2EQUA

Solution structure of the tudor domain of phd finger protein 20-like 1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
b'GSSGSSGFDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAKGQDWIALVKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 20-like 1
publication title Solution structure of the tudor domain of PHD finger protein 20-like 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2equA00
3LX7A 3OS2A 2PQWA 3OYAA 3S3NA 3H6ZA 3P8DA 3KUFA 4RG2A 5D6YA 3Q1JA 4BE1A 2MWOA 3FDRA 3FLGA 4E7HA 3ME9A 2D9TA 3OYJA 4IUPA 3UT1A 1OYXA 3OS0A 3OYCA 3OYEA 4BE2A 2VYTA 3LLRA 3OYHA 4C5HA 2E6NA 2RI5A 2G3RA 2P0KA 2F5KA 3NTKA 3OYBA 5D6XA 4QVZA 4C5GA 5J39A 2WACA 3OS1A 2BKDN 2R58A 5FRMA 3PFSA 3S6WA 5KE2A 5D6WA 5FROA 2IG0A 2RHIA 4OVAA 3ASKA 3FC3A 3META 4BDYA 5J26A 1H3ZA 4BACA 1SSFA 2YRVA 2RHXA 5FRNA 4A4GA 5KCOA 4N4IA 2M0OA 4Q5WA 1RI0A 4ZTFA 3OYDA 2RI2A 3OMGA 4PL6A 2X4YA 3BDLA 4FL6A 2X4WA 3UWNA 2XDPA 2EQJA 3C4SA 5C6SA 2L89A 3S3MA 2RJDA 2EFIA 5C0MA 4B9XA 3H8ZA 3O8VA 4E7LA 3OYGA 3MEWA 3QKJA 4L59A 4GY5A 5M9OA 3FEOA 1WGSA 3OB9A 3OY9A 4NS5A 3L42A 1OZ2A 3PMIA 3QIIA 4LD6A 4CRIA 3NTHA 2L8DA 2M1HA 2K3YA 4UC4A 3OYFA 3MO8A 2JZ2A 4C5IA 4IKFA 1XNIA 2E5QA 4BD3A 3NTIA 4E7IA 2HQEA 2EQUA 1OZ3A 3OYLA 2RHZA 2R5AA 4PLLA 5KH6A 3S3OA 1OI1A 4A4HA 3PNWC 4PLIA 2RO0A 4II1A 2RJFA 3E9FA 3LGFA 3OMCA 2GF7A 4HCZA 3QBYA 1WJQA 1N27A 2XK0A 3LGLA 4QW2A 4BDZA 4E7JA 2EKOA 2GFUA 3SD4A 2HQXA 2X35A 2X4XA 3DB3A 3LH0A 3L2RA 4BE0A 5CIUA 2LTOA 2RJCA 3QJ6A 2DIGA 3ZEHA 2NLUA 4EDUA 3OYKA 2M16A 3CEYA 3OYMA 3DB4A 1WJSA 2RI3A 3LYIA 2GFAA 3MEUA 3MP8A 4X34A 2K3XA 3DLMA 4QQDA 2DAQA 5KE3A 2JTFA 2RHYA 3PMTA 2R5MA 4FU6A 2LVMA 2BIVA 1KHCA 3MEAA 3P8HA 2O4XB 4B9WA 3GOXA 2R57A 3MEVA 2BUDA 2QQRA 2LDMA 5IN1A 4A4FA 3OYNA 2RHUA 4A4EA 2RJEA 3OQ5A 4IUTA 3M9QA 1WJRA 2L3RA 2CKKA 3L2UA 4IUQA 4E7KA 3OYIA 2DIQA 2EQMA 2QQSA 3MP6A 3L2VA 3F70A 2EQKA 3OA6A 3L2WA 2LRQA 3MP1A 5KCHA 4IURA 2B8AA 3E9GA 1G5VA 2LCCA 4Z02A 4QQGA 3EAEA 4N4GA 5IAYA 4ZTJA 4IUUA 3L2QA 1MHNA 4IUVA 4N4HA 4C5EA 4QQ6A 2MWPA 2FHDA 2O4XA
chains in the Genus database with same CATH superfamily
2ESWA 2KXDA 2ED0A 2E12A 5CVIA 5GANg 5I2MA 1QVGS 3CMAA 2GNCA 1M2OA 3X20B 3CC7A 4LN2A 1UE9A 4EPCA 3LWHA 4JS4A 1U1TA 2G3RA 3A5ZB 4QVZA 1VQNA 2YRDA 1VQ9A 1SSFA 4DA4A 1VQ6T 2JS2A 2XIDA 5LJ3d 1M1GA 3M0UA 1S72Q 2O9SA 1KSWA 1I5OB 2V26A 5C6SA 2CUBA 2YUQA 4OB3B 2KR3A 4PJOE 5GAN6 2CH4A 3CCSA 3HSBA 4EMKC 2EVRA 2DF6A 4CRIA 2K3YA 3OYFA 3CBPA 2O9VA 2KT8A 4HT8A 4X1VA 1M30A 2L0AA 1YNZA 1TXQA 4L6V5 1Q82R 2MI6A 3V7SA 2RO0A 2DA9A 2ZPEB 3LGFA 1WJQA 2YSQA 2EKOA 1XQHA 3EGXA 1YJNT 3REAB 1T3SA 3M4GA 5KYYA 2DZ9A 4X9DA 4EDUA 4Y91A 1M1FA 2OTLT 4J6XA 1H92A 1WXBA 1SHFA 1CKAA 2J7IA 2XHCA 1ZUKA 2FVUA 4C92G 4EMGA 2MF2A 5ECAA 2EW3A 2D8JA 2CZ6B 3O5ZA 2VGNA 1QLYA 2EJ9A 2Y90A 3CCLA 2AKKA 3HP9A 1M90U 4BY6B 4C8QC 2COWA 4BI3A 3CC4A 1WQWA 1QP2A 1UGQB 2NUPA 3ULRB 4J9IA 2FB7A 3V7RA 3OS2A 1PCXA 1JBMA 4A4KA 5D6YA 4PFZA 2E3HA 3CPWA 3CPWS 2DVEA 2W10A 1AWOA 1TH7A 1Y07A 3LH5A 4BE2A 2VGMA 2P4TA 2EGCA 2KQWA 1VQMQ 4KUIA 4F7UF 2DXCA 1I5LA 2P84A 1W2BS 1VQ4T 1N8RC 3OYYA 1OU9A 3S6WA 5FROA 3QO3A 1W6XA 2CGHA 1PRLC 3GNGA 4A4GA 2M0OA 1UHCA 4WTOB 1N5ZA 1TOVA 2QQBA 2X4WA 3JCMg 3HFNA 5AYFA 2RJDA 2XICA 5GANd 4DBRA 4C0FA 3MEWA 3V8KA 4ELZC 4JS5A 2RB6A 4ELYC 4KUDK 1OZ2A 3OSSC 2E5KA 1E7OA 4C5IA 3QYHB 1QMCA 5I22A 1RAHB 1YHQQ 2OTJT 3OYLA 1K0SA 3EHQA 2FPDA 3DLLA 1KIKA 3QXEB 1KHIA 2E1HA 1NPPA 1Y96B 2OI3A 4P5NA 1PD1A 2X4XA 2DL4A 3DB3A 1QCFA 4EMHA 2QA4A 1VQLQ 4BE0A 2RJCA 2M02A 3JCMQ 2RI3A 2PU9B 3JV3A 3CMAT 4PJOC 3RKXA 3CC7T 2AZVA 1X75C 2QGGA 4M7DF 1KQ2A 1VQNT 3JAME 1Z9ZA 2BIVA 2WSCE 3MEAA 4B9WA 2MK5A 2ZPBB 1LNXA 1M4ZA 4M75F 2VASA 2H3EB 1WJRA 4J7IA 3EG2A 2VXFA 2YXYA 2JM9A 1WZOA 3EGUA 2P4RA 1B7TA 2CP6A 3JB9H 1KC8R 4PJLA 1VYTA 1D0XA 1M3AA 4OGCA 2XU8A 1BBZA 2C06A 3GF5A 5I11A 2MPXC 4MMKA 4N0AC 1Q81U 2EKHA 2RHIA 3META 4CC2A 4M75A 1Q7YR 1T3LA 4J9HA 1OU8A 3PE0A 4FM4B 4LDWA 2E4HA 3LWIA 3EH2A 4FL6A 1KD1R 2WSEE 1XOVA 3EG0A 2LQ8A 1LJOA 4M75D 1O75A 3S3MA 3JCMJ 1ARKA 2DRKA 3H8ZA 3TU4K 2DYIA 2L3PA 2VC8A 2Y4XA 2MYSA 3OW2A 1YJNQ 3OY9A 4M7AB 3OW2S 3EGXB 1RADB 3QIIA 2RA2A 4LD6A 3M54A 2YWWA 4IKFA 2OTLQ 4BD3A 1QW1A 1VIEA 2DLPA 5FWBA 3S3OA 2LC4A 1HYOA 2PTKA 2QGFB 3ZFJA 3CC4T 2FPFA 1D1BA 4PJOD 4QW2A 4BDZA 1VYVA 1K73R 3H0FA 4OMNA 1BYMA 1C0MA 1E6HA 3FJ5A 3JCMe 1FYNA 1NYGA 4E2FB 2AT1B 1ZSGA 1SPKA 2EGAA 1KFZA 3DLMA 2MMPA 4CC7A 3DKMA 4RTWA 4ATOA 1WHGA 1PG5B 2LDMA 3L2ZA 1JJ2P 1TG0A 3M5AA 1VQOA 3M9QA 1Q95G 5AT1B 4ZN1A 1K1ZA 2RN8A 5GMKj 1UGPB 3EAEA 1VQ4Q 3JCMX 2QEXT 4C5EA 3SWNA 1Q86R 1V1CA 3MCAB 1FMKA 4VUBA 1D3BB 2DKGA 4HXJA 4OB0B 4AMCA 5CQXA 3M4YA 2K7AA 1EIFA 4BI4A 1QP3A 2A28A 2WACA 3I55T 5FRMA 3VS7A 3PIPA 1MMGA 2YRCA 8AT1B 3JB9J 3QDFA 1NPRA 2J06A 5KCOA 1BKBA 4XU3A 2OTJQ 3G7ZA 2RI2A 1VQKT 4JJCA 1N6AA 3UWNA 2P0QA 1H641 2V1QA 1WXUA 2L89A 5LJ5j 4FIBA 2A37A 4F7UB 3TREA 2RNAA 1YHQA 3CXCA 1N9RA 4KULA 3UA6A 1UEBA 4J9EA 2X4JA 2DTHA 3RESA 5LJ5f 2OX7A 3TEEA 2DYBA 2LQNA 2JMAA 3CMAQ 1VQLA 3A1PA 3CC7Q 5HK3A 4C92F 2BZYA 2F2WA 2RH2A 3PNWC 3GBQA 3RMSA 1NJIR 1VIFA 3NGPA 1VQNQ 1N8RU 1VA7A 2QI2A 1AD5A 5DM7R 1D09B 3EG1A 4XK8E 1IGUA 4OP0A 5GMKe 4J8OA 1RL2A 2R5MA 3P8HA 2HSPA 5EG2A 3OSVA 3EFOA 3QZ9B 2F5TX 3RR6A 4HVUA 2L3SA 3FJPA 3OQ5A 3EGDA 4K11A 4IUQA 1WHKA 1QVFA 1RAFB 3L2WA 1UJYA 5KCHA 2DL3A 2M51A 3CCMA 3CPFA 3VYHB 4M7DB 1MHNA 2K79A 4C8QG 3M57A 2PQWA 1KQSP 2ATCB 1PKSA 4J6YA 2AZSA 1VQ7T 1YJWQ 2C0IA 5CKDA 1OYXA 2VYTA 2E6NA 5LJ5e 2BKDN 3M0QA 2XD0A 3PFSA 5GAOr 4OVAA 2YRVA 5HKCA 1FMWA 2M9UA 3A8MB 1UJ0A 1CKBA 2OTLA 9ATCB 5FU7C 2NWMA 1HJDA 2CT4A 5HK0A 2GBQA 2JS0A 3VKIA 1ABOA 1S1NA 1UB4A 4M77F 1K9AA 3VJPA 2YUPA 2DBKA 2JZ2A 4QKUA 5CR2A 1VQOT 1K9MC 4OMFB 2XMFA 1QKWA 5GAMg 1W4SA 2YUNA 1V76A 1M1KC 3JB9D 4NOYA 2DD4A 4HT9A 1OV3A 2HQXA 1YITA 4ZGEB 4RTVA 3CCJT 2Z0WA 2ZPFB 4OGEA 4F7UE 5IT9E 2NLUA 3TSZA 3LYIA 3RKWA 3MP8A 2LT4A 2VB6A 3M53A 2QEXQ 3A8HB 3SEMA 4R55A 1PNJA 1NYFA 3SWNB 4PJOG 4M77A 3A98A 1UUEA 5LJ3j 3SFMA 3UDCA 4LD9K 4IUTA 2DFUA 5LL6S 2EQMA 4J6WA 4M77D 1X27A 4RCBA 3VYGA 3OA6A 3I5SA 3MP1A 3RBBB 2K6DA 1K8AU 2JW4A 3I55Q 1YHQT 1WHMA 2BE7D 1TWBA 1MMNA 5A0DA 4JRQA 1AT1B 3X26B 4FT2A 3VS1A 3H6ZA 1IREB 1A0NB 4JZ4A 2RMOA 3FDRA 1VQKQ 4E7HA 3VU3C 5GAMj 5IHIA 1WHHA 1JRIA 2RQTA 2RI5A 4R56A 4PFPA 2RM4A 1YN8A 4ME7A 4C5GA 4MZPA 4BDYA 5J26A 2XG8D 1WXTA 2X51A 2I2LA 4PL6A 2JXBA 8ATCB 2KRNA 2XDPA 4OMMA 1W1FA 4M75E 3LW5E 1EZZB 2AHJB 4BUGA 1QVGA 1GXIE 2A0FB 3HL8A 2L5QA 1BK2A 2HSEB 4NS5A 5GMKi 5IXFA 2QXFA 3QJYA 2H8HA 4M7AF 3UF4A 1MNDA 2O01E 5KH6A 3ZL7C 3L1AA 2EYXA 4PLIA 2RJFA 3CCMT 4HCZA 3PVLA 1ABQA 4JJDA 2VV5A 3EFOB 1Y57A 5I2SA 1BCMA 3L2RA 3CMEA 3QJ6A 4PJNA 5LJ3e 1IXDA 3EGDB 2KVQG 3DB4A 2RPNA 4C92B 2DTIA 2GFAA 1U3OA 3HHTB 3MEUA 4O5VA 1GCQC 3E19A 5GAMd 2CUDA 2LVMA 4J7FA 3BE3A 1KHCA 1QCNA 4DOVA 3V7CA 1VQ7Q 4J9DA 1AZGB 1VQ5A 4Z8AA 4IIOA 4M7AA 2KEAA 2WSFE 2CT3A 1VQPQ 4KT0E 5GAMe 5GANj 4Z88A 1M3CA 1YJWA 1LOJA 2X3XD 2KI7A 2MOXA 4M7AD 1PRMC 4QQ6A 1JQQA 1WNLA 1IHWA 3LX7A 1KQSS 2OJ2A 2DZCA 4B6MA 4LDXA 5GANf 2MWOA 4AFSC 4ZGJB 3ME9A 2D9TA 3JCMb 2DETA 4DQ2A 1RACB 5GAOp 1BI3A 2DL8A 4KGVB 2PVGB 2MIOA 3OS1A 1TU0B 4BACA 2RK2A 1YITT 1JXMA 1VQOQ 2JJ9A 3V8LA 2V8IA 3H0IA 3VS4A 1X2KA 2CREA 3QKJA 5A2QE 2QDYB 1WGSA 1MV3A 1NEGA 4CC3A 1W2BA 1NBEB 3EG3A 1G3YA 3CCJQ 2L8DA 3RUXA 5GAOn 5GAN5 2RQWA 3X24B 1I8FA 4MMLA 1D3BA 1X01A 2V8JA 2LJ3A 1QKXA 4A4HA 4II1A 2CYZB 2EJGA 1X2QA 1YJ9Q 3OMCA 1Q82C 1BI2A 4M77B 2FRYA 2H3JA 2QEXA 3MPUB 2DJZA 3G6ET 1HD3A 4FSXA 1RAGB 5CAIA 1EFNA 4M75C 2HBWA 5GANe 1JO8A 1N9SA 2J6KA 2HL5C 1HXDA 1NJIU 1PC0A 4FU6A 2LCLA 1B07A 4MDWA 4JDSA 4F7UA 2I0NA 2DEUA 1FX7A 3I55A 4A4FA 3CXCP 3REBB 1K76A 4C0DB 4GLMA 2DIQA 2QQSA 2KDSA 3U23A 1K9MU 2FG0A 1VQKA 2LCCA 3G4SQ 3GNFB 1KJWA 3HRTA 1M1KU 4M78F 3RIRA 3JCMP 2J6FA 3QWXX 2K5FA 3PVQA 2JTMA 3EFRA 2FEIA 3WVDB 1GBRA 2DBMA 2F5KA 2EIFA 2RQVA 2C0TA 2DTOA 4M4ZA 2FRWA 2MAMA 5FU6B 1TSFA 3JCMf 3CMET 1T0HA 5GJVB 5GAN7 3OS5A 4Y92A 4RTYA 3CCMQ 2KRMA 3TCJA 4KH0B 1QVFP 4M78A 2GCXA 7AT1B 3OB9A 1AZEA 2G6FX 1AOJA 4M7DA 1DJ7B 1Y71A 3EFSA 3FB9A 1VQ5T 3SWNC 2AKLA 4M7DD 1ZHIA 3VUZA 4IIMA 1YJWT 1I07A 2MCNA 4D8KA 3J7AF 5IXBA 4DOWA 3RERA 2PUKB 2RF0A 2XK0A 2CP3A 2X35A 1HK9A 4C0GA 1QVPA 5KYUB 2E10A 2VKNA 2KNBB 2LJ1A 4XTWA 3G1JA 1M8VA 1VQ7A 1AHJB 1WJSA 3HKSA 2D8HA 2IIMA 3QUIA 1VQPA 1K8AC 3N5BB 4ZGDB 5DY9A 1ZA1B 2VWFA 3VV0A 1G83A 3H9NA 3IQLA 2EAYA 3L2UA 4M77E 2B8AA 3VS6A 3VRYA 4RMOA 2FHDA 2O4XA 2DEQA 1E6GA 3S3NA 1FXXA 1YITQ 1OPKA 2PZ1A 3FLGA 1KC8C 4QT7A 4A53A 1C1AA 2BZ8A 4IUPA 2PNIA 2K9GA 4HA8A 3D7SB 1MMAA 3LLRA 5GMKl 1WI7A 3NMZC 3JCMW 2QQAA 4J9BA 3FC3A 3ASKA 2HNIA 2JN0A 1RLPC 4XQ3A 4GBQA 4HCBA 1UGRB 2A36A 5GAN8 3CCJA 2OAUA 2EQJA 2EFIA 1G2BA 3JCMh 5CKEA 2LNVA 3BFMA 1BU1A 2BTTA 3P8BB 4CI0C 1M90R 5J3BA 3G6EQ 1OULA 3NPFA 1YI2T 1YJ9A 2YT6A 4EMKB 3MO8A 5FW9A 1NM7A 2A3LA 2HQEA 3MJXA 2KAFA 2NUTA 1IRXA 1Y7XA 4RKUE 3QG1A 3MKDA 4Y28E 2XKOC 2YLCA 4JJBA 4DBHA 4E7JA 1UGSB 3QHSA 2K5LA 3M0RA 2HDAA 2P0PA 2KBTA 1SKUB 2YLBA 4LDYA 3FRNA 1ZSZA 4FYXB 1HSQA 3EH1A 5CO7A 3G4SA 4F04B 3GLXA 1QVGP 2HZYA 5CK9A 2L3RA 4BY6C 2RD1A 1I81A 2CP7A 1YBYA 4IURA 1KQ1A 2DPPB 2B86A 4FW1A 2CZ7B 4IUVA 4C8QB 4M7AE 1PD0A 4J5YA 1Q82U 1UFFA 2DXUA 2DXTA 3CMEQ 3A8OB 2K2MA 1WLPB 1T0JA 2X3WD 3CD6Q 4F7UG 1YP5A 2FZCB 2JUFA 3QWYA 3I9QA 4C5HA 1WQ7A 2P0KA 3NTKA 3KXTA 4C92A 4M78B 3E1SA 3RMQA 2IG0A 1YIJT 1JU5C 2RHXA 1VQ5Q 1GRIA 2QTXA 4N4IA 4RTUA 4QVDA 4C92D 2DERA 1WFWA 4M77C 1QCOA 3C4SA 4MZTA 3VS5A 2EWNA 5KYXB 2LQWA 4GY5A 1VQPT 2DK3A 4E6RA 2F2XA 2D0NA 3NTIA 5GAN3 5A0LA 3UA7A 2R5AA 4PLLA 2E6ZA 3HRUA 2QDLA 3CCRT 3C94A 1V29B 5GAOq 3QBYA 5IH2A 1N27A 4BI8B 4XU0A 1NJIC 2ED1A 2KE9A 2HEQA 2FPEA 4OMLA 3TVTA 1M27C 3QYGB 4ZN3A 3HPWA 1I1JA 1Q81R 2LTOA 1VYUA 2LT1A 4RCCA 2QG9B 1R8OB 2GTJA 4RTTA 1MGQA 3CEYA 1B34B 2CZ1B 2K57A 4X34A 2K3XA 2F1LA 4M75G 2O4XB 3CPWP 2DM1A 1VQ8T 5LJ5h 1K0XA 1ACMB 4KRTA 3CCET 2LX7A 2CKKA 3CCVT 1IB8A 4XU2A 2K2VA 1H8KA 2BZXA 1W2BP 1U06A 3MP6A 3L2VA 2QK0A 1GCPA 5DLOA 1PWTA 4DBFA 2LNHB 2GTOA 1YJ9T 4BE1A 1M5Q1 2LCSA 1BI0A 2KGTA 1JJ2S 1R0BG 1RUWA 1FMVA 1U5SA 3OYHA 5D6XA 2ZCFB 5D6WA 1H3ZA 1YI2Q 4LXCA 4LUDA 2CH4W 5LJ3f 3JB9I 1OQKA 1U8RA 1AWWA 2FYKA 3G6EA 1TUGB 2CP2A 2NUTB 1BIBA 2DL5A 4B9XA 4M7AC 1BCOA 1MNEA 4XTZA 3WXMB 3CCUT 3PMIA 1NLPC 3G4ST 1XNIA 5GAMf 1KC8U 4M78E 4F14A 3JRZA 4AFUC 5DLQE 4M7DE 4BB7A 1EX4A 1RAIB 1ZSZB 1KK7A 2GF7A 4OB1B 1AEYA 3CCQA 3HFOA 2YUOA 4WCIA 3NHNA 1IO6A 1G3TA 1OX9A 2EGEA 2PVDB 1Q7YU 2HL3A 2HKNA 1UECA 1ZA2B 4QQDA 1LPLA 1SEMA 2M0YA 2PUOB 1KD1U 2RHYA 3GOXA 4XTYA 5A0GA 2R57A 1K4US 2NUZA 5FWCA 3CBMA 2RHUA 4HCCA 3OYIA 1MUZA 3A8GB 3T9NA 3CD6A 4N4GA 1RABB 4DEYA 4PNOA 1BIAA 2HKQB 3ER0A 4RUGA 4WF2A 3VS0A 2EYQA 3G71A 1YIJQ 4D6WA 3Q1JA 4OMPA 1KG1A 1SRLA 3M0SA 2HMAA 1YCSB 2ABLA 2KSSA 3OYEA 1K73U 5KYUA 1N8RR 3OW2P 3I56Q 4PJJA 4Z89A 3J81E 2ROLA 4HCKA 4FCYA 3CBOA 1ZBJA 2RQRA 5HY6A 2COYA 2GQVA 1TUDA 3H41A 2ZPIB 1KQSA 3CC2T 4CC4B 5IHNA 3GPLA 2O2OA 2ZZDA 3CCRQ 3EG9B 1M2VA 1PM3A 2J05A 2E64A 5LJ3h 4E7LA 3NFCA 4AFZC 2AK5A 1VOMA 4EIKA 2KT1A 3PT9A 3H0HA 2DVJA 1Q86U 1WA7A 1TUCA 1B3QA 3SDZA 2JVVA 2JTEA 5GAN4 1JEGA 5GAMh 2GFUA 2DL7A 1VQ8Q 1WPYA 4JRKA 3CCEQ 2E41A 4JLIA 2ZPHB 3CCVQ 3BY7A 4V2SA 1RAEB 3PGGA 1P92A 3OYMA 1QQJA 2DXBA 3KFVA 1SSHA 2Y4YA 5L23A 3TQ7P 2ZPGB 1ZUYA 1QWEA 5IN1A 1PSFA 5I21A 1C6VX 2KK4A 3FIFA 3QZ5B 4LDVA 4M78C 4X9CA 4EMKA 1TTHB 2EPDA 4L5GA 2QTVA 4M7DC 2CSIA 4AG1C 1XJWB 2XDDA 1G5VA 4JRIA 4KH1B 3L2QA 4HVVA 1GCQA 5GAN2 3P8DA 3JB9G 4RG2A 4C8QF 2SRCA 3JSCA 1YI2A 3C12A 2HAXA 3M56A 4ESRA 2E70A 3OYBA 5KYNA 3CCQT 6AT1B 1JXOA 3CCUQ 2CS7A 2D0QB 3THKA 4Q5WA 4JUVA 2LX9A 4ZTFA 3OMGA 3OBWA 3QDRB 4C92E 2KXCA 2GQIA 2K3BA 4JZ3A 4L59A 4M77G 5FU7B 4KGZB 2EJFA 1YFNA 3L42A 2LJ0A 3ZBDA 4C8QA 5GANh 1GBQA 2M1HA 1K8AR 3MHXA 5EC7A 2DO3A 1OZ3A 2EQUA 4XTVA 3M58A 3AHUA 2JOYA 3HRSA 2LZ6B 1O9SA 4C8QD 4FYVB 2O31A 1VQ9T 3CD6T 2JT4A 1SHGA 1M8MA 3LGLA 3G71T 3SD4A 4ANJA 1BB9A 3UATA 2VXEA 1J3TA 1FWZA 2J6OA 4RG8A 4ORZA 1TS9A 2KMTA 3PTAA 1AWXA 4M78D 3CCST 2LMJA 1SF9A 1VQ6Q 2DNUA 2JTFA 4XTUA 1D0ZA 4AG2C 3R6OA 4LUEA 1X6GA 5KYXA 2EQIA 2X9HA 2ENMA 4PJOF 1YIJA 3HTRA 1X69A 1G8XA 1NE8A 1S72A 1GFDA 2QYZA 1ZX6A 2DJQA 4QQGA 4IUUA 3EHRA 4N4HA 3OBYA 3I35A 4DEXA 3C0CA 4E7KA 2KRSA 2SEMA 2CP0A 1X6BA 2PVOB 4F17A 3I56A 3KUFA 3CC2Q 4OF1A 4AFQC 2EYWA 3UT1A 1M2VB 4PJMA 4NL2A 2RK1A 1MV0B 5J39A 3J80E 1B34A 3V8JA 2FZGB 1WDXA 5KE2A 5KYYB 3CCRA 1D1AA 1RLQC 1LCKA 4PJOA 3CCLT 2QASA 2IVWA 1G3SA 1R77A 1ZSZC 2NYSA 2GGRA 3URGA 2X4YA 3GP8A 3JCMd 1PKTA 1UTIA 1D0YA 5M9OA 2JM8A 3E2UA 2HBPA 1WYXA 3NTHA 4M7AG 4UC4A 2VVKA 2E5QA 1ZQ1A 2COZA 1M9SA 1VQ8A 1PSEA 5LJ5g 2RHZA 3BW1A 4OB2B 3VS3A 3CCEA 3CCVA 2NUPB 3M0PA 2ZAEA 4PKCC 2DX1A 1Q7YC 5GMKm 3E9FA 5CKBA 1D1CA 2L3QA 1KD1C 1VUBA 4N0AA 4DBQA 3ZEHA 2KYMA 4FW2A 3RDVA 2A08A 3OYKA 4C92C 2CSQA 1VQMA 1X6OA 1UGVA 4F16A 1AVZC 2YHTA 5KE3A 1X43A 2JMCA 4R0KA 1Y0MA 5CKFA 2LP5A 2VUBA 3M59A 5HCKA 4E7ZA 1ZLMA 3OYNA 3SHWA 4JLGA 2FL7A 2LRQA 5KYWA 1K73C 2F69A 4OMQA 2C0OA 3CCQQ 2QA4T 4D8DA 4A4EA 3KBGA 3OYAA 4XU1A 2FZKB 2V8KA 4YTLA 5IHKA 2HQHA 1M3BA 3RNJA 1IHVA 4NL3A 3JCMV 3CCUA 5GJWB 3A8LB 3INZA 3CXCS 3OYCA 2F2VA 1XTDA 2HCKA 2EBPA 2KROA 1I4K1 1OEBA 5FRNA 4FYYB 1RI0A 3JCMc 3OYDA 2XI9A 3BDLA 3C95A 3WVEB 1Q86C 1NG2A 1VQ9Q 5C0MA 3O8VA 1WIEA 4J9CA 2BE9B 3OYGA 3VRZA 3G71Q 2JNGA 2DE0X 4O6JA 1K9MR 4PK4A 4A63B 1WX6A 3M55A 4E7IA 1M90C 1M1KR 3VUBA 2A7YA 5CKHA 1F1BB 1S72T 3CCSQ 4C0ZA 3I5RA 4JPBW 1RI9A 4KGXB 4HKEA 4HVWA 4FSSA 2K4YA 4JJNK 4QVCA 3I56T 1QVFS 1VQ6A 1PHTA 4PFOA 1YWOA 2E65A 2CDTA 1OX8A 2KYBA 2M16A 1AWJA 5GMKh 2EYZA 3VS2A 2XDBA 5LJ5d 4M75B 1OOTA 5FLXE 2DD5A 3M0TA 2DAQA 1WHJA 1OPLA 3EG9A 5D7UA 3BDUA 3JB9F 1SRMA 1RAAB 2QQRA 4C0DC 4A54A 4JRPA 2OAWA 1JB0E 3F70A 2EQKA 3UPUA 4MDXA 3CC2A 3E9GA 3AT1B 4ZTJA 1YCYA 1UHFA 4M78G 3GIBA 2O88A 2YDLA 1G3WA 5IAYA 4M7DG 3CCLQ 1YJNA 2W0ZA 5LJ3g 4PJOB 2LQKA 1GFCA 2L2PA 3CC4Q 1BI1A 5CQYA 3OYJA 1NLOC 4J83A 1QWFA 4XTXA 3OS0A 3QPHA 4ZNXA 4TVRA 4FT4A 3X25B 1IZ6A 1UDLA 2R58A 4GLKA 1YWPA 4LDUA 1NZ9A 4RTXA 5FU6C 4E47A 3CQTA 5GAOl 2KY9A 1MMDA 4XAXB 2QQ9A 1ZBXA 2D1XA 2DILA 1CSKA 1WHLA 2HD0A 4E7SA 2AIRB 1JJ2A 1VQMT 3PIOA 3FEOA 5GAOm 4LNPA 3TSWA 3X28B 4LE9A 1Z9QA 1UG1A 3SB2A 4KBMB 1OI1A 2E3IA 4J9GA 1U1SA 4C8QE 1VQ4A 2DRMA 2QAZA 4AT1B 3LH0A 4FYWB 4J9FA 5CIUA 2DIGA 2DMOA 1R0CB 1NEBA 1H3HA 1Q81C 2ROTA 1SG5A 4RTZA 1IGQA 1ZUUA 4OMOA 5CCAA 5KYWB 4MZMA 2QA4Q 1I0CA 2K5IA 2ZGWA 2FO0A 3PMTA 2D6FA 3QSUA 2IPOB 1LVKA 1Y96A 3MEVA 2BUDA 1W70A 2EYYA 2RQUA 1VQLT 1GL5A 2RJEA 2OTJA 2CZ0B 2CP5A 3R6NA 5L8RE 4Z02A 2ECZA 3RKYA 2V1RA 2MWPA
chains in the Genus database with same CATH topology
5GAN2 2DEQA 4C8QG 3M57A 2PQWA 3S3NA 1FXXA 3P8DA 3JB9G 4RG2A 4C8QF 4J6YA 1VQ7T 3FLGA 3JSCA 1KC8C 4A53A 2E12A 1YI2A 5CVIA 3C12A 5GANg 4IUPA 2HAXA 3M56A 5I2MA 5CKDA 1OYXA 1QVGS 4HA8A 3CMAA 3X20B 3CC7A 2VYTA 3LWHA 3LLRA 4EPCA 5GMKl 2E6NA 5LJ5e 1U1TA 2E70A 2G3RA 2QQAA 3OYBA 4JS4A 3JCMW 3A5ZB 4QVZA 1VQNA 2BKDN 2XD0A 3PFSA 3CCQT 3FC3A 5GAOr 4OVAA 2CS7A 3ASKA 1VQ9A 2D0QB 1SSFA 2HNIA 2YRVA 2JN0A 5HKCA 4DA4A 4Q5WA 4JUVA 4XQ3A 1VQ6T 2LX9A 2XIDA 2M9UA 4ZTFA 3A8MB 5LJ3d 1M1GA 3OMGA 3OBWA 4HCBA 3QDRB 1UGRB 5GAN8 3CCJA 4C92E 2OAUA 2EQJA 5C6SA 4OB3B 2OTLA 2EFIA 4PJOE 5FU7C 5GAN6 4L59A 4M77G 5FU7B 3JCMh 5CKEA 2LNVA 3BFMA 5HK0A 3CCSA 3VKIA 3HSBA 2EJFA 4EMKC 3P8BB 4CI0C 3L42A 1UB4A 4M77F 5J3BA 3ZBDA 4C8QA 4CRIA 5GANh 1YI2T 1YJ9A 2M1HA 4EMKB 2K3YA 3VJPA 3OYFA 3MO8A 2JZ2A 5CR2A 3CBPA 3MHXA 2A3LA 2HQEA 1VQOT 2DO3A 1OZ3A 2EQUA 4OMFB 2KAFA 3M58A 4XTVA 1K9MC 4HT8A 3AHUA 2JOYA 3HRSA 4L6V5 1O9SA 4C8QD 5GAMg 1Y7XA 4RKUE 2MI6A 1W4SA 2RO0A 3QG1A 3V7SA 3JB9D 4NOYA 2ZPEB 1VQ9T 2DD4A 3LGFA 4Y28E 2XKOC 3CD6T 4HT9A 2YLCA 1WJQA 3LGLA 3G71T 2EKOA 1XQHA 3SD4A 4E7JA 2HQXA 2VXEA 1YJNT 1YITA 4ZGEB 3M4GA 1FWZA 3CCJT 2ZPFB 2DZ9A 4OGEA 4X9DA 4F7UE 5IT9E 4EDUA 2NLUA 4Y91A 4RG8A 1M1FA 1UGSB 2OTLT 4J6XA 3QHSA 2K5LA 2KMTA 3PTAA 2P0PA 3LYIA 3RKWA 3MP8A 2LT4A 2YLBA 2XHCA 3M53A 3FRNA 2FVUA 3A8HB 4LDYA 4M78D 4C92G 4EMGA 2MF2A 4R55A 2JTFA 3SWNB 4XTUA 4PJOG 4M77A 3R6OA 5CO7A 2CZ6B 4PJOF 3G4SA 5LJ3j 3GLXA 3SFMA 3UDCA 4LD9K 2VGNA 5CK9A 2EJ9A 1YIJA 2Y90A 4IUTA 2L3RA 3CCLA 5LL6S 4BY6C 2EQMA 4J6WA 2RD1A 1M1KC 1NE8A 3HP9A 4M77D 4RCBA 1I81A 3VYGA 3OA6A 1S72A 4BY6B 1M90U 3MP1A 1YBYA 4IURA 4C8QC 1KQ1A 2DPPB 4BI3A 1K8AU 3CC4A 4QQGA 1YHQT 1WQWA 4IUUA 4C8QB 1QP2A 2CZ7B 4IUVA 4N4HA 1UGQB 3CCMT 3OBYA 5A0DA 4JRQA 3X26B 4E7KA 4M7AE 4FT2A 2FB7A 4J5YA 3V7RA 3OS2A 2PVOB 3H6ZA 1Q82U 2DXUA 2DXTA 3I56A 1IREB 1JBMA 3KUFA 4A4KA 3A8OB 5D6YA 3CPWA 3FDRA 3CPWS 2DVEA 4OF1A 4E7HA 3VU3C 5GAMj 1JRIA 3UT1A 4F7UG 1TH7A 1Y07A 2JUFA 4BE2A 2VGMA 2P4TA 2KQWA 4KUIA 1WQ7A 2DXCA 2RI5A 4C5HA 2P0KA 3NTKA 4F7UF 4NL2A 4R56A 2RK1A 3KXTA 1W2BS 2RM4A 4C5GA 4ME7A 1B34A 4MZPA 3V8JA 4C92A 5J39A 3OYYA 3J80E 3S6WA 4M78B 5KE2A 3E1SA 3RMQA 2IG0A 5FROA 3QO3A 3CCRA 4BDYA 5J26A 1YIJT 4PJOA 3CCLT 2CGHA 2IVWA 1G3SA 2RHXA 2QTXA 2XG8D 3GNGA 2M0OA 4N4IA 4A4GA 4QVDA 2I2LA 4C92D 4PL6A 2X4YA 2QQBA 3URGA 3GP8A 3JCMd 2X4WA 3JCMg 3HFNA 5AYFA 2XDPA 4M77C 3C4SA 2RJDA 4MZTA 2XICA 4M75E 5GANd 2EWNA 3LW5E 2AHJB 4BUGA 4C0FA 1QVGA 1GXIE 3MEWA 4GY5A 3V8KA 5M9OA 4ELZC 4JS5A 3HL8A 1VQPT 2RB6A 2L5QA 2DK3A 4ELYC 4NS5A 5GMKi 2HBPA 1OZ2A 4KUDK 3OSSC 3NTHA 4M7AG 4UC4A 2QXFA 4C5IA 2E5QA 3QYHB 3NTIA 1ZQ1A 3QJYA 1M9SA 2OTJT 1VQ8A 4M7AF 5GAN3 5A0LA 1PSEA 2O01E 3OYLA 5LJ5g 2RHZA 2R5AA 3BW1A 4OB2B 2E6ZA 4PLLA 5KH6A 3CCEA 3CCVA 3HRUA 4PKCC 3L1AA 4PLIA 3CCRT 3C94A 1Q7YC 2RJFA 5GMKm 3E9FA 1V29B 4HCZA 5CKBA 5GAOq 3QBYA 3QXEB 3DLLA 1KHIA 2E1HA 1N27A 4BI8B 1NPPA 4XU0A 1Y96B 2VV5A 1NJIC 1VUBA 1KD1C 4P5NA 2X4XA 5I2SA 3DB3A 2QA4A 4EMHA 3QYGB 3L2RA 4N0AA 3CMEA 4BE0A 4ZN3A 3HPWA 2LTOA 2RJCA 3QJ6A 2LT1A 3ZEHA 5LJ3e 4RCCA 1R8OB 3OYKA 4C92C 3JCMQ 1MGQA 3CEYA 2KVQG 3DB4A 1B34B 2CZ1B 2PU9B 2RI3A 4C92B 2K57A 3RKXA 2DTIA 3CC7T 3CMAT 2GFAA 3HHTB 3MEUA 1X6OA 4X34A 4O5VA 1X75C 1VQMA 2K3XA 3E19A 2YHTA 5KE3A 1KQ2A 5GAMd 4M7DF 1VQNT 3JAME 4J7FA 2LVMA 2BIVA 2WSCE 1KHCA 3MEAA 4M75G 2O4XB 4B9WA 3V7CA 4DOVA 2ZPBB 1LNXA 1M4ZA 4M75F 5CKFA 2VUBA 3M59A 5LJ5h 1VQ8T 1VQ5A 3OYNA 4JLGA 3CCET 4M7AA 1WJRA 2CKKA 4J7IA 3CCVT 4XU2A 2WSFE 2K2VA 2FL7A 3MP6A 4KT0E 5GAMe 3L2VA 5GANj 2D6FA 2LRQA 2VXFA 1YJWA 1K73C 2F69A 1LOJA 4M7AD 2QA4T 5DLOA 4QQ6A 4A4EA 3KBGA 1WNLA 3JB9H 3LX7A 3OYAA 4XU1A 1KQSS 2V8KA 4YTLA 2DZCA 4LDXA 5GANf 1YJ9T 4OGCA 2XU8A 4BE1A 1M5Q1 2MWOA 4NL3A 3JCMV 1BI0A 4ZGJB 3ME9A 3CCUA 2D9TA 3JCMb 3A8LB 3INZA 4DQ2A 1JJ2S 5GAOp 3CXCS 2C06A 3GF5A 1BI3A 3OYCA 2PVGB 4MMKA 3OYHA 4N0AC 1Q81U 3CCST 5D6XA 3OS1A 2ZCFB 1XTDA 5D6WA 2RHIA 1H3ZA 3META 4M75A 1I4K1 4BACA 2RK2A 5LJ3f 4FM4B 4LDWA 3JB9I 1YITT 1U8RA 5FRNA 2FYKA 1RI0A 3JCMc 3OYDA 3LWIA 2XI9A 4FL6A 3BDLA 2WSEE 1XOVA 3V8LA 3C95A 3G6EA 2LQ8A 1LJOA 2V8IA 4M75D 3WVEB 1O75A 3S3MA 1Q86C 3JCMJ 1BIBA 5C0MA 4B9XA 3H8ZA 3O8VA 3TU4K 3OYGA 3QKJA 2VC8A 4M7AC 5A2QE 2QDYB 2JNGA 2Y4XA 1WGSA 4O6JA 3OW2A 4XTZA 3WXMB 3OY9A 4M7AB 3OW2S 1W2BA 3CCUT 3PMIA 1G3YA 2RA2A 3QIIA 4LD6A 2L8DA 1VQ4T 3M54A 3RUXA 5GAOn 5GAN5 3G4ST 4IKFA 1XNIA 3M55A 4BD3A 3X24B 4E7IA 5GAMf 1I8FA 1QW1A 4MMLA 1M90C 1VIEA 3VUBA 2A7YA 1D3BA 5CKHA 1KC8U 4M78E 1S72T 1X01A 3S3OA 3JRZA 2LC4A 2V8JA 4A4HA 4C0ZA 5DLQE 4II1A 2CYZB 4M7DE 2EJGA 3ZFJA 4BB7A 3CC4T 3OMCA 4OB1B 2GF7A 1Q82C 3CCQA 4PJOD 4QW2A 1BI2A 4BDZA 4HKEA 4M77B 2H3JA 2QEXA 1BYMA 2K4YA 3HFOA 4QVCA 2DJZA 3I56T 4JJNK 3G6ET 1QVFS 1VQ6A 2E65A 3JCMe 2M16A 4FSXA 5CAIA 1G3TA 5GMKh 2PVDB 1Q7YU 4M75C 5GANe 2XDBA 1N9SA 5LJ5d 4M75B 3DLMA 4QQDA 2DD5A 2MMPA 1HXDA 2PUOB 2DAQA 5FLXE 1NJIU 1KD1U 2RHYA 4FU6A 3DKMA 2LCLA 4MDWA 4JDSA 4F7UA 3GOXA 3BDUA 3JB9F 4XTYA 5A0GA 4ATOA 2R57A 1FX7A 2QQRA 4C0DC 3L2ZA 2LDMA 4A54A 3I55A 4A4FA 3CBMA 4JRPA 2RHUA 3M5AA 4C0DB 1VQOA 3M9QA 4HCCA 3OYIA 2DIQA 1JB0E 2QQSA 2KDSA 4ZN1A 3F70A 2EQKA 3UPUA 1K9MU 4MDXA 3CC2A 5GMKj 1UGPB 1N8RC 3A8GB 3E9GA 1VQKA 2LCCA 3T9NA 4ZTJA 3EAEA 4N4GA 3CD6A 1YCYA 4M78G 4PNOA 3JCMX 3GIBA 2QEXT 1BIAA 4C5EA 3GNFB 3HRTA 3SWNA 1M1KU 3ER0A 3G71A 1G3WA 4WF2A 5IAYA 2EYQA 4M78F 4M7DG 1YJNA 3MCAB 5LJ3g 4VUBA 4PJOB 1D3BB 2DKGA 4D6WA 2LQKA 3Q1JA 3RIRA 3JCMP 4OB0B 2K5FA 2JTMA 1BI1A 3EFRA 5CQYA 3OYJA 1KG1A 5CQXA 3M4YA 4J83A 3WVDB 2KSSA 4XTXA 3OS0A 3OYEA 1K73U 1EIFA 3QPHA 4BI4A 1QP3A 2F5KA 2EIFA 4FT4A 4TVRA 3X25B 1IZ6A 2WACA 2R58A 3J81E 3I55T 5FRMA 4GLKA 3PIPA 3CBOA 4LDUA 1NZ9A 2DTOA 5FU6C 5HY6A 4E47A 3JB9J 1NPRA 2GQVA 5KCOA 5GAOl 2KY9A 4XAXB 1BKBA 2MAMA 2QQ9A 1ZBXA 2ZPIB 3G7ZA 4XU3A 5FU6B 3JCMf 3CMET 2RI2A 1KQSA 3CC2T 3GPLA 1VQKT 5GAN7 3OS5A 3UWNA 1N6AA 2P0QA 1H641 2HD0A 2ZZDA 5LJ5j 2L89A 4FIBA 2E64A 4F7UB 3TREA 1JJ2A 1YHQA 1VQMT 3CXCA 5LJ3h 4E7LA 3TCJA 1N9RA 3NFCA 4KULA 3FEOA 3PIOA 4M78A 2GCXA 1UEBA 5GAOm 3OB9A 4M7DA 1DJ7B 3X28B 1Y71A 2X4JA 2DTHA 3RESA 5LJ5f 3EFSA 3PT9A 3FB9A 1VQ5T 3TEEA 3SWNC 1Q86U 1VQLA 3SB2A 4M7DD 4KBMB 1OI1A 5HK3A 4C92F 1ZHIA 2RH2A 3VUZA 3PNWC 3RMSA 1U1SA 1VIFA 4C8QE 1YJWT 3J7AF 4DOWA 3SDZA 1VQ4A 3RERA 2PUKB 2JVVA 2XK0A 5GAN4 5GAMh 2GFUA 1N8RU 2X35A 1HK9A 2QI2A 3LH0A 1WPYA 4C0GA 4JRKA 1QVPA 2E41A 5CIUA 4JLIA 2ZPHB 5DM7R 2DIGA 2E10A 3BY7A 4V2SA 4XTWA 4XK8E 1M8VA 3PGGA 4PJOC 1P92A 3OYMA 1Q81C 1VQ7A 1AHJB 1WJSA 3HKSA 2DXBA 5CCAA 4MZMA 4OP0A 3QUIA 5GMKe 2K5IA 2ZGWA 4J8OA 1VQPA 1K8AC 1RL2A 2Y4YA 2R5MA 3PMTA 3N5BB 4ZGDB 1I5LA 3P8HA 1Y96A 5DY9A 5EG2A 3QSUA 3OSVA 3QZ9B 2F5TX 2ZPGB 3MEVA 2BUDA 5IN1A 3VV0A 3FJPA 1VQLT 1PSFA 5I21A 2RJEA 3OQ5A 2OTJA 2CZ0B 2EAYA 3L2UA 4IUQA 2KK4A 3FIFA 3QZ5B 4LDVA 4M78C 4X9CA 4EMKA 1QVFA 4L5GA 3L2WA 5KCHA 4M77E 2B8AA 4M7DC 5L8RE 2XDDA 1G5VA 3CCMA 4Z02A 3CPFA 4JRIA 3VYHB 3L2QA 4RMOA 3RKYA 1MHNA 4M7DB 2MWPA 2FHDA 2O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LX7 A;  3OS2 A;  2PQW A;  3OYA A;  3S3N A;  3H6Z A;  3P8D A;  3KUF A;  4RG2 A;  5D6Y A;  3Q1J A;  4BE1 A;  2MWO A;  3FDR A;  3FLG A;  4E7H A;  3ME9 A;  2D9T A;  3OYJ A;  4IUP A;  3UT1 A;  1OYX A;  3OS0 A;  3OYC A;  3OYE A;  4BE2 A;  2VYT A;  3LLR A;  3OYH A;  4C5H A;  2E6N A;  2RI5 A;  2G3R A;  2P0K A;  2F5K A;  3NTK A;  3OYB A;  5D6X A;  4QVZ A;  4C5G A;  5J39 A;  2WAC A;  3OS1 A;  2BKD N;  2R58 A;  5FRM A;  3PFS A;  3S6W A;  5KE2 A;  5D6W A;  5FRO A;  2IG0 A;  2RHI A;  4OVA A;  3ASK A;  3FC3 A;  3MET A;  4BDY A;  5J26 A;  1H3Z A;  4BAC A;  1SSF A;  2YRV A;  2RHX A;  5FRN A;  4A4G A;  5KCO A;  4N4I A;  2M0O A;  4Q5W A;  1RI0 A;  4ZTF A;  3OYD A;  2RI2 A;  3OMG A;  4PL6 A;  2X4Y A;  3BDL A;  4FL6 A;  2X4W A;  3UWN A;  2XDP A;  2EQJ A;  3C4S A;  5C6S A;  2L89 A;  3S3M A;  2RJD A;  2EFI A;  5C0M A;  4B9X A;  3H8Z A;  3O8V A;  4E7L A;  3OYG A;  3MEW A;  3QKJ A;  4L59 A;  4GY5 A;  5M9O A;  3FEO A;  1WGS A;  3OB9 A;  3OY9 A;  4NS5 A;  3L42 A;  1OZ2 A;  3PMI A;  3QII A;  4LD6 A;  4CRI A;  3NTH A;  2L8D A;  2M1H A;  2K3Y A;  4UC4 A;  3OYF A;  3MO8 A;  2JZ2 A;  4C5I A;  4IKF A;  1XNI A;  2E5Q A;  4BD3 A;  3NTI A;  4E7I A;  2HQE A;  2EQU A;  1OZ3 A;  3OYL A;  2RHZ A;  2R5A A;  4PLL A;  5KH6 A;  3S3O A;  1OI1 A;  4A4H A;  3PNW C;  4PLI A;  2RO0 A;  4II1 A;  2RJF A;  3E9F A;  3LGF A;  3OMC A;  2GF7 A;  4HCZ A;  3QBY A;  1WJQ A;  1N27 A;  2XK0 A;  3LGL A;  4QW2 A;  4BDZ A;  4E7J A;  2EKO A;  2GFU A;  3SD4 A;  2HQX A;  2X35 A;  2X4X A;  3DB3 A;  3LH0 A;  3L2R A;  4BE0 A;  5CIU A;  2LTO A;  2RJC A;  3QJ6 A;  2DIG A;  3ZEH A;  2NLU A;  4EDU A;  3OYK A;  2M16 A;  3CEY A;  3OYM A;  3DB4 A;  1WJS A;  2RI3 A;  3LYI A;  2GFA A;  3MEU A;  3MP8 A;  4X34 A;  2K3X A;  3DLM A;  4QQD A;  2DAQ A;  5KE3 A;  2JTF A;  2RHY A;  3PMT A;  2R5M A;  4FU6 A;  2LVM A;  2BIV A;  1KHC A;  3MEA A;  3P8H A;  2O4X B;  4B9W A;  3GOX A;  2R57 A;  3MEV A;  2BUD A;  2QQR A;  2LDM A;  5IN1 A;  4A4F A;  3OYN A;  2RHU A;  4A4E A;  2RJE A;  3OQ5 A;  4IUT A;  3M9Q A;  1WJR A;  2L3R A;  2CKK A;  3L2U A;  4IUQ A;  4E7K A;  3OYI A;  2DIQ A;  2EQM A;  2QQS A;  3MP6 A;  3L2V A;  3F70 A;  2EQK A;  3OA6 A;  3L2W A;  2LRQ A;  3MP1 A;  5KCH A;  4IUR A;  2B8A A;  3E9G A;  1G5V A;  2LCC A;  4Z02 A;  4QQG A;  3EAE A;  4N4G A;  5IAY A;  4ZTJ A;  4IUU A;  3L2Q A;  1MHN A;  4IUV A;  4N4H A;  4C5E A;  4QQ6 A;  2MWP A;  2FHD A;  2O4X A; 
#chains in the Genus database with same CATH topology
 2ESW A;  2KXD A;  2ED0 A;  2E12 A;  5CVI A;  5GAN g;  5I2M A;  1QVG S;  3CMA A;  2GNC A;  1M2O A;  3X20 B;  3CC7 A;  4LN2 A;  1UE9 A;  4EPC A;  3LWH A;  4JS4 A;  1U1T A;  2G3R A;  3A5Z B;  4QVZ A;  1VQN A;  2YRD A;  1VQ9 A;  1SSF A;  4DA4 A;  1VQ6 T;  2JS2 A;  2XID A;  5LJ3 d;  1M1G A;  3M0U A;  1S72 Q;  2O9S A;  1KSW A;  1I5O B;  2V26 A;  5C6S A;  2CUB A;  2YUQ A;  4OB3 B;  2KR3 A;  4PJO E;  5GAN 6;  2CH4 A;  3CCS A;  3HSB A;  4EMK C;  2EVR A;  2DF6 A;  4CRI A;  2K3Y A;  3OYF A;  3CBP A;  2O9V A;  2KT8 A;  4HT8 A;  4X1V A;  1M30 A;  2L0A A;  1YNZ A;  1TXQ A;  4L6V 5;  1Q82 R;  2MI6 A;  3V7S A;  2RO0 A;  2DA9 A;  2ZPE B;  3LGF A;  1WJQ A;  2YSQ A;  2EKO A;  1XQH A;  3EGX A;  1YJN T;  3REA B;  1T3S A;  3M4G A;  5KYY A;  2DZ9 A;  4X9D A;  4EDU A;  4Y91 A;  1M1F A;  2OTL T;  4J6X A;  1H92 A;  1WXB A;  1SHF A;  1CKA A;  2J7I A;  2XHC A;  1ZUK A;  2FVU A;  4C92 G;  4EMG A;  2MF2 A;  5ECA A;  2EW3 A;  2D8J A;  2CZ6 B;  3O5Z A;  2VGN A;  1QLY A;  2EJ9 A;  2Y90 A;  3CCL A;  2AKK A;  3HP9 A;  1M90 U;  4BY6 B;  4C8Q C;  2COW A;  4BI3 A;  3CC4 A;  1WQW A;  1QP2 A;  1UGQ B;  2NUP A;  3ULR B;  4J9I A;  2FB7 A;  3V7R A;  3OS2 A;  1PCX A;  1JBM A;  4A4K A;  5D6Y A;  4PFZ A;  2E3H A;  3CPW A;  3CPW S;  2DVE A;  2W10 A;  1AWO A;  1TH7 A;  1Y07 A;  3LH5 A;  4BE2 A;  2VGM A;  2P4T A;  2EGC A;  2KQW A;  1VQM Q;  4KUI A;  4F7U F;  2DXC A;  1I5L A;  2P84 A;  1W2B S;  1VQ4 T;  1N8R C;  3OYY A;  1OU9 A;  3S6W A;  5FRO A;  3QO3 A;  1W6X A;  2CGH A;  1PRL C;  3GNG A;  4A4G A;  2M0O A;  1UHC A;  4WTO B;  1N5Z A;  1TOV A;  2QQB A;  2X4W A;  3JCM g;  3HFN A;  5AYF A;  2RJD A;  2XIC A;  5GAN d;  4DBR A;  4C0F A;  3MEW A;  3V8K A;  4ELZ C;  4JS5 A;  2RB6 A;  4ELY C;  4KUD K;  1OZ2 A;  3OSS C;  2E5K A;  1E7O A;  4C5I A;  3QYH B;  1QMC A;  5I22 A;  1RAH B;  1YHQ Q;  2OTJ T;  3OYL A;  1K0S A;  3EHQ A;  2FPD A;  3DLL A;  1KIK A;  3QXE B;  1KHI A;  2E1H A;  1NPP A;  1Y96 B;  2OI3 A;  4P5N A;  1PD1 A;  2X4X A;  2DL4 A;  3DB3 A;  1QCF A;  4EMH A;  2QA4 A;  1VQL Q;  4BE0 A;  2RJC A;  2M02 A;  3JCM Q;  2RI3 A;  2PU9 B;  3JV3 A;  3CMA T;  4PJO C;  3RKX A;  3CC7 T;  2AZV A;  1X75 C;  2QGG A;  4M7D F;  1KQ2 A;  1VQN T;  3JAM E;  1Z9Z A;  2BIV A;  2WSC E;  3MEA A;  4B9W A;  2MK5 A;  2ZPB B;  1LNX A;  1M4Z A;  4M75 F;  2VAS A;  2H3E B;  1WJR A;  4J7I A;  3EG2 A;  2VXF A;  2YXY A;  2JM9 A;  1WZO A;  3EGU A;  2P4R A;  1B7T A;  2CP6 A;  3JB9 H;  1KC8 R;  4PJL A;  1VYT A;  1D0X A;  1M3A A;  4OGC A;  2XU8 A;  1BBZ A;  2C06 A;  3GF5 A;  5I11 A;  2MPX C;  4MMK A;  4N0A C;  1Q81 U;  2EKH A;  2RHI A;  3MET A;  4CC2 A;  4M75 A;  1Q7Y R;  1T3L A;  4J9H A;  1OU8 A;  3PE0 A;  4FM4 B;  4LDW A;  2E4H A;  3LWI A;  3EH2 A;  4FL6 A;  1KD1 R;  2WSE E;  1XOV A;  3EG0 A;  2LQ8 A;  1LJO A;  4M75 D;  1O75 A;  3S3M A;  3JCM J;  1ARK A;  2DRK A;  3H8Z A;  3TU4 K;  2DYI A;  2L3P A;  2VC8 A;  2Y4X A;  2MYS A;  3OW2 A;  1YJN Q;  3OY9 A;  4M7A B;  3OW2 S;  3EGX B;  1RAD B;  3QII A;  2RA2 A;  4LD6 A;  3M54 A;  2YWW A;  4IKF A;  2OTL Q;  4BD3 A;  1QW1 A;  1VIE A;  2DLP A;  5FWB A;  3S3O A;  2LC4 A;  1HYO A;  2PTK A;  2QGF B;  3ZFJ A;  3CC4 T;  2FPF A;  1D1B A;  4PJO D;  4QW2 A;  4BDZ A;  1VYV A;  1K73 R;  3H0F A;  4OMN A;  1BYM A;  1C0M A;  1E6H A;  3FJ5 A;  3JCM e;  1FYN A;  1NYG A;  4E2F B;  2AT1 B;  1ZSG A;  1SPK A;  2EGA A;  1KFZ A;  3DLM A;  2MMP A;  4CC7 A;  3DKM A;  4RTW A;  4ATO A;  1WHG A;  1PG5 B;  2LDM A;  3L2Z A;  1JJ2 P;  1TG0 A;  3M5A A;  1VQO A;  3M9Q A;  1Q95 G;  5AT1 B;  4ZN1 A;  1K1Z A;  2RN8 A;  5GMK j;  1UGP B;  3EAE A;  1VQ4 Q;  3JCM X;  2QEX T;  4C5E A;  3SWN A;  1Q86 R;  1V1C A;  3MCA B;  1FMK A;  4VUB A;  1D3B B;  2DKG A;  4HXJ A;  4OB0 B;  4AMC A;  5CQX A;  3M4Y A;  2K7A A;  1EIF A;  4BI4 A;  1QP3 A;  2A28 A;  2WAC A;  3I55 T;  5FRM A;  3VS7 A;  3PIP A;  1MMG A;  2YRC A;  8AT1 B;  3JB9 J;  3QDF A;  1NPR A;  2J06 A;  5KCO A;  1BKB A;  4XU3 A;  2OTJ Q;  3G7Z A;  2RI2 A;  1VQK T;  4JJC A;  1N6A A;  3UWN A;  2P0Q A;  1H64 1;  2V1Q A;  1WXU A;  2L89 A;  5LJ5 j;  4FIB A;  2A37 A;  4F7U B;  3TRE A;  2RNA A;  1YHQ A;  3CXC A;  1N9R A;  4KUL A;  3UA6 A;  1UEB A;  4J9E A;  2X4J A;  2DTH A;  3RES A;  5LJ5 f;  2OX7 A;  3TEE A;  2DYB A;  2LQN A;  2JMA A;  3CMA Q;  1VQL A;  3A1P A;  3CC7 Q;  5HK3 A;  4C92 F;  2BZY A;  2F2W A;  2RH2 A;  3PNW C;  3GBQ A;  3RMS A;  1NJI R;  1VIF A;  3NGP A;  1VQN Q;  1N8R U;  1VA7 A;  2QI2 A;  1AD5 A;  5DM7 R;  1D09 B;  3EG1 A;  4XK8 E;  1IGU A;  4OP0 A;  5GMK e;  4J8O A;  1RL2 A;  2R5M A;  3P8H A;  2HSP A;  5EG2 A;  3OSV A;  3EFO A;  3QZ9 B;  2F5T X;  3RR6 A;  4HVU A;  2L3S A;  3FJP A;  3OQ5 A;  3EGD A;  4K11 A;  4IUQ A;  1WHK A;  1QVF A;  1RAF B;  3L2W A;  1UJY A;  5KCH A;  2DL3 A;  2M51 A;  3CCM A;  3CPF A;  3VYH B;  4M7D B;  1MHN A;  2K79 A;  4C8Q G;  3M57 A;  2PQW A;  1KQS P;  2ATC B;  1PKS A;  4J6Y A;  2AZS A;  1VQ7 T;  1YJW Q;  2C0I A;  5CKD A;  1OYX A;  2VYT A;  2E6N A;  5LJ5 e;  2BKD N;  3M0Q A;  2XD0 A;  3PFS A;  5GAO r;  4OVA A;  2YRV A;  5HKC A;  1FMW A;  2M9U A;  3A8M B;  1UJ0 A;  1CKB A;  2OTL A;  9ATC B;  5FU7 C;  2NWM A;  1HJD A;  2CT4 A;  5HK0 A;  2GBQ A;  2JS0 A;  3VKI A;  1ABO A;  1S1N A;  1UB4 A;  4M77 F;  1K9A A;  3VJP A;  2YUP A;  2DBK A;  2JZ2 A;  4QKU A;  5CR2 A;  1VQO T;  1K9M C;  4OMF B;  2XMF A;  1QKW A;  5GAM g;  1W4S A;  2YUN A;  1V76 A;  1M1K C;  3JB9 D;  4NOY A;  2DD4 A;  4HT9 A;  1OV3 A;  2HQX A;  1YIT A;  4ZGE B;  4RTV A;  3CCJ T;  2Z0W A;  2ZPF B;  4OGE A;  4F7U E;  5IT9 E;  2NLU A;  3TSZ A;  3LYI A;  3RKW A;  3MP8 A;  2LT4 A;  2VB6 A;  3M53 A;  2QEX Q;  3A8H B;  3SEM A;  4R55 A;  1PNJ A;  1NYF A;  3SWN B;  4PJO G;  4M77 A;  3A98 A;  1UUE A;  5LJ3 j;  3SFM A;  3UDC A;  4LD9 K;  4IUT A;  2DFU A;  5LL6 S;  2EQM A;  4J6W A;  4M77 D;  1X27 A;  4RCB A;  3VYG A;  3OA6 A;  3I5S A;  3MP1 A;  3RBB B;  2K6D A;  1K8A U;  2JW4 A;  3I55 Q;  1YHQ T;  1WHM A;  2BE7 D;  1TWB A;  1MMN A;  5A0D A;  4JRQ A;  1AT1 B;  3X26 B;  4FT2 A;  3VS1 A;  3H6Z A;  1IRE B;  1A0N B;  4JZ4 A;  2RMO A;  3FDR A;  1VQK Q;  4E7H A;  3VU3 C;  5GAM j;  5IHI A;  1WHH A;  1JRI A;  2RQT A;  2RI5 A;  4R56 A;  4PFP A;  2RM4 A;  1YN8 A;  4ME7 A;  4C5G A;  4MZP A;  4BDY A;  5J26 A;  2XG8 D;  1WXT A;  2X51 A;  2I2L A;  4PL6 A;  2JXB A;  8ATC B;  2KRN A;  2XDP A;  4OMM A;  1W1F A;  4M75 E;  3LW5 E;  1EZZ B;  2AHJ B;  4BUG A;  1QVG A;  1GXI E;  2A0F B;  3HL8 A;  2L5Q A;  1BK2 A;  2HSE B;  4NS5 A;  5GMK i;  5IXF A;  2QXF A;  3QJY A;  2H8H A;  4M7A F;  3UF4 A;  1MND A;  2O01 E;  5KH6 A;  3ZL7 C;  3L1A A;  2EYX A;  4PLI A;  2RJF A;  3CCM T;  4HCZ A;  3PVL A;  1ABQ A;  4JJD A;  2VV5 A;  3EFO B;  1Y57 A;  5I2S A;  1BCM A;  3L2R A;  3CME A;  3QJ6 A;  4PJN A;  5LJ3 e;  1IXD A;  3EGD B;  2KVQ G;  3DB4 A;  2RPN A;  4C92 B;  2DTI A;  2GFA A;  1U3O A;  3HHT B;  3MEU A;  4O5V A;  1GCQ C;  3E19 A;  5GAM d;  2CUD A;  2LVM A;  4J7F A;  3BE3 A;  1KHC A;  1QCN A;  4DOV A;  3V7C A;  1VQ7 Q;  4J9D A;  1AZG B;  1VQ5 A;  4Z8A A;  4IIO A;  4M7A A;  2KEA A;  2WSF E;  2CT3 A;  1VQP Q;  4KT0 E;  5GAM e;  5GAN j;  4Z88 A;  1M3C A;  1YJW A;  1LOJ A;  2X3X D;  2KI7 A;  2MOX A;  4M7A D;  1PRM C;  4QQ6 A;  1JQQ A;  1WNL A;  1IHW A;  3LX7 A;  1KQS S;  2OJ2 A;  2DZC A;  4B6M A;  4LDX A;  5GAN f;  2MWO A;  4AFS C;  4ZGJ B;  3ME9 A;  2D9T A;  3JCM b;  2DET A;  4DQ2 A;  1RAC B;  5GAO p;  1BI3 A;  2DL8 A;  4KGV B;  2PVG B;  2MIO A;  3OS1 A;  1TU0 B;  4BAC A;  2RK2 A;  1YIT T;  1JXM A;  1VQO Q;  2JJ9 A;  3V8L A;  2V8I A;  3H0I A;  3VS4 A;  1X2K A;  2CRE A;  3QKJ A;  5A2Q E;  2QDY B;  1WGS A;  1MV3 A;  1NEG A;  4CC3 A;  1W2B A;  1NBE B;  3EG3 A;  1G3Y A;  3CCJ Q;  2L8D A;  3RUX A;  5GAO n;  5GAN 5;  2RQW A;  3X24 B;  1I8F A;  4MML A;  1D3B A;  1X01 A;  2V8J A;  2LJ3 A;  1QKX A;  4A4H A;  4II1 A;  2CYZ B;  2EJG A;  1X2Q A;  1YJ9 Q;  3OMC A;  1Q82 C;  1BI2 A;  4M77 B;  2FRY A;  2H3J A;  2QEX A;  3MPU B;  2DJZ A;  3G6E T;  1HD3 A;  4FSX A;  1RAG B;  5CAI A;  1EFN A;  4M75 C;  2HBW A;  5GAN e;  1JO8 A;  1N9S A;  2J6K A;  2HL5 C;  1HXD A;  1NJI U;  1PC0 A;  4FU6 A;  2LCL A;  1B07 A;  4MDW A;  4JDS A;  4F7U A;  2I0N A;  2DEU A;  1FX7 A;  3I55 A;  4A4F A;  3CXC P;  3REB B;  1K76 A;  4C0D B;  4GLM A;  2DIQ A;  2QQS A;  2KDS A;  3U23 A;  1K9M U;  2FG0 A;  1VQK A;  2LCC A;  3G4S Q;  3GNF B;  1KJW A;  3HRT A;  1M1K U;  4M78 F;  3RIR A;  3JCM P;  2J6F A;  3QWX X;  2K5F A;  3PVQ A;  2JTM A;  3EFR A;  2FEI A;  3WVD B;  1GBR A;  2DBM A;  2F5K A;  2EIF A;  2RQV A;  2C0T A;  2DTO A;  4M4Z A;  2FRW A;  2MAM A;  5FU6 B;  1TSF A;  3JCM f;  3CME T;  1T0H A;  5GJV B;  5GAN 7;  3OS5 A;  4Y92 A;  4RTY A;  3CCM Q;  2KRM A;  3TCJ A;  4KH0 B;  1QVF P;  4M78 A;  2GCX A;  7AT1 B;  3OB9 A;  1AZE A;  2G6F X;  1AOJ A;  4M7D A;  1DJ7 B;  1Y71 A;  3EFS A;  3FB9 A;  1VQ5 T;  3SWN C;  2AKL A;  4M7D D;  1ZHI A;  3VUZ A;  4IIM A;  1YJW T;  1I07 A;  2MCN A;  4D8K A;  3J7A F;  5IXB A;  4DOW A;  3RER A;  2PUK B;  2RF0 A;  2XK0 A;  2CP3 A;  2X35 A;  1HK9 A;  4C0G A;  1QVP A;  5KYU B;  2E10 A;  2VKN A;  2KNB B;  2LJ1 A;  4XTW A;  3G1J A;  1M8V A;  1VQ7 A;  1AHJ B;  1WJS A;  3HKS A;  2D8H A;  2IIM A;  3QUI A;  1VQP A;  1K8A C;  3N5B B;  4ZGD B;  5DY9 A;  1ZA1 B;  2VWF A;  3VV0 A;  1G83 A;  3H9N A;  3IQL A;  2EAY A;  3L2U A;  4M77 E;  2B8A A;  3VS6 A;  3VRY A;  4RMO A;  2FHD A;  2O4X A;  2DEQ A;  1E6G A;  3S3N A;  1FXX A;  1YIT Q;  1OPK A;  2PZ1 A;  3FLG A;  1KC8 C;  4QT7 A;  4A53 A;  1C1A A;  2BZ8 A;  4IUP A;  2PNI A;  2K9G A;  4HA8 A;  3D7S B;  1MMA A;  3LLR A;  5GMK l;  1WI7 A;  3NMZ C;  3JCM W;  2QQA A;  4J9B A;  3FC3 A;  3ASK A;  2HNI A;  2JN0 A;  1RLP C;  4XQ3 A;  4GBQ A;  4HCB A;  1UGR B;  2A36 A;  5GAN 8;  3CCJ A;  2OAU A;  2EQJ A;  2EFI A;  1G2B A;  3JCM h;  5CKE A;  2LNV A;  3BFM A;  1BU1 A;  2BTT A;  3P8B B;  4CI0 C;  1M90 R;  5J3B A;  3G6E Q;  1OUL A;  3NPF A;  1YI2 T;  1YJ9 A;  2YT6 A;  4EMK B;  3MO8 A;  5FW9 A;  1NM7 A;  2A3L A;  2HQE A;  3MJX A;  2KAF A;  2NUT A;  1IRX A;  1Y7X A;  4RKU E;  3QG1 A;  3MKD A;  4Y28 E;  2XKO C;  2YLC A;  4JJB A;  4DBH A;  4E7J A;  1UGS B;  3QHS A;  2K5L A;  3M0R A;  2HDA A;  2P0P A;  2KBT A;  1SKU B;  2YLB A;  4LDY A;  3FRN A;  1ZSZ A;  4FYX B;  1HSQ A;  3EH1 A;  5CO7 A;  3G4S A;  4F04 B;  3GLX A;  1QVG P;  2HZY A;  5CK9 A;  2L3R A;  4BY6 C;  2RD1 A;  1I81 A;  2CP7 A;  1YBY A;  4IUR A;  1KQ1 A;  2DPP B;  2B86 A;  4FW1 A;  2CZ7 B;  4IUV A;  4C8Q B;  4M7A E;  1PD0 A;  4J5Y A;  1Q82 U;  1UFF A;  2DXU A;  2DXT A;  3CME Q;  3A8O B;  2K2M A;  1WLP B;  1T0J A;  2X3W D;  3CD6 Q;  4F7U G;  1YP5 A;  2FZC B;  2JUF A;  3QWY A;  3I9Q A;  4C5H A;  1WQ7 A;  2P0K A;  3NTK A;  3KXT A;  4C92 A;  4M78 B;  3E1S A;  3RMQ A;  2IG0 A;  1YIJ T;  1JU5 C;  2RHX A;  1VQ5 Q;  1GRI A;  2QTX A;  4N4I A;  4RTU A;  4QVD A;  4C92 D;  2DER A;  1WFW A;  4M77 C;  1QCO A;  3C4S A;  4MZT A;  3VS5 A;  2EWN A;  5KYX B;  2LQW A;  4GY5 A;  1VQP T;  2DK3 A;  4E6R A;  2F2X A;  2D0N A;  3NTI A;  5GAN 3;  5A0L A;  3UA7 A;  2R5A A;  4PLL A;  2E6Z A;  3HRU A;  2QDL A;  3CCR T;  3C94 A;  1V29 B;  5GAO q;  3QBY A;  5IH2 A;  1N27 A;  4BI8 B;  4XU0 A;  1NJI C;  2ED1 A;  2KE9 A;  2HEQ A;  2FPE A;  4OML A;  3TVT A;  1M27 C;  3QYG B;  4ZN3 A;  3HPW A;  1I1J A;  1Q81 R;  2LTO A;  1VYU A;  2LT1 A;  4RCC A;  2QG9 B;  1R8O B;  2GTJ A;  4RTT A;  1MGQ A;  3CEY A;  1B34 B;  2CZ1 B;  2K57 A;  4X34 A;  2K3X A;  2F1L A;  4M75 G;  2O4X B;  3CPW P;  2DM1 A;  1VQ8 T;  5LJ5 h;  1K0X A;  1ACM B;  4KRT A;  3CCE T;  2LX7 A;  2CKK A;  3CCV T;  1IB8 A;  4XU2 A;  2K2V A;  1H8K A;  2BZX A;  1W2B P;  1U06 A;  3MP6 A;  3L2V A;  2QK0 A;  1GCP A;  5DLO A;  1PWT A;  4DBF A;  2LNH B;  2GTO A;  1YJ9 T;  4BE1 A;  1M5Q 1;  2LCS A;  1BI0 A;  2KGT A;  1JJ2 S;  1R0B G;  1RUW A;  1FMV A;  1U5S A;  3OYH A;  5D6X A;  2ZCF B;  5D6W A;  1H3Z A;  1YI2 Q;  4LXC A;  4LUD A;  2CH4 W;  5LJ3 f;  3JB9 I;  1OQK A;  1U8R A;  1AWW A;  2FYK A;  3G6E A;  1TUG B;  2CP2 A;  2NUT B;  1BIB A;  2DL5 A;  4B9X A;  4M7A C;  1BCO A;  1MNE A;  4XTZ A;  3WXM B;  3CCU T;  3PMI A;  1NLP C;  3G4S T;  1XNI A;  5GAM f;  1KC8 U;  4M78 E;  4F14 A;  3JRZ A;  4AFU C;  5DLQ E;  4M7D E;  4BB7 A;  1EX4 A;  1RAI B;  1ZSZ B;  1KK7 A;  2GF7 A;  4OB1 B;  1AEY A;  3CCQ A;  3HFO A;  2YUO A;  4WCI A;  3NHN A;  1IO6 A;  1G3T A;  1OX9 A;  2EGE A;  2PVD B;  1Q7Y U;  2HL3 A;  2HKN A;  1UEC A;  1ZA2 B;  4QQD A;  1LPL A;  1SEM A;  2M0Y A;  2PUO B;  1KD1 U;  2RHY A;  3GOX A;  4XTY A;  5A0G A;  2R57 A;  1K4U S;  2NUZ A;  5FWC A;  3CBM A;  2RHU A;  4HCC A;  3OYI A;  1MUZ A;  3A8G B;  3T9N A;  3CD6 A;  4N4G A;  1RAB B;  4DEY A;  4PNO A;  1BIA A;  2HKQ B;  3ER0 A;  4RUG A;  4WF2 A;  3VS0 A;  2EYQ A;  3G71 A;  1YIJ Q;  4D6W A;  3Q1J A;  4OMP A;  1KG1 A;  1SRL A;  3M0S A;  2HMA A;  1YCS B;  2ABL A;  2KSS A;  3OYE A;  1K73 U;  5KYU A;  1N8R R;  3OW2 P;  3I56 Q;  4PJJ A;  4Z89 A;  3J81 E;  2ROL A;  4HCK A;  4FCY A;  3CBO A;  1ZBJ A;  2RQR A;  5HY6 A;  2COY A;  2GQV A;  1TUD A;  3H41 A;  2ZPI B;  1KQS A;  3CC2 T;  4CC4 B;  5IHN A;  3GPL A;  2O2O A;  2ZZD A;  3CCR Q;  3EG9 B;  1M2V A;  1PM3 A;  2J05 A;  2E64 A;  5LJ3 h;  4E7L A;  3NFC A;  4AFZ C;  2AK5 A;  1VOM A;  4EIK A;  2KT1 A;  3PT9 A;  3H0H A;  2DVJ A;  1Q86 U;  1WA7 A;  1TUC A;  1B3Q A;  3SDZ A;  2JVV A;  2JTE A;  5GAN 4;  1JEG A;  5GAM h;  2GFU A;  2DL7 A;  1VQ8 Q;  1WPY A;  4JRK A;  3CCE Q;  2E41 A;  4JLI A;  2ZPH B;  3CCV Q;  3BY7 A;  4V2S A;  1RAE B;  3PGG A;  1P92 A;  3OYM A;  1QQJ A;  2DXB A;  3KFV A;  1SSH A;  2Y4Y A;  5L23 A;  3TQ7 P;  2ZPG B;  1ZUY A;  1QWE A;  5IN1 A;  1PSF A;  5I21 A;  1C6V X;  2KK4 A;  3FIF A;  3QZ5 B;  4LDV A;  4M78 C;  4X9C A;  4EMK A;  1TTH B;  2EPD A;  4L5G A;  2QTV A;  4M7D C;  2CSI A;  4AG1 C;  1XJW B;  2XDD A;  1G5V A;  4JRI A;  4KH1 B;  3L2Q A;  4HVV A;  1GCQ A;  5GAN 2;  3P8D A;  3JB9 G;  4RG2 A;  4C8Q F;  2SRC A;  3JSC A;  1YI2 A;  3C12 A;  2HAX A;  3M56 A;  4ESR A;  2E70 A;  3OYB A;  5KYN A;  3CCQ T;  6AT1 B;  1JXO A;  3CCU Q;  2CS7 A;  2D0Q B;  3THK A;  4Q5W A;  4JUV A;  2LX9 A;  4ZTF A;  3OMG A;  3OBW A;  3QDR B;  4C92 E;  2KXC A;  2GQI A;  2K3B A;  4JZ3 A;  4L59 A;  4M77 G;  5FU7 B;  4KGZ B;  2EJF A;  1YFN A;  3L42 A;  2LJ0 A;  3ZBD A;  4C8Q A;  5GAN h;  1GBQ A;  2M1H A;  1K8A R;  3MHX A;  5EC7 A;  2DO3 A;  1OZ3 A;  2EQU A;  4XTV A;  3M58 A;  3AHU A;  2JOY A;  3HRS A;  2LZ6 B;  1O9S A;  4C8Q D;  4FYV B;  2O31 A;  1VQ9 T;  3CD6 T;  2JT4 A;  1SHG A;  1M8M A;  3LGL A;  3G71 T;  3SD4 A;  4ANJ A;  1BB9 A;  3UAT A;  2VXE A;  1J3T A;  1FWZ A;  2J6O A;  4RG8 A;  4ORZ A;  1TS9 A;  2KMT A;  3PTA A;  1AWX A;  4M78 D;  3CCS T;  2LMJ A;  1SF9 A;  1VQ6 Q;  2DNU A;  2JTF A;  4XTU A;  1D0Z A;  4AG2 C;  3R6O A;  4LUE A;  1X6G A;  5KYX A;  2EQI A;  2X9H A;  2ENM A;  4PJO F;  1YIJ A;  3HTR A;  1X69 A;  1G8X A;  1NE8 A;  1S72 A;  1GFD A;  2QYZ A;  1ZX6 A;  2DJQ A;  4QQG A;  4IUU A;  3EHR A;  4N4H A;  3OBY A;  3I35 A;  4DEX A;  3C0C A;  4E7K A;  2KRS A;  2SEM A;  2CP0 A;  1X6B A;  2PVO B;  4F17 A;  3I56 A;  3KUF A;  3CC2 Q;  4OF1 A;  4AFQ C;  2EYW A;  3UT1 A;  1M2V B;  4PJM A;  4NL2 A;  2RK1 A;  1MV0 B;  5J39 A;  3J80 E;  1B34 A;  3V8J A;  2FZG B;  1WDX A;  5KE2 A;  5KYY B;  3CCR A;  1D1A A;  1RLQ C;  1LCK A;  4PJO A;  3CCL T;  2QAS A;  2IVW A;  1G3S A;  1R77 A;  1ZSZ C;  2NYS A;  2GGR A;  3URG A;  2X4Y A;  3GP8 A;  3JCM d;  1PKT A;  1UTI A;  1D0Y A;  5M9O A;  2JM8 A;  3E2U A;  2HBP A;  1WYX A;  3NTH A;  4M7A G;  4UC4 A;  2VVK A;  2E5Q A;  1ZQ1 A;  2COZ A;  1M9S A;  1VQ8 A;  1PSE A;  5LJ5 g;  2RHZ A;  3BW1 A;  4OB2 B;  3VS3 A;  3CCE A;  3CCV A;  2NUP B;  3M0P A;  2ZAE A;  4PKC C;  2DX1 A;  1Q7Y C;  5GMK m;  3E9F A;  5CKB A;  1D1C A;  2L3Q A;  1KD1 C;  1VUB A;  4N0A A;  4DBQ A;  3ZEH A;  2KYM A;  4FW2 A;  3RDV A;  2A08 A;  3OYK A;  4C92 C;  2CSQ A;  1VQM A;  1X6O A;  1UGV A;  4F16 A;  1AVZ C;  2YHT A;  5KE3 A;  1X43 A;  2JMC A;  4R0K A;  1Y0M A;  5CKF A;  2LP5 A;  2VUB A;  3M59 A;  5HCK A;  4E7Z A;  1ZLM A;  3OYN A;  3SHW A;  4JLG A;  2FL7 A;  2LRQ A;  5KYW A;  1K73 C;  2F69 A;  4OMQ A;  2C0O A;  3CCQ Q;  2QA4 T;  4D8D A;  4A4E A;  3KBG A;  3OYA A;  4XU1 A;  2FZK B;  2V8K A;  4YTL A;  5IHK A;  2HQH A;  1M3B A;  3RNJ A;  1IHV A;  4NL3 A;  3JCM V;  3CCU A;  5GJW B;  3A8L B;  3INZ A;  3CXC S;  3OYC A;  2F2V A;  1XTD A;  2HCK A;  2EBP A;  2KRO A;  1I4K 1;  1OEB A;  5FRN A;  4FYY B;  1RI0 A;  3JCM c;  3OYD A;  2XI9 A;  3BDL A;  3C95 A;  3WVE B;  1Q86 C;  1NG2 A;  1VQ9 Q;  5C0M A;  3O8V A;  1WIE A;  4J9C A;  2BE9 B;  3OYG A;  3VRZ A;  3G71 Q;  2JNG A;  2DE0 X;  4O6J A;  1K9M R;  4PK4 A;  4A63 B;  1WX6 A;  3M55 A;  4E7I A;  1M90 C;  1M1K R;  3VUB A;  2A7Y A;  5CKH A;  1F1B B;  1S72 T;  3CCS Q;  4C0Z A;  3I5R A;  4JPB W;  1RI9 A;  4KGX B;  4HKE A;  4HVW A;  4FSS A;  2K4Y A;  4JJN K;  4QVC A;  3I56 T;  1QVF S;  1VQ6 A;  1PHT A;  4PFO A;  1YWO A;  2E65 A;  2CDT A;  1OX8 A;  2KYB A;  2M16 A;  1AWJ A;  5GMK h;  2EYZ A;  3VS2 A;  2XDB A;  5LJ5 d;  4M75 B;  1OOT A;  5FLX E;  2DD5 A;  3M0T A;  2DAQ A;  1WHJ A;  1OPL A;  3EG9 A;  5D7U A;  3BDU A;  3JB9 F;  1SRM A;  1RAA B;  2QQR A;  4C0D C;  4A54 A;  4JRP A;  2OAW A;  1JB0 E;  3F70 A;  2EQK A;  3UPU A;  4MDX A;  3CC2 A;  3E9G A;  3AT1 B;  4ZTJ A;  1YCY A;  1UHF A;  4M78 G;  3GIB A;  2O88 A;  2YDL A;  1G3W A;  5IAY A;  4M7D G;  3CCL Q;  1YJN A;  2W0Z A;  5LJ3 g;  4PJO B;  2LQK A;  1GFC A;  2L2P A;  3CC4 Q;  1BI1 A;  5CQY A;  3OYJ A;  1NLO C;  4J83 A;  1QWF A;  4XTX A;  3OS0 A;  3QPH A;  4ZNX A;  4TVR A;  4FT4 A;  3X25 B;  1IZ6 A;  1UDL A;  2R58 A;  4GLK A;  1YWP A;  4LDU A;  1NZ9 A;  4RTX A;  5FU6 C;  4E47 A;  3CQT A;  5GAO l;  2KY9 A;  1MMD A;  4XAX B;  2QQ9 A;  1ZBX A;  2D1X A;  2DIL A;  1CSK A;  1WHL A;  2HD0 A;  4E7S A;  2AIR B;  1JJ2 A;  1VQM T;  3PIO A;  3FEO A;  5GAO m;  4LNP A;  3TSW A;  3X28 B;  4LE9 A;  1Z9Q A;  1UG1 A;  3SB2 A;  4KBM B;  1OI1 A;  2E3I A;  4J9G A;  1U1S A;  4C8Q E;  1VQ4 A;  2DRM A;  2QAZ A;  4AT1 B;  3LH0 A;  4FYW B;  4J9F A;  5CIU A;  2DIG A;  2DMO A;  1R0C B;  1NEB A;  1H3H A;  1Q81 C;  2ROT A;  1SG5 A;  4RTZ A;  1IGQ A;  1ZUU A;  4OMO A;  5CCA A;  5KYW B;  4MZM A;  2QA4 Q;  1I0C A;  2K5I A;  2ZGW A;  2FO0 A;  3PMT A;  2D6F A;  3QSU A;  2IPO B;  1LVK A;  1Y96 A;  3MEV A;  2BUD A;  1W70 A;  2EYY A;  2RQU A;  1VQL T;  1GL5 A;  2RJE A;  2OTJ A;  2CZ0 B;  2CP5 A;  3R6N A;  5L8R E;  4Z02 A;  2ECZ A;  3RKY A;  2V1R A;  2MWP A; 
#chains in the Genus database with same CATH homology
 5GAN 2;  2DEQ A;  4C8Q G;  3M57 A;  2PQW A;  3S3N A;  1FXX A;  3P8D A;  3JB9 G;  4RG2 A;  4C8Q F;  4J6Y A;  1VQ7 T;  3FLG A;  3JSC A;  1KC8 C;  4A53 A;  2E12 A;  1YI2 A;  5CVI A;  3C12 A;  5GAN g;  4IUP A;  2HAX A;  3M56 A;  5I2M A;  5CKD A;  1OYX A;  1QVG S;  4HA8 A;  3CMA A;  3X20 B;  3CC7 A;  2VYT A;  3LWH A;  3LLR A;  4EPC A;  5GMK l;  2E6N A;  5LJ5 e;  1U1T A;  2E70 A;  2G3R A;  2QQA A;  3OYB A;  4JS4 A;  3JCM W;  3A5Z B;  4QVZ A;  1VQN A;  2BKD N;  2XD0 A;  3PFS A;  3CCQ T;  3FC3 A;  5GAO r;  4OVA A;  2CS7 A;  3ASK A;  1VQ9 A;  2D0Q B;  1SSF A;  2HNI A;  2YRV A;  2JN0 A;  5HKC A;  4DA4 A;  4Q5W A;  4JUV A;  4XQ3 A;  1VQ6 T;  2LX9 A;  2XID A;  2M9U A;  4ZTF A;  3A8M B;  5LJ3 d;  1M1G A;  3OMG A;  3OBW A;  4HCB A;  3QDR B;  1UGR B;  5GAN 8;  3CCJ A;  4C92 E;  2OAU A;  2EQJ A;  5C6S A;  4OB3 B;  2OTL A;  2EFI A;  4PJO E;  5FU7 C;  5GAN 6;  4L59 A;  4M77 G;  5FU7 B;  3JCM h;  5CKE A;  2LNV A;  3BFM A;  5HK0 A;  3CCS A;  3VKI A;  3HSB A;  2EJF A;  4EMK C;  3P8B B;  4CI0 C;  3L42 A;  1UB4 A;  4M77 F;  5J3B A;  3ZBD A;  4C8Q A;  4CRI A;  5GAN h;  1YI2 T;  1YJ9 A;  2M1H A;  4EMK B;  2K3Y A;  3VJP A;  3OYF A;  3MO8 A;  2JZ2 A;  5CR2 A;  3CBP A;  3MHX A;  2A3L A;  2HQE A;  1VQO T;  2DO3 A;  1OZ3 A;  2EQU A;  4OMF B;  2KAF A;  3M58 A;  4XTV A;  1K9M C;  4HT8 A;  3AHU A;  2JOY A;  3HRS A;  4L6V 5;  1O9S A;  4C8Q D;  5GAM g;  1Y7X A;  4RKU E;  2MI6 A;  1W4S A;  2RO0 A;  3QG1 A;  3V7S A;  3JB9 D;  4NOY A;  2ZPE B;  1VQ9 T;  2DD4 A;  3LGF A;  4Y28 E;  2XKO C;  3CD6 T;  4HT9 A;  2YLC A;  1WJQ A;  3LGL A;  3G71 T;  2EKO A;  1XQH A;  3SD4 A;  4E7J A;  2HQX A;  2VXE A;  1YJN T;  1YIT A;  4ZGE B;  3M4G A;  1FWZ A;  3CCJ T;  2ZPF B;  2DZ9 A;  4OGE A;  4X9D A;  4F7U E;  5IT9 E;  4EDU A;  2NLU A;  4Y91 A;  4RG8 A;  1M1F A;  1UGS B;  2OTL T;  4J6X A;  3QHS A;  2K5L A;  2KMT A;  3PTA A;  2P0P A;  3LYI A;  3RKW A;  3MP8 A;  2LT4 A;  2YLB A;  2XHC A;  3M53 A;  3FRN A;  2FVU A;  3A8H B;  4LDY A;  4M78 D;  4C92 G;  4EMG A;  2MF2 A;  4R55 A;  2JTF A;  3SWN B;  4XTU A;  4PJO G;  4M77 A;  3R6O A;  5CO7 A;  2CZ6 B;  4PJO F;  3G4S A;  5LJ3 j;  3GLX A;  3SFM A;  3UDC A;  4LD9 K;  2VGN A;  5CK9 A;  2EJ9 A;  1YIJ A;  2Y90 A;  4IUT A;  2L3R A;  3CCL A;  5LL6 S;  4BY6 C;  2EQM A;  4J6W A;  2RD1 A;  1M1K C;  1NE8 A;  3HP9 A;  4M77 D;  4RCB A;  1I81 A;  3VYG A;  3OA6 A;  1S72 A;  4BY6 B;  1M90 U;  3MP1 A;  1YBY A;  4IUR A;  4C8Q C;  1KQ1 A;  2DPP B;  4BI3 A;  1K8A U;  3CC4 A;  4QQG A;  1YHQ T;  1WQW A;  4IUU A;  4C8Q B;  1QP2 A;  2CZ7 B;  4IUV A;  4N4H A;  1UGQ B;  3CCM T;  3OBY A;  5A0D A;  4JRQ A;  3X26 B;  4E7K A;  4M7A E;  4FT2 A;  2FB7 A;  4J5Y A;  3V7R A;  3OS2 A;  2PVO B;  3H6Z A;  1Q82 U;  2DXU A;  2DXT A;  3I56 A;  1IRE B;  1JBM A;  3KUF A;  4A4K A;  3A8O B;  5D6Y A;  3CPW A;  3FDR A;  3CPW S;  2DVE A;  4OF1 A;  4E7H A;  3VU3 C;  5GAM j;  1JRI A;  3UT1 A;  4F7U G;  1TH7 A;  1Y07 A;  2JUF A;  4BE2 A;  2VGM A;  2P4T A;  2KQW A;  4KUI A;  1WQ7 A;  2DXC A;  2RI5 A;  4C5H A;  2P0K A;  3NTK A;  4F7U F;  4NL2 A;  4R56 A;  2RK1 A;  3KXT A;  1W2B S;  2RM4 A;  4C5G A;  4ME7 A;  1B34 A;  4MZP A;  3V8J A;  4C92 A;  5J39 A;  3OYY A;  3J80 E;  3S6W A;  4M78 B;  5KE2 A;  3E1S A;  3RMQ A;  2IG0 A;  5FRO A;  3QO3 A;  3CCR A;  4BDY A;  5J26 A;  1YIJ T;  4PJO A;  3CCL T;  2CGH A;  2IVW A;  1G3S A;  2RHX A;  2QTX A;  2XG8 D;  3GNG A;  2M0O A;  4N4I A;  4A4G A;  4QVD A;  2I2L A;  4C92 D;  4PL6 A;  2X4Y A;  2QQB A;  3URG A;  3GP8 A;  3JCM d;  2X4W A;  3JCM g;  3HFN A;  5AYF A;  2XDP A;  4M77 C;  3C4S A;  2RJD A;  4MZT A;  2XIC A;  4M75 E;  5GAN d;  2EWN A;  3LW5 E;  2AHJ B;  4BUG A;  4C0F A;  1QVG A;  1GXI E;  3MEW A;  4GY5 A;  3V8K A;  5M9O A;  4ELZ C;  4JS5 A;  3HL8 A;  1VQP T;  2RB6 A;  2L5Q A;  2DK3 A;  4ELY C;  4NS5 A;  5GMK i;  2HBP A;  1OZ2 A;  4KUD K;  3OSS C;  3NTH A;  4M7A G;  4UC4 A;  2QXF A;  4C5I A;  2E5Q A;  3QYH B;  3NTI A;  1ZQ1 A;  3QJY A;  1M9S A;  2OTJ T;  1VQ8 A;  4M7A F;  5GAN 3;  5A0L A;  1PSE A;  2O01 E;  3OYL A;  5LJ5 g;  2RHZ A;  2R5A A;  3BW1 A;  4OB2 B;  2E6Z A;  4PLL A;  5KH6 A;  3CCE A;  3CCV A;  3HRU A;  4PKC C;  3L1A A;  4PLI A;  3CCR T;  3C94 A;  1Q7Y C;  2RJF A;  5GMK m;  3E9F A;  1V29 B;  4HCZ A;  5CKB A;  5GAO q;  3QBY A;  3QXE B;  3DLL A;  1KHI A;  2E1H A;  1N27 A;  4BI8 B;  1NPP A;  4XU0 A;  1Y96 B;  2VV5 A;  1NJI C;  1VUB A;  1KD1 C;  4P5N A;  2X4X A;  5I2S A;  3DB3 A;  2QA4 A;  4EMH A;  3QYG B;  3L2R A;  4N0A A;  3CME A;  4BE0 A;  4ZN3 A;  3HPW A;  2LTO A;  2RJC A;  3QJ6 A;  2LT1 A;  3ZEH A;  5LJ3 e;  4RCC A;  1R8O B;  3OYK A;  4C92 C;  3JCM Q;  1MGQ A;  3CEY A;  2KVQ G;  3DB4 A;  1B34 B;  2CZ1 B;  2PU9 B;  2RI3 A;  4C92 B;  2K57 A;  3RKX A;  2DTI A;  3CC7 T;  3CMA T;  2GFA A;  3HHT B;  3MEU A;  1X6O A;  4X34 A;  4O5V A;  1X75 C;  1VQM A;  2K3X A;  3E19 A;  2YHT A;  5KE3 A;  1KQ2 A;  5GAM d;  4M7D F;  1VQN T;  3JAM E;  4J7F A;  2LVM A;  2BIV A;  2WSC E;  1KHC A;  3MEA A;  4M75 G;  2O4X B;  4B9W A;  3V7C A;  4DOV A;  2ZPB B;  1LNX A;  1M4Z A;  4M75 F;  5CKF A;  2VUB A;  3M59 A;  5LJ5 h;  1VQ8 T;  1VQ5 A;  3OYN A;  4JLG A;  3CCE T;  4M7A A;  1WJR A;  2CKK A;  4J7I A;  3CCV T;  4XU2 A;  2WSF E;  2K2V A;  2FL7 A;  3MP6 A;  4KT0 E;  5GAM e;  3L2V A;  5GAN j;  2D6F A;  2LRQ A;  2VXF A;  1YJW A;  1K73 C;  2F69 A;  1LOJ A;  4M7A D;  2QA4 T;  5DLO A;  4QQ6 A;  4A4E A;  3KBG A;  1WNL A;  3JB9 H;  3LX7 A;  3OYA A;  4XU1 A;  1KQS S;  2V8K A;  4YTL A;  2DZC A;  4LDX A;  5GAN f;  1YJ9 T;  4OGC A;  2XU8 A;  4BE1 A;  1M5Q 1;  2MWO A;  4NL3 A;  3JCM V;  1BI0 A;  4ZGJ B;  3ME9 A;  3CCU A;  2D9T A;  3JCM b;  3A8L B;  3INZ A;  4DQ2 A;  1JJ2 S;  5GAO p;  3CXC S;  2C06 A;  3GF5 A;  1BI3 A;  3OYC A;  2PVG B;  4MMK A;  3OYH A;  4N0A C;  1Q81 U;  3CCS T;  5D6X A;  3OS1 A;  2ZCF B;  1XTD A;  5D6W A;  2RHI A;  1H3Z A;  3MET A;  4M75 A;  1I4K 1;  4BAC A;  2RK2 A;  5LJ3 f;  4FM4 B;  4LDW A;  3JB9 I;  1YIT T;  1U8R A;  5FRN A;  2FYK A;  1RI0 A;  3JCM c;  3OYD A;  3LWI A;  2XI9 A;  4FL6 A;  3BDL A;  2WSE E;  1XOV A;  3V8L A;  3C95 A;  3G6E A;  2LQ8 A;  1LJO A;  2V8I A;  4M75 D;  3WVE B;  1O75 A;  3S3M A;  1Q86 C;  3JCM J;  1BIB A;  5C0M A;  4B9X A;  3H8Z A;  3O8V A;  3TU4 K;  3OYG A;  3QKJ A;  2VC8 A;  4M7A C;  5A2Q E;  2QDY B;  2JNG A;  2Y4X A;  1WGS A;  4O6J A;  3OW2 A;  4XTZ A;  3WXM B;  3OY9 A;  4M7A B;  3OW2 S;  1W2B A;  3CCU T;  3PMI A;  1G3Y A;  2RA2 A;  3QII A;  4LD6 A;  2L8D A;  1VQ4 T;  3M54 A;  3RUX A;  5GAO n;  5GAN 5;  3G4S T;  4IKF A;  1XNI A;  3M55 A;  4BD3 A;  3X24 B;  4E7I A;  5GAM f;  1I8F A;  1QW1 A;  4MML A;  1M90 C;  1VIE A;  3VUB A;  2A7Y A;  1D3B A;  5CKH A;  1KC8 U;  4M78 E;  1S72 T;  1X01 A;  3S3O A;  3JRZ A;  2LC4 A;  2V8J A;  4A4H A;  4C0Z A;  5DLQ E;  4II1 A;  2CYZ B;  4M7D E;  2EJG A;  3ZFJ A;  4BB7 A;  3CC4 T;  3OMC A;  4OB1 B;  2GF7 A;  1Q82 C;  3CCQ A;  4PJO D;  4QW2 A;  1BI2 A;  4BDZ A;  4HKE A;  4M77 B;  2H3J A;  2QEX A;  1BYM A;  2K4Y A;  3HFO A;  4QVC A;  2DJZ A;  3I56 T;  4JJN K;  3G6E T;  1QVF S;  1VQ6 A;  2E65 A;  3JCM e;  2M16 A;  4FSX A;  5CAI A;  1G3T A;  5GMK h;  2PVD B;  1Q7Y U;  4M75 C;  5GAN e;  2XDB A;  1N9S A;  5LJ5 d;  4M75 B;  3DLM A;  4QQD A;  2DD5 A;  2MMP A;  1HXD A;  2PUO B;  2DAQ A;  5FLX E;  1NJI U;  1KD1 U;  2RHY A;  4FU6 A;  3DKM A;  2LCL A;  4MDW A;  4JDS A;  4F7U A;  3GOX A;  3BDU A;  3JB9 F;  4XTY A;  5A0G A;  4ATO A;  2R57 A;  1FX7 A;  2QQR A;  4C0D C;  3L2Z A;  2LDM A;  4A54 A;  3I55 A;  4A4F A;  3CBM A;  4JRP A;  2RHU A;  3M5A A;  4C0D B;  1VQO A;  3M9Q A;  4HCC A;  3OYI A;  2DIQ A;  1JB0 E;  2QQS A;  2KDS A;  4ZN1 A;  3F70 A;  2EQK A;  3UPU A;  1K9M U;  4MDX A;  3CC2 A;  5GMK j;  1UGP B;  1N8R C;  3A8G B;  3E9G A;  1VQK A;  2LCC A;  3T9N A;  4ZTJ A;  3EAE A;  4N4G A;  3CD6 A;  1YCY A;  4M78 G;  4PNO A;  3JCM X;  3GIB A;  2QEX T;  1BIA A;  4C5E A;  3GNF B;  3HRT A;  3SWN A;  1M1K U;  3ER0 A;  3G71 A;  1G3W A;  4WF2 A;  5IAY A;  2EYQ A;  4M78 F;  4M7D G;  1YJN A;  3MCA B;  5LJ3 g;  4VUB A;  4PJO B;  1D3B B;  2DKG A;  4D6W A;  2LQK A;  3Q1J A;  3RIR A;  3JCM P;  4OB0 B;  2K5F A;  2JTM A;  1BI1 A;  3EFR A;  5CQY A;  3OYJ A;  1KG1 A;  5CQX A;  3M4Y A;  4J83 A;  3WVD B;  2KSS A;  4XTX A;  3OS0 A;  3OYE A;  1K73 U;  1EIF A;  3QPH A;  4BI4 A;  1QP3 A;  2F5K A;  2EIF A;  4FT4 A;  4TVR A;  3X25 B;  1IZ6 A;  2WAC A;  2R58 A;  3J81 E;  3I55 T;  5FRM A;  4GLK A;  3PIP A;  3CBO A;  4LDU A;  1NZ9 A;  2DTO A;  5FU6 C;  5HY6 A;  4E47 A;  3JB9 J;  1NPR A;  2GQV A;  5KCO A;  5GAO l;  2KY9 A;  4XAX B;  1BKB A;  2MAM A;  2QQ9 A;  1ZBX A;  2ZPI B;  3G7Z A;  4XU3 A;  5FU6 B;  3JCM f;  3CME T;  2RI2 A;  1KQS A;  3CC2 T;  3GPL A;  1VQK T;  5GAN 7;  3OS5 A;  3UWN A;  1N6A A;  2P0Q A;  1H64 1;  2HD0 A;  2ZZD A;  5LJ5 j;  2L89 A;  4FIB A;  2E64 A;  4F7U B;  3TRE A;  1JJ2 A;  1YHQ A;  1VQM T;  3CXC A;  5LJ3 h;  4E7L A;  3TCJ A;  1N9R A;  3NFC A;  4KUL A;  3FEO A;  3PIO A;  4M78 A;  2GCX A;  1UEB A;  5GAO m;  3OB9 A;  4M7D A;  1DJ7 B;  3X28 B;  1Y71 A;  2X4J A;  2DTH A;  3RES A;  5LJ5 f;  3EFS A;  3PT9 A;  3FB9 A;  1VQ5 T;  3TEE A;  3SWN C;  1Q86 U;  1VQL A;  3SB2 A;  4M7D D;  4KBM B;  1OI1 A;  5HK3 A;  4C92 F;  1ZHI A;  2RH2 A;  3VUZ A;  3PNW C;  3RMS A;  1U1S A;  1VIF A;  4C8Q E;  1YJW T;  3J7A F;  4DOW A;  3SDZ A;  1VQ4 A;  3RER A;  2PUK B;  2JVV A;  2XK0 A;  5GAN 4;  5GAM h;  2GFU A;  1N8R U;  2X35 A;  1HK9 A;  2QI2 A;  3LH0 A;  1WPY A;  4C0G A;  4JRK A;  1QVP A;  2E41 A;  5CIU A;  4JLI A;  2ZPH B;  5DM7 R;  2DIG A;  2E10 A;  3BY7 A;  4V2S A;  4XTW A;  4XK8 E;  1M8V A;  3PGG A;  4PJO C;  1P92 A;  3OYM A;  1Q81 C;  1VQ7 A;  1AHJ B;  1WJS A;  3HKS A;  2DXB A;  5CCA A;  4MZM A;  4OP0 A;  3QUI A;  5GMK e;  2K5I A;  2ZGW A;  4J8O A;  1VQP A;  1K8A C;  1RL2 A;  2Y4Y A;  2R5M A;  3PMT A;  3N5B B;  4ZGD B;  1I5L A;  3P8H A;  1Y96 A;  5DY9 A;  5EG2 A;  3QSU A;  3OSV A;  3QZ9 B;  2F5T X;  2ZPG B;  3MEV A;  2BUD A;  5IN1 A;  3VV0 A;  3FJP A;  1VQL T;  1PSF A;  5I21 A;  2RJE A;  3OQ5 A;  2OTJ A;  2CZ0 B;  2EAY A;  3L2U A;  4IUQ A;  2KK4 A;  3FIF A;  3QZ5 B;  4LDV A;  4M78 C;  4X9C A;  4EMK A;  1QVF A;  4L5G A;  3L2W A;  5KCH A;  4M77 E;  2B8A A;  4M7D C;  5L8R E;  2XDD A;  1G5V A;  3CCM A;  4Z02 A;  3CPF A;  4JRI A;  3VYH B;  3L2Q A;  4RMO A;  3RKY A;  1MHN A;  4M7D B;  2MWP A;  2FHD A;  2O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...