2DRKA

Acanthamoeba myosin i sh3 domain bound to acan125
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
GSPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain IB
publication title The crystal structure of the SH3 domain of Acanthamoeba myosin IB bound to Acan125
rcsb
source organism Acanthamoeba castellanii
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2drkA00
1AWJA 3VS4A 4RTYA 1QWFA 2LCSA 1RI9A 4LNPA 1M3CA 1ZUUA 1OEBA 2KYBA 2C0IA 1G83A 1I07A 2SEMA 2DF6A 1X2QA 3CQTA 2X3XD 4OMOA 1YNZA 4GLMA 4D8KA 4DEXA 1HJDA 1V1CA 1K1ZA 1GFDA 2LMJA 1RUWA 4JZ4A 2LQNA 4EIKA 1SRLA 2D1XA 2LZ6B 2O88A 2JS2A 3UA6A 1I0CA 1X6GA 2O9VA 4HXJA 1UUEA 2CUDA 2GTOA 2JT4A 2VKNA 1W70A 2JM9A 2LNHB 4J9EA 3GBQA 3EHQA 4AFZC 1GBRA 1UGVA 1H3HA 1U5SA 2DBKA 4JJCA 4CC4B 5FWBA 2FRWA 2O31A 1JEGA 2DMOA 2CSIA 3EG0A 2AZVA 2K7AA 4JJBA 1Y0MA 2HBWA 2OI3A 1ZX6A 1S1NA 1JQQA 1YP5A 1BK2A 1KJWA 3VS1A 1JXOA 1UTIA 4HCKA 1IO6A 3VRYA 1SHFA 1WXTA 2EYXA 2ED1A 1NYGA 1QKWA 1UDLA 3TSZA 4JPBW 4D8DA 2FPDA 3M0QA 2JM8A 2DVJA 2LJ0A 1X43A 1FMKA 1SHGA 1UJ0A 2A36A 4IIMA 2CREA 1ZLMA 2EBPA 5IXBA 1GCPA 3I5RA 3SEMA 2RPNA 4ORZA 2DBMA 1FYNA 3REAB 1PRMC 4F17A 1JU5C 1WI7A 3VS5A 1GBQA 2LQWA 2W10A 4RTWA 2CT4A 2ROLA 2EVRA 3EG2A 2H8HA 2DRMA 1TG0A 2J7IA 2V1RA 1TUCA 1GRIA 1UG1A 1CKAA 3M0RA 4RTUA 4RTVA 2EYYA 4RTTA 1K4US 4F14A 1PNJA 5IH2A 2EYZA 4KRTA 1UHCA 4AG1C 1B07A 2J6OA 4J9IA 2DILA 5L23A 2DA9A 2L3QA 1H92A 2KE9A 2J6KA 1ZBJA 2RNAA 4RUGA 5ECAA 1VYVA 2KNBB 4AG2C 1M8MA 1OPLA 4GBQA 2ABLA 1BB9A 1AEYA 2GGRA 2JMCA 1JO8A 4LE9A 3EGUA 1UJYA 2FO0A 3U23A 4Z88A 3H0FA 2KT1A 2AKKA 3UATA 4JJDA 2ENMA 3REBB 2JMAA 4AFUC 2RQWA 2A28A 2G6FX 1VYTA 1UECA 2D8HA 4J9FA 2GBQA 2IIMA 2A37A 1W6XA 2EPDA 2RQVA 3TVTA 1T0HA 4CC3A 1PRLC 2E5KA 2M51A 2K9GA 4LUDA 2D8JA 2L3PA 1M27C 4J9CA 2CH4W 2KXDA 3NGPA 2BTTA 2OAWA 2MOXA 2KYMA 1PKTA 1HD3A 5FW9A 2XMFA 2KT8A 2EGAA 1T3SA 1X69A 1J3TA 1WIEA 3IQLA 2ESWA 5IXFA 1T3LA 4CC7A 3PE0A 1QLYA 3THKA 4OMPA 1NYFA 2KBTA 4HVWA 2NUZA 1SPKA 2KEAA 1U3OA 1OPKA 3PVLA 1X27A 3H0IA 2FPEA 2F2VA 2LJ1A 1N5ZA 5GJWB 1OV3A 2J6FA 3QWXX 2X3WD 2DE0X 4IIOA 1SSHA 2F2WA 1RLPC 2KRSA 2JW4A 2YSQA 2FG0A 1PWTA 2GTJA 2D0NA 4J9HA 1Y57A 2HCKA 2JTEA 1NEGA 1ZUYA 1ZUKA 2BZ8A 1E7OA 3VS0A 2PNIA 2DL5A 1WLPB 1T0JA 2DL7A 3NPFA 3VS2A 2A08A 2GQIA 1WYXA 2V1QA 4DEYA 2KRMA 3ZL7C 2FPFA 1RLQC 2DRKA 2HEQA 1QWEA 2DL3A 4Z8AA 1MUZA 1JXMA 2ECZA 2I0NA 3VS3A 1YN8A 2EYWA 2KGTA 4Z89A 1I1JA 1XOVA 2CSQA 1H8KA 3ULRB 1X2KA 1QKXA 4RTXA 3NHNA 2C0TA 2EKHA 3VRZA 4WCIA 4E6RA 1GCQA 1BU1A 2PTKA 1QCFA 4J9BA 1AWXA 1AWWA 2QDLA 5I11A 1AOJA 2DL4A 3LH5A 1UE9A 3QWYA 3RNJA 1YCSB 4J9DA 4X1VA 2CUBA 2K3BA 1ABOA 2O2OA 3JV3A 1NG2A 1B3QA 1U06A 2J05A 2RMOA 1PKSA 5FWCA 2DYBA 1A0NB 1WFWA 2DLPA 4LN2A 2W0ZA 3PVQA 4ZNXA 3R6NA 2HDAA 1HSQA 1K0SA 2RQTA 2ED0A 1E6GA 5IHKA 2AK5A 1TUDA 3UF4A 4ESRA 1WA7A 2DNUA 2DL8A 3UA7A 4R0KA 1K9AA 1AZEA 1WXBA 1W1FA 4OMQA 1Z9QA 2EGCA 2YUPA 1KSWA 2KR3A 3A98A 1KIKA 3RBBB 2RQRA 2OJ2A 1AVZC 2C0OA 2FRYA 2GNCA 1BBZA 1M3BA 2YUNA 1PHTA 1MV0B 2EW3A 2PZ1A 4AFQC 1YWPA 5GJVB 3M0SA 5IHIA 3NMZC 1AWOA 2JS0A 4OMNA 4RTZA 1GFCA 2L2PA 2DM1A 5IHNA 1UHFA 2LJ3A 1NEBA 2M0YA 1SRMA 2MCNA 2KRNA 2MIOA 4QT7A 4HVUA 3I5SA 2CT3A 2F2XA 2EGEA 1CSKA 5HCKA 2K2MA 2BZXA 2O9SA 1VA7A 2L3SA 1GL5A 2ROTA 4LUEA 2YUOA 1M3AA 2K6DA 1GCQC 1OOTA 4FSSA 2K79A 1SEMA 1AZGB 1WXUA 4OMMA 4Y92A 3VS6A 1YWOA 2DX1A 2VWFA 1Z9ZA 3SHWA 1ZSGA 1WX6A 3I9QA 2DJQA 2EQIA 1VYUA 2FEIA 2RN8A 2CDTA 2YUQA 1ABQA 1G2BA 1X6BA 3KFVA 1E6HA 3M0UA 1K76A 4K11A 1ARKA 3C0CA 2VVKA 4OMLA 2KROA 1AD5A 1K0XA 4J9GA 5I22A 1NLPC 1MV3A 1CKBA 2CH4A 1M30A 2BZYA 2AZSA 3EHRA 2HSPA 2YDLA 4JZ3A 1EFNA 2SRCA 4A63B 4F16A 1KFZA 2LP5A 2AKLA 2J06A 3M0TA 3TSWA 3VS7A 1WDXA 3EG1A 2YT6A 1NM7A 4HVVA 3O5ZA 1UFFA 3H0HA 2LX7A 3M0PA 3FJ5A 3H41A 4AFSC 2RQUA 2JXBA 2NWMA 3EG3A 1LCKA 1NLOC 2B86A 4CC2A 2L0AA 2P4RA 2KXCA 3I35A 2RF0A 4M4ZA 5EC7A
chains in the Genus database with same CATH superfamily
2X35A 1QW1A 3VS4A 3CD6A 2RB6A 3CCMT 1KQSA 5FU6B 2MYSA 5KCHA 5GMKl 4XTXA 3OYNA 2DZ9A 5FU7C 1IXDA 4GLMA 4QQ6A 4DEXA 1ZBXA 5GAOm 5LJ5e 3URGA 1PC0A 2QQBA 2GCXA 5CKEA 2O88A 2FB7A 3UA6A 2O9VA 5IN1A 3JCMf 4HXJA 2GTOA 3OYBA 2JM9A 4M7AF 1XTDA 4EMGA 1U5SA 1YJNQ 4JJCA 1H3HA 2DXUA 4C92E 4C8QC 2FRWA 2O31A 2DMOA 2CSIA 3EG0A 2AZVA 4JJBA 3S3OA 4KUIA 2HBWA 2O01E 1ZX6A 1S1NA 3CMEQ 1YP5A 3VYHB 1VQKA 2NUTB 3VS1A 2QA4A 1UTIA 5GMKm 4JLGA 1I5LA 2RI5A 1NYGA 2AHJB 1QKWA 3PMTA 2JM8A 4IIMA 4QQGA 1X43A 1SHGA 3JB9F 2DAQA 1GCPA 3I5RA 3M5AA 2RPNA 3REAB 3OA6A 4J7IA 4RCBA 1JU5C 1MMGA 1PM3A 5CO7A 3G71Q 2CT4A 1YJNT 1ACMB 2EQJA 1TG0A 3BDUA 5CAIA 3OYEA 1TUCA 1GRIA 2QEXA 4RTUA 2RJEA 1K4US 4F14A 4PLLA 5IH2A 3OYIA 3OYCA 2RO0A 3P8BB 4KRTA 2DXCA 4XTWA 2LT1A 3J80E 4NL3A 2J6KA 3C12A 4C8QE 3CPWS 2HQHA 5CQXA 1M8MA 1OPLA 1VQOA 5IAYA 1LVKA 4BDYA 1BB9A 1UGQB 2FHDA 5KYNA 3VUZA 4LE9A 1UJYA 2FO0A 3INZA 4KUDK 3I55Q 3QZ9B 4Z88A 2NUTA 5GAOr 2L8DA 3CCRA 3UATA 2YLBA 4UC4A 4C8QG 1RI0A 4JRQA 3QUIA 4AFUC 3RIRA 4HA8A 3M9QA 4J9FA 1VQOT 2GBQA 2IIMA 1Q86C 3JCMg 2EPDA 2EQKA 2RQVA 2DETA 2XD0A 4B9WA 4CC3A 2E5KA 4M7AB 1JRIA 2K9GA 3VUBA 4RCCA 1LPLA 2CZ7B 2RJFA 2L3PA 1UGSB 3Q1JA 1D0XA 2IVWA 2DFUA 2KXDA 1WHKA 1VQ4A 2DTOA 1YHQQ 2MOXA 4JJNK 1PKTA 3HP9A 4HCCA 2O4XA 4LDWA 3OW2A 2WSEE 2EGAA 1T3SA 4L5GA 3JAME 3CC2Q 2KQWA 4EPCA 1Y71A 2E70A 3CCEQ 3M59A 2M02A 5FU6C 2KAFA 2KBTA 3I55T 1F1BB 3LH0A 1U3OA 1SG5A 3PVLA 2F2VA 5GAMj 1N5ZA 5CK9A 4M77E 4OB2B 2MMPA 3ZFJA 1TS9A 2VXFA 1Q81R 2XICA 1KD1C 4J9HA 2D0NA 2XIDA 2DK3A 1NEGA 3WVEB 2QGFB 2BIVA 3VS0A 1Q81U 1WLPB 5LJ3e 4M7DD 3NTIA 2YRDA 2XDBA 4X9CA 3OSVA 2GQIA 3S3MA 4M78F 1WYXA 2V1QA 3D7SB 4DEYA 3ZL7C 1RLQC 4PFZA 2R57A 2HEQA 1Q95G 2VXEA 1VOMA 5D7UA 1MUZA 5LJ5f 1IGQA 4Z89A 1R0BG 2CSQA 4LD9K 3NHNA 2RM4A 1BU1A 4XU3A 2DD4A 2CZ1B 4XQ3A 4Y28E 1AOJA 4BB7A 1UE9A 1EX4A 3RNJA 4J9DA 3CCUA 4X1VA 2O2OA 3JV3A 3OBWA 5HK0A 1U06A 5CKHA 3SWNA 3ZBDA 1A0NB 1WFWA 2A0FB 1NBEB 1NJIU 2W0ZA 3PVQA 4PJMA 2XDDA 3M55A 2HDAA 2V26A 4X9DA 4N4HA 4HCZA 1H3ZA 4FT4A 1QVGA 1TUDA 5FROA 2YRCA 3UA7A 2QQRA 4C0FA 1K9AA 3KBGA 2RHUA 2MWPA 2YUPA 4N4IA 1UEBA 3OYLA 1AVZC 1R0CB 1YITQ 2C0OA 4J83A 1M3BA 2PU9B 2EW3A 5GAN8 2PZ1A 2DKGA 1YWPA 4ELZC 1VQLT 5IHIA 3RESA 3EFRA 1MNEA 2JS0A 4RTZA 1GFCA 2VYTA 2M0YA 4KGXB 2K5FA 2MIOA 3QJYA 1NJIC 4C92B 4IUVA 5A0LA 2EGEA 1CSKA 2E41A 1M1KC 4JUVA 4M7AC 3LX7A 1I81A 2P0KA 4OB0B 4DA4A 1FX7A 2K2MA 1YBYA 1G3TA 2O9SA 1GL5A 5GAN7 3I56A 1JJ2A 4P5NA 2ROTA 2JOYA 2K6DA 3LW5E 3CPWP 1HXDA 4JDSA 4R55A 2JVVA 1X75C 3R6OA 4M75E 2VGNA 4BI4A 5LJ5g 3PIOA 1YITT 2QI2A 3SHWA 4N4GA 3I9QA 1VQ7Q 5A0GA 5HKCA 2EQIA 2FEIA 2CDTA 4C0GA 2HAXA 3E2UA 1ABQA 3G6EA 3SDZA 3EG9B 1NZ9A 1E6HA 4PJOD 4E7ZA 4BY6B 2MI6A 3WXMB 1VQPA 5CCAA 3OMGA 4J9GA 1W2BA 5I22A 3RDVA 1CKBA 1LNXA 1M30A 5CIUA 5KE3A 2JNGA 1N9SA 2SRCA 1KFZA 4NL2A 2LP5A 2F69A 4A54A 1RACB 2WSFE 4KBMB 2I2LA 2YT6A 5GMKi 3JCMP 3O5ZA 4FT2A 4E7KA 3WVDB 4MMKA 1M1GA 1LCKA 1N6AA 1NLOC 4C8QB 3CCQT 3FRNA 1KC8C 4C92A 2KXCA 1V29B 5EC7A 2XG8D 5KYUB 1PCXA 1QWFA 1D09B 1C6VX 2GF7A 3O8VA 4LD6A 4LNPA 1G83A 1I07A 3QDFA 3M54A 4OMOA 1YNZA 4M7AG 4OB1B 4D8KA 1WQWA 1PD1A 5LJ3f 1V1CA 2ATCB 2K2VA 3QKJA 4EIKA 4JZ4A 2LQNA 2YXYA 3MKDA 2K3XA 1TSFA 1WHJA 1Q7YR 1SSFA 2LZ6B 3OS1A 1N9RA 3EG9A 1YIJA 2E6NA 1UUEA 2CP6A 2CUDA 1Q7YU 2LCLA 2F5TX 2LNHB 3QHSA 3CXCA 1UGVA 2DBKA 3RMSA 3JB9J 3G4SQ 3TREA 1FXXA 2IPOB 3G1JA 1D3BB 1Y0MA 3JB9G 2OI3A 2ZPBB 1BK2A 1KQ1A 4FW1A 3G7ZA 3CMAQ 1VQ5A 2ED1A 2RA2A 5KH6A 4M7DF 4D8DA 2FPDA 3M0QA 4PJJA 2KY9A 3MPUB 2DVJA 2LJ0A 1UJ0A 2XKOC 1ZLMA 2EBPA 4PJNA 1EZZB 3GNFB 4M77B 1BI1A 4C8QA 5GMKj 4OGEA 1ZQ1A 3KXTA 3OYHA 1S72T 5DLQE 1PRMC 4F17A 1VQ5T 8AT1B 5J26A 1JB0E 2M0OA 3BW1A 2V8IA 1K73U 2OTJQ 2W10A 4ZN1A 1Q7YC 4C92C 3G4ST 3A5ZB 3EG2A 3CC7A 4OB3B 2DRMA 2J7IA 3L2ZA 1YI2A 3M0RA 2CP3A 5CVIA 5C0MA 2P4TA 4RTTA 4JS5A 5KCOA 3BDLA 5GAOl 2FZKB 3JCMc 1PNJA 4M75F 1U1TA 2QTXA 3V8KA 5GANg 3CMAT 2QG9B 3CCMA 2J6OA 1M90C 1WQ7A 3TU4K 5L23A 3CCJQ 1H92A 2KE9A 3CC7T 2RNAA 3OYJA 4RUGA 2QQ9A 1YI2T 3OS0A 1AEYA 1QP2A 2K5IA 3CCVQ 1D3BA 2GGRA 5CR2A 3A1PA 2X51A 1JO8A 4CI0C 4BY6C 3GP8A 4J7FA 1BKBA 5LJ3g 4F7UE 4YTLA 1IRXA 3A8HB 1VIEA 3PT9A 4JJDA 4E7LA 1QVFA 3REBB 2JMAA 1UECA 2D8HA 1K73C 4XTUA 4OF1A 4CRIA 5LJ3h 1KQSS 3TVTA 1T0HA 1EIFA 3OYFA 2VC8A 4LUDA 3DB3A 4QVZA 2QAZA 2CZ0B 4M77A 4XTYA 1PSFA 5FLXE 1WNLA 2CYZB 2OAWA 3MCAB 3CCJT 2M1HA 1C0MA 4KGZB 1VQKQ 4GY5A 5FW9A 3RERA 2KT8A 2QA4Q 1J3TA 1WIEA 4QVCA 3CCVT 2ESWA 4DBHA 4CC7A 4M78E 4OMPA 1NYFA 1Q82R 5KYXB 2X4JA 4C92G 2RK1A 4OP0A 3QPHA 1Q82U 4OMFB 1BYMA 1X27A 2FPEA 1YJNA 4PL6A 1AT1B 2J6FA 3VYGA 3E9GA 5I2SA 4IIOA 1OYXA 4QW2A 2KRSA 4BI3A 2M16A 2JW4A 2YSQA 3V7CA 4PJOF 2FG0A 1PWTA 2GTJA 3CMEA 2L3RA 4DQ2A 1OX9A 1Y57A 1FMVA 2PVGB 1AHJB 3PMIA 3X26B 5D6YA 3JCMW 3HHTB 1T0JA 2E6ZA 4O5VA 3DLLA 1M9SA 3MHXA 1W4SA 4MMLA 4M75B 3HKSA 2JTFA 2KRMA 3JCMd 1YJWQ 2DRKA 4Z8AA 4Z02A 1D1BA 3M58A 2DZCA 3CMET 1YN8A 1N8RR 1K8AR 2HL3A 1X2KA 3FEOA 4RTXA 3C95A 3VRZA 4E6RA 3G71A 4NS5A 1AWWA 1I8FA 1Q82C 4R56A 4M77C 2DL4A 3LH5A 3TQ7P 2K3BA 1O9SA 2OTLQ 2RMOA 1PKSA 3OB9A 2E3HA 3MO8A 4WTOB 3UWNA 4A53A 4ZNXA 5KYXA 3G71T 1RAEB 5CKBA 2X9HA 3H8ZA 3X28B 2DIQA 3JCMQ 1YJWT 3FB9A 4XU1A 4ESRA 1Y96B 2DNUA 4E7SA 1AZEA 1VQ4Q 4N0AA 2E5QA 3RUXA 3I55A 3PFSA 2K4YA 5DM7R 3A98A 2BE7D 3RBBB 4GLKA 2QYZA 2GNCA 2PUOB 4J5YA 2YUNA 1PHTA 2CZ6B 4F7UF 1OI1A 1MV0B 3GOXA 4AFQC 2DXBA 3RKYA 2DM1A 5IHNA 4QQDA 1WHLA 3QIIA 3OW2S 3MEAA 1NEBA 3LWHA 2MCNA 4EMKB 2KRNA 3I5SA 2CT3A 1TXQA 1PG5B 4E47A 1YHQA 1QQJA 3EFOB 2BZXA 4E7HA 5LJ5j 4FYVB 3CC2A 2YLCA 1K9MR 3CC4Q 2K79A 3CCEA 5GAN4 3E1SA 3HPWA 1K9MU 4M77G 1YHQT 1Z9ZA 3H9NA 3DB4A 2RN8A 2VASA 2WSCE 5DY9A 5A0DA 3CC2T 2AT1B 2FZGB 4M7AA 1Y96A 3FJPA 1K76A 3CCLQ 3CCET 3TCJA 1VQNQ 1M2OA 4OMLA 4DBQA 2YWWA 1AD5A 2COWA 2F5KA 1KQSP 2C06A 1MHNA 1YFNA 4IUQA 2Z0WA 1P92A 1NLPC 1MV3A 2RI2A 3EHRA 2YDLA 3CCSQ 3FLGA 4A63B 4N0AC 4F16A 1VQ6Q 3P8DA 1RABB 1OU9A 3TSWA 5LL6S 4FU6A 1WDXA 1NM7A 1NPPA 3CC4T 6AT1B 2JUFA 1UFFA 2JJ9A 2PQWA 1VIFA 3H41A 2RQUA 4FYYB 2F1LA 2JXBA 1BIBA 3EG3A 4M75C 1Q81C 1QCOA 2DXTA 4EMKA 1X01A 1MNDA 7AT1B 3ER0A 1AWJA 3EFOA 1XNIA 2EQUA 1VQLA 5GAMd 2KYBA 1ZUUA 4O6JA 4F7UB 2DF6A 5HK3A 1X2QA 3CQTA 3L42A 4C0ZA 3TEEA 5LJ5d 2PVDB 1HJDA 4JRPA 1G3YA 3UPUA 1GFDA 3CCST 2LMJA 4M7DE 1RUWA 4FYWB 1SRLA 2D1XA 1VQ6T 3MJXA 1RADB 1NPRA 3RKXA 4FSXA 2RHZA 4V2SA 1D0YA 2JT4A 3QYGB 5EG2A 3FDRA 4J9EA 2MWOA 3GBQA 3EHQA 4QKUA 4RMOA 1VQ8Q 4Y91A 5FWBA 4AT1B 3GLXA 3ASKA 1JEGA 1IHWA 1ZHIA 2KK4A 1YITA 2K7AA 2RJDA 3QJ6A 2E65A 1M1FA 4A4FA 1B34B 1M4ZA 2EJGA 2RHXA 1QVPA 4M78B 1SHFA 1WXTA 4F04B 4M7AD 3TSZA 1IREB 2LDMA 4RG8A 2E4HA 2IG0A 3HL8A 2VUBA 5GAOq 3QG1A 2A36A 3GNGA 2CREA 2CP2A 4C5GA 4MZPA 2P84A 1FMWA 3SEMA 4ORZA 2HMAA 3HRSA 2DO3A 4DBRA 3JCMJ 1WJSA 3JB9H 2CGHA 4J8OA 2VGMA 3OYGA 3OS5A 2H3EB 2COZA 1XQHA 5J3BA 2EYQA 1WPYA 4EMKC 4M75G 2ROLA 1VQ8T 2EVRA 2DD5A 2RK2A 2H8HA 3PIPA 5GANj 4B6MA 5L8RE 1BCOA 1UG1A 1CKAA 2EKOA 3CCQA 2L5QA 2LRQA 1VQ7A 3CBOA 4PJLA 2JZ2A 1PD0A 5DLOA 2K3YA 1H641 3MP1A 2QQSA 2EYZA 3N5BB 1BI3A 1OQKA 1W2BS 1UHCA 2KVQG 1B07A 4J9IA 2HL5C 4MZMA 2DILA 3A8MB 2DA9A 2L3QA 1ZBJA 3C4SA 5ECAA 2XHCA 5LJ3j 4AG2C 4C5IA 4GBQA 3CEYA 1VQ7T 4BE1A 3KUFA 3OW2P 1MMDA 1M8VA 5C6SA 3U23A 2E1HA 2RJCA 3H0FA 2D9TA 1FWZA 4E7JA 1B34A 2KT1A 2KSSA 4EMHA 2AKKA 4J6XA 1ZA1B 4E2FB 5CQYA 4M78A 3HFOA 5KE2A 1VQMQ 1TH7A 2A28A 2KMTA 1VYTA 2L89A 2RQWA 2Y4YA 1VQ9Q 4AMCA 1W6XA 1PRLC 2FL7A 1I4K1 2M51A 3M57A 1YIJQ 2K5LA 2WACA 2D8JA 2R58A 1YJ9Q 3AT1B 1V76A 1R77A 1MGQA 2CH4W 2QDYB 3QDRB 3JCMX 5AT1B 3NGPA 4DOWA 3EAEA 3OSSC 2KYMA 3META 4RKUE 4PJOE 5KYWB 1HD3A 4E7IA 2DYIA 4ELYC 2NUPB 2ZGWA 1U1SA 3IQLA 1M2VB 3CXCS 5IXFA 1T3LA 3THKA 3CBPA 3JCMb 5GANd 1S72A 4HVWA 4FM4B 2NUZA 5FRNA 2KEAA 2HKNA 1OPKA 1C1AA 5I21A 1VQ9T 2LJ1A 2Y90A 3G4SA 1IGUA 3QWXX 2HQXA 2X3WD 2MAMA 4L59A 2DE0X 3DKMA 4KULA 2F2WA 4KT0E 3AHUA 2JTEA 3LGFA 1ZUKA 2PNIA 5KYUA 3CMAA 2H3JA 2DL7A 3VS2A 3OY9A 2QXFA 1RAHB 1QMCA 2X4WA 4J6YA 1QWEA 3FIFA 3NFCA 1JXMA 2ECZA 1QVGP 4XAXB 2EYWA 2KGTA 3LWIA 2NLUA 4C92D 4M78C 1H8KA 2RH2A 3VU3C 1G3SA 1QKXA 4L6V5 2VB6A 2C0TA 1HYOA 1GCQA 2PTKA 1QCFA 2K57A 1AWXA 2OTJA 2QDLA 5I11A 3S3NA 2FYKA 2VV5A 5KYWA 3QWYA 2EFIA 3CD6Q 1YCSB 1ABOA 4C0DC 2QTVA 4PKCC 2J05A 5FWCA 3X25B 1M2VA 3A8GB 4C5HA 2LTOA 1HSQA 1K0SA 2RQTA 4B9XA 2DVEA 2OTJT 2ED0A 3CCJA 4BE2A 1OX8A 2FZCB 2DL8A 3J7AF 1QVFS 3CCVA 4F7UG 1PSEA 4A4HA 4BACA 3OYYA 1WXBA 3EFSA 1MMAA 1N27A 1W1FA 4LDVA 1KSWA 1ZA2B 3MEVA 5GAMe 1JJ2P 1KIKA 1G8XA 3BE3A 2RQRA 3DLMA 2OJ2A 4FL6A 4BD3A 2FRYA 3GIBA 3V7RA 1BBZA 1OU8A 3CD6T 4M7DB 5GJVB 4VUBA 2DIGA 4PNOA 3NMZC 4C5EA 4C8QD 1AWOA 4MZTA 2DERA 1UHFA 2LJ3A 1UGPB 3L1AA 1IHVA 1SRMA 4KGVB 3OYAA 2F2XA 3NTKA 2HNIA 2QASA 2HBPA 2V8JA 5HCKA 1W2BP 4M78G 4JS4A 2L3SA 4WF2A 2JTMA 4LUEA 1M3AA 2HSEB 1GCQC 2XK0A 2V8KA 1AZGB 1WXUA 4OMMA 4PLIA 3A8LB 3VS6A 2E64A 2LQKA 2DX1A 4X34A 1ZSGA 2QEXQ 1WX6A 3MEWA 2YUQA 1VQKT 2QA4T 1G2BA 1X6BA 2DJZA 2D0QB 2MPXC 1WHGA 2OX7A 1Q86R 3MP8A 3QXEB 2NYSA 2VVKA 1Q86U 2KROA 2O4XB 1N8RU 1K8AU 1K0XA 1RAGB 1ZSZB 2G3RA 4QVDA 1VQOQ 3V8LA 2A3LA 3OMCA 4OGCA 1O75A 2HSPA 1EFNA 5GMKh 1D1CA 3QYHB 1YJWA 2AKLA 3LGLA 3CPWA 5KYYB 5D6XA 3VS7A 3NTHA 3CCRQ 4M7DA 3CBMA 3EG1A 3RKWA 5GAOn 1HK9A 4LXCA 4M77D 3OBYA 3H0HA 2LX7A 4MDXA 2DTIA 2NWMA 2JN0A 4BI8B 5M9OA 2QEXT 3CXCP 2KI7A 2L0AA 2PVOB 2EWNA 3I35A 4XTVA 4A4GA 2COYA 4RTYA 3C94A 2EAYA 2LCSA 2OTLA 1RI9A 4RG2A 1M3CA 1OEBA 4JRKA 2C0IA 2XU8A 3BY7A 2SEMA 4NOYA 4KH0B 3VJPA 4D6WA 2X3XD 1KD1R 3VV0A 1RL2A 3OQ5A 5GAN3 2DEQA 4IURA 1KHCA 1N8RC 1K8AC 1KD1U 1K1ZA 3SB2A 4ZGJB 4M75A 2JS2A 3EH1A 1I0CA 1X6GA 2OTLT 3JCMh 4XK8E 3CCRT 2LCCA 2VKNA 1W70A 1M5Q1 3E19A 4AFZC 1GBRA 2EJFA 2CP0A 4CC4B 4ATOA 4PJOB 1ZSZA 3A8OB 2ZAEA 5CKFA 1JQQA 3SWNB 1KJWA 1JXOA 1KHIA 2Y4XA 1IO6A 4HCKA 3VRYA 4XTZA 3X24B 5GAOp 2EYXA 1VQ4T 5KYYA 5GANe 1UDLA 3HRTA 3ZEHA 2LNVA 4JPBW 2E10A 3UT1A 4ZGEB 2RHYA 4XU2A 3J81E 1FMKA 2ZPIB 5IXBA 4HKEA 4M7DC 2DBMA 2YHTA 1FYNA 2ZPGB 4IUPA 4C92F 9ATCB 2LX9A 4ME7A 2FVUA 1WI7A 3VS5A 1GBQA 4FCYA 2LQWA 2P0QA 3CC4A 4RTWA 3EH2A 2HKQB 2RHIA 5GAMf 3HRUA 3CCUQ 2V1RA 4FYXB 4ZTJA 1QVFP 2QQAA 4RTVA 2EYYA 4DBFA 3PGGA 4J6WA 1Y7XA 4AG1C 3S6WA 4IUUA 3CPFA 2ZPHB 3CCLA 1UGRB 1VQNA 3RMQA 3H6ZA 2XDPA 1VYVA 2KNBB 1SKUB 1YCYA 2M9UA 2ABLA 1MMNA 1K9MC 4PJOA 2MK5A 4KH1B 3CCSA 2JMCA 1NJIR 1VQLQ 2X4YA 3EGUA 1VQ6A 4PK4A 4M75D 2GFAA 1M1KR 3CCLT 1QVGS 5I2MA 3EGDB 2ENMA 1VQNT 1M1KU 1ZSZC 4FIBA 2G6FX 2P0PA 1XJWB 3OS2A 2A37A 2DEUA 3CCUT 2DPPB 1BI2A 3EGXB 3T9NA 4Q5WA 2LC4A 1M27C 4J9CA 4C8QF 2DTHA 3GF5A 2E12A 1TUGB 2LT4A 4ZGDB 1GXIE 2QGGA 2BTTA 1DJ7B 1TTHB 3QBYA 2EQMA 1I5OB 3JB9I 5GMKe 1TU0B 5CKDA 3OYMA 4M7DG 2XMFA 3L2UA 1X69A 3I56Q 4A4EA 4PFPA 1D0ZA 1QP3A 4JRIA 4IUTA 3PE0A 1QLYA 4JLIA 1LOJA 4ANJA 2EIFA 3ME9A 3QZ5B 2HD0A 1SPKA 4LDUA 3H0IA 1VQ8A 5GJWB 3G6EQ 1OV3A 1JJ2S 1WJQA 2ZPEB 3L2QA 1SSHA 1RLPC 4C0DB 4DOVA 2HCKA 3RR6A 4IKFA 2HZYA 1VQPQ 1KC8R 5GAMg 1ZUYA 1TOVA 2BZ8A 2BE9B 1E7OA 4TVRA 2DL5A 1KC8U 3NPFA 5GAN6 3OYKA 2A08A 4PJOC 3EGDA 1U8RA 4F7UA 3CCQQ 3JB9D 5GAMh 2FPFA 2CS7A 1LJOA 2GQVA 3SWNC 2DL3A 3JCMe 3LYIA 3I56T 2A7YA 5LJ5h 2I0NA 3VS3A 3V8JA 1D1AA 3F70A 3EGXA 1I1JA 1XOVA 3ULRB 4M77F 2LQ8A 2EKHA 4WCIA 4J9BA 4HT8A 3SFMA 5FU7B 1Y07A 1UB4A 1X6OA 1IZ6A 2R5AA 3G6ET 1OZ2A 1WJRA 4BE0A 4ZTFA 2CUBA 1BI0A 1NG2A 1B3QA 1KG1A 1RAIB 1RAFB 2DYBA 3HSBA 2DLPA 1VQPT 4LN2A 5AYFA 2EJ9A 3R6NA 1NE8A 3QO3A 1E6GA 5GANf 5IHKA 5IT9E 1RAAB 1G3WA 2AK5A 4M7AE 4BUGA 1WHMA 1R8OB 3UF4A 5J39A 3BFMA 2LVMA 3M4GA 1WA7A 3M4YA 4LDYA 3M56A 4R0KA 1WGSA 2HQEA 2ZPFB 4OMQA 1Z9QA 2EGCA 1TWBA 4A4KA 2KR3A 4LDXA 5A2QE 1OULA 1VQMA 4OVAA 1WHHA 1VQ9A 3X20B 1VUBA 3V7SA 1QCNA 1BCMA 3MEUA 5HY6A 2KDSA 1S72Q 2BKDN 1VQ5Q 4II1A 3MP6A 4EDUA 1G5VA 3M0SA 2CKKA 3LLRA 2GFUA 2MF2A 4OMNA 1YJ9A 2L2PA 3E9FA 4PJOG 3UDCA 2XI9A 3L2WA 4QT7A 1VQMT 4HVUA 3GPLA 1M90R 1KQ2A 1VA7A 3PTAA 3FC3A 1YIJT 1M90U 2YUOA 1YJ9T 1OOTA 3HFNA 4FSSA 2AIRB 3QSUA 3SD4A 1SEMA 5LJ3d 2YRVA 2OAUA 4XU0A 1B7TA 3CC7Q 3HTRA 4Y92A 1YWOA 4HCBA 2QK0A 5GAN2 1IB8A 2VWFA 1YI2Q 2DJQA 3PNWC 4FW2A 1VYUA 8ATCB 3OYDA 3M53A 2R5MA 5FRMA 4PFOA 3KFVA 4MDWA 1K73R 3CCMQ 3M0UA 2ZZDA 4HT9A 1SF9A 1OZ3A 4K11A 3VKIA 1KK7A 1ARKA 3C0CA 2RI3A 4BDZA 2E3IA 2BUDA 4ZN3A 2B8AA 4M78D 2CP7A 2CH4A 2BZYA 2AZSA 4JZ3A 1WZOA 1BIAA 2J06A 3M0TA 5D6WA 2PUKB 2NUPA 2ZCFB 5GAN5 1JBMA 3L2RA 4HVVA 2RD1A 3M0PA 3FJ5A 4AFSC 5GANh 3JCMV 2B86A 2CP5A 4CC2A 2P4RA 3P8HA 3JRZA 3L2VA 2X4XA 2RF0A 2D6FA 4M4ZA 3JSCA
chains in the Genus database with same CATH topology
1AWJA 3VS4A 4RTYA 1QWFA 2LCSA 1RI9A 4LNPA 1M3CA 1ZUUA 1OEBA 2KYBA 2C0IA 1G83A 1I07A 2SEMA 2DF6A 1X2QA 3CQTA 2X3XD 4OMOA 1YNZA 4GLMA 4D8KA 4DEXA 1HJDA 1V1CA 1K1ZA 1GFDA 2LMJA 1RUWA 4JZ4A 2LQNA 4EIKA 1SRLA 2D1XA 2LZ6B 2O88A 2JS2A 3UA6A 1I0CA 1X6GA 2O9VA 4HXJA 1UUEA 2CUDA 2GTOA 2JT4A 2VKNA 1W70A 2JM9A 2LNHB 4J9EA 3GBQA 3EHQA 4AFZC 1GBRA 1UGVA 1H3HA 1U5SA 2DBKA 4JJCA 4CC4B 5FWBA 2FRWA 2O31A 1JEGA 2DMOA 2CSIA 3EG0A 2AZVA 2K7AA 4JJBA 1Y0MA 2HBWA 2OI3A 1ZX6A 1S1NA 1JQQA 1YP5A 1BK2A 1KJWA 3VS1A 1JXOA 1UTIA 4HCKA 1IO6A 3VRYA 1SHFA 1WXTA 2EYXA 2ED1A 1NYGA 1QKWA 1UDLA 3TSZA 4JPBW 4D8DA 2FPDA 3M0QA 2JM8A 2DVJA 2LJ0A 1X43A 1FMKA 1SHGA 1UJ0A 2A36A 4IIMA 2CREA 1ZLMA 2EBPA 5IXBA 1GCPA 3I5RA 3SEMA 2RPNA 4ORZA 2DBMA 1FYNA 3REAB 1PRMC 4F17A 1JU5C 1WI7A 3VS5A 1GBQA 2LQWA 2W10A 4RTWA 2CT4A 2ROLA 2EVRA 3EG2A 2H8HA 2DRMA 1TG0A 2J7IA 2V1RA 1TUCA 1GRIA 1UG1A 1CKAA 3M0RA 4RTUA 4RTVA 2EYYA 4RTTA 1K4US 4F14A 1PNJA 5IH2A 2EYZA 4KRTA 1UHCA 4AG1C 1B07A 2J6OA 4J9IA 2DILA 5L23A 2DA9A 2L3QA 1H92A 2KE9A 2J6KA 1ZBJA 2RNAA 4RUGA 5ECAA 1VYVA 2KNBB 4AG2C 1M8MA 1OPLA 4GBQA 2ABLA 1BB9A 1AEYA 2GGRA 2JMCA 1JO8A 4LE9A 3EGUA 1UJYA 2FO0A 3U23A 4Z88A 3H0FA 2KT1A 2AKKA 3UATA 4JJDA 2ENMA 3REBB 2JMAA 4AFUC 2RQWA 2A28A 2G6FX 1VYTA 1UECA 2D8HA 4J9FA 2GBQA 2IIMA 2A37A 1W6XA 2EPDA 2RQVA 3TVTA 1T0HA 4CC3A 1PRLC 2E5KA 2M51A 2K9GA 4LUDA 2D8JA 2L3PA 1M27C 4J9CA 2CH4W 2KXDA 3NGPA 2BTTA 2OAWA 2MOXA 2KYMA 1PKTA 1HD3A 5FW9A 2XMFA 2KT8A 2EGAA 1T3SA 1X69A 1J3TA 1WIEA 3IQLA 2ESWA 5IXFA 1T3LA 4CC7A 3PE0A 1QLYA 3THKA 4OMPA 1NYFA 2KBTA 4HVWA 2NUZA 1SPKA 2KEAA 1U3OA 1OPKA 3PVLA 1X27A 3H0IA 2FPEA 2F2VA 2LJ1A 1N5ZA 5GJWB 1OV3A 2J6FA 3QWXX 2X3WD 2DE0X 4IIOA 1SSHA 2F2WA 1RLPC 2KRSA 2JW4A 2YSQA 2FG0A 1PWTA 2GTJA 2D0NA 4J9HA 1Y57A 2HCKA 2JTEA 1NEGA 1ZUYA 1ZUKA 2BZ8A 1E7OA 3VS0A 2PNIA 2DL5A 1WLPB 1T0JA 2DL7A 3NPFA 3VS2A 2A08A 2GQIA 1WYXA 2V1QA 4DEYA 2KRMA 3ZL7C 2FPFA 1RLQC 2DRKA 2HEQA 1QWEA 2DL3A 4Z8AA 1MUZA 1JXMA 2ECZA 2I0NA 3VS3A 1YN8A 2EYWA 2KGTA 4Z89A 1I1JA 1XOVA 2CSQA 1H8KA 3ULRB 1X2KA 1QKXA 4RTXA 3NHNA 2C0TA 2EKHA 3VRZA 4WCIA 4E6RA 1GCQA 1BU1A 2PTKA 1QCFA 4J9BA 1AWXA 1AWWA 2QDLA 5I11A 1AOJA 2DL4A 3LH5A 1UE9A 3QWYA 3RNJA 1YCSB 4J9DA 4X1VA 2CUBA 2K3BA 1ABOA 2O2OA 3JV3A 1NG2A 1B3QA 1U06A 2J05A 2RMOA 1PKSA 5FWCA 2DYBA 1A0NB 1WFWA 2DLPA 4LN2A 2W0ZA 3PVQA 4ZNXA 3R6NA 2HDAA 1HSQA 1K0SA 2RQTA 2ED0A 1E6GA 5IHKA 2AK5A 1TUDA 3UF4A 4ESRA 1WA7A 2DNUA 2DL8A 3UA7A 4R0KA 1K9AA 1AZEA 1WXBA 1W1FA 4OMQA 1Z9QA 2EGCA 2YUPA 1KSWA 2KR3A 3A98A 1KIKA 3RBBB 2RQRA 2OJ2A 1AVZC 2C0OA 2FRYA 2GNCA 1BBZA 1M3BA 2YUNA 1PHTA 1MV0B 2EW3A 2PZ1A 4AFQC 1YWPA 5GJVB 3M0SA 5IHIA 3NMZC 1AWOA 2JS0A 4OMNA 4RTZA 1GFCA 2L2PA 2DM1A 5IHNA 1UHFA 2LJ3A 1NEBA 2M0YA 1SRMA 2MCNA 2KRNA 2MIOA 4QT7A 4HVUA 3I5SA 2CT3A 2F2XA 2EGEA 1CSKA 5HCKA 2K2MA 2BZXA 2O9SA 1VA7A 2L3SA 1GL5A 2ROTA 4LUEA 2YUOA 1M3AA 2K6DA 1GCQC 1OOTA 4FSSA 2K79A 1SEMA 1AZGB 1WXUA 4OMMA 4Y92A 3VS6A 1YWOA 2DX1A 2VWFA 1Z9ZA 3SHWA 1ZSGA 1WX6A 3I9QA 2DJQA 2EQIA 1VYUA 2FEIA 2RN8A 2CDTA 2YUQA 1ABQA 1G2BA 1X6BA 3KFVA 1E6HA 3M0UA 1K76A 4K11A 1ARKA 3C0CA 2VVKA 4OMLA 2KROA 1AD5A 1K0XA 4J9GA 5I22A 1NLPC 1MV3A 1CKBA 2CH4A 1M30A 2BZYA 2AZSA 3EHRA 2HSPA 2YDLA 4JZ3A 1EFNA 2SRCA 4A63B 4F16A 1KFZA 2LP5A 2AKLA 2J06A 3M0TA 3TSWA 3VS7A 1WDXA 3EG1A 2YT6A 1NM7A 4HVVA 3O5ZA 1UFFA 3H0HA 2LX7A 3M0PA 3FJ5A 3H41A 4AFSC 2RQUA 2JXBA 2NWMA 3EG3A 1LCKA 1NLOC 2B86A 4CC2A 2L0AA 2P4RA 2KXCA 3I35A 2RF0A 4M4ZA 5EC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWJ A;  3VS4 A;  4RTY A;  1QWF A;  2LCS A;  1RI9 A;  4LNP A;  1M3C A;  1ZUU A;  1OEB A;  2KYB A;  2C0I A;  1G83 A;  1I07 A;  2SEM A;  2DF6 A;  1X2Q A;  3CQT A;  2X3X D;  4OMO A;  1YNZ A;  4GLM A;  4D8K A;  4DEX A;  1HJD A;  1V1C A;  1K1Z A;  1GFD A;  2LMJ A;  1RUW A;  4JZ4 A;  2LQN A;  4EIK A;  1SRL A;  2D1X A;  2LZ6 B;  2O88 A;  2JS2 A;  3UA6 A;  1I0C A;  1X6G A;  2O9V A;  4HXJ A;  1UUE A;  2CUD A;  2GTO A;  2JT4 A;  2VKN A;  1W70 A;  2JM9 A;  2LNH B;  4J9E A;  3GBQ A;  3EHQ A;  4AFZ C;  1GBR A;  1UGV A;  1H3H A;  1U5S A;  2DBK A;  4JJC A;  4CC4 B;  5FWB A;  2FRW A;  2O31 A;  1JEG A;  2DMO A;  2CSI A;  3EG0 A;  2AZV A;  2K7A A;  4JJB A;  1Y0M A;  2HBW A;  2OI3 A;  1ZX6 A;  1S1N A;  1JQQ A;  1YP5 A;  1BK2 A;  1KJW A;  3VS1 A;  1JXO A;  1UTI A;  4HCK A;  1IO6 A;  3VRY A;  1SHF A;  1WXT A;  2EYX A;  2ED1 A;  1NYG A;  1QKW A;  1UDL A;  3TSZ A;  4JPB W;  4D8D A;  2FPD A;  3M0Q A;  2JM8 A;  2DVJ A;  2LJ0 A;  1X43 A;  1FMK A;  1SHG A;  1UJ0 A;  2A36 A;  4IIM A;  2CRE A;  1ZLM A;  2EBP A;  5IXB A;  1GCP A;  3I5R A;  3SEM A;  2RPN A;  4ORZ A;  2DBM A;  1FYN A;  3REA B;  1PRM C;  4F17 A;  1JU5 C;  1WI7 A;  3VS5 A;  1GBQ A;  2LQW A;  2W10 A;  4RTW A;  2CT4 A;  2ROL A;  2EVR A;  3EG2 A;  2H8H A;  2DRM A;  1TG0 A;  2J7I A;  2V1R A;  1TUC A;  1GRI A;  1UG1 A;  1CKA A;  3M0R A;  4RTU A;  4RTV A;  2EYY A;  4RTT A;  1K4U S;  4F14 A;  1PNJ A;  5IH2 A;  2EYZ A;  4KRT A;  1UHC A;  4AG1 C;  1B07 A;  2J6O A;  4J9I A;  2DIL A;  5L23 A;  2DA9 A;  2L3Q A;  1H92 A;  2KE9 A;  2J6K A;  1ZBJ A;  2RNA A;  4RUG A;  5ECA A;  1VYV A;  2KNB B;  4AG2 C;  1M8M A;  1OPL A;  4GBQ A;  2ABL A;  1BB9 A;  1AEY A;  2GGR A;  2JMC A;  1JO8 A;  4LE9 A;  3EGU A;  1UJY A;  2FO0 A;  3U23 A;  4Z88 A;  3H0F A;  2KT1 A;  2AKK A;  3UAT A;  4JJD A;  2ENM A;  3REB B;  2JMA A;  4AFU C;  2RQW A;  2A28 A;  2G6F X;  1VYT A;  1UEC A;  2D8H A;  4J9F A;  2GBQ A;  2IIM A;  2A37 A;  1W6X A;  2EPD A;  2RQV A;  3TVT A;  1T0H A;  4CC3 A;  1PRL C;  2E5K A;  2M51 A;  2K9G A;  4LUD A;  2D8J A;  2L3P A;  1M27 C;  4J9C A;  2CH4 W;  2KXD A;  3NGP A;  2BTT A;  2OAW A;  2MOX A;  2KYM A;  1PKT A;  1HD3 A;  5FW9 A;  2XMF A;  2KT8 A;  2EGA A;  1T3S A;  1X69 A;  1J3T A;  1WIE A;  3IQL A;  2ESW A;  5IXF A;  1T3L A;  4CC7 A;  3PE0 A;  1QLY A;  3THK A;  4OMP A;  1NYF A;  2KBT A;  4HVW A;  2NUZ A;  1SPK A;  2KEA A;  1U3O A;  1OPK A;  3PVL A;  1X27 A;  3H0I A;  2FPE A;  2F2V A;  2LJ1 A;  1N5Z A;  5GJW B;  1OV3 A;  2J6F A;  3QWX X;  2X3W D;  2DE0 X;  4IIO A;  1SSH A;  2F2W A;  1RLP C;  2KRS A;  2JW4 A;  2YSQ A;  2FG0 A;  1PWT A;  2GTJ A;  2D0N A;  4J9H A;  1Y57 A;  2HCK A;  2JTE A;  1NEG A;  1ZUY A;  1ZUK A;  2BZ8 A;  1E7O A;  3VS0 A;  2PNI A;  2DL5 A;  1WLP B;  1T0J A;  2DL7 A;  3NPF A;  3VS2 A;  2A08 A;  2GQI A;  1WYX A;  2V1Q A;  4DEY A;  2KRM A;  3ZL7 C;  2FPF A;  1RLQ C;  2DRK A;  2HEQ A;  1QWE A;  2DL3 A;  4Z8A A;  1MUZ A;  1JXM A;  2ECZ A;  2I0N A;  3VS3 A;  1YN8 A;  2EYW A;  2KGT A;  4Z89 A;  1I1J A;  1XOV A;  2CSQ A;  1H8K A;  3ULR B;  1X2K A;  1QKX A;  4RTX A;  3NHN A;  2C0T A;  2EKH A;  3VRZ A;  4WCI A;  4E6R A;  1GCQ A;  1BU1 A;  2PTK A;  1QCF A;  4J9B A;  1AWX A;  1AWW A;  2QDL A;  5I11 A;  1AOJ A;  2DL4 A;  3LH5 A;  1UE9 A;  3QWY A;  3RNJ A;  1YCS B;  4J9D A;  4X1V A;  2CUB A;  2K3B A;  1ABO A;  2O2O A;  3JV3 A;  1NG2 A;  1B3Q A;  1U06 A;  2J05 A;  2RMO A;  1PKS A;  5FWC A;  2DYB A;  1A0N B;  1WFW A;  2DLP A;  4LN2 A;  2W0Z A;  3PVQ A;  4ZNX A;  3R6N A;  2HDA A;  1HSQ A;  1K0S A;  2RQT A;  2ED0 A;  1E6G A;  5IHK A;  2AK5 A;  1TUD A;  3UF4 A;  4ESR A;  1WA7 A;  2DNU A;  2DL8 A;  3UA7 A;  4R0K A;  1K9A A;  1AZE A;  1WXB A;  1W1F A;  4OMQ A;  1Z9Q A;  2EGC A;  2YUP A;  1KSW A;  2KR3 A;  3A98 A;  1KIK A;  3RBB B;  2RQR A;  2OJ2 A;  1AVZ C;  2C0O A;  2FRY A;  2GNC A;  1BBZ A;  1M3B A;  2YUN A;  1PHT A;  1MV0 B;  2EW3 A;  2PZ1 A;  4AFQ C;  1YWP A;  5GJV B;  3M0S A;  5IHI A;  3NMZ C;  1AWO A;  2JS0 A;  4OMN A;  4RTZ A;  1GFC A;  2L2P A;  2DM1 A;  5IHN A;  1UHF A;  2LJ3 A;  1NEB A;  2M0Y A;  1SRM A;  2MCN A;  2KRN A;  2MIO A;  4QT7 A;  4HVU A;  3I5S A;  2CT3 A;  2F2X A;  2EGE A;  1CSK A;  5HCK A;  2K2M A;  2BZX A;  2O9S A;  1VA7 A;  2L3S A;  1GL5 A;  2ROT A;  4LUE A;  2YUO A;  1M3A A;  2K6D A;  1GCQ C;  1OOT A;  4FSS A;  2K79 A;  1SEM A;  1AZG B;  1WXU A;  4OMM A;  4Y92 A;  3VS6 A;  1YWO A;  2DX1 A;  2VWF A;  1Z9Z A;  3SHW A;  1ZSG A;  1WX6 A;  3I9Q A;  2DJQ A;  2EQI A;  1VYU A;  2FEI A;  2RN8 A;  2CDT A;  2YUQ A;  1ABQ A;  1G2B A;  1X6B A;  3KFV A;  1E6H A;  3M0U A;  1K76 A;  4K11 A;  1ARK A;  3C0C A;  2VVK A;  4OML A;  2KRO A;  1AD5 A;  1K0X A;  4J9G A;  5I22 A;  1NLP C;  1MV3 A;  1CKB A;  2CH4 A;  1M30 A;  2BZY A;  2AZS A;  3EHR A;  2HSP A;  2YDL A;  4JZ3 A;  1EFN A;  2SRC A;  4A63 B;  4F16 A;  1KFZ A;  2LP5 A;  2AKL A;  2J06 A;  3M0T A;  3TSW A;  3VS7 A;  1WDX A;  3EG1 A;  2YT6 A;  1NM7 A;  4HVV A;  3O5Z A;  1UFF A;  3H0H A;  2LX7 A;  3M0P A;  3FJ5 A;  3H41 A;  4AFS C;  2RQU A;  2JXB A;  2NWM A;  3EG3 A;  1LCK A;  1NLO C;  2B86 A;  4CC2 A;  2L0A A;  2P4R A;  2KXC A;  3I35 A;  2RF0 A;  4M4Z A;  5EC7 A; 
#chains in the Genus database with same CATH topology
 2X35 A;  1QW1 A;  3VS4 A;  3CD6 A;  2RB6 A;  3CCM T;  1KQS A;  5FU6 B;  2MYS A;  5KCH A;  5GMK l;  4XTX A;  3OYN A;  2DZ9 A;  5FU7 C;  1IXD A;  4GLM A;  4QQ6 A;  4DEX A;  1ZBX A;  5GAO m;  5LJ5 e;  3URG A;  1PC0 A;  2QQB A;  2GCX A;  5CKE A;  2O88 A;  2FB7 A;  3UA6 A;  2O9V A;  5IN1 A;  3JCM f;  4HXJ A;  2GTO A;  3OYB A;  2JM9 A;  4M7A F;  1XTD A;  4EMG A;  1U5S A;  1YJN Q;  4JJC A;  1H3H A;  2DXU A;  4C92 E;  4C8Q C;  2FRW A;  2O31 A;  2DMO A;  2CSI A;  3EG0 A;  2AZV A;  4JJB A;  3S3O A;  4KUI A;  2HBW A;  2O01 E;  1ZX6 A;  1S1N A;  3CME Q;  1YP5 A;  3VYH B;  1VQK A;  2NUT B;  3VS1 A;  2QA4 A;  1UTI A;  5GMK m;  4JLG A;  1I5L A;  2RI5 A;  1NYG A;  2AHJ B;  1QKW A;  3PMT A;  2JM8 A;  4IIM A;  4QQG A;  1X43 A;  1SHG A;  3JB9 F;  2DAQ A;  1GCP A;  3I5R A;  3M5A A;  2RPN A;  3REA B;  3OA6 A;  4J7I A;  4RCB A;  1JU5 C;  1MMG A;  1PM3 A;  5CO7 A;  3G71 Q;  2CT4 A;  1YJN T;  1ACM B;  2EQJ A;  1TG0 A;  3BDU A;  5CAI A;  3OYE A;  1TUC A;  1GRI A;  2QEX A;  4RTU A;  2RJE A;  1K4U S;  4F14 A;  4PLL A;  5IH2 A;  3OYI A;  3OYC A;  2RO0 A;  3P8B B;  4KRT A;  2DXC A;  4XTW A;  2LT1 A;  3J80 E;  4NL3 A;  2J6K A;  3C12 A;  4C8Q E;  3CPW S;  2HQH A;  5CQX A;  1M8M A;  1OPL A;  1VQO A;  5IAY A;  1LVK A;  4BDY A;  1BB9 A;  1UGQ B;  2FHD A;  5KYN A;  3VUZ A;  4LE9 A;  1UJY A;  2FO0 A;  3INZ A;  4KUD K;  3I55 Q;  3QZ9 B;  4Z88 A;  2NUT A;  5GAO r;  2L8D A;  3CCR A;  3UAT A;  2YLB A;  4UC4 A;  4C8Q G;  1RI0 A;  4JRQ A;  3QUI A;  4AFU C;  3RIR A;  4HA8 A;  3M9Q A;  4J9F A;  1VQO T;  2GBQ A;  2IIM A;  1Q86 C;  3JCM g;  2EPD A;  2EQK A;  2RQV A;  2DET A;  2XD0 A;  4B9W A;  4CC3 A;  2E5K A;  4M7A B;  1JRI A;  2K9G A;  3VUB A;  4RCC A;  1LPL A;  2CZ7 B;  2RJF A;  2L3P A;  1UGS B;  3Q1J A;  1D0X A;  2IVW A;  2DFU A;  2KXD A;  1WHK A;  1VQ4 A;  2DTO A;  1YHQ Q;  2MOX A;  4JJN K;  1PKT A;  3HP9 A;  4HCC A;  2O4X A;  4LDW A;  3OW2 A;  2WSE E;  2EGA A;  1T3S A;  4L5G A;  3JAM E;  3CC2 Q;  2KQW A;  4EPC A;  1Y71 A;  2E70 A;  3CCE Q;  3M59 A;  2M02 A;  5FU6 C;  2KAF A;  2KBT A;  3I55 T;  1F1B B;  3LH0 A;  1U3O A;  1SG5 A;  3PVL A;  2F2V A;  5GAM j;  1N5Z A;  5CK9 A;  4M77 E;  4OB2 B;  2MMP A;  3ZFJ A;  1TS9 A;  2VXF A;  1Q81 R;  2XIC A;  1KD1 C;  4J9H A;  2D0N A;  2XID A;  2DK3 A;  1NEG A;  3WVE B;  2QGF B;  2BIV A;  3VS0 A;  1Q81 U;  1WLP B;  5LJ3 e;  4M7D D;  3NTI A;  2YRD A;  2XDB A;  4X9C A;  3OSV A;  2GQI A;  3S3M A;  4M78 F;  1WYX A;  2V1Q A;  3D7S B;  4DEY A;  3ZL7 C;  1RLQ C;  4PFZ A;  2R57 A;  2HEQ A;  1Q95 G;  2VXE A;  1VOM A;  5D7U A;  1MUZ A;  5LJ5 f;  1IGQ A;  4Z89 A;  1R0B G;  2CSQ A;  4LD9 K;  3NHN A;  2RM4 A;  1BU1 A;  4XU3 A;  2DD4 A;  2CZ1 B;  4XQ3 A;  4Y28 E;  1AOJ A;  4BB7 A;  1UE9 A;  1EX4 A;  3RNJ A;  4J9D A;  3CCU A;  4X1V A;  2O2O A;  3JV3 A;  3OBW A;  5HK0 A;  1U06 A;  5CKH A;  3SWN A;  3ZBD A;  1A0N B;  1WFW A;  2A0F B;  1NBE B;  1NJI U;  2W0Z A;  3PVQ A;  4PJM A;  2XDD A;  3M55 A;  2HDA A;  2V26 A;  4X9D A;  4N4H A;  4HCZ A;  1H3Z A;  4FT4 A;  1QVG A;  1TUD A;  5FRO A;  2YRC A;  3UA7 A;  2QQR A;  4C0F A;  1K9A A;  3KBG A;  2RHU A;  2MWP A;  2YUP A;  4N4I A;  1UEB A;  3OYL A;  1AVZ C;  1R0C B;  1YIT Q;  2C0O A;  4J83 A;  1M3B A;  2PU9 B;  2EW3 A;  5GAN 8;  2PZ1 A;  2DKG A;  1YWP A;  4ELZ C;  1VQL T;  5IHI A;  3RES A;  3EFR A;  1MNE A;  2JS0 A;  4RTZ A;  1GFC A;  2VYT A;  2M0Y A;  4KGX B;  2K5F A;  2MIO A;  3QJY A;  1NJI C;  4C92 B;  4IUV A;  5A0L A;  2EGE A;  1CSK A;  2E41 A;  1M1K C;  4JUV A;  4M7A C;  3LX7 A;  1I81 A;  2P0K A;  4OB0 B;  4DA4 A;  1FX7 A;  2K2M A;  1YBY A;  1G3T A;  2O9S A;  1GL5 A;  5GAN 7;  3I56 A;  1JJ2 A;  4P5N A;  2ROT A;  2JOY A;  2K6D A;  3LW5 E;  3CPW P;  1HXD A;  4JDS A;  4R55 A;  2JVV A;  1X75 C;  3R6O A;  4M75 E;  2VGN A;  4BI4 A;  5LJ5 g;  3PIO A;  1YIT T;  2QI2 A;  3SHW A;  4N4G A;  3I9Q A;  1VQ7 Q;  5A0G A;  5HKC A;  2EQI A;  2FEI A;  2CDT A;  4C0G A;  2HAX A;  3E2U A;  1ABQ A;  3G6E A;  3SDZ A;  3EG9 B;  1NZ9 A;  1E6H A;  4PJO D;  4E7Z A;  4BY6 B;  2MI6 A;  3WXM B;  1VQP A;  5CCA A;  3OMG A;  4J9G A;  1W2B A;  5I22 A;  3RDV A;  1CKB A;  1LNX A;  1M30 A;  5CIU A;  5KE3 A;  2JNG A;  1N9S A;  2SRC A;  1KFZ A;  4NL2 A;  2LP5 A;  2F69 A;  4A54 A;  1RAC B;  2WSF E;  4KBM B;  2I2L A;  2YT6 A;  5GMK i;  3JCM P;  3O5Z A;  4FT2 A;  4E7K A;  3WVD B;  4MMK A;  1M1G A;  1LCK A;  1N6A A;  1NLO C;  4C8Q B;  3CCQ T;  3FRN A;  1KC8 C;  4C92 A;  2KXC A;  1V29 B;  5EC7 A;  2XG8 D;  5KYU B;  1PCX A;  1QWF A;  1D09 B;  1C6V X;  2GF7 A;  3O8V A;  4LD6 A;  4LNP A;  1G83 A;  1I07 A;  3QDF A;  3M54 A;  4OMO A;  1YNZ A;  4M7A G;  4OB1 B;  4D8K A;  1WQW A;  1PD1 A;  5LJ3 f;  1V1C A;  2ATC B;  2K2V A;  3QKJ A;  4EIK A;  4JZ4 A;  2LQN A;  2YXY A;  3MKD A;  2K3X A;  1TSF A;  1WHJ A;  1Q7Y R;  1SSF A;  2LZ6 B;  3OS1 A;  1N9R A;  3EG9 A;  1YIJ A;  2E6N A;  1UUE A;  2CP6 A;  2CUD A;  1Q7Y U;  2LCL A;  2F5T X;  2LNH B;  3QHS A;  3CXC A;  1UGV A;  2DBK A;  3RMS A;  3JB9 J;  3G4S Q;  3TRE A;  1FXX A;  2IPO B;  3G1J A;  1D3B B;  1Y0M A;  3JB9 G;  2OI3 A;  2ZPB B;  1BK2 A;  1KQ1 A;  4FW1 A;  3G7Z A;  3CMA Q;  1VQ5 A;  2ED1 A;  2RA2 A;  5KH6 A;  4M7D F;  4D8D A;  2FPD A;  3M0Q A;  4PJJ A;  2KY9 A;  3MPU B;  2DVJ A;  2LJ0 A;  1UJ0 A;  2XKO C;  1ZLM A;  2EBP A;  4PJN A;  1EZZ B;  3GNF B;  4M77 B;  1BI1 A;  4C8Q A;  5GMK j;  4OGE A;  1ZQ1 A;  3KXT A;  3OYH A;  1S72 T;  5DLQ E;  1PRM C;  4F17 A;  1VQ5 T;  8AT1 B;  5J26 A;  1JB0 E;  2M0O A;  3BW1 A;  2V8I A;  1K73 U;  2OTJ Q;  2W10 A;  4ZN1 A;  1Q7Y C;  4C92 C;  3G4S T;  3A5Z B;  3EG2 A;  3CC7 A;  4OB3 B;  2DRM A;  2J7I A;  3L2Z A;  1YI2 A;  3M0R A;  2CP3 A;  5CVI A;  5C0M A;  2P4T A;  4RTT A;  4JS5 A;  5KCO A;  3BDL A;  5GAO l;  2FZK B;  3JCM c;  1PNJ A;  4M75 F;  1U1T A;  2QTX A;  3V8K A;  5GAN g;  3CMA T;  2QG9 B;  3CCM A;  2J6O A;  1M90 C;  1WQ7 A;  3TU4 K;  5L23 A;  3CCJ Q;  1H92 A;  2KE9 A;  3CC7 T;  2RNA A;  3OYJ A;  4RUG A;  2QQ9 A;  1YI2 T;  3OS0 A;  1AEY A;  1QP2 A;  2K5I A;  3CCV Q;  1D3B A;  2GGR A;  5CR2 A;  3A1P A;  2X51 A;  1JO8 A;  4CI0 C;  4BY6 C;  3GP8 A;  4J7F A;  1BKB A;  5LJ3 g;  4F7U E;  4YTL A;  1IRX A;  3A8H B;  1VIE A;  3PT9 A;  4JJD A;  4E7L A;  1QVF A;  3REB B;  2JMA A;  1UEC A;  2D8H A;  1K73 C;  4XTU A;  4OF1 A;  4CRI A;  5LJ3 h;  1KQS S;  3TVT A;  1T0H A;  1EIF A;  3OYF A;  2VC8 A;  4LUD A;  3DB3 A;  4QVZ A;  2QAZ A;  2CZ0 B;  4M77 A;  4XTY A;  1PSF A;  5FLX E;  1WNL A;  2CYZ B;  2OAW A;  3MCA B;  3CCJ T;  2M1H A;  1C0M A;  4KGZ B;  1VQK Q;  4GY5 A;  5FW9 A;  3RER A;  2KT8 A;  2QA4 Q;  1J3T A;  1WIE A;  4QVC A;  3CCV T;  2ESW A;  4DBH A;  4CC7 A;  4M78 E;  4OMP A;  1NYF A;  1Q82 R;  5KYX B;  2X4J A;  4C92 G;  2RK1 A;  4OP0 A;  3QPH A;  1Q82 U;  4OMF B;  1BYM A;  1X27 A;  2FPE A;  1YJN A;  4PL6 A;  1AT1 B;  2J6F A;  3VYG A;  3E9G A;  5I2S A;  4IIO A;  1OYX A;  4QW2 A;  2KRS A;  4BI3 A;  2M16 A;  2JW4 A;  2YSQ A;  3V7C A;  4PJO F;  2FG0 A;  1PWT A;  2GTJ A;  3CME A;  2L3R A;  4DQ2 A;  1OX9 A;  1Y57 A;  1FMV A;  2PVG B;  1AHJ B;  3PMI A;  3X26 B;  5D6Y A;  3JCM W;  3HHT B;  1T0J A;  2E6Z A;  4O5V A;  3DLL A;  1M9S A;  3MHX A;  1W4S A;  4MML A;  4M75 B;  3HKS A;  2JTF A;  2KRM A;  3JCM d;  1YJW Q;  2DRK A;  4Z8A A;  4Z02 A;  1D1B A;  3M58 A;  2DZC A;  3CME T;  1YN8 A;  1N8R R;  1K8A R;  2HL3 A;  1X2K A;  3FEO A;  4RTX A;  3C95 A;  3VRZ A;  4E6R A;  3G71 A;  4NS5 A;  1AWW A;  1I8F A;  1Q82 C;  4R56 A;  4M77 C;  2DL4 A;  3LH5 A;  3TQ7 P;  2K3B A;  1O9S A;  2OTL Q;  2RMO A;  1PKS A;  3OB9 A;  2E3H A;  3MO8 A;  4WTO B;  3UWN A;  4A53 A;  4ZNX A;  5KYX A;  3G71 T;  1RAE B;  5CKB A;  2X9H A;  3H8Z A;  3X28 B;  2DIQ A;  3JCM Q;  1YJW T;  3FB9 A;  4XU1 A;  4ESR A;  1Y96 B;  2DNU A;  4E7S A;  1AZE A;  1VQ4 Q;  4N0A A;  2E5Q A;  3RUX A;  3I55 A;  3PFS A;  2K4Y A;  5DM7 R;  3A98 A;  2BE7 D;  3RBB B;  4GLK A;  2QYZ A;  2GNC A;  2PUO B;  4J5Y A;  2YUN A;  1PHT A;  2CZ6 B;  4F7U F;  1OI1 A;  1MV0 B;  3GOX A;  4AFQ C;  2DXB A;  3RKY A;  2DM1 A;  5IHN A;  4QQD A;  1WHL A;  3QII A;  3OW2 S;  3MEA A;  1NEB A;  3LWH A;  2MCN A;  4EMK B;  2KRN A;  3I5S A;  2CT3 A;  1TXQ A;  1PG5 B;  4E47 A;  1YHQ A;  1QQJ A;  3EFO B;  2BZX A;  4E7H A;  5LJ5 j;  4FYV B;  3CC2 A;  2YLC A;  1K9M R;  3CC4 Q;  2K79 A;  3CCE A;  5GAN 4;  3E1S A;  3HPW A;  1K9M U;  4M77 G;  1YHQ T;  1Z9Z A;  3H9N A;  3DB4 A;  2RN8 A;  2VAS A;  2WSC E;  5DY9 A;  5A0D A;  3CC2 T;  2AT1 B;  2FZG B;  4M7A A;  1Y96 A;  3FJP A;  1K76 A;  3CCL Q;  3CCE T;  3TCJ A;  1VQN Q;  1M2O A;  4OML A;  4DBQ A;  2YWW A;  1AD5 A;  2COW A;  2F5K A;  1KQS P;  2C06 A;  1MHN A;  1YFN A;  4IUQ A;  2Z0W A;  1P92 A;  1NLP C;  1MV3 A;  2RI2 A;  3EHR A;  2YDL A;  3CCS Q;  3FLG A;  4A63 B;  4N0A C;  4F16 A;  1VQ6 Q;  3P8D A;  1RAB B;  1OU9 A;  3TSW A;  5LL6 S;  4FU6 A;  1WDX A;  1NM7 A;  1NPP A;  3CC4 T;  6AT1 B;  2JUF A;  1UFF A;  2JJ9 A;  2PQW A;  1VIF A;  3H41 A;  2RQU A;  4FYY B;  2F1L A;  2JXB A;  1BIB A;  3EG3 A;  4M75 C;  1Q81 C;  1QCO A;  2DXT A;  4EMK A;  1X01 A;  1MND A;  7AT1 B;  3ER0 A;  1AWJ A;  3EFO A;  1XNI A;  2EQU A;  1VQL A;  5GAM d;  2KYB A;  1ZUU A;  4O6J A;  4F7U B;  2DF6 A;  5HK3 A;  1X2Q A;  3CQT A;  3L42 A;  4C0Z A;  3TEE A;  5LJ5 d;  2PVD B;  1HJD A;  4JRP A;  1G3Y A;  3UPU A;  1GFD A;  3CCS T;  2LMJ A;  4M7D E;  1RUW A;  4FYW B;  1SRL A;  2D1X A;  1VQ6 T;  3MJX A;  1RAD B;  1NPR A;  3RKX A;  4FSX A;  2RHZ A;  4V2S A;  1D0Y A;  2JT4 A;  3QYG B;  5EG2 A;  3FDR A;  4J9E A;  2MWO A;  3GBQ A;  3EHQ A;  4QKU A;  4RMO A;  1VQ8 Q;  4Y91 A;  5FWB A;  4AT1 B;  3GLX A;  3ASK A;  1JEG A;  1IHW A;  1ZHI A;  2KK4 A;  1YIT A;  2K7A A;  2RJD A;  3QJ6 A;  2E65 A;  1M1F A;  4A4F A;  1B34 B;  1M4Z A;  2EJG A;  2RHX A;  1QVP A;  4M78 B;  1SHF A;  1WXT A;  4F04 B;  4M7A D;  3TSZ A;  1IRE B;  2LDM A;  4RG8 A;  2E4H A;  2IG0 A;  3HL8 A;  2VUB A;  5GAO q;  3QG1 A;  2A36 A;  3GNG A;  2CRE A;  2CP2 A;  4C5G A;  4MZP A;  2P84 A;  1FMW A;  3SEM A;  4ORZ A;  2HMA A;  3HRS A;  2DO3 A;  4DBR A;  3JCM J;  1WJS A;  3JB9 H;  2CGH A;  4J8O A;  2VGM A;  3OYG A;  3OS5 A;  2H3E B;  2COZ A;  1XQH A;  5J3B A;  2EYQ A;  1WPY A;  4EMK C;  4M75 G;  2ROL A;  1VQ8 T;  2EVR A;  2DD5 A;  2RK2 A;  2H8H A;  3PIP A;  5GAN j;  4B6M A;  5L8R E;  1BCO A;  1UG1 A;  1CKA A;  2EKO A;  3CCQ A;  2L5Q A;  2LRQ A;  1VQ7 A;  3CBO A;  4PJL A;  2JZ2 A;  1PD0 A;  5DLO A;  2K3Y A;  1H64 1;  3MP1 A;  2QQS A;  2EYZ A;  3N5B B;  1BI3 A;  1OQK A;  1W2B S;  1UHC A;  2KVQ G;  1B07 A;  4J9I A;  2HL5 C;  4MZM A;  2DIL A;  3A8M B;  2DA9 A;  2L3Q A;  1ZBJ A;  3C4S A;  5ECA A;  2XHC A;  5LJ3 j;  4AG2 C;  4C5I A;  4GBQ A;  3CEY A;  1VQ7 T;  4BE1 A;  3KUF A;  3OW2 P;  1MMD A;  1M8V A;  5C6S A;  3U23 A;  2E1H A;  2RJC A;  3H0F A;  2D9T A;  1FWZ A;  4E7J A;  1B34 A;  2KT1 A;  2KSS A;  4EMH A;  2AKK A;  4J6X A;  1ZA1 B;  4E2F B;  5CQY A;  4M78 A;  3HFO A;  5KE2 A;  1VQM Q;  1TH7 A;  2A28 A;  2KMT A;  1VYT A;  2L89 A;  2RQW A;  2Y4Y A;  1VQ9 Q;  4AMC A;  1W6X A;  1PRL C;  2FL7 A;  1I4K 1;  2M51 A;  3M57 A;  1YIJ Q;  2K5L A;  2WAC A;  2D8J A;  2R58 A;  1YJ9 Q;  3AT1 B;  1V76 A;  1R77 A;  1MGQ A;  2CH4 W;  2QDY B;  3QDR B;  3JCM X;  5AT1 B;  3NGP A;  4DOW A;  3EAE A;  3OSS C;  2KYM A;  3MET A;  4RKU E;  4PJO E;  5KYW B;  1HD3 A;  4E7I A;  2DYI A;  4ELY C;  2NUP B;  2ZGW A;  1U1S A;  3IQL A;  1M2V B;  3CXC S;  5IXF A;  1T3L A;  3THK A;  3CBP A;  3JCM b;  5GAN d;  1S72 A;  4HVW A;  4FM4 B;  2NUZ A;  5FRN A;  2KEA A;  2HKN A;  1OPK A;  1C1A A;  5I21 A;  1VQ9 T;  2LJ1 A;  2Y90 A;  3G4S A;  1IGU A;  3QWX X;  2HQX A;  2X3W D;  2MAM A;  4L59 A;  2DE0 X;  3DKM A;  4KUL A;  2F2W A;  4KT0 E;  3AHU A;  2JTE A;  3LGF A;  1ZUK A;  2PNI A;  5KYU A;  3CMA A;  2H3J A;  2DL7 A;  3VS2 A;  3OY9 A;  2QXF A;  1RAH B;  1QMC A;  2X4W A;  4J6Y A;  1QWE A;  3FIF A;  3NFC A;  1JXM A;  2ECZ A;  1QVG P;  4XAX B;  2EYW A;  2KGT A;  3LWI A;  2NLU A;  4C92 D;  4M78 C;  1H8K A;  2RH2 A;  3VU3 C;  1G3S A;  1QKX A;  4L6V 5;  2VB6 A;  2C0T A;  1HYO A;  1GCQ A;  2PTK A;  1QCF A;  2K57 A;  1AWX A;  2OTJ A;  2QDL A;  5I11 A;  3S3N A;  2FYK A;  2VV5 A;  5KYW A;  3QWY A;  2EFI A;  3CD6 Q;  1YCS B;  1ABO A;  4C0D C;  2QTV A;  4PKC C;  2J05 A;  5FWC A;  3X25 B;  1M2V A;  3A8G B;  4C5H A;  2LTO A;  1HSQ A;  1K0S A;  2RQT A;  4B9X A;  2DVE A;  2OTJ T;  2ED0 A;  3CCJ A;  4BE2 A;  1OX8 A;  2FZC B;  2DL8 A;  3J7A F;  1QVF S;  3CCV A;  4F7U G;  1PSE A;  4A4H A;  4BAC A;  3OYY A;  1WXB A;  3EFS A;  1MMA A;  1N27 A;  1W1F A;  4LDV A;  1KSW A;  1ZA2 B;  3MEV A;  5GAM e;  1JJ2 P;  1KIK A;  1G8X A;  3BE3 A;  2RQR A;  3DLM A;  2OJ2 A;  4FL6 A;  4BD3 A;  2FRY A;  3GIB A;  3V7R A;  1BBZ A;  1OU8 A;  3CD6 T;  4M7D B;  5GJV B;  4VUB A;  2DIG A;  4PNO A;  3NMZ C;  4C5E A;  4C8Q D;  1AWO A;  4MZT A;  2DER A;  1UHF A;  2LJ3 A;  1UGP B;  3L1A A;  1IHV A;  1SRM A;  4KGV B;  3OYA A;  2F2X A;  3NTK A;  2HNI A;  2QAS A;  2HBP A;  2V8J A;  5HCK A;  1W2B P;  4M78 G;  4JS4 A;  2L3S A;  4WF2 A;  2JTM A;  4LUE A;  1M3A A;  2HSE B;  1GCQ C;  2XK0 A;  2V8K A;  1AZG B;  1WXU A;  4OMM A;  4PLI A;  3A8L B;  3VS6 A;  2E64 A;  2LQK A;  2DX1 A;  4X34 A;  1ZSG A;  2QEX Q;  1WX6 A;  3MEW A;  2YUQ A;  1VQK T;  2QA4 T;  1G2B A;  1X6B A;  2DJZ A;  2D0Q B;  2MPX C;  1WHG A;  2OX7 A;  1Q86 R;  3MP8 A;  3QXE B;  2NYS A;  2VVK A;  1Q86 U;  2KRO A;  2O4X B;  1N8R U;  1K8A U;  1K0X A;  1RAG B;  1ZSZ B;  2G3R A;  4QVD A;  1VQO Q;  3V8L A;  2A3L A;  3OMC A;  4OGC A;  1O75 A;  2HSP A;  1EFN A;  5GMK h;  1D1C A;  3QYH B;  1YJW A;  2AKL A;  3LGL A;  3CPW A;  5KYY B;  5D6X A;  3VS7 A;  3NTH A;  3CCR Q;  4M7D A;  3CBM A;  3EG1 A;  3RKW A;  5GAO n;  1HK9 A;  4LXC A;  4M77 D;  3OBY A;  3H0H A;  2LX7 A;  4MDX A;  2DTI A;  2NWM A;  2JN0 A;  4BI8 B;  5M9O A;  2QEX T;  3CXC P;  2KI7 A;  2L0A A;  2PVO B;  2EWN A;  3I35 A;  4XTV A;  4A4G A;  2COY A;  4RTY A;  3C94 A;  2EAY A;  2LCS A;  2OTL A;  1RI9 A;  4RG2 A;  1M3C A;  1OEB A;  4JRK A;  2C0I A;  2XU8 A;  3BY7 A;  2SEM A;  4NOY A;  4KH0 B;  3VJP A;  4D6W A;  2X3X D;  1KD1 R;  3VV0 A;  1RL2 A;  3OQ5 A;  5GAN 3;  2DEQ A;  4IUR A;  1KHC A;  1N8R C;  1K8A C;  1KD1 U;  1K1Z A;  3SB2 A;  4ZGJ B;  4M75 A;  2JS2 A;  3EH1 A;  1I0C A;  1X6G A;  2OTL T;  3JCM h;  4XK8 E;  3CCR T;  2LCC A;  2VKN A;  1W70 A;  1M5Q 1;  3E19 A;  4AFZ C;  1GBR A;  2EJF A;  2CP0 A;  4CC4 B;  4ATO A;  4PJO B;  1ZSZ A;  3A8O B;  2ZAE A;  5CKF A;  1JQQ A;  3SWN B;  1KJW A;  1JXO A;  1KHI A;  2Y4X A;  1IO6 A;  4HCK A;  3VRY A;  4XTZ A;  3X24 B;  5GAO p;  2EYX A;  1VQ4 T;  5KYY A;  5GAN e;  1UDL A;  3HRT A;  3ZEH A;  2LNV A;  4JPB W;  2E10 A;  3UT1 A;  4ZGE B;  2RHY A;  4XU2 A;  3J81 E;  1FMK A;  2ZPI B;  5IXB A;  4HKE A;  4M7D C;  2DBM A;  2YHT A;  1FYN A;  2ZPG B;  4IUP A;  4C92 F;  9ATC B;  2LX9 A;  4ME7 A;  2FVU A;  1WI7 A;  3VS5 A;  1GBQ A;  4FCY A;  2LQW A;  2P0Q A;  3CC4 A;  4RTW A;  3EH2 A;  2HKQ B;  2RHI A;  5GAM f;  3HRU A;  3CCU Q;  2V1R A;  4FYX B;  4ZTJ A;  1QVF P;  2QQA A;  4RTV A;  2EYY A;  4DBF A;  3PGG A;  4J6W A;  1Y7X A;  4AG1 C;  3S6W A;  4IUU A;  3CPF A;  2ZPH B;  3CCL A;  1UGR B;  1VQN A;  3RMQ A;  3H6Z A;  2XDP A;  1VYV A;  2KNB B;  1SKU B;  1YCY A;  2M9U A;  2ABL A;  1MMN A;  1K9M C;  4PJO A;  2MK5 A;  4KH1 B;  3CCS A;  2JMC A;  1NJI R;  1VQL Q;  2X4Y A;  3EGU A;  1VQ6 A;  4PK4 A;  4M75 D;  2GFA A;  1M1K R;  3CCL T;  1QVG S;  5I2M A;  3EGD B;  2ENM A;  1VQN T;  1M1K U;  1ZSZ C;  4FIB A;  2G6F X;  2P0P A;  1XJW B;  3OS2 A;  2A37 A;  2DEU A;  3CCU T;  2DPP B;  1BI2 A;  3EGX B;  3T9N A;  4Q5W A;  2LC4 A;  1M27 C;  4J9C A;  4C8Q F;  2DTH A;  3GF5 A;  2E12 A;  1TUG B;  2LT4 A;  4ZGD B;  1GXI E;  2QGG A;  2BTT A;  1DJ7 B;  1TTH B;  3QBY A;  2EQM A;  1I5O B;  3JB9 I;  5GMK e;  1TU0 B;  5CKD A;  3OYM A;  4M7D G;  2XMF A;  3L2U A;  1X69 A;  3I56 Q;  4A4E A;  4PFP A;  1D0Z A;  1QP3 A;  4JRI A;  4IUT A;  3PE0 A;  1QLY A;  4JLI A;  1LOJ A;  4ANJ A;  2EIF A;  3ME9 A;  3QZ5 B;  2HD0 A;  1SPK A;  4LDU A;  3H0I A;  1VQ8 A;  5GJW B;  3G6E Q;  1OV3 A;  1JJ2 S;  1WJQ A;  2ZPE B;  3L2Q A;  1SSH A;  1RLP C;  4C0D B;  4DOV A;  2HCK A;  3RR6 A;  4IKF A;  2HZY A;  1VQP Q;  1KC8 R;  5GAM g;  1ZUY A;  1TOV A;  2BZ8 A;  2BE9 B;  1E7O A;  4TVR A;  2DL5 A;  1KC8 U;  3NPF A;  5GAN 6;  3OYK A;  2A08 A;  4PJO C;  3EGD A;  1U8R A;  4F7U A;  3CCQ Q;  3JB9 D;  5GAM h;  2FPF A;  2CS7 A;  1LJO A;  2GQV A;  3SWN C;  2DL3 A;  3JCM e;  3LYI A;  3I56 T;  2A7Y A;  5LJ5 h;  2I0N A;  3VS3 A;  3V8J A;  1D1A A;  3F70 A;  3EGX A;  1I1J A;  1XOV A;  3ULR B;  4M77 F;  2LQ8 A;  2EKH A;  4WCI A;  4J9B A;  4HT8 A;  3SFM A;  5FU7 B;  1Y07 A;  1UB4 A;  1X6O A;  1IZ6 A;  2R5A A;  3G6E T;  1OZ2 A;  1WJR A;  4BE0 A;  4ZTF A;  2CUB A;  1BI0 A;  1NG2 A;  1B3Q A;  1KG1 A;  1RAI B;  1RAF B;  2DYB A;  3HSB A;  2DLP A;  1VQP T;  4LN2 A;  5AYF A;  2EJ9 A;  3R6N A;  1NE8 A;  3QO3 A;  1E6G A;  5GAN f;  5IHK A;  5IT9 E;  1RAA B;  1G3W A;  2AK5 A;  4M7A E;  4BUG A;  1WHM A;  1R8O B;  3UF4 A;  5J39 A;  3BFM A;  2LVM A;  3M4G A;  1WA7 A;  3M4Y A;  4LDY A;  3M56 A;  4R0K A;  1WGS A;  2HQE A;  2ZPF B;  4OMQ A;  1Z9Q A;  2EGC A;  1TWB A;  4A4K A;  2KR3 A;  4LDX A;  5A2Q E;  1OUL A;  1VQM A;  4OVA A;  1WHH A;  1VQ9 A;  3X20 B;  1VUB A;  3V7S A;  1QCN A;  1BCM A;  3MEU A;  5HY6 A;  2KDS A;  1S72 Q;  2BKD N;  1VQ5 Q;  4II1 A;  3MP6 A;  4EDU A;  1G5V A;  3M0S A;  2CKK A;  3LLR A;  2GFU A;  2MF2 A;  4OMN A;  1YJ9 A;  2L2P A;  3E9F A;  4PJO G;  3UDC A;  2XI9 A;  3L2W A;  4QT7 A;  1VQM T;  4HVU A;  3GPL A;  1M90 R;  1KQ2 A;  1VA7 A;  3PTA A;  3FC3 A;  1YIJ T;  1M90 U;  2YUO A;  1YJ9 T;  1OOT A;  3HFN A;  4FSS A;  2AIR B;  3QSU A;  3SD4 A;  1SEM A;  5LJ3 d;  2YRV A;  2OAU A;  4XU0 A;  1B7T A;  3CC7 Q;  3HTR A;  4Y92 A;  1YWO A;  4HCB A;  2QK0 A;  5GAN 2;  1IB8 A;  2VWF A;  1YI2 Q;  2DJQ A;  3PNW C;  4FW2 A;  1VYU A;  8ATC B;  3OYD A;  3M53 A;  2R5M A;  5FRM A;  4PFO A;  3KFV A;  4MDW A;  1K73 R;  3CCM Q;  3M0U A;  2ZZD A;  4HT9 A;  1SF9 A;  1OZ3 A;  4K11 A;  3VKI A;  1KK7 A;  1ARK A;  3C0C A;  2RI3 A;  4BDZ A;  2E3I A;  2BUD A;  4ZN3 A;  2B8A A;  4M78 D;  2CP7 A;  2CH4 A;  2BZY A;  2AZS A;  4JZ3 A;  1WZO A;  1BIA A;  2J06 A;  3M0T A;  5D6W A;  2PUK B;  2NUP A;  2ZCF B;  5GAN 5;  1JBM A;  3L2R A;  4HVV A;  2RD1 A;  3M0P A;  3FJ5 A;  4AFS C;  5GAN h;  3JCM V;  2B86 A;  2CP5 A;  4CC2 A;  2P4R A;  3P8H A;  3JRZ A;  3L2V A;  2X4X A;  2RF0 A;  2D6F A;  4M4Z A;  3JSC A; 
#chains in the Genus database with same CATH homology
 1AWJ A;  3VS4 A;  4RTY A;  1QWF A;  2LCS A;  1RI9 A;  4LNP A;  1M3C A;  1ZUU A;  1OEB A;  2KYB A;  2C0I A;  1G83 A;  1I07 A;  2SEM A;  2DF6 A;  1X2Q A;  3CQT A;  2X3X D;  4OMO A;  1YNZ A;  4GLM A;  4D8K A;  4DEX A;  1HJD A;  1V1C A;  1K1Z A;  1GFD A;  2LMJ A;  1RUW A;  4JZ4 A;  2LQN A;  4EIK A;  1SRL A;  2D1X A;  2LZ6 B;  2O88 A;  2JS2 A;  3UA6 A;  1I0C A;  1X6G A;  2O9V A;  4HXJ A;  1UUE A;  2CUD A;  2GTO A;  2JT4 A;  2VKN A;  1W70 A;  2JM9 A;  2LNH B;  4J9E A;  3GBQ A;  3EHQ A;  4AFZ C;  1GBR A;  1UGV A;  1H3H A;  1U5S A;  2DBK A;  4JJC A;  4CC4 B;  5FWB A;  2FRW A;  2O31 A;  1JEG A;  2DMO A;  2CSI A;  3EG0 A;  2AZV A;  2K7A A;  4JJB A;  1Y0M A;  2HBW A;  2OI3 A;  1ZX6 A;  1S1N A;  1JQQ A;  1YP5 A;  1BK2 A;  1KJW A;  3VS1 A;  1JXO A;  1UTI A;  4HCK A;  1IO6 A;  3VRY A;  1SHF A;  1WXT A;  2EYX A;  2ED1 A;  1NYG A;  1QKW A;  1UDL A;  3TSZ A;  4JPB W;  4D8D A;  2FPD A;  3M0Q A;  2JM8 A;  2DVJ A;  2LJ0 A;  1X43 A;  1FMK A;  1SHG A;  1UJ0 A;  2A36 A;  4IIM A;  2CRE A;  1ZLM A;  2EBP A;  5IXB A;  1GCP A;  3I5R A;  3SEM A;  2RPN A;  4ORZ A;  2DBM A;  1FYN A;  3REA B;  1PRM C;  4F17 A;  1JU5 C;  1WI7 A;  3VS5 A;  1GBQ A;  2LQW A;  2W10 A;  4RTW A;  2CT4 A;  2ROL A;  2EVR A;  3EG2 A;  2H8H A;  2DRM A;  1TG0 A;  2J7I A;  2V1R A;  1TUC A;  1GRI A;  1UG1 A;  1CKA A;  3M0R A;  4RTU A;  4RTV A;  2EYY A;  4RTT A;  1K4U S;  4F14 A;  1PNJ A;  5IH2 A;  2EYZ A;  4KRT A;  1UHC A;  4AG1 C;  1B07 A;  2J6O A;  4J9I A;  2DIL A;  5L23 A;  2DA9 A;  2L3Q A;  1H92 A;  2KE9 A;  2J6K A;  1ZBJ A;  2RNA A;  4RUG A;  5ECA A;  1VYV A;  2KNB B;  4AG2 C;  1M8M A;  1OPL A;  4GBQ A;  2ABL A;  1BB9 A;  1AEY A;  2GGR A;  2JMC A;  1JO8 A;  4LE9 A;  3EGU A;  1UJY A;  2FO0 A;  3U23 A;  4Z88 A;  3H0F A;  2KT1 A;  2AKK A;  3UAT A;  4JJD A;  2ENM A;  3REB B;  2JMA A;  4AFU C;  2RQW A;  2A28 A;  2G6F X;  1VYT A;  1UEC A;  2D8H A;  4J9F A;  2GBQ A;  2IIM A;  2A37 A;  1W6X A;  2EPD A;  2RQV A;  3TVT A;  1T0H A;  4CC3 A;  1PRL C;  2E5K A;  2M51 A;  2K9G A;  4LUD A;  2D8J A;  2L3P A;  1M27 C;  4J9C A;  2CH4 W;  2KXD A;  3NGP A;  2BTT A;  2OAW A;  2MOX A;  2KYM A;  1PKT A;  1HD3 A;  5FW9 A;  2XMF A;  2KT8 A;  2EGA A;  1T3S A;  1X69 A;  1J3T A;  1WIE A;  3IQL A;  2ESW A;  5IXF A;  1T3L A;  4CC7 A;  3PE0 A;  1QLY A;  3THK A;  4OMP A;  1NYF A;  2KBT A;  4HVW A;  2NUZ A;  1SPK A;  2KEA A;  1U3O A;  1OPK A;  3PVL A;  1X27 A;  3H0I A;  2FPE A;  2F2V A;  2LJ1 A;  1N5Z A;  5GJW B;  1OV3 A;  2J6F A;  3QWX X;  2X3W D;  2DE0 X;  4IIO A;  1SSH A;  2F2W A;  1RLP C;  2KRS A;  2JW4 A;  2YSQ A;  2FG0 A;  1PWT A;  2GTJ A;  2D0N A;  4J9H A;  1Y57 A;  2HCK A;  2JTE A;  1NEG A;  1ZUY A;  1ZUK A;  2BZ8 A;  1E7O A;  3VS0 A;  2PNI A;  2DL5 A;  1WLP B;  1T0J A;  2DL7 A;  3NPF A;  3VS2 A;  2A08 A;  2GQI A;  1WYX A;  2V1Q A;  4DEY A;  2KRM A;  3ZL7 C;  2FPF A;  1RLQ C;  2DRK A;  2HEQ A;  1QWE A;  2DL3 A;  4Z8A A;  1MUZ A;  1JXM A;  2ECZ A;  2I0N A;  3VS3 A;  1YN8 A;  2EYW A;  2KGT A;  4Z89 A;  1I1J A;  1XOV A;  2CSQ A;  1H8K A;  3ULR B;  1X2K A;  1QKX A;  4RTX A;  3NHN A;  2C0T A;  2EKH A;  3VRZ A;  4WCI A;  4E6R A;  1GCQ A;  1BU1 A;  2PTK A;  1QCF A;  4J9B A;  1AWX A;  1AWW A;  2QDL A;  5I11 A;  1AOJ A;  2DL4 A;  3LH5 A;  1UE9 A;  3QWY A;  3RNJ A;  1YCS B;  4J9D A;  4X1V A;  2CUB A;  2K3B A;  1ABO A;  2O2O A;  3JV3 A;  1NG2 A;  1B3Q A;  1U06 A;  2J05 A;  2RMO A;  1PKS A;  5FWC A;  2DYB A;  1A0N B;  1WFW A;  2DLP A;  4LN2 A;  2W0Z A;  3PVQ A;  4ZNX A;  3R6N A;  2HDA A;  1HSQ A;  1K0S A;  2RQT A;  2ED0 A;  1E6G A;  5IHK A;  2AK5 A;  1TUD A;  3UF4 A;  4ESR A;  1WA7 A;  2DNU A;  2DL8 A;  3UA7 A;  4R0K A;  1K9A A;  1AZE A;  1WXB A;  1W1F A;  4OMQ A;  1Z9Q A;  2EGC A;  2YUP A;  1KSW A;  2KR3 A;  3A98 A;  1KIK A;  3RBB B;  2RQR A;  2OJ2 A;  1AVZ C;  2C0O A;  2FRY A;  2GNC A;  1BBZ A;  1M3B A;  2YUN A;  1PHT A;  1MV0 B;  2EW3 A;  2PZ1 A;  4AFQ C;  1YWP A;  5GJV B;  3M0S A;  5IHI A;  3NMZ C;  1AWO A;  2JS0 A;  4OMN A;  4RTZ A;  1GFC A;  2L2P A;  2DM1 A;  5IHN A;  1UHF A;  2LJ3 A;  1NEB A;  2M0Y A;  1SRM A;  2MCN A;  2KRN A;  2MIO A;  4QT7 A;  4HVU A;  3I5S A;  2CT3 A;  2F2X A;  2EGE A;  1CSK A;  5HCK A;  2K2M A;  2BZX A;  2O9S A;  1VA7 A;  2L3S A;  1GL5 A;  2ROT A;  4LUE A;  2YUO A;  1M3A A;  2K6D A;  1GCQ C;  1OOT A;  4FSS A;  2K79 A;  1SEM A;  1AZG B;  1WXU A;  4OMM A;  4Y92 A;  3VS6 A;  1YWO A;  2DX1 A;  2VWF A;  1Z9Z A;  3SHW A;  1ZSG A;  1WX6 A;  3I9Q A;  2DJQ A;  2EQI A;  1VYU A;  2FEI A;  2RN8 A;  2CDT A;  2YUQ A;  1ABQ A;  1G2B A;  1X6B A;  3KFV A;  1E6H A;  3M0U A;  1K76 A;  4K11 A;  1ARK A;  3C0C A;  2VVK A;  4OML A;  2KRO A;  1AD5 A;  1K0X A;  4J9G A;  5I22 A;  1NLP C;  1MV3 A;  1CKB A;  2CH4 A;  1M30 A;  2BZY A;  2AZS A;  3EHR A;  2HSP A;  2YDL A;  4JZ3 A;  1EFN A;  2SRC A;  4A63 B;  4F16 A;  1KFZ A;  2LP5 A;  2AKL A;  2J06 A;  3M0T A;  3TSW A;  3VS7 A;  1WDX A;  3EG1 A;  2YT6 A;  1NM7 A;  4HVV A;  3O5Z A;  1UFF A;  3H0H A;  2LX7 A;  3M0P A;  3FJ5 A;  3H41 A;  4AFS C;  2RQU A;  2JXB A;  2NWM A;  3EG3 A;  1LCK A;  1NLO C;  2B86 A;  4CC2 A;  2L0A A;  2P4R A;  2KXC A;  3I35 A;  2RF0 A;  4M4Z A;  5EC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...