2DRKA

Acanthamoeba myosin i sh3 domain bound to acan125
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
GSPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the SH3 domain of Acanthamoeba myosin IB bound to Acan125
rcsb
source organism Acanthamoeba castellanii
molecule tags Contractile protein
molecule keywords Myosin heavy chain IB
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2drkA00
2F2XA 1K4US 3A98A 4AG2C 2DRMA 1ZLMA 2J6FA 3NHNA 2FPEA 3H41A 1M27C 3NMZC 1AWOA 1QCFA 4OMQA 1K0SA 1KJWA 1JXMA 3VS5A 4OMPA 3VRZA 1UECA 4Y92A 2K7AA 3I5SA 1LCKA 1UJ0A 1G83A 4RUGA 2VKNA 4CC3A 1WA7A 2RQWA 4J9EA 2DBKA 2DL7A 1GL5A 2PTKA 2J6OA 2RQTA 5IXBA 2BZ8A 1PKSA 3R6NA 2A08A 1OV3A 2D8HA 1ABQA 1K1ZA 2CSIA 2CDTA 2JTEA 2LZ6B 2KE9A 2PNIA 2JM9A 2ROTA 1AD5A 3EG2A 2C0OA 1AZEA 1J3TA 1NYGA 1GBRA 2CREA 4GLMA 1OOTA 2JMCA 3ZL7C 2DM1A 1KFZA 2D8JA 2LP5A 4JJDA 1FMKA 1E6HA 4J9GA 2F2VA 4M4ZA 1GCQC 1ZBJA 1TUDA 3U23A 4JZ4A 3VS4A 2O2OA 1WIEA 2JM8A 2ESWA 2RF0A 5IHIA 1GFDA 2CT3A 1I1JA 3NGPA 1NM7A 2O9SA 1GFCA 4AFUC 2SEMA 3EHQA 5IHNA 2DE0X 3VS0A 1UHFA 3I5RA 1MV0B 1UGVA 1HD3A 1AWJA 2RMOA 4Z8AA 2LMJA 2KXCA 1PNJA 2K3BA 2J06A 2L2PA 3EG3A 2C0TA 4RTZA 1T3SA 3REAB 4RTYA 3PE0A 1JU5C 4D8DA 3RBBB 2EKHA 2EGCA 1W1FA 2MCNA 2D0NA 1Z9QA 3EGUA 2AKLA 3M0TA 4ESRA 1Y57A 2EW3A 4GBQA 4HCKA 2OI3A 1GBQA 1E7OA 2RPNA 5IHKA 2YUOA 1YN8A 1ABOA 1NLPC 4J9CA 3GBQA 2GTJA 2EPDA 1OEBA 4R0KA 2G6FX 2D1XA 3VS2A 5GJWB 1QKWA 1WXBA 4K11A 1SHFA 1CSKA 3I35A 1QKXA 2DL3A 4ZNXA 2B86A 1AZGB 1WXTA 1H8KA 2FO0A 1SEMA 4AFQC 2CSQA 4JZ3A 2L3PA 3TSZA 2KBTA 1RLQC 4OMNA 2LJ1A 2F2WA 3THKA 2KRMA 1WFWA 3UF4A 2JT4A 1FYNA 2EYZA 2EYXA 1JEGA 2CT4A 5IH2A 3O5ZA 1AVZC 2OJ2A 1OPKA 2DL5A 1QWFA 2RN8A 5FW9A 3EG0A 2AK5A 1UJYA 2J05A 1GCQA 2I0NA 3TSWA 1ZUUA 2EYYA 5I11A 1Y0MA 3FJ5A 1WLPB 4WCIA 4JJBA 4IIOA 1NEBA 2KROA 5I22A 2FRYA 5EC7A 2A28A 2EBPA 1H3HA 1Z9ZA 2KT1A 1ZX6A 1B07A 1YNZA 2FG0A 2HCKA 4J9DA 4Z88A 1VYUA 2XMFA 2EGEA 5L23A 2RQUA 2DJQA 1SPKA 2YUNA 2HEQA 2DILA 2M51A 4J9BA 1T0JA 1X2QA 1MV3A 2A36A 1SHGA 1TUCA 1YCSB 1PKTA 1M3BA 3PVQA 2H8HA 4RTXA 1XOVA 1U5SA 2K79A 2QDLA 2GGRA 2X3WD 2ROLA 3H0IA 3KFVA 3ULRB 1M3AA 1HJDA 4HXJA 1YP5A 4RTVA 1W70A 4QT7A 1ARKA 3LH5A 4OMMA 4FSSA 2FEIA 2KR3A 3UATA 1HSQA 2CUBA 2AZVA 3UA7A 2KXDA 2BZXA 2EQIA 3SHWA 2DL4A 2FRWA 2GTOA 4AFSC 2MOXA 2DLPA 1K0XA 5FWCA 1ZSGA 4J9IA 4HVUA 2W0ZA 2GNCA 3M0UA 2AKKA 3VS1A 1H92A 2O31A 2RQVA 1WYXA 1UG1A 2JW4A 2CUDA 2L3SA 1PWTA 1WX6A 1G2BA 1NLOC 4OMLA 4LUEA 1K9AA 1JQQA 1ZUKA 2DMOA 2FPDA 3UA6A 4LUDA 3PVLA 4LN2A 1QLYA 1CKBA 2O88A 2RQRA 2ECZA 3JV3A 3RNJA 3VS3A 4HVWA 1RLPC 3VS7A 2LJ3A 2DRKA 1VYVA 4E6RA 4HVVA 2A37A 1AWXA 2IIMA 2GQIA 1EFNA 1JO8A 2LQNA 4EIKA 2SRCA 2LNHB 1E6GA 2PZ1A 1ZUYA 1BB9A 2EVRA 1QWEA 2X3XD 2KYMA 5ECAA 2K6DA 3C0CA 2K9GA 2KT8A 1OPLA 1V1CA 4ORZA 5FWBA 4F17A 1W6XA 1GCPA 1A0NB 3M0RA 2YDLA 1JXOA 1VYTA 1NEGA 1S1NA 4LNPA 2C0IA 4RTTA 2RNAA 1RUWA 1MUZA 3SEMA 1UTIA 1PHTA 4AG1C 1YWPA 2JS0A 1PRMC 2KYBA 1AWWA 4CC4B 3VRYA 4OMOA 2HBWA 2W10A 2VWFA 1B3QA 3CQTA 2JMAA 3IQLA 1IO6A 4J9FA 3M0PA 1U06A 2E5KA 2DVJA 4RTUA 1SSHA 2JXBA 2L0AA 1WDXA 4JPBW 1KSWA 1BK2A 2LQWA 1T0HA 2YUPA 1M3CA 1CKAA 4LE9A 2FPFA 1UE9A 1GRIA 2KRNA 2OAWA 2YT6A 2ED1A 4IIMA 1UDLA 2AZSA 1UHCA 3REBB 1I0CA 1VA7A 1PRLC 1SRMA 2KEAA 2YSQA 3TVTA 2LJ0A 2JS2A 1M8MA 1N5ZA 2LCSA 3EG1A 4DEXA 4Z89A 1AOJA 4F16A 1UUEA 5IXFA 2NWMA 2DBMA 4J9HA 3VS6A 2CH4W 2LX7A 1I07A 2DL8A 1BU1A 1T3LA 2YUQA 2DF6A 2KRSA 1WI7A 4AFZC 4CC7A 2M0YA 2P4RA 1AEYA 2EGAA 2K2MA 4CC2A 2BZYA 4X1VA 4A63B 2CH4A 3H0FA 2VVKA 4RTWA 1TG0A 2V1QA 3I9QA 4KRTA 1X69A 1X6GA 1YWOA 3M0SA 1SRLA 1NG2A 1K76A 2EYWA 1M30A 2GBQA 1KIKA 1X6BA 1BBZA 1X2KA 2ENMA 2MIOA 1NYFA 4JJCA 3EHRA 2KGTA 1U3OA 3H0HA 3QWYA 5HCKA 2ED0A 2BTTA 2V1RA 2DNUA 4F14A 1RI9A 2HSPA 2ABLA 2J6KA 2O9VA 1X43A 2DA9A 5GJVB 2DYBA 2J7IA 3M0QA 2L3QA 4DEYA 3NPFA 3QWXX 2DX1A 2HDAA 2NUZA 1X27A 4D8KA 2KNBB 1WXUA 1UFFA
chains in the Genus database with same CATH superfamily
7AT1B 2XD0A 1K4US 2X51A 4KBMB 1XNIA 1M1KR 4IUTA 2BE9B 1VQPT 3QPHA 1M27C 1AWOA 1K0SA 1KJWA 1JXMA 3GNFB 3ZFJA 3EFOB 2K7AA 3I5SA 1UJ0A 1RACB 4CC3A 3CCQQ 2VKNA 5A2QE 2RHYA 2PTKA 4PJOE 3T9NA 3FC3A 3PFSA 4M7AB 3EFRA 2A08A 1OV3A 1VQLQ 2EQKA 2GCXA 5AYFA 1FXXA 2CSIA 1OX8A 1RAFB 3HL8A 5FU7B 2GF7A 2C0OA 2DO3A 1WHJA 3G71A 2CREA 2DAQA 2JMCA 2DTHA 4FW1A 1AT1B 4Q5WA 4DQ2A 5CR2A 1KFZA 2D8JA 1TH7A 4JJDA 2QGFB 4JRKA 2CP5A 1YCYA 4J9GA 2CP6A 4M4ZA 3PIOA 3VS4A 3CC7A 3SWNB 3FJPA 2RF0A 2CT3A 1I1JA 3NGPA 3OYGA 2P0PA 3CCLA 2O9SA 1GFCA 2SEMA 2EJGA 4PJJA 2OAUA 3VS0A 3I5RA 4PJOC 1HD3A 4FCYA 2LMJA 3EG3A 2E3IA 2J06A 2C0TA 1T3SA 3REAB 3HSBA 4D8DA 1OYXA 5GAOr 4N0AA 4M7AE 2EQUA 3OW2S 2D0NA 1Z9QA 3EGUA 4OGCA 3CC4A 4M77C 2Z0WA 3CCJA 1QMCA 3JCMJ 2YUOA 4QVDA 1YN8A 2RH2A 1M1KU 4J9CA 5HKCA 2GTJA 2CP0A 2EPDA 3CPWS 3FEOA 4PJNA 1VQ9A 1O75A 4FYVB 3MJXA 2PVOB 5LJ3j 3NFCA 4M7DD 2DL3A 2RJCA 4ZNXA 2B86A 4N4HA 4ANJA 5LJ5f 4QQGA 5GANe 3CD6T 1M90R 4RCBA 1RLQC 1Q81U 1K9MU 5J3BA 4C92B 4OB1B 2M02A 3HPWA 3OYMA 3GOXA 3UF4A 1YJNQ 2JT4A 4C8QD 1RAHB 1IREB 4MZTA 5LJ3f 2CT4A 1KC8R 2MK5A 1ZA2B 3HRTA 1JJ2A 1Q82C 2OJ2A 2YRCA 3QYHB 3LWIA 2XK0A 3OS0A 4EDUA 2XG8D 4JRIA 2K4YA 2K57A 2JNGA 2I0NA 5KYUB 4C92G 1VQ8T 2RJEA 2F69A 1Q86U 4JJBA 1VQKT 1WPYA 3HTRA 5I22A 3RKXA 4BUGA 2FRYA 1X01A 5D7UA 2QEXA 3CBOA 4E7JA 3JAME 3G4SQ 3UT1A 1AHJB 3HRSA 1B07A 3OYCA 2FG0A 4J9DA 4Z88A 1OZ2A 2XMFA 2A0FB 2COYA 2RHUA 1W2BP 5L23A 3X25B 2RQUA 2C06A 1UGQB 2DJZA 2DJQA 1LOJA 2ZPHB 2BE7D 1Q7YR 3V8KA 2XICA 1X2QA 1MV3A 3VYGA 1Q82R 1TXQA 1M3BA 2L3RA 2X4XA 5KE2A 1XOVA 1K8AU 2QGGA 4WTOB 3EGDB 1KD1U 3G6ET 1M3AA 1M1KC 1ARKA 4OMMA 3CXCS 4FSSA 2FEIA 3OA6A 3CMAT 4X9CA 4M75E 1LVKA 4F04B 1LNXA 2BZXA 4A4FA 2DLPA 1K0XA 2AT1B 3PIPA 5FWCA 3CCUA 2E1HA 2GNCA 2AKKA 2KY9A 5KYUA 3V8JA 2JTFA 2HAXA 3LX7A 4M75F 1WYXA 1B34B 1PWTA 2FZKB 1BIAA 3QJYA 1NLOC 2VXEA 4BE1A 2MPXC 2DK3A 4PKCC 4LUEA 5GAOp 2AIRB 1JQQA 5GAMe 1VQ5T 5IT9E 1KD1C 2FPDA 3JCMe 1D0ZA 2ZCFB 2HQEA 5GAOm 3P8BB 1KD1R 3H9NA 1TUGB 2M0OA 2KMTA 3RNJA 1IB8A 4ZGEB 4PJMA 3L2RA 2KQWA 1Q82U 4J6XA 1VYVA 4M7AG 3OYKA 3GIBA 1Q7YU 4HVVA 3CMEQ 2LT1A 5GANj 2LQNA 4EIKA 2PUKB 4O6JA 4M75B 1W2BA 1U8RA 1ZUYA 3HKSA 5GAN7 2LNVA 3OYIA 2XU8A 1Q95G 5GAOl 2K6DA 3C0CA 4R56A 5DLQE 3E19A 1DJ7B 2D0QB 3EG9A 5GAN8 1OPLA 4E7ZA 1QVFS 5FWBA 3G1JA 5J26A 4HT9A 1A0NB 4PLIA 4C8QF 4C5IA 4M78E 3JB9H 3LLRA 4RTTA 1S72T 4PJOA 2RNAA 5GANh 3DKMA 4BB7A 1MUZA 3VKIA 4O5VA 3JB9F 2KYBA 2YHTA 2DPPB 1AWWA 4CC4B 2X4WA 1VQ6T 4MDWA 2XIDA 4P5NA 1N27A 1YJNA 1JJ2S 1BI1A 5GAN5 4PFOA 1YJ9A 2E5KA 2FB7A 3OYNA 5GAOq 5CQXA 3OW2A 1BK2A 1WGSA 3FIFA 5GANd 1YIJT 3A1PA 2LQWA 2A3LA 2D6FA 4QVCA 4NOYA 1M3CA 2R57A 1RADB 2DXBA 3SD4A 2YT6A 4A4KA 5HK3A 4XTZA 3CCST 3QKJA 4IUPA 1UHCA 1C6VX 4C8QC 1P92A 1WZOA 5CQYA 3BE3A 1VQPQ 3OYBA 1M8MA 4M75A 3BY7A 4A4GA 4DEXA 4Z89A 4DA4A 1D1BA 4X34A 3VUZA 1YJ9T 2VXFA 1R77A 2KRSA 4AFZC 2M0YA 2P4RA 3CCEA 4XU2A 3LGLA 2MF2A 4R55A 3QYGB 2BZYA 3QSUA 4RTWA 3QIIA 3PT9A 3ASKA 1WHMA 4KRTA 3CCRT 1X6GA 1YWOA 1S72A 4HCCA 4C92F 2DVEA 5FRMA 1QVFA 4BY6C 4DBQA 2EYWA 3OSVA 1G3TA 2OTLA 3A8HB 3QZ9B 2NUPB 2LQ8A 2DEUA 2E6NA 3P8DA 4M78G 3EHRA 1NZ9A 3VUBA 3PMIA 2ZPIB 2X4JA 1NBEB 2DNUA 1H641 1RI9A 2O9VA 2V8KA 1VQ9Q 1YIJQ 3OYEA 5LJ5j 3TCJA 1Y96B 2DYBA 3M0QA 2L3QA 1NPRA 1XTDA 2HDAA 2KNBB 1WXUA 2F2XA 4CRIA 2J6FA 2LRQA 3H41A 1D1AA 3NMZC 2XHCA 4OMQA 4ZTFA 3OS5A 4J8OA 3VS5A 1NPPA 4Y92A 4EMHA 5KYWA 1I8FA 4QQ6A 3AHUA 1MNEA 2EWNA 2ZPGB 2DBKA 1GL5A 5CVIA 2J6OA 1FWZA 1YITQ 1KQSA 3I55T 3L2WA 5IXBA 3JB9G 3C95A 4AT1B 1ABQA 4E7SA 3CBPA 3OYFA 2JTEA 3QJ6A 4ZN1A 4RMOA 1YHQQ 2YLBA 1BKBA 2PNIA 5LJ5g 4UC4A 1AZEA 1YJWT 1HK9A 3V8LA 3OYAA 1QQJA 2QK0A 1QVGP 4QW2A 1ZBJA 3MO8A 4BI4A 3G6EA 2QA4A 4DBHA 2ESWA 5IHIA 1GFDA 4XTYA 5KH6A 4PK4A 5GAMh 3EHQA 2ZPEB 3RKYA 2RMOA 4Z8AA 4B9WA 2KXCA 1PNJA 2QQRA 4XU0A 2F5TX 3CMAQ 4RTYA 1ZSZA 1UB4A 2LQKA 1BCOA 1M1FA 2QDYB 1QW1A 2EKHA 4JRPA 2EGCA 1W1FA 4KUIA 1BI3A 2OTJQ 3M0TA 4TVRA 1YI2T 1Y57A 4LDXA 4GBQA 1N6AA 4OF1A 1VQOT 5IHKA 2YRDA 5CK9A 3SWNA 3VV0A 5A0LA 4BY6B 1QVGA 1VQKA 4R0KA 1JRIA 1W2BS 3VS2A 1FMWA 4LD6A 4ATOA 4K11A 3I35A 4FU6A 1ZBXA 2NLUA 1QKXA 2PVDB 3GNGA 4F7UF 1YHQT 2BUDA 2E64A 2MWPA 1WXTA 2MYSA 1H8KA 3DB3A 3M5AA 4FYXB 2FO0A 1KHCA 4AFQC 2CSQA 2MAMA 2KBTA 4N4IA 4QKUA 3THKA 2R5AA 1VQOA 3KXTA 3S3NA 1WFWA 1VQ8Q 2H3EB 2EYZA 1JEGA 5M9OA 4CI0C 3FLGA 1WJSA 2COWA 1R8OB 1F1BB 3SFMA 1QWFA 1M2OA 1M2VB 2PVGB 1OX9A 4BI3A 3L1AA 3TSWA 2FZCB 1ZUUA 4E2FB 1RAGB 4MDXA 2M1HA 5I11A 1VQ9T 1NEBA 2ZPBB 4DBFA 4RG8A 1K73R 4OB0B 3META 2MWOA 1Z9ZA 2CKKA 3CC4T 1ZX6A 3A8MB 3M4YA 1Q81C 1VYUA 3RMQA 2JTMA 1N8RR 4EMGA 2RO0A 1XQHA 3FB9A 1Y7XA 2HEQA 2YUNA 4J9BA 3RKWA 2FZGB 2VGNA 1PM3A 1VQNT 1NJIR 1TUCA 2HZYA 3CXCA 3PVQA 2DEQA 3J80E 3RERA 3GPLA 3HHTB 1YJ9Q 1U5SA 2K79A 1QCNA 3I55A 2QDLA 2GGRA 3OQ5A 1JBMA 4HXJA 2DD5A 1W70A 4C5HA 3LH5A 8ATCB 3SDZA 1HSQA 1YHQA 2RB6A 4DOVA 2HNIA 1D0XA 3SHWA 2DL4A 3OMGA 2A7YA 2FRWA 2GTOA 1WHGA 4KGVB 2FVUA 5D6XA 4E7IA 5HY6A 4HVUA 2E70A 5A0DA 3H6ZA 3GF5A 2RQVA 1UG1A 1QVGS 4RKUE 3E9GA 3KBGA 1I4K1 1JB0E 1K9AA 3HFNA 4PNOA 2X9HA 2GQVA 2QASA 2M9UA 4XTVA 4PJOG 4PJOF 3OS1A 4IUQA 2IPOB 5GAMj 2RQRA 1Q86R 1VQPA 3CC2Q 1S72Q 3VS3A 2O4XB 4HVWA 4PL6A 1RLPC 1MMGA 3ZEHA 3CCRA 2KI7A 2LCCA 2A37A 1TWBA 3C4SA 3F70A 1AWXA 2GQIA 2RI2A 1JO8A 1B34A 3MEUA 1N9SA 2EIFA 2PQWA 3PNWC 2DZ9A 5ECAA 3CPFA 4BI8B 1V1CA 4ORZA 1HYOA 2VC8A 1W6XA 2DXCA 2QQAA 3M0RA 4IUVA 2YDLA 4J6YA 4N0AC 2OTLQ 5HK0A 3E1SA 1JXOA 4LNPA 1IZ6A 2QQBA 3CCSA 4M7DG 2DTIA 4AG1C 1PRMC 3JCMg 3VRYA 1I5OB 1B3QA 4KULA 5C0MA 4JDSA 4PFPA 1VQ5Q 1NJIU 3IQLA 5KYNA 4J9FA 3M0PA 4JLIA 1UGRB 4OB2B 5LJ3g 4D6WA 4Y28E 4RTUA 1IRXA 1SSHA 2JXBA 2L0AA 3ER0A 2CP2A 4M77D 1VQ6A 2K5FA 1PD1A 2YUPA 2QAZA 2BIVA 3V7CA 4HA8A 2O4XA 2JVVA 2ZGWA 1GRIA 4VUBA 2OAWA 3LGFA 2ED1A 4PJOB 2YWWA 3QBYA 3QDFA 1VIEA 3BW1A 3REBB 4C92D 4M7DF 1VA7A 2DKGA 2CP3A 2LJ0A 2JS2A 1VQ4T 1FMVA 4ZGJB 5I2MA 5CO7A 5DM7R 1KC8C 4M7AF 2PUOB 2CH4W 2DL8A 2JUFA 4CC7A 1JJ2P 1U1SA 3CC4Q 1AEYA 1M5Q1 4A63B 4X1VA 4ZTJA 2VVKA 5C6SA 2K5IA 3JCMQ 1EIFA 1NG2A 3EFSA 1K76A 2GBQA 1PSEA 2ENMA 1NYFA 4JJCA 3I55Q 1TU0B 2KGTA 1U3OA 3H0HA 5HCKA 2ED0A 2LT4A 3A8GB 2QQ9A 5D6YA 4F14A 2MI6A 2DETA 2ABLA 3M55A 2DA9A 4MZMA 2VV5A 4DBRA 4JS5A 2EJFA 3S3OA 2QQSA 5LJ5d 4FT2A 3URGA 3QZ5B 4D8KA 1UFFA 3CCUT 4PJOD 2OTJA 2L8DA 1M8VA 4C8QE 1D09B 2AHJB 2DRMA 4AG2C 3JCMb 5KYXB 4JS4A 5GAMg 1YJNT 1M90U 4OMPA 4XAXB 3VRZA 2RA2A 2P0QA 1N9RA 5L8RE 3JCMd 1LCKA 2HSEB 1G83A 4RUGA 1IGUA 1WA7A 2RQWA 4J9EA 2DL7A 2X35A 1BIBA 3R6NA 1I81A 4HCZA 1K1ZA 5FLXE 3PMTA 2RHZA 4X9DA 2XDBA 2LZ6B 2JM9A 5CAIA 2ROTA 3EG2A 4YTLA 2IVWA 1OOTA 2DD4A 3X20B 3ZL7C 2HKQB 5GAMd 2DM1A 4L59A 5LJ3e 3TU4K 2X4YA 1UGPB 1GCQC 4GLKA 4ME7A 4E7KA 1TUDA 3U23A 3EGXB 4M7AC 2QEXT 2O2OA 3OBWA 4E47A 1WIEA 2HBPA 1MHNA 3INZA 4J7IA 5IAYA 1YJWQ 4AFUC 1VQ8A 4M75G 2EQMA 5IHNA 2VB6A 5LJ5e 1UHFA 3JB9J 4V2SA 1UGVA 2D9TA 5GMKj 4BE0A 2WACA 1AWJA 5GAN2 3LWHA 2K3BA 5LL6S 4C92C 3OS2A 4N4GA 2R5MA 1JU5C 1PG5B 2DIQA 3RBBB 5KYXA 1VQ5A 3CCJQ 1I5LA 2MCNA 3L2QA 1WHKA 4ESRA 3NTIA 2OI3A 1E7OA 1VQNA 1ABOA 1NLPC 4F7UA 4M78D 3HFOA 2XKOC 1ZA1B 3LYIA 3X24B 4XK8E 1CSKA 2KSSA 2CZ0B 3RDVA 2ZPFB 3JB9D 2JJ9A 4F7UG 5GMKm 1K9MC 8AT1B 3A8OB 3A8LB 1MGQA 1KQ1A 2L3PA 1BCMA 4J6WA 2R58A 3TSZA 1V29B 3GLXA 5GMKi 4M78F 3OMCA 2LJ1A 2F2WA 2YXYA 5GANg 3VJPA 3MEVA 2KRMA 2GFAA 3CCJT 4M7AD 2DXUA 1G8XA 3JCMh 3UPUA 5IH2A 3EH2A 2Y4XA 3EFOA 4OGEA 1OPKA 3TQ7P 4XU1A 3EG0A 2AK5A 2QTXA 2LCLA 1FX7A 1M9SA 2E10A 4Z02A 4IUUA 1WQWA 3OB9A 4M7AA 4HT8A 3OY9A 4M78C 1Y0MA 3FJ5A 4WCIA 2E65A 1KK7A 1VQLA 3VU3C 4FL6A 1KQSP 3DLLA 2QYZA 3CC2A 2EBPA 2F1LA 2HQXA 3I56T 2KT1A 3SWNC 3G4SA 3I56Q 1YNZA 2HCKA 3M4GA 1D3BB 2EGEA 5KYYB 3G71T 3RIRA 1SPKA 3M58A 2QTVA 1T0JA 3JCMf 2A36A 2RI5A 1SHGA 1H3ZA 3QXEB 1ACMB 1YI2A 5KE3A 1KG1A 4RTXA 4A53A 3CD6A 2L5QA 3LH0A 4XQ3A 2X3WD 2F5KA 2ROLA 3H0IA 4JLGA 9ATCB 1HJDA 3JCMX 1IHWA 4FYYB 1YP5A 3BDLA 2DYIA 1MMDA 3MHXA 2PU9B 2AZVA 1D0YA 3UA7A 1C0MA 2KXDA 1YITT 2EQIA 4QQDA 2V8JA 2MOXA 1ZSGA 1VOMA 2W0ZA 3M0UA 2VUBA 3VS1A 1H92A 1QCOA 2QA4T 2O31A 3TREA 4F7UE 2JW4A 2RJDA 1RAAB 4OP0A 2H3JA 4EMKC 1G2BA 2JZ2A 4B9XA 4J5YA 5FRNA 3QO3A 2NUTA 4ELZC 1YJWA 3HRUA 4LUDA 3G7ZA 5FU7C 3S6WA 3PVLA 4LN2A 1QLYA 1CKBA 2K2VA 2XDPA 2EJ9A 1EX4A 1UEBA 3OYHA 1D3BA 2HL5C 1B7TA 1NE8A 3RESA 3VS7A 4C92A 2LJ3A 3CCLT 4NS5A 1IHVA 3M57A 4MMLA 2HQHA 5J39A 3RMSA 2IIMA 1M1GA 1EFNA 1MMAA 2SRCA 2LNHB 1VIFA 1VQ7T 3OBYA 3QDRB 1BB9A 1Q7YC 2FYKA 1VUBA 2COZA 3FRNA 5I2SA 5LJ3d 2HD0A 2KYMA 2K9GA 3S3MA 1U1TA 1Q81R 4F17A 1RI0A 2HL3A 1XJWB 1VYTA 1NEGA 1S1NA 3PGGA 5KYWB 4XTWA 2C0IA 2YLCA 1G3YA 4LD9K 2BKDN 2RD1A 1Y07A 4IURA 4LDVA 3CBMA 3SEMA 1UTIA 1PHTA 1YWPA 4OMOA 2HBWA 2W10A 1LJOA 2XI9A 4C0FA 2NUTB 1IO6A 3E9FA 5GMKe 2OTLT 2VYTA 2DVJA 1N8RU 1SG5A 4JPBW 1KSWA 4AMCA 4LDUA 4C0ZA 2EQJA 4M78B 1TOVA 1UE9A 3EGDA 5GMKl 4IIMA 2E5QA 2KRNA 4A4HA 1RABB 3C12A 1QP3A 2V8IA 3CCET 2AZSA 3DB4A 3FDRA 3CPWA 1K73U 2DFUA 1M90C 1WJQA 1X6OA 2KEAA 4C8QA 2YSQA 1M4ZA 3A5ZB 3TVTA 1K8AR 2CP7A 4FYWB 1N5ZA 3HP9A 3CCMT 1YBYA 2LCSA 4F16A 3J7AF 1UUEA 4XTXA 5IXFA 6AT1B 2DBMA 3VS6A 1BU1A 1T3LA 2YUQA 2DF6A 3L2VA 3L42A 1ZSZB 2EKOA 2K2MA 4CC2A 2CH4A 3D7SB 3H0FA 2EAYA 1TG0A 2V1QA 1YIJA 4M7DB 1VQKQ 1X69A 2K3YA 1SRLA 1KIKA 1BBZA 1RAEB 3QWYA 3CCEQ 1G3SA 4BDZA 2BTTA 2V1RA 4II1A 2LVMA 4ZN3A 2GFUA 1SF9A 1UGSB 2HSPA 3Q1JA 3N5BB 2IG0A 4MZPA 5D6WA 5FU6B 2E4HA 1VQMT 4M77A 5GAN4 4NL3A 4DEYA 1VQ7A 3OYYA 4LDYA 2O01E 3NPFA 3QWXX 2DX1A 2LC4A 5IN1A 1X27A 2ZZDA 3CCVA 2KK4A 3WVEB 1R0BG 3EG9B 3ZBDA 3A98A 3NHNA 1ZLMA 1SKUB 2FPEA 1VQNQ 1PSFA 4C8QB 1QCFA 4L5GA 1UECA 1PD0A 4PLLA 3RUXA 4EPCA 3MEAA 3ME9A 3M59A 1M2VA 5GANf 2RQTA 4JUVA 3TEEA 3H8ZA 2BZ8A 1N8RC 1PKSA 1VQMQ 2Y4YA 3AT1B 5GAOn 2WSCE 2CYZB 2D8HA 2I2LA 1OZ3A 3EH1A 2NYSA 2CDTA 1PC0A 3G6EQ 2KE9A 2XDDA 3X28B 1RL2A 1ZQ1A 1AD5A 4M7DA 5GAMf 1GBRA 1J3TA 1NYGA 4NL2A 4GLMA 1K73C 4KT0E 3DLMA 1YITA 2LP5A 2M16A 1IGQA 1FMKA 1E6HA 2MMPA 2F2VA 4JZ4A 4C5GA 3JRZA 3C94A 3OYLA 2JM8A 2QI2A 1NM7A 3JCMV 1SSFA 4M77B 3RR6A 2ZAEA 5CKEA 2LX9A 3GP8A 2DE0X 1MV0B 2QG9B 3BDUA 1BI2A 4FT4A 3CMAA 1O9SA 2L2PA 3CCMQ 4RTZA 3SB2A 5DY9A 4J83A 3PE0A 3OYJA 1Q86C 5EG2A 3G4ST 2AKLA 4MMKA 3I56A 2EW3A 2YRVA 4HCKA 3CCQT 4DOWA 3EGXA 4ELYC 1GBQA 2RPNA 3CC2T 1WJRA 2CS7A 1WNLA 3GBQA 1VQLT 1OEBA 2G6FX 2D1XA 2VGMA 5GJWB 1QKWA 2E6ZA 1WXBA 4M77F 1SHFA 1WHLA 3M9QA 3G71Q 3MPUB 5CKBA 1OU8A 3CD6Q 1AZGB 1VQ4Q 4M7DC 3MCAB 1KQSS 5AT1B 1SEMA 5FU6C 3JB9I 2DXTA 4JZ3A 4M77E 3CCRQ 2V26A 1VQOQ 4OMNA 3NTKA 1YI2Q 2EYQA 4FW2A 1HXDA 3CCQA 4F7UB 2HKNA 1FYNA 1IXDA 2EYXA 5KCOA 3M56A 3O5ZA 1AVZC 4M77G 2DL5A 2RN8A 5FW9A 1UJYA 1K8AC 2J05A 3UWNA 1X75C 3OSSC 1GCQA 2RHXA 4KH0B 2EYYA 4IKFA 1WLPB 1TSFA 4XTUA 4IIOA 2KROA 3CCSQ 2E12A 4KH1B 1D1CA 4QVZA 3CPWP 5EC7A 2L89A 2A28A 1H3HA 4RG2A 1VQ7Q 3CC7Q 1OULA 3VYHB 1V76A 3OW2P 3PTAA 3CCLQ 1QVFP 4WF2A 4C92E 3L2UA 1VQ6Q 2DILA 2M51A 1KQ2A 5FROA 3QG1A 2WSEE 1C1AA 1YCSB 2JOYA 1PKTA 2QA4Q 2H8HA 1BYMA 2LTOA 4C8QG 1QVPA 3JSCA 3KFVA 4BD3A 3ULRB 4OB3B 4RTVA 3MKDA 4BDYA 4QT7A 3LW5E 2KR3A 3UATA 2CUBA 3E2UA 4C5EA 1Y71A 5KYYA 1GXIE 4AFSC 4E7LA 2JN0A 5LJ5h 4J9IA 3CC7T 4HCBA 1Y96A 3O8VA 1VQMA 2CUDA 3JCMc 4FSXA 2L3SA 1WX6A 4A54A 3JCMP 5GAN3 4OMLA 2CGHA 4A4EA 1ZUKA 2HMAA 4C0GA 5LJ3h 2DMOA 3UA6A 3R6OA 1YFNA 1EZZB 4BACA 1G5VA 4M75C 2LDMA 2O88A 1R0CB 2ECZA 3JV3A 4Y91A 1MMNA 5CKFA 2K3XA 2RM4A 3M54A 4XU3A 4JJNK 5CCAA 1WHHA 2DRKA 3CXCP 4E6RA 1ZHIA 2OTJT 4PJLA 3WVDB 2B8AA 1E6GA 2K5LA 2PZ1A 2DERA 2EVRA 1QWEA 2OX7A 2X3XD 2E3HA 4LDWA 2VASA 1OI1A 2EFIA 1ZSZC 2KT8A 2WSFE 5CKDA 3CCMA 3QHSA 1RAIB 1BI0A 1GCPA 1WQ7A 2RK2A 2DZCA 4HKEA 2P0KA 4M75D 2FL7A 2KDSA 1RUWA 1NJIC 4RCCA 3MP1A 1G3WA 3OYDA 2JS0A 4OMFB 1OQKA 3M53A 5GMKh 2VWFA 2CZ7B 2FHDA 3CQTA 4JRQA 4LXCA 3CCUQ 1TS9A 2JMAA 4GY5A 4BE2A 4EMKA 1U06A 4J7FA 3BFMA 4C0DB 3CCVQ 1KHIA 1WDXA 3CCVT 2CZ6B 4FIBA 1VQ4A 2Y90A 2E41A 1T0HA 1CKAA 4LE9A 2FPFA 2P84A 2RJFA 3NTHA 3X26B 1UDLA 3MEWA 2RHIA 3UDCA 1I0CA 1OU9A 3JCMW 3QUIA 1PRLC 5GAN6 1SRMA 1QP2A 3CMET 2NUPA 3EG1A 1MNDA 1AOJA 1W4SA 2RI3A 4E7HA 3CMEA 2NWMA 4J9HA 2LX7A 1I07A 1WI7A 3MP6A 2EGAA 3V7SA 1KC8U 4M78A 2KVQG 2QEXQ 2RK1A 2CZ1B 5A0GA 4OVAA 2ATCB 2G3RA 5CKHA 3I9QA 5DLOA 3KUFA 3M0SA 2P4TA 1M30A 4M7DE 1LPLA 4KGXB 1K9MR 1TTHB 3EAEA 1X6BA 2DIGA 1X2KA 2DTOA 2MIOA 5CIUA 2KAFA 4C0DC 3V7RA 3MP8A 3CEYA 1PCXA 4EMKB 3J81E 4L6V5 4KUDK 3L2ZA 2J6KA 1X43A 2QXFA 4KGZB 3P8HA 5GJVB 4B6MA 4FM4B 2J7IA 4ZGDB 3WXMB 5I21A 5KCHA 2NUZA 4PFZA
chains in the Genus database with same CATH topology
2F2XA 1K4US 3A98A 4AG2C 2DRMA 1ZLMA 2J6FA 3NHNA 2FPEA 3H41A 1M27C 3NMZC 1AWOA 1QCFA 4OMQA 1K0SA 1KJWA 1JXMA 3VS5A 4OMPA 3VRZA 1UECA 4Y92A 2K7AA 3I5SA 1LCKA 1UJ0A 1G83A 4RUGA 2VKNA 4CC3A 1WA7A 2RQWA 4J9EA 2DBKA 2DL7A 1GL5A 2PTKA 2J6OA 2RQTA 5IXBA 2BZ8A 1PKSA 3R6NA 2A08A 1OV3A 2D8HA 1ABQA 1K1ZA 2CSIA 2CDTA 2JTEA 2LZ6B 2KE9A 2PNIA 2JM9A 2ROTA 1AD5A 3EG2A 2C0OA 1AZEA 1J3TA 1NYGA 1GBRA 2CREA 4GLMA 1OOTA 2JMCA 3ZL7C 2DM1A 1KFZA 2D8JA 2LP5A 4JJDA 1FMKA 1E6HA 4J9GA 2F2VA 4M4ZA 1GCQC 1ZBJA 1TUDA 3U23A 4JZ4A 3VS4A 2O2OA 1WIEA 2JM8A 2ESWA 2RF0A 5IHIA 1GFDA 2CT3A 1I1JA 3NGPA 1NM7A 2O9SA 1GFCA 4AFUC 2SEMA 3EHQA 5IHNA 2DE0X 3VS0A 1UHFA 3I5RA 1MV0B 1UGVA 1HD3A 1AWJA 2RMOA 4Z8AA 2LMJA 2KXCA 1PNJA 2K3BA 2J06A 2L2PA 3EG3A 2C0TA 4RTZA 1T3SA 3REAB 4RTYA 3PE0A 1JU5C 4D8DA 3RBBB 2EKHA 2EGCA 1W1FA 2MCNA 2D0NA 1Z9QA 3EGUA 2AKLA 3M0TA 4ESRA 1Y57A 2EW3A 4GBQA 4HCKA 2OI3A 1GBQA 1E7OA 2RPNA 5IHKA 2YUOA 1YN8A 1ABOA 1NLPC 4J9CA 3GBQA 2GTJA 2EPDA 1OEBA 4R0KA 2G6FX 2D1XA 3VS2A 5GJWB 1QKWA 1WXBA 4K11A 1SHFA 1CSKA 3I35A 1QKXA 2DL3A 4ZNXA 2B86A 1AZGB 1WXTA 1H8KA 2FO0A 1SEMA 4AFQC 2CSQA 4JZ3A 2L3PA 3TSZA 2KBTA 1RLQC 4OMNA 2LJ1A 2F2WA 3THKA 2KRMA 1WFWA 3UF4A 2JT4A 1FYNA 2EYZA 2EYXA 1JEGA 2CT4A 5IH2A 3O5ZA 1AVZC 2OJ2A 1OPKA 2DL5A 1QWFA 2RN8A 5FW9A 3EG0A 2AK5A 1UJYA 2J05A 1GCQA 2I0NA 3TSWA 1ZUUA 2EYYA 5I11A 1Y0MA 3FJ5A 1WLPB 4WCIA 4JJBA 4IIOA 1NEBA 2KROA 5I22A 2FRYA 5EC7A 2A28A 2EBPA 1H3HA 1Z9ZA 2KT1A 1ZX6A 1B07A 1YNZA 2FG0A 2HCKA 4J9DA 4Z88A 1VYUA 2XMFA 2EGEA 5L23A 2RQUA 2DJQA 1SPKA 2YUNA 2HEQA 2DILA 2M51A 4J9BA 1T0JA 1X2QA 1MV3A 2A36A 1SHGA 1TUCA 1YCSB 1PKTA 1M3BA 3PVQA 2H8HA 4RTXA 1XOVA 1U5SA 2K79A 2QDLA 2GGRA 2X3WD 2ROLA 3H0IA 3KFVA 3ULRB 1M3AA 1HJDA 4HXJA 1YP5A 4RTVA 1W70A 4QT7A 1ARKA 3LH5A 4OMMA 4FSSA 2FEIA 2KR3A 3UATA 1HSQA 2CUBA 2AZVA 3UA7A 2KXDA 2BZXA 2EQIA 3SHWA 2DL4A 2FRWA 2GTOA 4AFSC 2MOXA 2DLPA 1K0XA 5FWCA 1ZSGA 4J9IA 4HVUA 2W0ZA 2GNCA 3M0UA 2AKKA 3VS1A 1H92A 2O31A 2RQVA 1WYXA 1UG1A 2JW4A 2CUDA 2L3SA 1PWTA 1WX6A 1G2BA 1NLOC 4OMLA 4LUEA 1K9AA 1JQQA 1ZUKA 2DMOA 2FPDA 3UA6A 4LUDA 3PVLA 4LN2A 1QLYA 1CKBA 2O88A 2RQRA 2ECZA 3JV3A 3RNJA 3VS3A 4HVWA 1RLPC 3VS7A 2LJ3A 2DRKA 1VYVA 4E6RA 4HVVA 2A37A 1AWXA 2IIMA 2GQIA 1EFNA 1JO8A 2LQNA 4EIKA 2SRCA 2LNHB 1E6GA 2PZ1A 1ZUYA 1BB9A 2EVRA 1QWEA 2X3XD 2KYMA 5ECAA 2K6DA 3C0CA 2K9GA 2KT8A 1OPLA 1V1CA 4ORZA 5FWBA 4F17A 1W6XA 1GCPA 1A0NB 3M0RA 2YDLA 1JXOA 1VYTA 1NEGA 1S1NA 4LNPA 2C0IA 4RTTA 2RNAA 1RUWA 1MUZA 3SEMA 1UTIA 1PHTA 4AG1C 1YWPA 2JS0A 1PRMC 2KYBA 1AWWA 4CC4B 3VRYA 4OMOA 2HBWA 2W10A 2VWFA 1B3QA 3CQTA 2JMAA 3IQLA 1IO6A 4J9FA 3M0PA 1U06A 2E5KA 2DVJA 4RTUA 1SSHA 2JXBA 2L0AA 1WDXA 4JPBW 1KSWA 1BK2A 2LQWA 1T0HA 2YUPA 1M3CA 1CKAA 4LE9A 2FPFA 1UE9A 1GRIA 2KRNA 2OAWA 2YT6A 2ED1A 4IIMA 1UDLA 2AZSA 1UHCA 3REBB 1I0CA 1VA7A 1PRLC 1SRMA 2KEAA 2YSQA 3TVTA 2LJ0A 2JS2A 1M8MA 1N5ZA 2LCSA 3EG1A 4DEXA 4Z89A 1AOJA 4F16A 1UUEA 5IXFA 2NWMA 2DBMA 4J9HA 3VS6A 2CH4W 2LX7A 1I07A 2DL8A 1BU1A 1T3LA 2YUQA 2DF6A 2KRSA 1WI7A 4AFZC 4CC7A 2M0YA 2P4RA 1AEYA 2EGAA 2K2MA 4CC2A 2BZYA 4X1VA 4A63B 2CH4A 3H0FA 2VVKA 4RTWA 1TG0A 2V1QA 3I9QA 4KRTA 1X69A 1X6GA 1YWOA 3M0SA 1SRLA 1NG2A 1K76A 2EYWA 1M30A 2GBQA 1KIKA 1X6BA 1BBZA 1X2KA 2ENMA 2MIOA 1NYFA 4JJCA 3EHRA 2KGTA 1U3OA 3H0HA 3QWYA 5HCKA 2ED0A 2BTTA 2V1RA 2DNUA 4F14A 1RI9A 2HSPA 2ABLA 2J6KA 2O9VA 1X43A 2DA9A 5GJVB 2DYBA 2J7IA 3M0QA 2L3QA 4DEYA 3NPFA 3QWXX 2DX1A 2HDAA 2NUZA 1X27A 4D8KA 2KNBB 1WXUA 1UFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2X A;  1K4U S;  3A98 A;  4AG2 C;  2DRM A;  1ZLM A;  2J6F A;  3NHN A;  2FPE A;  3H41 A;  1M27 C;  3NMZ C;  1AWO A;  1QCF A;  4OMQ A;  1K0S A;  1KJW A;  1JXM A;  3VS5 A;  4OMP A;  3VRZ A;  1UEC A;  4Y92 A;  2K7A A;  3I5S A;  1LCK A;  1UJ0 A;  1G83 A;  4RUG A;  2VKN A;  4CC3 A;  1WA7 A;  2RQW A;  4J9E A;  2DBK A;  2DL7 A;  1GL5 A;  2PTK A;  2J6O A;  2RQT A;  5IXB A;  2BZ8 A;  1PKS A;  3R6N A;  2A08 A;  1OV3 A;  2D8H A;  1ABQ A;  1K1Z A;  2CSI A;  2CDT A;  2JTE A;  2LZ6 B;  2KE9 A;  2PNI A;  2JM9 A;  2ROT A;  1AD5 A;  3EG2 A;  2C0O A;  1AZE A;  1J3T A;  1NYG A;  1GBR A;  2CRE A;  4GLM A;  1OOT A;  2JMC A;  3ZL7 C;  2DM1 A;  1KFZ A;  2D8J A;  2LP5 A;  4JJD A;  1FMK A;  1E6H A;  4J9G A;  2F2V A;  4M4Z A;  1GCQ C;  1ZBJ A;  1TUD A;  3U23 A;  4JZ4 A;  3VS4 A;  2O2O A;  1WIE A;  2JM8 A;  2ESW A;  2RF0 A;  5IHI A;  1GFD A;  2CT3 A;  1I1J A;  3NGP A;  1NM7 A;  2O9S A;  1GFC A;  4AFU C;  2SEM A;  3EHQ A;  5IHN A;  2DE0 X;  3VS0 A;  1UHF A;  3I5R A;  1MV0 B;  1UGV A;  1HD3 A;  1AWJ A;  2RMO A;  4Z8A A;  2LMJ A;  2KXC A;  1PNJ A;  2K3B A;  2J06 A;  2L2P A;  3EG3 A;  2C0T A;  4RTZ A;  1T3S A;  3REA B;  4RTY A;  3PE0 A;  1JU5 C;  4D8D A;  3RBB B;  2EKH A;  2EGC A;  1W1F A;  2MCN A;  2D0N A;  1Z9Q A;  3EGU A;  2AKL A;  3M0T A;  4ESR A;  1Y57 A;  2EW3 A;  4GBQ A;  4HCK A;  2OI3 A;  1GBQ A;  1E7O A;  2RPN A;  5IHK A;  2YUO A;  1YN8 A;  1ABO A;  1NLP C;  4J9C A;  3GBQ A;  2GTJ A;  2EPD A;  1OEB A;  4R0K A;  2G6F X;  2D1X A;  3VS2 A;  5GJW B;  1QKW A;  1WXB A;  4K11 A;  1SHF A;  1CSK A;  3I35 A;  1QKX A;  2DL3 A;  4ZNX A;  2B86 A;  1AZG B;  1WXT A;  1H8K A;  2FO0 A;  1SEM A;  4AFQ C;  2CSQ A;  4JZ3 A;  2L3P A;  3TSZ A;  2KBT A;  1RLQ C;  4OMN A;  2LJ1 A;  2F2W A;  3THK A;  2KRM A;  1WFW A;  3UF4 A;  2JT4 A;  1FYN A;  2EYZ A;  2EYX A;  1JEG A;  2CT4 A;  5IH2 A;  3O5Z A;  1AVZ C;  2OJ2 A;  1OPK A;  2DL5 A;  1QWF A;  2RN8 A;  5FW9 A;  3EG0 A;  2AK5 A;  1UJY A;  2J05 A;  1GCQ A;  2I0N A;  3TSW A;  1ZUU A;  2EYY A;  5I11 A;  1Y0M A;  3FJ5 A;  1WLP B;  4WCI A;  4JJB A;  4IIO A;  1NEB A;  2KRO A;  5I22 A;  2FRY A;  5EC7 A;  2A28 A;  2EBP A;  1H3H A;  1Z9Z A;  2KT1 A;  1ZX6 A;  1B07 A;  1YNZ A;  2FG0 A;  2HCK A;  4J9D A;  4Z88 A;  1VYU A;  2XMF A;  2EGE A;  5L23 A;  2RQU A;  2DJQ A;  1SPK A;  2YUN A;  2HEQ A;  2DIL A;  2M51 A;  4J9B A;  1T0J A;  1X2Q A;  1MV3 A;  2A36 A;  1SHG A;  1TUC A;  1YCS B;  1PKT A;  1M3B A;  3PVQ A;  2H8H A;  4RTX A;  1XOV A;  1U5S A;  2K79 A;  2QDL A;  2GGR A;  2X3W D;  2ROL A;  3H0I A;  3KFV A;  3ULR B;  1M3A A;  1HJD A;  4HXJ A;  1YP5 A;  4RTV A;  1W70 A;  4QT7 A;  1ARK A;  3LH5 A;  4OMM A;  4FSS A;  2FEI A;  2KR3 A;  3UAT A;  1HSQ A;  2CUB A;  2AZV A;  3UA7 A;  2KXD A;  2BZX A;  2EQI A;  3SHW A;  2DL4 A;  2FRW A;  2GTO A;  4AFS C;  2MOX A;  2DLP A;  1K0X A;  5FWC A;  1ZSG A;  4J9I A;  4HVU A;  2W0Z A;  2GNC A;  3M0U A;  2AKK A;  3VS1 A;  1H92 A;  2O31 A;  2RQV A;  1WYX A;  1UG1 A;  2JW4 A;  2CUD A;  2L3S A;  1PWT A;  1WX6 A;  1G2B A;  1NLO C;  4OML A;  4LUE A;  1K9A A;  1JQQ A;  1ZUK A;  2DMO A;  2FPD A;  3UA6 A;  4LUD A;  3PVL A;  4LN2 A;  1QLY A;  1CKB A;  2O88 A;  2RQR A;  2ECZ A;  3JV3 A;  3RNJ A;  3VS3 A;  4HVW A;  1RLP C;  3VS7 A;  2LJ3 A;  2DRK A;  1VYV A;  4E6R A;  4HVV A;  2A37 A;  1AWX A;  2IIM A;  2GQI A;  1EFN A;  1JO8 A;  2LQN A;  4EIK A;  2SRC A;  2LNH B;  1E6G A;  2PZ1 A;  1ZUY A;  1BB9 A;  2EVR A;  1QWE A;  2X3X D;  2KYM A;  5ECA A;  2K6D A;  3C0C A;  2K9G A;  2KT8 A;  1OPL A;  1V1C A;  4ORZ A;  5FWB A;  4F17 A;  1W6X A;  1GCP A;  1A0N B;  3M0R A;  2YDL A;  1JXO A;  1VYT A;  1NEG A;  1S1N A;  4LNP A;  2C0I A;  4RTT A;  2RNA A;  1RUW A;  1MUZ A;  3SEM A;  1UTI A;  1PHT A;  4AG1 C;  1YWP A;  2JS0 A;  1PRM C;  2KYB A;  1AWW A;  4CC4 B;  3VRY A;  4OMO A;  2HBW A;  2W10 A;  2VWF A;  1B3Q A;  3CQT A;  2JMA A;  3IQL A;  1IO6 A;  4J9F A;  3M0P A;  1U06 A;  2E5K A;  2DVJ A;  4RTU A;  1SSH A;  2JXB A;  2L0A A;  1WDX A;  4JPB W;  1KSW A;  1BK2 A;  2LQW A;  1T0H A;  2YUP A;  1M3C A;  1CKA A;  4LE9 A;  2FPF A;  1UE9 A;  1GRI A;  2KRN A;  2OAW A;  2YT6 A;  2ED1 A;  4IIM A;  1UDL A;  2AZS A;  1UHC A;  3REB B;  1I0C A;  1VA7 A;  1PRL C;  1SRM A;  2KEA A;  2YSQ A;  3TVT A;  2LJ0 A;  2JS2 A;  1M8M A;  1N5Z A;  2LCS A;  3EG1 A;  4DEX A;  4Z89 A;  1AOJ A;  4F16 A;  1UUE A;  5IXF A;  2NWM A;  2DBM A;  4J9H A;  3VS6 A;  2CH4 W;  2LX7 A;  1I07 A;  2DL8 A;  1BU1 A;  1T3L A;  2YUQ A;  2DF6 A;  2KRS A;  1WI7 A;  4AFZ C;  4CC7 A;  2M0Y A;  2P4R A;  1AEY A;  2EGA A;  2K2M A;  4CC2 A;  2BZY A;  4X1V A;  4A63 B;  2CH4 A;  3H0F A;  2VVK A;  4RTW A;  1TG0 A;  2V1Q A;  3I9Q A;  4KRT A;  1X69 A;  1X6G A;  1YWO A;  3M0S A;  1SRL A;  1NG2 A;  1K76 A;  2EYW A;  1M30 A;  2GBQ A;  1KIK A;  1X6B A;  1BBZ A;  1X2K A;  2ENM A;  2MIO A;  1NYF A;  4JJC A;  3EHR A;  2KGT A;  1U3O A;  3H0H A;  3QWY A;  5HCK A;  2ED0 A;  2BTT A;  2V1R A;  2DNU A;  4F14 A;  1RI9 A;  2HSP A;  2ABL A;  2J6K A;  2O9V A;  1X43 A;  2DA9 A;  5GJV B;  2DYB A;  2J7I A;  3M0Q A;  2L3Q A;  4DEY A;  3NPF A;  3QWX X;  2DX1 A;  2HDA A;  2NUZ A;  1X27 A;  4D8K A;  2KNB B;  1WXU A;  1UFF A; 
#chains in the Genus database with same CATH topology
 7AT1 B;  2XD0 A;  1K4U S;  2X51 A;  4KBM B;  1XNI A;  1M1K R;  4IUT A;  2BE9 B;  1VQP T;  3QPH A;  1M27 C;  1AWO A;  1K0S A;  1KJW A;  1JXM A;  3GNF B;  3ZFJ A;  3EFO B;  2K7A A;  3I5S A;  1UJ0 A;  1RAC B;  4CC3 A;  3CCQ Q;  2VKN A;  5A2Q E;  2RHY A;  2PTK A;  4PJO E;  3T9N A;  3FC3 A;  3PFS A;  4M7A B;  3EFR A;  2A08 A;  1OV3 A;  1VQL Q;  2EQK A;  2GCX A;  5AYF A;  1FXX A;  2CSI A;  1OX8 A;  1RAF B;  3HL8 A;  5FU7 B;  2GF7 A;  2C0O A;  2DO3 A;  1WHJ A;  3G71 A;  2CRE A;  2DAQ A;  2JMC A;  2DTH A;  4FW1 A;  1AT1 B;  4Q5W A;  4DQ2 A;  5CR2 A;  1KFZ A;  2D8J A;  1TH7 A;  4JJD A;  2QGF B;  4JRK A;  2CP5 A;  1YCY A;  4J9G A;  2CP6 A;  4M4Z A;  3PIO A;  3VS4 A;  3CC7 A;  3SWN B;  3FJP A;  2RF0 A;  2CT3 A;  1I1J A;  3NGP A;  3OYG A;  2P0P A;  3CCL A;  2O9S A;  1GFC A;  2SEM A;  2EJG A;  4PJJ A;  2OAU A;  3VS0 A;  3I5R A;  4PJO C;  1HD3 A;  4FCY A;  2LMJ A;  3EG3 A;  2E3I A;  2J06 A;  2C0T A;  1T3S A;  3REA B;  3HSB A;  4D8D A;  1OYX A;  5GAO r;  4N0A A;  4M7A E;  2EQU A;  3OW2 S;  2D0N A;  1Z9Q A;  3EGU A;  4OGC A;  3CC4 A;  4M77 C;  2Z0W A;  3CCJ A;  1QMC A;  3JCM J;  2YUO A;  4QVD A;  1YN8 A;  2RH2 A;  1M1K U;  4J9C A;  5HKC A;  2GTJ A;  2CP0 A;  2EPD A;  3CPW S;  3FEO A;  4PJN A;  1VQ9 A;  1O75 A;  4FYV B;  3MJX A;  2PVO B;  5LJ3 j;  3NFC A;  4M7D D;  2DL3 A;  2RJC A;  4ZNX A;  2B86 A;  4N4H A;  4ANJ A;  5LJ5 f;  4QQG A;  5GAN e;  3CD6 T;  1M90 R;  4RCB A;  1RLQ C;  1Q81 U;  1K9M U;  5J3B A;  4C92 B;  4OB1 B;  2M02 A;  3HPW A;  3OYM A;  3GOX A;  3UF4 A;  1YJN Q;  2JT4 A;  4C8Q D;  1RAH B;  1IRE B;  4MZT A;  5LJ3 f;  2CT4 A;  1KC8 R;  2MK5 A;  1ZA2 B;  3HRT A;  1JJ2 A;  1Q82 C;  2OJ2 A;  2YRC A;  3QYH B;  3LWI A;  2XK0 A;  3OS0 A;  4EDU A;  2XG8 D;  4JRI A;  2K4Y A;  2K57 A;  2JNG A;  2I0N A;  5KYU B;  4C92 G;  1VQ8 T;  2RJE A;  2F69 A;  1Q86 U;  4JJB A;  1VQK T;  1WPY A;  3HTR A;  5I22 A;  3RKX A;  4BUG A;  2FRY A;  1X01 A;  5D7U A;  2QEX A;  3CBO A;  4E7J A;  3JAM E;  3G4S Q;  3UT1 A;  1AHJ B;  3HRS A;  1B07 A;  3OYC A;  2FG0 A;  4J9D A;  4Z88 A;  1OZ2 A;  2XMF A;  2A0F B;  2COY A;  2RHU A;  1W2B P;  5L23 A;  3X25 B;  2RQU A;  2C06 A;  1UGQ B;  2DJZ A;  2DJQ A;  1LOJ A;  2ZPH B;  2BE7 D;  1Q7Y R;  3V8K A;  2XIC A;  1X2Q A;  1MV3 A;  3VYG A;  1Q82 R;  1TXQ A;  1M3B A;  2L3R A;  2X4X A;  5KE2 A;  1XOV A;  1K8A U;  2QGG A;  4WTO B;  3EGD B;  1KD1 U;  3G6E T;  1M3A A;  1M1K C;  1ARK A;  4OMM A;  3CXC S;  4FSS A;  2FEI A;  3OA6 A;  3CMA T;  4X9C A;  4M75 E;  1LVK A;  4F04 B;  1LNX A;  2BZX A;  4A4F A;  2DLP A;  1K0X A;  2AT1 B;  3PIP A;  5FWC A;  3CCU A;  2E1H A;  2GNC A;  2AKK A;  2KY9 A;  5KYU A;  3V8J A;  2JTF A;  2HAX A;  3LX7 A;  4M75 F;  1WYX A;  1B34 B;  1PWT A;  2FZK B;  1BIA A;  3QJY A;  1NLO C;  2VXE A;  4BE1 A;  2MPX C;  2DK3 A;  4PKC C;  4LUE A;  5GAO p;  2AIR B;  1JQQ A;  5GAM e;  1VQ5 T;  5IT9 E;  1KD1 C;  2FPD A;  3JCM e;  1D0Z A;  2ZCF B;  2HQE A;  5GAO m;  3P8B B;  1KD1 R;  3H9N A;  1TUG B;  2M0O A;  2KMT A;  3RNJ A;  1IB8 A;  4ZGE B;  4PJM A;  3L2R A;  2KQW A;  1Q82 U;  4J6X A;  1VYV A;  4M7A G;  3OYK A;  3GIB A;  1Q7Y U;  4HVV A;  3CME Q;  2LT1 A;  5GAN j;  2LQN A;  4EIK A;  2PUK B;  4O6J A;  4M75 B;  1W2B A;  1U8R A;  1ZUY A;  3HKS A;  5GAN 7;  2LNV A;  3OYI A;  2XU8 A;  1Q95 G;  5GAO l;  2K6D A;  3C0C A;  4R56 A;  5DLQ E;  3E19 A;  1DJ7 B;  2D0Q B;  3EG9 A;  5GAN 8;  1OPL A;  4E7Z A;  1QVF S;  5FWB A;  3G1J A;  5J26 A;  4HT9 A;  1A0N B;  4PLI A;  4C8Q F;  4C5I A;  4M78 E;  3JB9 H;  3LLR A;  4RTT A;  1S72 T;  4PJO A;  2RNA A;  5GAN h;  3DKM A;  4BB7 A;  1MUZ A;  3VKI A;  4O5V A;  3JB9 F;  2KYB A;  2YHT A;  2DPP B;  1AWW A;  4CC4 B;  2X4W A;  1VQ6 T;  4MDW A;  2XID A;  4P5N A;  1N27 A;  1YJN A;  1JJ2 S;  1BI1 A;  5GAN 5;  4PFO A;  1YJ9 A;  2E5K A;  2FB7 A;  3OYN A;  5GAO q;  5CQX A;  3OW2 A;  1BK2 A;  1WGS A;  3FIF A;  5GAN d;  1YIJ T;  3A1P A;  2LQW A;  2A3L A;  2D6F A;  4QVC A;  4NOY A;  1M3C A;  2R57 A;  1RAD B;  2DXB A;  3SD4 A;  2YT6 A;  4A4K A;  5HK3 A;  4XTZ A;  3CCS T;  3QKJ A;  4IUP A;  1UHC A;  1C6V X;  4C8Q C;  1P92 A;  1WZO A;  5CQY A;  3BE3 A;  1VQP Q;  3OYB A;  1M8M A;  4M75 A;  3BY7 A;  4A4G A;  4DEX A;  4Z89 A;  4DA4 A;  1D1B A;  4X34 A;  3VUZ A;  1YJ9 T;  2VXF A;  1R77 A;  2KRS A;  4AFZ C;  2M0Y A;  2P4R A;  3CCE A;  4XU2 A;  3LGL A;  2MF2 A;  4R55 A;  3QYG B;  2BZY A;  3QSU A;  4RTW A;  3QII A;  3PT9 A;  3ASK A;  1WHM A;  4KRT A;  3CCR T;  1X6G A;  1YWO A;  1S72 A;  4HCC A;  4C92 F;  2DVE A;  5FRM A;  1QVF A;  4BY6 C;  4DBQ A;  2EYW A;  3OSV A;  1G3T A;  2OTL A;  3A8H B;  3QZ9 B;  2NUP B;  2LQ8 A;  2DEU A;  2E6N A;  3P8D A;  4M78 G;  3EHR A;  1NZ9 A;  3VUB A;  3PMI A;  2ZPI B;  2X4J A;  1NBE B;  2DNU A;  1H64 1;  1RI9 A;  2O9V A;  2V8K A;  1VQ9 Q;  1YIJ Q;  3OYE A;  5LJ5 j;  3TCJ A;  1Y96 B;  2DYB A;  3M0Q A;  2L3Q A;  1NPR A;  1XTD A;  2HDA A;  2KNB B;  1WXU A;  2F2X A;  4CRI A;  2J6F A;  2LRQ A;  3H41 A;  1D1A A;  3NMZ C;  2XHC A;  4OMQ A;  4ZTF A;  3OS5 A;  4J8O A;  3VS5 A;  1NPP A;  4Y92 A;  4EMH A;  5KYW A;  1I8F A;  4QQ6 A;  3AHU A;  1MNE A;  2EWN A;  2ZPG B;  2DBK A;  1GL5 A;  5CVI A;  2J6O A;  1FWZ A;  1YIT Q;  1KQS A;  3I55 T;  3L2W A;  5IXB A;  3JB9 G;  3C95 A;  4AT1 B;  1ABQ A;  4E7S A;  3CBP A;  3OYF A;  2JTE A;  3QJ6 A;  4ZN1 A;  4RMO A;  1YHQ Q;  2YLB A;  1BKB A;  2PNI A;  5LJ5 g;  4UC4 A;  1AZE A;  1YJW T;  1HK9 A;  3V8L A;  3OYA A;  1QQJ A;  2QK0 A;  1QVG P;  4QW2 A;  1ZBJ A;  3MO8 A;  4BI4 A;  3G6E A;  2QA4 A;  4DBH A;  2ESW A;  5IHI A;  1GFD A;  4XTY A;  5KH6 A;  4PK4 A;  5GAM h;  3EHQ A;  2ZPE B;  3RKY A;  2RMO A;  4Z8A A;  4B9W A;  2KXC A;  1PNJ A;  2QQR A;  4XU0 A;  2F5T X;  3CMA Q;  4RTY A;  1ZSZ A;  1UB4 A;  2LQK A;  1BCO A;  1M1F A;  2QDY B;  1QW1 A;  2EKH A;  4JRP A;  2EGC A;  1W1F A;  4KUI A;  1BI3 A;  2OTJ Q;  3M0T A;  4TVR A;  1YI2 T;  1Y57 A;  4LDX A;  4GBQ A;  1N6A A;  4OF1 A;  1VQO T;  5IHK A;  2YRD A;  5CK9 A;  3SWN A;  3VV0 A;  5A0L A;  4BY6 B;  1QVG A;  1VQK A;  4R0K A;  1JRI A;  1W2B S;  3VS2 A;  1FMW A;  4LD6 A;  4ATO A;  4K11 A;  3I35 A;  4FU6 A;  1ZBX A;  2NLU A;  1QKX A;  2PVD B;  3GNG A;  4F7U F;  1YHQ T;  2BUD A;  2E64 A;  2MWP A;  1WXT A;  2MYS A;  1H8K A;  3DB3 A;  3M5A A;  4FYX B;  2FO0 A;  1KHC A;  4AFQ C;  2CSQ A;  2MAM A;  2KBT A;  4N4I A;  4QKU A;  3THK A;  2R5A A;  1VQO A;  3KXT A;  3S3N A;  1WFW A;  1VQ8 Q;  2H3E B;  2EYZ A;  1JEG A;  5M9O A;  4CI0 C;  3FLG A;  1WJS A;  2COW A;  1R8O B;  1F1B B;  3SFM A;  1QWF A;  1M2O A;  1M2V B;  2PVG B;  1OX9 A;  4BI3 A;  3L1A A;  3TSW A;  2FZC B;  1ZUU A;  4E2F B;  1RAG B;  4MDX A;  2M1H A;  5I11 A;  1VQ9 T;  1NEB A;  2ZPB B;  4DBF A;  4RG8 A;  1K73 R;  4OB0 B;  3MET A;  2MWO A;  1Z9Z A;  2CKK A;  3CC4 T;  1ZX6 A;  3A8M B;  3M4Y A;  1Q81 C;  1VYU A;  3RMQ A;  2JTM A;  1N8R R;  4EMG A;  2RO0 A;  1XQH A;  3FB9 A;  1Y7X A;  2HEQ A;  2YUN A;  4J9B A;  3RKW A;  2FZG B;  2VGN A;  1PM3 A;  1VQN T;  1NJI R;  1TUC A;  2HZY A;  3CXC A;  3PVQ A;  2DEQ A;  3J80 E;  3RER A;  3GPL A;  3HHT B;  1YJ9 Q;  1U5S A;  2K79 A;  1QCN A;  3I55 A;  2QDL A;  2GGR A;  3OQ5 A;  1JBM A;  4HXJ A;  2DD5 A;  1W70 A;  4C5H A;  3LH5 A;  8ATC B;  3SDZ A;  1HSQ A;  1YHQ A;  2RB6 A;  4DOV A;  2HNI A;  1D0X A;  3SHW A;  2DL4 A;  3OMG A;  2A7Y A;  2FRW A;  2GTO A;  1WHG A;  4KGV B;  2FVU A;  5D6X A;  4E7I A;  5HY6 A;  4HVU A;  2E70 A;  5A0D A;  3H6Z A;  3GF5 A;  2RQV A;  1UG1 A;  1QVG S;  4RKU E;  3E9G A;  3KBG A;  1I4K 1;  1JB0 E;  1K9A A;  3HFN A;  4PNO A;  2X9H A;  2GQV A;  2QAS A;  2M9U A;  4XTV A;  4PJO G;  4PJO F;  3OS1 A;  4IUQ A;  2IPO B;  5GAM j;  2RQR A;  1Q86 R;  1VQP A;  3CC2 Q;  1S72 Q;  3VS3 A;  2O4X B;  4HVW A;  4PL6 A;  1RLP C;  1MMG A;  3ZEH A;  3CCR A;  2KI7 A;  2LCC A;  2A37 A;  1TWB A;  3C4S A;  3F70 A;  1AWX A;  2GQI A;  2RI2 A;  1JO8 A;  1B34 A;  3MEU A;  1N9S A;  2EIF A;  2PQW A;  3PNW C;  2DZ9 A;  5ECA A;  3CPF A;  4BI8 B;  1V1C A;  4ORZ A;  1HYO A;  2VC8 A;  1W6X A;  2DXC A;  2QQA A;  3M0R A;  4IUV A;  2YDL A;  4J6Y A;  4N0A C;  2OTL Q;  5HK0 A;  3E1S A;  1JXO A;  4LNP A;  1IZ6 A;  2QQB A;  3CCS A;  4M7D G;  2DTI A;  4AG1 C;  1PRM C;  3JCM g;  3VRY A;  1I5O B;  1B3Q A;  4KUL A;  5C0M A;  4JDS A;  4PFP A;  1VQ5 Q;  1NJI U;  3IQL A;  5KYN A;  4J9F A;  3M0P A;  4JLI A;  1UGR B;  4OB2 B;  5LJ3 g;  4D6W A;  4Y28 E;  4RTU A;  1IRX A;  1SSH A;  2JXB A;  2L0A A;  3ER0 A;  2CP2 A;  4M77 D;  1VQ6 A;  2K5F A;  1PD1 A;  2YUP A;  2QAZ A;  2BIV A;  3V7C A;  4HA8 A;  2O4X A;  2JVV A;  2ZGW A;  1GRI A;  4VUB A;  2OAW A;  3LGF A;  2ED1 A;  4PJO B;  2YWW A;  3QBY A;  3QDF A;  1VIE A;  3BW1 A;  3REB B;  4C92 D;  4M7D F;  1VA7 A;  2DKG A;  2CP3 A;  2LJ0 A;  2JS2 A;  1VQ4 T;  1FMV A;  4ZGJ B;  5I2M A;  5CO7 A;  5DM7 R;  1KC8 C;  4M7A F;  2PUO B;  2CH4 W;  2DL8 A;  2JUF A;  4CC7 A;  1JJ2 P;  1U1S A;  3CC4 Q;  1AEY A;  1M5Q 1;  4A63 B;  4X1V A;  4ZTJ A;  2VVK A;  5C6S A;  2K5I A;  3JCM Q;  1EIF A;  1NG2 A;  3EFS A;  1K76 A;  2GBQ A;  1PSE A;  2ENM A;  1NYF A;  4JJC A;  3I55 Q;  1TU0 B;  2KGT A;  1U3O A;  3H0H A;  5HCK A;  2ED0 A;  2LT4 A;  3A8G B;  2QQ9 A;  5D6Y A;  4F14 A;  2MI6 A;  2DET A;  2ABL A;  3M55 A;  2DA9 A;  4MZM A;  2VV5 A;  4DBR A;  4JS5 A;  2EJF A;  3S3O A;  2QQS A;  5LJ5 d;  4FT2 A;  3URG A;  3QZ5 B;  4D8K A;  1UFF A;  3CCU T;  4PJO D;  2OTJ A;  2L8D A;  1M8V A;  4C8Q E;  1D09 B;  2AHJ B;  2DRM A;  4AG2 C;  3JCM b;  5KYX B;  4JS4 A;  5GAM g;  1YJN T;  1M90 U;  4OMP A;  4XAX B;  3VRZ A;  2RA2 A;  2P0Q A;  1N9R A;  5L8R E;  3JCM d;  1LCK A;  2HSE B;  1G83 A;  4RUG A;  1IGU A;  1WA7 A;  2RQW A;  4J9E A;  2DL7 A;  2X35 A;  1BIB A;  3R6N A;  1I81 A;  4HCZ A;  1K1Z A;  5FLX E;  3PMT A;  2RHZ A;  4X9D A;  2XDB A;  2LZ6 B;  2JM9 A;  5CAI A;  2ROT A;  3EG2 A;  4YTL A;  2IVW A;  1OOT A;  2DD4 A;  3X20 B;  3ZL7 C;  2HKQ B;  5GAM d;  2DM1 A;  4L59 A;  5LJ3 e;  3TU4 K;  2X4Y A;  1UGP B;  1GCQ C;  4GLK A;  4ME7 A;  4E7K A;  1TUD A;  3U23 A;  3EGX B;  4M7A C;  2QEX T;  2O2O A;  3OBW A;  4E47 A;  1WIE A;  2HBP A;  1MHN A;  3INZ A;  4J7I A;  5IAY A;  1YJW Q;  4AFU C;  1VQ8 A;  4M75 G;  2EQM A;  5IHN A;  2VB6 A;  5LJ5 e;  1UHF A;  3JB9 J;  4V2S A;  1UGV A;  2D9T A;  5GMK j;  4BE0 A;  2WAC A;  1AWJ A;  5GAN 2;  3LWH A;  2K3B A;  5LL6 S;  4C92 C;  3OS2 A;  4N4G A;  2R5M A;  1JU5 C;  1PG5 B;  2DIQ A;  3RBB B;  5KYX A;  1VQ5 A;  3CCJ Q;  1I5L A;  2MCN A;  3L2Q A;  1WHK A;  4ESR A;  3NTI A;  2OI3 A;  1E7O A;  1VQN A;  1ABO A;  1NLP C;  4F7U A;  4M78 D;  3HFO A;  2XKO C;  1ZA1 B;  3LYI A;  3X24 B;  4XK8 E;  1CSK A;  2KSS A;  2CZ0 B;  3RDV A;  2ZPF B;  3JB9 D;  2JJ9 A;  4F7U G;  5GMK m;  1K9M C;  8AT1 B;  3A8O B;  3A8L B;  1MGQ A;  1KQ1 A;  2L3P A;  1BCM A;  4J6W A;  2R58 A;  3TSZ A;  1V29 B;  3GLX A;  5GMK i;  4M78 F;  3OMC A;  2LJ1 A;  2F2W A;  2YXY A;  5GAN g;  3VJP A;  3MEV A;  2KRM A;  2GFA A;  3CCJ T;  4M7A D;  2DXU A;  1G8X A;  3JCM h;  3UPU A;  5IH2 A;  3EH2 A;  2Y4X A;  3EFO A;  4OGE A;  1OPK A;  3TQ7 P;  4XU1 A;  3EG0 A;  2AK5 A;  2QTX A;  2LCL A;  1FX7 A;  1M9S A;  2E10 A;  4Z02 A;  4IUU A;  1WQW A;  3OB9 A;  4M7A A;  4HT8 A;  3OY9 A;  4M78 C;  1Y0M A;  3FJ5 A;  4WCI A;  2E65 A;  1KK7 A;  1VQL A;  3VU3 C;  4FL6 A;  1KQS P;  3DLL A;  2QYZ A;  3CC2 A;  2EBP A;  2F1L A;  2HQX A;  3I56 T;  2KT1 A;  3SWN C;  3G4S A;  3I56 Q;  1YNZ A;  2HCK A;  3M4G A;  1D3B B;  2EGE A;  5KYY B;  3G71 T;  3RIR A;  1SPK A;  3M58 A;  2QTV A;  1T0J A;  3JCM f;  2A36 A;  2RI5 A;  1SHG A;  1H3Z A;  3QXE B;  1ACM B;  1YI2 A;  5KE3 A;  1KG1 A;  4RTX A;  4A53 A;  3CD6 A;  2L5Q A;  3LH0 A;  4XQ3 A;  2X3W D;  2F5K A;  2ROL A;  3H0I A;  4JLG A;  9ATC B;  1HJD A;  3JCM X;  1IHW A;  4FYY B;  1YP5 A;  3BDL A;  2DYI A;  1MMD A;  3MHX A;  2PU9 B;  2AZV A;  1D0Y A;  3UA7 A;  1C0M A;  2KXD A;  1YIT T;  2EQI A;  4QQD A;  2V8J A;  2MOX A;  1ZSG A;  1VOM A;  2W0Z A;  3M0U A;  2VUB A;  3VS1 A;  1H92 A;  1QCO A;  2QA4 T;  2O31 A;  3TRE A;  4F7U E;  2JW4 A;  2RJD A;  1RAA B;  4OP0 A;  2H3J A;  4EMK C;  1G2B A;  2JZ2 A;  4B9X A;  4J5Y A;  5FRN A;  3QO3 A;  2NUT A;  4ELZ C;  1YJW A;  3HRU A;  4LUD A;  3G7Z A;  5FU7 C;  3S6W A;  3PVL A;  4LN2 A;  1QLY A;  1CKB A;  2K2V A;  2XDP A;  2EJ9 A;  1EX4 A;  1UEB A;  3OYH A;  1D3B A;  2HL5 C;  1B7T A;  1NE8 A;  3RES A;  3VS7 A;  4C92 A;  2LJ3 A;  3CCL T;  4NS5 A;  1IHV A;  3M57 A;  4MML A;  2HQH A;  5J39 A;  3RMS A;  2IIM A;  1M1G A;  1EFN A;  1MMA A;  2SRC A;  2LNH B;  1VIF A;  1VQ7 T;  3OBY A;  3QDR B;  1BB9 A;  1Q7Y C;  2FYK A;  1VUB A;  2COZ A;  3FRN A;  5I2S A;  5LJ3 d;  2HD0 A;  2KYM A;  2K9G A;  3S3M A;  1U1T A;  1Q81 R;  4F17 A;  1RI0 A;  2HL3 A;  1XJW B;  1VYT A;  1NEG A;  1S1N A;  3PGG A;  5KYW B;  4XTW A;  2C0I A;  2YLC A;  1G3Y A;  4LD9 K;  2BKD N;  2RD1 A;  1Y07 A;  4IUR A;  4LDV A;  3CBM A;  3SEM A;  1UTI A;  1PHT A;  1YWP A;  4OMO A;  2HBW A;  2W10 A;  1LJO A;  2XI9 A;  4C0F A;  2NUT B;  1IO6 A;  3E9F A;  5GMK e;  2OTL T;  2VYT A;  2DVJ A;  1N8R U;  1SG5 A;  4JPB W;  1KSW A;  4AMC A;  4LDU A;  4C0Z A;  2EQJ A;  4M78 B;  1TOV A;  1UE9 A;  3EGD A;  5GMK l;  4IIM A;  2E5Q A;  2KRN A;  4A4H A;  1RAB B;  3C12 A;  1QP3 A;  2V8I A;  3CCE T;  2AZS A;  3DB4 A;  3FDR A;  3CPW A;  1K73 U;  2DFU A;  1M90 C;  1WJQ A;  1X6O A;  2KEA A;  4C8Q A;  2YSQ A;  1M4Z A;  3A5Z B;  3TVT A;  1K8A R;  2CP7 A;  4FYW B;  1N5Z A;  3HP9 A;  3CCM T;  1YBY A;  2LCS A;  4F16 A;  3J7A F;  1UUE A;  4XTX A;  5IXF A;  6AT1 B;  2DBM A;  3VS6 A;  1BU1 A;  1T3L A;  2YUQ A;  2DF6 A;  3L2V A;  3L42 A;  1ZSZ B;  2EKO A;  2K2M A;  4CC2 A;  2CH4 A;  3D7S B;  3H0F A;  2EAY A;  1TG0 A;  2V1Q A;  1YIJ A;  4M7D B;  1VQK Q;  1X69 A;  2K3Y A;  1SRL A;  1KIK A;  1BBZ A;  1RAE B;  3QWY A;  3CCE Q;  1G3S A;  4BDZ A;  2BTT A;  2V1R A;  4II1 A;  2LVM A;  4ZN3 A;  2GFU A;  1SF9 A;  1UGS B;  2HSP A;  3Q1J A;  3N5B B;  2IG0 A;  4MZP A;  5D6W A;  5FU6 B;  2E4H A;  1VQM T;  4M77 A;  5GAN 4;  4NL3 A;  4DEY A;  1VQ7 A;  3OYY A;  4LDY A;  2O01 E;  3NPF A;  3QWX X;  2DX1 A;  2LC4 A;  5IN1 A;  1X27 A;  2ZZD A;  3CCV A;  2KK4 A;  3WVE B;  1R0B G;  3EG9 B;  3ZBD A;  3A98 A;  3NHN A;  1ZLM A;  1SKU B;  2FPE A;  1VQN Q;  1PSF A;  4C8Q B;  1QCF A;  4L5G A;  1UEC A;  1PD0 A;  4PLL A;  3RUX A;  4EPC A;  3MEA A;  3ME9 A;  3M59 A;  1M2V A;  5GAN f;  2RQT A;  4JUV A;  3TEE A;  3H8Z A;  2BZ8 A;  1N8R C;  1PKS A;  1VQM Q;  2Y4Y A;  3AT1 B;  5GAO n;  2WSC E;  2CYZ B;  2D8H A;  2I2L A;  1OZ3 A;  3EH1 A;  2NYS A;  2CDT A;  1PC0 A;  3G6E Q;  2KE9 A;  2XDD A;  3X28 B;  1RL2 A;  1ZQ1 A;  1AD5 A;  4M7D A;  5GAM f;  1GBR A;  1J3T A;  1NYG A;  4NL2 A;  4GLM A;  1K73 C;  4KT0 E;  3DLM A;  1YIT A;  2LP5 A;  2M16 A;  1IGQ A;  1FMK A;  1E6H A;  2MMP A;  2F2V A;  4JZ4 A;  4C5G A;  3JRZ A;  3C94 A;  3OYL A;  2JM8 A;  2QI2 A;  1NM7 A;  3JCM V;  1SSF A;  4M77 B;  3RR6 A;  2ZAE A;  5CKE A;  2LX9 A;  3GP8 A;  2DE0 X;  1MV0 B;  2QG9 B;  3BDU A;  1BI2 A;  4FT4 A;  3CMA A;  1O9S A;  2L2P A;  3CCM Q;  4RTZ A;  3SB2 A;  5DY9 A;  4J83 A;  3PE0 A;  3OYJ A;  1Q86 C;  5EG2 A;  3G4S T;  2AKL A;  4MMK A;  3I56 A;  2EW3 A;  2YRV A;  4HCK A;  3CCQ T;  4DOW A;  3EGX A;  4ELY C;  1GBQ A;  2RPN A;  3CC2 T;  1WJR A;  2CS7 A;  1WNL A;  3GBQ A;  1VQL T;  1OEB A;  2G6F X;  2D1X A;  2VGM A;  5GJW B;  1QKW A;  2E6Z A;  1WXB A;  4M77 F;  1SHF A;  1WHL A;  3M9Q A;  3G71 Q;  3MPU B;  5CKB A;  1OU8 A;  3CD6 Q;  1AZG B;  1VQ4 Q;  4M7D C;  3MCA B;  1KQS S;  5AT1 B;  1SEM A;  5FU6 C;  3JB9 I;  2DXT A;  4JZ3 A;  4M77 E;  3CCR Q;  2V26 A;  1VQO Q;  4OMN A;  3NTK A;  1YI2 Q;  2EYQ A;  4FW2 A;  1HXD A;  3CCQ A;  4F7U B;  2HKN A;  1FYN A;  1IXD A;  2EYX A;  5KCO A;  3M56 A;  3O5Z A;  1AVZ C;  4M77 G;  2DL5 A;  2RN8 A;  5FW9 A;  1UJY A;  1K8A C;  2J05 A;  3UWN A;  1X75 C;  3OSS C;  1GCQ A;  2RHX A;  4KH0 B;  2EYY A;  4IKF A;  1WLP B;  1TSF A;  4XTU A;  4IIO A;  2KRO A;  3CCS Q;  2E12 A;  4KH1 B;  1D1C A;  4QVZ A;  3CPW P;  5EC7 A;  2L89 A;  2A28 A;  1H3H A;  4RG2 A;  1VQ7 Q;  3CC7 Q;  1OUL A;  3VYH B;  1V76 A;  3OW2 P;  3PTA A;  3CCL Q;  1QVF P;  4WF2 A;  4C92 E;  3L2U A;  1VQ6 Q;  2DIL A;  2M51 A;  1KQ2 A;  5FRO A;  3QG1 A;  2WSE E;  1C1A A;  1YCS B;  2JOY A;  1PKT A;  2QA4 Q;  2H8H A;  1BYM A;  2LTO A;  4C8Q G;  1QVP A;  3JSC A;  3KFV A;  4BD3 A;  3ULR B;  4OB3 B;  4RTV A;  3MKD A;  4BDY A;  4QT7 A;  3LW5 E;  2KR3 A;  3UAT A;  2CUB A;  3E2U A;  4C5E A;  1Y71 A;  5KYY A;  1GXI E;  4AFS C;  4E7L A;  2JN0 A;  5LJ5 h;  4J9I A;  3CC7 T;  4HCB A;  1Y96 A;  3O8V A;  1VQM A;  2CUD A;  3JCM c;  4FSX A;  2L3S A;  1WX6 A;  4A54 A;  3JCM P;  5GAN 3;  4OML A;  2CGH A;  4A4E A;  1ZUK A;  2HMA A;  4C0G A;  5LJ3 h;  2DMO A;  3UA6 A;  3R6O A;  1YFN A;  1EZZ B;  4BAC A;  1G5V A;  4M75 C;  2LDM A;  2O88 A;  1R0C B;  2ECZ A;  3JV3 A;  4Y91 A;  1MMN A;  5CKF A;  2K3X A;  2RM4 A;  3M54 A;  4XU3 A;  4JJN K;  5CCA A;  1WHH A;  2DRK A;  3CXC P;  4E6R A;  1ZHI A;  2OTJ T;  4PJL A;  3WVD B;  2B8A A;  1E6G A;  2K5L A;  2PZ1 A;  2DER A;  2EVR A;  1QWE A;  2OX7 A;  2X3X D;  2E3H A;  4LDW A;  2VAS A;  1OI1 A;  2EFI A;  1ZSZ C;  2KT8 A;  2WSF E;  5CKD A;  3CCM A;  3QHS A;  1RAI B;  1BI0 A;  1GCP A;  1WQ7 A;  2RK2 A;  2DZC A;  4HKE A;  2P0K A;  4M75 D;  2FL7 A;  2KDS A;  1RUW A;  1NJI C;  4RCC A;  3MP1 A;  1G3W A;  3OYD A;  2JS0 A;  4OMF B;  1OQK A;  3M53 A;  5GMK h;  2VWF A;  2CZ7 B;  2FHD A;  3CQT A;  4JRQ A;  4LXC A;  3CCU Q;  1TS9 A;  2JMA A;  4GY5 A;  4BE2 A;  4EMK A;  1U06 A;  4J7F A;  3BFM A;  4C0D B;  3CCV Q;  1KHI A;  1WDX A;  3CCV T;  2CZ6 B;  4FIB A;  1VQ4 A;  2Y90 A;  2E41 A;  1T0H A;  1CKA A;  4LE9 A;  2FPF A;  2P84 A;  2RJF A;  3NTH A;  3X26 B;  1UDL A;  3MEW A;  2RHI A;  3UDC A;  1I0C A;  1OU9 A;  3JCM W;  3QUI A;  1PRL C;  5GAN 6;  1SRM A;  1QP2 A;  3CME T;  2NUP A;  3EG1 A;  1MND A;  1AOJ A;  1W4S A;  2RI3 A;  4E7H A;  3CME A;  2NWM A;  4J9H A;  2LX7 A;  1I07 A;  1WI7 A;  3MP6 A;  2EGA A;  3V7S A;  1KC8 U;  4M78 A;  2KVQ G;  2QEX Q;  2RK1 A;  2CZ1 B;  5A0G A;  4OVA A;  2ATC B;  2G3R A;  5CKH A;  3I9Q A;  5DLO A;  3KUF A;  3M0S A;  2P4T A;  1M30 A;  4M7D E;  1LPL A;  4KGX B;  1K9M R;  1TTH B;  3EAE A;  1X6B A;  2DIG A;  1X2K A;  2DTO A;  2MIO A;  5CIU A;  2KAF A;  4C0D C;  3V7R A;  3MP8 A;  3CEY A;  1PCX A;  4EMK B;  3J81 E;  4L6V 5;  4KUD K;  3L2Z A;  2J6K A;  1X43 A;  2QXF A;  4KGZ B;  3P8H A;  5GJV B;  4B6M A;  4FM4 B;  2J7I A;  4ZGD B;  3WXM B;  5I21 A;  5KCH A;  2NUZ A;  4PFZ A; 
#chains in the Genus database with same CATH homology
 2F2X A;  1K4U S;  3A98 A;  4AG2 C;  2DRM A;  1ZLM A;  2J6F A;  3NHN A;  2FPE A;  3H41 A;  1M27 C;  3NMZ C;  1AWO A;  1QCF A;  4OMQ A;  1K0S A;  1KJW A;  1JXM A;  3VS5 A;  4OMP A;  3VRZ A;  1UEC A;  4Y92 A;  2K7A A;  3I5S A;  1LCK A;  1UJ0 A;  1G83 A;  4RUG A;  2VKN A;  4CC3 A;  1WA7 A;  2RQW A;  4J9E A;  2DBK A;  2DL7 A;  1GL5 A;  2PTK A;  2J6O A;  2RQT A;  5IXB A;  2BZ8 A;  1PKS A;  3R6N A;  2A08 A;  1OV3 A;  2D8H A;  1ABQ A;  1K1Z A;  2CSI A;  2CDT A;  2JTE A;  2LZ6 B;  2KE9 A;  2PNI A;  2JM9 A;  2ROT A;  1AD5 A;  3EG2 A;  2C0O A;  1AZE A;  1J3T A;  1NYG A;  1GBR A;  2CRE A;  4GLM A;  1OOT A;  2JMC A;  3ZL7 C;  2DM1 A;  1KFZ A;  2D8J A;  2LP5 A;  4JJD A;  1FMK A;  1E6H A;  4J9G A;  2F2V A;  4M4Z A;  1GCQ C;  1ZBJ A;  1TUD A;  3U23 A;  4JZ4 A;  3VS4 A;  2O2O A;  1WIE A;  2JM8 A;  2ESW A;  2RF0 A;  5IHI A;  1GFD A;  2CT3 A;  1I1J A;  3NGP A;  1NM7 A;  2O9S A;  1GFC A;  4AFU C;  2SEM A;  3EHQ A;  5IHN A;  2DE0 X;  3VS0 A;  1UHF A;  3I5R A;  1MV0 B;  1UGV A;  1HD3 A;  1AWJ A;  2RMO A;  4Z8A A;  2LMJ A;  2KXC A;  1PNJ A;  2K3B A;  2J06 A;  2L2P A;  3EG3 A;  2C0T A;  4RTZ A;  1T3S A;  3REA B;  4RTY A;  3PE0 A;  1JU5 C;  4D8D A;  3RBB B;  2EKH A;  2EGC A;  1W1F A;  2MCN A;  2D0N A;  1Z9Q A;  3EGU A;  2AKL A;  3M0T A;  4ESR A;  1Y57 A;  2EW3 A;  4GBQ A;  4HCK A;  2OI3 A;  1GBQ A;  1E7O A;  2RPN A;  5IHK A;  2YUO A;  1YN8 A;  1ABO A;  1NLP C;  4J9C A;  3GBQ A;  2GTJ A;  2EPD A;  1OEB A;  4R0K A;  2G6F X;  2D1X A;  3VS2 A;  5GJW B;  1QKW A;  1WXB A;  4K11 A;  1SHF A;  1CSK A;  3I35 A;  1QKX A;  2DL3 A;  4ZNX A;  2B86 A;  1AZG B;  1WXT A;  1H8K A;  2FO0 A;  1SEM A;  4AFQ C;  2CSQ A;  4JZ3 A;  2L3P A;  3TSZ A;  2KBT A;  1RLQ C;  4OMN A;  2LJ1 A;  2F2W A;  3THK A;  2KRM A;  1WFW A;  3UF4 A;  2JT4 A;  1FYN A;  2EYZ A;  2EYX A;  1JEG A;  2CT4 A;  5IH2 A;  3O5Z A;  1AVZ C;  2OJ2 A;  1OPK A;  2DL5 A;  1QWF A;  2RN8 A;  5FW9 A;  3EG0 A;  2AK5 A;  1UJY A;  2J05 A;  1GCQ A;  2I0N A;  3TSW A;  1ZUU A;  2EYY A;  5I11 A;  1Y0M A;  3FJ5 A;  1WLP B;  4WCI A;  4JJB A;  4IIO A;  1NEB A;  2KRO A;  5I22 A;  2FRY A;  5EC7 A;  2A28 A;  2EBP A;  1H3H A;  1Z9Z A;  2KT1 A;  1ZX6 A;  1B07 A;  1YNZ A;  2FG0 A;  2HCK A;  4J9D A;  4Z88 A;  1VYU A;  2XMF A;  2EGE A;  5L23 A;  2RQU A;  2DJQ A;  1SPK A;  2YUN A;  2HEQ A;  2DIL A;  2M51 A;  4J9B A;  1T0J A;  1X2Q A;  1MV3 A;  2A36 A;  1SHG A;  1TUC A;  1YCS B;  1PKT A;  1M3B A;  3PVQ A;  2H8H A;  4RTX A;  1XOV A;  1U5S A;  2K79 A;  2QDL A;  2GGR A;  2X3W D;  2ROL A;  3H0I A;  3KFV A;  3ULR B;  1M3A A;  1HJD A;  4HXJ A;  1YP5 A;  4RTV A;  1W70 A;  4QT7 A;  1ARK A;  3LH5 A;  4OMM A;  4FSS A;  2FEI A;  2KR3 A;  3UAT A;  1HSQ A;  2CUB A;  2AZV A;  3UA7 A;  2KXD A;  2BZX A;  2EQI A;  3SHW A;  2DL4 A;  2FRW A;  2GTO A;  4AFS C;  2MOX A;  2DLP A;  1K0X A;  5FWC A;  1ZSG A;  4J9I A;  4HVU A;  2W0Z A;  2GNC A;  3M0U A;  2AKK A;  3VS1 A;  1H92 A;  2O31 A;  2RQV A;  1WYX A;  1UG1 A;  2JW4 A;  2CUD A;  2L3S A;  1PWT A;  1WX6 A;  1G2B A;  1NLO C;  4OML A;  4LUE A;  1K9A A;  1JQQ A;  1ZUK A;  2DMO A;  2FPD A;  3UA6 A;  4LUD A;  3PVL A;  4LN2 A;  1QLY A;  1CKB A;  2O88 A;  2RQR A;  2ECZ A;  3JV3 A;  3RNJ A;  3VS3 A;  4HVW A;  1RLP C;  3VS7 A;  2LJ3 A;  2DRK A;  1VYV A;  4E6R A;  4HVV A;  2A37 A;  1AWX A;  2IIM A;  2GQI A;  1EFN A;  1JO8 A;  2LQN A;  4EIK A;  2SRC A;  2LNH B;  1E6G A;  2PZ1 A;  1ZUY A;  1BB9 A;  2EVR A;  1QWE A;  2X3X D;  2KYM A;  5ECA A;  2K6D A;  3C0C A;  2K9G A;  2KT8 A;  1OPL A;  1V1C A;  4ORZ A;  5FWB A;  4F17 A;  1W6X A;  1GCP A;  1A0N B;  3M0R A;  2YDL A;  1JXO A;  1VYT A;  1NEG A;  1S1N A;  4LNP A;  2C0I A;  4RTT A;  2RNA A;  1RUW A;  1MUZ A;  3SEM A;  1UTI A;  1PHT A;  4AG1 C;  1YWP A;  2JS0 A;  1PRM C;  2KYB A;  1AWW A;  4CC4 B;  3VRY A;  4OMO A;  2HBW A;  2W10 A;  2VWF A;  1B3Q A;  3CQT A;  2JMA A;  3IQL A;  1IO6 A;  4J9F A;  3M0P A;  1U06 A;  2E5K A;  2DVJ A;  4RTU A;  1SSH A;  2JXB A;  2L0A A;  1WDX A;  4JPB W;  1KSW A;  1BK2 A;  2LQW A;  1T0H A;  2YUP A;  1M3C A;  1CKA A;  4LE9 A;  2FPF A;  1UE9 A;  1GRI A;  2KRN A;  2OAW A;  2YT6 A;  2ED1 A;  4IIM A;  1UDL A;  2AZS A;  1UHC A;  3REB B;  1I0C A;  1VA7 A;  1PRL C;  1SRM A;  2KEA A;  2YSQ A;  3TVT A;  2LJ0 A;  2JS2 A;  1M8M A;  1N5Z A;  2LCS A;  3EG1 A;  4DEX A;  4Z89 A;  1AOJ A;  4F16 A;  1UUE A;  5IXF A;  2NWM A;  2DBM A;  4J9H A;  3VS6 A;  2CH4 W;  2LX7 A;  1I07 A;  2DL8 A;  1BU1 A;  1T3L A;  2YUQ A;  2DF6 A;  2KRS A;  1WI7 A;  4AFZ C;  4CC7 A;  2M0Y A;  2P4R A;  1AEY A;  2EGA A;  2K2M A;  4CC2 A;  2BZY A;  4X1V A;  4A63 B;  2CH4 A;  3H0F A;  2VVK A;  4RTW A;  1TG0 A;  2V1Q A;  3I9Q A;  4KRT A;  1X69 A;  1X6G A;  1YWO A;  3M0S A;  1SRL A;  1NG2 A;  1K76 A;  2EYW A;  1M30 A;  2GBQ A;  1KIK A;  1X6B A;  1BBZ A;  1X2K A;  2ENM A;  2MIO A;  1NYF A;  4JJC A;  3EHR A;  2KGT A;  1U3O A;  3H0H A;  3QWY A;  5HCK A;  2ED0 A;  2BTT A;  2V1R A;  2DNU A;  4F14 A;  1RI9 A;  2HSP A;  2ABL A;  2J6K A;  2O9V A;  1X43 A;  2DA9 A;  5GJV B;  2DYB A;  2J7I A;  3M0Q A;  2L3Q A;  4DEY A;  3NPF A;  3QWX X;  2DX1 A;  2HDA A;  2NUZ A;  1X27 A;  4D8K A;  2KNB B;  1WXU A;  1UFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...