4A4KA

Crystal structure of the s. cerevisiae ski2 insertion domain
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
246
structure length
246
Chain Sequence
TLQPEHEKQIKVLQEELQTIEYKSCEICDNDIEKFLELMLAYKEATVNLMQEMVKSPSILHILKEGRLVAFRDPNDCLKLGFVFKVSLKDAVCVIMTFTKPYKLPNGEPNHLIYFPKADGYRRRNFPKFQKTDFYMEEVPVTAIEVITKRKFAAPLGKVIKKDVAALNEFNAETNNILDGKTLKEAINIEKQGLKIHQILLDRTNIRDEIFKLKSIKCPNLSQHIVPKFKAHVIKKKIEELYHLMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ANTIVIRAL HELICASE SKI2
publication title The Crystal Structure of S. Cerevisiae Ski2, a Dexh Helicase Associated with the Cytoplasmic Functions of the Exosome.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 65
structure length 246
sequence length 246
chains with identical sequence C, E, G, I
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1500.20 Mainly Alpha Up-down Bundle YheA-like fold YheA-like fold 4a4kA01
2.30.30.1160 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4kA02
2XGJA 4A4KA
chains in the Genus database with same CATH superfamily
3CPWP 4J9FA 4HVUA 3NTIA 3H8ZA 4M7DA 3JB9F 1I07A 1VQ9T 1VQPT 5FU6C 2HKNA 2E3HA 4II1A 3OS1A 1VIEA 2OTJA 2GTOA 4EMKC 2SRCA 4HA8A 1U06A 7AT1B 3CMAA 2L8DA 3HFOA 3T9NA 4PFZA 3NTHA 2RPNA 1Y57A 4A63B 1M27C 3L2ZA 2AK5A 2DEQA 1OI1A 1S72Q 2J06A 2PVOB 1BBZA 1X43A 3OW2P 4E7LA 3ASKA 4P5NA 2BZXA 4F17A 2DLPA 2EQMA 3VS2A 5GANj 4DEXA 2FHDA 2NUTA 2RJFA 3MP6A 2QAZA 1G5VA 2QQAA 2DRMA 4DBFA 3G71A 4C0ZA 1N8RU 2L0AA 1NZ9A 2HSPA 2LX7A 2QASA 2VYTA 1OULA 3P8BB 1PCXA 2YUNA 3QDRB 3INZA 1YJWA 2RI3A 2JMAA 4L5GA 3OYMA 1M2OA 2DTOA 2G6FX 1PD0A 3M57A 4M7DF 2WSCE 1ZHIA 3BY7A 2OTLA 4OB0B 3JRZA 2BUDA 4C0DB 1HXDA 1W6XA 1W4SA 3EG0A 2MPXC 1FXXA 2EQUA 3PIOA 3WVEB 4RTTA 3FDRA 1X6GA 4ZNXA 2VWFA 2Y4YA 5I2MA 2QXFA 1JB0E 3BW1A 2YWWA 1WXTA 3GNGA 3AT1B 5L8RE 4BDYA 1X75C 4JZ4A 5GAMf 1UJ0A 4OF1A 4E47A 2M1HA 2RHXA 2XMFA 3QG1A 3I55Q 1EZZB 1YJNA 4RTZA 1QW1A 2QQSA 4C8QE 2EKHA 1K9MC 2D8JA 5J39A 3UATA 3QJYA 4FIBA 4PFPA 3CCMQ 3CCRA 3MO8A 4OMPA 2K3XA 5GAN8 2VUBA 1AT1B 4FYYB 2DFUA 4A54A 1Q86R 3CMAT 2MWOA 3L42A 3V7CA 1Q81C 2E70A 4C0DC 3CCUA 3UWNA 1KHIA 3OSVA 1P92A 2K5IA 1WXBA 2OJ2A 2DVEA 1K73C 3OMGA 1O75A 2CP3A 2CH4W 2HZYA 5GMKm 3G71T 1NLOC 3UF4A 5FWCA 3OYDA 4FU6A 3PIPA 4KBMB 3FC3A 2KXDA 1YJWT 2PIHA 3M54A 3MEUA 2H3JA 1AD5A 2CT4A 4FYVB 1Y7XA 2G3RA 4M7AB 3CPFA 4MDWA 2D0QB 2QQRA 1ZSZA 3M0QA 4CC7A 4RTVA 3FLGA 1YI2Q 3HSBA 2OEEA 4FW1A 3G1JA 5CQXA 2LP5A 4PKCC 4A4HA 4A4FA 3JCMe 2LQ8A 5GANf 2FYKA 2XHCA 3OYHA 4PK4A 1IHWA 4Q5WA 1IB8A 2O4XA 1M1KR 2XI9A 1AWXA 2A08A 2LC4A 2XKOC 4E7JA 1M3CA 4QQGA 4C92B 3TQ7P 1X2QA 3QZ5B 3UA6A 2ZPFB 1YCYA 2M0YA 1YHQA 3M4YA 1SHFA 4DEYA 1YJ9Q 2DXUA 3CCRT 4LD6A 4LUDA 2X4WA 3VKIA 3JB9G 4C0GA 2IPOB 4XU1A 1OX9A 4Z02A 1WLPB 3V8LA 5KYXA 2RK2A 4FSXA 4M7AC 3VV0A 3OYAA 4Y92A 1PRMC 5GAMh 1JQQA 2LCSA 4C8QA 5FWBA 3CCUT 3CPWA 4JUVA 4GLKA 4KH0B 3M9QA 4M78B 4NL2A 2ZZDA 2X51A 3RERA 1D0ZA 4PJJA 2GF7A 4ORZA 4JJNK 4PL6A 4J6XA 3CCJT 1X6BA 2RQTA 2EWNA 4JS5A 2JTEA 3UT1A 1TTHB 2MWPA 5ECAA 3S3OA 2MI6A 2EJGA 2W10A 4B9WA 3I56A 1B34B 4DOWA 2DL5A 1W2BP 1FMKA 4DQ2A 1BI2A 3OW2A 1C6VX 2X4YA 2KROA 2VGNA 2KT8A 4LNPA 4J9HA 4AFUC 3S6WA 1T0HA 2DEUA 1MHNA 1MGQA 2DXCA 5GAOp 2KGTA 3CCJQ 4O6JA 4K11A 4BE1A 2KRSA 1M8MA 4MZPA 1HJDA 4KGVB 4M7DG 1H92A 1VQLA 3TU4K 3EFOB 2FPFA 1SSFA 4J6YA 2RJCA 1AOJA 2FPEA 4M75E 1NM7A 1IREB 3JB9J 1UTIA 2C0IA 2YLCA 2A37A 1OV3A 4MMKA 4MZTA 3RBBB 2JW4A 2CP2A 4ELZC 3A8HB 1TUCA 1KHCA 2D6FA 3EAEA 4ATOA 3ULRB 5IHKA 3CD6A 3FIFA 2EGCA 3META 1WGSA 3J81E 1BI0A 2FL7A 2K5LA 5L23A 3JCMQ 2F1LA 2PVGB 3MEVA 5GANh 2A3LA 1IRXA 1K9MR 1UHCA 1NYGA 2LDMA 2RJEA 3CCQA 4XK8E 3X24B 5CVIA 2EQKA 2K3YA 2DL8A 1MMAA 2AIRB 2V26A 2PZ1A 3CCVA 2F69A 2KK4A 1YBYA 1ZUYA 4FL6A 1YIJA 1K4US 3C94A 5GAN6 3O8VA 3QPHA 5FLXE 2QEXT 2FZKB 3KFVA 3OS5A 1TG0A 3BFMA 2QTVA 2NUPA 1Q81R 2EPDA 2EW3A 1TXQA 5IT9E 4XU3A 1N6AA 3EGUA 1BIBA 2GTJA 2QA4Q 2YT6A 2LJ0A 4O5VA 3CEYA 1G3WA 3PVQA 3CPWS 4ZGDB 4D8KA 3MKDA 4RTXA 3PMTA 3C95A 4OMNA 1JXMA 1Y71A 1UGVA 2OAUA 3I56T 2L5QA 5GAMd 2QEXQ 2QGGA 3RUXA 3M0RA 3EGDA 4BY6C 3PGGA 3SDZA 1RAAB 4DBHA 2M02A 4IURA 2OX7A 1UUEA 1S72A 3SD4A 3VRZA 1NJIU 1VQLT 4A4EA 4AFZC 2QI2A 2YLBA 4XAXB 3OW2S 2QTXA 3QYGB 1GCPA 3KUFA 1RAGB 1VYTA 2DK3A 4L6V5 5I22A 1WHKA 4AG2C 1BK2A 4LN2A 4AG1C 1KC8U 4J9CA 3C0CA 3QBYA 1K0SA 1JO8A 1PG5B 1Q82C 3MPUB 1I0CA 2YXYA 2KYMA 2FVUA 3LW5E 4J7IA 4BI8B 1AVZC 2HCKA 2HAXA 2LX9A 3RDVA 4EIKA 2J05A 4D8DA 3CD6T 4WF2A 4M75A 1YWOA 3L1AA 5KH6A 3EH1A 3V7SA 1QCNA 4KUIA 5LJ5d 4B9XA 3CCSQ 1B07A 5GAOl 1ZX6A 4LDXA 2HDAA 2YRCA 1NBEB 2L3SA 3CCQT 3RMSA 2E41A 4WCIA 4PJOB 4L59A 1PNJA 3CCVT 3I9QA 2KR3A 5KYUB 3QSUA 4PJOD 3JCMP 4ZTFA 1UGPB 1VQMQ 1YIJT 4B6MA 2XDPA 1UECA 2GQVA 4NOYA 3GLXA 2RHZA 2Y90A 1E6GA 4JRIA 1Y96A 2LJ1A 2OI3A 2P84A 3I55A 4R56A 2MAMA 1MV0B 1Q95G 4IUUA 1UHFA 2RQRA 1BB9A 1UEBA 2COZA 1Q86U 1EX4A 5KYYA 3CCMA 3TCJA 2LNHB 1KQ2A 4F16A 2HMAA 3EGXB 4LUEA 2HL5C 1N8RC 3AHUA 2LCCA 2XDDA 1H3HA 5M9OA 1N5ZA 2NLUA 2KMTA 5LJ5j 1W1FA 2AZVA 1BI1A 1CKBA 1ZUKA 5DY9A 1GCQA 1S72T 2QQ9A 2YRDA 4J9EA 3OYCA 4AFSC 3N5BB 1KQ1A 1WZOA 3RKWA 3HHTB 2JNGA 4PJOC 4ANJA 2FO0A 3LLRA 4C0FA 2QQBA 1W2BA 2ZPIB 1QVGP 1C1AA 1NPPA 3JSCA 2QDYB 3X26B 1C0MA 3I5SA 1SEMA 4PJNA 1DJ7B 4TVRA 4YTLA 4C8QG 5CKDA 3QDFA 2OEQA 1Q7YR 5KYWB 1OX8A 2RHIA 4F7UE 4JJBA 1R0CB 3VS4A 2DPPB 2X4XA 2L3PA 3CBMA 3UDCA 1IHVA 1QMCA 1KFZA 2CP6A 2P4TA 3P8DA 1WIEA 1KQSP 2RB6A 2D8HA 2KYBA 3G4SQ 5DLQE 1YI2A 3DLLA 4XTUA 4X1VA 4ME7A 4E7IA 5GAOq 1KSWA 1M1KU 4HCBA 2E1HA 1D3BA 2F2XA 2L2PA 1VQ8T 1H3ZA 1UFFA 2IIMA 2VASA 3BE3A 1RADB 2CREA 1WPYA 1RI9A 4QT7A 3OYYA 1M4ZA 5J3BA 1WXUA 5HCKA 2PQWA 3A8OB 3I55T 3RIRA 2KXCA 2I0NA 4R0KA 3M56A 1X6OA 1OOTA 1R0BG 3QZ9B 5FROA 1QWFA 1YJ9A 3VS3A 3LGLA 1SSHA 4M7DB 1PHTA 1GBQA 3CCMT 4D6WA 1D1CA 1NPRA 1HK9A 3V7RA 1FMVA 1VQ8Q 1MMNA 3CCEQ 3WXMB 3FJPA 2DMOA 3PMIA 5GAMg 2JS2A 3JCMb 2E6NA 2EFIA 5FRNA 4M77B 5HK0A 1IXDA 1TOVA 2JOYA 2EIFA 4BI4A 2XU8A 4M77D 3OS0A 1D1AA 1F1BB 1TUGB 3CC7Q 2E12A 3E2UA 1WHJA 2PUOB 3HRSA 1LPLA 3QWXX 2DAQA 5HK3A 2K2MA 4OGEA 2QYZA 1RACB 1NEGA 1V1CA 4EPCA 3GIBA 3VS0A 1SHGA 2NUTB 5KE2A 4CC3A 4J9GA 3LX7A 3UPUA 1U5SA 3QKJA 4R55A 4HCCA 2NUZA 4HXJA 4C5EA 2JUFA 2IAZA 3HRUA 1VA7A 2PNIA 2AHJB 1W2BS 1Q82R 5A2QE 1IO6A 1WJQA 1M3AA 3G6EQ 4C5IA 2BTTA 3VU3C 3CCJA 1SG5A 5LJ5g 2PVDB 8AT1B 1VQKQ 3C4SA 5LJ5f 5D6WA 1YI2T 1EIFA 3JAME 1WHLA 2KBTA 1UG1A 1WJRA 2EKOA 4M77C 4F7UA 6AT1B 5GMKe 1M2VA 1M90U 2FRYA 3LH5A 4BD3A 2E65A 4RMOA 1KD1U 4LDVA 1ZBJA 3JCMf 4J7FA 1YCSB 4N4GA 4CRIA 2CS7A 1LOJA 3I5RA 5CO7A 1M5Q1 2EAYA 4M7AD 2RH2A 1JXOA 2RQVA 3OYKA 3CQTA 4Z89A 1YITT 2DYBA 4JJDA 2QGFB 2X3WD 5GANg 1YJ9T 2DXBA 3SB2A 1N27A 1K8AC 2IG0A 2EYYA 3JV3A 4EMHA 5GAN5 1WHMA 3DKMA 3OY9A 1VQOQ 4IUVA 2K57A 4OVAA 1N8RR 4C92D 4M75G 1YITQ 1GFCA 4ZGJB 1RI0A 3EG9A 1RLPC 1GXIE 2F5KA 2P0KA 1W70A 2EJ9A 4F7UF 4QVCA 1QKWA 2O88A 3H0HA 1IGQA 1ABOA 2LNVA 5GMKi 1XTDA 3M55A 4CC4B 2SEMA 4LDWA 2QA4A 4OMQA 3NGPA 4Y28E 3H0FA 2KRNA 5GANe 1ZBXA 2EBPA 1YWPA 2K2VA 4OB1B 3JCMc 3CXCP 3H9NA 1ZA1B 5LJ3d 2QEXA 2HQHA 3DB4A 2RMOA 2VVKA 4RUGA 4OB2B 2XG8D 4M78D 5LL6S 3L2UA 3LYIA 5GAOr 2E5QA 1U8RA 2K5FA 1ZSZB 1QVGA 3M58A 3RMQA 1QCFA 3PVLA 3NFCA 3QIIA 4KGZB 2EGAA 2GGRA 2FEIA 2F2WA 2K7AA 4IIOA 2K3BA 4C92C 2HSEB 2DTIA 3TSZA 4HKEA 2V1QA 2A36A 1N9SA 8ATCB 4J9BA 2DO3A 4FT2A 2V8IA 3RKYA 2A7YA 2FB7A 1KQSA 2O4XB 1YNZA 3R6NA 4E2FB 9ATCB 2W0ZA 1VQ7Q 3VUZA 2ENMA 1D1BA 4XTVA 5LJ5h 1KIKA 2K6DA 2E6ZA 3NHNA 4ZGEB 4J83A 1VYUA 3QWYA 1X2KA 5GAN4 1Y0MA 2VXFA 3CCSA 4LD9K 3A8LB 4N4IA 5D6XA 4N0AA 3JCMh 5LJ3j 2J6OA 3SWNA 4A4KA 3VS1A 2CT3A 4M78C 4AFQC 3VRYA 1TSFA 4JRKA 4FW2A 3O5ZA 4BE0A 1CKAA 5KYXB 2DM1A 4PLLA 2ZGWA 2JZ2A 2YDLA 1AWJA 1RLQC 3L2VA 1BYMA 2M16A 4BUGA 4C8QB 1PKSA 1SF9A 1G2BA 2FRWA 1VQMA 2MF2A 4NS5A 4E7ZA 2EYXA 4KRTA 4BB7A 5HKCA 2M0OA 4BACA 2XD0A 2CKKA 2CGHA 1G83A 1M1GA 4JRQA 3E19A 5CK9A 1M1FA 1G3YA 1VYVA 1NJIC 3F70A 5CCAA 2QA4T 1RAFB 3RNJA 2DE0X 4IIMA 2L89A 1U1SA 3VS6A 1KC8C 2KSSA 3OYFA 1N9RA 3S3NA 3JCMW 4XU2A 2GQIA 3MP1A 3CC2Q 1IZ6A 2WACA 1VQNA 4JRPA 2FZCB 1PSFA 2DTHA 2E4HA 1ZUUA 1AHJB 2LCLA 4XTXA 5IHNA 2X4JA 3M0SA 2V8JA 4E7KA 1K73R 1LVKA 2EGEA 2VXEA 4JZ3A 4FCYA 5KCHA 5HY6A 2DD4A 4EDUA 2FPDA 4C8QC 2JTMA 2LZ6B 2BE9B 1UGQB 4PNOA 1Q7YU 3NPFA 3GOXA 1RAHB 3TREA 4M4ZA 1QVGS 4PJOA 5IXFA 1PRLC 2EYWA 2RJDA 1CSKA 2M51A 4EMKA 5GJVB 1RUWA 1TS9A 3JCMV 4ZN3A 1M3BA 3VUBA 1FMWA 3CCLQ 1UGRB 2ATCB 1M30A 4C5HA 2O2OA 1A0NB 2RN8A 4M77E 2CUBA 3J7AF 2KE9A 1WI7A 2KVQG 4JJCA 2RI5A 1V29B 2CSQA 3CCST 5CIUA 3HPWA 4X34A 1I1JA 2EJFA 2R57A 3G4SA 2NYSA 4JLGA 2A28A 2E5KA 4A53A 3VYHB 4NL3A 2KQWA 5CKBA 2JVVA 4EMGA 5I11A 1B7TA 4CC2A 3EGXA 1K8AR 1U3OA 2FZGB 5KYNA 1VQ5T 2GFAA 5EG2A 1VQ6Q 1VQMT 4OGCA 1AZEA 4RTYA 3HL8A 2BZYA 1TH7A 2RQWA 3TVTA 1NLPC 2NUPB 3OSSC 1NG2A 4DBQA 4F7UG 1KK7A 2H8HA 4ZTJA 1OPLA 2XIDA 3MEWA 4X9CA 3JCMd 4PJOF 2ESWA 4RG2A 2YHTA 1XNIA 3M0PA 1VQ5Q 1KG1A 1VQ8A 4XTZA 3CCEA 2EYZA 3EFRA 4LXCA 3URGA 1YN8A 4KT0E 2JM8A 2DILA 1AZGB 4Y91A 5LJ3f 2HL3A 3EHRA 2F5TX 3EGDB 3KXTA 2YSQA 4ZN1A 1VQNT 2CP5A 3G7ZA 3NMZC 1H8KA 2BZ8A 3CC4Q 1LCKA 1QVFP 3CC7A 5GMKj 1QQJA 1J3TA 2AZSA 3A8GB 4C5GA 4M7AE 2Y4XA 4FYWB 2DYIA 2F2VA 3PNWC 3CXCA 5A0LA 4FT4A 1G8XA 3H6ZA 4ESRA 2AT1B 3REBB 4OMLA 2DJQA 2VKNA 1UDLA 1VQNQ 1ZSGA 3CMEQ 1Q82U 1WX6A 2ZCFB 2RHUA 1NEBA 4E7SA 1K0XA 3PT9A 4E7HA 4OMMA 4E6RA 2ED1A 1D0XA 2LVMA 4M75B 2M9UA 3G6EA 5A0GA 1EFNA 1IGUA 4C92E 3MP8A 3HRTA 1VQKA 3G4ST 3SEMA 1NYFA 3JB9I 4FM4B 2DBMA 3CBPA 3JB9D 4RCBA 4ELYC 1PWTA 5I2SA 3VYGA 2MMPA 4DA4A 3M5AA 2KAFA 1OU9A 2ZPGB 4HT8A 4M77A 2VV5A 3QJ6A 4X9DA 3GPLA 3EG3A 2DERA 1R8OB 1WQWA 2LT1A 1Y96B 2RO0A 1D09B 1G3TA 5GAOm 2LRQA 1M8VA 2YUQA 4M78E 3M59A 3JCMJ 1VQPQ 1VQ9Q 1G3SA 5D7UA 2X3XD 1PSEA 1E6HA 5KYYB 5GMKl 2O01E 3HKSA 1NJIR 3CCET 4Z88A 2HKQB 1HD3A 3OYLA 4HCZA 1B3QA 2R58A 3BDUA 1JJ2P 1U1TA 1VQOA 4M75C 5D6YA 3JB9H 2RM4A 1FX7A 3H0IA 3OYIA 2DNUA 5FRMA 1WYXA 2CP7A 1KC8R 1OU8A 3J80E 5CKFA 3CC7T 2K9GA 4RTWA 2GCXA 1YITA 2DJZA 3VS7A 5GAN2 2RF0A 3ZL7C 5DLOA 1JU5C 3IQLA 5AYFA 4JLIA 5KE3A 2JJ9A 2CZ6B 2HNIA 2C06A 4M7DD 3SFMA 2CZ0B 1QP2A 1GRIA 1VQ4T 1M90C 1JBMA 2JT4A 5LJ3h 3OYNA 1KD1C 4M77F 1WQ7A 2E10A 2I2LA 1OZ3A 3LWIA 3CXCS 2VGMA 2ROTA 4M7AA 2ABLA 1GBRA 3M53A 2XDBA 2J6FA 5IN1A 3MJXA 2COWA 4AT1B 1JEGA 3THKA 1ABQA 2BKDN 1I5LA 2JXBA 2V8KA 2PU9B 3G6ET 4FYXB 1VQ4Q 2HQXA 2HQEA 1VQKT 2RD1A 1VOMA 1D0YA 2RHYA 4F04B 3GBQA 3EG1A 4KULA 3VS5A 2OTJT 2KI7A 1ZA2B 3V8JA 1D3BB 1GCQC 5GAMe 2DBKA 2CSIA 4M7DC 1K76A 5GJWB 2D1XA 2OAWA 4C92A 3M0TA 2K4YA 2MK5A 2EYQA 2X9HA 1VQ7A 2DKGA 1QP3A 2VC8A 1PD1A 3ME9A 4IUTA 1GFDA 4WTOB 1PM3A 5C0MA 2YUOA 4KUDK 2MIOA 2DF6A 2E3IA 1LJOA 2YRVA 3JCMg 1TU0B 2OTJQ 2PUKB 4XU0A 2XICA 4JS4A 1TWBA 4QVDA 5GAN3 1HYOA 4PJOG 3CMAQ 3D7SB 3E1SA 1QLYA 1M9SA 5J26A 2V1RA 1T3LA 2DRKA 3TEEA 3OYBA 1VQOT 4M7AF 3GNFB 4GY5A 2RQUA 1QWEA 2RNAA 4M78A 5CKHA 3EHQA 4LDYA 4QW2A 1AWWA 1K9MU 4XQ3A 4J9DA 1WFWA 2DZ9A 2OTLT 1YFNA 5LJ5e 2MYSA 3G71Q 4LDUA 4A4GA 4RCCA 1Z9QA 1B34A 2DZCA 1YJWQ 2KDSA 1I8FA 4C92F 1X27A 1Q81U 1QVFA 2KNBB 3X28B 2ED0A 4BE2A 3H41A 2DXTA 4VUBA 2P0QA 2VB6A 2EQJA 1MNEA 2L3RA 2OTLQ 1QVPA 3CC2A 4KGXB 3FRNA 1UJYA 5GAN7 1K73U 2LJ3A 3EFOA 1YJNT 1K9AA 1WHGA 3QUIA 1OZ2A 2YUPA 3PFSA 2WSFE 2QK0A 1GL5A 3GP8A 3OYJA 3RR6A 2C0OA 3X20B 2COYA 4F7UB 3EG2A 2CP0A 1I81A 1M2VB 3OS2A 4J6WA 5GAOn 3OBYA 2A0FB 2ZPEB 4M78F 1OEBA 4IUPA 2KT1A 2B86A 1BIAA 4QVZA 4PJOE 4PFOA 1AEYA 2O9SA 2ZPBB 1YJNQ 1R77A 1RL2A 3HFNA 1VQ7T 2XK0A 2LQWA 3A1PA 2P4RA 1ARKA 1KJWA 1ZLMA 3CCLA 1OQKA 2CDTA 3DLMA 1SRMA 3CCRQ 3OYEA 3U23A 1WHHA 1YP5A 1PKTA 5KCOA 5GMKh 1H641 3VJPA 1SPKA 3OQ5A 3L2RA 1O9SA 3E9FA 4OB3B 1K8AU 4HVVA 3FEOA 4GBQA 5IAYA 4N4HA 5C6SA 4XTYA 3CCUQ 2E64A 3A8MB 4QQDA 2D0NA 4OMOA 3DB3A 3RKXA 3A98A 5CAIA 3MEAA 1VQ6A 3E9GA 1NE8A 2RI2A 5FW9A 3ZBDA 1VUBA 2CZ7B 3EG9B 4QQ6A 3X25B 4DOVA 1HSQA 1XQHA 4HT9A 2LQKA 3EH2A 1JRIA 2ZPHB 2P0PA 1ZQ1A 1MMGA 1X69A 1JJ2A 1MMDA 3QYHB 4RKUE 3HTRA 4XTWA 3OMCA 2LMJA 4PJMA 1ZSZC 5CR2A 1Q7YC 2NWMA 1VQ5A 4C8QF 1I4K1 4J8OA 2JTFA 4M77G 4C8QD 2LT4A 1M90R 1KD1R 2JS0A 1FWZA 2JM9A 4OMFB 3LH0A 4V2SA 1BU1A 3CC2T 4Z8AA 3L2QA 3V8KA 3CC4A 1WJSA 2DIGA 1Z9ZA 1QVFS 2DA9A 1YHQT 2J7IA 3EFSA 4BY6B 2ECZA 2PTKA 1MV3A 2JMCA 5DM7R 3QHSA 3I35A 1T3SA 2QG9B 5AT1B 3M4GA 3OBWA 3JCMX 3MCAB 1ACMB 2WSEE 5IH2A 3CMEA 2ZAEA 4HCKA 3PE0A 3L2WA 3CCLT 3UA7A 2FG0A 1YHQQ 2LTOA 2H3EB 2BE7D 5EC7A 1Y07A 2RA2A 4BDZA 2GFUA 4DBRA 3FJ5A 4GLMA 4HVWA 2KRMA 3A5ZB 3SHWA 3SWNB 1LNXA 2LQNA 3RESA 2QDLA 4IUQA 3S3MA 5KYUA 2DIQA 4M7DE 1K1ZA 2Z0WA 1UGSB 4BI3A 2C0TA 3ZEHA 2DL4A 2R5MA 4M7AG 3LWHA 1S1NA 1XJWB 1VQ6T 4MMLA 3R6OA 1RABB 5IXBA 3Q1JA 3NTKA 2CZ1B 5CQYA 2DL3A 3REAB 2HD0A 1KQSS 2J6KA 4AMCA 1UB4A 4FSSA 3QXEB 2ROLA 1Q86C 1VQPA 1VQ9A 1OPKA 3OB9A 5I21A 1RAEB 3I56Q 3BDLA 1V76A 5FU7B 3CBOA 2MCNA 2D9TA 4C92G 3WVDB 1T0JA 1FYNA 4PLIA 1XOVA 2O31A 1RAIB 4PJLA 4CI0C 1JJ2S 2GNCA 5IHIA 1BI3A 2BIVA 2K79A 3CC4T 5CKEA 2HEQA 1VQLQ 4N0AC 3PTAA 2KY9A 3SWNC 1QCOA 1I5OB 2GBQA 1BCOA 1QKXA 4LE9A 2EQIA 4MZMA 2HBPA 1X01A 2X35A 2O9VA 2MOXA 5GAMj 5LJ3g 1WDXA 3LGFA 5KYWA 3P8HA 3TSWA 1SRLA 2DVJA 2AKKA 4MDXA 2IVWA 1SKUB 5FU6B 1BKBA 3M0UA 3CMET 4M78G 5A0DA 4F14A 3GF5A 2R5AA 4EMKB 4RTUA 3HP9A 3CD6Q 4JDSA 2RK1A 2B8AA 1E7OA 1AWOA 1WNLA 3QO3A 4RG8A 4JPBW 2CUDA 3C12A 4OP0A 1VIFA 1WA7A 5FU7C 2AKLA 1VQ4A 3CCQQ 1BCMA 2DD5A 2JN0A 1OYXA 1PC0A 4QKUA 3OYGA 1TUDA 1M1KC 3MHXA 5GANd 3CCVQ 2DETA 4UC4A 4J9IA 4J5YA 2KEAA 3KBGA 2DL7A 1MUZA 4KH1B 1MNDA 1YIJQ 2EVRA 3FB9A 1UE9A 2CH4A 5LJ3e 3ZFJA 2XGJA 2L3QA 2DX1A 4IKFA 3ER0A 4M75F 4M75D 2HBWA 2CYZB 3OA6A
chains in the Genus database with same CATH topology
2OTJT 5GAMd 3M58A 3RMQA 3V8JA 1D3BB 3RUXA 3NFCA 5GAMe 3NTIA 3QIIA 3H8ZA 4M7DA 3JB9F 4BY6C 4M7DC 3PGGA 3SDZA 4C92A 1VQ9T 1VQPT 5FU6C 2K4YA 4C92C 2EYQA 2DTIA 4II1A 3OS1A 1VIEA 2OTJA 1VQ7A 4EMKC 4HKEA 4IURA 2DKGA 1QP3A 1S72A 4HA8A 2VC8A 1N9SA 3SD4A 3CMAA 3ME9A 2L8DA 4IUTA 1NJIU 1VQLT 3HFOA 4M7DF 4A4EA 5C0MA 2DO3A 4KUDK 3T9NA 2QI2A 4FT2A 2V8IA 2YLBA 2A7YA 2FB7A 3NTHA 2QTXA 3QYGB 3KUFA 4XAXB 3OW2S 1KQSA 2O4XB 1LJOA 2YRVA 3JCMg 2DK3A 4L6V5 3L2ZA 2PUKB 4XU0A 2DEQA 3VUZA 2XICA 4JS4A 1OI1A 2PVOB 4QVDA 5GAN3 1KC8U 4PJOG 4XTVA 5LJ5h 4E7LA 3E1SA 3ASKA 1M9SA 3QBYA 5J26A 4P5NA 2E6ZA 1Q82C 4ZGEB 2EQMA 3TEEA 3OYBA 5GANj 1VQOT 4J83A 4M7AF 3GNFB 4GY5A 5GAN4 3OA6A 2FVUA 2FHDA 2VXFA 3CCSA 2RJFA 3MP6A 4LD9K 3LW5E 3A8LB 4J7IA 4BI8B 2HAXA 4N4IA 5D6XA 1G5VA 2LX9A 2QQAA 4N0AA 3JCMh 5LJ3j 4M78A 3SWNA 5CKHA 4A4KA 3G71A 4M78C 4LDYA 4QW2A 4C0ZA 1N8RU 4WF2A 4JRKA 3CD6T 1NZ9A 4M75A 1K9MU 4XQ3A 2VYTA 4BE0A 4PLLA 2ZGWA 3L1AA 2JZ2A 2DZ9A 5KH6A 3P8BB 3V7SA 4KUIA 5LJ5d 3QDRB 3INZA 4B9XA 3L2VA 1YJWA 1BYMA 2OTLT 2M16A 2RI3A 4BUGA 4C8QB 5LJ5e 5GAOl 4L5GA 3OYMA 4LDXA 4LDUA 4A4GA 1VQMA 2MF2A 3CCQT 4NS5A 2DTOA 4RCCA 3RMSA 2E41A 4BB7A 5HKCA 3M57A 2M0OA 4BACA 4PJOB 4L59A 2WSCE 1B34A 2DZCA 1ZHIA 2CKKA 2CGHA 3BY7A 2OTLA 2XD0A 3CCVT 1M1GA 4JRQA 3E19A 2KDSA 1I8FA 4OB0B 4C92F 5CK9A 3QSUA 4PJOD 3JRZA 3JCMP 2BUDA 1M1FA 1Q81U 1G3YA 1HXDA 1UGPB 4C0DB 4ZTFA 1QVFA 1W4SA 1NJIC 3F70A 1YIJT 2XDPA 5CCAA 3X28B 2QA4T 2GQVA 4NOYA 3GLXA 1FXXA 2RHZA 2Y90A 4BE2A 2DXTA 2EQUA 4VUBA 2P0QA 3PIOA 2EQJA 2L3RA 3WVEB 2L89A 3FDRA 1QVPA 1U1SA 4JRIA 1Y96A 3CC2A 2Y4YA 3FRNA 5I2MA 3I55A 2QXFA 1KC8C 2KSSA 5GAN7 3OYFA 1K73U 1JB0E 4R56A 1YJNT 2MAMA 3BW1A 1N9RA 3QUIA 1OZ2A 3PFSA 2WSFE 4IUUA 3S3NA 3GP8A 3GNGA 5L8RE 3OYJA 4BDYA 1UEBA 3JCMW 1Q86U 1X75C 3X20B 4XU2A 5GAMf 3CCMA 4OF1A 4E47A 3MP1A 2M1HA 2RHXA 1IZ6A 2WACA 3TCJA 4F7UB 3QG1A 1VQNA 4JRPA 1KQ2A 1I81A 1YJNA 3OS2A 1PSFA 1QW1A 2QQSA 4J6WA 5GAOn 2DTHA 4C8QE 1N8RC 3OBYA 1K9MC 3AHUA 1AHJB 2LCLA 4XTXA 5J39A 2ZPEB 3QJYA 2LCCA 2X4JA 4FIBA 2XDDA 4M78F 2V8JA 4IUPA 5M9OA 4E7KA 3CCRA 1BIAA 3MO8A 4QVZA 2NLUA 2VXEA 4PJOE 5GAN8 2K3XA 2KMTA 5KCHA 5HY6A 5LJ5j 2DD4A 2ZPBB 4EDUA 1BI1A 2VUBA 4C8QC 1RL2A 2JTMA 3HFNA 1VQ7T 2XK0A 1UGQB 4PNOA 4A54A 1Q7YU 5DY9A 1S72T 3CCLA 2QQ9A 3GOXA 3OYCA 3CMAT 3TREA 3DLMA 3N5BB 1KQ1A 2MWOA 3RKWA 3HHTB 1QVGS 2JNGA 3L42A 4PJOA 4PJOC 3LLRA 4C0FA 3OYEA 3V7CA 1Q81C 2QQBA 2RJDA 4EMKA 5KCOA 5GMKh 2E70A 3JCMV 1H641 4C0DC 3VJPA 4ZN3A 3CCUA 1W2BA 2ZPIB 3OQ5A 3UWNA 3VUBA 1NPPA 3JSCA 1KHIA 2QDYB 3L2RA 3X26B 3OSVA 1P92A 1UGRB 1O9SA 2K5IA 3E9FA 4OB3B 4C5HA 1K8AU 1DJ7B 4TVRA 4YTLA 4C8QG 3FEOA 5CKDA 2DVEA 5IAYA 4M77E 1K73C 2RHIA 3J7AF 2KVQG 4N4HA 4F7UE 5C6SA 3OMGA 1O75A 2RI5A 1V29B 4XTYA 2E64A 3A8MB 3CCST 5CIUA 3HPWA 4QQDA 4X34A 3DB3A 3RKXA 2EJFA 2R57A 5CAIA 2DPPB 2X4XA 3MEAA 5GMKm 3G4SA 1VQ6A 3E9GA 1NE8A 2RI2A 3CBMA 4JLGA 3UDCA 4A53A 3CXCA 3VYHB 3G71T 3ZBDA 4NL3A 3OYDA 4FU6A 1VUBA 3PIPA 2CZ7B 2KQWA 4QQ6A 5CKBA 3X25B 2JVVA 4KBMB 4EMGA 3FC3A 4DOVA 2P4TA 3P8DA 2RB6A 1XQHA 1YJWT 3M54A 4HT9A 3MEUA 2LQKA 1JRIA 2H3JA 1VQ5T 2GFAA 5DLQE 5EG2A 1YI2A 2ZPHB 1VQMT 2P0PA 1ZQ1A 4OGCA 1Y7XA 1JJ2A 3QYHB 3DLLA 4XTUA 2G3RA 3HL8A 4RKUE 1TH7A 4ME7A 4M7AB 3CPFA 4XTWA 4MDWA 2D0QB 3OMCA 2QQRA 4E7IA 5GAOq 5CR2A 1Q7YC 1M1KU 1VQ5A 4HCBA 2E1HA 3OSSC 1D3BA 3FLGA 4C8QF 1I4K1 4J8OA 1VQ8T 1H3ZA 2JTFA 3HSBA 4M77G 4C8QD 4F7UG 2LT4A 4ZTJA 2XIDA 5CQXA 3MEWA 4X9CA 1WPYA 1FWZA 3JCMd 4PKCC 4PJOF 3OYYA 1M4ZA 5J3BA 4OMFB 3LH0A 4A4HA 4A4FA 4V2SA 3JCMe 4RG2A 2YHTA 1XNIA 2LQ8A 2PQWA 3A8OB 3CC2T 1KG1A 3I55T 1VQ8A 4XTZA 3RIRA 5GANf 3L2QA 3CCEA 3V8KA 3CC4A 2FYKA 2XHCA 3OYHA 3EFRA 1WJSA 4M7AG 3URGA 3M56A 2DIGA 4Q5WA 1X6OA 2O4XA 4KT0E 1QVFS 3QZ9B 5FROA 1YHQT 4Y91A 1YJ9A 5LJ3f 2XI9A 3KXTA 2F5TX 3EFSA 3LGLA 4BY6B 4M7DB 3CCMT 4D6WA 1NPRA 2LC4A 2XKOC 1HK9A 4ZN1A 3V7RA 4E7JA 5DM7R 4QQGA 4C92B 1VQNT 3G7ZA 3QHSA 3QZ5B 3FJPA 3WXMB 2ZPFB 3CC7A 1YCYA 3PMIA 5GAMg 3JCMb 2E6NA 1YHQA 5GMKj 3M4GA 2EFIA 3OBWA 3A8GB 3M4YA 4C5GA 3JCMX 5FRNA 2DXUA 3MCAB 4M77B 5HK0A 4M7AE 3CCRT 2Y4XA 2JOYA 2EIFA 2WSEE 3PNWC 2X4WA 2XU8A 4LD6A 4M77D 4BI4A 5A0LA 4FT4A 3OS0A 3VKIA 3CMEA 3JB9G 3H6ZA 4C0GA 2E12A 4XU1A 4Z02A 3L2WA 3V8LA 3CCLT 2LTOA 2PUOB 2RK2A 3HRSA 4FSXA 4M7AC 3VV0A 3OYAA 5HK3A 1Y07A 2DAQA 5GAMh 4OGEA 2RA2A 4BDZA 2GFUA 4C8QA 1Q82U 2ZCFB 2RHUA 4EPCA 3GIBA 3CCUT 3CPWA 3PT9A 4JUVA 4GLKA 4E7HA 3A5ZB 5KE2A 3M9QA 4M78B 3SWNB 1LNXA 4NL2A 3RESA 2LVMA 2ZZDA 4IUQA 3S3MA 3LX7A 3UPUA 4M75B 3RERA 2DIQA 3QKJA 4R55A 4M7DE 2M9UA 3G6EA 2GF7A 4HCCA 5A0GA 1UGSB 4JJNK 4BI3A 4C92E 4PL6A 3ZEHA 4J6XA 2R5MA 3CCJT 4C5EA 3MP8A 2JUFA 3HRTA 2EWNA 4JS5A 3HRUA 3LWHA 3G4ST 1VQKA 3UT1A 1VQ6T 2MWPA 4MMLA 2AHJB 3R6OA 3JB9I 1W2BS 4FM4B 3S3OA 5A2QE 2MI6A 1WJQA 2EJGA 3CBPA 3JB9D 3Q1JA 3NTKA 2CZ1B 4RCBA 4C5IA 4ELYC 3VU3C 5CQYA 4B9WA 5I2SA 3I56A 3VYGA 1B34B 2HD0A 4DOWA 5LJ5g 2MMPA 3CCJA 4DA4A 1KQSS 2PVDB 3M5AA 4DQ2A 1BI2A 1UB4A 2KAFA 3OW2A 3QXEB 3C4SA 5LJ5f 5D6WA 1YI2T 2X4YA 2ZPGB 1EIFA 1Q86C 2VGNA 4HT8A 3JAME 4M77A 2VV5A 1WJRA 3QJ6A 2EKOA 4M77C 4X9DA 4F7UA 3GPLA 3S6WA 5GMKe 1VQPA 1VQ9A 1M90U 4BD3A 1MHNA 1MGQA 3OB9A 2E65A 2DXCA 5I21A 4RMOA 1KD1U 5GAOp 3BDLA 4O6JA 1R8OB 1WQWA 2LT1A 4BE1A 4LDVA 1Y96B 4MZPA 5FU7B 3CBOA 2RO0A 4J7FA 3JCMf 4M7DG 1G3TA 5GAOm 1VQLA 3TU4K 2D9TA 4N4GA 4CRIA 2CS7A 2LRQA 4C92G 1M8VA 3WVDB 1LOJA 4M78E 1SSFA 3M59A 3JCMJ 1G3SA 4J6YA 1XOVA 4PLIA 2RJCA 4M75E 5CO7A 1M5Q1 2EAYA 1JJ2S 4M7AD 4CI0C 1PSEA 1IREB 3JB9J 5GMKl 2RH2A 2O01E 2YLCA 3HKSA 1BI3A 3CCET 2BIVA 3OYKA 3CC4T 5CKEA 3OYLA 4HCZA 4N0AC 2R58A 3PTAA 4MMKA 2KY9A 4MZTA 3SWNC 1YITT 3BDUA 1U1TA 1VQOA 4M75C 4ELZC 5D6YA 3A8HB 2DXBA 5GANg 2RM4A 1FX7A 1YJ9T 3JB9H 3OYIA 5FRMA 4MZMA 1KHCA 2D6FA 2HBPA 1X01A 2X35A 3EAEA 3SB2A 4ATOA 1N27A 3J80E 1K8AC 2IG0A 5CKFA 4EMHA 5GAN5 5GAMj 1YITA 2GCXA 3CC7T 5LJ3g 2DJZA 3CD6A 3FIFA 3DKMA 3LGFA 3OY9A 5GAN2 3P8HA 4IUVA 5DLOA 4MDXA 3META 2IVWA 4JLIA 5AYFA 3RKYA 5KE3A 1WGSA 2CZ6B 2HNIA 2K57A 3J81E 1BI0A 2FL7A 5FU6B 1BKBA 2K5LA 2C06A 4OVAA 3JCMQ 4M7DD 3SFMA 3CMET 4M78G 5A0DA 2PVGB 3MEVA 5GANh 2CZ0B 2A3LA 2R5AA 3GF5A 4EMKB 4C92D 4M75G 1QP2A 2LDMA 2RJEA 3HP9A 3CCQA 4ZGJB 1RI0A 4JDSA 4XK8E 3X24B 1VQ4T 5CVIA 2RK1A 2B8AA 2EQKA 2K3YA 1M90C 1GXIE 2F5KA 2P0KA 1JBMA 5LJ3h 3OYNA 1KD1C 1WNLA 4M77F 3QO3A 2EJ9A 4F7UF 4QVCA 3CCVA 1WQ7A 2E10A 4RG8A 2F69A 2KK4A 3C12A 4OP0A 2I2LA 1VIFA 1YBYA 1OZ3A 2LNVA 5FU7C 5GMKi 1XTDA 3M55A 4FL6A 1VQ4A 1YIJA 3LWIA 4LDWA 3CXCS 2DD5A 2JN0A 3C94A 2QA4A 1OYXA 2VGMA 5GAN6 3O8VA 3QPHA 5FLXE 3OYGA 2QEXT 4M7AA 3M53A 3OS5A 2XDBA 5IN1A 3BFMA 1M1KC 3MHXA 4Y28E 5GANd 1I5LA 2BKDN 4UC4A 4J5YA 2V8KA 2PU9B 5GANe 3G6ET 1ZBXA 3KBGA 4OB1B 2K2VA 3JCMc 5IT9E 4XU3A 1N6AA 2HQXA 2HQEA 1BIBA 5LJ3d 2QEXA 1VQKT 3FB9A 4O5VA 3CEYA 2RD1A 3DB4A 1G3WA 5LJ3e 3ZFJA 2XGJA 3CPWS 4ZGDB 2RHYA 4IKFA 4OB2B 2XG8D 4M78D 5LL6S 3L2UA 3LYIA 5GAOr 3ER0A 3C95A 3PMTA 4M75F 1Y71A 2E5QA 1U8RA 4M75D 2K5FA 2OAUA 3I56T 2CYZB 2L5QA 4KULA 1QVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGJ A;  4A4K A; 
#chains in the Genus database with same CATH topology
 3CPW P;  4J9F A;  4HVU A;  3NTI A;  3H8Z A;  4M7D A;  3JB9 F;  1I07 A;  1VQ9 T;  1VQP T;  5FU6 C;  2HKN A;  2E3H A;  4II1 A;  3OS1 A;  1VIE A;  2OTJ A;  2GTO A;  4EMK C;  2SRC A;  4HA8 A;  1U06 A;  7AT1 B;  3CMA A;  2L8D A;  3HFO A;  3T9N A;  4PFZ A;  3NTH A;  2RPN A;  1Y57 A;  4A63 B;  1M27 C;  3L2Z A;  2AK5 A;  2DEQ A;  1OI1 A;  1S72 Q;  2J06 A;  2PVO B;  1BBZ A;  1X43 A;  3OW2 P;  4E7L A;  3ASK A;  4P5N A;  2BZX A;  4F17 A;  2DLP A;  2EQM A;  3VS2 A;  5GAN j;  4DEX A;  2FHD A;  2NUT A;  2RJF A;  3MP6 A;  2QAZ A;  1G5V A;  2QQA A;  2DRM A;  4DBF A;  3G71 A;  4C0Z A;  1N8R U;  2L0A A;  1NZ9 A;  2HSP A;  2LX7 A;  2QAS A;  2VYT A;  1OUL A;  3P8B B;  1PCX A;  2YUN A;  3QDR B;  3INZ A;  1YJW A;  2RI3 A;  2JMA A;  4L5G A;  3OYM A;  1M2O A;  2DTO A;  2G6F X;  1PD0 A;  3M57 A;  4M7D F;  2WSC E;  1ZHI A;  3BY7 A;  2OTL A;  4OB0 B;  3JRZ A;  2BUD A;  4C0D B;  1HXD A;  1W6X A;  1W4S A;  3EG0 A;  2MPX C;  1FXX A;  2EQU A;  3PIO A;  3WVE B;  4RTT A;  3FDR A;  1X6G A;  4ZNX A;  2VWF A;  2Y4Y A;  5I2M A;  2QXF A;  1JB0 E;  3BW1 A;  2YWW A;  1WXT A;  3GNG A;  3AT1 B;  5L8R E;  4BDY A;  1X75 C;  4JZ4 A;  5GAM f;  1UJ0 A;  4OF1 A;  4E47 A;  2M1H A;  2RHX A;  2XMF A;  3QG1 A;  3I55 Q;  1EZZ B;  1YJN A;  4RTZ A;  1QW1 A;  2QQS A;  4C8Q E;  2EKH A;  1K9M C;  2D8J A;  5J39 A;  3UAT A;  3QJY A;  4FIB A;  4PFP A;  3CCM Q;  3CCR A;  3MO8 A;  4OMP A;  2K3X A;  5GAN 8;  2VUB A;  1AT1 B;  4FYY B;  2DFU A;  4A54 A;  1Q86 R;  3CMA T;  2MWO A;  3L42 A;  3V7C A;  1Q81 C;  2E70 A;  4C0D C;  3CCU A;  3UWN A;  1KHI A;  3OSV A;  1P92 A;  2K5I A;  1WXB A;  2OJ2 A;  2DVE A;  1K73 C;  3OMG A;  1O75 A;  2CP3 A;  2CH4 W;  2HZY A;  5GMK m;  3G71 T;  1NLO C;  3UF4 A;  5FWC A;  3OYD A;  4FU6 A;  3PIP A;  4KBM B;  3FC3 A;  2KXD A;  1YJW T;  2PIH A;  3M54 A;  3MEU A;  2H3J A;  1AD5 A;  2CT4 A;  4FYV B;  1Y7X A;  2G3R A;  4M7A B;  3CPF A;  4MDW A;  2D0Q B;  2QQR A;  1ZSZ A;  3M0Q A;  4CC7 A;  4RTV A;  3FLG A;  1YI2 Q;  3HSB A;  2OEE A;  4FW1 A;  3G1J A;  5CQX A;  2LP5 A;  4PKC C;  4A4H A;  4A4F A;  3JCM e;  2LQ8 A;  5GAN f;  2FYK A;  2XHC A;  3OYH A;  4PK4 A;  1IHW A;  4Q5W A;  1IB8 A;  2O4X A;  1M1K R;  2XI9 A;  1AWX A;  2A08 A;  2LC4 A;  2XKO C;  4E7J A;  1M3C A;  4QQG A;  4C92 B;  3TQ7 P;  1X2Q A;  3QZ5 B;  3UA6 A;  2ZPF B;  1YCY A;  2M0Y A;  1YHQ A;  3M4Y A;  1SHF A;  4DEY A;  1YJ9 Q;  2DXU A;  3CCR T;  4LD6 A;  4LUD A;  2X4W A;  3VKI A;  3JB9 G;  4C0G A;  2IPO B;  4XU1 A;  1OX9 A;  4Z02 A;  1WLP B;  3V8L A;  5KYX A;  2RK2 A;  4FSX A;  4M7A C;  3VV0 A;  3OYA A;  4Y92 A;  1PRM C;  5GAM h;  1JQQ A;  2LCS A;  4C8Q A;  5FWB A;  3CCU T;  3CPW A;  4JUV A;  4GLK A;  4KH0 B;  3M9Q A;  4M78 B;  4NL2 A;  2ZZD A;  2X51 A;  3RER A;  1D0Z A;  4PJJ A;  2GF7 A;  4ORZ A;  4JJN K;  4PL6 A;  4J6X A;  3CCJ T;  1X6B A;  2RQT A;  2EWN A;  4JS5 A;  2JTE A;  3UT1 A;  1TTH B;  2MWP A;  5ECA A;  3S3O A;  2MI6 A;  2EJG A;  2W10 A;  4B9W A;  3I56 A;  1B34 B;  4DOW A;  2DL5 A;  1W2B P;  1FMK A;  4DQ2 A;  1BI2 A;  3OW2 A;  1C6V X;  2X4Y A;  2KRO A;  2VGN A;  2KT8 A;  4LNP A;  4J9H A;  4AFU C;  3S6W A;  1T0H A;  2DEU A;  1MHN A;  1MGQ A;  2DXC A;  5GAO p;  2KGT A;  3CCJ Q;  4O6J A;  4K11 A;  4BE1 A;  2KRS A;  1M8M A;  4MZP A;  1HJD A;  4KGV B;  4M7D G;  1H92 A;  1VQL A;  3TU4 K;  3EFO B;  2FPF A;  1SSF A;  4J6Y A;  2RJC A;  1AOJ A;  2FPE A;  4M75 E;  1NM7 A;  1IRE B;  3JB9 J;  1UTI A;  2C0I A;  2YLC A;  2A37 A;  1OV3 A;  4MMK A;  4MZT A;  3RBB B;  2JW4 A;  2CP2 A;  4ELZ C;  3A8H B;  1TUC A;  1KHC A;  2D6F A;  3EAE A;  4ATO A;  3ULR B;  5IHK A;  3CD6 A;  3FIF A;  2EGC A;  3MET A;  1WGS A;  3J81 E;  1BI0 A;  2FL7 A;  2K5L A;  5L23 A;  3JCM Q;  2F1L A;  2PVG B;  3MEV A;  5GAN h;  2A3L A;  1IRX A;  1K9M R;  1UHC A;  1NYG A;  2LDM A;  2RJE A;  3CCQ A;  4XK8 E;  3X24 B;  5CVI A;  2EQK A;  2K3Y A;  2DL8 A;  1MMA A;  2AIR B;  2V26 A;  2PZ1 A;  3CCV A;  2F69 A;  2KK4 A;  1YBY A;  1ZUY A;  4FL6 A;  1YIJ A;  1K4U S;  3C94 A;  5GAN 6;  3O8V A;  3QPH A;  5FLX E;  2QEX T;  2FZK B;  3KFV A;  3OS5 A;  1TG0 A;  3BFM A;  2QTV A;  2NUP A;  1Q81 R;  2EPD A;  2EW3 A;  1TXQ A;  5IT9 E;  4XU3 A;  1N6A A;  3EGU A;  1BIB A;  2GTJ A;  2QA4 Q;  2YT6 A;  2LJ0 A;  4O5V A;  3CEY A;  1G3W A;  3PVQ A;  3CPW S;  4ZGD B;  4D8K A;  3MKD A;  4RTX A;  3PMT A;  3C95 A;  4OMN A;  1JXM A;  1Y71 A;  1UGV A;  2OAU A;  3I56 T;  2L5Q A;  5GAM d;  2QEX Q;  2QGG A;  3RUX A;  3M0R A;  3EGD A;  4BY6 C;  3PGG A;  3SDZ A;  1RAA B;  4DBH A;  2M02 A;  4IUR A;  2OX7 A;  1UUE A;  1S72 A;  3SD4 A;  3VRZ A;  1NJI U;  1VQL T;  4A4E A;  4AFZ C;  2QI2 A;  2YLB A;  4XAX B;  3OW2 S;  2QTX A;  3QYG B;  1GCP A;  3KUF A;  1RAG B;  1VYT A;  2DK3 A;  4L6V 5;  5I22 A;  1WHK A;  4AG2 C;  1BK2 A;  4LN2 A;  4AG1 C;  1KC8 U;  4J9C A;  3C0C A;  3QBY A;  1K0S A;  1JO8 A;  1PG5 B;  1Q82 C;  3MPU B;  1I0C A;  2YXY A;  2KYM A;  2FVU A;  3LW5 E;  4J7I A;  4BI8 B;  1AVZ C;  2HCK A;  2HAX A;  2LX9 A;  3RDV A;  4EIK A;  2J05 A;  4D8D A;  3CD6 T;  4WF2 A;  4M75 A;  1YWO A;  3L1A A;  5KH6 A;  3EH1 A;  3V7S A;  1QCN A;  4KUI A;  5LJ5 d;  4B9X A;  3CCS Q;  1B07 A;  5GAO l;  1ZX6 A;  4LDX A;  2HDA A;  2YRC A;  1NBE B;  2L3S A;  3CCQ T;  3RMS A;  2E41 A;  4WCI A;  4PJO B;  4L59 A;  1PNJ A;  3CCV T;  3I9Q A;  2KR3 A;  5KYU B;  3QSU A;  4PJO D;  3JCM P;  4ZTF A;  1UGP B;  1VQM Q;  1YIJ T;  4B6M A;  2XDP A;  1UEC A;  2GQV A;  4NOY A;  3GLX A;  2RHZ A;  2Y90 A;  1E6G A;  4JRI A;  1Y96 A;  2LJ1 A;  2OI3 A;  2P84 A;  3I55 A;  4R56 A;  2MAM A;  1MV0 B;  1Q95 G;  4IUU A;  1UHF A;  2RQR A;  1BB9 A;  1UEB A;  2COZ A;  1Q86 U;  1EX4 A;  5KYY A;  3CCM A;  3TCJ A;  2LNH B;  1KQ2 A;  4F16 A;  2HMA A;  3EGX B;  4LUE A;  2HL5 C;  1N8R C;  3AHU A;  2LCC A;  2XDD A;  1H3H A;  5M9O A;  1N5Z A;  2NLU A;  2KMT A;  5LJ5 j;  1W1F A;  2AZV A;  1BI1 A;  1CKB A;  1ZUK A;  5DY9 A;  1GCQ A;  1S72 T;  2QQ9 A;  2YRD A;  4J9E A;  3OYC A;  4AFS C;  3N5B B;  1KQ1 A;  1WZO A;  3RKW A;  3HHT B;  2JNG A;  4PJO C;  4ANJ A;  2FO0 A;  3LLR A;  4C0F A;  2QQB A;  1W2B A;  2ZPI B;  1QVG P;  1C1A A;  1NPP A;  3JSC A;  2QDY B;  3X26 B;  1C0M A;  3I5S A;  1SEM A;  4PJN A;  1DJ7 B;  4TVR A;  4YTL A;  4C8Q G;  5CKD A;  3QDF A;  2OEQ A;  1Q7Y R;  5KYW B;  1OX8 A;  2RHI A;  4F7U E;  4JJB A;  1R0C B;  3VS4 A;  2DPP B;  2X4X A;  2L3P A;  3CBM A;  3UDC A;  1IHV A;  1QMC A;  1KFZ A;  2CP6 A;  2P4T A;  3P8D A;  1WIE A;  1KQS P;  2RB6 A;  2D8H A;  2KYB A;  3G4S Q;  5DLQ E;  1YI2 A;  3DLL A;  4XTU A;  4X1V A;  4ME7 A;  4E7I A;  5GAO q;  1KSW A;  1M1K U;  4HCB A;  2E1H A;  1D3B A;  2F2X A;  2L2P A;  1VQ8 T;  1H3Z A;  1UFF A;  2IIM A;  2VAS A;  3BE3 A;  1RAD B;  2CRE A;  1WPY A;  1RI9 A;  4QT7 A;  3OYY A;  1M4Z A;  5J3B A;  1WXU A;  5HCK A;  2PQW A;  3A8O B;  3I55 T;  3RIR A;  2KXC A;  2I0N A;  4R0K A;  3M56 A;  1X6O A;  1OOT A;  1R0B G;  3QZ9 B;  5FRO A;  1QWF A;  1YJ9 A;  3VS3 A;  3LGL A;  1SSH A;  4M7D B;  1PHT A;  1GBQ A;  3CCM T;  4D6W A;  1D1C A;  1NPR A;  1HK9 A;  3V7R A;  1FMV A;  1VQ8 Q;  1MMN A;  3CCE Q;  3WXM B;  3FJP A;  2DMO A;  3PMI A;  5GAM g;  2JS2 A;  3JCM b;  2E6N A;  2EFI A;  5FRN A;  4M77 B;  5HK0 A;  1IXD A;  1TOV A;  2JOY A;  2EIF A;  4BI4 A;  2XU8 A;  4M77 D;  3OS0 A;  1D1A A;  1F1B B;  1TUG B;  3CC7 Q;  2E12 A;  3E2U A;  1WHJ A;  2PUO B;  3HRS A;  1LPL A;  3QWX X;  2DAQ A;  5HK3 A;  2K2M A;  4OGE A;  2QYZ A;  1RAC B;  1NEG A;  1V1C A;  4EPC A;  3GIB A;  3VS0 A;  1SHG A;  2NUT B;  5KE2 A;  4CC3 A;  4J9G A;  3LX7 A;  3UPU A;  1U5S A;  3QKJ A;  4R55 A;  4HCC A;  2NUZ A;  4HXJ A;  4C5E A;  2JUF A;  2IAZ A;  3HRU A;  1VA7 A;  2PNI A;  2AHJ B;  1W2B S;  1Q82 R;  5A2Q E;  1IO6 A;  1WJQ A;  1M3A A;  3G6E Q;  4C5I A;  2BTT A;  3VU3 C;  3CCJ A;  1SG5 A;  5LJ5 g;  2PVD B;  8AT1 B;  1VQK Q;  3C4S A;  5LJ5 f;  5D6W A;  1YI2 T;  1EIF A;  3JAM E;  1WHL A;  2KBT A;  1UG1 A;  1WJR A;  2EKO A;  4M77 C;  4F7U A;  6AT1 B;  5GMK e;  1M2V A;  1M90 U;  2FRY A;  3LH5 A;  4BD3 A;  2E65 A;  4RMO A;  1KD1 U;  4LDV A;  1ZBJ A;  3JCM f;  4J7F A;  1YCS B;  4N4G A;  4CRI A;  2CS7 A;  1LOJ A;  3I5R A;  5CO7 A;  1M5Q 1;  2EAY A;  4M7A D;  2RH2 A;  1JXO A;  2RQV A;  3OYK A;  3CQT A;  4Z89 A;  1YIT T;  2DYB A;  4JJD A;  2QGF B;  2X3W D;  5GAN g;  1YJ9 T;  2DXB A;  3SB2 A;  1N27 A;  1K8A C;  2IG0 A;  2EYY A;  3JV3 A;  4EMH A;  5GAN 5;  1WHM A;  3DKM A;  3OY9 A;  1VQO Q;  4IUV A;  2K57 A;  4OVA A;  1N8R R;  4C92 D;  4M75 G;  1YIT Q;  1GFC A;  4ZGJ B;  1RI0 A;  3EG9 A;  1RLP C;  1GXI E;  2F5K A;  2P0K A;  1W70 A;  2EJ9 A;  4F7U F;  4QVC A;  1QKW A;  2O88 A;  3H0H A;  1IGQ A;  1ABO A;  2LNV A;  5GMK i;  1XTD A;  3M55 A;  4CC4 B;  2SEM A;  4LDW A;  2QA4 A;  4OMQ A;  3NGP A;  4Y28 E;  3H0F A;  2KRN A;  5GAN e;  1ZBX A;  2EBP A;  1YWP A;  2K2V A;  4OB1 B;  3JCM c;  3CXC P;  3H9N A;  1ZA1 B;  5LJ3 d;  2QEX A;  2HQH A;  3DB4 A;  2RMO A;  2VVK A;  4RUG A;  4OB2 B;  2XG8 D;  4M78 D;  5LL6 S;  3L2U A;  3LYI A;  5GAO r;  2E5Q A;  1U8R A;  2K5F A;  1ZSZ B;  1QVG A;  3M58 A;  3RMQ A;  1QCF A;  3PVL A;  3NFC A;  3QII A;  4KGZ B;  2EGA A;  2GGR A;  2FEI A;  2F2W A;  2K7A A;  4IIO A;  2K3B A;  4C92 C;  2HSE B;  2DTI A;  3TSZ A;  4HKE A;  2V1Q A;  2A36 A;  1N9S A;  8ATC B;  4J9B A;  2DO3 A;  4FT2 A;  2V8I A;  3RKY A;  2A7Y A;  2FB7 A;  1KQS A;  2O4X B;  1YNZ A;  3R6N A;  4E2F B;  9ATC B;  2W0Z A;  1VQ7 Q;  3VUZ A;  2ENM A;  1D1B A;  4XTV A;  5LJ5 h;  1KIK A;  2K6D A;  2E6Z A;  3NHN A;  4ZGE B;  4J83 A;  1VYU A;  3QWY A;  1X2K A;  5GAN 4;  1Y0M A;  2VXF A;  3CCS A;  4LD9 K;  3A8L B;  4N4I A;  5D6X A;  4N0A A;  3JCM h;  5LJ3 j;  2J6O A;  3SWN A;  4A4K A;  3VS1 A;  2CT3 A;  4M78 C;  4AFQ C;  3VRY A;  1TSF A;  4JRK A;  4FW2 A;  3O5Z A;  4BE0 A;  1CKA A;  5KYX B;  2DM1 A;  4PLL A;  2ZGW A;  2JZ2 A;  2YDL A;  1AWJ A;  1RLQ C;  3L2V A;  1BYM A;  2M16 A;  4BUG A;  4C8Q B;  1PKS A;  1SF9 A;  1G2B A;  2FRW A;  1VQM A;  2MF2 A;  4NS5 A;  4E7Z A;  2EYX A;  4KRT A;  4BB7 A;  5HKC A;  2M0O A;  4BAC A;  2XD0 A;  2CKK A;  2CGH A;  1G83 A;  1M1G A;  4JRQ A;  3E19 A;  5CK9 A;  1M1F A;  1G3Y A;  1VYV A;  1NJI C;  3F70 A;  5CCA A;  2QA4 T;  1RAF B;  3RNJ A;  2DE0 X;  4IIM A;  2L89 A;  1U1S A;  3VS6 A;  1KC8 C;  2KSS A;  3OYF A;  1N9R A;  3S3N A;  3JCM W;  4XU2 A;  2GQI A;  3MP1 A;  3CC2 Q;  1IZ6 A;  2WAC A;  1VQN A;  4JRP A;  2FZC B;  1PSF A;  2DTH A;  2E4H A;  1ZUU A;  1AHJ B;  2LCL A;  4XTX A;  5IHN A;  2X4J A;  3M0S A;  2V8J A;  4E7K A;  1K73 R;  1LVK A;  2EGE A;  2VXE A;  4JZ3 A;  4FCY A;  5KCH A;  5HY6 A;  2DD4 A;  4EDU A;  2FPD A;  4C8Q C;  2JTM A;  2LZ6 B;  2BE9 B;  1UGQ B;  4PNO A;  1Q7Y U;  3NPF A;  3GOX A;  1RAH B;  3TRE A;  4M4Z A;  1QVG S;  4PJO A;  5IXF A;  1PRL C;  2EYW A;  2RJD A;  1CSK A;  2M51 A;  4EMK A;  5GJV B;  1RUW A;  1TS9 A;  3JCM V;  4ZN3 A;  1M3B A;  3VUB A;  1FMW A;  3CCL Q;  1UGR B;  2ATC B;  1M30 A;  4C5H A;  2O2O A;  1A0N B;  2RN8 A;  4M77 E;  2CUB A;  3J7A F;  2KE9 A;  1WI7 A;  2KVQ G;  4JJC A;  2RI5 A;  1V29 B;  2CSQ A;  3CCS T;  5CIU A;  3HPW A;  4X34 A;  1I1J A;  2EJF A;  2R57 A;  3G4S A;  2NYS A;  4JLG A;  2A28 A;  2E5K A;  4A53 A;  3VYH B;  4NL3 A;  2KQW A;  5CKB A;  2JVV A;  4EMG A;  5I11 A;  1B7T A;  4CC2 A;  3EGX A;  1K8A R;  1U3O A;  2FZG B;  5KYN A;  1VQ5 T;  2GFA A;  5EG2 A;  1VQ6 Q;  1VQM T;  4OGC A;  1AZE A;  4RTY A;  3HL8 A;  2BZY A;  1TH7 A;  2RQW A;  3TVT A;  1NLP C;  2NUP B;  3OSS C;  1NG2 A;  4DBQ A;  4F7U G;  1KK7 A;  2H8H A;  4ZTJ A;  1OPL A;  2XID A;  3MEW A;  4X9C A;  3JCM d;  4PJO F;  2ESW A;  4RG2 A;  2YHT A;  1XNI A;  3M0P A;  1VQ5 Q;  1KG1 A;  1VQ8 A;  4XTZ A;  3CCE A;  2EYZ A;  3EFR A;  4LXC A;  3URG A;  1YN8 A;  4KT0 E;  2JM8 A;  2DIL A;  1AZG B;  4Y91 A;  5LJ3 f;  2HL3 A;  3EHR A;  2F5T X;  3EGD B;  3KXT A;  2YSQ A;  4ZN1 A;  1VQN T;  2CP5 A;  3G7Z A;  3NMZ C;  1H8K A;  2BZ8 A;  3CC4 Q;  1LCK A;  1QVF P;  3CC7 A;  5GMK j;  1QQJ A;  1J3T A;  2AZS A;  3A8G B;  4C5G A;  4M7A E;  2Y4X A;  4FYW B;  2DYI A;  2F2V A;  3PNW C;  3CXC A;  5A0L A;  4FT4 A;  1G8X A;  3H6Z A;  4ESR A;  2AT1 B;  3REB B;  4OML A;  2DJQ A;  2VKN A;  1UDL A;  1VQN Q;  1ZSG A;  3CME Q;  1Q82 U;  1WX6 A;  2ZCF B;  2RHU A;  1NEB A;  4E7S A;  1K0X A;  3PT9 A;  4E7H A;  4OMM A;  4E6R A;  2ED1 A;  1D0X A;  2LVM A;  4M75 B;  2M9U A;  3G6E A;  5A0G A;  1EFN A;  1IGU A;  4C92 E;  3MP8 A;  3HRT A;  1VQK A;  3G4S T;  3SEM A;  1NYF A;  3JB9 I;  4FM4 B;  2DBM A;  3CBP A;  3JB9 D;  4RCB A;  4ELY C;  1PWT A;  5I2S A;  3VYG A;  2MMP A;  4DA4 A;  3M5A A;  2KAF A;  1OU9 A;  2ZPG B;  4HT8 A;  4M77 A;  2VV5 A;  3QJ6 A;  4X9D A;  3GPL A;  3EG3 A;  2DER A;  1R8O B;  1WQW A;  2LT1 A;  1Y96 B;  2RO0 A;  1D09 B;  1G3T A;  5GAO m;  2LRQ A;  1M8V A;  2YUQ A;  4M78 E;  3M59 A;  3JCM J;  1VQP Q;  1VQ9 Q;  1G3S A;  5D7U A;  2X3X D;  1PSE A;  1E6H A;  5KYY B;  5GMK l;  2O01 E;  3HKS A;  1NJI R;  3CCE T;  4Z88 A;  2HKQ B;  1HD3 A;  3OYL A;  4HCZ A;  1B3Q A;  2R58 A;  3BDU A;  1JJ2 P;  1U1T A;  1VQO A;  4M75 C;  5D6Y A;  3JB9 H;  2RM4 A;  1FX7 A;  3H0I A;  3OYI A;  2DNU A;  5FRM A;  1WYX A;  2CP7 A;  1KC8 R;  1OU8 A;  3J80 E;  5CKF A;  3CC7 T;  2K9G A;  4RTW A;  2GCX A;  1YIT A;  2DJZ A;  3VS7 A;  5GAN 2;  2RF0 A;  3ZL7 C;  5DLO A;  1JU5 C;  3IQL A;  5AYF A;  4JLI A;  5KE3 A;  2JJ9 A;  2CZ6 B;  2HNI A;  2C06 A;  4M7D D;  3SFM A;  2CZ0 B;  1QP2 A;  1GRI A;  1VQ4 T;  1M90 C;  1JBM A;  2JT4 A;  5LJ3 h;  3OYN A;  1KD1 C;  4M77 F;  1WQ7 A;  2E10 A;  2I2L A;  1OZ3 A;  3LWI A;  3CXC S;  2VGM A;  2ROT A;  4M7A A;  2ABL A;  1GBR A;  3M53 A;  2XDB A;  2J6F A;  5IN1 A;  3MJX A;  2COW A;  4AT1 B;  1JEG A;  3THK A;  1ABQ A;  2BKD N;  1I5L A;  2JXB A;  2V8K A;  2PU9 B;  3G6E T;  4FYX B;  1VQ4 Q;  2HQX A;  2HQE A;  1VQK T;  2RD1 A;  1VOM A;  1D0Y A;  2RHY A;  4F04 B;  3GBQ A;  3EG1 A;  4KUL A;  3VS5 A;  2OTJ T;  2KI7 A;  1ZA2 B;  3V8J A;  1D3B B;  1GCQ C;  5GAM e;  2DBK A;  2CSI A;  4M7D C;  1K76 A;  5GJW B;  2D1X A;  2OAW A;  4C92 A;  3M0T A;  2K4Y A;  2MK5 A;  2EYQ A;  2X9H A;  1VQ7 A;  2DKG A;  1QP3 A;  2VC8 A;  1PD1 A;  3ME9 A;  4IUT A;  1GFD A;  4WTO B;  1PM3 A;  5C0M A;  2YUO A;  4KUD K;  2MIO A;  2DF6 A;  2E3I A;  1LJO A;  2YRV A;  3JCM g;  1TU0 B;  2OTJ Q;  2PUK B;  4XU0 A;  2XIC A;  4JS4 A;  1TWB A;  4QVD A;  5GAN 3;  1HYO A;  4PJO G;  3CMA Q;  3D7S B;  3E1S A;  1QLY A;  1M9S A;  5J26 A;  2V1R A;  1T3L A;  2DRK A;  3TEE A;  3OYB A;  1VQO T;  4M7A F;  3GNF B;  4GY5 A;  2RQU A;  1QWE A;  2RNA A;  4M78 A;  5CKH A;  3EHQ A;  4LDY A;  4QW2 A;  1AWW A;  1K9M U;  4XQ3 A;  4J9D A;  1WFW A;  2DZ9 A;  2OTL T;  1YFN A;  5LJ5 e;  2MYS A;  3G71 Q;  4LDU A;  4A4G A;  4RCC A;  1Z9Q A;  1B34 A;  2DZC A;  1YJW Q;  2KDS A;  1I8F A;  4C92 F;  1X27 A;  1Q81 U;  1QVF A;  2KNB B;  3X28 B;  2ED0 A;  4BE2 A;  3H41 A;  2DXT A;  4VUB A;  2P0Q A;  2VB6 A;  2EQJ A;  1MNE A;  2L3R A;  2OTL Q;  1QVP A;  3CC2 A;  4KGX B;  3FRN A;  1UJY A;  5GAN 7;  1K73 U;  2LJ3 A;  3EFO A;  1YJN T;  1K9A A;  1WHG A;  3QUI A;  1OZ2 A;  2YUP A;  3PFS A;  2WSF E;  2QK0 A;  1GL5 A;  3GP8 A;  3OYJ A;  3RR6 A;  2C0O A;  3X20 B;  2COY A;  4F7U B;  3EG2 A;  2CP0 A;  1I81 A;  1M2V B;  3OS2 A;  4J6W A;  5GAO n;  3OBY A;  2A0F B;  2ZPE B;  4M78 F;  1OEB A;  4IUP A;  2KT1 A;  2B86 A;  1BIA A;  4QVZ A;  4PJO E;  4PFO A;  1AEY A;  2O9S A;  2ZPB B;  1YJN Q;  1R77 A;  1RL2 A;  3HFN A;  1VQ7 T;  2XK0 A;  2LQW A;  3A1P A;  2P4R A;  1ARK A;  1KJW A;  1ZLM A;  3CCL A;  1OQK A;  2CDT A;  3DLM A;  1SRM A;  3CCR Q;  3OYE A;  3U23 A;  1WHH A;  1YP5 A;  1PKT A;  5KCO A;  5GMK h;  1H64 1;  3VJP A;  1SPK A;  3OQ5 A;  3L2R A;  1O9S A;  3E9F A;  4OB3 B;  1K8A U;  4HVV A;  3FEO A;  4GBQ A;  5IAY A;  4N4H A;  5C6S A;  4XTY A;  3CCU Q;  2E64 A;  3A8M B;  4QQD A;  2D0N A;  4OMO A;  3DB3 A;  3RKX A;  3A98 A;  5CAI A;  3MEA A;  1VQ6 A;  3E9G A;  1NE8 A;  2RI2 A;  5FW9 A;  3ZBD A;  1VUB A;  2CZ7 B;  3EG9 B;  4QQ6 A;  3X25 B;  4DOV A;  1HSQ A;  1XQH A;  4HT9 A;  2LQK A;  3EH2 A;  1JRI A;  2ZPH B;  2P0P A;  1ZQ1 A;  1MMG A;  1X69 A;  1JJ2 A;  1MMD A;  3QYH B;  4RKU E;  3HTR A;  4XTW A;  3OMC A;  2LMJ A;  4PJM A;  1ZSZ C;  5CR2 A;  1Q7Y C;  2NWM A;  1VQ5 A;  4C8Q F;  1I4K 1;  4J8O A;  2JTF A;  4M77 G;  4C8Q D;  2LT4 A;  1M90 R;  1KD1 R;  2JS0 A;  1FWZ A;  2JM9 A;  4OMF B;  3LH0 A;  4V2S A;  1BU1 A;  3CC2 T;  4Z8A A;  3L2Q A;  3V8K A;  3CC4 A;  1WJS A;  2DIG A;  1Z9Z A;  1QVF S;  2DA9 A;  1YHQ T;  2J7I A;  3EFS A;  4BY6 B;  2ECZ A;  2PTK A;  1MV3 A;  2JMC A;  5DM7 R;  3QHS A;  3I35 A;  1T3S A;  2QG9 B;  5AT1 B;  3M4G A;  3OBW A;  3JCM X;  3MCA B;  1ACM B;  2WSE E;  5IH2 A;  3CME A;  2ZAE A;  4HCK A;  3PE0 A;  3L2W A;  3CCL T;  3UA7 A;  2FG0 A;  1YHQ Q;  2LTO A;  2H3E B;  2BE7 D;  5EC7 A;  1Y07 A;  2RA2 A;  4BDZ A;  2GFU A;  4DBR A;  3FJ5 A;  4GLM A;  4HVW A;  2KRM A;  3A5Z B;  3SHW A;  3SWN B;  1LNX A;  2LQN A;  3RES A;  2QDL A;  4IUQ A;  3S3M A;  5KYU A;  2DIQ A;  4M7D E;  1K1Z A;  2Z0W A;  1UGS B;  4BI3 A;  2C0T A;  3ZEH A;  2DL4 A;  2R5M A;  4M7A G;  3LWH A;  1S1N A;  1XJW B;  1VQ6 T;  4MML A;  3R6O A;  1RAB B;  5IXB A;  3Q1J A;  3NTK A;  2CZ1 B;  5CQY A;  2DL3 A;  3REA B;  2HD0 A;  1KQS S;  2J6K A;  4AMC A;  1UB4 A;  4FSS A;  3QXE B;  2ROL A;  1Q86 C;  1VQP A;  1VQ9 A;  1OPK A;  3OB9 A;  5I21 A;  1RAE B;  3I56 Q;  3BDL A;  1V76 A;  5FU7 B;  3CBO A;  2MCN A;  2D9T A;  4C92 G;  3WVD B;  1T0J A;  1FYN A;  4PLI A;  1XOV A;  2O31 A;  1RAI B;  4PJL A;  4CI0 C;  1JJ2 S;  2GNC A;  5IHI A;  1BI3 A;  2BIV A;  2K79 A;  3CC4 T;  5CKE A;  2HEQ A;  1VQL Q;  4N0A C;  3PTA A;  2KY9 A;  3SWN C;  1QCO A;  1I5O B;  2GBQ A;  1BCO A;  1QKX A;  4LE9 A;  2EQI A;  4MZM A;  2HBP A;  1X01 A;  2X35 A;  2O9V A;  2MOX A;  5GAM j;  5LJ3 g;  1WDX A;  3LGF A;  5KYW A;  3P8H A;  3TSW A;  1SRL A;  2DVJ A;  2AKK A;  4MDX A;  2IVW A;  1SKU B;  5FU6 B;  1BKB A;  3M0U A;  3CME T;  4M78 G;  5A0D A;  4F14 A;  3GF5 A;  2R5A A;  4EMK B;  4RTU A;  3HP9 A;  3CD6 Q;  4JDS A;  2RK1 A;  2B8A A;  1E7O A;  1AWO A;  1WNL A;  3QO3 A;  4RG8 A;  4JPB W;  2CUD A;  3C12 A;  4OP0 A;  1VIF A;  1WA7 A;  5FU7 C;  2AKL A;  1VQ4 A;  3CCQ Q;  1BCM A;  2DD5 A;  2JN0 A;  1OYX A;  1PC0 A;  4QKU A;  3OYG A;  1TUD A;  1M1K C;  3MHX A;  5GAN d;  3CCV Q;  2DET A;  4UC4 A;  4J9I A;  4J5Y A;  2KEA A;  3KBG A;  2DL7 A;  1MUZ A;  4KH1 B;  1MND A;  1YIJ Q;  2EVR A;  3FB9 A;  1UE9 A;  2CH4 A;  5LJ3 e;  3ZFJ A;  2XGJ A;  2L3Q A;  2DX1 A;  4IKF A;  3ER0 A;  4M75 F;  4M75 D;  2HBW A;  2CYZ B;  3OA6 A; 
#chains in the Genus database with same CATH homology
 2OTJ T;  5GAM d;  3M58 A;  3RMQ A;  3V8J A;  1D3B B;  3RUX A;  3NFC A;  5GAM e;  3NTI A;  3QII A;  3H8Z A;  4M7D A;  3JB9 F;  4BY6 C;  4M7D C;  3PGG A;  3SDZ A;  4C92 A;  1VQ9 T;  1VQP T;  5FU6 C;  2K4Y A;  4C92 C;  2EYQ A;  2DTI A;  4II1 A;  3OS1 A;  1VIE A;  2OTJ A;  1VQ7 A;  4EMK C;  4HKE A;  4IUR A;  2DKG A;  1QP3 A;  1S72 A;  4HA8 A;  2VC8 A;  1N9S A;  3SD4 A;  3CMA A;  3ME9 A;  2L8D A;  4IUT A;  1NJI U;  1VQL T;  3HFO A;  4M7D F;  4A4E A;  5C0M A;  2DO3 A;  4KUD K;  3T9N A;  2QI2 A;  4FT2 A;  2V8I A;  2YLB A;  2A7Y A;  2FB7 A;  3NTH A;  2QTX A;  3QYG B;  3KUF A;  4XAX B;  3OW2 S;  1KQS A;  2O4X B;  1LJO A;  2YRV A;  3JCM g;  2DK3 A;  4L6V 5;  3L2Z A;  2PUK B;  4XU0 A;  2DEQ A;  3VUZ A;  2XIC A;  4JS4 A;  1OI1 A;  2PVO B;  4QVD A;  5GAN 3;  1KC8 U;  4PJO G;  4XTV A;  5LJ5 h;  4E7L A;  3E1S A;  3ASK A;  1M9S A;  3QBY A;  5J26 A;  4P5N A;  2E6Z A;  1Q82 C;  4ZGE B;  2EQM A;  3TEE A;  3OYB A;  5GAN j;  1VQO T;  4J83 A;  4M7A F;  3GNF B;  4GY5 A;  5GAN 4;  3OA6 A;  2FVU A;  2FHD A;  2VXF A;  3CCS A;  2RJF A;  3MP6 A;  4LD9 K;  3LW5 E;  3A8L B;  4J7I A;  4BI8 B;  2HAX A;  4N4I A;  5D6X A;  1G5V A;  2LX9 A;  2QQA A;  4N0A A;  3JCM h;  5LJ3 j;  4M78 A;  3SWN A;  5CKH A;  4A4K A;  3G71 A;  4M78 C;  4LDY A;  4QW2 A;  4C0Z A;  1N8R U;  4WF2 A;  4JRK A;  3CD6 T;  1NZ9 A;  4M75 A;  1K9M U;  4XQ3 A;  2VYT A;  4BE0 A;  4PLL A;  2ZGW A;  3L1A A;  2JZ2 A;  2DZ9 A;  5KH6 A;  3P8B B;  3V7S A;  4KUI A;  5LJ5 d;  3QDR B;  3INZ A;  4B9X A;  3L2V A;  1YJW A;  1BYM A;  2OTL T;  2M16 A;  2RI3 A;  4BUG A;  4C8Q B;  5LJ5 e;  5GAO l;  4L5G A;  3OYM A;  4LDX A;  4LDU A;  4A4G A;  1VQM A;  2MF2 A;  3CCQ T;  4NS5 A;  2DTO A;  4RCC A;  3RMS A;  2E41 A;  4BB7 A;  5HKC A;  3M57 A;  2M0O A;  4BAC A;  4PJO B;  4L59 A;  2WSC E;  1B34 A;  2DZC A;  1ZHI A;  2CKK A;  2CGH A;  3BY7 A;  2OTL A;  2XD0 A;  3CCV T;  1M1G A;  4JRQ A;  3E19 A;  2KDS A;  1I8F A;  4OB0 B;  4C92 F;  5CK9 A;  3QSU A;  4PJO D;  3JRZ A;  3JCM P;  2BUD A;  1M1F A;  1Q81 U;  1G3Y A;  1HXD A;  1UGP B;  4C0D B;  4ZTF A;  1QVF A;  1W4S A;  1NJI C;  3F70 A;  1YIJ T;  2XDP A;  5CCA A;  3X28 B;  2QA4 T;  2GQV A;  4NOY A;  3GLX A;  1FXX A;  2RHZ A;  2Y90 A;  4BE2 A;  2DXT A;  2EQU A;  4VUB A;  2P0Q A;  3PIO A;  2EQJ A;  2L3R A;  3WVE B;  2L89 A;  3FDR A;  1QVP A;  1U1S A;  4JRI A;  1Y96 A;  3CC2 A;  2Y4Y A;  3FRN A;  5I2M A;  3I55 A;  2QXF A;  1KC8 C;  2KSS A;  5GAN 7;  3OYF A;  1K73 U;  1JB0 E;  4R56 A;  1YJN T;  2MAM A;  3BW1 A;  1N9R A;  3QUI A;  1OZ2 A;  3PFS A;  2WSF E;  4IUU A;  3S3N A;  3GP8 A;  3GNG A;  5L8R E;  3OYJ A;  4BDY A;  1UEB A;  3JCM W;  1Q86 U;  1X75 C;  3X20 B;  4XU2 A;  5GAM f;  3CCM A;  4OF1 A;  4E47 A;  3MP1 A;  2M1H A;  2RHX A;  1IZ6 A;  2WAC A;  3TCJ A;  4F7U B;  3QG1 A;  1VQN A;  4JRP A;  1KQ2 A;  1I81 A;  1YJN A;  3OS2 A;  1PSF A;  1QW1 A;  2QQS A;  4J6W A;  5GAO n;  2DTH A;  4C8Q E;  1N8R C;  3OBY A;  1K9M C;  3AHU A;  1AHJ B;  2LCL A;  4XTX A;  5J39 A;  2ZPE B;  3QJY A;  2LCC A;  2X4J A;  4FIB A;  2XDD A;  4M78 F;  2V8J A;  4IUP A;  5M9O A;  4E7K A;  3CCR A;  1BIA A;  3MO8 A;  4QVZ A;  2NLU A;  2VXE A;  4PJO E;  5GAN 8;  2K3X A;  2KMT A;  5KCH A;  5HY6 A;  5LJ5 j;  2DD4 A;  2ZPB B;  4EDU A;  1BI1 A;  2VUB A;  4C8Q C;  1RL2 A;  2JTM A;  3HFN A;  1VQ7 T;  2XK0 A;  1UGQ B;  4PNO A;  4A54 A;  1Q7Y U;  5DY9 A;  1S72 T;  3CCL A;  2QQ9 A;  3GOX A;  3OYC A;  3CMA T;  3TRE A;  3DLM A;  3N5B B;  1KQ1 A;  2MWO A;  3RKW A;  3HHT B;  1QVG S;  2JNG A;  3L42 A;  4PJO A;  4PJO C;  3LLR A;  4C0F A;  3OYE A;  3V7C A;  1Q81 C;  2QQB A;  2RJD A;  4EMK A;  5KCO A;  5GMK h;  2E70 A;  3JCM V;  1H64 1;  4C0D C;  3VJP A;  4ZN3 A;  3CCU A;  1W2B A;  2ZPI B;  3OQ5 A;  3UWN A;  3VUB A;  1NPP A;  3JSC A;  1KHI A;  2QDY B;  3L2R A;  3X26 B;  3OSV A;  1P92 A;  1UGR B;  1O9S A;  2K5I A;  3E9F A;  4OB3 B;  4C5H A;  1K8A U;  1DJ7 B;  4TVR A;  4YTL A;  4C8Q G;  3FEO A;  5CKD A;  2DVE A;  5IAY A;  4M77 E;  1K73 C;  2RHI A;  3J7A F;  2KVQ G;  4N4H A;  4F7U E;  5C6S A;  3OMG A;  1O75 A;  2RI5 A;  1V29 B;  4XTY A;  2E64 A;  3A8M B;  3CCS T;  5CIU A;  3HPW A;  4QQD A;  4X34 A;  3DB3 A;  3RKX A;  2EJF A;  2R57 A;  5CAI A;  2DPP B;  2X4X A;  3MEA A;  5GMK m;  3G4S A;  1VQ6 A;  3E9G A;  1NE8 A;  2RI2 A;  3CBM A;  4JLG A;  3UDC A;  4A53 A;  3CXC A;  3VYH B;  3G71 T;  3ZBD A;  4NL3 A;  3OYD A;  4FU6 A;  1VUB A;  3PIP A;  2CZ7 B;  2KQW A;  4QQ6 A;  5CKB A;  3X25 B;  2JVV A;  4KBM B;  4EMG A;  3FC3 A;  4DOV A;  2P4T A;  3P8D A;  2RB6 A;  1XQH A;  1YJW T;  3M54 A;  4HT9 A;  3MEU A;  2LQK A;  1JRI A;  2H3J A;  1VQ5 T;  2GFA A;  5DLQ E;  5EG2 A;  1YI2 A;  2ZPH B;  1VQM T;  2P0P A;  1ZQ1 A;  4OGC A;  1Y7X A;  1JJ2 A;  3QYH B;  3DLL A;  4XTU A;  2G3R A;  3HL8 A;  4RKU E;  1TH7 A;  4ME7 A;  4M7A B;  3CPF A;  4XTW A;  4MDW A;  2D0Q B;  3OMC A;  2QQR A;  4E7I A;  5GAO q;  5CR2 A;  1Q7Y C;  1M1K U;  1VQ5 A;  4HCB A;  2E1H A;  3OSS C;  1D3B A;  3FLG A;  4C8Q F;  1I4K 1;  4J8O A;  1VQ8 T;  1H3Z A;  2JTF A;  3HSB A;  4M77 G;  4C8Q D;  4F7U G;  2LT4 A;  4ZTJ A;  2XID A;  5CQX A;  3MEW A;  4X9C A;  1WPY A;  1FWZ A;  3JCM d;  4PKC C;  4PJO F;  3OYY A;  1M4Z A;  5J3B A;  4OMF B;  3LH0 A;  4A4H A;  4A4F A;  4V2S A;  3JCM e;  4RG2 A;  2YHT A;  1XNI A;  2LQ8 A;  2PQW A;  3A8O B;  3CC2 T;  1KG1 A;  3I55 T;  1VQ8 A;  4XTZ A;  3RIR A;  5GAN f;  3L2Q A;  3CCE A;  3V8K A;  3CC4 A;  2FYK A;  2XHC A;  3OYH A;  3EFR A;  1WJS A;  4M7A G;  3URG A;  3M56 A;  2DIG A;  4Q5W A;  1X6O A;  2O4X A;  4KT0 E;  1QVF S;  3QZ9 B;  5FRO A;  1YHQ T;  4Y91 A;  1YJ9 A;  5LJ3 f;  2XI9 A;  3KXT A;  2F5T X;  3EFS A;  3LGL A;  4BY6 B;  4M7D B;  3CCM T;  4D6W A;  1NPR A;  2LC4 A;  2XKO C;  1HK9 A;  4ZN1 A;  3V7R A;  4E7J A;  5DM7 R;  4QQG A;  4C92 B;  1VQN T;  3G7Z A;  3QHS A;  3QZ5 B;  3FJP A;  3WXM B;  2ZPF B;  3CC7 A;  1YCY A;  3PMI A;  5GAM g;  3JCM b;  2E6N A;  1YHQ A;  5GMK j;  3M4G A;  2EFI A;  3OBW A;  3A8G B;  3M4Y A;  4C5G A;  3JCM X;  5FRN A;  2DXU A;  3MCA B;  4M77 B;  5HK0 A;  4M7A E;  3CCR T;  2Y4X A;  2JOY A;  2EIF A;  2WSE E;  3PNW C;  2X4W A;  2XU8 A;  4LD6 A;  4M77 D;  4BI4 A;  5A0L A;  4FT4 A;  3OS0 A;  3VKI A;  3CME A;  3JB9 G;  3H6Z A;  4C0G A;  2E12 A;  4XU1 A;  4Z02 A;  3L2W A;  3V8L A;  3CCL T;  2LTO A;  2PUO B;  2RK2 A;  3HRS A;  4FSX A;  4M7A C;  3VV0 A;  3OYA A;  5HK3 A;  1Y07 A;  2DAQ A;  5GAM h;  4OGE A;  2RA2 A;  4BDZ A;  2GFU A;  4C8Q A;  1Q82 U;  2ZCF B;  2RHU A;  4EPC A;  3GIB A;  3CCU T;  3CPW A;  3PT9 A;  4JUV A;  4GLK A;  4E7H A;  3A5Z B;  5KE2 A;  3M9Q A;  4M78 B;  3SWN B;  1LNX A;  4NL2 A;  3RES A;  2LVM A;  2ZZD A;  4IUQ A;  3S3M A;  3LX7 A;  3UPU A;  4M75 B;  3RER A;  2DIQ A;  3QKJ A;  4R55 A;  4M7D E;  2M9U A;  3G6E A;  2GF7 A;  4HCC A;  5A0G A;  1UGS B;  4JJN K;  4BI3 A;  4C92 E;  4PL6 A;  3ZEH A;  4J6X A;  2R5M A;  3CCJ T;  4C5E A;  3MP8 A;  2JUF A;  3HRT A;  2EWN A;  4JS5 A;  3HRU A;  3LWH A;  3G4S T;  1VQK A;  3UT1 A;  1VQ6 T;  2MWP A;  4MML A;  2AHJ B;  3R6O A;  3JB9 I;  1W2B S;  4FM4 B;  3S3O A;  5A2Q E;  2MI6 A;  1WJQ A;  2EJG A;  3CBP A;  3JB9 D;  3Q1J A;  3NTK A;  2CZ1 B;  4RCB A;  4C5I A;  4ELY C;  3VU3 C;  5CQY A;  4B9W A;  5I2S A;  3I56 A;  3VYG A;  1B34 B;  2HD0 A;  4DOW A;  5LJ5 g;  2MMP A;  3CCJ A;  4DA4 A;  1KQS S;  2PVD B;  3M5A A;  4DQ2 A;  1BI2 A;  1UB4 A;  2KAF A;  3OW2 A;  3QXE B;  3C4S A;  5LJ5 f;  5D6W A;  1YI2 T;  2X4Y A;  2ZPG B;  1EIF A;  1Q86 C;  2VGN A;  4HT8 A;  3JAM E;  4M77 A;  2VV5 A;  1WJR A;  3QJ6 A;  2EKO A;  4M77 C;  4X9D A;  4F7U A;  3GPL A;  3S6W A;  5GMK e;  1VQP A;  1VQ9 A;  1M90 U;  4BD3 A;  1MHN A;  1MGQ A;  3OB9 A;  2E65 A;  2DXC A;  5I21 A;  4RMO A;  1KD1 U;  5GAO p;  3BDL A;  4O6J A;  1R8O B;  1WQW A;  2LT1 A;  4BE1 A;  4LDV A;  1Y96 B;  4MZP A;  5FU7 B;  3CBO A;  2RO0 A;  4J7F A;  3JCM f;  4M7D G;  1G3T A;  5GAO m;  1VQL A;  3TU4 K;  2D9T A;  4N4G A;  4CRI A;  2CS7 A;  2LRQ A;  4C92 G;  1M8V A;  3WVD B;  1LOJ A;  4M78 E;  1SSF A;  3M59 A;  3JCM J;  1G3S A;  4J6Y A;  1XOV A;  4PLI A;  2RJC A;  4M75 E;  5CO7 A;  1M5Q 1;  2EAY A;  1JJ2 S;  4M7A D;  4CI0 C;  1PSE A;  1IRE B;  3JB9 J;  5GMK l;  2RH2 A;  2O01 E;  2YLC A;  3HKS A;  1BI3 A;  3CCE T;  2BIV A;  3OYK A;  3CC4 T;  5CKE A;  3OYL A;  4HCZ A;  4N0A C;  2R58 A;  3PTA A;  4MMK A;  2KY9 A;  4MZT A;  3SWN C;  1YIT T;  3BDU A;  1U1T A;  1VQO A;  4M75 C;  4ELZ C;  5D6Y A;  3A8H B;  2DXB A;  5GAN g;  2RM4 A;  1FX7 A;  1YJ9 T;  3JB9 H;  3OYI A;  5FRM A;  4MZM A;  1KHC A;  2D6F A;  2HBP A;  1X01 A;  2X35 A;  3EAE A;  3SB2 A;  4ATO A;  1N27 A;  3J80 E;  1K8A C;  2IG0 A;  5CKF A;  4EMH A;  5GAN 5;  5GAM j;  1YIT A;  2GCX A;  3CC7 T;  5LJ3 g;  2DJZ A;  3CD6 A;  3FIF A;  3DKM A;  3LGF A;  3OY9 A;  5GAN 2;  3P8H A;  4IUV A;  5DLO A;  4MDX A;  3MET A;  2IVW A;  4JLI A;  5AYF A;  3RKY A;  5KE3 A;  1WGS A;  2CZ6 B;  2HNI A;  2K57 A;  3J81 E;  1BI0 A;  2FL7 A;  5FU6 B;  1BKB A;  2K5L A;  2C06 A;  4OVA A;  3JCM Q;  4M7D D;  3SFM A;  3CME T;  4M78 G;  5A0D A;  2PVG B;  3MEV A;  5GAN h;  2CZ0 B;  2A3L A;  2R5A A;  3GF5 A;  4EMK B;  4C92 D;  4M75 G;  1QP2 A;  2LDM A;  2RJE A;  3HP9 A;  3CCQ A;  4ZGJ B;  1RI0 A;  4JDS A;  4XK8 E;  3X24 B;  1VQ4 T;  5CVI A;  2RK1 A;  2B8A A;  2EQK A;  2K3Y A;  1M90 C;  1GXI E;  2F5K A;  2P0K A;  1JBM A;  5LJ3 h;  3OYN A;  1KD1 C;  1WNL A;  4M77 F;  3QO3 A;  2EJ9 A;  4F7U F;  4QVC A;  3CCV A;  1WQ7 A;  2E10 A;  4RG8 A;  2F69 A;  2KK4 A;  3C12 A;  4OP0 A;  2I2L A;  1VIF A;  1YBY A;  1OZ3 A;  2LNV A;  5FU7 C;  5GMK i;  1XTD A;  3M55 A;  4FL6 A;  1VQ4 A;  1YIJ A;  3LWI A;  4LDW A;  3CXC S;  2DD5 A;  2JN0 A;  3C94 A;  2QA4 A;  1OYX A;  2VGM A;  5GAN 6;  3O8V A;  3QPH A;  5FLX E;  3OYG A;  2QEX T;  4M7A A;  3M53 A;  3OS5 A;  2XDB A;  5IN1 A;  3BFM A;  1M1K C;  3MHX A;  4Y28 E;  5GAN d;  1I5L A;  2BKD N;  4UC4 A;  4J5Y A;  2V8K A;  2PU9 B;  5GAN e;  3G6E T;  1ZBX A;  3KBG A;  4OB1 B;  2K2V A;  3JCM c;  5IT9 E;  4XU3 A;  1N6A A;  2HQX A;  2HQE A;  1BIB A;  5LJ3 d;  2QEX A;  1VQK T;  3FB9 A;  4O5V A;  3CEY A;  2RD1 A;  3DB4 A;  1G3W A;  5LJ3 e;  3ZFJ A;  2XGJ A;  3CPW S;  4ZGD B;  2RHY A;  4IKF A;  4OB2 B;  2XG8 D;  4M78 D;  5LL6 S;  3L2U A;  3LYI A;  5GAO r;  3ER0 A;  3C95 A;  3PMT A;  4M75 F;  1Y71 A;  2E5Q A;  1U8R A;  4M75 D;  2K5F A;  2OAU A;  3I56 T;  2CYZ B;  2L5Q A;  4KUL A;  1QVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...