4Z88A

Sh3-ii of drosophila rim-binding protein with aplip1 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
RYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGELRGRRGYVPHNMVSEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RIM-binding protein, isoform F
publication title A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rim-binding protein
total genus 14
structure length 65
sequence length 65
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4z88A00
1K9AA 5L23A 1RUWA 2KROA 2LZ6B 3CQTA 3EG3A 5GJWB 1YN8A 1UTIA 2DF6A 2JW4A 3VS4A 4HXJA 4QT7A 3PE0A 2J05A 2ROTA 1WIEA 4RTYA 2V1QA 2MOXA 2ED0A 1JU5C 1ABOA 2AKKA 2KYMA 4HVUA 2DYBA 3NPFA 2HSPA 4JJBA 1NEGA 2DRMA 2ROLA 2DE0X 2OAWA 3PVLA 1I0CA 3VS7A 2RQWA 1HD3A 2JS2A 2CREA 1WI7A 2EYZA 1PRMC 4HVWA 2KRMA 2RN8A 1NYGA 5IXBA 2ED1A 2K79A 1QLYA 4CC2A 3UA7A 1K76A 2K6DA 2BZXA 1E6GA 1GFDA 4F16A 1QWEA 1QCFA 4OMQA 1UG1A 1I1JA 4LUDA 2GNCA 2C0IA 2LMJA 4F14A 1GFCA 4OMPA 2F2WA 3EG1A 2FRYA 2PTKA 1BK2A 5IHNA 1RI9A 2HDAA 3NGPA 1JEGA 4M4ZA 4E6RA 3M0TA 4J9FA 1MUZA 2D0NA 1X6BA 1TUCA 2A37A 2DLPA 2DL7A 1HSQA 2E5KA 3R6NA 2EW3A 2YUQA 2D8JA 4IIMA 1ABQA 1WX6A 2VVKA 1X43A 3VS2A 1M3CA 2J6KA 3PVQA 1K1ZA 3ULRB 1UGVA 2EGEA 4OMOA 4LN2A 1I07A 2KE9A 2C0TA 2EKHA 2I0NA 3VS5A 2KRSA 2MIOA 2EYWA 3EGUA 2FPDA 1Y57A 2IIMA 1E7OA 2J6FA 2FPEA 1KJWA 4RTXA 4F17A 1MV0B 2RQUA 1SRMA 2D1XA 2HCKA 2A36A 2KEAA 4X1VA 2B86A 4J9DA 1JQQA 1N5ZA 2X3XD 4JZ4A 2LNHB 1QKWA 5FWCA 4OMNA 1T0HA 4AFSC 1AZEA 2XMFA 2YT6A 4AG2C 2LJ0A 1YP5A 4AG1C 2GTJA 5ECAA 2LQNA 2EYXA 2EGAA 1J3TA 1AWOA 4J9GA 1WA7A 2VKNA 1IO6A 1WYXA 1SEMA 1AOJA 1Z9ZA 1RLPC 2EPDA 4ZNXA 2DRKA 4JJDA 1WXUA 2CDTA 2CH4W 4LE9A 2JTEA 3I35A 4IIOA 1OOTA 1GCQA 2O9VA 3M0PA 2DBMA 3M0UA 1PHTA 5FWBA 1FMKA 1OEBA 2YDLA 3VS1A 3A98A 2AK5A 1NYFA 1UFFA 1BB9A 1PKSA 1OV3A 4D8DA 3REAB 2KYBA 1ARKA 2K9GA 2LCSA 2CUBA 2FPFA 3EG2A 1SSHA 1M3BA 2JMCA 2YUOA 1YWOA 2JM8A 3NMZC 1GBQA 1GBRA 2NUZA 2EVRA 1G2BA 1AVZC 3M0QA 2J6OA 1NG2A 2PNIA 2K7AA 1U3OA 2J06A 2OI3A 1KIKA 2EGCA 1KSWA 1T3SA 1X2QA 1QKXA 1BBZA 1W6XA 4HVVA 2RQVA 2JMAA 2RQRA 2DX1A 3VS0A 1JO8A 5IXFA 3TVTA 2DL8A 1H3HA 1NLPC 4RTZA 1VYTA 3I5SA 4R0KA 3VRYA 4GLMA 1M30A 2V1RA 1UE9A 1M27C 1YCSB 2DBKA 3H41A 4DEXA 1LCKA 2CSIA 3VRZA 1JXOA 2JT4A 2CT3A 1VYUA 3NHNA 1JXMA 4WCIA 2QDLA 5I22A 1EFNA 2L3PA 1PKTA 3QWXX 1B3QA 2O2OA 1YNZA 1T3LA 2C0OA 2G6FX 4RTTA 2RPNA 1ZX6A 2RQTA 3TSWA 3H0HA 2CSQA 1MV3A 2L0AA 2L3SA 2KGTA 2OJ2A 3UF4A 1UECA 1UJ0A 3I9QA 3RBBB 2BTTA 1E6HA 2VWFA 2K3BA 2X3WD 2FEIA 2EYYA 2KXCA 1Y0MA 1ZLMA 3O5ZA 2YUPA 2DILA 2JS0A 4J9CA 2LQWA 1UHFA 4Y92A 1GL5A 1AWJA 1UHCA 4ORZA 4D8KA 2FO0A 2KT8A 4AFUC 2AZVA 1W1FA 1X69A 3I5RA 3VS3A 2O88A 4AFZC 1PWTA 1WDXA 2LJ3A 1B07A 1X6GA 2DL3A 1SHFA 2RNAA 1GRIA 4JPBW 3ZL7C 1K4US 1H92A 3M0RA 1GCQC 1X27A 2ENMA 2W10A 2BZ8A 1CKBA 3VS6A 4CC7A 4DEYA 2DL5A 5IHIA 2M51A 4J9HA 2O31A 4J9EA 4LNPA 2W0ZA 2L3QA 1TUDA 1UUEA 2KBTA 4HCKA 3SEMA 2D8HA 2YUNA 4Z88A 1ZUUA 3H0IA 1CKAA 3UATA 1UDLA 1ZUYA 1U06A 1WLPB 2KNBB 2KR3A 1X2KA 4FSSA 3QWYA 2CUDA 2F2XA 4AFQC 2HBWA 2CT4A 2BZYA 1AZGB 5EC7A 1UJYA 1M3AA 2ECZA 3TSZA 4RUGA 1SRLA 3C0CA 2LX7A 2DNUA 2KT1A 4KRTA 2DVJA 1K0SA 1KFZA 4RTUA 1CSKA 2ABLA 3M0SA 3GBQA 1ZBJA 1K0XA 2EBPA 2PZ1A 4ESRA 5GJVB 1QWFA 1SPKA 2P4RA 1M8MA 2FRWA 3LH5A 1SHGA 1NEBA 1HJDA 1VA7A 2JXBA 4OMLA 4K11A 2GBQA 1WXBA 1S1NA 1G83A 2F2VA 3REBB 5I11A 3EHQA 2O9SA 2EQIA 2AZSA 2LP5A 2H8HA 1TG0A 2DMOA 2DJQA 3THKA 4GBQA 1A0NB 1OPKA 1V1CA 2LJ1A 1NLOC 3H0FA 1WXTA 2K2MA 2ESWA 5IH2A 2DL4A 4RTWA 4J9BA 4Z8AA 4JJCA 2YSQA 1AWXA 2J7IA 2NWMA 1XOVA 1FYNA 3U23A 1YWPA 2MCNA 2DM1A 3FJ5A 1H8KA 2GTOA 3SHWA 1AWWA 4A63B 2JM9A 2CH4A 1AEYA 1ZSGA 1AD5A 2RF0A 3IQLA 5IHKA 2GQIA 2RMOA 2SEMA 4Z89A 2SRCA 2A08A 5HCKA 2DA9A 1PNJA 1ZUKA 3EHRA 1NM7A 1WFWA 4EIKA 1OPLA 2A28A 1PRLC 1W70A 2L2PA 1BU1A 2M0YA 2AKLA 1GCPA 1Z9QA 3KFVA 4JZ3A 5FW9A 4OMMA 3RNJA 4RTVA 1VYVA 2HEQA 4LUEA 3UA6A 2GGRA 1RLQC 2FG0A 4CC4B 1U5SA 1T0JA 2KRNA 4J9IA 3JV3A 3EG0A 4CC3A 2KXDA
chains in the Genus database with same CATH superfamily
3EG3A 3CQTA 3EGDB 1M90C 1VQ9A 3QXEB 3S3OA 1VQKA 2J05A 4KGVB 3LGLA 4RTYA 5KYUA 2QAZA 1ABOA 2AKKA 5A2QE 4HVUA 2DYBA 1IRXA 4HA8A 5FU6B 3PVLA 3OSVA 3MHXA 5IXBA 2HQXA 4IUPA 1B34B 5KYXA 1W2BA 1YIJA 2LDMA 1K76A 2K6DA 3HRTA 1VQ6T 4F16A 2MF2A 3LH0A 1BI2A 4OMQA 1UG1A 3QDFA 1S72T 1YFNA 4HCBA 1NJIU 3JCMg 4J83A 3GF5A 1SG5A 2PTKA 2DJZA 5IHNA 3CCJQ 1RI9A 5CVIA 3PT9A 4IUVA 3EH2A 1FX7A 1M1KR 2E5KA 4X9CA 2YUQA 2D8JA 3OYCA 1M1FA 3FDRA 2VVKA 1HK9A 3PVQA 5GMKl 1B34A 3ULRB 4N0AA 1F1BB 4OMOA 3LX7A 4MZPA 1LVKA 2XHCA 2FPDA 2QYZA 1QMCA 1QP3A 2PUOB 1KJWA 1JJ2S 3OYGA 1MV0B 4O6JA 4PJOG 4X1VA 4XU0A 3A8LB 1YJWT 5GAOr 2RA2A 4J9DA 2QQBA 3LWHA 1WHGA 1QKWA 5GANf 1VQ8T 5FWCA 2JTFA 5CQXA 1VQ9Q 2EYQA 3L42A 2AT1B 1VQKQ 2MWOA 4ELYC 1Y96B 2LQNA 3UPUA 2EGAA 5CAIA 1AWOA 1N9SA 1R0CB 1D0XA 3LGFA 1Q82R 1W2BS 1IO6A 1WYXA 1SEMA 2XU8A 1AOJA 2XG8D 1RLPC 4IKFA 4PJOC 4FYXB 4ZNXA 2XD0A 4PJNA 1WXUA 2CH4W 2BUDA 2JTEA 3JB9H 3UWNA 1GCQA 2YXYA 2RO0A 5GAMg 2DBMA 3CMAQ 5FWBA 4C0DC 1FMKA 4A54A 2YDLA 1WGSA 2DTHA 2LQ8A 2MPXC 4CC3A 2ZPBB 2RHIA 4N4HA 5IT9E 2KYBA 1U1SA 1WNLA 4OB0B 3PIOA 2L3RA 3CC7A 1G5VA 2LCSA 4XTUA 3EG2A 4C92A 1M3BA 2JMCA 1FXXA 4LXCA 3M59A 2NUZA 1LNXA 2EVRA 3QDRB 5GANh 2PNIA 3R6OA 4KGZB 3EH1A 2EGCA 4BDZA 1YITQ 2X51A 2DIGA 1BBZA 4HVVA 4KT0E 2RQVA 1RAEB 4PK4A 1IGQA 5GAMe 5GMKj 2QK0A 1JO8A 1VQOT 2DETA 1IHVA 2DL8A 1NLPC 2QEXQ 3TREA 3I5SA 1MMNA 5GAOp 1TH7A 1PC0A 1PCXA 3QHSA 4DEXA 3CD6A 3SWNB 1LCKA 4EMKB 2CSIA 3OW2A 2CT3A 1I5LA 1Y71A 1JXMA 2QA4A 2QDLA 4X9DA 4DBRA 4BUGA 1FMWA 4M75G 5I22A 3A8MB 1NPPA 3CC2A 1YNZA 4C8QB 2C0OA 2D0QB 3H0HA 2A7YA 2KGTA 2OJ2A 3UF4A 3ASKA 4EMHA 1NPRA 1IB8A 2BTTA 1YBYA 2X3WD 2VGNA 4OB1B 4LDVA 2EYYA 2KXCA 3FB9A 1M2VB 2JN0A 3DB3A 1K8AC 2JVVA 2RI5A 5KYNA 1WHJA 2M1HA 1KC8C 4M75C 2LQWA 1UHFA 5DY9A 3UT1A 8ATCB 2FO0A 4BE2A 3CC7Q 3DLMA 4C8QD 3V8JA 3MEWA 2FB7A 4AFUC 4AFZC 2PU9B 1WDXA 3CPWA 1X6GA 1M90R 1D0ZA 3TEEA 4ZTJA 3M0RA 3CBOA 1M9SA 3I55A 5IAYA 1M2VA 4A4KA 4L59A 2FVUA 2M51A 4LNPA 2W0ZA 2V26A 4A4EA 3OW2S 3FJPA 3DB4A 2D8HA 2CP3A 3L2ZA 1G3SA 1ZUYA 4A4HA 2X4YA 3GPLA 3OMGA 4DQ2A 5CR2A 3CD6Q 5LJ5j 4AFQC 3FEOA 1AZGB 1PM3A 2QA4Q 4XU2A 3C0CA 2KT1A 5L8RE 1K0SA 2XI9A 5KCHA 5GAOl 3GBQA 1QVGA 1K0XA 2I2LA 5GAN4 3VKIA 3F70A 4M7DB 1VIFA 3CC4A 3LH5A 1SHGA 3E1SA 1VQPQ 3KBGA 4UC4A 1EX4A 1VA7A 2EKOA 1KHCA 1OZ3A 1KQ1A 4K11A 3JCMf 3CXCP 1S1NA 1M1KC 1G83A 3CPWS 3REBB 1M90U 2HNIA 1XTDA 3QIIA 2ESWA 3OYMA 4Y91A 5FU7C 4QQGA 4Z8AA 2E65A 3JCMc 3PGGA 2J7IA 4M7DD 3U23A 1YWPA 2QXFA 4ANJA 4M7DA 5C0MA 1H8KA 3SHWA 2MK5A 1VQ6A 1QP2A 5M9OA 2QG9B 4C5GA 1S72A 3M56A 2CH4A 4WTOB 1ZSGA 4N4GA 4DOVA 3QO3A 2M0OA 3OYJA 3I55Q 2OTJT 2RMOA 1VQ5T 1ZSZC 5HK3A 2JJ9A 5HCKA 1DJ7B 2RI3A 2LQKA 4JLIA 1ZUKA 5GANe 3QKJA 5KYYB 3QUIA 2A28A 5HK0A 1BU1A 2AKLA 4M77G 1Q82C 2NYSA 5FW9A 1BI1A 2CP5A 2P0QA 4RTVA 4PFZA 4J6XA 1QVGS 3L2WA 1VQLQ 1RLQC 4BB7A 2F1LA 1T0JA 4II1A 1HXDA 3JCMh 2KXDA 3J80E 5L23A 3OY9A 1RUWA 2KROA 2LZ6B 3HFNA 1VUBA 3D7SB 3G6ET 3OYBA 4HXJA 4QT7A 4ZGEB 2P84A 4EDUA 1U1TA 4LDWA 4ZGJB 1YJWA 3L2UA 1WIEA 4QKUA 4J8OA 5LL6S 2K5LA 2E3IA 4M77C 2V1QA 4F7UG 3CC4Q 1VQMQ 2MOXA 2ED0A 5KYYA 5GMKm 4B6MA 1VQ8A 4M7AB 4M78B 5I2SA 1WQ7A 2DRMA 3M4YA 3VU3C 2OAWA 3BDUA 3VS7A 5GAMf 4MZTA 4E7IA 3OQ5A 2CREA 1WI7A 2EYZA 5KYWB 2HZYA 2RN8A 2K79A 1QLYA 4CC2A 1RADB 3PIPA 1E6GA 1GFDA 1QWEA 2CP6A 3JCMW 4F14A 3OYNA 3EG1A 2FRYA 1TU0B 1BK2A 8AT1B 1UB4A 2JNGA 3P8DA 1VQ6Q 2DEUA 1KD1C 3NTKA 4M7AD 3BFMA 4PFPA 1S72Q 3CCQT 1XQHA 5J39A 4M7AA 1TUCA 4M78A 2DLPA 2DL7A 3EAEA 3J81E 3C95A 2EW3A 4PL6A 4FL6A 3KXTA 1WX6A 2XDDA 1X43A 1M1GA 2DTOA 3CEYA 4OB2B 3RMSA 5KYWA 2E4HA 4MZMA 2J6KA 1ZQ1A 4JS4A 3EG9B 1UGVA 5LJ3f 2EGEA 2G3RA 2KK4A 4LN2A 1I07A 3G71T 1PSFA 2I0NA 3DLLA 2KRSA 2IIMA 1KG1A 3CCRQ 1RAIB 1E7OA 3ZFJA 4OGCA 1K8AR 2RQUA 1D1CA 4BACA 3H6ZA 2HCKA 2K3YA 1KC8R 2B86A 5GAMh 1XNIA 3OS2A 2LNHB 4HT8A 1T0HA 1VQOA 1AZEA 1YI2Q 1G3TA 2XMFA 2YT6A 4AG2C 1YP5A 2GTJA 5CK9A 4PLIA 2EYXA 1J3TA 3G4SQ 4J9GA 4FIBA 1QVFP 3GLXA 3PFSA 1EZZB 2DTIA 1C6VX 4JS5A 5LJ3d 4BE0A 1OULA 1UGQB 1WZOA 1FWZA 2DRKA 3HKSA 2E64A 2MMPA 3WXMB 4LE9A 3A8OB 4IIOA 3M9QA 1JJ2A 3LWIA 3CCMT 4OMFB 2DD5A 3M0PA 5LJ3h 4E47A 3H9NA 2JUFA 5CQYA 3A98A 1UFFA 4CI0C 1VQ7T 1V29B 2FL7A 4NL2A 1OV3A 4NL3A 3JB9J 3OSSC 4XK8E 2CS7A 2K9GA 2CZ6B 2CUBA 3M57A 2FPFA 2RHXA 4XTYA 1GBRA 1K8AU 1MNDA 2DXUA 1N8RC 1KHIA 3QZ9B 3EGDA 1KIKA 1B7TA 1T3SA 4XU3A 2VXFA 1X2QA 5D6XA 4PJOF 1W6XA 4Y28E 2KAFA 3A5ZB 2DX1A 3MCAB 1H3HA 2KVQG 2BKDN 1ZA2B 4R0KA 3VJPA 4GLMA 1VQNT 1PSEA 3OYAA 4QQ6A 2V1RA 1VQOQ 5KE3A 1QW1A 2YRCA 3PMIA 4PJOE 4EMGA 2DBKA 5CKHA 1IREB 3VRZA 1M5Q1 2LCCA 2V8IA 3CBMA 3QJYA 4J6WA 1OI1A 2CZ1B 3UDCA 4JJNK 2L3PA 1PKTA 2RJCA 3JCMe 2O2OA 3MEAA 4DBQA 3QYHB 1AHJB 1D0YA 2G6FX 3G1JA 2R5AA 4C92F 1ZX6A 2JTMA 3CCUT 4GY5A 1MV3A 1I4K1 2L3SA 3QPHA 1UECA 5J26A 2VWFA 5CKFA 1I8FA 2DAQA 1Y0MA 1ZLMA 4E7KA 3O5ZA 2PVOB 4L5GA 3OMCA 3CCET 2DILA 4Y92A 1IXDA 2ZPFB 2M16A 4C0DB 1RAHB 4XTXA 2AZVA 2O88A 4BDYA 2RI2A 1PWTA 1YIJQ 1B07A 4JUVA 2B8AA 2DL3A 2M02A 5GAOm 3TU4K 1SHFA 4C92G 1M1KU 2RNAA 4OVAA 1GRIA 4JRIA 4PJOD 3ZL7C 5GAOq 3L2QA 1GCQC 2LRQA 2BZ8A 2R5MA 4VUBA 2A3LA 1WHLA 2X4WA 2LVMA 3MJXA 1Y96A 5IHIA 1C1AA 4ME7A 2JZ2A 2O31A 4J9HA 4J9EA 5EG2A 1AT1B 3WVEB 2YRVA 1TUDA 2KSSA 2KBTA 4HCKA 4QVZA 1OQKA 2YUNA 5CCAA 9ATCB 3RIRA 2OTJA 3JB9I 3OBWA 4C92C 1VQ5A 1UDLA 3AHUA 1BYMA 2OTLT 1WLPB 4DA4A 2KR3A 1X2KA 4FSSA 5CIUA 2F2XA 2O4XB 4M75F 1YHQT 2BE9B 4BI4A 2HBWA 1TXQA 2YLBA 3CBPA 1UJYA 4XTWA 2RM4A 1KD1R 3CCST 2DVJA 5I2MA 1KFZA 3M5AA 2MI6A 3OB9A 4RTUA 5LJ3g 5DM7R 4JLGA 3JB9G 2E70A 1Q82U 5GJVB 2YWWA 3HL8A 1M8MA 4M75E 2CYZB 2RK2A 4IUUA 3BY7A 2DO3A 4IURA 4TVRA 1D1AA 1MMAA 4C5IA 3G6EA 2E6NA 1OZ2A 3CCLT 4KUIA 2GBQA 1V76A 2VYTA 4HCZA 3BDLA 2O4XA 1TWBA 1BIBA 2O9SA 2EQIA 1QCNA 3META 2LP5A 1V1CA 2LJ1A 4BE1A 1FMVA 4BY6B 3PNWC 1PG5B 1UGSB 4F04B 1AWXA 5LJ3e 2NWMA 2ZGWA 1FYNA 4XTVA 3ZEHA 3FJ5A 1RI0A 2JM9A 3JRZA 4IUQA 3SWNA 4EMKA 4E7ZA 3IQLA 4QW2A 3JCMQ 3EFOB 2EJ9A 4BI3A 4E2FB 3OYFA 2OAUA 2RB6A 3CCQA 3EHRA 3QJ6A 2H3EB 4C8QA 5GMKh 1PRLC 1KD1U 3RR6A 1W70A 3BE3A 2QI2A 1I81A 1GCPA 2E10A 1Z9QA 3JSCA 4FCYA 1VQ5Q 3KFVA 4JZ3A 3RNJA 1NJIC 3A8GB 5IN1A 5CKEA 2GGRA 2FG0A 3G71A 2MWPA 3CMAT 3EG0A 4QVDA 2RHZA 5GJWB 1SKUB 2QDYB 4RG2A 1UTIA 2DF6A 3RKWA 2JW4A 1PD1A 3FLGA 4V2SA 2QTVA 3PE0A 2AIRB 2NUPB 4RMOA 2YRDA 2ROTA 1KK7A 4AMCA 4C5EA 5FRNA 1JU5C 1N8RR 2KYMA 4JJBA 5CKBA 3G6EQ 2ROLA 1U8RA 2DE0X 3MKDA 4A4FA 2RJEA 1HD3A 2JS2A 2ZPGB 1PRMC 3FIFA 5I21A 1LJOA 5LJ5f 1NYGA 4XU1A 1Q86C 1YITT 1R8OB 4DBHA 3UA7A 3CC2Q 2K2VA 3VUBA 3JCMX 1QCFA 1KQSA 3O8VA 1I1JA 5AT1B 1YJ9T 3OYHA 2C0IA 4KBMB 3INZA 3HP9A 4LD6A 2QEXT 5FROA 2C06A 1TS9A 5DLQE 2NUPA 2KY9A 3BW1A 4RCCA 2HDAA 3NGPA 5FU7B 4M4ZA 4E7HA 4M7DG 3V7SA 4NS5A 4J9FA 3CCMA 1MUZA 1X6BA 1K73C 3V8KA 4PJLA 4YTLA 4BI8B 3QBYA 2XK0A 1VQ7A 4M77F 1K1ZA 3CCQQ 6AT1B 5LJ5d 3HHTB 3URGA 2FZKB 4D6WA 2C0TA 1ZSZB 2X9HA 3VS5A 2RJDA 2MIOA 1Y57A 4JRPA 2RJFA 2J6FA 4M7DC 4RTXA 2D1XA 2DVEA 2A36A 1N8RU 4M77E 2LT1A 1N5ZA 2X3XD 3NTHA 3TQ7P 3J7AF 3FRNA 5LJ5h 4OMNA 4F7UF 4AFSC 2PUKB 2ZCFB 5ECAA 2A0FB 2QTXA 2NUTB 2WSCE 2HQHA 1VQNA 1WA7A 2VKNA 1KQSS 1OU8A 4JDSA 3E9GA 1YJNT 2F69A 4F7UE 4FM4B 1TOVA 5GMKi 2PVGB 2Y90A 2DK3A 1BIAA 1OOTA 2DXTA 2O9VA 5D6YA 4FYWB 3M0UA 1ZBXA 4C0FA 3CCUA 4IUTA 4E7SA 2CGHA 2NUTA 2P0PA 2QQRA 2AK5A 1NYFA 1PKSA 3E9FA 4F7UB 4PFOA 3REAB 5HKCA 3OA6A 1ARKA 2DERA 3OYDA 4M77D 4JRQA 4M7AG 4M78G 1Q95G 2KQWA 3I56T 3CCEA 2HAXA 2YUOA 1YWOA 2COZA 1VQ7Q 1D1BA 1NG2A 2K7AA 1U3OA 2OI3A 5FLXE 2E6ZA 1QKXA 2RQRA 2RD1A 1VQPT 5IXFA 1JJ2P 4PNOA 2HBPA 5D7UA 3OS0A 4FT2A 1VYTA 3C94A 3VRYA 4M78C 4M7AC 3WVDB 3ZBDA 3PMTA 3E2UA 5GMKe 2FZCB 3LW5E 2QQSA 1VQ4T 1UE9A 1M27C 4BD3A 1M8VA 3H41A 3QG1A 4PKCC 1WJRA 2WSFE 4FU6A 4LDYA 5D6WA 5GAN2 1W2BP 3JCMJ 1K9MC 3GNGA 1G3YA 3LLRA 1WPYA 2HL5C 2OTLA 3RESA 2GQVA 1T3LA 4CRIA 2HKNA 3QSUA 1YHQA 2RPNA 2RQTA 3TSWA 2MYSA 2CSQA 1UJ0A 3I9QA 2FYKA 3AT1B 4KH0B 2GF7A 3CCSA 2FEIA 1P92A 3EG9A 2VB6A 4XQ3A 1MMDA 1YJWQ 3CCUQ 2R57A 2YUPA 2EQJA 1NJIR 4J9CA 1H641 1VQ8Q 3EFRA 3RKYA 5HY6A 3SDZA 4O5VA 4ORZA 5C6SA 4C5HA 3CCLA 2FHDA 1Q7YC 1VQLT 2IVWA 2CKKA 3OYIA 1W1FA 1X69A 3VS3A 3CCVT 3OYYA 4RG8A 4JPBW 2QQAA 1K4US 4HT9A 1X27A 2ENMA 1QCOA 5LJ5g 3OS5A 4FYVB 3VS6A 5KYXB 3KUFA 2X4JA 1VQMT 4CC7A 2CP0A 2DL5A 3HTRA 1UUEA 2ZPHB 3SEMA 2DD4A 2O01E 1Q86R 4Z88A 3RMQA 5J3BA 3H0IA 3UATA 3MP8A 1KC8U 1TUGB 4OP0A 3M4GA 2CUDA 1VIEA 2ZPIB 2EJGA 3HRUA 4RCBA 4FSXA 5EC7A 4LDXA 2ECZA 2EWNA 4RUGA 1SRLA 3CMET 4E7JA 3H8ZA 2HQEA 2DNUA 3L1AA 1IGUA 2WSEE 5A0GA 2OTLQ 5LJ5e 1CSKA 1K73R 2ABLA 1YHQQ 2EBPA 1SPKA 2P4RA 3RUXA 3CMAA 5FU6C 5GAN5 3JCMP 4AT1B 1NEBA 4J7IA 2AHJB 3CCSQ 1HJDA 2JXBA 4OMLA 3FC3A 1RAGB 2GFAA 3RERA 4N0AC 4Q5WA 1NBEB 1D3BB 1WXBA 2VGMA 1BI3A 2F2VA 3L2RA 4FW1A 2ZZDA 5I11A 4MMLA 3GIBA 2H8HA 2DJQA 2RHUA 3V7CA 1QVFA 1WHHA 1A0NB 3CCRT 1OPKA 2E5QA 3CPFA 1WJQA 3H0FA 2PVDB 3CCLQ 1MMGA 2K2MA 3GNFB 3MP1A 4J9BA 3S3NA 1M2OA 2ZPEB 2VC8A 2YSQA 3P8HA 5CKDA 1XOVA 1YITA 4PJOB 2XDPA 1AWWA 4A63B 1Q86U 1YJ9A 1YI2T 1AEYA 2QEXA 4FYYB 5GANj 1AD5A 2K57A 3G4ST 4C92E 5KCOA 4R55A 4E7LA 1D3BA 2SRCA 1MHNA 1KQ2A 2DA9A 4A4GA 3OW2P 1NM7A 4EIKA 4RKUE 3HSBA 4ATOA 1MNEA 2M0YA 2DPPB 1GXIE 1NZ9A 1K73U 1Q81C 1N6AA 1VYVA 4PJOA 2XICA 3UA6A 1OYXA 2HKQB 4CC4B 5FRMA 4KGXB 2QGGA 3ME9A 4C92B 3JV3A 1PD0A 2DEQA 3VUZA 1JB0E 3JB9F 2R58A 4J7FA 1K9AA 1YN8A 2COWA 1UGPB 3VS4A 4ZTFA 2HD0A 3P8BB 1LPLA 3A8HB 4XAXB 3MEVA 5GANd 2VASA 1QVFS 4EPCA 1WQWA 2COYA 3NPFA 4XTZA 2HSPA 2NLUA 1NEGA 1I0CA 2RQWA 4HKEA 3HRSA 2CZ7B 3Q1JA 4HVWA 2KRMA 3CPWP 1TSFA 4C92D 1H3ZA 2ED1A 2EQKA 1UGRB 3A1PA 3CCJT 1JBMA 4ZN3A 4QVCA 2BZXA 5GAOn 3L2VA 2KDSA 4C8QF 1YJNA 4LUDA 2GNCA 2LMJA 4QQDA 3GOXA 3M58A 1GFCA 1WHMA 4OMPA 1RABB 2F2WA 3C4SA 3G7ZA 3MP6A 3X26B 3V8LA 3S3MA 1M4ZA 1LOJA 5GAN8 1JEGA 4E6RA 4N4IA 3OYKA 3M0TA 2YLCA 1YJ9Q 2D0NA 2A37A 1HSQA 3R6NA 3EGXB 4IIMA 4C8QE 1K9MR 4OF1A 1ABQA 2M9UA 3VS2A 1M3CA 2LC4A 2Y4YA 3VV0A 2RHYA 2KI7A 4M75B 1R77A 2XDBA 4WF2A 2EQMA 2KE9A 4KH1B 2EIFA 2EKHA 4C8QG 1XJWB 3I56A 2EYWA 3EGUA 3JB9D 2EJFA 4L6V5 2FPEA 1KQSP 1QVGP 1VQ9T 4F17A 1UEBA 1G8XA 2ATCB 5GAN3 1VQKT 1D09B 1SRMA 3S6WA 2KEAA 2OX7A 1MGQA 1JQQA 1N9RA 4JZ4A 3SWNC 2HL3A 4EMKC 3MEUA 3EGXA 1VQPA 1Q7YR 3X20B 1JRIA 2EAYA 2EQUA 2LJ0A 4AG1C 5GAN7 4M75D 3EFSA 2OTJQ 4C8QC 4M75A 3NFCA 4BY6C 4GLKA 2X4XA 1YIJT 4PJJA 1VQ4A 2LX9A 1RAFB 1Z9ZA 2D9TA 2EPDA 2LTOA 4J5YA 3V7RA 2PQWA 2E1HA 3MO8A 2IG0A 1X75C 2XKOC 4JJDA 2DYIA 2E12A 2CDTA 1BCOA 1OX8A 2V8JA 3I35A 2KMTA 3EFOA 1YJNQ 1K9MU 3T9NA 2CP2A 1PHTA 3HPWA 2E41A 4M7DF 1OEBA 3VS1A 2RH2A 4NOYA 2XIDA 1QVPA 4LDUA 1BB9A 1ZHIA 4D8DA 4MDWA 1Y7XA 3RDVA 4ELZC 1OX9A 4C0ZA 1SSHA 2WACA 2P4TA 2JM8A 3NMZC 1GBQA 4M7DE 1EIFA 1G2BA 1AVZC 3C12A 2J6OA 2K5FA 3M0QA 4R56A 2L5QA 4B9WA 2J06A 1VQLA 4ZGDB 1KSWA 1ZA1B 3RKXA 2CZ0B 3I56Q 1BCMA 3CCVA 1Q7YU 2JMAA 3X25B 3VS0A 2K5IA 3TVTA 1IZ6A 3GP8A 5GAN6 1X01A 4RTZA 1RAAB 1M30A 5A0DA 1VQMA 5KE2A 3X24B 2Y4XA 1YCSB 1JXOA 2JT4A 1VYUA 3NHNA 1HYOA 2X35A 4WCIA 5GANg 1EFNA 1NE8A 3QWXX 1VQ4Q 1B3QA 2E3HA 1Y07A 4PJMA 3SB2A 3G71Q 2DIQA 4RTTA 3VYHB 3OYLA 2K3XA 1WHKA 2LT4A 3QZ5B 2L0AA 3CMEA 1SSFA 3DKMA 4LD9K 3PTAA 3RBBB 2IPOB 1E6HA 3M53A 2K3BA 3OYEA 3TCJA 3CC7T 1X6OA 3M54A 1O75A 4OGEA 2D6FA 2JS0A 1ZSZA 1Q81R 4J6YA 1BKBA 1IHWA 1GL5A 1AWJA 4M7AF 1UHCA 4M78F 4MDXA 4D8KA 4M77B 1R0BG 2BE7D 2L8DA 3JCMd 2KT8A 4FT4A 3I5RA 4MMKA 4ZN1A 2QGFB 2LJ3A 2K4YA 2LCLA 2HMAA 4FW2A 3SFMA 3CCRA 2LNVA 1TTHB 1H92A 2W10A 2DXCA 4M7AE 1CKBA 4M78E 2HSEB 3SD4A 1WJSA 3CCVQ 4OB3B 3ER0A 4DEYA 2H3JA 5AYFA 2DZCA 4KUDK 3CCMQ 2L3QA 2VV5A 3CD6T 3MPUB 1VOMA 1YI2A 4M77A 3CXCA 2MAMA 2QA4T 2BIVA 4B9XA 3G4SA 1ZUUA 1W4SA 2RK1A 1G3WA 1CKAA 1U06A 3CC2T 5GAMj 2KNBB 1OU9A 4C0GA 4JRKA 3QWYA 2GCXA 2CT4A 2BZYA 3N5BB 1M3AA 3TSZA 2LX7A 4KRTA 3M0SA 3X28B 1ZBJA 2PZ1A 4F7UA 4ESRA 1QWFA 1Q81U 4Z02A 1C0MA 1SF9A 2FRWA 2VUBA 3CMEQ 5DLOA 1N27A 2P0KA 2VXEA 2V8KA 4M78D 2DFUA 4A53A 1VQNQ 5CO7A 1RL2A 4DBFA 3EHQA 3E19A 2AZSA 1TG0A 2DMOA 1RACB 3THKA 5LJ3j 4GBQA 1NLOC 1WXTA 5GAMd 4KULA 5IH2A 2DXBA 2DL4A 4RTWA 3JCMb 4JJCA 3I55T 3LYIA 5A0LA 1I5OB 2MCNA 3CCJA 2DM1A 2YHTA 2GTOA 4HCCA 2QQ9A 3QYGB 2EFIA 2L89A 2CP7A 3JCMV 3CXCS 2RF0A 3VYGA 3OBYA 3OS1A 5IHKA 2GQIA 2SEMA 4P5NA 4Z89A 1BI0A 1O9SA 2A08A 2DZ9A 2JOYA 1PNJA 5KYUB 1QQJA 4DOWA 1WFWA 1OPLA 3NTIA 3CCEQ 2L2PA 3JAME 2ZAEA 2Z0WA 1ACMB 1YCYA 2F5KA 4OMMA 4X34A 2DKGA 5KH6A 2F5TX 2HEQA 4LUEA 7AT1B 2QASA 1U5SA 2KRNA 2GFUA 4J9IA 3M55A 3CC4T 2FZGB 4PLLA 3HFOA
chains in the Genus database with same CATH topology
1K9AA 5L23A 1RUWA 2KROA 2LZ6B 3CQTA 3EG3A 5GJWB 1YN8A 1UTIA 2DF6A 2JW4A 3VS4A 4HXJA 4QT7A 3PE0A 2J05A 2ROTA 1WIEA 4RTYA 2V1QA 2MOXA 2ED0A 1JU5C 1ABOA 2AKKA 2KYMA 4HVUA 2DYBA 3NPFA 2HSPA 4JJBA 1NEGA 2DRMA 2ROLA 2DE0X 2OAWA 3PVLA 1I0CA 3VS7A 2RQWA 1HD3A 2JS2A 2CREA 1WI7A 2EYZA 1PRMC 4HVWA 2KRMA 2RN8A 1NYGA 5IXBA 2ED1A 2K79A 1QLYA 4CC2A 3UA7A 1K76A 2K6DA 2BZXA 1E6GA 1GFDA 4F16A 1QWEA 1QCFA 4OMQA 1UG1A 1I1JA 4LUDA 2GNCA 2C0IA 2LMJA 4F14A 1GFCA 4OMPA 2F2WA 3EG1A 2FRYA 2PTKA 1BK2A 5IHNA 1RI9A 2HDAA 3NGPA 1JEGA 4M4ZA 4E6RA 3M0TA 4J9FA 1MUZA 2D0NA 1X6BA 1TUCA 2A37A 2DLPA 2DL7A 1HSQA 2E5KA 3R6NA 2EW3A 2YUQA 2D8JA 4IIMA 1ABQA 1WX6A 2VVKA 1X43A 3VS2A 1M3CA 2J6KA 3PVQA 1K1ZA 3ULRB 1UGVA 2EGEA 4OMOA 4LN2A 1I07A 2KE9A 2C0TA 2EKHA 2I0NA 3VS5A 2KRSA 2MIOA 2EYWA 3EGUA 2FPDA 1Y57A 2IIMA 1E7OA 2J6FA 2FPEA 1KJWA 4RTXA 4F17A 1MV0B 2RQUA 1SRMA 2D1XA 2HCKA 2A36A 2KEAA 4X1VA 2B86A 4J9DA 1JQQA 1N5ZA 2X3XD 4JZ4A 2LNHB 1QKWA 5FWCA 4OMNA 1T0HA 4AFSC 1AZEA 2XMFA 2YT6A 4AG2C 2LJ0A 1YP5A 4AG1C 2GTJA 5ECAA 2LQNA 2EYXA 2EGAA 1J3TA 1AWOA 4J9GA 1WA7A 2VKNA 1IO6A 1WYXA 1SEMA 1AOJA 1Z9ZA 1RLPC 2EPDA 4ZNXA 2DRKA 4JJDA 1WXUA 2CDTA 2CH4W 4LE9A 2JTEA 3I35A 4IIOA 1OOTA 1GCQA 2O9VA 3M0PA 2DBMA 3M0UA 1PHTA 5FWBA 1FMKA 1OEBA 2YDLA 3VS1A 3A98A 2AK5A 1NYFA 1UFFA 1BB9A 1PKSA 1OV3A 4D8DA 3REAB 2KYBA 1ARKA 2K9GA 2LCSA 2CUBA 2FPFA 3EG2A 1SSHA 1M3BA 2JMCA 2YUOA 1YWOA 2JM8A 3NMZC 1GBQA 1GBRA 2NUZA 2EVRA 1G2BA 1AVZC 3M0QA 2J6OA 1NG2A 2PNIA 2K7AA 1U3OA 2J06A 2OI3A 1KIKA 2EGCA 1KSWA 1T3SA 1X2QA 1QKXA 1BBZA 1W6XA 4HVVA 2RQVA 2JMAA 2RQRA 2DX1A 3VS0A 1JO8A 5IXFA 3TVTA 2DL8A 1H3HA 1NLPC 4RTZA 1VYTA 3I5SA 4R0KA 3VRYA 4GLMA 1M30A 2V1RA 1UE9A 1M27C 1YCSB 2DBKA 3H41A 4DEXA 1LCKA 2CSIA 3VRZA 1JXOA 2JT4A 2CT3A 1VYUA 3NHNA 1JXMA 4WCIA 2QDLA 5I22A 1EFNA 2L3PA 1PKTA 3QWXX 1B3QA 2O2OA 1YNZA 1T3LA 2C0OA 2G6FX 4RTTA 2RPNA 1ZX6A 2RQTA 3TSWA 3H0HA 2CSQA 1MV3A 2L0AA 2L3SA 2KGTA 2OJ2A 3UF4A 1UECA 1UJ0A 3I9QA 3RBBB 2BTTA 1E6HA 2VWFA 2K3BA 2X3WD 2FEIA 2EYYA 2KXCA 1Y0MA 1ZLMA 3O5ZA 2YUPA 2DILA 2JS0A 4J9CA 2LQWA 1UHFA 4Y92A 1GL5A 1AWJA 1UHCA 4ORZA 4D8KA 2FO0A 2KT8A 4AFUC 2AZVA 1W1FA 1X69A 3I5RA 3VS3A 2O88A 4AFZC 1PWTA 1WDXA 2LJ3A 1B07A 1X6GA 2DL3A 1SHFA 2RNAA 1GRIA 4JPBW 3ZL7C 1K4US 1H92A 3M0RA 1GCQC 1X27A 2ENMA 2W10A 2BZ8A 1CKBA 3VS6A 4CC7A 4DEYA 2DL5A 5IHIA 2M51A 4J9HA 2O31A 4J9EA 4LNPA 2W0ZA 2L3QA 1TUDA 1UUEA 2KBTA 4HCKA 3SEMA 2D8HA 2YUNA 4Z88A 1ZUUA 3H0IA 1CKAA 3UATA 1UDLA 1ZUYA 1U06A 1WLPB 2KNBB 2KR3A 1X2KA 4FSSA 3QWYA 2CUDA 2F2XA 4AFQC 2HBWA 2CT4A 2BZYA 1AZGB 5EC7A 1UJYA 1M3AA 2ECZA 3TSZA 4RUGA 1SRLA 3C0CA 2LX7A 2DNUA 2KT1A 4KRTA 2DVJA 1K0SA 1KFZA 4RTUA 1CSKA 2ABLA 3M0SA 3GBQA 1ZBJA 1K0XA 2EBPA 2PZ1A 4ESRA 5GJVB 1QWFA 1SPKA 2P4RA 1M8MA 2FRWA 3LH5A 1SHGA 1NEBA 1HJDA 1VA7A 2JXBA 4OMLA 4K11A 2GBQA 1WXBA 1S1NA 1G83A 2F2VA 3REBB 5I11A 3EHQA 2O9SA 2EQIA 2AZSA 2LP5A 2H8HA 1TG0A 2DMOA 2DJQA 3THKA 4GBQA 1A0NB 1OPKA 1V1CA 2LJ1A 1NLOC 3H0FA 1WXTA 2K2MA 2ESWA 5IH2A 2DL4A 4RTWA 4J9BA 4Z8AA 4JJCA 2YSQA 1AWXA 2J7IA 2NWMA 1XOVA 1FYNA 3U23A 1YWPA 2MCNA 2DM1A 3FJ5A 1H8KA 2GTOA 3SHWA 1AWWA 4A63B 2JM9A 2CH4A 1AEYA 1ZSGA 1AD5A 2RF0A 3IQLA 5IHKA 2GQIA 2RMOA 2SEMA 4Z89A 2SRCA 2A08A 5HCKA 2DA9A 1PNJA 1ZUKA 3EHRA 1NM7A 1WFWA 4EIKA 1OPLA 2A28A 1PRLC 1W70A 2L2PA 1BU1A 2M0YA 2AKLA 1GCPA 1Z9QA 3KFVA 4JZ3A 5FW9A 4OMMA 3RNJA 4RTVA 1VYVA 2HEQA 4LUEA 3UA6A 2GGRA 1RLQC 2FG0A 4CC4B 1U5SA 1T0JA 2KRNA 4J9IA 3JV3A 3EG0A 4CC3A 2KXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9A A;  5L23 A;  1RUW A;  2KRO A;  2LZ6 B;  3CQT A;  3EG3 A;  5GJW B;  1YN8 A;  1UTI A;  2DF6 A;  2JW4 A;  3VS4 A;  4HXJ A;  4QT7 A;  3PE0 A;  2J05 A;  2ROT A;  1WIE A;  4RTY A;  2V1Q A;  2MOX A;  2ED0 A;  1JU5 C;  1ABO A;  2AKK A;  2KYM A;  4HVU A;  2DYB A;  3NPF A;  2HSP A;  4JJB A;  1NEG A;  2DRM A;  2ROL A;  2DE0 X;  2OAW A;  3PVL A;  1I0C A;  3VS7 A;  2RQW A;  1HD3 A;  2JS2 A;  2CRE A;  1WI7 A;  2EYZ A;  1PRM C;  4HVW A;  2KRM A;  2RN8 A;  1NYG A;  5IXB A;  2ED1 A;  2K79 A;  1QLY A;  4CC2 A;  3UA7 A;  1K76 A;  2K6D A;  2BZX A;  1E6G A;  1GFD A;  4F16 A;  1QWE A;  1QCF A;  4OMQ A;  1UG1 A;  1I1J A;  4LUD A;  2GNC A;  2C0I A;  2LMJ A;  4F14 A;  1GFC A;  4OMP A;  2F2W A;  3EG1 A;  2FRY A;  2PTK A;  1BK2 A;  5IHN A;  1RI9 A;  2HDA A;  3NGP A;  1JEG A;  4M4Z A;  4E6R A;  3M0T A;  4J9F A;  1MUZ A;  2D0N A;  1X6B A;  1TUC A;  2A37 A;  2DLP A;  2DL7 A;  1HSQ A;  2E5K A;  3R6N A;  2EW3 A;  2YUQ A;  2D8J A;  4IIM A;  1ABQ A;  1WX6 A;  2VVK A;  1X43 A;  3VS2 A;  1M3C A;  2J6K A;  3PVQ A;  1K1Z A;  3ULR B;  1UGV A;  2EGE A;  4OMO A;  4LN2 A;  1I07 A;  2KE9 A;  2C0T A;  2EKH A;  2I0N A;  3VS5 A;  2KRS A;  2MIO A;  2EYW A;  3EGU A;  2FPD A;  1Y57 A;  2IIM A;  1E7O A;  2J6F A;  2FPE A;  1KJW A;  4RTX A;  4F17 A;  1MV0 B;  2RQU A;  1SRM A;  2D1X A;  2HCK A;  2A36 A;  2KEA A;  4X1V A;  2B86 A;  4J9D A;  1JQQ A;  1N5Z A;  2X3X D;  4JZ4 A;  2LNH B;  1QKW A;  5FWC A;  4OMN A;  1T0H A;  4AFS C;  1AZE A;  2XMF A;  2YT6 A;  4AG2 C;  2LJ0 A;  1YP5 A;  4AG1 C;  2GTJ A;  5ECA A;  2LQN A;  2EYX A;  2EGA A;  1J3T A;  1AWO A;  4J9G A;  1WA7 A;  2VKN A;  1IO6 A;  1WYX A;  1SEM A;  1AOJ A;  1Z9Z A;  1RLP C;  2EPD A;  4ZNX A;  2DRK A;  4JJD A;  1WXU A;  2CDT A;  2CH4 W;  4LE9 A;  2JTE A;  3I35 A;  4IIO A;  1OOT A;  1GCQ A;  2O9V A;  3M0P A;  2DBM A;  3M0U A;  1PHT A;  5FWB A;  1FMK A;  1OEB A;  2YDL A;  3VS1 A;  3A98 A;  2AK5 A;  1NYF A;  1UFF A;  1BB9 A;  1PKS A;  1OV3 A;  4D8D A;  3REA B;  2KYB A;  1ARK A;  2K9G A;  2LCS A;  2CUB A;  2FPF A;  3EG2 A;  1SSH A;  1M3B A;  2JMC A;  2YUO A;  1YWO A;  2JM8 A;  3NMZ C;  1GBQ A;  1GBR A;  2NUZ A;  2EVR A;  1G2B A;  1AVZ C;  3M0Q A;  2J6O A;  1NG2 A;  2PNI A;  2K7A A;  1U3O A;  2J06 A;  2OI3 A;  1KIK A;  2EGC A;  1KSW A;  1T3S A;  1X2Q A;  1QKX A;  1BBZ A;  1W6X A;  4HVV A;  2RQV A;  2JMA A;  2RQR A;  2DX1 A;  3VS0 A;  1JO8 A;  5IXF A;  3TVT A;  2DL8 A;  1H3H A;  1NLP C;  4RTZ A;  1VYT A;  3I5S A;  4R0K A;  3VRY A;  4GLM A;  1M30 A;  2V1R A;  1UE9 A;  1M27 C;  1YCS B;  2DBK A;  3H41 A;  4DEX A;  1LCK A;  2CSI A;  3VRZ A;  1JXO A;  2JT4 A;  2CT3 A;  1VYU A;  3NHN A;  1JXM A;  4WCI A;  2QDL A;  5I22 A;  1EFN A;  2L3P A;  1PKT A;  3QWX X;  1B3Q A;  2O2O A;  1YNZ A;  1T3L A;  2C0O A;  2G6F X;  4RTT A;  2RPN A;  1ZX6 A;  2RQT A;  3TSW A;  3H0H A;  2CSQ A;  1MV3 A;  2L0A A;  2L3S A;  2KGT A;  2OJ2 A;  3UF4 A;  1UEC A;  1UJ0 A;  3I9Q A;  3RBB B;  2BTT A;  1E6H A;  2VWF A;  2K3B A;  2X3W D;  2FEI A;  2EYY A;  2KXC A;  1Y0M A;  1ZLM A;  3O5Z A;  2YUP A;  2DIL A;  2JS0 A;  4J9C A;  2LQW A;  1UHF A;  4Y92 A;  1GL5 A;  1AWJ A;  1UHC A;  4ORZ A;  4D8K A;  2FO0 A;  2KT8 A;  4AFU C;  2AZV A;  1W1F A;  1X69 A;  3I5R A;  3VS3 A;  2O88 A;  4AFZ C;  1PWT A;  1WDX A;  2LJ3 A;  1B07 A;  1X6G A;  2DL3 A;  1SHF A;  2RNA A;  1GRI A;  4JPB W;  3ZL7 C;  1K4U S;  1H92 A;  3M0R A;  1GCQ C;  1X27 A;  2ENM A;  2W10 A;  2BZ8 A;  1CKB A;  3VS6 A;  4CC7 A;  4DEY A;  2DL5 A;  5IHI A;  2M51 A;  4J9H A;  2O31 A;  4J9E A;  4LNP A;  2W0Z A;  2L3Q A;  1TUD A;  1UUE A;  2KBT A;  4HCK A;  3SEM A;  2D8H A;  2YUN A;  4Z88 A;  1ZUU A;  3H0I A;  1CKA A;  3UAT A;  1UDL A;  1ZUY A;  1U06 A;  1WLP B;  2KNB B;  2KR3 A;  1X2K A;  4FSS A;  3QWY A;  2CUD A;  2F2X A;  4AFQ C;  2HBW A;  2CT4 A;  2BZY A;  1AZG B;  5EC7 A;  1UJY A;  1M3A A;  2ECZ A;  3TSZ A;  4RUG A;  1SRL A;  3C0C A;  2LX7 A;  2DNU A;  2KT1 A;  4KRT A;  2DVJ A;  1K0S A;  1KFZ A;  4RTU A;  1CSK A;  2ABL A;  3M0S A;  3GBQ A;  1ZBJ A;  1K0X A;  2EBP A;  2PZ1 A;  4ESR A;  5GJV B;  1QWF A;  1SPK A;  2P4R A;  1M8M A;  2FRW A;  3LH5 A;  1SHG A;  1NEB A;  1HJD A;  1VA7 A;  2JXB A;  4OML A;  4K11 A;  2GBQ A;  1WXB A;  1S1N A;  1G83 A;  2F2V A;  3REB B;  5I11 A;  3EHQ A;  2O9S A;  2EQI A;  2AZS A;  2LP5 A;  2H8H A;  1TG0 A;  2DMO A;  2DJQ A;  3THK A;  4GBQ A;  1A0N B;  1OPK A;  1V1C A;  2LJ1 A;  1NLO C;  3H0F A;  1WXT A;  2K2M A;  2ESW A;  5IH2 A;  2DL4 A;  4RTW A;  4J9B A;  4Z8A A;  4JJC A;  2YSQ A;  1AWX A;  2J7I A;  2NWM A;  1XOV A;  1FYN A;  3U23 A;  1YWP A;  2MCN A;  2DM1 A;  3FJ5 A;  1H8K A;  2GTO A;  3SHW A;  1AWW A;  4A63 B;  2JM9 A;  2CH4 A;  1AEY A;  1ZSG A;  1AD5 A;  2RF0 A;  3IQL A;  5IHK A;  2GQI A;  2RMO A;  2SEM A;  4Z89 A;  2SRC A;  2A08 A;  5HCK A;  2DA9 A;  1PNJ A;  1ZUK A;  3EHR A;  1NM7 A;  1WFW A;  4EIK A;  1OPL A;  2A28 A;  1PRL C;  1W70 A;  2L2P A;  1BU1 A;  2M0Y A;  2AKL A;  1GCP A;  1Z9Q A;  3KFV A;  4JZ3 A;  5FW9 A;  4OMM A;  3RNJ A;  4RTV A;  1VYV A;  2HEQ A;  4LUE A;  3UA6 A;  2GGR A;  1RLQ C;  2FG0 A;  4CC4 B;  1U5S A;  1T0J A;  2KRN A;  4J9I A;  3JV3 A;  3EG0 A;  4CC3 A;  2KXD A; 
#chains in the Genus database with same CATH topology
 3EG3 A;  3CQT A;  3EGD B;  1M90 C;  1VQ9 A;  3QXE B;  3S3O A;  1VQK A;  2J05 A;  4KGV B;  3LGL A;  4RTY A;  5KYU A;  2QAZ A;  1ABO A;  2AKK A;  5A2Q E;  4HVU A;  2DYB A;  1IRX A;  4HA8 A;  5FU6 B;  3PVL A;  3OSV A;  3MHX A;  5IXB A;  2HQX A;  4IUP A;  1B34 B;  5KYX A;  1W2B A;  1YIJ A;  2LDM A;  1K76 A;  2K6D A;  3HRT A;  1VQ6 T;  4F16 A;  2MF2 A;  3LH0 A;  1BI2 A;  4OMQ A;  1UG1 A;  3QDF A;  1S72 T;  1YFN A;  4HCB A;  1NJI U;  3JCM g;  4J83 A;  3GF5 A;  1SG5 A;  2PTK A;  2DJZ A;  5IHN A;  3CCJ Q;  1RI9 A;  5CVI A;  3PT9 A;  4IUV A;  3EH2 A;  1FX7 A;  1M1K R;  2E5K A;  4X9C A;  2YUQ A;  2D8J A;  3OYC A;  1M1F A;  3FDR A;  2VVK A;  1HK9 A;  3PVQ A;  5GMK l;  1B34 A;  3ULR B;  4N0A A;  1F1B B;  4OMO A;  3LX7 A;  4MZP A;  1LVK A;  2XHC A;  2FPD A;  2QYZ A;  1QMC A;  1QP3 A;  2PUO B;  1KJW A;  1JJ2 S;  3OYG A;  1MV0 B;  4O6J A;  4PJO G;  4X1V A;  4XU0 A;  3A8L B;  1YJW T;  5GAO r;  2RA2 A;  4J9D A;  2QQB A;  3LWH A;  1WHG A;  1QKW A;  5GAN f;  1VQ8 T;  5FWC A;  2JTF A;  5CQX A;  1VQ9 Q;  2EYQ A;  3L42 A;  2AT1 B;  1VQK Q;  2MWO A;  4ELY C;  1Y96 B;  2LQN A;  3UPU A;  2EGA A;  5CAI A;  1AWO A;  1N9S A;  1R0C B;  1D0X A;  3LGF A;  1Q82 R;  1W2B S;  1IO6 A;  1WYX A;  1SEM A;  2XU8 A;  1AOJ A;  2XG8 D;  1RLP C;  4IKF A;  4PJO C;  4FYX B;  4ZNX A;  2XD0 A;  4PJN A;  1WXU A;  2CH4 W;  2BUD A;  2JTE A;  3JB9 H;  3UWN A;  1GCQ A;  2YXY A;  2RO0 A;  5GAM g;  2DBM A;  3CMA Q;  5FWB A;  4C0D C;  1FMK A;  4A54 A;  2YDL A;  1WGS A;  2DTH A;  2LQ8 A;  2MPX C;  4CC3 A;  2ZPB B;  2RHI A;  4N4H A;  5IT9 E;  2KYB A;  1U1S A;  1WNL A;  4OB0 B;  3PIO A;  2L3R A;  3CC7 A;  1G5V A;  2LCS A;  4XTU A;  3EG2 A;  4C92 A;  1M3B A;  2JMC A;  1FXX A;  4LXC A;  3M59 A;  2NUZ A;  1LNX A;  2EVR A;  3QDR B;  5GAN h;  2PNI A;  3R6O A;  4KGZ B;  3EH1 A;  2EGC A;  4BDZ A;  1YIT Q;  2X51 A;  2DIG A;  1BBZ A;  4HVV A;  4KT0 E;  2RQV A;  1RAE B;  4PK4 A;  1IGQ A;  5GAM e;  5GMK j;  2QK0 A;  1JO8 A;  1VQO T;  2DET A;  1IHV A;  2DL8 A;  1NLP C;  2QEX Q;  3TRE A;  3I5S A;  1MMN A;  5GAO p;  1TH7 A;  1PC0 A;  1PCX A;  3QHS A;  4DEX A;  3CD6 A;  3SWN B;  1LCK A;  4EMK B;  2CSI A;  3OW2 A;  2CT3 A;  1I5L A;  1Y71 A;  1JXM A;  2QA4 A;  2QDL A;  4X9D A;  4DBR A;  4BUG A;  1FMW A;  4M75 G;  5I22 A;  3A8M B;  1NPP A;  3CC2 A;  1YNZ A;  4C8Q B;  2C0O A;  2D0Q B;  3H0H A;  2A7Y A;  2KGT A;  2OJ2 A;  3UF4 A;  3ASK A;  4EMH A;  1NPR A;  1IB8 A;  2BTT A;  1YBY A;  2X3W D;  2VGN A;  4OB1 B;  4LDV A;  2EYY A;  2KXC A;  3FB9 A;  1M2V B;  2JN0 A;  3DB3 A;  1K8A C;  2JVV A;  2RI5 A;  5KYN A;  1WHJ A;  2M1H A;  1KC8 C;  4M75 C;  2LQW A;  1UHF A;  5DY9 A;  3UT1 A;  8ATC B;  2FO0 A;  4BE2 A;  3CC7 Q;  3DLM A;  4C8Q D;  3V8J A;  3MEW A;  2FB7 A;  4AFU C;  4AFZ C;  2PU9 B;  1WDX A;  3CPW A;  1X6G A;  1M90 R;  1D0Z A;  3TEE A;  4ZTJ A;  3M0R A;  3CBO A;  1M9S A;  3I55 A;  5IAY A;  1M2V A;  4A4K A;  4L59 A;  2FVU A;  2M51 A;  4LNP A;  2W0Z A;  2V26 A;  4A4E A;  3OW2 S;  3FJP A;  3DB4 A;  2D8H A;  2CP3 A;  3L2Z A;  1G3S A;  1ZUY A;  4A4H A;  2X4Y A;  3GPL A;  3OMG A;  4DQ2 A;  5CR2 A;  3CD6 Q;  5LJ5 j;  4AFQ C;  3FEO A;  1AZG B;  1PM3 A;  2QA4 Q;  4XU2 A;  3C0C A;  2KT1 A;  5L8R E;  1K0S A;  2XI9 A;  5KCH A;  5GAO l;  3GBQ A;  1QVG A;  1K0X A;  2I2L A;  5GAN 4;  3VKI A;  3F70 A;  4M7D B;  1VIF A;  3CC4 A;  3LH5 A;  1SHG A;  3E1S A;  1VQP Q;  3KBG A;  4UC4 A;  1EX4 A;  1VA7 A;  2EKO A;  1KHC A;  1OZ3 A;  1KQ1 A;  4K11 A;  3JCM f;  3CXC P;  1S1N A;  1M1K C;  1G83 A;  3CPW S;  3REB B;  1M90 U;  2HNI A;  1XTD A;  3QII A;  2ESW A;  3OYM A;  4Y91 A;  5FU7 C;  4QQG A;  4Z8A A;  2E65 A;  3JCM c;  3PGG A;  2J7I A;  4M7D D;  3U23 A;  1YWP A;  2QXF A;  4ANJ A;  4M7D A;  5C0M A;  1H8K A;  3SHW A;  2MK5 A;  1VQ6 A;  1QP2 A;  5M9O A;  2QG9 B;  4C5G A;  1S72 A;  3M56 A;  2CH4 A;  4WTO B;  1ZSG A;  4N4G A;  4DOV A;  3QO3 A;  2M0O A;  3OYJ A;  3I55 Q;  2OTJ T;  2RMO A;  1VQ5 T;  1ZSZ C;  5HK3 A;  2JJ9 A;  5HCK A;  1DJ7 B;  2RI3 A;  2LQK A;  4JLI A;  1ZUK A;  5GAN e;  3QKJ A;  5KYY B;  3QUI A;  2A28 A;  5HK0 A;  1BU1 A;  2AKL A;  4M77 G;  1Q82 C;  2NYS A;  5FW9 A;  1BI1 A;  2CP5 A;  2P0Q A;  4RTV A;  4PFZ A;  4J6X A;  1QVG S;  3L2W A;  1VQL Q;  1RLQ C;  4BB7 A;  2F1L A;  1T0J A;  4II1 A;  1HXD A;  3JCM h;  2KXD A;  3J80 E;  5L23 A;  3OY9 A;  1RUW A;  2KRO A;  2LZ6 B;  3HFN A;  1VUB A;  3D7S B;  3G6E T;  3OYB A;  4HXJ A;  4QT7 A;  4ZGE B;  2P84 A;  4EDU A;  1U1T A;  4LDW A;  4ZGJ B;  1YJW A;  3L2U A;  1WIE A;  4QKU A;  4J8O A;  5LL6 S;  2K5L A;  2E3I A;  4M77 C;  2V1Q A;  4F7U G;  3CC4 Q;  1VQM Q;  2MOX A;  2ED0 A;  5KYY A;  5GMK m;  4B6M A;  1VQ8 A;  4M7A B;  4M78 B;  5I2S A;  1WQ7 A;  2DRM A;  3M4Y A;  3VU3 C;  2OAW A;  3BDU A;  3VS7 A;  5GAM f;  4MZT A;  4E7I A;  3OQ5 A;  2CRE A;  1WI7 A;  2EYZ A;  5KYW B;  2HZY A;  2RN8 A;  2K79 A;  1QLY A;  4CC2 A;  1RAD B;  3PIP A;  1E6G A;  1GFD A;  1QWE A;  2CP6 A;  3JCM W;  4F14 A;  3OYN A;  3EG1 A;  2FRY A;  1TU0 B;  1BK2 A;  8AT1 B;  1UB4 A;  2JNG A;  3P8D A;  1VQ6 Q;  2DEU A;  1KD1 C;  3NTK A;  4M7A D;  3BFM A;  4PFP A;  1S72 Q;  3CCQ T;  1XQH A;  5J39 A;  4M7A A;  1TUC A;  4M78 A;  2DLP A;  2DL7 A;  3EAE A;  3J81 E;  3C95 A;  2EW3 A;  4PL6 A;  4FL6 A;  3KXT A;  1WX6 A;  2XDD A;  1X43 A;  1M1G A;  2DTO A;  3CEY A;  4OB2 B;  3RMS A;  5KYW A;  2E4H A;  4MZM A;  2J6K A;  1ZQ1 A;  4JS4 A;  3EG9 B;  1UGV A;  5LJ3 f;  2EGE A;  2G3R A;  2KK4 A;  4LN2 A;  1I07 A;  3G71 T;  1PSF A;  2I0N A;  3DLL A;  2KRS A;  2IIM A;  1KG1 A;  3CCR Q;  1RAI B;  1E7O A;  3ZFJ A;  4OGC A;  1K8A R;  2RQU A;  1D1C A;  4BAC A;  3H6Z A;  2HCK A;  2K3Y A;  1KC8 R;  2B86 A;  5GAM h;  1XNI A;  3OS2 A;  2LNH B;  4HT8 A;  1T0H A;  1VQO A;  1AZE A;  1YI2 Q;  1G3T A;  2XMF A;  2YT6 A;  4AG2 C;  1YP5 A;  2GTJ A;  5CK9 A;  4PLI A;  2EYX A;  1J3T A;  3G4S Q;  4J9G A;  4FIB A;  1QVF P;  3GLX A;  3PFS A;  1EZZ B;  2DTI A;  1C6V X;  4JS5 A;  5LJ3 d;  4BE0 A;  1OUL A;  1UGQ B;  1WZO A;  1FWZ A;  2DRK A;  3HKS A;  2E64 A;  2MMP A;  3WXM B;  4LE9 A;  3A8O B;  4IIO A;  3M9Q A;  1JJ2 A;  3LWI A;  3CCM T;  4OMF B;  2DD5 A;  3M0P A;  5LJ3 h;  4E47 A;  3H9N A;  2JUF A;  5CQY A;  3A98 A;  1UFF A;  4CI0 C;  1VQ7 T;  1V29 B;  2FL7 A;  4NL2 A;  1OV3 A;  4NL3 A;  3JB9 J;  3OSS C;  4XK8 E;  2CS7 A;  2K9G A;  2CZ6 B;  2CUB A;  3M57 A;  2FPF A;  2RHX A;  4XTY A;  1GBR A;  1K8A U;  1MND A;  2DXU A;  1N8R C;  1KHI A;  3QZ9 B;  3EGD A;  1KIK A;  1B7T A;  1T3S A;  4XU3 A;  2VXF A;  1X2Q A;  5D6X A;  4PJO F;  1W6X A;  4Y28 E;  2KAF A;  3A5Z B;  2DX1 A;  3MCA B;  1H3H A;  2KVQ G;  2BKD N;  1ZA2 B;  4R0K A;  3VJP A;  4GLM A;  1VQN T;  1PSE A;  3OYA A;  4QQ6 A;  2V1R A;  1VQO Q;  5KE3 A;  1QW1 A;  2YRC A;  3PMI A;  4PJO E;  4EMG A;  2DBK A;  5CKH A;  1IRE B;  3VRZ A;  1M5Q 1;  2LCC A;  2V8I A;  3CBM A;  3QJY A;  4J6W A;  1OI1 A;  2CZ1 B;  3UDC A;  4JJN K;  2L3P A;  1PKT A;  2RJC A;  3JCM e;  2O2O A;  3MEA A;  4DBQ A;  3QYH B;  1AHJ B;  1D0Y A;  2G6F X;  3G1J A;  2R5A A;  4C92 F;  1ZX6 A;  2JTM A;  3CCU T;  4GY5 A;  1MV3 A;  1I4K 1;  2L3S A;  3QPH A;  1UEC A;  5J26 A;  2VWF A;  5CKF A;  1I8F A;  2DAQ A;  1Y0M A;  1ZLM A;  4E7K A;  3O5Z A;  2PVO B;  4L5G A;  3OMC A;  3CCE T;  2DIL A;  4Y92 A;  1IXD A;  2ZPF B;  2M16 A;  4C0D B;  1RAH B;  4XTX A;  2AZV A;  2O88 A;  4BDY A;  2RI2 A;  1PWT A;  1YIJ Q;  1B07 A;  4JUV A;  2B8A A;  2DL3 A;  2M02 A;  5GAO m;  3TU4 K;  1SHF A;  4C92 G;  1M1K U;  2RNA A;  4OVA A;  1GRI A;  4JRI A;  4PJO D;  3ZL7 C;  5GAO q;  3L2Q A;  1GCQ C;  2LRQ A;  2BZ8 A;  2R5M A;  4VUB A;  2A3L A;  1WHL A;  2X4W A;  2LVM A;  3MJX A;  1Y96 A;  5IHI A;  1C1A A;  4ME7 A;  2JZ2 A;  2O31 A;  4J9H A;  4J9E A;  5EG2 A;  1AT1 B;  3WVE B;  2YRV A;  1TUD A;  2KSS A;  2KBT A;  4HCK A;  4QVZ A;  1OQK A;  2YUN A;  5CCA A;  9ATC B;  3RIR A;  2OTJ A;  3JB9 I;  3OBW A;  4C92 C;  1VQ5 A;  1UDL A;  3AHU A;  1BYM A;  2OTL T;  1WLP B;  4DA4 A;  2KR3 A;  1X2K A;  4FSS A;  5CIU A;  2F2X A;  2O4X B;  4M75 F;  1YHQ T;  2BE9 B;  4BI4 A;  2HBW A;  1TXQ A;  2YLB A;  3CBP A;  1UJY A;  4XTW A;  2RM4 A;  1KD1 R;  3CCS T;  2DVJ A;  5I2M A;  1KFZ A;  3M5A A;  2MI6 A;  3OB9 A;  4RTU A;  5LJ3 g;  5DM7 R;  4JLG A;  3JB9 G;  2E70 A;  1Q82 U;  5GJV B;  2YWW A;  3HL8 A;  1M8M A;  4M75 E;  2CYZ B;  2RK2 A;  4IUU A;  3BY7 A;  2DO3 A;  4IUR A;  4TVR A;  1D1A A;  1MMA A;  4C5I A;  3G6E A;  2E6N A;  1OZ2 A;  3CCL T;  4KUI A;  2GBQ A;  1V76 A;  2VYT A;  4HCZ A;  3BDL A;  2O4X A;  1TWB A;  1BIB A;  2O9S A;  2EQI A;  1QCN A;  3MET A;  2LP5 A;  1V1C A;  2LJ1 A;  4BE1 A;  1FMV A;  4BY6 B;  3PNW C;  1PG5 B;  1UGS B;  4F04 B;  1AWX A;  5LJ3 e;  2NWM A;  2ZGW A;  1FYN A;  4XTV A;  3ZEH A;  3FJ5 A;  1RI0 A;  2JM9 A;  3JRZ A;  4IUQ A;  3SWN A;  4EMK A;  4E7Z A;  3IQL A;  4QW2 A;  3JCM Q;  3EFO B;  2EJ9 A;  4BI3 A;  4E2F B;  3OYF A;  2OAU A;  2RB6 A;  3CCQ A;  3EHR A;  3QJ6 A;  2H3E B;  4C8Q A;  5GMK h;  1PRL C;  1KD1 U;  3RR6 A;  1W70 A;  3BE3 A;  2QI2 A;  1I81 A;  1GCP A;  2E10 A;  1Z9Q A;  3JSC A;  4FCY A;  1VQ5 Q;  3KFV A;  4JZ3 A;  3RNJ A;  1NJI C;  3A8G B;  5IN1 A;  5CKE A;  2GGR A;  2FG0 A;  3G71 A;  2MWP A;  3CMA T;  3EG0 A;  4QVD A;  2RHZ A;  5GJW B;  1SKU B;  2QDY B;  4RG2 A;  1UTI A;  2DF6 A;  3RKW A;  2JW4 A;  1PD1 A;  3FLG A;  4V2S A;  2QTV A;  3PE0 A;  2AIR B;  2NUP B;  4RMO A;  2YRD A;  2ROT A;  1KK7 A;  4AMC A;  4C5E A;  5FRN A;  1JU5 C;  1N8R R;  2KYM A;  4JJB A;  5CKB A;  3G6E Q;  2ROL A;  1U8R A;  2DE0 X;  3MKD A;  4A4F A;  2RJE A;  1HD3 A;  2JS2 A;  2ZPG B;  1PRM C;  3FIF A;  5I21 A;  1LJO A;  5LJ5 f;  1NYG A;  4XU1 A;  1Q86 C;  1YIT T;  1R8O B;  4DBH A;  3UA7 A;  3CC2 Q;  2K2V A;  3VUB A;  3JCM X;  1QCF A;  1KQS A;  3O8V A;  1I1J A;  5AT1 B;  1YJ9 T;  3OYH A;  2C0I A;  4KBM B;  3INZ A;  3HP9 A;  4LD6 A;  2QEX T;  5FRO A;  2C06 A;  1TS9 A;  5DLQ E;  2NUP A;  2KY9 A;  3BW1 A;  4RCC A;  2HDA A;  3NGP A;  5FU7 B;  4M4Z A;  4E7H A;  4M7D G;  3V7S A;  4NS5 A;  4J9F A;  3CCM A;  1MUZ A;  1X6B A;  1K73 C;  3V8K A;  4PJL A;  4YTL A;  4BI8 B;  3QBY A;  2XK0 A;  1VQ7 A;  4M77 F;  1K1Z A;  3CCQ Q;  6AT1 B;  5LJ5 d;  3HHT B;  3URG A;  2FZK B;  4D6W A;  2C0T A;  1ZSZ B;  2X9H A;  3VS5 A;  2RJD A;  2MIO A;  1Y57 A;  4JRP A;  2RJF A;  2J6F A;  4M7D C;  4RTX A;  2D1X A;  2DVE A;  2A36 A;  1N8R U;  4M77 E;  2LT1 A;  1N5Z A;  2X3X D;  3NTH A;  3TQ7 P;  3J7A F;  3FRN A;  5LJ5 h;  4OMN A;  4F7U F;  4AFS C;  2PUK B;  2ZCF B;  5ECA A;  2A0F B;  2QTX A;  2NUT B;  2WSC E;  2HQH A;  1VQN A;  1WA7 A;  2VKN A;  1KQS S;  1OU8 A;  4JDS A;  3E9G A;  1YJN T;  2F69 A;  4F7U E;  4FM4 B;  1TOV A;  5GMK i;  2PVG B;  2Y90 A;  2DK3 A;  1BIA A;  1OOT A;  2DXT A;  2O9V A;  5D6Y A;  4FYW B;  3M0U A;  1ZBX A;  4C0F A;  3CCU A;  4IUT A;  4E7S A;  2CGH A;  2NUT A;  2P0P A;  2QQR A;  2AK5 A;  1NYF A;  1PKS A;  3E9F A;  4F7U B;  4PFO A;  3REA B;  5HKC A;  3OA6 A;  1ARK A;  2DER A;  3OYD A;  4M77 D;  4JRQ A;  4M7A G;  4M78 G;  1Q95 G;  2KQW A;  3I56 T;  3CCE A;  2HAX A;  2YUO A;  1YWO A;  2COZ A;  1VQ7 Q;  1D1B A;  1NG2 A;  2K7A A;  1U3O A;  2OI3 A;  5FLX E;  2E6Z A;  1QKX A;  2RQR A;  2RD1 A;  1VQP T;  5IXF A;  1JJ2 P;  4PNO A;  2HBP A;  5D7U A;  3OS0 A;  4FT2 A;  1VYT A;  3C94 A;  3VRY A;  4M78 C;  4M7A C;  3WVD B;  3ZBD A;  3PMT A;  3E2U A;  5GMK e;  2FZC B;  3LW5 E;  2QQS A;  1VQ4 T;  1UE9 A;  1M27 C;  4BD3 A;  1M8V A;  3H41 A;  3QG1 A;  4PKC C;  1WJR A;  2WSF E;  4FU6 A;  4LDY A;  5D6W A;  5GAN 2;  1W2B P;  3JCM J;  1K9M C;  3GNG A;  1G3Y A;  3LLR A;  1WPY A;  2HL5 C;  2OTL A;  3RES A;  2GQV A;  1T3L A;  4CRI A;  2HKN A;  3QSU A;  1YHQ A;  2RPN A;  2RQT A;  3TSW A;  2MYS A;  2CSQ A;  1UJ0 A;  3I9Q A;  2FYK A;  3AT1 B;  4KH0 B;  2GF7 A;  3CCS A;  2FEI A;  1P92 A;  3EG9 A;  2VB6 A;  4XQ3 A;  1MMD A;  1YJW Q;  3CCU Q;  2R57 A;  2YUP A;  2EQJ A;  1NJI R;  4J9C A;  1H64 1;  1VQ8 Q;  3EFR A;  3RKY A;  5HY6 A;  3SDZ A;  4O5V A;  4ORZ A;  5C6S A;  4C5H A;  3CCL A;  2FHD A;  1Q7Y C;  1VQL T;  2IVW A;  2CKK A;  3OYI A;  1W1F A;  1X69 A;  3VS3 A;  3CCV T;  3OYY A;  4RG8 A;  4JPB W;  2QQA A;  1K4U S;  4HT9 A;  1X27 A;  2ENM A;  1QCO A;  5LJ5 g;  3OS5 A;  4FYV B;  3VS6 A;  5KYX B;  3KUF A;  2X4J A;  1VQM T;  4CC7 A;  2CP0 A;  2DL5 A;  3HTR A;  1UUE A;  2ZPH B;  3SEM A;  2DD4 A;  2O01 E;  1Q86 R;  4Z88 A;  3RMQ A;  5J3B A;  3H0I A;  3UAT A;  3MP8 A;  1KC8 U;  1TUG B;  4OP0 A;  3M4G A;  2CUD A;  1VIE A;  2ZPI B;  2EJG A;  3HRU A;  4RCB A;  4FSX A;  5EC7 A;  4LDX A;  2ECZ A;  2EWN A;  4RUG A;  1SRL A;  3CME T;  4E7J A;  3H8Z A;  2HQE A;  2DNU A;  3L1A A;  1IGU A;  2WSE E;  5A0G A;  2OTL Q;  5LJ5 e;  1CSK A;  1K73 R;  2ABL A;  1YHQ Q;  2EBP A;  1SPK A;  2P4R A;  3RUX A;  3CMA A;  5FU6 C;  5GAN 5;  3JCM P;  4AT1 B;  1NEB A;  4J7I A;  2AHJ B;  3CCS Q;  1HJD A;  2JXB A;  4OML A;  3FC3 A;  1RAG B;  2GFA A;  3RER A;  4N0A C;  4Q5W A;  1NBE B;  1D3B B;  1WXB A;  2VGM A;  1BI3 A;  2F2V A;  3L2R A;  4FW1 A;  2ZZD A;  5I11 A;  4MML A;  3GIB A;  2H8H A;  2DJQ A;  2RHU A;  3V7C A;  1QVF A;  1WHH A;  1A0N B;  3CCR T;  1OPK A;  2E5Q A;  3CPF A;  1WJQ A;  3H0F A;  2PVD B;  3CCL Q;  1MMG A;  2K2M A;  3GNF B;  3MP1 A;  4J9B A;  3S3N A;  1M2O A;  2ZPE B;  2VC8 A;  2YSQ A;  3P8H A;  5CKD A;  1XOV A;  1YIT A;  4PJO B;  2XDP A;  1AWW A;  4A63 B;  1Q86 U;  1YJ9 A;  1YI2 T;  1AEY A;  2QEX A;  4FYY B;  5GAN j;  1AD5 A;  2K57 A;  3G4S T;  4C92 E;  5KCO A;  4R55 A;  4E7L A;  1D3B A;  2SRC A;  1MHN A;  1KQ2 A;  2DA9 A;  4A4G A;  3OW2 P;  1NM7 A;  4EIK A;  4RKU E;  3HSB A;  4ATO A;  1MNE A;  2M0Y A;  2DPP B;  1GXI E;  1NZ9 A;  1K73 U;  1Q81 C;  1N6A A;  1VYV A;  4PJO A;  2XIC A;  3UA6 A;  1OYX A;  2HKQ B;  4CC4 B;  5FRM A;  4KGX B;  2QGG A;  3ME9 A;  4C92 B;  3JV3 A;  1PD0 A;  2DEQ A;  3VUZ A;  1JB0 E;  3JB9 F;  2R58 A;  4J7F A;  1K9A A;  1YN8 A;  2COW A;  1UGP B;  3VS4 A;  4ZTF A;  2HD0 A;  3P8B B;  1LPL A;  3A8H B;  4XAX B;  3MEV A;  5GAN d;  2VAS A;  1QVF S;  4EPC A;  1WQW A;  2COY A;  3NPF A;  4XTZ A;  2HSP A;  2NLU A;  1NEG A;  1I0C A;  2RQW A;  4HKE A;  3HRS A;  2CZ7 B;  3Q1J A;  4HVW A;  2KRM A;  3CPW P;  1TSF A;  4C92 D;  1H3Z A;  2ED1 A;  2EQK A;  1UGR B;  3A1P A;  3CCJ T;  1JBM A;  4ZN3 A;  4QVC A;  2BZX A;  5GAO n;  3L2V A;  2KDS A;  4C8Q F;  1YJN A;  4LUD A;  2GNC A;  2LMJ A;  4QQD A;  3GOX A;  3M58 A;  1GFC A;  1WHM A;  4OMP A;  1RAB B;  2F2W A;  3C4S A;  3G7Z A;  3MP6 A;  3X26 B;  3V8L A;  3S3M A;  1M4Z A;  1LOJ A;  5GAN 8;  1JEG A;  4E6R A;  4N4I A;  3OYK A;  3M0T A;  2YLC A;  1YJ9 Q;  2D0N A;  2A37 A;  1HSQ A;  3R6N A;  3EGX B;  4IIM A;  4C8Q E;  1K9M R;  4OF1 A;  1ABQ A;  2M9U A;  3VS2 A;  1M3C A;  2LC4 A;  2Y4Y A;  3VV0 A;  2RHY A;  2KI7 A;  4M75 B;  1R77 A;  2XDB A;  4WF2 A;  2EQM A;  2KE9 A;  4KH1 B;  2EIF A;  2EKH A;  4C8Q G;  1XJW B;  3I56 A;  2EYW A;  3EGU A;  3JB9 D;  2EJF A;  4L6V 5;  2FPE A;  1KQS P;  1QVG P;  1VQ9 T;  4F17 A;  1UEB A;  1G8X A;  2ATC B;  5GAN 3;  1VQK T;  1D09 B;  1SRM A;  3S6W A;  2KEA A;  2OX7 A;  1MGQ A;  1JQQ A;  1N9R A;  4JZ4 A;  3SWN C;  2HL3 A;  4EMK C;  3MEU A;  3EGX A;  1VQP A;  1Q7Y R;  3X20 B;  1JRI A;  2EAY A;  2EQU A;  2LJ0 A;  4AG1 C;  5GAN 7;  4M75 D;  3EFS A;  2OTJ Q;  4C8Q C;  4M75 A;  3NFC A;  4BY6 C;  4GLK A;  2X4X A;  1YIJ T;  4PJJ A;  1VQ4 A;  2LX9 A;  1RAF B;  1Z9Z A;  2D9T A;  2EPD A;  2LTO A;  4J5Y A;  3V7R A;  2PQW A;  2E1H A;  3MO8 A;  2IG0 A;  1X75 C;  2XKO C;  4JJD A;  2DYI A;  2E12 A;  2CDT A;  1BCO A;  1OX8 A;  2V8J A;  3I35 A;  2KMT A;  3EFO A;  1YJN Q;  1K9M U;  3T9N A;  2CP2 A;  1PHT A;  3HPW A;  2E41 A;  4M7D F;  1OEB A;  3VS1 A;  2RH2 A;  4NOY A;  2XID A;  1QVP A;  4LDU A;  1BB9 A;  1ZHI A;  4D8D A;  4MDW A;  1Y7X A;  3RDV A;  4ELZ C;  1OX9 A;  4C0Z A;  1SSH A;  2WAC A;  2P4T A;  2JM8 A;  3NMZ C;  1GBQ A;  4M7D E;  1EIF A;  1G2B A;  1AVZ C;  3C12 A;  2J6O A;  2K5F A;  3M0Q A;  4R56 A;  2L5Q A;  4B9W A;  2J06 A;  1VQL A;  4ZGD B;  1KSW A;  1ZA1 B;  3RKX A;  2CZ0 B;  3I56 Q;  1BCM A;  3CCV A;  1Q7Y U;  2JMA A;  3X25 B;  3VS0 A;  2K5I A;  3TVT A;  1IZ6 A;  3GP8 A;  5GAN 6;  1X01 A;  4RTZ A;  1RAA B;  1M30 A;  5A0D A;  1VQM A;  5KE2 A;  3X24 B;  2Y4X A;  1YCS B;  1JXO A;  2JT4 A;  1VYU A;  3NHN A;  1HYO A;  2X35 A;  4WCI A;  5GAN g;  1EFN A;  1NE8 A;  3QWX X;  1VQ4 Q;  1B3Q A;  2E3H A;  1Y07 A;  4PJM A;  3SB2 A;  3G71 Q;  2DIQ A;  4RTT A;  3VYH B;  3OYL A;  2K3X A;  1WHK A;  2LT4 A;  3QZ5 B;  2L0A A;  3CME A;  1SSF A;  3DKM A;  4LD9 K;  3PTA A;  3RBB B;  2IPO B;  1E6H A;  3M53 A;  2K3B A;  3OYE A;  3TCJ A;  3CC7 T;  1X6O A;  3M54 A;  1O75 A;  4OGE A;  2D6F A;  2JS0 A;  1ZSZ A;  1Q81 R;  4J6Y A;  1BKB A;  1IHW A;  1GL5 A;  1AWJ A;  4M7A F;  1UHC A;  4M78 F;  4MDX A;  4D8K A;  4M77 B;  1R0B G;  2BE7 D;  2L8D A;  3JCM d;  2KT8 A;  4FT4 A;  3I5R A;  4MMK A;  4ZN1 A;  2QGF B;  2LJ3 A;  2K4Y A;  2LCL A;  2HMA A;  4FW2 A;  3SFM A;  3CCR A;  2LNV A;  1TTH B;  1H92 A;  2W10 A;  2DXC A;  4M7A E;  1CKB A;  4M78 E;  2HSE B;  3SD4 A;  1WJS A;  3CCV Q;  4OB3 B;  3ER0 A;  4DEY A;  2H3J A;  5AYF A;  2DZC A;  4KUD K;  3CCM Q;  2L3Q A;  2VV5 A;  3CD6 T;  3MPU B;  1VOM A;  1YI2 A;  4M77 A;  3CXC A;  2MAM A;  2QA4 T;  2BIV A;  4B9X A;  3G4S A;  1ZUU A;  1W4S A;  2RK1 A;  1G3W A;  1CKA A;  1U06 A;  3CC2 T;  5GAM j;  2KNB B;  1OU9 A;  4C0G A;  4JRK A;  3QWY A;  2GCX A;  2CT4 A;  2BZY A;  3N5B B;  1M3A A;  3TSZ A;  2LX7 A;  4KRT A;  3M0S A;  3X28 B;  1ZBJ A;  2PZ1 A;  4F7U A;  4ESR A;  1QWF A;  1Q81 U;  4Z02 A;  1C0M A;  1SF9 A;  2FRW A;  2VUB A;  3CME Q;  5DLO A;  1N27 A;  2P0K A;  2VXE A;  2V8K A;  4M78 D;  2DFU A;  4A53 A;  1VQN Q;  5CO7 A;  1RL2 A;  4DBF A;  3EHQ A;  3E19 A;  2AZS A;  1TG0 A;  2DMO A;  1RAC B;  3THK A;  5LJ3 j;  4GBQ A;  1NLO C;  1WXT A;  5GAM d;  4KUL A;  5IH2 A;  2DXB A;  2DL4 A;  4RTW A;  3JCM b;  4JJC A;  3I55 T;  3LYI A;  5A0L A;  1I5O B;  2MCN A;  3CCJ A;  2DM1 A;  2YHT A;  2GTO A;  4HCC A;  2QQ9 A;  3QYG B;  2EFI A;  2L89 A;  2CP7 A;  3JCM V;  3CXC S;  2RF0 A;  3VYG A;  3OBY A;  3OS1 A;  5IHK A;  2GQI A;  2SEM A;  4P5N A;  4Z89 A;  1BI0 A;  1O9S A;  2A08 A;  2DZ9 A;  2JOY A;  1PNJ A;  5KYU B;  1QQJ A;  4DOW A;  1WFW A;  1OPL A;  3NTI A;  3CCE Q;  2L2P A;  3JAM E;  2ZAE A;  2Z0W A;  1ACM B;  1YCY A;  2F5K A;  4OMM A;  4X34 A;  2DKG A;  5KH6 A;  2F5T X;  2HEQ A;  4LUE A;  7AT1 B;  2QAS A;  1U5S A;  2KRN A;  2GFU A;  4J9I A;  3M55 A;  3CC4 T;  2FZG B;  4PLL A;  3HFO A; 
#chains in the Genus database with same CATH homology
 1K9A A;  5L23 A;  1RUW A;  2KRO A;  2LZ6 B;  3CQT A;  3EG3 A;  5GJW B;  1YN8 A;  1UTI A;  2DF6 A;  2JW4 A;  3VS4 A;  4HXJ A;  4QT7 A;  3PE0 A;  2J05 A;  2ROT A;  1WIE A;  4RTY A;  2V1Q A;  2MOX A;  2ED0 A;  1JU5 C;  1ABO A;  2AKK A;  2KYM A;  4HVU A;  2DYB A;  3NPF A;  2HSP A;  4JJB A;  1NEG A;  2DRM A;  2ROL A;  2DE0 X;  2OAW A;  3PVL A;  1I0C A;  3VS7 A;  2RQW A;  1HD3 A;  2JS2 A;  2CRE A;  1WI7 A;  2EYZ A;  1PRM C;  4HVW A;  2KRM A;  2RN8 A;  1NYG A;  5IXB A;  2ED1 A;  2K79 A;  1QLY A;  4CC2 A;  3UA7 A;  1K76 A;  2K6D A;  2BZX A;  1E6G A;  1GFD A;  4F16 A;  1QWE A;  1QCF A;  4OMQ A;  1UG1 A;  1I1J A;  4LUD A;  2GNC A;  2C0I A;  2LMJ A;  4F14 A;  1GFC A;  4OMP A;  2F2W A;  3EG1 A;  2FRY A;  2PTK A;  1BK2 A;  5IHN A;  1RI9 A;  2HDA A;  3NGP A;  1JEG A;  4M4Z A;  4E6R A;  3M0T A;  4J9F A;  1MUZ A;  2D0N A;  1X6B A;  1TUC A;  2A37 A;  2DLP A;  2DL7 A;  1HSQ A;  2E5K A;  3R6N A;  2EW3 A;  2YUQ A;  2D8J A;  4IIM A;  1ABQ A;  1WX6 A;  2VVK A;  1X43 A;  3VS2 A;  1M3C A;  2J6K A;  3PVQ A;  1K1Z A;  3ULR B;  1UGV A;  2EGE A;  4OMO A;  4LN2 A;  1I07 A;  2KE9 A;  2C0T A;  2EKH A;  2I0N A;  3VS5 A;  2KRS A;  2MIO A;  2EYW A;  3EGU A;  2FPD A;  1Y57 A;  2IIM A;  1E7O A;  2J6F A;  2FPE A;  1KJW A;  4RTX A;  4F17 A;  1MV0 B;  2RQU A;  1SRM A;  2D1X A;  2HCK A;  2A36 A;  2KEA A;  4X1V A;  2B86 A;  4J9D A;  1JQQ A;  1N5Z A;  2X3X D;  4JZ4 A;  2LNH B;  1QKW A;  5FWC A;  4OMN A;  1T0H A;  4AFS C;  1AZE A;  2XMF A;  2YT6 A;  4AG2 C;  2LJ0 A;  1YP5 A;  4AG1 C;  2GTJ A;  5ECA A;  2LQN A;  2EYX A;  2EGA A;  1J3T A;  1AWO A;  4J9G A;  1WA7 A;  2VKN A;  1IO6 A;  1WYX A;  1SEM A;  1AOJ A;  1Z9Z A;  1RLP C;  2EPD A;  4ZNX A;  2DRK A;  4JJD A;  1WXU A;  2CDT A;  2CH4 W;  4LE9 A;  2JTE A;  3I35 A;  4IIO A;  1OOT A;  1GCQ A;  2O9V A;  3M0P A;  2DBM A;  3M0U A;  1PHT A;  5FWB A;  1FMK A;  1OEB A;  2YDL A;  3VS1 A;  3A98 A;  2AK5 A;  1NYF A;  1UFF A;  1BB9 A;  1PKS A;  1OV3 A;  4D8D A;  3REA B;  2KYB A;  1ARK A;  2K9G A;  2LCS A;  2CUB A;  2FPF A;  3EG2 A;  1SSH A;  1M3B A;  2JMC A;  2YUO A;  1YWO A;  2JM8 A;  3NMZ C;  1GBQ A;  1GBR A;  2NUZ A;  2EVR A;  1G2B A;  1AVZ C;  3M0Q A;  2J6O A;  1NG2 A;  2PNI A;  2K7A A;  1U3O A;  2J06 A;  2OI3 A;  1KIK A;  2EGC A;  1KSW A;  1T3S A;  1X2Q A;  1QKX A;  1BBZ A;  1W6X A;  4HVV A;  2RQV A;  2JMA A;  2RQR A;  2DX1 A;  3VS0 A;  1JO8 A;  5IXF A;  3TVT A;  2DL8 A;  1H3H A;  1NLP C;  4RTZ A;  1VYT A;  3I5S A;  4R0K A;  3VRY A;  4GLM A;  1M30 A;  2V1R A;  1UE9 A;  1M27 C;  1YCS B;  2DBK A;  3H41 A;  4DEX A;  1LCK A;  2CSI A;  3VRZ A;  1JXO A;  2JT4 A;  2CT3 A;  1VYU A;  3NHN A;  1JXM A;  4WCI A;  2QDL A;  5I22 A;  1EFN A;  2L3P A;  1PKT A;  3QWX X;  1B3Q A;  2O2O A;  1YNZ A;  1T3L A;  2C0O A;  2G6F X;  4RTT A;  2RPN A;  1ZX6 A;  2RQT A;  3TSW A;  3H0H A;  2CSQ A;  1MV3 A;  2L0A A;  2L3S A;  2KGT A;  2OJ2 A;  3UF4 A;  1UEC A;  1UJ0 A;  3I9Q A;  3RBB B;  2BTT A;  1E6H A;  2VWF A;  2K3B A;  2X3W D;  2FEI A;  2EYY A;  2KXC A;  1Y0M A;  1ZLM A;  3O5Z A;  2YUP A;  2DIL A;  2JS0 A;  4J9C A;  2LQW A;  1UHF A;  4Y92 A;  1GL5 A;  1AWJ A;  1UHC A;  4ORZ A;  4D8K A;  2FO0 A;  2KT8 A;  4AFU C;  2AZV A;  1W1F A;  1X69 A;  3I5R A;  3VS3 A;  2O88 A;  4AFZ C;  1PWT A;  1WDX A;  2LJ3 A;  1B07 A;  1X6G A;  2DL3 A;  1SHF A;  2RNA A;  1GRI A;  4JPB W;  3ZL7 C;  1K4U S;  1H92 A;  3M0R A;  1GCQ C;  1X27 A;  2ENM A;  2W10 A;  2BZ8 A;  1CKB A;  3VS6 A;  4CC7 A;  4DEY A;  2DL5 A;  5IHI A;  2M51 A;  4J9H A;  2O31 A;  4J9E A;  4LNP A;  2W0Z A;  2L3Q A;  1TUD A;  1UUE A;  2KBT A;  4HCK A;  3SEM A;  2D8H A;  2YUN A;  4Z88 A;  1ZUU A;  3H0I A;  1CKA A;  3UAT A;  1UDL A;  1ZUY A;  1U06 A;  1WLP B;  2KNB B;  2KR3 A;  1X2K A;  4FSS A;  3QWY A;  2CUD A;  2F2X A;  4AFQ C;  2HBW A;  2CT4 A;  2BZY A;  1AZG B;  5EC7 A;  1UJY A;  1M3A A;  2ECZ A;  3TSZ A;  4RUG A;  1SRL A;  3C0C A;  2LX7 A;  2DNU A;  2KT1 A;  4KRT A;  2DVJ A;  1K0S A;  1KFZ A;  4RTU A;  1CSK A;  2ABL A;  3M0S A;  3GBQ A;  1ZBJ A;  1K0X A;  2EBP A;  2PZ1 A;  4ESR A;  5GJV B;  1QWF A;  1SPK A;  2P4R A;  1M8M A;  2FRW A;  3LH5 A;  1SHG A;  1NEB A;  1HJD A;  1VA7 A;  2JXB A;  4OML A;  4K11 A;  2GBQ A;  1WXB A;  1S1N A;  1G83 A;  2F2V A;  3REB B;  5I11 A;  3EHQ A;  2O9S A;  2EQI A;  2AZS A;  2LP5 A;  2H8H A;  1TG0 A;  2DMO A;  2DJQ A;  3THK A;  4GBQ A;  1A0N B;  1OPK A;  1V1C A;  2LJ1 A;  1NLO C;  3H0F A;  1WXT A;  2K2M A;  2ESW A;  5IH2 A;  2DL4 A;  4RTW A;  4J9B A;  4Z8A A;  4JJC A;  2YSQ A;  1AWX A;  2J7I A;  2NWM A;  1XOV A;  1FYN A;  3U23 A;  1YWP A;  2MCN A;  2DM1 A;  3FJ5 A;  1H8K A;  2GTO A;  3SHW A;  1AWW A;  4A63 B;  2JM9 A;  2CH4 A;  1AEY A;  1ZSG A;  1AD5 A;  2RF0 A;  3IQL A;  5IHK A;  2GQI A;  2RMO A;  2SEM A;  4Z89 A;  2SRC A;  2A08 A;  5HCK A;  2DA9 A;  1PNJ A;  1ZUK A;  3EHR A;  1NM7 A;  1WFW A;  4EIK A;  1OPL A;  2A28 A;  1PRL C;  1W70 A;  2L2P A;  1BU1 A;  2M0Y A;  2AKL A;  1GCP A;  1Z9Q A;  3KFV A;  4JZ3 A;  5FW9 A;  4OMM A;  3RNJ A;  4RTV A;  1VYV A;  2HEQ A;  4LUE A;  3UA6 A;  2GGR A;  1RLQ C;  2FG0 A;  4CC4 B;  1U5S A;  1T0J A;  2KRN A;  4J9I A;  3JV3 A;  3EG0 A;  4CC3 A;  2KXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...