2DRKA

Acanthamoeba myosin i sh3 domain bound to acan125
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
b'GSPGIQVKALYDYDAQTGDELTFKEGDTIIVHQKDPAGWWEGELNGKRGWVPANYVQDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain IB
molecule tags Contractile protein
source organism Acanthamoeba castellanii
publication title The crystal structure of the SH3 domain of Acanthamoeba myosin IB bound to Acan125
rcsb
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2drkA00
3TSZA 2RF0A 2RN8A 4J9HA 2DL7A 3VS1A 4CC4B 2A08A 4OMNA 3EHQA 3VRYA 1YNZA 3VS7A 4D8KA 1OPLA 4D8DA 1H92A 1AOJA 3TSWA 4DEYA 1AVZC 3H0IA 3VS2A 4LUDA 1JEGA 1SSHA 2CDTA 2YT6A 2MIOA 2NUZA 1GFCA 2ED1A 2ECZA 2JM9A 2KRSA 2GNCA 1VYTA 2IIMA 1M3CA 3A98A 1OPKA 4LN2A 4HXJA 2YSQA 1AWJA 2YUNA 2X3XD 3UF4A 1N5ZA 2RQRA 1CSKA 4OMOA 5EC7A 4J9DA 2AK5A 4LE9A 2L0AA 4J9IA 1X69A 1X43A 2FRYA 1X27A 2OAWA 1EFNA 1UFFA 2CH4A 4J9GA 2CREA 2M0YA 4J9CA 1M27C 2W0ZA 2LJ3A 2VKNA 2ABLA 4E6RA 1V1CA 2EVRA 1GCQC 1NEGA 2FEIA 1GRIA 1UUEA 2KRMA 2JXBA 5L23A 2KBTA 4AFSC 1VYUA 1GBQA 1LCKA 2AKKA 1YCSB 3PVQA 2JM8A 2A28A 4AFQC 2KR3A 2EBPA 4HVVA 1UE9A 2M51A 4Z89A 1T0JA 2W10A 3EG2A 2O2OA 5I11A 4HVUA 1NYGA 1GCPA 4JZ4A 2ESWA 3H41A 2FPFA 2KROA 4F14A 2C0IA 3C0CA 1W70A 1NG2A 4HCKA 4OMMA 4F16A 1WXTA 3ZL7C 3QWYA 2J7IA 2DBKA 2L3QA 2DL4A 2H8HA 3UATA 3EG1A 1ABQA 2EYYA 1ZSGA 4RTYA 2EYWA 4FSSA 2P4RA 4OMPA 1H8KA 1UJYA 2JT4A 2LMJA 1M8MA 2B86A 1PKTA 1XOVA 3SEMA 2PNIA 1WDXA 4IIOA 4JJDA 3M0RA 2LX7A 2FPDA 4J9EA 2LQNA 2KXDA 2SEMA 3REAB 1I0CA 1SRMA 2CUDA 2DMOA 2KXCA 1YN8A 3EG0A 1GFDA 3O5ZA 1AZGB 1UDLA 4JZ3A 4LUEA 2K6DA 3IQLA 1QKWA 2K3BA 1UJ0A 3VS5A 2EKHA 2DNUA 4IIMA 5IHIA 1QCFA 2J05A 2HEQA 4JJCA 2SRCA 5IHNA 1KIKA 3NPFA 1YWPA 1NLPC 2KNBB 1QWEA 2BZ8A 3ULRB 4QT7A 2FG0A 2FO0A 1JXOA 2DL3A 1H3HA 2O9SA 4DEXA 4M4ZA 2VWFA 1BK2A 2PZ1A 1SRLA 4RUGA 2OJ2A 1X2QA 2D8JA 1QKXA 2YUOA 1FYNA 1UECA 1U06A 2XMFA 1GCQA 1WA7A 2BZYA 2D1XA 1QLYA 2DL5A 4ZNXA 2G6FX 2AKLA 2F2VA 3EG3A 1UTIA 2E5KA 2V1QA 3M0TA 2AZVA 2LP5A 2ED0A 2DYBA 2EGAA 2KEAA 3PE0A 4OMLA 3THKA 4AG1C 1FMKA 2PTKA 2LNHB 3VS3A 5I22A 1PRLC 2DM1A 3VS6A 2KGTA 1U5SA 1HSQA 2J06A 4RTTA 1SHGA 2GQIA 5FWCA 4X1VA 4RTVA 2MCNA 2D0NA 1WI7A 2LJ0A 1I1JA 1TUCA 2CSQA 1ZUUA 1AZEA 2HBWA 1PRMC 4ESRA 1G2BA 1UHFA 1JQQA 1TG0A 1RLPC 2EGEA 2AZSA 2C0TA 4GBQA 1WXUA 3M0QA 1ABOA 2BTTA 1WX6A 5FWBA 1K9AA 3U23A 4Y92A 4Z8AA 1JU5C 4HVWA 2DLPA 2JTEA 2RNAA 1ZUYA 2O31A 2DX1A 2EPDA 1HJDA 1B07A 1X6BA 1CKBA 1GL5A 5IH2A 5GJWB 4OMQA 4RTWA 2A37A 1ZUKA 2MOXA 5GJVB 3I35A 1MV3A 1NM7A 2D8HA 1IO6A 3M0SA 1X2KA 1B3QA 2EYZA 3GBQA 5HCKA 4AG2C 2DL8A 2KYBA 1SPKA 2K79A 3NHNA 2LCSA 1T3SA 1SEMA 1K1ZA 2V1RA 3I5SA 2EW3A 2I0NA 1PNJA 3RNJA 1Z9ZA 3FJ5A 1UHCA 3R6NA 1ARKA 1K0XA 1W6XA 4CC7A 3LH5A 2L3PA 4K11A 3VS0A 1MV0B 5IXBA 1PWTA 1OV3A 2RQTA 3I5RA 3KFVA 1Y0MA 1J3TA 1K76A 1Y57A 2LJ1A 5IXFA 1U3OA 1AD5A 4RTUA 1M3AA 3M0PA 2BZXA 2DA9A 1ZLMA 4CC2A 1CKAA 1NYFA 3CQTA 2GTJA 2GGRA 4R0KA 3PVLA 4Z88A 4F17A 1OEBA 2KT1A 1AWWA 2KRNA 1AWXA 2LQWA 4RTXA 2JMAA 1M3BA 2ROTA 1G83A 1JXMA 2JS2A 2X3WD 2O88A 2L2PA 1WYXA 2JMCA 2VVKA 3I9QA 4J9BA 4ORZA 1Z9QA 3REBB 2DILA 3H0HA 2HDAA 1VA7A 1QWFA 1T3LA 1RUWA 2DRKA 2FRWA 5FW9A 1WFWA 1YWOA 3UA7A 5IHKA 3H0FA 4GLMA 1VYVA 1T0HA 4WCIA 2HSPA 1E7OA 3QWXX 4A63B 2J6KA 1M30A 2KYMA 2K9GA 3M0UA 2O9VA 1NLOC 1KSWA 1RI9A 1S1NA 1E6HA 3NGPA 2J6FA 2F2WA 3VS4A 1WIEA 2C0OA 1KFZA 2DF6A 3EHRA 2EYXA 4CC3A 2CUBA 1UG1A 2GBQA 1K4US 2EQIA 4RTZA 3UA6A 2A36A 1WLPB 2ENMA 3RBBB 4EIKA 1GBRA 5ECAA 1BB9A 2K2MA 1TUDA 2HCKA 1W1FA 1NEBA 1BU1A 1MUZA 4JJBA 3NMZC 2YUPA 1AEYA 1JO8A 2RMOA 3JV3A 1WXBA 1HD3A 2F2XA 1ZX6A 3TVTA 4AFUC 2JS0A 2CH4W 3EGUA 3VRZA 1RLQC 4JPBW 4LNPA 2FPEA 1PHTA 1AWOA 4AFZC 2YDLA 2DE0X 2CSIA 2LZ6B 2DBMA 1KJWA 2DVJA 2KT8A 1X6GA 1YP5A 2OI3A 2YUQA 1SHFA 3SHWA 2GTOA 2JW4A 1I07A 2DRMA 1BBZA 2K7AA 1UGVA 2EGCA 1OOTA 1E6GA 2CT4A 1ZBJA 2DJQA 2RQVA 2RQWA 2RPNA 2NWMA 2RQUA 1PKSA 2QDLA 1K0SA 2KE9A 2L3SA 2CT3A 2J6OA 4J9FA 4KRTA 1A0NB 2ROLA
chains in the Genus database with same CATH superfamily
2LCCA 4IUQA 1N6AA 3JB9J 4CC4B 4ELZC 3VRYA 1H92A 1JJ2P 1AOJA 2O4XB 5J26A 3VS2A 1JEGA 1SSHA 2EJ9A 2MIOA 3JCMg 4D6WA 3JB9I 2ED1A 2ECZA 4L5GA 1VQ7T 2GNCA 1VYTA 3A98A 3NTKA 1I4K1 4J6WA 4HXJA 2YUNA 3PMIA 4M7AE 1N5ZA 3LH0A 4J9DA 5IN1A 3CPWS 1RABB 2CP7A 1X69A 1X43A 4C0FA 4OGEA 5CKBA 1D0ZA 2KDSA 2CH4A 2CREA 4J9CA 3OSSC 2ABLA 4E6RA 2YRVA 1V1CA 5AT1B 5GAN3 4J7IA 4C8QF 2FEIA 3ZFJA 1GRIA 1UUEA 4M75A 2KRMA 2KBTA 1KQ1A 4FT4A 4AFSC 5DM7R 4P5NA 4R55A 2QA4T 2JM8A 4M78G 1YIJT 1RADB 1BYMA 4HVVA 1M1KR 4V2SA 2YHTA 2LQKA 3RKYA 4HVUA 2QEXQ 1GCPA 3OYHA 5FRMA 2MPXC 4MZTA 4F14A 3CCVA 2EQJA 1WHLA 1NG2A 3C0CA 4N0AC 1S72A 4KH0B 1VQNQ 1IRXA 2QASA 4QKUA 1X01A 2FZCB 2ZPIB 3OYEA 1RAEB 4BE2A 4XU2A 5GANe 2EYYA 1VQ6T 1BI3A 3VYGA 1TOVA 4JDSA 1H8KA 3MKDA 1Q7YU 4PJMA 2EKOA 1M9SA 2P0KA 4JJDA 5DLQE 1YFNA 4N4HA 1VQ7Q 4PNOA 3M0RA 4M7DF 5CCAA 2FVUA 3CC4T 2FPDA 4J9EA 2XD0A 4B9XA 2LQNA 2ZPHB 2KXDA 4IKFA 3CC2A 4RG8A 4KUIA 1VQ5A 2E3HA 1SKUB 1GFDA 5LJ5e 4E7HA 4LUEA 1NE8A 4JRIA 3CD6A 2D6FA 1VQ9A 1D1CA 4M7AC 3L2UA 3QHSA 5GMKm 2CYZB 2DNUA 5IHIA 2BKDN 4C8QB 3CCVT 1QVGS 4PJOC 2HEQA 4JJCA 2SRCA 3CCET 1YWPA 1QWEA 3G6EA 1JXOA 3OYGA 1NJIC 8AT1B 4C5EA 1W2BA 4J5YA 5CK9A 3I56T 3OY9A 1X2QA 2MWOA 1Y7XA 4Q5WA 1JB0E 1VQPT 1R77A 1VQ8A 4J83A 2BZYA 1QLYA 2QK0A 3CCJT 1MMNA 1NZ9A 2MYSA 2G6FX 3OYMA 1QVFA 1M1FA 2RM4A 3M0TA 2AZVA 2ED0A 5GAN7 2EGAA 1VQ6Q 3DLMA 4M75E 1Q86R 2KK4A 3BE3A 2KGTA 2ZZDA 1M5Q1 4RTTA 2KI7A 3C94A 1WZOA 2XHCA 2K5IA 2GQIA 4J6YA 4L59A 5FWCA 5GAOl 4PJOE 3G71T 1WI7A 1IZ6A 2FYKA 3G71Q 3E1SA 5LJ5f 4PJOF 4M7AA 1Y96B 1I5LA 2DYIA 3MHXA 1FX7A 2AZSA 2C0TA 3FEOA 1WXUA 2RI2A 3A8OB 1GXIE 1ACMB 5GMKi 2DAQA 4F7UF 1WJSA 1JU5C 1NJIR 2JTEA 2RNAA 1PD0A 4PJLA 4E2FB 1QP3A 1G3YA 4XTXA 4RKUE 3CBPA 1X6BA 1MNEA 3M56A 4FL6A 1QVFS 5GJWB 1Q81C 2OX7A 4C92B 2LTOA 3MPUB 2WSFE 3I35A 2F5TX 3Q1JA 3VUBA 3LYIA 4BY6B 2NUPB 1YHQQ 2M02A 3JB9H 1SEMA 1YCYA 3I5SA 3NFCA 5HY6A 6AT1B 1Z9ZA 2E4HA 3FJ5A 5GAMd 1ZSZA 2K4YA 1ARKA 4CC7A 2EQKA 4K11A 3OW2P 4MMLA 3OS0A 3I55Q 1OV3A 3G4ST 1K8AR 1C0MA 2DXUA 1BKBA 4M77C 5IXFA 1MMGA 2DPPB 3RIRA 4HA8A 3OQ5A 1PSEA 3ZBDA 4DBRA 1IHWA 4R0KA 3PVLA 4F17A 2XI9A 1OEBA 2KRNA 3OB9A 4FYXB 1AWXA 1ZQ1A 3LLRA 5A0LA 4E7KA 2LQWA 2WACA 1VIEA 4RTXA 2ZPFB 2OTLT 3CCUQ 1M3BA 2CGHA 3SWNC 3A8GB 1KD1R 5FROA 4C8QG 3CC7T 1KQSS 1JRIA 2AIRB 2HNIA 4A4GA 1TH7A 3MEUA 4EMHA 4GLKA 1AHJB 2QGGA 2VV5A 1PD1A 2HKQB 4II1A 4M78E 2RHIA 5FW9A 5CR2A 2DEUA 3M55A 1YWOA 3UA7A 1BI2A 2JZ2A 2BUDA 5IT9E 1VQOA 3QWXX 2KYMA 3QDFA 5KE2A 3OS2A 3ER0A 2R57A 1KSWA 5KYNA 3D7SB 5GAMh 2NUTB 3NGPA 3QJ6A 3X28B 5KYWA 3QSUA 3SFMA 3J81E 3I56A 2P0QA 2ZPEB 2K57A 4N4GA 1YI2T 3G71A 4C8QC 5KYYB 4PJOD 2HQEA 4CC3A 2CUBA 4OF1A 5LL6S 4KGXB 4DOWA 3RESA 4GY5A 8ATCB 2HMAA 3GPLA 3G1JA 3CXCS 4QQDA 4EIKA 4N4IA 4PK4A 3LGFA 3EG9B 1NEBA 2RMOA 4QQ6A 1VQLA 1UGPB 2ZGWA 5GMKe 1VQOT 1LVKA 1FMVA 3EGUA 5J3BA 5LJ5h 1AWOA 4ZTFA 3KUFA 2YDLA 4LDVA 2OTJT 1LNXA 3MEAA 2DBMA 2DVJA 1OU8A 4KULA 1YP5A 2OI3A 1EZZB 2VXEA 2ZCFB 2JW4A 4JLGA 5D6YA 1TUGB 1BIAA 5KCHA 3OYIA 4A4FA 2LNVA 1VQ8T 2RQWA 2CP0A 3HTRA 2KE9A 1Y71A 1YITT 2CT3A 2J6OA 4JUVA 3P8DA 3FJPA 3C95A 2PVDB 5FLXE 2RF0A 3P8BB 4DOVA 4EMKB 4J9HA 2D9TA 3G6ET 4EMKA 2QQBA 4LDWA 2E10A 1WNLA 3VS1A 5GMKj 2DK3A 5GAMg 3EHQA 4PFOA 3VS7A 4D8KA 1OPLA 5FU6B 1N8RR 1K73R 3TQ7P 2YT6A 4XU0A 3UWNA 1D0XA 2NUZA 5GAN2 3QG1A 4BDZA 3UT1A 1K73U 3P8HA 1AWJA 3FB9A 2VC8A 3J7AF 1CSKA 5GANh 4OMOA 5EC7A 1VQLT 2AK5A 4LE9A 2P84A 2DKGA 1VQ4Q 1X27A 4FYVB 1EFNA 1UFFA 1VOMA 2M0YA 1M27C 1B7TA 1OX9A 2CP2A 1VQMQ 2EQUA 2QQRA 5GAN5 1RACB 5CO7A 5L23A 3PFSA 4OB1B 1R0BG 1VYUA 2QG9B 1GBQA 2AKKA 3PVQA 1ZHIA 4AFQC 2COYA 2BIVA 2M51A 4FT2A 4Z89A 3JCMQ 4JJNK 2O2OA 4LD6A 5GMKl 4BI8B 5I11A 2YRDA 4JZ4A 4XU3A 4E7LA 2KAFA 2ESWA 2KROA 4HCKA 3PNWC 4F16A 3CPFA 3ZL7C 2J7IA 2DBKA 1HK9A 2L3QA 5KYYA 2DL4A 3UATA 3EG1A 3A1PA 2O4XA 1G3SA 4XTWA 1BIBA 3A8LB 1ZSGA 3JSCA 3PGGA 2EYWA 3QYGB 4FSSA 2MI6A 2RHUA 2HL3A 1UJYA 4DA4A 3CC2Q 4KT0E 3EFOB 2PVOB 2DTHA 2RD1A 1WDXA 4X34A 2ATCB 4BI3A 2H3JA 2OTLA 2RJDA 1S72Q 1YBYA 3V8KA 5I2SA 2GFUA 5I21A 4VUBA 4AMCA 4JZ3A 2E5QA 2DXCA 1O75A 3INZA 2QQAA 5GAOp 1UJ0A 3VS5A 4BI4A 1K9MR 4BY6C 1IHVA 4X9CA 3J80E 3OW2S 1KIKA 3EGDB 2DXTA 1NLPC 3ULRB 4QT7A 4XQ3A 2DL3A 1MHNA 1H3HA 3EGXA 3A8MB 4M4ZA 1YIJQ 3WVDB 1BK2A 3EGXB 4E47A 3F70A 1VQ5T 3OMCA 1QKXA 1LPLA 4ZGDB 3M4GA 2DD5A 2JNGA 4JS4A 3E9GA 1N8RC 1GCQA 1VQNA 2D1XA 4ZNXA 3RUXA 1VQ9Q 1UTIA 2E5KA 2K2VA 2XICA 2CP5A 2LP5A 4JRPA 2KEAA 4OMLA 3QPHA 2PTKA 2LVMA 2M0OA 1M4ZA 4M77E 2NUTA 3OYBA 1HSQA 4TVRA 1SHGA 1XQHA 2VYTA 1Q86C 2CSQA 1TUCA 5LJ3d 1VQNT 1PRMC 3HRTA 1VQLQ 2HQHA 2LC4A 1VQ4T 1UHFA 1TG0A 2EGEA 2X4JA 1OQKA 5CKDA 3LX7A 3M0QA 1ABOA 3M57A 5FU7C 1WX6A 2QA4A 3VV0A 4Z8AA 3CCVQ 2DLPA 4Z02A 4B6MA 3CCST 4O6JA 3CCMT 2DX1A 1KK7A 2YWWA 2QAZA 1Q7YC 2EPDA 1HJDA 1B07A 4PFPA 5DY9A 2CKKA 3VYHB 4PL6A 3OYJA 5GANf 1NPRA 3NTHA 2YXYA 2MOXA 3M4YA 1MV3A 1IO6A 4PFZA 4HCBA 3AHUA 1P92A 2KYBA 1D3BB 1M90U 2K79A 2LCSA 1T3SA 4NL3A 1D3BA 1K1ZA 2V26A 2CP3A 3CMET 3HPWA 1FMWA 4PJJA 3R6NA 2V8JA 3V8LA 1K0XA 2EWNA 4PLIA 3MCAB 3CC4A 1WHGA 2DETA 2RQTA 3TCJA 2Z0WA 1J3TA 5LJ3j 1K76A 1Y57A 3QBYA 4RG2A 5IAYA 1U3OA 2RK2A 3OA6A 1F1BB 2EAYA 1M3AA 1K9MU 4OMFB 1RAIB 4OGCA 5LJ3f 1ZLMA 2COZA 2DTIA 1YI2A 4Z88A 1YHQT 1AWWA 3DB3A 2ZPBB 2JMAA 1XTDA 2EIFA 2VASA 1G83A 2PUKB 2OAUA 4LDYA 4C0DB 4XTZA 2QYZA 4J9BA 1WYXA 2VVKA 3I9QA 1YJWA 1TWBA 1Z9QA 3KXTA 3REBB 4DBFA 3H0HA 4ATOA 1QWFA 1T3LA 2DRKA 2R58A 3DKMA 1Q95G 1U1SA 4OP0A 2QQSA 5M9OA 3H0FA 2DEQA 1B34B 2E3IA 1E7OA 3PTAA 3CPWP 2HAXA 2J6KA 1M30A 1WQWA 2K9GA 2GF7A 2CZ6B 2O9VA 1RI9A 2XG8D 4C92E 2YRCA 2A0FB 2JVVA 2F2WA 3GNFB 2M1HA 2CZ1B 2RJCA 1YIJA 2DF6A 2EYXA 3JB9D 3H6ZA 1PG5B 1WHKA 1UG1A 2R5AA 1K4US 3QO3A 4RTZA 1C1AA 4HCCA 1VQKT 1UB4A 1G8XA 2ENMA 2QA4Q 3I55T 1K73C 3RBBB 1W2BP 3UPUA 2K2MA 2HCKA 1W1FA 3JCMW 2LT1A 1MUZA 3EG9A 4DBQA 1AEYA 4F7UA 1RI0A 2LX9A 3C4SA 1BCMA 4J6XA 1ZX6A 1VQ9T 3UDCA 4AFUC 3L2QA 5KE3A 3L2RA 3O8VA 2DVEA 3OBYA 1RLQC 4JPBW 4LNPA 1YJ9T 1PHTA 3N5BB 4PJOA 2MMPA 2X4XA 3L1AA 3SWNB 3OYLA 1QP2A 3SHWA 4C0GA 1I07A 2DRMA 2VB6A 1OI1A 3SD4A 3VKIA 1M90R 4M75B 1UGVA 1OULA 3R6OA 2CT4A 1ZBJA 3HHTB 4KGVB 1Q82R 2RH2A 2NWMA 2RQUA 2QDLA 1BI0A 1BCOA 2PVGB 3JRZA 3JB9G 2E6ZA 4KRTA 3QXEB 3JCMc 2ROLA 4XAXB 2XDPA 1SF9A 2MF2A 4JLIA 2DJZA 1XJWB 3META 5GMKh 3FC3A 2RN8A 3CMAA 3HFNA 3CBOA 2BE7D 4OMNA 1G3TA 1YNZA 2JTFA 3EAEA 4E7IA 5GAOr 3TSWA 1N27A 4DEYA 1AVZC 3H0IA 2CDTA 1GFCA 3I56Q 2JM9A 2KRSA 2IIMA 1M3CA 1WHJA 1ZA2B 2GFAA 1OPKA 4C8QE 1YJNQ 2YSQA 5LJ5g 2RI3A 4AT1B 5DLOA 2L0AA 2Y4YA 2OAWA 3HKSA 3CCRT 4J9GA 4A4HA 2W0ZA 2LJ3A 2RHYA 2IVWA 3S3OA 4XTVA 5CQXA 3CPWA 2EVRA 5GAMj 1GCQC 2D0QB 2X51A 1WGSA 2JXBA 2QEXA 4C5IA 4MDXA 3TREA 4HT9A 1YCSB 2E12A 2E1HA 2X4YA 3NTIA 4FYYB 2KR3A 2EBPA 1T0JA 1XNIA 2W10A 1QCNA 1M2VB 3DB4A 4FW2A 5CVIA 2FZGB 3RERA 3HP9A 3M9QA 3H41A 1ZSZB 3CCRA 1W70A 4OMMA 1WXTA 3QWYA 3PIOA 2QQ9A 3URGA 2XK0A 2H8HA 3EFSA 1M1KU 5I2MA 3CCQT 1MMAA 4RTYA 5GAOm 3M54A 2EYQA 2P4RA 4WF2A 2CS7A 2LMJA 1M8MA 2B86A 1K8AC 2GQVA 1N8RU 1XOVA 2PNIA 5GANd 1VQ8Q 3GLXA 5GAMe 4KH1B 4HCZA 4IIOA 3X20B 3OYNA 2JOYA 3MO8A 3V7CA 3REAB 1O9SA 2CUDA 4M77F 2DMOA 3GOXA 2V8IA 3EG0A 4BD3A 1UDLA 3RKWA 3HFOA 1U1TA 3IQLA 3CXCP 2HZYA 1QKWA 4ZGJB 2E64A 5GAN8 4IIMA 1QVPA 4FW1A 5IHNA 2EQMA 3NPFA 4IUTA 2KNBB 4BB7A 3CEYA 1KQ2A 2O9SA 1OX8A 4QVCA 2VWFA 3JCMd 4RUGA 1H641 3CCMQ 2OJ2A 2LT4A 4M78F 2YUOA 1YJ9Q 5KYXB 1UECA 1U06A 2QGFB 3JCMV 1WA7A 1YJNA 2DL5A 1TXQA 3E9FA 2KQWA 3H8ZA 3M58A 1OZ3A 5EG2A 2V1QA 1D0YA 2DYBA 3PE0A 4AG1C 1PCXA 1FMKA 2LNHB 4JRQA 5I22A 4C92D 4MZPA 4NS5A 2J06A 1C6VX 1I8FA 5GAOn 3QIIA 1EX4A 2F5KA 4ZTJA 2ZPGB 1VQMA 4RTVA 2VGNA 2E70A 1I1JA 1AZEA 1Q86U 2HBWA 3LWHA 4ESRA 3OMGA 2FHDA 1KC8R 4M77B 1KQSP 1ZSZC 3CCJQ 3PMTA 3QYHB 2QTVA 4F7UB 3RMQA 5FWBA 4OVAA 4M7DG 4OB0B 4Y92A 3U23A 3TEEA 1JJ2A 4A53A 1VUBA 2LQ8A 2X35A 4FM4B 4HVWA 2XDDA 1ZUYA 4EPCA 2DIQA 3FDRA 3WXMB 1CKBA 1GL5A 4C92F 1VQPQ 1S72T 5C6SA 4O5VA 3E19A 3OS1A 2QI2A 4OMQA 4HT8A 4C92C 1OYXA 2K3XA 5GJVB 1PSFA 1NJIU 2PQWA 2EYZA 2X9HA 1QCOA 3GBQA 5HCKA 2DL8A 1SPKA 3NHNA 4M75G 2VUBA 2V1RA 2EW3A 4M7DA 1PNJA 4BUGA 2XU8A 1UHCA 4M78C 4M7DB 1W6XA 1IXDA 3LH5A 4OB3B 3JCMJ 5IXBA 1YI2Q 1V29B 3V7RA 3I5RA 3KFVA 3LW5E 2E41A 7AT1B 3L2WA 2HSEB 3JCMP 2HQXA 1AD5A 2O01E 3DLLA 2WSEE 4RTUA 2COWA 3OYKA 3JAME 1D09B 2LRQA 2HKNA 2BZXA 2DA9A 3S3MA 3CQTA 2KT1A 1UGQB 3CCEA 1LJOA 1JXMA 2JS2A 5A2QE 4DBHA 1KQSA 2O88A 2JMCA 1M1KC 5AYFA 2DILA 2P4TA 2FZKB 1VA7A 4MZMA 2OTJA 3G4SQ 2FRWA 3CCSQ 1WFWA 4C92A 1I5OB 4GLMA 1VYVA 1T0HA 4WCIA 1G5VA 1RAHB 3CCRQ 2NUPA 2IPOB 1B34A 3EGDA 3ZEHA 2X4WA 3BFMA 3QZ5B 1QVFP 1BI1A 4M78B 4M7DC 4C0ZA 4IURA 1G3WA 4M77D 4M78A 3QUIA 4XTYA 3VS4A 1WIEA 3CC7Q 1VIFA 2A3LA 1VQMT 3EHRA 2RK1A 1UGRB 5GAOq 2GBQA 2EQIA 2LCLA 4M78D 1Y07A 1EIFA 1YJ9A 4JS5A 1WLPB 5D7UA 1GBRA 1D1AA 5ECAA 1BB9A 3T9NA 5FU6C 2XKOC 1BU1A 3E2UA 5CKEA 1JO8A 3JV3A 1WXBA 1M2OA 4F7UE 1HD3A 2F2XA 1OU9A 1YITQ 3CCUT 4QW2A 4EMKC 2JS0A 2K5LA 3L2ZA 4EMGA 4LD9K 2FPEA 5GAN4 2DE0X 2LZ6B 4LDXA 1KJWA 3OSVA 1Q82C 1RAFB 2KT8A 2DZCA 2BE9B 2YUQA 4ZN3A 2E65A 5KCOA 3GIBA 4PJNA 4FYWB 2PUOB 1SSFA 4KBMB 4WTOB 1X75C 1ZBXA 2K7AA 2R5MA 2EGCA 3EH2A 3MEVA 1OOTA 5A0DA 1E6GA 2QXFA 2DJQA 2RPNA 5LJ5d 4DQ2A 3CCMA 4RMOA 1K0SA 2HBPA 1TSFA 1RAAB 2K3YA 2L3SA 2EJFA 4OB2B 4RCBA 2DXBA 2IG0A 9ATCB 4FIBA 3TSZA 4XU1A 2KVQG 2PU9B 3CCUA 2CZ7B 2RI5A 2RO0A 2EFIA 1IB8A 2DL7A 3GNGA 1KD1C 2A08A 5KYXA 4D8DA 3MP6A 2CP6A 1Q7YR 3M53A 3FRNA 4LUDA 2ZAEA 4LN2A 1KHIA 1TS9A 4M7DD 1I81A 4M75D 2X3XD 3UF4A 2RQRA 4M7AF 1VQ5Q 1YJWT 1JBMA 1QQJA 4J9IA 2FRYA 2DTOA 5HK0A 3BY7A 4PJOB 3OYFA 3CMAQ 3RKXA 2KSSA 2VKNA 3RDVA 3G6EQ 3GF5A 3CD6T 3CMAT 1IGUA 3MP1A 1NEGA 3CC2T 3CBMA 5GANj 1LCKA 4M7DE 4BE0A 4IUPA 3HRSA 2A28A 3CCQA 4M7AD 1UE9A 3HRUA 3EG2A 3SB2A 2K5FA 2GCXA 1H3ZA 3L2VA 1NYGA 1D1BA 3G7ZA 2C06A 3M59A 2FPFA 2C0IA 5LJ3h 2A7YA 1SG5A 3OS5A 4FCYA 3CMEA 1UGSB 3JCMb 4MDWA 4XTUA 1IGQA 4ANJA 2OTJQ 1ABQA 3CCSA 2DERA 2V8KA 4UC4A 1KC8U 4QVDA 5A0GA 4FSXA 2MK5A 4OMPA 4ELYC 2JT4A 3G4SA 2AHJB 1PKTA 3CCLQ 3SEMA 3OYDA 4F04B 2MAMA 3MP8A 4ZGEB 1K9MC 4C5GA 3GP8A 2LX7A 1YJNT 3WVEB 1HYOA 4R56A 4L6V5 2SEMA 1I0CA 1SRMA 2NYSA 2KXCA 1YN8A 4RCCA 2DFUA 2RHXA 1RAGB 3O5ZA 1AZGB 4A54A 1NBEB 2K6DA 3CCQQ 5GAN6 2QTXA 3LWIA 2K3BA 4C8QA 1Y96A 1U8RA 2EKHA 3KBGA 2DIGA 3VUZA 1QCFA 2J05A 2P0PA 2G3RA 2CZ0B 4M77G 2BZ8A 3QDRB 3FIFA 2FG0A 2FO0A 3PIPA 1DJ7B 1JJ2S 5KYUA 3MJXA 1WJRA 4JRKA 2VGMA 2MWPA 4DEXA 1YHQA 4BACA 3PT9A 4J8OA 2PZ1A 1SRLA 1WJQA 5KYWB 3OBWA 3S6WA 1PM3A 3EFRA 3SWNA 2D8JA 4A4EA 3RR6A 1FYNA 2HL5C 2RB6A 5C0MA 2YLCA 1R0CB 2XMFA 2AT1B 3JB9F 2DD4A 4KGZB 2RJEA 2AKLA 2F2VA 3EG3A 4F7UG 3CC7A 3VJPA 2OTLQ 1OZ2A 3EFOA 3THKA 1RL2A 3VS3A 1PRLC 2DM1A 3I55A 3VS6A 4PJOG 4Y91A 1U5SA 3CCLT 3X26B 1AT1B 3V8JA 4N0AA 4M7AG 4X1VA 2Y90A 5D6WA 2MCNA 5L8RE 2D0NA 2DZ9A 3HL8A 2LJ0A 1ZUUA 5LJ3e 4YTLA 1V76A 1G2BA 4QVZA 1PC0A 1JQQA 1RLPC 5KH6A 3CXCA 2JN0A 4GBQA 3JCMe 2BTTA 5CKHA 1VQKA 1VQPA 4X9DA 1K9AA 3EH1A 3JCMh 4C5HA 2O31A 4BDYA 1FXXA 2XIDA 4NL2A 3QKJA 1TU0B 2F69A 1K8AU 5FRNA 5LJ5j 4Y28E 3X25B 1FWZA 5CKFA 5IH2A 2QDYB 1NPPA 4RTWA 2A37A 2FL7A 1ZUKA 2D8HA 1NM7A 3M0SA 4PKCC 2I2LA 1R8OB 1X2KA 1B3QA 3ME9A 4NOYA 4AG2C 4A4KA 3TU4K 5CAIA 3JCMX 2L3RA 1MMDA 3OYAA 4ME7A 3FLGA 1WPYA 3QJYA 2I0NA 5CIUA 3RNJA 2JTMA 4XK8E 3A5ZB 2HD0A 3H9NA 4EDUA 3HSBA 1M8VA 2L3PA 4FU6A 1Q82U 5FU7B 3OYCA 4LXCA 1M1GA 3VS0A 2FB7A 1MV0B 4J7FA 1QVGP 1PWTA 3MEWA 5HK3A 5GANg 1Y0MA 5J39A 3M5AA 3CCEQ 2LJ1A 1VQKQ 3RMSA 3CC4Q 2JUFA 4C0DC 3OYYA 4LDUA 3M0PA 5CQYA 1VQOQ 4CC2A 1CKAA 1NYFA 1MNDA 3SDZA 5GAMf 2GTJA 2GGRA 3L42A 3QZ9B 2WSCE 3BDLA 3CD6Q 1QW1A 2ROTA 1UEBA 2X3WD 1N9RA 1WQ7A 1W4SA 2L2PA 4ORZA 2DO3A 3CCJA 2YLBA 2HDAA 2RJFA 1QMCA 1RUWA 1IREB 3AT1B 1YJWQ 1ZA1B 5IHKA 2QEXT 4E7JA 2L89A 2HSPA 4A63B 5D6XA 2B8AA 4CI0C 1WHMA 1KHCA 3CMEQ 5LJ3g 4B9WA 3M0UA 3OW2A 1NLOC 4IUUA 1S1NA 2L5QA 1TTHB 1E6HA 3JCMf 4IUVA 2JJ9A 2J6FA 2L8DA 2VXFA 4CRIA 2KY9A 1X6OA 1VQ6A 2M9UA 2C0OA 1KFZA 2NLUA 4E7SA 4KUDK 1YITA 1KG1A 3VU3C 1Q81U 3CCLA 3UA6A 2XDBA 2A36A 3LGLA 2LDMA 1N9SA 1W2BS 4M7AB 3ASKA 1Q81R 1TUDA 1VQ4A 1LOJA 4ZN1A 1QVGA 4JJBA 3NMZC 2YUPA 4QQGA 2EJGA 4C8QD 3X24B 3TVTA 2F1LA 2CH4W 4BE1A 3S3NA 3VRZA 1WHHA 2H3EB 2E6NA 3V7SA 1HXDA 4PLLA 4AFZC 2CSIA 4E7ZA 4MMKA 1VQ7A 2RHZA 2RA2A 1X6GA 3BW1A 4M77A 1SHFA 4M75F 3C12A 1M90C 2GTOA 1KC8C 3BDUA 1BBZA 2KMTA 4M75C 2Y4XA 2M16A 2RQVA 1PKSA 1MGQA 5HKCA 4C92G 3A8HB 5KYUB 1M2VA 4J9FA 1KD1U 1A0NB 4HKEA
chains in the Genus database with same CATH topology
3TSZA 2RF0A 2RN8A 4J9HA 2DL7A 3VS1A 4CC4B 2A08A 4OMNA 3EHQA 3VRYA 1YNZA 3VS7A 4D8KA 1OPLA 4D8DA 1H92A 1AOJA 3TSWA 4DEYA 1AVZC 3H0IA 3VS2A 4LUDA 1JEGA 1SSHA 2CDTA 2YT6A 2MIOA 2NUZA 1GFCA 2ED1A 2ECZA 2JM9A 2KRSA 2GNCA 1VYTA 2IIMA 1M3CA 3A98A 1OPKA 4LN2A 4HXJA 2YSQA 1AWJA 2YUNA 2X3XD 3UF4A 1N5ZA 2RQRA 1CSKA 4OMOA 5EC7A 4J9DA 2AK5A 4LE9A 2L0AA 4J9IA 1X69A 1X43A 2FRYA 1X27A 2OAWA 1EFNA 1UFFA 2CH4A 4J9GA 2CREA 2M0YA 4J9CA 1M27C 2W0ZA 2LJ3A 2VKNA 2ABLA 4E6RA 1V1CA 2EVRA 1GCQC 1NEGA 2FEIA 1GRIA 1UUEA 2KRMA 2JXBA 5L23A 2KBTA 4AFSC 1VYUA 1GBQA 1LCKA 2AKKA 1YCSB 3PVQA 2JM8A 2A28A 4AFQC 2KR3A 2EBPA 4HVVA 1UE9A 2M51A 4Z89A 1T0JA 2W10A 3EG2A 2O2OA 5I11A 4HVUA 1NYGA 1GCPA 4JZ4A 2ESWA 3H41A 2FPFA 2KROA 4F14A 2C0IA 3C0CA 1W70A 1NG2A 4HCKA 4OMMA 4F16A 1WXTA 3ZL7C 3QWYA 2J7IA 2DBKA 2L3QA 2DL4A 2H8HA 3UATA 3EG1A 1ABQA 2EYYA 1ZSGA 4RTYA 2EYWA 4FSSA 2P4RA 4OMPA 1H8KA 1UJYA 2JT4A 2LMJA 1M8MA 2B86A 1PKTA 1XOVA 3SEMA 2PNIA 1WDXA 4IIOA 4JJDA 3M0RA 2LX7A 2FPDA 4J9EA 2LQNA 2KXDA 2SEMA 3REAB 1I0CA 1SRMA 2CUDA 2DMOA 2KXCA 1YN8A 3EG0A 1GFDA 3O5ZA 1AZGB 1UDLA 4JZ3A 4LUEA 2K6DA 3IQLA 1QKWA 2K3BA 1UJ0A 3VS5A 2EKHA 2DNUA 4IIMA 5IHIA 1QCFA 2J05A 2HEQA 4JJCA 2SRCA 5IHNA 1KIKA 3NPFA 1YWPA 1NLPC 2KNBB 1QWEA 2BZ8A 3ULRB 4QT7A 2FG0A 2FO0A 1JXOA 2DL3A 1H3HA 2O9SA 4DEXA 4M4ZA 2VWFA 1BK2A 2PZ1A 1SRLA 4RUGA 2OJ2A 1X2QA 2D8JA 1QKXA 2YUOA 1FYNA 1UECA 1U06A 2XMFA 1GCQA 1WA7A 2BZYA 2D1XA 1QLYA 2DL5A 4ZNXA 2G6FX 2AKLA 2F2VA 3EG3A 1UTIA 2E5KA 2V1QA 3M0TA 2AZVA 2LP5A 2ED0A 2DYBA 2EGAA 2KEAA 3PE0A 4OMLA 3THKA 4AG1C 1FMKA 2PTKA 2LNHB 3VS3A 5I22A 1PRLC 2DM1A 3VS6A 2KGTA 1U5SA 1HSQA 2J06A 4RTTA 1SHGA 2GQIA 5FWCA 4X1VA 4RTVA 2MCNA 2D0NA 1WI7A 2LJ0A 1I1JA 1TUCA 2CSQA 1ZUUA 1AZEA 2HBWA 1PRMC 4ESRA 1G2BA 1UHFA 1JQQA 1TG0A 1RLPC 2EGEA 2AZSA 2C0TA 4GBQA 1WXUA 3M0QA 1ABOA 2BTTA 1WX6A 5FWBA 1K9AA 3U23A 4Y92A 4Z8AA 1JU5C 4HVWA 2DLPA 2JTEA 2RNAA 1ZUYA 2O31A 2DX1A 2EPDA 1HJDA 1B07A 1X6BA 1CKBA 1GL5A 5IH2A 5GJWB 4OMQA 4RTWA 2A37A 1ZUKA 2MOXA 5GJVB 3I35A 1MV3A 1NM7A 2D8HA 1IO6A 3M0SA 1X2KA 1B3QA 2EYZA 3GBQA 5HCKA 4AG2C 2DL8A 2KYBA 1SPKA 2K79A 3NHNA 2LCSA 1T3SA 1SEMA 1K1ZA 2V1RA 3I5SA 2EW3A 2I0NA 1PNJA 3RNJA 1Z9ZA 3FJ5A 1UHCA 3R6NA 1ARKA 1K0XA 1W6XA 4CC7A 3LH5A 2L3PA 4K11A 3VS0A 1MV0B 5IXBA 1PWTA 1OV3A 2RQTA 3I5RA 3KFVA 1Y0MA 1J3TA 1K76A 1Y57A 2LJ1A 5IXFA 1U3OA 1AD5A 4RTUA 1M3AA 3M0PA 2BZXA 2DA9A 1ZLMA 4CC2A 1CKAA 1NYFA 3CQTA 2GTJA 2GGRA 4R0KA 3PVLA 4Z88A 4F17A 1OEBA 2KT1A 1AWWA 2KRNA 1AWXA 2LQWA 4RTXA 2JMAA 1M3BA 2ROTA 1G83A 1JXMA 2JS2A 2X3WD 2O88A 2L2PA 1WYXA 2JMCA 2VVKA 3I9QA 4J9BA 4ORZA 1Z9QA 3REBB 2DILA 3H0HA 2HDAA 1VA7A 1QWFA 1T3LA 1RUWA 2DRKA 2FRWA 5FW9A 1WFWA 1YWOA 3UA7A 5IHKA 3H0FA 4GLMA 1VYVA 1T0HA 4WCIA 2HSPA 1E7OA 3QWXX 4A63B 2J6KA 1M30A 2KYMA 2K9GA 3M0UA 2O9VA 1NLOC 1KSWA 1RI9A 1S1NA 1E6HA 3NGPA 2J6FA 2F2WA 3VS4A 1WIEA 2C0OA 1KFZA 2DF6A 3EHRA 2EYXA 4CC3A 2CUBA 1UG1A 2GBQA 1K4US 2EQIA 4RTZA 3UA6A 2A36A 1WLPB 2ENMA 3RBBB 4EIKA 1GBRA 5ECAA 1BB9A 2K2MA 1TUDA 2HCKA 1W1FA 1NEBA 1BU1A 1MUZA 4JJBA 3NMZC 2YUPA 1AEYA 1JO8A 2RMOA 3JV3A 1WXBA 1HD3A 2F2XA 1ZX6A 3TVTA 4AFUC 2JS0A 2CH4W 3EGUA 3VRZA 1RLQC 4JPBW 4LNPA 2FPEA 1PHTA 1AWOA 4AFZC 2YDLA 2DE0X 2CSIA 2LZ6B 2DBMA 1KJWA 2DVJA 2KT8A 1X6GA 1YP5A 2OI3A 2YUQA 1SHFA 3SHWA 2GTOA 2JW4A 1I07A 2DRMA 1BBZA 2K7AA 1UGVA 2EGCA 1OOTA 1E6GA 2CT4A 1ZBJA 2DJQA 2RQVA 2RQWA 2RPNA 2NWMA 2RQUA 1PKSA 2QDLA 1K0SA 2KE9A 2L3SA 2CT3A 2J6OA 4J9FA 4KRTA 1A0NB 2ROLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSZ A;  2RF0 A;  2RN8 A;  4J9H A;  2DL7 A;  3VS1 A;  4CC4 B;  2A08 A;  4OMN A;  3EHQ A;  3VRY A;  1YNZ A;  3VS7 A;  4D8K A;  1OPL A;  4D8D A;  1H92 A;  1AOJ A;  3TSW A;  4DEY A;  1AVZ C;  3H0I A;  3VS2 A;  4LUD A;  1JEG A;  1SSH A;  2CDT A;  2YT6 A;  2MIO A;  2NUZ A;  1GFC A;  2ED1 A;  2ECZ A;  2JM9 A;  2KRS A;  2GNC A;  1VYT A;  2IIM A;  1M3C A;  3A98 A;  1OPK A;  4LN2 A;  4HXJ A;  2YSQ A;  1AWJ A;  2YUN A;  2X3X D;  3UF4 A;  1N5Z A;  2RQR A;  1CSK A;  4OMO A;  5EC7 A;  4J9D A;  2AK5 A;  4LE9 A;  2L0A A;  4J9I A;  1X69 A;  1X43 A;  2FRY A;  1X27 A;  2OAW A;  1EFN A;  1UFF A;  2CH4 A;  4J9G A;  2CRE A;  2M0Y A;  4J9C A;  1M27 C;  2W0Z A;  2LJ3 A;  2VKN A;  2ABL A;  4E6R A;  1V1C A;  2EVR A;  1GCQ C;  1NEG A;  2FEI A;  1GRI A;  1UUE A;  2KRM A;  2JXB A;  5L23 A;  2KBT A;  4AFS C;  1VYU A;  1GBQ A;  1LCK A;  2AKK A;  1YCS B;  3PVQ A;  2JM8 A;  2A28 A;  4AFQ C;  2KR3 A;  2EBP A;  4HVV A;  1UE9 A;  2M51 A;  4Z89 A;  1T0J A;  2W10 A;  3EG2 A;  2O2O A;  5I11 A;  4HVU A;  1NYG A;  1GCP A;  4JZ4 A;  2ESW A;  3H41 A;  2FPF A;  2KRO A;  4F14 A;  2C0I A;  3C0C A;  1W70 A;  1NG2 A;  4HCK A;  4OMM A;  4F16 A;  1WXT A;  3ZL7 C;  3QWY A;  2J7I A;  2DBK A;  2L3Q A;  2DL4 A;  2H8H A;  3UAT A;  3EG1 A;  1ABQ A;  2EYY A;  1ZSG A;  4RTY A;  2EYW A;  4FSS A;  2P4R A;  4OMP A;  1H8K A;  1UJY A;  2JT4 A;  2LMJ A;  1M8M A;  2B86 A;  1PKT A;  1XOV A;  3SEM A;  2PNI A;  1WDX A;  4IIO A;  4JJD A;  3M0R A;  2LX7 A;  2FPD A;  4J9E A;  2LQN A;  2KXD A;  2SEM A;  3REA B;  1I0C A;  1SRM A;  2CUD A;  2DMO A;  2KXC A;  1YN8 A;  3EG0 A;  1GFD A;  3O5Z A;  1AZG B;  1UDL A;  4JZ3 A;  4LUE A;  2K6D A;  3IQL A;  1QKW A;  2K3B A;  1UJ0 A;  3VS5 A;  2EKH A;  2DNU A;  4IIM A;  5IHI A;  1QCF A;  2J05 A;  2HEQ A;  4JJC A;  2SRC A;  5IHN A;  1KIK A;  3NPF A;  1YWP A;  1NLP C;  2KNB B;  1QWE A;  2BZ8 A;  3ULR B;  4QT7 A;  2FG0 A;  2FO0 A;  1JXO A;  2DL3 A;  1H3H A;  2O9S A;  4DEX A;  4M4Z A;  2VWF A;  1BK2 A;  2PZ1 A;  1SRL A;  4RUG A;  2OJ2 A;  1X2Q A;  2D8J A;  1QKX A;  2YUO A;  1FYN A;  1UEC A;  1U06 A;  2XMF A;  1GCQ A;  1WA7 A;  2BZY A;  2D1X A;  1QLY A;  2DL5 A;  4ZNX A;  2G6F X;  2AKL A;  2F2V A;  3EG3 A;  1UTI A;  2E5K A;  2V1Q A;  3M0T A;  2AZV A;  2LP5 A;  2ED0 A;  2DYB A;  2EGA A;  2KEA A;  3PE0 A;  4OML A;  3THK A;  4AG1 C;  1FMK A;  2PTK A;  2LNH B;  3VS3 A;  5I22 A;  1PRL C;  2DM1 A;  3VS6 A;  2KGT A;  1U5S A;  1HSQ A;  2J06 A;  4RTT A;  1SHG A;  2GQI A;  5FWC A;  4X1V A;  4RTV A;  2MCN A;  2D0N A;  1WI7 A;  2LJ0 A;  1I1J A;  1TUC A;  2CSQ A;  1ZUU A;  1AZE A;  2HBW A;  1PRM C;  4ESR A;  1G2B A;  1UHF A;  1JQQ A;  1TG0 A;  1RLP C;  2EGE A;  2AZS A;  2C0T A;  4GBQ A;  1WXU A;  3M0Q A;  1ABO A;  2BTT A;  1WX6 A;  5FWB A;  1K9A A;  3U23 A;  4Y92 A;  4Z8A A;  1JU5 C;  4HVW A;  2DLP A;  2JTE A;  2RNA A;  1ZUY A;  2O31 A;  2DX1 A;  2EPD A;  1HJD A;  1B07 A;  1X6B A;  1CKB A;  1GL5 A;  5IH2 A;  5GJW B;  4OMQ A;  4RTW A;  2A37 A;  1ZUK A;  2MOX A;  5GJV B;  3I35 A;  1MV3 A;  1NM7 A;  2D8H A;  1IO6 A;  3M0S A;  1X2K A;  1B3Q A;  2EYZ A;  3GBQ A;  5HCK A;  4AG2 C;  2DL8 A;  2KYB A;  1SPK A;  2K79 A;  3NHN A;  2LCS A;  1T3S A;  1SEM A;  1K1Z A;  2V1R A;  3I5S A;  2EW3 A;  2I0N A;  1PNJ A;  3RNJ A;  1Z9Z A;  3FJ5 A;  1UHC A;  3R6N A;  1ARK A;  1K0X A;  1W6X A;  4CC7 A;  3LH5 A;  2L3P A;  4K11 A;  3VS0 A;  1MV0 B;  5IXB A;  1PWT A;  1OV3 A;  2RQT A;  3I5R A;  3KFV A;  1Y0M A;  1J3T A;  1K76 A;  1Y57 A;  2LJ1 A;  5IXF A;  1U3O A;  1AD5 A;  4RTU A;  1M3A A;  3M0P A;  2BZX A;  2DA9 A;  1ZLM A;  4CC2 A;  1CKA A;  1NYF A;  3CQT A;  2GTJ A;  2GGR A;  4R0K A;  3PVL A;  4Z88 A;  4F17 A;  1OEB A;  2KT1 A;  1AWW A;  2KRN A;  1AWX A;  2LQW A;  4RTX A;  2JMA A;  1M3B A;  2ROT A;  1G83 A;  1JXM A;  2JS2 A;  2X3W D;  2O88 A;  2L2P A;  1WYX A;  2JMC A;  2VVK A;  3I9Q A;  4J9B A;  4ORZ A;  1Z9Q A;  3REB B;  2DIL A;  3H0H A;  2HDA A;  1VA7 A;  1QWF A;  1T3L A;  1RUW A;  2DRK A;  2FRW A;  5FW9 A;  1WFW A;  1YWO A;  3UA7 A;  5IHK A;  3H0F A;  4GLM A;  1VYV A;  1T0H A;  4WCI A;  2HSP A;  1E7O A;  3QWX X;  4A63 B;  2J6K A;  1M30 A;  2KYM A;  2K9G A;  3M0U A;  2O9V A;  1NLO C;  1KSW A;  1RI9 A;  1S1N A;  1E6H A;  3NGP A;  2J6F A;  2F2W A;  3VS4 A;  1WIE A;  2C0O A;  1KFZ A;  2DF6 A;  3EHR A;  2EYX A;  4CC3 A;  2CUB A;  1UG1 A;  2GBQ A;  1K4U S;  2EQI A;  4RTZ A;  3UA6 A;  2A36 A;  1WLP B;  2ENM A;  3RBB B;  4EIK A;  1GBR A;  5ECA A;  1BB9 A;  2K2M A;  1TUD A;  2HCK A;  1W1F A;  1NEB A;  1BU1 A;  1MUZ A;  4JJB A;  3NMZ C;  2YUP A;  1AEY A;  1JO8 A;  2RMO A;  3JV3 A;  1WXB A;  1HD3 A;  2F2X A;  1ZX6 A;  3TVT A;  4AFU C;  2JS0 A;  2CH4 W;  3EGU A;  3VRZ A;  1RLQ C;  4JPB W;  4LNP A;  2FPE A;  1PHT A;  1AWO A;  4AFZ C;  2YDL A;  2DE0 X;  2CSI A;  2LZ6 B;  2DBM A;  1KJW A;  2DVJ A;  2KT8 A;  1X6G A;  1YP5 A;  2OI3 A;  2YUQ A;  1SHF A;  3SHW A;  2GTO A;  2JW4 A;  1I07 A;  2DRM A;  1BBZ A;  2K7A A;  1UGV A;  2EGC A;  1OOT A;  1E6G A;  2CT4 A;  1ZBJ A;  2DJQ A;  2RQV A;  2RQW A;  2RPN A;  2NWM A;  2RQU A;  1PKS A;  2QDL A;  1K0S A;  2KE9 A;  2L3S A;  2CT3 A;  2J6O A;  4J9F A;  4KRT A;  1A0N B;  2ROL A; 
#chains in the Genus database with same CATH topology
 2LCC A;  4IUQ A;  1N6A A;  3JB9 J;  4CC4 B;  4ELZ C;  3VRY A;  1H92 A;  1JJ2 P;  1AOJ A;  2O4X B;  5J26 A;  3VS2 A;  1JEG A;  1SSH A;  2EJ9 A;  2MIO A;  3JCM g;  4D6W A;  3JB9 I;  2ED1 A;  2ECZ A;  4L5G A;  1VQ7 T;  2GNC A;  1VYT A;  3A98 A;  3NTK A;  1I4K 1;  4J6W A;  4HXJ A;  2YUN A;  3PMI A;  4M7A E;  1N5Z A;  3LH0 A;  4J9D A;  5IN1 A;  3CPW S;  1RAB B;  2CP7 A;  1X69 A;  1X43 A;  4C0F A;  4OGE A;  5CKB A;  1D0Z A;  2KDS A;  2CH4 A;  2CRE A;  4J9C A;  3OSS C;  2ABL A;  4E6R A;  2YRV A;  1V1C A;  5AT1 B;  5GAN 3;  4J7I A;  4C8Q F;  2FEI A;  3ZFJ A;  1GRI A;  1UUE A;  4M75 A;  2KRM A;  2KBT A;  1KQ1 A;  4FT4 A;  4AFS C;  5DM7 R;  4P5N A;  4R55 A;  2QA4 T;  2JM8 A;  4M78 G;  1YIJ T;  1RAD B;  1BYM A;  4HVV A;  1M1K R;  4V2S A;  2YHT A;  2LQK A;  3RKY A;  4HVU A;  2QEX Q;  1GCP A;  3OYH A;  5FRM A;  2MPX C;  4MZT A;  4F14 A;  3CCV A;  2EQJ A;  1WHL A;  1NG2 A;  3C0C A;  4N0A C;  1S72 A;  4KH0 B;  1VQN Q;  1IRX A;  2QAS A;  4QKU A;  1X01 A;  2FZC B;  2ZPI B;  3OYE A;  1RAE B;  4BE2 A;  4XU2 A;  5GAN e;  2EYY A;  1VQ6 T;  1BI3 A;  3VYG A;  1TOV A;  4JDS A;  1H8K A;  3MKD A;  1Q7Y U;  4PJM A;  2EKO A;  1M9S A;  2P0K A;  4JJD A;  5DLQ E;  1YFN A;  4N4H A;  1VQ7 Q;  4PNO A;  3M0R A;  4M7D F;  5CCA A;  2FVU A;  3CC4 T;  2FPD A;  4J9E A;  2XD0 A;  4B9X A;  2LQN A;  2ZPH B;  2KXD A;  4IKF A;  3CC2 A;  4RG8 A;  4KUI A;  1VQ5 A;  2E3H A;  1SKU B;  1GFD A;  5LJ5 e;  4E7H A;  4LUE A;  1NE8 A;  4JRI A;  3CD6 A;  2D6F A;  1VQ9 A;  1D1C A;  4M7A C;  3L2U A;  3QHS A;  5GMK m;  2CYZ B;  2DNU A;  5IHI A;  2BKD N;  4C8Q B;  3CCV T;  1QVG S;  4PJO C;  2HEQ A;  4JJC A;  2SRC A;  3CCE T;  1YWP A;  1QWE A;  3G6E A;  1JXO A;  3OYG A;  1NJI C;  8AT1 B;  4C5E A;  1W2B A;  4J5Y A;  5CK9 A;  3I56 T;  3OY9 A;  1X2Q A;  2MWO A;  1Y7X A;  4Q5W A;  1JB0 E;  1VQP T;  1R77 A;  1VQ8 A;  4J83 A;  2BZY A;  1QLY A;  2QK0 A;  3CCJ T;  1MMN A;  1NZ9 A;  2MYS A;  2G6F X;  3OYM A;  1QVF A;  1M1F A;  2RM4 A;  3M0T A;  2AZV A;  2ED0 A;  5GAN 7;  2EGA A;  1VQ6 Q;  3DLM A;  4M75 E;  1Q86 R;  2KK4 A;  3BE3 A;  2KGT A;  2ZZD A;  1M5Q 1;  4RTT A;  2KI7 A;  3C94 A;  1WZO A;  2XHC A;  2K5I A;  2GQI A;  4J6Y A;  4L59 A;  5FWC A;  5GAO l;  4PJO E;  3G71 T;  1WI7 A;  1IZ6 A;  2FYK A;  3G71 Q;  3E1S A;  5LJ5 f;  4PJO F;  4M7A A;  1Y96 B;  1I5L A;  2DYI A;  3MHX A;  1FX7 A;  2AZS A;  2C0T A;  3FEO A;  1WXU A;  2RI2 A;  3A8O B;  1GXI E;  1ACM B;  5GMK i;  2DAQ A;  4F7U F;  1WJS A;  1JU5 C;  1NJI R;  2JTE A;  2RNA A;  1PD0 A;  4PJL A;  4E2F B;  1QP3 A;  1G3Y A;  4XTX A;  4RKU E;  3CBP A;  1X6B A;  1MNE A;  3M56 A;  4FL6 A;  1QVF S;  5GJW B;  1Q81 C;  2OX7 A;  4C92 B;  2LTO A;  3MPU B;  2WSF E;  3I35 A;  2F5T X;  3Q1J A;  3VUB A;  3LYI A;  4BY6 B;  2NUP B;  1YHQ Q;  2M02 A;  3JB9 H;  1SEM A;  1YCY A;  3I5S A;  3NFC A;  5HY6 A;  6AT1 B;  1Z9Z A;  2E4H A;  3FJ5 A;  5GAM d;  1ZSZ A;  2K4Y A;  1ARK A;  4CC7 A;  2EQK A;  4K11 A;  3OW2 P;  4MML A;  3OS0 A;  3I55 Q;  1OV3 A;  3G4S T;  1K8A R;  1C0M A;  2DXU A;  1BKB A;  4M77 C;  5IXF A;  1MMG A;  2DPP B;  3RIR A;  4HA8 A;  3OQ5 A;  1PSE A;  3ZBD A;  4DBR A;  1IHW A;  4R0K A;  3PVL A;  4F17 A;  2XI9 A;  1OEB A;  2KRN A;  3OB9 A;  4FYX B;  1AWX A;  1ZQ1 A;  3LLR A;  5A0L A;  4E7K A;  2LQW A;  2WAC A;  1VIE A;  4RTX A;  2ZPF B;  2OTL T;  3CCU Q;  1M3B A;  2CGH A;  3SWN C;  3A8G B;  1KD1 R;  5FRO A;  4C8Q G;  3CC7 T;  1KQS S;  1JRI A;  2AIR B;  2HNI A;  4A4G A;  1TH7 A;  3MEU A;  4EMH A;  4GLK A;  1AHJ B;  2QGG A;  2VV5 A;  1PD1 A;  2HKQ B;  4II1 A;  4M78 E;  2RHI A;  5FW9 A;  5CR2 A;  2DEU A;  3M55 A;  1YWO A;  3UA7 A;  1BI2 A;  2JZ2 A;  2BUD A;  5IT9 E;  1VQO A;  3QWX X;  2KYM A;  3QDF A;  5KE2 A;  3OS2 A;  3ER0 A;  2R57 A;  1KSW A;  5KYN A;  3D7S B;  5GAM h;  2NUT B;  3NGP A;  3QJ6 A;  3X28 B;  5KYW A;  3QSU A;  3SFM A;  3J81 E;  3I56 A;  2P0Q A;  2ZPE B;  2K57 A;  4N4G A;  1YI2 T;  3G71 A;  4C8Q C;  5KYY B;  4PJO D;  2HQE A;  4CC3 A;  2CUB A;  4OF1 A;  5LL6 S;  4KGX B;  4DOW A;  3RES A;  4GY5 A;  8ATC B;  2HMA A;  3GPL A;  3G1J A;  3CXC S;  4QQD A;  4EIK A;  4N4I A;  4PK4 A;  3LGF A;  3EG9 B;  1NEB A;  2RMO A;  4QQ6 A;  1VQL A;  1UGP B;  2ZGW A;  5GMK e;  1VQO T;  1LVK A;  1FMV A;  3EGU A;  5J3B A;  5LJ5 h;  1AWO A;  4ZTF A;  3KUF A;  2YDL A;  4LDV A;  2OTJ T;  1LNX A;  3MEA A;  2DBM A;  2DVJ A;  1OU8 A;  4KUL A;  1YP5 A;  2OI3 A;  1EZZ B;  2VXE A;  2ZCF B;  2JW4 A;  4JLG A;  5D6Y A;  1TUG B;  1BIA A;  5KCH A;  3OYI A;  4A4F A;  2LNV A;  1VQ8 T;  2RQW A;  2CP0 A;  3HTR A;  2KE9 A;  1Y71 A;  1YIT T;  2CT3 A;  2J6O A;  4JUV A;  3P8D A;  3FJP A;  3C95 A;  2PVD B;  5FLX E;  2RF0 A;  3P8B B;  4DOV A;  4EMK B;  4J9H A;  2D9T A;  3G6E T;  4EMK A;  2QQB A;  4LDW A;  2E10 A;  1WNL A;  3VS1 A;  5GMK j;  2DK3 A;  5GAM g;  3EHQ A;  4PFO A;  3VS7 A;  4D8K A;  1OPL A;  5FU6 B;  1N8R R;  1K73 R;  3TQ7 P;  2YT6 A;  4XU0 A;  3UWN A;  1D0X A;  2NUZ A;  5GAN 2;  3QG1 A;  4BDZ A;  3UT1 A;  1K73 U;  3P8H A;  1AWJ A;  3FB9 A;  2VC8 A;  3J7A F;  1CSK A;  5GAN h;  4OMO A;  5EC7 A;  1VQL T;  2AK5 A;  4LE9 A;  2P84 A;  2DKG A;  1VQ4 Q;  1X27 A;  4FYV B;  1EFN A;  1UFF A;  1VOM A;  2M0Y A;  1M27 C;  1B7T A;  1OX9 A;  2CP2 A;  1VQM Q;  2EQU A;  2QQR A;  5GAN 5;  1RAC B;  5CO7 A;  5L23 A;  3PFS A;  4OB1 B;  1R0B G;  1VYU A;  2QG9 B;  1GBQ A;  2AKK A;  3PVQ A;  1ZHI A;  4AFQ C;  2COY A;  2BIV A;  2M51 A;  4FT2 A;  4Z89 A;  3JCM Q;  4JJN K;  2O2O A;  4LD6 A;  5GMK l;  4BI8 B;  5I11 A;  2YRD A;  4JZ4 A;  4XU3 A;  4E7L A;  2KAF A;  2ESW A;  2KRO A;  4HCK A;  3PNW C;  4F16 A;  3CPF A;  3ZL7 C;  2J7I A;  2DBK A;  1HK9 A;  2L3Q A;  5KYY A;  2DL4 A;  3UAT A;  3EG1 A;  3A1P A;  2O4X A;  1G3S A;  4XTW A;  1BIB A;  3A8L B;  1ZSG A;  3JSC A;  3PGG A;  2EYW A;  3QYG B;  4FSS A;  2MI6 A;  2RHU A;  2HL3 A;  1UJY A;  4DA4 A;  3CC2 Q;  4KT0 E;  3EFO B;  2PVO B;  2DTH A;  2RD1 A;  1WDX A;  4X34 A;  2ATC B;  4BI3 A;  2H3J A;  2OTL A;  2RJD A;  1S72 Q;  1YBY A;  3V8K A;  5I2S A;  2GFU A;  5I21 A;  4VUB A;  4AMC A;  4JZ3 A;  2E5Q A;  2DXC A;  1O75 A;  3INZ A;  2QQA A;  5GAO p;  1UJ0 A;  3VS5 A;  4BI4 A;  1K9M R;  4BY6 C;  1IHV A;  4X9C A;  3J80 E;  3OW2 S;  1KIK A;  3EGD B;  2DXT A;  1NLP C;  3ULR B;  4QT7 A;  4XQ3 A;  2DL3 A;  1MHN A;  1H3H A;  3EGX A;  3A8M B;  4M4Z A;  1YIJ Q;  3WVD B;  1BK2 A;  3EGX B;  4E47 A;  3F70 A;  1VQ5 T;  3OMC A;  1QKX A;  1LPL A;  4ZGD B;  3M4G A;  2DD5 A;  2JNG A;  4JS4 A;  3E9G A;  1N8R C;  1GCQ A;  1VQN A;  2D1X A;  4ZNX A;  3RUX A;  1VQ9 Q;  1UTI A;  2E5K A;  2K2V A;  2XIC A;  2CP5 A;  2LP5 A;  4JRP A;  2KEA A;  4OML A;  3QPH A;  2PTK A;  2LVM A;  2M0O A;  1M4Z A;  4M77 E;  2NUT A;  3OYB A;  1HSQ A;  4TVR A;  1SHG A;  1XQH A;  2VYT A;  1Q86 C;  2CSQ A;  1TUC A;  5LJ3 d;  1VQN T;  1PRM C;  3HRT A;  1VQL Q;  2HQH A;  2LC4 A;  1VQ4 T;  1UHF A;  1TG0 A;  2EGE A;  2X4J A;  1OQK A;  5CKD A;  3LX7 A;  3M0Q A;  1ABO A;  3M57 A;  5FU7 C;  1WX6 A;  2QA4 A;  3VV0 A;  4Z8A A;  3CCV Q;  2DLP A;  4Z02 A;  4B6M A;  3CCS T;  4O6J A;  3CCM T;  2DX1 A;  1KK7 A;  2YWW A;  2QAZ A;  1Q7Y C;  2EPD A;  1HJD A;  1B07 A;  4PFP A;  5DY9 A;  2CKK A;  3VYH B;  4PL6 A;  3OYJ A;  5GAN f;  1NPR A;  3NTH A;  2YXY A;  2MOX A;  3M4Y A;  1MV3 A;  1IO6 A;  4PFZ A;  4HCB A;  3AHU A;  1P92 A;  2KYB A;  1D3B B;  1M90 U;  2K79 A;  2LCS A;  1T3S A;  4NL3 A;  1D3B A;  1K1Z A;  2V26 A;  2CP3 A;  3CME T;  3HPW A;  1FMW A;  4PJJ A;  3R6N A;  2V8J A;  3V8L A;  1K0X A;  2EWN A;  4PLI A;  3MCA B;  3CC4 A;  1WHG A;  2DET A;  2RQT A;  3TCJ A;  2Z0W A;  1J3T A;  5LJ3 j;  1K76 A;  1Y57 A;  3QBY A;  4RG2 A;  5IAY A;  1U3O A;  2RK2 A;  3OA6 A;  1F1B B;  2EAY A;  1M3A A;  1K9M U;  4OMF B;  1RAI B;  4OGC A;  5LJ3 f;  1ZLM A;  2COZ A;  2DTI A;  1YI2 A;  4Z88 A;  1YHQ T;  1AWW A;  3DB3 A;  2ZPB B;  2JMA A;  1XTD A;  2EIF A;  2VAS A;  1G83 A;  2PUK B;  2OAU A;  4LDY A;  4C0D B;  4XTZ A;  2QYZ A;  4J9B A;  1WYX A;  2VVK A;  3I9Q A;  1YJW A;  1TWB A;  1Z9Q A;  3KXT A;  3REB B;  4DBF A;  3H0H A;  4ATO A;  1QWF A;  1T3L A;  2DRK A;  2R58 A;  3DKM A;  1Q95 G;  1U1S A;  4OP0 A;  2QQS A;  5M9O A;  3H0F A;  2DEQ A;  1B34 B;  2E3I A;  1E7O A;  3PTA A;  3CPW P;  2HAX A;  2J6K A;  1M30 A;  1WQW A;  2K9G A;  2GF7 A;  2CZ6 B;  2O9V A;  1RI9 A;  2XG8 D;  4C92 E;  2YRC A;  2A0F B;  2JVV A;  2F2W A;  3GNF B;  2M1H A;  2CZ1 B;  2RJC A;  1YIJ A;  2DF6 A;  2EYX A;  3JB9 D;  3H6Z A;  1PG5 B;  1WHK A;  1UG1 A;  2R5A A;  1K4U S;  3QO3 A;  4RTZ A;  1C1A A;  4HCC A;  1VQK T;  1UB4 A;  1G8X A;  2ENM A;  2QA4 Q;  3I55 T;  1K73 C;  3RBB B;  1W2B P;  3UPU A;  2K2M A;  2HCK A;  1W1F A;  3JCM W;  2LT1 A;  1MUZ A;  3EG9 A;  4DBQ A;  1AEY A;  4F7U A;  1RI0 A;  2LX9 A;  3C4S A;  1BCM A;  4J6X A;  1ZX6 A;  1VQ9 T;  3UDC A;  4AFU C;  3L2Q A;  5KE3 A;  3L2R A;  3O8V A;  2DVE A;  3OBY A;  1RLQ C;  4JPB W;  4LNP A;  1YJ9 T;  1PHT A;  3N5B B;  4PJO A;  2MMP A;  2X4X A;  3L1A A;  3SWN B;  3OYL A;  1QP2 A;  3SHW A;  4C0G A;  1I07 A;  2DRM A;  2VB6 A;  1OI1 A;  3SD4 A;  3VKI A;  1M90 R;  4M75 B;  1UGV A;  1OUL A;  3R6O A;  2CT4 A;  1ZBJ A;  3HHT B;  4KGV B;  1Q82 R;  2RH2 A;  2NWM A;  2RQU A;  2QDL A;  1BI0 A;  1BCO A;  2PVG B;  3JRZ A;  3JB9 G;  2E6Z A;  4KRT A;  3QXE B;  3JCM c;  2ROL A;  4XAX B;  2XDP A;  1SF9 A;  2MF2 A;  4JLI A;  2DJZ A;  1XJW B;  3MET A;  5GMK h;  3FC3 A;  2RN8 A;  3CMA A;  3HFN A;  3CBO A;  2BE7 D;  4OMN A;  1G3T A;  1YNZ A;  2JTF A;  3EAE A;  4E7I A;  5GAO r;  3TSW A;  1N27 A;  4DEY A;  1AVZ C;  3H0I A;  2CDT A;  1GFC A;  3I56 Q;  2JM9 A;  2KRS A;  2IIM A;  1M3C A;  1WHJ A;  1ZA2 B;  2GFA A;  1OPK A;  4C8Q E;  1YJN Q;  2YSQ A;  5LJ5 g;  2RI3 A;  4AT1 B;  5DLO A;  2L0A A;  2Y4Y A;  2OAW A;  3HKS A;  3CCR T;  4J9G A;  4A4H A;  2W0Z A;  2LJ3 A;  2RHY A;  2IVW A;  3S3O A;  4XTV A;  5CQX A;  3CPW A;  2EVR A;  5GAM j;  1GCQ C;  2D0Q B;  2X51 A;  1WGS A;  2JXB A;  2QEX A;  4C5I A;  4MDX A;  3TRE A;  4HT9 A;  1YCS B;  2E12 A;  2E1H A;  2X4Y A;  3NTI A;  4FYY B;  2KR3 A;  2EBP A;  1T0J A;  1XNI A;  2W10 A;  1QCN A;  1M2V B;  3DB4 A;  4FW2 A;  5CVI A;  2FZG B;  3RER A;  3HP9 A;  3M9Q A;  3H41 A;  1ZSZ B;  3CCR A;  1W70 A;  4OMM A;  1WXT A;  3QWY A;  3PIO A;  2QQ9 A;  3URG A;  2XK0 A;  2H8H A;  3EFS A;  1M1K U;  5I2M A;  3CCQ T;  1MMA A;  4RTY A;  5GAO m;  3M54 A;  2EYQ A;  2P4R A;  4WF2 A;  2CS7 A;  2LMJ A;  1M8M A;  2B86 A;  1K8A C;  2GQV A;  1N8R U;  1XOV A;  2PNI A;  5GAN d;  1VQ8 Q;  3GLX A;  5GAM e;  4KH1 B;  4HCZ A;  4IIO A;  3X20 B;  3OYN A;  2JOY A;  3MO8 A;  3V7C A;  3REA B;  1O9S A;  2CUD A;  4M77 F;  2DMO A;  3GOX A;  2V8I A;  3EG0 A;  4BD3 A;  1UDL A;  3RKW A;  3HFO A;  1U1T A;  3IQL A;  3CXC P;  2HZY A;  1QKW A;  4ZGJ B;  2E64 A;  5GAN 8;  4IIM A;  1QVP A;  4FW1 A;  5IHN A;  2EQM A;  3NPF A;  4IUT A;  2KNB B;  4BB7 A;  3CEY A;  1KQ2 A;  2O9S A;  1OX8 A;  4QVC A;  2VWF A;  3JCM d;  4RUG A;  1H64 1;  3CCM Q;  2OJ2 A;  2LT4 A;  4M78 F;  2YUO A;  1YJ9 Q;  5KYX B;  1UEC A;  1U06 A;  2QGF B;  3JCM V;  1WA7 A;  1YJN A;  2DL5 A;  1TXQ A;  3E9F A;  2KQW A;  3H8Z A;  3M58 A;  1OZ3 A;  5EG2 A;  2V1Q A;  1D0Y A;  2DYB A;  3PE0 A;  4AG1 C;  1PCX A;  1FMK A;  2LNH B;  4JRQ A;  5I22 A;  4C92 D;  4MZP A;  4NS5 A;  2J06 A;  1C6V X;  1I8F A;  5GAO n;  3QII A;  1EX4 A;  2F5K A;  4ZTJ A;  2ZPG B;  1VQM A;  4RTV A;  2VGN A;  2E70 A;  1I1J A;  1AZE A;  1Q86 U;  2HBW A;  3LWH A;  4ESR A;  3OMG A;  2FHD A;  1KC8 R;  4M77 B;  1KQS P;  1ZSZ C;  3CCJ Q;  3PMT A;  3QYH B;  2QTV A;  4F7U B;  3RMQ A;  5FWB A;  4OVA A;  4M7D G;  4OB0 B;  4Y92 A;  3U23 A;  3TEE A;  1JJ2 A;  4A53 A;  1VUB A;  2LQ8 A;  2X35 A;  4FM4 B;  4HVW A;  2XDD A;  1ZUY A;  4EPC A;  2DIQ A;  3FDR A;  3WXM B;  1CKB A;  1GL5 A;  4C92 F;  1VQP Q;  1S72 T;  5C6S A;  4O5V A;  3E19 A;  3OS1 A;  2QI2 A;  4OMQ A;  4HT8 A;  4C92 C;  1OYX A;  2K3X A;  5GJV B;  1PSF A;  1NJI U;  2PQW A;  2EYZ A;  2X9H A;  1QCO A;  3GBQ A;  5HCK A;  2DL8 A;  1SPK A;  3NHN A;  4M75 G;  2VUB A;  2V1R A;  2EW3 A;  4M7D A;  1PNJ A;  4BUG A;  2XU8 A;  1UHC A;  4M78 C;  4M7D B;  1W6X A;  1IXD A;  3LH5 A;  4OB3 B;  3JCM J;  5IXB A;  1YI2 Q;  1V29 B;  3V7R A;  3I5R A;  3KFV A;  3LW5 E;  2E41 A;  7AT1 B;  3L2W A;  2HSE B;  3JCM P;  2HQX A;  1AD5 A;  2O01 E;  3DLL A;  2WSE E;  4RTU A;  2COW A;  3OYK A;  3JAM E;  1D09 B;  2LRQ A;  2HKN A;  2BZX A;  2DA9 A;  3S3M A;  3CQT A;  2KT1 A;  1UGQ B;  3CCE A;  1LJO A;  1JXM A;  2JS2 A;  5A2Q E;  4DBH A;  1KQS A;  2O88 A;  2JMC A;  1M1K C;  5AYF A;  2DIL A;  2P4T A;  2FZK B;  1VA7 A;  4MZM A;  2OTJ A;  3G4S Q;  2FRW A;  3CCS Q;  1WFW A;  4C92 A;  1I5O B;  4GLM A;  1VYV A;  1T0H A;  4WCI A;  1G5V A;  1RAH B;  3CCR Q;  2NUP A;  2IPO B;  1B34 A;  3EGD A;  3ZEH A;  2X4W A;  3BFM A;  3QZ5 B;  1QVF P;  1BI1 A;  4M78 B;  4M7D C;  4C0Z A;  4IUR A;  1G3W A;  4M77 D;  4M78 A;  3QUI A;  4XTY A;  3VS4 A;  1WIE A;  3CC7 Q;  1VIF A;  2A3L A;  1VQM T;  3EHR A;  2RK1 A;  1UGR B;  5GAO q;  2GBQ A;  2EQI A;  2LCL A;  4M78 D;  1Y07 A;  1EIF A;  1YJ9 A;  4JS5 A;  1WLP B;  5D7U A;  1GBR A;  1D1A A;  5ECA A;  1BB9 A;  3T9N A;  5FU6 C;  2XKO C;  1BU1 A;  3E2U A;  5CKE A;  1JO8 A;  3JV3 A;  1WXB A;  1M2O A;  4F7U E;  1HD3 A;  2F2X A;  1OU9 A;  1YIT Q;  3CCU T;  4QW2 A;  4EMK C;  2JS0 A;  2K5L A;  3L2Z A;  4EMG A;  4LD9 K;  2FPE A;  5GAN 4;  2DE0 X;  2LZ6 B;  4LDX A;  1KJW A;  3OSV A;  1Q82 C;  1RAF B;  2KT8 A;  2DZC A;  2BE9 B;  2YUQ A;  4ZN3 A;  2E65 A;  5KCO A;  3GIB A;  4PJN A;  4FYW B;  2PUO B;  1SSF A;  4KBM B;  4WTO B;  1X75 C;  1ZBX A;  2K7A A;  2R5M A;  2EGC A;  3EH2 A;  3MEV A;  1OOT A;  5A0D A;  1E6G A;  2QXF A;  2DJQ A;  2RPN A;  5LJ5 d;  4DQ2 A;  3CCM A;  4RMO A;  1K0S A;  2HBP A;  1TSF A;  1RAA B;  2K3Y A;  2L3S A;  2EJF A;  4OB2 B;  4RCB A;  2DXB A;  2IG0 A;  9ATC B;  4FIB A;  3TSZ A;  4XU1 A;  2KVQ G;  2PU9 B;  3CCU A;  2CZ7 B;  2RI5 A;  2RO0 A;  2EFI A;  1IB8 A;  2DL7 A;  3GNG A;  1KD1 C;  2A08 A;  5KYX A;  4D8D A;  3MP6 A;  2CP6 A;  1Q7Y R;  3M53 A;  3FRN A;  4LUD A;  2ZAE A;  4LN2 A;  1KHI A;  1TS9 A;  4M7D D;  1I81 A;  4M75 D;  2X3X D;  3UF4 A;  2RQR A;  4M7A F;  1VQ5 Q;  1YJW T;  1JBM A;  1QQJ A;  4J9I A;  2FRY A;  2DTO A;  5HK0 A;  3BY7 A;  4PJO B;  3OYF A;  3CMA Q;  3RKX A;  2KSS A;  2VKN A;  3RDV A;  3G6E Q;  3GF5 A;  3CD6 T;  3CMA T;  1IGU A;  3MP1 A;  1NEG A;  3CC2 T;  3CBM A;  5GAN j;  1LCK A;  4M7D E;  4BE0 A;  4IUP A;  3HRS A;  2A28 A;  3CCQ A;  4M7A D;  1UE9 A;  3HRU A;  3EG2 A;  3SB2 A;  2K5F A;  2GCX A;  1H3Z A;  3L2V A;  1NYG A;  1D1B A;  3G7Z A;  2C06 A;  3M59 A;  2FPF A;  2C0I A;  5LJ3 h;  2A7Y A;  1SG5 A;  3OS5 A;  4FCY A;  3CME A;  1UGS B;  3JCM b;  4MDW A;  4XTU A;  1IGQ A;  4ANJ A;  2OTJ Q;  1ABQ A;  3CCS A;  2DER A;  2V8K A;  4UC4 A;  1KC8 U;  4QVD A;  5A0G A;  4FSX A;  2MK5 A;  4OMP A;  4ELY C;  2JT4 A;  3G4S A;  2AHJ B;  1PKT A;  3CCL Q;  3SEM A;  3OYD A;  4F04 B;  2MAM A;  3MP8 A;  4ZGE B;  1K9M C;  4C5G A;  3GP8 A;  2LX7 A;  1YJN T;  3WVE B;  1HYO A;  4R56 A;  4L6V 5;  2SEM A;  1I0C A;  1SRM A;  2NYS A;  2KXC A;  1YN8 A;  4RCC A;  2DFU A;  2RHX A;  1RAG B;  3O5Z A;  1AZG B;  4A54 A;  1NBE B;  2K6D A;  3CCQ Q;  5GAN 6;  2QTX A;  3LWI A;  2K3B A;  4C8Q A;  1Y96 A;  1U8R A;  2EKH A;  3KBG A;  2DIG A;  3VUZ A;  1QCF A;  2J05 A;  2P0P A;  2G3R A;  2CZ0 B;  4M77 G;  2BZ8 A;  3QDR B;  3FIF A;  2FG0 A;  2FO0 A;  3PIP A;  1DJ7 B;  1JJ2 S;  5KYU A;  3MJX A;  1WJR A;  4JRK A;  2VGM A;  2MWP A;  4DEX A;  1YHQ A;  4BAC A;  3PT9 A;  4J8O A;  2PZ1 A;  1SRL A;  1WJQ A;  5KYW B;  3OBW A;  3S6W A;  1PM3 A;  3EFR A;  3SWN A;  2D8J A;  4A4E A;  3RR6 A;  1FYN A;  2HL5 C;  2RB6 A;  5C0M A;  2YLC A;  1R0C B;  2XMF A;  2AT1 B;  3JB9 F;  2DD4 A;  4KGZ B;  2RJE A;  2AKL A;  2F2V A;  3EG3 A;  4F7U G;  3CC7 A;  3VJP A;  2OTL Q;  1OZ2 A;  3EFO A;  3THK A;  1RL2 A;  3VS3 A;  1PRL C;  2DM1 A;  3I55 A;  3VS6 A;  4PJO G;  4Y91 A;  1U5S A;  3CCL T;  3X26 B;  1AT1 B;  3V8J A;  4N0A A;  4M7A G;  4X1V A;  2Y90 A;  5D6W A;  2MCN A;  5L8R E;  2D0N A;  2DZ9 A;  3HL8 A;  2LJ0 A;  1ZUU A;  5LJ3 e;  4YTL A;  1V76 A;  1G2B A;  4QVZ A;  1PC0 A;  1JQQ A;  1RLP C;  5KH6 A;  3CXC A;  2JN0 A;  4GBQ A;  3JCM e;  2BTT A;  5CKH A;  1VQK A;  1VQP A;  4X9D A;  1K9A A;  3EH1 A;  3JCM h;  4C5H A;  2O31 A;  4BDY A;  1FXX A;  2XID A;  4NL2 A;  3QKJ A;  1TU0 B;  2F69 A;  1K8A U;  5FRN A;  5LJ5 j;  4Y28 E;  3X25 B;  1FWZ A;  5CKF A;  5IH2 A;  2QDY B;  1NPP A;  4RTW A;  2A37 A;  2FL7 A;  1ZUK A;  2D8H A;  1NM7 A;  3M0S A;  4PKC C;  2I2L A;  1R8O B;  1X2K A;  1B3Q A;  3ME9 A;  4NOY A;  4AG2 C;  4A4K A;  3TU4 K;  5CAI A;  3JCM X;  2L3R A;  1MMD A;  3OYA A;  4ME7 A;  3FLG A;  1WPY A;  3QJY A;  2I0N A;  5CIU A;  3RNJ A;  2JTM A;  4XK8 E;  3A5Z B;  2HD0 A;  3H9N A;  4EDU A;  3HSB A;  1M8V A;  2L3P A;  4FU6 A;  1Q82 U;  5FU7 B;  3OYC A;  4LXC A;  1M1G A;  3VS0 A;  2FB7 A;  1MV0 B;  4J7F A;  1QVG P;  1PWT A;  3MEW A;  5HK3 A;  5GAN g;  1Y0M A;  5J39 A;  3M5A A;  3CCE Q;  2LJ1 A;  1VQK Q;  3RMS A;  3CC4 Q;  2JUF A;  4C0D C;  3OYY A;  4LDU A;  3M0P A;  5CQY A;  1VQO Q;  4CC2 A;  1CKA A;  1NYF A;  1MND A;  3SDZ A;  5GAM f;  2GTJ A;  2GGR A;  3L42 A;  3QZ9 B;  2WSC E;  3BDL A;  3CD6 Q;  1QW1 A;  2ROT A;  1UEB A;  2X3W D;  1N9R A;  1WQ7 A;  1W4S A;  2L2P A;  4ORZ A;  2DO3 A;  3CCJ A;  2YLB A;  2HDA A;  2RJF A;  1QMC A;  1RUW A;  1IRE B;  3AT1 B;  1YJW Q;  1ZA1 B;  5IHK A;  2QEX T;  4E7J A;  2L89 A;  2HSP A;  4A63 B;  5D6X A;  2B8A A;  4CI0 C;  1WHM A;  1KHC A;  3CME Q;  5LJ3 g;  4B9W A;  3M0U A;  3OW2 A;  1NLO C;  4IUU A;  1S1N A;  2L5Q A;  1TTH B;  1E6H A;  3JCM f;  4IUV A;  2JJ9 A;  2J6F A;  2L8D A;  2VXF A;  4CRI A;  2KY9 A;  1X6O A;  1VQ6 A;  2M9U A;  2C0O A;  1KFZ A;  2NLU A;  4E7S A;  4KUD K;  1YIT A;  1KG1 A;  3VU3 C;  1Q81 U;  3CCL A;  3UA6 A;  2XDB A;  2A36 A;  3LGL A;  2LDM A;  1N9S A;  1W2B S;  4M7A B;  3ASK A;  1Q81 R;  1TUD A;  1VQ4 A;  1LOJ A;  4ZN1 A;  1QVG A;  4JJB A;  3NMZ C;  2YUP A;  4QQG A;  2EJG A;  4C8Q D;  3X24 B;  3TVT A;  2F1L A;  2CH4 W;  4BE1 A;  3S3N A;  3VRZ A;  1WHH A;  2H3E B;  2E6N A;  3V7S A;  1HXD A;  4PLL A;  4AFZ C;  2CSI A;  4E7Z A;  4MMK A;  1VQ7 A;  2RHZ A;  2RA2 A;  1X6G A;  3BW1 A;  4M77 A;  1SHF A;  4M75 F;  3C12 A;  1M90 C;  2GTO A;  1KC8 C;  3BDU A;  1BBZ A;  2KMT A;  4M75 C;  2Y4X A;  2M16 A;  2RQV A;  1PKS A;  1MGQ A;  5HKC A;  4C92 G;  3A8H B;  5KYU B;  1M2V A;  4J9F A;  1KD1 U;  1A0N B;  4HKE A; 
#chains in the Genus database with same CATH homology
 3TSZ A;  2RF0 A;  2RN8 A;  4J9H A;  2DL7 A;  3VS1 A;  4CC4 B;  2A08 A;  4OMN A;  3EHQ A;  3VRY A;  1YNZ A;  3VS7 A;  4D8K A;  1OPL A;  4D8D A;  1H92 A;  1AOJ A;  3TSW A;  4DEY A;  1AVZ C;  3H0I A;  3VS2 A;  4LUD A;  1JEG A;  1SSH A;  2CDT A;  2YT6 A;  2MIO A;  2NUZ A;  1GFC A;  2ED1 A;  2ECZ A;  2JM9 A;  2KRS A;  2GNC A;  1VYT A;  2IIM A;  1M3C A;  3A98 A;  1OPK A;  4LN2 A;  4HXJ A;  2YSQ A;  1AWJ A;  2YUN A;  2X3X D;  3UF4 A;  1N5Z A;  2RQR A;  1CSK A;  4OMO A;  5EC7 A;  4J9D A;  2AK5 A;  4LE9 A;  2L0A A;  4J9I A;  1X69 A;  1X43 A;  2FRY A;  1X27 A;  2OAW A;  1EFN A;  1UFF A;  2CH4 A;  4J9G A;  2CRE A;  2M0Y A;  4J9C A;  1M27 C;  2W0Z A;  2LJ3 A;  2VKN A;  2ABL A;  4E6R A;  1V1C A;  2EVR A;  1GCQ C;  1NEG A;  2FEI A;  1GRI A;  1UUE A;  2KRM A;  2JXB A;  5L23 A;  2KBT A;  4AFS C;  1VYU A;  1GBQ A;  1LCK A;  2AKK A;  1YCS B;  3PVQ A;  2JM8 A;  2A28 A;  4AFQ C;  2KR3 A;  2EBP A;  4HVV A;  1UE9 A;  2M51 A;  4Z89 A;  1T0J A;  2W10 A;  3EG2 A;  2O2O A;  5I11 A;  4HVU A;  1NYG A;  1GCP A;  4JZ4 A;  2ESW A;  3H41 A;  2FPF A;  2KRO A;  4F14 A;  2C0I A;  3C0C A;  1W70 A;  1NG2 A;  4HCK A;  4OMM A;  4F16 A;  1WXT A;  3ZL7 C;  3QWY A;  2J7I A;  2DBK A;  2L3Q A;  2DL4 A;  2H8H A;  3UAT A;  3EG1 A;  1ABQ A;  2EYY A;  1ZSG A;  4RTY A;  2EYW A;  4FSS A;  2P4R A;  4OMP A;  1H8K A;  1UJY A;  2JT4 A;  2LMJ A;  1M8M A;  2B86 A;  1PKT A;  1XOV A;  3SEM A;  2PNI A;  1WDX A;  4IIO A;  4JJD A;  3M0R A;  2LX7 A;  2FPD A;  4J9E A;  2LQN A;  2KXD A;  2SEM A;  3REA B;  1I0C A;  1SRM A;  2CUD A;  2DMO A;  2KXC A;  1YN8 A;  3EG0 A;  1GFD A;  3O5Z A;  1AZG B;  1UDL A;  4JZ3 A;  4LUE A;  2K6D A;  3IQL A;  1QKW A;  2K3B A;  1UJ0 A;  3VS5 A;  2EKH A;  2DNU A;  4IIM A;  5IHI A;  1QCF A;  2J05 A;  2HEQ A;  4JJC A;  2SRC A;  5IHN A;  1KIK A;  3NPF A;  1YWP A;  1NLP C;  2KNB B;  1QWE A;  2BZ8 A;  3ULR B;  4QT7 A;  2FG0 A;  2FO0 A;  1JXO A;  2DL3 A;  1H3H A;  2O9S A;  4DEX A;  4M4Z A;  2VWF A;  1BK2 A;  2PZ1 A;  1SRL A;  4RUG A;  2OJ2 A;  1X2Q A;  2D8J A;  1QKX A;  2YUO A;  1FYN A;  1UEC A;  1U06 A;  2XMF A;  1GCQ A;  1WA7 A;  2BZY A;  2D1X A;  1QLY A;  2DL5 A;  4ZNX A;  2G6F X;  2AKL A;  2F2V A;  3EG3 A;  1UTI A;  2E5K A;  2V1Q A;  3M0T A;  2AZV A;  2LP5 A;  2ED0 A;  2DYB A;  2EGA A;  2KEA A;  3PE0 A;  4OML A;  3THK A;  4AG1 C;  1FMK A;  2PTK A;  2LNH B;  3VS3 A;  5I22 A;  1PRL C;  2DM1 A;  3VS6 A;  2KGT A;  1U5S A;  1HSQ A;  2J06 A;  4RTT A;  1SHG A;  2GQI A;  5FWC A;  4X1V A;  4RTV A;  2MCN A;  2D0N A;  1WI7 A;  2LJ0 A;  1I1J A;  1TUC A;  2CSQ A;  1ZUU A;  1AZE A;  2HBW A;  1PRM C;  4ESR A;  1G2B A;  1UHF A;  1JQQ A;  1TG0 A;  1RLP C;  2EGE A;  2AZS A;  2C0T A;  4GBQ A;  1WXU A;  3M0Q A;  1ABO A;  2BTT A;  1WX6 A;  5FWB A;  1K9A A;  3U23 A;  4Y92 A;  4Z8A A;  1JU5 C;  4HVW A;  2DLP A;  2JTE A;  2RNA A;  1ZUY A;  2O31 A;  2DX1 A;  2EPD A;  1HJD A;  1B07 A;  1X6B A;  1CKB A;  1GL5 A;  5IH2 A;  5GJW B;  4OMQ A;  4RTW A;  2A37 A;  1ZUK A;  2MOX A;  5GJV B;  3I35 A;  1MV3 A;  1NM7 A;  2D8H A;  1IO6 A;  3M0S A;  1X2K A;  1B3Q A;  2EYZ A;  3GBQ A;  5HCK A;  4AG2 C;  2DL8 A;  2KYB A;  1SPK A;  2K79 A;  3NHN A;  2LCS A;  1T3S A;  1SEM A;  1K1Z A;  2V1R A;  3I5S A;  2EW3 A;  2I0N A;  1PNJ A;  3RNJ A;  1Z9Z A;  3FJ5 A;  1UHC A;  3R6N A;  1ARK A;  1K0X A;  1W6X A;  4CC7 A;  3LH5 A;  2L3P A;  4K11 A;  3VS0 A;  1MV0 B;  5IXB A;  1PWT A;  1OV3 A;  2RQT A;  3I5R A;  3KFV A;  1Y0M A;  1J3T A;  1K76 A;  1Y57 A;  2LJ1 A;  5IXF A;  1U3O A;  1AD5 A;  4RTU A;  1M3A A;  3M0P A;  2BZX A;  2DA9 A;  1ZLM A;  4CC2 A;  1CKA A;  1NYF A;  3CQT A;  2GTJ A;  2GGR A;  4R0K A;  3PVL A;  4Z88 A;  4F17 A;  1OEB A;  2KT1 A;  1AWW A;  2KRN A;  1AWX A;  2LQW A;  4RTX A;  2JMA A;  1M3B A;  2ROT A;  1G83 A;  1JXM A;  2JS2 A;  2X3W D;  2O88 A;  2L2P A;  1WYX A;  2JMC A;  2VVK A;  3I9Q A;  4J9B A;  4ORZ A;  1Z9Q A;  3REB B;  2DIL A;  3H0H A;  2HDA A;  1VA7 A;  1QWF A;  1T3L A;  1RUW A;  2DRK A;  2FRW A;  5FW9 A;  1WFW A;  1YWO A;  3UA7 A;  5IHK A;  3H0F A;  4GLM A;  1VYV A;  1T0H A;  4WCI A;  2HSP A;  1E7O A;  3QWX X;  4A63 B;  2J6K A;  1M30 A;  2KYM A;  2K9G A;  3M0U A;  2O9V A;  1NLO C;  1KSW A;  1RI9 A;  1S1N A;  1E6H A;  3NGP A;  2J6F A;  2F2W A;  3VS4 A;  1WIE A;  2C0O A;  1KFZ A;  2DF6 A;  3EHR A;  2EYX A;  4CC3 A;  2CUB A;  1UG1 A;  2GBQ A;  1K4U S;  2EQI A;  4RTZ A;  3UA6 A;  2A36 A;  1WLP B;  2ENM A;  3RBB B;  4EIK A;  1GBR A;  5ECA A;  1BB9 A;  2K2M A;  1TUD A;  2HCK A;  1W1F A;  1NEB A;  1BU1 A;  1MUZ A;  4JJB A;  3NMZ C;  2YUP A;  1AEY A;  1JO8 A;  2RMO A;  3JV3 A;  1WXB A;  1HD3 A;  2F2X A;  1ZX6 A;  3TVT A;  4AFU C;  2JS0 A;  2CH4 W;  3EGU A;  3VRZ A;  1RLQ C;  4JPB W;  4LNP A;  2FPE A;  1PHT A;  1AWO A;  4AFZ C;  2YDL A;  2DE0 X;  2CSI A;  2LZ6 B;  2DBM A;  1KJW A;  2DVJ A;  2KT8 A;  1X6G A;  1YP5 A;  2OI3 A;  2YUQ A;  1SHF A;  3SHW A;  2GTO A;  2JW4 A;  1I07 A;  2DRM A;  1BBZ A;  2K7A A;  1UGV A;  2EGC A;  1OOT A;  1E6G A;  2CT4 A;  1ZBJ A;  2DJQ A;  2RQV A;  2RQW A;  2RPN A;  2NWM A;  2RQU A;  1PKS A;  2QDL A;  1K0S A;  2KE9 A;  2L3S A;  2CT3 A;  2J6O A;  4J9F A;  4KRT A;  1A0N B;  2ROL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...