1Q7YR

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q7yR00
3CC7Q 1VQ7Q 1Q81R 1NJIR 3CCVQ 3G6EQ 1VQ8Q 3CMEQ 3CCLQ 1W2BP 1VQ9Q 1VQ6Q 1QVGP 1VQ5Q 3CCSQ 2QA4Q 1VQLQ 3OW2P 1YJNQ 3CCJQ 1M1KR 1S72Q 2OTJQ 3CCQQ 3G4SQ 3CC4Q 1M90R 1VQOQ 1K8AR 1VQ4Q 1Q82R 1JJ2P 3CCEQ 3I55Q 3CCMQ 1Q7YR 1KQSP 1VQNQ 1YIJQ 1VQMQ 3CCRQ 3I56Q 3CXCP 2QEXQ 1KD1R 1QVFP 1K9MR 3CCUQ 1VQPQ 3CMAQ 3CPWP 1YHQQ 1N8RR 3G71Q 1Q86R 1YJ9Q 1VQKQ 3CC2Q 1YI2Q 2OTLQ 1KC8R 1K73R 1YJWQ 3CD6Q 1YITQ
chains in the Genus database with same CATH superfamily
1NEBA 1OOTA 4HCZA 3CPFA 2EGAA 2D6FA 3OW2P 1AVZC 4PFPA 5LJ3f 4OB3B 4Q5WA 5KCOA 3QZ9B 3VRYA 4F7UB 3OSSC 4RUGA 3JCMX 5GMKi 1UDLA 5KYXA 2KRSA 3EGDB 1OZ2A 1BKBA 2QXFA 1YJWQ 4OB0B 2NLUA 3M5AA 1GFCA 1QWFA 4J8OA 1O75A 1G3TA 2ZPFB 3ZFJA 2EJGA 4LNPA 4D6WA 1BYMA 4XU1A 4N4HA 1AWWA 2C06A 3FJ5A 4E6RA 5GMKm 2IG0A 4E2FB 3G1JA 1UECA 1G3WA 2KE9A 3MP8A 4KH1B 1IHWA 1CSKA 1IZ6A 2H8HA 2XDBA 2EYXA 1NEGA 1VQ8Q 4RG2A 3JB9F 1M9SA 2COZA 3FLGA 4E7SA 4QVDA 3ER0A 3THKA 4PFZA 1Q81C 2AIRB 3PVLA 3VS5A 2K79A 2HBPA 4E7JA 3N5BB 2M16A 4J9IA 5LJ5g 1VQNQ 2M0OA 5A0LA 2RMOA 4J7FA 2JMCA 1R0BG 2DETA 1KK7A 3M53A 4X9CA 1R8OB 5D6YA 1FMWA 1UGPB 1VQ9Q 4QVZA 8ATCB 5A0GA 1IGUA 2M1HA 3FB9A 4HVVA 2DJZA 3QHSA 2LT4A 3OW2S 5I11A 5IXFA 1ZUUA 3S3MA 2J7IA 2EJFA 5FRNA 3WVDB 3L2QA 5IXBA 1IREB 3EG1A 3CD6T 1Q81R 5GANj 3HP9A 1QKXA 3CCMA 3CCJQ 2GFUA 2V26A 2X4YA 4PJNA 1LVKA 2JUFA 2LQWA 3OMGA 3LH5A 2EAYA 2DTOA 2D8HA 3CCMT 2EPDA 3VS3A 4C92D 5IHKA 4HKEA 2XI9A 3HSBA 3I5SA 1KD1C 1JXMA 1FXXA 2NUZA 3QIIA 1Y7XA 2HNIA 2O9SA 4M77E 3BE3A 2VWFA 4Z89A 3CC4A 1BI1A 3UA7A 1VQ5Q 3JRZA 3CCSQ 3HTRA 2JVVA 3A5ZB 3CC4T 4LE9A 2XK0A 5AT1B 4XU2A 2B86A 2FPDA 1QMCA 1RLPC 3PMTA 4UC4A 1VQKQ 1UG1A 1I0CA 3VS0A 2EFIA 3EFRA 4M77B 3CQTA 3I5RA 4M77C 2CYZB 3CMEQ 1Q81U 2FHDA 1VQ8T 4E7IA 1MMGA 2RH2A 5GAOr 2DAQA 2RQVA 4IKFA 5IHNA 5CKHA 5FWCA 1RLQC 1W2BS 2R5MA 3ZEHA 4LDWA 1KD1R 2LX7A 4ZTJA 4J9CA 4R0KA 1X2KA 4JRIA 2A3LA 2CGHA 3H0FA 2JJ9A 3KFVA 3A1PA 1WLPB 3E9GA 1KSWA 2CUBA 4NL2A 1VQ9A 2QK0A 3VUBA 1YJNA 2WSEE 3JCMe 4Z8AA 4M7AE 1M3CA 1R77A 2COYA 1MGQA 2F1LA 3OYHA 2JMAA 1VQ9T 1OEBA 2X9HA 2QEXA 2YRCA 1BCMA 3FC3A 1TUCA 5LJ5f 3ASKA 2A7YA 1GCQC 3M0SA 2QEXT 2X35A 2YUNA 4HCCA 1KHCA 2BKDN 1GBRA 4BE0A 1OU9A 3ULRB 2FB7A 2KMTA 4M7AB 4C8QA 4M7AC 3RMQA 1X01A 3HRSA 2P4TA 4LD6A 1QCFA 4A4FA 1PD1A 3I55Q 2EQJA 3P8HA 3GOXA 3DB3A 3M4GA 1KD1U 4A4EA 1VQ5A 1Y0MA 4ZGJB 4M7DG 3KXTA 4WTOB 1ABQA 3C94A 5GAN8 1VQ5T 3UATA 2OTJQ 2LVMA 1WFWA 1RAHB 3EH2A 5GAMg 2J06A 2KBTA 1H641 2RJDA 3CCEQ 2ENMA 1R0CB 1OPKA 3VS4A 2PUKB 1PCXA 1JBMA 3QG1A 3MP1A 1M4ZA 1MMNA 2QASA 1WJQA 4EPCA 1M8VA 2KVQG 2PVGB 1D1BA 2XICA 3M55A 4KULA 2HEQA 4QVCA 2F2XA 1VQ4Q 2LMJA 5LJ5e 3I56Q 1YHQQ 2A08A 2YHTA 1VQ6A 3V7RA 4OMMA 3V8KA 1RUWA 1TS9A 3OY9A 5GAOp 2H3EB 2MCNA 1NBEB 1V1CA 1M90C 1VQ6T 4M78E 4A4GA 2EYWA 2R5AA 3CCUA 1TOVA 2HL3A 2SEMA 1WGSA 2E1HA 1VQ7A 1PSFA 5HY6A 3J80E 3EGXB 1B34B 3CCVQ 4CRIA 2ZCFB 4M77D 4M78B 2ZPGB 4M78C 4FSXA 7AT1B 3QWYA 2MF2A 2RN8A 2JS0A 3OYAA 4F17A 3H0HA 3RKWA 4DOWA 4HT9A 1QVPA 2FPFA 1YCSB 5CKDA 1KG1A 1HSQA 4J6WA 2OX7A 3L2VA 1NPPA 2QA4Q 2I0NA 3CCQQ 4ATOA 2PVOB 1NJIC 5GMKh 1YCYA 2CP0A 1G3SA 2D8JA 3OYKA 2HMAA 2ZPBB 3CMAQ 1X6OA 3EG2A 4J9HA 1SSFA 3P8BB 3PTAA 3SD4A 2KRMA 4OVAA 3QZ5B 1AWOA 1NLOC 3OBWA 5GANf 3V8LA 1VQ4A 1LCKA 1G2BA 2RI5A 4ELYC 4PJOG 1ZSZA 3EG9B 5GAMf 1B7TA 1RL2A 3QSUA 1VQ4T 3CXCP 9ATCB 3X25B 1VQPQ 2C0OA 1X6BA 2GQIA 1YHQT 2EVRA 2KAFA 5GAN5 2RJCA 3MP6A 2HZYA 3TCJA 1PC0A 2CDTA 2RA2A 3ZBDA 2JT4A 1VIEA 2M51A 2AZVA 1M1KC 2CT4A 2IIMA 2WSCE 3RNJA 1Y96B 2YUOA 2YWWA 4ORZA 1XTDA 3LGLA 3EFOB 2DX1A 2XU8A 3EG0A 5GAOn 1UB4A 1NG2A 1YITQ 4QQDA 3C0CA 1P92A 1Z9QA 4F7UG 4AG2C 5DM7R 3GLXA 3CBOA 3CCVT 2W10A 1W4SA 4NL3A 2L89A 4XTUA 1W2BA 5GAOl 3INZA 2DXUA 1GBQA 5LJ3g 2QG9B 2DL7A 3HL8A 1WNLA 3PIPA 3UF4A 4O6JA 1RAAB 2QQRA 4RTVA 4J7IA 1XJWB 2MIOA 3SB2A 2K7AA 4RTYA 2QQAA 2LCSA 2O01E 5CQYA 4II1A 3M54A 1BI0A 1M1KR 1YIJA 2NYSA 2FYKA 2H3JA 4M7DF 2E4HA 2RJEA 1DJ7B 2BE7D 2EIFA 5GAMe 3CCQT 3SWNA 1PD0A 4VUBA 1A0NB 3QXEB 5FU7B 3CC2A 5FU7C 1OULA 5DLOA 3BFMA 4BDYA 5CO7A 3HFOA 2MI6A 4DBQA 1PWTA 4D8DA 3CC2T 3CXCS 2OI3A 1KFZA 1C1AA 1UEBA 3CCLQ 3JV3A 5KYYB 2DZCA 2MWPA 4M7DA 3PT9A 3JCMV 1E7OA 2PZ1A 2MMPA 2K4YA 1Q7YC 3ZL7C 1VYTA 2DXTA 3WXMB 3OA6A 2DYBA 2L8DA 4PL6A 3NPFA 2AKLA 3SHWA 4FYYB 3TREA 2RHUA 2O31A 2LQ8A 1PRMC 2JTFA 2XHCA 5CIUA 3SFMA 1BI2A 2XKOC 3REAB 1NYFA 4C92B 1U1SA 4MZTA 2ATCB 2CZ7B 2HDAA 1RAGB 1GL5A 1UGSB 1AWXA 3JCMd 2LRQA 3MPUB 2ESWA 2O4XB 3G7ZA 5GAOm 2DYIA 2WACA 1WDXA 4J6XA 1WI7A 3KBGA 1WPYA 3VUZA 2GTJA 3FIFA 4P5NA 2RQTA 2EQUA 1JJ2P 1Q7YR 1UE9A 4AMCA 4E47A 5HCKA 1IGQA 1EIFA 3I9QA 1EX4A 2DL8A 2GCXA 1I8FA 1AZGB 3OS2A 1VUBA 1RADB 1RI0A 2HKQB 2KXCA 3JCMW 1M8MA 3CPWS 3MJXA 5M9OA 4ZGDB 2FO0A 2L0AA 5GMKj 3VS2A 2X3WD 1MNEA 1JRIA 1UGQB 4F14A 3CCMQ 4M77G 1KQSP 1ZQ1A 2L3QA 4N0AA 5KYNA 4JLGA 4FSSA 4PJLA 3V7SA 4GLKA 2P0KA 3CCLA 1D0ZA 2HCKA 3P8DA 4XK8E 1AEYA 1KQ1A 5GJVB 3NTKA 2KQWA 2YDLA 4LDYA 1QVGP 1UFFA 2BZXA 1SG5A 1QLYA 3CCLT 3LH0A 3G4SQ 1X27A 3CC4Q 1G3YA 1PM3A 3L1AA 2A37A 2FRWA 3G71A 4JDSA 1D3BA 1EFNA 2OTLA 1Q7YU 1F1BB 4PJOF 3X28B 3M56A 4CI0C 3G71T 2DE0X 2OTLT 4OB2B 2PUOB 3VU3C 2QQ9A 4BE1A 2MOXA 2E10A 5FROA 5LJ5d 4C92A 1BI3A 5DLQE 1HJDA 2FVUA 2JS2A 4M7AG 2O4XA 4PJOA 1AOJA 2D1XA 1JJ2S 2NUTB 1W70A 2DNUA 2P0QA 2JXBA 2HSEB 1YJNQ 4TVRA 5AYFA 4F7UF 4AG1C 3OQ5A 3PIOA 2E65A 5LJ3e 1AZEA 3JB9H 3RKXA 3OYIA 2QEXQ 4FIBA 4KUIA 2RK1A 1SRMA 5I2MA 2PU9B 1KQSS 3OYNA 3E9FA 2XMFA 2K2MA 3EFSA 4PJJA 4F7UA 3GBQA 3MEWA 1VQOQ 1K8AU 2SRCA 2K6DA 1QVGS 2DL3A 3VV0A 3EGDA 2F2WA 4B9XA 2CSIA 1ZX6A 4Z02A 3D7SB 3BW1A 2MPXC 1V29B 1XNIA 2WSFE 3G4SA 4EMGA 1WHLA 1W6XA 4Y91A 1O9SA 3HRTA 3LX7A 4IIMA 5CKEA 5L8RE 3QYHB 3G4ST 2ZPEB 1MNDA 1BB9A 5L23A 4KGVB 4PLIA 4JJBA 3QUIA 3S6WA 4A4KA 5I22A 2KEAA 1H3ZA 1RAIB 1KJWA 3OS5A 1OX9A 1KQ2A 1VQLA 2VVKA 1VYUA 1PSEA 1MMDA 4OMPA 1VQMA 1VQLT 2KY9A 2EKHA 3LYIA 3PFSA 3JB9D 3OMCA 3DLLA 2NUTA 1VQMT 2HQXA 4XQ3A 4XTWA 3RIRA 1OV3A 1Z9ZA 4M78G 3PE0A 1WJRA 1K73R 1IB8A 1WXUA 2P84A 1VQ6Q 2XIDA 2K2VA 4KRTA 4C8QF 3QYGB 2LJ0A 1N9SA 4C5EA 1YJNT 2YT6A 3U23A 3CEYA 3REBB 4JJDA 1TWBA 1QVFP 1B07A 3PGGA 3CCUQ 3GF5A 3C4SA 3JCMh 5D6XA 3EAEA 2K3YA 3HPWA 1U06A 1Y71A 5FW9A 1M3BA 4OMOA 2QTVA 3JB9J 2FRYA 4BI3A 1VQ7Q 2V1RA 2YUPA 4C5HA 1VQOA 2EW3A 1PNJA 2V8IA 2M0YA 2X4XA 2DMOA 3RDVA 4F16A 2RB6A 1VQOT 4A4HA 2O88A 4Z88A 3SEMA 2EYYA 3META 2KT1A 2CT3A 3L2UA 4M77F 1Q86R 3O5ZA 2VV5A 1JQQA 4AFQC 1K73U 1VYVA 5GAMd 4EMKB 4EMKC 4JRKA 5GANg 1AHJB 1OQKA 2LCLA 3I35A 1WQWA 3O8VA 3DLMA 2CUDA 3NHNA 1QP2A 1WHHA 2B8AA 3M4YA 1OU8A 2DEUA 1I5LA 2K3BA 4JS4A 2FZGB 4M77A 1E6GA 4J83A 4LDVA 2EKOA 1WHKA 4EIKA 3CPWA 5ECAA 4FYVB 3BY7A 1ZA1B 3OYBA 1Y07A 3RERA 4FU6A 1AT1B 4R56A 2P0PA 2EQKA 5KYUB 1WYXA 3Q1JA 5KYWB 2DZ9A 4MDXA 5CR2A 2E6ZA 1TG0A 4RCCA 1GFDA 4RMOA 2X3XD 4M7AF 1JXOA 1QVFS 4KH0B 1Q86U 1FMVA 4OMFB 2J05A 3V8JA 1GCQA 1BU1A 2F5TX 1SF9A 4HCBA 2BZ8A 2BE9B 2A0FB 3DB4A 2JW4A 4J9GA 4F04B 2F2VA 3LLRA 3CCUT 4M7AA 3L42A 1XOVA 1YN8A 3JCMb 2KROA 2DL5A 1D0YA 1WHMA 1M2VB 4XTYA 1VQ7T 4J6YA 3JCMQ 2CKKA 2L3RA 1AWJA 3M0PA 3X20B 4A54A 5C6SA 4CC4B 4JJCA 2V1QA 2Y4XA 1YWPA 1RACB 2CP2A 1WQ7A 4J9FA 5FWBA 5KE2A 1WJSA 3CBPA 3TSWA 2JN0A 3QDFA 5GJWB 2A28A 4M75E 3OW2A 1W1FA 3RESA 4DBFA 1YIJQ 1ZSGA 4GBQA 4RTWA 1YI2A 3TQ7P 3MCAB 2EYQA 3EG3A 4JS5A 1YBYA 2JM8A 3CC2Q 3OYCA 1SHGA 3H6ZA 4M4ZA 3FRNA 1M5Q1 4C92G 1I4K1 1IO6A 4RCBA 4C0FA 1T0JA 5IH2A 1I1JA 8AT1B 3VS7A 3FJPA 3M0TA 1HK9A 3GPLA 4M75B 2ABLA 4M75C 4MZPA 2K5LA 4XAXB 1K9AA 3AHUA 2DO3A 2RQWA 4ZGEB 4N4GA 2HKNA 4M78F 2J6FA 2JTEA 3QWXX 4LXCA 2E3HA 2NUPB 4AFSC 1UGVA 5HK3A 2KRNA 3X24B 2DM1A 3M9QA 3UT1A 4EDUA 4QQGA 4HXJA 1YJ9A 2VB6A 2EQMA 4C0ZA 4XU3A 2CS7A 4LDUA 4JLIA 1GCPA 2R58A 3EGXA 1B34A 1SEMA 3G6EA 3J7AF 4DBRA 5FU6B 2DF6A 2RF0A 3UPUA 5FU6C 3H0IA 1YJ9T 2D0NA 4M78A 4PJMA 3G6ET 5LJ3d 1ZBXA 6AT1B 4LDXA 4EMHA 1M3AA 1NLPC 4FT4A 4IURA 5GAOq 4FW1A 3OS1A 1QCOA 1FX7A 4DA4A 2LTOA 3A8OB 2RD1A 2Y4YA 2O2OA 3R6OA 1QW1A 4XTZA 3CBMA 4QQ6A 1MUZA 1TH7A 1X2QA 2JM9A 2EGEA 2LQKA 4WF2A 1U5SA 2DRMA 3JB9I 3HRUA 5GANe 2DILA 2W0ZA 1ZHIA 3WVEB 1WIEA 1YIJT 5CKFA 3CC7A 1D1AA 4IUTA 2DIQA 3NGPA 2EQIA 2LNVA 4DQ2A 1X69A 3CC7T 2YLBA 1B3QA 3V7CA 3EG9A 3OBYA 5GAMh 2MK5A 1I81A 2RM4A 3QPHA 2HBWA 2DERA 1U1TA 2VC8A 1WHJA 3A8MB 3OYDA 1NYGA 5FRMA 1QKWA 2ED1A 2DJQA 3G71Q 4E7LA 2LT1A 2NUPA 1T0HA 4FL6A 2OTLQ 4N4IA 2QDYB 1TU0B 5KYXB 2F5KA 2MWOA 3TSZA 5CQXA 2JZ2A 2DXCA 1Y96A 5LJ5j 3HKSA 3NMZC 2CZ6B 3JAME 3EFOA 2DPPB 3R6NA 1SHFA 2J6KA 4DEYA 1H3HA 4MMKA 1YFNA 4PLLA 1S72A 3E19A 2HSPA 3GNGA 2GFAA 2DD5A 2GTOA 1NPRA 2LNHB 1S72T 4QT7A 2YXYA 4OMLA 4D8KA 2KDSA 4GLMA 4M75D 3JCMJ 3S3OA 3FEOA 3A8GB 3PNWC 2DBKA 4PJOC 1K0XA 2FG0A 4JJNK 1RABB 1K4US 2CZ1B 5CK9A 2ZZDA 4B6MA 2VGNA 3HHTB 2AZSA 2PVDB 1UUEA 2VUBA 2GGRA 1VA7A 1RAEB 2RO0A 2HQEA 1H92A 1K8AC 1PRLC 4M7DD 2F69A 2J6OA 5KCHA 5KYYA 1N27A 3OYGA 3T9NA 5J3BA 1JU5C 5IAYA 2I2LA 1BBZA 3URGA 5CAIA 3MEUA 4CC7A 5CVIA 2RQUA 3UWNA 4C92F 2AT1B 4JZ3A 1MV3A 2BUDA 2LQNA 1NZ9A 1MHNA 4B9WA 2VYTA 4PNOA 2QDLA 1WXBA 2VASA 1FYNA 4PK4A 4BDZA 2RHXA 1PKSA 2LDMA 1ZLMA 1GRIA 1ZA2B 1G5VA 5A2QE 2E3IA 2C0IA 5GAN2 5HK0A 1VQLQ 4K11A 4BB7A 1K8AR 4C0GA 1VQMQ 1HYOA 1YP5A 1ZUYA 1SSHA 4RG8A 1RI9A 4IUVA 4RTTA 4YTLA 2DTIA 5CKBA 2K5IA 2EGCA 1N8RC 2RI2A 4FYWB 1KC8U 3SDZA 3HFNA 3UDCA 3EH1A 4FT2A 1ZUKA 4X9DA 1UHFA 2CP6A 2ZPHB 2KYMA 4BUGA 1PHTA 4QW2A 3JCMP 2LZ6B 1QCNA 1WZOA 1OPLA 2MAMA 3AT1B 3FDRA 2XD0A 1FWZA 4MMLA 2YRDA 3IQLA 2NWMA 1W2BP 1K76A 4J9DA 2KSSA 3L2WA 5LJ3h 5FLXE 4C8QE 5LL6S 3S3NA 4R55A 1Q95G 4C0DB 2QGGA 2VGMA 4IUPA 4C0DC 3CD6A 2GF7A 1N8RR 3OYLA 2QQBA 2ZPIB 3GNFB 2AK5A 5IN1A 4OP0A 2E12A 3JCMf 5GAN4 3NTIA 1BIAA 2O9VA 1T3LA 1AD5A 2HD0A 2PNIA 4RTUA 1K73C 5GAMj 5A0DA 4KUDK 3GP8A 2ZGWA 4C8QB 1D0XA 4C8QC 1LPLA 2KK4A 1BCOA 3PMIA 3OB9A 1YJWA 3QBYA 1H8KA 4ME7A 1GXIE 1TSFA 1ABOA 1YJWT 4PJOD 1VOMA 3GIBA 3VYGA 1LOJA 1D1CA 2CP7A 2HQHA 1EZZB 1X6GA 3F70A 2X51A 1UJ0A 2Z0WA 1X43A 2M9UA 4KGZB 3OYYA 2DRKA 1Y57A 2BIVA 2LX9A 2KR3A 1K1ZA 4FYXB 2AKKA 4HVUA 1N8RU 1VQ8A 1T3SA 2HL5C 3CXCA 3VS1A 1K9MC 2L3PA 2CH4A 5IHIA 3H9NA 4WCIA 2FEIA 1Q86C 3BDUA 1MMAA 3EHRA 1VQNA 2RI3A 4A53A 2OJ2A 2RJFA 3VYHB 4V2SA 1JB0E 1VQNT 1QQJA 2DBMA 5J26A 3LWHA 4JRPA 3H8ZA 2G3RA 1M30A 4HA8A 2L2PA 3C95A 3L2RA 4JZ4A 3L2ZA 5EC7A 3M0UA 5KH6A 2E5KA 1G83A 2D0QB 2IVWA 2YUQA 4Y92A 1N5ZA 3QJ6A 2K57A 2LP5A 2BZYA 4LUDA 2HAXA 2EBPA 2E6NA 3A98A 1K9MR 4A63B 2V8JA 5IT9E 1QWEA 3QKJA 5GANd 4M75G 1CKAA 2CSQA 3CCJA 4Y28E 3J81E 2GBQA 4OMQA 2JOYA 4J9EA 3CCJT 1WHGA 1OZ3A 4PKCC 2K3XA 3MEAA 1IHVA 1C6VX 4DEXA 1U8RA 2LJ3A 4E7ZA 3NFCA 4JRQA 1WX6A 2CP5A 3LW5E 2QI2A 4QKUA 2DKGA 1U3OA 3CCSA 1N6AA 1YI2Q 2X4JA 2OAUA 4HVWA 1SPKA 2QTXA 4CC3A 2MYSA 3CCST 1IRXA 2R57A 2DL4A 1YNZA 1G8XA 3LWIA 4XTVA 4ZTFA 5GAN3 5GAN6 1VQKA 2KXDA 5C0MA 2L5QA 1K9MU 2BTTA 2ECZA 4RTZA 3CMEA 1VQKT 2CP3A 2EWNA 1M1GA 3M57A 3VRZA 3CMET 2E64A 5LJ5h 2DIGA 5KE3A 2PQWA 1UTIA 3OYEA 3A8HB 4C8QD 2ED0A 1LNXA 1ZSZB 1J3TA 1ZSZC 3MKDA 2GQVA 4BI8B 1D09B 1YJ9Q 2Y90A 4E7KA 1YWOA 4J9BA 3OYJA 2CH4W 3G6EQ 5J39A 2RHYA 2COWA 3OYFA 2QGFB 5LJ3j 2VXEA 4O5VA 3E2UA 4XTXA 1JJ2A 2FPEA 4EMKA 3DKMA 2PTKA 3TVTA 1OI1A 4LD9K 3M0RA 1NE8A 3I55A 3LGFA 2XDDA 4ZN1A 2DK3A 2RNAA 1HD3A 4E7HA 3I55T 4NOYA 5GMKe 4XU0A 3TEEA 4BE2A 2GNCA 1KQSA 2RK2A 4FW2A 1KHIA 1M90R 1OYXA 3RR6A 3CC7Q 2DVEA 1YI2T 3M58A 2OTJA 3VKIA 4X34A 5KYUA 1LJOA 4X1VA 2FZKB 5KYWA 3C12A 3CCEA 2KT8A 2OAWA 2V8KA 4J5YA 5D6WA 2OTJT 4BD3A 1QVGA 2C0TA 2EJ9A 3E1SA 4M7DE 3CCET 2VXFA 4CC2A 3SWNB 1JEGA 1K0SA 3SWNC 3RBBB 2JTMA 2LC4A 1SRLA 1WA7A 2L3SA 4OB1B 1PKTA 1VIFA 1MV0B 3VS6A 3EGUA 4M7AD 2YLCA 3M0QA 3I56A 4BACA 4AFZC 1BIBA 2JNGA 1YHQA 2M02A 5I21A 2K5FA 3EHQA 4M7DB 4M7DC 3CCRQ 3JCMc 3I56T 3JB9G 4ZN3A 1M2VA 1N9RA 4C5GA 1UJYA 2VKNA 4ESRA 1NJIR 1M90U 2EYZA 1SKUB 4AFUC 4AT1B 1S72Q 2RQRA 3VJPA 5I2SA 4OF1A 1I07A 3OS0A 3QO3A 2D9TA 1ARKA 2ROLA 2YRVA 1Q82C 4JPBW 4NS5A 2DA9A 2FL7A 4L59A 3CCVA 2FZCB 3A8LB 2DTHA 2KI7A 4IIOA 1BK2A 2KYBA 4DOVA 2XDPA 1TXQA 3QDRB 1S1NA 3RKYA 1XQHA 4JUVA 4MDWA 3RMSA 4M75F 2A36A 1KIKA 2ZAEA 3NTHA 3UA6A 2QQSA 4IUQA 4HCKA 4IUUA 1OX8A 2DEQA 4C5IA 3MO8A 2AHJB 4OGCA 2E70A 3RUXA 2QYZA 2QA4A 3ME9A 3KUFA 5GANh 3CCQA 2ROTA 1HXDA 1PG5B 1NJIU 1V76A 4M75A 4OMNA 2QA4T 5D7UA 2E5QA 1Q82R 3CMAA 4FM4B 2DD4A 2IPOB 3PVQA 2CZ0B 4LUEA 4FCYA 1C0MA 4GY5A 1UHCA 5HKCA 4KBMB 1X75C 3CPWP 3CMAT 1CKBA 4N0AC 3MEVA 3MHXA 1I5OB 3X26B 2XG8D 2KGTA 2QAZA 1WXTA 2P4RA 1ACMB 3BDLA 4M78D 3CCRA 1VQPA 4C92E 2DVJA 3TU4K 4ANJA 3OYMA 3CCRT 1VQPT 4L6V5 4BI4A 1D3BB 3JSCA 4PJOE 4RTXA 4BY6B 1TUDA 4BY6C 2E41A 5GMKl 1RAFB 1KC8C 2RHZA 1QP3A 5GAN7 2RHIA 1E6HA 2G6FX 2CREA 2LCCA 1M1KU 3M59A 5EG2A 3OSVA 4KT0E 4C92C 1Q82U 5DY9A 2RPNA 1YITA 1IXDA 1TUGB 4C8QG 1QVFA 3QJYA 4PJOB 1M2OA 4KGXB 3JCMg 1YITT 1UGRB 2YSQA 2LJ1A 1M27C 2DFUA 3H41A 4DBHA 2DLPA 2X4WA 4MZMA 1M1FA 4HT8A 2K9GA 4L5GA 4ZNXA 4F7UE 4OGEA 2KNBB 4ELZC 4RKUE 1JO8A 1FMKA 5CCAA 4PFOA 2DXBA 1NM7A 1TTHB 1KC8R 3CD6Q 4LN2A 1ZBJA
chains in the Genus database with same CATH topology
3CC7Q 1VQ7Q 1Q81R 1NJIR 3CCVQ 3G6EQ 1VQ8Q 3CMEQ 3CCLQ 1W2BP 1VQ9Q 1VQ6Q 1QVGP 1VQ5Q 3CCSQ 2QA4Q 1VQLQ 3OW2P 1YJNQ 3CCJQ 1M1KR 1S72Q 2OTJQ 3CCQQ 3G4SQ 3CC4Q 1M90R 1VQOQ 1K8AR 1VQ4Q 1Q82R 1JJ2P 3CCEQ 3I55Q 3CCMQ 1Q7YR 1KQSP 1VQNQ 1YIJQ 1VQMQ 3CCRQ 3I56Q 3CXCP 2QEXQ 1KD1R 1QVFP 1K9MR 3CCUQ 1VQPQ 3CMAQ 3CPWP 1YHQQ 1N8RR 3G71Q 1Q86R 1YJ9Q 1VQKQ 3CC2Q 1YI2Q 2OTLQ 1KC8R 1K73R 1YJWQ 3CD6Q 1YITQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 Q;  1VQ7 Q;  1Q81 R;  1NJI R;  3CCV Q;  3G6E Q;  1VQ8 Q;  3CME Q;  3CCL Q;  1W2B P;  1VQ9 Q;  1VQ6 Q;  1QVG P;  1VQ5 Q;  3CCS Q;  2QA4 Q;  1VQL Q;  3OW2 P;  1YJN Q;  3CCJ Q;  1M1K R;  1S72 Q;  2OTJ Q;  3CCQ Q;  3G4S Q;  3CC4 Q;  1M90 R;  1VQO Q;  1K8A R;  1VQ4 Q;  1Q82 R;  1JJ2 P;  3CCE Q;  3I55 Q;  3CCM Q;  1Q7Y R;  1KQS P;  1VQN Q;  1YIJ Q;  1VQM Q;  3CCR Q;  3I56 Q;  3CXC P;  2QEX Q;  1KD1 R;  1QVF P;  1K9M R;  3CCU Q;  1VQP Q;  3CMA Q;  3CPW P;  1YHQ Q;  1N8R R;  3G71 Q;  1Q86 R;  1YJ9 Q;  1VQK Q;  3CC2 Q;  1YI2 Q;  2OTL Q;  1KC8 R;  1K73 R;  1YJW Q;  3CD6 Q;  1YIT Q; 
#chains in the Genus database with same CATH topology
 1NEB A;  1OOT A;  4HCZ A;  3CPF A;  2EGA A;  2D6F A;  3OW2 P;  1AVZ C;  4PFP A;  5LJ3 f;  4OB3 B;  4Q5W A;  5KCO A;  3QZ9 B;  3VRY A;  4F7U B;  3OSS C;  4RUG A;  3JCM X;  5GMK i;  1UDL A;  5KYX A;  2KRS A;  3EGD B;  1OZ2 A;  1BKB A;  2QXF A;  1YJW Q;  4OB0 B;  2NLU A;  3M5A A;  1GFC A;  1QWF A;  4J8O A;  1O75 A;  1G3T A;  2ZPF B;  3ZFJ A;  2EJG A;  4LNP A;  4D6W A;  1BYM A;  4XU1 A;  4N4H A;  1AWW A;  2C06 A;  3FJ5 A;  4E6R A;  5GMK m;  2IG0 A;  4E2F B;  3G1J A;  1UEC A;  1G3W A;  2KE9 A;  3MP8 A;  4KH1 B;  1IHW A;  1CSK A;  1IZ6 A;  2H8H A;  2XDB A;  2EYX A;  1NEG A;  1VQ8 Q;  4RG2 A;  3JB9 F;  1M9S A;  2COZ A;  3FLG A;  4E7S A;  4QVD A;  3ER0 A;  3THK A;  4PFZ A;  1Q81 C;  2AIR B;  3PVL A;  3VS5 A;  2K79 A;  2HBP A;  4E7J A;  3N5B B;  2M16 A;  4J9I A;  5LJ5 g;  1VQN Q;  2M0O A;  5A0L A;  2RMO A;  4J7F A;  2JMC A;  1R0B G;  2DET A;  1KK7 A;  3M53 A;  4X9C A;  1R8O B;  5D6Y A;  1FMW A;  1UGP B;  1VQ9 Q;  4QVZ A;  8ATC B;  5A0G A;  1IGU A;  2M1H A;  3FB9 A;  4HVV A;  2DJZ A;  3QHS A;  2LT4 A;  3OW2 S;  5I11 A;  5IXF A;  1ZUU A;  3S3M A;  2J7I A;  2EJF A;  5FRN A;  3WVD B;  3L2Q A;  5IXB A;  1IRE B;  3EG1 A;  3CD6 T;  1Q81 R;  5GAN j;  3HP9 A;  1QKX A;  3CCM A;  3CCJ Q;  2GFU A;  2V26 A;  2X4Y A;  4PJN A;  1LVK A;  2JUF A;  2LQW A;  3OMG A;  3LH5 A;  2EAY A;  2DTO A;  2D8H A;  3CCM T;  2EPD A;  3VS3 A;  4C92 D;  5IHK A;  4HKE A;  2XI9 A;  3HSB A;  3I5S A;  1KD1 C;  1JXM A;  1FXX A;  2NUZ A;  3QII A;  1Y7X A;  2HNI A;  2O9S A;  4M77 E;  3BE3 A;  2VWF A;  4Z89 A;  3CC4 A;  1BI1 A;  3UA7 A;  1VQ5 Q;  3JRZ A;  3CCS Q;  3HTR A;  2JVV A;  3A5Z B;  3CC4 T;  4LE9 A;  2XK0 A;  5AT1 B;  4XU2 A;  2B86 A;  2FPD A;  1QMC A;  1RLP C;  3PMT A;  4UC4 A;  1VQK Q;  1UG1 A;  1I0C A;  3VS0 A;  2EFI A;  3EFR A;  4M77 B;  3CQT A;  3I5R A;  4M77 C;  2CYZ B;  3CME Q;  1Q81 U;  2FHD A;  1VQ8 T;  4E7I A;  1MMG A;  2RH2 A;  5GAO r;  2DAQ A;  2RQV A;  4IKF A;  5IHN A;  5CKH A;  5FWC A;  1RLQ C;  1W2B S;  2R5M A;  3ZEH A;  4LDW A;  1KD1 R;  2LX7 A;  4ZTJ A;  4J9C A;  4R0K A;  1X2K A;  4JRI A;  2A3L A;  2CGH A;  3H0F A;  2JJ9 A;  3KFV A;  3A1P A;  1WLP B;  3E9G A;  1KSW A;  2CUB A;  4NL2 A;  1VQ9 A;  2QK0 A;  3VUB A;  1YJN A;  2WSE E;  3JCM e;  4Z8A A;  4M7A E;  1M3C A;  1R77 A;  2COY A;  1MGQ A;  2F1L A;  3OYH A;  2JMA A;  1VQ9 T;  1OEB A;  2X9H A;  2QEX A;  2YRC A;  1BCM A;  3FC3 A;  1TUC A;  5LJ5 f;  3ASK A;  2A7Y A;  1GCQ C;  3M0S A;  2QEX T;  2X35 A;  2YUN A;  4HCC A;  1KHC A;  2BKD N;  1GBR A;  4BE0 A;  1OU9 A;  3ULR B;  2FB7 A;  2KMT A;  4M7A B;  4C8Q A;  4M7A C;  3RMQ A;  1X01 A;  3HRS A;  2P4T A;  4LD6 A;  1QCF A;  4A4F A;  1PD1 A;  3I55 Q;  2EQJ A;  3P8H A;  3GOX A;  3DB3 A;  3M4G A;  1KD1 U;  4A4E A;  1VQ5 A;  1Y0M A;  4ZGJ B;  4M7D G;  3KXT A;  4WTO B;  1ABQ A;  3C94 A;  5GAN 8;  1VQ5 T;  3UAT A;  2OTJ Q;  2LVM A;  1WFW A;  1RAH B;  3EH2 A;  5GAM g;  2J06 A;  2KBT A;  1H64 1;  2RJD A;  3CCE Q;  2ENM A;  1R0C B;  1OPK A;  3VS4 A;  2PUK B;  1PCX A;  1JBM A;  3QG1 A;  3MP1 A;  1M4Z A;  1MMN A;  2QAS A;  1WJQ A;  4EPC A;  1M8V A;  2KVQ G;  2PVG B;  1D1B A;  2XIC A;  3M55 A;  4KUL A;  2HEQ A;  4QVC A;  2F2X A;  1VQ4 Q;  2LMJ A;  5LJ5 e;  3I56 Q;  1YHQ Q;  2A08 A;  2YHT A;  1VQ6 A;  3V7R A;  4OMM A;  3V8K A;  1RUW A;  1TS9 A;  3OY9 A;  5GAO p;  2H3E B;  2MCN A;  1NBE B;  1V1C A;  1M90 C;  1VQ6 T;  4M78 E;  4A4G A;  2EYW A;  2R5A A;  3CCU A;  1TOV A;  2HL3 A;  2SEM A;  1WGS A;  2E1H A;  1VQ7 A;  1PSF A;  5HY6 A;  3J80 E;  3EGX B;  1B34 B;  3CCV Q;  4CRI A;  2ZCF B;  4M77 D;  4M78 B;  2ZPG B;  4M78 C;  4FSX A;  7AT1 B;  3QWY A;  2MF2 A;  2RN8 A;  2JS0 A;  3OYA A;  4F17 A;  3H0H A;  3RKW A;  4DOW A;  4HT9 A;  1QVP A;  2FPF A;  1YCS B;  5CKD A;  1KG1 A;  1HSQ A;  4J6W A;  2OX7 A;  3L2V A;  1NPP A;  2QA4 Q;  2I0N A;  3CCQ Q;  4ATO A;  2PVO B;  1NJI C;  5GMK h;  1YCY A;  2CP0 A;  1G3S A;  2D8J A;  3OYK A;  2HMA A;  2ZPB B;  3CMA Q;  1X6O A;  3EG2 A;  4J9H A;  1SSF A;  3P8B B;  3PTA A;  3SD4 A;  2KRM A;  4OVA A;  3QZ5 B;  1AWO A;  1NLO C;  3OBW A;  5GAN f;  3V8L A;  1VQ4 A;  1LCK A;  1G2B A;  2RI5 A;  4ELY C;  4PJO G;  1ZSZ A;  3EG9 B;  5GAM f;  1B7T A;  1RL2 A;  3QSU A;  1VQ4 T;  3CXC P;  9ATC B;  3X25 B;  1VQP Q;  2C0O A;  1X6B A;  2GQI A;  1YHQ T;  2EVR A;  2KAF A;  5GAN 5;  2RJC A;  3MP6 A;  2HZY A;  3TCJ A;  1PC0 A;  2CDT A;  2RA2 A;  3ZBD A;  2JT4 A;  1VIE A;  2M51 A;  2AZV A;  1M1K C;  2CT4 A;  2IIM A;  2WSC E;  3RNJ A;  1Y96 B;  2YUO A;  2YWW A;  4ORZ A;  1XTD A;  3LGL A;  3EFO B;  2DX1 A;  2XU8 A;  3EG0 A;  5GAO n;  1UB4 A;  1NG2 A;  1YIT Q;  4QQD A;  3C0C A;  1P92 A;  1Z9Q A;  4F7U G;  4AG2 C;  5DM7 R;  3GLX A;  3CBO A;  3CCV T;  2W10 A;  1W4S A;  4NL3 A;  2L89 A;  4XTU A;  1W2B A;  5GAO l;  3INZ A;  2DXU A;  1GBQ A;  5LJ3 g;  2QG9 B;  2DL7 A;  3HL8 A;  1WNL A;  3PIP A;  3UF4 A;  4O6J A;  1RAA B;  2QQR A;  4RTV A;  4J7I A;  1XJW B;  2MIO A;  3SB2 A;  2K7A A;  4RTY A;  2QQA A;  2LCS A;  2O01 E;  5CQY A;  4II1 A;  3M54 A;  1BI0 A;  1M1K R;  1YIJ A;  2NYS A;  2FYK A;  2H3J A;  4M7D F;  2E4H A;  2RJE A;  1DJ7 B;  2BE7 D;  2EIF A;  5GAM e;  3CCQ T;  3SWN A;  1PD0 A;  4VUB A;  1A0N B;  3QXE B;  5FU7 B;  3CC2 A;  5FU7 C;  1OUL A;  5DLO A;  3BFM A;  4BDY A;  5CO7 A;  3HFO A;  2MI6 A;  4DBQ A;  1PWT A;  4D8D A;  3CC2 T;  3CXC S;  2OI3 A;  1KFZ A;  1C1A A;  1UEB A;  3CCL Q;  3JV3 A;  5KYY B;  2DZC A;  2MWP A;  4M7D A;  3PT9 A;  3JCM V;  1E7O A;  2PZ1 A;  2MMP A;  2K4Y A;  1Q7Y C;  3ZL7 C;  1VYT A;  2DXT A;  3WXM B;  3OA6 A;  2DYB A;  2L8D A;  4PL6 A;  3NPF A;  2AKL A;  3SHW A;  4FYY B;  3TRE A;  2RHU A;  2O31 A;  2LQ8 A;  1PRM C;  2JTF A;  2XHC A;  5CIU A;  3SFM A;  1BI2 A;  2XKO C;  3REA B;  1NYF A;  4C92 B;  1U1S A;  4MZT A;  2ATC B;  2CZ7 B;  2HDA A;  1RAG B;  1GL5 A;  1UGS B;  1AWX A;  3JCM d;  2LRQ A;  3MPU B;  2ESW A;  2O4X B;  3G7Z A;  5GAO m;  2DYI A;  2WAC A;  1WDX A;  4J6X A;  1WI7 A;  3KBG A;  1WPY A;  3VUZ A;  2GTJ A;  3FIF A;  4P5N A;  2RQT A;  2EQU A;  1JJ2 P;  1Q7Y R;  1UE9 A;  4AMC A;  4E47 A;  5HCK A;  1IGQ A;  1EIF A;  3I9Q A;  1EX4 A;  2DL8 A;  2GCX A;  1I8F A;  1AZG B;  3OS2 A;  1VUB A;  1RAD B;  1RI0 A;  2HKQ B;  2KXC A;  3JCM W;  1M8M A;  3CPW S;  3MJX A;  5M9O A;  4ZGD B;  2FO0 A;  2L0A A;  5GMK j;  3VS2 A;  2X3W D;  1MNE A;  1JRI A;  1UGQ B;  4F14 A;  3CCM Q;  4M77 G;  1KQS P;  1ZQ1 A;  2L3Q A;  4N0A A;  5KYN A;  4JLG A;  4FSS A;  4PJL A;  3V7S A;  4GLK A;  2P0K A;  3CCL A;  1D0Z A;  2HCK A;  3P8D A;  4XK8 E;  1AEY A;  1KQ1 A;  5GJV B;  3NTK A;  2KQW A;  2YDL A;  4LDY A;  1QVG P;  1UFF A;  2BZX A;  1SG5 A;  1QLY A;  3CCL T;  3LH0 A;  3G4S Q;  1X27 A;  3CC4 Q;  1G3Y A;  1PM3 A;  3L1A A;  2A37 A;  2FRW A;  3G71 A;  4JDS A;  1D3B A;  1EFN A;  2OTL A;  1Q7Y U;  1F1B B;  4PJO F;  3X28 B;  3M56 A;  4CI0 C;  3G71 T;  2DE0 X;  2OTL T;  4OB2 B;  2PUO B;  3VU3 C;  2QQ9 A;  4BE1 A;  2MOX A;  2E10 A;  5FRO A;  5LJ5 d;  4C92 A;  1BI3 A;  5DLQ E;  1HJD A;  2FVU A;  2JS2 A;  4M7A G;  2O4X A;  4PJO A;  1AOJ A;  2D1X A;  1JJ2 S;  2NUT B;  1W70 A;  2DNU A;  2P0Q A;  2JXB A;  2HSE B;  1YJN Q;  4TVR A;  5AYF A;  4F7U F;  4AG1 C;  3OQ5 A;  3PIO A;  2E65 A;  5LJ3 e;  1AZE A;  3JB9 H;  3RKX A;  3OYI A;  2QEX Q;  4FIB A;  4KUI A;  2RK1 A;  1SRM A;  5I2M A;  2PU9 B;  1KQS S;  3OYN A;  3E9F A;  2XMF A;  2K2M A;  3EFS A;  4PJJ A;  4F7U A;  3GBQ A;  3MEW A;  1VQO Q;  1K8A U;  2SRC A;  2K6D A;  1QVG S;  2DL3 A;  3VV0 A;  3EGD A;  2F2W A;  4B9X A;  2CSI A;  1ZX6 A;  4Z02 A;  3D7S B;  3BW1 A;  2MPX C;  1V29 B;  1XNI A;  2WSF E;  3G4S A;  4EMG A;  1WHL A;  1W6X A;  4Y91 A;  1O9S A;  3HRT A;  3LX7 A;  4IIM A;  5CKE A;  5L8R E;  3QYH B;  3G4S T;  2ZPE B;  1MND A;  1BB9 A;  5L23 A;  4KGV B;  4PLI A;  4JJB A;  3QUI A;  3S6W A;  4A4K A;  5I22 A;  2KEA A;  1H3Z A;  1RAI B;  1KJW A;  3OS5 A;  1OX9 A;  1KQ2 A;  1VQL A;  2VVK A;  1VYU A;  1PSE A;  1MMD A;  4OMP A;  1VQM A;  1VQL T;  2KY9 A;  2EKH A;  3LYI A;  3PFS A;  3JB9 D;  3OMC A;  3DLL A;  2NUT A;  1VQM T;  2HQX A;  4XQ3 A;  4XTW A;  3RIR A;  1OV3 A;  1Z9Z A;  4M78 G;  3PE0 A;  1WJR A;  1K73 R;  1IB8 A;  1WXU A;  2P84 A;  1VQ6 Q;  2XID A;  2K2V A;  4KRT A;  4C8Q F;  3QYG B;  2LJ0 A;  1N9S A;  4C5E A;  1YJN T;  2YT6 A;  3U23 A;  3CEY A;  3REB B;  4JJD A;  1TWB A;  1QVF P;  1B07 A;  3PGG A;  3CCU Q;  3GF5 A;  3C4S A;  3JCM h;  5D6X A;  3EAE A;  2K3Y A;  3HPW A;  1U06 A;  1Y71 A;  5FW9 A;  1M3B A;  4OMO A;  2QTV A;  3JB9 J;  2FRY A;  4BI3 A;  1VQ7 Q;  2V1R A;  2YUP A;  4C5H A;  1VQO A;  2EW3 A;  1PNJ A;  2V8I A;  2M0Y A;  2X4X A;  2DMO A;  3RDV A;  4F16 A;  2RB6 A;  1VQO T;  4A4H A;  2O88 A;  4Z88 A;  3SEM A;  2EYY A;  3MET A;  2KT1 A;  2CT3 A;  3L2U A;  4M77 F;  1Q86 R;  3O5Z A;  2VV5 A;  1JQQ A;  4AFQ C;  1K73 U;  1VYV A;  5GAM d;  4EMK B;  4EMK C;  4JRK A;  5GAN g;  1AHJ B;  1OQK A;  2LCL A;  3I35 A;  1WQW A;  3O8V A;  3DLM A;  2CUD A;  3NHN A;  1QP2 A;  1WHH A;  2B8A A;  3M4Y A;  1OU8 A;  2DEU A;  1I5L A;  2K3B A;  4JS4 A;  2FZG B;  4M77 A;  1E6G A;  4J83 A;  4LDV A;  2EKO A;  1WHK A;  4EIK A;  3CPW A;  5ECA A;  4FYV B;  3BY7 A;  1ZA1 B;  3OYB A;  1Y07 A;  3RER A;  4FU6 A;  1AT1 B;  4R56 A;  2P0P A;  2EQK A;  5KYU B;  1WYX A;  3Q1J A;  5KYW B;  2DZ9 A;  4MDX A;  5CR2 A;  2E6Z A;  1TG0 A;  4RCC A;  1GFD A;  4RMO A;  2X3X D;  4M7A F;  1JXO A;  1QVF S;  4KH0 B;  1Q86 U;  1FMV A;  4OMF B;  2J05 A;  3V8J A;  1GCQ A;  1BU1 A;  2F5T X;  1SF9 A;  4HCB A;  2BZ8 A;  2BE9 B;  2A0F B;  3DB4 A;  2JW4 A;  4J9G A;  4F04 B;  2F2V A;  3LLR A;  3CCU T;  4M7A A;  3L42 A;  1XOV A;  1YN8 A;  3JCM b;  2KRO A;  2DL5 A;  1D0Y A;  1WHM A;  1M2V B;  4XTY A;  1VQ7 T;  4J6Y A;  3JCM Q;  2CKK A;  2L3R A;  1AWJ A;  3M0P A;  3X20 B;  4A54 A;  5C6S A;  4CC4 B;  4JJC A;  2V1Q A;  2Y4X A;  1YWP A;  1RAC B;  2CP2 A;  1WQ7 A;  4J9F A;  5FWB A;  5KE2 A;  1WJS A;  3CBP A;  3TSW A;  2JN0 A;  3QDF A;  5GJW B;  2A28 A;  4M75 E;  3OW2 A;  1W1F A;  3RES A;  4DBF A;  1YIJ Q;  1ZSG A;  4GBQ A;  4RTW A;  1YI2 A;  3TQ7 P;  3MCA B;  2EYQ A;  3EG3 A;  4JS5 A;  1YBY A;  2JM8 A;  3CC2 Q;  3OYC A;  1SHG A;  3H6Z A;  4M4Z A;  3FRN A;  1M5Q 1;  4C92 G;  1I4K 1;  1IO6 A;  4RCB A;  4C0F A;  1T0J A;  5IH2 A;  1I1J A;  8AT1 B;  3VS7 A;  3FJP A;  3M0T A;  1HK9 A;  3GPL A;  4M75 B;  2ABL A;  4M75 C;  4MZP A;  2K5L A;  4XAX B;  1K9A A;  3AHU A;  2DO3 A;  2RQW A;  4ZGE B;  4N4G A;  2HKN A;  4M78 F;  2J6F A;  2JTE A;  3QWX X;  4LXC A;  2E3H A;  2NUP B;  4AFS C;  1UGV A;  5HK3 A;  2KRN A;  3X24 B;  2DM1 A;  3M9Q A;  3UT1 A;  4EDU A;  4QQG A;  4HXJ A;  1YJ9 A;  2VB6 A;  2EQM A;  4C0Z A;  4XU3 A;  2CS7 A;  4LDU A;  4JLI A;  1GCP A;  2R58 A;  3EGX A;  1B34 A;  1SEM A;  3G6E A;  3J7A F;  4DBR A;  5FU6 B;  2DF6 A;  2RF0 A;  3UPU A;  5FU6 C;  3H0I A;  1YJ9 T;  2D0N A;  4M78 A;  4PJM A;  3G6E T;  5LJ3 d;  1ZBX A;  6AT1 B;  4LDX A;  4EMH A;  1M3A A;  1NLP C;  4FT4 A;  4IUR A;  5GAO q;  4FW1 A;  3OS1 A;  1QCO A;  1FX7 A;  4DA4 A;  2LTO A;  3A8O B;  2RD1 A;  2Y4Y A;  2O2O A;  3R6O A;  1QW1 A;  4XTZ A;  3CBM A;  4QQ6 A;  1MUZ A;  1TH7 A;  1X2Q A;  2JM9 A;  2EGE A;  2LQK A;  4WF2 A;  1U5S A;  2DRM A;  3JB9 I;  3HRU A;  5GAN e;  2DIL A;  2W0Z A;  1ZHI A;  3WVE B;  1WIE A;  1YIJ T;  5CKF A;  3CC7 A;  1D1A A;  4IUT A;  2DIQ A;  3NGP A;  2EQI A;  2LNV A;  4DQ2 A;  1X69 A;  3CC7 T;  2YLB A;  1B3Q A;  3V7C A;  3EG9 A;  3OBY A;  5GAM h;  2MK5 A;  1I81 A;  2RM4 A;  3QPH A;  2HBW A;  2DER A;  1U1T A;  2VC8 A;  1WHJ A;  3A8M B;  3OYD A;  1NYG A;  5FRM A;  1QKW A;  2ED1 A;  2DJQ A;  3G71 Q;  4E7L A;  2LT1 A;  2NUP A;  1T0H A;  4FL6 A;  2OTL Q;  4N4I A;  2QDY B;  1TU0 B;  5KYX B;  2F5K A;  2MWO A;  3TSZ A;  5CQX A;  2JZ2 A;  2DXC A;  1Y96 A;  5LJ5 j;  3HKS A;  3NMZ C;  2CZ6 B;  3JAM E;  3EFO A;  2DPP B;  3R6N A;  1SHF A;  2J6K A;  4DEY A;  1H3H A;  4MMK A;  1YFN A;  4PLL A;  1S72 A;  3E19 A;  2HSP A;  3GNG A;  2GFA A;  2DD5 A;  2GTO A;  1NPR A;  2LNH B;  1S72 T;  4QT7 A;  2YXY A;  4OML A;  4D8K A;  2KDS A;  4GLM A;  4M75 D;  3JCM J;  3S3O A;  3FEO A;  3A8G B;  3PNW C;  2DBK A;  4PJO C;  1K0X A;  2FG0 A;  4JJN K;  1RAB B;  1K4U S;  2CZ1 B;  5CK9 A;  2ZZD A;  4B6M A;  2VGN A;  3HHT B;  2AZS A;  2PVD B;  1UUE A;  2VUB A;  2GGR A;  1VA7 A;  1RAE B;  2RO0 A;  2HQE A;  1H92 A;  1K8A C;  1PRL C;  4M7D D;  2F69 A;  2J6O A;  5KCH A;  5KYY A;  1N27 A;  3OYG A;  3T9N A;  5J3B A;  1JU5 C;  5IAY A;  2I2L A;  1BBZ A;  3URG A;  5CAI A;  3MEU A;  4CC7 A;  5CVI A;  2RQU A;  3UWN A;  4C92 F;  2AT1 B;  4JZ3 A;  1MV3 A;  2BUD A;  2LQN A;  1NZ9 A;  1MHN A;  4B9W A;  2VYT A;  4PNO A;  2QDL A;  1WXB A;  2VAS A;  1FYN A;  4PK4 A;  4BDZ A;  2RHX A;  1PKS A;  2LDM A;  1ZLM A;  1GRI A;  1ZA2 B;  1G5V A;  5A2Q E;  2E3I A;  2C0I A;  5GAN 2;  5HK0 A;  1VQL Q;  4K11 A;  4BB7 A;  1K8A R;  4C0G A;  1VQM Q;  1HYO A;  1YP5 A;  1ZUY A;  1SSH A;  4RG8 A;  1RI9 A;  4IUV A;  4RTT A;  4YTL A;  2DTI A;  5CKB A;  2K5I A;  2EGC A;  1N8R C;  2RI2 A;  4FYW B;  1KC8 U;  3SDZ A;  3HFN A;  3UDC A;  3EH1 A;  4FT2 A;  1ZUK A;  4X9D A;  1UHF A;  2CP6 A;  2ZPH B;  2KYM A;  4BUG A;  1PHT A;  4QW2 A;  3JCM P;  2LZ6 B;  1QCN A;  1WZO A;  1OPL A;  2MAM A;  3AT1 B;  3FDR A;  2XD0 A;  1FWZ A;  4MML A;  2YRD A;  3IQL A;  2NWM A;  1W2B P;  1K76 A;  4J9D A;  2KSS A;  3L2W A;  5LJ3 h;  5FLX E;  4C8Q E;  5LL6 S;  3S3N A;  4R55 A;  1Q95 G;  4C0D B;  2QGG A;  2VGM A;  4IUP A;  4C0D C;  3CD6 A;  2GF7 A;  1N8R R;  3OYL A;  2QQB A;  2ZPI B;  3GNF B;  2AK5 A;  5IN1 A;  4OP0 A;  2E12 A;  3JCM f;  5GAN 4;  3NTI A;  1BIA A;  2O9V A;  1T3L A;  1AD5 A;  2HD0 A;  2PNI A;  4RTU A;  1K73 C;  5GAM j;  5A0D A;  4KUD K;  3GP8 A;  2ZGW A;  4C8Q B;  1D0X A;  4C8Q C;  1LPL A;  2KK4 A;  1BCO A;  3PMI A;  3OB9 A;  1YJW A;  3QBY A;  1H8K A;  4ME7 A;  1GXI E;  1TSF A;  1ABO A;  1YJW T;  4PJO D;  1VOM A;  3GIB A;  3VYG A;  1LOJ A;  1D1C A;  2CP7 A;  2HQH A;  1EZZ B;  1X6G A;  3F70 A;  2X51 A;  1UJ0 A;  2Z0W A;  1X43 A;  2M9U A;  4KGZ B;  3OYY A;  2DRK A;  1Y57 A;  2BIV A;  2LX9 A;  2KR3 A;  1K1Z A;  4FYX B;  2AKK A;  4HVU A;  1N8R U;  1VQ8 A;  1T3S A;  2HL5 C;  3CXC A;  3VS1 A;  1K9M C;  2L3P A;  2CH4 A;  5IHI A;  3H9N A;  4WCI A;  2FEI A;  1Q86 C;  3BDU A;  1MMA A;  3EHR A;  1VQN A;  2RI3 A;  4A53 A;  2OJ2 A;  2RJF A;  3VYH B;  4V2S A;  1JB0 E;  1VQN T;  1QQJ A;  2DBM A;  5J26 A;  3LWH A;  4JRP A;  3H8Z A;  2G3R A;  1M30 A;  4HA8 A;  2L2P A;  3C95 A;  3L2R A;  4JZ4 A;  3L2Z A;  5EC7 A;  3M0U A;  5KH6 A;  2E5K A;  1G83 A;  2D0Q B;  2IVW A;  2YUQ A;  4Y92 A;  1N5Z A;  3QJ6 A;  2K57 A;  2LP5 A;  2BZY A;  4LUD A;  2HAX A;  2EBP A;  2E6N A;  3A98 A;  1K9M R;  4A63 B;  2V8J A;  5IT9 E;  1QWE A;  3QKJ A;  5GAN d;  4M75 G;  1CKA A;  2CSQ A;  3CCJ A;  4Y28 E;  3J81 E;  2GBQ A;  4OMQ A;  2JOY A;  4J9E A;  3CCJ T;  1WHG A;  1OZ3 A;  4PKC C;  2K3X A;  3MEA A;  1IHV A;  1C6V X;  4DEX A;  1U8R A;  2LJ3 A;  4E7Z A;  3NFC A;  4JRQ A;  1WX6 A;  2CP5 A;  3LW5 E;  2QI2 A;  4QKU A;  2DKG A;  1U3O A;  3CCS A;  1N6A A;  1YI2 Q;  2X4J A;  2OAU A;  4HVW A;  1SPK A;  2QTX A;  4CC3 A;  2MYS A;  3CCS T;  1IRX A;  2R57 A;  2DL4 A;  1YNZ A;  1G8X A;  3LWI A;  4XTV A;  4ZTF A;  5GAN 3;  5GAN 6;  1VQK A;  2KXD A;  5C0M A;  2L5Q A;  1K9M U;  2BTT A;  2ECZ A;  4RTZ A;  3CME A;  1VQK T;  2CP3 A;  2EWN A;  1M1G A;  3M57 A;  3VRZ A;  3CME T;  2E64 A;  5LJ5 h;  2DIG A;  5KE3 A;  2PQW A;  1UTI A;  3OYE A;  3A8H B;  4C8Q D;  2ED0 A;  1LNX A;  1ZSZ B;  1J3T A;  1ZSZ C;  3MKD A;  2GQV A;  4BI8 B;  1D09 B;  1YJ9 Q;  2Y90 A;  4E7K A;  1YWO A;  4J9B A;  3OYJ A;  2CH4 W;  3G6E Q;  5J39 A;  2RHY A;  2COW A;  3OYF A;  2QGF B;  5LJ3 j;  2VXE A;  4O5V A;  3E2U A;  4XTX A;  1JJ2 A;  2FPE A;  4EMK A;  3DKM A;  2PTK A;  3TVT A;  1OI1 A;  4LD9 K;  3M0R A;  1NE8 A;  3I55 A;  3LGF A;  2XDD A;  4ZN1 A;  2DK3 A;  2RNA A;  1HD3 A;  4E7H A;  3I55 T;  4NOY A;  5GMK e;  4XU0 A;  3TEE A;  4BE2 A;  2GNC A;  1KQS A;  2RK2 A;  4FW2 A;  1KHI A;  1M90 R;  1OYX A;  3RR6 A;  3CC7 Q;  2DVE A;  1YI2 T;  3M58 A;  2OTJ A;  3VKI A;  4X34 A;  5KYU A;  1LJO A;  4X1V A;  2FZK B;  5KYW A;  3C12 A;  3CCE A;  2KT8 A;  2OAW A;  2V8K A;  4J5Y A;  5D6W A;  2OTJ T;  4BD3 A;  1QVG A;  2C0T A;  2EJ9 A;  3E1S A;  4M7D E;  3CCE T;  2VXF A;  4CC2 A;  3SWN B;  1JEG A;  1K0S A;  3SWN C;  3RBB B;  2JTM A;  2LC4 A;  1SRL A;  1WA7 A;  2L3S A;  4OB1 B;  1PKT A;  1VIF A;  1MV0 B;  3VS6 A;  3EGU A;  4M7A D;  2YLC A;  3M0Q A;  3I56 A;  4BAC A;  4AFZ C;  1BIB A;  2JNG A;  1YHQ A;  2M02 A;  5I21 A;  2K5F A;  3EHQ A;  4M7D B;  4M7D C;  3CCR Q;  3JCM c;  3I56 T;  3JB9 G;  4ZN3 A;  1M2V A;  1N9R A;  4C5G A;  1UJY A;  2VKN A;  4ESR A;  1NJI R;  1M90 U;  2EYZ A;  1SKU B;  4AFU C;  4AT1 B;  1S72 Q;  2RQR A;  3VJP A;  5I2S A;  4OF1 A;  1I07 A;  3OS0 A;  3QO3 A;  2D9T A;  1ARK A;  2ROL A;  2YRV A;  1Q82 C;  4JPB W;  4NS5 A;  2DA9 A;  2FL7 A;  4L59 A;  3CCV A;  2FZC B;  3A8L B;  2DTH A;  2KI7 A;  4IIO A;  1BK2 A;  2KYB A;  4DOV A;  2XDP A;  1TXQ A;  3QDR B;  1S1N A;  3RKY A;  1XQH A;  4JUV A;  4MDW A;  3RMS A;  4M75 F;  2A36 A;  1KIK A;  2ZAE A;  3NTH A;  3UA6 A;  2QQS A;  4IUQ A;  4HCK A;  4IUU A;  1OX8 A;  2DEQ A;  4C5I A;  3MO8 A;  2AHJ B;  4OGC A;  2E70 A;  3RUX A;  2QYZ A;  2QA4 A;  3ME9 A;  3KUF A;  5GAN h;  3CCQ A;  2ROT A;  1HXD A;  1PG5 B;  1NJI U;  1V76 A;  4M75 A;  4OMN A;  2QA4 T;  5D7U A;  2E5Q A;  1Q82 R;  3CMA A;  4FM4 B;  2DD4 A;  2IPO B;  3PVQ A;  2CZ0 B;  4LUE A;  4FCY A;  1C0M A;  4GY5 A;  1UHC A;  5HKC A;  4KBM B;  1X75 C;  3CPW P;  3CMA T;  1CKB A;  4N0A C;  3MEV A;  3MHX A;  1I5O B;  3X26 B;  2XG8 D;  2KGT A;  2QAZ A;  1WXT A;  2P4R A;  1ACM B;  3BDL A;  4M78 D;  3CCR A;  1VQP A;  4C92 E;  2DVJ A;  3TU4 K;  4ANJ A;  3OYM A;  3CCR T;  1VQP T;  4L6V 5;  4BI4 A;  1D3B B;  3JSC A;  4PJO E;  4RTX A;  4BY6 B;  1TUD A;  4BY6 C;  2E41 A;  5GMK l;  1RAF B;  1KC8 C;  2RHZ A;  1QP3 A;  5GAN 7;  2RHI A;  1E6H A;  2G6F X;  2CRE A;  2LCC A;  1M1K U;  3M59 A;  5EG2 A;  3OSV A;  4KT0 E;  4C92 C;  1Q82 U;  5DY9 A;  2RPN A;  1YIT A;  1IXD A;  1TUG B;  4C8Q G;  1QVF A;  3QJY A;  4PJO B;  1M2O A;  4KGX B;  3JCM g;  1YIT T;  1UGR B;  2YSQ A;  2LJ1 A;  1M27 C;  2DFU A;  3H41 A;  4DBH A;  2DLP A;  2X4W A;  4MZM A;  1M1F A;  4HT8 A;  2K9G A;  4L5G A;  4ZNX A;  4F7U E;  4OGE A;  2KNB B;  4ELZ C;  4RKU E;  1JO8 A;  1FMK A;  5CCA A;  4PFO A;  2DXB A;  1NM7 A;  1TTH B;  1KC8 R;  3CD6 Q;  4LN2 A;  1ZBJ A; 
#chains in the Genus database with same CATH homology
 3CC7 Q;  1VQ7 Q;  1Q81 R;  1NJI R;  3CCV Q;  3G6E Q;  1VQ8 Q;  3CME Q;  3CCL Q;  1W2B P;  1VQ9 Q;  1VQ6 Q;  1QVG P;  1VQ5 Q;  3CCS Q;  2QA4 Q;  1VQL Q;  3OW2 P;  1YJN Q;  3CCJ Q;  1M1K R;  1S72 Q;  2OTJ Q;  3CCQ Q;  3G4S Q;  3CC4 Q;  1M90 R;  1VQO Q;  1K8A R;  1VQ4 Q;  1Q82 R;  1JJ2 P;  3CCE Q;  3I55 Q;  3CCM Q;  1Q7Y R;  1KQS P;  1VQN Q;  1YIJ Q;  1VQM Q;  3CCR Q;  3I56 Q;  3CXC P;  2QEX Q;  1KD1 R;  1QVF P;  1K9M R;  3CCU Q;  1VQP Q;  3CMA Q;  3CPW P;  1YHQ Q;  1N8R R;  3G71 Q;  1Q86 R;  1YJ9 Q;  1VQK Q;  3CC2 Q;  1YI2 Q;  2OTL Q;  1KC8 R;  1K73 R;  1YJW Q;  3CD6 Q;  1YIT Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...