2DRKA

Acanthamoeba myosin i sh3 domain bound to acan125
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
GSPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain IB
publication title The crystal structure of the SH3 domain of Acanthamoeba myosin IB bound to Acan125
rcsb
source organism Acanthamoeba castellanii
molecule tags Contractile protein
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2drkA00
3GBQA 2GNCA 2E5KA 1QKXA 4Z88A 1CKAA 1PNJA 3VS5A 2DL5A 3VS0A 4CC3A 2LJ0A 3UF4A 5L23A 2VWFA 3H0HA 1H8KA 1VA7A 2YDLA 3VRYA 1BBZA 4K11A 1G83A 1FYNA 2EYWA 2DNUA 4DEYA 2QDLA 1U5SA 2ABLA 2YT6A 3M0UA 4WCIA 2RQWA 3VS6A 2K9GA 3FJ5A 2FEIA 1HD3A 1ABQA 3I5SA 1QLYA 1OPLA 4GBQA 2SEMA 4RTUA 3VS1A 3M0PA 2O2OA 2LMJA 2X3WD 2P4RA 1Y57A 1GRIA 2RPNA 2FRYA 4OMLA 5FWCA 4J9FA 3NHNA 1AWXA 3M0SA 2NUZA 2LQWA 5ECAA 2KRMA 2ENMA 4OMNA 2BZXA 1AWOA 1ZUKA 1GBRA 1B07A 4FSSA 2GGRA 4AG2C 4AFQC 3PVQA 2JMCA 2JTEA 4A63B 3M0RA 1LCKA 1BK2A 2KR3A 2VVKA 2LX7A 2BZ8A 4ORZA 3VS7A 3R6NA 2A36A 2EYZA 4DEXA 3EG1A 3EGUA 2HDAA 1T0JA 1SHFA 2DJQA 1RI9A 2O88A 1CKBA 4AG1C 1MUZA 2O31A 2A37A 2O9VA 2L0AA 1E7OA 1UUEA 2RMOA 2J6FA 4RTYA 1QKWA 2ED1A 2J06A 3IQLA 2DE0X 2LCSA 1K0XA 3CQTA 1N5ZA 1RLQC 2J7IA 2K6DA 2OAWA 3I9QA 1KIKA 1BB9A 3A98A 4RTTA 4OMPA 2DRMA 1M30A 1VYVA 1UHCA 1ZBJA 5EC7A 2G6FX 2LQNA 2EPDA 1X6GA 1WIEA 2JS2A 2EGEA 1K76A 2YUQA 3I35A 1A0NB 1UECA 1OV3A 2CT4A 1NYGA 2FPEA 2CDTA 3UATA 2D8JA 4LE9A 2A08A 1ABOA 1AZEA 4KRTA 1PWTA 2F2VA 3EG3A 5I22A 1QWEA 1E6GA 4F17A 2DL8A 1PKTA 2EGCA 1AWWA 1UJ0A 4RUGA 2YSQA 1HSQA 2RQTA 1KJWA 1X6BA 2LJ1A 3EG2A 2EVRA 4Y92A 4RTZA 2M0YA 4ZNXA 1NEGA 1UGVA 2CUDA 1T3SA 2ESWA 3REAB 1SRLA 2JS0A 1WXBA 4HVUA 2XMFA 1X27A 1WYXA 2KEAA 2B86A 2DA9A 2DVJA 1WXUA 2EQIA 4LNPA 2D8HA 1GL5A 3RNJA 1XOVA 2F2XA 2GBQA 5FWBA 1WXTA 2W10A 2K7AA 3M0TA 1JXMA 2ROTA 1K1ZA 1ZLMA 1Z9QA 1W1FA 2EYXA 3REBB 2RN8A 3UA6A 4EIKA 1UE9A 1GCQC 2W0ZA 3PE0A 1X43A 4J9EA 2KE9A 3PVLA 1M3AA 2PNIA 2C0OA 2EGAA 1YNZA 2D1XA 2DL7A 3EHRA 1ZX6A 4LUEA 1J3TA 3O5ZA 4D8KA 1PKSA 1TUCA 2IIMA 1T0HA 2CT3A 1AVZC 1UJYA 1SSHA 2K3BA 1M3BA 2KT1A 3U23A 2GTOA 2ED0A 2KYBA 4JZ4A 1UHFA 2EW3A 3TSWA 3C0CA 3EHQA 1PRMC 2H8HA 1S1NA 1QWFA 4R0KA 3H0IA 3TSZA 2DM1A 2EYYA 3I5RA 3ULRB 1NLPC 1TUDA 5FW9A 3H41A 4CC7A 3SEMA 1YWOA 1ZSGA 2HEQA 3THKA 2VKNA 4AFUC 2C0TA 2V1RA 2CSQA 1RUWA 2EBPA 3KFVA 1SRMA 1X2QA 1WDXA 1V1CA 2KYMA 1YCSB 2I0NA 3VS2A 1H92A 2DRKA 1NG2A 2JW4A 2GQIA 4AFSC 4CC4B 2J6KA 2DILA 1SEMA 1GFDA 2ROLA 1M3CA 1AEYA 1I0CA 2PZ1A 4RTXA 1NYFA 2JMAA 2L3SA 1WFWA 1AWJA 4F16A 2FG0A 1WX6A 3NMZC 5IHNA 2DX1A 2RQUA 4X1VA 3VRZA 4J9HA 2C0IA 2HBWA 1M27C 2RNAA 4HVVA 4AFZC 4HCKA 1MV0B 5I11A 1SPKA 2SRCA 2CUBA 1FMKA 2KROA 1JEGA 2V1QA 1AZGB 2MOXA 2L2PA 4JJCA 2MCNA 1QCFA 2K2MA 4ESRA 2PTKA 4JJBA 1Z9ZA 2FPFA 2DL3A 4JJDA 2DL4A 3VS3A 5IXBA 1JU5C 1YP5A 4HVWA 2K79A 4D8DA 2DMOA 2OI3A 1B3QA 1UFFA 1U3OA 1OOTA 4OMQA 2KNBB 2JM8A 1BU1A 2KT8A 2FRWA 1YN8A 4IIOA 4CC2A 1UTIA 2KBTA 2A28A 1X69A 1KFZA 1PHTA 2AZVA 4IIMA 2CH4A 3NGPA 1VYUA 2AKLA 1WLPB 2LP5A 4Z89A 2FPDA 2KGTA 1OPKA 3SHWA 2YUPA 2KXCA 2DYBA 1GCQA 1WI7A 2ECZA 2JM9A 2CREA 4J9CA 2YUOA 3QWXX 1G2BA 2AKKA 2FO0A 2X3XD 1KSWA 1NEBA 1T3LA 1WA7A 3RBBB 1ZUYA 1ZUUA 3NPFA 2BZYA 1W70A 1E6HA 4M4ZA 4E6RA 2MIOA 1JXOA 5IHKA 2OJ2A 2KXDA 4LUDA 1IO6A 2YUNA 2DLPA 3UA7A 1M8MA 1NLOC 2RF0A 2J05A 2M51A 1VYTA 4LN2A 2L3QA 2AZSA 2DBMA 4J9IA 1K4US 4HXJA 1CSKA 4QT7A 5GJVB 2LJ3A 1YWPA 1PRLC 5IHIA 5HCKA 4OMMA 2EKHA 4GLMA 4F14A 2CSIA 1SHGA 1I1JA 1TG0A 2D0NA 3H0FA 1UDLA 2BTTA 2HCKA 3EG0A 1GCPA 1NM7A 1OEBA 3ZL7C 1MV3A 2LNHB 2KRNA 2CH4W 1JQQA 4JZ3A 1EFNA 1AOJA 2RQRA 4Z8AA 2DF6A 4OMOA 2JXBA 1X2KA 4J9DA 4JPBW 2DBKA 5IH2A 3QWYA 4J9BA 1Y0MA 2RQVA 1K0SA 2GTJA 2F2WA 1GFCA 1W6XA 2AK5A 1ARKA 1I07A 3JV3A 1HJDA 1K9AA 2JT4A 1UG1A 1GBQA 3M0QA 5GJWB 4RTWA 1JO8A 2KRSA 4RTVA 3LH5A 3VS4A 3TVTA 2L3PA 2J6OA 2LZ6B 2NWMA 1U06A 1AD5A 5IXFA 2O9SA 1RLPC 4J9GA 1H3HA 2HSPA
chains in the Genus database with same CATH superfamily
1YJWA 3VS0A 4CC3A 2LJ0A 5GANg 4XU0A 1H8KA 4EMKC 3VRYA 1BBZA 1ZSZB 1G83A 4OP0A 4PJOC 2DNUA 1M2VB 5GAN6 3M0UA 3LWIA 5J3BA 2GF7A 2RQWA 4NS5A 1FWZA 2LT1A 1K73C 3HSBA 1V76A 3I5SA 2F69A 1OPLA 2KMTA 1QVPA 4J6XA 4J6WA 4MZTA 4M78C 2SEMA 3Q1JA 3VS1A 3CPWP 3JCMW 2X3WD 2P4RA 1GRIA 4LDVA 2OAUA 2JJ9A 3NTHA 4J6YA 4BI8B 1RAIB 2BZXA 3VYGA 4DOVA 1YITQ 3JCMf 5LJ5j 4A53A 1LCKA 3OYAA 4JDSA 3SFMA 3M59A 3NTIA 3EG1A 2HKNA 3RERA 2HDAA 3OYIA 1WPYA 5CQXA 4M7DC 2HSEB 2DD4A 3PNWC 5GAMe 1G3TA 2L0AA 1QKWA 3CD6Q 3CQTA 4Y28E 3OYMA 1BI1A 1RAFB 4II1A 1KG1A 4OVAA 2DRMA 3RR6A 2G6FX 1WIEA 3LH0A 2HAXA 4KGZB 1K76A 3M57A 2JVVA 3JCMJ 2CT4A 2FPEA 2O4XB 1RI0A 1KC8R 4C8QA 1VQ8T 3OS2A 3FJPA 2E3HA 3QXEB 1E6GA 4O6JA 4C92G 4F17A 2RI2A 1Q81U 1M1GA 3EG9B 2EGCA 2MYSA 1XNIA 2NUTB 4ELYC 3G71A 1KJWA 2PUKB 3TEEA 1VQ6A 3PTAA 2CS7A 2M0YA 4M75B 1MNEA 1T3SA 3M4GA 3HL8A 1WJSA 1ACMB 5GANj 2E6NA 2HQXA 2XI9A 2CZ0B 3G1JA 4FYVB 2DVJA 2RK1A 4HCZA 1WXUA 5LJ5h 5CO7A 1GL5A 2E4HA 4KUIA 3L2VA 2RHYA 1WXTA 2OTJQ 3M0TA 4MZPA 3CXCP 4CRIA 3DLLA 1ZLMA 1W1FA 3CPFA 1UE9A 1GCQC 3MO8A 4FW1A 3JCMP 2ZPGB 3UT1A 4ATOA 1SKUB 1VQ7T 4OGCA 5LJ3d 4R56A 2DK3A 2DZ9A 2EGAA 2X4JA 4LUEA 1J3TA 1Y71A 4JUVA 4X9CA 4C5IA 1U8RA 3PT9A 4BDYA 1AVZC 1UGQB 3U23A 2GTOA 2KYBA 3V7SA 1S72A 3TSWA 3C0CA 4EMHA 2D0QB 1VQ4A 4RG2A 3CCRA 1QVFA 1VQ9A 2JUFA 3JB9D 1OZ3A 3HRSA 2QQRA 2R58A 3FEOA 4L6V5 1WHLA 4QQDA 3CCVA 1ZSGA 1RAHB 2K5IA 1VQKA 3PFSA 1K9MU 2CSQA 4DBHA 2IVWA 2CP7A 1KQSP 2KYMA 2I0NA 1OULA 1H92A 1X6OA 1NG2A 4E7IA 1G8XA 2JW4A 1Y96B 2J6KA 3HFOA 1QVGA 1D3BB 3OS0A 2LNVA 1M3CA 3BDUA 4BD3A 1I0CA 1X75C 3QG1A 1N9SA 3HPWA 9ATCB 4XAXB 3M4YA 1HYOA 4FIBA 5GANh 4LDXA 1GXIE 1KQ1A 4C92D 4F16A 2RHIA 2V8KA 4E7ZA 1M27C 4A54A 4KGXB 3CBMA 4C92F 1JRIA 4JJNK 3QJ6A 3CCQA 1MV0B 2X35A 2K5FA 2CUBA 1FMKA 2X4XA 2WSCE 1NBEB 4JJCA 1QCFA 1YJ9Q 2RD1A 4A4HA 2NYSA 2HNIA 1DJ7B 2DL4A 5CKEA 1FX7A 2I2LA 4M75F 4FT2A 2QQBA 4KBMB 2OI3A 1B3QA 1UFFA 3G4SQ 2E6ZA 1OOTA 2BE9B 4OMQA 3H6ZA 1BIAA 3OSSC 1BU1A 3TQ7P 4F7UB 4IIOA 1YJNT 3CMAA 4CC2A 1VQMQ 2FVUA 2FZCB 5A0LA 1YHQA 3OS1A 1OU8A 1ZA1B 1KFZA 2AZVA 3CCLT 4IIMA 3CCMT 5KYYB 3R6OA 2LP5A 2AKLA 2K57A 3HP9A 4Z89A 2NUPA 5HK0A 3JCMQ 3S3OA 1NJIU 1OPKA 3SHWA 1D3BA 2YUPA 1U1TA 2CZ1B 3OYLA 5CQYA 3CC7Q 1Q81R 3SDZA 3NTKA 2YRVA 2LCLA 2AKKA 2JZ2A 4Z02A 1Q86U 2X3XD 5GAN8 3GOXA 1NEBA 4C92C 1AT1B 2DAQA 2DXCA 1MMAA 2IG0A 3LX7A 4M4ZA 3JB9I 2MIOA 1W2BP 3META 2COYA 2KXDA 1IGQA 1VQNA 5EG2A 3URGA 3I55A 2QQSA 4LN2A 3JCMX 5KYUA 4M7AB 2AZSA 5LJ3g 3G6EA 4C0FA 4J9IA 3BY7A 3PGGA 1K4US 4QT7A 1WNLA 1MMGA 1WHMA 1ZBXA 4J7IA 2M0OA 3OMGA 4OMMA 2EKHA 4GLMA 2D0NA 3H0FA 1UDLA 2HCKA 1GCPA 1QMCA 1HK9A 5CR2A 1I5OB 3ZL7C 1K73U 3MP6A 1VQ5T 2P84A 2KRNA 1EZZB 2FHDA 4JZ3A 2DKGA 4F7UA 1VQPT 1V29B 2XG8D 2QEXA 1MMDA 3H9NA 4E7SA 2RA2A 3OQ5A 1R8OB 1Y0MA 4J5YA 1D0XA 1K0SA 2EKOA 3CCSA 4OF1A 4D6WA 2RK2A 2JT4A 1OX8A 3RKYA 4RTWA 1JO8A 2KRSA 2F1LA 3LH5A 3VS4A 5GAN2 3MEAA 1WHJA 3TVTA 5C0MA 3BW1A 2L3PA 3GIBA 5AYFA 3E2UA 1QW1A 2GFAA 1PCXA 5IXFA 3MEWA 1UGPB 2XICA 4PJNA 2HSPA 1BCMA 1R0CB 1M8VA 2GNCA 2A7YA 1K9MR 4N4GA 1QKXA 2RH2A 1CKAA 1PNJA 3VS5A 3CCJA 1YJWT 5GAMd 2JNGA 3LLRA 3H0HA 5HY6A 1KK7A 1VA7A 5GAN4 1YBYA 2YDLA 3ZFJA 1M9SA 4K11A 2EYWA 3RUXA 1I81A 2FL7A 3M5AA 4M77B 2FZKB 1D0ZA 4AT1B 4F7UF 2BKDN 2DXBA 2PQWA 4WCIA 4EMKA 3VS6A 4LDUA 1TUGB 2FEIA 4ZGJB 1TU0B 4PJOA 2HKQB 1QLYA 4ZTFA 1Q82C 1VUBA 2PUOB 2HMAA 5HK3A 1VQ8Q 4RTUA 5GAOn 1LJOA 3TCJA 4RCBA 1Y57A 4HKEA 2FRYA 4OMLA 5FWCA 4J9FA 5LJ5g 3NHNA 2NUZA 1QVFS 4M78A 2DTIA 2V8JA 2VUBA 2GGRA 4AG2C 2QI2A 2LT4A 1R77A 4AFQC 3S3MA 2JMCA 2JTEA 3M0RA 3EH2A 4C5GA 3PMTA 3VJPA 4QW2A 3RKWA 3CC2A 3X26B 1MHNA 4LDYA 3LWHA 1T0JA 5FRMA 1TH7A 1RI9A 3QJYA 4AG1C 2VC8A 2O31A 2V26A 3OYDA 1WJQA 4M7AF 1QVGS 5LJ3j 2R57A 1G3YA 2ED1A 2J06A 2DE0X 2LCSA 1N5ZA 2J7IA 2K6DA 2OAWA 3I9QA 1BB9A 1NJIR 1VQ7Q 3D7SB 3JCMe 3ER0A 4M77A 1UHCA 3SWNC 2XDPA 4MMKA 2LTOA 1PM3A 1ZHIA 2YUQA 1Q86R 3UATA 2HBPA 1PG5B 5FU7B 2RHUA 1ABOA 3CPWA 1KQ2A 4QVCA 4B9WA 2M16A 3HKSA 4OB1B 2IPOB 2DXUA 1AWWA 1O75A 2YSQA 1HSQA 2RQTA 3EG2A 4NL2A 4Y92A 4RTZA 4ZNXA 3VUBA 4PLLA 2E10A 3G71T 4JLGA 1UEBA 2ESWA 3REAB 1SRLA 1VQ6T 1B7TA 2XMFA 4M75E 4ME7A 2JTFA 5A0DA 1FMVA 1WYXA 1K73R 2KEAA 2VYTA 2B86A 4LNPA 3CC4A 2F5KA 4C0DC 1XOVA 3C12A 2GBQA 4M77F 4B6MA 4GY5A 3PIOA 2VGMA 4JLIA 3OY9A 1K1ZA 4QQGA 2WSEE 5DY9A 4XTXA 2EYXA 1YCYA 3L42A 4C8QB 1ZA2B 2C06A 5GAOm 3UA6A 2W0ZA 3PE0A 5LJ3h 3MCAB 4J9EA 2KE9A 5GAMg 3PVLA 5GAOr 4RKUE 5KYNA 2C0OA 2AHJB 3S3NA 2CP2A 3CMEA 2D6FA 3QZ9B 2D1XA 1ZX6A 4D8KA 1PKSA 2IIMA 5GAOp 5LJ5f 4XTUA 5FU6B 2CT3A 3CBPA 3A5ZB 4JZ4A 3EH1A 1UHFA 3N5BB 3CCUA 3OYGA 4R0KA 3HFNA 3TSZA 1JJ2P 3CCRT 3ULRB 1IRXA 1VQ9T 4CC7A 1YJNQ 2EFIA 3SEMA 4P5NA 1M1KC 1YWOA 2DTOA 1PSEA 1YJ9A 5CKBA 4XTYA 2HL3A 4LDWA 3CCLQ 2V1RA 3CCMQ 3CCVT 2EBPA 1YI2T 4LD9K 1SRMA 1X2QA 1VQKT 1V1CA 4ANJA 1YCSB 1D1AA 3VS2A 2DRKA 3V8LA 2EWNA 2GQIA 4CC4B 5KCHA 2DZCA 1NPRA 2DIQA 2QA4A 5GMKj 2PZ1A 4OB2B 5GAN3 3VYHB 2L3SA 7AT1B 1WZOA 2EJFA 3OYNA 2FG0A 1F1BB 3NMZC 5IHNA 2RQUA 1Q95G 4RCCA 2RNAA 3HHTB 3QBYA 3OYKA 3L2WA 5CVIA 1SPKA 1EX4A 3BFMA 3CCQT 3JCMb 2KROA 2MOXA 2MCNA 3QIIA 2OTLA 2QTVA 1IZ6A 4BY6C 2K2MA 4ESRA 4BUGA 2FPFA 2DL3A 4JJDA 3VS3A 2M1HA 4M75G 3EGXA 5IXBA 5GANf 2E65A 2RM4A 1MNDA 4PFPA 1U3OA 1VQ5Q 2ZPIB 1UB4A 4KH0B 3SB2A 2MMPA 3FB9A 2CZ6B 1M90C 1YN8A 1VQPQ 1IHVA 1UTIA 4BDZA 1WHHA 2QGGA 4F7UE 1VQLA 3QDRB 3TREA 3CMAT 4IUVA 1P92A 4N0AC 1YHQT 1ZQ1A 1KQSA 1VYUA 3V7CA 2FPDA 4IUQA 2KQWA 4C8QF 3OBYA 5I21A 3C4SA 2XDDA 3LGLA 2QDYB 1KD1C 5GAMj 2MAMA 8ATCB 1WI7A 2ECZA 2DERA 5HKCA 2CREA 4J9CA 3I56A 2ZAEA 3QWXX 4PJLA 4XU3A 2FO0A 1KSWA 3V8KA 1T3LA 5GMKh 3NPFA 4E2FB 1YJWQ 4E6RA 2AIRB 4XU1A 1JXOA 2VXEA 5IHKA 2X4WA 4MZMA 4LUDA 1IO6A 2KSSA 1NLOC 2QTXA 3MPUB 1VQNT 3CCEA 2XHCA 4E7JA 2DBMA 3I55T 4HXJA 1YWPA 4M7AE 3G6ET 5IHIA 5HCKA 1ZSZC 2NUPB 2BE7D 5FLXE 1LPLA 2BTTA 5GMKm 4A4KA 2CGHA 3OW2P 1H641 3GP8A 1VQOA 2COWA 1UGSB 1Q82U 5KYWB 1C1AA 1YFNA 1Q7YC 3WVDB 4NL3A 3CPWS 5D6WA 4E47A 2RQRA 2DF6A 4L5GA 4O5VA 2VASA 2QEXT 4JRPA 2RQVA 1TSFA 2GTJA 1YIJA 2F2WA 1W6XA 4J8OA 3MKDA 3OYFA 1WGSA 1UG1A 3ME9A 3CCST 2CP3A 4WF2A 5KYUB 4V2SA 2MK5A 2ZGWA 3MJXA 4MMLA 1BI3A 3P8DA 4M75D 2LZ6B 3M9QA 1H3ZA 4BI3A 3F70A 1AD5A 1RLPC 4J83A 3GBQA 3VKIA 5KE2A 2E5KA 3QPHA 4Z88A 5GAMh 3FRNA 1W2BA 3UF4A 3KXTA 2A0FB 3A8GB 3CCJT 3RKXA 5A0GA 5CKFA 1TWBA 1JBMA 1VIFA 4DEYA 2QDLA 4F7UG 3JCMd 4M77E 4PFOA 1WJRA 2K9GA 2L5QA 2XD0A 5I2MA 4JS4A 4BE0A 1QQJA 4X9DA 2EQKA 1TXQA 3ASKA 2XK0A 3M0PA 2M9UA 3SD4A 2O2OA 5J39A 2LMJA 5KYWA 3MEVA 1IREB 2FZGB 2LQWA 3C95A 1UGRB 2KRMA 1PD1A 2ZZDA 2ENMA 2VGNA 1GBRA 1ZUKA 3BE3A 2XDBA 4FM4B 4BI4A 2DEUA 3G71Q 4A63B 2CYZB 4OMFB 3J81E 1VQ6Q 1BK2A 2E64A 1G3WA 2LX7A 4ORZA 2EYZA 3EGUA 5D7UA 2RJCA 1CKBA 4M75C 3J7AF 2E70A 4EMKB 1MUZA 6AT1B 4M7AG 2A37A 4PNOA 1XTDA 2O9VA 1UUEA 4PJOB 2J6FA 4RTYA 2HQHA 3IQLA 4HCBA 1RACB 1RLQC 4HCCA 2KVQG 3J80E 3CXCS 2EIFA 3A98A 1LNXA 2RJFA 2KAFA 2R5AA 4OMPA 1VYVA 1OQKA 3WVEB 3OYYA 2LQNA 2EPDA 4M78B 1RADB 1X6GA 1G3SA 2CP5A 1WHGA 2EGEA 2XKOC 1A0NB 2QQ9A 1NYGA 2CDTA 2D8JA 4OGEA 4RG8A 3OBWA 4A4GA 2DEQA 1AZEA 4KRTA 2F2VA 5I22A 1VQ4Q 3L1AA 3A8OB 2PVGB 1KHCA 3CCRQ 1VQ9Q 1PKTA 4QVDA 1YITA 2O01E 4RUGA 1IGUA 3GF5A 1X6BA 3RIRA 3CCVQ 3UWNA 1YI2Q 4M7DB 3OYHA 1VQKQ 1NEGA 1UGVA 4N4HA 4ZTJA 1M1KU 2JS0A 1WXBA 4HVUA 4DBRA 1X27A 3JCMc 2Y4XA 1BCOA 4ZGDB 4BB7A 1KQSS 2DA9A 4FYXB 1Q82R 4LXCA 2D8HA 2K4YA 3RNJA 2F2XA 4M77G 2K7AA 3CC4T 2ROTA 3CD6A 1B34A 3DB4A 3OYBA 1EIFA 1N9RA 4C5EA 4EIKA 4DBQA 2H3EB 4VUBA 4C8QE 1QCNA 4QKUA 4DOWA 3CCQQ 2EJ9A 2DL7A 3EHRA 2HZYA 1HXDA 3O5ZA 3JSCA 1TUCA 3CMET 3JCMg 5CK9A 2ED0A 4XU2A 5GMKi 2EW3A 1WHKA 4M7AD 1PRMC 2CKKA 2QG9B 1S1NA 2DXTA 3GNFB 3H0IA 4B9XA 2EQUA 2RJEA 2DM1A 1M5Q1 5FW9A 5LJ3f 3H41A 4AMCA 4PL6A 5KH6A 3EFOB 4HA8A 3CMAQ 2VKNA 4M7DA 4AFUC 2LCCA 2C0TA 1M90U 1YHQQ 5CCAA 2M02A 4PJOF 1PSFA 3KFVA 3GNGA 1G5VA 1K8AC 5LJ5e 3QSUA 3MP1A 5DLQE 2DILA 1GFDA 3P8HA 2ROLA 4PJJA 1U1SA 2OTJA 1M2OA 1AEYA 4C0ZA 4RTXA 1NYFA 2JMAA 2QA4T 4M78F 1R0BG 1PD0A 1KD1U 2ZPFB 3RMQA 1WX6A 2DX1A 3VRZA 4J9HA 3M53A 3RDVA 4AFZC 5C6SA 2Z0WA 2EYQA 1VQNQ 1W2BS 2V1QA 1AZGB 3I55Q 2E1HA 5KYXA 3G6EQ 1OU9A 4IUPA 2AT1B 2PTKA 2OTLT 3VV0A 1NPPA 1OYXA 4M77D 2E41A 1JU5C 4M7AC 5AT1B 2DMOA 2KNBB 3E19A 3E9FA 4ZN1A 1JJ2A 5GAOl 5J26A 2KT8A 3EFOA 3GPLA 1QP2A 2QGFB 3FIFA 3QHSA 4XK8E 4DA4A 4XTZA 3QYHB 3EGDB 4ZGEB 4X34A 2QEXQ 1M1FA 1PHTA 1Q7YU 4HT9A 2CH4A 1VQLT 3NGPA 2YXYA 4C8QG 2KGTA 3DKMA 3CCSQ 3X28B 4IURA 3PMIA 3CEYA 3L2ZA 2CZ7B 2E5QA 4MDXA 3T9NA 1GCQA 2GCXA 4N0AA 1N27A 5GANe 2RHXA 2ZPHB 3JAME 3V7RA 4KGVB 4GLKA 2EAYA 4FL6A 3I56T 3EGXB 1WA7A 1S72T 1SG5A 1ZUYA 1ZUUA 2BUDA 2BZYA 3ZEHA 1E6HA 2EQMA 1VQ4T 1M1KR 3CCJQ 1BI2A 4C5HA 4JRQA 3UA7A 4EDUA 4NOYA 3FLGA 3DB3A 3OYCA 4KUDK 4LD6A 2DYIA 5GJVB 3CCET 2LJ3A 4EPCA 1OX9A 3HTRA 2CSIA 3TU4K 3X20B 4M77C 2L3RA 3G4SA 2FYKA 3JB9G 1NM7A 1OEBA 4XTWA 2WACA 2LNHB 3OS5A 1JQQA 2KI7A 1VQMA 1ZSZA 4RMOA 1EFNA 3P8BB 3CXCA 4PFZA 2JOYA 1I5LA 2K5LA 1VQOT 3EGDA 2XIDA 1MMNA 2LDMA 4E7KA 1M2VA 2ATCB 2PVOB 4J9DA 1N8RU 3QWYA 3L2RA 2NLUA 1GFCA 1ARKA 1I07A 3JV3A 1HJDA 4UC4A 1K9AA 1RABB 2P0QA 2V8IA 3M0QA 1YIJT 5GJWB 5M9OA 1W4SA 1BI0A 4RTVA 2R5MA 4C92B 3CC7A 3FC3A 3KBGA 2KY9A 2NWMA 3CC2Q 1U06A 1KC8C 4J9GA 3MEUA 3E1SA 2GFUA 1M90R 2A3LA 2G3RA 2DL5A 4E7HA 5KE3A 2L89A 5L23A 4C0GA 2VWFA 4JS5A 3X24B 1D09B 1NE8A 1SF9A 1X01A 3QZ5B 3V8JA 1FYNA 3JCMh 4C8QD 1U5SA 2ABLA 2YT6A 4MDWA 3MHXA 3O8VA 2ZPEB 2PVDB 8AT1B 3FJ5A 1HD3A 1ABQA 1KD1R 1IXDA 3JB9J 1M4ZA 5LL6S 1OI1A 4QQ6A 4GBQA 4BE2A 5GAN7 3HRTA 3OW2A 5GAMf 2RPNA 2VXFA 1TS9A 4KH1B 1AWXA 3M0SA 5ECAA 5FU7C 4OMNA 1AWOA 3OA6A 1B07A 4FSSA 5FROA 3PVQA 2KR3A 2O4XA 3QO3A 2VVKA 2BZ8A 3VS7A 4C92A 2Y90A 3R6NA 2A36A 4DEXA 1SHFA 2DJQA 1BKBA 5GMKl 2O88A 3CC4Q 3EG9A 2GQVA 2MWPA 1E7OA 2RMOA 2NUTA 2E12A 4JRKA 3EFSA 3OB9A 2RO0A 3A8HB 4N4IA 1Q7YR 1K0XA 3JB9F 1YI2A 1FMWA 4PJOE 1BYMA 2DD5A 5D6XA 4M75A 1KIKA 4RTTA 4F04B 1M30A 3VUZA 1VIEA 3QKJA 1ZBJA 5EC7A 2P4TA 1QP3A 2WSFE 2JS2A 4C8QC 3CMEQ 4M78E 3I35A 3X25B 1UECA 4FYYB 1OV3A 2QAZA 3G7ZA 1N6AA 1NZ9A 4XQ3A 1VQ8A 4JRIA 1KHIA 4LE9A 2A08A 4PJMA 1PWTA 4E7LA 3EG3A 1D1BA 1QVFP 1QWEA 4R55A 2RHZA 2YRDA 4XTVA 3CCUQ 5FU6C 2X9HA 2DL8A 2DVEA 1UJ0A 2RJDA 3OYJA 2LJ1A 1JJ2S 1YITT 2EVRA 1OZ2A 1RAGB 2QQAA 2CUDA 5L8RE 4ELZC 1PC0A 2K3XA 4M7DE 3L2UA 5KCOA 3AHUA 2KK4A 2LC4A 1QVGP 3M56A 2YWWA 2EQIA 4FYWB 4YTLA 5GAN5 5LJ5d 5FWBA 2QA4Q 2BIVA 1IHWA 1K8AU 2W10A 1JXMA 3ZBDA 5A2QE 3E9GA 1N8RR 1Z9QA 3SWNB 1SSFA 3REBB 3CD6T 5IT9E 2RN8A 1VQ7A 1N8RC 3H8ZA 2QYZA 1X43A 2D9TA 1TTHB 1IB8A 1M3AA 2YLBA 2LRQA 2RI5A 2PNIA 2XU8A 2YLCA 1Y96A 1RAEB 2CP0A 1YNZA 3RMSA 5CKHA 3LW5E 4IUUA 1T0HA 4A4FA 2VV5A 5FRNA 2OTLQ 1UJYA 1SSHA 2ZPBB 2K3BA 1M3BA 2KT1A 3EHQA 4PK4A 1Q81C 2H8HA 2P0PA 3KUFA 5D6YA 1QWFA 2DPPB 2Y4YA 3CC2T 3C94A 2EYYA 1LVKA 4QVZA 3I5RA 1NLPC 1TUDA 1Y7XA 5CIUA 1B34B 2COZA 2HEQA 3THKA 4BACA 4PJOG 4C0DB 1RUWA 1VQLQ 1WDXA 3INZA 2LQKA 4AFSC 4OB3B 2DJZA 5I2SA 1SEMA 2DTHA 2JTMA 5DM7R 4KT0E 1XJWB 1AHJB 4PLIA 4M78G 2ZCFB 2OTJT 1WFWA 1AWJA 3SWNA 3I56Q 2DIGA 2JN0A 5GANd 1S72Q 4X1VA 5LJ3e 3OYEA 2C0IA 5KYYA 5DLOA 2HBWA 4HVVA 2KDSA 3M54A 4HCKA 5I11A 4TVRA 2SRCA 2CP6A 3OMCA 5IN1A 4ZN3A 2FB7A 1I8FA 3HRUA 1JEGA 2YRCA 3UPUA 3A8LB 2PU9B 2L2PA 4BE1A 1WQ7A 1XQHA 4FW2A 3CCEQ 3RESA 1O9SA 4JJBA 1Z9ZA 4M7DG 5GAOq 3EAEA 1YP5A 1WQWA 4HVWA 2K79A 4Y91A 4D8DA 2LVMA 2H3JA 4DQ2A 4OB0B 1YJNA 1MGQA 2JM8A 3DLMA 2HL5C 1K9MC 5CAIA 2FRWA 2HQEA 1VQOQ 3OW2S 2RI3A 2KBTA 4FCYA 1D1CA 3CCLA 4M7AA 3M55A 2A28A 3CCMA 4IUTA 1X69A 3A1PA 3GLXA 3NFCA 2K2VA 3FDRA 4IKFA 3QUIA 2QASA 1WLPB 1YIJQ 2E3IA 2HD0A 5IAYA 1FXXA 2KXCA 2DYBA 2QK0A 4FSXA 1C0MA 1JB0E 2MPXC 2EJGA 5KYXB 2JM9A 1RL2A 2YUOA 4HT8A 2B8AA 3LYIA 2QXFA 1G2BA 2K3YA 1VOMA 3JRZA 3RBBB 2DFUA 1W70A 1KC8U 2L8DA 3CCUT 1BIBA 2OJ2A 4BY6B 4KULA 2YUNA 4PJOD 2DLPA 4L59A 1M8MA 2RF0A 1LOJA 2MF2A 2J05A 4EMGA 2M51A 1VYTA 3CBOA 2L3QA 4FT4A 2F5TX 3JB9H 3VU3C 1K8AR 1CSKA 3EFRA 1PRLC 1Y07A 1YJ9T 2LQ8A 1QCOA 5CKDA 2VB6A 4F14A 4FU6A 3WXMB 1C6VX 1SHGA 1I1JA 1TG0A 4M78D 2RB6A 2P0KA 3UDCA 1VQ5A 2DO3A 2DETA 4PKCC 3L2QA 3EG0A 3BDLA 3G4ST 1MV3A 3OSVA 1VQPA 3AT1B 3QYGB 2CH4W 2EQJA 2MI6A 2OX7A 1RAAB 1VQMT 1AOJA 4Z8AA 3PIPA 4OMOA 2MWOA 2JXBA 1X2KA 1NJIC 4JPBW 2DBKA 4Q5WA 5IH2A 2LX9A 4A4EA 4J9BA 1D0YA 3JCMV 2AK5A 3QDFA 3MP8A 4WTOB 2X51A 1GBQA 2YHTA 1I4K1 1TOVA 4M7DD 2X4YA 2J6OA 1Q86C 3A8MB 3LGFA 4DBFA 4J7FA 4C92E 3S6WA 3CC7T 4CI0C 3M58A 2O9SA 5GMKe 1H3HA 4M7DF
chains in the Genus database with same CATH topology
3GBQA 2GNCA 2E5KA 1QKXA 4Z88A 1CKAA 1PNJA 3VS5A 2DL5A 3VS0A 4CC3A 2LJ0A 3UF4A 5L23A 2VWFA 3H0HA 1H8KA 1VA7A 2YDLA 3VRYA 1BBZA 4K11A 1G83A 1FYNA 2EYWA 2DNUA 4DEYA 2QDLA 1U5SA 2ABLA 2YT6A 3M0UA 4WCIA 2RQWA 3VS6A 2K9GA 3FJ5A 2FEIA 1HD3A 1ABQA 3I5SA 1QLYA 1OPLA 4GBQA 2SEMA 4RTUA 3VS1A 3M0PA 2O2OA 2LMJA 2X3WD 2P4RA 1Y57A 1GRIA 2RPNA 2FRYA 4OMLA 5FWCA 4J9FA 3NHNA 1AWXA 3M0SA 2NUZA 2LQWA 5ECAA 2KRMA 2ENMA 4OMNA 2BZXA 1AWOA 1ZUKA 1GBRA 1B07A 4FSSA 2GGRA 4AG2C 4AFQC 3PVQA 2JMCA 2JTEA 4A63B 3M0RA 1LCKA 1BK2A 2KR3A 2VVKA 2LX7A 2BZ8A 4ORZA 3VS7A 3R6NA 2A36A 2EYZA 4DEXA 3EG1A 3EGUA 2HDAA 1T0JA 1SHFA 2DJQA 1RI9A 2O88A 1CKBA 4AG1C 1MUZA 2O31A 2A37A 2O9VA 2L0AA 1E7OA 1UUEA 2RMOA 2J6FA 4RTYA 1QKWA 2ED1A 2J06A 3IQLA 2DE0X 2LCSA 1K0XA 3CQTA 1N5ZA 1RLQC 2J7IA 2K6DA 2OAWA 3I9QA 1KIKA 1BB9A 3A98A 4RTTA 4OMPA 2DRMA 1M30A 1VYVA 1UHCA 1ZBJA 5EC7A 2G6FX 2LQNA 2EPDA 1X6GA 1WIEA 2JS2A 2EGEA 1K76A 2YUQA 3I35A 1A0NB 1UECA 1OV3A 2CT4A 1NYGA 2FPEA 2CDTA 3UATA 2D8JA 4LE9A 2A08A 1ABOA 1AZEA 4KRTA 1PWTA 2F2VA 3EG3A 5I22A 1QWEA 1E6GA 4F17A 2DL8A 1PKTA 2EGCA 1AWWA 1UJ0A 4RUGA 2YSQA 1HSQA 2RQTA 1KJWA 1X6BA 2LJ1A 3EG2A 2EVRA 4Y92A 4RTZA 2M0YA 4ZNXA 1NEGA 1UGVA 2CUDA 1T3SA 2ESWA 3REAB 1SRLA 2JS0A 1WXBA 4HVUA 2XMFA 1X27A 1WYXA 2KEAA 2B86A 2DA9A 2DVJA 1WXUA 2EQIA 4LNPA 2D8HA 1GL5A 3RNJA 1XOVA 2F2XA 2GBQA 5FWBA 1WXTA 2W10A 2K7AA 3M0TA 1JXMA 2ROTA 1K1ZA 1ZLMA 1Z9QA 1W1FA 2EYXA 3REBB 2RN8A 3UA6A 4EIKA 1UE9A 1GCQC 2W0ZA 3PE0A 1X43A 4J9EA 2KE9A 3PVLA 1M3AA 2PNIA 2C0OA 2EGAA 1YNZA 2D1XA 2DL7A 3EHRA 1ZX6A 4LUEA 1J3TA 3O5ZA 4D8KA 1PKSA 1TUCA 2IIMA 1T0HA 2CT3A 1AVZC 1UJYA 1SSHA 2K3BA 1M3BA 2KT1A 3U23A 2GTOA 2ED0A 2KYBA 4JZ4A 1UHFA 2EW3A 3TSWA 3C0CA 3EHQA 1PRMC 2H8HA 1S1NA 1QWFA 4R0KA 3H0IA 3TSZA 2DM1A 2EYYA 3I5RA 3ULRB 1NLPC 1TUDA 5FW9A 3H41A 4CC7A 3SEMA 1YWOA 1ZSGA 2HEQA 3THKA 2VKNA 4AFUC 2C0TA 2V1RA 2CSQA 1RUWA 2EBPA 3KFVA 1SRMA 1X2QA 1WDXA 1V1CA 2KYMA 1YCSB 2I0NA 3VS2A 1H92A 2DRKA 1NG2A 2JW4A 2GQIA 4AFSC 4CC4B 2J6KA 2DILA 1SEMA 1GFDA 2ROLA 1M3CA 1AEYA 1I0CA 2PZ1A 4RTXA 1NYFA 2JMAA 2L3SA 1WFWA 1AWJA 4F16A 2FG0A 1WX6A 3NMZC 5IHNA 2DX1A 2RQUA 4X1VA 3VRZA 4J9HA 2C0IA 2HBWA 1M27C 2RNAA 4HVVA 4AFZC 4HCKA 1MV0B 5I11A 1SPKA 2SRCA 2CUBA 1FMKA 2KROA 1JEGA 2V1QA 1AZGB 2MOXA 2L2PA 4JJCA 2MCNA 1QCFA 2K2MA 4ESRA 2PTKA 4JJBA 1Z9ZA 2FPFA 2DL3A 4JJDA 2DL4A 3VS3A 5IXBA 1JU5C 1YP5A 4HVWA 2K79A 4D8DA 2DMOA 2OI3A 1B3QA 1UFFA 1U3OA 1OOTA 4OMQA 2KNBB 2JM8A 1BU1A 2KT8A 2FRWA 1YN8A 4IIOA 4CC2A 1UTIA 2KBTA 2A28A 1X69A 1KFZA 1PHTA 2AZVA 4IIMA 2CH4A 3NGPA 1VYUA 2AKLA 1WLPB 2LP5A 4Z89A 2FPDA 2KGTA 1OPKA 3SHWA 2YUPA 2KXCA 2DYBA 1GCQA 1WI7A 2ECZA 2JM9A 2CREA 4J9CA 2YUOA 3QWXX 1G2BA 2AKKA 2FO0A 2X3XD 1KSWA 1NEBA 1T3LA 1WA7A 3RBBB 1ZUYA 1ZUUA 3NPFA 2BZYA 1W70A 1E6HA 4M4ZA 4E6RA 2MIOA 1JXOA 5IHKA 2OJ2A 2KXDA 4LUDA 1IO6A 2YUNA 2DLPA 3UA7A 1M8MA 1NLOC 2RF0A 2J05A 2M51A 1VYTA 4LN2A 2L3QA 2AZSA 2DBMA 4J9IA 1K4US 4HXJA 1CSKA 4QT7A 5GJVB 2LJ3A 1YWPA 1PRLC 5IHIA 5HCKA 4OMMA 2EKHA 4GLMA 4F14A 2CSIA 1SHGA 1I1JA 1TG0A 2D0NA 3H0FA 1UDLA 2BTTA 2HCKA 3EG0A 1GCPA 1NM7A 1OEBA 3ZL7C 1MV3A 2LNHB 2KRNA 2CH4W 1JQQA 4JZ3A 1EFNA 1AOJA 2RQRA 4Z8AA 2DF6A 4OMOA 2JXBA 1X2KA 4J9DA 4JPBW 2DBKA 5IH2A 3QWYA 4J9BA 1Y0MA 2RQVA 1K0SA 2GTJA 2F2WA 1GFCA 1W6XA 2AK5A 1ARKA 1I07A 3JV3A 1HJDA 1K9AA 2JT4A 1UG1A 1GBQA 3M0QA 5GJWB 4RTWA 1JO8A 2KRSA 4RTVA 3LH5A 3VS4A 3TVTA 2L3PA 2J6OA 2LZ6B 2NWMA 1U06A 1AD5A 5IXFA 2O9SA 1RLPC 4J9GA 1H3HA 2HSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GBQ A;  2GNC A;  2E5K A;  1QKX A;  4Z88 A;  1CKA A;  1PNJ A;  3VS5 A;  2DL5 A;  3VS0 A;  4CC3 A;  2LJ0 A;  3UF4 A;  5L23 A;  2VWF A;  3H0H A;  1H8K A;  1VA7 A;  2YDL A;  3VRY A;  1BBZ A;  4K11 A;  1G83 A;  1FYN A;  2EYW A;  2DNU A;  4DEY A;  2QDL A;  1U5S A;  2ABL A;  2YT6 A;  3M0U A;  4WCI A;  2RQW A;  3VS6 A;  2K9G A;  3FJ5 A;  2FEI A;  1HD3 A;  1ABQ A;  3I5S A;  1QLY A;  1OPL A;  4GBQ A;  2SEM A;  4RTU A;  3VS1 A;  3M0P A;  2O2O A;  2LMJ A;  2X3W D;  2P4R A;  1Y57 A;  1GRI A;  2RPN A;  2FRY A;  4OML A;  5FWC A;  4J9F A;  3NHN A;  1AWX A;  3M0S A;  2NUZ A;  2LQW A;  5ECA A;  2KRM A;  2ENM A;  4OMN A;  2BZX A;  1AWO A;  1ZUK A;  1GBR A;  1B07 A;  4FSS A;  2GGR A;  4AG2 C;  4AFQ C;  3PVQ A;  2JMC A;  2JTE A;  4A63 B;  3M0R A;  1LCK A;  1BK2 A;  2KR3 A;  2VVK A;  2LX7 A;  2BZ8 A;  4ORZ A;  3VS7 A;  3R6N A;  2A36 A;  2EYZ A;  4DEX A;  3EG1 A;  3EGU A;  2HDA A;  1T0J A;  1SHF A;  2DJQ A;  1RI9 A;  2O88 A;  1CKB A;  4AG1 C;  1MUZ A;  2O31 A;  2A37 A;  2O9V A;  2L0A A;  1E7O A;  1UUE A;  2RMO A;  2J6F A;  4RTY A;  1QKW A;  2ED1 A;  2J06 A;  3IQL A;  2DE0 X;  2LCS A;  1K0X A;  3CQT A;  1N5Z A;  1RLQ C;  2J7I A;  2K6D A;  2OAW A;  3I9Q A;  1KIK A;  1BB9 A;  3A98 A;  4RTT A;  4OMP A;  2DRM A;  1M30 A;  1VYV A;  1UHC A;  1ZBJ A;  5EC7 A;  2G6F X;  2LQN A;  2EPD A;  1X6G A;  1WIE A;  2JS2 A;  2EGE A;  1K76 A;  2YUQ A;  3I35 A;  1A0N B;  1UEC A;  1OV3 A;  2CT4 A;  1NYG A;  2FPE A;  2CDT A;  3UAT A;  2D8J A;  4LE9 A;  2A08 A;  1ABO A;  1AZE A;  4KRT A;  1PWT A;  2F2V A;  3EG3 A;  5I22 A;  1QWE A;  1E6G A;  4F17 A;  2DL8 A;  1PKT A;  2EGC A;  1AWW A;  1UJ0 A;  4RUG A;  2YSQ A;  1HSQ A;  2RQT A;  1KJW A;  1X6B A;  2LJ1 A;  3EG2 A;  2EVR A;  4Y92 A;  4RTZ A;  2M0Y A;  4ZNX A;  1NEG A;  1UGV A;  2CUD A;  1T3S A;  2ESW A;  3REA B;  1SRL A;  2JS0 A;  1WXB A;  4HVU A;  2XMF A;  1X27 A;  1WYX A;  2KEA A;  2B86 A;  2DA9 A;  2DVJ A;  1WXU A;  2EQI A;  4LNP A;  2D8H A;  1GL5 A;  3RNJ A;  1XOV A;  2F2X A;  2GBQ A;  5FWB A;  1WXT A;  2W10 A;  2K7A A;  3M0T A;  1JXM A;  2ROT A;  1K1Z A;  1ZLM A;  1Z9Q A;  1W1F A;  2EYX A;  3REB B;  2RN8 A;  3UA6 A;  4EIK A;  1UE9 A;  1GCQ C;  2W0Z A;  3PE0 A;  1X43 A;  4J9E A;  2KE9 A;  3PVL A;  1M3A A;  2PNI A;  2C0O A;  2EGA A;  1YNZ A;  2D1X A;  2DL7 A;  3EHR A;  1ZX6 A;  4LUE A;  1J3T A;  3O5Z A;  4D8K A;  1PKS A;  1TUC A;  2IIM A;  1T0H A;  2CT3 A;  1AVZ C;  1UJY A;  1SSH A;  2K3B A;  1M3B A;  2KT1 A;  3U23 A;  2GTO A;  2ED0 A;  2KYB A;  4JZ4 A;  1UHF A;  2EW3 A;  3TSW A;  3C0C A;  3EHQ A;  1PRM C;  2H8H A;  1S1N A;  1QWF A;  4R0K A;  3H0I A;  3TSZ A;  2DM1 A;  2EYY A;  3I5R A;  3ULR B;  1NLP C;  1TUD A;  5FW9 A;  3H41 A;  4CC7 A;  3SEM A;  1YWO A;  1ZSG A;  2HEQ A;  3THK A;  2VKN A;  4AFU C;  2C0T A;  2V1R A;  2CSQ A;  1RUW A;  2EBP A;  3KFV A;  1SRM A;  1X2Q A;  1WDX A;  1V1C A;  2KYM A;  1YCS B;  2I0N A;  3VS2 A;  1H92 A;  2DRK A;  1NG2 A;  2JW4 A;  2GQI A;  4AFS C;  4CC4 B;  2J6K A;  2DIL A;  1SEM A;  1GFD A;  2ROL A;  1M3C A;  1AEY A;  1I0C A;  2PZ1 A;  4RTX A;  1NYF A;  2JMA A;  2L3S A;  1WFW A;  1AWJ A;  4F16 A;  2FG0 A;  1WX6 A;  3NMZ C;  5IHN A;  2DX1 A;  2RQU A;  4X1V A;  3VRZ A;  4J9H A;  2C0I A;  2HBW A;  1M27 C;  2RNA A;  4HVV A;  4AFZ C;  4HCK A;  1MV0 B;  5I11 A;  1SPK A;  2SRC A;  2CUB A;  1FMK A;  2KRO A;  1JEG A;  2V1Q A;  1AZG B;  2MOX A;  2L2P A;  4JJC A;  2MCN A;  1QCF A;  2K2M A;  4ESR A;  2PTK A;  4JJB A;  1Z9Z A;  2FPF A;  2DL3 A;  4JJD A;  2DL4 A;  3VS3 A;  5IXB A;  1JU5 C;  1YP5 A;  4HVW A;  2K79 A;  4D8D A;  2DMO A;  2OI3 A;  1B3Q A;  1UFF A;  1U3O A;  1OOT A;  4OMQ A;  2KNB B;  2JM8 A;  1BU1 A;  2KT8 A;  2FRW A;  1YN8 A;  4IIO A;  4CC2 A;  1UTI A;  2KBT A;  2A28 A;  1X69 A;  1KFZ A;  1PHT A;  2AZV A;  4IIM A;  2CH4 A;  3NGP A;  1VYU A;  2AKL A;  1WLP B;  2LP5 A;  4Z89 A;  2FPD A;  2KGT A;  1OPK A;  3SHW A;  2YUP A;  2KXC A;  2DYB A;  1GCQ A;  1WI7 A;  2ECZ A;  2JM9 A;  2CRE A;  4J9C A;  2YUO A;  3QWX X;  1G2B A;  2AKK A;  2FO0 A;  2X3X D;  1KSW A;  1NEB A;  1T3L A;  1WA7 A;  3RBB B;  1ZUY A;  1ZUU A;  3NPF A;  2BZY A;  1W70 A;  1E6H A;  4M4Z A;  4E6R A;  2MIO A;  1JXO A;  5IHK A;  2OJ2 A;  2KXD A;  4LUD A;  1IO6 A;  2YUN A;  2DLP A;  3UA7 A;  1M8M A;  1NLO C;  2RF0 A;  2J05 A;  2M51 A;  1VYT A;  4LN2 A;  2L3Q A;  2AZS A;  2DBM A;  4J9I A;  1K4U S;  4HXJ A;  1CSK A;  4QT7 A;  5GJV B;  2LJ3 A;  1YWP A;  1PRL C;  5IHI A;  5HCK A;  4OMM A;  2EKH A;  4GLM A;  4F14 A;  2CSI A;  1SHG A;  1I1J A;  1TG0 A;  2D0N A;  3H0F A;  1UDL A;  2BTT A;  2HCK A;  3EG0 A;  1GCP A;  1NM7 A;  1OEB A;  3ZL7 C;  1MV3 A;  2LNH B;  2KRN A;  2CH4 W;  1JQQ A;  4JZ3 A;  1EFN A;  1AOJ A;  2RQR A;  4Z8A A;  2DF6 A;  4OMO A;  2JXB A;  1X2K A;  4J9D A;  4JPB W;  2DBK A;  5IH2 A;  3QWY A;  4J9B A;  1Y0M A;  2RQV A;  1K0S A;  2GTJ A;  2F2W A;  1GFC A;  1W6X A;  2AK5 A;  1ARK A;  1I07 A;  3JV3 A;  1HJD A;  1K9A A;  2JT4 A;  1UG1 A;  1GBQ A;  3M0Q A;  5GJW B;  4RTW A;  1JO8 A;  2KRS A;  4RTV A;  3LH5 A;  3VS4 A;  3TVT A;  2L3P A;  2J6O A;  2LZ6 B;  2NWM A;  1U06 A;  1AD5 A;  5IXF A;  2O9S A;  1RLP C;  4J9G A;  1H3H A;  2HSP A; 
#chains in the Genus database with same CATH topology
 1YJW A;  3VS0 A;  4CC3 A;  2LJ0 A;  5GAN g;  4XU0 A;  1H8K A;  4EMK C;  3VRY A;  1BBZ A;  1ZSZ B;  1G83 A;  4OP0 A;  4PJO C;  2DNU A;  1M2V B;  5GAN 6;  3M0U A;  3LWI A;  5J3B A;  2GF7 A;  2RQW A;  4NS5 A;  1FWZ A;  2LT1 A;  1K73 C;  3HSB A;  1V76 A;  3I5S A;  2F69 A;  1OPL A;  2KMT A;  1QVP A;  4J6X A;  4J6W A;  4MZT A;  4M78 C;  2SEM A;  3Q1J A;  3VS1 A;  3CPW P;  3JCM W;  2X3W D;  2P4R A;  1GRI A;  4LDV A;  2OAU A;  2JJ9 A;  3NTH A;  4J6Y A;  4BI8 B;  1RAI B;  2BZX A;  3VYG A;  4DOV A;  1YIT Q;  3JCM f;  5LJ5 j;  4A53 A;  1LCK A;  3OYA A;  4JDS A;  3SFM A;  3M59 A;  3NTI A;  3EG1 A;  2HKN A;  3RER A;  2HDA A;  3OYI A;  1WPY A;  5CQX A;  4M7D C;  2HSE B;  2DD4 A;  3PNW C;  5GAM e;  1G3T A;  2L0A A;  1QKW A;  3CD6 Q;  3CQT A;  4Y28 E;  3OYM A;  1BI1 A;  1RAF B;  4II1 A;  1KG1 A;  4OVA A;  2DRM A;  3RR6 A;  2G6F X;  1WIE A;  3LH0 A;  2HAX A;  4KGZ B;  1K76 A;  3M57 A;  2JVV A;  3JCM J;  2CT4 A;  2FPE A;  2O4X B;  1RI0 A;  1KC8 R;  4C8Q A;  1VQ8 T;  3OS2 A;  3FJP A;  2E3H A;  3QXE B;  1E6G A;  4O6J A;  4C92 G;  4F17 A;  2RI2 A;  1Q81 U;  1M1G A;  3EG9 B;  2EGC A;  2MYS A;  1XNI A;  2NUT B;  4ELY C;  3G71 A;  1KJW A;  2PUK B;  3TEE A;  1VQ6 A;  3PTA A;  2CS7 A;  2M0Y A;  4M75 B;  1MNE A;  1T3S A;  3M4G A;  3HL8 A;  1WJS A;  1ACM B;  5GAN j;  2E6N A;  2HQX A;  2XI9 A;  2CZ0 B;  3G1J A;  4FYV B;  2DVJ A;  2RK1 A;  4HCZ A;  1WXU A;  5LJ5 h;  5CO7 A;  1GL5 A;  2E4H A;  4KUI A;  3L2V A;  2RHY A;  1WXT A;  2OTJ Q;  3M0T A;  4MZP A;  3CXC P;  4CRI A;  3DLL A;  1ZLM A;  1W1F A;  3CPF A;  1UE9 A;  1GCQ C;  3MO8 A;  4FW1 A;  3JCM P;  2ZPG B;  3UT1 A;  4ATO A;  1SKU B;  1VQ7 T;  4OGC A;  5LJ3 d;  4R56 A;  2DK3 A;  2DZ9 A;  2EGA A;  2X4J A;  4LUE A;  1J3T A;  1Y71 A;  4JUV A;  4X9C A;  4C5I A;  1U8R A;  3PT9 A;  4BDY A;  1AVZ C;  1UGQ B;  3U23 A;  2GTO A;  2KYB A;  3V7S A;  1S72 A;  3TSW A;  3C0C A;  4EMH A;  2D0Q B;  1VQ4 A;  4RG2 A;  3CCR A;  1QVF A;  1VQ9 A;  2JUF A;  3JB9 D;  1OZ3 A;  3HRS A;  2QQR A;  2R58 A;  3FEO A;  4L6V 5;  1WHL A;  4QQD A;  3CCV A;  1ZSG A;  1RAH B;  2K5I A;  1VQK A;  3PFS A;  1K9M U;  2CSQ A;  4DBH A;  2IVW A;  2CP7 A;  1KQS P;  2KYM A;  2I0N A;  1OUL A;  1H92 A;  1X6O A;  1NG2 A;  4E7I A;  1G8X A;  2JW4 A;  1Y96 B;  2J6K A;  3HFO A;  1QVG A;  1D3B B;  3OS0 A;  2LNV A;  1M3C A;  3BDU A;  4BD3 A;  1I0C A;  1X75 C;  3QG1 A;  1N9S A;  3HPW A;  9ATC B;  4XAX B;  3M4Y A;  1HYO A;  4FIB A;  5GAN h;  4LDX A;  1GXI E;  1KQ1 A;  4C92 D;  4F16 A;  2RHI A;  2V8K A;  4E7Z A;  1M27 C;  4A54 A;  4KGX B;  3CBM A;  4C92 F;  1JRI A;  4JJN K;  3QJ6 A;  3CCQ A;  1MV0 B;  2X35 A;  2K5F A;  2CUB A;  1FMK A;  2X4X A;  2WSC E;  1NBE B;  4JJC A;  1QCF A;  1YJ9 Q;  2RD1 A;  4A4H A;  2NYS A;  2HNI A;  1DJ7 B;  2DL4 A;  5CKE A;  1FX7 A;  2I2L A;  4M75 F;  4FT2 A;  2QQB A;  4KBM B;  2OI3 A;  1B3Q A;  1UFF A;  3G4S Q;  2E6Z A;  1OOT A;  2BE9 B;  4OMQ A;  3H6Z A;  1BIA A;  3OSS C;  1BU1 A;  3TQ7 P;  4F7U B;  4IIO A;  1YJN T;  3CMA A;  4CC2 A;  1VQM Q;  2FVU A;  2FZC B;  5A0L A;  1YHQ A;  3OS1 A;  1OU8 A;  1ZA1 B;  1KFZ A;  2AZV A;  3CCL T;  4IIM A;  3CCM T;  5KYY B;  3R6O A;  2LP5 A;  2AKL A;  2K57 A;  3HP9 A;  4Z89 A;  2NUP A;  5HK0 A;  3JCM Q;  3S3O A;  1NJI U;  1OPK A;  3SHW A;  1D3B A;  2YUP A;  1U1T A;  2CZ1 B;  3OYL A;  5CQY A;  3CC7 Q;  1Q81 R;  3SDZ A;  3NTK A;  2YRV A;  2LCL A;  2AKK A;  2JZ2 A;  4Z02 A;  1Q86 U;  2X3X D;  5GAN 8;  3GOX A;  1NEB A;  4C92 C;  1AT1 B;  2DAQ A;  2DXC A;  1MMA A;  2IG0 A;  3LX7 A;  4M4Z A;  3JB9 I;  2MIO A;  1W2B P;  3MET A;  2COY A;  2KXD A;  1IGQ A;  1VQN A;  5EG2 A;  3URG A;  3I55 A;  2QQS A;  4LN2 A;  3JCM X;  5KYU A;  4M7A B;  2AZS A;  5LJ3 g;  3G6E A;  4C0F A;  4J9I A;  3BY7 A;  3PGG A;  1K4U S;  4QT7 A;  1WNL A;  1MMG A;  1WHM A;  1ZBX A;  4J7I A;  2M0O A;  3OMG A;  4OMM A;  2EKH A;  4GLM A;  2D0N A;  3H0F A;  1UDL A;  2HCK A;  1GCP A;  1QMC A;  1HK9 A;  5CR2 A;  1I5O B;  3ZL7 C;  1K73 U;  3MP6 A;  1VQ5 T;  2P84 A;  2KRN A;  1EZZ B;  2FHD A;  4JZ3 A;  2DKG A;  4F7U A;  1VQP T;  1V29 B;  2XG8 D;  2QEX A;  1MMD A;  3H9N A;  4E7S A;  2RA2 A;  3OQ5 A;  1R8O B;  1Y0M A;  4J5Y A;  1D0X A;  1K0S A;  2EKO A;  3CCS A;  4OF1 A;  4D6W A;  2RK2 A;  2JT4 A;  1OX8 A;  3RKY A;  4RTW A;  1JO8 A;  2KRS A;  2F1L A;  3LH5 A;  3VS4 A;  5GAN 2;  3MEA A;  1WHJ A;  3TVT A;  5C0M A;  3BW1 A;  2L3P A;  3GIB A;  5AYF A;  3E2U A;  1QW1 A;  2GFA A;  1PCX A;  5IXF A;  3MEW A;  1UGP B;  2XIC A;  4PJN A;  2HSP A;  1BCM A;  1R0C B;  1M8V A;  2GNC A;  2A7Y A;  1K9M R;  4N4G A;  1QKX A;  2RH2 A;  1CKA A;  1PNJ A;  3VS5 A;  3CCJ A;  1YJW T;  5GAM d;  2JNG A;  3LLR A;  3H0H A;  5HY6 A;  1KK7 A;  1VA7 A;  5GAN 4;  1YBY A;  2YDL A;  3ZFJ A;  1M9S A;  4K11 A;  2EYW A;  3RUX A;  1I81 A;  2FL7 A;  3M5A A;  4M77 B;  2FZK B;  1D0Z A;  4AT1 B;  4F7U F;  2BKD N;  2DXB A;  2PQW A;  4WCI A;  4EMK A;  3VS6 A;  4LDU A;  1TUG B;  2FEI A;  4ZGJ B;  1TU0 B;  4PJO A;  2HKQ B;  1QLY A;  4ZTF A;  1Q82 C;  1VUB A;  2PUO B;  2HMA A;  5HK3 A;  1VQ8 Q;  4RTU A;  5GAO n;  1LJO A;  3TCJ A;  4RCB A;  1Y57 A;  4HKE A;  2FRY A;  4OML A;  5FWC A;  4J9F A;  5LJ5 g;  3NHN A;  2NUZ A;  1QVF S;  4M78 A;  2DTI A;  2V8J A;  2VUB A;  2GGR A;  4AG2 C;  2QI2 A;  2LT4 A;  1R77 A;  4AFQ C;  3S3M A;  2JMC A;  2JTE A;  3M0R A;  3EH2 A;  4C5G A;  3PMT A;  3VJP A;  4QW2 A;  3RKW A;  3CC2 A;  3X26 B;  1MHN A;  4LDY A;  3LWH A;  1T0J A;  5FRM A;  1TH7 A;  1RI9 A;  3QJY A;  4AG1 C;  2VC8 A;  2O31 A;  2V26 A;  3OYD A;  1WJQ A;  4M7A F;  1QVG S;  5LJ3 j;  2R57 A;  1G3Y A;  2ED1 A;  2J06 A;  2DE0 X;  2LCS A;  1N5Z A;  2J7I A;  2K6D A;  2OAW A;  3I9Q A;  1BB9 A;  1NJI R;  1VQ7 Q;  3D7S B;  3JCM e;  3ER0 A;  4M77 A;  1UHC A;  3SWN C;  2XDP A;  4MMK A;  2LTO A;  1PM3 A;  1ZHI A;  2YUQ A;  1Q86 R;  3UAT A;  2HBP A;  1PG5 B;  5FU7 B;  2RHU A;  1ABO A;  3CPW A;  1KQ2 A;  4QVC A;  4B9W A;  2M16 A;  3HKS A;  4OB1 B;  2IPO B;  2DXU A;  1AWW A;  1O75 A;  2YSQ A;  1HSQ A;  2RQT A;  3EG2 A;  4NL2 A;  4Y92 A;  4RTZ A;  4ZNX A;  3VUB A;  4PLL A;  2E10 A;  3G71 T;  4JLG A;  1UEB A;  2ESW A;  3REA B;  1SRL A;  1VQ6 T;  1B7T A;  2XMF A;  4M75 E;  4ME7 A;  2JTF A;  5A0D A;  1FMV A;  1WYX A;  1K73 R;  2KEA A;  2VYT A;  2B86 A;  4LNP A;  3CC4 A;  2F5K A;  4C0D C;  1XOV A;  3C12 A;  2GBQ A;  4M77 F;  4B6M A;  4GY5 A;  3PIO A;  2VGM A;  4JLI A;  3OY9 A;  1K1Z A;  4QQG A;  2WSE E;  5DY9 A;  4XTX A;  2EYX A;  1YCY A;  3L42 A;  4C8Q B;  1ZA2 B;  2C06 A;  5GAO m;  3UA6 A;  2W0Z A;  3PE0 A;  5LJ3 h;  3MCA B;  4J9E A;  2KE9 A;  5GAM g;  3PVL A;  5GAO r;  4RKU E;  5KYN A;  2C0O A;  2AHJ B;  3S3N A;  2CP2 A;  3CME A;  2D6F A;  3QZ9 B;  2D1X A;  1ZX6 A;  4D8K A;  1PKS A;  2IIM A;  5GAO p;  5LJ5 f;  4XTU A;  5FU6 B;  2CT3 A;  3CBP A;  3A5Z B;  4JZ4 A;  3EH1 A;  1UHF A;  3N5B B;  3CCU A;  3OYG A;  4R0K A;  3HFN A;  3TSZ A;  1JJ2 P;  3CCR T;  3ULR B;  1IRX A;  1VQ9 T;  4CC7 A;  1YJN Q;  2EFI A;  3SEM A;  4P5N A;  1M1K C;  1YWO A;  2DTO A;  1PSE A;  1YJ9 A;  5CKB A;  4XTY A;  2HL3 A;  4LDW A;  3CCL Q;  2V1R A;  3CCM Q;  3CCV T;  2EBP A;  1YI2 T;  4LD9 K;  1SRM A;  1X2Q A;  1VQK T;  1V1C A;  4ANJ A;  1YCS B;  1D1A A;  3VS2 A;  2DRK A;  3V8L A;  2EWN A;  2GQI A;  4CC4 B;  5KCH A;  2DZC A;  1NPR A;  2DIQ A;  2QA4 A;  5GMK j;  2PZ1 A;  4OB2 B;  5GAN 3;  3VYH B;  2L3S A;  7AT1 B;  1WZO A;  2EJF A;  3OYN A;  2FG0 A;  1F1B B;  3NMZ C;  5IHN A;  2RQU A;  1Q95 G;  4RCC A;  2RNA A;  3HHT B;  3QBY A;  3OYK A;  3L2W A;  5CVI A;  1SPK A;  1EX4 A;  3BFM A;  3CCQ T;  3JCM b;  2KRO A;  2MOX A;  2MCN A;  3QII A;  2OTL A;  2QTV A;  1IZ6 A;  4BY6 C;  2K2M A;  4ESR A;  4BUG A;  2FPF A;  2DL3 A;  4JJD A;  3VS3 A;  2M1H A;  4M75 G;  3EGX A;  5IXB A;  5GAN f;  2E65 A;  2RM4 A;  1MND A;  4PFP A;  1U3O A;  1VQ5 Q;  2ZPI B;  1UB4 A;  4KH0 B;  3SB2 A;  2MMP A;  3FB9 A;  2CZ6 B;  1M90 C;  1YN8 A;  1VQP Q;  1IHV A;  1UTI A;  4BDZ A;  1WHH A;  2QGG A;  4F7U E;  1VQL A;  3QDR B;  3TRE A;  3CMA T;  4IUV A;  1P92 A;  4N0A C;  1YHQ T;  1ZQ1 A;  1KQS A;  1VYU A;  3V7C A;  2FPD A;  4IUQ A;  2KQW A;  4C8Q F;  3OBY A;  5I21 A;  3C4S A;  2XDD A;  3LGL A;  2QDY B;  1KD1 C;  5GAM j;  2MAM A;  8ATC B;  1WI7 A;  2ECZ A;  2DER A;  5HKC A;  2CRE A;  4J9C A;  3I56 A;  2ZAE A;  3QWX X;  4PJL A;  4XU3 A;  2FO0 A;  1KSW A;  3V8K A;  1T3L A;  5GMK h;  3NPF A;  4E2F B;  1YJW Q;  4E6R A;  2AIR B;  4XU1 A;  1JXO A;  2VXE A;  5IHK A;  2X4W A;  4MZM A;  4LUD A;  1IO6 A;  2KSS A;  1NLO C;  2QTX A;  3MPU B;  1VQN T;  3CCE A;  2XHC A;  4E7J A;  2DBM A;  3I55 T;  4HXJ A;  1YWP A;  4M7A E;  3G6E T;  5IHI A;  5HCK A;  1ZSZ C;  2NUP B;  2BE7 D;  5FLX E;  1LPL A;  2BTT A;  5GMK m;  4A4K A;  2CGH A;  3OW2 P;  1H64 1;  3GP8 A;  1VQO A;  2COW A;  1UGS B;  1Q82 U;  5KYW B;  1C1A A;  1YFN A;  1Q7Y C;  3WVD B;  4NL3 A;  3CPW S;  5D6W A;  4E47 A;  2RQR A;  2DF6 A;  4L5G A;  4O5V A;  2VAS A;  2QEX T;  4JRP A;  2RQV A;  1TSF A;  2GTJ A;  1YIJ A;  2F2W A;  1W6X A;  4J8O A;  3MKD A;  3OYF A;  1WGS A;  1UG1 A;  3ME9 A;  3CCS T;  2CP3 A;  4WF2 A;  5KYU B;  4V2S A;  2MK5 A;  2ZGW A;  3MJX A;  4MML A;  1BI3 A;  3P8D A;  4M75 D;  2LZ6 B;  3M9Q A;  1H3Z A;  4BI3 A;  3F70 A;  1AD5 A;  1RLP C;  4J83 A;  3GBQ A;  3VKI A;  5KE2 A;  2E5K A;  3QPH A;  4Z88 A;  5GAM h;  3FRN A;  1W2B A;  3UF4 A;  3KXT A;  2A0F B;  3A8G B;  3CCJ T;  3RKX A;  5A0G A;  5CKF A;  1TWB A;  1JBM A;  1VIF A;  4DEY A;  2QDL A;  4F7U G;  3JCM d;  4M77 E;  4PFO A;  1WJR A;  2K9G A;  2L5Q A;  2XD0 A;  5I2M A;  4JS4 A;  4BE0 A;  1QQJ A;  4X9D A;  2EQK A;  1TXQ A;  3ASK A;  2XK0 A;  3M0P A;  2M9U A;  3SD4 A;  2O2O A;  5J39 A;  2LMJ A;  5KYW A;  3MEV A;  1IRE B;  2FZG B;  2LQW A;  3C95 A;  1UGR B;  2KRM A;  1PD1 A;  2ZZD A;  2ENM A;  2VGN A;  1GBR A;  1ZUK A;  3BE3 A;  2XDB A;  4FM4 B;  4BI4 A;  2DEU A;  3G71 Q;  4A63 B;  2CYZ B;  4OMF B;  3J81 E;  1VQ6 Q;  1BK2 A;  2E64 A;  1G3W A;  2LX7 A;  4ORZ A;  2EYZ A;  3EGU A;  5D7U A;  2RJC A;  1CKB A;  4M75 C;  3J7A F;  2E70 A;  4EMK B;  1MUZ A;  6AT1 B;  4M7A G;  2A37 A;  4PNO A;  1XTD A;  2O9V A;  1UUE A;  4PJO B;  2J6F A;  4RTY A;  2HQH A;  3IQL A;  4HCB A;  1RAC B;  1RLQ C;  4HCC A;  2KVQ G;  3J80 E;  3CXC S;  2EIF A;  3A98 A;  1LNX A;  2RJF A;  2KAF A;  2R5A A;  4OMP A;  1VYV A;  1OQK A;  3WVE B;  3OYY A;  2LQN A;  2EPD A;  4M78 B;  1RAD B;  1X6G A;  1G3S A;  2CP5 A;  1WHG A;  2EGE A;  2XKO C;  1A0N B;  2QQ9 A;  1NYG A;  2CDT A;  2D8J A;  4OGE A;  4RG8 A;  3OBW A;  4A4G A;  2DEQ A;  1AZE A;  4KRT A;  2F2V A;  5I22 A;  1VQ4 Q;  3L1A A;  3A8O B;  2PVG B;  1KHC A;  3CCR Q;  1VQ9 Q;  1PKT A;  4QVD A;  1YIT A;  2O01 E;  4RUG A;  1IGU A;  3GF5 A;  1X6B A;  3RIR A;  3CCV Q;  3UWN A;  1YI2 Q;  4M7D B;  3OYH A;  1VQK Q;  1NEG A;  1UGV A;  4N4H A;  4ZTJ A;  1M1K U;  2JS0 A;  1WXB A;  4HVU A;  4DBR A;  1X27 A;  3JCM c;  2Y4X A;  1BCO A;  4ZGD B;  4BB7 A;  1KQS S;  2DA9 A;  4FYX B;  1Q82 R;  4LXC A;  2D8H A;  2K4Y A;  3RNJ A;  2F2X A;  4M77 G;  2K7A A;  3CC4 T;  2ROT A;  3CD6 A;  1B34 A;  3DB4 A;  3OYB A;  1EIF A;  1N9R A;  4C5E A;  4EIK A;  4DBQ A;  2H3E B;  4VUB A;  4C8Q E;  1QCN A;  4QKU A;  4DOW A;  3CCQ Q;  2EJ9 A;  2DL7 A;  3EHR A;  2HZY A;  1HXD A;  3O5Z A;  3JSC A;  1TUC A;  3CME T;  3JCM g;  5CK9 A;  2ED0 A;  4XU2 A;  5GMK i;  2EW3 A;  1WHK A;  4M7A D;  1PRM C;  2CKK A;  2QG9 B;  1S1N A;  2DXT A;  3GNF B;  3H0I A;  4B9X A;  2EQU A;  2RJE A;  2DM1 A;  1M5Q 1;  5FW9 A;  5LJ3 f;  3H41 A;  4AMC A;  4PL6 A;  5KH6 A;  3EFO B;  4HA8 A;  3CMA Q;  2VKN A;  4M7D A;  4AFU C;  2LCC A;  2C0T A;  1M90 U;  1YHQ Q;  5CCA A;  2M02 A;  4PJO F;  1PSF A;  3KFV A;  3GNG A;  1G5V A;  1K8A C;  5LJ5 e;  3QSU A;  3MP1 A;  5DLQ E;  2DIL A;  1GFD A;  3P8H A;  2ROL A;  4PJJ A;  1U1S A;  2OTJ A;  1M2O A;  1AEY A;  4C0Z A;  4RTX A;  1NYF A;  2JMA A;  2QA4 T;  4M78 F;  1R0B G;  1PD0 A;  1KD1 U;  2ZPF B;  3RMQ A;  1WX6 A;  2DX1 A;  3VRZ A;  4J9H A;  3M53 A;  3RDV A;  4AFZ C;  5C6S A;  2Z0W A;  2EYQ A;  1VQN Q;  1W2B S;  2V1Q A;  1AZG B;  3I55 Q;  2E1H A;  5KYX A;  3G6E Q;  1OU9 A;  4IUP A;  2AT1 B;  2PTK A;  2OTL T;  3VV0 A;  1NPP A;  1OYX A;  4M77 D;  2E41 A;  1JU5 C;  4M7A C;  5AT1 B;  2DMO A;  2KNB B;  3E19 A;  3E9F A;  4ZN1 A;  1JJ2 A;  5GAO l;  5J26 A;  2KT8 A;  3EFO A;  3GPL A;  1QP2 A;  2QGF B;  3FIF A;  3QHS A;  4XK8 E;  4DA4 A;  4XTZ A;  3QYH B;  3EGD B;  4ZGE B;  4X34 A;  2QEX Q;  1M1F A;  1PHT A;  1Q7Y U;  4HT9 A;  2CH4 A;  1VQL T;  3NGP A;  2YXY A;  4C8Q G;  2KGT A;  3DKM A;  3CCS Q;  3X28 B;  4IUR A;  3PMI A;  3CEY A;  3L2Z A;  2CZ7 B;  2E5Q A;  4MDX A;  3T9N A;  1GCQ A;  2GCX A;  4N0A A;  1N27 A;  5GAN e;  2RHX A;  2ZPH B;  3JAM E;  3V7R A;  4KGV B;  4GLK A;  2EAY A;  4FL6 A;  3I56 T;  3EGX B;  1WA7 A;  1S72 T;  1SG5 A;  1ZUY A;  1ZUU A;  2BUD A;  2BZY A;  3ZEH A;  1E6H A;  2EQM A;  1VQ4 T;  1M1K R;  3CCJ Q;  1BI2 A;  4C5H A;  4JRQ A;  3UA7 A;  4EDU A;  4NOY A;  3FLG A;  3DB3 A;  3OYC A;  4KUD K;  4LD6 A;  2DYI A;  5GJV B;  3CCE T;  2LJ3 A;  4EPC A;  1OX9 A;  3HTR A;  2CSI A;  3TU4 K;  3X20 B;  4M77 C;  2L3R A;  3G4S A;  2FYK A;  3JB9 G;  1NM7 A;  1OEB A;  4XTW A;  2WAC A;  2LNH B;  3OS5 A;  1JQQ A;  2KI7 A;  1VQM A;  1ZSZ A;  4RMO A;  1EFN A;  3P8B B;  3CXC A;  4PFZ A;  2JOY A;  1I5L A;  2K5L A;  1VQO T;  3EGD A;  2XID A;  1MMN A;  2LDM A;  4E7K A;  1M2V A;  2ATC B;  2PVO B;  4J9D A;  1N8R U;  3QWY A;  3L2R A;  2NLU A;  1GFC A;  1ARK A;  1I07 A;  3JV3 A;  1HJD A;  4UC4 A;  1K9A A;  1RAB B;  2P0Q A;  2V8I A;  3M0Q A;  1YIJ T;  5GJW B;  5M9O A;  1W4S A;  1BI0 A;  4RTV A;  2R5M A;  4C92 B;  3CC7 A;  3FC3 A;  3KBG A;  2KY9 A;  2NWM A;  3CC2 Q;  1U06 A;  1KC8 C;  4J9G A;  3MEU A;  3E1S A;  2GFU A;  1M90 R;  2A3L A;  2G3R A;  2DL5 A;  4E7H A;  5KE3 A;  2L89 A;  5L23 A;  4C0G A;  2VWF A;  4JS5 A;  3X24 B;  1D09 B;  1NE8 A;  1SF9 A;  1X01 A;  3QZ5 B;  3V8J A;  1FYN A;  3JCM h;  4C8Q D;  1U5S A;  2ABL A;  2YT6 A;  4MDW A;  3MHX A;  3O8V A;  2ZPE B;  2PVD B;  8AT1 B;  3FJ5 A;  1HD3 A;  1ABQ A;  1KD1 R;  1IXD A;  3JB9 J;  1M4Z A;  5LL6 S;  1OI1 A;  4QQ6 A;  4GBQ A;  4BE2 A;  5GAN 7;  3HRT A;  3OW2 A;  5GAM f;  2RPN A;  2VXF A;  1TS9 A;  4KH1 B;  1AWX A;  3M0S A;  5ECA A;  5FU7 C;  4OMN A;  1AWO A;  3OA6 A;  1B07 A;  4FSS A;  5FRO A;  3PVQ A;  2KR3 A;  2O4X A;  3QO3 A;  2VVK A;  2BZ8 A;  3VS7 A;  4C92 A;  2Y90 A;  3R6N A;  2A36 A;  4DEX A;  1SHF A;  2DJQ A;  1BKB A;  5GMK l;  2O88 A;  3CC4 Q;  3EG9 A;  2GQV A;  2MWP A;  1E7O A;  2RMO A;  2NUT A;  2E12 A;  4JRK A;  3EFS A;  3OB9 A;  2RO0 A;  3A8H B;  4N4I A;  1Q7Y R;  1K0X A;  3JB9 F;  1YI2 A;  1FMW A;  4PJO E;  1BYM A;  2DD5 A;  5D6X A;  4M75 A;  1KIK A;  4RTT A;  4F04 B;  1M30 A;  3VUZ A;  1VIE A;  3QKJ A;  1ZBJ A;  5EC7 A;  2P4T A;  1QP3 A;  2WSF E;  2JS2 A;  4C8Q C;  3CME Q;  4M78 E;  3I35 A;  3X25 B;  1UEC A;  4FYY B;  1OV3 A;  2QAZ A;  3G7Z A;  1N6A A;  1NZ9 A;  4XQ3 A;  1VQ8 A;  4JRI A;  1KHI A;  4LE9 A;  2A08 A;  4PJM A;  1PWT A;  4E7L A;  3EG3 A;  1D1B A;  1QVF P;  1QWE A;  4R55 A;  2RHZ A;  2YRD A;  4XTV A;  3CCU Q;  5FU6 C;  2X9H A;  2DL8 A;  2DVE A;  1UJ0 A;  2RJD A;  3OYJ A;  2LJ1 A;  1JJ2 S;  1YIT T;  2EVR A;  1OZ2 A;  1RAG B;  2QQA A;  2CUD A;  5L8R E;  4ELZ C;  1PC0 A;  2K3X A;  4M7D E;  3L2U A;  5KCO A;  3AHU A;  2KK4 A;  2LC4 A;  1QVG P;  3M56 A;  2YWW A;  2EQI A;  4FYW B;  4YTL A;  5GAN 5;  5LJ5 d;  5FWB A;  2QA4 Q;  2BIV A;  1IHW A;  1K8A U;  2W10 A;  1JXM A;  3ZBD A;  5A2Q E;  3E9G A;  1N8R R;  1Z9Q A;  3SWN B;  1SSF A;  3REB B;  3CD6 T;  5IT9 E;  2RN8 A;  1VQ7 A;  1N8R C;  3H8Z A;  2QYZ A;  1X43 A;  2D9T A;  1TTH B;  1IB8 A;  1M3A A;  2YLB A;  2LRQ A;  2RI5 A;  2PNI A;  2XU8 A;  2YLC A;  1Y96 A;  1RAE B;  2CP0 A;  1YNZ A;  3RMS A;  5CKH A;  3LW5 E;  4IUU A;  1T0H A;  4A4F A;  2VV5 A;  5FRN A;  2OTL Q;  1UJY A;  1SSH A;  2ZPB B;  2K3B A;  1M3B A;  2KT1 A;  3EHQ A;  4PK4 A;  1Q81 C;  2H8H A;  2P0P A;  3KUF A;  5D6Y A;  1QWF A;  2DPP B;  2Y4Y A;  3CC2 T;  3C94 A;  2EYY A;  1LVK A;  4QVZ A;  3I5R A;  1NLP C;  1TUD A;  1Y7X A;  5CIU A;  1B34 B;  2COZ A;  2HEQ A;  3THK A;  4BAC A;  4PJO G;  4C0D B;  1RUW A;  1VQL Q;  1WDX A;  3INZ A;  2LQK A;  4AFS C;  4OB3 B;  2DJZ A;  5I2S A;  1SEM A;  2DTH A;  2JTM A;  5DM7 R;  4KT0 E;  1XJW B;  1AHJ B;  4PLI A;  4M78 G;  2ZCF B;  2OTJ T;  1WFW A;  1AWJ A;  3SWN A;  3I56 Q;  2DIG A;  2JN0 A;  5GAN d;  1S72 Q;  4X1V A;  5LJ3 e;  3OYE A;  2C0I A;  5KYY A;  5DLO A;  2HBW A;  4HVV A;  2KDS A;  3M54 A;  4HCK A;  5I11 A;  4TVR A;  2SRC A;  2CP6 A;  3OMC A;  5IN1 A;  4ZN3 A;  2FB7 A;  1I8F A;  3HRU A;  1JEG A;  2YRC A;  3UPU A;  3A8L B;  2PU9 B;  2L2P A;  4BE1 A;  1WQ7 A;  1XQH A;  4FW2 A;  3CCE Q;  3RES A;  1O9S A;  4JJB A;  1Z9Z A;  4M7D G;  5GAO q;  3EAE A;  1YP5 A;  1WQW A;  4HVW A;  2K79 A;  4Y91 A;  4D8D A;  2LVM A;  2H3J A;  4DQ2 A;  4OB0 B;  1YJN A;  1MGQ A;  2JM8 A;  3DLM A;  2HL5 C;  1K9M C;  5CAI A;  2FRW A;  2HQE A;  1VQO Q;  3OW2 S;  2RI3 A;  2KBT A;  4FCY A;  1D1C A;  3CCL A;  4M7A A;  3M55 A;  2A28 A;  3CCM A;  4IUT A;  1X69 A;  3A1P A;  3GLX A;  3NFC A;  2K2V A;  3FDR A;  4IKF A;  3QUI A;  2QAS A;  1WLP B;  1YIJ Q;  2E3I A;  2HD0 A;  5IAY A;  1FXX A;  2KXC A;  2DYB A;  2QK0 A;  4FSX A;  1C0M A;  1JB0 E;  2MPX C;  2EJG A;  5KYX B;  2JM9 A;  1RL2 A;  2YUO A;  4HT8 A;  2B8A A;  3LYI A;  2QXF A;  1G2B A;  2K3Y A;  1VOM A;  3JRZ A;  3RBB B;  2DFU A;  1W70 A;  1KC8 U;  2L8D A;  3CCU T;  1BIB A;  2OJ2 A;  4BY6 B;  4KUL A;  2YUN A;  4PJO D;  2DLP A;  4L59 A;  1M8M A;  2RF0 A;  1LOJ A;  2MF2 A;  2J05 A;  4EMG A;  2M51 A;  1VYT A;  3CBO A;  2L3Q A;  4FT4 A;  2F5T X;  3JB9 H;  3VU3 C;  1K8A R;  1CSK A;  3EFR A;  1PRL C;  1Y07 A;  1YJ9 T;  2LQ8 A;  1QCO A;  5CKD A;  2VB6 A;  4F14 A;  4FU6 A;  3WXM B;  1C6V X;  1SHG A;  1I1J A;  1TG0 A;  4M78 D;  2RB6 A;  2P0K A;  3UDC A;  1VQ5 A;  2DO3 A;  2DET A;  4PKC C;  3L2Q A;  3EG0 A;  3BDL A;  3G4S T;  1MV3 A;  3OSV A;  1VQP A;  3AT1 B;  3QYG B;  2CH4 W;  2EQJ A;  2MI6 A;  2OX7 A;  1RAA B;  1VQM T;  1AOJ A;  4Z8A A;  3PIP A;  4OMO A;  2MWO A;  2JXB A;  1X2K A;  1NJI C;  4JPB W;  2DBK A;  4Q5W A;  5IH2 A;  2LX9 A;  4A4E A;  4J9B A;  1D0Y A;  3JCM V;  2AK5 A;  3QDF A;  3MP8 A;  4WTO B;  2X51 A;  1GBQ A;  2YHT A;  1I4K 1;  1TOV A;  4M7D D;  2X4Y A;  2J6O A;  1Q86 C;  3A8M B;  3LGF A;  4DBF A;  4J7F A;  4C92 E;  3S6W A;  3CC7 T;  4CI0 C;  3M58 A;  2O9S A;  5GMK e;  1H3H A;  4M7D F; 
#chains in the Genus database with same CATH homology
 3GBQ A;  2GNC A;  2E5K A;  1QKX A;  4Z88 A;  1CKA A;  1PNJ A;  3VS5 A;  2DL5 A;  3VS0 A;  4CC3 A;  2LJ0 A;  3UF4 A;  5L23 A;  2VWF A;  3H0H A;  1H8K A;  1VA7 A;  2YDL A;  3VRY A;  1BBZ A;  4K11 A;  1G83 A;  1FYN A;  2EYW A;  2DNU A;  4DEY A;  2QDL A;  1U5S A;  2ABL A;  2YT6 A;  3M0U A;  4WCI A;  2RQW A;  3VS6 A;  2K9G A;  3FJ5 A;  2FEI A;  1HD3 A;  1ABQ A;  3I5S A;  1QLY A;  1OPL A;  4GBQ A;  2SEM A;  4RTU A;  3VS1 A;  3M0P A;  2O2O A;  2LMJ A;  2X3W D;  2P4R A;  1Y57 A;  1GRI A;  2RPN A;  2FRY A;  4OML A;  5FWC A;  4J9F A;  3NHN A;  1AWX A;  3M0S A;  2NUZ A;  2LQW A;  5ECA A;  2KRM A;  2ENM A;  4OMN A;  2BZX A;  1AWO A;  1ZUK A;  1GBR A;  1B07 A;  4FSS A;  2GGR A;  4AG2 C;  4AFQ C;  3PVQ A;  2JMC A;  2JTE A;  4A63 B;  3M0R A;  1LCK A;  1BK2 A;  2KR3 A;  2VVK A;  2LX7 A;  2BZ8 A;  4ORZ A;  3VS7 A;  3R6N A;  2A36 A;  2EYZ A;  4DEX A;  3EG1 A;  3EGU A;  2HDA A;  1T0J A;  1SHF A;  2DJQ A;  1RI9 A;  2O88 A;  1CKB A;  4AG1 C;  1MUZ A;  2O31 A;  2A37 A;  2O9V A;  2L0A A;  1E7O A;  1UUE A;  2RMO A;  2J6F A;  4RTY A;  1QKW A;  2ED1 A;  2J06 A;  3IQL A;  2DE0 X;  2LCS A;  1K0X A;  3CQT A;  1N5Z A;  1RLQ C;  2J7I A;  2K6D A;  2OAW A;  3I9Q A;  1KIK A;  1BB9 A;  3A98 A;  4RTT A;  4OMP A;  2DRM A;  1M30 A;  1VYV A;  1UHC A;  1ZBJ A;  5EC7 A;  2G6F X;  2LQN A;  2EPD A;  1X6G A;  1WIE A;  2JS2 A;  2EGE A;  1K76 A;  2YUQ A;  3I35 A;  1A0N B;  1UEC A;  1OV3 A;  2CT4 A;  1NYG A;  2FPE A;  2CDT A;  3UAT A;  2D8J A;  4LE9 A;  2A08 A;  1ABO A;  1AZE A;  4KRT A;  1PWT A;  2F2V A;  3EG3 A;  5I22 A;  1QWE A;  1E6G A;  4F17 A;  2DL8 A;  1PKT A;  2EGC A;  1AWW A;  1UJ0 A;  4RUG A;  2YSQ A;  1HSQ A;  2RQT A;  1KJW A;  1X6B A;  2LJ1 A;  3EG2 A;  2EVR A;  4Y92 A;  4RTZ A;  2M0Y A;  4ZNX A;  1NEG A;  1UGV A;  2CUD A;  1T3S A;  2ESW A;  3REA B;  1SRL A;  2JS0 A;  1WXB A;  4HVU A;  2XMF A;  1X27 A;  1WYX A;  2KEA A;  2B86 A;  2DA9 A;  2DVJ A;  1WXU A;  2EQI A;  4LNP A;  2D8H A;  1GL5 A;  3RNJ A;  1XOV A;  2F2X A;  2GBQ A;  5FWB A;  1WXT A;  2W10 A;  2K7A A;  3M0T A;  1JXM A;  2ROT A;  1K1Z A;  1ZLM A;  1Z9Q A;  1W1F A;  2EYX A;  3REB B;  2RN8 A;  3UA6 A;  4EIK A;  1UE9 A;  1GCQ C;  2W0Z A;  3PE0 A;  1X43 A;  4J9E A;  2KE9 A;  3PVL A;  1M3A A;  2PNI A;  2C0O A;  2EGA A;  1YNZ A;  2D1X A;  2DL7 A;  3EHR A;  1ZX6 A;  4LUE A;  1J3T A;  3O5Z A;  4D8K A;  1PKS A;  1TUC A;  2IIM A;  1T0H A;  2CT3 A;  1AVZ C;  1UJY A;  1SSH A;  2K3B A;  1M3B A;  2KT1 A;  3U23 A;  2GTO A;  2ED0 A;  2KYB A;  4JZ4 A;  1UHF A;  2EW3 A;  3TSW A;  3C0C A;  3EHQ A;  1PRM C;  2H8H A;  1S1N A;  1QWF A;  4R0K A;  3H0I A;  3TSZ A;  2DM1 A;  2EYY A;  3I5R A;  3ULR B;  1NLP C;  1TUD A;  5FW9 A;  3H41 A;  4CC7 A;  3SEM A;  1YWO A;  1ZSG A;  2HEQ A;  3THK A;  2VKN A;  4AFU C;  2C0T A;  2V1R A;  2CSQ A;  1RUW A;  2EBP A;  3KFV A;  1SRM A;  1X2Q A;  1WDX A;  1V1C A;  2KYM A;  1YCS B;  2I0N A;  3VS2 A;  1H92 A;  2DRK A;  1NG2 A;  2JW4 A;  2GQI A;  4AFS C;  4CC4 B;  2J6K A;  2DIL A;  1SEM A;  1GFD A;  2ROL A;  1M3C A;  1AEY A;  1I0C A;  2PZ1 A;  4RTX A;  1NYF A;  2JMA A;  2L3S A;  1WFW A;  1AWJ A;  4F16 A;  2FG0 A;  1WX6 A;  3NMZ C;  5IHN A;  2DX1 A;  2RQU A;  4X1V A;  3VRZ A;  4J9H A;  2C0I A;  2HBW A;  1M27 C;  2RNA A;  4HVV A;  4AFZ C;  4HCK A;  1MV0 B;  5I11 A;  1SPK A;  2SRC A;  2CUB A;  1FMK A;  2KRO A;  1JEG A;  2V1Q A;  1AZG B;  2MOX A;  2L2P A;  4JJC A;  2MCN A;  1QCF A;  2K2M A;  4ESR A;  2PTK A;  4JJB A;  1Z9Z A;  2FPF A;  2DL3 A;  4JJD A;  2DL4 A;  3VS3 A;  5IXB A;  1JU5 C;  1YP5 A;  4HVW A;  2K79 A;  4D8D A;  2DMO A;  2OI3 A;  1B3Q A;  1UFF A;  1U3O A;  1OOT A;  4OMQ A;  2KNB B;  2JM8 A;  1BU1 A;  2KT8 A;  2FRW A;  1YN8 A;  4IIO A;  4CC2 A;  1UTI A;  2KBT A;  2A28 A;  1X69 A;  1KFZ A;  1PHT A;  2AZV A;  4IIM A;  2CH4 A;  3NGP A;  1VYU A;  2AKL A;  1WLP B;  2LP5 A;  4Z89 A;  2FPD A;  2KGT A;  1OPK A;  3SHW A;  2YUP A;  2KXC A;  2DYB A;  1GCQ A;  1WI7 A;  2ECZ A;  2JM9 A;  2CRE A;  4J9C A;  2YUO A;  3QWX X;  1G2B A;  2AKK A;  2FO0 A;  2X3X D;  1KSW A;  1NEB A;  1T3L A;  1WA7 A;  3RBB B;  1ZUY A;  1ZUU A;  3NPF A;  2BZY A;  1W70 A;  1E6H A;  4M4Z A;  4E6R A;  2MIO A;  1JXO A;  5IHK A;  2OJ2 A;  2KXD A;  4LUD A;  1IO6 A;  2YUN A;  2DLP A;  3UA7 A;  1M8M A;  1NLO C;  2RF0 A;  2J05 A;  2M51 A;  1VYT A;  4LN2 A;  2L3Q A;  2AZS A;  2DBM A;  4J9I A;  1K4U S;  4HXJ A;  1CSK A;  4QT7 A;  5GJV B;  2LJ3 A;  1YWP A;  1PRL C;  5IHI A;  5HCK A;  4OMM A;  2EKH A;  4GLM A;  4F14 A;  2CSI A;  1SHG A;  1I1J A;  1TG0 A;  2D0N A;  3H0F A;  1UDL A;  2BTT A;  2HCK A;  3EG0 A;  1GCP A;  1NM7 A;  1OEB A;  3ZL7 C;  1MV3 A;  2LNH B;  2KRN A;  2CH4 W;  1JQQ A;  4JZ3 A;  1EFN A;  1AOJ A;  2RQR A;  4Z8A A;  2DF6 A;  4OMO A;  2JXB A;  1X2K A;  4J9D A;  4JPB W;  2DBK A;  5IH2 A;  3QWY A;  4J9B A;  1Y0M A;  2RQV A;  1K0S A;  2GTJ A;  2F2W A;  1GFC A;  1W6X A;  2AK5 A;  1ARK A;  1I07 A;  3JV3 A;  1HJD A;  1K9A A;  2JT4 A;  1UG1 A;  1GBQ A;  3M0Q A;  5GJW B;  4RTW A;  1JO8 A;  2KRS A;  4RTV A;  3LH5 A;  3VS4 A;  3TVT A;  2L3P A;  2J6O A;  2LZ6 B;  2NWM A;  1U06 A;  1AD5 A;  5IXF A;  2O9S A;  1RLP C;  4J9G A;  1H3H A;  2HSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...