2EQUA

Solution structure of the tudor domain of phd finger protein 20-like 1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
GSSGSSGFDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAKGQDWIALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 20-like 1
publication title Solution structure of the tudor domain of PHD finger protein 20-like 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2equA00
3UT1A 4E7LA 3S3OA 1RI0A 5CIUA 4BE1A 2LTOA 2MWOA 3C4SA 2GFUA 4E7IA 3F70A 3OYLA 2RHYA 4IUPA 4QQ6A 3P8HA 4BD3A 2LRQA 3OYDA 5KCHA 3M9QA 3OYNA 4HCZA 2VYTA 3L2VA 1MHNA 2X4XA 2XK0A 3OQ5A 2R5AA 4FU6A 4UC4A 5FRNA 2O4XA 3QJ6A 4A4HA 2RHZA 2BIVA 3OA6A 4QQGA 5IN1A 2RI3A 3LYIA 4A4EA 3DB3A 2L8DA 2O4XB 3QKJA 4EDUA 2D9TA 3OY9A 1OI1A 3L2WA 2EQMA 3OYBA 2FHDA 4IURA 2JTFA 3CEYA 2R58A 2DAQA 3DLMA 5D6YA 3OYEA 4BACA 3OYAA 4ZTFA 3OMCA 3NTKA 4QQDA 5KH6A 2X35A 1WJSA 3EAEA 3MP1A 3FC3A 3L2RA 2IG0A 4C5HA 3Q1JA 4B9WA 2BKDN 1SSFA 1WJRA 3E9GA 3PMIA 4PLIA 2GFAA 2X4YA 5IAYA 5FROA 2RHXA 1WGSA 4CRIA 1XNIA 2EQKA 2RJDA 4A4GA 2R57A 4BDYA 2EKOA 3O8VA 4BE2A 3H8ZA 2F5KA 3OYMA 2B8AA 4GY5A 3E9FA 3PFSA 5D6XA 5J26A 4C5IA 2E6NA 1G5VA 3S3MA 2K3XA 3PMTA 2RJCA 4BE0A 1OYXA 3OYCA 4PLLA 3LH0A 2NLUA 2P0KA 2LDMA 3MEVA 2M1HA 4Z02A 4E7KA 2EFIA 3LLRA 4IUQA 3P8DA 2YRVA 2QQSA 4FL6A 4NS5A 5C6SA 3L2UA 3MEUA 5J39A 4RG2A 3MO8A 2L89A 4II1A 3GOXA 3META 2PQWA 2XDPA 3OS1A 2QQRA 3FEOA 3ZEHA 4E7HA 3DB4A 2R5MA 3FDRA 3FLGA 4Q5WA 3OS0A 2K3YA 4IKFA 4ZTJA 2RI5A 2RI2A 3MEAA 4IUVA 3OS2A 4PL6A 2JZ2A 3OMGA 4X34A 3NTIA 2DIGA 3SD4A 5FRMA 2WACA 4LD6A 2RHUA 2RJEA 3ASKA 3MP8A 5D6WA 4A4FA 1H3ZA 5C0MA 1KHCA 4C5GA 2E5QA 2GF7A 4QVZA 3LGFA 3S6WA 2DIQA 5KCOA 2LVMA 3OYIA 2RJFA 3UWNA 3OYGA 4N4GA 2LCCA 3L42A 2CKKA 3PNWC 4BDZA 3BDLA 2HQEA 2HQXA 4OVAA 3QBYA 3LX7A 3OB9A 2M0OA 3MP6A 2EQUA 2M16A 2MWPA 3OYFA 3OYHA 2RO0A 1N27A 3KUFA 1OZ3A 2X4WA 3ME9A 1WJQA 4N4HA 2L3RA 2BUDA 3H6ZA 4L59A 5M9OA 2EQJA 4IUUA 3OYKA 4C5EA 1OZ2A 3S3NA 5KE2A 3LGLA 4QW2A 5KE3A 3MEWA 4B9XA 3QIIA 4E7JA 2G3RA 3OYJA 4IUTA 3L2QA 4N4IA 3NTHA 2RHIA
chains in the Genus database with same CATH superfamily
1RI9A 3UT1A 3S3OA 3CC2A 2L5QA 3OYLA 4HCZA 2LQNA 4JS5A 4V2SA 4FYYB 1YI2T 3URGA 2DXUA 2LNVA 2DLPA 3OA6A 3CMEA 1E6HA 2L8DA 2WSEE 4MZTA 4EDUA 2D9TA 3I55A 3RMQA 5AT1B 2NWMA 4M75E 5KYYA 3SFMA 4DEXA 5A0DA 2DAQA 2ED1A 1PCXA 5KH6A 2X35A 3L2RA 1IHWA 2LC4A 2KMTA 1UDLA 2XDDA 4DBQA 2NUTA 2CUDA 3TSWA 1UJ0A 3BFMA 2MAMA 1U3OA 3H8ZA 4EMKC 4F7UE 1K73U 2HL3A 5CAIA 2YUQA 3CCRA 1S72Q 3JSCA 4C5IA 2P84A 1MMNA 2DK3A 3JCMP 1G5VA 4OB3B 1AWOA 1N6AA 1PD1A 1I5OB 4JPBW 5KYXB 4J5YA 1VQ7A 5J39A 1T3SA 2E5KA 4JJDA 3OS1A 3DB4A 4NL3A 3OS0A 1QQJA 2K3YA 5LJ3d 2JM9A 4RTVA 2QEXT 2KRSA 3UWNA 5GJWB 3BW1A 1CSKA 3RESA 1YIJT 2HQEA 1M30A 4OB1B 4PJOF 1VOMA 2CT4A 2KK4A 1N27A 5IXBA 4LDVA 5I11A 2V26A 3CC7Q 1X6BA 4PKCC 3CD6T 1WIEA 4C92B 4OMMA 1JBMA 4M78B 2K79A 3VYGA 3F70A 4D8KA 4X1VA 5GMKe 4C8QC 2RF0A 3M58A 3G71Q 1JU5C 2XKOC 3CC4Q 4UC4A 3T9NA 4JJCA 3QKJA 2RK2A 3M0QA 1G8XA 2EQMA 4BY6B 2JTFA 3L2ZA 1N9RA 2MMPA 4Y28E 3I55Q 3NGPA 3QPHA 1HXDA 1NJIU 1K9MC 3I56Q 3HRSA 5HK3A 2DKGA 2D8JA 3M57A 4OB2B 3OYMA 1VIEA 5KYWB 5J26A 5D6XA 2F69A 2E3IA 5LJ3f 4ANJA 3QSUA 1OU9A 2L3QA 4F04B 1Q81C 2EJFA 5CQXA 2DFUA 1QVFS 4J7IA 2PQWA 1QVGS 3OS5A 4C92A 4ZTJA 1I81A 3EFOA 3SD4A 1M2VA 1N8RC 2QK0A 2WACA 1NJIR 3CD6A 1Q95G 1M4ZA 3QWYA 3S6WA 1W6XA 3BDUA 1VQ5A 3M0RA 5LJ3j 4LUEA 1SF9A 1X27A 1U5SA 1M3BA 3CMAA 4PJOD 4AFUC 3NFCA 4C92G 1JB0E 2KXCA 2BZYA 4ZGEB 1PRMC 4BI8B 4KGVB 4N4HA 1TUDA 2MYSA 2L0AA 3VS7A 2L3SA 4IUTA 1Z9ZA 2W10A 2OAUA 4OGCA 2G6FX 5GAN8 3PIPA 4E7LA 2LQKA 2C06A 2ZZDA 4M7DF 4LN2A 2LTOA 4XTUA 2YUNA 3V7CA 1ZX6A 3KBGA 4XU3A 1YJWQ 2DXTA 4EMKB 2CP0A 3M0TA 1GBQA 3EGXB 2A0FB 5GAOp 2PU9B 3EG3A 2JUFA 1YWPA 4J9HA 2RI3A 1FYNA 3C12A 2E12A 2RA2A 2EJ9A 4LNPA 2RN8A 3QUIA 1TG0A 3CXCP 1TUGB 3OMCA 4KH0B 4Y92A 2AK5A 2QGFB 2BKDN 2EYZA 2CZ0B 4YTLA 2ED0A 1Q7YC 4K11A 2P4TA 4JZ3A 1LCKA 2KBTA 3VS1A 2O2OA 1X01A 2CP3A 3NPFA 4GY5A 2K7AA 2VB6A 1VUBA 3S3MA 3RDVA 1PRLC 3CCMA 1YHQT 1VQ8A 2XI9A 3QYHB 3OW2S 3RKXA 1M1GA 2IIMA 4F17A 1VYVA 2L89A 3GOXA 4GLKA 3VUZA 3JCMb 1WYXA 1SPKA 5L8RE 2DXCA 2V8KA 4J7FA 3GNGA 2X51A 1VQ4A 4EMGA 3JB9F 2LNHB 3V8LA 2RK1A 4BUGA 4A4FA 4KRTA 2FYKA 3A5ZB 2EAYA 4C8QB 1Q82C 1ZUKA 1K9MU 1JQQA 2F5TX 2KDSA 2WSCE 1M1FA 1W2BA 3AT1B 2F2VA 2X9HA 1SSHA 1RAAB 3X26B 3WVDB 1KIKA 1QLYA 3G7ZA 3OBWA 5IT9E 1OZ2A 1Q81U 1XJWB 1QCFA 2VC8A 5DY9A 1Q86R 1ZBJA 4E7JA 1KQSA 3NTHA 2DRMA 3QHSA 2YHTA 1GCQC 2YUPA 4E7IA 1EZZB 2Y4XA 3L2VA 1TU0B 1K9AA 4M7AD 2K5IA 3UATA 1N8RU 1FWZA 4PJOE 2HZYA 4FU6A 5LL6S 5GAN3 1Y0MA 2O4XA 2PTKA 2HBPA 3OBYA 2BIVA 4A54A 1RAHB 5GANg 1KQ1A 2QA4A 3VS3A 3CCVT 2VVKA 3EG9A 1OU8A 5GAN4 1YHQA 3Q1JA 4HA8A 2O31A 1BYMA 2RHXA 4CRIA 3EH2A 1V29B 2K2VA 4BDYA 1WHLA 4E6RA 1T3LA 2B8AA 1LJOA 4M75C 4N0AA 5IHKA 2KE9A 2RQRA 1N8RR 3MEVA 2FG0A 1D09B 4MDWA 3ULRB 2WSFE 2YRVA 2KGTA 3GLXA 2RD1A 3MEUA 2DZ9A 5CKFA 3JB9J 1KQ2A 1VQ8Q 2D8HA 4B6MA 5LJ5g 1AVZC 3CPWP 1G3WA 2HBWA 2QQ9A 2RI5A 1QMCA 3JB9D 4ELZC 2XD0A 3NTIA 3VKIA 1VQ4Q 1KC8C 2OAWA 1GRIA 2CGHA 5KCOA 3QXEB 2VASA 3JB9H 1X69A 4HVUA 1Q7YU 2RPNA 3P8BB 4BI4A 4AMCA 3LX7A 3JCMf 1K0SA 4QVCA 3OYKA 1T0JA 4B9XA 4KH1B 2G3RA 1X6OA 3FJPA 1SKUB 4CI0C 4RTXA 4BE1A 1YJ9A 2V1RA 1W70A 4KGZB 4AFSC 1RLQC 2MCNA 5CO7A 3G4SQ 1Y96B 1D0YA 1J3TA 5IXFA 5HCKA 2P0PA 1Q82U 4CC3A 3OY9A 1Q7YR 1X6GA 2NYSA 3PVLA 3CEYA 1ZSZA 1NYGA 1JO8A 4E7SA 2QA4Q 2DL8A 3VU3C 5CK9A 1K8AR 4M7DE 3CC7T 2BE9B 3PMIA 2GFAA 3M53A 1MNDA 1QW1A 3CCLA 5GAOl 4M7AE 1Y07A 1BI3A 2CYZB 3PIOA 1MV0B 3UPUA 2CZ1B 5IHIA 1T0HA 2KROA 2M51A 3CC2T 4M7AA 2K9GA 3NMZC 5J3BA 2IPOB 1R0CB 2AIRB 4C92F 2K5LA 1D3BB 2QQSA 3R6OA 1X75C 1XTDA 1KD1C 1Q82R 4M78F 4KUIA 1IXDA 1S72A 3MEAA 1M5Q1 3I55T 2AHJB 4FT2A 2DIGA 1H8KA 2O9VA 5FRMA 4J9DA 2RHUA 4M7AG 3VS2A 3I56T 2IVWA 4M4ZA 1ZSGA 3CBOA 2RJFA 3OSSC 4N4GA 1VYTA 4DBHA 2CKKA 2H3JA 2CS7A 1YJNQ 2DEQA 1X2QA 4PJLA 2K57A 1HD3A 1M1KR 4FYVB 5M9OA 5GMKm 1C6VX 3JCMW 1XOVA 1RAIB 1AWWA 5LJ5e 1OULA 1VQ7T 1VQOA 1MUZA 4ORZA 5CIUA 1FMKA 4ESRA 4BD3A 1QWFA 3M9QA 3OYNA 1UB4A 1ZLMA 5L23A 2R5AA 3A8OB 2DL3A 2FRYA 1KC8U 4BI3A 2RQUA 2AZVA 5A0GA 3CCSQ 2ROTA 4KGXB 3JRZA 4XTZA 3DLLA 2DTOA 4BACA 3DLMA 1RAEB 3EFSA 4TVRA 3EAEA 2FPFA 1Y7XA 4AG1C 3G71A 2OTLQ 1OV3A 4C5HA 4F7UB 4PLIA 3VRYA 4QVDA 5GANh 3CC4A 5CKHA 3VUBA 2JXBA 2LMJA 2E64A 1BIAA 1O75A 3JV3A 2YLBA 4LDUA 2DL7A 4RCBA 3CCLQ 2COWA 3THKA 3QZ5B 3PMTA 2DNUA 2NLUA 2P0KA 5GAN7 3QZ9B 4C92D 1WXTA 2EFIA 3LLRA 4PJNA 3I56A 3MKDA 1KC8R 2DTHA 3MO8A 4RG2A 1GL5A 4R55A 2HQHA 4M78D 1WXBA 4R0KA 2VWFA 2CP5A 2CDTA 5KYUB 2FB7A 3RKYA 1IREB 1VQ9Q 1QCOA 2KVQG 4JRIA 2ZPIB 4JLGA 2D0QB 1NEGA 2DILA 5LJ5h 2LVMA 2JMCA 2FRWA 4E7ZA 2ABLA 4MMLA 4OVAA 4FYXB 3CBPA 3V8JA 4J9GA 4M77B 1VQMA 3H6ZA 3PTAA 3SWNB 3JB9I 3EGDB 1F1BB 3MEWA 1KFZA 3SEMA 1KD1U 2M02A 2GFUA 1LOJA 2VGNA 3RERA 1WI7A 3P8HA 2KY9A 2EYQA 3A98A 5FLXE 3CCJA 1K73R 1VQOQ 3CPFA 1VQPQ 2PUOB 1NLPC 4LDXA 2JVVA 2RHZA 2QI2A 3LYIA 2E3HA 2E65A 2X4JA 1BU1A 5FWCA 1VQ5T 4HCCA 2LX9A 2R58A 1YJWA 4KULA 4FIBA 2ZPHB 3CMAT 2HEQA 5I21A 5FW9A 2V8JA 2EGCA 3C95A 5IAYA 4PJOC 2OTJQ 4PFZA 1PHTA 4BB7A 1XNIA 2CP7A 4A4GA 5HY6A 1KD1R 5CQYA 5EC7A 5FU7C 1SRMA 5GAOr 4HCBA 4BE0A 5KYXA 3OYCA 2H3EB 1Y71A 2DTIA 5D7UA 2EQIA 3M4GA 3U23A 3VS6A 4N0AC 4M77A 3L2UA 4WF2A 3VV0A 1W2BP 2J7IA 2RB6A 5FU6C 1X2KA 2ROLA 4ZGJB 3SWNA 3FB9A 4J6XA 2H8HA 4IIOA 3QWXX 5GMKj 2EYWA 3X24B 2JOYA 1KQSP 2J6KA 4M77G 1OX9A 1G3YA 3MPUB 4C92E 2DXBA 1AZGB 1RACB 1RLPC 2I0NA 1RL2A 2A37A 1TSFA 4M78E 1BBZA 2FPDA 3EGUA 2DM1A 4CC4B 3CCMT 1FX7A 4QW2A 1GCPA 4M78A 1VQ8T 1VQMQ 3MCAB 2RHIA 1JJ2A 2HNIA 4JRPA 4WTOB 3HRUA 3CXCS 1N5ZA 4IUPA 3LWHA 3GF5A 3WXMB 3G6EQ 1VQ4T 1SEMA 2Y4YA 2F2XA 5GAN5 3CCJQ 1PNJA 2BE7D 4HT9A 4M78G 1ZQ1A 2KRMA 3H9NA 3C0CA 3CCEQ 4FW1A 1X43A 4OMLA 1WQ7A 3UA7A 1H92A 2A3LA 4C8QD 3TQ7P 1VIFA 1WGSA 1TUCA 4M7AF 2R57A 5KYWA 3A8LB 1UJYA 1K4US 5CKEA 3E9FA 1YI2Q 2SEMA 3G4ST 2QTVA 3LH0A 1I0CA 4M7DC 4PJJA 4EPCA 5GAN2 1QVPA 2F1LA 3META 3RBBB 2XDPA 1MNEA 1AD5A 4M7AC 1VQLA 2DL5A 4ME7A 4IUVA 5CVIA 4HVWA 2JZ2A 1FXXA 2QA4T 2ZCFB 4LD6A 4NL2A 3ASKA 3MP8A 1NEBA 4C5GA 2GQIA 2X3XD 2DIQA 2KR3A 4OGEA 1M8MA 3X28B 2XMFA 5GAOn 4LXCA 3L42A 2AZSA 3I35A 5AYFA 2E1HA 3QBYA 2GGRA 1M3CA 2EQUA 5GMKl 3JCMg 3M54A 1UGVA 1ACMB 2KXDA 2L3RA 3RMSA 3QDRB 1Y57A 1BB9A 2CSQA 4C0GA 1NZ9A 3CQTA 2CP6A 3L2QA 4L5GA 4A63B 4RG8A 1PC0A 2RHYA 3M59A 5IHNA 2YWWA 4EMKA 1WDXA 2COZA 3RR6A 2QEXQ 5GJVB 4C0DC 3EGXA 1I5LA 5GAMg 4LDWA 4E2FB 3A1PA 4QQGA 1H641 5IN1A 2JNGA 3DB3A 1ARKA 4IIMA 1QCNA 1YJNT 2ZPGB 1NBEB 5I2MA 4RTZA 2J6OA 2YDLA 1BCOA 5FU6B 4QQDA 4RCCA 3G4SA 2XHCA 1UGPB 4J83A 5FROA 1I1JA 4F16A 1SHFA 2EQKA 1AWJA 4PNOA 2YXYA 2EKOA 3E19A 4LDYA 4NOYA 2F5KA 1K9MR 2F2WA 1TS9A 3HL8A 4OP0A 2GTOA 4Z02A 1YJ9T 3JCMQ 1YN8A 2QXFA 2JM8A 3QG1A 5HKCA 1MMGA 3CCST 2O9SA 2BZXA 2HMAA 1Q81R 4RUGA 1TOVA 2DF6A 2KSSA 4X34A 4DEYA 1B34B 1B7TA 2DVJA 2EJGA 2KQWA 2HCKA 1VQLQ 4C8QA 4AFQC 2O01E 2VXFA 2E5QA 4JJNK 3HRTA 2DD4A 2HAXA 2X3WD 1YBYA 4OMFB 3CCLT 3A8GB 3TCJA 2AKLA 2E10A 2KRNA 5EG2A 2BTTA 1LPLA 3PGGA 1XQHA 4C8QG 4Z89A 1BK2A 4L59A 1W4SA 3JCMX 2ZGWA 4FSSA 4ZN1A 2YT6A 1UECA 1H3ZA 4MZMA 4N4IA 1YJNA 3V7SA 4LUDA 2YRCA 1VQ9T 4KBMB 1QVFA 1QVGA 2LRQA 4L6V5 5KCHA 2QTXA 5GANd 2VYTA 2J05A 1S72T 2K5FA 2XK0A 1ZBXA 2DBMA 5CKBA 3QJ6A 4A4HA 1M8VA 1D0ZA 4M7DB 1WHJA 2XIDA 3CCUA 3FIFA 3OYAA 4XTWA 4XK8E 2DO3A 1B34A 3CCSA 2EGEA 4C0ZA 2QG9B 3VRZA 1C0MA 1D1CA 3O8VA 4M77F 4J6WA 1VQOT 2OTLA 1BCMA 1NG2A 5LJ5d 1QKWA 1LNXA 3TSZA 5GAMe 2A28A 3ZL7C 4FL6A 5C6SA 8AT1B 4R56A 2NUZA 3L1AA 1NYFA 3ZEHA 4A4KA 1WZOA 3FLGA 4Q5WA 1U1TA 5CCAA 2MF2A 2RI2A 1FMWA 4PL6A 1IRXA 3N5BB 4DQ2A 2EIFA 4ZNXA 4HVVA 3VYHB 1KHCA 2OTJT 1H3HA 2I2LA 1YITQ 1MMDA 2DEUA 3G71T 4GLMA 1OX8A 4FW2A 3CC4T 2VKNA 1ZUYA 4JRKA 1VQ9A 2EYYA 3OYYA 5GANe 3TREA 1BIBA 2VGMA 3KUFA 1C1AA 4JRQA 2EW3A 1AEYA 4IUUA 2EBPA 3GP8A 4EMHA 3JCMh 1NLOC 4C92C 3OW2A 3H0HA 2LJ1A 1PKSA 2K6DA 2FPEA 5DLQE 1Y96A 2E70A 4M78C 2K4YA 1SHGA 7AT1B 1AWXA 3QJYA 2COYA 2CZ6B 2DETA 4GBQA 2KYBA 3PE0A 1OI1A 5GANj 1OOTA 1VQNQ 1S1NA 5GAMh 5D6YA 2HD0A 5KYYB 4J9BA 3NTKA 1QP3A 1VQPA 3CCUQ 4JUVA 4XAXB 1YNZA 3UF4A 4M75B 2PVOB 3M55A 1VQMT 2NUTB 3CCQQ 3M0SA 4M77D 1VQKA 3VS5A 3G6ET 1D3BA 1VQ6A 2LDMA 4DOWA 2OTJA 2RNAA 1M90C 2KYMA 3CCJT 1ZUUA 1PKTA 2C0OA 2MPXC 3CCVQ 1JXOA 1SG5A 4II1A 2ATCB 3FEOA 2LT1A 1IO6A 4XU2A 5LJ5j 1PD0A 2EVRA 3G1JA 2BZ8A 2FEIA 3QDFA 1AT1B 2JW4A 3J80E 1NE8A 5C0MA 1YJWT 3JCMc 4OMNA 3LGFA 2E4HA 1G3TA 4PFPA 5LJ3g 1JJ2P 4JDSA 1OEBA 1G2BA 1YCSB 3INZA 4Z8AA 1I4K1 1D1AA 4MDXA 1U1SA 2CT3A 3I9QA 2KNBB 3MP6A 1G83A 2OI3A 2M16A 2K3BA 2L2PA 5IH2A 4Z88A 3HFOA 1I8FA 3S3NA 4RTWA 3LGLA 2PNIA 2Z0WA 3LW5E 2FZCB 1P92A 3CBMA 1RUWA 1WXUA 2YLCA 2FZKB 2QDYB 1RI0A 2MWOA 4M75A 1NM7A 2ZPFB 3I5RA 2QQAA 4JS4A 2HL5C 1IB8A 2RH2A 5FRNA 2KT8A 2K2MA 3M5AA 4A4EA 1QP2A 5ECAA 4QT7A 1BI0A 3OYBA 3JCMJ 2FHDA 1U8RA 9ATCB 4WCIA 2MK5A 2HKQB 5I2SA 1R8OB 4F7UA 4M75G 3MP1A 3G6EA 3REAB 4B9WA 3E9GA 1HSQA 2V1QA 3RKWA 2LZ6B 3ZBDA 1W2BS 1PSFA 2OJ2A 2CH4W 3CCEA 3E2UA 2ESWA 4J9FA 2E6NA 4F7UG 1K76A 1YWOA 1VQKQ 2M1HA 1RADB 1YP5A 1WHMA 1KQSS 1UGSB 2DERA 3TEEA 5KYUA 4XU0A 2KAFA 3EG0A 3PVQA 1VQ6Q 4C8QF 4JLIA 4E7HA 1RAGB 5I22A 1NPRA 4C0FA 1YI2A 3OMGA 1GXIE 3EFOB 4M77E 1M2VB 4RTTA 8ATCB 3JCMV 1GFCA 3QO3A 3EG2A 4AFZC 3NHNA 2MI6A 3CC2Q 2ECZA 1Q86C 2X4WA 3MHXA 1WJQA 3EFRA 2BUDA 2RQWA 3EGDA 3LWIA 2EQJA 3JAME 5KE2A 3SHWA 1M90U 3GNFB 3QIIA 3CMEQ 1G3SA 1M2OA 1AOJA 1TTHB 5A0LA 3C4SA 1IHVA 1N9SA 4AT1B 4AG2C 4CC2A 1VQLT 2JS0A 4HKEA 3OQ5A 5LJ3e 4OMPA 1ZA2B 4J8OA 5GAOm 3ZFJA 5CR2A 1M3AA 4IURA 1IZ6A 3CCRQ 2QEXA 2VV5A 3J81E 3C94A 3FC3A 2IG0A 2ZPBB 3IQLA 4XTXA 2M0YA 3RUXA 4KT0E 1YIJA 1M90R 2DYIA 1VQ7Q 2D6FA 4JZ4A 2YUOA 3A8MB 1KJWA 2O88A 1CKAA 2RJCA 1B07A 2DJQA 3HP9A 4ELYC 2W0ZA 2D1XA 5GMKh 3UDCA 3H0FA 5GAN6 2QQRA 2R5MA 1KSWA 4EIKA 1UHCA 2JN0A 1ZSZC 4IKFA 3X25B 1M27C 2DPPB 2LQ8A 2GF7A 4DA4A 1QVFP 1QVGP 2LJ3A 6AT1B 3BDLA 3SB2A 3ER0A 2AT1B 2EKHA 2QDLA 3OYHA 1VA7A 2MWPA 5LJ3h 1OPLA 4XQ3A 1ZHIA 4C5EA 4OMOA 1JEGA 1BI1A 1W1FA 5KE3A 4KUDK 1ABOA 4J9IA 2FL7A 3DKMA 5GMKi 2DJZA 1Z9QA 2CP2A 3M0PA 1IGUA 4O6JA 2RM4A 4QQ6A 3OYDA 4RKUE 2EGAA 3X20B 2PVDB 1GFDA 1MMAA 1MHNA 1V1CA 4DBFA 1YITT 1WHHA 2FO0A 3FRNA 2RQTA 1WQWA 1TXQA 2JJ9A 5CKDA 2O4XB 1K8AC 1R0BG 3PT9A 4LE9A 2ZAEA 4PJOB 1B3QA 3HPWA 3M56A 4D8DA 3EG9B 3HKSA 4ZN3A 1Q86U 2JS2A 2X4YA 2CSIA 4XU1A 1YFNA 3BE3A 3D7SB 5FU7B 4MZPA 1UFFA 2CZ7B 4HCKA 2DZCA 1YIJQ 4J9EA 1FMVA 3H41A 1WHGA 1E7OA 2EWNA 2K3XA 1WFWA 1RAFB 3UA6A 2D0NA 2LQWA 4VUBA 1RABB 1WNLA 2J06A 2XU8A 1EFNA 1NPPA 4IUQA 4NS5A 3CD6Q 2VUBA 1VQ5Q 1VQNT 3QYGB 1UG1A 3FDRA 3CMAQ 2HSEB 3OS2A 2JMAA 3CPWS 2LP5A 1UEBA 3HTRA 1U06A 3CCUT 4MMKA 2FZGB 2E6ZA 4M7DD 1PM3A 1HK9A 3OW2P 3CCQT 3OYGA 4PK4A 3JCMd 2QASA 1QWEA 3MJXA 4HXJA 1M1KC 2A36A 4E47A 2GCXA 2HQXA 1UGQB 4C8QE 2HSPA 4PFOA 1EX4A 1QKXA 2CH4A 3VJPA 3GIBA 1MV3A 1I07A 2E41A 3AHUA 1PG5B 1YITA 1KHIA 4M75F 2OTLT 4PJOA 2JT4A 3RNJA 3A8HB 1AZEA 1A0NB 4PJMA 1HYOA 5DLOA 3RIRA 5GAMd 1K0XA 2RMOA 2P4RA 1GBRA 1R77A 1ABQA 2X4XA 4ATOA 1OQKA 2NUPB 2QYZA 4OB0B 4F7UF 4J6YA 1BI2A 4PJOG 2GNCA 3HHTB 3I5SA 3EHQA 2GBQA 4FYWB 3REBB 3L2WA 2QQBA 2DL4A 2XDBA 3CCMQ 1ZSZB 2DE0X 1SSFA 1WJRA 3H0IA 1HJDA 2HKNA 2XICA 1LVKA 4HT8A 1VQNA 4LD9K 1WHKA 4BE2A 2LX7A 2C0IA 4FT4A 4J9CA 2PZ1A 3PFSA 3TVTA 1OYXA 2DD5A 3BY7A 2DYBA 2QAZA 4PLLA 3CXCA 2ZPEB 3E1SA 4XTYA 1BKBA 3P8DA 3JCMe 4M7AB 1KK7A 3CCQA 2KI7A 1WA7A 3KFVA 2MOXA 1K8AU 2DRKA 2C0TA 4RTUA 1D1BA 1SRLA 1UHFA 2QGGA 2Y90A 3OSVA 4FM4B 5D6WA 1JRIA 2XG8D 1TH7A 2KEAA 3VS4A 3CCVA 1O9SA 1VQPT 4CC7A 4DOVA 2ENMA 2RQVA 2JTMA 3PNWC 3J7AF 1WLPB 2DX1A 4X9CA 5GAMf 2NUPA 3OB9A 2M0OA 2LT4A 3OYFA 4Y91A 5FWBA 3R6NA 1VQKT 4DBRA 2PVGB 3ME9A 2GQVA 2VXEA 4M75D 4M77C 3EH1A 5DM7R 3LH5A 2KT1A 1VQ6T 2P0QA 1K73C 3SWNC 5A2QE 4C0DB 5GAOq 1PWTA 3FJ5A 4FSXA 2DA9A 1K1ZA 1V76A 2V8IA 3KXTA 1E6GA 4JJBA 4ZGDB 2LJ0A 3TU4K 1YHQQ 2JTEA 4M7DA 5GAMj 3V7RA 2A7YA 4D6WA 1ZA1B 5GANf 2M9UA 3M4YA 1MGQA 2B86A 4QKUA 4OF1A 3HFNA 1M1KU 3WVEB 1WX6A 2CUBA 3OYEA 4ZTFA 1UTIA 1WJSA 4FCYA 3HSBA 3GBQA 1DJ7B 1IGQA 2FVUA 2L3PA 4M7DG 2YSQA 3CMET 2EPDA 2DBKA 2RJDA 3M0UA 2PUKB 2LCLA 4RTYA 4X9DA 1UE9A 2YRDA 2AKKA 5HK0A 3EHRA 1M9SA 2MIOA 2OX7A 1UUEA 1WPYA 4E7KA 4P5NA 2HDAA 4OMQA 1JJ2S 4BY6C 5KYNA 4F14A 1PSEA 4XTVA 4A53A 5LJ5f 2J6FA 1TWBA 3SDZA 2DMOA 3EG1A 1EIFA 3CCRT 4O5VA 2SRCA 4RMOA 2A08A 3VS0A 3V8KA 2RJEA 1OPKA 1D0XA 3O5ZA 1CKBA 4QVZA 3OYIA 1JXMA 2LCCA 2CREA 4BDZA 3GPLA 1YCYA 3CC7A 1YJ9Q 2EYXA 3CCET 3CPWA 2DVEA 2GTJA 2RO0A 2LCSA 1OZ3A 1NJIC 1GCQA 1KG1A 1UGRB 3OYJA 1VYUA 3JB9G 1AHJB
chains in the Genus database with same CATH topology
3UT1A 5A0LA 3S3OA 4BE1A 3C4SA 4RG8A 3CC2A 2L5QA 3OYLA 3M59A 2RHYA 4EMKA 1YJ9A 1QVGA 1N9SA 1VQLT 4HCZA 4C0DC 4JS5A 1I5LA 5CO7A 4V2SA 5GAMg 1Y96B 3URGA 4HKEA 1YI2T 2DXUA 3OQ5A 2LNVA 4LDWA 5LJ3e 4J8OA 5GAOm 3OA6A 2P0PA 1H641 4QQGA 2JNGA 5IN1A 3CMEA 3DB3A 2L8DA 1Q82U 2WSEE 4MZTA 3ZFJA 2D9TA 4EDUA 3RMQA 5CR2A 3OY9A 3I55A 2ZPGB 4M75E 1YJNT 3SFMA 5I2MA 4IURA 5A0DA 1IZ6A 3CEYA 2QEXA 2DAQA 5FU6B 2VV5A 3J81E 3C94A 4QQDA 5KH6A 2X35A 3FC3A 4RCCA 3G4SA 3VU3C 2IG0A 2ZPBB 5CK9A 2LC4A 3L2RA 4M7DE 2KMTA 1UGPB 2XHCA 4J83A 4XTXA 3CC7T 3PMIA 3RUXA 2XDDA 2GFAA 3M53A 5FROA 4KT0E 1YIJA 1QW1A 2D6FA 3CCLA 3BFMA 5GAOl 2EQKA 2MAMA 4M7AE 4NOYA 4PNOA 2EKOA 1Y07A 3A8MB 3E19A 4LDYA 3H8ZA 2F5KA 1BI3A 4EMKC 2CYZB 4F7UE 3PIOA 1K73U 5CAIA 3CCRA 3JSCA 4C5IA 3JCMP 2DK3A 3UPUA 2CZ1B 1G5VA 3HL8A 4OB3B 4OP0A 2RJCA 1N6AA 3HP9A 3CC2T 4Z02A 4ELYC 4M7AA 5J3BA 1YJ9T 3JCMQ 2QXFA 4C92F 2K5LA 1D3BB 2QQSA 3QG1A 4J5YA 3R6OA 5GMKh 5HKCA 1VQ7A 5J39A 1X75C 1XTDA 1KD1C 3CCST 3UDCA 4M78F 2QQRA 5GAN6 3OS1A 3DB4A 2R5MA 4KUIA 4NL3A 2JN0A 3OS0A 2K3YA 4IKFA 1S72A 3MEAA 5LJ3d 2KSSA 1M5Q1 4X34A 3I55T 2AHJB 4FT2A 2DIGA 1B34B 3X25B 2EJGA 5FRMA 2KQWA 2RHUA 4C8QA 2O01E 4M7AG 2QEXT 2DPPB 2LQ8A 2VXFA 3I56T 2E5QA 2GF7A 2IVWA 4DA4A 4JJNK 3CBOA 2RJFA 3UWNA 3HRTA 3BW1A 3OSSC 2DD4A 4N4GA 2HAXA 2CKKA 2H3JA 1YBYA 2CS7A 4OMFB 3RESA 1YIJT 3BDLA 2HQEA 3CCLT 3SB2A 3ER0A 2DEQA 3A8GB 4OB1B 3TCJA 2E10A 4PJOF 2K57A 5EG2A 3OYHA 2MWPA 2KK4A 3PGGA 1N27A 5LJ3h 4LDVA 1XQHA 4XQ3A 4C8QG 5M9OA 4L59A 1W4SA 5GMKm 3JCMX 3CD6T 4PKCC 1ZHIA 3JCMW 4C5EA 4C92B 2ZGWA 1XOVA 1BI1A 4ZN1A 5KE3A 4KUDK 2FL7A 1H3ZA 4MZMA 5LJ5e 4N4IA 1YJNA 1JBMA 3DKMA 3V7SA 4M78B 5GMKi 1VQOA 2DJZA 1VQ7T 1VQ9T 5CIUA 4O6JA 3VYGA 4KBMB 3F70A 1QVFA 2RM4A 4QQ6A 4BD3A 3OYDA 2LRQA 4RKUE 4L6V5 3X20B 2PVDB 3M9QA 4C8QC 5KCHA 2QTXA 1UB4A 2VYTA 5GMKe 5GANd 3OYNA 3M58A 1S72T 1MHNA 2XKOC 2K5FA 2XK0A 1ZBXA 2R5AA 5CKBA 4UC4A 1YITT 3QJ6A 3A8OB 3FRNA 4A4HA 1KC8U 1M8VA 3T9NA 4BI3A 1WQWA 4M7DB 5A0GA 5CKDA 2O4XB 3QKJA 2RK2A 1K8AC 3JRZA 2EQMA 3PT9A 4XTZA 4BY6B 3DLLA 2JTFA 2XIDA 2DTOA 3L2ZA 3CCUA 3FIFA 4BACA 1N9RA 3DLMA 2MMPA 4Y28E 3OYAA 3EFSA 4PJOB 4TVRA 3HPWA 3EAEA 4XTWA 3M56A 1Y7XA 3G71A 1VQ6A 4C5HA 4XK8E 3HKSA 3QPHA 4PLIA 4F7UB 4ZN3A 1HXDA 2DO3A 4QVDA 5GANh 2X4YA 5CKHA 3VUBA 1Q86U 3CC4A 1NJIU 1K9MC 4XU1A 3HRSA 5HK3A 2E64A 1BIAA 5FU7B 1O75A 1B34A 4MZPA 2DKGA 3CCSA 2YLBA 4C0ZA 2CZ7B 4LDUA 3O8VA 2DZCA 3M57A 4OB2B 3OYMA 4RCBA 1VIEA 4M77F 5J26A 5D6XA 3QZ5B 2F69A 2EWNA 2K3XA 3PMTA 5LJ3f 4J6WA 1VQOT 2OTLA 3QSUA 4VUBA 2NLUA 2P0KA 5LJ5d 1LNXA 3QZ9B 1WNLA 4C92D 5GAMe 5GAN7 2XU8A 2EFIA 3LLRA 1Q81C 1NPPA 4IUQA 3I56A 5FRNA 4FL6A 4NS5A 5C6SA 2VUBA 2DTHA 3MO8A 4RG2A 4R55A 2EJFA 4M78D 5CQXA 1QVFS 4J7IA 2PQWA 4R56A 1QVGS 3L1AA 3ZEHA 1VQNT 3QYGB 4A4KA 3FDRA 3FLGA 4Q5WA 3OS5A 2FB7A 3RKYA 1IREB 4C92A 1U1TA 5CCAA 4ZTJA 2MF2A 2RI2A 4PJOD 1I81A 3OS2A 4PL6A 2KVQG 4JRIA 2ZPIB 3SD4A 3CPWS 3N5BB 1N8RC 2WACA 4JLGA 4DQ2A 1UEBA 2D0QB 2EIFA 3CCUT 4MMKA 3VYHB 1KHCA 2OTJT 3CD6A 1M4ZA 2E6ZA 5LJ5h 4M7DD 3S6WA 2I2LA 2LVMA 3BDUA 1HK9A 3G71T 1VQ5A 3CCQT 3OYGA 3JCMd 5LJ3j 3CC4T 4JRKA 1M1KC 4E47A 2GCXA 4MMLA 2HQXA 4OVAA 3CMAA 3CBPA 3OYYA 3V8JA 3NFCA 1VQ9A 5GANe 1UGQB 1BIBA 4M77B 3TREA 4C92G 1JB0E 4C8QE 2VGMA 3KUFA 3VJPA 4ZGEB 3GIBA 4JRQA 1VQMA 4BI8B 4N4HA 2E41A 3H6ZA 3AHUA 3PTAA 4IUUA 3SWNB 1KHIA 3JB9I 4M75F 1YITA 2OTLT 4PJOA 3MEWA 3GP8A 3A8HB 4IUTA 4EMHA 5DLOA 4OGCA 1KD1U 2OAUA 3RIRA 3JCMh 4C92C 5GAMd 5GAN8 2LQKA 3PIPA 2ZZDA 3OW2A 4E7LA 2C06A 2LTOA 4XTUA 4M7DF 2GFUA 3V7CA 4CI0C 1LOJA 2VGNA 3KBGA 3RERA 3P8HA 4XU3A 2KY9A 5DLQE 2EYQA 5FLXE 1Y96A 2DXTA 2E70A 4M78C 4EMKB 3CCJA 3CPFA 2X4XA 4ATOA 2K4YA 2PUOB 4LDXA 2JVVA 4OB0B 5GAOp 4F7UF 2PU9B 2RHZA 1BI2A 2JUFA 2QI2A 3QJYA 4J6YA 4PJOG 2CZ6B 2RI3A 3C12A 3HHTB 3LYIA 2E12A 2E65A 2RA2A 2X4JA 2EJ9A 1OI1A 3L2WA 5GANj 1VQ5T 4HCCA 3QUIA 2LX9A 2QQBA 5GAMh 5D6YA 2R58A 2HD0A 1YJWA 4KULA 3OMCA 4FIBA 3NTKA 2XDBA 2ZPHB 3CMAT 5I21A 1QP3A 1VQPA 1SSFA 1WJRA 2BKDN 2V8JA 3C95A 5IAYA 2CZ0B 4PJOC 4JUVA 4YTLA 4XAXB 4M75B 2PVOB 3M55A 1VQMT 4BB7A 1XNIA 1Q7YC 4A4GA 2XICA 2P4TA 5HY6A 5CQYA 4HT8A 1VQNA 4LD9K 4M77D 1X01A 4BE2A 1VQKA 4FT4A 5FU7C 4GY5A 3PFSA 5GAOr 4HCBA 1VUBA 3S3MA 4BE0A 1OYXA 2DD5A 3BY7A 3CCMA 3G6ET 3OYCA 4PLLA 1D3BA 3CXCA 2ZPEB 1YHQT 2LDMA 1Y71A 3E1SA 4DOWA 2DTIA 1BKBA 2XI9A 4XTYA 3M4GA 1VQ8A 2OTJA 3QYHB 3P8DA 1M90C 3JCMe 4N0AC 4M77A 4M7AB 4WF2A 3L2UA 3CCJT 3OW2S 3RKXA 1M1GA 3VV0A 3CCQA 2L89A 4II1A 3GOXA 4GLKA 3VUZA 3JCMb 2RB6A 3FEOA 5FU6C 2DXCA 2LT1A 2V8KA 5L8RE 4J7FA 4ZGJB 4XU2A 3GNGA 3SWNA 5LJ5j 1VQ4A 1K8AU 3FB9A 4J6XA 4EMGA 3JB9F 2Y90A 3OSVA 4FM4B 3V8LA 3J80E 2RK1A 4BUGA 5GMKj 3L2QA 5D6WA 1JRIA 3X24B 1NE8A 2XG8D 4A4FA 5C0MA 3JCMc 2FYKA 3A5ZB 4L5GA 1TH7A 2EAYA 2JOYA 1YJWT 4C8QB 3LGFA 1G3TA 5LJ3g 3CCVA 4JDSA 4M77G 1Q82C 1O9SA 1VQPT 1K9MU 4DOVA 2WSCE 1G3YA 2F5TX 2KDSA 2JTMA 3INZA 3PNWC 3J7AF 4C92E 1M1FA 1I4K1 2DXBA 4X9CA 1W2BA 4MDXA 5GAMf 1U1SA 3OB9A 2M0OA 3X26B 3MP6A 1RL2A 2LT4A 4M78E 2M16A 3OYFA 4Y91A 3WVDB 1VQKT 2PVGB 3ME9A 2GQVA 3G7ZA 3OBWA 2VXEA 4M75D 4M77C 5DM7R 5IT9E 3HFOA 1I8FA 1OZ2A 3CCMT 1FX7A 3S3NA 1Q81U 3LGLA 2VC8A 5DY9A 4QW2A 1VQ6T 4M78A 1VQ8T 2P0QA 3LW5E 4E7JA 1P92A 3CBMA 1K73C 1KQSA 3MCAB 3NTHA 2RHIA 3SWNC 2HNIA 5A2QE 2YLCA 4C0DB 1JJ2A 2QDYB 3QHSA 4JRPA 1RI0A 5GAOq 4FSXA 2YHTA 3HRUA 2MWOA 3CXCS 4E7IA 4IUPA 4M75A 2V8IA 2ZPFB 3KXTA 2QQAA 4ZGDB 2Y4XA 3L2VA 3LWHA 3TU4K 3GF5A 3WXMB 1VQ4T 4JS4A 2K5IA 4M7AD 1N8RU 1FWZA 4PJOE 4M7DA 4FU6A 2Y4YA 5LL6S 5GAMj 2RH2A 3V7RA 2A7YA 2O4XA 5GAN3 4D6WA 2HBPA 3OBYA 2BIVA 5GAN5 5GANf 4A54A 3M5AA 4M78G 4HT9A 1ZQ1A 4A4EA 5GANg 1KQ1A 1QP2A 2QA4A 2M9UA 3M4YA 1MGQA 3CCVT 1BI0A 3OYBA 3JCMJ 2FHDA 4OF1A 3HFNA 1U8RA 1M1KU 3WVEB 3OYEA 5I2SA 1R8OB 1WQ7A 4M75G 4F7UA 4ZTFA 5GAN4 1WJSA 3MP1A 3G6EA 1YHQA 2A3LA 3HSBA 3Q1JA 4B9WA 3E9GA 4C8QD 4HA8A 1DJ7B 2FVUA 1BYMA 3RKWA 1VIFA 4M7DG 2RHXA 3ZBDA 1W2BS 1WGSA 4CRIA 1PSFA 1V29B 3CMET 2RJDA 4M7AF 2K2VA 2R57A 4BDYA 3CCEA 3A8LB 2PUKB 2LCLA 2B8AA 1LJOA 4M75C 4N0AA 4X9DA 5CKEA 3E9FA 2E6NA 5HK0A 4F7UG 1M9SA 3G4ST 1WPYA 3LH0A 4E7KA 3MEVA 2M1HA 4P5NA 4M7DC 4MDWA 4EPCA 2WSFE 5GAN2 1KQSS 2YRVA 1QVPA 3GLXA 2RD1A 1JJ2S 4BY6C 3MEUA 2DZ9A 1UGSB 5CKFA 3TEEA 3JB9J 4XU0A 2KAFA 1KQ2A 1PSEA 3META 4XTVA 4A53A 5LJ5f 4C8QF 2XDPA 4JLIA 4E7HA 3SDZA 5LJ5g 4M7AC 1NPRA 1VQLA 1G3WA 2QQ9A 4C0FA 1EIFA 4ME7A 3CCRT 4O5VA 2RI5A 4IUVA 5CVIA 4RMOA 3JB9D 4ELZC 2JZ2A 3OMGA 1FXXA 3NTIA 2QA4T 1YI2A 2XD0A 1GXIE 2ZCFB 3V8KA 4LD6A 4NL2A 2RJEA 3ASKA 3MP8A 3VKIA 4M77E 4C5GA 1KC8C 4QVZA 2CGHA 4OGEA 2DIQA 3JCMV 5KCOA 3X28B 3OYIA 3QXEB 5GAOn 3JB9H 2LCCA 3QO3A 3L42A 1Q7YU 4BDZA 3P8BB 4BI4A 5AYFA 3GPLA 2E1HA 3QBYA 1YCYA 3LX7A 2MI6A 3CC7A 3JCMf 3CCET 2EQUA 5GMKl 2DVEA 3CPWA 1Q86C 2RO0A 3JCMg 3M54A 1OZ3A 2X4WA 3MHXA 1NJIC 1WJQA 3EFRA 2L3RA 2BUDA 3RMSA 4QVCA 3LWIA 2EQJA 3OYKA 3JB9G 3JAME 3QDRB 5KE2A 1KG1A 1UGRB 1M90U 4C0GA 4B9XA 3GNFB 3QIIA 1G3SA 1NZ9A 1X6OA 2G3RA 3FJPA 3OYJA 1AHJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT1 A;  4E7L A;  3S3O A;  1RI0 A;  5CIU A;  4BE1 A;  2LTO A;  2MWO A;  3C4S A;  2GFU A;  4E7I A;  3F70 A;  3OYL A;  2RHY A;  4IUP A;  4QQ6 A;  3P8H A;  4BD3 A;  2LRQ A;  3OYD A;  5KCH A;  3M9Q A;  3OYN A;  4HCZ A;  2VYT A;  3L2V A;  1MHN A;  2X4X A;  2XK0 A;  3OQ5 A;  2R5A A;  4FU6 A;  4UC4 A;  5FRN A;  2O4X A;  3QJ6 A;  4A4H A;  2RHZ A;  2BIV A;  3OA6 A;  4QQG A;  5IN1 A;  2RI3 A;  3LYI A;  4A4E A;  3DB3 A;  2L8D A;  2O4X B;  3QKJ A;  4EDU A;  2D9T A;  3OY9 A;  1OI1 A;  3L2W A;  2EQM A;  3OYB A;  2FHD A;  4IUR A;  2JTF A;  3CEY A;  2R58 A;  2DAQ A;  3DLM A;  5D6Y A;  3OYE A;  4BAC A;  3OYA A;  4ZTF A;  3OMC A;  3NTK A;  4QQD A;  5KH6 A;  2X35 A;  1WJS A;  3EAE A;  3MP1 A;  3FC3 A;  3L2R A;  2IG0 A;  4C5H A;  3Q1J A;  4B9W A;  2BKD N;  1SSF A;  1WJR A;  3E9G A;  3PMI A;  4PLI A;  2GFA A;  2X4Y A;  5IAY A;  5FRO A;  2RHX A;  1WGS A;  4CRI A;  1XNI A;  2EQK A;  2RJD A;  4A4G A;  2R57 A;  4BDY A;  2EKO A;  3O8V A;  4BE2 A;  3H8Z A;  2F5K A;  3OYM A;  2B8A A;  4GY5 A;  3E9F A;  3PFS A;  5D6X A;  5J26 A;  4C5I A;  2E6N A;  1G5V A;  3S3M A;  2K3X A;  3PMT A;  2RJC A;  4BE0 A;  1OYX A;  3OYC A;  4PLL A;  3LH0 A;  2NLU A;  2P0K A;  2LDM A;  3MEV A;  2M1H A;  4Z02 A;  4E7K A;  2EFI A;  3LLR A;  4IUQ A;  3P8D A;  2YRV A;  2QQS A;  4FL6 A;  4NS5 A;  5C6S A;  3L2U A;  3MEU A;  5J39 A;  4RG2 A;  3MO8 A;  2L89 A;  4II1 A;  3GOX A;  3MET A;  2PQW A;  2XDP A;  3OS1 A;  2QQR A;  3FEO A;  3ZEH A;  4E7H A;  3DB4 A;  2R5M A;  3FDR A;  3FLG A;  4Q5W A;  3OS0 A;  2K3Y A;  4IKF A;  4ZTJ A;  2RI5 A;  2RI2 A;  3MEA A;  4IUV A;  3OS2 A;  4PL6 A;  2JZ2 A;  3OMG A;  4X34 A;  3NTI A;  2DIG A;  3SD4 A;  5FRM A;  2WAC A;  4LD6 A;  2RHU A;  2RJE A;  3ASK A;  3MP8 A;  5D6W A;  4A4F A;  1H3Z A;  5C0M A;  1KHC A;  4C5G A;  2E5Q A;  2GF7 A;  4QVZ A;  3LGF A;  3S6W A;  2DIQ A;  5KCO A;  2LVM A;  3OYI A;  2RJF A;  3UWN A;  3OYG A;  4N4G A;  2LCC A;  3L42 A;  2CKK A;  3PNW C;  4BDZ A;  3BDL A;  2HQE A;  2HQX A;  4OVA A;  3QBY A;  3LX7 A;  3OB9 A;  2M0O A;  3MP6 A;  2EQU A;  2M16 A;  2MWP A;  3OYF A;  3OYH A;  2RO0 A;  1N27 A;  3KUF A;  1OZ3 A;  2X4W A;  3ME9 A;  1WJQ A;  4N4H A;  2L3R A;  2BUD A;  3H6Z A;  4L59 A;  5M9O A;  2EQJ A;  4IUU A;  3OYK A;  4C5E A;  1OZ2 A;  3S3N A;  5KE2 A;  3LGL A;  4QW2 A;  5KE3 A;  3MEW A;  4B9X A;  3QII A;  4E7J A;  2G3R A;  3OYJ A;  4IUT A;  3L2Q A;  4N4I A;  3NTH A;  2RHI A; 
#chains in the Genus database with same CATH topology
 1RI9 A;  3UT1 A;  3S3O A;  3CC2 A;  2L5Q A;  3OYL A;  4HCZ A;  2LQN A;  4JS5 A;  4V2S A;  4FYY B;  1YI2 T;  3URG A;  2DXU A;  2LNV A;  2DLP A;  3OA6 A;  3CME A;  1E6H A;  2L8D A;  2WSE E;  4MZT A;  4EDU A;  2D9T A;  3I55 A;  3RMQ A;  5AT1 B;  2NWM A;  4M75 E;  5KYY A;  3SFM A;  4DEX A;  5A0D A;  2DAQ A;  2ED1 A;  1PCX A;  5KH6 A;  2X35 A;  3L2R A;  1IHW A;  2LC4 A;  2KMT A;  1UDL A;  2XDD A;  4DBQ A;  2NUT A;  2CUD A;  3TSW A;  1UJ0 A;  3BFM A;  2MAM A;  1U3O A;  3H8Z A;  4EMK C;  4F7U E;  1K73 U;  2HL3 A;  5CAI A;  2YUQ A;  3CCR A;  1S72 Q;  3JSC A;  4C5I A;  2P84 A;  1MMN A;  2DK3 A;  3JCM P;  1G5V A;  4OB3 B;  1AWO A;  1N6A A;  1PD1 A;  1I5O B;  4JPB W;  5KYX B;  4J5Y A;  1VQ7 A;  5J39 A;  1T3S A;  2E5K A;  4JJD A;  3OS1 A;  3DB4 A;  4NL3 A;  3OS0 A;  1QQJ A;  2K3Y A;  5LJ3 d;  2JM9 A;  4RTV A;  2QEX T;  2KRS A;  3UWN A;  5GJW B;  3BW1 A;  1CSK A;  3RES A;  1YIJ T;  2HQE A;  1M30 A;  4OB1 B;  4PJO F;  1VOM A;  2CT4 A;  2KK4 A;  1N27 A;  5IXB A;  4LDV A;  5I11 A;  2V26 A;  3CC7 Q;  1X6B A;  4PKC C;  3CD6 T;  1WIE A;  4C92 B;  4OMM A;  1JBM A;  4M78 B;  2K79 A;  3VYG A;  3F70 A;  4D8K A;  4X1V A;  5GMK e;  4C8Q C;  2RF0 A;  3M58 A;  3G71 Q;  1JU5 C;  2XKO C;  3CC4 Q;  4UC4 A;  3T9N A;  4JJC A;  3QKJ A;  2RK2 A;  3M0Q A;  1G8X A;  2EQM A;  4BY6 B;  2JTF A;  3L2Z A;  1N9R A;  2MMP A;  4Y28 E;  3I55 Q;  3NGP A;  3QPH A;  1HXD A;  1NJI U;  1K9M C;  3I56 Q;  3HRS A;  5HK3 A;  2DKG A;  2D8J A;  3M57 A;  4OB2 B;  3OYM A;  1VIE A;  5KYW B;  5J26 A;  5D6X A;  2F69 A;  2E3I A;  5LJ3 f;  4ANJ A;  3QSU A;  1OU9 A;  2L3Q A;  4F04 B;  1Q81 C;  2EJF A;  5CQX A;  2DFU A;  1QVF S;  4J7I A;  2PQW A;  1QVG S;  3OS5 A;  4C92 A;  4ZTJ A;  1I81 A;  3EFO A;  3SD4 A;  1M2V A;  1N8R C;  2QK0 A;  2WAC A;  1NJI R;  3CD6 A;  1Q95 G;  1M4Z A;  3QWY A;  3S6W A;  1W6X A;  3BDU A;  1VQ5 A;  3M0R A;  5LJ3 j;  4LUE A;  1SF9 A;  1X27 A;  1U5S A;  1M3B A;  3CMA A;  4PJO D;  4AFU C;  3NFC A;  4C92 G;  1JB0 E;  2KXC A;  2BZY A;  4ZGE B;  1PRM C;  4BI8 B;  4KGV B;  4N4H A;  1TUD A;  2MYS A;  2L0A A;  3VS7 A;  2L3S A;  4IUT A;  1Z9Z A;  2W10 A;  2OAU A;  4OGC A;  2G6F X;  5GAN 8;  3PIP A;  4E7L A;  2LQK A;  2C06 A;  2ZZD A;  4M7D F;  4LN2 A;  2LTO A;  4XTU A;  2YUN A;  3V7C A;  1ZX6 A;  3KBG A;  4XU3 A;  1YJW Q;  2DXT A;  4EMK B;  2CP0 A;  3M0T A;  1GBQ A;  3EGX B;  2A0F B;  5GAO p;  2PU9 B;  3EG3 A;  2JUF A;  1YWP A;  4J9H A;  2RI3 A;  1FYN A;  3C12 A;  2E12 A;  2RA2 A;  2EJ9 A;  4LNP A;  2RN8 A;  3QUI A;  1TG0 A;  3CXC P;  1TUG B;  3OMC A;  4KH0 B;  4Y92 A;  2AK5 A;  2QGF B;  2BKD N;  2EYZ A;  2CZ0 B;  4YTL A;  2ED0 A;  1Q7Y C;  4K11 A;  2P4T A;  4JZ3 A;  1LCK A;  2KBT A;  3VS1 A;  2O2O A;  1X01 A;  2CP3 A;  3NPF A;  4GY5 A;  2K7A A;  2VB6 A;  1VUB A;  3S3M A;  3RDV A;  1PRL C;  3CCM A;  1YHQ T;  1VQ8 A;  2XI9 A;  3QYH B;  3OW2 S;  3RKX A;  1M1G A;  2IIM A;  4F17 A;  1VYV A;  2L89 A;  3GOX A;  4GLK A;  3VUZ A;  3JCM b;  1WYX A;  1SPK A;  5L8R E;  2DXC A;  2V8K A;  4J7F A;  3GNG A;  2X51 A;  1VQ4 A;  4EMG A;  3JB9 F;  2LNH B;  3V8L A;  2RK1 A;  4BUG A;  4A4F A;  4KRT A;  2FYK A;  3A5Z B;  2EAY A;  4C8Q B;  1Q82 C;  1ZUK A;  1K9M U;  1JQQ A;  2F5T X;  2KDS A;  2WSC E;  1M1F A;  1W2B A;  3AT1 B;  2F2V A;  2X9H A;  1SSH A;  1RAA B;  3X26 B;  3WVD B;  1KIK A;  1QLY A;  3G7Z A;  3OBW A;  5IT9 E;  1OZ2 A;  1Q81 U;  1XJW B;  1QCF A;  2VC8 A;  5DY9 A;  1Q86 R;  1ZBJ A;  4E7J A;  1KQS A;  3NTH A;  2DRM A;  3QHS A;  2YHT A;  1GCQ C;  2YUP A;  4E7I A;  1EZZ B;  2Y4X A;  3L2V A;  1TU0 B;  1K9A A;  4M7A D;  2K5I A;  3UAT A;  1N8R U;  1FWZ A;  4PJO E;  2HZY A;  4FU6 A;  5LL6 S;  5GAN 3;  1Y0M A;  2O4X A;  2PTK A;  2HBP A;  3OBY A;  2BIV A;  4A54 A;  1RAH B;  5GAN g;  1KQ1 A;  2QA4 A;  3VS3 A;  3CCV T;  2VVK A;  3EG9 A;  1OU8 A;  5GAN 4;  1YHQ A;  3Q1J A;  4HA8 A;  2O31 A;  1BYM A;  2RHX A;  4CRI A;  3EH2 A;  1V29 B;  2K2V A;  4BDY A;  1WHL A;  4E6R A;  1T3L A;  2B8A A;  1LJO A;  4M75 C;  4N0A A;  5IHK A;  2KE9 A;  2RQR A;  1N8R R;  3MEV A;  2FG0 A;  1D09 B;  4MDW A;  3ULR B;  2WSF E;  2YRV A;  2KGT A;  3GLX A;  2RD1 A;  3MEU A;  2DZ9 A;  5CKF A;  3JB9 J;  1KQ2 A;  1VQ8 Q;  2D8H A;  4B6M A;  5LJ5 g;  1AVZ C;  3CPW P;  1G3W A;  2HBW A;  2QQ9 A;  2RI5 A;  1QMC A;  3JB9 D;  4ELZ C;  2XD0 A;  3NTI A;  3VKI A;  1VQ4 Q;  1KC8 C;  2OAW A;  1GRI A;  2CGH A;  5KCO A;  3QXE B;  2VAS A;  3JB9 H;  1X69 A;  4HVU A;  1Q7Y U;  2RPN A;  3P8B B;  4BI4 A;  4AMC A;  3LX7 A;  3JCM f;  1K0S A;  4QVC A;  3OYK A;  1T0J A;  4B9X A;  4KH1 B;  2G3R A;  1X6O A;  3FJP A;  1SKU B;  4CI0 C;  4RTX A;  4BE1 A;  1YJ9 A;  2V1R A;  1W70 A;  4KGZ B;  4AFS C;  1RLQ C;  2MCN A;  5CO7 A;  3G4S Q;  1Y96 B;  1D0Y A;  1J3T A;  5IXF A;  5HCK A;  2P0P A;  1Q82 U;  4CC3 A;  3OY9 A;  1Q7Y R;  1X6G A;  2NYS A;  3PVL A;  3CEY A;  1ZSZ A;  1NYG A;  1JO8 A;  4E7S A;  2QA4 Q;  2DL8 A;  3VU3 C;  5CK9 A;  1K8A R;  4M7D E;  3CC7 T;  2BE9 B;  3PMI A;  2GFA A;  3M53 A;  1MND A;  1QW1 A;  3CCL A;  5GAO l;  4M7A E;  1Y07 A;  1BI3 A;  2CYZ B;  3PIO A;  1MV0 B;  3UPU A;  2CZ1 B;  5IHI A;  1T0H A;  2KRO A;  2M51 A;  3CC2 T;  4M7A A;  2K9G A;  3NMZ C;  5J3B A;  2IPO B;  1R0C B;  2AIR B;  4C92 F;  2K5L A;  1D3B B;  2QQS A;  3R6O A;  1X75 C;  1XTD A;  1KD1 C;  1Q82 R;  4M78 F;  4KUI A;  1IXD A;  1S72 A;  3MEA A;  1M5Q 1;  3I55 T;  2AHJ B;  4FT2 A;  2DIG A;  1H8K A;  2O9V A;  5FRM A;  4J9D A;  2RHU A;  4M7A G;  3VS2 A;  3I56 T;  2IVW A;  4M4Z A;  1ZSG A;  3CBO A;  2RJF A;  3OSS C;  4N4G A;  1VYT A;  4DBH A;  2CKK A;  2H3J A;  2CS7 A;  1YJN Q;  2DEQ A;  1X2Q A;  4PJL A;  2K57 A;  1HD3 A;  1M1K R;  4FYV B;  5M9O A;  5GMK m;  1C6V X;  3JCM W;  1XOV A;  1RAI B;  1AWW A;  5LJ5 e;  1OUL A;  1VQ7 T;  1VQO A;  1MUZ A;  4ORZ A;  5CIU A;  1FMK A;  4ESR A;  4BD3 A;  1QWF A;  3M9Q A;  3OYN A;  1UB4 A;  1ZLM A;  5L23 A;  2R5A A;  3A8O B;  2DL3 A;  2FRY A;  1KC8 U;  4BI3 A;  2RQU A;  2AZV A;  5A0G A;  3CCS Q;  2ROT A;  4KGX B;  3JRZ A;  4XTZ A;  3DLL A;  2DTO A;  4BAC A;  3DLM A;  1RAE B;  3EFS A;  4TVR A;  3EAE A;  2FPF A;  1Y7X A;  4AG1 C;  3G71 A;  2OTL Q;  1OV3 A;  4C5H A;  4F7U B;  4PLI A;  3VRY A;  4QVD A;  5GAN h;  3CC4 A;  5CKH A;  3VUB A;  2JXB A;  2LMJ A;  2E64 A;  1BIA A;  1O75 A;  3JV3 A;  2YLB A;  4LDU A;  2DL7 A;  4RCB A;  3CCL Q;  2COW A;  3THK A;  3QZ5 B;  3PMT A;  2DNU A;  2NLU A;  2P0K A;  5GAN 7;  3QZ9 B;  4C92 D;  1WXT A;  2EFI A;  3LLR A;  4PJN A;  3I56 A;  3MKD A;  1KC8 R;  2DTH A;  3MO8 A;  4RG2 A;  1GL5 A;  4R55 A;  2HQH A;  4M78 D;  1WXB A;  4R0K A;  2VWF A;  2CP5 A;  2CDT A;  5KYU B;  2FB7 A;  3RKY A;  1IRE B;  1VQ9 Q;  1QCO A;  2KVQ G;  4JRI A;  2ZPI B;  4JLG A;  2D0Q B;  1NEG A;  2DIL A;  5LJ5 h;  2LVM A;  2JMC A;  2FRW A;  4E7Z A;  2ABL A;  4MML A;  4OVA A;  4FYX B;  3CBP A;  3V8J A;  4J9G A;  4M77 B;  1VQM A;  3H6Z A;  3PTA A;  3SWN B;  3JB9 I;  3EGD B;  1F1B B;  3MEW A;  1KFZ A;  3SEM A;  1KD1 U;  2M02 A;  2GFU A;  1LOJ A;  2VGN A;  3RER A;  1WI7 A;  3P8H A;  2KY9 A;  2EYQ A;  3A98 A;  5FLX E;  3CCJ A;  1K73 R;  1VQO Q;  3CPF A;  1VQP Q;  2PUO B;  1NLP C;  4LDX A;  2JVV A;  2RHZ A;  2QI2 A;  3LYI A;  2E3H A;  2E65 A;  2X4J A;  1BU1 A;  5FWC A;  1VQ5 T;  4HCC A;  2LX9 A;  2R58 A;  1YJW A;  4KUL A;  4FIB A;  2ZPH B;  3CMA T;  2HEQ A;  5I21 A;  5FW9 A;  2V8J A;  2EGC A;  3C95 A;  5IAY A;  4PJO C;  2OTJ Q;  4PFZ A;  1PHT A;  4BB7 A;  1XNI A;  2CP7 A;  4A4G A;  5HY6 A;  1KD1 R;  5CQY A;  5EC7 A;  5FU7 C;  1SRM A;  5GAO r;  4HCB A;  4BE0 A;  5KYX A;  3OYC A;  2H3E B;  1Y71 A;  2DTI A;  5D7U A;  2EQI A;  3M4G A;  3U23 A;  3VS6 A;  4N0A C;  4M77 A;  3L2U A;  4WF2 A;  3VV0 A;  1W2B P;  2J7I A;  2RB6 A;  5FU6 C;  1X2K A;  2ROL A;  4ZGJ B;  3SWN A;  3FB9 A;  4J6X A;  2H8H A;  4IIO A;  3QWX X;  5GMK j;  2EYW A;  3X24 B;  2JOY A;  1KQS P;  2J6K A;  4M77 G;  1OX9 A;  1G3Y A;  3MPU B;  4C92 E;  2DXB A;  1AZG B;  1RAC B;  1RLP C;  2I0N A;  1RL2 A;  2A37 A;  1TSF A;  4M78 E;  1BBZ A;  2FPD A;  3EGU A;  2DM1 A;  4CC4 B;  3CCM T;  1FX7 A;  4QW2 A;  1GCP A;  4M78 A;  1VQ8 T;  1VQM Q;  3MCA B;  2RHI A;  1JJ2 A;  2HNI A;  4JRP A;  4WTO B;  3HRU A;  3CXC S;  1N5Z A;  4IUP A;  3LWH A;  3GF5 A;  3WXM B;  3G6E Q;  1VQ4 T;  1SEM A;  2Y4Y A;  2F2X A;  5GAN 5;  3CCJ Q;  1PNJ A;  2BE7 D;  4HT9 A;  4M78 G;  1ZQ1 A;  2KRM A;  3H9N A;  3C0C A;  3CCE Q;  4FW1 A;  1X43 A;  4OML A;  1WQ7 A;  3UA7 A;  1H92 A;  2A3L A;  4C8Q D;  3TQ7 P;  1VIF A;  1WGS A;  1TUC A;  4M7A F;  2R57 A;  5KYW A;  3A8L B;  1UJY A;  1K4U S;  5CKE A;  3E9F A;  1YI2 Q;  2SEM A;  3G4S T;  2QTV A;  3LH0 A;  1I0C A;  4M7D C;  4PJJ A;  4EPC A;  5GAN 2;  1QVP A;  2F1L A;  3MET A;  3RBB B;  2XDP A;  1MNE A;  1AD5 A;  4M7A C;  1VQL A;  2DL5 A;  4ME7 A;  4IUV A;  5CVI A;  4HVW A;  2JZ2 A;  1FXX A;  2QA4 T;  2ZCF B;  4LD6 A;  4NL2 A;  3ASK A;  3MP8 A;  1NEB A;  4C5G A;  2GQI A;  2X3X D;  2DIQ A;  2KR3 A;  4OGE A;  1M8M A;  3X28 B;  2XMF A;  5GAO n;  4LXC A;  3L42 A;  2AZS A;  3I35 A;  5AYF A;  2E1H A;  3QBY A;  2GGR A;  1M3C A;  2EQU A;  5GMK l;  3JCM g;  3M54 A;  1UGV A;  1ACM B;  2KXD A;  2L3R A;  3RMS A;  3QDR B;  1Y57 A;  1BB9 A;  2CSQ A;  4C0G A;  1NZ9 A;  3CQT A;  2CP6 A;  3L2Q A;  4L5G A;  4A63 B;  4RG8 A;  1PC0 A;  2RHY A;  3M59 A;  5IHN A;  2YWW A;  4EMK A;  1WDX A;  2COZ A;  3RR6 A;  2QEX Q;  5GJV B;  4C0D C;  3EGX A;  1I5L A;  5GAM g;  4LDW A;  4E2F B;  3A1P A;  4QQG A;  1H64 1;  5IN1 A;  2JNG A;  3DB3 A;  1ARK A;  4IIM A;  1QCN A;  1YJN T;  2ZPG B;  1NBE B;  5I2M A;  4RTZ A;  2J6O A;  2YDL A;  1BCO A;  5FU6 B;  4QQD A;  4RCC A;  3G4S A;  2XHC A;  1UGP B;  4J83 A;  5FRO A;  1I1J A;  4F16 A;  1SHF A;  2EQK A;  1AWJ A;  4PNO A;  2YXY A;  2EKO A;  3E19 A;  4LDY A;  4NOY A;  2F5K A;  1K9M R;  2F2W A;  1TS9 A;  3HL8 A;  4OP0 A;  2GTO A;  4Z02 A;  1YJ9 T;  3JCM Q;  1YN8 A;  2QXF A;  2JM8 A;  3QG1 A;  5HKC A;  1MMG A;  3CCS T;  2O9S A;  2BZX A;  2HMA A;  1Q81 R;  4RUG A;  1TOV A;  2DF6 A;  2KSS A;  4X34 A;  4DEY A;  1B34 B;  1B7T A;  2DVJ A;  2EJG A;  2KQW A;  2HCK A;  1VQL Q;  4C8Q A;  4AFQ C;  2O01 E;  2VXF A;  2E5Q A;  4JJN K;  3HRT A;  2DD4 A;  2HAX A;  2X3W D;  1YBY A;  4OMF B;  3CCL T;  3A8G B;  3TCJ A;  2AKL A;  2E10 A;  2KRN A;  5EG2 A;  2BTT A;  1LPL A;  3PGG A;  1XQH A;  4C8Q G;  4Z89 A;  1BK2 A;  4L59 A;  1W4S A;  3JCM X;  2ZGW A;  4FSS A;  4ZN1 A;  2YT6 A;  1UEC A;  1H3Z A;  4MZM A;  4N4I A;  1YJN A;  3V7S A;  4LUD A;  2YRC A;  1VQ9 T;  4KBM B;  1QVF A;  1QVG A;  2LRQ A;  4L6V 5;  5KCH A;  2QTX A;  5GAN d;  2VYT A;  2J05 A;  1S72 T;  2K5F A;  2XK0 A;  1ZBX A;  2DBM A;  5CKB A;  3QJ6 A;  4A4H A;  1M8V A;  1D0Z A;  4M7D B;  1WHJ A;  2XID A;  3CCU A;  3FIF A;  3OYA A;  4XTW A;  4XK8 E;  2DO3 A;  1B34 A;  3CCS A;  2EGE A;  4C0Z A;  2QG9 B;  3VRZ A;  1C0M A;  1D1C A;  3O8V A;  4M77 F;  4J6W A;  1VQO T;  2OTL A;  1BCM A;  1NG2 A;  5LJ5 d;  1QKW A;  1LNX A;  3TSZ A;  5GAM e;  2A28 A;  3ZL7 C;  4FL6 A;  5C6S A;  8AT1 B;  4R56 A;  2NUZ A;  3L1A A;  1NYF A;  3ZEH A;  4A4K A;  1WZO A;  3FLG A;  4Q5W A;  1U1T A;  5CCA A;  2MF2 A;  2RI2 A;  1FMW A;  4PL6 A;  1IRX A;  3N5B B;  4DQ2 A;  2EIF A;  4ZNX A;  4HVV A;  3VYH B;  1KHC A;  2OTJ T;  1H3H A;  2I2L A;  1YIT Q;  1MMD A;  2DEU A;  3G71 T;  4GLM A;  1OX8 A;  4FW2 A;  3CC4 T;  2VKN A;  1ZUY A;  4JRK A;  1VQ9 A;  2EYY A;  3OYY A;  5GAN e;  3TRE A;  1BIB A;  2VGM A;  3KUF A;  1C1A A;  4JRQ A;  2EW3 A;  1AEY A;  4IUU A;  2EBP A;  3GP8 A;  4EMH A;  3JCM h;  1NLO C;  4C92 C;  3OW2 A;  3H0H A;  2LJ1 A;  1PKS A;  2K6D A;  2FPE A;  5DLQ E;  1Y96 A;  2E70 A;  4M78 C;  2K4Y A;  1SHG A;  7AT1 B;  1AWX A;  3QJY A;  2COY A;  2CZ6 B;  2DET A;  4GBQ A;  2KYB A;  3PE0 A;  1OI1 A;  5GAN j;  1OOT A;  1VQN Q;  1S1N A;  5GAM h;  5D6Y A;  2HD0 A;  5KYY B;  4J9B A;  3NTK A;  1QP3 A;  1VQP A;  3CCU Q;  4JUV A;  4XAX B;  1YNZ A;  3UF4 A;  4M75 B;  2PVO B;  3M55 A;  1VQM T;  2NUT B;  3CCQ Q;  3M0S A;  4M77 D;  1VQK A;  3VS5 A;  3G6E T;  1D3B A;  1VQ6 A;  2LDM A;  4DOW A;  2OTJ A;  2RNA A;  1M90 C;  2KYM A;  3CCJ T;  1ZUU A;  1PKT A;  2C0O A;  2MPX C;  3CCV Q;  1JXO A;  1SG5 A;  4II1 A;  2ATC B;  3FEO A;  2LT1 A;  1IO6 A;  4XU2 A;  5LJ5 j;  1PD0 A;  2EVR A;  3G1J A;  2BZ8 A;  2FEI A;  3QDF A;  1AT1 B;  2JW4 A;  3J80 E;  1NE8 A;  5C0M A;  1YJW T;  3JCM c;  4OMN A;  3LGF A;  2E4H A;  1G3T A;  4PFP A;  5LJ3 g;  1JJ2 P;  4JDS A;  1OEB A;  1G2B A;  1YCS B;  3INZ A;  4Z8A A;  1I4K 1;  1D1A A;  4MDX A;  1U1S A;  2CT3 A;  3I9Q A;  2KNB B;  3MP6 A;  1G83 A;  2OI3 A;  2M16 A;  2K3B A;  2L2P A;  5IH2 A;  4Z88 A;  3HFO A;  1I8F A;  3S3N A;  4RTW A;  3LGL A;  2PNI A;  2Z0W A;  3LW5 E;  2FZC B;  1P92 A;  3CBM A;  1RUW A;  1WXU A;  2YLC A;  2FZK B;  2QDY B;  1RI0 A;  2MWO A;  4M75 A;  1NM7 A;  2ZPF B;  3I5R A;  2QQA A;  4JS4 A;  2HL5 C;  1IB8 A;  2RH2 A;  5FRN A;  2KT8 A;  2K2M A;  3M5A A;  4A4E A;  1QP2 A;  5ECA A;  4QT7 A;  1BI0 A;  3OYB A;  3JCM J;  2FHD A;  1U8R A;  9ATC B;  4WCI A;  2MK5 A;  2HKQ B;  5I2S A;  1R8O B;  4F7U A;  4M75 G;  3MP1 A;  3G6E A;  3REA B;  4B9W A;  3E9G A;  1HSQ A;  2V1Q A;  3RKW A;  2LZ6 B;  3ZBD A;  1W2B S;  1PSF A;  2OJ2 A;  2CH4 W;  3CCE A;  3E2U A;  2ESW A;  4J9F A;  2E6N A;  4F7U G;  1K76 A;  1YWO A;  1VQK Q;  2M1H A;  1RAD B;  1YP5 A;  1WHM A;  1KQS S;  1UGS B;  2DER A;  3TEE A;  5KYU A;  4XU0 A;  2KAF A;  3EG0 A;  3PVQ A;  1VQ6 Q;  4C8Q F;  4JLI A;  4E7H A;  1RAG B;  5I22 A;  1NPR A;  4C0F A;  1YI2 A;  3OMG A;  1GXI E;  3EFO B;  4M77 E;  1M2V B;  4RTT A;  8ATC B;  3JCM V;  1GFC A;  3QO3 A;  3EG2 A;  4AFZ C;  3NHN A;  2MI6 A;  3CC2 Q;  2ECZ A;  1Q86 C;  2X4W A;  3MHX A;  1WJQ A;  3EFR A;  2BUD A;  2RQW A;  3EGD A;  3LWI A;  2EQJ A;  3JAM E;  5KE2 A;  3SHW A;  1M90 U;  3GNF B;  3QII A;  3CME Q;  1G3S A;  1M2O A;  1AOJ A;  1TTH B;  5A0L A;  3C4S A;  1IHV A;  1N9S A;  4AT1 B;  4AG2 C;  4CC2 A;  1VQL T;  2JS0 A;  4HKE A;  3OQ5 A;  5LJ3 e;  4OMP A;  1ZA2 B;  4J8O A;  5GAO m;  3ZFJ A;  5CR2 A;  1M3A A;  4IUR A;  1IZ6 A;  3CCR Q;  2QEX A;  2VV5 A;  3J81 E;  3C94 A;  3FC3 A;  2IG0 A;  2ZPB B;  3IQL A;  4XTX A;  2M0Y A;  3RUX A;  4KT0 E;  1YIJ A;  1M90 R;  2DYI A;  1VQ7 Q;  2D6F A;  4JZ4 A;  2YUO A;  3A8M B;  1KJW A;  2O88 A;  1CKA A;  2RJC A;  1B07 A;  2DJQ A;  3HP9 A;  4ELY C;  2W0Z A;  2D1X A;  5GMK h;  3UDC A;  3H0F A;  5GAN 6;  2QQR A;  2R5M A;  1KSW A;  4EIK A;  1UHC A;  2JN0 A;  1ZSZ C;  4IKF A;  3X25 B;  1M27 C;  2DPP B;  2LQ8 A;  2GF7 A;  4DA4 A;  1QVF P;  1QVG P;  2LJ3 A;  6AT1 B;  3BDL A;  3SB2 A;  3ER0 A;  2AT1 B;  2EKH A;  2QDL A;  3OYH A;  1VA7 A;  2MWP A;  5LJ3 h;  1OPL A;  4XQ3 A;  1ZHI A;  4C5E A;  4OMO A;  1JEG A;  1BI1 A;  1W1F A;  5KE3 A;  4KUD K;  1ABO A;  4J9I A;  2FL7 A;  3DKM A;  5GMK i;  2DJZ A;  1Z9Q A;  2CP2 A;  3M0P A;  1IGU A;  4O6J A;  2RM4 A;  4QQ6 A;  3OYD A;  4RKU E;  2EGA A;  3X20 B;  2PVD B;  1GFD A;  1MMA A;  1MHN A;  1V1C A;  4DBF A;  1YIT T;  1WHH A;  2FO0 A;  3FRN A;  2RQT A;  1WQW A;  1TXQ A;  2JJ9 A;  5CKD A;  2O4X B;  1K8A C;  1R0B G;  3PT9 A;  4LE9 A;  2ZAE A;  4PJO B;  1B3Q A;  3HPW A;  3M56 A;  4D8D A;  3EG9 B;  3HKS A;  4ZN3 A;  1Q86 U;  2JS2 A;  2X4Y A;  2CSI A;  4XU1 A;  1YFN A;  3BE3 A;  3D7S B;  5FU7 B;  4MZP A;  1UFF A;  2CZ7 B;  4HCK A;  2DZC A;  1YIJ Q;  4J9E A;  1FMV A;  3H41 A;  1WHG A;  1E7O A;  2EWN A;  2K3X A;  1WFW A;  1RAF B;  3UA6 A;  2D0N A;  2LQW A;  4VUB A;  1RAB B;  1WNL A;  2J06 A;  2XU8 A;  1EFN A;  1NPP A;  4IUQ A;  4NS5 A;  3CD6 Q;  2VUB A;  1VQ5 Q;  1VQN T;  3QYG B;  1UG1 A;  3FDR A;  3CMA Q;  2HSE B;  3OS2 A;  2JMA A;  3CPW S;  2LP5 A;  1UEB A;  3HTR A;  1U06 A;  3CCU T;  4MMK A;  2FZG B;  2E6Z A;  4M7D D;  1PM3 A;  1HK9 A;  3OW2 P;  3CCQ T;  3OYG A;  4PK4 A;  3JCM d;  2QAS A;  1QWE A;  3MJX A;  4HXJ A;  1M1K C;  2A36 A;  4E47 A;  2GCX A;  2HQX A;  1UGQ B;  4C8Q E;  2HSP A;  4PFO A;  1EX4 A;  1QKX A;  2CH4 A;  3VJP A;  3GIB A;  1MV3 A;  1I07 A;  2E41 A;  3AHU A;  1PG5 B;  1YIT A;  1KHI A;  4M75 F;  2OTL T;  4PJO A;  2JT4 A;  3RNJ A;  3A8H B;  1AZE A;  1A0N B;  4PJM A;  1HYO A;  5DLO A;  3RIR A;  5GAM d;  1K0X A;  2RMO A;  2P4R A;  1GBR A;  1R77 A;  1ABQ A;  2X4X A;  4ATO A;  1OQK A;  2NUP B;  2QYZ A;  4OB0 B;  4F7U F;  4J6Y A;  1BI2 A;  4PJO G;  2GNC A;  3HHT B;  3I5S A;  3EHQ A;  2GBQ A;  4FYW B;  3REB B;  3L2W A;  2QQB A;  2DL4 A;  2XDB A;  3CCM Q;  1ZSZ B;  2DE0 X;  1SSF A;  1WJR A;  3H0I A;  1HJD A;  2HKN A;  2XIC A;  1LVK A;  4HT8 A;  1VQN A;  4LD9 K;  1WHK A;  4BE2 A;  2LX7 A;  2C0I A;  4FT4 A;  4J9C A;  2PZ1 A;  3PFS A;  3TVT A;  1OYX A;  2DD5 A;  3BY7 A;  2DYB A;  2QAZ A;  4PLL A;  3CXC A;  2ZPE B;  3E1S A;  4XTY A;  1BKB A;  3P8D A;  3JCM e;  4M7A B;  1KK7 A;  3CCQ A;  2KI7 A;  1WA7 A;  3KFV A;  2MOX A;  1K8A U;  2DRK A;  2C0T A;  4RTU A;  1D1B A;  1SRL A;  1UHF A;  2QGG A;  2Y90 A;  3OSV A;  4FM4 B;  5D6W A;  1JRI A;  2XG8 D;  1TH7 A;  2KEA A;  3VS4 A;  3CCV A;  1O9S A;  1VQP T;  4CC7 A;  4DOV A;  2ENM A;  2RQV A;  2JTM A;  3PNW C;  3J7A F;  1WLP B;  2DX1 A;  4X9C A;  5GAM f;  2NUP A;  3OB9 A;  2M0O A;  2LT4 A;  3OYF A;  4Y91 A;  5FWB A;  3R6N A;  1VQK T;  4DBR A;  2PVG B;  3ME9 A;  2GQV A;  2VXE A;  4M75 D;  4M77 C;  3EH1 A;  5DM7 R;  3LH5 A;  2KT1 A;  1VQ6 T;  2P0Q A;  1K73 C;  3SWN C;  5A2Q E;  4C0D B;  5GAO q;  1PWT A;  3FJ5 A;  4FSX A;  2DA9 A;  1K1Z A;  1V76 A;  2V8I A;  3KXT A;  1E6G A;  4JJB A;  4ZGD B;  2LJ0 A;  3TU4 K;  1YHQ Q;  2JTE A;  4M7D A;  5GAM j;  3V7R A;  2A7Y A;  4D6W A;  1ZA1 B;  5GAN f;  2M9U A;  3M4Y A;  1MGQ A;  2B86 A;  4QKU A;  4OF1 A;  3HFN A;  1M1K U;  3WVE B;  1WX6 A;  2CUB A;  3OYE A;  4ZTF A;  1UTI A;  1WJS A;  4FCY A;  3HSB A;  3GBQ A;  1DJ7 B;  1IGQ A;  2FVU A;  2L3P A;  4M7D G;  2YSQ A;  3CME T;  2EPD A;  2DBK A;  2RJD A;  3M0U A;  2PUK B;  2LCL A;  4RTY A;  4X9D A;  1UE9 A;  2YRD A;  2AKK A;  5HK0 A;  3EHR A;  1M9S A;  2MIO A;  2OX7 A;  1UUE A;  1WPY A;  4E7K A;  4P5N A;  2HDA A;  4OMQ A;  1JJ2 S;  4BY6 C;  5KYN A;  4F14 A;  1PSE A;  4XTV A;  4A53 A;  5LJ5 f;  2J6F A;  1TWB A;  3SDZ A;  2DMO A;  3EG1 A;  1EIF A;  3CCR T;  4O5V A;  2SRC A;  4RMO A;  2A08 A;  3VS0 A;  3V8K A;  2RJE A;  1OPK A;  1D0X A;  3O5Z A;  1CKB A;  4QVZ A;  3OYI A;  1JXM A;  2LCC A;  2CRE A;  4BDZ A;  3GPL A;  1YCY A;  3CC7 A;  1YJ9 Q;  2EYX A;  3CCE T;  3CPW A;  2DVE A;  2GTJ A;  2RO0 A;  2LCS A;  1OZ3 A;  1NJI C;  1GCQ A;  1KG1 A;  1UGR B;  3OYJ A;  1VYU A;  3JB9 G;  1AHJ B; 
#chains in the Genus database with same CATH homology
 3UT1 A;  5A0L A;  3S3O A;  4BE1 A;  3C4S A;  4RG8 A;  3CC2 A;  2L5Q A;  3OYL A;  3M59 A;  2RHY A;  4EMK A;  1YJ9 A;  1QVG A;  1N9S A;  1VQL T;  4HCZ A;  4C0D C;  4JS5 A;  1I5L A;  5CO7 A;  4V2S A;  5GAM g;  1Y96 B;  3URG A;  4HKE A;  1YI2 T;  2DXU A;  3OQ5 A;  2LNV A;  4LDW A;  5LJ3 e;  4J8O A;  5GAO m;  3OA6 A;  2P0P A;  1H64 1;  4QQG A;  2JNG A;  5IN1 A;  3CME A;  3DB3 A;  2L8D A;  1Q82 U;  2WSE E;  4MZT A;  3ZFJ A;  2D9T A;  4EDU A;  3RMQ A;  5CR2 A;  3OY9 A;  3I55 A;  2ZPG B;  4M75 E;  1YJN T;  3SFM A;  5I2M A;  4IUR A;  5A0D A;  1IZ6 A;  3CEY A;  2QEX A;  2DAQ A;  5FU6 B;  2VV5 A;  3J81 E;  3C94 A;  4QQD A;  5KH6 A;  2X35 A;  3FC3 A;  4RCC A;  3G4S A;  3VU3 C;  2IG0 A;  2ZPB B;  5CK9 A;  2LC4 A;  3L2R A;  4M7D E;  2KMT A;  1UGP B;  2XHC A;  4J83 A;  4XTX A;  3CC7 T;  3PMI A;  3RUX A;  2XDD A;  2GFA A;  3M53 A;  5FRO A;  4KT0 E;  1YIJ A;  1QW1 A;  2D6F A;  3CCL A;  3BFM A;  5GAO l;  2EQK A;  2MAM A;  4M7A E;  4NOY A;  4PNO A;  2EKO A;  1Y07 A;  3A8M B;  3E19 A;  4LDY A;  3H8Z A;  2F5K A;  1BI3 A;  4EMK C;  2CYZ B;  4F7U E;  3PIO A;  1K73 U;  5CAI A;  3CCR A;  3JSC A;  4C5I A;  3JCM P;  2DK3 A;  3UPU A;  2CZ1 B;  1G5V A;  3HL8 A;  4OB3 B;  4OP0 A;  2RJC A;  1N6A A;  3HP9 A;  3CC2 T;  4Z02 A;  4ELY C;  4M7A A;  5J3B A;  1YJ9 T;  3JCM Q;  2QXF A;  4C92 F;  2K5L A;  1D3B B;  2QQS A;  3QG1 A;  4J5Y A;  3R6O A;  5GMK h;  5HKC A;  1VQ7 A;  5J39 A;  1X75 C;  1XTD A;  1KD1 C;  3CCS T;  3UDC A;  4M78 F;  2QQR A;  5GAN 6;  3OS1 A;  3DB4 A;  2R5M A;  4KUI A;  4NL3 A;  2JN0 A;  3OS0 A;  2K3Y A;  4IKF A;  1S72 A;  3MEA A;  5LJ3 d;  2KSS A;  1M5Q 1;  4X34 A;  3I55 T;  2AHJ B;  4FT2 A;  2DIG A;  1B34 B;  3X25 B;  2EJG A;  5FRM A;  2KQW A;  2RHU A;  4C8Q A;  2O01 E;  4M7A G;  2QEX T;  2DPP B;  2LQ8 A;  2VXF A;  3I56 T;  2E5Q A;  2GF7 A;  2IVW A;  4DA4 A;  4JJN K;  3CBO A;  2RJF A;  3UWN A;  3HRT A;  3BW1 A;  3OSS C;  2DD4 A;  4N4G A;  2HAX A;  2CKK A;  2H3J A;  1YBY A;  2CS7 A;  4OMF B;  3RES A;  1YIJ T;  3BDL A;  2HQE A;  3CCL T;  3SB2 A;  3ER0 A;  2DEQ A;  3A8G B;  4OB1 B;  3TCJ A;  2E10 A;  4PJO F;  2K57 A;  5EG2 A;  3OYH A;  2MWP A;  2KK4 A;  3PGG A;  1N27 A;  5LJ3 h;  4LDV A;  1XQH A;  4XQ3 A;  4C8Q G;  5M9O A;  4L59 A;  1W4S A;  5GMK m;  3JCM X;  3CD6 T;  4PKC C;  1ZHI A;  3JCM W;  4C5E A;  4C92 B;  2ZGW A;  1XOV A;  1BI1 A;  4ZN1 A;  5KE3 A;  4KUD K;  2FL7 A;  1H3Z A;  4MZM A;  5LJ5 e;  4N4I A;  1YJN A;  1JBM A;  3DKM A;  3V7S A;  4M78 B;  5GMK i;  1VQO A;  2DJZ A;  1VQ7 T;  1VQ9 T;  5CIU A;  4O6J A;  3VYG A;  4KBM B;  3F70 A;  1QVF A;  2RM4 A;  4QQ6 A;  4BD3 A;  3OYD A;  2LRQ A;  4RKU E;  4L6V 5;  3X20 B;  2PVD B;  3M9Q A;  4C8Q C;  5KCH A;  2QTX A;  1UB4 A;  2VYT A;  5GMK e;  5GAN d;  3OYN A;  3M58 A;  1S72 T;  1MHN A;  2XKO C;  2K5F A;  2XK0 A;  1ZBX A;  2R5A A;  5CKB A;  4UC4 A;  1YIT T;  3QJ6 A;  3A8O B;  3FRN A;  4A4H A;  1KC8 U;  1M8V A;  3T9N A;  4BI3 A;  1WQW A;  4M7D B;  5A0G A;  5CKD A;  2O4X B;  3QKJ A;  2RK2 A;  1K8A C;  3JRZ A;  2EQM A;  3PT9 A;  4XTZ A;  4BY6 B;  3DLL A;  2JTF A;  2XID A;  2DTO A;  3L2Z A;  3CCU A;  3FIF A;  4BAC A;  1N9R A;  3DLM A;  2MMP A;  4Y28 E;  3OYA A;  3EFS A;  4PJO B;  4TVR A;  3HPW A;  3EAE A;  4XTW A;  3M56 A;  1Y7X A;  3G71 A;  1VQ6 A;  4C5H A;  4XK8 E;  3HKS A;  3QPH A;  4PLI A;  4F7U B;  4ZN3 A;  1HXD A;  2DO3 A;  4QVD A;  5GAN h;  2X4Y A;  5CKH A;  3VUB A;  1Q86 U;  3CC4 A;  1NJI U;  1K9M C;  4XU1 A;  3HRS A;  5HK3 A;  2E64 A;  1BIA A;  5FU7 B;  1O75 A;  1B34 A;  4MZP A;  2DKG A;  3CCS A;  2YLB A;  4C0Z A;  2CZ7 B;  4LDU A;  3O8V A;  2DZC A;  3M57 A;  4OB2 B;  3OYM A;  4RCB A;  1VIE A;  4M77 F;  5J26 A;  5D6X A;  3QZ5 B;  2F69 A;  2EWN A;  2K3X A;  3PMT A;  5LJ3 f;  4J6W A;  1VQO T;  2OTL A;  3QSU A;  4VUB A;  2NLU A;  2P0K A;  5LJ5 d;  1LNX A;  3QZ9 B;  1WNL A;  4C92 D;  5GAM e;  5GAN 7;  2XU8 A;  2EFI A;  3LLR A;  1Q81 C;  1NPP A;  4IUQ A;  3I56 A;  5FRN A;  4FL6 A;  4NS5 A;  5C6S A;  2VUB A;  2DTH A;  3MO8 A;  4RG2 A;  4R55 A;  2EJF A;  4M78 D;  5CQX A;  1QVF S;  4J7I A;  2PQW A;  4R56 A;  1QVG S;  3L1A A;  3ZEH A;  1VQN T;  3QYG B;  4A4K A;  3FDR A;  3FLG A;  4Q5W A;  3OS5 A;  2FB7 A;  3RKY A;  1IRE B;  4C92 A;  1U1T A;  5CCA A;  4ZTJ A;  2MF2 A;  2RI2 A;  4PJO D;  1I81 A;  3OS2 A;  4PL6 A;  2KVQ G;  4JRI A;  2ZPI B;  3SD4 A;  3CPW S;  3N5B B;  1N8R C;  2WAC A;  4JLG A;  4DQ2 A;  1UEB A;  2D0Q B;  2EIF A;  3CCU T;  4MMK A;  3VYH B;  1KHC A;  2OTJ T;  3CD6 A;  1M4Z A;  2E6Z A;  5LJ5 h;  4M7D D;  3S6W A;  2I2L A;  2LVM A;  3BDU A;  1HK9 A;  3G71 T;  1VQ5 A;  3CCQ T;  3OYG A;  3JCM d;  5LJ3 j;  3CC4 T;  4JRK A;  1M1K C;  4E47 A;  2GCX A;  4MML A;  2HQX A;  4OVA A;  3CMA A;  3CBP A;  3OYY A;  3V8J A;  3NFC A;  1VQ9 A;  5GAN e;  1UGQ B;  1BIB A;  4M77 B;  3TRE A;  4C92 G;  1JB0 E;  4C8Q E;  2VGM A;  3KUF A;  3VJP A;  4ZGE B;  3GIB A;  4JRQ A;  1VQM A;  4BI8 B;  4N4H A;  2E41 A;  3H6Z A;  3AHU A;  3PTA A;  4IUU A;  3SWN B;  1KHI A;  3JB9 I;  4M75 F;  1YIT A;  2OTL T;  4PJO A;  3MEW A;  3GP8 A;  3A8H B;  4IUT A;  4EMH A;  5DLO A;  4OGC A;  1KD1 U;  2OAU A;  3RIR A;  3JCM h;  4C92 C;  5GAM d;  5GAN 8;  2LQK A;  3PIP A;  2ZZD A;  3OW2 A;  4E7L A;  2C06 A;  2LTO A;  4XTU A;  4M7D F;  2GFU A;  3V7C A;  4CI0 C;  1LOJ A;  2VGN A;  3KBG A;  3RER A;  3P8H A;  4XU3 A;  2KY9 A;  5DLQ E;  2EYQ A;  5FLX E;  1Y96 A;  2DXT A;  2E70 A;  4M78 C;  4EMK B;  3CCJ A;  3CPF A;  2X4X A;  4ATO A;  2K4Y A;  2PUO B;  4LDX A;  2JVV A;  4OB0 B;  5GAO p;  4F7U F;  2PU9 B;  2RHZ A;  1BI2 A;  2JUF A;  2QI2 A;  3QJY A;  4J6Y A;  4PJO G;  2CZ6 B;  2RI3 A;  3C12 A;  3HHT B;  3LYI A;  2E12 A;  2E65 A;  2RA2 A;  2X4J A;  2EJ9 A;  1OI1 A;  3L2W A;  5GAN j;  1VQ5 T;  4HCC A;  3QUI A;  2LX9 A;  2QQB A;  5GAM h;  5D6Y A;  2R58 A;  2HD0 A;  1YJW A;  4KUL A;  3OMC A;  4FIB A;  3NTK A;  2XDB A;  2ZPH B;  3CMA T;  5I21 A;  1QP3 A;  1VQP A;  1SSF A;  1WJR A;  2BKD N;  2V8J A;  3C95 A;  5IAY A;  2CZ0 B;  4PJO C;  4JUV A;  4YTL A;  4XAX B;  4M75 B;  2PVO B;  3M55 A;  1VQM T;  4BB7 A;  1XNI A;  1Q7Y C;  4A4G A;  2XIC A;  2P4T A;  5HY6 A;  5CQY A;  4HT8 A;  1VQN A;  4LD9 K;  4M77 D;  1X01 A;  4BE2 A;  1VQK A;  4FT4 A;  5FU7 C;  4GY5 A;  3PFS A;  5GAO r;  4HCB A;  1VUB A;  3S3M A;  4BE0 A;  1OYX A;  2DD5 A;  3BY7 A;  3CCM A;  3G6E T;  3OYC A;  4PLL A;  1D3B A;  3CXC A;  2ZPE B;  1YHQ T;  2LDM A;  1Y71 A;  3E1S A;  4DOW A;  2DTI A;  1BKB A;  2XI9 A;  4XTY A;  3M4G A;  1VQ8 A;  2OTJ A;  3QYH B;  3P8D A;  1M90 C;  3JCM e;  4N0A C;  4M77 A;  4M7A B;  4WF2 A;  3L2U A;  3CCJ T;  3OW2 S;  3RKX A;  1M1G A;  3VV0 A;  3CCQ A;  2L89 A;  4II1 A;  3GOX A;  4GLK A;  3VUZ A;  3JCM b;  2RB6 A;  3FEO A;  5FU6 C;  2DXC A;  2LT1 A;  2V8K A;  5L8R E;  4J7F A;  4ZGJ B;  4XU2 A;  3GNG A;  3SWN A;  5LJ5 j;  1VQ4 A;  1K8A U;  3FB9 A;  4J6X A;  4EMG A;  3JB9 F;  2Y90 A;  3OSV A;  4FM4 B;  3V8L A;  3J80 E;  2RK1 A;  4BUG A;  5GMK j;  3L2Q A;  5D6W A;  1JRI A;  3X24 B;  1NE8 A;  2XG8 D;  4A4F A;  5C0M A;  3JCM c;  2FYK A;  3A5Z B;  4L5G A;  1TH7 A;  2EAY A;  2JOY A;  1YJW T;  4C8Q B;  3LGF A;  1G3T A;  5LJ3 g;  3CCV A;  4JDS A;  4M77 G;  1Q82 C;  1O9S A;  1VQP T;  1K9M U;  4DOV A;  2WSC E;  1G3Y A;  2F5T X;  2KDS A;  2JTM A;  3INZ A;  3PNW C;  3J7A F;  4C92 E;  1M1F A;  1I4K 1;  2DXB A;  4X9C A;  1W2B A;  4MDX A;  5GAM f;  1U1S A;  3OB9 A;  2M0O A;  3X26 B;  3MP6 A;  1RL2 A;  2LT4 A;  4M78 E;  2M16 A;  3OYF A;  4Y91 A;  3WVD B;  1VQK T;  2PVG B;  3ME9 A;  2GQV A;  3G7Z A;  3OBW A;  2VXE A;  4M75 D;  4M77 C;  5DM7 R;  5IT9 E;  3HFO A;  1I8F A;  1OZ2 A;  3CCM T;  1FX7 A;  3S3N A;  1Q81 U;  3LGL A;  2VC8 A;  5DY9 A;  4QW2 A;  1VQ6 T;  4M78 A;  1VQ8 T;  2P0Q A;  3LW5 E;  4E7J A;  1P92 A;  3CBM A;  1K73 C;  1KQS A;  3MCA B;  3NTH A;  2RHI A;  3SWN C;  2HNI A;  5A2Q E;  2YLC A;  4C0D B;  1JJ2 A;  2QDY B;  3QHS A;  4JRP A;  1RI0 A;  5GAO q;  4FSX A;  2YHT A;  3HRU A;  2MWO A;  3CXC S;  4E7I A;  4IUP A;  4M75 A;  2V8I A;  2ZPF B;  3KXT A;  2QQA A;  4ZGD B;  2Y4X A;  3L2V A;  3LWH A;  3TU4 K;  3GF5 A;  3WXM B;  1VQ4 T;  4JS4 A;  2K5I A;  4M7A D;  1N8R U;  1FWZ A;  4PJO E;  4M7D A;  4FU6 A;  2Y4Y A;  5LL6 S;  5GAM j;  2RH2 A;  3V7R A;  2A7Y A;  2O4X A;  5GAN 3;  4D6W A;  2HBP A;  3OBY A;  2BIV A;  5GAN 5;  5GAN f;  4A54 A;  3M5A A;  4M78 G;  4HT9 A;  1ZQ1 A;  4A4E A;  5GAN g;  1KQ1 A;  1QP2 A;  2QA4 A;  2M9U A;  3M4Y A;  1MGQ A;  3CCV T;  1BI0 A;  3OYB A;  3JCM J;  2FHD A;  4OF1 A;  3HFN A;  1U8R A;  1M1K U;  3WVE B;  3OYE A;  5I2S A;  1R8O B;  1WQ7 A;  4M75 G;  4F7U A;  4ZTF A;  5GAN 4;  1WJS A;  3MP1 A;  3G6E A;  1YHQ A;  2A3L A;  3HSB A;  3Q1J A;  4B9W A;  3E9G A;  4C8Q D;  4HA8 A;  1DJ7 B;  2FVU A;  1BYM A;  3RKW A;  1VIF A;  4M7D G;  2RHX A;  3ZBD A;  1W2B S;  1WGS A;  4CRI A;  1PSF A;  1V29 B;  3CME T;  2RJD A;  4M7A F;  2K2V A;  2R57 A;  4BDY A;  3CCE A;  3A8L B;  2PUK B;  2LCL A;  2B8A A;  1LJO A;  4M75 C;  4N0A A;  4X9D A;  5CKE A;  3E9F A;  2E6N A;  5HK0 A;  4F7U G;  1M9S A;  3G4S T;  1WPY A;  3LH0 A;  4E7K A;  3MEV A;  2M1H A;  4P5N A;  4M7D C;  4MDW A;  4EPC A;  2WSF E;  5GAN 2;  1KQS S;  2YRV A;  1QVP A;  3GLX A;  2RD1 A;  1JJ2 S;  4BY6 C;  3MEU A;  2DZ9 A;  1UGS B;  5CKF A;  3TEE A;  3JB9 J;  4XU0 A;  2KAF A;  1KQ2 A;  1PSE A;  3MET A;  4XTV A;  4A53 A;  5LJ5 f;  4C8Q F;  2XDP A;  4JLI A;  4E7H A;  3SDZ A;  5LJ5 g;  4M7A C;  1NPR A;  1VQL A;  1G3W A;  2QQ9 A;  4C0F A;  1EIF A;  4ME7 A;  3CCR T;  4O5V A;  2RI5 A;  4IUV A;  5CVI A;  4RMO A;  3JB9 D;  4ELZ C;  2JZ2 A;  3OMG A;  1FXX A;  3NTI A;  2QA4 T;  1YI2 A;  2XD0 A;  1GXI E;  2ZCF B;  3V8K A;  4LD6 A;  4NL2 A;  2RJE A;  3ASK A;  3MP8 A;  3VKI A;  4M77 E;  4C5G A;  1KC8 C;  4QVZ A;  2CGH A;  4OGE A;  2DIQ A;  3JCM V;  5KCO A;  3X28 B;  3OYI A;  3QXE B;  5GAO n;  3JB9 H;  2LCC A;  3QO3 A;  3L42 A;  1Q7Y U;  4BDZ A;  3P8B B;  4BI4 A;  5AYF A;  3GPL A;  2E1H A;  3QBY A;  1YCY A;  3LX7 A;  2MI6 A;  3CC7 A;  3JCM f;  3CCE T;  2EQU A;  5GMK l;  2DVE A;  3CPW A;  1Q86 C;  2RO0 A;  3JCM g;  3M54 A;  1OZ3 A;  2X4W A;  3MHX A;  1NJI C;  1WJQ A;  3EFR A;  2L3R A;  2BUD A;  3RMS A;  4QVC A;  3LWI A;  2EQJ A;  3OYK A;  3JB9 G;  3JAM E;  3QDR B;  5KE2 A;  1KG1 A;  1UGR B;  1M90 U;  4C0G A;  4B9X A;  3GNF B;  3QII A;  1G3S A;  1NZ9 A;  1X6O A;  2G3R A;  3FJP A;  3OYJ A;  1AHJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...