2DRKA

Acanthamoeba myosin i sh3 domain bound to acan125
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
GSPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain IB
publication title The crystal structure of the SH3 domain of Acanthamoeba myosin IB bound to Acan125
rcsb
source organism Acanthamoeba castellanii
molecule tags Contractile protein
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2drkA00
1NM7A 1QWEA 2ROTA 2J06A 2DRKA 2QDLA 3NGPA 1Z9QA 1TUDA 3H0FA 2AKLA 1W6XA 2CUBA 3NMZC 2KE9A 3TVTA 2YUQA 1H92A 1WXUA 1RLQC 2FG0A 1JXOA 4X1VA 2O2OA 2X3WD 2CH4A 2LX7A 1BB9A 1GCPA 1VYTA 1ZX6A 1HSQA 1ABOA 2DL4A 3RNJA 1WX6A 2A36A 1B3QA 1CKAA 1V1CA 2GBQA 3VS5A 3QWXX 4Z89A 2D1XA 1CSKA 2MCNA 1JXMA 2DF6A 5ECAA 1RUWA 2LJ3A 1FMKA 1GFCA 4AFUC 2MIOA 4RTYA 2RQTA 3H0HA 1M8MA 1S1NA 2C0OA 1WIEA 3U23A 2JM9A 2K6DA 1M30A 3ULRB 2CT3A 1RI9A 3I5SA 2AKKA 1IO6A 4AG2C 1HJDA 2O9VA 1SHGA 1M3AA 4J9EA 2GGRA 2LNHB 1UG1A 2LQNA 1WYXA 1JQQA 4EIKA 4IIMA 1UECA 2ENMA 2ROLA 1G83A 4HXJA 2KYMA 1XOVA 2J7IA 4D8KA 1KJWA 4CC7A 3EG0A 2EGCA 4J9CA 2MOXA 3CQTA 2CUDA 1WA7A 4LNPA 1GBRA 1KFZA 1U5SA 1E6HA 2P4RA 1E7OA 2HBWA 3SHWA 2JMCA 1WFWA 1UE9A 1B07A 3VRZA 5L23A 2F2VA 4ESRA 1AD5A 4M4ZA 3UF4A 1YCSB 2YT6A 3EG2A 2DMOA 2AK5A 2OI3A 2KROA 4JJBA 1NEBA 2EYZA 1SRMA 2H8HA 4LUEA 4OMQA 2G6FX 4GBQA 1GCQC 3I5RA 1NYGA 2L2PA 1T3SA 2RQWA 2DLPA 1T3LA 4OMOA 4RTZA 2J6OA 3KFVA 4JPBW 1AWXA 1WLPB 3SEMA 1MUZA 1CKBA 3VS1A 2K79A 3VS2A 1SEMA 5I11A 2DILA 1N5ZA 3JV3A 1AVZC 1X69A 2ESWA 2JTEA 2VVKA 1M3BA 2L3PA 2KNBB 1MV3A 1GFDA 1LCKA 1MV0B 2LJ1A 2JMAA 2CREA 1VYUA 3THKA 2NWMA 2FRWA 2D0NA 2RPNA 4ORZA 2C0IA 4A63B 2BZYA 3PE0A 1KSWA 2J6KA 2JT4A 2RQRA 1J3TA 2FPDA 2KXDA 2RQUA 2O31A 4JJDA 2DYBA 4LE9A 1QLYA 2K2MA 4R0KA 1I1JA 1WI7A 2KEAA 2FEIA 4RTUA 4DEYA 1X6GA 2OAWA 1VA7A 4HVUA 3REBB 2W0ZA 4D8DA 4HVVA 1ZUYA 4QT7A 2RQVA 4J9IA 4JJCA 1AEYA 1TUCA 1AOJA 4F14A 1UHFA 3I35A 2DX1A 2AZSA 2YUOA 1X27A 4Y92A 1UTIA 3LH5A 4OMMA 1GRIA 1NG2A 5FWCA 4K11A 4WCIA 1X6BA 1PRLC 5IXBA 1ARKA 2DRMA 1AZEA 4RTTA 1NLOC 2GQIA 1UHCA 3I9QA 2OJ2A 2FPFA 2NUZA 1U3OA 2DA9A 4IIOA 1BK2A 2EYWA 2K3BA 3VS0A 2EYXA 2JXBA 3M0RA 1QKXA 1Z9ZA 2KGTA 2FO0A 2DE0X 4RUGA 2KT8A 1KIKA 1JU5C 2YSQA 4CC3A 4JZ3A 3QWYA 4ZNXA 3VS7A 4GLMA 5IHIA 1BU1A 2DL8A 2DBMA 1Y57A 1TG0A 3VRYA 4AFQC 2RNAA 5GJWB 1SHFA 1UUEA 2ED1A 1WXTA 1X2QA 2CSQA 2EGAA 2DM1A 2BTTA 4LN2A 2GTJA 2L0AA 2O9SA 1GBQA 2VKNA 2M51A 1ZBJA 1JEGA 2L3QA 2BZ8A 2E5KA 1PRMC 2PTKA 2YUPA 3FJ5A 3REAB 1W70A 2LJ0A 3TSZA 1K9AA 4OMLA 1AWOA 2B86A 1AZGB 1ZLMA 2KXCA 3H0IA 2LCSA 2LP5A 2KBTA 4JZ4A 2DL5A 1ZUUA 2RMOA 2RF0A 1W1FA 1H3HA 2YUNA 2ABLA 1T0HA 1OOTA 3PVLA 2ED0A 1K0XA 2KYBA 2XMFA 2LMJA 2M0YA 2EYYA 2GTOA 3A98A 4LUDA 1X43A 2HDAA 1K1ZA 2L3SA 4CC4B 2D8HA 1T0JA 3EHQA 2DBKA 4AFZC 2HEQA 5IHKA 1NEGA 2DJQA 4E6RA 1QWFA 1AWWA 3H41A 1PKSA 1PNJA 5IHNA 1UGVA 4OMNA 3EG3A 1OV3A 1K0SA 1NYFA 2EGEA 2RN8A 1WXBA 1G2BA 2EKHA 2A37A 3UA6A 3EHRA 1H8KA 2J05A 4F16A 4J9FA 2A08A 4Z88A 1SRLA 1WDXA 1UDLA 1ZSGA 2V1QA 1ABQA 1I07A 1HD3A 5IH2A 2JS2A 2X3XD 1I0CA 1SSHA 4J9GA 3VS3A 4F17A 2ECZA 5FW9A 1VYVA 2JS0A 2K9GA 3IQLA 1ZUKA 2CH4W 1UFFA 1A0NB 2HCKA 1FYNA 4J9HA 1YWOA 3R6NA 2DVJA 2GNCA 5IXFA 2EPDA 1PWTA 2K7AA 3UA7A 5HCKA 1K4US 2BZXA 2EVRA 1UJ0A 2FPEA 2EQIA 2HSPA 1OPLA 1UJYA 2KR3A 3VS4A 2EW3A 2O88A 2LQWA 2KRMA 4CC2A 4Z8AA 1EFNA 1PHTA 2I0NA 4J9DA 2SEMA 3O5ZA 1U06A 2JW4A 1AWJA 4RTVA 1NLPC 1E6GA 2LZ6B 4DEXA 5EC7A 1YNZA 2SRCA 2CT4A 3C0CA 3EG1A 2V1RA 4HVWA 2DNUA 1Y0MA 2PNIA 2YDLA 2JM8A 4AFSC 2DL7A 3GBQA 1SPKA 5FWBA 3NHNA 3UATA 1PKTA 4KRTA 2CSIA 4RTXA 4J9BA 3M0QA 2KT1A 1RLPC 1YN8A 3PVQA 2D8JA 2KRNA 2EBPA 1QCFA 2CDTA 3TSWA 3VS6A 1X2KA 3ZL7C 2A28A 1M3CA 3RBBB 2C0TA 2FRYA 1K76A 2F2XA 3M0SA 2IIMA 3M0UA 2PZ1A 2AZVA 5GJVB 4FSSA 3M0PA 1GL5A 1YP5A 2W10A 1YWPA 3M0TA 1GCQA 1M27C 1QKWA 1BBZA 2F2WA 2VWFA 4RTWA 5I22A 2DL3A 1JO8A 2KRSA 1OPKA 3EGUA 3NPFA 4OMPA 4AG1C 4HCKA 2J6FA 1OEBA
chains in the Genus database with same CATH superfamily
4C5EA 1QWEA 4M7DC 2YRDA 4B9XA 4C8QB 1TU0B 5CAIA 3H0FA 4CRIA 1OZ2A 3JCMV 1W6XA 3JAME 1VQMA 3TVTA 5A0LA 2YUQA 1YI2T 2A0FB 1H92A 3HTRA 4M77E 2LQ8A 4X1VA 2O2OA 5FU6B 2X3WD 3HSBA 1BB9A 1K73C 4C92C 2NYSA 2DTOA 5FRNA 1ABOA 2Y4XA 5CK9A 2LDMA 4MMKA 2DJZA 1V1CA 3QWXX 2JOYA 1Q82R 5ECAA 2LJ3A 3CCMA 3OS1A 2ZPEB 4RTYA 3H0HA 1S1NA 4HCCA 2C0OA 1KC8R 1R8OB 3F70A 1M30A 1WJSA 1BCMA 4M7AG 4DBRA 2M1HA 2XDPA 1HJDA 1OU9A 4KBMB 4M7DD 4PLLA 4ELYC 3FJPA 4C0DB 2ENMA 2HNIA 3V8KA 5LJ3e 3M4GA 3JB9J 2KYMA 3EG0A 2MMPA 2YHTA 2OTJQ 2MOXA 1K8AR 4J6YA 4LNPA 2MWOA 5GANj 2RJCA 3RERA 1VIFA 4C92D 1U5SA 5HK3A 4VUBA 1E7OA 3CD6T 2ZPBB 2CYZB 3QJYA 1UE9A 4C5GA 5L23A 2F2VA 4ESRA 1BIBA 4M4ZA 3UF4A 1YCSB 2YT6A 3A1PA 3EG2A 1Q81U 3CCST 2CZ0B 2DMOA 5GMKm 2KAFA 1M9SA 3EGDB 5GAMh 1NEBA 2EYZA 1IHWA 3KUFA 5HY6A 4OMQA 4BE2A 1TWBA 4GBQA 2OAUA 1D09B 3QHSA 2L2PA 1ZQ1A 2DLPA 1T3LA 4OMOA 1RAFB 4RTZA 2QQ9A 2J6OA 1K9MU 1X01A 1VQNT 1O9SA 1IREB 1SEMA 5I11A 1TUGB 2DILA 1F1BB 3JB9D 2GFUA 2ESWA 3OQ5A 3V7CA 1K9MC 1M3BA 5M9OA 1GFDA 2GFAA 3RKWA 5GAMf 1Y71A 1MV0B 4B6MA 4C8QC 1VQKQ 4M7AF 1VYUA 3OSVA 3C12A 5FRMA 3HPWA 1SG5A 3H9NA 2XDBA 2X4WA 1LPLA 3PNWC 2RPNA 4ORZA 4A63B 3ME9A 4EDUA 3PE0A 3FRNA 1NBEB 5C0MA 1QLYA 1I1JA 2EQKA 4DEYA 1N8RR 1X6GA 2OAWA 2NUPA 2VXEA 4KH1B 2E3HA 1ZSZC 2HMAA 2RQVA 4JRIA 3OYIA 1TUCA 3A8MB 3CBOA 4MDXA 1X27A 5LJ5e 4Y92A 4BE1A 2LCCA 1NG2A 1YITT 1PRLC 5GMKi 3GPLA 1NLOC 2GQIA 2HZYA 2DD4A 2RM4A 3VYHB 4Y91A 2FPFA 4LDYA 2FHDA 1S72T 3L1AA 2QQBA 4J7IA 2JXBA 2QEXQ 1VQKA 4RUGA 1R0CB 3UWNA 2YSQA 2A3LA 3UPUA 4QW2A 4N4HA 2FYKA 3PFSA 4XAXB 2DBMA 2GCXA 3VRYA 3MEAA 4RG2A 4XK8E 5GJWB 3H8ZA 1SHFA 4AMCA 3RMSA 4JS4A 3CEYA 3L2UA 2ZPFB 1EZZB 1M1KU 2K2VA 2DETA 1GBQA 3EH2A 1O75A 2BE9B 1JEGA 2KQWA 2L3QA 3REAB 3TSZA 2LJ0A 1YI2Q 5KYNA 1M1KC 3TU4K 1ZLMA 3BFMA 1RAEB 2R5AA 1JJ2S 1M1FA 3VJPA 1KHIA 1H3HA 3HHTB 2QEXA 1SF9A 3C4SA 2KYBA 4HCBA 3EG9A 5CQYA 4J83A 1M90U 1VQPQ 1X43A 2HDAA 2L3SA 3OB9A 2B8AA 5GANe 4ZN1A 3JCMJ 1VQMT 2DKGA 1G8XA 2D8HA 5KYYA 3QIIA 3TCJA 4PLIA 1FWZA 2PVGB 1M90C 4WTOB 1OZ3A 3WXMB 3H41A 1NJIC 1IXDA 1UGVA 5GMKh 3EG3A 4DBFA 2YRVA 1K0SA 3SWNB 1D0XA 2PUKB 1WXBA 2PUOB 4M7DA 2DYIA 2A37A 3UA6A 4KULA 1H8KA 5LJ3g 4C0ZA 2X35A 1SRLA 2XK0A 4EMKC 3C95A 1YI2A 3OYYA 2HQHA 2X3XD 4FSXA 3G1JA 4J9GA 4PJLA 4BE0A 1BYMA 4F17A 3I55Q 1BI0A 3T9NA 3QUIA 1YCYA 4C92A 3CD6Q 2G3RA 2JS0A 2V8JA 3QZ5B 1W2BA 1ZUKA 4XTYA 3CCSQ 1QVGP 3M53A 1VQPA 4LDXA 1YWOA 3S3MA 5KCOA 3S6WA 3WVEB 3EAEA 2CGHA 2VV5A 1K4US 2VASA 3ZBDA 2HSPA 4M7AC 3MEVA 4CI0C 2KR3A 2QQSA 3QYGB 4OB3B 2CZ1B 4CC2A 3V7RA 4J9DA 2SEMA 4XU1A 1YJ9T 1VQNQ 1U8RA 1U06A 1Y07A 2QTXA 1AWJA 4Q5WA 4M77G 3GOXA 2LZ6B 2LNVA 4DEXA 2SRCA 1VQ7Q 2HKQB 3PMIA 3HRUA 3L2RA 4PK4A 3ASKA 1R0BG 1PKTA 4KRTA 2CP2A 1ZHIA 2KT1A 1YN8A 3M0QA 3JCMh 1QP2A 1MMGA 3CD6A 3PVQA 2D8JA 2KRNA 2EBPA 2CDTA 3CXCA 5KCHA 1D1AA 1QQJA 2EJGA 3BDLA 3CCSA 3EH1A 9ATCB 2FRYA 1YBYA 4BI3A 2D6FA 2IIMA 4BUGA 2WSCE 4M7AD 2EYQA 1BKBA 4NOYA 1GL5A 4JUVA 2OTJT 1YP5A 4EMHA 3JSCA 2W10A 4KT0E 1YWPA 1PCXA 5KYYB 1D1BA 3UT1A 3OYAA 5I22A 4BY6B 4E7KA 3CCQQ 2M9UA 3M55A 3EGUA 1YITQ 1VQNA 1VUBA 4M7DB 1C1AA 2ROTA 2DRKA 3QJ6A 4GY5A 3OW2S 3SWNC 1VQ7A 1Z9QA 1B34B 4C8QA 4HKEA 2EAYA 2KE9A 4ZN3A 2PVDB 4A4HA 2ZPHB 4F7UF 1ZA2B 2LX7A 2O4XB 4ZTJA 1VYTA 1ZX6A 3INZA 2K5IA 3RNJA 4M77F 4PKCC 1B3QA 1CKAA 3NFCA 1YFNA 1CSKA 3CMAT 1JXMA 1RUWA 5GAOr 1ZSZA 1VQ8Q 1GFCA 3WVDB 2P0KA 4AFUC 2RJEA 4XTZA 2RQTA 2EJ9A 3GLXA 1VQKT 1MMAA 4QVZA 3CCQA 3M57A 4O5VA 3HRTA 3CMET 1YITA 2O9VA 1WJRA 4WF2A 2LNHB 5LJ3f 3DLLA 1WYXA 4LXCA 2ROLA 2R5MA 1Q7YR 2RH2A 4HXJA 1S72A 2J7IA 2RHIA 4EPCA 1C6VX 5KYWA 5CKHA 5KE2A 4PL6A 4J9CA 2MYSA 2LTOA 5AYFA 2CUDA 1KFZA 3MEWA 3KXTA 1I5LA 2P4RA 3CBPA 4M77B 2HBWA 3JCMQ 1WJQA 3SHWA 2JMCA 5KYUA 2RK1A 1QVFS 4KUIA 1VQ8A 1M2VB 4JJNK 3A8OB 2KROA 4JJBA 2HL3A 2JTFA 1SRMA 4JDSA 3CPWS 3CCUQ 1N9RA 5IT9E 2QEXT 4DBQA 3EGDA 3TQ7P 3MO8A 5GAN2 5DLQE 2BKDN 3OS2A 3G7ZA 3I5RA 2MWPA 4PJMA 2WSFE 4JPBW 4BY6C 1AWXA 2XKOC 1Q95G 3VS1A 5CQXA 2L3RA 3VS2A 2ZZDA 3CCJQ 3L2QA 1XQHA 2VVKA 3BY7A 3GIBA 3SFMA 2L3PA 2KNBB 5LJ5h 1MV3A 2JN0A 1VQ6Q 5GAOp 2HL5C 1LCKA 4P5NA 2YRCA 2LJ1A 2JMAA 4F7UE 1MMNA 2CREA 4BI4A 2RK2A 1KSWA 2RQRA 3CCLQ 3GNFB 2O31A 2K2MA 3META 3P8HA 4R0KA 4IUUA 2DZCA 2KEAA 4RTUA 5GAMd 5C6SA 4EMGA 1YJ9Q 1ZSZB 2X4YA 3CCUA 2W0ZA 1K73R 3CCRT 1ZUYA 4QT7A 5LJ5f 4J9IA 4JJCA 4JRPA 1VQPT 4F14A 1AOJA 1UHFA 4XU2A 3RR6A 4EMKA 3LGLA 1KC8U 1AHJB 1UTIA 5KH6A 1NZ9A 4Y28E 1SSFA 1X6BA 5IXBA 1ARKA 5I21A 1AZEA 3CCJA 2F1LA 4RTTA 2F69A 3S3OA 3I9QA 1U3OA 2DA9A 4IIOA 2QXFA 1VQ6A 1BK2A 4DOWA 2RHYA 5CO7A 5KYWB 2D0QB 3VS0A 2RJFA 2DERA 4PJOF 2DIQA 1I5OB 2YLBA 3MJXA 2VYTA 1Z9ZA 4OB1B 3QXEB 4M7AA 2KGTA 2FO0A 3RIRA 3M5AA 2DE0X 1PD0A 2RJDA 1H3ZA 4MMLA 1KIKA 3CCLA 5KYUB 3DB4A 3I55T 1WNLA 2P4TA 5GAOq 2DL8A 1TG0A 4M77C 1Q86U 1YJ9A 4KGZB 2ED1A 1WXTA 1X2QA 4A54A 5GANh 2QQRA 1M2OA 3MP8A 4X9DA 2GTJA 4BI8B 1BIAA 2O9SA 2KMTA 1Q86C 3OYEA 1KQ1A 2BIVA 2YWWA 4M75E 1ZBJA 1Q81C 1KHCA 4RG8A 3RUXA 1BCOA 1PC0A 1W70A 2L5QA 4OMLA 1VOMA 4QKUA 1QVPA 3VUBA 3LX7A 3P8DA 3H0IA 5FROA 2K3XA 3FIFA 2DIGA 1QP3A 2MPXC 2R58A 2DL5A 2QK0A 1N9SA 1KD1U 2YUNA 4IUTA 1OOTA 3CMAQ 2ED0A 2HAXA 5GANf 3A5ZB 2HKNA 4E47A 2M0YA 4N4IA 1VQ7T 2GTOA 2OTJA 3A98A 3KBGA 1KD1C 3HL8A 3X20B 1D1CA 3DLMA 1K9MR 1T0JA 3EGXA 1YIJQ 4M77D 4FIBA 4E6RA 3CMEQ 1PNJA 1QCNA 1OV3A 3LGFA 4M78E 2DXUA 2RN8A 2EKHA 2AT1B 1N8RU 3SWNA 5EG2A 2J05A 4F16A 4N4GA 3QG1A 4BD3A 2A08A 2QA4T 4EMKB 1UDLA 3VU3C 1ZSGA 2V1QA 4B9WA 4FT4A 2KDSA 2KSSA 1HD3A 2H3EB 5IH2A 2IVWA 4L59A 3CCQT 1MNEA 2Z0WA 3HFOA 2ZPGB 3CCEQ 3IQLA 4PJOE 3CMAA 1A0NB 2HCKA 4NL2A 1MGQA 4JS5A 1G3WA 1KG1A 2DVJA 3NTIA 3JB9I 2EPDA 2F5KA 4E7SA 3OYNA 4M7AB 2EVRA 2EQIA 2V26A 1OPLA 1UJYA 1M4ZA 2E70A 3A8GB 5A0GA 1YIJA 2EW3A 4UC4A 2O88A 1BI3A 3CMEA 4HT9A 1W2BP 4FYWB 3GNGA 2RB6A 1N27A 2JW4A 3VUZA 4QQGA 4RTVA 1NLPC 2I2LA 3OS5A 4OB2B 1YNZA 1VQ8T 2LX9A 3EG1A 3JCMg 4HVWA 2PNIA 4XU3A 5GAN6 2QYZA 6AT1B 1RAIB 3FC3A 2PQWA 4AT1B 3UATA 4C5IA 4J9BA 5A0DA 1RLPC 4OGEA 4L5GA 1UGSB 5KYXA 3CCEA 3TSWA 1X2KA 5GAN3 4E7HA 2A28A 1WHGA 1MHNA 3RBBB 1M1KR 4BDZA 4BB7A 2F2XA 4E2FB 2AZVA 4ZGDB 1WZOA 1KQSS 2C06A 4FSSA 3M0PA 3CCRQ 1IGQA 3E2UA 1D3BA 2DXTA 2F2WA 2VWFA 5IN1A 2X9HA 3EGXB 2QTVA 1FMWA 3CXCP 2E12A 2IG0A 3OW2A 4OMPA 1P92A 4HCKA 2J6FA 2QQAA 1NM7A 1M90R 2DXBA 4FL6A 1TUDA 8ATCB 1NJIR 2AKLA 3PT9A 3CCUT 2E41A 2A7YA 4E7ZA 4LD6A 4DBHA 1B34A 4BACA 3JCMd 2F5TX 1RAAB 5GAN4 1I8FA 4RMOA 2E64A 1VQOT 5CKFA 2FG0A 1JXOA 3R6OA 3L2WA 2CH4A 3EFOB 1GCPA 4XTUA 2VXFA 2DO3A 1BI2A 3LLRA 2EQJA 1HSQA 2DL4A 2O4XA 3JCMW 3VS5A 4Z89A 1WHKA 3MEUA 2D1XA 3CCJT 4PJOD 1VQ5T 2DF6A 3HFNA 2CP7A 1FMKA 2E4HA 3CCRA 1VQ6T 2MIOA 1M8MA 1WIEA 2K6DA 2L89A 1LVKA 5GMKl 2CT3A 2AKKA 3CPFA 3OYFA 4AG2C 3RMQA 1SHGA 1M3AA 4J9EA 3CCLT 1VQ4Q 1UG1A 2LQNA 3BW1A 4F7UG 3G4ST 4IIMA 2LVMA 4RCBA 3NTKA 1XOVA 4D8KA 1KJWA 2RHUA 4CC7A 2X4XA 3JCMb 1WA7A 1GBRA 4ZTFA 5LJ3d 3OY9A 1KK7A 3L42A 5KYXB 3I55A 1VQLT 1WFWA 1GXIE 4M77A 1AD5A 3OMGA 2E10A 4LDWA 2AK5A 2OI3A 2JNGA 1NE8A 5CR2A 3OYCA 3BDUA 1M2VA 2RA2A 4LUEA 5A2QE 1D3BB 4N0AC 2WACA 2G6FX 2QA4Q 2JTMA 3M9QA 3RKXA 4YTLA 4FM4B 1NYGA 1T3SA 3OYBA 2V8KA 2RQWA 1MNDA 4C92F 4ZGEB 1VQ4A 1XJWB 5LJ5g 3KFVA 2E6ZA 3P8BB 3FEOA 4J8OA 3SEMA 3JCMf 2X51A 2YXYA 5CCAA 3JV3A 1AVZC 3L2ZA 1PD1A 5HK0A 3QZ9B 3CC7Q 2WSEE 4C5HA 3EFSA 4C8QG 3THKA 3OBYA 1FXXA 4II1A 1C0MA 2JT4A 2LQKA 2KXDA 2RQUA 4LE9A 2E6NA 2DYBA 4ELZC 2LT4A 1WI7A 3X25B 4M75G 4MZTA 3OYGA 2X4JA 2MI6A 2K5FA 3REBB 4IUVA 2M0OA 4A4EA 2QA4A 4LD9K 3ER0A 2AZSA 1IRXA 3JCMP 2CKKA 4FW1A 5FWCA 1TSFA 4K11A 1YIJT 4WCIA 2CZ6B 2DRMA 4XTXA 1HYOA 2E5QA 2XHCA 3OYLA 4JRKA 5LJ5d 4FT2A 3I56T 2RI3A 3A8HB 1OU8A 3OS0A 1Q7YU 4PFZA 1B7TA 2EYXA 4FU6A 4J6WA 3CC7A 3PIPA 1QKXA 4DA4A 3SDZA 4M78G 3EFRA 4F7UB 4XTVA 3MHXA 4CC3A 3TREA 2VB6A 5GANg 4IURA 3VS7A 4GLMA 2P0PA 1Y57A 4AFQC 2XG8D 3CCET 2RNAA 2D9TA 1UUEA 2CSQA 2CP5A 4C0GA 2LT1A 1PSEA 2JZ2A 2L0AA 2RI2A 3OMCA 2QDYB 1KQ2A 4C8QF 2VKNA 1LOJA 2NUTA 3QDFA 2M51A 3PIOA 4C92E 2YLCA 4PJOG 4QVCA 2RI5A 4PJJA 4MDWA 1VQOQ 3QDRB 4FYXB 1AZGB 4M75F 1RAHB 1Y96A 3OYDA 2LRQA 2KBTA 3N5BB 4JZ4A 2RMOA 2RD1A 2RF0A 2O01E 1W1FA 3X28B 1LJOA 1N6AA 1WHMA 4Z02A 1VQ5Q 2XMFA 2LMJA 3VV0A 4FW2A 4LUDA 1UEBA 2FZGB 3S3NA 3J81E 1JJ2P 2DZ9A 4CC4B 1XTDA 1Y7XA 5IHKA 1NEGA 2DJQA 3CC4T 1PKSA 5IHNA 4FYYB 5GANd 1NYFA 2EGEA 3G4SQ 2FL7A 2DFUA 5CVIA 4OVAA 3QPHA 1M1GA 1K73U 1Q82U 3HKSA 4M78F 1WDXA 3QBYA 3FB9A 4J6XA 3LH0A 1YJWT 2ZAEA 1VIEA 1UGPB 3G71T 1QVGS 1IZ6A 2JS2A 4M75B 1YHQQ 1I0CA 4A4KA 1SSHA 3C94A 1VQOA 1Q82C 2DAQA 1VYVA 1VQLQ 4OB0B 5GAOl 4C0FA 1G3YA 1KC8C 2CH4W 4R56A 1VQ5A 2R57A 1LNXA 1UGQB 1FYNA 4J9HA 3M4YA 3R6NA 2GNCA 1PWTA 2K7AA 3UA7A 5HCKA 2XDDA 3M58A 3VS4A 1K8AU 2LQWA 5KE3A 2OX7A 1EFNA 2DTIA 2HBPA 4A4GA 2I0NA 1UB4A 4R55A 5CKDA 1K8AC 1JBMA 3G4SA 4X9CA 4C8QE 1U1SA 4M78B 1E6GA 4A53A 5EC7A 3O8VA 4V2SA 3C0CA 1G5VA 2NUTB 3QYHB 2DNUA 4IUPA 1FMVA 2YDLA 2DL7A 1YHQA 2DTHA 3GBQA 1M5Q1 1SPKA 2QASA 1IHVA 3E9GA 2P0QA 5GAMj 4MZPA 1JJ2A 2CSIA 3JCMc 1Q86R 3X26B 1VQLA 1Y96B 2HD0A 1QCFA 5I2SA 3VS6A 1V76A 1YJNT 1VQ4T 1Q81R 1KQSA 1ACMB 4PFPA 4HCZA 5I2MA 5L8RE 4OP0A 4PJOB 3M0UA 5GJVB 3VYGA 3RDVA 4N0AA 3NTHA 3AHUA 3M0TA 2XU8A 4J5YA 1EIFA 1I4K1 1M27C 1QKWA 1BBZA 3E19A 5DLOA 2DL3A 1JO8A 2KRSA 1OPKA 5DM7R 1KD1R 2QAZA 3NPFA 1RAGB 2QGFB 5GAN5 2CP3A 5AT1B 2K3YA 3A8LB 3M56A 2JJ9A 4AG1C 1G3SA 5FU7B 2H3JA 1OEBA 4QQ6A 2J06A 2QDLA 5LL6S 3I56Q 3NGPA 3GP8A 2E3IA 1X6OA 3M59A 2CUBA 3NMZC 4DOVA 1OYXA 4MZMA 1WXUA 1RLQC 1QMCA 4OMFB 1N8RC 4XTWA 2DPPB 3OW2P 4ATOA 4M75C 5FU6C 2OTLT 1AT1B 1WQWA 4X34A 1WX6A 2A36A 3EFOA 2GBQA 1SKUB 2MCNA 2XI9A 1D0ZA 1RL2A 3SD4A 1VQ9T 2Y4YA 1TTHB 3U23A 3CC7T 2JM9A 2EWNA 3UDCA 3ULRB 1R77A 2K57A 4OGCA 2HQEA 2COYA 1RI9A 3I5SA 3CC2T 1IO6A 4E7LA 1WGSA 1OI1A 2E65A 2GGRA 1OX8A 2GF7A 4D6WA 4PFOA 1JQQA 1PG5B 4EIKA 1UECA 3I56A 2LC4A 2FZKB 4C0DC 4C8QD 1G83A 3ZFJA 2EGCA 2QG9B 4M78C 1XNIA 3LYIA 4KGXB 1HK9A 3CQTA 3J80E 3OA6A 4M75D 4QQDA 2CZ7B 1E6HA 2M02A 5FLXE 5D6XA 1RACB 4ANJA 1WQ7A 1B07A 3VRZA 2EFIA 1TXQA 3L2VA 3CC4Q 2LCLA 1RABB 3G6ET 1V29B 3OYKA 2DEUA 4PNOA 2IPOB 3TEEA 2KI7A 2H8HA 3OYMA 3E1SA 4PJOC 1QVFP 1YJWQ 2L8DA 1GCQC 2ATCB 2EKOA 4ZGJB 3G71Q 2M16A 3LW5E 3MPUB 2VC8A 1TH7A 5IAYA 2DXCA 1TOVA 3CPWP 1WLPB 1DJ7B 1FX7A 2HSEB 1MUZA 1CKBA 3CCVT 2K79A 3QSUA 2AIRB 1RI0A 1N5ZA 2QI2A 1X69A 2JTEA 4M7AE 4M78D 5FU7C 1TS9A 3DB3A 5GMKj 3X24B 4M7DG 1NJIU 4ME7A 4IKFA 2EQMA 5GAMe 3JB9H 2E1HA 2NWMA 2FRWA 3PTAA 2XIDA 2D0NA 2QGGA 2C0IA 2BZYA 3ZEHA 2J6KA 1J3TA 2FPDA 3DKMA 4JJDA 3CC4A 2NUPB 2FEIA 4C92G 1VA7A 4HVUA 2CP6A 4D8DA 4HVVA 3CCMT 3QO3A 2VGNA 5CIUA 1AEYA 4XQ3A 5J26A 3I35A 1YJWA 3AT1B 2DX1A 2YUOA 3OBWA 5CKBA 3BE3A 3G71A 2VGMA 2CS7A 3LH5A 4OMMA 3HRSA 1GRIA 5HKCA 1ZBXA 2EQUA 5GAN7 3FDRA 1JRIA 2HQXA 2COWA 3V8JA 3QKJA 1YJNQ 1UHCA 1G3TA 2P84A 2OJ2A 1H641 3JCMX 2NUZA 5GAOn 2XD0A 2EYWA 2K3BA 3M0RA 4F04B 3JB9G 4DQ2A 5J3BA 4JRQA 2DK3A 4RKUE 2KT8A 4IUQA 2JUFA 1YHQT 4GLKA 1QVFA 1JU5C 2EJFA 2V8IA 4JZ3A 4F7UA 3QWYA 4ZNXA 5IHIA 1BU1A 2BUDA 1WHLA 3CPWA 1WPYA 3FLGA 1NPPA 2EGAA 3MKDA 5D6WA 4M7DF 2DM1A 2BTTA 4LN2A 3HP9A 1W4SA 5GAOm 3URGA 2K5LA 4E7IA 1ZA1B 2PVOB 2FZCB 3PGGA 2KY9A 1JB0E 2PTKA 2BZ8A 2E5KA 1PRMC 2YUPA 3FJ5A 3MCAB 3SB2A 1K9AA 5J39A 1AWOA 2K4YA 4HA8A 2B86A 2COZA 3D7SB 3CBMA 2KXCA 2LCSA 1YJNA 2LP5A 2GQVA 2ZPIB 2OTLQ 4RCCA 1ZUUA 2DVEA 1EX4A 2FB7A 5GAN8 3EG9B 1NPRA 2ABLA 1T0HA 3JRZA 3PVLA 1K0XA 2EYYA 1UGRB 1K1ZA 7AT1B 1VQ9Q 3M54A 1OQKA 2MF2A 3EHQA 2DBKA 4AFZC 4OF1A 2HEQA 4KH0B 2VUBA 3CC2Q 1QWFA 1AWWA 4PJNA 4OMNA 2AHJB 3J7AF 3V7SA 4QVDA 4LDVA 3Q1JA 3LWIA 1G2BA 5D6YA 2PU9B 2MAMA 3PMTA 1S72Q 2RO0A 3EHRA 5LJ3j 1QVGA 2KVQG 4J9FA 4BDYA 3JB9F 1RADB 3GF5A 5CKEA 4Z88A 1ABQA 1I07A 4XU0A 3VKIA 1IGUA 4C92B 1I81A 3LWHA 3VS3A 5LJ3h 4M75A 2ECZA 5FW9A 4KGVB 2OTLA 2DD5A 2K9GA 1WHHA 2Y90A 1UFFA 2ZGWA 3G6EQ 5GMKe 1W2BS 2DEQA 4J7FA 5IXFA 1VQ9A 4LDUA 3V8LA 2BZXA 1UJ0A 4JLGA 2FPEA 3OYJA 2FVUA 2JVVA 2XICA 2NLUA 4TVRA 3H6ZA 3RESA 3RKYA 4FCYA 1Q7YC 2KK4A 4A4FA 4E7JA 3CC2A 2KRMA 4Z8AA 1PHTA 4M7DE 1WHJA 4JLIA 4FYVB 2EIFA 3O5ZA 3CCVQ 2RHZA 4KUDK 1MMDA 1U1TA 2CT4A 2V1RA 4M78A 1X75C 1QW1A 1IB8A 1Y0MA 2CP0A 2JM8A 4AFSC 8AT1B 5FWBA 1D0YA 1VQMQ 2ZCFB 3NHNA 4HT8A 1PM3A 1BI1A 4RTXA 5GAMg 1PSFA 3ZL7C 3MP1A 5DY9A 1M3CA 1OX9A 5D7UA 4NL3A 3G6EA 2C0TA 3OYHA 1QCOA 1K76A 3M0SA 3CXCS 1OULA 3E9FA 2PZ1A 2MK5A 3CCMQ 4O6JA 3OSSC 4PJOA 4NS5A 3MP6A 1GCQA 5LJ5j 1HXDA 4RTWA 2BE7D 1M8VA 1KQSP 2RHXA 4L6V5 3CCVA 3JCMe
chains in the Genus database with same CATH topology
1NM7A 1QWEA 2ROTA 2J06A 2DRKA 2QDLA 3NGPA 1Z9QA 1TUDA 3H0FA 2AKLA 1W6XA 2CUBA 3NMZC 2KE9A 3TVTA 2YUQA 1H92A 1WXUA 1RLQC 2FG0A 1JXOA 4X1VA 2O2OA 2X3WD 2CH4A 2LX7A 1BB9A 1GCPA 1VYTA 1ZX6A 1HSQA 1ABOA 2DL4A 3RNJA 1WX6A 2A36A 1B3QA 1CKAA 1V1CA 2GBQA 3VS5A 3QWXX 4Z89A 2D1XA 1CSKA 2MCNA 1JXMA 2DF6A 5ECAA 1RUWA 2LJ3A 1FMKA 1GFCA 4AFUC 2MIOA 4RTYA 2RQTA 3H0HA 1M8MA 1S1NA 2C0OA 1WIEA 3U23A 2JM9A 2K6DA 1M30A 3ULRB 2CT3A 1RI9A 3I5SA 2AKKA 1IO6A 4AG2C 1HJDA 2O9VA 1SHGA 1M3AA 4J9EA 2GGRA 2LNHB 1UG1A 2LQNA 1WYXA 1JQQA 4EIKA 4IIMA 1UECA 2ENMA 2ROLA 1G83A 4HXJA 2KYMA 1XOVA 2J7IA 4D8KA 1KJWA 4CC7A 3EG0A 2EGCA 4J9CA 2MOXA 3CQTA 2CUDA 1WA7A 4LNPA 1GBRA 1KFZA 1U5SA 1E6HA 2P4RA 1E7OA 2HBWA 3SHWA 2JMCA 1WFWA 1UE9A 1B07A 3VRZA 5L23A 2F2VA 4ESRA 1AD5A 4M4ZA 3UF4A 1YCSB 2YT6A 3EG2A 2DMOA 2AK5A 2OI3A 2KROA 4JJBA 1NEBA 2EYZA 1SRMA 2H8HA 4LUEA 4OMQA 2G6FX 4GBQA 1GCQC 3I5RA 1NYGA 2L2PA 1T3SA 2RQWA 2DLPA 1T3LA 4OMOA 4RTZA 2J6OA 3KFVA 4JPBW 1AWXA 1WLPB 3SEMA 1MUZA 1CKBA 3VS1A 2K79A 3VS2A 1SEMA 5I11A 2DILA 1N5ZA 3JV3A 1AVZC 1X69A 2ESWA 2JTEA 2VVKA 1M3BA 2L3PA 2KNBB 1MV3A 1GFDA 1LCKA 1MV0B 2LJ1A 2JMAA 2CREA 1VYUA 3THKA 2NWMA 2FRWA 2D0NA 2RPNA 4ORZA 2C0IA 4A63B 2BZYA 3PE0A 1KSWA 2J6KA 2JT4A 2RQRA 1J3TA 2FPDA 2KXDA 2RQUA 2O31A 4JJDA 2DYBA 4LE9A 1QLYA 2K2MA 4R0KA 1I1JA 1WI7A 2KEAA 2FEIA 4RTUA 4DEYA 1X6GA 2OAWA 1VA7A 4HVUA 3REBB 2W0ZA 4D8DA 4HVVA 1ZUYA 4QT7A 2RQVA 4J9IA 4JJCA 1AEYA 1TUCA 1AOJA 4F14A 1UHFA 3I35A 2DX1A 2AZSA 2YUOA 1X27A 4Y92A 1UTIA 3LH5A 4OMMA 1GRIA 1NG2A 5FWCA 4K11A 4WCIA 1X6BA 1PRLC 5IXBA 1ARKA 2DRMA 1AZEA 4RTTA 1NLOC 2GQIA 1UHCA 3I9QA 2OJ2A 2FPFA 2NUZA 1U3OA 2DA9A 4IIOA 1BK2A 2EYWA 2K3BA 3VS0A 2EYXA 2JXBA 3M0RA 1QKXA 1Z9ZA 2KGTA 2FO0A 2DE0X 4RUGA 2KT8A 1KIKA 1JU5C 2YSQA 4CC3A 4JZ3A 3QWYA 4ZNXA 3VS7A 4GLMA 5IHIA 1BU1A 2DL8A 2DBMA 1Y57A 1TG0A 3VRYA 4AFQC 2RNAA 5GJWB 1SHFA 1UUEA 2ED1A 1WXTA 1X2QA 2CSQA 2EGAA 2DM1A 2BTTA 4LN2A 2GTJA 2L0AA 2O9SA 1GBQA 2VKNA 2M51A 1ZBJA 1JEGA 2L3QA 2BZ8A 2E5KA 1PRMC 2PTKA 2YUPA 3FJ5A 3REAB 1W70A 2LJ0A 3TSZA 1K9AA 4OMLA 1AWOA 2B86A 1AZGB 1ZLMA 2KXCA 3H0IA 2LCSA 2LP5A 2KBTA 4JZ4A 2DL5A 1ZUUA 2RMOA 2RF0A 1W1FA 1H3HA 2YUNA 2ABLA 1T0HA 1OOTA 3PVLA 2ED0A 1K0XA 2KYBA 2XMFA 2LMJA 2M0YA 2EYYA 2GTOA 3A98A 4LUDA 1X43A 2HDAA 1K1ZA 2L3SA 4CC4B 2D8HA 1T0JA 3EHQA 2DBKA 4AFZC 2HEQA 5IHKA 1NEGA 2DJQA 4E6RA 1QWFA 1AWWA 3H41A 1PKSA 1PNJA 5IHNA 1UGVA 4OMNA 3EG3A 1OV3A 1K0SA 1NYFA 2EGEA 2RN8A 1WXBA 1G2BA 2EKHA 2A37A 3UA6A 3EHRA 1H8KA 2J05A 4F16A 4J9FA 2A08A 4Z88A 1SRLA 1WDXA 1UDLA 1ZSGA 2V1QA 1ABQA 1I07A 1HD3A 5IH2A 2JS2A 2X3XD 1I0CA 1SSHA 4J9GA 3VS3A 4F17A 2ECZA 5FW9A 1VYVA 2JS0A 2K9GA 3IQLA 1ZUKA 2CH4W 1UFFA 1A0NB 2HCKA 1FYNA 4J9HA 1YWOA 3R6NA 2DVJA 2GNCA 5IXFA 2EPDA 1PWTA 2K7AA 3UA7A 5HCKA 1K4US 2BZXA 2EVRA 1UJ0A 2FPEA 2EQIA 2HSPA 1OPLA 1UJYA 2KR3A 3VS4A 2EW3A 2O88A 2LQWA 2KRMA 4CC2A 4Z8AA 1EFNA 1PHTA 2I0NA 4J9DA 2SEMA 3O5ZA 1U06A 2JW4A 1AWJA 4RTVA 1NLPC 1E6GA 2LZ6B 4DEXA 5EC7A 1YNZA 2SRCA 2CT4A 3C0CA 3EG1A 2V1RA 4HVWA 2DNUA 1Y0MA 2PNIA 2YDLA 2JM8A 4AFSC 2DL7A 3GBQA 1SPKA 5FWBA 3NHNA 3UATA 1PKTA 4KRTA 2CSIA 4RTXA 4J9BA 3M0QA 2KT1A 1RLPC 1YN8A 3PVQA 2D8JA 2KRNA 2EBPA 1QCFA 2CDTA 3TSWA 3VS6A 1X2KA 3ZL7C 2A28A 1M3CA 3RBBB 2C0TA 2FRYA 1K76A 2F2XA 3M0SA 2IIMA 3M0UA 2PZ1A 2AZVA 5GJVB 4FSSA 3M0PA 1GL5A 1YP5A 2W10A 1YWPA 3M0TA 1GCQA 1M27C 1QKWA 1BBZA 2F2WA 2VWFA 4RTWA 5I22A 2DL3A 1JO8A 2KRSA 1OPKA 3EGUA 3NPFA 4OMPA 4AG1C 4HCKA 2J6FA 1OEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NM7 A;  1QWE A;  2ROT A;  2J06 A;  2DRK A;  2QDL A;  3NGP A;  1Z9Q A;  1TUD A;  3H0F A;  2AKL A;  1W6X A;  2CUB A;  3NMZ C;  2KE9 A;  3TVT A;  2YUQ A;  1H92 A;  1WXU A;  1RLQ C;  2FG0 A;  1JXO A;  4X1V A;  2O2O A;  2X3W D;  2CH4 A;  2LX7 A;  1BB9 A;  1GCP A;  1VYT A;  1ZX6 A;  1HSQ A;  1ABO A;  2DL4 A;  3RNJ A;  1WX6 A;  2A36 A;  1B3Q A;  1CKA A;  1V1C A;  2GBQ A;  3VS5 A;  3QWX X;  4Z89 A;  2D1X A;  1CSK A;  2MCN A;  1JXM A;  2DF6 A;  5ECA A;  1RUW A;  2LJ3 A;  1FMK A;  1GFC A;  4AFU C;  2MIO A;  4RTY A;  2RQT A;  3H0H A;  1M8M A;  1S1N A;  2C0O A;  1WIE A;  3U23 A;  2JM9 A;  2K6D A;  1M30 A;  3ULR B;  2CT3 A;  1RI9 A;  3I5S A;  2AKK A;  1IO6 A;  4AG2 C;  1HJD A;  2O9V A;  1SHG A;  1M3A A;  4J9E A;  2GGR A;  2LNH B;  1UG1 A;  2LQN A;  1WYX A;  1JQQ A;  4EIK A;  4IIM A;  1UEC A;  2ENM A;  2ROL A;  1G83 A;  4HXJ A;  2KYM A;  1XOV A;  2J7I A;  4D8K A;  1KJW A;  4CC7 A;  3EG0 A;  2EGC A;  4J9C A;  2MOX A;  3CQT A;  2CUD A;  1WA7 A;  4LNP A;  1GBR A;  1KFZ A;  1U5S A;  1E6H A;  2P4R A;  1E7O A;  2HBW A;  3SHW A;  2JMC A;  1WFW A;  1UE9 A;  1B07 A;  3VRZ A;  5L23 A;  2F2V A;  4ESR A;  1AD5 A;  4M4Z A;  3UF4 A;  1YCS B;  2YT6 A;  3EG2 A;  2DMO A;  2AK5 A;  2OI3 A;  2KRO A;  4JJB A;  1NEB A;  2EYZ A;  1SRM A;  2H8H A;  4LUE A;  4OMQ A;  2G6F X;  4GBQ A;  1GCQ C;  3I5R A;  1NYG A;  2L2P A;  1T3S A;  2RQW A;  2DLP A;  1T3L A;  4OMO A;  4RTZ A;  2J6O A;  3KFV A;  4JPB W;  1AWX A;  1WLP B;  3SEM A;  1MUZ A;  1CKB A;  3VS1 A;  2K79 A;  3VS2 A;  1SEM A;  5I11 A;  2DIL A;  1N5Z A;  3JV3 A;  1AVZ C;  1X69 A;  2ESW A;  2JTE A;  2VVK A;  1M3B A;  2L3P A;  2KNB B;  1MV3 A;  1GFD A;  1LCK A;  1MV0 B;  2LJ1 A;  2JMA A;  2CRE A;  1VYU A;  3THK A;  2NWM A;  2FRW A;  2D0N A;  2RPN A;  4ORZ A;  2C0I A;  4A63 B;  2BZY A;  3PE0 A;  1KSW A;  2J6K A;  2JT4 A;  2RQR A;  1J3T A;  2FPD A;  2KXD A;  2RQU A;  2O31 A;  4JJD A;  2DYB A;  4LE9 A;  1QLY A;  2K2M A;  4R0K A;  1I1J A;  1WI7 A;  2KEA A;  2FEI A;  4RTU A;  4DEY A;  1X6G A;  2OAW A;  1VA7 A;  4HVU A;  3REB B;  2W0Z A;  4D8D A;  4HVV A;  1ZUY A;  4QT7 A;  2RQV A;  4J9I A;  4JJC A;  1AEY A;  1TUC A;  1AOJ A;  4F14 A;  1UHF A;  3I35 A;  2DX1 A;  2AZS A;  2YUO A;  1X27 A;  4Y92 A;  1UTI A;  3LH5 A;  4OMM A;  1GRI A;  1NG2 A;  5FWC A;  4K11 A;  4WCI A;  1X6B A;  1PRL C;  5IXB A;  1ARK A;  2DRM A;  1AZE A;  4RTT A;  1NLO C;  2GQI A;  1UHC A;  3I9Q A;  2OJ2 A;  2FPF A;  2NUZ A;  1U3O A;  2DA9 A;  4IIO A;  1BK2 A;  2EYW A;  2K3B A;  3VS0 A;  2EYX A;  2JXB A;  3M0R A;  1QKX A;  1Z9Z A;  2KGT A;  2FO0 A;  2DE0 X;  4RUG A;  2KT8 A;  1KIK A;  1JU5 C;  2YSQ A;  4CC3 A;  4JZ3 A;  3QWY A;  4ZNX A;  3VS7 A;  4GLM A;  5IHI A;  1BU1 A;  2DL8 A;  2DBM A;  1Y57 A;  1TG0 A;  3VRY A;  4AFQ C;  2RNA A;  5GJW B;  1SHF A;  1UUE A;  2ED1 A;  1WXT A;  1X2Q A;  2CSQ A;  2EGA A;  2DM1 A;  2BTT A;  4LN2 A;  2GTJ A;  2L0A A;  2O9S A;  1GBQ A;  2VKN A;  2M51 A;  1ZBJ A;  1JEG A;  2L3Q A;  2BZ8 A;  2E5K A;  1PRM C;  2PTK A;  2YUP A;  3FJ5 A;  3REA B;  1W70 A;  2LJ0 A;  3TSZ A;  1K9A A;  4OML A;  1AWO A;  2B86 A;  1AZG B;  1ZLM A;  2KXC A;  3H0I A;  2LCS A;  2LP5 A;  2KBT A;  4JZ4 A;  2DL5 A;  1ZUU A;  2RMO A;  2RF0 A;  1W1F A;  1H3H A;  2YUN A;  2ABL A;  1T0H A;  1OOT A;  3PVL A;  2ED0 A;  1K0X A;  2KYB A;  2XMF A;  2LMJ A;  2M0Y A;  2EYY A;  2GTO A;  3A98 A;  4LUD A;  1X43 A;  2HDA A;  1K1Z A;  2L3S A;  4CC4 B;  2D8H A;  1T0J A;  3EHQ A;  2DBK A;  4AFZ C;  2HEQ A;  5IHK A;  1NEG A;  2DJQ A;  4E6R A;  1QWF A;  1AWW A;  3H41 A;  1PKS A;  1PNJ A;  5IHN A;  1UGV A;  4OMN A;  3EG3 A;  1OV3 A;  1K0S A;  1NYF A;  2EGE A;  2RN8 A;  1WXB A;  1G2B A;  2EKH A;  2A37 A;  3UA6 A;  3EHR A;  1H8K A;  2J05 A;  4F16 A;  4J9F A;  2A08 A;  4Z88 A;  1SRL A;  1WDX A;  1UDL A;  1ZSG A;  2V1Q A;  1ABQ A;  1I07 A;  1HD3 A;  5IH2 A;  2JS2 A;  2X3X D;  1I0C A;  1SSH A;  4J9G A;  3VS3 A;  4F17 A;  2ECZ A;  5FW9 A;  1VYV A;  2JS0 A;  2K9G A;  3IQL A;  1ZUK A;  2CH4 W;  1UFF A;  1A0N B;  2HCK A;  1FYN A;  4J9H A;  1YWO A;  3R6N A;  2DVJ A;  2GNC A;  5IXF A;  2EPD A;  1PWT A;  2K7A A;  3UA7 A;  5HCK A;  1K4U S;  2BZX A;  2EVR A;  1UJ0 A;  2FPE A;  2EQI A;  2HSP A;  1OPL A;  1UJY A;  2KR3 A;  3VS4 A;  2EW3 A;  2O88 A;  2LQW A;  2KRM A;  4CC2 A;  4Z8A A;  1EFN A;  1PHT A;  2I0N A;  4J9D A;  2SEM A;  3O5Z A;  1U06 A;  2JW4 A;  1AWJ A;  4RTV A;  1NLP C;  1E6G A;  2LZ6 B;  4DEX A;  5EC7 A;  1YNZ A;  2SRC A;  2CT4 A;  3C0C A;  3EG1 A;  2V1R A;  4HVW A;  2DNU A;  1Y0M A;  2PNI A;  2YDL A;  2JM8 A;  4AFS C;  2DL7 A;  3GBQ A;  1SPK A;  5FWB A;  3NHN A;  3UAT A;  1PKT A;  4KRT A;  2CSI A;  4RTX A;  4J9B A;  3M0Q A;  2KT1 A;  1RLP C;  1YN8 A;  3PVQ A;  2D8J A;  2KRN A;  2EBP A;  1QCF A;  2CDT A;  3TSW A;  3VS6 A;  1X2K A;  3ZL7 C;  2A28 A;  1M3C A;  3RBB B;  2C0T A;  2FRY A;  1K76 A;  2F2X A;  3M0S A;  2IIM A;  3M0U A;  2PZ1 A;  2AZV A;  5GJV B;  4FSS A;  3M0P A;  1GL5 A;  1YP5 A;  2W10 A;  1YWP A;  3M0T A;  1GCQ A;  1M27 C;  1QKW A;  1BBZ A;  2F2W A;  2VWF A;  4RTW A;  5I22 A;  2DL3 A;  1JO8 A;  2KRS A;  1OPK A;  3EGU A;  3NPF A;  4OMP A;  4AG1 C;  4HCK A;  2J6F A;  1OEB A; 
#chains in the Genus database with same CATH topology
 4C5E A;  1QWE A;  4M7D C;  2YRD A;  4B9X A;  4C8Q B;  1TU0 B;  5CAI A;  3H0F A;  4CRI A;  1OZ2 A;  3JCM V;  1W6X A;  3JAM E;  1VQM A;  3TVT A;  5A0L A;  2YUQ A;  1YI2 T;  2A0F B;  1H92 A;  3HTR A;  4M77 E;  2LQ8 A;  4X1V A;  2O2O A;  5FU6 B;  2X3W D;  3HSB A;  1BB9 A;  1K73 C;  4C92 C;  2NYS A;  2DTO A;  5FRN A;  1ABO A;  2Y4X A;  5CK9 A;  2LDM A;  4MMK A;  2DJZ A;  1V1C A;  3QWX X;  2JOY A;  1Q82 R;  5ECA A;  2LJ3 A;  3CCM A;  3OS1 A;  2ZPE B;  4RTY A;  3H0H A;  1S1N A;  4HCC A;  2C0O A;  1KC8 R;  1R8O B;  3F70 A;  1M30 A;  1WJS A;  1BCM A;  4M7A G;  4DBR A;  2M1H A;  2XDP A;  1HJD A;  1OU9 A;  4KBM B;  4M7D D;  4PLL A;  4ELY C;  3FJP A;  4C0D B;  2ENM A;  2HNI A;  3V8K A;  5LJ3 e;  3M4G A;  3JB9 J;  2KYM A;  3EG0 A;  2MMP A;  2YHT A;  2OTJ Q;  2MOX A;  1K8A R;  4J6Y A;  4LNP A;  2MWO A;  5GAN j;  2RJC A;  3RER A;  1VIF A;  4C92 D;  1U5S A;  5HK3 A;  4VUB A;  1E7O A;  3CD6 T;  2ZPB B;  2CYZ B;  3QJY A;  1UE9 A;  4C5G A;  5L23 A;  2F2V A;  4ESR A;  1BIB A;  4M4Z A;  3UF4 A;  1YCS B;  2YT6 A;  3A1P A;  3EG2 A;  1Q81 U;  3CCS T;  2CZ0 B;  2DMO A;  5GMK m;  2KAF A;  1M9S A;  3EGD B;  5GAM h;  1NEB A;  2EYZ A;  1IHW A;  3KUF A;  5HY6 A;  4OMQ A;  4BE2 A;  1TWB A;  4GBQ A;  2OAU A;  1D09 B;  3QHS A;  2L2P A;  1ZQ1 A;  2DLP A;  1T3L A;  4OMO A;  1RAF B;  4RTZ A;  2QQ9 A;  2J6O A;  1K9M U;  1X01 A;  1VQN T;  1O9S A;  1IRE B;  1SEM A;  5I11 A;  1TUG B;  2DIL A;  1F1B B;  3JB9 D;  2GFU A;  2ESW A;  3OQ5 A;  3V7C A;  1K9M C;  1M3B A;  5M9O A;  1GFD A;  2GFA A;  3RKW A;  5GAM f;  1Y71 A;  1MV0 B;  4B6M A;  4C8Q C;  1VQK Q;  4M7A F;  1VYU A;  3OSV A;  3C12 A;  5FRM A;  3HPW A;  1SG5 A;  3H9N A;  2XDB A;  2X4W A;  1LPL A;  3PNW C;  2RPN A;  4ORZ A;  4A63 B;  3ME9 A;  4EDU A;  3PE0 A;  3FRN A;  1NBE B;  5C0M A;  1QLY A;  1I1J A;  2EQK A;  4DEY A;  1N8R R;  1X6G A;  2OAW A;  2NUP A;  2VXE A;  4KH1 B;  2E3H A;  1ZSZ C;  2HMA A;  2RQV A;  4JRI A;  3OYI A;  1TUC A;  3A8M B;  3CBO A;  4MDX A;  1X27 A;  5LJ5 e;  4Y92 A;  4BE1 A;  2LCC A;  1NG2 A;  1YIT T;  1PRL C;  5GMK i;  3GPL A;  1NLO C;  2GQI A;  2HZY A;  2DD4 A;  2RM4 A;  3VYH B;  4Y91 A;  2FPF A;  4LDY A;  2FHD A;  1S72 T;  3L1A A;  2QQB A;  4J7I A;  2JXB A;  2QEX Q;  1VQK A;  4RUG A;  1R0C B;  3UWN A;  2YSQ A;  2A3L A;  3UPU A;  4QW2 A;  4N4H A;  2FYK A;  3PFS A;  4XAX B;  2DBM A;  2GCX A;  3VRY A;  3MEA A;  4RG2 A;  4XK8 E;  5GJW B;  3H8Z A;  1SHF A;  4AMC A;  3RMS A;  4JS4 A;  3CEY A;  3L2U A;  2ZPF B;  1EZZ B;  1M1K U;  2K2V A;  2DET A;  1GBQ A;  3EH2 A;  1O75 A;  2BE9 B;  1JEG A;  2KQW A;  2L3Q A;  3REA B;  3TSZ A;  2LJ0 A;  1YI2 Q;  5KYN A;  1M1K C;  3TU4 K;  1ZLM A;  3BFM A;  1RAE B;  2R5A A;  1JJ2 S;  1M1F A;  3VJP A;  1KHI A;  1H3H A;  3HHT B;  2QEX A;  1SF9 A;  3C4S A;  2KYB A;  4HCB A;  3EG9 A;  5CQY A;  4J83 A;  1M90 U;  1VQP Q;  1X43 A;  2HDA A;  2L3S A;  3OB9 A;  2B8A A;  5GAN e;  4ZN1 A;  3JCM J;  1VQM T;  2DKG A;  1G8X A;  2D8H A;  5KYY A;  3QII A;  3TCJ A;  4PLI A;  1FWZ A;  2PVG B;  1M90 C;  4WTO B;  1OZ3 A;  3WXM B;  3H41 A;  1NJI C;  1IXD A;  1UGV A;  5GMK h;  3EG3 A;  4DBF A;  2YRV A;  1K0S A;  3SWN B;  1D0X A;  2PUK B;  1WXB A;  2PUO B;  4M7D A;  2DYI A;  2A37 A;  3UA6 A;  4KUL A;  1H8K A;  5LJ3 g;  4C0Z A;  2X35 A;  1SRL A;  2XK0 A;  4EMK C;  3C95 A;  1YI2 A;  3OYY A;  2HQH A;  2X3X D;  4FSX A;  3G1J A;  4J9G A;  4PJL A;  4BE0 A;  1BYM A;  4F17 A;  3I55 Q;  1BI0 A;  3T9N A;  3QUI A;  1YCY A;  4C92 A;  3CD6 Q;  2G3R A;  2JS0 A;  2V8J A;  3QZ5 B;  1W2B A;  1ZUK A;  4XTY A;  3CCS Q;  1QVG P;  3M53 A;  1VQP A;  4LDX A;  1YWO A;  3S3M A;  5KCO A;  3S6W A;  3WVE B;  3EAE A;  2CGH A;  2VV5 A;  1K4U S;  2VAS A;  3ZBD A;  2HSP A;  4M7A C;  3MEV A;  4CI0 C;  2KR3 A;  2QQS A;  3QYG B;  4OB3 B;  2CZ1 B;  4CC2 A;  3V7R A;  4J9D A;  2SEM A;  4XU1 A;  1YJ9 T;  1VQN Q;  1U8R A;  1U06 A;  1Y07 A;  2QTX A;  1AWJ A;  4Q5W A;  4M77 G;  3GOX A;  2LZ6 B;  2LNV A;  4DEX A;  2SRC A;  1VQ7 Q;  2HKQ B;  3PMI A;  3HRU A;  3L2R A;  4PK4 A;  3ASK A;  1R0B G;  1PKT A;  4KRT A;  2CP2 A;  1ZHI A;  2KT1 A;  1YN8 A;  3M0Q A;  3JCM h;  1QP2 A;  1MMG A;  3CD6 A;  3PVQ A;  2D8J A;  2KRN A;  2EBP A;  2CDT A;  3CXC A;  5KCH A;  1D1A A;  1QQJ A;  2EJG A;  3BDL A;  3CCS A;  3EH1 A;  9ATC B;  2FRY A;  1YBY A;  4BI3 A;  2D6F A;  2IIM A;  4BUG A;  2WSC E;  4M7A D;  2EYQ A;  1BKB A;  4NOY A;  1GL5 A;  4JUV A;  2OTJ T;  1YP5 A;  4EMH A;  3JSC A;  2W10 A;  4KT0 E;  1YWP A;  1PCX A;  5KYY B;  1D1B A;  3UT1 A;  3OYA A;  5I22 A;  4BY6 B;  4E7K A;  3CCQ Q;  2M9U A;  3M55 A;  3EGU A;  1YIT Q;  1VQN A;  1VUB A;  4M7D B;  1C1A A;  2ROT A;  2DRK A;  3QJ6 A;  4GY5 A;  3OW2 S;  3SWN C;  1VQ7 A;  1Z9Q A;  1B34 B;  4C8Q A;  4HKE A;  2EAY A;  2KE9 A;  4ZN3 A;  2PVD B;  4A4H A;  2ZPH B;  4F7U F;  1ZA2 B;  2LX7 A;  2O4X B;  4ZTJ A;  1VYT A;  1ZX6 A;  3INZ A;  2K5I A;  3RNJ A;  4M77 F;  4PKC C;  1B3Q A;  1CKA A;  3NFC A;  1YFN A;  1CSK A;  3CMA T;  1JXM A;  1RUW A;  5GAO r;  1ZSZ A;  1VQ8 Q;  1GFC A;  3WVD B;  2P0K A;  4AFU C;  2RJE A;  4XTZ A;  2RQT A;  2EJ9 A;  3GLX A;  1VQK T;  1MMA A;  4QVZ A;  3CCQ A;  3M57 A;  4O5V A;  3HRT A;  3CME T;  1YIT A;  2O9V A;  1WJR A;  4WF2 A;  2LNH B;  5LJ3 f;  3DLL A;  1WYX A;  4LXC A;  2ROL A;  2R5M A;  1Q7Y R;  2RH2 A;  4HXJ A;  1S72 A;  2J7I A;  2RHI A;  4EPC A;  1C6V X;  5KYW A;  5CKH A;  5KE2 A;  4PL6 A;  4J9C A;  2MYS A;  2LTO A;  5AYF A;  2CUD A;  1KFZ A;  3MEW A;  3KXT A;  1I5L A;  2P4R A;  3CBP A;  4M77 B;  2HBW A;  3JCM Q;  1WJQ A;  3SHW A;  2JMC A;  5KYU A;  2RK1 A;  1QVF S;  4KUI A;  1VQ8 A;  1M2V B;  4JJN K;  3A8O B;  2KRO A;  4JJB A;  2HL3 A;  2JTF A;  1SRM A;  4JDS A;  3CPW S;  3CCU Q;  1N9R A;  5IT9 E;  2QEX T;  4DBQ A;  3EGD A;  3TQ7 P;  3MO8 A;  5GAN 2;  5DLQ E;  2BKD N;  3OS2 A;  3G7Z A;  3I5R A;  2MWP A;  4PJM A;  2WSF E;  4JPB W;  4BY6 C;  1AWX A;  2XKO C;  1Q95 G;  3VS1 A;  5CQX A;  2L3R A;  3VS2 A;  2ZZD A;  3CCJ Q;  3L2Q A;  1XQH A;  2VVK A;  3BY7 A;  3GIB A;  3SFM A;  2L3P A;  2KNB B;  5LJ5 h;  1MV3 A;  2JN0 A;  1VQ6 Q;  5GAO p;  2HL5 C;  1LCK A;  4P5N A;  2YRC A;  2LJ1 A;  2JMA A;  4F7U E;  1MMN A;  2CRE A;  4BI4 A;  2RK2 A;  1KSW A;  2RQR A;  3CCL Q;  3GNF B;  2O31 A;  2K2M A;  3MET A;  3P8H A;  4R0K A;  4IUU A;  2DZC A;  2KEA A;  4RTU A;  5GAM d;  5C6S A;  4EMG A;  1YJ9 Q;  1ZSZ B;  2X4Y A;  3CCU A;  2W0Z A;  1K73 R;  3CCR T;  1ZUY A;  4QT7 A;  5LJ5 f;  4J9I A;  4JJC A;  4JRP A;  1VQP T;  4F14 A;  1AOJ A;  1UHF A;  4XU2 A;  3RR6 A;  4EMK A;  3LGL A;  1KC8 U;  1AHJ B;  1UTI A;  5KH6 A;  1NZ9 A;  4Y28 E;  1SSF A;  1X6B A;  5IXB A;  1ARK A;  5I21 A;  1AZE A;  3CCJ A;  2F1L A;  4RTT A;  2F69 A;  3S3O A;  3I9Q A;  1U3O A;  2DA9 A;  4IIO A;  2QXF A;  1VQ6 A;  1BK2 A;  4DOW A;  2RHY A;  5CO7 A;  5KYW B;  2D0Q B;  3VS0 A;  2RJF A;  2DER A;  4PJO F;  2DIQ A;  1I5O B;  2YLB A;  3MJX A;  2VYT A;  1Z9Z A;  4OB1 B;  3QXE B;  4M7A A;  2KGT A;  2FO0 A;  3RIR A;  3M5A A;  2DE0 X;  1PD0 A;  2RJD A;  1H3Z A;  4MML A;  1KIK A;  3CCL A;  5KYU B;  3DB4 A;  3I55 T;  1WNL A;  2P4T A;  5GAO q;  2DL8 A;  1TG0 A;  4M77 C;  1Q86 U;  1YJ9 A;  4KGZ B;  2ED1 A;  1WXT A;  1X2Q A;  4A54 A;  5GAN h;  2QQR A;  1M2O A;  3MP8 A;  4X9D A;  2GTJ A;  4BI8 B;  1BIA A;  2O9S A;  2KMT A;  1Q86 C;  3OYE A;  1KQ1 A;  2BIV A;  2YWW A;  4M75 E;  1ZBJ A;  1Q81 C;  1KHC A;  4RG8 A;  3RUX A;  1BCO A;  1PC0 A;  1W70 A;  2L5Q A;  4OML A;  1VOM A;  4QKU A;  1QVP A;  3VUB A;  3LX7 A;  3P8D A;  3H0I A;  5FRO A;  2K3X A;  3FIF A;  2DIG A;  1QP3 A;  2MPX C;  2R58 A;  2DL5 A;  2QK0 A;  1N9S A;  1KD1 U;  2YUN A;  4IUT A;  1OOT A;  3CMA Q;  2ED0 A;  2HAX A;  5GAN f;  3A5Z B;  2HKN A;  4E47 A;  2M0Y A;  4N4I A;  1VQ7 T;  2GTO A;  2OTJ A;  3A98 A;  3KBG A;  1KD1 C;  3HL8 A;  3X20 B;  1D1C A;  3DLM A;  1K9M R;  1T0J A;  3EGX A;  1YIJ Q;  4M77 D;  4FIB A;  4E6R A;  3CME Q;  1PNJ A;  1QCN A;  1OV3 A;  3LGF A;  4M78 E;  2DXU A;  2RN8 A;  2EKH A;  2AT1 B;  1N8R U;  3SWN A;  5EG2 A;  2J05 A;  4F16 A;  4N4G A;  3QG1 A;  4BD3 A;  2A08 A;  2QA4 T;  4EMK B;  1UDL A;  3VU3 C;  1ZSG A;  2V1Q A;  4B9W A;  4FT4 A;  2KDS A;  2KSS A;  1HD3 A;  2H3E B;  5IH2 A;  2IVW A;  4L59 A;  3CCQ T;  1MNE A;  2Z0W A;  3HFO A;  2ZPG B;  3CCE Q;  3IQL A;  4PJO E;  3CMA A;  1A0N B;  2HCK A;  4NL2 A;  1MGQ A;  4JS5 A;  1G3W A;  1KG1 A;  2DVJ A;  3NTI A;  3JB9 I;  2EPD A;  2F5K A;  4E7S A;  3OYN A;  4M7A B;  2EVR A;  2EQI A;  2V26 A;  1OPL A;  1UJY A;  1M4Z A;  2E70 A;  3A8G B;  5A0G A;  1YIJ A;  2EW3 A;  4UC4 A;  2O88 A;  1BI3 A;  3CME A;  4HT9 A;  1W2B P;  4FYW B;  3GNG A;  2RB6 A;  1N27 A;  2JW4 A;  3VUZ A;  4QQG A;  4RTV A;  1NLP C;  2I2L A;  3OS5 A;  4OB2 B;  1YNZ A;  1VQ8 T;  2LX9 A;  3EG1 A;  3JCM g;  4HVW A;  2PNI A;  4XU3 A;  5GAN 6;  2QYZ A;  6AT1 B;  1RAI B;  3FC3 A;  2PQW A;  4AT1 B;  3UAT A;  4C5I A;  4J9B A;  5A0D A;  1RLP C;  4OGE A;  4L5G A;  1UGS B;  5KYX A;  3CCE A;  3TSW A;  1X2K A;  5GAN 3;  4E7H A;  2A28 A;  1WHG A;  1MHN A;  3RBB B;  1M1K R;  4BDZ A;  4BB7 A;  2F2X A;  4E2F B;  2AZV A;  4ZGD B;  1WZO A;  1KQS S;  2C06 A;  4FSS A;  3M0P A;  3CCR Q;  1IGQ A;  3E2U A;  1D3B A;  2DXT A;  2F2W A;  2VWF A;  5IN1 A;  2X9H A;  3EGX B;  2QTV A;  1FMW A;  3CXC P;  2E12 A;  2IG0 A;  3OW2 A;  4OMP A;  1P92 A;  4HCK A;  2J6F A;  2QQA A;  1NM7 A;  1M90 R;  2DXB A;  4FL6 A;  1TUD A;  8ATC B;  1NJI R;  2AKL A;  3PT9 A;  3CCU T;  2E41 A;  2A7Y A;  4E7Z A;  4LD6 A;  4DBH A;  1B34 A;  4BAC A;  3JCM d;  2F5T X;  1RAA B;  5GAN 4;  1I8F A;  4RMO A;  2E64 A;  1VQO T;  5CKF A;  2FG0 A;  1JXO A;  3R6O A;  3L2W A;  2CH4 A;  3EFO B;  1GCP A;  4XTU A;  2VXF A;  2DO3 A;  1BI2 A;  3LLR A;  2EQJ A;  1HSQ A;  2DL4 A;  2O4X A;  3JCM W;  3VS5 A;  4Z89 A;  1WHK A;  3MEU A;  2D1X A;  3CCJ T;  4PJO D;  1VQ5 T;  2DF6 A;  3HFN A;  2CP7 A;  1FMK A;  2E4H A;  3CCR A;  1VQ6 T;  2MIO A;  1M8M A;  1WIE A;  2K6D A;  2L89 A;  1LVK A;  5GMK l;  2CT3 A;  2AKK A;  3CPF A;  3OYF A;  4AG2 C;  3RMQ A;  1SHG A;  1M3A A;  4J9E A;  3CCL T;  1VQ4 Q;  1UG1 A;  2LQN A;  3BW1 A;  4F7U G;  3G4S T;  4IIM A;  2LVM A;  4RCB A;  3NTK A;  1XOV A;  4D8K A;  1KJW A;  2RHU A;  4CC7 A;  2X4X A;  3JCM b;  1WA7 A;  1GBR A;  4ZTF A;  5LJ3 d;  3OY9 A;  1KK7 A;  3L42 A;  5KYX B;  3I55 A;  1VQL T;  1WFW A;  1GXI E;  4M77 A;  1AD5 A;  3OMG A;  2E10 A;  4LDW A;  2AK5 A;  2OI3 A;  2JNG A;  1NE8 A;  5CR2 A;  3OYC A;  3BDU A;  1M2V A;  2RA2 A;  4LUE A;  5A2Q E;  1D3B B;  4N0A C;  2WAC A;  2G6F X;  2QA4 Q;  2JTM A;  3M9Q A;  3RKX A;  4YTL A;  4FM4 B;  1NYG A;  1T3S A;  3OYB A;  2V8K A;  2RQW A;  1MND A;  4C92 F;  4ZGE B;  1VQ4 A;  1XJW B;  5LJ5 g;  3KFV A;  2E6Z A;  3P8B B;  3FEO A;  4J8O A;  3SEM A;  3JCM f;  2X51 A;  2YXY A;  5CCA A;  3JV3 A;  1AVZ C;  3L2Z A;  1PD1 A;  5HK0 A;  3QZ9 B;  3CC7 Q;  2WSE E;  4C5H A;  3EFS A;  4C8Q G;  3THK A;  3OBY A;  1FXX A;  4II1 A;  1C0M A;  2JT4 A;  2LQK A;  2KXD A;  2RQU A;  4LE9 A;  2E6N A;  2DYB A;  4ELZ C;  2LT4 A;  1WI7 A;  3X25 B;  4M75 G;  4MZT A;  3OYG A;  2X4J A;  2MI6 A;  2K5F A;  3REB B;  4IUV A;  2M0O A;  4A4E A;  2QA4 A;  4LD9 K;  3ER0 A;  2AZS A;  1IRX A;  3JCM P;  2CKK A;  4FW1 A;  5FWC A;  1TSF A;  4K11 A;  1YIJ T;  4WCI A;  2CZ6 B;  2DRM A;  4XTX A;  1HYO A;  2E5Q A;  2XHC A;  3OYL A;  4JRK A;  5LJ5 d;  4FT2 A;  3I56 T;  2RI3 A;  3A8H B;  1OU8 A;  3OS0 A;  1Q7Y U;  4PFZ A;  1B7T A;  2EYX A;  4FU6 A;  4J6W A;  3CC7 A;  3PIP A;  1QKX A;  4DA4 A;  3SDZ A;  4M78 G;  3EFR A;  4F7U B;  4XTV A;  3MHX A;  4CC3 A;  3TRE A;  2VB6 A;  5GAN g;  4IUR A;  3VS7 A;  4GLM A;  2P0P A;  1Y57 A;  4AFQ C;  2XG8 D;  3CCE T;  2RNA A;  2D9T A;  1UUE A;  2CSQ A;  2CP5 A;  4C0G A;  2LT1 A;  1PSE A;  2JZ2 A;  2L0A A;  2RI2 A;  3OMC A;  2QDY B;  1KQ2 A;  4C8Q F;  2VKN A;  1LOJ A;  2NUT A;  3QDF A;  2M51 A;  3PIO A;  4C92 E;  2YLC A;  4PJO G;  4QVC A;  2RI5 A;  4PJJ A;  4MDW A;  1VQO Q;  3QDR B;  4FYX B;  1AZG B;  4M75 F;  1RAH B;  1Y96 A;  3OYD A;  2LRQ A;  2KBT A;  3N5B B;  4JZ4 A;  2RMO A;  2RD1 A;  2RF0 A;  2O01 E;  1W1F A;  3X28 B;  1LJO A;  1N6A A;  1WHM A;  4Z02 A;  1VQ5 Q;  2XMF A;  2LMJ A;  3VV0 A;  4FW2 A;  4LUD A;  1UEB A;  2FZG B;  3S3N A;  3J81 E;  1JJ2 P;  2DZ9 A;  4CC4 B;  1XTD A;  1Y7X A;  5IHK A;  1NEG A;  2DJQ A;  3CC4 T;  1PKS A;  5IHN A;  4FYY B;  5GAN d;  1NYF A;  2EGE A;  3G4S Q;  2FL7 A;  2DFU A;  5CVI A;  4OVA A;  3QPH A;  1M1G A;  1K73 U;  1Q82 U;  3HKS A;  4M78 F;  1WDX A;  3QBY A;  3FB9 A;  4J6X A;  3LH0 A;  1YJW T;  2ZAE A;  1VIE A;  1UGP B;  3G71 T;  1QVG S;  1IZ6 A;  2JS2 A;  4M75 B;  1YHQ Q;  1I0C A;  4A4K A;  1SSH A;  3C94 A;  1VQO A;  1Q82 C;  2DAQ A;  1VYV A;  1VQL Q;  4OB0 B;  5GAO l;  4C0F A;  1G3Y A;  1KC8 C;  2CH4 W;  4R56 A;  1VQ5 A;  2R57 A;  1LNX A;  1UGQ B;  1FYN A;  4J9H A;  3M4Y A;  3R6N A;  2GNC A;  1PWT A;  2K7A A;  3UA7 A;  5HCK A;  2XDD A;  3M58 A;  3VS4 A;  1K8A U;  2LQW A;  5KE3 A;  2OX7 A;  1EFN A;  2DTI A;  2HBP A;  4A4G A;  2I0N A;  1UB4 A;  4R55 A;  5CKD A;  1K8A C;  1JBM A;  3G4S A;  4X9C A;  4C8Q E;  1U1S A;  4M78 B;  1E6G A;  4A53 A;  5EC7 A;  3O8V A;  4V2S A;  3C0C A;  1G5V A;  2NUT B;  3QYH B;  2DNU A;  4IUP A;  1FMV A;  2YDL A;  2DL7 A;  1YHQ A;  2DTH A;  3GBQ A;  1M5Q 1;  1SPK A;  2QAS A;  1IHV A;  3E9G A;  2P0Q A;  5GAM j;  4MZP A;  1JJ2 A;  2CSI A;  3JCM c;  1Q86 R;  3X26 B;  1VQL A;  1Y96 B;  2HD0 A;  1QCF A;  5I2S A;  3VS6 A;  1V76 A;  1YJN T;  1VQ4 T;  1Q81 R;  1KQS A;  1ACM B;  4PFP A;  4HCZ A;  5I2M A;  5L8R E;  4OP0 A;  4PJO B;  3M0U A;  5GJV B;  3VYG A;  3RDV A;  4N0A A;  3NTH A;  3AHU A;  3M0T A;  2XU8 A;  4J5Y A;  1EIF A;  1I4K 1;  1M27 C;  1QKW A;  1BBZ A;  3E19 A;  5DLO A;  2DL3 A;  1JO8 A;  2KRS A;  1OPK A;  5DM7 R;  1KD1 R;  2QAZ A;  3NPF A;  1RAG B;  2QGF B;  5GAN 5;  2CP3 A;  5AT1 B;  2K3Y A;  3A8L B;  3M56 A;  2JJ9 A;  4AG1 C;  1G3S A;  5FU7 B;  2H3J A;  1OEB A;  4QQ6 A;  2J06 A;  2QDL A;  5LL6 S;  3I56 Q;  3NGP A;  3GP8 A;  2E3I A;  1X6O A;  3M59 A;  2CUB A;  3NMZ C;  4DOV A;  1OYX A;  4MZM A;  1WXU A;  1RLQ C;  1QMC A;  4OMF B;  1N8R C;  4XTW A;  2DPP B;  3OW2 P;  4ATO A;  4M75 C;  5FU6 C;  2OTL T;  1AT1 B;  1WQW A;  4X34 A;  1WX6 A;  2A36 A;  3EFO A;  2GBQ A;  1SKU B;  2MCN A;  2XI9 A;  1D0Z A;  1RL2 A;  3SD4 A;  1VQ9 T;  2Y4Y A;  1TTH B;  3U23 A;  3CC7 T;  2JM9 A;  2EWN A;  3UDC A;  3ULR B;  1R77 A;  2K57 A;  4OGC A;  2HQE A;  2COY A;  1RI9 A;  3I5S A;  3CC2 T;  1IO6 A;  4E7L A;  1WGS A;  1OI1 A;  2E65 A;  2GGR A;  1OX8 A;  2GF7 A;  4D6W A;  4PFO A;  1JQQ A;  1PG5 B;  4EIK A;  1UEC A;  3I56 A;  2LC4 A;  2FZK B;  4C0D C;  4C8Q D;  1G83 A;  3ZFJ A;  2EGC A;  2QG9 B;  4M78 C;  1XNI A;  3LYI A;  4KGX B;  1HK9 A;  3CQT A;  3J80 E;  3OA6 A;  4M75 D;  4QQD A;  2CZ7 B;  1E6H A;  2M02 A;  5FLX E;  5D6X A;  1RAC B;  4ANJ A;  1WQ7 A;  1B07 A;  3VRZ A;  2EFI A;  1TXQ A;  3L2V A;  3CC4 Q;  2LCL A;  1RAB B;  3G6E T;  1V29 B;  3OYK A;  2DEU A;  4PNO A;  2IPO B;  3TEE A;  2KI7 A;  2H8H A;  3OYM A;  3E1S A;  4PJO C;  1QVF P;  1YJW Q;  2L8D A;  1GCQ C;  2ATC B;  2EKO A;  4ZGJ B;  3G71 Q;  2M16 A;  3LW5 E;  3MPU B;  2VC8 A;  1TH7 A;  5IAY A;  2DXC A;  1TOV A;  3CPW P;  1WLP B;  1DJ7 B;  1FX7 A;  2HSE B;  1MUZ A;  1CKB A;  3CCV T;  2K79 A;  3QSU A;  2AIR B;  1RI0 A;  1N5Z A;  2QI2 A;  1X69 A;  2JTE A;  4M7A E;  4M78 D;  5FU7 C;  1TS9 A;  3DB3 A;  5GMK j;  3X24 B;  4M7D G;  1NJI U;  4ME7 A;  4IKF A;  2EQM A;  5GAM e;  3JB9 H;  2E1H A;  2NWM A;  2FRW A;  3PTA A;  2XID A;  2D0N A;  2QGG A;  2C0I A;  2BZY A;  3ZEH A;  2J6K A;  1J3T A;  2FPD A;  3DKM A;  4JJD A;  3CC4 A;  2NUP B;  2FEI A;  4C92 G;  1VA7 A;  4HVU A;  2CP6 A;  4D8D A;  4HVV A;  3CCM T;  3QO3 A;  2VGN A;  5CIU A;  1AEY A;  4XQ3 A;  5J26 A;  3I35 A;  1YJW A;  3AT1 B;  2DX1 A;  2YUO A;  3OBW A;  5CKB A;  3BE3 A;  3G71 A;  2VGM A;  2CS7 A;  3LH5 A;  4OMM A;  3HRS A;  1GRI A;  5HKC A;  1ZBX A;  2EQU A;  5GAN 7;  3FDR A;  1JRI A;  2HQX A;  2COW A;  3V8J A;  3QKJ A;  1YJN Q;  1UHC A;  1G3T A;  2P84 A;  2OJ2 A;  1H64 1;  3JCM X;  2NUZ A;  5GAO n;  2XD0 A;  2EYW A;  2K3B A;  3M0R A;  4F04 B;  3JB9 G;  4DQ2 A;  5J3B A;  4JRQ A;  2DK3 A;  4RKU E;  2KT8 A;  4IUQ A;  2JUF A;  1YHQ T;  4GLK A;  1QVF A;  1JU5 C;  2EJF A;  2V8I A;  4JZ3 A;  4F7U A;  3QWY A;  4ZNX A;  5IHI A;  1BU1 A;  2BUD A;  1WHL A;  3CPW A;  1WPY A;  3FLG A;  1NPP A;  2EGA A;  3MKD A;  5D6W A;  4M7D F;  2DM1 A;  2BTT A;  4LN2 A;  3HP9 A;  1W4S A;  5GAO m;  3URG A;  2K5L A;  4E7I A;  1ZA1 B;  2PVO B;  2FZC B;  3PGG A;  2KY9 A;  1JB0 E;  2PTK A;  2BZ8 A;  2E5K A;  1PRM C;  2YUP A;  3FJ5 A;  3MCA B;  3SB2 A;  1K9A A;  5J39 A;  1AWO A;  2K4Y A;  4HA8 A;  2B86 A;  2COZ A;  3D7S B;  3CBM A;  2KXC A;  2LCS A;  1YJN A;  2LP5 A;  2GQV A;  2ZPI B;  2OTL Q;  4RCC A;  1ZUU A;  2DVE A;  1EX4 A;  2FB7 A;  5GAN 8;  3EG9 B;  1NPR A;  2ABL A;  1T0H A;  3JRZ A;  3PVL A;  1K0X A;  2EYY A;  1UGR B;  1K1Z A;  7AT1 B;  1VQ9 Q;  3M54 A;  1OQK A;  2MF2 A;  3EHQ A;  2DBK A;  4AFZ C;  4OF1 A;  2HEQ A;  4KH0 B;  2VUB A;  3CC2 Q;  1QWF A;  1AWW A;  4PJN A;  4OMN A;  2AHJ B;  3J7A F;  3V7S A;  4QVD A;  4LDV A;  3Q1J A;  3LWI A;  1G2B A;  5D6Y A;  2PU9 B;  2MAM A;  3PMT A;  1S72 Q;  2RO0 A;  3EHR A;  5LJ3 j;  1QVG A;  2KVQ G;  4J9F A;  4BDY A;  3JB9 F;  1RAD B;  3GF5 A;  5CKE A;  4Z88 A;  1ABQ A;  1I07 A;  4XU0 A;  3VKI A;  1IGU A;  4C92 B;  1I81 A;  3LWH A;  3VS3 A;  5LJ3 h;  4M75 A;  2ECZ A;  5FW9 A;  4KGV B;  2OTL A;  2DD5 A;  2K9G A;  1WHH A;  2Y90 A;  1UFF A;  2ZGW A;  3G6E Q;  5GMK e;  1W2B S;  2DEQ A;  4J7F A;  5IXF A;  1VQ9 A;  4LDU A;  3V8L A;  2BZX A;  1UJ0 A;  4JLG A;  2FPE A;  3OYJ A;  2FVU A;  2JVV A;  2XIC A;  2NLU A;  4TVR A;  3H6Z A;  3RES A;  3RKY A;  4FCY A;  1Q7Y C;  2KK4 A;  4A4F A;  4E7J A;  3CC2 A;  2KRM A;  4Z8A A;  1PHT A;  4M7D E;  1WHJ A;  4JLI A;  4FYV B;  2EIF A;  3O5Z A;  3CCV Q;  2RHZ A;  4KUD K;  1MMD A;  1U1T A;  2CT4 A;  2V1R A;  4M78 A;  1X75 C;  1QW1 A;  1IB8 A;  1Y0M A;  2CP0 A;  2JM8 A;  4AFS C;  8AT1 B;  5FWB A;  1D0Y A;  1VQM Q;  2ZCF B;  3NHN A;  4HT8 A;  1PM3 A;  1BI1 A;  4RTX A;  5GAM g;  1PSF A;  3ZL7 C;  3MP1 A;  5DY9 A;  1M3C A;  1OX9 A;  5D7U A;  4NL3 A;  3G6E A;  2C0T A;  3OYH A;  1QCO A;  1K76 A;  3M0S A;  3CXC S;  1OUL A;  3E9F A;  2PZ1 A;  2MK5 A;  3CCM Q;  4O6J A;  3OSS C;  4PJO A;  4NS5 A;  3MP6 A;  1GCQ A;  5LJ5 j;  1HXD A;  4RTW A;  2BE7 D;  1M8V A;  1KQS P;  2RHX A;  4L6V 5;  3CCV A;  3JCM e; 
#chains in the Genus database with same CATH homology
 1NM7 A;  1QWE A;  2ROT A;  2J06 A;  2DRK A;  2QDL A;  3NGP A;  1Z9Q A;  1TUD A;  3H0F A;  2AKL A;  1W6X A;  2CUB A;  3NMZ C;  2KE9 A;  3TVT A;  2YUQ A;  1H92 A;  1WXU A;  1RLQ C;  2FG0 A;  1JXO A;  4X1V A;  2O2O A;  2X3W D;  2CH4 A;  2LX7 A;  1BB9 A;  1GCP A;  1VYT A;  1ZX6 A;  1HSQ A;  1ABO A;  2DL4 A;  3RNJ A;  1WX6 A;  2A36 A;  1B3Q A;  1CKA A;  1V1C A;  2GBQ A;  3VS5 A;  3QWX X;  4Z89 A;  2D1X A;  1CSK A;  2MCN A;  1JXM A;  2DF6 A;  5ECA A;  1RUW A;  2LJ3 A;  1FMK A;  1GFC A;  4AFU C;  2MIO A;  4RTY A;  2RQT A;  3H0H A;  1M8M A;  1S1N A;  2C0O A;  1WIE A;  3U23 A;  2JM9 A;  2K6D A;  1M30 A;  3ULR B;  2CT3 A;  1RI9 A;  3I5S A;  2AKK A;  1IO6 A;  4AG2 C;  1HJD A;  2O9V A;  1SHG A;  1M3A A;  4J9E A;  2GGR A;  2LNH B;  1UG1 A;  2LQN A;  1WYX A;  1JQQ A;  4EIK A;  4IIM A;  1UEC A;  2ENM A;  2ROL A;  1G83 A;  4HXJ A;  2KYM A;  1XOV A;  2J7I A;  4D8K A;  1KJW A;  4CC7 A;  3EG0 A;  2EGC A;  4J9C A;  2MOX A;  3CQT A;  2CUD A;  1WA7 A;  4LNP A;  1GBR A;  1KFZ A;  1U5S A;  1E6H A;  2P4R A;  1E7O A;  2HBW A;  3SHW A;  2JMC A;  1WFW A;  1UE9 A;  1B07 A;  3VRZ A;  5L23 A;  2F2V A;  4ESR A;  1AD5 A;  4M4Z A;  3UF4 A;  1YCS B;  2YT6 A;  3EG2 A;  2DMO A;  2AK5 A;  2OI3 A;  2KRO A;  4JJB A;  1NEB A;  2EYZ A;  1SRM A;  2H8H A;  4LUE A;  4OMQ A;  2G6F X;  4GBQ A;  1GCQ C;  3I5R A;  1NYG A;  2L2P A;  1T3S A;  2RQW A;  2DLP A;  1T3L A;  4OMO A;  4RTZ A;  2J6O A;  3KFV A;  4JPB W;  1AWX A;  1WLP B;  3SEM A;  1MUZ A;  1CKB A;  3VS1 A;  2K79 A;  3VS2 A;  1SEM A;  5I11 A;  2DIL A;  1N5Z A;  3JV3 A;  1AVZ C;  1X69 A;  2ESW A;  2JTE A;  2VVK A;  1M3B A;  2L3P A;  2KNB B;  1MV3 A;  1GFD A;  1LCK A;  1MV0 B;  2LJ1 A;  2JMA A;  2CRE A;  1VYU A;  3THK A;  2NWM A;  2FRW A;  2D0N A;  2RPN A;  4ORZ A;  2C0I A;  4A63 B;  2BZY A;  3PE0 A;  1KSW A;  2J6K A;  2JT4 A;  2RQR A;  1J3T A;  2FPD A;  2KXD A;  2RQU A;  2O31 A;  4JJD A;  2DYB A;  4LE9 A;  1QLY A;  2K2M A;  4R0K A;  1I1J A;  1WI7 A;  2KEA A;  2FEI A;  4RTU A;  4DEY A;  1X6G A;  2OAW A;  1VA7 A;  4HVU A;  3REB B;  2W0Z A;  4D8D A;  4HVV A;  1ZUY A;  4QT7 A;  2RQV A;  4J9I A;  4JJC A;  1AEY A;  1TUC A;  1AOJ A;  4F14 A;  1UHF A;  3I35 A;  2DX1 A;  2AZS A;  2YUO A;  1X27 A;  4Y92 A;  1UTI A;  3LH5 A;  4OMM A;  1GRI A;  1NG2 A;  5FWC A;  4K11 A;  4WCI A;  1X6B A;  1PRL C;  5IXB A;  1ARK A;  2DRM A;  1AZE A;  4RTT A;  1NLO C;  2GQI A;  1UHC A;  3I9Q A;  2OJ2 A;  2FPF A;  2NUZ A;  1U3O A;  2DA9 A;  4IIO A;  1BK2 A;  2EYW A;  2K3B A;  3VS0 A;  2EYX A;  2JXB A;  3M0R A;  1QKX A;  1Z9Z A;  2KGT A;  2FO0 A;  2DE0 X;  4RUG A;  2KT8 A;  1KIK A;  1JU5 C;  2YSQ A;  4CC3 A;  4JZ3 A;  3QWY A;  4ZNX A;  3VS7 A;  4GLM A;  5IHI A;  1BU1 A;  2DL8 A;  2DBM A;  1Y57 A;  1TG0 A;  3VRY A;  4AFQ C;  2RNA A;  5GJW B;  1SHF A;  1UUE A;  2ED1 A;  1WXT A;  1X2Q A;  2CSQ A;  2EGA A;  2DM1 A;  2BTT A;  4LN2 A;  2GTJ A;  2L0A A;  2O9S A;  1GBQ A;  2VKN A;  2M51 A;  1ZBJ A;  1JEG A;  2L3Q A;  2BZ8 A;  2E5K A;  1PRM C;  2PTK A;  2YUP A;  3FJ5 A;  3REA B;  1W70 A;  2LJ0 A;  3TSZ A;  1K9A A;  4OML A;  1AWO A;  2B86 A;  1AZG B;  1ZLM A;  2KXC A;  3H0I A;  2LCS A;  2LP5 A;  2KBT A;  4JZ4 A;  2DL5 A;  1ZUU A;  2RMO A;  2RF0 A;  1W1F A;  1H3H A;  2YUN A;  2ABL A;  1T0H A;  1OOT A;  3PVL A;  2ED0 A;  1K0X A;  2KYB A;  2XMF A;  2LMJ A;  2M0Y A;  2EYY A;  2GTO A;  3A98 A;  4LUD A;  1X43 A;  2HDA A;  1K1Z A;  2L3S A;  4CC4 B;  2D8H A;  1T0J A;  3EHQ A;  2DBK A;  4AFZ C;  2HEQ A;  5IHK A;  1NEG A;  2DJQ A;  4E6R A;  1QWF A;  1AWW A;  3H41 A;  1PKS A;  1PNJ A;  5IHN A;  1UGV A;  4OMN A;  3EG3 A;  1OV3 A;  1K0S A;  1NYF A;  2EGE A;  2RN8 A;  1WXB A;  1G2B A;  2EKH A;  2A37 A;  3UA6 A;  3EHR A;  1H8K A;  2J05 A;  4F16 A;  4J9F A;  2A08 A;  4Z88 A;  1SRL A;  1WDX A;  1UDL A;  1ZSG A;  2V1Q A;  1ABQ A;  1I07 A;  1HD3 A;  5IH2 A;  2JS2 A;  2X3X D;  1I0C A;  1SSH A;  4J9G A;  3VS3 A;  4F17 A;  2ECZ A;  5FW9 A;  1VYV A;  2JS0 A;  2K9G A;  3IQL A;  1ZUK A;  2CH4 W;  1UFF A;  1A0N B;  2HCK A;  1FYN A;  4J9H A;  1YWO A;  3R6N A;  2DVJ A;  2GNC A;  5IXF A;  2EPD A;  1PWT A;  2K7A A;  3UA7 A;  5HCK A;  1K4U S;  2BZX A;  2EVR A;  1UJ0 A;  2FPE A;  2EQI A;  2HSP A;  1OPL A;  1UJY A;  2KR3 A;  3VS4 A;  2EW3 A;  2O88 A;  2LQW A;  2KRM A;  4CC2 A;  4Z8A A;  1EFN A;  1PHT A;  2I0N A;  4J9D A;  2SEM A;  3O5Z A;  1U06 A;  2JW4 A;  1AWJ A;  4RTV A;  1NLP C;  1E6G A;  2LZ6 B;  4DEX A;  5EC7 A;  1YNZ A;  2SRC A;  2CT4 A;  3C0C A;  3EG1 A;  2V1R A;  4HVW A;  2DNU A;  1Y0M A;  2PNI A;  2YDL A;  2JM8 A;  4AFS C;  2DL7 A;  3GBQ A;  1SPK A;  5FWB A;  3NHN A;  3UAT A;  1PKT A;  4KRT A;  2CSI A;  4RTX A;  4J9B A;  3M0Q A;  2KT1 A;  1RLP C;  1YN8 A;  3PVQ A;  2D8J A;  2KRN A;  2EBP A;  1QCF A;  2CDT A;  3TSW A;  3VS6 A;  1X2K A;  3ZL7 C;  2A28 A;  1M3C A;  3RBB B;  2C0T A;  2FRY A;  1K76 A;  2F2X A;  3M0S A;  2IIM A;  3M0U A;  2PZ1 A;  2AZV A;  5GJV B;  4FSS A;  3M0P A;  1GL5 A;  1YP5 A;  2W10 A;  1YWP A;  3M0T A;  1GCQ A;  1M27 C;  1QKW A;  1BBZ A;  2F2W A;  2VWF A;  4RTW A;  5I22 A;  2DL3 A;  1JO8 A;  2KRS A;  1OPK A;  3EGU A;  3NPF A;  4OMP A;  4AG1 C;  4HCK A;  2J6F A;  1OEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...