2EQUA

Solution structure of the tudor domain of phd finger protein 20-like 1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
GSSGSSGFDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAKGQDWIALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 20-like 1
publication title Solution structure of the tudor domain of PHD finger protein 20-like 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2equA00
3DB4A 2L8DA 3LH0A 3ASKA 4IUQA 2E6NA 2FHDA 4BDZA 4IKFA 3BDLA 2YRVA 3MP8A 4BE2A 4E7HA 2RI2A 3OMGA 2BIVA 2RHIA 2BKDN 3OYLA 3DLMA 2PQWA 3P8DA 3GOXA 3OS0A 2JTFA 3PMIA 4E7JA 2R5MA 3S3NA 4N4GA 3SD4A 2G3RA 3S3MA 3PMTA 2L89A 2NLUA 5FRMA 3L2VA 1G5VA 1OI1A 1MHNA 2DIQA 3MEWA 2QQSA 3OYNA 3L2UA 3L2RA 1KHCA 2VYTA 4C5GA 4A4FA 2X4XA 2RJCA 4UC4A 4HCZA 2GF7A 3OYHA 5IN1A 2LCCA 3S3OA 3OB9A 4OVAA 3FDRA 2QQRA 3FEOA 4QQGA 3PNWC 4PL6A 5C0MA 2JZ2A 3QIIA 3OYAA 2X4WA 3OMCA 4C5EA 5FRNA 1N27A 3NTHA 2XK0A 2O4XB 5D6WA 5J39A 3LGLA 4E7IA 3L42A 3OYIA 5D6XA 3E9GA 4X34A 5KE3A 4FU6A 4IURA 2EQMA 5KCHA 4BE0A 1WJRA 2RHZA 3OA6A 4BE1A 2RI3A 3OYMA 2L3RA 2CKKA 1XNIA 2X4YA 3P8HA 3H8ZA 3OYJA 4BDYA 1OZ3A 1OZ2A 4II1A 2R57A 4BD3A 5C6SA 4ZTFA 3UT1A 2E5QA 4N4IA 4EDUA 4B9WA 3KUFA 3L2WA 3LLRA 3NTKA 3FLGA 2RI5A 2HQXA 2MWPA 2M0OA 2R58A 4Q5WA 2RHYA 2LRQA 4QQ6A 2B8AA 2R5AA 4E7LA 2HQEA 2MWOA 2IG0A 4BACA 2GFUA 2RJDA 4E7KA 3QBYA 3NTIA 2XDPA 4NS5A 4PLLA 4CRIA 2EQKA 2O4XA 2P0KA 3EAEA 3MEVA 5CIUA 4A4EA 2RJFA 4A4HA 3OS1A 3MEUA 3QKJA 3F70A 2DIGA 5M9OA 3DB3A 4QVZA 2M1HA 5D6YA 2K3XA 1SSFA 2EQUA 1WGSA 1WJQA 3MEAA 2EQJA 3S6WA 2EKOA 4RG2A 4FL6A 4C5IA 4IUTA 3MO8A 3PFSA 4C5HA 3LGFA 4A4GA 3ZEHA 3ME9A 3LYIA 3LX7A 3UWNA 5KCOA 3META 3OYBA 2EFIA 2RJEA 1RI0A 3H6ZA 4IUVA 2DAQA 2X35A 3MP6A 4Z02A 3C4SA 3OYGA 3L2QA 3Q1JA 2M16A 4QW2A 2K3YA 1H3ZA 5KH6A 3OYEA 2F5KA 2LTOA 4IUPA 1WJSA 4GY5A 3O8VA 3OYDA 5FROA 4LD6A 3QJ6A 2D9TA 4N4HA 4B9XA 3OS2A 3OY9A 4QQDA 2RHUA 2WACA 4PLIA 5KE2A 3OYCA 2LDMA 2RO0A 3MP1A 2BUDA 3CEYA 4L59A 3OYKA 3OYFA 4ZTJA 3OQ5A 4IUUA 5IAYA 2GFAA 3E9FA 1OYXA 5J26A 3FC3A 3M9QA 2LVMA 2RHXA
chains in the Genus database with same CATH superfamily
4O6JA 2H8HA 1KK7A 3FRNA 3VS0A 3OSVA 4E7HA 2B86A 4JZ4A 2IPOB 2DTIA 1AOJA 1K73U 1VQ6T 2FB7A 3CCLT 1T0HA 2RK2A 2OTJT 3L2VA 2A3LA 3THKA 1MHNA 3CC2T 1W2BS 1KHCA 1KHIA 3JB9D 2MK5A 5CO7A 3CC7T 2AHJB 1M1KU 1NE8A 3CCQQ 3JCMX 1JQQA 3VJPA 4YTLA 3QPHA 1IO6A 2VC8A 1ZUKA 1U1SA 2H3EB 1NYFA 2YT6A 1VQOT 1QLYA 2NUPA 5A0LA 2V8IA 3ER0A 5GANg 1Y96A 1M90R 1QVFP 3MHXA 4KBMB 1QVGP 1VQ8T 4JLIA 1FXXA 3M58A 2AKKA 2K9GA 1WHGA 3HRTA 3PIOA 4BY6B 1I5OB 2K57A 2ED1A 4OMNA 3V7SA 4OB3B 3EH2A 4PKCC 1KQ2A 1QCFA 3JCMP 4M78B 2KXDA 5KYWA 1V29B 4M78G 2KK4A 2EFIA 2AZVA 4LDVA 1H3HA 2QDLA 3CCRT 2FRYA 3HP9A 2WSFE 2RNAA 4N4HA 1K0SA 3H9NA 4F17A 4ME7A 3MP1A 4WF2A 2MAMA 2QASA 1KG1A 5J26A 1M1GA 2QA4Q 1M2VB 4J9HA 3VS1A 1VYVA 2YRVA 1ZA1B 3JV3A 5LJ5e 2KRNA 3X20B 2EGCA 1OX9A 2RN8A 2QAZA 4LDYA 4A4FA 2D8JA 1SKUB 1TU0B 1QWFA 4M75F 3RKWA 1G3WA 5HKCA 1YIJT 4HA8A 3CXCS 1R77A 2HD0A 2J6KA 1QVFA 2HBPA 2CP6A 1M27C 2LQNA 3VS3A 5GAOq 3NTHA 3V8KA 4J7IA 3I55T 4DOVA 4FT2A 2ZPGB 4BE1A 2FG0A 5IHIA 2PU9B 3OYMA 2L3RA 2CKKA 2CUBA 8AT1B 4RTUA 1YNZA 1VQ4T 2AIRB 3I56T 1KD1C 4ZGJB 4E7LA 2YUQA 3BDUA 2OJ2A 3HHTB 4J7FA 5KYXB 2AKLA 3EG0A 4Y91A 2XMFA 4A4HA 2ZGWA 2PZ1A 2EVRA 1H92A 4C92B 3OW2P 1J3TA 1S72A 4B6MA 1YWPA 4C92G 5A0GA 4EMKC 4D6WA 2VKNA 3LGFA 2HCKA 2LMJA 4J8OA 3LX7A 4J6WA 1Q82C 4EMGA 3SEMA 1KQSS 4J5YA 2X35A 4F14A 3QDRB 4QW2A 5LJ5h 2F5KA 2E64A 3J7AF 1M1FA 4RMOA 2HL5C 4R0KA 2COZA 4JDSA 2DL7A 4OMLA 1B34B 4PNOA 5GANe 4HCKA 2LRQA 4PFOA 2QXFA 3HSBA 5GAN4 1Q7YC 2KNBB 3CCLQ 2F2XA 3G6ET 3A1PA 2OTJQ 3L1AA 3H0FA 3M5AA 5LJ3f 3MKDA 1N9SA 4N4GA 4M78D 4CC4B 4ELYC 1ACMB 1D3BA 4GLKA 4PFZA 4LDXA 1OI1A 4L6V5 3M54A 4HKEA 3CC7Q 2RF0A 8ATCB 3OBYA 1EFNA 2KI7A 3OYHA 4J9DA 1KD1U 3VU3C 1YITA 2JZ2A 2EWNA 4KUIA 4OB2B 4C5EA 4CC3A 1N6AA 1S72Q 1VQOQ 2NYSA 2RB6A 1BKBA 3M0SA 2ZZDA 2EQMA 4FM4B 1TG0A 3CQTA 3OW2A 4BD3A 4D8KA 4N4IA 1PG5B 2DBKA 1Q82U 1HYOA 2HMAA 5GAMj 1NYGA 2HSEB 3QBYA 1WXTA 4EMKA 1IGQA 1VQPA 1VQ7T 3REAB 4KGXB 2XI9A 4EIKA 1IZ6A 4JRQA 9ATCB 1VQ5A 2E3HA 1QCOA 1Y0MA 4E7SA 1K76A 5GANh 2K5LA 4PJMA 3CMAT 2QQBA 1FMVA 2DA9A 3OBWA 1UGSB 1AWJA 5KCOA 4N0AC 2WSCE 1Q7YU 1W2BP 3CCRQ 1RI0A 3JCMc 2DAQA 5D7UA 1ZHIA 4PJOC 5I22A 3JCMe 2Z0WA 3CCET 5FROA 3CD6T 2XICA 5I11A 5GMKi 2KDSA 3RERA 1BIBA 1XTDA 2EYXA 3OYFA 1AEYA 1YJNT 2XIDA 5KYYA 4C0GA 2E6NA 4M7AG 2RM4A 1JXMA 4A4KA 2D1XA 4AFZC 4J6YA 4E7JA 2KR3A 4HXJA 3G4ST 3G71A 1G5VA 4BB7A 1YIJQ 1LPLA 3PT9A 4XTUA 2DETA 4DBQA 6AT1B 2DNUA 1BK2A 1JB0E 1Q81C 1VQPQ 2LNHB 1Y71A 3I55Q 2COWA 3QO3A 1VOMA 1LCKA 3L42A 3JB9I 2RHZA 2L3SA 2DVJA 1VQ4Q 1XNIA 3QG1A 1YBYA 4J9FA 2L3QA 4M75E 5FU7B 1BI2A 2OTLT 3CPWP 1ZSZC 2HQXA 4KGVB 2HQEA 2DL5A 3VS5A 2CP5A 4QT7A 2DL4A 3T9NA 1TXQA 1W2BA 2K6DA 3EAEA 3M0QA 2I0NA 3TU4K 3V8LA 5CKDA 3E19A 3VYHB 1UHFA 5D6YA 4LUEA 2YUPA 4N0AA 3SHWA 1UGVA 1JU5C 4GLMA 4F7UA 4PJOA 1UG1A 1VIFA 2EJ9A 1D0XA 3NMZC 4AMCA 4VUBA 2MF2A 1VYTA 3CCUT 2GBQA 2LCSA 3OYGA 2K5FA 1K9MR 1WPYA 2J6FA 3G71Q 1D1AA 3UATA 1I0CA 3QJ6A 4B9XA 5GAMd 1AWXA 4BI8B 3CCMT 2M0YA 4L5GA 2RO0A 2YLCA 1GL5A 1RI9A 3FJPA 2RMOA 2KGTA 3G6EQ 3EG9A 2VGMA 3CCST 1Q81U 2VASA 1PRLC 4EPCA 2KT8A 7AT1B 1T3SA 5LJ5f 2NUTA 2E1HA 1ZQ1A 1VQLA 2DZ9A 2JNGA 1A0NB 5IXFA 3CCJT 1U5SA 1RADB 2LCCA 1WI7A 1NG2A 5C0MA 1IRXA 1TSFA 1EX4A 1K9AA 4F04B 5FRNA 1N27A 5GJVB 1BBZA 2JUFA 1KQSP 1E7OA 1ZSZA 1VQNT 1WQ7A 3P8HA 1D1CA 2DXBA 2OI3A 3X26B 1UECA 4Q5WA 2M0OA 4QQ6A 2RHYA 1TOVA 4FW1A 2ZPEB 1PHTA 2EYWA 3GNFB 5KYNA 3QKJA 3F70A 2ZAEA 2PVOB 3NPFA 1D09B 1QP2A 3CMAQ 2YXYA 3CXCA 2Y4XA 2EKOA 4RG2A 4C92C 2OAWA 1XJWB 2ZPFB 4DEYA 1M3BA 3OS5A 3CD6Q 2O2OA 4CC2A 4M7DB 4JJDA 4FT4A 1YJWT 3VV0A 3OY9A 3CCQA 4OMMA 2RHUA 1YJNQ 1CSKA 3OYCA 3GP8A 3H0HA 1BIAA 3RKYA 4IUUA 3U23A 1PD0A 1OYXA 5GANf 3M4YA 3PE0A 1VQ9T 2QI2A 2F5TX 1Z9ZA 2RQVA 3OMGA 1QKWA 1G8XA 3P8DA 1X6BA 2DO3A 3G4SQ 1ABQA 5HK0A 1M8VA 5FU6C 2L89A 2O9SA 2NWMA 4XTYA 2YUOA 2J06A 4M7DF 1TS9A 4DEXA 1MUZA 4PK4A 2K2VA 3GPLA 1OEBA 3UDCA 1JJ2S 1ZUUA 5CKHA 1VYUA 4C0DB 2QGFB 1W1FA 2XK0A 3EFOA 3LW5E 3H41A 2L3PA 3FB9A 3TQ7P 2FYKA 3JSCA 5CCAA 1NLPC 4FSXA 3KXTA 4TVRA 2FEIA 2FO0A 1QWEA 5GAN7 3UA7A 3LWHA 2JM9A 2MWPA 4FYYB 2DLPA 1X01A 2D8HA 4F7UF 2XHCA 4O5VA 1WHKA 1C6VX 2QA4A 2MYSA 4A4EA 4C8QC 4E6RA 2DIGA 2V26A 1PD1A 3DB3A 1JXOA 3X24B 2KE9A 1UFFA 4Z8AA 3CCUQ 2J05A 1BI3A 4JPBW 2Y90A 4C5HA 4NL3A 1AD5A 1ZX6A 3EFRA 2E70A 3INZA 5CK9A 3MP6A 4Z02A 2HBWA 3C95A 3P8BB 2FZKB 2W0ZA 3JCMf 4LD6A 2DE0X 4DBHA 2LJ1A 1YHQA 4A54A 1UGRB 1O9SA 3CCSQ 3OSSC 1MMDA 1N9RA 4CI0C 1WJQA 3ASKA 3QXEB 5GAOl 1F1BB 2CYZB 1Q86R 3GIBA 4IIOA 3G1JA 4M7AC 3CBMA 4A63B 1BB9A 5GMKj 3S3NA 3CCJQ 4M75B 2C0IA 1M8MA 1OULA 1D1BA 5GAOr 1AWWA 4AFQC 4M7DD 2V1RA 1HXDA 2FRWA 2QGGA 1YI2T 1I8FA 2GQIA 3OB9A 4R56A 3JB9H 3CCVA 4FW2A 4QVDA 2A0FB 2CS7A 2ROLA 2E41A 1I4K1 1N5ZA 3GLXA 3EGUA 1VQNQ 3EGDB 2DK3A 2JM8A 2JTMA 4J83A 4X34A 4BE0A 1WJRA 1OX8A 3C12A 4ZN3A 2KRMA 3EGXB 2CGHA 2DM1A 3JB9J 5LJ3j 4MMKA 4EDUA 2FL7A 2KEAA 2V1QA 2K5IA 3LLRA 3NTKA 4C8QA 2LQKA 1OV3A 2R5AA 1YJ9T 2EW3A 2XDPA 2YUNA 1X75C 1RAGB 3OS1A 5CIUA 1YHQQ 1WFWA 1Y57A 2MMPA 2XKOC 1VQ6A 4V2SA 3CCLA 2KROA 1K73R 1SPKA 2OTJA 1UUEA 2K3XA 3EH1A 4IIMA 3CC2A 1AVZC 3C0CA 2F2VA 3CC7A 5CVIA 4KRTA 3BW1A 4D8DA 1X27A 2M16A 2DF6A 3M59A 1M1KR 4XU2A 2K2MA 1U3OA 2LDMA 1UDLA 1VQOA 3FJ5A 3VKIA 2EKHA 1K0XA 1VQMT 2FPEA 1X2KA 4PJJA 3OQ5A 4M7AA 3CCVQ 1GRIA 4JUVA 2DMOA 1VUBA 4DBRA 5AYFA 1QW1A 4KULA 4Z88A 1B7TA 2CT3A 1QKXA 3V7RA 2LT4A 4J6XA 4A53A 1VQ8A 1PSEA 1JO8A 1YFNA 2EAYA 3VYGA 1K8AC 2EJFA 5KYUA 2QYZA 2YWWA 2QQSA 4DQ2A 2NUPB 3MJXA 1BCMA 3X25B 1NJIR 5FWCA 1Y96B 1WIEA 3M0UA 1M9SA 1NZ9A 1VQ6Q 3PGGA 2K7AA 3OMCA 1N8RC 1UEBA 2J7IA 2YSQA 4OP0A 3G7ZA 5D6XA 3CCRA 3CC2Q 5KE3A 5KCHA 4RKUE 2FZGB 2RI3A 2PUOB 2RPNA 1NEGA 3CMET 3JCMb 4M7DE 5GAOm 1ZUYA 2A7YA 2DEUA 5GAN8 2V8JA 2L0AA 3A98A 4M75D 1I07A 3HKSA 5KYWB 2YHTA 3TVTA 2G6FX 2BE9B 2AT1B 1MV3A 2DKGA 2O4XA 5CKFA 2EBPA 2EPDA 1OQKA 3NGPA 1LJOA 3IQLA 2DYIA 3JCMQ 3SWNC 1M5Q1 3PFSA 1VQ8Q 3M56A 5CQYA 3LYIA 4OMFB 1YIJA 5LL6S 2ED0A 2JOYA 2BZ8A 4XTWA 4LDWA 1SSHA 5LJ3d 4F7UE 2P84A 2YDLA 3TSWA 1K8AU 2VXEA 3OYDA 3I55A 4PLIA 1YCYA 2HNIA 4ZTJA 1NBEB 2LX9A 1D0ZA 3URGA 1VQ4A 1RAFB 3H0IA 3WXMB 1WXBA 2LZ6B 1IXDA 1N8RU 4M77C 2PQWA 4DOWA 2YRDA 4ZGEB 3RR6A 2JMCA 4KUDK 2H3JA 2LQ8A 4WCIA 2LCLA 1FX7A 1UHCA 1YI2Q 2QEXT 2GF7A 2KXCA 3AT1B 1Q95G 4QQGA 4X1VA 3QIIA 3OYAA 2X4WA 4JJNK 4C8QF 2EYZA 4FCYA 5FLXE 1K4US 3A8LB 3QYGB 1QCNA 1LOJA 3H8ZA 4BDYA 2FZCB 2R57A 4RTXA 4ZTFA 1YJ9Q 5LJ5j 4B9WA 4JZ3A 1D0YA 3FLGA 3M53A 3G6EA 4NS5A 2XU8A 1SG5A 2RQUA 3VS6A 2RJFA 3SWNA 2L5QA 1R0BG 1JJ2A 1IGUA 4MZMA 1G3TA 2EQUA 1WGSA 3JCMW 1KC8C 4HT8A 2E4HA 1ZBXA 3I56Q 2QDYB 4ANJA 3UWNA 2DD4A 3META 3UPUA 2CH4W 4KH0B 1KD1R 4M7AF 2JS2A 1QP3A 4LN2A 3UF4A 2LTOA 1WJSA 4JS4A 4AG2C 1AT1B 1D3BB 5CKBA 4OMQA 4BI4A 2QQAA 1I5LA 3EHRA 4L59A 1TWBA 1LNXA 1CKAA 4M77A 4BY6C 1BU1A 4ELZC 4J9BA 4IUQA 1IREB 2HAXA 2P0QA 1OU9A 1UGPB 3VRYA 4K11A 1Q82R 1I81A 2BKDN 3DLLA 4JRKA 3QWYA 4M78C 1SRMA 3SD4A 4AFUC 1VQ7A 1VQKT 3PMTA 2GTJA 3CXCP 3EG1A 1NPPA 3MEWA 2DJZA 3L2RA 1GCPA 4C5GA 1B3QA 5AT1B 2CDTA 1M90C 3CMAA 1UB4A 5GMKl 4OB0B 3JCMV 3FEOA 1Q7YR 3HFOA 5D6WA 4EMKB 4E7IA 1UTIA 1LVKA 5GANj 4C8QD 3E9GA 3CCEA 3CD6A 2CP3A 1OOTA 3CC4T 1MMAA 2ZCFB 5CR2A 1KC8U 3OYJA 2CP2A 3E2UA 1YJNA 1UJYA 4MMLA 2RI5A 1V1CA 4GBQA 4BACA 2RJDA 3HPWA 1SF9A 1WHHA 1RAAB 2DPPB 2VB6A 3MEUA 4AG1C 2RK1A 3KBGA 2XD0A 2CP0A 4QVZA 3G4SA 1E6HA 5GAMg 1G2BA 5DLOA 3VRZA 4XU3A 3UA6A 1X6OA 5KYYB 2QG9B 4M4ZA 4ZGDB 3HRSA 1VQ7Q 2P4TA 3RUXA 5LJ5d 4RCCA 2E5KA 4MZTA 4IUPA 5IT9E 1S1NA 3OS2A 2DRMA 1PKSA 2VGNA 1G3YA 3JB9F 4Z89A 2O88A 3SFMA 2EYQA 4XTXA 5EC7A 5I21A 1M90U 2EQIA 1Y07A 4MDWA 1RAIB 2L8DA 4M78A 2OTLA 4BDZA 3BDLA 1TUDA 4LDUA 3CCEQ 2X51A 2JVVA 3CBOA 5FWBA 3OYYA 2ABLA 1G83A 1ZLMA 2O01E 2R5MA 5EG2A 3VS7A 3M0RA 4M7DG 2JTEA 2LNVA 2QEXQ 2LX7A 1RL2A 3PTAA 2MPXC 2C0OA 1M2VA 5L23A 3TEEA 1QVPA 2CZ1B 5IXBA 3CCUA 3PNWC 3EHQA 1RLPC 4NL2A 2DTOA 2X3XD 4Y28E 3LGLA 2EYYA 2VWFA 3A5ZB 4XAXB 1KFZA 3CPFA 2J6OA 4J9GA 2DERA 3QJYA 3CCMA 4MDXA 2FPDA 2HDAA 2X9HA 1G3SA 4II1A 2ATCB 3QZ9B 2DEQA 4F7UB 4PJOB 2AZSA 3QDFA 2FVUA 4F7UG 2KAFA 4PFPA 5A0DA 3CCSA 3J81E 2A08A 2IG0A 4E7KA 1HJDA 1BCOA 1NPRA 3SDZA 1RLQC 2W10A 4PLLA 4C8QE 1GXIE 3I35A 3JCMJ 3L2ZA 1VIEA 1NJIC 1AWOA 2OTLQ 5HK3A 1OPKA 1IB8A 1GFCA 5GANd 1FWZA 3CCJA 2ESWA 4E7ZA 1MMNA 1ZA2B 2HKQB 4DA4A 1YWOA 3EG9B 4XK8E 1RAEB 4J9EA 4M77F 5KYXA 4PJOF 3OYEA 3O5ZA 4HVVA 2NUTB 2JXBA 4C92A 1MNDA 1VQNA 4FSSA 2MI6A 3EFSA 1KSWA 1YP5A 2DX1A 4ORZA 2LVMA 1FMWA 2ZPIB 3DB4A 4F16A 4FYXB 4XQ3A 3MP8A 4M7AE 1VQKQ 3GBQA 4QVCA 3CCMQ 1PC0A 4LE9A 2OX7A 1UGQB 1S72T 1HSQA 1ZSZB 5GAMe 3QSUA 4XU0A 2CSQA 2HZYA 1JRIA 5I2MA 2X4XA 1B34A 1O75A 2KVQG 2K3BA 2JS0A 1WQWA 2LC4A 3CC4Q 4Y92A 2PNIA 1YJWA 2ZPHB 2JT4A 4EMHA 1NJIU 4M75G 1IHVA 2XG8D 5GAN6 1H8KA 1SHFA 5IH2A 2CT4A 2R58A 1VQ9A 2B8AA 3ZBDA 4AFSC 1ZBJA 3NTIA 1WX6A 3JCMd 2CSIA 4BUGA 4E2FB 1KQ1A 3RMQA 2NUZA 4XU1A 1T3LA 3CPWS 5M9OA 1ARKA 3MEAA 3M0TA 2RQWA 2DFUA 2LJ3A 4C5IA 4IUTA 2HKNA 1M3CA 2CP7A 1W70A 4E47A 1YITT 1DJ7B 2OAUA 3X28B 3JAME 2RJEA 2DRKA 1T0JA 4LUDA 4M77D 2K3YA 1WHMA 5FU7C 4M78F 5KH6A 2GQVA 4PJOD 2VVKA 1MNEA 2XDDA 2F2WA 4QQDA 5GAMh 2F1LA 4OB1B 3M55A 3WVEB 4ZN1A 3E9FA 3FC3A 3M9QA 3D7SB 3LH0A 1E6GA 2FHDA 4OMPA 1KIKA 3R6NA 1HD3A 1KJWA 2E10A 4PJNA 2BIVA 1QVGA 3EG2A 1I1JA 1YJWQ 2CREA 4KGZB 1VQPT 3JCMg 3PMIA 3EFOB 4BI3A 1HK9A 3S3MA 2QK0A 2KRSA 1VQ5T 1M4ZA 1XQHA 5GAN5 2RH2A 1PKTA 2P0PA 3OYNA 3HRUA 3VUZA 1VQ9Q 2IIMA 1M3AA 1WNLA 2C0TA 1PM3A 1YN8A 2DD5A 3S3OA 2QQRA 2EIFA 1X43A 1GCQC 4RTTA 5GAOn 4XTZA 4IURA 2CH4A 3I5SA 3OA6A 4NOYA 2GNCA 4JS5A 1BYMA 1R8OB 4JRIA 1OZ3A 1H641 1V76A 1X69A 1WHJA 2O31A 1RABB 2WSEE 1Z9QA 1K9MC 4ESRA 2V8KA 4CRIA 2EQKA 2P0KA 3MEVA 5IHKA 3A8OB 3BY7A 1UE9A 4RTVA 3G71T 2M1HA 1SSFA 2EQJA 2MOXA 2I2LA 4C92F 4A4GA 3ZL7C 1W6XA 4KT0E 1YI2A 5FU6B 4WTOB 2DJQA 3H6ZA 3L2QA 1OPLA 3A8MB 1PRMC 2MIOA 1MGQA 2O9VA 3HTRA 3O8VA 3PIPA 1WZOA 4OF1A 1U1TA 3LH5A 2LP5A 2BZYA 2M51A 1PSFA 2BTTA 2HQHA 2L2PA 3M57A 2M02A 4QKUA 4BE2A 2D0QB 2ENMA 1YJ9A 4M77E 1U06A 3OYLA 3GOXA 3OS0A 4PJOE 1YCSB 1X6GA 4RCBA 3M4GA 1JJ2P 2GCXA 2E12A 1QQJA 2JN0A 2KY9A 4FIBA 5FRMA 1EIFA 2RQTA 2DXUA 1JBMA 4M7DC 1RAHB 2KT1A 2PVDB 2RJCA 4FYWB 2ZPBB 1GCQA 5L8RE 3VUBA 1Y7XA 2CUDA 5GJWB 2LJ0A 4C8QB 3I56A 4OVAA 2VV5A 1K9MU 5HCKA 4C8QG 2F69A 2DXCA 4RTYA 1TTHB 2A28A 5CAIA 2PTKA 2MCNA 2DYBA 2X4YA 4OMOA 4CC7A 1OZ2A 4JJBA 5C6SA 5GAN3 1VQMA 1WHLA 3UT1A 4LNPA 3QHSA 2Y4YA 2KMTA 2MWOA 4LD9K 1QMCA 3TSZA 3REBB 5LJ3g 4J9CA 3JRZA 1ZSGA 1AZEA 2DXTA 1VQLT 2KSSA 1C0MA 2KQWA 3RMSA 4C0DC 1YITQ 3MCAB 2K79A 4M7AB 2RQRA 2RA2A 1RACB 3MO8A 3GNGA 4C92D 4ATOA 1MV0B 3ZEHA 4RUGA 4HT9A 3VS2A 2HL3A 3OYBA 2DTHA 3TCJA 1H3ZA 1SHGA 1UJ0A 3MPUB 1ABOA 3SB2A 4GY5A 5KYUB 1QVFS 3EG3A 1X2QA 2WACA 3RDVA 2HSPA 3VS4A 4RTWA 1QVGS 2X3WD 3CMEA 2BUDA 3CEYA 3OYKA 1GBQA 1MMGA 2GFAA 3RBBB 2DILA 2DVEA 1VA7A 1WXUA 2EJGA 3R6OA 2D6FA 2P4RA 1WYXA 1VQ5Q 4M78E 4M7DA 2JTFA 3PVLA 2DL8A 1VQMQ 5GAN2 3M0PA 4X9CA 5GAMf 2IVWA 4AT1B 1WA7A 2CZ0B 4UC4A 4HCZA 3AHUA 1IHWA 3E1SA 5DM7R 5IN1A 3I5RA 2YRCA 4PL6A 1GBRA 3RKXA 3ZFJA 3JCMh 4OGEA 2O4XB 2E6ZA 4LXCA 2COYA 2GTOA 5J39A 5CKEA 2EGEA 1GFDA 3BFMA 1K8AR 3CCQT 4C0ZA 4J9IA 1NEBA 2E3IA 3QYHB 2HEQA 3RNJA 1NLOC 2FPFA 4JLGA 4X9DA 2CZ6B 2VUBA 5DY9A 2E5QA 2SRCA 5CQXA 4M75C 3KUFA 3L2WA 2XDBA 3V7CA 1TUCA 5IHNA 3V8JA 1FYNA 4RG8A 3LWIA 4DBFA 1M2OA 1N8RR 3CMEQ 1JEGA 3QUIA 4MZPA 2KBTA 1XOVA 5J3BA 4XTVA 4HCBA 5DLQE 1BI1A 4FL6A 5GMKe 1W4SA 2EGAA 2QEXA 1Q86C 1TUGB 4HVWA 2PVGB 2ROTA 3A8HB 2DZCA 1SEMA 3TREA 2QTVA 4IUVA 4KH1B 3C4SA 2KYBA 3Q1JA 2BE7D 2RD1A 1AZGB 3BE3A 3WVDB 5HY6A 3JB9G 2D9TA 5FW9A 4R55A 4HVUA 5I2SA 2DBMA 5ECAA 3RIRA 4C92E 5IAYA 1PNJA 4HCCA 2VXFA 2SEMA 2JJ9A 4IKFA 2JW4A 1OU8A 2RI2A 3CPWA 3OW2S 2KYMA 4C0FA 2RHIA 2QA4T 1FMKA 1PWTA 3DLMA 5LJ3e 4M7AD 3QWXX 1PCXA 2G3RA 2JMAA 2PUKB 2NLUA 3RESA 3I9QA 2DIQA 3HFNA 3L2UA 2D0NA 2VYTA 2DL3A 1TH7A 1EZZB 1WLPB 4FYVB 2C06A 3FDRA 2K4YA 1C1AA 1K73C 2YLBA 3OYIA 1RUWA 2BZXA 3SWNB 4FU6A 3GF5A 4M75A 1YHQT 2ECZA 3A8GB 3QZ5B 1B07A 4PJLA 5GMKh 3HL8A 4ZNXA 2E65A 1Q86U 1CKBA 1AHJB 2QTXA 1M1KC 2GFUA 1VQLQ 3KFVA 5LJ5g 3EGDA 1VQKA 4OGCA 3DKMA 1SRLA 2CZ7B 3J80E 3EGXA 3S6WA 2QQ9A 2LT1A 1R0CB 4M77B 2A37A 3CBPA 2A36A 3C94A 3ME9A 4M77G 3NHNA 3CCVT 4PJOG 4RTZA 2LQWA 2AK5A 3PVQA 5GAOp 3FIFA 2M9UA 5A2QE 1NM7A 1BI0A 5LJ3h 1Q81R 3ULRB 4JRPA 1K1ZA 1U8RA 3NFCA 2X4JA 1P92A 1WDXA 3N5BB 5KE2A 4P5NA 1KQSA 3CC4A 5GMKm 2GGRA 4JJCA 1KC8R 1M30A 2RHXA
chains in the Genus database with same CATH topology
4O6JA 3URGA 3LH0A 1VQ4A 2FHDA 2VGMA 3CCST 3FRNA 1Q81U 3OSVA 4E7HA 3WXMB 2E10A 2BIVA 1QVGA 4EPCA 2DTIA 1N8RU 4M77C 2PQWA 4DOWA 1K73U 1VQPT 3JCMg 3PMIA 5LJ5f 4ZGEB 1VQ6T 2FB7A 4BI3A 3CCLT 2E1HA 1HK9A 2RK2A 1ZQ1A 3S3MA 1VQLA 2OTJT 1VQ5T 1M4ZA 2DZ9A 4KUDK 3L2VA 1XQHA 2A3LA 2H3JA 2RH2A 5GAN5 2JNGA 1MHNA 3CC2T 2P0PA 3OYNA 1W2BS 2LQ8A 1KHCA 3HRUA 2LCLA 1FX7A 1KHIA 3VUZA 3CCJT 3JB9D 1WNLA 5CO7A 2QEXT 2GF7A 3CC7T 2DD5A 2LCCA 3S3OA 2AHJB 2QQRA 4QQGA 5C0MA 1M1KU 2EIFA 3QIIA 3OYAA 2X4WA 1NE8A 4JJNK 5FRNA 1N27A 3JCMX 5GAOn 3VJPA 4YTLA 4C8QF 3QPHA 4XTZA 2JUFA 4IURA 2VC8A 5FLXE 3A8LB 3OA6A 3QYGB 1U1SA 4NOYA 1VQOT 1VQNT 1WQ7A 1LOJA 3P8HA 4JS5A 5A0LA 1BYMA 3H8ZA 1R8OB 4JRIA 1OZ3A 2DXBA 4BDYA 2R57A 1H641 2V8IA 4ZTFA 5LJ5j 3X26B 3ER0A 5GANg 1Y96A 4B9WA 3MHXA 4KBMB 3FLGA 2WSEE 3M53A 4Q5WA 2M0OA 4QQ6A 2RHYA 1VQ8T 1K9MC 4JLIA 1FXXA 2ZPEB 3M58A 3G6EA 2V8KA 4NS5A 2XU8A 3GNFB 2EQKA 4CRIA 2P0KA 3MEVA 3HRTA 2RJFA 3PIOA 3QKJA 3SWNA 4BY6B 3F70A 2K57A 3A8OB 3BY7A 2PVOB 2L5QA 1JJ2A 1QP2A 3G71T 4MZMA 2M1HA 1G3TA 1SSFA 2EQUA 1WGSA 3CXCA 3JCMW 2EQJA 1KC8C 4HT8A 2Y4XA 1ZBXA 3V7SA 2EKOA 2I2LA 4OB3B 4RG2A 2QDYB 4C92F 4PKCC 4C92C 1KQ2A 4A4GA 3JCMP 4M78B 3UWNA 1V29B 2DD4A 2ZPFB 3META 4KT0E 3UPUA 1YI2A 5FU6B 4M78G 2KK4A 2EFIA 3OS5A 3H6ZA 4M7AF 4LDVA 3L2QA 1QP3A 3A8MB 2LTOA 4M7DB 3CCRT 3HP9A 1WJSA 1MGQA 2WSFE 3O8VA 4FT4A 3PIPA 3CCVT 4JS4A 1D3BB 4N4HA 3VV0A 5CKBA 3OY9A 3CCQA 1YJWT 4OF1A 1U1TA 2RHUA 4BI4A 3OYCA 3GP8A 2QQAA 4ME7A 1I5LA 3MP1A 4WF2A 2MAMA 4L59A 1BIAA 1KG1A 3RKYA 1LNXA 4IUUA 4M77A 4BY6C 5J26A 1OYXA 1PSFA 5GANf 1M1GA 3M4YA 4ELZC 4IUQA 1VQ9T 3M57A 1IREB 2HAXA 2YRVA 4BE2A 2QI2A 2F5TX 2D0QB 2P0QA 3OMGA 1YJ9A 1UGPB 4M77E 1I81A 2BKDN 3OYLA 3GOXA 3P8DA 2DO3A 3OS0A 5LJ5e 3DLLA 4PJOE 4JRKA 3X20B 4RCBA 3M4GA 4M78C 2GCXA 3SD4A 1VQ7A 2E12A 2JN0A 2KY9A 1VQKT 5HK0A 3PMTA 1M8VA 5FU6C 2L89A 4FIBA 5FRMA 1EIFA 4XTYA 2DXUA 1NPPA 1JBMA 3MEWA 2DJZA 3L2RA 4M7DF 4C5GA 4M7DC 4LDYA 4A4FA 1M90C 2PVDB 2RJCA 2ZPBB 4M75F 3RKWA 5L8RE 2K2VA 3CMAA 3GPLA 1G3WA 3UDCA 3VUBA 1UB4A 5HKCA 5GMKl 1JJ2S 4OB0B 1Y7XA 4HA8A 1YIJT 4C8QB 3I56A 3JCMV 4OVAA 5CKHA 2VV5A 3CXCS 3FEOA 2HD0A 1K9MU 1QVFA 2HBPA 4C8QG 3HFOA 2F69A 5GAOq 2DXCA 4C0DB 3NTHA 3V8KA 2XK0A 5D6WA 4EMKB 4E7IA 4J7IA 3LW5E 5CAIA 5GANj 3I55T 4C8QD 3E9GA 3CCEA 4DOVA 3FB9A 3CD6A 4FT2A 2ZPGB 4BE1A 2PU9B 3CC4T 3OYMA 2FYKA 2CKKA 2L3RA 3JSCA 2ZCFB 5CR2A 2X4YA 1KC8U 5CCAA 3OYJA 4FSXA 1OZ2A 5C6SA 5GAN3 3KXTA 4TVRA 3UT1A 1VQMA 1YJNA 1VQ4T 3I56T 5GAN7 4MMLA 1KD1C 2RI5A 3QHSA 4ZGJB 2Y4YA 2MWPA 3LWHA 4E7LA 2KMTA 3BDUA 2MWOA 4BACA 1X01A 2RJDA 4LD9K 4F7UF 2XHCA 4O5VA 3HHTB 3HPWA 2QA4A 4J7FA 4Y91A 5LJ3g 4A4EA 4A4HA 2ZGWA 2DPPB 3JRZA 3MEUA 2DXTA 4C8QC 2RK1A 1VQLT 3KBGA 4C92B 2XD0A 2DIGA 3DB3A 4QVZA 2KSSA 1S72A 3G4SA 4C92G 5A0GA 2KQWA 3RMSA 5GAMg 3X24B 5DLOA 4C0DC 4EMKC 4XU3A 3MCAB 4D6WA 4M7AB 1BI3A 2RA2A 2Y90A 3MO8A 3GNGA 3LGFA 1X6OA 4C5HA 4J8OA 4C92D 3ZEHA 4NL3A 4ATOA 4HT9A 3EFRA 3LX7A 4J6WA 1Q82C 4EMGA 2E70A 1KQSS 3INZA 3OYBA 4J5YA 2DTHA 4ZGDB 3HRSA 5CK9A 2P4TA 3MP6A 2X35A 3TCJA 4Z02A 3RUXA 4RCCA 5LJ5d 3QDRB 4QW2A 1H3ZA 5LJ5h 4MZTA 3C95A 2F5KA 3P8BB 2E64A 3J7AF 1M1FA 4IUPA 3JCMf 3SB2A 4GY5A 4RMOA 4LD6A 5IT9E 3OS2A 1QVFS 2WACA 1YHQA 2VGNA 3JB9F 1G3YA 1QVGS 3CMEA 3SFMA 2BUDA 3CEYA 2EYQA 4JDSA 4XTXA 4A54A 1UGRB 1O9SA 5I21A 3OYKA 1B34B 4PNOA 1M90U 3OSSC 5GANe 2GFAA 1N9RA 1Y07A 2LRQA 4CI0C 1WJQA 4MDWA 4M78A 2L8DA 3ASKA 2OTLA 3QXEB 2DVEA 2QXFA 2EJGA 3R6OA 3BDLA 5GAN4 5GAOl 4BDZA 1Q7YC 2CYZB 2D6FA 4LDUA 3GIBA 3G6ET 4M7AC 2JVVA 3CBOA 3L1AA 3OYYA 3CBMA 3M5AA 4M78E 5LJ3f 4M7DA 2JTFA 2O01E 5GMKj 2R5MA 5EG2A 3S3NA 1N9SA 4N4GA 4M78D 4ELYC 1D3BA 4M75B 4GLKA 4LDXA 4M7DG 2LNVA 1OI1A 4L6V5 5GAN2 4X9CA 5GAMf 2IVWA 3M54A 4HKEA 5GAOr 1RL2A 3PTAA 4M7DD 2CZ0B 4UC4A 3OBYA 4HCZA 3AHUA 3E1SA 3OYHA 5DM7R 5IN1A 1KD1U 3TEEA 1HXDA 3VU3C 1QVPA 2CZ1B 1YI2T 1I8FA 3OB9A 1YITA 4R56A 3JB9H 3CCVA 3CCUA 3PNWC 4PL6A 4QVDA 2JZ2A 2EWNA 4KUIA 2CS7A 4OB2B 4NL2A 3RKXA 3ZFJA 4C5EA 2E41A 2DTOA 1I4K1 3GLXA 4OGEA 1N6AA 3JCMh 4Y28E 2O4XB 2E6ZA 5J39A 3LGLA 2DK3A 2RB6A 1BKBA 5CKEA 3A5ZB 2JTMA 3BFMA 4J83A 4X34A 4XAXB 2ZZDA 3CCQT 2EQMA 4BE0A 3CPFA 1WJRA 4C0ZA 4FM4B 3C12A 3QYHB 3QJYA 3CCMA 4ZN3A 4MDXA 4JLGA 4X9DA 2CGHA 2CZ6B 1G3SA 3OW2A 3JB9J 4II1A 4BD3A 2VUBA 3QZ9B 5DY9A 2DEQA 5LJ3j 2E5QA 4MMKA 4F7UB 4N4IA 4EDUA 5CQXA 2FL7A 3KUFA 4M75C 3L2WA 2FVUA 2K5IA 3LLRA 4PJOB 2XDBA 3NTKA 3V7CA 4F7UG 4C8QA 2KAFA 1Q82U 2LQKA 3V8JA 5A0DA 3CCSA 2R5AA 1YJ9T 3J81E 2IG0A 5GAMj 4E7KA 1NPRA 3QBYA 3SDZA 4RG8A 2XDPA 3LWIA 4PLLA 1X75C 4EMKA 3OS1A 5CIUA 4C8QE 1VQPA 1VQ7T 2MMPA 1GXIE 2XKOC 1VQ6A 4V2SA 3CCLA 2XI9A 1IZ6A 3QUIA 4JRQA 3JCMJ 2OTJA 1VQ5A 2K3XA 4MZPA 3L2ZA 1VIEA 1XOVA 1NJIC 3CC2A 5J3BA 4XTVA 4HCBA 5DLQE 5HK3A 1BI1A 5GANd 1FWZA 4FL6A 3CCJA 5GMKe 1W4SA 5GANh 2K5LA 3CMAT 2QQBA 2QEXA 1Q86C 4DA4A 3OBWA 1UGSB 2PVGB 5KCOA 3A8HB 2WSCE 2DZCA 4N0AC 5CVIA 3TREA 4XK8E 3CC7A 1Q7YU 1RI0A 4IUVA 3BW1A 4M77F 3JCMc 2DAQA 3C4SA 3Q1JA 1ZHIA 2M16A 2RD1A 3M59A 4PJOF 3WVDB 3OYEA 4PJOC 3JCMe 4XU2A 5HY6A 3CCET 5FROA 4C92A 3JB9G 3CD6T 2D9TA 2XICA 4R55A 5GMKi 2KDSA 3RERA 5I2SA 2LDMA 1VQOA 1BIBA 3VKIA 1VQNA 1XTDA 1VQMT 3OYFA 4M7AA 2MI6A 3EFSA 3OQ5A 3RIRA 4C92E 5IAYA 4JUVA 1YJNT 1VUBA 2XIDA 2LVMA 5AYFA 4HCCA 1QW1A 2VXFA 2ZPIB 3DB4A 4KULA 4C0GA 2E6NA 4XQ3A 4M7AG 2RM4A 4IKFA 3MP8A 3V7RA 2LT4A 2RI2A 4J6XA 4A53A 3CPWA 1VQ8A 3OW2S 4M7AE 1PSEA 2RHIA 4C0FA 2QA4T 3DLMA 5LJ3e 4M7AD 2EAYA 3VYGA 4A4KA 4QVCA 1K8AC 4J6YA 4E7JA 2EJFA 2G3RA 2PUKB 2NLUA 1UGQB 1S72T 3G4ST 3HSBA 3RESA 5GAMe 3G71A 4XU0A 3QSUA 1G5VA 4BB7A 2DIQA 2QQSA 3HFNA 4DQ2A 3L2UA 3PT9A 1JRIA 2VYTA 4XTUA 5I2MA 2X4XA 1B34A 3X25B 1TH7A 1O75A 2KVQG 1Y96B 2C06A 1WQWA 2LC4A 1JB0E 3FDRA 1Q81C 1M9SA 1NZ9A 2K4YA 1Y71A 3PGGA 3OMCA 1N8RC 1UEBA 3QO3A 4OP0A 1K73C 3G7ZA 3L42A 2YLBA 5D6XA 3OYIA 3CCRA 3SWNB 5KE3A 4FU6A 3GF5A 4M75A 5KCHA 4RKUE 2RHZA 3JB9I 2ZPHB 1YJWA 2RI3A 1YHQT 2PUOB 1XNIA 3QG1A 4EMHA 3CMET 1NJIU 4M75G 3A8GB 2XG8D 1YBYA 3QZ5B 5GAN6 3JCMb 5GAOm 4M7DE 5GMKh 2A7YA 3HL8A 4M75E 5FU7B 5GAN8 2E65A 1BI2A 2OTLT 2V8JA 4M75D 1Q86U 1AHJB 3HKSA 2HQXA 2R58A 2QTXA 1VQ9A 2YHTA 2B8AA 2HQEA 3ZBDA 1M1KC 2GFUA 3NTIA 3T9NA 1W2BA 3JCMd 2DKGA 2O4XA 3EAEA 5CKFA 5LJ5g 3TU4K 4BUGA 3V8LA 5CKDA 1KQ1A 3E19A 3RMQA 1VQKA 4OGCA 4XU1A 3DKMA 3VYHB 5M9OA 3CPWS 5D6YA 4N0AA 1LJOA 2CZ7B 3MEAA 3S6WA 3J80E 2QQ9A 3JCMQ 2LT1A 3CBPA 4IUTA 4M77B 3SWNC 4C5IA 1M5Q1 3PFSA 4F7UA 3M56A 4PJOA 1VIFA 3C94A 3ME9A 2EJ9A 4M77G 4VUBA 3LYIA 4OMFB 5CQYA 2MF2A 4E47A 1YITT 1YIJA 1DJ7B 5LL6S 3CCUT 2OAUA 4PJOG 3X28B 2JOYA 5GAOp 3JAME 2RJEA 3FIFA 2M9UA 4LDWA 4XTWA 5A2QE 5LJ3d 4F7UE 1BI0A 4M77D 3OYGA 5LJ3h 2K5FA 2K3YA 5FU7C 4M78F 5KH6A 1WPYA 4JRPA 1K8AU 2GQVA 4PJOD 1U8RA 2VXEA 3NFCA 3OYDA 2X4JA 3QJ6A 1P92A 3I55A 4B9XA 2XDDA 5GAMd 3N5BB 4QQDA 4PLIA 4BI8B 5GAMh 3CCMT 5KE2A 4OB1B 4P5NA 1KQSA 4L5GA 3CC4A 1YCYA 2RO0A 2HNIA 3M55A 5GMKm 3WVEB 2YLCA 4ZTJA 3FJPA 4ZN1A 3E9FA 3FC3A 2LX9A 3M9QA 2RHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DB4 A;  2L8D A;  3LH0 A;  3ASK A;  4IUQ A;  2E6N A;  2FHD A;  4BDZ A;  4IKF A;  3BDL A;  2YRV A;  3MP8 A;  4BE2 A;  4E7H A;  2RI2 A;  3OMG A;  2BIV A;  2RHI A;  2BKD N;  3OYL A;  3DLM A;  2PQW A;  3P8D A;  3GOX A;  3OS0 A;  2JTF A;  3PMI A;  4E7J A;  2R5M A;  3S3N A;  4N4G A;  3SD4 A;  2G3R A;  3S3M A;  3PMT A;  2L89 A;  2NLU A;  5FRM A;  3L2V A;  1G5V A;  1OI1 A;  1MHN A;  2DIQ A;  3MEW A;  2QQS A;  3OYN A;  3L2U A;  3L2R A;  1KHC A;  2VYT A;  4C5G A;  4A4F A;  2X4X A;  2RJC A;  4UC4 A;  4HCZ A;  2GF7 A;  3OYH A;  5IN1 A;  2LCC A;  3S3O A;  3OB9 A;  4OVA A;  3FDR A;  2QQR A;  3FEO A;  4QQG A;  3PNW C;  4PL6 A;  5C0M A;  2JZ2 A;  3QII A;  3OYA A;  2X4W A;  3OMC A;  4C5E A;  5FRN A;  1N27 A;  3NTH A;  2XK0 A;  2O4X B;  5D6W A;  5J39 A;  3LGL A;  4E7I A;  3L42 A;  3OYI A;  5D6X A;  3E9G A;  4X34 A;  5KE3 A;  4FU6 A;  4IUR A;  2EQM A;  5KCH A;  4BE0 A;  1WJR A;  2RHZ A;  3OA6 A;  4BE1 A;  2RI3 A;  3OYM A;  2L3R A;  2CKK A;  1XNI A;  2X4Y A;  3P8H A;  3H8Z A;  3OYJ A;  4BDY A;  1OZ3 A;  1OZ2 A;  4II1 A;  2R57 A;  4BD3 A;  5C6S A;  4ZTF A;  3UT1 A;  2E5Q A;  4N4I A;  4EDU A;  4B9W A;  3KUF A;  3L2W A;  3LLR A;  3NTK A;  3FLG A;  2RI5 A;  2HQX A;  2MWP A;  2M0O A;  2R58 A;  4Q5W A;  2RHY A;  2LRQ A;  4QQ6 A;  2B8A A;  2R5A A;  4E7L A;  2HQE A;  2MWO A;  2IG0 A;  4BAC A;  2GFU A;  2RJD A;  4E7K A;  3QBY A;  3NTI A;  2XDP A;  4NS5 A;  4PLL A;  4CRI A;  2EQK A;  2O4X A;  2P0K A;  3EAE A;  3MEV A;  5CIU A;  4A4E A;  2RJF A;  4A4H A;  3OS1 A;  3MEU A;  3QKJ A;  3F70 A;  2DIG A;  5M9O A;  3DB3 A;  4QVZ A;  2M1H A;  5D6Y A;  2K3X A;  1SSF A;  2EQU A;  1WGS A;  1WJQ A;  3MEA A;  2EQJ A;  3S6W A;  2EKO A;  4RG2 A;  4FL6 A;  4C5I A;  4IUT A;  3MO8 A;  3PFS A;  4C5H A;  3LGF A;  4A4G A;  3ZEH A;  3ME9 A;  3LYI A;  3LX7 A;  3UWN A;  5KCO A;  3MET A;  3OYB A;  2EFI A;  2RJE A;  1RI0 A;  3H6Z A;  4IUV A;  2DAQ A;  2X35 A;  3MP6 A;  4Z02 A;  3C4S A;  3OYG A;  3L2Q A;  3Q1J A;  2M16 A;  4QW2 A;  2K3Y A;  1H3Z A;  5KH6 A;  3OYE A;  2F5K A;  2LTO A;  4IUP A;  1WJS A;  4GY5 A;  3O8V A;  3OYD A;  5FRO A;  4LD6 A;  3QJ6 A;  2D9T A;  4N4H A;  4B9X A;  3OS2 A;  3OY9 A;  4QQD A;  2RHU A;  2WAC A;  4PLI A;  5KE2 A;  3OYC A;  2LDM A;  2RO0 A;  3MP1 A;  2BUD A;  3CEY A;  4L59 A;  3OYK A;  3OYF A;  4ZTJ A;  3OQ5 A;  4IUU A;  5IAY A;  2GFA A;  3E9F A;  1OYX A;  5J26 A;  3FC3 A;  3M9Q A;  2LVM A;  2RHX A; 
#chains in the Genus database with same CATH topology
 4O6J A;  2H8H A;  1KK7 A;  3FRN A;  3VS0 A;  3OSV A;  4E7H A;  2B86 A;  4JZ4 A;  2IPO B;  2DTI A;  1AOJ A;  1K73 U;  1VQ6 T;  2FB7 A;  3CCL T;  1T0H A;  2RK2 A;  2OTJ T;  3L2V A;  2A3L A;  3THK A;  1MHN A;  3CC2 T;  1W2B S;  1KHC A;  1KHI A;  3JB9 D;  2MK5 A;  5CO7 A;  3CC7 T;  2AHJ B;  1M1K U;  1NE8 A;  3CCQ Q;  3JCM X;  1JQQ A;  3VJP A;  4YTL A;  3QPH A;  1IO6 A;  2VC8 A;  1ZUK A;  1U1S A;  2H3E B;  1NYF A;  2YT6 A;  1VQO T;  1QLY A;  2NUP A;  5A0L A;  2V8I A;  3ER0 A;  5GAN g;  1Y96 A;  1M90 R;  1QVF P;  3MHX A;  4KBM B;  1QVG P;  1VQ8 T;  4JLI A;  1FXX A;  3M58 A;  2AKK A;  2K9G A;  1WHG A;  3HRT A;  3PIO A;  4BY6 B;  1I5O B;  2K57 A;  2ED1 A;  4OMN A;  3V7S A;  4OB3 B;  3EH2 A;  4PKC C;  1KQ2 A;  1QCF A;  3JCM P;  4M78 B;  2KXD A;  5KYW A;  1V29 B;  4M78 G;  2KK4 A;  2EFI A;  2AZV A;  4LDV A;  1H3H A;  2QDL A;  3CCR T;  2FRY A;  3HP9 A;  2WSF E;  2RNA A;  4N4H A;  1K0S A;  3H9N A;  4F17 A;  4ME7 A;  3MP1 A;  4WF2 A;  2MAM A;  2QAS A;  1KG1 A;  5J26 A;  1M1G A;  2QA4 Q;  1M2V B;  4J9H A;  3VS1 A;  1VYV A;  2YRV A;  1ZA1 B;  3JV3 A;  5LJ5 e;  2KRN A;  3X20 B;  2EGC A;  1OX9 A;  2RN8 A;  2QAZ A;  4LDY A;  4A4F A;  2D8J A;  1SKU B;  1TU0 B;  1QWF A;  4M75 F;  3RKW A;  1G3W A;  5HKC A;  1YIJ T;  4HA8 A;  3CXC S;  1R77 A;  2HD0 A;  2J6K A;  1QVF A;  2HBP A;  2CP6 A;  1M27 C;  2LQN A;  3VS3 A;  5GAO q;  3NTH A;  3V8K A;  4J7I A;  3I55 T;  4DOV A;  4FT2 A;  2ZPG B;  4BE1 A;  2FG0 A;  5IHI A;  2PU9 B;  3OYM A;  2L3R A;  2CKK A;  2CUB A;  8AT1 B;  4RTU A;  1YNZ A;  1VQ4 T;  2AIR B;  3I56 T;  1KD1 C;  4ZGJ B;  4E7L A;  2YUQ A;  3BDU A;  2OJ2 A;  3HHT B;  4J7F A;  5KYX B;  2AKL A;  3EG0 A;  4Y91 A;  2XMF A;  4A4H A;  2ZGW A;  2PZ1 A;  2EVR A;  1H92 A;  4C92 B;  3OW2 P;  1J3T A;  1S72 A;  4B6M A;  1YWP A;  4C92 G;  5A0G A;  4EMK C;  4D6W A;  2VKN A;  3LGF A;  2HCK A;  2LMJ A;  4J8O A;  3LX7 A;  4J6W A;  1Q82 C;  4EMG A;  3SEM A;  1KQS S;  4J5Y A;  2X35 A;  4F14 A;  3QDR B;  4QW2 A;  5LJ5 h;  2F5K A;  2E64 A;  3J7A F;  1M1F A;  4RMO A;  2HL5 C;  4R0K A;  2COZ A;  4JDS A;  2DL7 A;  4OML A;  1B34 B;  4PNO A;  5GAN e;  4HCK A;  2LRQ A;  4PFO A;  2QXF A;  3HSB A;  5GAN 4;  1Q7Y C;  2KNB B;  3CCL Q;  2F2X A;  3G6E T;  3A1P A;  2OTJ Q;  3L1A A;  3H0F A;  3M5A A;  5LJ3 f;  3MKD A;  1N9S A;  4N4G A;  4M78 D;  4CC4 B;  4ELY C;  1ACM B;  1D3B A;  4GLK A;  4PFZ A;  4LDX A;  1OI1 A;  4L6V 5;  3M54 A;  4HKE A;  3CC7 Q;  2RF0 A;  8ATC B;  3OBY A;  1EFN A;  2KI7 A;  3OYH A;  4J9D A;  1KD1 U;  3VU3 C;  1YIT A;  2JZ2 A;  2EWN A;  4KUI A;  4OB2 B;  4C5E A;  4CC3 A;  1N6A A;  1S72 Q;  1VQO Q;  2NYS A;  2RB6 A;  1BKB A;  3M0S A;  2ZZD A;  2EQM A;  4FM4 B;  1TG0 A;  3CQT A;  3OW2 A;  4BD3 A;  4D8K A;  4N4I A;  1PG5 B;  2DBK A;  1Q82 U;  1HYO A;  2HMA A;  5GAM j;  1NYG A;  2HSE B;  3QBY A;  1WXT A;  4EMK A;  1IGQ A;  1VQP A;  1VQ7 T;  3REA B;  4KGX B;  2XI9 A;  4EIK A;  1IZ6 A;  4JRQ A;  9ATC B;  1VQ5 A;  2E3H A;  1QCO A;  1Y0M A;  4E7S A;  1K76 A;  5GAN h;  2K5L A;  4PJM A;  3CMA T;  2QQB A;  1FMV A;  2DA9 A;  3OBW A;  1UGS B;  1AWJ A;  5KCO A;  4N0A C;  2WSC E;  1Q7Y U;  1W2B P;  3CCR Q;  1RI0 A;  3JCM c;  2DAQ A;  5D7U A;  1ZHI A;  4PJO C;  5I22 A;  3JCM e;  2Z0W A;  3CCE T;  5FRO A;  3CD6 T;  2XIC A;  5I11 A;  5GMK i;  2KDS A;  3RER A;  1BIB A;  1XTD A;  2EYX A;  3OYF A;  1AEY A;  1YJN T;  2XID A;  5KYY A;  4C0G A;  2E6N A;  4M7A G;  2RM4 A;  1JXM A;  4A4K A;  2D1X A;  4AFZ C;  4J6Y A;  4E7J A;  2KR3 A;  4HXJ A;  3G4S T;  3G71 A;  1G5V A;  4BB7 A;  1YIJ Q;  1LPL A;  3PT9 A;  4XTU A;  2DET A;  4DBQ A;  6AT1 B;  2DNU A;  1BK2 A;  1JB0 E;  1Q81 C;  1VQP Q;  2LNH B;  1Y71 A;  3I55 Q;  2COW A;  3QO3 A;  1VOM A;  1LCK A;  3L42 A;  3JB9 I;  2RHZ A;  2L3S A;  2DVJ A;  1VQ4 Q;  1XNI A;  3QG1 A;  1YBY A;  4J9F A;  2L3Q A;  4M75 E;  5FU7 B;  1BI2 A;  2OTL T;  3CPW P;  1ZSZ C;  2HQX A;  4KGV B;  2HQE A;  2DL5 A;  3VS5 A;  2CP5 A;  4QT7 A;  2DL4 A;  3T9N A;  1TXQ A;  1W2B A;  2K6D A;  3EAE A;  3M0Q A;  2I0N A;  3TU4 K;  3V8L A;  5CKD A;  3E19 A;  3VYH B;  1UHF A;  5D6Y A;  4LUE A;  2YUP A;  4N0A A;  3SHW A;  1UGV A;  1JU5 C;  4GLM A;  4F7U A;  4PJO A;  1UG1 A;  1VIF A;  2EJ9 A;  1D0X A;  3NMZ C;  4AMC A;  4VUB A;  2MF2 A;  1VYT A;  3CCU T;  2GBQ A;  2LCS A;  3OYG A;  2K5F A;  1K9M R;  1WPY A;  2J6F A;  3G71 Q;  1D1A A;  3UAT A;  1I0C A;  3QJ6 A;  4B9X A;  5GAM d;  1AWX A;  4BI8 B;  3CCM T;  2M0Y A;  4L5G A;  2RO0 A;  2YLC A;  1GL5 A;  1RI9 A;  3FJP A;  2RMO A;  2KGT A;  3G6E Q;  3EG9 A;  2VGM A;  3CCS T;  1Q81 U;  2VAS A;  1PRL C;  4EPC A;  2KT8 A;  7AT1 B;  1T3S A;  5LJ5 f;  2NUT A;  2E1H A;  1ZQ1 A;  1VQL A;  2DZ9 A;  2JNG A;  1A0N B;  5IXF A;  3CCJ T;  1U5S A;  1RAD B;  2LCC A;  1WI7 A;  1NG2 A;  5C0M A;  1IRX A;  1TSF A;  1EX4 A;  1K9A A;  4F04 B;  5FRN A;  1N27 A;  5GJV B;  1BBZ A;  2JUF A;  1KQS P;  1E7O A;  1ZSZ A;  1VQN T;  1WQ7 A;  3P8H A;  1D1C A;  2DXB A;  2OI3 A;  3X26 B;  1UEC A;  4Q5W A;  2M0O A;  4QQ6 A;  2RHY A;  1TOV A;  4FW1 A;  2ZPE B;  1PHT A;  2EYW A;  3GNF B;  5KYN A;  3QKJ A;  3F70 A;  2ZAE A;  2PVO B;  3NPF A;  1D09 B;  1QP2 A;  3CMA Q;  2YXY A;  3CXC A;  2Y4X A;  2EKO A;  4RG2 A;  4C92 C;  2OAW A;  1XJW B;  2ZPF B;  4DEY A;  1M3B A;  3OS5 A;  3CD6 Q;  2O2O A;  4CC2 A;  4M7D B;  4JJD A;  4FT4 A;  1YJW T;  3VV0 A;  3OY9 A;  3CCQ A;  4OMM A;  2RHU A;  1YJN Q;  1CSK A;  3OYC A;  3GP8 A;  3H0H A;  1BIA A;  3RKY A;  4IUU A;  3U23 A;  1PD0 A;  1OYX A;  5GAN f;  3M4Y A;  3PE0 A;  1VQ9 T;  2QI2 A;  2F5T X;  1Z9Z A;  2RQV A;  3OMG A;  1QKW A;  1G8X A;  3P8D A;  1X6B A;  2DO3 A;  3G4S Q;  1ABQ A;  5HK0 A;  1M8V A;  5FU6 C;  2L89 A;  2O9S A;  2NWM A;  4XTY A;  2YUO A;  2J06 A;  4M7D F;  1TS9 A;  4DEX A;  1MUZ A;  4PK4 A;  2K2V A;  3GPL A;  1OEB A;  3UDC A;  1JJ2 S;  1ZUU A;  5CKH A;  1VYU A;  4C0D B;  2QGF B;  1W1F A;  2XK0 A;  3EFO A;  3LW5 E;  3H41 A;  2L3P A;  3FB9 A;  3TQ7 P;  2FYK A;  3JSC A;  5CCA A;  1NLP C;  4FSX A;  3KXT A;  4TVR A;  2FEI A;  2FO0 A;  1QWE A;  5GAN 7;  3UA7 A;  3LWH A;  2JM9 A;  2MWP A;  4FYY B;  2DLP A;  1X01 A;  2D8H A;  4F7U F;  2XHC A;  4O5V A;  1WHK A;  1C6V X;  2QA4 A;  2MYS A;  4A4E A;  4C8Q C;  4E6R A;  2DIG A;  2V26 A;  1PD1 A;  3DB3 A;  1JXO A;  3X24 B;  2KE9 A;  1UFF A;  4Z8A A;  3CCU Q;  2J05 A;  1BI3 A;  4JPB W;  2Y90 A;  4C5H A;  4NL3 A;  1AD5 A;  1ZX6 A;  3EFR A;  2E70 A;  3INZ A;  5CK9 A;  3MP6 A;  4Z02 A;  2HBW A;  3C95 A;  3P8B B;  2FZK B;  2W0Z A;  3JCM f;  4LD6 A;  2DE0 X;  4DBH A;  2LJ1 A;  1YHQ A;  4A54 A;  1UGR B;  1O9S A;  3CCS Q;  3OSS C;  1MMD A;  1N9R A;  4CI0 C;  1WJQ A;  3ASK A;  3QXE B;  5GAO l;  1F1B B;  2CYZ B;  1Q86 R;  3GIB A;  4IIO A;  3G1J A;  4M7A C;  3CBM A;  4A63 B;  1BB9 A;  5GMK j;  3S3N A;  3CCJ Q;  4M75 B;  2C0I A;  1M8M A;  1OUL A;  1D1B A;  5GAO r;  1AWW A;  4AFQ C;  4M7D D;  2V1R A;  1HXD A;  2FRW A;  2QGG A;  1YI2 T;  1I8F A;  2GQI A;  3OB9 A;  4R56 A;  3JB9 H;  3CCV A;  4FW2 A;  4QVD A;  2A0F B;  2CS7 A;  2ROL A;  2E41 A;  1I4K 1;  1N5Z A;  3GLX A;  3EGU A;  1VQN Q;  3EGD B;  2DK3 A;  2JM8 A;  2JTM A;  4J83 A;  4X34 A;  4BE0 A;  1WJR A;  1OX8 A;  3C12 A;  4ZN3 A;  2KRM A;  3EGX B;  2CGH A;  2DM1 A;  3JB9 J;  5LJ3 j;  4MMK A;  4EDU A;  2FL7 A;  2KEA A;  2V1Q A;  2K5I A;  3LLR A;  3NTK A;  4C8Q A;  2LQK A;  1OV3 A;  2R5A A;  1YJ9 T;  2EW3 A;  2XDP A;  2YUN A;  1X75 C;  1RAG B;  3OS1 A;  5CIU A;  1YHQ Q;  1WFW A;  1Y57 A;  2MMP A;  2XKO C;  1VQ6 A;  4V2S A;  3CCL A;  2KRO A;  1K73 R;  1SPK A;  2OTJ A;  1UUE A;  2K3X A;  3EH1 A;  4IIM A;  3CC2 A;  1AVZ C;  3C0C A;  2F2V A;  3CC7 A;  5CVI A;  4KRT A;  3BW1 A;  4D8D A;  1X27 A;  2M16 A;  2DF6 A;  3M59 A;  1M1K R;  4XU2 A;  2K2M A;  1U3O A;  2LDM A;  1UDL A;  1VQO A;  3FJ5 A;  3VKI A;  2EKH A;  1K0X A;  1VQM T;  2FPE A;  1X2K A;  4PJJ A;  3OQ5 A;  4M7A A;  3CCV Q;  1GRI A;  4JUV A;  2DMO A;  1VUB A;  4DBR A;  5AYF A;  1QW1 A;  4KUL A;  4Z88 A;  1B7T A;  2CT3 A;  1QKX A;  3V7R A;  2LT4 A;  4J6X A;  4A53 A;  1VQ8 A;  1PSE A;  1JO8 A;  1YFN A;  2EAY A;  3VYG A;  1K8A C;  2EJF A;  5KYU A;  2QYZ A;  2YWW A;  2QQS A;  4DQ2 A;  2NUP B;  3MJX A;  1BCM A;  3X25 B;  1NJI R;  5FWC A;  1Y96 B;  1WIE A;  3M0U A;  1M9S A;  1NZ9 A;  1VQ6 Q;  3PGG A;  2K7A A;  3OMC A;  1N8R C;  1UEB A;  2J7I A;  2YSQ A;  4OP0 A;  3G7Z A;  5D6X A;  3CCR A;  3CC2 Q;  5KE3 A;  5KCH A;  4RKU E;  2FZG B;  2RI3 A;  2PUO B;  2RPN A;  1NEG A;  3CME T;  3JCM b;  4M7D E;  5GAO m;  1ZUY A;  2A7Y A;  2DEU A;  5GAN 8;  2V8J A;  2L0A A;  3A98 A;  4M75 D;  1I07 A;  3HKS A;  5KYW B;  2YHT A;  3TVT A;  2G6F X;  2BE9 B;  2AT1 B;  1MV3 A;  2DKG A;  2O4X A;  5CKF A;  2EBP A;  2EPD A;  1OQK A;  3NGP A;  1LJO A;  3IQL A;  2DYI A;  3JCM Q;  3SWN C;  1M5Q 1;  3PFS A;  1VQ8 Q;  3M56 A;  5CQY A;  3LYI A;  4OMF B;  1YIJ A;  5LL6 S;  2ED0 A;  2JOY A;  2BZ8 A;  4XTW A;  4LDW A;  1SSH A;  5LJ3 d;  4F7U E;  2P84 A;  2YDL A;  3TSW A;  1K8A U;  2VXE A;  3OYD A;  3I55 A;  4PLI A;  1YCY A;  2HNI A;  4ZTJ A;  1NBE B;  2LX9 A;  1D0Z A;  3URG A;  1VQ4 A;  1RAF B;  3H0I A;  3WXM B;  1WXB A;  2LZ6 B;  1IXD A;  1N8R U;  4M77 C;  2PQW A;  4DOW A;  2YRD A;  4ZGE B;  3RR6 A;  2JMC A;  4KUD K;  2H3J A;  2LQ8 A;  4WCI A;  2LCL A;  1FX7 A;  1UHC A;  1YI2 Q;  2QEX T;  2GF7 A;  2KXC A;  3AT1 B;  1Q95 G;  4QQG A;  4X1V A;  3QII A;  3OYA A;  2X4W A;  4JJN K;  4C8Q F;  2EYZ A;  4FCY A;  5FLX E;  1K4U S;  3A8L B;  3QYG B;  1QCN A;  1LOJ A;  3H8Z A;  4BDY A;  2FZC B;  2R57 A;  4RTX A;  4ZTF A;  1YJ9 Q;  5LJ5 j;  4B9W A;  4JZ3 A;  1D0Y A;  3FLG A;  3M53 A;  3G6E A;  4NS5 A;  2XU8 A;  1SG5 A;  2RQU A;  3VS6 A;  2RJF A;  3SWN A;  2L5Q A;  1R0B G;  1JJ2 A;  1IGU A;  4MZM A;  1G3T A;  2EQU A;  1WGS A;  3JCM W;  1KC8 C;  4HT8 A;  2E4H A;  1ZBX A;  3I56 Q;  2QDY B;  4ANJ A;  3UWN A;  2DD4 A;  3MET A;  3UPU A;  2CH4 W;  4KH0 B;  1KD1 R;  4M7A F;  2JS2 A;  1QP3 A;  4LN2 A;  3UF4 A;  2LTO A;  1WJS A;  4JS4 A;  4AG2 C;  1AT1 B;  1D3B B;  5CKB A;  4OMQ A;  4BI4 A;  2QQA A;  1I5L A;  3EHR A;  4L59 A;  1TWB A;  1LNX A;  1CKA A;  4M77 A;  4BY6 C;  1BU1 A;  4ELZ C;  4J9B A;  4IUQ A;  1IRE B;  2HAX A;  2P0Q A;  1OU9 A;  1UGP B;  3VRY A;  4K11 A;  1Q82 R;  1I81 A;  2BKD N;  3DLL A;  4JRK A;  3QWY A;  4M78 C;  1SRM A;  3SD4 A;  4AFU C;  1VQ7 A;  1VQK T;  3PMT A;  2GTJ A;  3CXC P;  3EG1 A;  1NPP A;  3MEW A;  2DJZ A;  3L2R A;  1GCP A;  4C5G A;  1B3Q A;  5AT1 B;  2CDT A;  1M90 C;  3CMA A;  1UB4 A;  5GMK l;  4OB0 B;  3JCM V;  3FEO A;  1Q7Y R;  3HFO A;  5D6W A;  4EMK B;  4E7I A;  1UTI A;  1LVK A;  5GAN j;  4C8Q D;  3E9G A;  3CCE A;  3CD6 A;  2CP3 A;  1OOT A;  3CC4 T;  1MMA A;  2ZCF B;  5CR2 A;  1KC8 U;  3OYJ A;  2CP2 A;  3E2U A;  1YJN A;  1UJY A;  4MML A;  2RI5 A;  1V1C A;  4GBQ A;  4BAC A;  2RJD A;  3HPW A;  1SF9 A;  1WHH A;  1RAA B;  2DPP B;  2VB6 A;  3MEU A;  4AG1 C;  2RK1 A;  3KBG A;  2XD0 A;  2CP0 A;  4QVZ A;  3G4S A;  1E6H A;  5GAM g;  1G2B A;  5DLO A;  3VRZ A;  4XU3 A;  3UA6 A;  1X6O A;  5KYY B;  2QG9 B;  4M4Z A;  4ZGD B;  3HRS A;  1VQ7 Q;  2P4T A;  3RUX A;  5LJ5 d;  4RCC A;  2E5K A;  4MZT A;  4IUP A;  5IT9 E;  1S1N A;  3OS2 A;  2DRM A;  1PKS A;  2VGN A;  1G3Y A;  3JB9 F;  4Z89 A;  2O88 A;  3SFM A;  2EYQ A;  4XTX A;  5EC7 A;  5I21 A;  1M90 U;  2EQI A;  1Y07 A;  4MDW A;  1RAI B;  2L8D A;  4M78 A;  2OTL A;  4BDZ A;  3BDL A;  1TUD A;  4LDU A;  3CCE Q;  2X51 A;  2JVV A;  3CBO A;  5FWB A;  3OYY A;  2ABL A;  1G83 A;  1ZLM A;  2O01 E;  2R5M A;  5EG2 A;  3VS7 A;  3M0R A;  4M7D G;  2JTE A;  2LNV A;  2QEX Q;  2LX7 A;  1RL2 A;  3PTA A;  2MPX C;  2C0O A;  1M2V A;  5L23 A;  3TEE A;  1QVP A;  2CZ1 B;  5IXB A;  3CCU A;  3PNW C;  3EHQ A;  1RLP C;  4NL2 A;  2DTO A;  2X3X D;  4Y28 E;  3LGL A;  2EYY A;  2VWF A;  3A5Z B;  4XAX B;  1KFZ A;  3CPF A;  2J6O A;  4J9G A;  2DER A;  3QJY A;  3CCM A;  4MDX A;  2FPD A;  2HDA A;  2X9H A;  1G3S A;  4II1 A;  2ATC B;  3QZ9 B;  2DEQ A;  4F7U B;  4PJO B;  2AZS A;  3QDF A;  2FVU A;  4F7U G;  2KAF A;  4PFP A;  5A0D A;  3CCS A;  3J81 E;  2A08 A;  2IG0 A;  4E7K A;  1HJD A;  1BCO A;  1NPR A;  3SDZ A;  1RLQ C;  2W10 A;  4PLL A;  4C8Q E;  1GXI E;  3I35 A;  3JCM J;  3L2Z A;  1VIE A;  1NJI C;  1AWO A;  2OTL Q;  5HK3 A;  1OPK A;  1IB8 A;  1GFC A;  5GAN d;  1FWZ A;  3CCJ A;  2ESW A;  4E7Z A;  1MMN A;  1ZA2 B;  2HKQ B;  4DA4 A;  1YWO A;  3EG9 B;  4XK8 E;  1RAE B;  4J9E A;  4M77 F;  5KYX A;  4PJO F;  3OYE A;  3O5Z A;  4HVV A;  2NUT B;  2JXB A;  4C92 A;  1MND A;  1VQN A;  4FSS A;  2MI6 A;  3EFS A;  1KSW A;  1YP5 A;  2DX1 A;  4ORZ A;  2LVM A;  1FMW A;  2ZPI B;  3DB4 A;  4F16 A;  4FYX B;  4XQ3 A;  3MP8 A;  4M7A E;  1VQK Q;  3GBQ A;  4QVC A;  3CCM Q;  1PC0 A;  4LE9 A;  2OX7 A;  1UGQ B;  1S72 T;  1HSQ A;  1ZSZ B;  5GAM e;  3QSU A;  4XU0 A;  2CSQ A;  2HZY A;  1JRI A;  5I2M A;  2X4X A;  1B34 A;  1O75 A;  2KVQ G;  2K3B A;  2JS0 A;  1WQW A;  2LC4 A;  3CC4 Q;  4Y92 A;  2PNI A;  1YJW A;  2ZPH B;  2JT4 A;  4EMH A;  1NJI U;  4M75 G;  1IHV A;  2XG8 D;  5GAN 6;  1H8K A;  1SHF A;  5IH2 A;  2CT4 A;  2R58 A;  1VQ9 A;  2B8A A;  3ZBD A;  4AFS C;  1ZBJ A;  3NTI A;  1WX6 A;  3JCM d;  2CSI A;  4BUG A;  4E2F B;  1KQ1 A;  3RMQ A;  2NUZ A;  4XU1 A;  1T3L A;  3CPW S;  5M9O A;  1ARK A;  3MEA A;  3M0T A;  2RQW A;  2DFU A;  2LJ3 A;  4C5I A;  4IUT A;  2HKN A;  1M3C A;  2CP7 A;  1W70 A;  4E47 A;  1YIT T;  1DJ7 B;  2OAU A;  3X28 B;  3JAM E;  2RJE A;  2DRK A;  1T0J A;  4LUD A;  4M77 D;  2K3Y A;  1WHM A;  5FU7 C;  4M78 F;  5KH6 A;  2GQV A;  4PJO D;  2VVK A;  1MNE A;  2XDD A;  2F2W A;  4QQD A;  5GAM h;  2F1L A;  4OB1 B;  3M55 A;  3WVE B;  4ZN1 A;  3E9F A;  3FC3 A;  3M9Q A;  3D7S B;  3LH0 A;  1E6G A;  2FHD A;  4OMP A;  1KIK A;  3R6N A;  1HD3 A;  1KJW A;  2E10 A;  4PJN A;  2BIV A;  1QVG A;  3EG2 A;  1I1J A;  1YJW Q;  2CRE A;  4KGZ B;  1VQP T;  3JCM g;  3PMI A;  3EFO B;  4BI3 A;  1HK9 A;  3S3M A;  2QK0 A;  2KRS A;  1VQ5 T;  1M4Z A;  1XQH A;  5GAN 5;  2RH2 A;  1PKT A;  2P0P A;  3OYN A;  3HRU A;  3VUZ A;  1VQ9 Q;  2IIM A;  1M3A A;  1WNL A;  2C0T A;  1PM3 A;  1YN8 A;  2DD5 A;  3S3O A;  2QQR A;  2EIF A;  1X43 A;  1GCQ C;  4RTT A;  5GAO n;  4XTZ A;  4IUR A;  2CH4 A;  3I5S A;  3OA6 A;  4NOY A;  2GNC A;  4JS5 A;  1BYM A;  1R8O B;  4JRI A;  1OZ3 A;  1H64 1;  1V76 A;  1X69 A;  1WHJ A;  2O31 A;  1RAB B;  2WSE E;  1Z9Q A;  1K9M C;  4ESR A;  2V8K A;  4CRI A;  2EQK A;  2P0K A;  3MEV A;  5IHK A;  3A8O B;  3BY7 A;  1UE9 A;  4RTV A;  3G71 T;  2M1H A;  1SSF A;  2EQJ A;  2MOX A;  2I2L A;  4C92 F;  4A4G A;  3ZL7 C;  1W6X A;  4KT0 E;  1YI2 A;  5FU6 B;  4WTO B;  2DJQ A;  3H6Z A;  3L2Q A;  1OPL A;  3A8M B;  1PRM C;  2MIO A;  1MGQ A;  2O9V A;  3HTR A;  3O8V A;  3PIP A;  1WZO A;  4OF1 A;  1U1T A;  3LH5 A;  2LP5 A;  2BZY A;  2M51 A;  1PSF A;  2BTT A;  2HQH A;  2L2P A;  3M57 A;  2M02 A;  4QKU A;  4BE2 A;  2D0Q B;  2ENM A;  1YJ9 A;  4M77 E;  1U06 A;  3OYL A;  3GOX A;  3OS0 A;  4PJO E;  1YCS B;  1X6G A;  4RCB A;  3M4G A;  1JJ2 P;  2GCX A;  2E12 A;  1QQJ A;  2JN0 A;  2KY9 A;  4FIB A;  5FRM A;  1EIF A;  2RQT A;  2DXU A;  1JBM A;  4M7D C;  1RAH B;  2KT1 A;  2PVD B;  2RJC A;  4FYW B;  2ZPB B;  1GCQ A;  5L8R E;  3VUB A;  1Y7X A;  2CUD A;  5GJW B;  2LJ0 A;  4C8Q B;  3I56 A;  4OVA A;  2VV5 A;  1K9M U;  5HCK A;  4C8Q G;  2F69 A;  2DXC A;  4RTY A;  1TTH B;  2A28 A;  5CAI A;  2PTK A;  2MCN A;  2DYB A;  2X4Y A;  4OMO A;  4CC7 A;  1OZ2 A;  4JJB A;  5C6S A;  5GAN 3;  1VQM A;  1WHL A;  3UT1 A;  4LNP A;  3QHS A;  2Y4Y A;  2KMT A;  2MWO A;  4LD9 K;  1QMC A;  3TSZ A;  3REB B;  5LJ3 g;  4J9C A;  3JRZ A;  1ZSG A;  1AZE A;  2DXT A;  1VQL T;  2KSS A;  1C0M A;  2KQW A;  3RMS A;  4C0D C;  1YIT Q;  3MCA B;  2K79 A;  4M7A B;  2RQR A;  2RA2 A;  1RAC B;  3MO8 A;  3GNG A;  4C92 D;  4ATO A;  1MV0 B;  3ZEH A;  4RUG A;  4HT9 A;  3VS2 A;  2HL3 A;  3OYB A;  2DTH A;  3TCJ A;  1H3Z A;  1SHG A;  1UJ0 A;  3MPU B;  1ABO A;  3SB2 A;  4GY5 A;  5KYU B;  1QVF S;  3EG3 A;  1X2Q A;  2WAC A;  3RDV A;  2HSP A;  3VS4 A;  4RTW A;  1QVG S;  2X3W D;  3CME A;  2BUD A;  3CEY A;  3OYK A;  1GBQ A;  1MMG A;  2GFA A;  3RBB B;  2DIL A;  2DVE A;  1VA7 A;  1WXU A;  2EJG A;  3R6O A;  2D6F A;  2P4R A;  1WYX A;  1VQ5 Q;  4M78 E;  4M7D A;  2JTF A;  3PVL A;  2DL8 A;  1VQM Q;  5GAN 2;  3M0P A;  4X9C A;  5GAM f;  2IVW A;  4AT1 B;  1WA7 A;  2CZ0 B;  4UC4 A;  4HCZ A;  3AHU A;  1IHW A;  3E1S A;  5DM7 R;  5IN1 A;  3I5R A;  2YRC A;  4PL6 A;  1GBR A;  3RKX A;  3ZFJ A;  3JCM h;  4OGE A;  2O4X B;  2E6Z A;  4LXC A;  2COY A;  2GTO A;  5J39 A;  5CKE A;  2EGE A;  1GFD A;  3BFM A;  1K8A R;  3CCQ T;  4C0Z A;  4J9I A;  1NEB A;  2E3I A;  3QYH B;  2HEQ A;  3RNJ A;  1NLO C;  2FPF A;  4JLG A;  4X9D A;  2CZ6 B;  2VUB A;  5DY9 A;  2E5Q A;  2SRC A;  5CQX A;  4M75 C;  3KUF A;  3L2W A;  2XDB A;  3V7C A;  1TUC A;  5IHN A;  3V8J A;  1FYN A;  4RG8 A;  3LWI A;  4DBF A;  1M2O A;  1N8R R;  3CME Q;  1JEG A;  3QUI A;  4MZP A;  2KBT A;  1XOV A;  5J3B A;  4XTV A;  4HCB A;  5DLQ E;  1BI1 A;  4FL6 A;  5GMK e;  1W4S A;  2EGA A;  2QEX A;  1Q86 C;  1TUG B;  4HVW A;  2PVG B;  2ROT A;  3A8H B;  2DZC A;  1SEM A;  3TRE A;  2QTV A;  4IUV A;  4KH1 B;  3C4S A;  2KYB A;  3Q1J A;  2BE7 D;  2RD1 A;  1AZG B;  3BE3 A;  3WVD B;  5HY6 A;  3JB9 G;  2D9T A;  5FW9 A;  4R55 A;  4HVU A;  5I2S A;  2DBM A;  5ECA A;  3RIR A;  4C92 E;  5IAY A;  1PNJ A;  4HCC A;  2VXF A;  2SEM A;  2JJ9 A;  4IKF A;  2JW4 A;  1OU8 A;  2RI2 A;  3CPW A;  3OW2 S;  2KYM A;  4C0F A;  2RHI A;  2QA4 T;  1FMK A;  1PWT A;  3DLM A;  5LJ3 e;  4M7A D;  3QWX X;  1PCX A;  2G3R A;  2JMA A;  2PUK B;  2NLU A;  3RES A;  3I9Q A;  2DIQ A;  3HFN A;  3L2U A;  2D0N A;  2VYT A;  2DL3 A;  1TH7 A;  1EZZ B;  1WLP B;  4FYV B;  2C06 A;  3FDR A;  2K4Y A;  1C1A A;  1K73 C;  2YLB A;  3OYI A;  1RUW A;  2BZX A;  3SWN B;  4FU6 A;  3GF5 A;  4M75 A;  1YHQ T;  2ECZ A;  3A8G B;  3QZ5 B;  1B07 A;  4PJL A;  5GMK h;  3HL8 A;  4ZNX A;  2E65 A;  1Q86 U;  1CKB A;  1AHJ B;  2QTX A;  1M1K C;  2GFU A;  1VQL Q;  3KFV A;  5LJ5 g;  3EGD A;  1VQK A;  4OGC A;  3DKM A;  1SRL A;  2CZ7 B;  3J80 E;  3EGX A;  3S6W A;  2QQ9 A;  2LT1 A;  1R0C B;  4M77 B;  2A37 A;  3CBP A;  2A36 A;  3C94 A;  3ME9 A;  4M77 G;  3NHN A;  3CCV T;  4PJO G;  4RTZ A;  2LQW A;  2AK5 A;  3PVQ A;  5GAO p;  3FIF A;  2M9U A;  5A2Q E;  1NM7 A;  1BI0 A;  5LJ3 h;  1Q81 R;  3ULR B;  4JRP A;  1K1Z A;  1U8R A;  3NFC A;  2X4J A;  1P92 A;  1WDX A;  3N5B B;  5KE2 A;  4P5N A;  1KQS A;  3CC4 A;  5GMK m;  2GGR A;  4JJC A;  1KC8 R;  1M30 A;  2RHX A; 
#chains in the Genus database with same CATH homology
 4O6J A;  3URG A;  3LH0 A;  1VQ4 A;  2FHD A;  2VGM A;  3CCS T;  3FRN A;  1Q81 U;  3OSV A;  4E7H A;  3WXM B;  2E10 A;  2BIV A;  1QVG A;  4EPC A;  2DTI A;  1N8R U;  4M77 C;  2PQW A;  4DOW A;  1K73 U;  1VQP T;  3JCM g;  3PMI A;  5LJ5 f;  4ZGE B;  1VQ6 T;  2FB7 A;  4BI3 A;  3CCL T;  2E1H A;  1HK9 A;  2RK2 A;  1ZQ1 A;  3S3M A;  1VQL A;  2OTJ T;  1VQ5 T;  1M4Z A;  2DZ9 A;  4KUD K;  3L2V A;  1XQH A;  2A3L A;  2H3J A;  2RH2 A;  5GAN 5;  2JNG A;  1MHN A;  3CC2 T;  2P0P A;  3OYN A;  1W2B S;  2LQ8 A;  1KHC A;  3HRU A;  2LCL A;  1FX7 A;  1KHI A;  3VUZ A;  3CCJ T;  3JB9 D;  1WNL A;  5CO7 A;  2QEX T;  2GF7 A;  3CC7 T;  2DD5 A;  2LCC A;  3S3O A;  2AHJ B;  2QQR A;  4QQG A;  5C0M A;  1M1K U;  2EIF A;  3QII A;  3OYA A;  2X4W A;  1NE8 A;  4JJN K;  5FRN A;  1N27 A;  3JCM X;  5GAO n;  3VJP A;  4YTL A;  4C8Q F;  3QPH A;  4XTZ A;  2JUF A;  4IUR A;  2VC8 A;  5FLX E;  3A8L B;  3OA6 A;  3QYG B;  1U1S A;  4NOY A;  1VQO T;  1VQN T;  1WQ7 A;  1LOJ A;  3P8H A;  4JS5 A;  5A0L A;  1BYM A;  3H8Z A;  1R8O B;  4JRI A;  1OZ3 A;  2DXB A;  4BDY A;  2R57 A;  1H64 1;  2V8I A;  4ZTF A;  5LJ5 j;  3X26 B;  3ER0 A;  5GAN g;  1Y96 A;  4B9W A;  3MHX A;  4KBM B;  3FLG A;  2WSE E;  3M53 A;  4Q5W A;  2M0O A;  4QQ6 A;  2RHY A;  1VQ8 T;  1K9M C;  4JLI A;  1FXX A;  2ZPE B;  3M58 A;  3G6E A;  2V8K A;  4NS5 A;  2XU8 A;  3GNF B;  2EQK A;  4CRI A;  2P0K A;  3MEV A;  3HRT A;  2RJF A;  3PIO A;  3QKJ A;  3SWN A;  4BY6 B;  3F70 A;  2K57 A;  3A8O B;  3BY7 A;  2PVO B;  2L5Q A;  1JJ2 A;  1QP2 A;  3G71 T;  4MZM A;  2M1H A;  1G3T A;  1SSF A;  2EQU A;  1WGS A;  3CXC A;  3JCM W;  2EQJ A;  1KC8 C;  4HT8 A;  2Y4X A;  1ZBX A;  3V7S A;  2EKO A;  2I2L A;  4OB3 B;  4RG2 A;  2QDY B;  4C92 F;  4PKC C;  4C92 C;  1KQ2 A;  4A4G A;  3JCM P;  4M78 B;  3UWN A;  1V29 B;  2DD4 A;  2ZPF B;  3MET A;  4KT0 E;  3UPU A;  1YI2 A;  5FU6 B;  4M78 G;  2KK4 A;  2EFI A;  3OS5 A;  3H6Z A;  4M7A F;  4LDV A;  3L2Q A;  1QP3 A;  3A8M B;  2LTO A;  4M7D B;  3CCR T;  3HP9 A;  1WJS A;  1MGQ A;  2WSF E;  3O8V A;  4FT4 A;  3PIP A;  3CCV T;  4JS4 A;  1D3B B;  4N4H A;  3VV0 A;  5CKB A;  3OY9 A;  3CCQ A;  1YJW T;  4OF1 A;  1U1T A;  2RHU A;  4BI4 A;  3OYC A;  3GP8 A;  2QQA A;  4ME7 A;  1I5L A;  3MP1 A;  4WF2 A;  2MAM A;  4L59 A;  1BIA A;  1KG1 A;  3RKY A;  1LNX A;  4IUU A;  4M77 A;  4BY6 C;  5J26 A;  1OYX A;  1PSF A;  5GAN f;  1M1G A;  3M4Y A;  4ELZ C;  4IUQ A;  1VQ9 T;  3M57 A;  1IRE B;  2HAX A;  2YRV A;  4BE2 A;  2QI2 A;  2F5T X;  2D0Q B;  2P0Q A;  3OMG A;  1YJ9 A;  1UGP B;  4M77 E;  1I81 A;  2BKD N;  3OYL A;  3GOX A;  3P8D A;  2DO3 A;  3OS0 A;  5LJ5 e;  3DLL A;  4PJO E;  4JRK A;  3X20 B;  4RCB A;  3M4G A;  4M78 C;  2GCX A;  3SD4 A;  1VQ7 A;  2E12 A;  2JN0 A;  2KY9 A;  1VQK T;  5HK0 A;  3PMT A;  1M8V A;  5FU6 C;  2L89 A;  4FIB A;  5FRM A;  1EIF A;  4XTY A;  2DXU A;  1NPP A;  1JBM A;  3MEW A;  2DJZ A;  3L2R A;  4M7D F;  4C5G A;  4M7D C;  4LDY A;  4A4F A;  1M90 C;  2PVD B;  2RJC A;  2ZPB B;  4M75 F;  3RKW A;  5L8R E;  2K2V A;  3CMA A;  3GPL A;  1G3W A;  3UDC A;  3VUB A;  1UB4 A;  5HKC A;  5GMK l;  1JJ2 S;  4OB0 B;  1Y7X A;  4HA8 A;  1YIJ T;  4C8Q B;  3I56 A;  3JCM V;  4OVA A;  5CKH A;  2VV5 A;  3CXC S;  3FEO A;  2HD0 A;  1K9M U;  1QVF A;  2HBP A;  4C8Q G;  3HFO A;  2F69 A;  5GAO q;  2DXC A;  4C0D B;  3NTH A;  3V8K A;  2XK0 A;  5D6W A;  4EMK B;  4E7I A;  4J7I A;  3LW5 E;  5CAI A;  5GAN j;  3I55 T;  4C8Q D;  3E9G A;  3CCE A;  4DOV A;  3FB9 A;  3CD6 A;  4FT2 A;  2ZPG B;  4BE1 A;  2PU9 B;  3CC4 T;  3OYM A;  2FYK A;  2CKK A;  2L3R A;  3JSC A;  2ZCF B;  5CR2 A;  2X4Y A;  1KC8 U;  5CCA A;  3OYJ A;  4FSX A;  1OZ2 A;  5C6S A;  5GAN 3;  3KXT A;  4TVR A;  3UT1 A;  1VQM A;  1YJN A;  1VQ4 T;  3I56 T;  5GAN 7;  4MML A;  1KD1 C;  2RI5 A;  3QHS A;  4ZGJ B;  2Y4Y A;  2MWP A;  3LWH A;  4E7L A;  2KMT A;  3BDU A;  2MWO A;  4BAC A;  1X01 A;  2RJD A;  4LD9 K;  4F7U F;  2XHC A;  4O5V A;  3HHT B;  3HPW A;  2QA4 A;  4J7F A;  4Y91 A;  5LJ3 g;  4A4E A;  4A4H A;  2ZGW A;  2DPP B;  3JRZ A;  3MEU A;  2DXT A;  4C8Q C;  2RK1 A;  1VQL T;  3KBG A;  4C92 B;  2XD0 A;  2DIG A;  3DB3 A;  4QVZ A;  2KSS A;  1S72 A;  3G4S A;  4C92 G;  5A0G A;  2KQW A;  3RMS A;  5GAM g;  3X24 B;  5DLO A;  4C0D C;  4EMK C;  4XU3 A;  3MCA B;  4D6W A;  4M7A B;  1BI3 A;  2RA2 A;  2Y90 A;  3MO8 A;  3GNG A;  3LGF A;  1X6O A;  4C5H A;  4J8O A;  4C92 D;  3ZEH A;  4NL3 A;  4ATO A;  4HT9 A;  3EFR A;  3LX7 A;  4J6W A;  1Q82 C;  4EMG A;  2E70 A;  1KQS S;  3INZ A;  3OYB A;  4J5Y A;  2DTH A;  4ZGD B;  3HRS A;  5CK9 A;  2P4T A;  3MP6 A;  2X35 A;  3TCJ A;  4Z02 A;  3RUX A;  4RCC A;  5LJ5 d;  3QDR B;  4QW2 A;  1H3Z A;  5LJ5 h;  4MZT A;  3C95 A;  2F5K A;  3P8B B;  2E64 A;  3J7A F;  1M1F A;  4IUP A;  3JCM f;  3SB2 A;  4GY5 A;  4RMO A;  4LD6 A;  5IT9 E;  3OS2 A;  1QVF S;  2WAC A;  1YHQ A;  2VGN A;  3JB9 F;  1G3Y A;  1QVG S;  3CME A;  3SFM A;  2BUD A;  3CEY A;  2EYQ A;  4JDS A;  4XTX A;  4A54 A;  1UGR B;  1O9S A;  5I21 A;  3OYK A;  1B34 B;  4PNO A;  1M90 U;  3OSS C;  5GAN e;  2GFA A;  1N9R A;  1Y07 A;  2LRQ A;  4CI0 C;  1WJQ A;  4MDW A;  4M78 A;  2L8D A;  3ASK A;  2OTL A;  3QXE B;  2DVE A;  2QXF A;  2EJG A;  3R6O A;  3BDL A;  5GAN 4;  5GAO l;  4BDZ A;  1Q7Y C;  2CYZ B;  2D6F A;  4LDU A;  3GIB A;  3G6E T;  4M7A C;  2JVV A;  3CBO A;  3L1A A;  3OYY A;  3CBM A;  3M5A A;  4M78 E;  5LJ3 f;  4M7D A;  2JTF A;  2O01 E;  5GMK j;  2R5M A;  5EG2 A;  3S3N A;  1N9S A;  4N4G A;  4M78 D;  4ELY C;  1D3B A;  4M75 B;  4GLK A;  4LDX A;  4M7D G;  2LNV A;  1OI1 A;  4L6V 5;  5GAN 2;  4X9C A;  5GAM f;  2IVW A;  3M54 A;  4HKE A;  5GAO r;  1RL2 A;  3PTA A;  4M7D D;  2CZ0 B;  4UC4 A;  3OBY A;  4HCZ A;  3AHU A;  3E1S A;  3OYH A;  5DM7 R;  5IN1 A;  1KD1 U;  3TEE A;  1HXD A;  3VU3 C;  1QVP A;  2CZ1 B;  1YI2 T;  1I8F A;  3OB9 A;  1YIT A;  4R56 A;  3JB9 H;  3CCV A;  3CCU A;  3PNW C;  4PL6 A;  4QVD A;  2JZ2 A;  2EWN A;  4KUI A;  2CS7 A;  4OB2 B;  4NL2 A;  3RKX A;  3ZFJ A;  4C5E A;  2E41 A;  2DTO A;  1I4K 1;  3GLX A;  4OGE A;  1N6A A;  3JCM h;  4Y28 E;  2O4X B;  2E6Z A;  5J39 A;  3LGL A;  2DK3 A;  2RB6 A;  1BKB A;  5CKE A;  3A5Z B;  2JTM A;  3BFM A;  4J83 A;  4X34 A;  4XAX B;  2ZZD A;  3CCQ T;  2EQM A;  4BE0 A;  3CPF A;  1WJR A;  4C0Z A;  4FM4 B;  3C12 A;  3QYH B;  3QJY A;  3CCM A;  4ZN3 A;  4MDX A;  4JLG A;  4X9D A;  2CGH A;  2CZ6 B;  1G3S A;  3OW2 A;  3JB9 J;  4II1 A;  4BD3 A;  2VUB A;  3QZ9 B;  5DY9 A;  2DEQ A;  5LJ3 j;  2E5Q A;  4MMK A;  4F7U B;  4N4I A;  4EDU A;  5CQX A;  2FL7 A;  3KUF A;  4M75 C;  3L2W A;  2FVU A;  2K5I A;  3LLR A;  4PJO B;  2XDB A;  3NTK A;  3V7C A;  4F7U G;  4C8Q A;  2KAF A;  1Q82 U;  2LQK A;  3V8J A;  5A0D A;  3CCS A;  2R5A A;  1YJ9 T;  3J81 E;  2IG0 A;  5GAM j;  4E7K A;  1NPR A;  3QBY A;  3SDZ A;  4RG8 A;  2XDP A;  3LWI A;  4PLL A;  1X75 C;  4EMK A;  3OS1 A;  5CIU A;  4C8Q E;  1VQP A;  1VQ7 T;  2MMP A;  1GXI E;  2XKO C;  1VQ6 A;  4V2S A;  3CCL A;  2XI9 A;  1IZ6 A;  3QUI A;  4JRQ A;  3JCM J;  2OTJ A;  1VQ5 A;  2K3X A;  4MZP A;  3L2Z A;  1VIE A;  1XOV A;  1NJI C;  3CC2 A;  5J3B A;  4XTV A;  4HCB A;  5DLQ E;  5HK3 A;  1BI1 A;  5GAN d;  1FWZ A;  4FL6 A;  3CCJ A;  5GMK e;  1W4S A;  5GAN h;  2K5L A;  3CMA T;  2QQB A;  2QEX A;  1Q86 C;  4DA4 A;  3OBW A;  1UGS B;  2PVG B;  5KCO A;  3A8H B;  2WSC E;  2DZC A;  4N0A C;  5CVI A;  3TRE A;  4XK8 E;  3CC7 A;  1Q7Y U;  1RI0 A;  4IUV A;  3BW1 A;  4M77 F;  3JCM c;  2DAQ A;  3C4S A;  3Q1J A;  1ZHI A;  2M16 A;  2RD1 A;  3M59 A;  4PJO F;  3WVD B;  3OYE A;  4PJO C;  3JCM e;  4XU2 A;  5HY6 A;  3CCE T;  5FRO A;  4C92 A;  3JB9 G;  3CD6 T;  2D9T A;  2XIC A;  4R55 A;  5GMK i;  2KDS A;  3RER A;  5I2S A;  2LDM A;  1VQO A;  1BIB A;  3VKI A;  1VQN A;  1XTD A;  1VQM T;  3OYF A;  4M7A A;  2MI6 A;  3EFS A;  3OQ5 A;  3RIR A;  4C92 E;  5IAY A;  4JUV A;  1YJN T;  1VUB A;  2XID A;  2LVM A;  5AYF A;  4HCC A;  1QW1 A;  2VXF A;  2ZPI B;  3DB4 A;  4KUL A;  4C0G A;  2E6N A;  4XQ3 A;  4M7A G;  2RM4 A;  4IKF A;  3MP8 A;  3V7R A;  2LT4 A;  2RI2 A;  4J6X A;  4A53 A;  3CPW A;  1VQ8 A;  3OW2 S;  4M7A E;  1PSE A;  2RHI A;  4C0F A;  2QA4 T;  3DLM A;  5LJ3 e;  4M7A D;  2EAY A;  3VYG A;  4A4K A;  4QVC A;  1K8A C;  4J6Y A;  4E7J A;  2EJF A;  2G3R A;  2PUK B;  2NLU A;  1UGQ B;  1S72 T;  3G4S T;  3HSB A;  3RES A;  5GAM e;  3G71 A;  4XU0 A;  3QSU A;  1G5V A;  4BB7 A;  2DIQ A;  2QQS A;  3HFN A;  4DQ2 A;  3L2U A;  3PT9 A;  1JRI A;  2VYT A;  4XTU A;  5I2M A;  2X4X A;  1B34 A;  3X25 B;  1TH7 A;  1O75 A;  2KVQ G;  1Y96 B;  2C06 A;  1WQW A;  2LC4 A;  1JB0 E;  3FDR A;  1Q81 C;  1M9S A;  1NZ9 A;  2K4Y A;  1Y71 A;  3PGG A;  3OMC A;  1N8R C;  1UEB A;  3QO3 A;  4OP0 A;  1K73 C;  3G7Z A;  3L42 A;  2YLB A;  5D6X A;  3OYI A;  3CCR A;  3SWN B;  5KE3 A;  4FU6 A;  3GF5 A;  4M75 A;  5KCH A;  4RKU E;  2RHZ A;  3JB9 I;  2ZPH B;  1YJW A;  2RI3 A;  1YHQ T;  2PUO B;  1XNI A;  3QG1 A;  4EMH A;  3CME T;  1NJI U;  4M75 G;  3A8G B;  2XG8 D;  1YBY A;  3QZ5 B;  5GAN 6;  3JCM b;  5GAO m;  4M7D E;  5GMK h;  2A7Y A;  3HL8 A;  4M75 E;  5FU7 B;  5GAN 8;  2E65 A;  1BI2 A;  2OTL T;  2V8J A;  4M75 D;  1Q86 U;  1AHJ B;  3HKS A;  2HQX A;  2R58 A;  2QTX A;  1VQ9 A;  2YHT A;  2B8A A;  2HQE A;  3ZBD A;  1M1K C;  2GFU A;  3NTI A;  3T9N A;  1W2B A;  3JCM d;  2DKG A;  2O4X A;  3EAE A;  5CKF A;  5LJ5 g;  3TU4 K;  4BUG A;  3V8L A;  5CKD A;  1KQ1 A;  3E19 A;  3RMQ A;  1VQK A;  4OGC A;  4XU1 A;  3DKM A;  3VYH B;  5M9O A;  3CPW S;  5D6Y A;  4N0A A;  1LJO A;  2CZ7 B;  3MEA A;  3S6W A;  3J80 E;  2QQ9 A;  3JCM Q;  2LT1 A;  3CBP A;  4IUT A;  4M77 B;  3SWN C;  4C5I A;  1M5Q 1;  3PFS A;  4F7U A;  3M56 A;  4PJO A;  1VIF A;  3C94 A;  3ME9 A;  2EJ9 A;  4M77 G;  4VUB A;  3LYI A;  4OMF B;  5CQY A;  2MF2 A;  4E47 A;  1YIT T;  1YIJ A;  1DJ7 B;  5LL6 S;  3CCU T;  2OAU A;  4PJO G;  3X28 B;  2JOY A;  5GAO p;  3JAM E;  2RJE A;  3FIF A;  2M9U A;  4LDW A;  4XTW A;  5A2Q E;  5LJ3 d;  4F7U E;  1BI0 A;  4M77 D;  3OYG A;  5LJ3 h;  2K5F A;  2K3Y A;  5FU7 C;  4M78 F;  5KH6 A;  1WPY A;  4JRP A;  1K8A U;  2GQV A;  4PJO D;  1U8R A;  2VXE A;  3NFC A;  3OYD A;  2X4J A;  3QJ6 A;  1P92 A;  3I55 A;  4B9X A;  2XDD A;  5GAM d;  3N5B B;  4QQD A;  4PLI A;  4BI8 B;  5GAM h;  3CCM T;  5KE2 A;  4OB1 B;  4P5N A;  1KQS A;  4L5G A;  3CC4 A;  1YCY A;  2RO0 A;  2HNI A;  3M55 A;  5GMK m;  3WVE B;  2YLC A;  4ZTJ A;  3FJP A;  4ZN1 A;  3E9F A;  3FC3 A;  2LX9 A;  3M9Q A;  2RHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...