;  3JV3 A;  2J6F A;  2KE9 A;  1KIK A;  2FPE A;  2CT4 A;  4HVV A;  5I11 A;  1UUE A;  4RUG A;  2KYM A;  2AKK A;  2JM8 A;  2YUO A;  1ZUU A;  2DBM A;  2EPD A;  1NYF A;  1X2Q A;  2SEM A;  4ZNX A;  4X1V A;  3H41 A;  2FPD A;  2A08 A;  2EGC A;  1H3H A;  2BZ8 A;  4Y92 A;  2DMO A;  2D0N A;  1UJY A;  2KYB A;  2GGR A;  3TSZ A;  2KBT A;  1SRL A;  3VS4 A;  1M3C A;  2FRW A;  1UEC A;  1GBR A;  1YP5 A;  2LJ1 A;  1HSQ A;  3C0C A;  2DYB A;  2YUN A;  4A63 B;  4JJC A;  2MIO A;  2GTJ A;  1AOJ A;  4Z88 A;  3EGU A;  2LJ3 A;  5EC7 A;  2KXC A;  1GCQ C;  2C0O A;  1Z9Q A;  3M0U A;  4Z89 A;  2GBQ A;  2PNI A;  2V1Q A;  3O5Z A;  2KRM A;  2C0T A;  4AFS C;  1HJD A;  1K4U S;  2DNU A;  1YN8 A;  1GFC A;  1GFD A;  1AZG B;  1GCQ A;  1JU5 C;  2KT1 A;  1I07 A;  3ZL7 C;  2AZS A;  1K1Z A;  2A37 A;  1LCK A;  1UE9 A;  3TSW A;  4F14 A;  2KRS A;  5IH2 A;  2C0I A;  3U23 A;  3UAT A;  1G83 A;  2JTE A;  1ABO A;  2K3B A;  4JPB W;  3RBB B;  4CC7 A;  2VVK A;  4F17 A;  4RTV A;  2LP5 A;  1I0C A;  3H0H A;  2LJ0 A;  4J9D A;  4F16 A;  2EYX A;  1MV3 A;  4LN2 A;  1W70 A;  3I5S A;  1TUD A;  1QKX A;  3VRY A;  2L3P A;  4J9H A;  2FPF A;  1WFW A;  4ORZ A;  2O9S A;  2SRC A;  2LQN A;  4E6R A;  1NG2 A;  2DL3 A;  1B07 A;  2ED1 A;  1PHT A;  1T0H A;  1OV3 A;  2ABL A;  1BB9 A;  1AWW A;  2LMJ A;  1WA7 A;  2EYW A;  4RTZ A;  1UG1 A;  1AWX A;  4RTX A;  1TUC A;  1ZSG A;  2W10 A;  4JJD A;  2OAW A;  2CSQ A;  2RQV A;  2DRM A;  2RQW A;  1UDL A;  4RTW A;  2HDA A;  2X3X D;  2JMC A;  1UGV A;  3SHW A;  2RQU A;  2RNA A;  4RTU A;  4OMP A;  3I35 A;  1SRM A;  2X3W D;  4AG1 C;  2DF6 A;  2L3Q A;  2NUZ A;  1BU1 A;  1ZBJ A;  3REA B;  3EG0 A;  1MUZ A;  3NGP A;  5FWC A;  3THK A;  2F2W A;  2KXD A;  2J06 A;  3EHR A;  2LQW A;  3M0P A;  4QT7 A;  2FEI A;  4JZ3 A;  1NYG A;  2KRO A;  1M3B A;  2MCN A;  1MV0 B;  2DIL A;  1T3S A;  1SHG A;  3NMZ C;  2GNC A;  2JXB A;  1CSK A;  2YT6 A;  1OPL A;  2FRY A;  3M0T A;  1JEG A;  2HSP A;  2D1X A;  5ECA A;  5IXF A;  1ARK A;  2ROL A;  4HVW A;  1NLO C;  4CC3 A;  1ZLM A;  3I5R A;  3A98 A;  3PE0 A;  1A0N B;  2JM9 A;  2AZV A;  1WI7 A;  1GL5 A;  2DL8 A;  1UHF A;  2EBP A;  1B3Q A;  1YCS B;  1UTI A;  3CQT A;  1E6G A;  4OML A;  4ESR A;  1AVZ C;  2EVR A;  2K79 A;  2I0N A;  2XMF A;  2KGT A;  3R6N A;  1VYU A;  4J9I A;  1AD5 A;  1SPK A;  2LZ6 B;  4J9B A;  1N5Z A;  3EG3 A;  4D8D A;  2BZY A;  2CRE A;  2RQT A;  4LUE A;  3SEM A;  1K76 A;  2DL7 A;  2VWF A;  1AWJ A;  1QLY A;  3IQL A;  1X2K A;  3VS3 A;  1J3T A;  2EGA A;  3M0R A;  1YWP A;  2J6O A;  1SHF A;  3EHQ A;  4J9F A;  4LE9 A;  2DX1 A;  3VS7 A;  1JQQ A;  1PWT A;  2ESW A;  1KFZ A;  1RI9 A;  1NEG A;  1M8M A;  3VS2 A;  1WXB A;  2QDL A;  2F2V A;  1AEY A;  1X27 A;  1G2B A;  1SEM A;  4IIM A;  2K6D A;  2DLP A;  1NLP C;  2JW4 A;  4JJB A;  2CUD A;  2O31 A;  2DJQ A;  2H8H A; 
#chains in the Genus database with same CATH topology
 1QWE A;  3I9Q A;  3CCJ T;  2HBW A;  1TSF A;  1ZQ1 A;  4XU3 A;  4E7H A;  3RMQ A;  5CKB A;  2OJ2 A;  4PLI A;  1M1K R;  4M7D C;  2VXE A;  2NWM A;  4OMQ A;  2ZCF B;  1VQP Q;  3OBY A;  5IHN A;  2K2M A;  4PK4 A;  1BKB A;  3BFM A;  3JCM b;  2ZAE A;  1OQK A;  2QEX T;  1N8R R;  3JCM c;  2RPN A;  4M78 C;  1PKS A;  1U3O A;  5CAI A;  2YUQ A;  3BDU A;  2BTT A;  2Y4X A;  1V76 A;  2BZX A;  4HA8 A;  2DVJ A;  1WQ7 A;  2CT3 A;  4EMH A;  2HL5 C;  2DTO A;  3RNJ A;  4C92 E;  1M3A A;  1WHG A;  2CH4 W;  2E70 A;  1RAG B;  3A1P A;  4LUD A;  4RCC A;  3MP6 A;  2YRD A;  1IB8 A;  2DTH A;  1P92 A;  2M51 A;  2VC8 A;  5DY9 A;  3ZEH A;  4RTT A;  3WVD B;  2LRQ A;  1YJN A;  3JCM Q;  5FU7 C;  5CK9 A;  4GBQ A;  3V8J A;  1N9R A;  2M0Y A;  2LNH B;  2JS2 A;  4A54 A;  3E2U A;  3CCM A;  5C6S A;  2WSF E;  1KD1 C;  2JMA A;  1NBE B;  1X43 A;  4QQ6 A;  2HBP A;  2Y4Y A;  3CBP A;  3M0S A;  2D8J A;  3CD6 Q;  2V8I A;  1M27 C;  1M1G A;  2HNI A;  2JN0 A;  4PJO F;  4X34 A;  2YXY A;  1GRI A;  4JS4 A;  1D0Y A;  2NLU A;  4KGV B;  1WX6 A;  2WSC E;  3GPL A;  3PMT A;  3CMA Q;  3CCR A;  1G3S A;  3X26 B;  1BCM A;  4J9G A;  4OB1 B;  4GLM A;  2QYZ A;  2EYQ A;  2KNB B;  1SSH A;  4J83 A;  4M7A C;  2DXT A;  1WQW A;  3CME Q;  3EFR A;  4XAX B;  3X28 B;  3FRN A;  2P4R A;  3VYH B;  1GCP A;  2J05 A;  3J80 E;  2A7Y A;  2R5M A;  4E7K A;  2RJF A;  2O88 A;  2YUP A;  2JOY A;  4QQG A;  5D6Y A;  1VQN Q;  2E5K A;  2FHD A;  3FDR A;  3OYC A;  4IUQ A;  1KHI A;  5C0M A;  1D1C A;  1QCF A;  5AT1 B;  1RLP C;  4M4Z A;  2RI5 A;  1WJS A;  4C0D C;  3CCL T;  2O2O A;  1U06 A;  5LJ3 d;  1ZX6 A;  5GMK m;  4M75 E;  2LTO A;  1M1K U;  1I8F A;  3M59 A;  3VS0 A;  1K9A A;  1TTH B;  1BI0 A;  2DA9 A;  1OOT A;  3SD4 A;  4RG8 A;  3CC4 T;  1AHJ B;  2DL5 A;  5CKD A;  1E7O A;  1QW1 A;  2IIM A;  3URG A;  1YIJ A;  3VS1 A;  3L2Z A;  3LYI A;  5CKF A;  1PD1 A;  2LCL A;  2MWP A;  1WGS A;  2PVO B;  3HRT A;  1M90 C;  4M7D D;  1D3B B;  2ATC B;  5FRO A;  2MYS A;  3CCU A;  1IHW A;  3M57 A;  1QQJ A;  1YJW A;  1OX9 A;  3VS6 A;  2DL4 A;  1DJ7 B;  1JO8 A;  1FYN A;  3A8O B;  3RER A;  2QQB A;  3GOX A;  3UA6 A;  2DIQ A;  5GMK h;  4M78 D;  3ME9 A;  1U5S A;  5IHI A;  5KYW A;  4IUP A;  5A2Q E;  3I56 A;  3SB2 A;  1WLP B;  2DD4 A;  2NUT B;  2PZ1 A;  1FXX A;  3TEE A;  3CCV T;  2J6F A;  2KE9 A;  1RAB B;  3JCM P;  2FPE A;  4RCB A;  1VUB A;  2DIG A;  5KYY B;  4X9D A;  3OW2 S;  4JRQ A;  3FLG A;  3CPW A;  3M4G A;  1VQ4 A;  2NYS A;  2AKK A;  2JM8 A;  1ZUU A;  1VOM A;  2EPD A;  3OSV A;  4PJJ A;  3RIR A;  4C8Q F;  3G4S Q;  2LQK A;  3Q1J A;  4D6W A;  3OS2 A;  4Y92 A;  2PU9 B;  2D0N A;  2XID A;  2PQW A;  2KYB A;  2DYI A;  2KBT A;  1KQ1 A;  2VXF A;  1SRL A;  5LJ3 e;  1Q81 R;  1M3C A;  1UEC A;  1KG1 A;  5CR2 A;  3CXC S;  2DYB A;  3EAE A;  3JCM d;  4JJC A;  1FMV A;  2MIO A;  4Z88 A;  4BDZ A;  2BE9 B;  2KXC A;  3MCA B;  3PIO A;  5GAM g;  2LCC A;  3H9N A;  3OS5 A;  2AHJ B;  3O5Z A;  4CI0 C;  2DEU A;  1Y07 A;  4RG2 A;  1HJD A;  3QJY A;  1K4U S;  2DNU A;  2DXC A;  2CP2 A;  1Y71 A;  3D7S B;  1JU5 C;  1I07 A;  1YHQ A;  4M7A D;  2OTL Q;  3OYI A;  5KCH A;  2VGM A;  5IH2 A;  2LX9 A;  3U23 A;  3M54 A;  1G83 A;  3EGX B;  4M77 A;  3ASK A;  1IHV A;  4M75 F;  2LP5 A;  2YRV A;  4M7D G;  1YJN T;  3C95 A;  1UB4 A;  2EQK A;  4L5G A;  2PVG B;  4JRK A;  5GMK j;  1TUD A;  1O75 A;  3CCM T;  1WFW A;  1JBM A;  2SRC A;  4DOW A;  5LJ3 j;  1JJ2 S;  4MML A;  4A4E A;  4PL6 A;  2AIR B;  5CQY A;  1T0H A;  4M78 G;  1UGQ B;  3VUZ A;  3FC3 A;  1QVG P;  1LNX A;  1VQ9 Q;  3MO8 A;  4DBR A;  4RTZ A;  1UG1 A;  2V26 A;  3JB9 D;  4WTO B;  3OYE A;  1ZSG A;  1N27 A;  1R0B G;  2K5F A;  4LD9 K;  2RQV A;  1MND A;  2DRM A;  4ZGJ B;  3CCR T;  1W4S A;  5A0G A;  2QG9 B;  4BUG A;  4OMP A;  1I5L A;  2JVV A;  2DAQ A;  3JCM e;  1B34 B;  2LNV A;  4BI4 A;  2F2W A;  2BKD N;  1G3T A;  2FEI A;  1G5V A;  4JZ3 A;  3VKI A;  3C94 A;  4F7U B;  2QQA A;  3GIB A;  2MCN A;  3G71 A;  1MV0 B;  2X51 A;  3OYH A;  1KQS P;  3RDV A;  2YT6 A;  1OPL A;  2FRY A;  3CPF A;  3EGD A;  2NUP B;  4LDU A;  2ROL A;  4NOY A;  3VUB A;  3OQ5 A;  2QAS A;  3ER0 A;  4CC3 A;  3EG9 A;  3A98 A;  3PE0 A;  4P5N A;  5GAN d;  1WI7 A;  1Q95 G;  2K5I A;  1QVF A;  4BE2 A;  3JB9 J;  4LDW A;  3QSU A;  1TOV A;  4N0A A;  1RAD B;  2KI7 A;  4XQ3 A;  5GAO q;  1YIJ T;  2FYK A;  2IG0 A;  4WF2 A;  4QW2 A;  2QXF A;  3MP1 A;  4J7F A;  1AD5 A;  2RO0 A;  4J9B A;  4LUE A;  3CCU T;  3SEM A;  1K76 A;  1QLY A;  3QPH A;  1YJW T;  1NZ9 A;  4LDX A;  2RK1 A;  4A4G A;  4NL3 A;  2CP6 A;  4HKE A;  5D6X A;  4GY5 A;  1YWP A;  2J6O A;  1HK9 A;  3L2Q A;  2GF7 A;  2CP7 A;  1PWT A;  1PSF A;  3I56 T;  4Q5W A;  1NPP A;  2XIC A;  3R6O A;  4XTV A;  1QP2 A;  1OZ3 A;  3JB9 G;  1B7T A;  4HT8 A;  1ZBX A;  1PM3 A;  1YJ9 A;  3CCJ Q;  1VQ4 T;  2CZ1 B;  4JJB A;  1WHL A;  2E12 A;  2VB6 A;  2RI3 A;  2R5A A;  4KGX B;  2L0A A;  2F5T X;  3LH5 A;  5GAM d;  3ZFJ A;  3VU3 C;  4LDY A;  4JRI A;  4Z02 A;  2B86 A;  4C92 B;  1NE8 A;  1NPR A;  2CDT A;  5CQX A;  2QEX Q;  2GTO A;  1H8K A;  2JUF A;  2RA2 A;  3HFO A;  1FX7 A;  4UC4 A;  5GAN e;  4M7D A;  1ACM B;  3FJ5 A;  1KC8 U;  1K0S A;  5IHK A;  3TQ7 P;  2HCK A;  2E3H A;  3QXE B;  3OW2 A;  2JTF A;  3M9Q A;  1GBQ A;  4E7S A;  1YI2 A;  1RL2 A;  2X4Y A;  3JB9 I;  4M78 A;  3UPU A;  2RN8 A;  1X69 A;  3A8H B;  1YHQ T;  4C0F A;  4ZN3 A;  4ZN1 A;  3NHN A;  5I22 A;  4Z8A A;  4C5E A;  1IRE B;  4HCK A;  4KBM B;  4HVU A;  2V1R A;  1H92 A;  4LD6 A;  5M9O A;  3QWX X;  2ZPF B;  3CXC A;  1R0C B;  3EG2 A;  5KYN A;  3CC2 A;  3HHT B;  3CPW S;  1K9M U;  1QCN A;  1NJI C;  3A8M B;  3LGF A;  2E65 A;  1ZUK A;  4PJO C;  5FU6 C;  1K8A C;  4DEX A;  1EFN A;  3M4Y A;  1Q82 C;  4C5I A;  5LJ3 g;  1VQL A;  1PRM C;  2ZPB B;  5GAN j;  3E9G A;  1U8R A;  1M90 R;  2HQE A;  5GAN 5;  3GNG A;  2CZ6 B;  3M0Q A;  3OYF A;  1OX8 A;  4DA4 A;  4J9E A;  2FZG B;  4PLL A;  4FYY B;  3MEA A;  4PJL A;  2CP0 A;  1UHC A;  2RI2 A;  1MMD A;  1E6H A;  3GBQ A;  2FO0 A;  2HAX A;  4RKU E;  1HYO A;  2KDS A;  5GAN 6;  3OMC A;  3JRZ A;  4RTY A;  4FYV B;  3S3O A;  2ROT A;  1WJQ A;  4M7A A;  4MZT A;  2CKK A;  2FL7 A;  2H3E B;  2KQW A;  1QWF A;  3CCL Q;  1O9S A;  3E19 A;  1VQ8 A;  1W1F A;  3G71 T;  1WZO A;  1PRL C;  3OY9 A;  2JS0 A;  1BK2 A;  2D6F A;  1VYV A;  2QA4 A;  5J3B A;  5KE3 A;  1UJ0 A;  2XDP A;  3QKJ A;  1MMN A;  2EYY A;  4LDV A;  2ENM A;  3DLM A;  4ELY C;  3CC4 Q;  4J5Y A;  2O4X A;  3VS5 A;  2CP3 A;  1VYT A;  1WIE A;  2BIV A;  4AFU C;  3PTA A;  1PKT A;  5L23 A;  3CCE A;  1IGU A;  2KEA A;  4QQD A;  2YRC A;  4ELZ C;  4J9C A;  5GMK l;  1MGQ A;  2E3I A;  4FIB A;  1EZZ B;  3CC7 A;  5GAM j;  2J6K A;  4ANJ A;  2K9G A;  1W2B A;  2HEQ A;  4AFQ C;  2A28 A;  2G6F X;  2RHX A;  2GQV A;  5GAN 3;  1RLQ C;  1S1N A;  2COZ A;  3H0I A;  4PKC C;  3G6E A;  1PC0 A;  1ZA2 B;  5GAN 7;  2XDD A;  5EG2 A;  2GFA A;  4V2S A;  5HK3 A;  5GJW B;  3JCM g;  3WVE B;  4DEY A;  1BBZ A;  3L1A A;  3CCV Q;  4B6M A;  3QYH B;  2KY9 A;  3H0F A;  3NFC A;  1Q7Y R;  4EMK C;  4XU0 A;  1CKB A;  1X75 C;  3JV3 A;  2RD1 A;  5KE2 A;  5GAO n;  1KIK A;  2CZ0 B;  2CT4 A;  4HVV A;  5GAM f;  4PFZ A;  1D0Z A;  4Y91 A;  2KYM A;  3PGG A;  2XG8 D;  4C8Q C;  4B9W A;  4F7U F;  1NYF A;  3CCQ A;  1YJ9 T;  1X2Q A;  2EWN A;  2E6Z A;  1M2V B;  1XNI A;  3H41 A;  1QCO A;  5CVI A;  1IXD A;  3M55 A;  3L2U A;  1EX4 A;  2YLB A;  1YBY A;  1OI1 A;  3VS4 A;  1M90 U;  2FRW A;  2XU8 A;  4M77 G;  1GBR A;  3BDL A;  2LJ1 A;  4FW1 A;  4N4H A;  1HSQ A;  2X4W A;  4PJO D;  4VUB A;  4B9X A;  1SG5 A;  1QVF S;  3RUX A;  1D09 B;  5EC7 A;  3N5B B;  2DJZ A;  1Q86 R;  3T9N A;  1GCQ C;  2GBQ A;  2V1Q A;  1ZHI A;  2C0T A;  2KRM A;  4AFS C;  2M9U A;  1MMA A;  2DK3 A;  1YN8 A;  2K5L A;  1YI2 T;  1GFC A;  4HCB A;  2EQM A;  2AZS A;  2RM4 A;  1LCK A;  3TSW A;  3AT1 B;  4PFP A;  1ZSZ C;  3JCM V;  3UAT A;  2JTE A;  1YJN Q;  3JB9 H;  4E7J A;  4M75 C;  2XKO C;  4F17 A;  4PNO A;  4J9D A;  2LJ0 A;  4F16 A;  2EYX A;  3CCM Q;  4LN2 A;  1W70 A;  2XHC A;  1VIE A;  3CC2 T;  2FPF A;  3FB9 A;  2CYZ B;  2O9S A;  3V7S A;  3M56 A;  5KYU A;  4E6R A;  2DL3 A;  1FMW A;  1B07 A;  1PHT A;  1OV3 A;  1N8R U;  2L5Q A;  2GCX A;  1BB9 A;  3CCR Q;  1WA7 A;  4DBQ A;  1VQL T;  2PUO B;  3ZBD A;  2O01 E;  5GAN g;  4RTW A;  2MAM A;  2HDA A;  1M9S A;  1UGV A;  4C92 F;  3SHW A;  2RNA A;  4RTU A;  2QI2 A;  2DD5 A;  1U1T A;  3QHS A;  1SRM A;  5GAN 4;  2QK0 A;  4QVD A;  2DZ9 A;  1Q7Y U;  3QZ9 B;  1ZBJ A;  2PUK B;  5LJ3 h;  3THK A;  5GAO p;  2EAY A;  2J06 A;  5L8R E;  3CEY A;  3A8G B;  2X4J A;  1M3B A;  2K57 A;  1JJ2 P;  3RKW A;  5CCA A;  3SWN B;  1CSK A;  3PIP A;  1VQ8 T;  3M0T A;  2HKQ B;  3H8Z A;  5ECA A;  4PJO G;  2RHI A;  2QA4 T;  1ARK A;  4PJN A;  1WHK A;  2ZPG B;  3I5R A;  4MMK A;  1A0N B;  4C8Q D;  2AZV A;  1GL5 A;  2M02 A;  1YIJ Q;  2A3L A;  3OYL A;  2EBP A;  3M58 A;  1B3Q A;  3TU4 K;  3CCE T;  3NTI A;  3H6Z A;  3QO3 A;  1Q86 U;  2E5Q A;  2XMF A;  2I0N A;  2KGT A;  3CCU Q;  3CC7 T;  4MDX A;  1PG5 B;  1YJW Q;  1SPK A;  3KUF A;  3EG3 A;  4D8D A;  2BZY A;  2CRE A;  1QMC A;  4KH0 B;  1UGR B;  2EIF A;  3G6E T;  1UGS B;  1J3T A;  3I56 Q;  1Y96 B;  5DLQ E;  1SHF A;  4LE9 A;  5IT9 E;  2MK5 A;  3VS7 A;  4KUL A;  4J6W A;  2ESW A;  1WNL A;  1VQ5 T;  2XI9 A;  1KFZ A;  1TS9 A;  3VS2 A;  5GAN 8;  1WXB A;  3DB3 A;  4AMC A;  2QDL A;  7AT1 B;  3NTH A;  4BY6 B;  3X20 B;  1VQ4 Q;  2DKG A;  2JZ2 A;  3OA6 A;  1R77 A;  4A53 A;  3JCM h;  3OYY A;  4M75 D;  2O31 A;  2OTJ A;  5LJ5 d;  3CCQ T;  3MPU B;  3QDF A;  2ED0 A;  2EQI A;  5J26 A;  5KYX A;  1D0X A;  1NJI R;  4D8K A;  3L2R A;  4EIK A;  1BIB A;  3J81 E;  1K8A R;  4NS5 A;  2HQH A;  2AKL A;  2A36 A;  1OEB A;  1WJR A;  4OMM A;  2DER A;  2F5K A;  1VA7 A;  3QYG B;  3WXM B;  3QBY A;  1X6B A;  1KK7 A;  2FVU A;  2MI6 A;  3C12 A;  4WCI A;  3EGD B;  2VYT A;  1W2B S;  5LJ3 f;  1YHQ Q;  3LGL A;  1KSW A;  4R56 A;  2KAF A;  3FJP A;  1I81 A;  2QTV A;  4C8Q G;  2PTK A;  4BI8 B;  3A8L B;  2QQS A;  2RF0 A;  3HPW A;  2BE7 D;  2I2L A;  3PMI A;  3JCM J;  2RB6 A;  1UFF A;  4MZP A;  1BI3 A;  3DKM A;  2C06 A;  2YSQ A;  2VV5 A;  1PD0 A;  3EFO A;  4A4H A;  3QJ6 A;  4FSS A;  1Q81 U;  1VQ6 A;  1YIT T;  3SWN C;  4FYW B;  3VV0 A;  2M1H A;  3RR6 A;  2EW3 A;  4E7Z A;  4BE0 A;  2VGN A;  2MWO A;  4M7A G;  4OMN A;  3P8B B;  3I55 A;  1QKW A;  3HTR A;  1M4Z A;  2YLC A;  5LJ5 e;  2K7A A;  3OYK A;  1KJW A;  4PJO A;  1M30 A;  2CUB A;  3AHU A;  1YWO A;  3QII A;  4J7I A;  2DXU A;  1PSE A;  1K73 C;  2L2P A;  2RJD A;  2COW A;  3S6W A;  3EG1 A;  4KGZ B;  3PFS A;  2DZC A;  1VQM A;  4M75 G;  2LCS A;  1T3L A;  4FSX A;  2Z0W A;  5I2S A;  4MDW A;  1S72 A;  1QVG S;  2DRK A;  3G71 Q;  8ATC B;  2JT4 A;  1CKA A;  4AG2 C;  5GAN h;  3CPW P;  3UF4 A;  2P0Q A;  4M77 E;  3UA7 A;  4DQ2 A;  4ATO A;  2CP5 A;  3INZ A;  4CC4 B;  3BY7 A;  2EYZ A;  2EKH A;  5GJV B;  5A0L A;  2EJG A;  1FMK A;  1ABQ A;  3JCM f;  4N4I A;  1KD1 R;  2KR3 A;  4OMO A;  5GAO m;  3PVL A;  1VQ6 Q;  4M7D B;  1WXT A;  1AZE A;  4XU2 A;  3RKX A;  4X9C A;  1RI0 A;  2KT8 A;  1G8X A;  1SKU B;  1RAI B;  4XTX A;  2A0F B;  4JZ4 A;  1TUG B;  2L3S A;  3JAM E;  4M78 B;  2E1H A;  3G7Z A;  2QDY B;  2AT1 B;  4OF1 A;  2D8H A;  4ZGE B;  3TRE A;  2LT1 A;  2F69 A;  3KBG A;  1IGQ A;  2MMP A;  4O6J A;  1M5Q 1;  1JXM A;  2MF2 A;  4E7L A;  8AT1 B;  1N6A A;  3QZ5 B;  1R8O B;  1M1F A;  3DB4 A;  1NEB A;  3GLX A;  3KFV A;  4HXJ A;  1I1J A;  2ZGW A;  4ZTJ A;  1WHJ A;  4N4G A;  2OI3 A;  3VRZ A;  2X9H A;  5GAM h;  3OYJ A;  1TH7 A;  1VQ7 A;  5IAY A;  2L89 A;  1OU8 A;  2QAZ A;  1YJ9 Q;  3CCS A;  3F70 A;  4EMK A;  4RUG A;  1G3Y A;  4FU6 A;  1RAC B;  3E9F A;  1RAF B;  3VJP A;  2V8K A;  5I21 A;  2SEM A;  2QQR A;  4OB3 B;  2P0P A;  1VQO A;  2FPD A;  2A08 A;  2OTJ T;  2HZY A;  4C8Q A;  4E47 A;  2IVW A;  2GGR A;  3TSZ A;  2HL3 A;  3DLL A;  2E41 A;  2DTI A;  3VYG A;  1YP5 A;  2X35 A;  4A63 B;  1VQP A;  4XTY A;  4IUT A;  2GTJ A;  1AOJ A;  1XTD A;  4C0G A;  5D6W A;  5CIU A;  4PJO E;  3M53 A;  4II1 A;  2WSE E;  5I2M A;  3L2V A;  2C0O A;  1Z9Q A;  1IZ6 A;  4Z89 A;  2L3R A;  4KUI A;  1YI2 Q;  4GLK A;  4FL6 A;  1EIF A;  1XJW B;  4OGC A;  1KC8 C;  1GCQ A;  3PNW C;  4LXC A;  2KT1 A;  3ZL7 C;  4M77 F;  5GAN f;  1K1Z A;  2A37 A;  6AT1 B;  2O4X B;  3G1J A;  4C0D B;  1C1A A;  2C0I A;  3O8V A;  1ABO A;  4ZTF A;  4JPB W;  2EQU A;  4CC7 A;  3LWI A;  3OYA A;  3L2W A;  3S3N A;  1KD1 U;  1YCY A;  3MEW A;  3SDZ A;  3CC2 Q;  3H0H A;  1BYM A;  1MV3 A;  1M2O A;  1ZSZ A;  3A5Z B;  1QVF P;  3I5S A;  3J7A F;  2L3P A;  1F1B B;  4M75 A;  1VQ6 T;  2LQN A;  1NG2 A;  2YHT A;  1VQL Q;  2ED1 A;  2ABL A;  1G3W A;  1AWW A;  3CD6 A;  2HSE B;  3I55 T;  1AWX A;  3OBW A;  2E4H A;  3E1S A;  1K9M C;  2CGH A;  4M7D E;  2W10 A;  4FT4 A;  4JJD A;  5AYF A;  1LPL A;  2CSQ A;  2RQW A;  1UDL A;  1OYX A;  3M5A A;  4C92 C;  1WHH A;  2K4Y A;  4A4F A;  3CMA A;  2JNG A;  4IUV A;  2RQU A;  4XTU A;  2EFI A;  3I35 A;  2ZPH B;  1ZA1 B;  2X3W D;  4AG1 C;  2G3R A;  1VQ5 A;  1BU1 A;  5GMK i;  4M78 E;  2COY A;  1VQM T;  5FWC A;  3TCJ A;  1JRI A;  3CME A;  4FM4 B;  2DEQ A;  2P0K A;  2LQW A;  3M0P A;  9ATC B;  2PVD B;  1BI1 A;  1NYG A;  1S72 T;  1VQ8 Q;  2KRO A;  1H64 1;  2DIL A;  1BIA A;  2QA4 Q;  2OX7 A;  1SHG A;  3NMZ C;  2GNC A;  1VQN A;  2JXB A;  1D1A A;  4J8O A;  1LOJ A;  2XD0 A;  1JEG A;  2HSP A;  3GNF B;  2KK4 A;  4IKF A;  2D1X A;  5IXF A;  3OYN A;  2LQ8 A;  1NLO C;  1ZLM A;  1VQK T;  2L8D A;  2V8J A;  4OVA A;  4FCY A;  3CCE Q;  2DO3 A;  2RHY A;  4OMF B;  4NL2 A;  1UHF A;  4C8Q E;  3CC7 Q;  2XDB A;  1YCS B;  1UTI A;  3CQT A;  1FWZ A;  1WPY A;  3UT1 A;  1E6G A;  1KHC A;  4OML A;  2EJ9 A;  5LJ5 g;  3L42 A;  3R6N A;  3OYG A;  1QVG A;  1AT1 B;  1KQ2 A;  3OW2 P;  2LZ6 B;  1N5Z A;  3G6E Q;  2RQT A;  4HCC A;  3UDC A;  1M2V A;  2DPP B;  2VWF A;  1SF9 A;  4C5H A;  4JRP A;  1HXD A;  3VS3 A;  3M0R A;  5KH6 A;  2HD0 A;  2M0O A;  1VQ5 Q;  3EHQ A;  4J9F A;  1JQQ A;  4OB2 B;  4QKU A;  4M7A E;  5GAN 2;  5FRM A;  1M8M A;  4AT1 B;  5LL6 S;  3OYD A;  5KYU B;  3MP8 A;  3CXC P;  2DET A;  1X27 A;  1VQ7 T;  1G2B A;  4A4K A;  1YIT A;  3CCQ Q;  1RAE B;  3CCS T;  2RHZ A;  2K6D A;  1NLP C;  1KQS A;  3RMS A;  3HRU A;  5HK0 A;  2CUD A;  3HP9 A;  1MHN A;  2DJQ A;  2H8H A;  4OGE A;  5D7U A;  3G4S A;  4JJN K;  1VQO T;  2RJC A;  1WDX A;  5KYW B;  3HFN A;  1Y0M A;  4M7D F;  2MOX A;  1M8V A;  1X01 A;  1VQP T;  5DM7 R;  1HD3 A;  2R58 A;  2YDL A;  4OP0 A;  1K0X A;  1T0J A;  2CZ7 B;  2QTX A;  1Y57 A;  1K73 R;  4C92 D;  4M78 F;  4EPC A;  1W6X A;  4BDY A;  5FWB A;  4K11 A;  2LX7 A;  2X4X A;  2DM1 A;  2J7I A;  4XU1 A;  2CH4 A;  4F7U G;  1U1S A;  3RES A;  1LVK A;  1D3B A;  5IXB A;  2D0Q B;  1UGP B;  2E6N A;  3OYM A;  1ZUY A;  3X24 B;  3NTK A;  3JSC A;  2OTL A;  2HKN A;  2AK5 A;  2O9V A;  2KRN A;  3V8K A;  3MEV A;  2R57 A;  4HCZ A;  1XOV A;  1YIT Q;  2W0Z A;  2YWW A;  3LLR A;  1WXU A;  2HMA A;  2NUT A;  1JB0 E;  3MEU A;  4XTZ A;  1OPK A;  3CBM A;  4R0K A;  1M1K C;  4R55 A;  2ECZ A;  3HRS A;  1AWO A;  1C0M A;  3QUI A;  4IIO A;  5KYY A;  5GMK e;  2M16 A;  4C5G A;  1W2B P;  5HY6 A;  1V29 B;  3UWN A;  2K3Y A;  3MJX A;  3SWN A;  2EGE A;  3CD6 T;  3HKS A;  2E10 A;  5HKC A;  3NPF A;  3MKD A;  2B8A A;  4PJM A;  1VQ9 A;  4JLI A;  1YNZ A;  1TG0 A;  4JLG A;  2FG0 A;  4M77 B;  4BD3 A;  4MZM A;  1N8R C;  1JXO A;  4AFZ C;  3PVQ A;  3CMA T;  4CC2 A;  4J6Y A;  5FW9 A;  4KRT A;  3REB B;  2RQR A;  2ZPI B;  4M7A F;  3CBO A;  3TVT A;  3OB9 A;  3CME T;  2DFU A;  4BI3 A;  5J39 A;  4BAC A;  1Q7Y C;  3MHX A;  5KYX B;  3LW5 E;  2LDM A;  1VQN T;  5HCK A;  3GP8 A;  1X6O A;  3FEO A;  2VKN A;  4EMG A;  3V7R A;  1Y96 A;  2BUD A;  2K2V A;  2GQI A;  1RUW A;  2P4T A;  1WHM A;  2DVE A;  3QWY A;  4C92 G;  1RAH B;  1WYX A;  1Q82 R;  4L6V 5;  3EGX A;  1SSF A;  3JB9 F;  2FZK B;  1Z9Z A;  2CSI A;  3OMG A;  4QVZ A;  1YFN A;  2ZZD A;  1TU0 B;  1V1C A;  2RHU A;  5GAO l;  2JTM A;  3OS1 A;  1RAA B;  1K73 U;  4O5V A;  4YTL A;  1X6G A;  1Q86 C;  1PNJ A;  1NM7 A;  2RMO A;  1I5O B;  1UEB A;  3EFO B;  3EG9 B;  2F2X A;  2CS7 A;  1IO6 A;  2FZC B;  3ULR B;  4BB7 A;  3LH0 A;  1KC8 R;  5FRN A;  2DE0 X;  4QVC A;  5LJ5 h;  3EH1 A;  3BW1 A;  2DBK A;  1OZ2 A;  4LNP A;  4E7I A;  1XQH A;  4OB0 B;  3LX7 A;  5FLX E;  4KUD K;  1BCO A;  5I11 A;  1UUE A;  3V8L A;  3X25 B;  5CKH A;  2OTJ Q;  4L59 A;  1B34 A;  2RJE A;  2YUO A;  2DBM A;  1D1B A;  3PT9 A;  4PJO B;  5FU6 B;  4ZNX A;  3CCJ A;  4KH1 B;  4X1V A;  2EGC A;  2OAU A;  4FYX B;  3JCM X;  4F7U A;  1LJO A;  1OUL A;  2BZ8 A;  1TXQ A;  2DMO A;  1H3H A;  3BE3 A;  4FW2 A;  3G4S T;  2JJ9 A;  3SFM A;  3EFS A;  2FB7 A;  1UJY A;  4Y28 E;  3LWH A;  2NUP A;  3V7C A;  2VUB A;  1N9S A;  3C0C A;  2YUN A;  1IRX A;  2KMT A;  1K9M R;  3EGU A;  2QEX A;  1QVP A;  2LJ3 A;  2QGG A;  4KT0 E;  5KCO A;  2ZPE B;  3M0U A;  2E64 A;  2KVQ G;  2K3X A;  2PNI A;  1QP3 A;  4M77 C;  1MNE A;  1GFD A;  1AZG B;  4JUV A;  1UE9 A;  4F14 A;  2KRS A;  5DLO A;  2WAC A;  2OTL T;  1OU9 A;  2K3B A;  3RBB B;  5A0D A;  1VQK A;  2VVK A;  4RTV A;  1I0C A;  3QG1 A;  1NJI U;  4BY6 C;  3JCM W;  1K8A U;  1Q82 U;  3P8D A;  4TVR A;  1QKX A;  3VRY A;  2XK0 A;  4JDS A;  4J9H A;  4FT2 A;  1BI2 A;  4ORZ A;  2IPO B;  5LJ5 j;  1I4K 1;  2KSS A;  3GF5 A;  4E2F B;  3I55 Q;  1KQS S;  4IUU A;  1Q81 C;  2LC4 A;  2LMJ A;  2EYW A;  2RH2 A;  4RTX A;  2QQ9 A;  1TUC A;  4JS5 A;  2OAW A;  4F04 B;  1VQ9 T;  1TWB A;  2X3X D;  2JMC A;  4ZGD B;  4DOV A;  2RK2 A;  4C0Z A;  4J6X A;  1VQM Q;  3HSB A;  2DF6 A;  2L3Q A;  4EMK B;  4C92 A;  2NUZ A;  2P84 A;  1S72 Q;  3REA B;  3EG0 A;  2MPX C;  4EDU A;  1MUZ A;  5FU7 B;  3NGP A;  4XK8 E;  5LJ5 f;  2EQJ A;  2KXD A;  3EHR A;  3P8H A;  4QT7 A;  2LT4 A;  5CO7 A;  4RMO A;  4C8Q B;  2QGF B;  1Y7X A;  2EKO A;  1T3S A;  4PFO A;  4DBF A;  4ME7 A;  3CCL A;  1VQK Q;  4HVW A;  4DBH A;  4N0A C;  5CKE A;  4HT9 A;  3OS0 A;  2JM9 A;  1VIF A;  2DL8 A;  3CC4 A;  3EH2 A;  1GXI E;  4F7U E;  3HL8 A;  1PCX A;  3OSS C;  5GAO r;  3OYB A;  2Y90 A;  2GFU A;  4IUR A;  4ESR A;  4M7A B;  4XTW A;  1AVZ C;  2EVR A;  2VAS A;  2K79 A;  1MMG A;  3S3M A;  1VYU A;  4J9I A;  2LVM A;  2D9T A;  3RKY A;  3FIF A;  5GAM e;  2DL7 A;  1AWJ A;  3IQL A;  1X2K A;  2EGA A;  2HQX A;  2DX1 A;  1ZSZ B;  5IN1 A;  2EJF A;  4M75 B;  2DXB A;  3QDR B;  1VQ7 Q;  1RI9 A;  1NEG A;  3CCV A;  3MET A;  4M77 D;  1H3Z A;  2H3J A;  3CCS Q;  3C4S A;  2F2V A;  1AEY A;  1SEM A;  3KXT A;  4IIM A;  2F1L A;  4CRI A;  2DLP A;  1JJ2 A;  1C6V X;  2JW4 A;  1VQO Q;  4BE1 A; 
#chains in the Genus database with same CATH homology
 1QWE A;  3I9Q A;  2ED0 A;  2HBW A;  2L0A A;  2EQI A;  3LH5 A;  1WDX A;  2OJ2 A;  4D8K A;  2NWM A;  4EIK A;  4OMQ A;  1Y0M A;  2B86 A;  2AKL A;  5IHN A;  2A36 A;  2CDT A;  2K2M A;  2MOX A;  1OEB A;  2GTO A;  1H8K A;  4OMM A;  1HD3 A;  2YDL A;  1K0X A;  1VA7 A;  3FJ5 A;  1T0J A;  1K0S A;  5IHK A;  2RPN A;  1PKS A;  1U3O A;  1X6B A;  2YUQ A;  2HCK A;  1Y57 A;  2BTT A;  4WCI A;  2BZX A;  1W6X A;  2DVJ A;  5FWB A;  1GBQ A;  4K11 A;  2LX7 A;  2CT3 A;  3RNJ A;  1KSW A;  2DM1 A;  1M3A A;  2J7I A;  2CH4 W;  2CH4 A;  2RN8 A;  4LUD A;  2PTK A;  1X69 A;  5IXB A;  3NHN A;  1ZUY A;  2RF0 A;  5I22 A;  4Z8A A;  2M51 A;  4HCK A;  4RTT A;  4HVU A;  1UFF A;  2AK5 A;  2KRN A;  2O9V A;  2V1R A;  2YSQ A;  1H92 A;  1XOV A;  4GBQ A;  2M0Y A;  3QWX X;  2LNH B;  2W0Z A;  2JS2 A;  4FSS A;  3EG2 A;  1WXU A;  2JMA A;  1OPK A;  1X43 A;  4R0K A;  3M0S A;  2EW3 A;  2ECZ A;  1ZUK A;  2D8J A;  4DEX A;  1AWO A;  4IIO A;  1EFN A;  1M27 C;  4OMN A;  1QKW A;  1PRM C;  1GRI A;  2EGE A;  3NPF A;  1WX6 A;  2K7A A;  1KJW A;  1YNZ A;  1M30 A;  1TG0 A;  2CUB A;  2FG0 A;  1YWO A;  1JXO A;  3M0Q A;  4AFZ C;  3PVQ A;  4J9G A;  4J9E A;  4CC2 A;  4GLM A;  1UHC A;  5FW9 A;  2L2P A;  4KRT A;  3EG1 A;  3REB B;  1E6H A;  2KNB B;  3GBQ A;  1SSH A;  2FO0 A;  2RQR A;  2LCS A;  1T3L A;  2P4R A;  1GCP A;  2J05 A;  4RTY A;  3TVT A;  2ROT A;  2DRK A;  2O88 A;  2YUP A;  2JT4 A;  1CKA A;  4AG2 C;  3UF4 A;  2E5K A;  3UA7 A;  1QWF A;  1W1F A;  1QCF A;  1PRL C;  1RLP C;  2JS0 A;  4M4Z A;  1BK2 A;  4CC4 B;  2EYZ A;  1VYV A;  2EKH A;  5GJV B;  5HCK A;  2O2O A;  1FMK A;  1ABQ A;  1U06 A;  2VKN A;  1UJ0 A;  1ZX6 A;  2EYY A;  2ENM A;  2KR3 A;  4OMO A;  1AZE A;  3PVL A;  1WXT A;  3VS0 A;  1K9A A;  3VS5 A;  2KT8 A;  2GQI A;  2DA9 A;  1RUW A;  3QWY A;  1OOT A;  1WYX A;  1VYT A;  1WIE A;  4AFU C;  1PKT A;  5L23 A;  2DL5 A;  1E7O A;  2KEA A;  2IIM A;  1Z9Z A;  4JZ4 A;  2CSI A;  3VS1 A;  2L3S A;  4J9C A;  1V1C A;  2J6K A;  2K9G A;  2HEQ A;  4AFQ C;  2A28 A;  2G6F X;  1X6G A;  1RLQ C;  2D8H A;  1S1N A;  3H0I A;  1PNJ A;  1NM7 A;  3VS6 A;  2DL4 A;  1JO8 A;  1FYN A;  2RMO A;  3UA6 A;  1JXM A;  1U5S A;  5IHI A;  2F2X A;  5GJW B;  4DEY A;  1IO6 A;  3ULR B;  1BBZ A;  1NEB A;  1WLP B;  2DE0 X;  3H0F A;  3KFV A;  4HXJ A;  2PZ1 A;  2DBK A;  1CKB A;  1I1J A;  4LNP A;  2OI3 A;  3VRZ A;  3JV3 A;  2J6F A;  2KE9 A;  1KIK A;  2FPE A;  2CT4 A;  4HVV A;  5I11 A;  1UUE A;  4RUG A;  2KYM A;  2AKK A;  2JM8 A;  2YUO A;  1ZUU A;  2DBM A;  2EPD A;  1NYF A;  1X2Q A;  2SEM A;  4ZNX A;  4X1V A;  3H41 A;  2FPD A;  2A08 A;  2EGC A;  1H3H A;  2BZ8 A;  4Y92 A;  2DMO A;  2D0N A;  1UJY A;  2KYB A;  2GGR A;  3TSZ A;  2KBT A;  1SRL A;  3VS4 A;  1M3C A;  2FRW A;  1UEC A;  1GBR A;  1YP5 A;  2LJ1 A;  1HSQ A;  3C0C A;  2DYB A;  2YUN A;  4A63 B;  4JJC A;  2MIO A;  2GTJ A;  1AOJ A;  4Z88 A;  3EGU A;  2LJ3 A;  5EC7 A;  2KXC A;  1GCQ C;  2C0O A;  1Z9Q A;  3M0U A;  4Z89 A;  2GBQ A;  2PNI A;  2V1Q A;  3O5Z A;  2KRM A;  2C0T A;  4AFS C;  1HJD A;  1K4U S;  2DNU A;  1YN8 A;  1GFC A;  1GFD A;  1AZG B;  1GCQ A;  1JU5 C;  2KT1 A;  1I07 A;  3ZL7 C;  2AZS A;  1K1Z A;  2A37 A;  1LCK A;  1UE9 A;  3TSW A;  4F14 A;  2KRS A;  5IH2 A;  2C0I A;  3U23 A;  3UAT A;  1G83 A;  2JTE A;  1ABO A;  2K3B A;  4JPB W;  3RBB B;  4CC7 A;  2VVK A;  4F17 A;  4RTV A;  2LP5 A;  1I0C A;  3H0H A;  2LJ0 A;  4J9D A;  4F16 A;  2EYX A;  1MV3 A;  4LN2 A;  1W70 A;  3I5S A;  1TUD A;  1QKX A;  3VRY A;  2L3P A;  4J9H A;  2FPF A;  1WFW A;  4ORZ A;  2O9S A;  2SRC A;  2LQN A;  4E6R A;  1NG2 A;  2DL3 A;  1B07 A;  2ED1 A;  1PHT A;  1T0H A;  1OV3 A;  2ABL A;  1BB9 A;  1AWW A;  2LMJ A;  1WA7 A;  2EYW A;  4RTZ A;  1UG1 A;  1AWX A;  4RTX A;  1TUC A;  1ZSG A;  2W10 A;  4JJD A;  2OAW A;  2CSQ A;  2RQV A;  2DRM A;  2RQW A;  1UDL A;  4RTW A;  2HDA A;  2X3X D;  2JMC A;  1UGV A;  3SHW A;  2RQU A;  2RNA A;  4RTU A;  4OMP A;  3I35 A;  1SRM A;  2X3W D;  4AG1 C;  2DF6 A;  2L3Q A;  2NUZ A;  1BU1 A;  1ZBJ A;  3REA B;  3EG0 A;  1MUZ A;  3NGP A;  5FWC A;  3THK A;  2F2W A;  2KXD A;  2J06 A;  3EHR A;  2LQW A;  3M0P A;  4QT7 A;  2FEI A;  4JZ3 A;  1NYG A;  2KRO A;  1M3B A;  2MCN A;  1MV0 B;  2DIL A;  1T3S A;  1SHG A;  3NMZ C;  2GNC A;  2JXB A;  1CSK A;  2YT6 A;  1OPL A;  2FRY A;  3M0T A;  1JEG A;  2HSP A;  2D1X A;  5ECA A;  5IXF A;  1ARK A;  2ROL A;  4HVW A;  1NLO C;  4CC3 A;  1ZLM A;  3I5R A;  3A98 A;  3PE0 A;  1A0N B;  2JM9 A;  2AZV A;  1WI7 A;  1GL5 A;  2DL8 A;  1UHF A;  2EBP A;  1B3Q A;  1YCS B;  1UTI A;  3CQT A;  1E6G A;  4OML A;  4ESR A;  1AVZ C;  2EVR A;  2K79 A;  2I0N A;  2XMF A;  2KGT A;  3R6N A;  1VYU A;  4J9I A;  1AD5 A;  1SPK A;  2LZ6 B;  4J9B A;  1N5Z A;  3EG3 A;  4D8D A;  2BZY A;  2CRE A;  2RQT A;  4LUE A;  3SEM A;  1K76 A;  2DL7 A;  2VWF A;  1AWJ A;  1QLY A;  3IQL A;  1X2K A;  3VS3 A;  1J3T A;  2EGA A;  3M0R A;  1YWP A;  2J6O A;  1SHF A;  3EHQ A;  4J9F A;  4LE9 A;  2DX1 A;  3VS7 A;  1JQQ A;  1PWT A;  2ESW A;  1KFZ A;  1RI9 A;  1NEG A;  1M8M A;  3VS2 A;  1WXB A;  2QDL A;  2F2V A;  1AEY A;  1X27 A;  1G2B A;  1SEM A;  4IIM A;  2K6D A;  2DLP A;  1NLP C;  2JW4 A;  4JJB A;  2CUD A;  2O31 A;  2DJQ A;  2H8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...