2EQUA

Solution structure of the tudor domain of phd finger protein 20-like 1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
GSSGSSGFDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAKGQDWIALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the tudor domain of PHD finger protein 20-like 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords PHD finger protein 20-like 1
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2equA00
2R58A 3C4SA 4N4GA 2D9TA 3OA6A 1G5VA 3H8ZA 2JZ2A 4BE1A 2K3XA 2EFIA 2RO0A 3OYMA 2L89A 2GF7A 5KE3A 2EKOA 4BDYA 4NS5A 5FRNA 4IUQA 4LD6A 4OVAA 2XK0A 2RJCA 3MEUA 3QBYA 2DAQA 3P8DA 4II1A 2GFUA 2O4XA 2RJEA 4IUPA 2EQUA 3L2VA 2BKDN 5D6YA 4BACA 3FDRA 3OYGA 2R5MA 2E5QA 2F5KA 2LCCA 3DB3A 3ME9A 4A4HA 3LYIA 3OYAA 2M16A 3LGLA 3META 5D6XA 3UT1A 3OYDA 3S3NA 4BDZA 3LX7A 3L2QA 2YRVA 4C5HA 2RHUA 4BE0A 2L8DA 3DB4A 5KH6A 4L59A 4E7IA 2EQMA 4A4FA 2RHIA 4A4EA 3L2RA 1OYXA 5CIUA 2RJFA 2X4XA 3OB9A 5C6SA 5IAYA 4IKFA 2G3RA 3MEAA 4A4GA 3OYBA 2JTFA 3S6WA 4IUUA 2RI3A 3MEVA 2E6NA 4QQGA 3S3OA 3OYFA 4BE2A 4PL6A 2EQJA 5J26A 4Q5WA 3ZEHA 5J39A 4EDUA 3OYJA 2RHYA 3LLRA 1WJQA 2O4XB 1XNIA 3QKJA 4FU6A 3OS1A 2WACA 3QIIA 3OYHA 2EQKA 1OZ3A 4CRIA 2QQSA 2P0KA 3PFSA 2L3RA 3E9FA 3OYCA 2DIGA 1SSFA 1RI0A 4QW2A 3OYIA 4HCZA 2RI2A 2CKKA 2HQEA 2NLUA 5KE2A 3FEOA 4Z02A 4C5EA 4PLIA 3OYLA 4UC4A 3OYNA 4RG2A 3ASKA 2RI5A 3S3MA 2LRQA 2XDPA 3MO8A 5KCHA 5KCOA 4E7HA 4QVZA 4X34A 2MWOA 2FHDA 3UWNA 4E7JA 2LVMA 5FRMA 3NTIA 4B9WA 2BUDA 2VYTA 3M9QA 3MP1A 3OS2A 1OZ2A 3OYKA 3Q1JA 4QQDA 3L42A 3OMGA 5D6WA 1OI1A 4IURA 5IN1A 3KUFA 3NTHA 3P8HA 5C0MA 2HQXA 3PNWC 2X4YA 3LH0A 3L2WA 1KHCA 1MHNA 1WJRA 3LGFA 2LTOA 2RHXA 1WJSA 1WGSA 3OY9A 4E7KA 3DLMA 3MP8A 4N4IA 2M0OA 5M9OA 1H3ZA 3GOXA 4IUTA 3OMCA 4N4HA 3PMTA 2PQWA 4E7LA 3FLGA 3O8VA 4C5GA 3OS0A 2X4WA 4C5IA 2X35A 2IG0A 3OQ5A 3SD4A 5FROA 4QQ6A 4BD3A 2LDMA 3FC3A 3NTKA 3QJ6A 3L2UA 3BDLA 3PMIA 2QQRA 3E9GA 4PLLA 2DIQA 4GY5A 4FL6A 1N27A 4IUVA 2RHZA 4B9XA 3MEWA 2M1HA 2GFAA 2BIVA 4ZTJA 4ZTFA 3OYEA 2R5AA 2B8AA 3F70A 3MP6A 2K3YA 2R57A 2RJDA 3EAEA 2MWPA 3H6ZA 3CEYA
chains in the Genus database with same CATH superfamily
1D0ZA 2Y90A 5GAMg 2JZ2A 1E6GA 2PVDB 3SWNC 4BE1A 3I9QA 1Q86C 1M8MA 3HHTB 3SFMA 2DAQA 2J6KA 3I35A 2HDAA 3HKSA 4M78C 1WHHA 1QLYA 1EFNA 5DM7R 1XJWB 3S3NA 4A4KA 3CCJT 1T3SA 1X01A 3DB4A 3EFOA 3CCLA 1M30A 1IGUA 5GMKh 3JCMc 4PJOD 2E6NA 5GANe 3S3OA 3PTAA 4LUEA 2RPNA 4BE2A 3QO3A 3PGGA 2QEXT 4J9BA 5FWBA 3V7CA 1YIJQ 1N9SA 5DY9A 9ATCB 4LDVA 5GAMd 3CC2Q 2LX7A 4RKUE 4J9GA 4Y28E 3NPFA 2E70A 5GAOm 5AYFA 2Y4YA 2KYMA 1KD1R 4D8DA 8ATCB 2CYZB 5GAOl 2K5LA 1AEYA 4QVZA 4X34A 4LXCA 2DERA 4M75G 4OGCA 4KBMB 4FYXB 1BK2A 5IN1A 3JCMd 5GMKm 2FPFA 5KYYA 1N9RA 3EGXA 3JRZA 2CP6A 1A0NB 3U23A 3PMTA 4MZTA 4A54A 3TU4K 1NM7A 3J7AF 3FC3A 1VUBA 2QEXA 3QJ6A 4P5NA 1D1AA 3E9GA 1M1KU 1YHQT 3HSBA 2IVWA 1J3TA 3WVDB 3BE3A 4OMOA 3MEWA 3VS2A 3ER0A 3RMQA 2B8AA 3CCLT 1K1ZA 1YP5A 5GANg 2KXDA 3H6ZA 4N4GA 2XMFA 4MZMA 1G5VA 1UEBA 1VQ4Q 4J9CA 4F17A 4BDYA 1I81A 3CCEQ 2OTLA 1SKUB 2FPEA 1NPRA 2ABLA 1VQKQ 3RNJA 4LDYA 3RUXA 2O9SA 2P4RA 4V2SA 1D1BA 4J8OA 1I5OB 1X2QA 1GL5A 1KFZA 3LYIA 2A3LA 2DL3A 1M2OA 1C1AA 2LMJA 8AT1B 1TTHB 4FYYB 2DILA 2GQIA 1OU9A 4E7IA 2EQMA 4M7AC 5FU7B 4RTZA 2FYKA 3PIPA 2DXCA 1W2BA 1C0MA 4PFOA 2LJ0A 1IO6A 3EG1A 3CCQA 3OS5A 1FMVA 4M78A 2K2VA 3LW5E 4OMPA 1UE9A 3JCMQ 2VB6A 4RCCA 4E2FB 3AHUA 4C0DB 5CKBA 1M90R 4XK8E 4C8QD 1NJIC 1QVFA 4M77C 3GF5A 4M77A 4C5EA 4NL2A 2KGTA 4M7DC 3OYNA 1VQOQ 4A63B 1Q82U 4M78E 2JOYA 4HT9A 1QCNA 3CCQT 3X24B 4R55A 1TUCA 3N5BB 1ZUYA 2X4YA 3LH0A 1D1CA 2HL3A 1QVPA 1IZ6A 1ZBXA 2AT1B 4N4HA 1YJNT 2KT1A 2YT6A 1RAHB 2DL4A 3FJPA 2DE0X 2JXBA 4F7UG 2DM1A 2AK5A 1OULA 1YI2Q 3UDCA 1BCMA 2M1HA 1UJYA 2CSIA 3M54A 2D8HA 3L1AA 2R57A 2RJDA 1WHJA 2K5IA 1IHWA 2D0NA 2QI2A 3OSVA 3THKA 2PUOB 1GRIA 2RM4A 4FSXA 2AZVA 2MYSA 4IUQA 3I56T 1KQSP 1BKBA 2JNGA 2M9UA 3DKMA 1U1TA 2RJEA 1MV0B 2DTIA 3TSZA 1Q86R 2KBTA 2OX7A 3ME9A 4RTUA 2DKGA 4M78F 3OYAA 2CZ0B 3OYDA 2JS0A 4DBQA 5DLQE 2M0YA 1YJNA 2ED1A 4A4EA 5IAYA 1UHFA 4IKFA 3OYBA 3S6WA 4C92C 3CCVA 3MEVA 1PSEA 4C92A 3X25B 1VQNA 3CCSA 5GAOq 1X69A 3CC7Q 3RKYA 3OYCA 1JQQA 1VQKT 4AMCA 1RAIB 4JUVA 5KE2A 2LX9A 1PM3A 2KRNA 3CCUA 1NJIU 2CUDA 2NUPB 5LJ3j 2HKNA 2LRQA 4E7HA 2OJ2A 4N0AA 4DBRA 3QXEB 1BU1A 2RNAA 3Q1JA 4IURA 3KUFA 4HVWA 2XICA 3EGUA 1KHCA 2DL5A 1E7OA 2RHXA 2KE9A 1K0SA 5IHNA 3DLMA 1ZHIA 5GJVB 1H3ZA 3GOXA 2HAXA 3VJPA 2HD0A 2EKHA 2FZCB 3UPUA 1YJWA 2F2VA 1Q82R 2E3HA 5GAN3 2I2LA 2JJ9A 1M27C 3CMAQ 4ZTFA 5GANf 1VQOT 1ZSZB 1VQMA 1VQ6A 1MNEA 2YUPA 2R58A 1AD5A 1KQSS 3CCUT 2NUPA 1S1NA 3CC2T 4HVVA 1CKBA 3M0QA 3CPWA 3L2VA 2VC8A 3H0HA 4GLKA 2H3EB 1G3SA 4F7UE 5LJ5g 2BE7D 5FU6C 2L3QA 3CQTA 2P0PA 4DBFA 1RAFB 2C06A 1NE8A 5KYWA 2DRKA 1M8VA 1WHGA 1FMKA 2WSFE 2CZ7B 2YRDA 3RR6A 3SEMA 4Y91A 1GCQC 3ZEHA 1PKSA 1VQ7A 2RQTA 4J6YA 4EMHA 3CCSQ 3CBOA 4ZGJB 2Y4XA 2QAZA 3E9FA 1F1BB 1M9SA 2LJ3A 2EYXA 2LC4A 2OAUA 3H0IA 1PCXA 3PVQA 1NPPA 1KQ1A 2EQIA 4FYVB 3V8LA 1CSKA 2NYSA 3A8GB 5FRMA 1JBMA 3QDFA 2BUDA 1W2BP 1P92A 2K9GA 1GBRA 2QA4A 3VYGA 2KY9A 3CD6Q 1IRXA 3LGFA 2LTOA 3OY9A 3A8OB 2YUOA 2ED0A 4KT0E 3RBBB 1QVFS 4EPCA 2DA9A 3SD4A 4BD3A 1U8RA 2DYBA 3L2UA 2LQNA 1SF9A 1N5ZA 2I0NA 3T9NA 3O5ZA 1KD1U 1X6BA 3CXCS 1WIEA 1WNLA 2BIVA 1Y96B 1VQ9A 3CBMA 3VUZA 2LQKA 4Y92A 1PHTA 1T0HA 3HRUA 2FPDA 2H8HA 2D9TA 3MCAB 2ZPEB 1PC0A 4QVDA 1M2VA 2JT4A 5L8RE 4LDUA 3EFRA 1H641 1WZOA 4II1A 3V8KA 4JS4A 5AT1B 2O4XA 2ZPGB 4IUPA 1VYUA 3NGPA 2LCCA 3DB3A 1WPYA 4C8QB 4FW2A 1PG5B 3E19A 4TVRA 5HK0A 2RQRA 1K9AA 1M1FA 1AZEA 3M57A 1KQ2A 3VYHB 2O01E 2RJFA 2X4XA 3NHNA 2QTXA 3C12A 3MEAA 5GAOn 3CC4A 2EQJA 1OX9A 2PVOB 1K9MU 2E3IA 2FRWA 3NMZC 3JCMX 2DVEA 1V1CA 4M7DE 4M75D 2QDYB 4ZNXA 3CCMT 1AWOA 4RTWA 1VQ5A 1WQ7A 2K5FA 2KNBB 2ZPBB 2D0QB 4VUBA 3OBWA 2DMOA 2WSEE 4KH0B 3TQ7P 4RG2A 1PWTA 1YJ9A 1UHCA 4M77D 4FW1A 2LVMA 3VV0A 5CKEA 4M7DA 3MP1A 1Y0MA 3OS2A 3EFSA 3OYKA 2V8JA 1AVZC 4QQDA 3KBGA 4C8QA 4F14A 1TUGB 4C8QC 4YTLA 3I56Q 4AFZC 1K73R 4E7SA 3M4YA 2E65A 4M78D 2VWFA 3O8VA 4OMFB 4C5GA 3GIBA 3OQ5A 1WHMA 2CDTA 2CGHA 1BIAA 2MK5A 2Z0WA 4LE9A 2GCXA 1JXOA 1GFCA 4GY5A 5A2QE 3CCVT 1PRMC 2RHZA 3J80E 3E1SA 1M90U 5IXBA 4JS5A 1MUZA 3SWNA 2XHCA 1B07A 4BY6B 4OF1A 2RK2A 3A98A 3IQLA 1PSFA 2QEXQ 3MPUB 1VQ9T 2EFIA 2RO0A 3G7ZA 2L89A 3QUIA 5FRNA 1DJ7B 4ZGDB 2EJFA 3RKXA 4EMKB 1Q81U 5KYXB 1RADB 5D6XA 2M02A 2NUTB 3RESA 2CSQA 1ZLMA 1O75A 2GQVA 1OYXA 2LQ8A 3OB9A 5KYNA 5LJ3g 1U1SA 1RLPC 1NYFA 2FZKB 1QQJA 3CC2A 4XTWA 1YIJA 4OB1B 1OZ3A 5A0DA 4BY6C 4MDXA 1Q86U 2RI2A 4JZ3A 4OMNA 4PJOB 2HSEB 2OAWA 1SRLA 3CCLQ 2KAFA 1M2VB 1GBQA 4RTVA 3FJ5A 3TREA 3LWIA 2DBKA 5EG2A 1H92A 1AZGB 3EG3A 5D6WA 4EMKC 2JM8A 1Q95G 1AT1B 2E4HA 5IH2A 1LNXA 3L2WA 3VU3C 3OW2P 3JB9G 1D3BA 4KUIA 4HCKA 3VS5A 2M51A 2VGMA 2L3PA 4XTYA 3M0SA 4E7LA 4PJOA 4C92E 2QA4Q 1AWWA 1TWBA 3NTKA 4OB0B 5FU6B 1LJOA 4RUGA 2DTHA 2A36A 2QQ9A 4IUVA 4DOWA 3F70A 1YHQA 4PJMA 3M59A 2BTTA 1UGSB 3CMEQ 1VIFA 5GMKj 4QVCA 4LDXA 1EIFA 2GBQA 3A8MB 3KXTA 2O2OA 2CZ6B 4OVAA 5ECAA 2XK0A 5HY6A 1Q7YR 4PJJA 1W70A 1W1FA 2EYYA 3VRZA 4KGXB 4M7DB 2E1HA 2D6FA 4PKCC 2CREA 2RH2A 2NWMA 3H9NA 2JTEA 4F7UF 4MZPA 2V1QA 1SHFA 1QVFP 2MIOA 4A4FA 2GGRA 4M7DF 1WI7A 4DEXA 3QSUA 2ZGWA 4BUGA 3REAB 3CXCP 2JTFA 4EIKA 4QQGA 3OYJA 4ZN1A 3LLRA 2RQUA 2AIRB 2P4TA 3ULRB 2XD0A 2EBPA 5GAMh 1OV3A 3EGXB 4C0ZA 2AHJB 3D7SB 1Y07A 1KD1C 3CBPA 3GPLA 5GJWB 2FVUA 2P0QA 2CH4W 1G3TA 4PJOF 2JUFA 3OYLA 3TCJA 2XDPA 3UWNA 2FHDA 2K3BA 3FIFA 3JAME 1W2BS 3PVLA 3NTHA 3P8HA 1PNJA 2KEAA 1PD0A 2YUNA 1WGSA 2XDDA 1FWZA 1YJWT 3RIRA 1JJ2A 1VQLA 3ZL7C 2IG0A 3C95A 1QVGP 1K73C 2EW3A 3GP8A 4C0GA 1Y57A 1RAEB 4FL6A 3JSCA 4JJDA 4JPBW 3OBYA 3I5RA 2K4YA 3C4SA 2HKQB 1VQNQ 4C92G 5CVIA 4IIOA 2X4JA 1UECA 2EQUA 4LDWA 3EH2A 1KIKA 1UB4A 1OPKA 1OPLA 2R5MA 3J81E 1QWFA 5CCAA 5IT9E 3BDUA 1WFWA 5LJ5e 1I8FA 3G4ST 4KH1B 4F7UB 3EG9B 1YCYA 1VQPA 1D3BB 2HQHA 4ZGEB 1RLQC 3EGDA 1VQLT 3EG2A 3VS4A 2J7IA 1TH7A 2V8IA 3CCET 5I21A 4IUUA 2KXCA 1VQ5Q 3LH5A 1N8RR 4NL3A 2CH4A 1WJQA 3CXCA 1NEBA 4AFQC 2P0KA 5I2SA 4EMGA 4WF2A 1LCKA 1RI0A 4J6WA 3A1PA 5GANd 3JCMW 3EG9A 4M75C 3M4GA 3CCRQ 3EGDB 1Q7YU 5GAOr 5GAMe 1RUWA 2A0FB 4XTVA 1YBYA 3M53A 2ATCB 2J06A 3ZBDA 1B34B 3JCMV 1RAAB 2DYIA 4PJNA 2KROA 3PNWC 7AT1B 3I5SA 4KGVB 1WJSA 2E41A 1X75C 3V8JA 1K4US 4FYWB 3OS0A 1QVGS 1AWXA 1M3CA 2FG0A 4J7FA 3QZ9B 1M3BA 2V8KA 4JJBA 3CPWP 3TEEA 1FX7A 4KUDK 5CO7A 3UA6A 2KSSA 3QDRB 2LT4A 3EAEA 2D1XA 1RABB 2VUBA 1YN8A 4M77B 2DVJA 3OW2A 1K9MR 2GF7A 4CC2A 2DD5A 1YITQ 4HKEA 4M7AD 1GFDA 3CCQQ 2E5KA 2YRCA 2FEIA 4OMMA 4WTOB 4J9HA 5GAN8 1K8AU 3C94A 3QYHB 1JXMA 4JLGA 3META 1VQPQ 1TXQA 2ROTA 5GAOp 1IXDA 3R6OA 4J5YA 3AT1B 1IREB 1N6AA 2KT8A 3L2RA 2GNCA 3CD6T 1WYXA 2QG9B 2SEMA 2HCKA 4O5VA 3A5ZB 1SSHA 4CC3A 5J39A 4JRKA 2OTLQ 4FU6A 3CCEA 2KI7A 1MNDA 2WACA 4XTZA 1I07A 1VQ4A 2EQKA 1VQ7Q 3NFCA 1WXBA 4C8QE 2DXBA 3OYIA 2E10A 5HCKA 2HQEA 2ZPIB 3UF4A 1G8XA 2BZYA 1XQHA 4QT7A 3S3MA 1NYGA 4OB2B 4E7JA 2FZGB 1B7TA 2MCNA 4J9EA 1OI1A 2BZXA 1WJRA 1V76A 1RACB 1Q82C 2K6DA 3OMCA 1VYTA 2PQWA 3FLGA 5FROA 2JMCA 4N0AC 4M77F 2LCLA 4MDWA 3HFOA 3M0RA 4J9IA 4PLLA 1X43A 1UGQB 3QJYA 1GCPA 3BFMA 2GFAA 3CMAA 4K11A 4D8KA 4ATOA 3TVTA 4ESRA 4DEYA 2MWPA 1KC8R 3VS3A 2COZA 3H8ZA 2JM9A 3OYMA 3M0TA 2X3XD 2JS2A 4XU0A 4M75E 3VKIA 3I55T 4RTXA 2YHTA 4C92F 2CUBA 2ZZDA 1ZX6A 2DL8A 5HK3A 4ELYC 4CI0C 3OYYA 4E6RA 2YLCA 1D0XA 1QW1A 1QP3A 2KRSA 1Y71A 4L59A 4FM4B 3CCUQ 3CCST 1BI3A 3MHXA 3JB9F 2LJ1A 4A4GA 2KMTA 2XU8A 1ARKA 4M7AG 1RL2A 4Q5WA 1BBZA 3CC7A 1OU8A 1QWEA 3CMAT 1NLOC 2EIFA 4DOVA 3QIIA 4F04B 3CPWS 1M1KC 1E6HA 1K8AR 3QWYA 1LVKA 2W0ZA 2KDSA 3PFSA 5L23A 3WVEB 1N8RC 4QW2A 4BB7A 1T3LA 5GMKl 3CMEA 3CCVQ 4F16A 1OQKA 2W10A 1YWOA 2LP5A 5GMKi 2MOXA 1VQPT 1UUEA 2CT3A 2JTMA 5FWCA 3HRTA 4M4ZA 1XTDA 4PJOE 3NTIA 1ZUUA 1Y96A 1FMWA 1JJ2P 2HNIA 5A0GA 3HL8A 1Z9QA 2DXTA 2FL7A 4M77E 1TUDA 2DRMA 5LJ5f 2X4WA 4LNPA 4GBQA 2J6FA 3I55A 1MMDA 3REBB 2DZ9A 5CKHA 3L2ZA 4L6V5 1JU5C 1R77A 1VQ8Q 1VQNT 5GAN2 1I5LA 1EZZB 1YI2A 4PFPA 1KQSA 3OA6A 5I11A 1KJWA 1R0BG 4M75F 4NS5A 3PE0A 4C92B 1WA7A 2DL7A 1M1GA 1BI2A 1QMCA 1U06A 3CC4T 1TS9A 3G71A 2RMOA 1NEGA 4AFUC 1YIJT 3UA7A 4L5GA 1GXIE 2QGGA 4AG1C 2PTKA 4BI8B 5IXFA 1I4K1 3L2QA 2PZ1A 5KH6A 2YSQA 2AKKA 4WCIA 2WSCE 3CCJQ 2J05A 1D0YA 1I0CA 2KQWA 4PL6A 5J26A 2ZPHB 4EDUA 5CK9A 3OS1A 3OYHA 4J6XA 2KYBA 1Q81R 1UFFA 2DIGA 2C0TA 2YUQA 4AT1B 4J9DA 5GAN4 4M7DD 1FXXA 1C6VX 1ZBJA 1YITT 2QQAA 4PJLA 4JLIA 4D6WA 4PNOA 4PK4A 4UC4A 2RI5A 3CMET 3MO8A 3VUBA 5KCOA 2EWNA 1WDXA 3MJXA 5CKDA 3OSSC 2PNIA 2JN0A 1WXTA 1OX8A 3M9QA 1X27A 1NLPC 1UTIA 5GAN6 4OGEA 1JB0E 5KYUB 1PKTA 1I1JA 3X20B 3I56A 2V1RA 4IUTA 2NUZA 1JO8A 4M7AB 3HTRA 4HCBA 4XAXB 3VS0A 2OTJQ 3M58A 1YJ9Q 5LJ3f 1ZA2B 1K73U 4AG2C 5HKCA 1WHLA 1VQ7T 5KYWB 2OTJA 2RB6A 2LNVA 2XKOC 5KYUA 3INZA 2PUKB 3JCMb 1PD1A 4JZ4A 1BIBA 2KVQG 2DF6A 2IPOB 5KE3A 4LD6A 4M7AA 4X1VA 3CC4Q 2RJCA 2AKLA 3QHSA 1VQ4T 5GANj 2E5QA 3G6EQ 1HSQA 4QKUA 3UT1A 4BDZA 4LD9K 3SDZA 1X6GA 4O6JA 3QZ5B 3OW2S 3X26B 5GAMj 5C6SA 1HYOA 1GCQA 2ECZA 1ZSGA 1SPKA 1VA7A 3KFVA 3P8BB 2XI9A 5CKFA 4ORZA 3JB9J 3SWNB 1BB9A 1TSFA 1SEMA 2QQSA 2HMAA 2DEQA 1PRLC 3CCJA 5LJ3h 1VQ9Q 1HK9A 2C0IA 4ME7A 2QQBA 4RTTA 2KR3A 1NG2A 4JJCA 1NJIR 2CP3A 2BZ8A 5D7UA 2VGNA 4PFZA 1NZ9A 1UJ0A 3GNFB 4FT2A 3UATA 2VVKA 4FSSA 3G71Q 3JCMP 2FRYA 2DJQA 2FB7A 2DXUA 3RERA 2X51A 2EYZA 3CD6A 4C5IA 2X35A 3GBQA 2L0AA 1QP2A 2CP2A 2EPDA 3QWXX 4RTYA 2QQRA 2K57A 2GTOA 2QA4T 1QKWA 1W4SA 1VQ8A 2R5AA 5CQYA 4KGZB 4CC7A 1Y7XA 4PJOC 1Q7YC 1KK7A 2DBMA 2DETA 2K3XA 3HPWA 4J83A 4C0DC 2PVGB 5FW9A 5GANh 2X9HA 3MEUA 1S72A 5FLXE 2ZAEA 2F1LA 2QXFA 3OYGA 1ZUKA 4A4HA 2A37A 4X9CA 1KHIA 2CP7A 3LGLA 4BI3A 3MKDA 1QKXA 4RG8A 3SHWA 1ZQ1A 3TSWA 3GLXA 3RDVA 5EC7A 2E6ZA 2HBPA 1UG1A 2LQWA 1M4ZA 2YDLA 1VIEA 1ABOA 3G4SA 2RI3A 3G1JA 2FO0A 1MGQA 1Q81C 1MMNA 2EGEA 4XTUA 3QKJA 2EGAA 1YFNA 1IGQA 5CAIA 3M55A 2COYA 1G2BA 1SSFA 4M7DG 1M3AA 1ZSZA 1H3HA 1VQMQ 1VQ6Q 4FIBA 4RCBA 2VXEA 2CZ1B 1QCOA 4J9FA 2LZ6B 5KCHA 1UGVA 2J6OA 2KRMA 2X3WD 3VS1A 4OMQA 4Z89A 4XU2A 1YJWQ 3V7RA 1OZ2A 1TOVA 2C0OA 1KC8U 3OMGA 2CS7A 2DJZA 3A8HB 5LJ3e 2HQXA 4XU1A 1WLPB 4X9DA 2O9VA 5KYXA 2F2WA 2SRCA 3MP8A 4N4IA 4ANJA 1KG1A 2A28A 4A53A 2MI6A 4C92D 2LCSA 1OOTA 3QYGB 1U5SA 4QQ6A 2LDMA 3EG0A 1X2KA 3RKWA 2B86A 2DIQA 3LWHA 4FCYA 2DD4A 2GTJA 3MP6A 1IHVA 2K3YA 2DO3A 3JCMf 3JB9D 2XDBA 4NOYA 2EVRA 3PIOA 3CEYA 4JDSA 2OTLT 2ROLA 1HXDA 2EKOA 1WQWA 4LUDA 1KC8C 4FT4A 6AT1B 3G4SQ 4BACA 1UGPB 1X6OA 2F5KA 4XQ3A 5FU7C 1YJNQ 1UDLA 3JB9H 3LX7A 1HD3A 3R6NA 1AWJA 2YRVA 1T0JA 2RHUA 4JRIA 4C5HA 3C0CA 1WXUA 3FB9A 2RK1A 2E64A 1SHGA 4Z8AA 3JB9I 2PU9B 1WX6A 1M90C 1KSWA 2EJGA 2RQWA 1XNIA 3JCMg 4M75B 1YCSB 1FYNA 2H3JA 4HVUA 3ZFJA 2DTOA 1S72T 2OI3A 2A7YA 1QVGA 2NUTA 2OTJT 3JCMe 2V26A 1N8RU 4PLIA 5A0LA 2K2MA 1BI0A 1NBEB 3V7SA 4B9WA 3H41A 2VYTA 4EMKA 1OEBA 3L42A 2BE9B 2RN8A 1AOJA 5C0MA 3EH1A 4M75A 1H8KA 5J3BA 2D8JA 2O88A 1ABQA 2MAMA 1JJ2S 2YLBA 5M9OA 3URGA 1YITA 3HP9A 4HA8A 1R8OB 1YNZA 4KULA 1VQMT 1VQ6T 1SG5A 4C8QF 4JRQA 4M78G 1VQOA 4XTXA 2MPXC 4B9XA 4IIMA 2CP0A 3JV3A 4OMLA 2HEQA 3X28B 1BYMA 1MMGA 4ELZC 3CCRT 5LJ5h 1G83A 3HFNA 3VS7A 5CR2A 5LJ5d 1O9SA 4OB3B 4R0KA 3H0FA 2ZCFB 2KK4A 3P8DA 2GFUA 2L2PA 5I22A 2F69A 4KRTA 2BKDN 2DZCA 5DLOA 1D09B 4GLMA 1TU0B 3G71T 1K76A 2M16A 2QASA 1XOVA 2YXYA 2EYQA 4M7AF 2RHIA 3CCRA 5CIUA 3G6EA 4HT8A 2DEUA 1VQKA 3OYFA 1VOMA 2K7AA 5KYYB 2F2XA 2O4XB 2DLPA 2L3RA 3SB2A 2XIDA 1R0CB 2QTVA 4HCZA 2RD1A 5I2MA 2EAYA 2NLUA 1V29B 2MF2A 1ACMB 3ASKA 2CT4A 3GNGA 2MWOA 4OP0A 4MMLA 1YWPA 4PJOG 1YJ9T 2JVVA 2RF0A 3CC7T 1HJDA 1EX4A 3JCMh 1G3WA 1MHNA 2EJ9A 1Z9ZA 3PT9A 5CQXA 2HZYA 4E7KA 1VQ5T 1K0XA 2M0OA 2ENMA 2VV5A 2IIMA 2G6FX 4ZN3A 3A8LB 3VS6A 2VXFA 3BDLA 2VKNA 1RI9A 4B6MA 4M7AE 2DNUA 2XG8D 4E7ZA 2YWWA 1RAGB 2QYZA 4LN2A 2QK0A 4ZTJA 5GAMf 1AHJB 2L3SA 4F7UA 4DA4A 2L5QA 2RQVA 3BY7A 2K79A 1M5Q1 2HSPA 1YI2T 1WHKA 3E2UA 1VQLQ 5GMKe 3DLLA 3CPFA 2EGCA 3QBYA 4HCCA 2CP5A 2DX1A 5D6YA 1QCFA 3FDRA 2JW4A 2O31A 1B34A 4JJNK 2QGFB 2DFUA 4C0FA 1ZA1B 1JEGA 1JRIA 3JCMJ 4HXJA 4M77G 4BE0A 2L8DA 3M0UA 1MMAA 1G3YA 4DQ2A 3M0PA 2G3RA 4J7IA 1UGRB 1K8AC 1IB8A 4MMKA 5IHKA 2VASA 5LL6S 1LOJA 2RHYA 2HBWA 1LPLA 4CC4B 2JMAA 3VRYA 2QDLA 3HRSA 3FRNA 5IHIA 1W6XA 1SRMA 4DBHA 2EYWA 5GAN5 2LT1A 4Z88A 1M1KR 2CKKA 3FEOA 4Z02A 5LJ3d 3QPHA 2E12A 2DK3A 3EHQA 4R56A 3CCMA 1ZSZC 2RA2A 1U3OA 3I55Q 4JRPA 5LJ5j 2ZPFB 3M56A 3M5AA 2ESWA 1B3QA 2A08A 1S72Q 5GAN7 2LNHB 1MV3A 3G6ET 4E47A 4AFSC 2F5TX 3EFOB 2DPPB 4XU3A 1VQ8T 2P84A 2AZSA 1CKAA 3CCMQ 3RMSA 3PMIA 2MMPA 1VYVA 4M78B 2COWA 1BCOA 1YHQQ 4RMOA 1N27A 3WXMB 3QG1A 1BI1A 3EHRA 3OYEA 1K9MC 1TG0A 3BW1A 4C8QG 4BI4A 4CRIA 2HL5C
chains in the Genus database with same CATH topology
1Y7XA 2VUBA 2Y90A 2D9TA 4M77B 3MCAB 5GAMg 2ZPEB 3OW2A 1Q7YC 2JZ2A 2PVDB 4PJOC 3SWNC 2K3XA 4BE1A 3HPWA 4QVDA 2GF7A 4J83A 2DD5A 1Q86C 5L8RE 4HKEA 4C0DC 4LDUA 2PVGB 5GANh 4M7AD 3HHTB 3SFMA 3EFRA 3MEUA 1H641 5FLXE 2DAQA 1S72A 4II1A 3V8KA 4JS4A 2O4XA 2ZPGB 4IUPA 3HKSA 2QXFA 4M78C 3OYGA 2LCCA 3DB3A 4A4HA 5GAN8 1K8AU 3C94A 3QYHB 1WPYA 4X9CA 4C8QB 4JLGA 5DM7R 1KHIA 3META 3LGLA 3E19A 4TVRA 5HK0A 4A4KA 5GAOp 4BI3A 3CCJT 3S3NA 1M1FA 3R6OA 1X01A 4J5YA 1IREB 3DB4A 3M57A 4RG8A 1ZQ1A 1KQ2A 1N6AA 3CCLA 3GLXA 3VYHB 2E6ZA 3L2RA 3CD6T 2X4XA 2HBPA 2O01E 2RJFA 1M4ZA 2QTXA 3C12A 3MEAA 5GMKh 1VIEA 3G4SA 5GAOn 2RI3A 3JCMc 4PJOD 2E6NA 1MGQA 4O5VA 5GANe 3A5ZB 3PTAA 3S3OA 1Q81C 4BE2A 3QO3A 2EQJA 3CC4A 5J39A 4JRKA 3PGGA 4XTUA 2PVOB 2QEXT 3QKJA 4FU6A 3CCEA 5CAIA 1K9MU 3V7CA 2WACA 3M55A 4XTZA 1N9SA 5DY9A 3JCMX 2DVEA 1VQ4A 4LDVA 2EQKA 5GAMd 4M7DE 4M75D 3NFCA 2QDYB 4RKUE 3CCMT 4Y28E 1SSFA 4C8QE 4M7DG 2DXBA 3OYIA 1VQ5A 2E10A 1WQ7A 2E70A 2K5FA 5GAOm 5AYFA 2ZPBB 2HQEA 2D0QB 2ZPIB 4FIBA 4RCBA 2Y4YA 3OBWA 4VUBA 2VXEA 2WSEE 2CYZB 2CZ1B 1XQHA 3S3MA 4RG2A 2K5LA 4OB2B 5GAOl 1YJ9A 5KCHA 4E7JA 4QVZA 4X34A 4M77D 2LVMA 3VV0A 4M75G 5CKEA 4M7DA 3MP1A 4XU2A 4OGCA 3V7RA 4KBMB 1OZ2A 3EFSA 2V8JA 4QQDA 3OS2A 3OYKA 3OMGA 3KBGA 1OI1A 2CS7A 2DJZA 3A8HB 5IN1A 4C8QA 5GMKm 3JCMd 1N9RA 5LJ3e 4C8QC 2HQXA 3JRZA 4YTLA 4XU1A 1WJRA 4X9DA 3M4YA 2E65A 3MP8A 4M78D 4N4IA 1KG1A 1Q82C 3OMCA 3PMTA 2MI6A 2PQWA 4A53A 3FLGA 3O8VA 4MZTA 4OMFB 3QYGB 4A54A 4C5GA 4C92D 3TU4K 3OQ5A 3GIBA 5FROA 3J7AF 2CGHA 4QQ6A 1BIAA 2LDMA 4N0AC 4M77F 2LCLA 4MDWA 1VUBA 3FC3A 3HFOA 3QJ6A 2QEXA 2GCXA 4P5NA 3RKWA 4PLLA 3E9GA 1M1KU 2DIQA 1YHQT 4GY5A 1UGQB 3QJYA 2IVWA 5A2QE 2DD4A 3LWHA 3WVDB 3CCVT 3HSBA 2RHZA 3BFMA 3MEWA 2GFAA 3CMAA 3ER0A 3RMQA 3J80E 3MP6A 2B8AA 3E1SA 1M90U 2K3YA 4ATOA 4JS5A 2DO3A 3JCMf 3JB9D 2XDBA 3CCLT 3SWNA 4NOYA 2MWPA 2XHCA 5GANg 3H6ZA 4BY6B 4OF1A 3CEYA 3PIOA 4N4GA 4JDSA 2RK2A 4MZMA 2OTLT 1PSFA 1G5VA 1UEBA 3H8ZA 1VQ9T 2EFIA 2RO0A 3G7ZA 2L89A 3QUIA 3OYMA 1HXDA 2EKOA 4BDYA 1WQWA 1I81A 5FRNA 2OTLA 1DJ7B 4ZGDB 1KC8C 1NPRA 4XU0A 4FT4A 2EJFA 4LDYA 3RUXA 4M75E 4BACA 3VKIA 3I55T 1UGPB 2YHTA 4C92F 4V2SA 1X6OA 3RKXA 4J8OA 2F5KA 2ZZDA 4XQ3A 5FU7C 4EMKB 5HK3A 1Q81U 3LYIA 2A3LA 4ELYC 4CI0C 5D6XA 3JB9H 3OYYA 1KC8U 2YLCA 3LX7A 3RESA 1QW1A 1QP3A 2YRVA 2RHUA 4JRIA 4C5HA 1Y71A 4E7IA 4L59A 1O75A 2EQMA 2GQVA 4M7AC 3FB9A 5FU7B 1OYXA 4FM4B 2LQ8A 3OB9A 2FYKA 2RK1A 5LJ3g 3CCST 1BI3A 1U1SA 2E64A 3MHXA 3JB9F 3PIPA 4A4GA 2KMTA 2DXCA 3JB9I 1W2BA 2XU8A 2PU9B 3CCQA 4M7AG 1RL2A 3OS5A 4Q5WA 1M90C 3CC7A 2EJGA 3CC2A 4XTWA 1XNIA 3CMAT 4M78A 2K2VA 3JCMg 2EIFA 4DOVA 3QIIA 3LW5E 4M75B 3CPWS 1M1KC 1YIJA 4OB1B 1OZ3A 3JCMQ 2H3JA 2KDSA 3PFSA 4RCCA 5A0DA 3AHUA 3WVEB 5CKBA 3ZFJA 2DTOA 4C0DB 1S72T 1N8RC 4QW2A 4XK8E 4BB7A 4BY6C 4C8QD 1NJIC 5GMKl 2A7YA 3CMEA 1Q86U 2RI2A 1QVGA 4MDXA 1QVFA 4M77C 4PJOB 2OTJT 3GF5A 3JCMe 1N8RU 4M77A 4C5EA 4PLIA 5GMKi 5A0LA 4NL2A 4M7DC 1VQPT 2KAFA 3OYNA 2JTMA 1BI0A 1Q82U 3TREA 3HRTA 4M78E 3LWIA 5EG2A 1XTDA 2JOYA 4HT9A 4PJOE 3CCQT 3NTIA 3V7SA 4B9WA 3X24B 2VYTA 4EMKA 1Y96A 4R55A 5D6WA 3L42A 4EMKC 3N5BB 5C0MA 1LNXA 2X4YA 3LH0A 2HNIA 4M75A 3VU3C 5A0GA 3L2WA 3HL8A 5J3BA 2DXTA 2FL7A 3JB9G 1D3BA 4M77E 4KUIA 1QVPA 1IZ6A 1ZBXA 2MAMA 2VGMA 1JJ2S 2YLBA 5M9OA 3URGA 4N4HA 1YITA 4XTYA 4E7LA 1YJNT 5LJ5f 4PJOA 4C92E 2X4WA 3HP9A 4HA8A 1R8OB 3FJPA 3NTKA 4OB0B 3I55A 5FU6B 1LJOA 4KULA 2DTHA 1VQMT 1VQ6T 2DZ9A 5CKHA 2QQ9A 4M78G 4C8QF 3L2ZA 4JRQA 1VQOA 4XTXA 4F7UG 4L6V5 4IUVA 3UDCA 4B9XA 2M1HA 1VQNT 4BI4A 4DOWA 3M54A 5GAN2 1I5LA 3F70A 1YI2A 1YHQA 3L1AA 2R57A 2RJDA 3M59A 2K5IA 1UGSB 1VIFA 1KQSA 5GMKj 4QVCA 3X28B 2QI2A 3OSVA 3OA6A 4LDXA 1BYMA 1EIFA 2PUOB 3A8MB 4ELZC 3KXTA 4M75F 2RM4A 4FSXA 5LJ5h 2CZ6B 3HFNA 3CCRT 4NS5A 4IUQA 4OVAA 5CR2A 3I56T 5LJ5d 1O9SA 4OB3B 4C92B 2XK0A 5HY6A 4E7HA 1BKBA 2JNGA 2M9UA 2ZCFB 1BI2A 1M1GA 2KK4A 3DKMA 1U1TA 3P8DA 3CC4T 2GFUA 2RJEA 3G71A 2F69A 2DTIA 2BKDN 1YIJT 2DZCA 5DLOA 4M7DB 4L5GA 1GXIE 2E1HA 3ME9A 2D6FA 4PKCC 2DKGA 4M78F 2RH2A 3OYAA 3G71T 2CZ0B 2M16A 4BI8B 4F7UF 4MZPA 1XOVA 3OYDA 1I4K1 3L2QA 5KH6A 5DLQE 2EYQA 4A4FA 1YJNA 2RHIA 4A4EA 3CCRA 4M7AF 2WSCE 4M7DF 5CIUA 3G6EA 4HT8A 3QSUA 2ZGWA 5IAYA 4IKFA 4BUGA 3OYBA 2JTFA 3S6WA 4C92C 3CCVA 1VQKA 3MEVA 4QQGA 1PSEA 4C92A 3OYFA 2KQWA 4PL6A 5J26A 2ZPHB 4EDUA 4ZN1A 3LLRA 3OYJA 5CK9A 2P4TA 2O4XB 2XD0A 3X25B 5GAMh 1VQNA 3OS1A 4C0ZA 3OYHA 4J6XA 2AHJB 3CCSA 5GAOq 1Y07A 1KD1C 3RKYA 2L3RA 3SB2A 2XIDA 3OYCA 2DIGA 3CBPA 3GPLA 1VQKT 4HCZA 2RD1A 5I2MA 2EAYA 2FVUA 2P0QA 4JUVA 5KE2A 1FXXA 2LX9A 2NLUA 1G3TA 5GAN4 4M7DD 1YITT 3CCUA 1V29B 2QQAA 2JUFA 4JLIA 4PJOF 2MF2A 4PNOA 4D6WA 3OYLA 4UC4A 5LJ3j 1NJIU 3ASKA 2RI5A 3TCJA 3CMET 2LRQA 2XDPA 3MO8A 3VUBA 5KCOA 2EWNA 3UWNA 3GNGA 2MWOA 2FHDA 5CKDA 3OSSC 4N0AA 4OP0A 3QXEB 2JN0A 4MMLA 3FIFA 3JAME 3M9QA 4PJOG 1YJ9T 3Q1JA 1W2BS 5GAN6 2JVVA 4IURA 3KUFA 3NTHA 4OGEA 3P8HA 3CC7T 2XICA 1JB0E 3JCMh 1G3WA 1KHCA 1MHNA 2EJ9A 1WGSA 2RHXA 2XDDA 3PT9A 5CQXA 3DLMA 4E7KA 1VQ5T 1FWZA 1ZHIA 3X20B 3I56A 1YJWT 2M0OA 3RIRA 1H3ZA 3GOXA 2VV5A 4IUTA 2HAXA 3VJPA 4M7AB 4ZN3A 1JJ2A 2HD0A 1VQLA 3A8LB 2IG0A 3UPUA 3C95A 1YJWA 1K73C 4HCBA 4XAXB 2VXFA 3GP8A 4C0GA 3BDLA 5GAN3 2I2LA 3M58A 4M7AE 2XG8D 5LJ3f 4FL6A 1K73U 3JSCA 5HKCA 4ZTJA 4ZTFA 5GANf 5GAMf 1VQ7T 1VQOT 1AHJB 3OBYA 1VQMA 1VQ6A 2RB6A 2LNVA 4F7UA 2XKOC 2OTJA 2K4YA 3INZA 4DA4A 2L5QA 3BY7A 2R58A 3C4SA 2PUKB 1KQSS 3JCMb 1M5Q1 3CCUT 1YI2T 1BIBA 2KVQG 5KE3A 5GMKe 4C92G 4LD6A 3DLLA 4M7AA 3CC2T 5CVIA 3CPFA 2X4JA 2RJCA 3QBYA 4HCCA 2EQUA 4LDWA 3QHSA 3L2VA 3CPWA 5D6YA 2VC8A 5GANj 1VQ4T 1UB4A 3FDRA 4GLKA 1G3SA 4F7UE 5LJ5g 2R5MA 3J81E 2E5QA 5CCAA 5IT9E 3BDUA 1B34A 5FU6C 4JJNK 4C0FA 2P0PA 3UT1A 5LJ5e 1JRIA 4BDZA 1I8FA 2C06A 3JCMJ 4LD9K 3SDZA 1NE8A 3G4ST 4M77G 4F7UB 1YCYA 4BE0A 2L8DA 1VQPA 1D3BB 4ZGEB 1VQLT 4O6JA 3QZ5B 3OW2S 3X26B 5GAMj 1TH7A 1G3YA 4DQ2A 1M8VA 2V8IA 2WSFE 2CZ7B 5C6SA 2G3RA 4J7IA 3CCET 1UGRB 5I21A 4IUUA 1K8AC 4Y91A 4MMKA 4NL3A 3ZEHA 5LL6S 1VQ7A 3P8BB 1LOJA 2RHYA 4J6YA 1WJQA 2XI9A 3CXCA 5CKFA 4EMHA 3JB9J 3HRSA 3CBOA 3FRNA 3SWNB 4ZGJB 2Y4XA 2QQSA 2P0KA 5I2SA 2DEQA 3E9FA 4EMGA 4WF2A 1RI0A 5GAN5 1M9SA 4J6WA 2LC4A 2OAUA 2LT1A 5GANd 3JCMW 3CCJA 5LJ3h 2CKKA 1NPPA 3FEOA 4Z02A 1KQ1A 4M75C 5LJ3d 3M4GA 3QPHA 1HK9A 4ME7A 3V8LA 2QQBA 1Q7YU 2E12A 5GAOr 2DK3A 5GAMe 3A8GB 4XTVA 5FRMA 1YBYA 2VGNA 3M53A 4R56A 3CCMA 2RA2A 1JBMA 2BUDA 1NZ9A 4JRPA 1P92A 3ZBDA 1B34B 3GNFB 4FT2A 5LJ5j 2QA4A 3JCMV 3VYGA 2KY9A 2ZPFB 3M56A 3M5AA 3PNWC 3LGFA 3JCMP 1WJSA 2LTOA 3OY9A 2E41A 3A8OB 5GAN7 1X75C 3V8JA 2FB7A 2DXUA 4KT0E 3G6ET 3CD6A 3RERA 4E47A 1QVFS 2F5TX 3OS0A 4XU3A 2DPPB 4C5IA 4EPCA 2X35A 1QVGS 1VQ8T 4J7FA 3SD4A 1QP2A 4BD3A 3QZ9B 1U8RA 2V8KA 3L2UA 3RMSA 3TEEA 1FX7A 2MMPA 2QQRA 3PMIA 4M78B 3T9NA 4KUDK 2K57A 1KD1U 5CO7A 1N27A 1WNLA 4RMOA 3CXCS 3WXMB 2QA4T 3QG1A 2BIVA 1W4SA 1Y96B 1BI1A 2KSSA 2R5AA 5CQYA 3OYEA 1VQ8A 1K9MC 3BW1A 1VQ9A 3QDRB 3CBMA 2LT4A 3EAEA 3VUZA 2LQKA 4C8QG 3HRUA 4CRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R58 A;  3C4S A;  4N4G A;  2D9T A;  3OA6 A;  1G5V A;  3H8Z A;  2JZ2 A;  4BE1 A;  2K3X A;  2EFI A;  2RO0 A;  3OYM A;  2L89 A;  2GF7 A;  5KE3 A;  2EKO A;  4BDY A;  4NS5 A;  5FRN A;  4IUQ A;  4LD6 A;  4OVA A;  2XK0 A;  2RJC A;  3MEU A;  3QBY A;  2DAQ A;  3P8D A;  4II1 A;  2GFU A;  2O4X A;  2RJE A;  4IUP A;  2EQU A;  3L2V A;  2BKD N;  5D6Y A;  4BAC A;  3FDR A;  3OYG A;  2R5M A;  2E5Q A;  2F5K A;  2LCC A;  3DB3 A;  3ME9 A;  4A4H A;  3LYI A;  3OYA A;  2M16 A;  3LGL A;  3MET A;  5D6X A;  3UT1 A;  3OYD A;  3S3N A;  4BDZ A;  3LX7 A;  3L2Q A;  2YRV A;  4C5H A;  2RHU A;  4BE0 A;  2L8D A;  3DB4 A;  5KH6 A;  4L59 A;  4E7I A;  2EQM A;  4A4F A;  2RHI A;  4A4E A;  3L2R A;  1OYX A;  5CIU A;  2RJF A;  2X4X A;  3OB9 A;  5C6S A;  5IAY A;  4IKF A;  2G3R A;  3MEA A;  4A4G A;  3OYB A;  2JTF A;  3S6W A;  4IUU A;  2RI3 A;  3MEV A;  2E6N A;  4QQG A;  3S3O A;  3OYF A;  4BE2 A;  4PL6 A;  2EQJ A;  5J26 A;  4Q5W A;  3ZEH A;  5J39 A;  4EDU A;  3OYJ A;  2RHY A;  3LLR A;  1WJQ A;  2O4X B;  1XNI A;  3QKJ A;  4FU6 A;  3OS1 A;  2WAC A;  3QII A;  3OYH A;  2EQK A;  1OZ3 A;  4CRI A;  2QQS A;  2P0K A;  3PFS A;  2L3R A;  3E9F A;  3OYC A;  2DIG A;  1SSF A;  1RI0 A;  4QW2 A;  3OYI A;  4HCZ A;  2RI2 A;  2CKK A;  2HQE A;  2NLU A;  5KE2 A;  3FEO A;  4Z02 A;  4C5E A;  4PLI A;  3OYL A;  4UC4 A;  3OYN A;  4RG2 A;  3ASK A;  2RI5 A;  3S3M A;  2LRQ A;  2XDP A;  3MO8 A;  5KCH A;  5KCO A;  4E7H A;  4QVZ A;  4X34 A;  2MWO A;  2FHD A;  3UWN A;  4E7J A;  2LVM A;  5FRM A;  3NTI A;  4B9W A;  2BUD A;  2VYT A;  3M9Q A;  3MP1 A;  3OS2 A;  1OZ2 A;  3OYK A;  3Q1J A;  4QQD A;  3L42 A;  3OMG A;  5D6W A;  1OI1 A;  4IUR A;  5IN1 A;  3KUF A;  3NTH A;  3P8H A;  5C0M A;  2HQX A;  3PNW C;  2X4Y A;  3LH0 A;  3L2W A;  1KHC A;  1MHN A;  1WJR A;  3LGF A;  2LTO A;  2RHX A;  1WJS A;  1WGS A;  3OY9 A;  4E7K A;  3DLM A;  3MP8 A;  4N4I A;  2M0O A;  5M9O A;  1H3Z A;  3GOX A;  4IUT A;  3OMC A;  4N4H A;  3PMT A;  2PQW A;  4E7L A;  3FLG A;  3O8V A;  4C5G A;  3OS0 A;  2X4W A;  4C5I A;  2X35 A;  2IG0 A;  3OQ5 A;  3SD4 A;  5FRO A;  4QQ6 A;  4BD3 A;  2LDM A;  3FC3 A;  3NTK A;  3QJ6 A;  3L2U A;  3BDL A;  3PMI A;  2QQR A;  3E9G A;  4PLL A;  2DIQ A;  4GY5 A;  4FL6 A;  1N27 A;  4IUV A;  2RHZ A;  4B9X A;  3MEW A;  2M1H A;  2GFA A;  2BIV A;  4ZTJ A;  4ZTF A;  3OYE A;  2R5A A;  2B8A A;  3F70 A;  3MP6 A;  2K3Y A;  2R57 A;  2RJD A;  3EAE A;  2MWP A;  3H6Z A;  3CEY A; 
#chains in the Genus database with same CATH topology
 1D0Z A;  2Y90 A;  5GAM g;  2JZ2 A;  1E6G A;  2PVD B;  3SWN C;  4BE1 A;  3I9Q A;  1Q86 C;  1M8M A;  3HHT B;  3SFM A;  2DAQ A;  2J6K A;  3I35 A;  2HDA A;  3HKS A;  4M78 C;  1WHH A;  1QLY A;  1EFN A;  5DM7 R;  1XJW B;  3S3N A;  4A4K A;  3CCJ T;  1T3S A;  1X01 A;  3DB4 A;  3EFO A;  3CCL A;  1M30 A;  1IGU A;  5GMK h;  3JCM c;  4PJO D;  2E6N A;  5GAN e;  3S3O A;  3PTA A;  4LUE A;  2RPN A;  4BE2 A;  3QO3 A;  3PGG A;  2QEX T;  4J9B A;  5FWB A;  3V7C A;  1YIJ Q;  1N9S A;  5DY9 A;  9ATC B;  4LDV A;  5GAM d;  3CC2 Q;  2LX7 A;  4RKU E;  4J9G A;  4Y28 E;  3NPF A;  2E70 A;  5GAO m;  5AYF A;  2Y4Y A;  2KYM A;  1KD1 R;  4D8D A;  8ATC B;  2CYZ B;  5GAO l;  2K5L A;  1AEY A;  4QVZ A;  4X34 A;  4LXC A;  2DER A;  4M75 G;  4OGC A;  4KBM B;  4FYX B;  1BK2 A;  5IN1 A;  3JCM d;  5GMK m;  2FPF A;  5KYY A;  1N9R A;  3EGX A;  3JRZ A;  2CP6 A;  1A0N B;  3U23 A;  3PMT A;  4MZT A;  4A54 A;  3TU4 K;  1NM7 A;  3J7A F;  3FC3 A;  1VUB A;  2QEX A;  3QJ6 A;  4P5N A;  1D1A A;  3E9G A;  1M1K U;  1YHQ T;  3HSB A;  2IVW A;  1J3T A;  3WVD B;  3BE3 A;  4OMO A;  3MEW A;  3VS2 A;  3ER0 A;  3RMQ A;  2B8A A;  3CCL T;  1K1Z A;  1YP5 A;  5GAN g;  2KXD A;  3H6Z A;  4N4G A;  2XMF A;  4MZM A;  1G5V A;  1UEB A;  1VQ4 Q;  4J9C A;  4F17 A;  4BDY A;  1I81 A;  3CCE Q;  2OTL A;  1SKU B;  2FPE A;  1NPR A;  2ABL A;  1VQK Q;  3RNJ A;  4LDY A;  3RUX A;  2O9S A;  2P4R A;  4V2S A;  1D1B A;  4J8O A;  1I5O B;  1X2Q A;  1GL5 A;  1KFZ A;  3LYI A;  2A3L A;  2DL3 A;  1M2O A;  1C1A A;  2LMJ A;  8AT1 B;  1TTH B;  4FYY B;  2DIL A;  2GQI A;  1OU9 A;  4E7I A;  2EQM A;  4M7A C;  5FU7 B;  4RTZ A;  2FYK A;  3PIP A;  2DXC A;  1W2B A;  1C0M A;  4PFO A;  2LJ0 A;  1IO6 A;  3EG1 A;  3CCQ A;  3OS5 A;  1FMV A;  4M78 A;  2K2V A;  3LW5 E;  4OMP A;  1UE9 A;  3JCM Q;  2VB6 A;  4RCC A;  4E2F B;  3AHU A;  4C0D B;  5CKB A;  1M90 R;  4XK8 E;  4C8Q D;  1NJI C;  1QVF A;  4M77 C;  3GF5 A;  4M77 A;  4C5E A;  4NL2 A;  2KGT A;  4M7D C;  3OYN A;  1VQO Q;  4A63 B;  1Q82 U;  4M78 E;  2JOY A;  4HT9 A;  1QCN A;  3CCQ T;  3X24 B;  4R55 A;  1TUC A;  3N5B B;  1ZUY A;  2X4Y A;  3LH0 A;  1D1C A;  2HL3 A;  1QVP A;  1IZ6 A;  1ZBX A;  2AT1 B;  4N4H A;  1YJN T;  2KT1 A;  2YT6 A;  1RAH B;  2DL4 A;  3FJP A;  2DE0 X;  2JXB A;  4F7U G;  2DM1 A;  2AK5 A;  1OUL A;  1YI2 Q;  3UDC A;  1BCM A;  2M1H A;  1UJY A;  2CSI A;  3M54 A;  2D8H A;  3L1A A;  2R57 A;  2RJD A;  1WHJ A;  2K5I A;  1IHW A;  2D0N A;  2QI2 A;  3OSV A;  3THK A;  2PUO B;  1GRI A;  2RM4 A;  4FSX A;  2AZV A;  2MYS A;  4IUQ A;  3I56 T;  1KQS P;  1BKB A;  2JNG A;  2M9U A;  3DKM A;  1U1T A;  2RJE A;  1MV0 B;  2DTI A;  3TSZ A;  1Q86 R;  2KBT A;  2OX7 A;  3ME9 A;  4RTU A;  2DKG A;  4M78 F;  3OYA A;  2CZ0 B;  3OYD A;  2JS0 A;  4DBQ A;  5DLQ E;  2M0Y A;  1YJN A;  2ED1 A;  4A4E A;  5IAY A;  1UHF A;  4IKF A;  3OYB A;  3S6W A;  4C92 C;  3CCV A;  3MEV A;  1PSE A;  4C92 A;  3X25 B;  1VQN A;  3CCS A;  5GAO q;  1X69 A;  3CC7 Q;  3RKY A;  3OYC A;  1JQQ A;  1VQK T;  4AMC A;  1RAI B;  4JUV A;  5KE2 A;  2LX9 A;  1PM3 A;  2KRN A;  3CCU A;  1NJI U;  2CUD A;  2NUP B;  5LJ3 j;  2HKN A;  2LRQ A;  4E7H A;  2OJ2 A;  4N0A A;  4DBR A;  3QXE B;  1BU1 A;  2RNA A;  3Q1J A;  4IUR A;  3KUF A;  4HVW A;  2XIC A;  3EGU A;  1KHC A;  2DL5 A;  1E7O A;  2RHX A;  2KE9 A;  1K0S A;  5IHN A;  3DLM A;  1ZHI A;  5GJV B;  1H3Z A;  3GOX A;  2HAX A;  3VJP A;  2HD0 A;  2EKH A;  2FZC B;  3UPU A;  1YJW A;  2F2V A;  1Q82 R;  2E3H A;  5GAN 3;  2I2L A;  2JJ9 A;  1M27 C;  3CMA Q;  4ZTF A;  5GAN f;  1VQO T;  1ZSZ B;  1VQM A;  1VQ6 A;  1MNE A;  2YUP A;  2R58 A;  1AD5 A;  1KQS S;  3CCU T;  2NUP A;  1S1N A;  3CC2 T;  4HVV A;  1CKB A;  3M0Q A;  3CPW A;  3L2V A;  2VC8 A;  3H0H A;  4GLK A;  2H3E B;  1G3S A;  4F7U E;  5LJ5 g;  2BE7 D;  5FU6 C;  2L3Q A;  3CQT A;  2P0P A;  4DBF A;  1RAF B;  2C06 A;  1NE8 A;  5KYW A;  2DRK A;  1M8V A;  1WHG A;  1FMK A;  2WSF E;  2CZ7 B;  2YRD A;  3RR6 A;  3SEM A;  4Y91 A;  1GCQ C;  3ZEH A;  1PKS A;  1VQ7 A;  2RQT A;  4J6Y A;  4EMH A;  3CCS Q;  3CBO A;  4ZGJ B;  2Y4X A;  2QAZ A;  3E9F A;  1F1B B;  1M9S A;  2LJ3 A;  2EYX A;  2LC4 A;  2OAU A;  3H0I A;  1PCX A;  3PVQ A;  1NPP A;  1KQ1 A;  2EQI A;  4FYV B;  3V8L A;  1CSK A;  2NYS A;  3A8G B;  5FRM A;  1JBM A;  3QDF A;  2BUD A;  1W2B P;  1P92 A;  2K9G A;  1GBR A;  2QA4 A;  3VYG A;  2KY9 A;  3CD6 Q;  1IRX A;  3LGF A;  2LTO A;  3OY9 A;  3A8O B;  2YUO A;  2ED0 A;  4KT0 E;  3RBB B;  1QVF S;  4EPC A;  2DA9 A;  3SD4 A;  4BD3 A;  1U8R A;  2DYB A;  3L2U A;  2LQN A;  1SF9 A;  1N5Z A;  2I0N A;  3T9N A;  3O5Z A;  1KD1 U;  1X6B A;  3CXC S;  1WIE A;  1WNL A;  2BIV A;  1Y96 B;  1VQ9 A;  3CBM A;  3VUZ A;  2LQK A;  4Y92 A;  1PHT A;  1T0H A;  3HRU A;  2FPD A;  2H8H A;  2D9T A;  3MCA B;  2ZPE B;  1PC0 A;  4QVD A;  1M2V A;  2JT4 A;  5L8R E;  4LDU A;  3EFR A;  1H64 1;  1WZO A;  4II1 A;  3V8K A;  4JS4 A;  5AT1 B;  2O4X A;  2ZPG B;  4IUP A;  1VYU A;  3NGP A;  2LCC A;  3DB3 A;  1WPY A;  4C8Q B;  4FW2 A;  1PG5 B;  3E19 A;  4TVR A;  5HK0 A;  2RQR A;  1K9A A;  1M1F A;  1AZE A;  3M57 A;  1KQ2 A;  3VYH B;  2O01 E;  2RJF A;  2X4X A;  3NHN A;  2QTX A;  3C12 A;  3MEA A;  5GAO n;  3CC4 A;  2EQJ A;  1OX9 A;  2PVO B;  1K9M U;  2E3I A;  2FRW A;  3NMZ C;  3JCM X;  2DVE A;  1V1C A;  4M7D E;  4M75 D;  2QDY B;  4ZNX A;  3CCM T;  1AWO A;  4RTW A;  1VQ5 A;  1WQ7 A;  2K5F A;  2KNB B;  2ZPB B;  2D0Q B;  4VUB A;  3OBW A;  2DMO A;  2WSE E;  4KH0 B;  3TQ7 P;  4RG2 A;  1PWT A;  1YJ9 A;  1UHC A;  4M77 D;  4FW1 A;  2LVM A;  3VV0 A;  5CKE A;  4M7D A;  3MP1 A;  1Y0M A;  3OS2 A;  3EFS A;  3OYK A;  2V8J A;  1AVZ C;  4QQD A;  3KBG A;  4C8Q A;  4F14 A;  1TUG B;  4C8Q C;  4YTL A;  3I56 Q;  4AFZ C;  1K73 R;  4E7S A;  3M4Y A;  2E65 A;  4M78 D;  2VWF A;  3O8V A;  4OMF B;  4C5G A;  3GIB A;  3OQ5 A;  1WHM A;  2CDT A;  2CGH A;  1BIA A;  2MK5 A;  2Z0W A;  4LE9 A;  2GCX A;  1JXO A;  1GFC A;  4GY5 A;  5A2Q E;  3CCV T;  1PRM C;  2RHZ A;  3J80 E;  3E1S A;  1M90 U;  5IXB A;  4JS5 A;  1MUZ A;  3SWN A;  2XHC A;  1B07 A;  4BY6 B;  4OF1 A;  2RK2 A;  3A98 A;  3IQL A;  1PSF A;  2QEX Q;  3MPU B;  1VQ9 T;  2EFI A;  2RO0 A;  3G7Z A;  2L89 A;  3QUI A;  5FRN A;  1DJ7 B;  4ZGD B;  2EJF A;  3RKX A;  4EMK B;  1Q81 U;  5KYX B;  1RAD B;  5D6X A;  2M02 A;  2NUT B;  3RES A;  2CSQ A;  1ZLM A;  1O75 A;  2GQV A;  1OYX A;  2LQ8 A;  3OB9 A;  5KYN A;  5LJ3 g;  1U1S A;  1RLP C;  1NYF A;  2FZK B;  1QQJ A;  3CC2 A;  4XTW A;  1YIJ A;  4OB1 B;  1OZ3 A;  5A0D A;  4BY6 C;  4MDX A;  1Q86 U;  2RI2 A;  4JZ3 A;  4OMN A;  4PJO B;  2HSE B;  2OAW A;  1SRL A;  3CCL Q;  2KAF A;  1M2V B;  1GBQ A;  4RTV A;  3FJ5 A;  3TRE A;  3LWI A;  2DBK A;  5EG2 A;  1H92 A;  1AZG B;  3EG3 A;  5D6W A;  4EMK C;  2JM8 A;  1Q95 G;  1AT1 B;  2E4H A;  5IH2 A;  1LNX A;  3L2W A;  3VU3 C;  3OW2 P;  3JB9 G;  1D3B A;  4KUI A;  4HCK A;  3VS5 A;  2M51 A;  2VGM A;  2L3P A;  4XTY A;  3M0S A;  4E7L A;  4PJO A;  4C92 E;  2QA4 Q;  1AWW A;  1TWB A;  3NTK A;  4OB0 B;  5FU6 B;  1LJO A;  4RUG A;  2DTH A;  2A36 A;  2QQ9 A;  4IUV A;  4DOW A;  3F70 A;  1YHQ A;  4PJM A;  3M59 A;  2BTT A;  1UGS B;  3CME Q;  1VIF A;  5GMK j;  4QVC A;  4LDX A;  1EIF A;  2GBQ A;  3A8M B;  3KXT A;  2O2O A;  2CZ6 B;  4OVA A;  5ECA A;  2XK0 A;  5HY6 A;  1Q7Y R;  4PJJ A;  1W70 A;  1W1F A;  2EYY A;  3VRZ A;  4KGX B;  4M7D B;  2E1H A;  2D6F A;  4PKC C;  2CRE A;  2RH2 A;  2NWM A;  3H9N A;  2JTE A;  4F7U F;  4MZP A;  2V1Q A;  1SHF A;  1QVF P;  2MIO A;  4A4F A;  2GGR A;  4M7D F;  1WI7 A;  4DEX A;  3QSU A;  2ZGW A;  4BUG A;  3REA B;  3CXC P;  2JTF A;  4EIK A;  4QQG A;  3OYJ A;  4ZN1 A;  3LLR A;  2RQU A;  2AIR B;  2P4T A;  3ULR B;  2XD0 A;  2EBP A;  5GAM h;  1OV3 A;  3EGX B;  4C0Z A;  2AHJ B;  3D7S B;  1Y07 A;  1KD1 C;  3CBP A;  3GPL A;  5GJW B;  2FVU A;  2P0Q A;  2CH4 W;  1G3T A;  4PJO F;  2JUF A;  3OYL A;  3TCJ A;  2XDP A;  3UWN A;  2FHD A;  2K3B A;  3FIF A;  3JAM E;  1W2B S;  3PVL A;  3NTH A;  3P8H A;  1PNJ A;  2KEA A;  1PD0 A;  2YUN A;  1WGS A;  2XDD A;  1FWZ A;  1YJW T;  3RIR A;  1JJ2 A;  1VQL A;  3ZL7 C;  2IG0 A;  3C95 A;  1QVG P;  1K73 C;  2EW3 A;  3GP8 A;  4C0G A;  1Y57 A;  1RAE B;  4FL6 A;  3JSC A;  4JJD A;  4JPB W;  3OBY A;  3I5R A;  2K4Y A;  3C4S A;  2HKQ B;  1VQN Q;  4C92 G;  5CVI A;  4IIO A;  2X4J A;  1UEC A;  2EQU A;  4LDW A;  3EH2 A;  1KIK A;  1UB4 A;  1OPK A;  1OPL A;  2R5M A;  3J81 E;  1QWF A;  5CCA A;  5IT9 E;  3BDU A;  1WFW A;  5LJ5 e;  1I8F A;  3G4S T;  4KH1 B;  4F7U B;  3EG9 B;  1YCY A;  1VQP A;  1D3B B;  2HQH A;  4ZGE B;  1RLQ C;  3EGD A;  1VQL T;  3EG2 A;  3VS4 A;  2J7I A;  1TH7 A;  2V8I A;  3CCE T;  5I21 A;  4IUU A;  2KXC A;  1VQ5 Q;  3LH5 A;  1N8R R;  4NL3 A;  2CH4 A;  1WJQ A;  3CXC A;  1NEB A;  4AFQ C;  2P0K A;  5I2S A;  4EMG A;  4WF2 A;  1LCK A;  1RI0 A;  4J6W A;  3A1P A;  5GAN d;  3JCM W;  3EG9 A;  4M75 C;  3M4G A;  3CCR Q;  3EGD B;  1Q7Y U;  5GAO r;  5GAM e;  1RUW A;  2A0F B;  4XTV A;  1YBY A;  3M53 A;  2ATC B;  2J06 A;  3ZBD A;  1B34 B;  3JCM V;  1RAA B;  2DYI A;  4PJN A;  2KRO A;  3PNW C;  7AT1 B;  3I5S A;  4KGV B;  1WJS A;  2E41 A;  1X75 C;  3V8J A;  1K4U S;  4FYW B;  3OS0 A;  1QVG S;  1AWX A;  1M3C A;  2FG0 A;  4J7F A;  3QZ9 B;  1M3B A;  2V8K A;  4JJB A;  3CPW P;  3TEE A;  1FX7 A;  4KUD K;  5CO7 A;  3UA6 A;  2KSS A;  3QDR B;  2LT4 A;  3EAE A;  2D1X A;  1RAB B;  2VUB A;  1YN8 A;  4M77 B;  2DVJ A;  3OW2 A;  1K9M R;  2GF7 A;  4CC2 A;  2DD5 A;  1YIT Q;  4HKE A;  4M7A D;  1GFD A;  3CCQ Q;  2E5K A;  2YRC A;  2FEI A;  4OMM A;  4WTO B;  4J9H A;  5GAN 8;  1K8A U;  3C94 A;  3QYH B;  1JXM A;  4JLG A;  3MET A;  1VQP Q;  1TXQ A;  2ROT A;  5GAO p;  1IXD A;  3R6O A;  4J5Y A;  3AT1 B;  1IRE B;  1N6A A;  2KT8 A;  3L2R A;  2GNC A;  3CD6 T;  1WYX A;  2QG9 B;  2SEM A;  2HCK A;  4O5V A;  3A5Z B;  1SSH A;  4CC3 A;  5J39 A;  4JRK A;  2OTL Q;  4FU6 A;  3CCE A;  2KI7 A;  1MND A;  2WAC A;  4XTZ A;  1I07 A;  1VQ4 A;  2EQK A;  1VQ7 Q;  3NFC A;  1WXB A;  4C8Q E;  2DXB A;  3OYI A;  2E10 A;  5HCK A;  2HQE A;  2ZPI B;  3UF4 A;  1G8X A;  2BZY A;  1XQH A;  4QT7 A;  3S3M A;  1NYG A;  4OB2 B;  4E7J A;  2FZG B;  1B7T A;  2MCN A;  4J9E A;  1OI1 A;  2BZX A;  1WJR A;  1V76 A;  1RAC B;  1Q82 C;  2K6D A;  3OMC A;  1VYT A;  2PQW A;  3FLG A;  5FRO A;  2JMC A;  4N0A C;  4M77 F;  2LCL A;  4MDW A;  3HFO A;  3M0R A;  4J9I A;  4PLL A;  1X43 A;  1UGQ B;  3QJY A;  1GCP A;  3BFM A;  2GFA A;  3CMA A;  4K11 A;  4D8K A;  4ATO A;  3TVT A;  4ESR A;  4DEY A;  2MWP A;  1KC8 R;  3VS3 A;  2COZ A;  3H8Z A;  2JM9 A;  3OYM A;  3M0T A;  2X3X D;  2JS2 A;  4XU0 A;  4M75 E;  3VKI A;  3I55 T;  4RTX A;  2YHT A;  4C92 F;  2CUB A;  2ZZD A;  1ZX6 A;  2DL8 A;  5HK3 A;  4ELY C;  4CI0 C;  3OYY A;  4E6R A;  2YLC A;  1D0X A;  1QW1 A;  1QP3 A;  2KRS A;  1Y71 A;  4L59 A;  4FM4 B;  3CCU Q;  3CCS T;  1BI3 A;  3MHX A;  3JB9 F;  2LJ1 A;  4A4G A;  2KMT A;  2XU8 A;  1ARK A;  4M7A G;  1RL2 A;  4Q5W A;  1BBZ A;  3CC7 A;  1OU8 A;  1QWE A;  3CMA T;  1NLO C;  2EIF A;  4DOV A;  3QII A;  4F04 B;  3CPW S;  1M1K C;  1E6H A;  1K8A R;  3QWY A;  1LVK A;  2W0Z A;  2KDS A;  3PFS A;  5L23 A;  3WVE B;  1N8R C;  4QW2 A;  4BB7 A;  1T3L A;  5GMK l;  3CME A;  3CCV Q;  4F16 A;  1OQK A;  2W10 A;  1YWO A;  2LP5 A;  5GMK i;  2MOX A;  1VQP T;  1UUE A;  2CT3 A;  2JTM A;  5FWC A;  3HRT A;  4M4Z A;  1XTD A;  4PJO E;  3NTI A;  1ZUU A;  1Y96 A;  1FMW A;  1JJ2 P;  2HNI A;  5A0G A;  3HL8 A;  1Z9Q A;  2DXT A;  2FL7 A;  4M77 E;  1TUD A;  2DRM A;  5LJ5 f;  2X4W A;  4LNP A;  4GBQ A;  2J6F A;  3I55 A;  1MMD A;  3REB B;  2DZ9 A;  5CKH A;  3L2Z A;  4L6V 5;  1JU5 C;  1R77 A;  1VQ8 Q;  1VQN T;  5GAN 2;  1I5L A;  1EZZ B;  1YI2 A;  4PFP A;  1KQS A;  3OA6 A;  5I11 A;  1KJW A;  1R0B G;  4M75 F;  4NS5 A;  3PE0 A;  4C92 B;  1WA7 A;  2DL7 A;  1M1G A;  1BI2 A;  1QMC A;  1U06 A;  3CC4 T;  1TS9 A;  3G71 A;  2RMO A;  1NEG A;  4AFU C;  1YIJ T;  3UA7 A;  4L5G A;  1GXI E;  2QGG A;  4AG1 C;  2PTK A;  4BI8 B;  5IXF A;  1I4K 1;  3L2Q A;  2PZ1 A;  5KH6 A;  2YSQ A;  2AKK A;  4WCI A;  2WSC E;  3CCJ Q;  2J05 A;  1D0Y A;  1I0C A;  2KQW A;  4PL6 A;  5J26 A;  2ZPH B;  4EDU A;  5CK9 A;  3OS1 A;  3OYH A;  4J6X A;  2KYB A;  1Q81 R;  1UFF A;  2DIG A;  2C0T A;  2YUQ A;  4AT1 B;  4J9D A;  5GAN 4;  4M7D D;  1FXX A;  1C6V X;  1ZBJ A;  1YIT T;  2QQA A;  4PJL A;  4JLI A;  4D6W A;  4PNO A;  4PK4 A;  4UC4 A;  2RI5 A;  3CME T;  3MO8 A;  3VUB A;  5KCO A;  2EWN A;  1WDX A;  3MJX A;  5CKD A;  3OSS C;  2PNI A;  2JN0 A;  1WXT A;  1OX8 A;  3M9Q A;  1X27 A;  1NLP C;  1UTI A;  5GAN 6;  4OGE A;  1JB0 E;  5KYU B;  1PKT A;  1I1J A;  3X20 B;  3I56 A;  2V1R A;  4IUT A;  2NUZ A;  1JO8 A;  4M7A B;  3HTR A;  4HCB A;  4XAX B;  3VS0 A;  2OTJ Q;  3M58 A;  1YJ9 Q;  5LJ3 f;  1ZA2 B;  1K73 U;  4AG2 C;  5HKC A;  1WHL A;  1VQ7 T;  5KYW B;  2OTJ A;  2RB6 A;  2LNV A;  2XKO C;  5KYU A;  3INZ A;  2PUK B;  3JCM b;  1PD1 A;  4JZ4 A;  1BIB A;  2KVQ G;  2DF6 A;  2IPO B;  5KE3 A;  4LD6 A;  4M7A A;  4X1V A;  3CC4 Q;  2RJC A;  2AKL A;  3QHS A;  1VQ4 T;  5GAN j;  2E5Q A;  3G6E Q;  1HSQ A;  4QKU A;  3UT1 A;  4BDZ A;  4LD9 K;  3SDZ A;  1X6G A;  4O6J A;  3QZ5 B;  3OW2 S;  3X26 B;  5GAM j;  5C6S A;  1HYO A;  1GCQ A;  2ECZ A;  1ZSG A;  1SPK A;  1VA7 A;  3KFV A;  3P8B B;  2XI9 A;  5CKF A;  4ORZ A;  3JB9 J;  3SWN B;  1BB9 A;  1TSF A;  1SEM A;  2QQS A;  2HMA A;  2DEQ A;  1PRL C;  3CCJ A;  5LJ3 h;  1VQ9 Q;  1HK9 A;  2C0I A;  4ME7 A;  2QQB A;  4RTT A;  2KR3 A;  1NG2 A;  4JJC A;  1NJI R;  2CP3 A;  2BZ8 A;  5D7U A;  2VGN A;  4PFZ A;  1NZ9 A;  1UJ0 A;  3GNF B;  4FT2 A;  3UAT A;  2VVK A;  4FSS A;  3G71 Q;  3JCM P;  2FRY A;  2DJQ A;  2FB7 A;  2DXU A;  3RER A;  2X51 A;  2EYZ A;  3CD6 A;  4C5I A;  2X35 A;  3GBQ A;  2L0A A;  1QP2 A;  2CP2 A;  2EPD A;  3QWX X;  4RTY A;  2QQR A;  2K57 A;  2GTO A;  2QA4 T;  1QKW A;  1W4S A;  1VQ8 A;  2R5A A;  5CQY A;  4KGZ B;  4CC7 A;  1Y7X A;  4PJO C;  1Q7Y C;  1KK7 A;  2DBM A;  2DET A;  2K3X A;  3HPW A;  4J83 A;  4C0D C;  2PVG B;  5FW9 A;  5GAN h;  2X9H A;  3MEU A;  1S72 A;  5FLX E;  2ZAE A;  2F1L A;  2QXF A;  3OYG A;  1ZUK A;  4A4H A;  2A37 A;  4X9C A;  1KHI A;  2CP7 A;  3LGL A;  4BI3 A;  3MKD A;  1QKX A;  4RG8 A;  3SHW A;  1ZQ1 A;  3TSW A;  3GLX A;  3RDV A;  5EC7 A;  2E6Z A;  2HBP A;  1UG1 A;  2LQW A;  1M4Z A;  2YDL A;  1VIE A;  1ABO A;  3G4S A;  2RI3 A;  3G1J A;  2FO0 A;  1MGQ A;  1Q81 C;  1MMN A;  2EGE A;  4XTU A;  3QKJ A;  2EGA A;  1YFN A;  1IGQ A;  5CAI A;  3M55 A;  2COY A;  1G2B A;  1SSF A;  4M7D G;  1M3A A;  1ZSZ A;  1H3H A;  1VQM Q;  1VQ6 Q;  4FIB A;  4RCB A;  2VXE A;  2CZ1 B;  1QCO A;  4J9F A;  2LZ6 B;  5KCH A;  1UGV A;  2J6O A;  2KRM A;  2X3W D;  3VS1 A;  4OMQ A;  4Z89 A;  4XU2 A;  1YJW Q;  3V7R A;  1OZ2 A;  1TOV A;  2C0O A;  1KC8 U;  3OMG A;  2CS7 A;  2DJZ A;  3A8H B;  5LJ3 e;  2HQX A;  4XU1 A;  1WLP B;  4X9D A;  2O9V A;  5KYX A;  2F2W A;  2SRC A;  3MP8 A;  4N4I A;  4ANJ A;  1KG1 A;  2A28 A;  4A53 A;  2MI6 A;  4C92 D;  2LCS A;  1OOT A;  3QYG B;  1U5S A;  4QQ6 A;  2LDM A;  3EG0 A;  1X2K A;  3RKW A;  2B86 A;  2DIQ A;  3LWH A;  4FCY A;  2DD4 A;  2GTJ A;  3MP6 A;  1IHV A;  2K3Y A;  2DO3 A;  3JCM f;  3JB9 D;  2XDB A;  4NOY A;  2EVR A;  3PIO A;  3CEY A;  4JDS A;  2OTL T;  2ROL A;  1HXD A;  2EKO A;  1WQW A;  4LUD A;  1KC8 C;  4FT4 A;  6AT1 B;  3G4S Q;  4BAC A;  1UGP B;  1X6O A;  2F5K A;  4XQ3 A;  5FU7 C;  1YJN Q;  1UDL A;  3JB9 H;  3LX7 A;  1HD3 A;  3R6N A;  1AWJ A;  2YRV A;  1T0J A;  2RHU A;  4JRI A;  4C5H A;  3C0C A;  1WXU A;  3FB9 A;  2RK1 A;  2E64 A;  1SHG A;  4Z8A A;  3JB9 I;  2PU9 B;  1WX6 A;  1M90 C;  1KSW A;  2EJG A;  2RQW A;  1XNI A;  3JCM g;  4M75 B;  1YCS B;  1FYN A;  2H3J A;  4HVU A;  3ZFJ A;  2DTO A;  1S72 T;  2OI3 A;  2A7Y A;  1QVG A;  2NUT A;  2OTJ T;  3JCM e;  2V26 A;  1N8R U;  4PLI A;  5A0L A;  2K2M A;  1BI0 A;  1NBE B;  3V7S A;  4B9W A;  3H41 A;  2VYT A;  4EMK A;  1OEB A;  3L42 A;  2BE9 B;  2RN8 A;  1AOJ A;  5C0M A;  3EH1 A;  4M75 A;  1H8K A;  5J3B A;  2D8J A;  2O88 A;  1ABQ A;  2MAM A;  1JJ2 S;  2YLB A;  5M9O A;  3URG A;  1YIT A;  3HP9 A;  4HA8 A;  1R8O B;  1YNZ A;  4KUL A;  1VQM T;  1VQ6 T;  1SG5 A;  4C8Q F;  4JRQ A;  4M78 G;  1VQO A;  4XTX A;  2MPX C;  4B9X A;  4IIM A;  2CP0 A;  3JV3 A;  4OML A;  2HEQ A;  3X28 B;  1BYM A;  1MMG A;  4ELZ C;  3CCR T;  5LJ5 h;  1G83 A;  3HFN A;  3VS7 A;  5CR2 A;  5LJ5 d;  1O9S A;  4OB3 B;  4R0K A;  3H0F A;  2ZCF B;  2KK4 A;  3P8D A;  2GFU A;  2L2P A;  5I22 A;  2F69 A;  4KRT A;  2BKD N;  2DZC A;  5DLO A;  1D09 B;  4GLM A;  1TU0 B;  3G71 T;  1K76 A;  2M16 A;  2QAS A;  1XOV A;  2YXY A;  2EYQ A;  4M7A F;  2RHI A;  3CCR A;  5CIU A;  3G6E A;  4HT8 A;  2DEU A;  1VQK A;  3OYF A;  1VOM A;  2K7A A;  5KYY B;  2F2X A;  2O4X B;  2DLP A;  2L3R A;  3SB2 A;  2XID A;  1R0C B;  2QTV A;  4HCZ A;  2RD1 A;  5I2M A;  2EAY A;  2NLU A;  1V29 B;  2MF2 A;  1ACM B;  3ASK A;  2CT4 A;  3GNG A;  2MWO A;  4OP0 A;  4MML A;  1YWP A;  4PJO G;  1YJ9 T;  2JVV A;  2RF0 A;  3CC7 T;  1HJD A;  1EX4 A;  3JCM h;  1G3W A;  1MHN A;  2EJ9 A;  1Z9Z A;  3PT9 A;  5CQX A;  2HZY A;  4E7K A;  1VQ5 T;  1K0X A;  2M0O A;  2ENM A;  2VV5 A;  2IIM A;  2G6F X;  4ZN3 A;  3A8L B;  3VS6 A;  2VXF A;  3BDL A;  2VKN A;  1RI9 A;  4B6M A;  4M7A E;  2DNU A;  2XG8 D;  4E7Z A;  2YWW A;  1RAG B;  2QYZ A;  4LN2 A;  2QK0 A;  4ZTJ A;  5GAM f;  1AHJ B;  2L3S A;  4F7U A;  4DA4 A;  2L5Q A;  2RQV A;  3BY7 A;  2K79 A;  1M5Q 1;  2HSP A;  1YI2 T;  1WHK A;  3E2U A;  1VQL Q;  5GMK e;  3DLL A;  3CPF A;  2EGC A;  3QBY A;  4HCC A;  2CP5 A;  2DX1 A;  5D6Y A;  1QCF A;  3FDR A;  2JW4 A;  2O31 A;  1B34 A;  4JJN K;  2QGF B;  2DFU A;  4C0F A;  1ZA1 B;  1JEG A;  1JRI A;  3JCM J;  4HXJ A;  4M77 G;  4BE0 A;  2L8D A;  3M0U A;  1MMA A;  1G3Y A;  4DQ2 A;  3M0P A;  2G3R A;  4J7I A;  1UGR B;  1K8A C;  1IB8 A;  4MMK A;  5IHK A;  2VAS A;  5LL6 S;  1LOJ A;  2RHY A;  2HBW A;  1LPL A;  4CC4 B;  2JMA A;  3VRY A;  2QDL A;  3HRS A;  3FRN A;  5IHI A;  1W6X A;  1SRM A;  4DBH A;  2EYW A;  5GAN 5;  2LT1 A;  4Z88 A;  1M1K R;  2CKK A;  3FEO A;  4Z02 A;  5LJ3 d;  3QPH A;  2E12 A;  2DK3 A;  3EHQ A;  4R56 A;  3CCM A;  1ZSZ C;  2RA2 A;  1U3O A;  3I55 Q;  4JRP A;  5LJ5 j;  2ZPF B;  3M56 A;  3M5A A;  2ESW A;  1B3Q A;  2A08 A;  1S72 Q;  5GAN 7;  2LNH B;  1MV3 A;  3G6E T;  4E47 A;  4AFS C;  2F5T X;  3EFO B;  2DPP B;  4XU3 A;  1VQ8 T;  2P84 A;  2AZS A;  1CKA A;  3CCM Q;  3RMS A;  3PMI A;  2MMP A;  1VYV A;  4M78 B;  2COW A;  1BCO A;  1YHQ Q;  4RMO A;  1N27 A;  3WXM B;  3QG1 A;  1BI1 A;  3EHR A;  3OYE A;  1K9M C;  1TG0 A;  3BW1 A;  4C8Q G;  4BI4 A;  4CRI A;  2HL5 C; 
#chains in the Genus database with same CATH homology
 1Y7X A;  2VUB A;  2Y90 A;  2D9T A;  4M77 B;  3MCA B;  5GAM g;  2ZPE B;  3OW2 A;  1Q7Y C;  2JZ2 A;  2PVD B;  4PJO C;  3SWN C;  2K3X A;  4BE1 A;  3HPW A;  4QVD A;  2GF7 A;  4J83 A;  2DD5 A;  1Q86 C;  5L8R E;  4HKE A;  4C0D C;  4LDU A;  2PVG B;  5GAN h;  4M7A D;  3HHT B;  3SFM A;  3EFR A;  3MEU A;  1H64 1;  5FLX E;  2DAQ A;  1S72 A;  4II1 A;  3V8K A;  4JS4 A;  2O4X A;  2ZPG B;  4IUP A;  3HKS A;  2QXF A;  4M78 C;  3OYG A;  2LCC A;  3DB3 A;  4A4H A;  5GAN 8;  1K8A U;  3C94 A;  3QYH B;  1WPY A;  4X9C A;  4C8Q B;  4JLG A;  5DM7 R;  1KHI A;  3MET A;  3LGL A;  3E19 A;  4TVR A;  5HK0 A;  4A4K A;  5GAO p;  4BI3 A;  3CCJ T;  3S3N A;  1M1F A;  3R6O A;  1X01 A;  4J5Y A;  1IRE B;  3DB4 A;  3M57 A;  4RG8 A;  1ZQ1 A;  1KQ2 A;  1N6A A;  3CCL A;  3GLX A;  3VYH B;  2E6Z A;  3L2R A;  3CD6 T;  2X4X A;  2HBP A;  2O01 E;  2RJF A;  1M4Z A;  2QTX A;  3C12 A;  3MEA A;  5GMK h;  1VIE A;  3G4S A;  5GAO n;  2RI3 A;  3JCM c;  4PJO D;  2E6N A;  1MGQ A;  4O5V A;  5GAN e;  3A5Z B;  3PTA A;  3S3O A;  1Q81 C;  4BE2 A;  3QO3 A;  2EQJ A;  3CC4 A;  5J39 A;  4JRK A;  3PGG A;  4XTU A;  2PVO B;  2QEX T;  3QKJ A;  4FU6 A;  3CCE A;  5CAI A;  1K9M U;  3V7C A;  2WAC A;  3M55 A;  4XTZ A;  1N9S A;  5DY9 A;  3JCM X;  2DVE A;  1VQ4 A;  4LDV A;  2EQK A;  5GAM d;  4M7D E;  4M75 D;  3NFC A;  2QDY B;  4RKU E;  3CCM T;  4Y28 E;  1SSF A;  4C8Q E;  4M7D G;  2DXB A;  3OYI A;  1VQ5 A;  2E10 A;  1WQ7 A;  2E70 A;  2K5F A;  5GAO m;  5AYF A;  2ZPB B;  2HQE A;  2D0Q B;  2ZPI B;  4FIB A;  4RCB A;  2Y4Y A;  3OBW A;  4VUB A;  2VXE A;  2WSE E;  2CYZ B;  2CZ1 B;  1XQH A;  3S3M A;  4RG2 A;  2K5L A;  4OB2 B;  5GAO l;  1YJ9 A;  5KCH A;  4E7J A;  4QVZ A;  4X34 A;  4M77 D;  2LVM A;  3VV0 A;  4M75 G;  5CKE A;  4M7D A;  3MP1 A;  4XU2 A;  4OGC A;  3V7R A;  4KBM B;  1OZ2 A;  3EFS A;  2V8J A;  4QQD A;  3OS2 A;  3OYK A;  3OMG A;  3KBG A;  1OI1 A;  2CS7 A;  2DJZ A;  3A8H B;  5IN1 A;  4C8Q A;  5GMK m;  3JCM d;  1N9R A;  5LJ3 e;  4C8Q C;  2HQX A;  3JRZ A;  4YTL A;  4XU1 A;  1WJR A;  4X9D A;  3M4Y A;  2E65 A;  3MP8 A;  4M78 D;  4N4I A;  1KG1 A;  1Q82 C;  3OMC A;  3PMT A;  2MI6 A;  2PQW A;  4A53 A;  3FLG A;  3O8V A;  4MZT A;  4OMF B;  3QYG B;  4A54 A;  4C5G A;  4C92 D;  3TU4 K;  3OQ5 A;  3GIB A;  5FRO A;  3J7A F;  2CGH A;  4QQ6 A;  1BIA A;  2LDM A;  4N0A C;  4M77 F;  2LCL A;  4MDW A;  1VUB A;  3FC3 A;  3HFO A;  3QJ6 A;  2QEX A;  2GCX A;  4P5N A;  3RKW A;  4PLL A;  3E9G A;  1M1K U;  2DIQ A;  1YHQ T;  4GY5 A;  1UGQ B;  3QJY A;  2IVW A;  5A2Q E;  2DD4 A;  3LWH A;  3WVD B;  3CCV T;  3HSB A;  2RHZ A;  3BFM A;  3MEW A;  2GFA A;  3CMA A;  3ER0 A;  3RMQ A;  3J80 E;  3MP6 A;  2B8A A;  3E1S A;  1M90 U;  2K3Y A;  4ATO A;  4JS5 A;  2DO3 A;  3JCM f;  3JB9 D;  2XDB A;  3CCL T;  3SWN A;  4NOY A;  2MWP A;  2XHC A;  5GAN g;  3H6Z A;  4BY6 B;  4OF1 A;  3CEY A;  3PIO A;  4N4G A;  4JDS A;  2RK2 A;  4MZM A;  2OTL T;  1PSF A;  1G5V A;  1UEB A;  3H8Z A;  1VQ9 T;  2EFI A;  2RO0 A;  3G7Z A;  2L89 A;  3QUI A;  3OYM A;  1HXD A;  2EKO A;  4BDY A;  1WQW A;  1I81 A;  5FRN A;  2OTL A;  1DJ7 B;  4ZGD B;  1KC8 C;  1NPR A;  4XU0 A;  4FT4 A;  2EJF A;  4LDY A;  3RUX A;  4M75 E;  4BAC A;  3VKI A;  3I55 T;  1UGP B;  2YHT A;  4C92 F;  4V2S A;  1X6O A;  3RKX A;  4J8O A;  2F5K A;  2ZZD A;  4XQ3 A;  5FU7 C;  4EMK B;  5HK3 A;  1Q81 U;  3LYI A;  2A3L A;  4ELY C;  4CI0 C;  5D6X A;  3JB9 H;  3OYY A;  1KC8 U;  2YLC A;  3LX7 A;  3RES A;  1QW1 A;  1QP3 A;  2YRV A;  2RHU A;  4JRI A;  4C5H A;  1Y71 A;  4E7I A;  4L59 A;  1O75 A;  2EQM A;  2GQV A;  4M7A C;  3FB9 A;  5FU7 B;  1OYX A;  4FM4 B;  2LQ8 A;  3OB9 A;  2FYK A;  2RK1 A;  5LJ3 g;  3CCS T;  1BI3 A;  1U1S A;  2E64 A;  3MHX A;  3JB9 F;  3PIP A;  4A4G A;  2KMT A;  2DXC A;  3JB9 I;  1W2B A;  2XU8 A;  2PU9 B;  3CCQ A;  4M7A G;  1RL2 A;  3OS5 A;  4Q5W A;  1M90 C;  3CC7 A;  2EJG A;  3CC2 A;  4XTW A;  1XNI A;  3CMA T;  4M78 A;  2K2V A;  3JCM g;  2EIF A;  4DOV A;  3QII A;  3LW5 E;  4M75 B;  3CPW S;  1M1K C;  1YIJ A;  4OB1 B;  1OZ3 A;  3JCM Q;  2H3J A;  2KDS A;  3PFS A;  4RCC A;  5A0D A;  3AHU A;  3WVE B;  5CKB A;  3ZFJ A;  2DTO A;  4C0D B;  1S72 T;  1N8R C;  4QW2 A;  4XK8 E;  4BB7 A;  4BY6 C;  4C8Q D;  1NJI C;  5GMK l;  2A7Y A;  3CME A;  1Q86 U;  2RI2 A;  1QVG A;  4MDX A;  1QVF A;  4M77 C;  4PJO B;  2OTJ T;  3GF5 A;  3JCM e;  1N8R U;  4M77 A;  4C5E A;  4PLI A;  5GMK i;  5A0L A;  4NL2 A;  4M7D C;  1VQP T;  2KAF A;  3OYN A;  2JTM A;  1BI0 A;  1Q82 U;  3TRE A;  3HRT A;  4M78 E;  3LWI A;  5EG2 A;  1XTD A;  2JOY A;  4HT9 A;  4PJO E;  3CCQ T;  3NTI A;  3V7S A;  4B9W A;  3X24 B;  2VYT A;  4EMK A;  1Y96 A;  4R55 A;  5D6W A;  3L42 A;  4EMK C;  3N5B B;  5C0M A;  1LNX A;  2X4Y A;  3LH0 A;  2HNI A;  4M75 A;  3VU3 C;  5A0G A;  3L2W A;  3HL8 A;  5J3B A;  2DXT A;  2FL7 A;  3JB9 G;  1D3B A;  4M77 E;  4KUI A;  1QVP A;  1IZ6 A;  1ZBX A;  2MAM A;  2VGM A;  1JJ2 S;  2YLB A;  5M9O A;  3URG A;  4N4H A;  1YIT A;  4XTY A;  4E7L A;  1YJN T;  5LJ5 f;  4PJO A;  4C92 E;  2X4W A;  3HP9 A;  4HA8 A;  1R8O B;  3FJP A;  3NTK A;  4OB0 B;  3I55 A;  5FU6 B;  1LJO A;  4KUL A;  2DTH A;  1VQM T;  1VQ6 T;  2DZ9 A;  5CKH A;  2QQ9 A;  4M78 G;  4C8Q F;  3L2Z A;  4JRQ A;  1VQO A;  4XTX A;  4F7U G;  4L6V 5;  4IUV A;  3UDC A;  4B9X A;  2M1H A;  1VQN T;  4BI4 A;  4DOW A;  3M54 A;  5GAN 2;  1I5L A;  3F70 A;  1YI2 A;  1YHQ A;  3L1A A;  2R57 A;  2RJD A;  3M59 A;  2K5I A;  1UGS B;  1VIF A;  1KQS A;  5GMK j;  4QVC A;  3X28 B;  2QI2 A;  3OSV A;  3OA6 A;  4LDX A;  1BYM A;  1EIF A;  2PUO B;  3A8M B;  4ELZ C;  3KXT A;  4M75 F;  2RM4 A;  4FSX A;  5LJ5 h;  2CZ6 B;  3HFN A;  3CCR T;  4NS5 A;  4IUQ A;  4OVA A;  5CR2 A;  3I56 T;  5LJ5 d;  1O9S A;  4OB3 B;  4C92 B;  2XK0 A;  5HY6 A;  4E7H A;  1BKB A;  2JNG A;  2M9U A;  2ZCF B;  1BI2 A;  1M1G A;  2KK4 A;  3DKM A;  1U1T A;  3P8D A;  3CC4 T;  2GFU A;  2RJE A;  3G71 A;  2F69 A;  2DTI A;  2BKD N;  1YIJ T;  2DZC A;  5DLO A;  4M7D B;  4L5G A;  1GXI E;  2E1H A;  3ME9 A;  2D6F A;  4PKC C;  2DKG A;  4M78 F;  2RH2 A;  3OYA A;  3G71 T;  2CZ0 B;  2M16 A;  4BI8 B;  4F7U F;  4MZP A;  1XOV A;  3OYD A;  1I4K 1;  3L2Q A;  5KH6 A;  5DLQ E;  2EYQ A;  4A4F A;  1YJN A;  2RHI A;  4A4E A;  3CCR A;  4M7A F;  2WSC E;  4M7D F;  5CIU A;  3G6E A;  4HT8 A;  3QSU A;  2ZGW A;  5IAY A;  4IKF A;  4BUG A;  3OYB A;  2JTF A;  3S6W A;  4C92 C;  3CCV A;  1VQK A;  3MEV A;  4QQG A;  1PSE A;  4C92 A;  3OYF A;  2KQW A;  4PL6 A;  5J26 A;  2ZPH B;  4EDU A;  4ZN1 A;  3LLR A;  3OYJ A;  5CK9 A;  2P4T A;  2O4X B;  2XD0 A;  3X25 B;  5GAM h;  1VQN A;  3OS1 A;  4C0Z A;  3OYH A;  4J6X A;  2AHJ B;  3CCS A;  5GAO q;  1Y07 A;  1KD1 C;  3RKY A;  2L3R A;  3SB2 A;  2XID A;  3OYC A;  2DIG A;  3CBP A;  3GPL A;  1VQK T;  4HCZ A;  2RD1 A;  5I2M A;  2EAY A;  2FVU A;  2P0Q A;  4JUV A;  5KE2 A;  1FXX A;  2LX9 A;  2NLU A;  1G3T A;  5GAN 4;  4M7D D;  1YIT T;  3CCU A;  1V29 B;  2QQA A;  2JUF A;  4JLI A;  4PJO F;  2MF2 A;  4PNO A;  4D6W A;  3OYL A;  4UC4 A;  5LJ3 j;  1NJI U;  3ASK A;  2RI5 A;  3TCJ A;  3CME T;  2LRQ A;  2XDP A;  3MO8 A;  3VUB A;  5KCO A;  2EWN A;  3UWN A;  3GNG A;  2MWO A;  2FHD A;  5CKD A;  3OSS C;  4N0A A;  4OP0 A;  3QXE B;  2JN0 A;  4MML A;  3FIF A;  3JAM E;  3M9Q A;  4PJO G;  1YJ9 T;  3Q1J A;  1W2B S;  5GAN 6;  2JVV A;  4IUR A;  3KUF A;  3NTH A;  4OGE A;  3P8H A;  3CC7 T;  2XIC A;  1JB0 E;  3JCM h;  1G3W A;  1KHC A;  1MHN A;  2EJ9 A;  1WGS A;  2RHX A;  2XDD A;  3PT9 A;  5CQX A;  3DLM A;  4E7K A;  1VQ5 T;  1FWZ A;  1ZHI A;  3X20 B;  3I56 A;  1YJW T;  2M0O A;  3RIR A;  1H3Z A;  3GOX A;  2VV5 A;  4IUT A;  2HAX A;  3VJP A;  4M7A B;  4ZN3 A;  1JJ2 A;  2HD0 A;  1VQL A;  3A8L B;  2IG0 A;  3UPU A;  3C95 A;  1YJW A;  1K73 C;  4HCB A;  4XAX B;  2VXF A;  3GP8 A;  4C0G A;  3BDL A;  5GAN 3;  2I2L A;  3M58 A;  4M7A E;  2XG8 D;  5LJ3 f;  4FL6 A;  1K73 U;  3JSC A;  5HKC A;  4ZTJ A;  4ZTF A;  5GAN f;  5GAM f;  1VQ7 T;  1VQO T;  1AHJ B;  3OBY A;  1VQM A;  1VQ6 A;  2RB6 A;  2LNV A;  4F7U A;  2XKO C;  2OTJ A;  2K4Y A;  3INZ A;  4DA4 A;  2L5Q A;  3BY7 A;  2R58 A;  3C4S A;  2PUK B;  1KQS S;  3JCM b;  1M5Q 1;  3CCU T;  1YI2 T;  1BIB A;  2KVQ G;  5KE3 A;  5GMK e;  4C92 G;  4LD6 A;  3DLL A;  4M7A A;  3CC2 T;  5CVI A;  3CPF A;  2X4J A;  2RJC A;  3QBY A;  4HCC A;  2EQU A;  4LDW A;  3QHS A;  3L2V A;  3CPW A;  5D6Y A;  2VC8 A;  5GAN j;  1VQ4 T;  1UB4 A;  3FDR A;  4GLK A;  1G3S A;  4F7U E;  5LJ5 g;  2R5M A;  3J81 E;  2E5Q A;  5CCA A;  5IT9 E;  3BDU A;  1B34 A;  5FU6 C;  4JJN K;  4C0F A;  2P0P A;  3UT1 A;  5LJ5 e;  1JRI A;  4BDZ A;  1I8F A;  2C06 A;  3JCM J;  4LD9 K;  3SDZ A;  1NE8 A;  3G4S T;  4M77 G;  4F7U B;  1YCY A;  4BE0 A;  2L8D A;  1VQP A;  1D3B B;  4ZGE B;  1VQL T;  4O6J A;  3QZ5 B;  3OW2 S;  3X26 B;  5GAM j;  1TH7 A;  1G3Y A;  4DQ2 A;  1M8V A;  2V8I A;  2WSF E;  2CZ7 B;  5C6S A;  2G3R A;  4J7I A;  3CCE T;  1UGR B;  5I21 A;  4IUU A;  1K8A C;  4Y91 A;  4MMK A;  4NL3 A;  3ZEH A;  5LL6 S;  1VQ7 A;  3P8B B;  1LOJ A;  2RHY A;  4J6Y A;  1WJQ A;  2XI9 A;  3CXC A;  5CKF A;  4EMH A;  3JB9 J;  3HRS A;  3CBO A;  3FRN A;  3SWN B;  4ZGJ B;  2Y4X A;  2QQS A;  2P0K A;  5I2S A;  2DEQ A;  3E9F A;  4EMG A;  4WF2 A;  1RI0 A;  5GAN 5;  1M9S A;  4J6W A;  2LC4 A;  2OAU A;  2LT1 A;  5GAN d;  3JCM W;  3CCJ A;  5LJ3 h;  2CKK A;  1NPP A;  3FEO A;  4Z02 A;  1KQ1 A;  4M75 C;  5LJ3 d;  3M4G A;  3QPH A;  1HK9 A;  4ME7 A;  3V8L A;  2QQB A;  1Q7Y U;  2E12 A;  5GAO r;  2DK3 A;  5GAM e;  3A8G B;  4XTV A;  5FRM A;  1YBY A;  2VGN A;  3M53 A;  4R56 A;  3CCM A;  2RA2 A;  1JBM A;  2BUD A;  1NZ9 A;  4JRP A;  1P92 A;  3ZBD A;  1B34 B;  3GNF B;  4FT2 A;  5LJ5 j;  2QA4 A;  3JCM V;  3VYG A;  2KY9 A;  2ZPF B;  3M56 A;  3M5A A;  3PNW C;  3LGF A;  3JCM P;  1WJS A;  2LTO A;  3OY9 A;  2E41 A;  3A8O B;  5GAN 7;  1X75 C;  3V8J A;  2FB7 A;  2DXU A;  4KT0 E;  3G6E T;  3CD6 A;  3RER A;  4E47 A;  1QVF S;  2F5T X;  3OS0 A;  4XU3 A;  2DPP B;  4C5I A;  4EPC A;  2X35 A;  1QVG S;  1VQ8 T;  4J7F A;  3SD4 A;  1QP2 A;  4BD3 A;  3QZ9 B;  1U8R A;  2V8K A;  3L2U A;  3RMS A;  3TEE A;  1FX7 A;  2MMP A;  2QQR A;  3PMI A;  4M78 B;  3T9N A;  4KUD K;  2K57 A;  1KD1 U;  5CO7 A;  1N27 A;  1WNL A;  4RMO A;  3CXC S;  3WXM B;  2QA4 T;  3QG1 A;  2BIV A;  1W4S A;  1Y96 B;  1BI1 A;  2KSS A;  2R5A A;  5CQY A;  3OYE A;  1VQ8 A;  1K9M C;  3BW1 A;  1VQ9 A;  3QDR B;  3CBM A;  2LT4 A;  3EAE A;  3VUZ A;  2LQK A;  4C8Q G;  3HRU A;  4CRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...