2K9GA

Solution structure of the third sh3 domain of the cin85 adapter protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
SMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords SH3 domain-containing kinase-binding protein 1
publication title Solution structure of the Sh3-C domain of Cin85
rcsb
source organism Homo sapiens
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k9gA00
4RTXA 1SRMA 5IHKA 1Y57A 3TVTA 1ZSGA 4F17A 1NYGA 1AEYA 2BZYA 3VS4A 2ROLA 2FRYA 3NGPA 3I5SA 1OOTA 2CT4A 2CH4A 2L0AA 4RTYA 3NHNA 1CSKA 1QWEA 1W1FA 2DL4A 2LP5A 1YN8A 1PRLC 2KRNA 1E6HA 1K1ZA 2DL8A 1AWXA 1KSWA 2JW4A 2K6DA 1A0NB 2CUBA 2EYYA 2DX1A 2FG0A 2KYBA 1OPKA 4QT7A 4F16A 1WFWA 2PTKA 2RNAA 4Y92A 2P4RA 3VS5A 3M0PA 2B86A 3EHRA 1ZUUA 2FPDA 2L3SA 2KRSA 3H41A 3R6NA 1PKSA 2JTEA 1LCKA 2JS2A 1W70A 1YNZA 2F2WA 1ZLMA 3EG1A 2GBQA 2EYXA 2RQWA 1K0XA 1GFCA 1T0HA 1JXMA 1QKXA 2XMFA 1X2KA 4J9DA 4OMLA 2D8HA 1H92A 1RI9A 1ABQA 1WDXA 1JU5C 2IIMA 1B07A 4RTVA 2CUDA 2A08A 2D1XA 2DL7A 4OMOA 2DL5A 1RLQC 2V1QA 4K11A 2J6FA 2K3BA 3IQLA 1G2BA 3EG3A 4LNPA 4OMMA 1AVZC 3TSZA 1CKBA 4R0KA 4RTZA 1UFFA 2EW3A 4J9BA 1GRIA 1ZX6A 4ZNXA 1TG0A 2KE9A 4WCIA 1FMKA 4AG1C 2EPDA 4AFQC 1ZUYA 3VS0A 4GLMA 2DRKA 4Z89A 1J3TA 1V1CA 2ED1A 1UE9A 4AFUC 1ZBJA 1JXOA 2CREA 2DBKA 1PKTA 1UHFA 3U23A 2YUPA 2DBMA 2C0OA 2V1RA 2ESWA 1K0SA 5IHIA 1OPLA 2DE0X 2YUQA 2KXDA 3EG2A 4CC4B 2FRWA 1H3HA 2DILA 2W0ZA 2LJ3A 2DJQA 1OV3A 4RTUA 3RNJA 3TSWA 1WIEA 2GNCA 1TUDA 4GBQA 1I07A 1UJYA 2X3WD 4JJCA 2O9VA 5GJVB 2MIOA 1NG2A 3M0TA 1U3OA 1UJ0A 4JZ3A 1M30A 2JS0A 1M3AA 4LUDA 4ESRA 2EVRA 2LJ1A 3REBB 2YT6A 2KT1A 4X1VA 2LCSA 2K79A 2KROA 3M0UA 4D8DA 1HJDA 3I35A 1UTIA 2D0NA 2DMOA 3PVLA 4HCKA 3RBBB 2DRMA 1X2QA 4A63B 2EGEA 3SEMA 3H0FA 2YDLA 2AZVA 2A37A 2KEAA 2K7AA 1GCPA 5ECAA 3UA6A 2CSQA 1SEMA 3FJ5A 2YUOA 2RQRA 1T0JA 2JMAA 1X6GA 2LMJA 2DVJA 2OAWA 1BU1A 3VS1A 3ZL7C 2MOXA 1I0CA 1Z9ZA 1XOVA 3VS3A 1JO8A 3EGUA 1E7OA 2ED0A 2FEIA 3VS6A 2CH4W 4LUEA 2W10A 1QLYA 3I5RA 4J9HA 2FPFA 3C0CA 2DLPA 2M0YA 2D8JA 1BB9A 2GQIA 1M8MA 3QWYA 3UF4A 5GJWB 1Z9QA 2DA9A 3PVQA 4E6RA 2L3PA 1CKAA 2L3QA 1PNJA 3I9QA 2EGCA 2GGRA 2KBTA 1K4US 5FWBA 2KXCA 2JXBA 3H0HA 1UECA 1YCSB 2SEMA 2HEQA 5L23A 1B3QA 1QWFA 1WI7A 2JT4A 2LNHB 1SPKA 2BTTA 4AFSC 4Z88A 2FPEA 3VRYA 1GBRA 2LQWA 2ROTA 4RUGA 5FWCA 3SHWA 1TUCA 1SSHA 1M3CA 1N5ZA 1VA7A 1VYVA 1QKWA 2NUZA 2EKHA 4JPBW 4ORZA 1E6GA 3O5ZA 1AWOA 1WXUA 2ABLA 1X69A 4IIMA 2O31A 1IO6A 1PHTA 4OMNA 3A98A 2EBPA 2E5KA 3KFVA 1JQQA 3H0IA 1GFDA 5I22A 2K9GA 4OMQA 1UGVA 1NEGA 4FSSA 4CC2A 2JM8A 2CSIA 2ENMA 4DEXA 4JZ4A 1EFNA 1BBZA 1KFZA 1UDLA 1NM7A 1RLPC 1UHCA 1UG1A 2CDTA 1WXBA 1YP5A 2O2OA 1WYXA 1FYNA 4JJBA 2C0IA 4J9FA 1T3LA 1AZGB 4J9IA 4JJDA 1K9AA 1NEBA 3M0QA 2JMCA 1PWTA 3JV3A 2RMOA 2L2PA 2K2MA 2F2XA 2F2VA 1OEBA 4HXJA 2EYZA 4F14A 1WXTA 2DYBA 1AWWA 2LJ0A 1H8KA 1M27C 2X3XD 2EYWA 2BZ8A 1UUEA 1WX6A 3LH5A 4Z8AA 4J9EA 1BK2A 2A28A 2AKLA 5IHNA 1SHFA 1GCQC 2SRCA 3GBQA 2KR3A 2J6KA 2YSQA 1VYUA 1K76A 1ABOA 1GBQA 4CC3A 4LN2A 2VKNA 1YWPA 2AK5A 2C0TA 1X27A 2O88A 5IXFA 2GTOA 2PNIA 3THKA 2VVKA 2NWMA 3NMZC 4M4ZA 3VS2A 2CT3A 2DNUA 3QWXX 5IH2A 1X43A 1GCQA 1MV3A 3EG0A 2OI3A 2AKKA 3UA7A 4HVUA 1SHGA 2J06A 4AG2C 2KNBB 4J9GA 2O9SA 2MCNA 4RTTA 1GL5A 1NLOC 2H8HA 2AZSA 1RUWA 5HCKA 2M51A 2JM9A 5IXBA 3NPFA 4HVWA 2LQNA 3M0SA 2J6OA 2LX7A 1JEGA 1HD3A 1AOJA 2KGTA 2OJ2A 1U5SA 4RTWA 4J9CA 2GTJA 3CQTA 1W6XA 1YWOA 2BZXA 1ZUKA 3VS7A 2FO0A 2DM1A 5FW9A 1WLPB 5EC7A 1X6BA 4KRTA 2QDLA 2RQTA 2RQVA 2YUNA 2ECZA 1QCFA 4CC7A 1VYTA 2HBWA 5I11A 2DF6A 2KRMA 1MV0B 2KYMA 1NLPC 2PZ1A 2VWFA 1WA7A 3UATA 1SRLA 3M0RA 1M3BA 4D8KA 1NYFA 2HCKA 4HVVA 4AFZC 2EQIA 3REAB 1T3SA 2J05A 1AWJA 2RN8A 1HSQA 4DEYA 1I1JA 2KT8A 3EHQA 3VRZA 2RQUA 1ARKA 2RPNA 1S1NA 1AD5A 1G83A 1Y0MA 3ULRB 2EGAA 2J7IA 2I0NA 2RF0A 1AZEA 4OMPA 2HDAA 3PE0A 2DL3A 4LE9A 1U06A 1MUZA 2LZ6B 1KIKA 2HSPA 4IIOA 1KJWA 2G6FX 1PRMC 2A36A 4EIKA
chains in the Genus database with same CATH superfamily
1KHCA 4OB1B 4RTXA 3DB3A 2ZPEB 2V8KA 1Y57A 4QQDA 1ZSGA 3NFCA 3G4SQ 1OOTA 5FLXE 2CH4A 4M77G 4C0ZA 4KT0E 4PLLA 5LJ5h 1CSKA 4M7AG 1W1FA 5CKBA 3NTKA 4E7ZA 1YN8A 4LDVA 2JJ9A 1M9SA 5A0GA 3OA6A 1M90R 2EYYA 4BE1A 1R8OB 5EG2A 4F16A 1WFWA 3JCMV 4Y92A 2P4RA 3VS5A 4CI0C 3M0PA 2P0PA 2FPDA 1S72A 2KRSA 1VQ8T 1PKSA 2JTEA 2M02A 5D6YA 3H6ZA 3CCLQ 1YNZA 4F7UG 1ZA1B 1VQ9Q 4OB0B 1K0XA 1M2VB 2LDMA 5DLOA 1QKXA 2XMFA 4J9DA 3LH0A 5GMKh 2OTLT 3HRSA 4XAXB 3Q1JA 1JU5C 2IIMA 4RTVA 2A08A 3CCRA 3OMGA 1YI2A 2V1QA 1H641 5KYUB 4HT9A 3KBGA 4OVAA 4OMMA 4KGXB 5CCAA 1CKBA 1BI1A 1WQWA 4PFOA 2CZ6B 4RTZA 4J9BA 4ZNXA 3OYEA 1TG0A 3CPWA 4ZTJA 2JNGA 5KCHA 2KVQG 2EPDA 1ZUYA 4LXCA 1I81A 4AFUC 4JJNK 1JXOA 2E6ZA 3EH2A 2PVOB 3RKXA 2QQ9A 5GANg 2C0OA 2V1RA 2ESWA 4C8QF 3LW5E 5DM7R 3CXCA 4FT4A 2EKOA 5CKDA 4ELYC 2QTXA 3MP8A 4MZTA 1H3HA 2LC4A 1YIJQ 1RADB 3CBOA 4JUVA 5KH6A 4LD6A 2KQWA 3TSWA 2OTJQ 5LJ5e 4GBQA 2LQ8A 1W2BP 4GY5A 2X3WD 5GJVB 2MIOA 5I21A 1M30A 1RAAB 2HAXA 4PKCC 4KH0B 3OYYA 2IPOB 2DD4A 4M78D 2EQUA 3HP9A 2LCSA 3G6EQ 1MMAA 2K79A 5LJ3f 3BDLA 4V2SA 1QCOA 3CC7T 2DMOA 3TEEA 2EGEA 3SEMA 3H0FA 3EGDB 1WJSA 4JS5A 5GMKe 3JCMg 1TUGB 2K7AA 3LWIA 2RO0A 1GCPA 2VV5A 1N8RR 4C92A 4XTZA 5LL6S 2DVJA 5GAOl 2MWPA 4XTXA 1I0CA 1WJRA 5CKEA 4UC4A 3VS3A 1JJ2A 1YITA 3JAME 3VS6A 2CH4W 3CMAT 3RR6A 4IUTA 4J9HA 3OBYA 3C0CA 3CCUT 2M0YA 1WHGA 2D8JA 3ASKA 2DETA 2RK1A 3MHXA 3HRTA 3UF4A 1KD1C 5GJWB 4YTLA 1Z9QA 4F7UB 1TSFA 2Y90A 2L3QA 4DOWA 1YJ9Q 2VUBA 2GGRA 4J7IA 3CC2T 2RJEA 3SFMA 1M90U 2K4YA 4C8QG 3H0HA 1AHJB 5GANh 1VQ8Q 2CP0A 3X26B 3OSSC 4Z88A 1N9SA 2FPEA 2LQWA 2ROTA 1VYVA 3L2QA 3BE3A 1Q7YR 2QA4T 1E6GA 5GAOn 2HL5C 2OTLQ 4F7UE 4XU3A 2PUKB 1IO6A 2EAYA 4X9CA 4BI4A 3CCMT 1N6AA 5CKHA 1JQQA 3H0IA 1GFDA 3P8HA 3JCMX 4QQGA 5GAMg 3OYJA 2DXUA 3V8LA 1X75C 4DOVA 4J6WA 3HSBA 2QXFA 2HKNA 4DEXA 3CCVA 1K8AC 1BBZA 4BI3A 4KULA 1M2VA 5GMKm 3EAEA 5C6SA 1M4ZA 1VQ5T 1VQMA 5GANd 1X6OA 1HYOA 2DTIA 4J9FA 4J9IA 1AZGB 1RL2A 2AIRB 3JCMh 4B9XA 1M2OA 3A5ZB 4C92F 3PMIA 1O75A 2ZZDA 2L2PA 1N9RA 4DBQA 2RHIA 2K2MA 4ZGEB 2X51A 4QKUA 2LCCA 2DYBA 4QVZA 3C94A 4PJOC 2RM4A 3CMET 2DFUA 1W2BS 3LH5A 4BY6C 1VQNA 3MEUA 1NE8A 4WF2A 4EMKC 1SHFA 4M75D 5GANe 4M75C 3CCEA 2KR3A 3M53A 2JN0A 2YSQA 2CP3A 1K76A 3CD6Q 1C1AA 1WHKA 4XK8E 1U1TA 3QO3A 1ABOA 2M0OA 3CC7Q 2M16A 1IHVA 2VKNA 2DVEA 2P0KA 2XK0A 2AK5A 2C0TA 2K3XA 2EQMA 2YRDA 3THKA 2YRVA 2VVKA 4RKUE 4KUIA 3JCMd 2BUDA 1PM3A 1N8RU 2DNUA 3R6OA 2E65A 2FVUA 4C0GA 1MV3A 3UA7A 3CCQQ 4HVUA 2E4HA 1RACB 4J9GA 2O9SA 2DPPB 4E7SA 3RDVA 2JM9A 4HVWA 2LQNA 4HCZA 3CMAQ 3LLRA 1JEGA 3BY7A 1XQHA 3M57A 3MEVA 3OS0A 3CCUQ 3EGDA 5J3BA 2OJ2A 4E7LA 1U5SA 4J9CA 3OS2A 1VQPA 5GAMh 4HT8A 1VQ4A 3S6WA 1SG5A 1OX8A 3JCMe 1OYXA 3RKYA 4M77A 3VS7A 3CC2Q 1LJOA 1X6BA 4Y28E 2QGGA 2H3EB 2RQTA 2RQVA 4C92G 1LNXA 4PFPA 1XJWB 4CC7A 1MNDA 4C5GA 3S3OA 4IUPA 2AHJB 2KYMA 2R5AA 5FROA 2VWFA 1QCNA 2JUFA 4FYVB 1ZQ1A 1Q7YU 4F7UA 2QA4Q 1KQ1A 3FLGA 4D8KA 1NYFA 2PU9B 2HCKA 5L8RE 3REAB 1T3SA 3JCMQ 1X01A 1I1JA 3EHQA 3CCMQ 4C5HA 1YJNT 4XTYA 4PJOB 1AD5A 1Y0MA 3URGA 2J7IA 1BKBA 2RF0A 3M59A 3G4SA 3G1JA 2A0FB 3PE0A 4LE9A 4EMKB 1U06A 3VU3C 1MUZA 3M58A 4QQ6A 1C0MA 4IIOA 1OZ3A 4FL6A 2KK4A 1B7TA 2XI9A 3M55A 5CO7A 4EIKA 3UT1A 3CPWP 2QQSA 1SRMA 5IHKA 3UDCA 3TVTA 1KD1R 3OYKA 3RESA 1AEYA 2BZYA 2FRYA 3CCJT 4PJOE 2L8DA 2MPXC 4PJNA 1M5Q1 5GAMe 2X4JA 3MP1A 1VUBA 1QWEA 2DL4A 2LP5A 3CBMA 5IN1A 1PRLC 3A8MB 4PNOA 1E6HA 1K1ZA 2JW4A 1KSWA 3OS1A 2CUBA 2DXCA 2F69A 2DX1A 2KYBA 2PTKA 2E3HA 2E3IA 3EHRA 1ZUUA 2DEUA 3HHTB 3NTIA 3EFOB 3META 2DXTA 1BCOA 3FIFA 1W70A 3QZ9B 1Q82U 1NPPA 1ZLMA 3EG1A 3I56T 4B6MA 1T0HA 5CR2A 4C0FA 4LDXA 4OMLA 2D8HA 1Q81C 2KDSA 1ABQA 2E12A 1WDXA 5A0LA 2FL7A 4FYWB 5LJ5j 5GMKl 4A4GA 2RD1A 2DL5A 3L2RA 2K3BA 4EMGA 1G2BA 3EG3A 3G71T 4M7DD 1I8FA 5LJ5f 3CCST 1QVPA 4R0KA 1K8AR 1UFFA 1W4SA 1ZX6A 2VXFA 4F7UF 1VQLA 2KE9A 1G8XA 4E7JA 1BI3A 2V8IA 3FRNA 2NUTA 1J3TA 1SSFA 2OTJA 3L1AA 1ZBJA 2HMAA 3ZFJA 1U1SA 2CREA 4PL6A 1PKTA 3I55A 3U23A 2DBMA 2EQJA 4XTWA 4LDYA 2XDDA 3OSVA 3G7ZA 1VQ6T 1VQKT 1I5LA 4J7FA 3V7RA 1UGPB 2YUQA 2KXDA 1KQSA 2M1HA 1QVFP 3DKMA 2RHXA 2FRWA 1QVGP 3V7CA 2DILA 1YJWA 2DO3A 4MDWA 2E6NA 3OYMA 3RNJA 1VQ7A 2GNCA 3JB9H 3PGGA 4C5EA 4HCBA 2O9VA 4JLIA 1P92A 4JZ3A 3H9NA 1M3AA 2EVRA 3CEYA 2YT6A 4ZGDB 2LX9A 1NBEB 1YHQA 2WSFE 4HCKA 1YJNQ 2DRMA 3RMSA 2F5TX 2YDLA 2AZVA 4XU1A 2A37A 2X4XA 4PFZA 1WGSA 5ECAA 4AT1B 2V26A 1SEMA 1WHHA 2YUOA 5D7UA 4PJJA 1QQJA 5GAN2 2EJFA 1T0JA 4EDUA 3ER0A 2X4WA 1YJ9A 1BU1A 2MOXA 3QKJA 1Q95G 2ZAEA 2LRQA 3F70A 1WPYA 1UGSB 3CPWS 3BW1A 4OP0A 1KD1U 4LUEA 3I5RA 3OB9A 1G3WA 3CCJQ 1M8MA 3CC4Q 4X9DA 2DA9A 3PVQA 3QZ5B 3WXMB 4E6RA 3PTAA 4M77D 3CXCS 1S72T 2KBTA 5GAOr 1K4US 4M7AD 5FWBA 6AT1B 2KXCA 3EGXB 1MGQA 1M8VA 3L42A 1M1KC 2JOYA 4HCCA 2MAMA 5GAOq 4JRKA 2HEQA 2WSEE 1IRXA 1B3QA 2LNHB 1SPKA 1OU8A 1QP2A 4GLKA 1WNLA 3FEOA 3QDRB 3VRYA 3QYGB 2QEXT 2YLBA 3A8GB 4RUGA 1NJIC 2RHZA 3I56Q 3CCRT 1N5ZA 2FHDA 4IKFA 2EKHA 2X9HA 3M4GA 3QHSA 1YI2T 4PK4A 4JRPA 3KXTA 2WSCE 4MZPA 1X69A 2A7YA 3M5AA 1PHTA 2PVGB 2VB6A 3J80E 2EBPA 3FB9A 2E5KA 2PQWA 5HKCA 4IUUA 4XQ3A 3JB9F 3LGLA 2DTHA 3G71Q 1K8AU 3CCSQ 2ZPBB 1NEGA 4FSSA 2QI2A 4DBRA 2CSIA 3OYFA 4DQ2A 2ENMA 1EFNA 1KFZA 5GAN7 1NM7A 2COWA 4Z02A 4LD9K 1UG1A 4N0AA 4D6WA 5GANf 1VOMA 5HK0A 3GLXA 5LJ3j 3OYDA 1YP5A 2O2OA 1WYXA 2L5QA 2C0IA 4JJBA 1VQ6Q 3OYLA 1VQKQ 1T3LA 1D09B 3C4SA 1NEBA 1JJ2S 4M78C 3CD6A 1WHJA 4JDSA 2F2XA 2QTVA 1OEBA 2EYZA 8AT1B 1WXTA 1Q86C 3OW2A 1IREB 1OULA 3H8ZA 4JS4A 2D6FA 1WX6A 1D1CA 4PJOF 4L59A 2NYSA 1R77A 2R5MA 3SWNA 3EH1A 2SRCA 3GBQA 3BDUA 2O01E 2J6KA 1VYUA 3CCQA 4J8OA 2EQKA 1GBQA 1Y7XA 1Q81R 1QVFA 2MI6A 1QVGA 5KYWB 2E5QA 1X27A 2O88A 2GTOA 2PNIA 1G3SA 5D6XA 3JCMf 4TVRA 3S3NA 2CT3A 4FT2A 2QGFB 3TCJA 4QVCA 2E1HA 5IH2A 1GCQA 2EYQA 3VV0A 4KBMB 2OI3A 1YITT 1SHGA 2J06A 3T9NA 3OMCA 2KSSA 4AG2C 2HSEB 4BB7A 1D3BB 1GL5A 4MMLA 2AZSA 2L3RA 1YFNA 1RUWA 2XU8A 5HCKA 2LQKA 5IXBA 3EG9A 4DBHA 3NPFA 5KE3A 2VASA 3JB9G 1ZSZC 3OY9A 2J6OA 2DXBA 2DTOA 2GQVA 2I2LA 4FW1A 2ZPIB 1AOJA 4O5VA 2LVMA 3GP8A 1S72Q 1MNEA 5A0DA 2FO0A 1WLPB 2YWWA 3M56A 1M1FA 1KC8C 4KRTA 1UB4A 4BDYA 2DYIA 4C8QD 5AYFA 5I11A 5KYXB 2EFIA 2QEXQ 1NLPC 1SF9A 4N4IA 2PZ1A 3OQ5A 1WA7A 3CCRQ 3PT9A 1SRLA 1GXIE 1M3BA 1YI2Q 1UGQB 2XDBA 4HVVA 5GAMj 4M78B 2EQIA 2J05A 1AWJA 1HSQA 4PJOG 3QYHB 3VYGA 2RQUA 3EGXA 1H3ZA 1ARKA 5KYUA 3CCVT 4DA4A 5GAMf 1G83A 2KAFA 3ZEHA 2I0NA 1Y96B 1VQMT 2DL3A 1VQOA 2COYA 3A8HB 1UGRB 3SD4A 4ZN3A 2LZ6B 5FRMA 2HSPA 1KIKA 2BE7D 3HFOA 2DERA 3FC3A 2BIVA 4ZGJB 3E9FA 2A36A 3JB9J 4M78E 1YCYA 4KUDK 1TXQA 2K57A 4RCCA 2NLUA 4C0DC 4FU6A 4E2FB 2JVVA 3I5SA 1VQNT 2CT4A 2KI7A 2L0AA 2DD5A 4RTYA 3NHNA 3OYCA 4KGZB 3M4YA 2KRNA 3CCET 1M1KR 1AWXA 1XNIA 1A0NB 1KQSP 3OS5A 5D6WA 5DY9A 2FG0A 1OPKA 2B86A 4AMCA 1ZSZB 4MDXA 4ZTFA 1MHNA 3GF5A 3RERA 5HK3A 2F2WA 1Q81U 2RQWA 3JB9I 1JXMA 1RAGB 3HRUA 3DLMA 1H92A 2KMTA 1TOVA 2VGNA 1B07A 2CUDA 2D1XA 2DL7A 4OMOA 4HA8A 1RLQC 4K11A 2XD0A 2J6FA 1D0XA 4LNPA 1YITQ 2HL3A 1OX9A 2EW3A 3M9QA 4OB3B 3CPFA 3MEAA 4WCIA 1FMKA 1V76A 1I4K1 3OYBA 1VQPT 2DRKA 5CK9A 1PG5B 1VQ4T 1V1CA 5KYWA 4ZN1A 2DBKA 4O6JA 2CP2A 2QASA 2QYZA 2YUPA 3L2WA 3OBWA 1QP3A 5IHIA 2DE0X 3JCMW 2C06A 3EG2A 3GNFB 1Q86R 4J6YA 1D3BA 3TU4K 2DJZA 4RTUA 2MYSA 1IGUA 1WIEA 2XIDA 1TUDA 4BE0A 2CZ0B 3PNWC 1I07A 1UJYA 2KY9A 4BY6B 4JJCA 4C92D 4JRIA 4EMHA 1NG2A 1U3OA 2JS0A 1ZHIA 4LUDA 3S3MA 4M75B 4ESRA 2GCXA 5GAN6 2RJFA 2RJDA 1VQ5Q 4X1VA 2QAZA 3M0UA 4C0DB 2PVDB 4OF1A 4D8DA 3I35A 1HJDA 3O8VA 3G4ST 2AT1B 2HKQB 5KYNA 3CCVQ 1PCXA 1X2QA 4A63B 3GPLA 3CCLA 1VQMQ 1Y07A 4BD3A 3V8KA 3C95A 4OMFB 3V7SA 2E41A 4IUQA 1VQ9A 5KYXA 2CSQA 2FB7A 5CAIA 3CC4A 1BI0A 1DJ7B 2DZ9A 3VJPA 3CMEQ 2OAWA 3VS1A 2A3LA 3ZL7C 4M75E 4E7IA 1BCMA 2LT1A 1BIAA 1JO8A 3DB4A 2ED0A 2FEIA 3GNGA 4XTUA 5FU6C 2W10A 1IZ6A 3VUZA 4RMOA 3QG1A 2XICA 1BB9A 1VQNQ 3MJXA 4NL3A 2X35A 3QWYA 4XTVA 3LYIA 4XU2A 1KC8R 1CKAA 1M1KU 4JLGA 1YBYA 3CCEQ 2HD0A 2FZCB 1N8RC 1RABB 1KQSS 4DBFA 2JXBA 2LNVA 2QK0A 4Y91A 1YCSB 2YRCA 3GOXA 2SEMA 2LT4A 2VGMA 1WI7A 2JT4A 2BTTA 4AFSC 3J81E 4M7DC 3OW2P 4FW2A 2CP6A 4IUVA 1YIJA 2WACA 5FWCA 1SSHA 1M3CA 1VA7A 1QKWA 1FMVA 3O5ZA 1WXUA 3QBYA 2R58A 2R57A 3RUXA 1OI1A 5GMKj 1VQLT 2D0QB 3A98A 5CVIA 4FSXA 2K9GA 4OMQA 3OYAA 3G6EA 2OTJT 4CC2A 3I55T 3QSUA 3QXEB 5GMKi 2CKKA 1VQPQ 4JZ4A 1VQ4Q 1UDLA 3PMTA 1UHCA 1NZ9A 3X20B 1WXBA 1JB0E 1FYNA 1MMNA 1K73C 1RAIB 2GFUA 1YJWT 4JJDA 1D0YA 1K9AA 3M0QA 1HK9A 3QJ6A 2E10A 1I5OB 1VQ7T 1FXXA 2RMOA 3MKDA 1Q86U 2F2VA 1KK7A 4R55A 4ANJA 4Q5WA 2LJ0A 1H8KA 1AWWA 1M27C 1KHIA 2BZ8A 2NUPB 1UUEA 4Z8AA 2G3RA 4J9EA 5FU7C 3HPWA 2XDPA 3PIOA 2QG9B 1YHQT 3PFSA 5DLQE 4EPCA 5FU6B 2DIQA 1D1BA 1D1AA 1PSEA 2P84A 4CC3A 1TTHB 1BI2A 4LN2A 3V8JA 2RI2A 1VQ8A 4MMKA 2BKDN 2NWMA 4L5GA 4PJOA 3JRZA 3HL8A 4M4ZA 1YJ9T 2XHCA 2ZGWA 3QWXX 2HZYA 1OZ2A 4EMKA 3C12A 1X43A 3VKIA 3EG0A 3WVEB 4M75A 2OTLA 5AT1B 2AKKA 4M77C 4FCYA 4M7DB 4M7AC 4RTTA 1NLOC 4J83A 2H8HA 1ZA2B 2O4XB 3HFNA 2RA2A 5KE2A 2DIGA 5FRNA 3E1SA 3M0SA 1EX4A 1Q82C 1HD3A 1EIFA 2QEXA 3EFRA 2MK5A 2VC8A 2RK2A 4OB2B 1KC8U 1YWOA 4FIBA 1ZUKA 3MP6A 4KH1B 2Y4YA 5LJ5d 5EC7A 1QW1A 4M7DE 2QDLA 2CZ7B 2GF7A 2YUNA 3OW2S 2HBWA 3EFOA 2DF6A 5GANj 2K5FA 3M0RA 4M78G 1RI0A 3RMQA 2F1LA 2P4TA 5LJ3g 2RN8A 1G3TA 4DEYA 3VRZA 2KT8A 1VQLQ 1AT1B 3CBPA 1U8RA 1QVFS 2P0QA 2DAQA 3HKSA 1QVGS 4IURA 1AZEA 3I55Q 5FU7B 5J39A 3CC7A 2HDAA 1WJQA 4BE2A 1K9MC 4J5YA 2IG0A 1OQKA 2IVWA 4LDUA 2K3YA 2ZPFB 3CD6T 1PRMC 4PJMA 1WHLA 1YJWQ 2JTFA 1IHWA 4X34A 2OAUA 4A4HA 1SKUB 1VQ7Q 1OU9A 4F17A 1NYGA 3VS4A 4E7KA 2ROLA 4JRQA 4M75F 3NGPA 4J6XA 2ATCB 3CMAA 4M77B 1LPLA 2K6DA 2DL8A 3QJYA 3CCUA 4A4FA 4ME7A 4M7AB 3CCQT 4C5IA 1MMGA 5GAN3 2MWOA 4QT7A 2ZPHB 5CIUA 1YHQQ 2RNAA 5HY6A 2L3SA 3H41A 3VUBA 1EZZB 1ZBXA 3R6NA 4RG2A 1LCKA 3CC2A 2JS2A 1MMDA 1ACMB 2GBQA 2ZPGB 2EYXA 1GFCA 1RAEB 3INZA 4RG8A 3OYGA 4WTOB 1X2KA 1FWZA 4NL2A 2X4YA 3MO8A 1RI9A 1PC0A 5I2MA 3SDZA 2NUPA 3ZBDA 1TWBA 2L89A 4M77E 4CRIA 2HQEA 1B34B 4M7AE 2QA4A 3X28B 1WZOA 1PSFA 2Y4XA 3IQLA 1AVZC 3TSZA 5IAYA 1G5VA 3BFMA 2CZ1B 1GRIA 4QVDA 3CCMA 4AG1C 3JCMc 4AFQC 3VS0A 4GLMA 4Z89A 2V8JA 4C8QC 2ED1A 1UE9A 5LJ3h 1K73R 1WQ7A 4XU0A 1UHFA 3JB9D 1LOJA 3X25B 1K0SA 5CQXA 4A53A 2DKGA 1OPLA 1UEBA 1VQ5A 2K2VA 4CC4B 3D7SB 2CP5A 4M7DA 2W0ZA 2LJ3A 2DJQA 4A4EA 3P8DA 4OGEA 1PD1A 1OV3A 2O4XA 3JSCA 1IXDA 2CS7A 1FX7A 4E7HA 2FYKA 1NPRA 4M75G 5A2QE 3UWNA 3M0TA 3FDRA 1UJ0A 3VYHB 3EFSA 3CMEA 2LJ1A 3REBB 3DLLA 4E47A 3HTRA 1VIFA 2KT1A 2KROA 5LJ3d 1UTIA 3SB2A 3OYIA 2D0NA 1VQOT 2RI5A 3PVLA 3RBBB 4PJOD 2K5LA 2KEAA 2CYZB 3UA6A 3MPUB 2HQXA 3FJ5A 2RQRA 4F04B 5KYYB 1JRIA 2E70A 1X6GA 2JMAA 2LMJA 5C0MA 2QDYB 2PUOB 5CKFA 5GAN5 1Z9ZA 1XOVA 3LWHA 2ZCFB 3KUFA 3LGFA 1Q82R 2H3JA 2NUTB 3EGUA 3TREA 1NJIR 1E7OA 7AT1B 1RAFB 4FYYB 5LJ3e 1O9SA 1QLYA 2B8AA 1BIBA 2FPFA 3A8OB 2DLPA 2GFAA 2GQIA 2Z0WA 5I2SA 1W2BA 1PD0A 2L3PA 2DEQA 1PNJA 3I9QA 2EGCA 3FJPA 3RIRA 1UECA 1N27A 3TQ7P 3PIPA 2FZGB 3QIIA 2VXEA 2RH2A 4C8QB 5L23A 1M90C 2E64A 1QWFA 2YLCA 2RHUA 9ATCB 2K5IA 1GBRA 2D9TA 3SHWA 1TUCA 5M9OA 4M7DF 2XKOC 2EWNA 2NUZA 4JPBW 1HXDA 4ORZA 1VIEA 1AWOA 5J26A 3E19A 4N0AC 2QQBA 2ABLA 4BACA 4IIMA 2O31A 3QPHA 4M7AA 4OMNA 3L2VA 4LDWA 3QUIA 3KFVA 5IT9E 5I22A 1K9MR 3E2UA 4FYXB 2JZ2A 3NTHA 2HBPA 3E9GA 5KCOA 1UGVA 4ELZC 4C8QE 3ME9A 2JM8A 4B9WA 1YJNA 2DK3A 1K73U 2LTOA 4PLIA 1XTDA 1RLPC 1Y71A 4HKEA 2QQAA 2CDTA 3QDFA 4NS5A 4C92C 1TU0B 5GAN8 2RJCA 3RKWA 3SWNC 1IGQA 2JMCA 1B34A 1PWTA 3JV3A 4R56A 5GAMd 4BDZA 2QQRA 2EJ9A 4FM4B 2MF2A 4HXJA 4L6V5 4F14A 2CP7A 2COZA 4KGVB 2FZKB 2X3XD 1BYMA 4A4KA 1C6VX 2EYWA 1RAHB 3AT1B 3CCJA 1BK2A 2A28A 3L2UA 2AKLA 3L2ZA 1KG1A 2EIFA 5IHNA 2EJGA 1GCQC 4QW2A 2M9UA 2RB6A 3P8BB 3A1PA 4M78A 3CCLT 1R0BG 4MZMA 1VQ9T 2HNIA 1VQOQ 1YWPA 4OGCA 5IXFA 3CC4T 2MMPA 2RI3A 1QMCA 3NMZC 1IB8A 2OX7A 3VS2A 3CXCP 1Y96A 2YXYA 3I56A 4M7DG 3LX7A 1FMWA 1JBMA 5CQYA 3X24B 5LJ5g 2LCLA 2KNBB 2MCNA 4PJLA 1V29B 2DZCA 4BUGA 4M77F 2M51A 1NJIU 4M7AF 2JTMA 3G71A 1R0CB 3OYNA 3CCSA 2LX7A 1M1GA 2VYTA 3AHUA 2KGTA 4RTWA 2GTJA 3M54A 5GAOm 3CQTA 1W6XA 1LVKA 5KYYA 2BZXA 4VUBA 4A54A 2DM1A 5FW9A 3GIBA 5GAN4 2F5KA 1VQ6A 1VQKA 1YIJT 4NOYA 4N4HA 2ECZA 1QCFA 1ZSZA 3MCAB 2RHYA 1G3YA 1VYTA 2KRMA 1MV0B 4C92B 3WVDB 3JCMJ 4ATOA 3MEWA 3UPUA 3UATA 1WHMA 3SWNB 1D0ZA 4AFZC 3N5BB 5GAOp 3G6ET 1JJ2P 2BE9B 1TS9A 1Q7YC 1KQ2A 2CGHA 2XG8D 3J7AF 4BI8B 4N4GA 1K9MU 2RPNA 1S1NA 2YHTA 4C8QA 3ULRB 2EGAA 1F1BB 8ATCB 1TH7A 4OMPA 4P5NA 4M78F 4C92E 3JCMb 4II1A 1KJWA 4RCBA 2HQHA 3A8LB 2G6FX 3OYHA 3JCMP 3EG9B
chains in the Genus database with same CATH topology
4RTXA 1SRMA 5IHKA 1Y57A 3TVTA 1ZSGA 4F17A 1NYGA 1AEYA 2BZYA 3VS4A 2ROLA 2FRYA 3NGPA 3I5SA 1OOTA 2CT4A 2CH4A 2L0AA 4RTYA 3NHNA 1CSKA 1QWEA 1W1FA 2DL4A 2LP5A 1YN8A 1PRLC 2KRNA 1E6HA 1K1ZA 2DL8A 1AWXA 1KSWA 2JW4A 2K6DA 1A0NB 2CUBA 2EYYA 2DX1A 2FG0A 2KYBA 1OPKA 4QT7A 4F16A 1WFWA 2PTKA 2RNAA 4Y92A 2P4RA 3VS5A 3M0PA 2B86A 3EHRA 1ZUUA 2FPDA 2L3SA 2KRSA 3H41A 3R6NA 1PKSA 2JTEA 1LCKA 2JS2A 1W70A 1YNZA 2F2WA 1ZLMA 3EG1A 2GBQA 2EYXA 2RQWA 1K0XA 1GFCA 1T0HA 1JXMA 1QKXA 2XMFA 1X2KA 4J9DA 4OMLA 2D8HA 1H92A 1RI9A 1ABQA 1WDXA 1JU5C 2IIMA 1B07A 4RTVA 2CUDA 2A08A 2D1XA 2DL7A 4OMOA 2DL5A 1RLQC 2V1QA 4K11A 2J6FA 2K3BA 3IQLA 1G2BA 3EG3A 4LNPA 4OMMA 1AVZC 3TSZA 1CKBA 4R0KA 4RTZA 1UFFA 2EW3A 4J9BA 1GRIA 1ZX6A 4ZNXA 1TG0A 2KE9A 4WCIA 1FMKA 4AG1C 2EPDA 4AFQC 1ZUYA 3VS0A 4GLMA 2DRKA 4Z89A 1J3TA 1V1CA 2ED1A 1UE9A 4AFUC 1ZBJA 1JXOA 2CREA 2DBKA 1PKTA 1UHFA 3U23A 2YUPA 2DBMA 2C0OA 2V1RA 2ESWA 1K0SA 5IHIA 1OPLA 2DE0X 2YUQA 2KXDA 3EG2A 4CC4B 2FRWA 1H3HA 2DILA 2W0ZA 2LJ3A 2DJQA 1OV3A 4RTUA 3RNJA 3TSWA 1WIEA 2GNCA 1TUDA 4GBQA 1I07A 1UJYA 2X3WD 4JJCA 2O9VA 5GJVB 2MIOA 1NG2A 3M0TA 1U3OA 1UJ0A 4JZ3A 1M30A 2JS0A 1M3AA 4LUDA 4ESRA 2EVRA 2LJ1A 3REBB 2YT6A 2KT1A 4X1VA 2LCSA 2K79A 2KROA 3M0UA 4D8DA 1HJDA 3I35A 1UTIA 2D0NA 2DMOA 3PVLA 4HCKA 3RBBB 2DRMA 1X2QA 4A63B 2EGEA 3SEMA 3H0FA 2YDLA 2AZVA 2A37A 2KEAA 2K7AA 1GCPA 5ECAA 3UA6A 2CSQA 1SEMA 3FJ5A 2YUOA 2RQRA 1T0JA 2JMAA 1X6GA 2LMJA 2DVJA 2OAWA 1BU1A 3VS1A 3ZL7C 2MOXA 1I0CA 1Z9ZA 1XOVA 3VS3A 1JO8A 3EGUA 1E7OA 2ED0A 2FEIA 3VS6A 2CH4W 4LUEA 2W10A 1QLYA 3I5RA 4J9HA 2FPFA 3C0CA 2DLPA 2M0YA 2D8JA 1BB9A 2GQIA 1M8MA 3QWYA 3UF4A 5GJWB 1Z9QA 2DA9A 3PVQA 4E6RA 2L3PA 1CKAA 2L3QA 1PNJA 3I9QA 2EGCA 2GGRA 2KBTA 1K4US 5FWBA 2KXCA 2JXBA 3H0HA 1UECA 1YCSB 2SEMA 2HEQA 5L23A 1B3QA 1QWFA 1WI7A 2JT4A 2LNHB 1SPKA 2BTTA 4AFSC 4Z88A 2FPEA 3VRYA 1GBRA 2LQWA 2ROTA 4RUGA 5FWCA 3SHWA 1TUCA 1SSHA 1M3CA 1N5ZA 1VA7A 1VYVA 1QKWA 2NUZA 2EKHA 4JPBW 4ORZA 1E6GA 3O5ZA 1AWOA 1WXUA 2ABLA 1X69A 4IIMA 2O31A 1IO6A 1PHTA 4OMNA 3A98A 2EBPA 2E5KA 3KFVA 1JQQA 3H0IA 1GFDA 5I22A 2K9GA 4OMQA 1UGVA 1NEGA 4FSSA 4CC2A 2JM8A 2CSIA 2ENMA 4DEXA 4JZ4A 1EFNA 1BBZA 1KFZA 1UDLA 1NM7A 1RLPC 1UHCA 1UG1A 2CDTA 1WXBA 1YP5A 2O2OA 1WYXA 1FYNA 4JJBA 2C0IA 4J9FA 1T3LA 1AZGB 4J9IA 4JJDA 1K9AA 1NEBA 3M0QA 2JMCA 1PWTA 3JV3A 2RMOA 2L2PA 2K2MA 2F2XA 2F2VA 1OEBA 4HXJA 2EYZA 4F14A 1WXTA 2DYBA 1AWWA 2LJ0A 1H8KA 1M27C 2X3XD 2EYWA 2BZ8A 1UUEA 1WX6A 3LH5A 4Z8AA 4J9EA 1BK2A 2A28A 2AKLA 5IHNA 1SHFA 1GCQC 2SRCA 3GBQA 2KR3A 2J6KA 2YSQA 1VYUA 1K76A 1ABOA 1GBQA 4CC3A 4LN2A 2VKNA 1YWPA 2AK5A 2C0TA 1X27A 2O88A 5IXFA 2GTOA 2PNIA 3THKA 2VVKA 2NWMA 3NMZC 4M4ZA 3VS2A 2CT3A 2DNUA 3QWXX 5IH2A 1X43A 1GCQA 1MV3A 3EG0A 2OI3A 2AKKA 3UA7A 4HVUA 1SHGA 2J06A 4AG2C 2KNBB 4J9GA 2O9SA 2MCNA 4RTTA 1GL5A 1NLOC 2H8HA 2AZSA 1RUWA 5HCKA 2M51A 2JM9A 5IXBA 3NPFA 4HVWA 2LQNA 3M0SA 2J6OA 2LX7A 1JEGA 1HD3A 1AOJA 2KGTA 2OJ2A 1U5SA 4RTWA 4J9CA 2GTJA 3CQTA 1W6XA 1YWOA 2BZXA 1ZUKA 3VS7A 2FO0A 2DM1A 5FW9A 1WLPB 5EC7A 1X6BA 4KRTA 2QDLA 2RQTA 2RQVA 2YUNA 2ECZA 1QCFA 4CC7A 1VYTA 2HBWA 5I11A 2DF6A 2KRMA 1MV0B 2KYMA 1NLPC 2PZ1A 2VWFA 1WA7A 3UATA 1SRLA 3M0RA 1M3BA 4D8KA 1NYFA 2HCKA 4HVVA 4AFZC 2EQIA 3REAB 1T3SA 2J05A 1AWJA 2RN8A 1HSQA 4DEYA 1I1JA 2KT8A 3EHQA 3VRZA 2RQUA 1ARKA 2RPNA 1S1NA 1AD5A 1G83A 1Y0MA 3ULRB 2EGAA 2J7IA 2I0NA 2RF0A 1AZEA 4OMPA 2HDAA 3PE0A 2DL3A 4LE9A 1U06A 1MUZA 2LZ6B 1KIKA 2HSPA 4IIOA 1KJWA 2G6FX 1PRMC 2A36A 4EIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RTX A;  1SRM A;  5IHK A;  1Y57 A;  3TVT A;  1ZSG A;  4F17 A;  1NYG A;  1AEY A;  2BZY A;  3VS4 A;  2ROL A;  2FRY A;  3NGP A;  3I5S A;  1OOT A;  2CT4 A;  2CH4 A;  2L0A A;  4RTY A;  3NHN A;  1CSK A;  1QWE A;  1W1F A;  2DL4 A;  2LP5 A;  1YN8 A;  1PRL C;  2KRN A;  1E6H A;  1K1Z A;  2DL8 A;  1AWX A;  1KSW A;  2JW4 A;  2K6D A;  1A0N B;  2CUB A;  2EYY A;  2DX1 A;  2FG0 A;  2KYB A;  1OPK A;  4QT7 A;  4F16 A;  1WFW A;  2PTK A;  2RNA A;  4Y92 A;  2P4R A;  3VS5 A;  3M0P A;  2B86 A;  3EHR A;  1ZUU A;  2FPD A;  2L3S A;  2KRS A;  3H41 A;  3R6N A;  1PKS A;  2JTE A;  1LCK A;  2JS2 A;  1W70 A;  1YNZ A;  2F2W A;  1ZLM A;  3EG1 A;  2GBQ A;  2EYX A;  2RQW A;  1K0X A;  1GFC A;  1T0H A;  1JXM A;  1QKX A;  2XMF A;  1X2K A;  4J9D A;  4OML A;  2D8H A;  1H92 A;  1RI9 A;  1ABQ A;  1WDX A;  1JU5 C;  2IIM A;  1B07 A;  4RTV A;  2CUD A;  2A08 A;  2D1X A;  2DL7 A;  4OMO A;  2DL5 A;  1RLQ C;  2V1Q A;  4K11 A;  2J6F A;  2K3B A;  3IQL A;  1G2B A;  3EG3 A;  4LNP A;  4OMM A;  1AVZ C;  3TSZ A;  1CKB A;  4R0K A;  4RTZ A;  1UFF A;  2EW3 A;  4J9B A;  1GRI A;  1ZX6 A;  4ZNX A;  1TG0 A;  2KE9 A;  4WCI A;  1FMK A;  4AG1 C;  2EPD A;  4AFQ C;  1ZUY A;  3VS0 A;  4GLM A;  2DRK A;  4Z89 A;  1J3T A;  1V1C A;  2ED1 A;  1UE9 A;  4AFU C;  1ZBJ A;  1JXO A;  2CRE A;  2DBK A;  1PKT A;  1UHF A;  3U23 A;  2YUP A;  2DBM A;  2C0O A;  2V1R A;  2ESW A;  1K0S A;  5IHI A;  1OPL A;  2DE0 X;  2YUQ A;  2KXD A;  3EG2 A;  4CC4 B;  2FRW A;  1H3H A;  2DIL A;  2W0Z A;  2LJ3 A;  2DJQ A;  1OV3 A;  4RTU A;  3RNJ A;  3TSW A;  1WIE A;  2GNC A;  1TUD A;  4GBQ A;  1I07 A;  1UJY A;  2X3W D;  4JJC A;  2O9V A;  5GJV B;  2MIO A;  1NG2 A;  3M0T A;  1U3O A;  1UJ0 A;  4JZ3 A;  1M30 A;  2JS0 A;  1M3A A;  4LUD A;  4ESR A;  2EVR A;  2LJ1 A;  3REB B;  2YT6 A;  2KT1 A;  4X1V A;  2LCS A;  2K79 A;  2KRO A;  3M0U A;  4D8D A;  1HJD A;  3I35 A;  1UTI A;  2D0N A;  2DMO A;  3PVL A;  4HCK A;  3RBB B;  2DRM A;  1X2Q A;  4A63 B;  2EGE A;  3SEM A;  3H0F A;  2YDL A;  2AZV A;  2A37 A;  2KEA A;  2K7A A;  1GCP A;  5ECA A;  3UA6 A;  2CSQ A;  1SEM A;  3FJ5 A;  2YUO A;  2RQR A;  1T0J A;  2JMA A;  1X6G A;  2LMJ A;  2DVJ A;  2OAW A;  1BU1 A;  3VS1 A;  3ZL7 C;  2MOX A;  1I0C A;  1Z9Z A;  1XOV A;  3VS3 A;  1JO8 A;  3EGU A;  1E7O A;  2ED0 A;  2FEI A;  3VS6 A;  2CH4 W;  4LUE A;  2W10 A;  1QLY A;  3I5R A;  4J9H A;  2FPF A;  3C0C A;  2DLP A;  2M0Y A;  2D8J A;  1BB9 A;  2GQI A;  1M8M A;  3QWY A;  3UF4 A;  5GJW B;  1Z9Q A;  2DA9 A;  3PVQ A;  4E6R A;  2L3P A;  1CKA A;  2L3Q A;  1PNJ A;  3I9Q A;  2EGC A;  2GGR A;  2KBT A;  1K4U S;  5FWB A;  2KXC A;  2JXB A;  3H0H A;  1UEC A;  1YCS B;  2SEM A;  2HEQ A;  5L23 A;  1B3Q A;  1QWF A;  1WI7 A;  2JT4 A;  2LNH B;  1SPK A;  2BTT A;  4AFS C;  4Z88 A;  2FPE A;  3VRY A;  1GBR A;  2LQW A;  2ROT A;  4RUG A;  5FWC A;  3SHW A;  1TUC A;  1SSH A;  1M3C A;  1N5Z A;  1VA7 A;  1VYV A;  1QKW A;  2NUZ A;  2EKH A;  4JPB W;  4ORZ A;  1E6G A;  3O5Z A;  1AWO A;  1WXU A;  2ABL A;  1X69 A;  4IIM A;  2O31 A;  1IO6 A;  1PHT A;  4OMN A;  3A98 A;  2EBP A;  2E5K A;  3KFV A;  1JQQ A;  3H0I A;  1GFD A;  5I22 A;  2K9G A;  4OMQ A;  1UGV A;  1NEG A;  4FSS A;  4CC2 A;  2JM8 A;  2CSI A;  2ENM A;  4DEX A;  4JZ4 A;  1EFN A;  1BBZ A;  1KFZ A;  1UDL A;  1NM7 A;  1RLP C;  1UHC A;  1UG1 A;  2CDT A;  1WXB A;  1YP5 A;  2O2O A;  1WYX A;  1FYN A;  4JJB A;  2C0I A;  4J9F A;  1T3L A;  1AZG B;  4J9I A;  4JJD A;  1K9A A;  1NEB A;  3M0Q A;  2JMC A;  1PWT A;  3JV3 A;  2RMO A;  2L2P A;  2K2M A;  2F2X A;  2F2V A;  1OEB A;  4HXJ A;  2EYZ A;  4F14 A;  1WXT A;  2DYB A;  1AWW A;  2LJ0 A;  1H8K A;  1M27 C;  2X3X D;  2EYW A;  2BZ8 A;  1UUE A;  1WX6 A;  3LH5 A;  4Z8A A;  4J9E A;  1BK2 A;  2A28 A;  2AKL A;  5IHN A;  1SHF A;  1GCQ C;  2SRC A;  3GBQ A;  2KR3 A;  2J6K A;  2YSQ A;  1VYU A;  1K76 A;  1ABO A;  1GBQ A;  4CC3 A;  4LN2 A;  2VKN A;  1YWP A;  2AK5 A;  2C0T A;  1X27 A;  2O88 A;  5IXF A;  2GTO A;  2PNI A;  3THK A;  2VVK A;  2NWM A;  3NMZ C;  4M4Z A;  3VS2 A;  2CT3 A;  2DNU A;  3QWX X;  5IH2 A;  1X43 A;  1GCQ A;  1MV3 A;  3EG0 A;  2OI3 A;  2AKK A;  3UA7 A;  4HVU A;  1SHG A;  2J06 A;  4AG2 C;  2KNB B;  4J9G A;  2O9S A;  2MCN A;  4RTT A;  1GL5 A;  1NLO C;  2H8H A;  2AZS A;  1RUW A;  5HCK A;  2M51 A;  2JM9 A;  5IXB A;  3NPF A;  4HVW A;  2LQN A;  3M0S A;  2J6O A;  2LX7 A;  1JEG A;  1HD3 A;  1AOJ A;  2KGT A;  2OJ2 A;  1U5S A;  4RTW A;  4J9C A;  2GTJ A;  3CQT A;  1W6X A;  1YWO A;  2BZX A;  1ZUK A;  3VS7 A;  2FO0 A;  2DM1 A;  5FW9 A;  1WLP B;  5EC7 A;  1X6B A;  4KRT A;  2QDL A;  2RQT A;  2RQV A;  2YUN A;  2ECZ A;  1QCF A;  4CC7 A;  1VYT A;  2HBW A;  5I11 A;  2DF6 A;  2KRM A;  1MV0 B;  2KYM A;  1NLP C;  2PZ1 A;  2VWF A;  1WA7 A;  3UAT A;  1SRL A;  3M0R A;  1M3B A;  4D8K A;  1NYF A;  2HCK A;  4HVV A;  4AFZ C;  2EQI A;  3REA B;  1T3S A;  2J05 A;  1AWJ A;  2RN8 A;  1HSQ A;  4DEY A;  1I1J A;  2KT8 A;  3EHQ A;  3VRZ A;  2RQU A;  1ARK A;  2RPN A;  1S1N A;  1AD5 A;  1G83 A;  1Y0M A;  3ULR B;  2EGA A;  2J7I A;  2I0N A;  2RF0 A;  1AZE A;  4OMP A;  2HDA A;  3PE0 A;  2DL3 A;  4LE9 A;  1U06 A;  1MUZ A;  2LZ6 B;  1KIK A;  2HSP A;  4IIO A;  1KJW A;  2G6F X;  1PRM C;  2A36 A;  4EIK A; 
#chains in the Genus database with same CATH topology
 1KHC A;  4OB1 B;  4RTX A;  3DB3 A;  2ZPE B;  2V8K A;  1Y57 A;  4QQD A;  1ZSG A;  3NFC A;  3G4S Q;  1OOT A;  5FLX E;  2CH4 A;  4M77 G;  4C0Z A;  4KT0 E;  4PLL A;  5LJ5 h;  1CSK A;  4M7A G;  1W1F A;  5CKB A;  3NTK A;  4E7Z A;  1YN8 A;  4LDV A;  2JJ9 A;  1M9S A;  5A0G A;  3OA6 A;  1M90 R;  2EYY A;  4BE1 A;  1R8O B;  5EG2 A;  4F16 A;  1WFW A;  3JCM V;  4Y92 A;  2P4R A;  3VS5 A;  4CI0 C;  3M0P A;  2P0P A;  2FPD A;  1S72 A;  2KRS A;  1VQ8 T;  1PKS A;  2JTE A;  2M02 A;  5D6Y A;  3H6Z A;  3CCL Q;  1YNZ A;  4F7U G;  1ZA1 B;  1VQ9 Q;  4OB0 B;  1K0X A;  1M2V B;  2LDM A;  5DLO A;  1QKX A;  2XMF A;  4J9D A;  3LH0 A;  5GMK h;  2OTL T;  3HRS A;  4XAX B;  3Q1J A;  1JU5 C;  2IIM A;  4RTV A;  2A08 A;  3CCR A;  3OMG A;  1YI2 A;  2V1Q A;  1H64 1;  5KYU B;  4HT9 A;  3KBG A;  4OVA A;  4OMM A;  4KGX B;  5CCA A;  1CKB A;  1BI1 A;  1WQW A;  4PFO A;  2CZ6 B;  4RTZ A;  4J9B A;  4ZNX A;  3OYE A;  1TG0 A;  3CPW A;  4ZTJ A;  2JNG A;  5KCH A;  2KVQ G;  2EPD A;  1ZUY A;  4LXC A;  1I81 A;  4AFU C;  4JJN K;  1JXO A;  2E6Z A;  3EH2 A;  2PVO B;  3RKX A;  2QQ9 A;  5GAN g;  2C0O A;  2V1R A;  2ESW A;  4C8Q F;  3LW5 E;  5DM7 R;  3CXC A;  4FT4 A;  2EKO A;  5CKD A;  4ELY C;  2QTX A;  3MP8 A;  4MZT A;  1H3H A;  2LC4 A;  1YIJ Q;  1RAD B;  3CBO A;  4JUV A;  5KH6 A;  4LD6 A;  2KQW A;  3TSW A;  2OTJ Q;  5LJ5 e;  4GBQ A;  2LQ8 A;  1W2B P;  4GY5 A;  2X3W D;  5GJV B;  2MIO A;  5I21 A;  1M30 A;  1RAA B;  2HAX A;  4PKC C;  4KH0 B;  3OYY A;  2IPO B;  2DD4 A;  4M78 D;  2EQU A;  3HP9 A;  2LCS A;  3G6E Q;  1MMA A;  2K79 A;  5LJ3 f;  3BDL A;  4V2S A;  1QCO A;  3CC7 T;  2DMO A;  3TEE A;  2EGE A;  3SEM A;  3H0F A;  3EGD B;  1WJS A;  4JS5 A;  5GMK e;  3JCM g;  1TUG B;  2K7A A;  3LWI A;  2RO0 A;  1GCP A;  2VV5 A;  1N8R R;  4C92 A;  4XTZ A;  5LL6 S;  2DVJ A;  5GAO l;  2MWP A;  4XTX A;  1I0C A;  1WJR A;  5CKE A;  4UC4 A;  3VS3 A;  1JJ2 A;  1YIT A;  3JAM E;  3VS6 A;  2CH4 W;  3CMA T;  3RR6 A;  4IUT A;  4J9H A;  3OBY A;  3C0C A;  3CCU T;  2M0Y A;  1WHG A;  2D8J A;  3ASK A;  2DET A;  2RK1 A;  3MHX A;  3HRT A;  3UF4 A;  1KD1 C;  5GJW B;  4YTL A;  1Z9Q A;  4F7U B;  1TSF A;  2Y90 A;  2L3Q A;  4DOW A;  1YJ9 Q;  2VUB A;  2GGR A;  4J7I A;  3CC2 T;  2RJE A;  3SFM A;  1M90 U;  2K4Y A;  4C8Q G;  3H0H A;  1AHJ B;  5GAN h;  1VQ8 Q;  2CP0 A;  3X26 B;  3OSS C;  4Z88 A;  1N9S A;  2FPE A;  2LQW A;  2ROT A;  1VYV A;  3L2Q A;  3BE3 A;  1Q7Y R;  2QA4 T;  1E6G A;  5GAO n;  2HL5 C;  2OTL Q;  4F7U E;  4XU3 A;  2PUK B;  1IO6 A;  2EAY A;  4X9C A;  4BI4 A;  3CCM T;  1N6A A;  5CKH A;  1JQQ A;  3H0I A;  1GFD A;  3P8H A;  3JCM X;  4QQG A;  5GAM g;  3OYJ A;  2DXU A;  3V8L A;  1X75 C;  4DOV A;  4J6W A;  3HSB A;  2QXF A;  2HKN A;  4DEX A;  3CCV A;  1K8A C;  1BBZ A;  4BI3 A;  4KUL A;  1M2V A;  5GMK m;  3EAE A;  5C6S A;  1M4Z A;  1VQ5 T;  1VQM A;  5GAN d;  1X6O A;  1HYO A;  2DTI A;  4J9F A;  4J9I A;  1AZG B;  1RL2 A;  2AIR B;  3JCM h;  4B9X A;  1M2O A;  3A5Z B;  4C92 F;  3PMI A;  1O75 A;  2ZZD A;  2L2P A;  1N9R A;  4DBQ A;  2RHI A;  2K2M A;  4ZGE B;  2X51 A;  4QKU A;  2LCC A;  2DYB A;  4QVZ A;  3C94 A;  4PJO C;  2RM4 A;  3CME T;  2DFU A;  1W2B S;  3LH5 A;  4BY6 C;  1VQN A;  3MEU A;  1NE8 A;  4WF2 A;  4EMK C;  1SHF A;  4M75 D;  5GAN e;  4M75 C;  3CCE A;  2KR3 A;  3M53 A;  2JN0 A;  2YSQ A;  2CP3 A;  1K76 A;  3CD6 Q;  1C1A A;  1WHK A;  4XK8 E;  1U1T A;  3QO3 A;  1ABO A;  2M0O A;  3CC7 Q;  2M16 A;  1IHV A;  2VKN A;  2DVE A;  2P0K A;  2XK0 A;  2AK5 A;  2C0T A;  2K3X A;  2EQM A;  2YRD A;  3THK A;  2YRV A;  2VVK A;  4RKU E;  4KUI A;  3JCM d;  2BUD A;  1PM3 A;  1N8R U;  2DNU A;  3R6O A;  2E65 A;  2FVU A;  4C0G A;  1MV3 A;  3UA7 A;  3CCQ Q;  4HVU A;  2E4H A;  1RAC B;  4J9G A;  2O9S A;  2DPP B;  4E7S A;  3RDV A;  2JM9 A;  4HVW A;  2LQN A;  4HCZ A;  3CMA Q;  3LLR A;  1JEG A;  3BY7 A;  1XQH A;  3M57 A;  3MEV A;  3OS0 A;  3CCU Q;  3EGD A;  5J3B A;  2OJ2 A;  4E7L A;  1U5S A;  4J9C A;  3OS2 A;  1VQP A;  5GAM h;  4HT8 A;  1VQ4 A;  3S6W A;  1SG5 A;  1OX8 A;  3JCM e;  1OYX A;  3RKY A;  4M77 A;  3VS7 A;  3CC2 Q;  1LJO A;  1X6B A;  4Y28 E;  2QGG A;  2H3E B;  2RQT A;  2RQV A;  4C92 G;  1LNX A;  4PFP A;  1XJW B;  4CC7 A;  1MND A;  4C5G A;  3S3O A;  4IUP A;  2AHJ B;  2KYM A;  2R5A A;  5FRO A;  2VWF A;  1QCN A;  2JUF A;  4FYV B;  1ZQ1 A;  1Q7Y U;  4F7U A;  2QA4 Q;  1KQ1 A;  3FLG A;  4D8K A;  1NYF A;  2PU9 B;  2HCK A;  5L8R E;  3REA B;  1T3S A;  3JCM Q;  1X01 A;  1I1J A;  3EHQ A;  3CCM Q;  4C5H A;  1YJN T;  4XTY A;  4PJO B;  1AD5 A;  1Y0M A;  3URG A;  2J7I A;  1BKB A;  2RF0 A;  3M59 A;  3G4S A;  3G1J A;  2A0F B;  3PE0 A;  4LE9 A;  4EMK B;  1U06 A;  3VU3 C;  1MUZ A;  3M58 A;  4QQ6 A;  1C0M A;  4IIO A;  1OZ3 A;  4FL6 A;  2KK4 A;  1B7T A;  2XI9 A;  3M55 A;  5CO7 A;  4EIK A;  3UT1 A;  3CPW P;  2QQS A;  1SRM A;  5IHK A;  3UDC A;  3TVT A;  1KD1 R;  3OYK A;  3RES A;  1AEY A;  2BZY A;  2FRY A;  3CCJ T;  4PJO E;  2L8D A;  2MPX C;  4PJN A;  1M5Q 1;  5GAM e;  2X4J A;  3MP1 A;  1VUB A;  1QWE A;  2DL4 A;  2LP5 A;  3CBM A;  5IN1 A;  1PRL C;  3A8M B;  4PNO A;  1E6H A;  1K1Z A;  2JW4 A;  1KSW A;  3OS1 A;  2CUB A;  2DXC A;  2F69 A;  2DX1 A;  2KYB A;  2PTK A;  2E3H A;  2E3I A;  3EHR A;  1ZUU A;  2DEU A;  3HHT B;  3NTI A;  3EFO B;  3MET A;  2DXT A;  1BCO A;  3FIF A;  1W70 A;  3QZ9 B;  1Q82 U;  1NPP A;  1ZLM A;  3EG1 A;  3I56 T;  4B6M A;  1T0H A;  5CR2 A;  4C0F A;  4LDX A;  4OML A;  2D8H A;  1Q81 C;  2KDS A;  1ABQ A;  2E12 A;  1WDX A;  5A0L A;  2FL7 A;  4FYW B;  5LJ5 j;  5GMK l;  4A4G A;  2RD1 A;  2DL5 A;  3L2R A;  2K3B A;  4EMG A;  1G2B A;  3EG3 A;  3G71 T;  4M7D D;  1I8F A;  5LJ5 f;  3CCS T;  1QVP A;  4R0K A;  1K8A R;  1UFF A;  1W4S A;  1ZX6 A;  2VXF A;  4F7U F;  1VQL A;  2KE9 A;  1G8X A;  4E7J A;  1BI3 A;  2V8I A;  3FRN A;  2NUT A;  1J3T A;  1SSF A;  2OTJ A;  3L1A A;  1ZBJ A;  2HMA A;  3ZFJ A;  1U1S A;  2CRE A;  4PL6 A;  1PKT A;  3I55 A;  3U23 A;  2DBM A;  2EQJ A;  4XTW A;  4LDY A;  2XDD A;  3OSV A;  3G7Z A;  1VQ6 T;  1VQK T;  1I5L A;  4J7F A;  3V7R A;  1UGP B;  2YUQ A;  2KXD A;  1KQS A;  2M1H A;  1QVF P;  3DKM A;  2RHX A;  2FRW A;  1QVG P;  3V7C A;  2DIL A;  1YJW A;  2DO3 A;  4MDW A;  2E6N A;  3OYM A;  3RNJ A;  1VQ7 A;  2GNC A;  3JB9 H;  3PGG A;  4C5E A;  4HCB A;  2O9V A;  4JLI A;  1P92 A;  4JZ3 A;  3H9N A;  1M3A A;  2EVR A;  3CEY A;  2YT6 A;  4ZGD B;  2LX9 A;  1NBE B;  1YHQ A;  2WSF E;  4HCK A;  1YJN Q;  2DRM A;  3RMS A;  2F5T X;  2YDL A;  2AZV A;  4XU1 A;  2A37 A;  2X4X A;  4PFZ A;  1WGS A;  5ECA A;  4AT1 B;  2V26 A;  1SEM A;  1WHH A;  2YUO A;  5D7U A;  4PJJ A;  1QQJ A;  5GAN 2;  2EJF A;  1T0J A;  4EDU A;  3ER0 A;  2X4W A;  1YJ9 A;  1BU1 A;  2MOX A;  3QKJ A;  1Q95 G;  2ZAE A;  2LRQ A;  3F70 A;  1WPY A;  1UGS B;  3CPW S;  3BW1 A;  4OP0 A;  1KD1 U;  4LUE A;  3I5R A;  3OB9 A;  1G3W A;  3CCJ Q;  1M8M A;  3CC4 Q;  4X9D A;  2DA9 A;  3PVQ A;  3QZ5 B;  3WXM B;  4E6R A;  3PTA A;  4M77 D;  3CXC S;  1S72 T;  2KBT A;  5GAO r;  1K4U S;  4M7A D;  5FWB A;  6AT1 B;  2KXC A;  3EGX B;  1MGQ A;  1M8V A;  3L42 A;  1M1K C;  2JOY A;  4HCC A;  2MAM A;  5GAO q;  4JRK A;  2HEQ A;  2WSE E;  1IRX A;  1B3Q A;  2LNH B;  1SPK A;  1OU8 A;  1QP2 A;  4GLK A;  1WNL A;  3FEO A;  3QDR B;  3VRY A;  3QYG B;  2QEX T;  2YLB A;  3A8G B;  4RUG A;  1NJI C;  2RHZ A;  3I56 Q;  3CCR T;  1N5Z A;  2FHD A;  4IKF A;  2EKH A;  2X9H A;  3M4G A;  3QHS A;  1YI2 T;  4PK4 A;  4JRP A;  3KXT A;  2WSC E;  4MZP A;  1X69 A;  2A7Y A;  3M5A A;  1PHT A;  2PVG B;  2VB6 A;  3J80 E;  2EBP A;  3FB9 A;  2E5K A;  2PQW A;  5HKC A;  4IUU A;  4XQ3 A;  3JB9 F;  3LGL A;  2DTH A;  3G71 Q;  1K8A U;  3CCS Q;  2ZPB B;  1NEG A;  4FSS A;  2QI2 A;  4DBR A;  2CSI A;  3OYF A;  4DQ2 A;  2ENM A;  1EFN A;  1KFZ A;  5GAN 7;  1NM7 A;  2COW A;  4Z02 A;  4LD9 K;  1UG1 A;  4N0A A;  4D6W A;  5GAN f;  1VOM A;  5HK0 A;  3GLX A;  5LJ3 j;  3OYD A;  1YP5 A;  2O2O A;  1WYX A;  2L5Q A;  2C0I A;  4JJB A;  1VQ6 Q;  3OYL A;  1VQK Q;  1T3L A;  1D09 B;  3C4S A;  1NEB A;  1JJ2 S;  4M78 C;  3CD6 A;  1WHJ A;  4JDS A;  2F2X A;  2QTV A;  1OEB A;  2EYZ A;  8AT1 B;  1WXT A;  1Q86 C;  3OW2 A;  1IRE B;  1OUL A;  3H8Z A;  4JS4 A;  2D6F A;  1WX6 A;  1D1C A;  4PJO F;  4L59 A;  2NYS A;  1R77 A;  2R5M A;  3SWN A;  3EH1 A;  2SRC A;  3GBQ A;  3BDU A;  2O01 E;  2J6K A;  1VYU A;  3CCQ A;  4J8O A;  2EQK A;  1GBQ A;  1Y7X A;  1Q81 R;  1QVF A;  2MI6 A;  1QVG A;  5KYW B;  2E5Q A;  1X27 A;  2O88 A;  2GTO A;  2PNI A;  1G3S A;  5D6X A;  3JCM f;  4TVR A;  3S3N A;  2CT3 A;  4FT2 A;  2QGF B;  3TCJ A;  4QVC A;  2E1H A;  5IH2 A;  1GCQ A;  2EYQ A;  3VV0 A;  4KBM B;  2OI3 A;  1YIT T;  1SHG A;  2J06 A;  3T9N A;  3OMC A;  2KSS A;  4AG2 C;  2HSE B;  4BB7 A;  1D3B B;  1GL5 A;  4MML A;  2AZS A;  2L3R A;  1YFN A;  1RUW A;  2XU8 A;  5HCK A;  2LQK A;  5IXB A;  3EG9 A;  4DBH A;  3NPF A;  5KE3 A;  2VAS A;  3JB9 G;  1ZSZ C;  3OY9 A;  2J6O A;  2DXB A;  2DTO A;  2GQV A;  2I2L A;  4FW1 A;  2ZPI B;  1AOJ A;  4O5V A;  2LVM A;  3GP8 A;  1S72 Q;  1MNE A;  5A0D A;  2FO0 A;  1WLP B;  2YWW A;  3M56 A;  1M1F A;  1KC8 C;  4KRT A;  1UB4 A;  4BDY A;  2DYI A;  4C8Q D;  5AYF A;  5I11 A;  5KYX B;  2EFI A;  2QEX Q;  1NLP C;  1SF9 A;  4N4I A;  2PZ1 A;  3OQ5 A;  1WA7 A;  3CCR Q;  3PT9 A;  1SRL A;  1GXI E;  1M3B A;  1YI2 Q;  1UGQ B;  2XDB A;  4HVV A;  5GAM j;  4M78 B;  2EQI A;  2J05 A;  1AWJ A;  1HSQ A;  4PJO G;  3QYH B;  3VYG A;  2RQU A;  3EGX A;  1H3Z A;  1ARK A;  5KYU A;  3CCV T;  4DA4 A;  5GAM f;  1G83 A;  2KAF A;  3ZEH A;  2I0N A;  1Y96 B;  1VQM T;  2DL3 A;  1VQO A;  2COY A;  3A8H B;  1UGR B;  3SD4 A;  4ZN3 A;  2LZ6 B;  5FRM A;  2HSP A;  1KIK A;  2BE7 D;  3HFO A;  2DER A;  3FC3 A;  2BIV A;  4ZGJ B;  3E9F A;  2A36 A;  3JB9 J;  4M78 E;  1YCY A;  4KUD K;  1TXQ A;  2K57 A;  4RCC A;  2NLU A;  4C0D C;  4FU6 A;  4E2F B;  2JVV A;  3I5S A;  1VQN T;  2CT4 A;  2KI7 A;  2L0A A;  2DD5 A;  4RTY A;  3NHN A;  3OYC A;  4KGZ B;  3M4Y A;  2KRN A;  3CCE T;  1M1K R;  1AWX A;  1XNI A;  1A0N B;  1KQS P;  3OS5 A;  5D6W A;  5DY9 A;  2FG0 A;  1OPK A;  2B86 A;  4AMC A;  1ZSZ B;  4MDX A;  4ZTF A;  1MHN A;  3GF5 A;  3RER A;  5HK3 A;  2F2W A;  1Q81 U;  2RQW A;  3JB9 I;  1JXM A;  1RAG B;  3HRU A;  3DLM A;  1H92 A;  2KMT A;  1TOV A;  2VGN A;  1B07 A;  2CUD A;  2D1X A;  2DL7 A;  4OMO A;  4HA8 A;  1RLQ C;  4K11 A;  2XD0 A;  2J6F A;  1D0X A;  4LNP A;  1YIT Q;  2HL3 A;  1OX9 A;  2EW3 A;  3M9Q A;  4OB3 B;  3CPF A;  3MEA A;  4WCI A;  1FMK A;  1V76 A;  1I4K 1;  3OYB A;  1VQP T;  2DRK A;  5CK9 A;  1PG5 B;  1VQ4 T;  1V1C A;  5KYW A;  4ZN1 A;  2DBK A;  4O6J A;  2CP2 A;  2QAS A;  2QYZ A;  2YUP A;  3L2W A;  3OBW A;  1QP3 A;  5IHI A;  2DE0 X;  3JCM W;  2C06 A;  3EG2 A;  3GNF B;  1Q86 R;  4J6Y A;  1D3B A;  3TU4 K;  2DJZ A;  4RTU A;  2MYS A;  1IGU A;  1WIE A;  2XID A;  1TUD A;  4BE0 A;  2CZ0 B;  3PNW C;  1I07 A;  1UJY A;  2KY9 A;  4BY6 B;  4JJC A;  4C92 D;  4JRI A;  4EMH A;  1NG2 A;  1U3O A;  2JS0 A;  1ZHI A;  4LUD A;  3S3M A;  4M75 B;  4ESR A;  2GCX A;  5GAN 6;  2RJF A;  2RJD A;  1VQ5 Q;  4X1V A;  2QAZ A;  3M0U A;  4C0D B;  2PVD B;  4OF1 A;  4D8D A;  3I35 A;  1HJD A;  3O8V A;  3G4S T;  2AT1 B;  2HKQ B;  5KYN A;  3CCV Q;  1PCX A;  1X2Q A;  4A63 B;  3GPL A;  3CCL A;  1VQM Q;  1Y07 A;  4BD3 A;  3V8K A;  3C95 A;  4OMF B;  3V7S A;  2E41 A;  4IUQ A;  1VQ9 A;  5KYX A;  2CSQ A;  2FB7 A;  5CAI A;  3CC4 A;  1BI0 A;  1DJ7 B;  2DZ9 A;  3VJP A;  3CME Q;  2OAW A;  3VS1 A;  2A3L A;  3ZL7 C;  4M75 E;  4E7I A;  1BCM A;  2LT1 A;  1BIA A;  1JO8 A;  3DB4 A;  2ED0 A;  2FEI A;  3GNG A;  4XTU A;  5FU6 C;  2W10 A;  1IZ6 A;  3VUZ A;  4RMO A;  3QG1 A;  2XIC A;  1BB9 A;  1VQN Q;  3MJX A;  4NL3 A;  2X35 A;  3QWY A;  4XTV A;  3LYI A;  4XU2 A;  1KC8 R;  1CKA A;  1M1K U;  4JLG A;  1YBY A;  3CCE Q;  2HD0 A;  2FZC B;  1N8R C;  1RAB B;  1KQS S;  4DBF A;  2JXB A;  2LNV A;  2QK0 A;  4Y91 A;  1YCS B;  2YRC A;  3GOX A;  2SEM A;  2LT4 A;  2VGM A;  1WI7 A;  2JT4 A;  2BTT A;  4AFS C;  3J81 E;  4M7D C;  3OW2 P;  4FW2 A;  2CP6 A;  4IUV A;  1YIJ A;  2WAC A;  5FWC A;  1SSH A;  1M3C A;  1VA7 A;  1QKW A;  1FMV A;  3O5Z A;  1WXU A;  3QBY A;  2R58 A;  2R57 A;  3RUX A;  1OI1 A;  5GMK j;  1VQL T;  2D0Q B;  3A98 A;  5CVI A;  4FSX A;  2K9G A;  4OMQ A;  3OYA A;  3G6E A;  2OTJ T;  4CC2 A;  3I55 T;  3QSU A;  3QXE B;  5GMK i;  2CKK A;  1VQP Q;  4JZ4 A;  1VQ4 Q;  1UDL A;  3PMT A;  1UHC A;  1NZ9 A;  3X20 B;  1WXB A;  1JB0 E;  1FYN A;  1MMN A;  1K73 C;  1RAI B;  2GFU A;  1YJW T;  4JJD A;  1D0Y A;  1K9A A;  3M0Q A;  1HK9 A;  3QJ6 A;  2E10 A;  1I5O B;  1VQ7 T;  1FXX A;  2RMO A;  3MKD A;  1Q86 U;  2F2V A;  1KK7 A;  4R55 A;  4ANJ A;  4Q5W A;  2LJ0 A;  1H8K A;  1AWW A;  1M27 C;  1KHI A;  2BZ8 A;  2NUP B;  1UUE A;  4Z8A A;  2G3R A;  4J9E A;  5FU7 C;  3HPW A;  2XDP A;  3PIO A;  2QG9 B;  1YHQ T;  3PFS A;  5DLQ E;  4EPC A;  5FU6 B;  2DIQ A;  1D1B A;  1D1A A;  1PSE A;  2P84 A;  4CC3 A;  1TTH B;  1BI2 A;  4LN2 A;  3V8J A;  2RI2 A;  1VQ8 A;  4MMK A;  2BKD N;  2NWM A;  4L5G A;  4PJO A;  3JRZ A;  3HL8 A;  4M4Z A;  1YJ9 T;  2XHC A;  2ZGW A;  3QWX X;  2HZY A;  1OZ2 A;  4EMK A;  3C12 A;  1X43 A;  3VKI A;  3EG0 A;  3WVE B;  4M75 A;  2OTL A;  5AT1 B;  2AKK A;  4M77 C;  4FCY A;  4M7D B;  4M7A C;  4RTT A;  1NLO C;  4J83 A;  2H8H A;  1ZA2 B;  2O4X B;  3HFN A;  2RA2 A;  5KE2 A;  2DIG A;  5FRN A;  3E1S A;  3M0S A;  1EX4 A;  1Q82 C;  1HD3 A;  1EIF A;  2QEX A;  3EFR A;  2MK5 A;  2VC8 A;  2RK2 A;  4OB2 B;  1KC8 U;  1YWO A;  4FIB A;  1ZUK A;  3MP6 A;  4KH1 B;  2Y4Y A;  5LJ5 d;  5EC7 A;  1QW1 A;  4M7D E;  2QDL A;  2CZ7 B;  2GF7 A;  2YUN A;  3OW2 S;  2HBW A;  3EFO A;  2DF6 A;  5GAN j;  2K5F A;  3M0R A;  4M78 G;  1RI0 A;  3RMQ A;  2F1L A;  2P4T A;  5LJ3 g;  2RN8 A;  1G3T A;  4DEY A;  3VRZ A;  2KT8 A;  1VQL Q;  1AT1 B;  3CBP A;  1U8R A;  1QVF S;  2P0Q A;  2DAQ A;  3HKS A;  1QVG S;  4IUR A;  1AZE A;  3I55 Q;  5FU7 B;  5J39 A;  3CC7 A;  2HDA A;  1WJQ A;  4BE2 A;  1K9M C;  4J5Y A;  2IG0 A;  1OQK A;  2IVW A;  4LDU A;  2K3Y A;  2ZPF B;  3CD6 T;  1PRM C;  4PJM A;  1WHL A;  1YJW Q;  2JTF A;  1IHW A;  4X34 A;  2OAU A;  4A4H A;  1SKU B;  1VQ7 Q;  1OU9 A;  4F17 A;  1NYG A;  3VS4 A;  4E7K A;  2ROL A;  4JRQ A;  4M75 F;  3NGP A;  4J6X A;  2ATC B;  3CMA A;  4M77 B;  1LPL A;  2K6D A;  2DL8 A;  3QJY A;  3CCU A;  4A4F A;  4ME7 A;  4M7A B;  3CCQ T;  4C5I A;  1MMG A;  5GAN 3;  2MWO A;  4QT7 A;  2ZPH B;  5CIU A;  1YHQ Q;  2RNA A;  5HY6 A;  2L3S A;  3H41 A;  3VUB A;  1EZZ B;  1ZBX A;  3R6N A;  4RG2 A;  1LCK A;  3CC2 A;  2JS2 A;  1MMD A;  1ACM B;  2GBQ A;  2ZPG B;  2EYX A;  1GFC A;  1RAE B;  3INZ A;  4RG8 A;  3OYG A;  4WTO B;  1X2K A;  1FWZ A;  4NL2 A;  2X4Y A;  3MO8 A;  1RI9 A;  1PC0 A;  5I2M A;  3SDZ A;  2NUP A;  3ZBD A;  1TWB A;  2L89 A;  4M77 E;  4CRI A;  2HQE A;  1B34 B;  4M7A E;  2QA4 A;  3X28 B;  1WZO A;  1PSF A;  2Y4X A;  3IQL A;  1AVZ C;  3TSZ A;  5IAY A;  1G5V A;  3BFM A;  2CZ1 B;  1GRI A;  4QVD A;  3CCM A;  4AG1 C;  3JCM c;  4AFQ C;  3VS0 A;  4GLM A;  4Z89 A;  2V8J A;  4C8Q C;  2ED1 A;  1UE9 A;  5LJ3 h;  1K73 R;  1WQ7 A;  4XU0 A;  1UHF A;  3JB9 D;  1LOJ A;  3X25 B;  1K0S A;  5CQX A;  4A53 A;  2DKG A;  1OPL A;  1UEB A;  1VQ5 A;  2K2V A;  4CC4 B;  3D7S B;  2CP5 A;  4M7D A;  2W0Z A;  2LJ3 A;  2DJQ A;  4A4E A;  3P8D A;  4OGE A;  1PD1 A;  1OV3 A;  2O4X A;  3JSC A;  1IXD A;  2CS7 A;  1FX7 A;  4E7H A;  2FYK A;  1NPR A;  4M75 G;  5A2Q E;  3UWN A;  3M0T A;  3FDR A;  1UJ0 A;  3VYH B;  3EFS A;  3CME A;  2LJ1 A;  3REB B;  3DLL A;  4E47 A;  3HTR A;  1VIF A;  2KT1 A;  2KRO A;  5LJ3 d;  1UTI A;  3SB2 A;  3OYI A;  2D0N A;  1VQO T;  2RI5 A;  3PVL A;  3RBB B;  4PJO D;  2K5L A;  2KEA A;  2CYZ B;  3UA6 A;  3MPU B;  2HQX A;  3FJ5 A;  2RQR A;  4F04 B;  5KYY B;  1JRI A;  2E70 A;  1X6G A;  2JMA A;  2LMJ A;  5C0M A;  2QDY B;  2PUO B;  5CKF A;  5GAN 5;  1Z9Z A;  1XOV A;  3LWH A;  2ZCF B;  3KUF A;  3LGF A;  1Q82 R;  2H3J A;  2NUT B;  3EGU A;  3TRE A;  1NJI R;  1E7O A;  7AT1 B;  1RAF B;  4FYY B;  5LJ3 e;  1O9S A;  1QLY A;  2B8A A;  1BIB A;  2FPF A;  3A8O B;  2DLP A;  2GFA A;  2GQI A;  2Z0W A;  5I2S A;  1W2B A;  1PD0 A;  2L3P A;  2DEQ A;  1PNJ A;  3I9Q A;  2EGC A;  3FJP A;  3RIR A;  1UEC A;  1N27 A;  3TQ7 P;  3PIP A;  2FZG B;  3QII A;  2VXE A;  2RH2 A;  4C8Q B;  5L23 A;  1M90 C;  2E64 A;  1QWF A;  2YLC A;  2RHU A;  9ATC B;  2K5I A;  1GBR A;  2D9T A;  3SHW A;  1TUC A;  5M9O A;  4M7D F;  2XKO C;  2EWN A;  2NUZ A;  4JPB W;  1HXD A;  4ORZ A;  1VIE A;  1AWO A;  5J26 A;  3E19 A;  4N0A C;  2QQB A;  2ABL A;  4BAC A;  4IIM A;  2O31 A;  3QPH A;  4M7A A;  4OMN A;  3L2V A;  4LDW A;  3QUI A;  3KFV A;  5IT9 E;  5I22 A;  1K9M R;  3E2U A;  4FYX B;  2JZ2 A;  3NTH A;  2HBP A;  3E9G A;  5KCO A;  1UGV A;  4ELZ C;  4C8Q E;  3ME9 A;  2JM8 A;  4B9W A;  1YJN A;  2DK3 A;  1K73 U;  2LTO A;  4PLI A;  1XTD A;  1RLP C;  1Y71 A;  4HKE A;  2QQA A;  2CDT A;  3QDF A;  4NS5 A;  4C92 C;  1TU0 B;  5GAN 8;  2RJC A;  3RKW A;  3SWN C;  1IGQ A;  2JMC A;  1B34 A;  1PWT A;  3JV3 A;  4R56 A;  5GAM d;  4BDZ A;  2QQR A;  2EJ9 A;  4FM4 B;  2MF2 A;  4HXJ A;  4L6V 5;  4F14 A;  2CP7 A;  2COZ A;  4KGV B;  2FZK B;  2X3X D;  1BYM A;  4A4K A;  1C6V X;  2EYW A;  1RAH B;  3AT1 B;  3CCJ A;  1BK2 A;  2A28 A;  3L2U A;  2AKL A;  3L2Z A;  1KG1 A;  2EIF A;  5IHN A;  2EJG A;  1GCQ C;  4QW2 A;  2M9U A;  2RB6 A;  3P8B B;  3A1P A;  4M78 A;  3CCL T;  1R0B G;  4MZM A;  1VQ9 T;  2HNI A;  1VQO Q;  1YWP A;  4OGC A;  5IXF A;  3CC4 T;  2MMP A;  2RI3 A;  1QMC A;  3NMZ C;  1IB8 A;  2OX7 A;  3VS2 A;  3CXC P;  1Y96 A;  2YXY A;  3I56 A;  4M7D G;  3LX7 A;  1FMW A;  1JBM A;  5CQY A;  3X24 B;  5LJ5 g;  2LCL A;  2KNB B;  2MCN A;  4PJL A;  1V29 B;  2DZC A;  4BUG A;  4M77 F;  2M51 A;  1NJI U;  4M7A F;  2JTM A;  3G71 A;  1R0C B;  3OYN A;  3CCS A;  2LX7 A;  1M1G A;  2VYT A;  3AHU A;  2KGT A;  4RTW A;  2GTJ A;  3M54 A;  5GAO m;  3CQT A;  1W6X A;  1LVK A;  5KYY A;  2BZX A;  4VUB A;  4A54 A;  2DM1 A;  5FW9 A;  3GIB A;  5GAN 4;  2F5K A;  1VQ6 A;  1VQK A;  1YIJ T;  4NOY A;  4N4H A;  2ECZ A;  1QCF A;  1ZSZ A;  3MCA B;  2RHY A;  1G3Y A;  1VYT A;  2KRM A;  1MV0 B;  4C92 B;  3WVD B;  3JCM J;  4ATO A;  3MEW A;  3UPU A;  3UAT A;  1WHM A;  3SWN B;  1D0Z A;  4AFZ C;  3N5B B;  5GAO p;  3G6E T;  1JJ2 P;  2BE9 B;  1TS9 A;  1Q7Y C;  1KQ2 A;  2CGH A;  2XG8 D;  3J7A F;  4BI8 B;  4N4G A;  1K9M U;  2RPN A;  1S1N A;  2YHT A;  4C8Q A;  3ULR B;  2EGA A;  1F1B B;  8ATC B;  1TH7 A;  4OMP A;  4P5N A;  4M78 F;  4C92 E;  3JCM b;  4II1 A;  1KJW A;  4RCB A;  2HQH A;  3A8L B;  2G6F X;  3OYH A;  3JCM P;  3EG9 B; 
#chains in the Genus database with same CATH homology
 4RTX A;  1SRM A;  5IHK A;  1Y57 A;  3TVT A;  1ZSG A;  4F17 A;  1NYG A;  1AEY A;  2BZY A;  3VS4 A;  2ROL A;  2FRY A;  3NGP A;  3I5S A;  1OOT A;  2CT4 A;  2CH4 A;  2L0A A;  4RTY A;  3NHN A;  1CSK A;  1QWE A;  1W1F A;  2DL4 A;  2LP5 A;  1YN8 A;  1PRL C;  2KRN A;  1E6H A;  1K1Z A;  2DL8 A;  1AWX A;  1KSW A;  2JW4 A;  2K6D A;  1A0N B;  2CUB A;  2EYY A;  2DX1 A;  2FG0 A;  2KYB A;  1OPK A;  4QT7 A;  4F16 A;  1WFW A;  2PTK A;  2RNA A;  4Y92 A;  2P4R A;  3VS5 A;  3M0P A;  2B86 A;  3EHR A;  1ZUU A;  2FPD A;  2L3S A;  2KRS A;  3H41 A;  3R6N A;  1PKS A;  2JTE A;  1LCK A;  2JS2 A;  1W70 A;  1YNZ A;  2F2W A;  1ZLM A;  3EG1 A;  2GBQ A;  2EYX A;  2RQW A;  1K0X A;  1GFC A;  1T0H A;  1JXM A;  1QKX A;  2XMF A;  1X2K A;  4J9D A;  4OML A;  2D8H A;  1H92 A;  1RI9 A;  1ABQ A;  1WDX A;  1JU5 C;  2IIM A;  1B07 A;  4RTV A;  2CUD A;  2A08 A;  2D1X A;  2DL7 A;  4OMO A;  2DL5 A;  1RLQ C;  2V1Q A;  4K11 A;  2J6F A;  2K3B A;  3IQL A;  1G2B A;  3EG3 A;  4LNP A;  4OMM A;  1AVZ C;  3TSZ A;  1CKB A;  4R0K A;  4RTZ A;  1UFF A;  2EW3 A;  4J9B A;  1GRI A;  1ZX6 A;  4ZNX A;  1TG0 A;  2KE9 A;  4WCI A;  1FMK A;  4AG1 C;  2EPD A;  4AFQ C;  1ZUY A;  3VS0 A;  4GLM A;  2DRK A;  4Z89 A;  1J3T A;  1V1C A;  2ED1 A;  1UE9 A;  4AFU C;  1ZBJ A;  1JXO A;  2CRE A;  2DBK A;  1PKT A;  1UHF A;  3U23 A;  2YUP A;  2DBM A;  2C0O A;  2V1R A;  2ESW A;  1K0S A;  5IHI A;  1OPL A;  2DE0 X;  2YUQ A;  2KXD A;  3EG2 A;  4CC4 B;  2FRW A;  1H3H A;  2DIL A;  2W0Z A;  2LJ3 A;  2DJQ A;  1OV3 A;  4RTU A;  3RNJ A;  3TSW A;  1WIE A;  2GNC A;  1TUD A;  4GBQ A;  1I07 A;  1UJY A;  2X3W D;  4JJC A;  2O9V A;  5GJV B;  2MIO A;  1NG2 A;  3M0T A;  1U3O A;  1UJ0 A;  4JZ3 A;  1M30 A;  2JS0 A;  1M3A A;  4LUD A;  4ESR A;  2EVR A;  2LJ1 A;  3REB B;  2YT6 A;  2KT1 A;  4X1V A;  2LCS A;  2K79 A;  2KRO A;  3M0U A;  4D8D A;  1HJD A;  3I35 A;  1UTI A;  2D0N A;  2DMO A;  3PVL A;  4HCK A;  3RBB B;  2DRM A;  1X2Q A;  4A63 B;  2EGE A;  3SEM A;  3H0F A;  2YDL A;  2AZV A;  2A37 A;  2KEA A;  2K7A A;  1GCP A;  5ECA A;  3UA6 A;  2CSQ A;  1SEM A;  3FJ5 A;  2YUO A;  2RQR A;  1T0J A;  2JMA A;  1X6G A;  2LMJ A;  2DVJ A;  2OAW A;  1BU1 A;  3VS1 A;  3ZL7 C;  2MOX A;  1I0C A;  1Z9Z A;  1XOV A;  3VS3 A;  1JO8 A;  3EGU A;  1E7O A;  2ED0 A;  2FEI A;  3VS6 A;  2CH4 W;  4LUE A;  2W10 A;  1QLY A;  3I5R A;  4J9H A;  2FPF A;  3C0C A;  2DLP A;  2M0Y A;  2D8J A;  1BB9 A;  2GQI A;  1M8M A;  3QWY A;  3UF4 A;  5GJW B;  1Z9Q A;  2DA9 A;  3PVQ A;  4E6R A;  2L3P A;  1CKA A;  2L3Q A;  1PNJ A;  3I9Q A;  2EGC A;  2GGR A;  2KBT A;  1K4U S;  5FWB A;  2KXC A;  2JXB A;  3H0H A;  1UEC A;  1YCS B;  2SEM A;  2HEQ A;  5L23 A;  1B3Q A;  1QWF A;  1WI7 A;  2JT4 A;  2LNH B;  1SPK A;  2BTT A;  4AFS C;  4Z88 A;  2FPE A;  3VRY A;  1GBR A;  2LQW A;  2ROT A;  4RUG A;  5FWC A;  3SHW A;  1TUC A;  1SSH A;  1M3C A;  1N5Z A;  1VA7 A;  1VYV A;  1QKW A;  2NUZ A;  2EKH A;  4JPB W;  4ORZ A;  1E6G A;  3O5Z A;  1AWO A;  1WXU A;  2ABL A;  1X69 A;  4IIM A;  2O31 A;  1IO6 A;  1PHT A;  4OMN A;  3A98 A;  2EBP A;  2E5K A;  3KFV A;  1JQQ A;  3H0I A;  1GFD A;  5I22 A;  2K9G A;  4OMQ A;  1UGV A;  1NEG A;  4FSS A;  4CC2 A;  2JM8 A;  2CSI A;  2ENM A;  4DEX A;  4JZ4 A;  1EFN A;  1BBZ A;  1KFZ A;  1UDL A;  1NM7 A;  1RLP C;  1UHC A;  1UG1 A;  2CDT A;  1WXB A;  1YP5 A;  2O2O A;  1WYX A;  1FYN A;  4JJB A;  2C0I A;  4J9F A;  1T3L A;  1AZG B;  4J9I A;  4JJD A;  1K9A A;  1NEB A;  3M0Q A;  2JMC A;  1PWT A;  3JV3 A;  2RMO A;  2L2P A;  2K2M A;  2F2X A;  2F2V A;  1OEB A;  4HXJ A;  2EYZ A;  4F14 A;  1WXT A;  2DYB A;  1AWW A;  2LJ0 A;  1H8K A;  1M27 C;  2X3X D;  2EYW A;  2BZ8 A;  1UUE A;  1WX6 A;  3LH5 A;  4Z8A A;  4J9E A;  1BK2 A;  2A28 A;  2AKL A;  5IHN A;  1SHF A;  1GCQ C;  2SRC A;  3GBQ A;  2KR3 A;  2J6K A;  2YSQ A;  1VYU A;  1K76 A;  1ABO A;  1GBQ A;  4CC3 A;  4LN2 A;  2VKN A;  1YWP A;  2AK5 A;  2C0T A;  1X27 A;  2O88 A;  5IXF A;  2GTO A;  2PNI A;  3THK A;  2VVK A;  2NWM A;  3NMZ C;  4M4Z A;  3VS2 A;  2CT3 A;  2DNU A;  3QWX X;  5IH2 A;  1X43 A;  1GCQ A;  1MV3 A;  3EG0 A;  2OI3 A;  2AKK A;  3UA7 A;  4HVU A;  1SHG A;  2J06 A;  4AG2 C;  2KNB B;  4J9G A;  2O9S A;  2MCN A;  4RTT A;  1GL5 A;  1NLO C;  2H8H A;  2AZS A;  1RUW A;  5HCK A;  2M51 A;  2JM9 A;  5IXB A;  3NPF A;  4HVW A;  2LQN A;  3M0S A;  2J6O A;  2LX7 A;  1JEG A;  1HD3 A;  1AOJ A;  2KGT A;  2OJ2 A;  1U5S A;  4RTW A;  4J9C A;  2GTJ A;  3CQT A;  1W6X A;  1YWO A;  2BZX A;  1ZUK A;  3VS7 A;  2FO0 A;  2DM1 A;  5FW9 A;  1WLP B;  5EC7 A;  1X6B A;  4KRT A;  2QDL A;  2RQT A;  2RQV A;  2YUN A;  2ECZ A;  1QCF A;  4CC7 A;  1VYT A;  2HBW A;  5I11 A;  2DF6 A;  2KRM A;  1MV0 B;  2KYM A;  1NLP C;  2PZ1 A;  2VWF A;  1WA7 A;  3UAT A;  1SRL A;  3M0R A;  1M3B A;  4D8K A;  1NYF A;  2HCK A;  4HVV A;  4AFZ C;  2EQI A;  3REA B;  1T3S A;  2J05 A;  1AWJ A;  2RN8 A;  1HSQ A;  4DEY A;  1I1J A;  2KT8 A;  3EHQ A;  3VRZ A;  2RQU A;  1ARK A;  2RPN A;  1S1N A;  1AD5 A;  1G83 A;  1Y0M A;  3ULR B;  2EGA A;  2J7I A;  2I0N A;  2RF0 A;  1AZE A;  4OMP A;  2HDA A;  3PE0 A;  2DL3 A;  4LE9 A;  1U06 A;  1MUZ A;  2LZ6 B;  1KIK A;  2HSP A;  4IIO A;  1KJW A;  2G6F X;  1PRM C;  2A36 A;  4EIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...