1Q7YR

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q7yR00
3CMAQ 3G6EQ 3I55Q 1K73R 1Q81R 3CCQQ 3CCEQ 3CXCP 1YI2Q 3CCJQ 1QVGP 1JJ2P 1VQLQ 2OTLQ 1M90R 3CCVQ 1S72Q 3OW2P 3CCLQ 1YJNQ 3CC4Q 1K8AR 2QEXQ 1YITQ 1N8RR 1YJWQ 3CC7Q 1YHQQ 1Q7YR 3CCSQ 3G4SQ 3CCUQ 1NJIR 1YJ9Q 1VQOQ 3CC2Q 1VQ6Q 1VQKQ 3CD6Q 1VQ4Q 3CPWP 1VQ5Q 1M1KR 1VQ9Q 1VQPQ 3CCRQ 1W2BP 3I56Q 1Q82R 1K9MR 1VQMQ 2QA4Q 1KQSP 2OTJQ 1Q86R 3G71Q 1YIJQ 1VQ8Q 1VQ7Q 1VQNQ 3CMEQ 1KC8R 1QVFP 3CCMQ 1KD1R
chains in the Genus database with same CATH superfamily
1BIAA 4RMOA 2F1LA 4HCZA 3QWYA 2EQKA 1N9SA 3SHWA 1SF9A 4RTZA 4JJCA 3QKJA 2RHUA 3BFMA 3DLLA 5FU7C 1WQ7A 5AYFA 2K4YA 1Y57A 3ZBDA 4AG1C 4M7AD 3V7CA 2J06A 4F7UE 4PK4A 2DF6A 4DA4A 2X4JA 3DKMA 2KE9A 1D0YA 1TS9A 1D1CA 1XJWB 4AFZC 5LL6S 2RO0A 1UFFA 2XDDA 2X4XA 1D3BB 1VOMA 1OI1A 2V8JA 2Z0WA 2YRDA 2RHYA 1VQ4A 3JCMh 2L3SA 4CRIA 4C0ZA 2E4HA 1G5VA 3JRZA 1EFNA 2CP5A 4A4KA 4XTUA 2DRKA 2DJQA 5CK9A 2CUBA 1XQHA 1OX8A 3KBGA 4LUDA 1VQ9T 2RB6A 3E19A 3A1PA 4MZMA 3VYGA 2LCCA 1XTDA 1ZSZB 4RG8A 4IUTA 3RERA 3MKDA 2DXCA 2OX7A 3SWNA 3CD6A 4Z89A 4X9CA 1UGPB 1B3QA 2DK3A 3E2UA 5HK0A 1FMVA 1BB9A 1YNZA 1QVGA 2VASA 2M9UA 1GCQC 3M4YA 3OBWA 2JM9A 3CBPA 4EDUA 3OYMA 3CMET 3QZ5B 4L6V5 3LLRA 4OB3B 2DIGA 3QO3A 4A4GA 5GAN6 1I1JA 1R77A 3G1JA 4O5VA 2MOXA 1Q7YU 1KQ1A 3L2QA 1PRMC 1T0JA 2EQIA 2ZPEB 3FJ5A 4HVUA 4J9FA 2DA9A 5GMKh 5KE2A 4MMKA 4C0GA 2KY9A 2QYZA 3L1AA 1WXTA 3HFNA 2DYBA 2XK0A 3MJXA 2DETA 4C8QB 4EMGA 2D9TA 4J7FA 4E47A 2MYSA 3UWNA 5HCKA 2E64A 2D8HA 2C0TA 2CZ6B 2R58A 2DXBA 4OMMA 4JZ4A 3DLMA 3RESA 3A8OB 2YUPA 3DB4A 5CCAA 2JT4A 3OW2A 3WVEB 4M77C 1JXOA 2HKNA 2F2WA 3AHUA 4KT0E 3M4GA 1NPRA 4N0AA 1K8AU 2LX7A 3S3NA 1VQ6T 4ZTFA 1AWOA 3H6ZA 1K4US 3JCMc 1U3OA 2Y90A 4LDYA 3PVLA 2L8DA 3VS5A 3QBYA 1QVGS 2ROLA 5GMKj 4QKUA 2DBMA 3M59A 1I0CA 1K0XA 1ZBXA 3QDRB 2K3YA 3RKWA 2O9SA 2CP0A 1IGUA 2LJ1A 2RI3A 2I2LA 3M0PA 4E7ZA 4EMKB 2DBKA 3V8KA 5KYYA 4XTZA 2F2XA 4JS5A 4VUBA 2O01E 4HKEA 4C5HA 1VQ6Q 4Y28E 3HRUA 1KQSS 3T9NA 1TG0A 2JVVA 4R0KA 5GAOr 2W0ZA 2O4XB 2HMAA 2GQIA 3UF4A 5LJ5e 2VYTA 2FL7A 1KD1U 1N8RR 1C6VX 4WCIA 1BI0A 1WHGA 3C95A 2QQSA 2E6NA 3REAB 1K1ZA 3C94A 2LVMA 4J8OA 3QPHA 1RUWA 2RHXA 3E1SA 2CREA 1QWEA 4LXCA 4C92D 1ABQA 1NYFA 4MDWA 4F14A 4UC4A 4N4HA 1BBZA 4RG2A 2OTLA 1NYGA 2X9HA 4FYWB 5LJ3d 3CCEQ 2RA2A 2QEXA 1YITA 2COYA 2GGRA 1W1FA 3V7RA 4PJOF 5IHKA 3TCJA 3JAME 1H8KA 3KUFA 1ZBJA 2CGHA 4M7DD 3ZFJA 5AT1B 2VUBA 2ZCFB 4FSSA 2QA4A 2K5LA 3X26B 3OY9A 1LVKA 4GBQA 2BZ8A 4C92F 4DBRA 3JCMd 4GLKA 4L59A 5L23A 1SHFA 1YI2A 1QVGP 1AWJA 2PVOB 2J7IA 4HXJA 2ZPHB 3V8JA 2RHZA 1M90U 2QQBA 4BDZA 1M3BA 5J3BA 2R5AA 3PNWC 3TEEA 1OX9A 4M7DF 2KT1A 1TU0B 3OYJA 2LCSA 1QKXA 3MEWA 2DAQA 3CCQA 3OYLA 3RKYA 2CP7A 1VQLA 1AT1B 1BCOA 3SDZA 5J26A 4J9DA 1B34B 2PUKB 3INZA 3VS1A 3EG3A 3WXMB 1SPKA 1MMAA 2RJCA 4OMLA 2QQ9A 2BTTA 1PD0A 1ZSGA 1G2BA 4M78B 4RTYA 3H8ZA 2LTOA 1GXIE 2AZSA 3OYDA 3OW2P 2C0IA 2K3BA 2YHTA 5GANh 1OPKA 4DEXA 1RAGB 1H641 3G4SQ 1RADB 2EKHA 2O2OA 2QEXT 4EMKC 1U1TA 2L3PA 1D3BA 5KYWB 3UPUA 1Q95G 3RIRA 3I55A 4IUQA 3M0RA 2QA4T 1RI0A 1ZHIA 4IURA 1YI2T 1YJWQ 2E3HA 3VUZA 4QVDA 4HA8A 2CZ0B 2VB6A 2RHIA 3O5ZA 1C1AA 1ZSZA 1UDLA 2LNVA 1PNJA 5FW9A 4PJNA 4F04B 2MWPA 1AHJB 1AZEA 3PMIA 2DPPB 4EMHA 2YLCA 1K9MC 2J05A 5FWBA 4A4EA 4PJOB 1S1NA 3JB9D 4XTVA 1VQLT 2EIFA 3CCJT 5GANj 2FZGB 1VQKA 4AT1B 2DEUA 2QA4Q 2IIMA 1QVFS 4JRKA 3FIFA 2DL5A 5KCOA 2E3IA 2KBTA 2DX1A 1QCFA 3EHQA 2CP3A 3CC7A 3VS7A 3MO8A 2SEMA 4E6RA 3JB9F 5I2SA 3IQLA 1OU9A 2BE7D 2PZ1A 2OJ2A 3KFVA 2CSIA 2K9GA 2LQWA 3VU3C 2FPDA 4C8QA 4II1A 2EW3A 4XU2A 1IREB 3LWIA 3CCJQ 3CBOA 4J9IA 1E6HA 1S72A 2E12A 2O31A 4K11A 2AKLA 3M57A 2L0AA 5KYXA 3A8GB 3JB9I 3BW1A 2WSFE 2EVRA 2XHCA 4BI3A 1YIJA 2KYMA 4AFQC 4PLIA 3JCMJ 1ZUKA 3CMAT 2CSQA 2KAFA 3AT1B 3JCMe 4GLMA 4KH1B 3FJPA 4ZN1A 1GBQA 1VQKT 4C8QG 2J6OA 4J5YA 1MV0B 3NTIA 1NM7A 2W10A 3J80E 4A54A 3JCMP 1K73R 1Q82C 2CS7A 4DOWA 3CC4A 2JW4A 1MMNA 1QP3A 1YHQA 2AIRB 2YUNA 4XTXA 3CC7T 2KDSA 4EMKA 2LJ0A 2KEAA 1X69A 1Q82R 2DYIA 1NPPA 4C8QE 4E7JA 5GMKm 5J39A 1NJIC 2QG9B 3CMAQ 2EYXA 1M9SA 1TSFA 1JQQA 1Q86C 1H3HA 1M3AA 2DE0X 3EG2A 1S72T 3VS0A 3CC2A 5CKHA 2DJZA 2O4XA 5GJWB 3H9NA 4BD3A 2V8KA 1M8VA 3QHSA 2GTJA 5I2MA 4PJOC 3EFRA 2GFUA 1UHCA 1Y96B 2ZPBB 1JXMA 3CPFA 3OS5A 5GMKe 4M75D 1YIJT 1VQ7T 4QVZA 3M0QA 4Z88A 1P92A 2G6FX 4J9BA 3X24B 4C92C 1CSKA 3P8BB 4EPCA 5LJ3g 3UT1A 2Y4XA 2R5MA 2CP2A 4M77B 4JDSA 2HKQB 2FVUA 3QXEB 2DVJA 3N5BB 2K79A 1BI1A 3CXCS 2DXUA 4J9CA 3MP8A 4M7DC 4M75F 4DQ2A 4KGVB 4J7IA 1D09B 1N6AA 1YJ9A 2RJFA 3CC4T 1HXDA 1YHQT 2ABLA 4AFSC 2RN8A 5LJ3f 1NEGA 2LQKA 1VQMA 2RJEA 4E7IA 2L2PA 5LJ5d 1YIJQ 1VQ7Q 2IPOB 3EH2A 1KG1A 4XK8E 2OTJT 1KJWA 2EYZA 1GCPA 2P0PA 2K3XA 1UGRB 6AT1B 1W70A 1UHFA 1WHKA 2M1HA 1QMCA 4ZGEB 1HD3A 1VQPA 4J83A 2QDLA 2A3LA 4DBHA 1WNLA 3CC2T 2DL4A 1M1KU 3O8VA 3NTKA 4M7AF 1Q81R 4A63B 1SSFA 1OULA 5FRMA 1PKSA 1TUGB 3RBBB 4XU0A 3CCUA 3SB2A 4QQ6A 3L42A 2R57A 2HL3A 4ELYC 2YRVA 2HQEA 4PLLA 1YWOA 4M78A 4PJMA 4C5EA 3X20B 2RQWA 7AT1B 2OTJQ 1U1SA 1GRIA 2OAWA 3EGUA 4ATOA 1WIEA 3LWHA 3M9QA 2H3JA 3C0CA 4X34A 1CKBA 3QWXX 1KC8C 1QWFA 5GAN3 8AT1B 1X75C 5DLOA 5KYWA 3BDUA 3CC2Q 4F7UF 3TQ7P 1VQ9Q 5KE3A 2DRMA 2RH2A 2CZ1B 2A37A 1QCOA 3LYIA 2PVDB 3VYHB 5GAMg 3CCMA 1KC8R 2LQ8A 1K9MU 3JCMV 2D1XA 3L2ZA 4XU3A 3Q1JA 2MF2A 2VWFA 4HT9A 3RR6A 1Y71A 2YDLA 1CKAA 1WHJA 4M78G 4BE1A 2JS2A 3FLGA 2DD4A 4C5IA 4A4FA 2OI3A 2F5TX 1KQSA 4FYYB 1VQ4T 4PJOA 2JN0A 5GAMf 3CMEQ 3E9FA 4LE9A 3VV0A 2GBQA 1Z9ZA 2LQNA 1DJ7B 3CPWS 4M78E 3H0FA 4Q5WA 1RAHB 5GJVB 1MMGA 2DZ9A 1G3WA 3CCUT 2EGCA 4PFZA 3CD6T 1QVPA 4JRIA 4LDXA 3META 1WLPB 2KXCA 1UECA 1D1AA 3OBYA 2QGFB 3A5ZB 1XNIA 2DL7A 1WGSA 1FYNA 1ZLMA 1Y7XA 2QQRA 5IXBA 1VQ4Q 2XG8D 2QQAA 2VVKA 3M56A 3QDFA 5I22A 1SSHA 1UJ0A 3MHXA 4FT2A 1VQ8A 2EYYA 4M7AB 3TSZA 1IGQA 4JZ3A 3QYHB 5HK3A 2ZPIB 2E10A 2FPEA 1SHGA 4HCCA 2XDPA 3CCMT 1FMWA 3EH1A 5GANe 4RTUA 4PJLA 1TOVA 3VS2A 2LMJA 2ENMA 3M0SA 3CCUQ 3LGFA 5CAIA 3CD6Q 1WX6A 1N8RC 4A4HA 1AWXA 1RABB 3RMQA 1X6OA 2JOYA 5IAYA 1ZX6A 4DBQA 1M4ZA 1UGQB 3E9GA 1W6XA 2P0QA 1AWWA 2FHDA 2QTXA 2JMAA 2X35A 1UE9A 4DOVA 1ZA1B 1AEYA 3VRZA 3HRTA 4LDUA 4FU6A 2V1QA 1VQOA 3JCMW 4BUGA 1YN8A 2PU9B 1NJIU 3NTHA 1VQNA 4OMPA 1MV3A 5C6SA 2D6FA 1UG1A 1GCQA 3OYBA 1Q86U 1KQ2A 2LZ6B 4HVVA 2BE9B 1M1GA 3OSVA 1I5OB 1X2QA 3M0UA 5A2QE 3I35A 1M27C 4KUDK 3JSCA 4XQ3A 1M5Q1 4MZTA 1GFDA 2CZ7B 4LNPA 2RQTA 1HSQA 2KSSA 3GLXA 4B9WA 4P5NA 1VQ8T 1KHCA 1LNXA 3VS3A 5EC7A 1QCNA 3R6NA 2JMCA 2ZAEA 4DBFA 1JO8A 4R56A 4M75C 4KBMB 2CUDA 3RMSA 2V8IA 4KRTA 2ZZDA 1SEMA 3JCMX 2KROA 3CCVA 2CYZB 4C0DB 2M0YA 1RACB 2K2MA 4M77A 2LJ3A 4Y91A 1VQ5A 4CC4B 2IG0A 2RPNA 1VQOT 3VS4A 2WSEE 2FG0A 2KT8A 1KQSP 1QVFA 4FYVB 5CO7A 1VQNT 1YCYA 4E2FB 5FRNA 1R8OB 2K57A 3UA7A 3V7SA 5LJ5g 5GMKi 2OTLT 4M7AC 1PM3A 5CKBA 2KRNA 2NWMA 1YITT 3VKIA 3H41A 3S6WA 2NLUA 3OMCA 1G8XA 1D0ZA 1KIKA 2VXFA 2NUPB 2A08A 2ESWA 4FM4B 1RAAB 3G6EA 9ATCB 4M77G 3QUIA 2DERA 3SFMA 4C0FA 2JJ9A 3THKA 3OB9A 2FB7A 2KGTA 4F17A 2LC4A 2K7AA 1UB4A 2PNIA 1MNDA 4QQDA 5FLXE 1LJOA 5D6XA 1ACMB 1SRLA 3M5AA 2PQWA 3G71A 2XD0A 5ECAA 4KUIA 4WTOB 1AZGB 1I81A 3M53A 4RTWA 1HK9A 1M2VB 5GAN5 3GBQA 4A53A 1OV3A 4XAXB 5I11A 3LW5E 4M77E 2OTLQ 2F5KA 2KQWA 3OYHA 4OGCA 2QEXQ 1H92A 1YITQ 3CCQT 3CCVT 2MMPA 2RJDA 4TVRA 1PC0A 2MIOA 2D0QB 1B07A 1Q7YC 1MUZA 1VQ5T 1IHWA 4X1VA 2M16A 1WHLA 4C92B 1OEBA 5KYUB 4FYXB 4BE2A 1YI2Q 3EGXB 4BY6C 2H3EB 2E1HA 1YJNA 2E5KA 2GNCA 2DILA 2DLPA 2HSEB 2PVGB 4BE0A 3VJPA 5M9OA 1Q7YR 4HT8A 5CVIA 3PE0A 4PKCC 3KXTA 4XU1A 1J3TA 5FROA 3CCRA 4M7DB 3OYEA 1N27A 1X43A 3M58A 2HD0A 4FIBA 3JCMQ 2J6FA 2L89A 3OYCA 3CCQQ 2JS0A 3RDVA 1VQLQ 4BI4A 1YP5A 3QG1A 2D8JA 3I55T 1UTIA 1ARKA 1LPLA 4MDXA 2L5QA 2JUFA 3RNJA 2RQUA 4LD6A 5L8RE 3I56A 2KK4A 4C0DC 2KRSA 4D8DA 3NMZC 5HY6A 2P84A 2XKOC 3X28B 1BK2A 3G71T 3JCMb 1RLQC 2HQXA 4N4GA 1K8AR 2E65A 2KR3A 2EBPA 4BI8B 4NL3A 2M02A 4FT4A 1K73C 5GAN8 1WI7A 3G7ZA 5EG2A 4QT7A 1BU1A 3HP9A 3REBB 1N9RA 3ULRB 1RL2A 4OMQA 1ZUYA 5KH6A 1C0MA 1MGQA 3QYGB 3CXCA 2KYBA 2K5FA 3I55Q 2ZPGB 5GAN4 2XIDA 1FX7A 1TUDA 2EYQA 3SWNC 5DM7R 4KH0B 1YJNT 4M7AA 1E6GA 2CH4A 4R55A 1N8RU 2RD1A 1EX4A 4OP0A 2MPXC 1M30A 1JU5C 1KSWA 3V8LA 2DTIA 3X25B 1QVFP 4ESRA 3L2RA 3UDCA 2F69A 2RK1A 4PNOA 3PMTA 2XU8A 1KD1C 3OYAA 5IN1A 1Y07A 1VQKQ 4OMFB 1T3SA 2EQJA 1QLYA 2JZ2A 4D8KA 4IUUA 2WACA 3GIBA 3I56T 5GAN7 4RKUE 4PFPA 1KD1R 2X51A 3BE3A 1XOVA 2GF7A 1UGVA 4J6WA 2FRWA 3EFOB 3CC7Q 4C8QD 1VUBA 5GMKl 2EYWA 4FW1A 1OZ3A 1SRMA 3LX7A 3F70A 2EJ9A 2MAMA 3HHTB 5CKDA 2H8HA 5GANd 4IKFA 3HTRA 5A0LA 3OYFA 2K5IA 4BB7A 2RQVA 2LRQA 4D6WA 1K0SA 1S72Q 2FYKA 2VGMA 4NL2A 3QIIA 4MMLA 3M55A 1WXUA 2E41A 4C8QF 2HSPA 4E7LA 2P4RA 4N0AC 1M90C 1NZ9A 2LCLA 3JCMg 5GAMe 5A0DA 4ZNXA 3H0HA 2DM1A 5DY9A 2P4TA 1VYUA 3M0TA 2XDBA 1BYMA 2SRCA 3FEOA 5FU6B 2DZCA 1MHNA 1M90R 3TSWA 3OYYA 2RK2A 2MCNA 3TVTA 2L3QA 4YTLA 1Q81C 3CQTA 1HYOA 5LJ3h 3JCMf 1UJYA 1MMDA 2E5QA 2X4WA 1RAFB 2NUTB 3OS0A 1KFZA 1NLPC 4OB1B 2LP5A 1F1BB 2Y4YA 5IH2A 3S3MA 1EZZB 3EG9B 1B34A 3R6OA 2LDMA 2RQRA 2EKOA 5D6YA 3CC4Q 1YHQQ 3CPWA 1N5ZA 1T0HA 2FPFA 5A0GA 5CKEA 2G3RA 1W2BA 3FRNA 1RAEB 2DTHA 1O75A 4KULA 1R0CB 1PSFA 2YWWA 3SD4A 4DEYA 4RUGA 3I5SA 2A36A 2AHJB 1OPLA 2ED1A 4OGEA 1ZQ1A 1X6BA 3CCLA 5D7UA 3VS6A 2VKNA 1FMKA 2I0NA 3MP1A 2BUDA 2NUPA 3EG0A 4BDYA 2DEQA 4OVAA 5IHIA 1VQ6A 2ZGWA 3S3OA 2KI7A 3QSUA 1YJ9T 1X6GA 3MEUA 2HNIA 5LJ3j 1UEBA 4RCBA 4OB2B 1JBMA 2FEIA 2B8AA 3J81E 1VQMT 1D0XA 1WJQA 3CXCP 1G3TA 1OQKA 4FCYA 2EGAA 2BIVA 2ROTA 3L2VA 2BZXA 1OYXA 1M2VA 2QI2A 4RCCA 2AT1B 4JJBA 2WSCE 3C12A 1FWZA 3P8DA 1NBEB 1VQPT 1RLPC 1JEGA 4B9XA 2YLBA 1KK7A 1ABOA 4JRPA 4JLGA 4QQGA 3CCEA 2X4YA 3C4SA 4J9EA 3UA6A 4M75B 3RUXA 2DIQA 2JM8A 4ZGDB 3L2WA 3GNFB 2K2VA 4C92A 4J6XA 1YJ9Q 5KYUA 1M2OA 1BI3A 1W2BS 4PJJA 3EGXA 4V2SA 1B7TA 5GAMh 1VQMQ 3HFOA 2JNGA 3PVQA 3HKSA 1JRIA 4BACA 1SKUB 1TXQA 2AK5A 5KYXB 2ZPFB 4M7DA 2ED0A 4OMOA 4JLIA 4QVCA 3CCLT 5KYNA 3I5RA 2OAUA 2DXTA 5FU6C 2MWOA 1SG5A 2KVQG 4PJOG 1VQPQ 2MI6A 4ELZC 2YUOA 2QAZA 1GL5A 2VV5A 3D7SB 4XTWA 2EQUA 2YRCA 2EFIA 4M78D 2IVWA 3EHRA 4Z02A 2COWA 4C92G 3PIPA 1K73U 4C5GA 3U23A 3P8HA 1U06A 3ASKA 2J6KA 1NLOC 2NUZA 4HCKA 4PJOE 1FXXA 1V76A 4JJDA 5GAMj 4J6YA 3EGDB 2LNHB 2NYSA 1Q82U 4M7DG 1PCXA 3H0IA 1M1FA 4M78F 3CCLQ 4E7SA 4C92E 3CCET 4AFUC 3G4SA 2CDTA 3A98A 1QW1A 4F7UB 3PIOA 3OYGA 2MK5A 1ZSZC 2RMOA 1TTHB 4PL6A 1ZA2B 2EJFA 3OYKA 2CT3A 3CCMQ 3SEMA 4M7DE 1WQWA 3OW2S 2B86A 2GCXA 2HBWA 5CIUA 4PJOD 1YJWA 1IO6A 4LDVA 1OZ2A 1U8RA 1W4SA 1JB0E 2DL8A 4KGXB 3CPWP 5GAOp 3CBMA 4BY6B 1TH7A 3MPUB 1W2BP 2EAYA 4RTVA 3NFCA 2KNBB 2JTFA 1WZOA 4L5GA 4OF1A 1JJ2A 2EJGA 2KMTA 2JTEA 2FZCB 3OA6A 2YSQA 4CC3A 3GPLA 1IB8A 5KCHA 3NPFA 1Y96A 5CQYA 1M8MA 1I5LA 1WDXA 3GF5A 1UUEA 1IZ6A 1PHTA 3HSBA 2DVEA 4FL6A 3EFOA 4QW2A 4C8QC 1BCMA 1K9AA 2E6ZA 2AZVA 2RI2A 4FSXA 2ECZA 4B6MA 2VGNA 4J9GA 5CQXA 4FW2A 3VRYA 5GANg 4NS5A 3OQ5A 1RI9A 4E7HA 1NEBA 2LT4A 4AG2C 5GAOm 3G4ST 5IHNA 5CKFA 1PSEA 3A8HB 1G83A 4ORZA 3MP6A 3FB9A 8ATCB 1VQ8Q 4GY5A 4RTTA 2QASA 5GAOq 1WA7A 2X3XD 4JRQA 3CCJA 4OMNA 1O9SA 1GFCA 1AD5A 5GANf 1Q81U 3CCSA 2COZA 1UGSB 2DNUA 3LH5A 1YJWT 3QZ9B 1V29B 2XICA 4IUPA 2GQVA 3JB9G 4ZN3A 1QP2A 1I07A 2A0FB 1PD1A 3SWNB 2DO3A 3EFSA 3ME9A 2GFAA 1M1KC 1PKTA 1JJ2S 2HZYA 4WF2A 4N4IA 3DB3A 5GAOl 3FDRA 3HL8A 1WPYA 5GAN2 2QGGA 4JJNK 2NUTA 2HL5C 3HRSA 2EGEA 2HAXA 1G3YA 3M54A 5LJ5f 1ZUUA 1VQOQ 4Y92A 1Z9QA 1TUCA 2FO0A 2PUOB 3EG9A 1M1KR 2QK0A 2A28A 1VQNQ 4LUEA 3EG1A 5DLQE 2DFUA 5GAMd 1KC8U 4JS4A 1WXBA 5LJ5h 2YUQA 1AOJA 2DD5A 2HBPA 1I8FA 2YT6A 4ZGJB 3I9QA 4PFOA 4CC2A 4IIMA 1OU8A 2A7YA 3HPWA 1HJDA 1BIBA 3MCAB 2VXEA 4LDWA 3FC3A 4ME7A 4IUVA 3LH0A 4AMCA 3WVDB 3OYNA 2GTOA 4Z8AA 2BKDN 3CMAA 3NGPA 4JPBW 2RF0A 3L2UA 2LT1A 5I21A 1YCSB 3TREA 2QXFA 1KHIA 4MZPA 2C06A 1WJSA 2V26A 4OB0B 2FRYA 2DL3A 1K76A 3CCST 3PTAA 4M77D 1K9MR 2BZYA 2DTOA 1U5SA 2ATCB 1WHMA 2CH4W 4HCBA 1YBYA 3CCVQ 1A0NB 1IRXA 3GP8A 4ZTJA 3G6ET 2O88A 2PTKA 5LJ5j 1H3ZA 1VQ5Q 4IIOA 1K8AC 1QKWA 2CKKA 4M75A 1X27A 3A8MB 3PGGA 4RTXA 4M77F 1X2KA 2JXBA 2HQHA 4CI0C 1I4K1 3A8LB 3EAEA 2KRMA 5FU7B 5C0MA 3URGA 4CC7A 1JJ2P 4E7KA 3RKXA 3J7AF 3JB9J 5D6WA 4EIKA 2K6DA 3CCSQ 3GNGA 1GBRA 2XMFA 5LJ3e 1VYTA 1YFNA 5KYYB 5IT9E 5HKCA 3OMGA 2E70A 1VQ7A 3QJYA 5FWCA 1TWBA 3OSSC 3PFSA 3UATA 2HCKA 3G6EQ 4X9DA 1IHVA 3MEAA 4LD9K 4KGZB 1OOTA 4M4ZA 3OYIA 4M75G 5GAOn 4M78C 3NHNA 5CR2A 2CP6A 3VUBA 3JV3A 3ZL7C 2HEQA 2RI5A 3G71Q 1BI2A 2YXYA 1WJRA 3CCRT 2QTVA 2AKKA 1Y0MA 1WFWA 1T3LA 2LX9A 1V1CA 2FZKB 4XTYA 1MNEA 1IXDA 2RM4A 2JTMA 1LCKA 3MEVA 2CT4A 3LGLA 4M75E 1QQJA 2L3RA 3EGDA 3CEYA 3JB9H 2EQMA 2OTJA 1PWTA 3ER0A 2DKGA 3OS2A 3ZEHA 1VIEA 1VA7A 1RAIB 2RNAA 1PG5B 2DMOA 1LOJA 4F7UA 1X01A 1VYVA 4ANJA 1PRLC 4NOYA 1BKBA 3BY7A 2O9VA 4HVWA 1YJNQ 4LN2A 3OS1A 4M7AG 2EPDA 2VC8A 1NJIR 3QJ6A 4O6JA 1VQ9A 1NG2A 3GOXA 3CCRQ 1G3SA 2M0OA 2P0KA 1NE8A 4F16A 2F2VA 1EIFA 2V1RA 1Q86R 1VIFA 2M51A 1AVZC 1WYXA 5IXFA 2EWNA 1M3CA 4JUVA 1R0BG 2C0OA 1YWPA 4M7AE 2QDYB 3PT9A 1D1BA 3TU4K 1WHHA 2XI9A 1E7OA 2D0NA 4J9HA 3I56Q 2X3WD 3BDLA 2HDAA 2KXDA 3CMEA 4F7UG
chains in the Genus database with same CATH topology
3CMAQ 3G6EQ 3I55Q 1K73R 1Q81R 3CCQQ 3CCEQ 3CXCP 1YI2Q 3CCJQ 1QVGP 1JJ2P 1VQLQ 2OTLQ 1M90R 3CCVQ 1S72Q 3OW2P 3CCLQ 1YJNQ 3CC4Q 1K8AR 2QEXQ 1YITQ 1N8RR 1YJWQ 3CC7Q 1YHQQ 1Q7YR 3CCSQ 3G4SQ 3CCUQ 1NJIR 1YJ9Q 1VQOQ 3CC2Q 1VQ6Q 1VQKQ 3CD6Q 1VQ4Q 3CPWP 1VQ5Q 1M1KR 1VQ9Q 1VQPQ 3CCRQ 1W2BP 3I56Q 1Q82R 1K9MR 1VQMQ 2QA4Q 1KQSP 2OTJQ 1Q86R 3G71Q 1YIJQ 1VQ8Q 1VQ7Q 1VQNQ 3CMEQ 1KC8R 1QVFP 3CCMQ 1KD1R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA Q;  3G6E Q;  3I55 Q;  1K73 R;  1Q81 R;  3CCQ Q;  3CCE Q;  3CXC P;  1YI2 Q;  3CCJ Q;  1QVG P;  1JJ2 P;  1VQL Q;  2OTL Q;  1M90 R;  3CCV Q;  1S72 Q;  3OW2 P;  3CCL Q;  1YJN Q;  3CC4 Q;  1K8A R;  2QEX Q;  1YIT Q;  1N8R R;  1YJW Q;  3CC7 Q;  1YHQ Q;  1Q7Y R;  3CCS Q;  3G4S Q;  3CCU Q;  1NJI R;  1YJ9 Q;  1VQO Q;  3CC2 Q;  1VQ6 Q;  1VQK Q;  3CD6 Q;  1VQ4 Q;  3CPW P;  1VQ5 Q;  1M1K R;  1VQ9 Q;  1VQP Q;  3CCR Q;  1W2B P;  3I56 Q;  1Q82 R;  1K9M R;  1VQM Q;  2QA4 Q;  1KQS P;  2OTJ Q;  1Q86 R;  3G71 Q;  1YIJ Q;  1VQ8 Q;  1VQ7 Q;  1VQN Q;  3CME Q;  1KC8 R;  1QVF P;  3CCM Q;  1KD1 R; 
#chains in the Genus database with same CATH topology
 1BIA A;  4RMO A;  2F1L A;  4HCZ A;  3QWY A;  2EQK A;  1N9S A;  3SHW A;  1SF9 A;  4RTZ A;  4JJC A;  3QKJ A;  2RHU A;  3BFM A;  3DLL A;  5FU7 C;  1WQ7 A;  5AYF A;  2K4Y A;  1Y57 A;  3ZBD A;  4AG1 C;  4M7A D;  3V7C A;  2J06 A;  4F7U E;  4PK4 A;  2DF6 A;  4DA4 A;  2X4J A;  3DKM A;  2KE9 A;  1D0Y A;  1TS9 A;  1D1C A;  1XJW B;  4AFZ C;  5LL6 S;  2RO0 A;  1UFF A;  2XDD A;  2X4X A;  1D3B B;  1VOM A;  1OI1 A;  2V8J A;  2Z0W A;  2YRD A;  2RHY A;  1VQ4 A;  3JCM h;  2L3S A;  4CRI A;  4C0Z A;  2E4H A;  1G5V A;  3JRZ A;  1EFN A;  2CP5 A;  4A4K A;  4XTU A;  2DRK A;  2DJQ A;  5CK9 A;  2CUB A;  1XQH A;  1OX8 A;  3KBG A;  4LUD A;  1VQ9 T;  2RB6 A;  3E19 A;  3A1P A;  4MZM A;  3VYG A;  2LCC A;  1XTD A;  1ZSZ B;  4RG8 A;  4IUT A;  3RER A;  3MKD A;  2DXC A;  2OX7 A;  3SWN A;  3CD6 A;  4Z89 A;  4X9C A;  1UGP B;  1B3Q A;  2DK3 A;  3E2U A;  5HK0 A;  1FMV A;  1BB9 A;  1YNZ A;  1QVG A;  2VAS A;  2M9U A;  1GCQ C;  3M4Y A;  3OBW A;  2JM9 A;  3CBP A;  4EDU A;  3OYM A;  3CME T;  3QZ5 B;  4L6V 5;  3LLR A;  4OB3 B;  2DIG A;  3QO3 A;  4A4G A;  5GAN 6;  1I1J A;  1R77 A;  3G1J A;  4O5V A;  2MOX A;  1Q7Y U;  1KQ1 A;  3L2Q A;  1PRM C;  1T0J A;  2EQI A;  2ZPE B;  3FJ5 A;  4HVU A;  4J9F A;  2DA9 A;  5GMK h;  5KE2 A;  4MMK A;  4C0G A;  2KY9 A;  2QYZ A;  3L1A A;  1WXT A;  3HFN A;  2DYB A;  2XK0 A;  3MJX A;  2DET A;  4C8Q B;  4EMG A;  2D9T A;  4J7F A;  4E47 A;  2MYS A;  3UWN A;  5HCK A;  2E64 A;  2D8H A;  2C0T A;  2CZ6 B;  2R58 A;  2DXB A;  4OMM A;  4JZ4 A;  3DLM A;  3RES A;  3A8O B;  2YUP A;  3DB4 A;  5CCA A;  2JT4 A;  3OW2 A;  3WVE B;  4M77 C;  1JXO A;  2HKN A;  2F2W A;  3AHU A;  4KT0 E;  3M4G A;  1NPR A;  4N0A A;  1K8A U;  2LX7 A;  3S3N A;  1VQ6 T;  4ZTF A;  1AWO A;  3H6Z A;  1K4U S;  3JCM c;  1U3O A;  2Y90 A;  4LDY A;  3PVL A;  2L8D A;  3VS5 A;  3QBY A;  1QVG S;  2ROL A;  5GMK j;  4QKU A;  2DBM A;  3M59 A;  1I0C A;  1K0X A;  1ZBX A;  3QDR B;  2K3Y A;  3RKW A;  2O9S A;  2CP0 A;  1IGU A;  2LJ1 A;  2RI3 A;  2I2L A;  3M0P A;  4E7Z A;  4EMK B;  2DBK A;  3V8K A;  5KYY A;  4XTZ A;  2F2X A;  4JS5 A;  4VUB A;  2O01 E;  4HKE A;  4C5H A;  1VQ6 Q;  4Y28 E;  3HRU A;  1KQS S;  3T9N A;  1TG0 A;  2JVV A;  4R0K A;  5GAO r;  2W0Z A;  2O4X B;  2HMA A;  2GQI A;  3UF4 A;  5LJ5 e;  2VYT A;  2FL7 A;  1KD1 U;  1N8R R;  1C6V X;  4WCI A;  1BI0 A;  1WHG A;  3C95 A;  2QQS A;  2E6N A;  3REA B;  1K1Z A;  3C94 A;  2LVM A;  4J8O A;  3QPH A;  1RUW A;  2RHX A;  3E1S A;  2CRE A;  1QWE A;  4LXC A;  4C92 D;  1ABQ A;  1NYF A;  4MDW A;  4F14 A;  4UC4 A;  4N4H A;  1BBZ A;  4RG2 A;  2OTL A;  1NYG A;  2X9H A;  4FYW B;  5LJ3 d;  3CCE Q;  2RA2 A;  2QEX A;  1YIT A;  2COY A;  2GGR A;  1W1F A;  3V7R A;  4PJO F;  5IHK A;  3TCJ A;  3JAM E;  1H8K A;  3KUF A;  1ZBJ A;  2CGH A;  4M7D D;  3ZFJ A;  5AT1 B;  2VUB A;  2ZCF B;  4FSS A;  2QA4 A;  2K5L A;  3X26 B;  3OY9 A;  1LVK A;  4GBQ A;  2BZ8 A;  4C92 F;  4DBR A;  3JCM d;  4GLK A;  4L59 A;  5L23 A;  1SHF A;  1YI2 A;  1QVG P;  1AWJ A;  2PVO B;  2J7I A;  4HXJ A;  2ZPH B;  3V8J A;  2RHZ A;  1M90 U;  2QQB A;  4BDZ A;  1M3B A;  5J3B A;  2R5A A;  3PNW C;  3TEE A;  1OX9 A;  4M7D F;  2KT1 A;  1TU0 B;  3OYJ A;  2LCS A;  1QKX A;  3MEW A;  2DAQ A;  3CCQ A;  3OYL A;  3RKY A;  2CP7 A;  1VQL A;  1AT1 B;  1BCO A;  3SDZ A;  5J26 A;  4J9D A;  1B34 B;  2PUK B;  3INZ A;  3VS1 A;  3EG3 A;  3WXM B;  1SPK A;  1MMA A;  2RJC A;  4OML A;  2QQ9 A;  2BTT A;  1PD0 A;  1ZSG A;  1G2B A;  4M78 B;  4RTY A;  3H8Z A;  2LTO A;  1GXI E;  2AZS A;  3OYD A;  3OW2 P;  2C0I A;  2K3B A;  2YHT A;  5GAN h;  1OPK A;  4DEX A;  1RAG B;  1H64 1;  3G4S Q;  1RAD B;  2EKH A;  2O2O A;  2QEX T;  4EMK C;  1U1T A;  2L3P A;  1D3B A;  5KYW B;  3UPU A;  1Q95 G;  3RIR A;  3I55 A;  4IUQ A;  3M0R A;  2QA4 T;  1RI0 A;  1ZHI A;  4IUR A;  1YI2 T;  1YJW Q;  2E3H A;  3VUZ A;  4QVD A;  4HA8 A;  2CZ0 B;  2VB6 A;  2RHI A;  3O5Z A;  1C1A A;  1ZSZ A;  1UDL A;  2LNV A;  1PNJ A;  5FW9 A;  4PJN A;  4F04 B;  2MWP A;  1AHJ B;  1AZE A;  3PMI A;  2DPP B;  4EMH A;  2YLC A;  1K9M C;  2J05 A;  5FWB A;  4A4E A;  4PJO B;  1S1N A;  3JB9 D;  4XTV A;  1VQL T;  2EIF A;  3CCJ T;  5GAN j;  2FZG B;  1VQK A;  4AT1 B;  2DEU A;  2QA4 Q;  2IIM A;  1QVF S;  4JRK A;  3FIF A;  2DL5 A;  5KCO A;  2E3I A;  2KBT A;  2DX1 A;  1QCF A;  3EHQ A;  2CP3 A;  3CC7 A;  3VS7 A;  3MO8 A;  2SEM A;  4E6R A;  3JB9 F;  5I2S A;  3IQL A;  1OU9 A;  2BE7 D;  2PZ1 A;  2OJ2 A;  3KFV A;  2CSI A;  2K9G A;  2LQW A;  3VU3 C;  2FPD A;  4C8Q A;  4II1 A;  2EW3 A;  4XU2 A;  1IRE B;  3LWI A;  3CCJ Q;  3CBO A;  4J9I A;  1E6H A;  1S72 A;  2E12 A;  2O31 A;  4K11 A;  2AKL A;  3M57 A;  2L0A A;  5KYX A;  3A8G B;  3JB9 I;  3BW1 A;  2WSF E;  2EVR A;  2XHC A;  4BI3 A;  1YIJ A;  2KYM A;  4AFQ C;  4PLI A;  3JCM J;  1ZUK A;  3CMA T;  2CSQ A;  2KAF A;  3AT1 B;  3JCM e;  4GLM A;  4KH1 B;  3FJP A;  4ZN1 A;  1GBQ A;  1VQK T;  4C8Q G;  2J6O A;  4J5Y A;  1MV0 B;  3NTI A;  1NM7 A;  2W10 A;  3J80 E;  4A54 A;  3JCM P;  1K73 R;  1Q82 C;  2CS7 A;  4DOW A;  3CC4 A;  2JW4 A;  1MMN A;  1QP3 A;  1YHQ A;  2AIR B;  2YUN A;  4XTX A;  3CC7 T;  2KDS A;  4EMK A;  2LJ0 A;  2KEA A;  1X69 A;  1Q82 R;  2DYI A;  1NPP A;  4C8Q E;  4E7J A;  5GMK m;  5J39 A;  1NJI C;  2QG9 B;  3CMA Q;  2EYX A;  1M9S A;  1TSF A;  1JQQ A;  1Q86 C;  1H3H A;  1M3A A;  2DE0 X;  3EG2 A;  1S72 T;  3VS0 A;  3CC2 A;  5CKH A;  2DJZ A;  2O4X A;  5GJW B;  3H9N A;  4BD3 A;  2V8K A;  1M8V A;  3QHS A;  2GTJ A;  5I2M A;  4PJO C;  3EFR A;  2GFU A;  1UHC A;  1Y96 B;  2ZPB B;  1JXM A;  3CPF A;  3OS5 A;  5GMK e;  4M75 D;  1YIJ T;  1VQ7 T;  4QVZ A;  3M0Q A;  4Z88 A;  1P92 A;  2G6F X;  4J9B A;  3X24 B;  4C92 C;  1CSK A;  3P8B B;  4EPC A;  5LJ3 g;  3UT1 A;  2Y4X A;  2R5M A;  2CP2 A;  4M77 B;  4JDS A;  2HKQ B;  2FVU A;  3QXE B;  2DVJ A;  3N5B B;  2K79 A;  1BI1 A;  3CXC S;  2DXU A;  4J9C A;  3MP8 A;  4M7D C;  4M75 F;  4DQ2 A;  4KGV B;  4J7I A;  1D09 B;  1N6A A;  1YJ9 A;  2RJF A;  3CC4 T;  1HXD A;  1YHQ T;  2ABL A;  4AFS C;  2RN8 A;  5LJ3 f;  1NEG A;  2LQK A;  1VQM A;  2RJE A;  4E7I A;  2L2P A;  5LJ5 d;  1YIJ Q;  1VQ7 Q;  2IPO B;  3EH2 A;  1KG1 A;  4XK8 E;  2OTJ T;  1KJW A;  2EYZ A;  1GCP A;  2P0P A;  2K3X A;  1UGR B;  6AT1 B;  1W70 A;  1UHF A;  1WHK A;  2M1H A;  1QMC A;  4ZGE B;  1HD3 A;  1VQP A;  4J83 A;  2QDL A;  2A3L A;  4DBH A;  1WNL A;  3CC2 T;  2DL4 A;  1M1K U;  3O8V A;  3NTK A;  4M7A F;  1Q81 R;  4A63 B;  1SSF A;  1OUL A;  5FRM A;  1PKS A;  1TUG B;  3RBB B;  4XU0 A;  3CCU A;  3SB2 A;  4QQ6 A;  3L42 A;  2R57 A;  2HL3 A;  4ELY C;  2YRV A;  2HQE A;  4PLL A;  1YWO A;  4M78 A;  4PJM A;  4C5E A;  3X20 B;  2RQW A;  7AT1 B;  2OTJ Q;  1U1S A;  1GRI A;  2OAW A;  3EGU A;  4ATO A;  1WIE A;  3LWH A;  3M9Q A;  2H3J A;  3C0C A;  4X34 A;  1CKB A;  3QWX X;  1KC8 C;  1QWF A;  5GAN 3;  8AT1 B;  1X75 C;  5DLO A;  5KYW A;  3BDU A;  3CC2 Q;  4F7U F;  3TQ7 P;  1VQ9 Q;  5KE3 A;  2DRM A;  2RH2 A;  2CZ1 B;  2A37 A;  1QCO A;  3LYI A;  2PVD B;  3VYH B;  5GAM g;  3CCM A;  1KC8 R;  2LQ8 A;  1K9M U;  3JCM V;  2D1X A;  3L2Z A;  4XU3 A;  3Q1J A;  2MF2 A;  2VWF A;  4HT9 A;  3RR6 A;  1Y71 A;  2YDL A;  1CKA A;  1WHJ A;  4M78 G;  4BE1 A;  2JS2 A;  3FLG A;  2DD4 A;  4C5I A;  4A4F A;  2OI3 A;  2F5T X;  1KQS A;  4FYY B;  1VQ4 T;  4PJO A;  2JN0 A;  5GAM f;  3CME Q;  3E9F A;  4LE9 A;  3VV0 A;  2GBQ A;  1Z9Z A;  2LQN A;  1DJ7 B;  3CPW S;  4M78 E;  3H0F A;  4Q5W A;  1RAH B;  5GJV B;  1MMG A;  2DZ9 A;  1G3W A;  3CCU T;  2EGC A;  4PFZ A;  3CD6 T;  1QVP A;  4JRI A;  4LDX A;  3MET A;  1WLP B;  2KXC A;  1UEC A;  1D1A A;  3OBY A;  2QGF B;  3A5Z B;  1XNI A;  2DL7 A;  1WGS A;  1FYN A;  1ZLM A;  1Y7X A;  2QQR A;  5IXB A;  1VQ4 Q;  2XG8 D;  2QQA A;  2VVK A;  3M56 A;  3QDF A;  5I22 A;  1SSH A;  1UJ0 A;  3MHX A;  4FT2 A;  1VQ8 A;  2EYY A;  4M7A B;  3TSZ A;  1IGQ A;  4JZ3 A;  3QYH B;  5HK3 A;  2ZPI B;  2E10 A;  2FPE A;  1SHG A;  4HCC A;  2XDP A;  3CCM T;  1FMW A;  3EH1 A;  5GAN e;  4RTU A;  4PJL A;  1TOV A;  3VS2 A;  2LMJ A;  2ENM A;  3M0S A;  3CCU Q;  3LGF A;  5CAI A;  3CD6 Q;  1WX6 A;  1N8R C;  4A4H A;  1AWX A;  1RAB B;  3RMQ A;  1X6O A;  2JOY A;  5IAY A;  1ZX6 A;  4DBQ A;  1M4Z A;  1UGQ B;  3E9G A;  1W6X A;  2P0Q A;  1AWW A;  2FHD A;  2QTX A;  2JMA A;  2X35 A;  1UE9 A;  4DOV A;  1ZA1 B;  1AEY A;  3VRZ A;  3HRT A;  4LDU A;  4FU6 A;  2V1Q A;  1VQO A;  3JCM W;  4BUG A;  1YN8 A;  2PU9 B;  1NJI U;  3NTH A;  1VQN A;  4OMP A;  1MV3 A;  5C6S A;  2D6F A;  1UG1 A;  1GCQ A;  3OYB A;  1Q86 U;  1KQ2 A;  2LZ6 B;  4HVV A;  2BE9 B;  1M1G A;  3OSV A;  1I5O B;  1X2Q A;  3M0U A;  5A2Q E;  3I35 A;  1M27 C;  4KUD K;  3JSC A;  4XQ3 A;  1M5Q 1;  4MZT A;  1GFD A;  2CZ7 B;  4LNP A;  2RQT A;  1HSQ A;  2KSS A;  3GLX A;  4B9W A;  4P5N A;  1VQ8 T;  1KHC A;  1LNX A;  3VS3 A;  5EC7 A;  1QCN A;  3R6N A;  2JMC A;  2ZAE A;  4DBF A;  1JO8 A;  4R56 A;  4M75 C;  4KBM B;  2CUD A;  3RMS A;  2V8I A;  4KRT A;  2ZZD A;  1SEM A;  3JCM X;  2KRO A;  3CCV A;  2CYZ B;  4C0D B;  2M0Y A;  1RAC B;  2K2M A;  4M77 A;  2LJ3 A;  4Y91 A;  1VQ5 A;  4CC4 B;  2IG0 A;  2RPN A;  1VQO T;  3VS4 A;  2WSE E;  2FG0 A;  2KT8 A;  1KQS P;  1QVF A;  4FYV B;  5CO7 A;  1VQN T;  1YCY A;  4E2F B;  5FRN A;  1R8O B;  2K57 A;  3UA7 A;  3V7S A;  5LJ5 g;  5GMK i;  2OTL T;  4M7A C;  1PM3 A;  5CKB A;  2KRN A;  2NWM A;  1YIT T;  3VKI A;  3H41 A;  3S6W A;  2NLU A;  3OMC A;  1G8X A;  1D0Z A;  1KIK A;  2VXF A;  2NUP B;  2A08 A;  2ESW A;  4FM4 B;  1RAA B;  3G6E A;  9ATC B;  4M77 G;  3QUI A;  2DER A;  3SFM A;  4C0F A;  2JJ9 A;  3THK A;  3OB9 A;  2FB7 A;  2KGT A;  4F17 A;  2LC4 A;  2K7A A;  1UB4 A;  2PNI A;  1MND A;  4QQD A;  5FLX E;  1LJO A;  5D6X A;  1ACM B;  1SRL A;  3M5A A;  2PQW A;  3G71 A;  2XD0 A;  5ECA A;  4KUI A;  4WTO B;  1AZG B;  1I81 A;  3M53 A;  4RTW A;  1HK9 A;  1M2V B;  5GAN 5;  3GBQ A;  4A53 A;  1OV3 A;  4XAX B;  5I11 A;  3LW5 E;  4M77 E;  2OTL Q;  2F5K A;  2KQW A;  3OYH A;  4OGC A;  2QEX Q;  1H92 A;  1YIT Q;  3CCQ T;  3CCV T;  2MMP A;  2RJD A;  4TVR A;  1PC0 A;  2MIO A;  2D0Q B;  1B07 A;  1Q7Y C;  1MUZ A;  1VQ5 T;  1IHW A;  4X1V A;  2M16 A;  1WHL A;  4C92 B;  1OEB A;  5KYU B;  4FYX B;  4BE2 A;  1YI2 Q;  3EGX B;  4BY6 C;  2H3E B;  2E1H A;  1YJN A;  2E5K A;  2GNC A;  2DIL A;  2DLP A;  2HSE B;  2PVG B;  4BE0 A;  3VJP A;  5M9O A;  1Q7Y R;  4HT8 A;  5CVI A;  3PE0 A;  4PKC C;  3KXT A;  4XU1 A;  1J3T A;  5FRO A;  3CCR A;  4M7D B;  3OYE A;  1N27 A;  1X43 A;  3M58 A;  2HD0 A;  4FIB A;  3JCM Q;  2J6F A;  2L89 A;  3OYC A;  3CCQ Q;  2JS0 A;  3RDV A;  1VQL Q;  4BI4 A;  1YP5 A;  3QG1 A;  2D8J A;  3I55 T;  1UTI A;  1ARK A;  1LPL A;  4MDX A;  2L5Q A;  2JUF A;  3RNJ A;  2RQU A;  4LD6 A;  5L8R E;  3I56 A;  2KK4 A;  4C0D C;  2KRS A;  4D8D A;  3NMZ C;  5HY6 A;  2P84 A;  2XKO C;  3X28 B;  1BK2 A;  3G71 T;  3JCM b;  1RLQ C;  2HQX A;  4N4G A;  1K8A R;  2E65 A;  2KR3 A;  2EBP A;  4BI8 B;  4NL3 A;  2M02 A;  4FT4 A;  1K73 C;  5GAN 8;  1WI7 A;  3G7Z A;  5EG2 A;  4QT7 A;  1BU1 A;  3HP9 A;  3REB B;  1N9R A;  3ULR B;  1RL2 A;  4OMQ A;  1ZUY A;  5KH6 A;  1C0M A;  1MGQ A;  3QYG B;  3CXC A;  2KYB A;  2K5F A;  3I55 Q;  2ZPG B;  5GAN 4;  2XID A;  1FX7 A;  1TUD A;  2EYQ A;  3SWN C;  5DM7 R;  4KH0 B;  1YJN T;  4M7A A;  1E6G A;  2CH4 A;  4R55 A;  1N8R U;  2RD1 A;  1EX4 A;  4OP0 A;  2MPX C;  1M30 A;  1JU5 C;  1KSW A;  3V8L A;  2DTI A;  3X25 B;  1QVF P;  4ESR A;  3L2R A;  3UDC A;  2F69 A;  2RK1 A;  4PNO A;  3PMT A;  2XU8 A;  1KD1 C;  3OYA A;  5IN1 A;  1Y07 A;  1VQK Q;  4OMF B;  1T3S A;  2EQJ A;  1QLY A;  2JZ2 A;  4D8K A;  4IUU A;  2WAC A;  3GIB A;  3I56 T;  5GAN 7;  4RKU E;  4PFP A;  1KD1 R;  2X51 A;  3BE3 A;  1XOV A;  2GF7 A;  1UGV A;  4J6W A;  2FRW A;  3EFO B;  3CC7 Q;  4C8Q D;  1VUB A;  5GMK l;  2EYW A;  4FW1 A;  1OZ3 A;  1SRM A;  3LX7 A;  3F70 A;  2EJ9 A;  2MAM A;  3HHT B;  5CKD A;  2H8H A;  5GAN d;  4IKF A;  3HTR A;  5A0L A;  3OYF A;  2K5I A;  4BB7 A;  2RQV A;  2LRQ A;  4D6W A;  1K0S A;  1S72 Q;  2FYK A;  2VGM A;  4NL2 A;  3QII A;  4MML A;  3M55 A;  1WXU A;  2E41 A;  4C8Q F;  2HSP A;  4E7L A;  2P4R A;  4N0A C;  1M90 C;  1NZ9 A;  2LCL A;  3JCM g;  5GAM e;  5A0D A;  4ZNX A;  3H0H A;  2DM1 A;  5DY9 A;  2P4T A;  1VYU A;  3M0T A;  2XDB A;  1BYM A;  2SRC A;  3FEO A;  5FU6 B;  2DZC A;  1MHN A;  1M90 R;  3TSW A;  3OYY A;  2RK2 A;  2MCN A;  3TVT A;  2L3Q A;  4YTL A;  1Q81 C;  3CQT A;  1HYO A;  5LJ3 h;  3JCM f;  1UJY A;  1MMD A;  2E5Q A;  2X4W A;  1RAF B;  2NUT B;  3OS0 A;  1KFZ A;  1NLP C;  4OB1 B;  2LP5 A;  1F1B B;  2Y4Y A;  5IH2 A;  3S3M A;  1EZZ B;  3EG9 B;  1B34 A;  3R6O A;  2LDM A;  2RQR A;  2EKO A;  5D6Y A;  3CC4 Q;  1YHQ Q;  3CPW A;  1N5Z A;  1T0H A;  2FPF A;  5A0G A;  5CKE A;  2G3R A;  1W2B A;  3FRN A;  1RAE B;  2DTH A;  1O75 A;  4KUL A;  1R0C B;  1PSF A;  2YWW A;  3SD4 A;  4DEY A;  4RUG A;  3I5S A;  2A36 A;  2AHJ B;  1OPL A;  2ED1 A;  4OGE A;  1ZQ1 A;  1X6B A;  3CCL A;  5D7U A;  3VS6 A;  2VKN A;  1FMK A;  2I0N A;  3MP1 A;  2BUD A;  2NUP A;  3EG0 A;  4BDY A;  2DEQ A;  4OVA A;  5IHI A;  1VQ6 A;  2ZGW A;  3S3O A;  2KI7 A;  3QSU A;  1YJ9 T;  1X6G A;  3MEU A;  2HNI A;  5LJ3 j;  1UEB A;  4RCB A;  4OB2 B;  1JBM A;  2FEI A;  2B8A A;  3J81 E;  1VQM T;  1D0X A;  1WJQ A;  3CXC P;  1G3T A;  1OQK A;  4FCY A;  2EGA A;  2BIV A;  2ROT A;  3L2V A;  2BZX A;  1OYX A;  1M2V A;  2QI2 A;  4RCC A;  2AT1 B;  4JJB A;  2WSC E;  3C12 A;  1FWZ A;  3P8D A;  1NBE B;  1VQP T;  1RLP C;  1JEG A;  4B9X A;  2YLB A;  1KK7 A;  1ABO A;  4JRP A;  4JLG A;  4QQG A;  3CCE A;  2X4Y A;  3C4S A;  4J9E A;  3UA6 A;  4M75 B;  3RUX A;  2DIQ A;  2JM8 A;  4ZGD B;  3L2W A;  3GNF B;  2K2V A;  4C92 A;  4J6X A;  1YJ9 Q;  5KYU A;  1M2O A;  1BI3 A;  1W2B S;  4PJJ A;  3EGX A;  4V2S A;  1B7T A;  5GAM h;  1VQM Q;  3HFO A;  2JNG A;  3PVQ A;  3HKS A;  1JRI A;  4BAC A;  1SKU B;  1TXQ A;  2AK5 A;  5KYX B;  2ZPF B;  4M7D A;  2ED0 A;  4OMO A;  4JLI A;  4QVC A;  3CCL T;  5KYN A;  3I5R A;  2OAU A;  2DXT A;  5FU6 C;  2MWO A;  1SG5 A;  2KVQ G;  4PJO G;  1VQP Q;  2MI6 A;  4ELZ C;  2YUO A;  2QAZ A;  1GL5 A;  2VV5 A;  3D7S B;  4XTW A;  2EQU A;  2YRC A;  2EFI A;  4M78 D;  2IVW A;  3EHR A;  4Z02 A;  2COW A;  4C92 G;  3PIP A;  1K73 U;  4C5G A;  3U23 A;  3P8H A;  1U06 A;  3ASK A;  2J6K A;  1NLO C;  2NUZ A;  4HCK A;  4PJO E;  1FXX A;  1V76 A;  4JJD A;  5GAM j;  4J6Y A;  3EGD B;  2LNH B;  2NYS A;  1Q82 U;  4M7D G;  1PCX A;  3H0I A;  1M1F A;  4M78 F;  3CCL Q;  4E7S A;  4C92 E;  3CCE T;  4AFU C;  3G4S A;  2CDT A;  3A98 A;  1QW1 A;  4F7U B;  3PIO A;  3OYG A;  2MK5 A;  1ZSZ C;  2RMO A;  1TTH B;  4PL6 A;  1ZA2 B;  2EJF A;  3OYK A;  2CT3 A;  3CCM Q;  3SEM A;  4M7D E;  1WQW A;  3OW2 S;  2B86 A;  2GCX A;  2HBW A;  5CIU A;  4PJO D;  1YJW A;  1IO6 A;  4LDV A;  1OZ2 A;  1U8R A;  1W4S A;  1JB0 E;  2DL8 A;  4KGX B;  3CPW P;  5GAO p;  3CBM A;  4BY6 B;  1TH7 A;  3MPU B;  1W2B P;  2EAY A;  4RTV A;  3NFC A;  2KNB B;  2JTF A;  1WZO A;  4L5G A;  4OF1 A;  1JJ2 A;  2EJG A;  2KMT A;  2JTE A;  2FZC B;  3OA6 A;  2YSQ A;  4CC3 A;  3GPL A;  1IB8 A;  5KCH A;  3NPF A;  1Y96 A;  5CQY A;  1M8M A;  1I5L A;  1WDX A;  3GF5 A;  1UUE A;  1IZ6 A;  1PHT A;  3HSB A;  2DVE A;  4FL6 A;  3EFO A;  4QW2 A;  4C8Q C;  1BCM A;  1K9A A;  2E6Z A;  2AZV A;  2RI2 A;  4FSX A;  2ECZ A;  4B6M A;  2VGN A;  4J9G A;  5CQX A;  4FW2 A;  3VRY A;  5GAN g;  4NS5 A;  3OQ5 A;  1RI9 A;  4E7H A;  1NEB A;  2LT4 A;  4AG2 C;  5GAO m;  3G4S T;  5IHN A;  5CKF A;  1PSE A;  3A8H B;  1G83 A;  4ORZ A;  3MP6 A;  3FB9 A;  8ATC B;  1VQ8 Q;  4GY5 A;  4RTT A;  2QAS A;  5GAO q;  1WA7 A;  2X3X D;  4JRQ A;  3CCJ A;  4OMN A;  1O9S A;  1GFC A;  1AD5 A;  5GAN f;  1Q81 U;  3CCS A;  2COZ A;  1UGS B;  2DNU A;  3LH5 A;  1YJW T;  3QZ9 B;  1V29 B;  2XIC A;  4IUP A;  2GQV A;  3JB9 G;  4ZN3 A;  1QP2 A;  1I07 A;  2A0F B;  1PD1 A;  3SWN B;  2DO3 A;  3EFS A;  3ME9 A;  2GFA A;  1M1K C;  1PKT A;  1JJ2 S;  2HZY A;  4WF2 A;  4N4I A;  3DB3 A;  5GAO l;  3FDR A;  3HL8 A;  1WPY A;  5GAN 2;  2QGG A;  4JJN K;  2NUT A;  2HL5 C;  3HRS A;  2EGE A;  2HAX A;  1G3Y A;  3M54 A;  5LJ5 f;  1ZUU A;  1VQO Q;  4Y92 A;  1Z9Q A;  1TUC A;  2FO0 A;  2PUO B;  3EG9 A;  1M1K R;  2QK0 A;  2A28 A;  1VQN Q;  4LUE A;  3EG1 A;  5DLQ E;  2DFU A;  5GAM d;  1KC8 U;  4JS4 A;  1WXB A;  5LJ5 h;  2YUQ A;  1AOJ A;  2DD5 A;  2HBP A;  1I8F A;  2YT6 A;  4ZGJ B;  3I9Q A;  4PFO A;  4CC2 A;  4IIM A;  1OU8 A;  2A7Y A;  3HPW A;  1HJD A;  1BIB A;  3MCA B;  2VXE A;  4LDW A;  3FC3 A;  4ME7 A;  4IUV A;  3LH0 A;  4AMC A;  3WVD B;  3OYN A;  2GTO A;  4Z8A A;  2BKD N;  3CMA A;  3NGP A;  4JPB W;  2RF0 A;  3L2U A;  2LT1 A;  5I21 A;  1YCS B;  3TRE A;  2QXF A;  1KHI A;  4MZP A;  2C06 A;  1WJS A;  2V26 A;  4OB0 B;  2FRY A;  2DL3 A;  1K76 A;  3CCS T;  3PTA A;  4M77 D;  1K9M R;  2BZY A;  2DTO A;  1U5S A;  2ATC B;  1WHM A;  2CH4 W;  4HCB A;  1YBY A;  3CCV Q;  1A0N B;  1IRX A;  3GP8 A;  4ZTJ A;  3G6E T;  2O88 A;  2PTK A;  5LJ5 j;  1H3Z A;  1VQ5 Q;  4IIO A;  1K8A C;  1QKW A;  2CKK A;  4M75 A;  1X27 A;  3A8M B;  3PGG A;  4RTX A;  4M77 F;  1X2K A;  2JXB A;  2HQH A;  4CI0 C;  1I4K 1;  3A8L B;  3EAE A;  2KRM A;  5FU7 B;  5C0M A;  3URG A;  4CC7 A;  1JJ2 P;  4E7K A;  3RKX A;  3J7A F;  3JB9 J;  5D6W A;  4EIK A;  2K6D A;  3CCS Q;  3GNG A;  1GBR A;  2XMF A;  5LJ3 e;  1VYT A;  1YFN A;  5KYY B;  5IT9 E;  5HKC A;  3OMG A;  2E70 A;  1VQ7 A;  3QJY A;  5FWC A;  1TWB A;  3OSS C;  3PFS A;  3UAT A;  2HCK A;  3G6E Q;  4X9D A;  1IHV A;  3MEA A;  4LD9 K;  4KGZ B;  1OOT A;  4M4Z A;  3OYI A;  4M75 G;  5GAO n;  4M78 C;  3NHN A;  5CR2 A;  2CP6 A;  3VUB A;  3JV3 A;  3ZL7 C;  2HEQ A;  2RI5 A;  3G71 Q;  1BI2 A;  2YXY A;  1WJR A;  3CCR T;  2QTV A;  2AKK A;  1Y0M A;  1WFW A;  1T3L A;  2LX9 A;  1V1C A;  2FZK B;  4XTY A;  1MNE A;  1IXD A;  2RM4 A;  2JTM A;  1LCK A;  3MEV A;  2CT4 A;  3LGL A;  4M75 E;  1QQJ A;  2L3R A;  3EGD A;  3CEY A;  3JB9 H;  2EQM A;  2OTJ A;  1PWT A;  3ER0 A;  2DKG A;  3OS2 A;  3ZEH A;  1VIE A;  1VA7 A;  1RAI B;  2RNA A;  1PG5 B;  2DMO A;  1LOJ A;  4F7U A;  1X01 A;  1VYV A;  4ANJ A;  1PRL C;  4NOY A;  1BKB A;  3BY7 A;  2O9V A;  4HVW A;  1YJN Q;  4LN2 A;  3OS1 A;  4M7A G;  2EPD A;  2VC8 A;  1NJI R;  3QJ6 A;  4O6J A;  1VQ9 A;  1NG2 A;  3GOX A;  3CCR Q;  1G3S A;  2M0O A;  2P0K A;  1NE8 A;  4F16 A;  2F2V A;  1EIF A;  2V1R A;  1Q86 R;  1VIF A;  2M51 A;  1AVZ C;  1WYX A;  5IXF A;  2EWN A;  1M3C A;  4JUV A;  1R0B G;  2C0O A;  1YWP A;  4M7A E;  2QDY B;  3PT9 A;  1D1B A;  3TU4 K;  1WHH A;  2XI9 A;  1E7O A;  2D0N A;  4J9H A;  3I56 Q;  2X3W D;  3BDL A;  2HDA A;  2KXD A;  3CME A;  4F7U G; 
#chains in the Genus database with same CATH homology
 3CMA Q;  3G6E Q;  3I55 Q;  1K73 R;  1Q81 R;  3CCQ Q;  3CCE Q;  3CXC P;  1YI2 Q;  3CCJ Q;  1QVG P;  1JJ2 P;  1VQL Q;  2OTL Q;  1M90 R;  3CCV Q;  1S72 Q;  3OW2 P;  3CCL Q;  1YJN Q;  3CC4 Q;  1K8A R;  2QEX Q;  1YIT Q;  1N8R R;  1YJW Q;  3CC7 Q;  1YHQ Q;  1Q7Y R;  3CCS Q;  3G4S Q;  3CCU Q;  1NJI R;  1YJ9 Q;  1VQO Q;  3CC2 Q;  1VQ6 Q;  1VQK Q;  3CD6 Q;  1VQ4 Q;  3CPW P;  1VQ5 Q;  1M1K R;  1VQ9 Q;  1VQP Q;  3CCR Q;  1W2B P;  3I56 Q;  1Q82 R;  1K9M R;  1VQM Q;  2QA4 Q;  1KQS P;  2OTJ Q;  1Q86 R;  3G71 Q;  1YIJ Q;  1VQ8 Q;  1VQ7 Q;  1VQN Q;  3CME Q;  1KC8 R;  1QVF P;  3CCM Q;  1KD1 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...