2K9GA

Solution structure of the third sh3 domain of the cin85 adapter protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
SMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the Sh3-C domain of Cin85
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SH3 domain-containing kinase-binding protein 1
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k9gA00
1VYTA 2LJ3A 1K0XA 2E5KA 2QDLA 2DA9A 2KYBA 4RTYA 1WX6A 2AK5A 2AZSA 1SHGA 1TG0A 2J6OA 3IQLA 1KJWA 2DRMA 1PNJA 2DNUA 1H3HA 1WXTA 1AOJA 4IIOA 4Y92A 1RLQC 2JTEA 2P4RA 4AFUC 1ABQA 2ROLA 2DL4A 2ENMA 5IHIA 3EG0A 1JU5C 2RQRA 4E6RA 2A37A 4RTZA 2RNAA 4M4ZA 1OEBA 2ECZA 1SPKA 3FJ5A 3THKA 2CDTA 3EHQA 2LJ0A 3KFVA 1ABOA 1OPKA 2EW3A 1UTIA 1FMKA 1H92A 1JO8A 2BZYA 4J9EA 1WIEA 4A63B 2D8JA 1WI7A 4D8DA 1UGVA 2D0NA 2ESWA 4LN2A 3VS6A 2IIMA 2SEMA 1YWOA 1PKTA 2AKKA 4QT7A 2X3WD 2CH4A 2LZ6B 1I0CA 3H41A 1Z9ZA 3ZL7C 4JJBA 2EGCA 2NWMA 1K9AA 1AD5A 2ED1A 3CQTA 3UF4A 4J9CA 1UHFA 3QWXX 1YWPA 4DEXA 3O5ZA 3TSWA 1GCPA 3NMZC 1X6BA 1AEYA 2DL5A 1BB9A 1SRMA 1GCQA 1T0JA 2L3PA 3I9QA 3EHRA 1U5SA 1KSWA 2KROA 5FW9A 2I0NA 2D8HA 1KIKA 3ULRB 1UECA 4AFQC 3VS3A 1GRIA 2CH4W 1OV3A 2ED0A 4J9BA 5IHNA 2HCKA 2KGTA 4KRTA 3M0TA 1M3CA 1UFFA 2JM9A 2L3SA 2C0OA 2FEIA 1UJ0A 1WXBA 1QWFA 1ZSGA 2W0ZA 2LQNA 2DBKA 3PE0A 3JV3A 3REBB 3I5RA 1W6XA 1OOTA 4J9FA 3VS1A 4ESRA 1Y0MA 2OAWA 2X3XD 4OMMA 2LQWA 1VA7A 4OMPA 3EG3A 4AFSC 1M8MA 1MUZA 1RUWA 4CC4B 5L23A 1MV0B 2ABLA 5IHKA 2A28A 3REAB 1OPLA 2KR3A 1AVZC 2DBMA 2MIOA 4RTXA 1UE9A 1V1CA 2KBTA 2A08A 2K6DA 4OMOA 1AWOA 1AWJA 1VYVA 1SEMA 5FWBA 4CC3A 2GNCA 3M0RA 1RLPC 1YP5A 1AZEA 4ORZA 1Z9QA 4EIKA 2LNHB 2LP5A 5GJVB 1HJDA 3M0PA 1QKXA 2EYZA 1AWXA 4RTVA 3M0QA 2EYYA 1K1ZA 1TUCA 1UG1A 4J9DA 1X2QA 3GBQA 2DRKA 1ZUUA 4LNPA 2K3BA 2DE0X 1GFCA 1X27A 1BK2A 1JQQA 1JEGA 1CKBA 1NYGA 3SHWA 1BBZA 3PVQA 2RN8A 3VS4A 1K4US 2JM8A 4HVVA 1NLOC 1QWEA 1K0SA 2C0IA 2EGAA 2RQWA 2CUBA 2KNBB 2DX1A 4J9IA 4F17A 2KT8A 1GBRA 2EPDA 1GCQC 4JJDA 2DYBA 3I5SA 3UA7A 2J6KA 1U3OA 2BZ8A 4F14A 1I07A 1X43A 1ZUKA 4HCKA 4D8KA 2H8HA 1A0NB 1PWTA 4OMLA 1BU1A 1XOVA 2KRSA 1ZLMA 1E6HA 2LX7A 5ECAA 1B07A 2MOXA 3H0HA 4GLMA 2L3QA 3C0CA 4X1VA 2YSQA 1MV3A 5I11A 5FWCA 4AFZC 2PTKA 1LCKA 3VRYA 1T3SA 3H0FA 2GQIA 2V1QA 2HEQA 2RQUA 2EBPA 2K7AA 1SSHA 4JZ3A 1AWWA 1QKWA 2HDAA 2KXCA 4IIMA 1WLPB 2DVJA 2YUQA 2G6FX 2FO0A 2L0AA 2A36A 2LMJA 3EGUA 1IO6A 1WFWA 2CSQA 1WDXA 2O9VA 3EG2A 4FSSA 1T3LA 2KT1A 1HSQA 2DF6A 2CSIA 1YN8A 3TSZA 1ZX6A 1FYNA 2FPEA 2FRYA 4RTUA 2VWFA 1NEGA 1PRMC 1WA7A 2EKHA 1ZBJA 5HCKA 5I22A 3QWYA 4OMNA 1M3BA 2DLPA 4R0KA 2F2WA 3M0UA 2RPNA 5IH2A 3UATA 1X69A 1CSKA 2DM1A 2F2VA 2W10A 4AG1C 4JZ4A 3PVLA 3LH5A 1S1NA 2EGEA 1JXOA 1JXMA 2VKNA 3I35A 2GTJA 4LUDA 1T0HA 2CREA 1ARKA 2JS2A 2FPFA 1PKSA 1GBQA 2YUPA 2YUOA 2JMAA 2VVKA 2FRWA 1G2BA 3R6NA 1H8KA 2ROTA 3RNJA 4J9HA 2AKLA 3RBBB 2NUZA 1J3TA 1SRLA 2M51A 2FG0A 2JS0A 2DL7A 2LJ1A 2DJQA 2OI3A 2YDLA 2AZVA 1M27C 2EVRA 3NGPA 1W70A 1NG2A 1B3QA 3TVTA 4RTTA 1G83A 4F16A 1UHCA 4OMQA 2GTOA 4LUEA 3SEMA 4HVWA 2GGRA 1M30A 2K79A 2RMOA 2RF0A 1QCFA 2JW4A 2EQIA 5GJWB 1TUDA 1I1JA 4CC2A 1VYUA 1M3AA 2DILA 1UJYA 3VS5A 2J05A 2KRMA 2DL8A 2K9GA 1NEBA 2BTTA 2DL3A 1YNZA 1QLYA 1U06A 1CKAA 2V1RA 2BZXA 3EG1A 2GBQA 1UDLA 2RQTA 4Z8AA 2D1XA 1YCSB 1Y57A 2L2PA 1AZGB 3VS0A 2KYMA 4HVUA 5IXFA 2O31A 4ZNXA 2LCSA 2J06A 1RI9A 2B86A 2HBWA 3NPFA 2J6FA 2KRNA 1UUEA 2F2XA 4AG2C 3H0IA 2O88A 1NM7A 2YT6A 2HSPA 2PZ1A 1ZUYA 4Z89A 1GFDA 1K76A 2C0TA 1X6GA 2O9SA 1E7OA 4GBQA 3U23A 1SHFA 2JMCA 3UA6A 1KFZA 2JXBA 4HXJA 2DMOA 4JJCA 2FPDA 3VS2A 2CT4A 2SRCA 1GL5A 2J7IA 4Z88A 1EFNA 4J9GA 4WCIA 1NLPC 1WXUA 3VS7A 4DEYA 2EYXA 2EYWA 1E6GA 3A98A 1WYXA 2PNIA 4CC7A 2KE9A 2KXDA 4LE9A 2YUNA 2JT4A 1W1FA 2CUDA 2RQVA 1N5ZA 1HD3A 4RUGA 4JPBW 1X2KA 3M0SA 1PHTA 4RTWA 3VRZA 2CT3A 2K2MA 2KEAA 1NYFA 2M0YA 2O2OA 2OJ2A 3NHNA 1PRLC 2MCNA 4K11A 5EC7A 5IXBA 2XMFA
chains in the Genus database with same CATH superfamily
1VYTA 2ZPEB 2QDLA 2KYBA 2ZCFB 4M78A 4M7AE 1MMAA 1JRIA 2KY9A 4BE2A 1YJWA 2XHCA 2DRMA 1PNJA 3I55A 4F7UG 3P8DA 5FRMA 1AOJA 3QUIA 2NUTB 1RLQC 1QVPA 2RK2A 3CCJQ 2HSEB 3NFCA 4AFUC 2OTJQ 3CCVQ 4FW1A 5C0MA 2ENMA 1R0CB 5IHIA 1JU5C 2RQRA 2EQUA 2QK0A 3M5AA 3RKYA 4E6RA 3I56T 2A37A 2QTVA 3BY7A 3QXEB 1OEBA 2XU8A 1YJWT 4E7IA 3RUXA 2CDTA 3LLRA 2D9TA 3CCLQ 1OPKA 1WGSA 2E6ZA 3CMET 1JO8A 1WIEA 4MDWA 2MK5A 1DJ7B 4PJNA 4D8DA 2YXYA 2OTLQ 4GLKA 4BY6C 2ESWA 1YIJQ 5CIUA 3JCMW 3VV0A 4IUPA 1LJOA 1UGQB 2SEMA 1G5VA 3QZ9B 2X3WD 3RKWA 1KK7A 1Z9ZA 4JJBA 2EGCA 3HTRA 3SWNB 3UF4A 5GANg 4J9CA 1UHFA 1QCNA 1LOJA 2E4HA 2MPXC 1JJ2S 4DOVA 1R0BG 3SWNA 4FSXA 2HQHA 4TVRA 1AEYA 4JLGA 2RJFA 1BB9A 1SRMA 2L3PA 2KROA 4LXCA 2I0NA 4L59A 3QJ6A 3ULRB 4RCCA 2DIQA 5HK0A 2RHZA 2H3EB 4J9BA 2HL3A 1W2BP 4KH1B 1YBYA 5IHNA 2HCKA 2KGTA 5FU7C 2G3RA 1WHGA 1VQKA 2K2VA 1M3CA 2FEIA 1ZSGA 4MDXA 2GQVA 2LQNA 5GAN8 1YITT 2PQWA 3I5RA 3A8LB 1VQKT 4C8QC 2EQJA 1AHJB 4HKEA 2V26A 1Q86C 3NTKA 3MO8A 5HY6A 4JRIA 1K73R 3CD6A 3JCMc 1TXQA 1QVFA 1M8MA 1Q82C 3HHTB 2BUDA 2A28A 1OPLA 2ZZDA 5KYUA 5CR2A 2DBMA 2MIOA 4RTXA 2V8JA 3JCMX 2QQSA 2XDDA 3CD6Q 4IUUA 3QIIA 1M90C 2V8KA 1VYVA 4CC3A 3M0RA 2JJ9A 5KCOA 1YP5A 4ORZA 2DXUA 1Z9QA 3KUFA 2LP5A 4IUQA 3EAEA 1VQNT 1X6OA 3QYGB 4JRQA 3M0PA 4LDUA 4EDUA 2OTLA 2GCXA 3OMGA 2PVDB 1AWXA 1U1TA 3HP9A 1NE8A 1UG1A 5KE2A 3SD4A 4J9DA 2E12A 3OYBA 3G71T 4LDVA 3GBQA 3CCQQ 4LNPA 2JZ2A 3L2WA 3I56A 4FYWB 3SHWA 5LJ5g 1BBZA 1OU8A 4NOYA 1NLOC 1Y7XA 2I2LA 1QWEA 1IHVA 1KQSP 4M77A 4M77E 4X34A 3UWNA 5KYXA 4C8QF 1Y96B 5I2SA 2KNBB 4Z02A 4J9IA 4R56A 1GCQC 2L89A 4ZN3A 4C0DC 5CQYA 1WPYA 3E1SA 3CCUT 2BZ8A 5GAOn 3CPWS 4A4HA 1KG1A 4X9CA 2QDYB 4BE1A 1XOVA 2KRSA 2XICA 2O4XA 4C5HA 5ECAA 2MOXA 3M9QA 2RA2A 2PTKA 9ATCB 2ZAEA 3VRYA 4V2SA 5FU6B 2FYKA 2GQIA 3VKIA 3G71A 2HEQA 2RQUA 2MWPA 2M16A 2WSEE 1SSHA 3JRZA 2LVMA 1UGRB 4PJOG 5GAMf 4M7DC 2FHDA 3OYDA 2IG0A 3EGXA 2DAQA 2L3RA 5GAOm 3QKJA 2FO0A 2A36A 2LMJA 3EGUA 4O5VA 2C06A 3MKDA 2O9VA 1M2VA 1T3LA 1D0YA 2RHIA 4OP0A 1ACMB 2EKOA 1D1CA 5CKBA 3OY9A 1ZX6A 2FRYA 4N4HA 2KQWA 1PRMC 1WHLA 1B34A 1M1KC 4ZGEB 4PJOA 1ZBJA 5A0LA 3DB4A 1KC8U 4IUTA 4BE0A 3MEVA 4OMNA 1M3BA 2F2WA 4BD3A 5IH2A 1MNDA 3G1JA 3UATA 2M0OA 1X69A 2K5IA 4M78C 2JVVA 3OYAA 2FZCB 5D6XA 4KULA 4JZ4A 3C4SA 4OMFB 3LH5A 5LJ3e 3GF5A 4LUDA 3I55Q 2LQ8A 4PFZA 1VQLA 1PKSA 3MEWA 1VQ5T 4L6V5 3FLGA 3V8KA 1ZA2B 1PD0A 5J3BA 2YUOA 4J7FA 1J3TA 1PCXA 4C0FA 1SRLA 2M51A 5LL6S 4PKCC 3CXCA 4AMCA 1GXIE 1SG5A 2EVRA 3VU3C 4FYVB 1W70A 1B3QA 1G83A 2L5QA 1UHCA 4IURA 5KYUB 2QQAA 1B34B 4LUEA 3BW1A 5CKFA 1YITA 2A3LA 1WJSA 5KCHA 3H9NA 2JW4A 2AIRB 3AHUA 4CC2A 2NUPA 1PC0A 3WVEB 1UJYA 3VS5A 1N9RA 2BTTA 4M75E 4GY5A 3CCEA 2LRQA 3EH2A 2V1RA 1TUGB 1VUBA 2WACA 1VQ9A 4HCZA 4PJMA 2O31A 2DERA 3EH1A 1G3WA 4OB3B 2DK3A 4XTYA 4AG2C 3OA6A 2YT6A 4M7AG 1EZZB 4HCBA 2C0TA 3OSSC 1YJNQ 1M2VB 1EIFA 4VUBA 5GAMh 2DD4A 1Q95G 3U23A 2K5LA 3ZEHA 8ATCB 1SHFA 2JMCA 2JXBA 4JDSA 4HXJA 2QEXQ 3VS2A 3JB9H 2CT4A 2SRCA 1NZ9A 2J7IA 3CMEA 3M58A 2DZ9A 5FU6C 2FZGB 4J9GA 1VQ8Q 2KMTA 4WCIA 1BI3A 1K9MU 1NLPC 3VS7A 1RI0A 3HPWA 3CCRA 5J39A 4ELZC 3TQ7P 2LT1A 1FMVA 1SF9A 6AT1B 1HD3A 3M56A 4JPBW 1X2KA 3CCET 2E10A 2CT3A 1ZHIA 4PLIA 2QA4A 3CCMT 3O8VA 3RR6A 4M75F 3MP1A 2F5TX 1VIFA 3META 5C6SA 4PJJA 5GMKl 4RTYA 2AK5A 3X26B 2E1HA 4M75B 1SHGA 3CCQA 1TG0A 2KK4A 1KJWA 3JCMJ 1C6VX 1H3HA 1M4ZA 4A4FA 3OYKA 2YRVA 3KXTA 3CC2T 3BDUA 1PG5B 3MHXA 3DLMA 1IXDA 4C92G 1H641 2K5FA 3M4GA 3MEAA 3DKMA 3EG0A 4DQ2A 4XU3A 1SPKA 3GLXA 2RHYA 3RERA 2KI7A 3KFVA 1ABOA 5M9OA 1UTIA 2BZYA 3OBYA 1UB4A 2D8JA 1TH7A 3RMQA 1WZOA 1VQOT 3VS6A 2IIMA 4BDZA 2X9HA 1YWOA 4OF1A 4QT7A 1FMWA 2LZ6B 5I21A 2V8IA 1I0CA 3ZL7C 3NTIA 5LJ3j 1VQPA 2ED1A 2AHJB 3NTHA 1YJ9Q 2QAZA 3QWXX 2RB6A 3O5ZA 1Q7YR 1IREB 1G3YA 1ZSZA 3NMZC 1X6BA 5J26A 2DL5A 1M1GA 5CAIA 1N27A 4FT4A 1BIAA 1KSWA 5DM7R 5FW9A 4RCBA 2D8HA 4M75C 1KIKA 1UECA 3VS3A 4F04B 3EGDA 2CH4W 2ED0A 2F1LA 4OGEA 3QDRB 4RG8A 3CCVT 3CBPA 1UFFA 1WXBA 2W0ZA 2DBKA 2CZ6B 3JV3A 3REBB 2XI9A 1FWZA 2QASA 1W6XA 2XDPA 2COZA 1OOTA 4J9FA 2YRCA 1XQHA 3CMEQ 4ESRA 1QQJA 1TTHB 4J8OA 4QVZA 3V7SA 1IB8A 1VA7A 4KUIA 4Y28E 5FROA 3G6EQ 1S72A 4OMPA 1YIJT 2XD0A 2XK0A 2E41A 3E9GA 2E64A 3RMSA 5IHKA 3INZA 2QTXA 1D1BA 2Y4XA 4XK8E 1AVZC 1UE9A 1V1CA 4B9WA 3OYIA 2A08A 4E2FB 3PFSA 1AWJA 1M8VA 4BY6B 2GNCA 1QP3A 4NL3A 4DA4A 4PJOF 5GJVB 1SSFA 4C0ZA 2NUTA 3CCJA 1VQ4T 1KQSS 1HJDA 1QKXA 2EYZA 2GF7A 4HT8A 1KHIA 4LDWA 1TUCA 4E7KA 2DO3A 4M78B 3PTAA 3HRSA 3S3MA 3CMAA 2K3BA 4QKUA 1X27A 4PL6A 1RAEB 2ZPBB 1M9SA 3X20B 3L2QA 2RN8A 1K4US 4HVVA 5KYWB 3VJPA 2OTJA 4QVDA 4M77C 4C8QE 4C8QG 5GAN4 1R77A 1Q81R 1VOMA 4E7LA 2VC8A 3DLLA 2YLCA 1YI2T 3MJXA 2QGGA 3CCRT 3HRTA 5L8RE 1ZA1B 2YHTA 4JJDA 2DTHA 4M7DD 4JS5A 2OX7A 3I5SA 3UA7A 2ZGWA 2DPPB 3QYHB 2EJFA 4HCKA 1S72T 3ASKA 2DD5A 2LC4A 3L42A 4E47A 3CMAQ 5KYYA 2EAYA 4X1VA 2YSQA 3CCLA 1MV3A 3GNGA 5FWCA 2JTFA 4DBRA 2GFUA 2CZ0B 1OZ3A 1T3SA 2X4XA 4E7SA 1VQ6Q 1YHQQ 1D1AA 2K7AA 1TS9A 1AWWA 2HDAA 4IIMA 3EGDB 4M78D 5EG2A 4LDYA 2DVJA 5GAN3 1Q81U 2VGNA 4FL6A 2PUKB 1IO6A 2CZ7B 4XU2A 5LJ5j 3CC7A 4FSSA 1TSFA 3OYGA 2CSIA 3QBYA 4M78F 3EFSA 4ZGDB 4JRKA 3C12A 3CCSA 1YN8A 3OW2P 2FPEA 3OS1A 4RTUA 3VUZA 1WA7A 3P8BB 2K4YA 4M77F 1MMDA 4BI4A 3CXCP 5HCKA 3MEUA 4C0DB 2DLPA 3EFOA 4R0KA 5CK9A 5GANj 1VQ7T 5GAMg 1WNLA 2AT1B 2W10A 3CC4Q 4AG1C 3PVLA 2EGEA 3D7SB 1JXOA 4OB0B 1VQLT 1ARKA 2COWA 2JS2A 4KGZB 1M2OA 2K57A 3T9NA 5KH6A 2YUPA 5LJ5h 2FRWA 5DLQE 1G2BA 3R6NA 1H8KA 1MHNA 3RNJA 4J9HA 2NUZA 5KYNA 3J80E 2BE9B 2X51A 2JN0A 2DL7A 2XDBA 5GMKm 3NGPA 4II1A 1NG2A 3BDLA 3TVTA 1BCMA 4OMQA 4PK4A 5CVIA 2DZCA 1VQPQ 2LT4A 4HVWA 2K79A 2RF0A 1QCFA 5GJWB 1TUDA 1VYUA 1M3AA 2LCLA 3G4ST 1QVFP 4FU6A 2KRMA 2DL8A 2Y4YA 1NEBA 2DL3A 4M7DA 4NS5A 5FLXE 1D0ZA 1CKAA 2A0FB 3JB9G 2WSFE 5D6YA 4Z8AA 5IAYA 2L2PA 3FDRA 2KYMA 4HVUA 4C5GA 4KGVB 2J06A 1D09B 1RI9A 4FYXB 2HBWA 5GANe 2DFUA 3NPFA 2J6FA 1UUEA 1UGSB 3PIOA 3H0IA 4DBFA 3BFMA 4A4KA 4KT0E 4C92A 1NM7A 2R58A 2HSPA 4FIBA 3JCMg 1GFDA 4XTZA 1X6GA 1E7OA 2E5QA 3CPWP 4GBQA 3OYEA 1VQ5Q 2DKGA 3KBGA 1VQ7A 4ZTFA 2RI3A 5GAMj 1WQWA 1WHKA 3G7ZA 4CI0C 1W2BS 4Z88A 4B9XA 2YRDA 1YJNA 2NUPB 1KC8C 3PT9A 1BYMA 1Q81C 3FC3A 3LGLA 2EYWA 1E6GA 3HKSA 1KQSA 2EJ9A 4CC7A 2KE9A 2RD1A 4LE9A 2RHUA 2RQVA 3FEOA 4QVCA 2EQKA 3CCJT 2X4YA 3L2RA 3EGXB 2KEAA 4N0AC 1KC8R 2M0YA 3P8HA 4XTXA 2VUBA 1VQMT 3E2UA 2OJ2A 5DY9A 3NHNA 1PRLC 4K11A 5EC7A 1NJIU 2CZ1B 3M4YA 2LJ3A 2DA9A 2R5MA 2AZSA 3JCMQ 2J6OA 3IQLA 5LJ5f 1XNIA 2DNUA 3G6EA 3VYHB 2OTLT 2IPOB 1PSEA 4BACA 4IIOA 1YJNT 2JTEA 1ZQ1A 3OS0A 2RJCA 4QQGA 2ROLA 5LJ5d 3VUBA 3HL8A 4IKFA 4RTZA 2RNAA 4M4ZA 1P92A 3THKA 4E7JA 3FJ5A 2LJ0A 4E7HA 4RKUE 2LCCA 1H92A 2KSSA 1YI2A 4J9EA 4A63B 4RG2A 3CC4A 1BI2A 2VXFA 1WI7A 2D0NA 4J6XA 4M75D 4ME7A 1C0MA 3A8OB 1G8XA 4LN2A 3GNFB 3OQ5A 4E7ZA 3OYJA 2VB6A 3I56Q 3ME9A 1K9AA 1AD5A 4EMGA 2Z0WA 3CQTA 5A2QE 3CCLT 1WQ7A 4C5IA 1YWPA 4N4IA 1OX8A 4ELYC 1GCPA 7AT1B 1GCQA 1T0JA 2PVOB 4OB1B 3JCMP 3I9QA 2CYZB 3EHRA 3OS5A 1YIJA 2L8DA 3WXMB 4AFQC 1WHJA 4Q5WA 1M90U 4F7UF 1VQ6A 2BE7D 3R6OA 2LX9A 2CP5A 1UGPB 2L3SA 3CCSQ 2DEUA 1UJ0A 1OX9A 3PE0A 5FU7B 2NYSA 5KYXB 1O75A 2O4XB 4EMHA 3OSVA 2CP2A 3VS1A 4NL2A 2OAWA 2X3XD 4M7DF 4XTUA 4OMMA 5DLOA 3EFOB 3OYMA 3EG3A 1VQNQ 1MUZA 1Q7YC 2QQ9A 4CC4B 5L23A 4BI8B 1N8RU 3REAB 1Y96A 4M7DG 4B6MA 4PJOC 2KR3A 3JCMV 4N0AA 4A4EA 4ANJA 1D3BA 2KBTA 2K6DA 4P5NA 4OMOA 1QVGS 1VQKQ 1AWOA 4M77D 1I4K1 1SEMA 5HKCA 5FWBA 4MMLA 1KD1U 3V7RA 3JCMe 4JUVA 4C5EA 2ATCB 3S3NA 5GAMd 3GP8A 3M0QA 1ZSZC 2E3IA 2EYYA 1K1ZA 2DTOA 1R8OB 1MNEA 5GAN5 1X2QA 2DYIA 3M53A 1M90R 1ZUUA 1RAIB 1RACB 3X24B 3L2VA 3FRNA 3CD6T 1BK2A 1YCYA 3JAME 1PD1A 1Q82U 4DBQA 1IZ6A 1JQQA 2DXCA 4DOWA 3PVQA 3C94A 1RAGB 4M75G 1K0SA 5AYFA 3L2ZA 2EGAA 2HAXA 3N5BB 2RQWA 2CUBA 4M77G 3G6ET 4MZMA 2DX1A 4F17A 2KT8A 1GBRA 4BI3A 2EPDA 4C92B 3G71Q 1IHWA 4MMKA 3URGA 1VQ9T 4R55A 1RAFB 4OVAA 1U3OA 1AT1B 2M02A 1I07A 3PIPA 1X43A 2F69A 5KYWA 3QZ5B 3V7CA 4D8KA 1JJ2A 3G4SA 5GAOr 1A0NB 1PWTA 2EQMA 2DTIA 3EG9B 2DETA 1BU1A 1ZLMA 1B07A 3H0HA 2MYSA 2L3QA 2JTMA 4JS4A 1NJIR 5I11A 2H3JA 4AFZC 5GAOl 1HYOA 4J83A 1LCKA 2EYQA 3L2UA 4FCYA 2DXTA 3H0FA 2V1QA 3GIBA 2A7YA 2QA4T 3E19A 4JZ3A 2K3YA 1QKWA 2KXCA 3CCUQ 1WLPB 3CXCS 1N8RC 2ZPGB 2CP0A 1WFWA 2CSQA 3CBOA 1WDXA 1TU0B 4XTVA 4F7UB 4ATOA 2KDSA 1HSQA 2DF6A 3PMIA 4MZTA 3QO3A 3JB9I 3I55T 2B8AA 2RJEA 3TSZA 2PVGB 2VWFA 1YI2Q 2EKHA 2HQXA 2HKNA 4EMKA 3UDCA 2RPNA 3X25B 3FIFA 3MP8A 3OYLA 1RAAB 4C92E 2YLBA 4QW2A 4JLIA 3CMAT 3OB9A 1JXMA 2VKNA 2F5KA 3I35A 2X4WA 4KH0B 2DEQA 4RMOA 2FPFA 1GBQA 1G3SA 4PFOA 3SWNC 2ROTA 1VQ6T 2AKLA 3RBBB 3JCMb 5KYYB 1ZBXA 2BKDN 1RABB 4C92D 2DJQA 3FB9A 1IGQA 2AZVA 1M27C 3A8GB 2CP6A 4F16A 3C95A 3LGFA 3LYIA 2DJZA 2GTOA 2CP7A 1Q86U 3M54A 2RMOA 3CC7T 3VYGA 3J81E 1JJ2P 1QVFS 4M7AA 2J05A 4F7UE 4LDXA 2K9GA 1VQ8A 1H3ZA 4A53A 1QLYA 1WJQA 2QQRA 2GBQA 2MWOA 1K8AU 1UDLA 2XIDA 2YWWA 1YCSB 4XU0A 1AZGB 1VQ8T 5IXFA 2LCSA 4QQ6A 3MCAB 3M55A 1M1FA 1VQ5A 4YTLA 2KRNA 2VGMA 2F2XA 2XKOC 4J6WA 1OQKA 3TU4K 1KD1C 2O88A 2FB7A 1I5LA 1ZUYA 2MMPA 4C8QB 4Z89A 1K76A 4JJNK 1N9SA 2O9SA 3LH0A 3CCVA 4F7UA 2OTJT 1OYXA 1LPLA 2X4JA 2DMOA 2FPDA 1GL5A 4KGXB 1YJWQ 4EMKB 1KQ2A 4O6JA 1IRXA 3DB3A 1WHMA 5GAN7 3JB9F 1QMCA 1WHHA 2EWNA 2OAUA 3OW2S 4WF2A 5I2MA 5D6WA 4N4GA 1VQ4A 1JBMA 3A98A 1QP2A 2PNIA 1I5OB 3CCMA 1LNXA 2YUNA 2JT4A 1W1FA 2CUDA 3JB9D 2QEXT 1PHTA 5GMKh 3VRZA 2HZYA 2K2MA 5GAMe 1QVGA 1BKBA 2MCNA 5IXBA 3CCUA 2XMFA 2Y90A 1K0XA 2E5KA 4JRPA 1TWBA 1WX6A 4KUDK 4J6YA 3TREA 1U8RA 1NJIC 4D6WA 3OYHA 4M7AC 3H8ZA 1WXTA 3V8LA 4HT9A 3HFOA 4HA8A 4Y92A 2XG8D 2P4RA 5GAN2 2LQKA 3CCEQ 4A4GA 1ABQA 5GANf 2DL4A 1F1BB 2CGHA 2HMAA 3CCMQ 1YITQ 2ECZA 2JNGA 4HCCA 5CO7A 2PUOB 3EHQA 4C0GA 2P4TA 2EW3A 1FMKA 4BDYA 1UGVA 2DVEA 4X9DA 4XAXB 3JCMh 1OZ2A 1QW1A 2AKKA 1PKTA 1OULA 3M57A 3OW2A 4LD6A 2CH4A 3HSBA 5GAOp 1LVKA 3H41A 5GAN6 4PJOB 2NWMA 4XU1A 4EMKC 1VQMQ 1TOVA 4PLLA 3OYFA 5CKHA 5LJ3h 4DEXA 2FZKB 2QI2A 1UEBA 3TSWA 3S6WA 1VQNA 2ZPHB 4IUVA 2RHXA 2DIGA 2LTOA 3EFRA 3L1AA 4EPCA 1XTDA 1IGUA 4WTOB 4M78E 1U5SA 2MI6A 2E6NA 2VV5A 4XTWA 1GRIA 1OV3A 2VYTA 3CPFA 1YFNA 4KRTA 4PJOD 4ZGJB 4KBMB 1WJRA 2JOYA 3M0TA 3CCQT 3RIRA 2ZPIB 2JM9A 2C0OA 3A8MB 1QWFA 1YJ9T 4M75A 4QQDA 1M5Q1 2FL7A 1Y0MA 4FW2A 3OBWA 3WVDB 2LQWA 1I8FA 5LJ3d 2RO0A 4AFSC 2O01E 1QCOA 1VQ4Q 1YHQA 1RUWA 2MF2A 1MV0B 2K3XA 3A5ZB 3S3OA 5D7UA 2ABLA 4OGCA 1HXDA 2HKQB 2E65A 1RL2A 4L5GA 4FYYB 4PJOE 3AT1B 4C8QD 1RLPC 1VIEA 1AZEA 1O9SA 5GAOq 2JUFA 4EIKA 2LNHB 5GANh 1Y71A 1KD1R 3OYYA 1HK9A 3MP6A 4RTVA 1BI1A 1Y07A 1PSFA 3JB9J 2DRKA 1NBEB 5IT9E 1NPRA 3CCST 2DE0X 1GFCA 2HL5C 2E70A 5GMKe 5A0GA 3JCMf 2D6FA 1JEGA 1CKBA 1NYGA 1PM3A 3VS4A 2JM8A 2CP3A 5AT1B 4M7AB 2C0IA 3CC2A 2PU9B 3PNWC 2IVWA 3QPHA 2QQBA 3UT1A 2CKKA 5A0DA 1YJ9A 5KE3A 3ZFJA 4PFPA 5CKEA 3LW5E 3SDZA 4A54A 5CQXA 2DYBA 2R57A 2ZPFB 5LJ3f 5CKDA 2EJGA 3E9FA 2J6KA 3RKXA 2QXFA 3SB2A 4F14A 4DBHA 1ZUKA 1EX4A 2RI5A 4CRIA 2H8HA 2HD0A 5GANd 4OMLA 2NLUA 1E6HA 2LX7A 1FX7A 4GLMA 3C0CA 1RAHB 4M7DE 3CCRQ 1Q7YU 2COYA 2EBPA 3J7AF 3M59A 2RK1A 4M7AF 1S72Q 2LNVA 3OYNA 4AT1B 2RM4A 2YUQA 1VQ7Q 2G6FX 2P0PA 2L0AA 3MPUB 5GMKj 3SFMA 3PMTA 3EG2A 3A1PA 1BCOA 8AT1B 3JCMd 2KT1A 3UPUA 1NPPA 1FYNA 2VASA 1NEGA 1D0XA 3H6ZA 1W4SA 1C1AA 1YHQT 5IN1A 1FXXA 1N6AA 2D0QB 5I22A 3QWYA 3X28B 4OB2B 4C92C 1VQ9Q 3M0UA 1JB0E 3RDVA 1CSKA 2DM1A 3RESA 3QDFA 1K9MC 1BI0A 4LD9K 1BIBA 2F2VA 3LWIA 3A8HB 1S1NA 1V29B 2GTJA 1T0HA 3BE3A 2CREA 3QSUA 1V76A 3OMCA 2P0KA 4XQ3A 2EFIA 1KQ1A 1KHCA 2JMAA 2VVKA 3EG9A 3G4SQ 2P0QA 4J7IA 2QA4Q 1U1SA 2M1HA 1OU9A 4M7DB 2FG0A 2JS0A 3OYCA 1K73U 2LJ1A 3LX7A 3OS2A 2OI3A 2YDLA 3CBMA 3CPWA 2RH2A 3CC4T 4RTTA 1M1KR 1M1KU 4UC4A 3HFNA 1K73C 2KVQG 3SEMA 1VQLQ 3F70A 3GOXA 2GGRA 1M30A 3QG1A 3ZBDA 4Y91A 2EQIA 1I81A 1I1JA 2FVUA 2DXBA 5FRNA 2DILA 1MGQA 2MAMA 1K9MR 1Q82R 1G3TA 3FJPA 5HK3A 1YNZA 3GPLA 1U06A 2HQEA 2BZXA 3EG1A 3Q1JA 3TCJA 1ZSZB 2HBPA 2RQTA 2D1XA 4PNOA 1Y57A 1VQOA 3VS0A 1SKUB 4ZNXA 2B86A 4FM4B 2X35A 2WSCE 3JSCA 2HNIA 1VQPT 2CS7A 4C92F 4ZTJA 4J5YA 1MMGA 2PZ1A 2KAFA 3CC2Q 2QYZA 4PJLA 3CEYA 5LJ3g 4M77B 2BIVA 1QVGP 3LWHA 2QG9B 2E3HA 3UA6A 1KFZA 1MMNA 2QGFB 1K8AR 4BUGA 1XJWB 2RJDA 4JJCA 2LDMA 4FT2A 1X75C 1B7TA 1N8RR 1D3BB 5GMKi 1EFNA 2GFAA 4C8QA 5LJ5e 1WXUA 2P84A 4MZPA 4DEYA 1W2BA 4ZN1A 3TEEA 5CCAA 4M7AD 4BB7A 2RI2A 2EYXA 2EIFA 1VQOQ 1Q86R 1WYXA 1VQMA 1K8AC 3HRUA 3CC7Q 2KXDA 3ER0A 1N5ZA 2QEXA 1OI1A 2VXEA 4RUGA 4M78G 3M0SA 4RTWA 1X01A 3QHSA 1NYFA 3QJYA 2O2OA 2R5AA 2M9UA 1RADB 3V8JA 3PGGA
chains in the Genus database with same CATH topology
1VYTA 2LJ3A 1K0XA 2E5KA 2QDLA 2DA9A 2KYBA 4RTYA 1WX6A 2AK5A 2AZSA 1SHGA 1TG0A 2J6OA 3IQLA 1KJWA 2DRMA 1PNJA 2DNUA 1H3HA 1WXTA 1AOJA 4IIOA 4Y92A 1RLQC 2JTEA 2P4RA 4AFUC 1ABQA 2ROLA 2DL4A 2ENMA 5IHIA 3EG0A 1JU5C 2RQRA 4E6RA 2A37A 4RTZA 2RNAA 4M4ZA 1OEBA 2ECZA 1SPKA 3FJ5A 3THKA 2CDTA 3EHQA 2LJ0A 3KFVA 1ABOA 1OPKA 2EW3A 1UTIA 1FMKA 1H92A 1JO8A 2BZYA 4J9EA 1WIEA 4A63B 2D8JA 1WI7A 4D8DA 1UGVA 2D0NA 2ESWA 4LN2A 3VS6A 2IIMA 2SEMA 1YWOA 1PKTA 2AKKA 4QT7A 2X3WD 2CH4A 2LZ6B 1I0CA 3H41A 1Z9ZA 3ZL7C 4JJBA 2EGCA 2NWMA 1K9AA 1AD5A 2ED1A 3CQTA 3UF4A 4J9CA 1UHFA 3QWXX 1YWPA 4DEXA 3O5ZA 3TSWA 1GCPA 3NMZC 1X6BA 1AEYA 2DL5A 1BB9A 1SRMA 1GCQA 1T0JA 2L3PA 3I9QA 3EHRA 1U5SA 1KSWA 2KROA 5FW9A 2I0NA 2D8HA 1KIKA 3ULRB 1UECA 4AFQC 3VS3A 1GRIA 2CH4W 1OV3A 2ED0A 4J9BA 5IHNA 2HCKA 2KGTA 4KRTA 3M0TA 1M3CA 1UFFA 2JM9A 2L3SA 2C0OA 2FEIA 1UJ0A 1WXBA 1QWFA 1ZSGA 2W0ZA 2LQNA 2DBKA 3PE0A 3JV3A 3REBB 3I5RA 1W6XA 1OOTA 4J9FA 3VS1A 4ESRA 1Y0MA 2OAWA 2X3XD 4OMMA 2LQWA 1VA7A 4OMPA 3EG3A 4AFSC 1M8MA 1MUZA 1RUWA 4CC4B 5L23A 1MV0B 2ABLA 5IHKA 2A28A 3REAB 1OPLA 2KR3A 1AVZC 2DBMA 2MIOA 4RTXA 1UE9A 1V1CA 2KBTA 2A08A 2K6DA 4OMOA 1AWOA 1AWJA 1VYVA 1SEMA 5FWBA 4CC3A 2GNCA 3M0RA 1RLPC 1YP5A 1AZEA 4ORZA 1Z9QA 4EIKA 2LNHB 2LP5A 5GJVB 1HJDA 3M0PA 1QKXA 2EYZA 1AWXA 4RTVA 3M0QA 2EYYA 1K1ZA 1TUCA 1UG1A 4J9DA 1X2QA 3GBQA 2DRKA 1ZUUA 4LNPA 2K3BA 2DE0X 1GFCA 1X27A 1BK2A 1JQQA 1JEGA 1CKBA 1NYGA 3SHWA 1BBZA 3PVQA 2RN8A 3VS4A 1K4US 2JM8A 4HVVA 1NLOC 1QWEA 1K0SA 2C0IA 2EGAA 2RQWA 2CUBA 2KNBB 2DX1A 4J9IA 4F17A 2KT8A 1GBRA 2EPDA 1GCQC 4JJDA 2DYBA 3I5SA 3UA7A 2J6KA 1U3OA 2BZ8A 4F14A 1I07A 1X43A 1ZUKA 4HCKA 4D8KA 2H8HA 1A0NB 1PWTA 4OMLA 1BU1A 1XOVA 2KRSA 1ZLMA 1E6HA 2LX7A 5ECAA 1B07A 2MOXA 3H0HA 4GLMA 2L3QA 3C0CA 4X1VA 2YSQA 1MV3A 5I11A 5FWCA 4AFZC 2PTKA 1LCKA 3VRYA 1T3SA 3H0FA 2GQIA 2V1QA 2HEQA 2RQUA 2EBPA 2K7AA 1SSHA 4JZ3A 1AWWA 1QKWA 2HDAA 2KXCA 4IIMA 1WLPB 2DVJA 2YUQA 2G6FX 2FO0A 2L0AA 2A36A 2LMJA 3EGUA 1IO6A 1WFWA 2CSQA 1WDXA 2O9VA 3EG2A 4FSSA 1T3LA 2KT1A 1HSQA 2DF6A 2CSIA 1YN8A 3TSZA 1ZX6A 1FYNA 2FPEA 2FRYA 4RTUA 2VWFA 1NEGA 1PRMC 1WA7A 2EKHA 1ZBJA 5HCKA 5I22A 3QWYA 4OMNA 1M3BA 2DLPA 4R0KA 2F2WA 3M0UA 2RPNA 5IH2A 3UATA 1X69A 1CSKA 2DM1A 2F2VA 2W10A 4AG1C 4JZ4A 3PVLA 3LH5A 1S1NA 2EGEA 1JXOA 1JXMA 2VKNA 3I35A 2GTJA 4LUDA 1T0HA 2CREA 1ARKA 2JS2A 2FPFA 1PKSA 1GBQA 2YUPA 2YUOA 2JMAA 2VVKA 2FRWA 1G2BA 3R6NA 1H8KA 2ROTA 3RNJA 4J9HA 2AKLA 3RBBB 2NUZA 1J3TA 1SRLA 2M51A 2FG0A 2JS0A 2DL7A 2LJ1A 2DJQA 2OI3A 2YDLA 2AZVA 1M27C 2EVRA 3NGPA 1W70A 1NG2A 1B3QA 3TVTA 4RTTA 1G83A 4F16A 1UHCA 4OMQA 2GTOA 4LUEA 3SEMA 4HVWA 2GGRA 1M30A 2K79A 2RMOA 2RF0A 1QCFA 2JW4A 2EQIA 5GJWB 1TUDA 1I1JA 4CC2A 1VYUA 1M3AA 2DILA 1UJYA 3VS5A 2J05A 2KRMA 2DL8A 2K9GA 1NEBA 2BTTA 2DL3A 1YNZA 1QLYA 1U06A 1CKAA 2V1RA 2BZXA 3EG1A 2GBQA 1UDLA 2RQTA 4Z8AA 2D1XA 1YCSB 1Y57A 2L2PA 1AZGB 3VS0A 2KYMA 4HVUA 5IXFA 2O31A 4ZNXA 2LCSA 2J06A 1RI9A 2B86A 2HBWA 3NPFA 2J6FA 2KRNA 1UUEA 2F2XA 4AG2C 3H0IA 2O88A 1NM7A 2YT6A 2HSPA 2PZ1A 1ZUYA 4Z89A 1GFDA 1K76A 2C0TA 1X6GA 2O9SA 1E7OA 4GBQA 3U23A 1SHFA 2JMCA 3UA6A 1KFZA 2JXBA 4HXJA 2DMOA 4JJCA 2FPDA 3VS2A 2CT4A 2SRCA 1GL5A 2J7IA 4Z88A 1EFNA 4J9GA 4WCIA 1NLPC 1WXUA 3VS7A 4DEYA 2EYXA 2EYWA 1E6GA 3A98A 1WYXA 2PNIA 4CC7A 2KE9A 2KXDA 4LE9A 2YUNA 2JT4A 1W1FA 2CUDA 2RQVA 1N5ZA 1HD3A 4RUGA 4JPBW 1X2KA 3M0SA 1PHTA 4RTWA 3VRZA 2CT3A 2K2MA 2KEAA 1NYFA 2M0YA 2O2OA 2OJ2A 3NHNA 1PRLC 2MCNA 4K11A 5EC7A 5IXBA 2XMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYT A;  2LJ3 A;  1K0X A;  2E5K A;  2QDL A;  2DA9 A;  2KYB A;  4RTY A;  1WX6 A;  2AK5 A;  2AZS A;  1SHG A;  1TG0 A;  2J6O A;  3IQL A;  1KJW A;  2DRM A;  1PNJ A;  2DNU A;  1H3H A;  1WXT A;  1AOJ A;  4IIO A;  4Y92 A;  1RLQ C;  2JTE A;  2P4R A;  4AFU C;  1ABQ A;  2ROL A;  2DL4 A;  2ENM A;  5IHI A;  3EG0 A;  1JU5 C;  2RQR A;  4E6R A;  2A37 A;  4RTZ A;  2RNA A;  4M4Z A;  1OEB A;  2ECZ A;  1SPK A;  3FJ5 A;  3THK A;  2CDT A;  3EHQ A;  2LJ0 A;  3KFV A;  1ABO A;  1OPK A;  2EW3 A;  1UTI A;  1FMK A;  1H92 A;  1JO8 A;  2BZY A;  4J9E A;  1WIE A;  4A63 B;  2D8J A;  1WI7 A;  4D8D A;  1UGV A;  2D0N A;  2ESW A;  4LN2 A;  3VS6 A;  2IIM A;  2SEM A;  1YWO A;  1PKT A;  2AKK A;  4QT7 A;  2X3W D;  2CH4 A;  2LZ6 B;  1I0C A;  3H41 A;  1Z9Z A;  3ZL7 C;  4JJB A;  2EGC A;  2NWM A;  1K9A A;  1AD5 A;  2ED1 A;  3CQT A;  3UF4 A;  4J9C A;  1UHF A;  3QWX X;  1YWP A;  4DEX A;  3O5Z A;  3TSW A;  1GCP A;  3NMZ C;  1X6B A;  1AEY A;  2DL5 A;  1BB9 A;  1SRM A;  1GCQ A;  1T0J A;  2L3P A;  3I9Q A;  3EHR A;  1U5S A;  1KSW A;  2KRO A;  5FW9 A;  2I0N A;  2D8H A;  1KIK A;  3ULR B;  1UEC A;  4AFQ C;  3VS3 A;  1GRI A;  2CH4 W;  1OV3 A;  2ED0 A;  4J9B A;  5IHN A;  2HCK A;  2KGT A;  4KRT A;  3M0T A;  1M3C A;  1UFF A;  2JM9 A;  2L3S A;  2C0O A;  2FEI A;  1UJ0 A;  1WXB A;  1QWF A;  1ZSG A;  2W0Z A;  2LQN A;  2DBK A;  3PE0 A;  3JV3 A;  3REB B;  3I5R A;  1W6X A;  1OOT A;  4J9F A;  3VS1 A;  4ESR A;  1Y0M A;  2OAW A;  2X3X D;  4OMM A;  2LQW A;  1VA7 A;  4OMP A;  3EG3 A;  4AFS C;  1M8M A;  1MUZ A;  1RUW A;  4CC4 B;  5L23 A;  1MV0 B;  2ABL A;  5IHK A;  2A28 A;  3REA B;  1OPL A;  2KR3 A;  1AVZ C;  2DBM A;  2MIO A;  4RTX A;  1UE9 A;  1V1C A;  2KBT A;  2A08 A;  2K6D A;  4OMO A;  1AWO A;  1AWJ A;  1VYV A;  1SEM A;  5FWB A;  4CC3 A;  2GNC A;  3M0R A;  1RLP C;  1YP5 A;  1AZE A;  4ORZ A;  1Z9Q A;  4EIK A;  2LNH B;  2LP5 A;  5GJV B;  1HJD A;  3M0P A;  1QKX A;  2EYZ A;  1AWX A;  4RTV A;  3M0Q A;  2EYY A;  1K1Z A;  1TUC A;  1UG1 A;  4J9D A;  1X2Q A;  3GBQ A;  2DRK A;  1ZUU A;  4LNP A;  2K3B A;  2DE0 X;  1GFC A;  1X27 A;  1BK2 A;  1JQQ A;  1JEG A;  1CKB A;  1NYG A;  3SHW A;  1BBZ A;  3PVQ A;  2RN8 A;  3VS4 A;  1K4U S;  2JM8 A;  4HVV A;  1NLO C;  1QWE A;  1K0S A;  2C0I A;  2EGA A;  2RQW A;  2CUB A;  2KNB B;  2DX1 A;  4J9I A;  4F17 A;  2KT8 A;  1GBR A;  2EPD A;  1GCQ C;  4JJD A;  2DYB A;  3I5S A;  3UA7 A;  2J6K A;  1U3O A;  2BZ8 A;  4F14 A;  1I07 A;  1X43 A;  1ZUK A;  4HCK A;  4D8K A;  2H8H A;  1A0N B;  1PWT A;  4OML A;  1BU1 A;  1XOV A;  2KRS A;  1ZLM A;  1E6H A;  2LX7 A;  5ECA A;  1B07 A;  2MOX A;  3H0H A;  4GLM A;  2L3Q A;  3C0C A;  4X1V A;  2YSQ A;  1MV3 A;  5I11 A;  5FWC A;  4AFZ C;  2PTK A;  1LCK A;  3VRY A;  1T3S A;  3H0F A;  2GQI A;  2V1Q A;  2HEQ A;  2RQU A;  2EBP A;  2K7A A;  1SSH A;  4JZ3 A;  1AWW A;  1QKW A;  2HDA A;  2KXC A;  4IIM A;  1WLP B;  2DVJ A;  2YUQ A;  2G6F X;  2FO0 A;  2L0A A;  2A36 A;  2LMJ A;  3EGU A;  1IO6 A;  1WFW A;  2CSQ A;  1WDX A;  2O9V A;  3EG2 A;  4FSS A;  1T3L A;  2KT1 A;  1HSQ A;  2DF6 A;  2CSI A;  1YN8 A;  3TSZ A;  1ZX6 A;  1FYN A;  2FPE A;  2FRY A;  4RTU A;  2VWF A;  1NEG A;  1PRM C;  1WA7 A;  2EKH A;  1ZBJ A;  5HCK A;  5I22 A;  3QWY A;  4OMN A;  1M3B A;  2DLP A;  4R0K A;  2F2W A;  3M0U A;  2RPN A;  5IH2 A;  3UAT A;  1X69 A;  1CSK A;  2DM1 A;  2F2V A;  2W10 A;  4AG1 C;  4JZ4 A;  3PVL A;  3LH5 A;  1S1N A;  2EGE A;  1JXO A;  1JXM A;  2VKN A;  3I35 A;  2GTJ A;  4LUD A;  1T0H A;  2CRE A;  1ARK A;  2JS2 A;  2FPF A;  1PKS A;  1GBQ A;  2YUP A;  2YUO A;  2JMA A;  2VVK A;  2FRW A;  1G2B A;  3R6N A;  1H8K A;  2ROT A;  3RNJ A;  4J9H A;  2AKL A;  3RBB B;  2NUZ A;  1J3T A;  1SRL A;  2M51 A;  2FG0 A;  2JS0 A;  2DL7 A;  2LJ1 A;  2DJQ A;  2OI3 A;  2YDL A;  2AZV A;  1M27 C;  2EVR A;  3NGP A;  1W70 A;  1NG2 A;  1B3Q A;  3TVT A;  4RTT A;  1G83 A;  4F16 A;  1UHC A;  4OMQ A;  2GTO A;  4LUE A;  3SEM A;  4HVW A;  2GGR A;  1M30 A;  2K79 A;  2RMO A;  2RF0 A;  1QCF A;  2JW4 A;  2EQI A;  5GJW B;  1TUD A;  1I1J A;  4CC2 A;  1VYU A;  1M3A A;  2DIL A;  1UJY A;  3VS5 A;  2J05 A;  2KRM A;  2DL8 A;  2K9G A;  1NEB A;  2BTT A;  2DL3 A;  1YNZ A;  1QLY A;  1U06 A;  1CKA A;  2V1R A;  2BZX A;  3EG1 A;  2GBQ A;  1UDL A;  2RQT A;  4Z8A A;  2D1X A;  1YCS B;  1Y57 A;  2L2P A;  1AZG B;  3VS0 A;  2KYM A;  4HVU A;  5IXF A;  2O31 A;  4ZNX A;  2LCS A;  2J06 A;  1RI9 A;  2B86 A;  2HBW A;  3NPF A;  2J6F A;  2KRN A;  1UUE A;  2F2X A;  4AG2 C;  3H0I A;  2O88 A;  1NM7 A;  2YT6 A;  2HSP A;  2PZ1 A;  1ZUY A;  4Z89 A;  1GFD A;  1K76 A;  2C0T A;  1X6G A;  2O9S A;  1E7O A;  4GBQ A;  3U23 A;  1SHF A;  2JMC A;  3UA6 A;  1KFZ A;  2JXB A;  4HXJ A;  2DMO A;  4JJC A;  2FPD A;  3VS2 A;  2CT4 A;  2SRC A;  1GL5 A;  2J7I A;  4Z88 A;  1EFN A;  4J9G A;  4WCI A;  1NLP C;  1WXU A;  3VS7 A;  4DEY A;  2EYX A;  2EYW A;  1E6G A;  3A98 A;  1WYX A;  2PNI A;  4CC7 A;  2KE9 A;  2KXD A;  4LE9 A;  2YUN A;  2JT4 A;  1W1F A;  2CUD A;  2RQV A;  1N5Z A;  1HD3 A;  4RUG A;  4JPB W;  1X2K A;  3M0S A;  1PHT A;  4RTW A;  3VRZ A;  2CT3 A;  2K2M A;  2KEA A;  1NYF A;  2M0Y A;  2O2O A;  2OJ2 A;  3NHN A;  1PRL C;  2MCN A;  4K11 A;  5EC7 A;  5IXB A;  2XMF A; 
#chains in the Genus database with same CATH topology
 1VYT A;  2ZPE B;  2QDL A;  2KYB A;  2ZCF B;  4M78 A;  4M7A E;  1MMA A;  1JRI A;  2KY9 A;  4BE2 A;  1YJW A;  2XHC A;  2DRM A;  1PNJ A;  3I55 A;  4F7U G;  3P8D A;  5FRM A;  1AOJ A;  3QUI A;  2NUT B;  1RLQ C;  1QVP A;  2RK2 A;  3CCJ Q;  2HSE B;  3NFC A;  4AFU C;  2OTJ Q;  3CCV Q;  4FW1 A;  5C0M A;  2ENM A;  1R0C B;  5IHI A;  1JU5 C;  2RQR A;  2EQU A;  2QK0 A;  3M5A A;  3RKY A;  4E6R A;  3I56 T;  2A37 A;  2QTV A;  3BY7 A;  3QXE B;  1OEB A;  2XU8 A;  1YJW T;  4E7I A;  3RUX A;  2CDT A;  3LLR A;  2D9T A;  3CCL Q;  1OPK A;  1WGS A;  2E6Z A;  3CME T;  1JO8 A;  1WIE A;  4MDW A;  2MK5 A;  1DJ7 B;  4PJN A;  4D8D A;  2YXY A;  2OTL Q;  4GLK A;  4BY6 C;  2ESW A;  1YIJ Q;  5CIU A;  3JCM W;  3VV0 A;  4IUP A;  1LJO A;  1UGQ B;  2SEM A;  1G5V A;  3QZ9 B;  2X3W D;  3RKW A;  1KK7 A;  1Z9Z A;  4JJB A;  2EGC A;  3HTR A;  3SWN B;  3UF4 A;  5GAN g;  4J9C A;  1UHF A;  1QCN A;  1LOJ A;  2E4H A;  2MPX C;  1JJ2 S;  4DOV A;  1R0B G;  3SWN A;  4FSX A;  2HQH A;  4TVR A;  1AEY A;  4JLG A;  2RJF A;  1BB9 A;  1SRM A;  2L3P A;  2KRO A;  4LXC A;  2I0N A;  4L59 A;  3QJ6 A;  3ULR B;  4RCC A;  2DIQ A;  5HK0 A;  2RHZ A;  2H3E B;  4J9B A;  2HL3 A;  1W2B P;  4KH1 B;  1YBY A;  5IHN A;  2HCK A;  2KGT A;  5FU7 C;  2G3R A;  1WHG A;  1VQK A;  2K2V A;  1M3C A;  2FEI A;  1ZSG A;  4MDX A;  2GQV A;  2LQN A;  5GAN 8;  1YIT T;  2PQW A;  3I5R A;  3A8L B;  1VQK T;  4C8Q C;  2EQJ A;  1AHJ B;  4HKE A;  2V26 A;  1Q86 C;  3NTK A;  3MO8 A;  5HY6 A;  4JRI A;  1K73 R;  3CD6 A;  3JCM c;  1TXQ A;  1QVF A;  1M8M A;  1Q82 C;  3HHT B;  2BUD A;  2A28 A;  1OPL A;  2ZZD A;  5KYU A;  5CR2 A;  2DBM A;  2MIO A;  4RTX A;  2V8J A;  3JCM X;  2QQS A;  2XDD A;  3CD6 Q;  4IUU A;  3QII A;  1M90 C;  2V8K A;  1VYV A;  4CC3 A;  3M0R A;  2JJ9 A;  5KCO A;  1YP5 A;  4ORZ A;  2DXU A;  1Z9Q A;  3KUF A;  2LP5 A;  4IUQ A;  3EAE A;  1VQN T;  1X6O A;  3QYG B;  4JRQ A;  3M0P A;  4LDU A;  4EDU A;  2OTL A;  2GCX A;  3OMG A;  2PVD B;  1AWX A;  1U1T A;  3HP9 A;  1NE8 A;  1UG1 A;  5KE2 A;  3SD4 A;  4J9D A;  2E12 A;  3OYB A;  3G71 T;  4LDV A;  3GBQ A;  3CCQ Q;  4LNP A;  2JZ2 A;  3L2W A;  3I56 A;  4FYW B;  3SHW A;  5LJ5 g;  1BBZ A;  1OU8 A;  4NOY A;  1NLO C;  1Y7X A;  2I2L A;  1QWE A;  1IHV A;  1KQS P;  4M77 A;  4M77 E;  4X34 A;  3UWN A;  5KYX A;  4C8Q F;  1Y96 B;  5I2S A;  2KNB B;  4Z02 A;  4J9I A;  4R56 A;  1GCQ C;  2L89 A;  4ZN3 A;  4C0D C;  5CQY A;  1WPY A;  3E1S A;  3CCU T;  2BZ8 A;  5GAO n;  3CPW S;  4A4H A;  1KG1 A;  4X9C A;  2QDY B;  4BE1 A;  1XOV A;  2KRS A;  2XIC A;  2O4X A;  4C5H A;  5ECA A;  2MOX A;  3M9Q A;  2RA2 A;  2PTK A;  9ATC B;  2ZAE A;  3VRY A;  4V2S A;  5FU6 B;  2FYK A;  2GQI A;  3VKI A;  3G71 A;  2HEQ A;  2RQU A;  2MWP A;  2M16 A;  2WSE E;  1SSH A;  3JRZ A;  2LVM A;  1UGR B;  4PJO G;  5GAM f;  4M7D C;  2FHD A;  3OYD A;  2IG0 A;  3EGX A;  2DAQ A;  2L3R A;  5GAO m;  3QKJ A;  2FO0 A;  2A36 A;  2LMJ A;  3EGU A;  4O5V A;  2C06 A;  3MKD A;  2O9V A;  1M2V A;  1T3L A;  1D0Y A;  2RHI A;  4OP0 A;  1ACM B;  2EKO A;  1D1C A;  5CKB A;  3OY9 A;  1ZX6 A;  2FRY A;  4N4H A;  2KQW A;  1PRM C;  1WHL A;  1B34 A;  1M1K C;  4ZGE B;  4PJO A;  1ZBJ A;  5A0L A;  3DB4 A;  1KC8 U;  4IUT A;  4BE0 A;  3MEV A;  4OMN A;  1M3B A;  2F2W A;  4BD3 A;  5IH2 A;  1MND A;  3G1J A;  3UAT A;  2M0O A;  1X69 A;  2K5I A;  4M78 C;  2JVV A;  3OYA A;  2FZC B;  5D6X A;  4KUL A;  4JZ4 A;  3C4S A;  4OMF B;  3LH5 A;  5LJ3 e;  3GF5 A;  4LUD A;  3I55 Q;  2LQ8 A;  4PFZ A;  1VQL A;  1PKS A;  3MEW A;  1VQ5 T;  4L6V 5;  3FLG A;  3V8K A;  1ZA2 B;  1PD0 A;  5J3B A;  2YUO A;  4J7F A;  1J3T A;  1PCX A;  4C0F A;  1SRL A;  2M51 A;  5LL6 S;  4PKC C;  3CXC A;  4AMC A;  1GXI E;  1SG5 A;  2EVR A;  3VU3 C;  4FYV B;  1W70 A;  1B3Q A;  1G83 A;  2L5Q A;  1UHC A;  4IUR A;  5KYU B;  2QQA A;  1B34 B;  4LUE A;  3BW1 A;  5CKF A;  1YIT A;  2A3L A;  1WJS A;  5KCH A;  3H9N A;  2JW4 A;  2AIR B;  3AHU A;  4CC2 A;  2NUP A;  1PC0 A;  3WVE B;  1UJY A;  3VS5 A;  1N9R A;  2BTT A;  4M75 E;  4GY5 A;  3CCE A;  2LRQ A;  3EH2 A;  2V1R A;  1TUG B;  1VUB A;  2WAC A;  1VQ9 A;  4HCZ A;  4PJM A;  2O31 A;  2DER A;  3EH1 A;  1G3W A;  4OB3 B;  2DK3 A;  4XTY A;  4AG2 C;  3OA6 A;  2YT6 A;  4M7A G;  1EZZ B;  4HCB A;  2C0T A;  3OSS C;  1YJN Q;  1M2V B;  1EIF A;  4VUB A;  5GAM h;  2DD4 A;  1Q95 G;  3U23 A;  2K5L A;  3ZEH A;  8ATC B;  1SHF A;  2JMC A;  2JXB A;  4JDS A;  4HXJ A;  2QEX Q;  3VS2 A;  3JB9 H;  2CT4 A;  2SRC A;  1NZ9 A;  2J7I A;  3CME A;  3M58 A;  2DZ9 A;  5FU6 C;  2FZG B;  4J9G A;  1VQ8 Q;  2KMT A;  4WCI A;  1BI3 A;  1K9M U;  1NLP C;  3VS7 A;  1RI0 A;  3HPW A;  3CCR A;  5J39 A;  4ELZ C;  3TQ7 P;  2LT1 A;  1FMV A;  1SF9 A;  6AT1 B;  1HD3 A;  3M56 A;  4JPB W;  1X2K A;  3CCE T;  2E10 A;  2CT3 A;  1ZHI A;  4PLI A;  2QA4 A;  3CCM T;  3O8V A;  3RR6 A;  4M75 F;  3MP1 A;  2F5T X;  1VIF A;  3MET A;  5C6S A;  4PJJ A;  5GMK l;  4RTY A;  2AK5 A;  3X26 B;  2E1H A;  4M75 B;  1SHG A;  3CCQ A;  1TG0 A;  2KK4 A;  1KJW A;  3JCM J;  1C6V X;  1H3H A;  1M4Z A;  4A4F A;  3OYK A;  2YRV A;  3KXT A;  3CC2 T;  3BDU A;  1PG5 B;  3MHX A;  3DLM A;  1IXD A;  4C92 G;  1H64 1;  2K5F A;  3M4G A;  3MEA A;  3DKM A;  3EG0 A;  4DQ2 A;  4XU3 A;  1SPK A;  3GLX A;  2RHY A;  3RER A;  2KI7 A;  3KFV A;  1ABO A;  5M9O A;  1UTI A;  2BZY A;  3OBY A;  1UB4 A;  2D8J A;  1TH7 A;  3RMQ A;  1WZO A;  1VQO T;  3VS6 A;  2IIM A;  4BDZ A;  2X9H A;  1YWO A;  4OF1 A;  4QT7 A;  1FMW A;  2LZ6 B;  5I21 A;  2V8I A;  1I0C A;  3ZL7 C;  3NTI A;  5LJ3 j;  1VQP A;  2ED1 A;  2AHJ B;  3NTH A;  1YJ9 Q;  2QAZ A;  3QWX X;  2RB6 A;  3O5Z A;  1Q7Y R;  1IRE B;  1G3Y A;  1ZSZ A;  3NMZ C;  1X6B A;  5J26 A;  2DL5 A;  1M1G A;  5CAI A;  1N27 A;  4FT4 A;  1BIA A;  1KSW A;  5DM7 R;  5FW9 A;  4RCB A;  2D8H A;  4M75 C;  1KIK A;  1UEC A;  3VS3 A;  4F04 B;  3EGD A;  2CH4 W;  2ED0 A;  2F1L A;  4OGE A;  3QDR B;  4RG8 A;  3CCV T;  3CBP A;  1UFF A;  1WXB A;  2W0Z A;  2DBK A;  2CZ6 B;  3JV3 A;  3REB B;  2XI9 A;  1FWZ A;  2QAS A;  1W6X A;  2XDP A;  2COZ A;  1OOT A;  4J9F A;  2YRC A;  1XQH A;  3CME Q;  4ESR A;  1QQJ A;  1TTH B;  4J8O A;  4QVZ A;  3V7S A;  1IB8 A;  1VA7 A;  4KUI A;  4Y28 E;  5FRO A;  3G6E Q;  1S72 A;  4OMP A;  1YIJ T;  2XD0 A;  2XK0 A;  2E41 A;  3E9G A;  2E64 A;  3RMS A;  5IHK A;  3INZ A;  2QTX A;  1D1B A;  2Y4X A;  4XK8 E;  1AVZ C;  1UE9 A;  1V1C A;  4B9W A;  3OYI A;  2A08 A;  4E2F B;  3PFS A;  1AWJ A;  1M8V A;  4BY6 B;  2GNC A;  1QP3 A;  4NL3 A;  4DA4 A;  4PJO F;  5GJV B;  1SSF A;  4C0Z A;  2NUT A;  3CCJ A;  1VQ4 T;  1KQS S;  1HJD A;  1QKX A;  2EYZ A;  2GF7 A;  4HT8 A;  1KHI A;  4LDW A;  1TUC A;  4E7K A;  2DO3 A;  4M78 B;  3PTA A;  3HRS A;  3S3M A;  3CMA A;  2K3B A;  4QKU A;  1X27 A;  4PL6 A;  1RAE B;  2ZPB B;  1M9S A;  3X20 B;  3L2Q A;  2RN8 A;  1K4U S;  4HVV A;  5KYW B;  3VJP A;  2OTJ A;  4QVD A;  4M77 C;  4C8Q E;  4C8Q G;  5GAN 4;  1R77 A;  1Q81 R;  1VOM A;  4E7L A;  2VC8 A;  3DLL A;  2YLC A;  1YI2 T;  3MJX A;  2QGG A;  3CCR T;  3HRT A;  5L8R E;  1ZA1 B;  2YHT A;  4JJD A;  2DTH A;  4M7D D;  4JS5 A;  2OX7 A;  3I5S A;  3UA7 A;  2ZGW A;  2DPP B;  3QYH B;  2EJF A;  4HCK A;  1S72 T;  3ASK A;  2DD5 A;  2LC4 A;  3L42 A;  4E47 A;  3CMA Q;  5KYY A;  2EAY A;  4X1V A;  2YSQ A;  3CCL A;  1MV3 A;  3GNG A;  5FWC A;  2JTF A;  4DBR A;  2GFU A;  2CZ0 B;  1OZ3 A;  1T3S A;  2X4X A;  4E7S A;  1VQ6 Q;  1YHQ Q;  1D1A A;  2K7A A;  1TS9 A;  1AWW A;  2HDA A;  4IIM A;  3EGD B;  4M78 D;  5EG2 A;  4LDY A;  2DVJ A;  5GAN 3;  1Q81 U;  2VGN A;  4FL6 A;  2PUK B;  1IO6 A;  2CZ7 B;  4XU2 A;  5LJ5 j;  3CC7 A;  4FSS A;  1TSF A;  3OYG A;  2CSI A;  3QBY A;  4M78 F;  3EFS A;  4ZGD B;  4JRK A;  3C12 A;  3CCS A;  1YN8 A;  3OW2 P;  2FPE A;  3OS1 A;  4RTU A;  3VUZ A;  1WA7 A;  3P8B B;  2K4Y A;  4M77 F;  1MMD A;  4BI4 A;  3CXC P;  5HCK A;  3MEU A;  4C0D B;  2DLP A;  3EFO A;  4R0K A;  5CK9 A;  5GAN j;  1VQ7 T;  5GAM g;  1WNL A;  2AT1 B;  2W10 A;  3CC4 Q;  4AG1 C;  3PVL A;  2EGE A;  3D7S B;  1JXO A;  4OB0 B;  1VQL T;  1ARK A;  2COW A;  2JS2 A;  4KGZ B;  1M2O A;  2K57 A;  3T9N A;  5KH6 A;  2YUP A;  5LJ5 h;  2FRW A;  5DLQ E;  1G2B A;  3R6N A;  1H8K A;  1MHN A;  3RNJ A;  4J9H A;  2NUZ A;  5KYN A;  3J80 E;  2BE9 B;  2X51 A;  2JN0 A;  2DL7 A;  2XDB A;  5GMK m;  3NGP A;  4II1 A;  1NG2 A;  3BDL A;  3TVT A;  1BCM A;  4OMQ A;  4PK4 A;  5CVI A;  2DZC A;  1VQP Q;  2LT4 A;  4HVW A;  2K79 A;  2RF0 A;  1QCF A;  5GJW B;  1TUD A;  1VYU A;  1M3A A;  2LCL A;  3G4S T;  1QVF P;  4FU6 A;  2KRM A;  2DL8 A;  2Y4Y A;  1NEB A;  2DL3 A;  4M7D A;  4NS5 A;  5FLX E;  1D0Z A;  1CKA A;  2A0F B;  3JB9 G;  2WSF E;  5D6Y A;  4Z8A A;  5IAY A;  2L2P A;  3FDR A;  2KYM A;  4HVU A;  4C5G A;  4KGV B;  2J06 A;  1D09 B;  1RI9 A;  4FYX B;  2HBW A;  5GAN e;  2DFU A;  3NPF A;  2J6F A;  1UUE A;  1UGS B;  3PIO A;  3H0I A;  4DBF A;  3BFM A;  4A4K A;  4KT0 E;  4C92 A;  1NM7 A;  2R58 A;  2HSP A;  4FIB A;  3JCM g;  1GFD A;  4XTZ A;  1X6G A;  1E7O A;  2E5Q A;  3CPW P;  4GBQ A;  3OYE A;  1VQ5 Q;  2DKG A;  3KBG A;  1VQ7 A;  4ZTF A;  2RI3 A;  5GAM j;  1WQW A;  1WHK A;  3G7Z A;  4CI0 C;  1W2B S;  4Z88 A;  4B9X A;  2YRD A;  1YJN A;  2NUP B;  1KC8 C;  3PT9 A;  1BYM A;  1Q81 C;  3FC3 A;  3LGL A;  2EYW A;  1E6G A;  3HKS A;  1KQS A;  2EJ9 A;  4CC7 A;  2KE9 A;  2RD1 A;  4LE9 A;  2RHU A;  2RQV A;  3FEO A;  4QVC A;  2EQK A;  3CCJ T;  2X4Y A;  3L2R A;  3EGX B;  2KEA A;  4N0A C;  1KC8 R;  2M0Y A;  3P8H A;  4XTX A;  2VUB A;  1VQM T;  3E2U A;  2OJ2 A;  5DY9 A;  3NHN A;  1PRL C;  4K11 A;  5EC7 A;  1NJI U;  2CZ1 B;  3M4Y A;  2LJ3 A;  2DA9 A;  2R5M A;  2AZS A;  3JCM Q;  2J6O A;  3IQL A;  5LJ5 f;  1XNI A;  2DNU A;  3G6E A;  3VYH B;  2OTL T;  2IPO B;  1PSE A;  4BAC A;  4IIO A;  1YJN T;  2JTE A;  1ZQ1 A;  3OS0 A;  2RJC A;  4QQG A;  2ROL A;  5LJ5 d;  3VUB A;  3HL8 A;  4IKF A;  4RTZ A;  2RNA A;  4M4Z A;  1P92 A;  3THK A;  4E7J A;  3FJ5 A;  2LJ0 A;  4E7H A;  4RKU E;  2LCC A;  1H92 A;  2KSS A;  1YI2 A;  4J9E A;  4A63 B;  4RG2 A;  3CC4 A;  1BI2 A;  2VXF A;  1WI7 A;  2D0N A;  4J6X A;  4M75 D;  4ME7 A;  1C0M A;  3A8O B;  1G8X A;  4LN2 A;  3GNF B;  3OQ5 A;  4E7Z A;  3OYJ A;  2VB6 A;  3I56 Q;  3ME9 A;  1K9A A;  1AD5 A;  4EMG A;  2Z0W A;  3CQT A;  5A2Q E;  3CCL T;  1WQ7 A;  4C5I A;  1YWP A;  4N4I A;  1OX8 A;  4ELY C;  1GCP A;  7AT1 B;  1GCQ A;  1T0J A;  2PVO B;  4OB1 B;  3JCM P;  3I9Q A;  2CYZ B;  3EHR A;  3OS5 A;  1YIJ A;  2L8D A;  3WXM B;  4AFQ C;  1WHJ A;  4Q5W A;  1M90 U;  4F7U F;  1VQ6 A;  2BE7 D;  3R6O A;  2LX9 A;  2CP5 A;  1UGP B;  2L3S A;  3CCS Q;  2DEU A;  1UJ0 A;  1OX9 A;  3PE0 A;  5FU7 B;  2NYS A;  5KYX B;  1O75 A;  2O4X B;  4EMH A;  3OSV A;  2CP2 A;  3VS1 A;  4NL2 A;  2OAW A;  2X3X D;  4M7D F;  4XTU A;  4OMM A;  5DLO A;  3EFO B;  3OYM A;  3EG3 A;  1VQN Q;  1MUZ A;  1Q7Y C;  2QQ9 A;  4CC4 B;  5L23 A;  4BI8 B;  1N8R U;  3REA B;  1Y96 A;  4M7D G;  4B6M A;  4PJO C;  2KR3 A;  3JCM V;  4N0A A;  4A4E A;  4ANJ A;  1D3B A;  2KBT A;  2K6D A;  4P5N A;  4OMO A;  1QVG S;  1VQK Q;  1AWO A;  4M77 D;  1I4K 1;  1SEM A;  5HKC A;  5FWB A;  4MML A;  1KD1 U;  3V7R A;  3JCM e;  4JUV A;  4C5E A;  2ATC B;  3S3N A;  5GAM d;  3GP8 A;  3M0Q A;  1ZSZ C;  2E3I A;  2EYY A;  1K1Z A;  2DTO A;  1R8O B;  1MNE A;  5GAN 5;  1X2Q A;  2DYI A;  3M53 A;  1M90 R;  1ZUU A;  1RAI B;  1RAC B;  3X24 B;  3L2V A;  3FRN A;  3CD6 T;  1BK2 A;  1YCY A;  3JAM E;  1PD1 A;  1Q82 U;  4DBQ A;  1IZ6 A;  1JQQ A;  2DXC A;  4DOW A;  3PVQ A;  3C94 A;  1RAG B;  4M75 G;  1K0S A;  5AYF A;  3L2Z A;  2EGA A;  2HAX A;  3N5B B;  2RQW A;  2CUB A;  4M77 G;  3G6E T;  4MZM A;  2DX1 A;  4F17 A;  2KT8 A;  1GBR A;  4BI3 A;  2EPD A;  4C92 B;  3G71 Q;  1IHW A;  4MMK A;  3URG A;  1VQ9 T;  4R55 A;  1RAF B;  4OVA A;  1U3O A;  1AT1 B;  2M02 A;  1I07 A;  3PIP A;  1X43 A;  2F69 A;  5KYW A;  3QZ5 B;  3V7C A;  4D8K A;  1JJ2 A;  3G4S A;  5GAO r;  1A0N B;  1PWT A;  2EQM A;  2DTI A;  3EG9 B;  2DET A;  1BU1 A;  1ZLM A;  1B07 A;  3H0H A;  2MYS A;  2L3Q A;  2JTM A;  4JS4 A;  1NJI R;  5I11 A;  2H3J A;  4AFZ C;  5GAO l;  1HYO A;  4J83 A;  1LCK A;  2EYQ A;  3L2U A;  4FCY A;  2DXT A;  3H0F A;  2V1Q A;  3GIB A;  2A7Y A;  2QA4 T;  3E19 A;  4JZ3 A;  2K3Y A;  1QKW A;  2KXC A;  3CCU Q;  1WLP B;  3CXC S;  1N8R C;  2ZPG B;  2CP0 A;  1WFW A;  2CSQ A;  3CBO A;  1WDX A;  1TU0 B;  4XTV A;  4F7U B;  4ATO A;  2KDS A;  1HSQ A;  2DF6 A;  3PMI A;  4MZT A;  3QO3 A;  3JB9 I;  3I55 T;  2B8A A;  2RJE A;  3TSZ A;  2PVG B;  2VWF A;  1YI2 Q;  2EKH A;  2HQX A;  2HKN A;  4EMK A;  3UDC A;  2RPN A;  3X25 B;  3FIF A;  3MP8 A;  3OYL A;  1RAA B;  4C92 E;  2YLB A;  4QW2 A;  4JLI A;  3CMA T;  3OB9 A;  1JXM A;  2VKN A;  2F5K A;  3I35 A;  2X4W A;  4KH0 B;  2DEQ A;  4RMO A;  2FPF A;  1GBQ A;  1G3S A;  4PFO A;  3SWN C;  2ROT A;  1VQ6 T;  2AKL A;  3RBB B;  3JCM b;  5KYY B;  1ZBX A;  2BKD N;  1RAB B;  4C92 D;  2DJQ A;  3FB9 A;  1IGQ A;  2AZV A;  1M27 C;  3A8G B;  2CP6 A;  4F16 A;  3C95 A;  3LGF A;  3LYI A;  2DJZ A;  2GTO A;  2CP7 A;  1Q86 U;  3M54 A;  2RMO A;  3CC7 T;  3VYG A;  3J81 E;  1JJ2 P;  1QVF S;  4M7A A;  2J05 A;  4F7U E;  4LDX A;  2K9G A;  1VQ8 A;  1H3Z A;  4A53 A;  1QLY A;  1WJQ A;  2QQR A;  2GBQ A;  2MWO A;  1K8A U;  1UDL A;  2XID A;  2YWW A;  1YCS B;  4XU0 A;  1AZG B;  1VQ8 T;  5IXF A;  2LCS A;  4QQ6 A;  3MCA B;  3M55 A;  1M1F A;  1VQ5 A;  4YTL A;  2KRN A;  2VGM A;  2F2X A;  2XKO C;  4J6W A;  1OQK A;  3TU4 K;  1KD1 C;  2O88 A;  2FB7 A;  1I5L A;  1ZUY A;  2MMP A;  4C8Q B;  4Z89 A;  1K76 A;  4JJN K;  1N9S A;  2O9S A;  3LH0 A;  3CCV A;  4F7U A;  2OTJ T;  1OYX A;  1LPL A;  2X4J A;  2DMO A;  2FPD A;  1GL5 A;  4KGX B;  1YJW Q;  4EMK B;  1KQ2 A;  4O6J A;  1IRX A;  3DB3 A;  1WHM A;  5GAN 7;  3JB9 F;  1QMC A;  1WHH A;  2EWN A;  2OAU A;  3OW2 S;  4WF2 A;  5I2M A;  5D6W A;  4N4G A;  1VQ4 A;  1JBM A;  3A98 A;  1QP2 A;  2PNI A;  1I5O B;  3CCM A;  1LNX A;  2YUN A;  2JT4 A;  1W1F A;  2CUD A;  3JB9 D;  2QEX T;  1PHT A;  5GMK h;  3VRZ A;  2HZY A;  2K2M A;  5GAM e;  1QVG A;  1BKB A;  2MCN A;  5IXB A;  3CCU A;  2XMF A;  2Y90 A;  1K0X A;  2E5K A;  4JRP A;  1TWB A;  1WX6 A;  4KUD K;  4J6Y A;  3TRE A;  1U8R A;  1NJI C;  4D6W A;  3OYH A;  4M7A C;  3H8Z A;  1WXT A;  3V8L A;  4HT9 A;  3HFO A;  4HA8 A;  4Y92 A;  2XG8 D;  2P4R A;  5GAN 2;  2LQK A;  3CCE Q;  4A4G A;  1ABQ A;  5GAN f;  2DL4 A;  1F1B B;  2CGH A;  2HMA A;  3CCM Q;  1YIT Q;  2ECZ A;  2JNG A;  4HCC A;  5CO7 A;  2PUO B;  3EHQ A;  4C0G A;  2P4T A;  2EW3 A;  1FMK A;  4BDY A;  1UGV A;  2DVE A;  4X9D A;  4XAX B;  3JCM h;  1OZ2 A;  1QW1 A;  2AKK A;  1PKT A;  1OUL A;  3M57 A;  3OW2 A;  4LD6 A;  2CH4 A;  3HSB A;  5GAO p;  1LVK A;  3H41 A;  5GAN 6;  4PJO B;  2NWM A;  4XU1 A;  4EMK C;  1VQM Q;  1TOV A;  4PLL A;  3OYF A;  5CKH A;  5LJ3 h;  4DEX A;  2FZK B;  2QI2 A;  1UEB A;  3TSW A;  3S6W A;  1VQN A;  2ZPH B;  4IUV A;  2RHX A;  2DIG A;  2LTO A;  3EFR A;  3L1A A;  4EPC A;  1XTD A;  1IGU A;  4WTO B;  4M78 E;  1U5S A;  2MI6 A;  2E6N A;  2VV5 A;  4XTW A;  1GRI A;  1OV3 A;  2VYT A;  3CPF A;  1YFN A;  4KRT A;  4PJO D;  4ZGJ B;  4KBM B;  1WJR A;  2JOY A;  3M0T A;  3CCQ T;  3RIR A;  2ZPI B;  2JM9 A;  2C0O A;  3A8M B;  1QWF A;  1YJ9 T;  4M75 A;  4QQD A;  1M5Q 1;  2FL7 A;  1Y0M A;  4FW2 A;  3OBW A;  3WVD B;  2LQW A;  1I8F A;  5LJ3 d;  2RO0 A;  4AFS C;  2O01 E;  1QCO A;  1VQ4 Q;  1YHQ A;  1RUW A;  2MF2 A;  1MV0 B;  2K3X A;  3A5Z B;  3S3O A;  5D7U A;  2ABL A;  4OGC A;  1HXD A;  2HKQ B;  2E65 A;  1RL2 A;  4L5G A;  4FYY B;  4PJO E;  3AT1 B;  4C8Q D;  1RLP C;  1VIE A;  1AZE A;  1O9S A;  5GAO q;  2JUF A;  4EIK A;  2LNH B;  5GAN h;  1Y71 A;  1KD1 R;  3OYY A;  1HK9 A;  3MP6 A;  4RTV A;  1BI1 A;  1Y07 A;  1PSF A;  3JB9 J;  2DRK A;  1NBE B;  5IT9 E;  1NPR A;  3CCS T;  2DE0 X;  1GFC A;  2HL5 C;  2E70 A;  5GMK e;  5A0G A;  3JCM f;  2D6F A;  1JEG A;  1CKB A;  1NYG A;  1PM3 A;  3VS4 A;  2JM8 A;  2CP3 A;  5AT1 B;  4M7A B;  2C0I A;  3CC2 A;  2PU9 B;  3PNW C;  2IVW A;  3QPH A;  2QQB A;  3UT1 A;  2CKK A;  5A0D A;  1YJ9 A;  5KE3 A;  3ZFJ A;  4PFP A;  5CKE A;  3LW5 E;  3SDZ A;  4A54 A;  5CQX A;  2DYB A;  2R57 A;  2ZPF B;  5LJ3 f;  5CKD A;  2EJG A;  3E9F A;  2J6K A;  3RKX A;  2QXF A;  3SB2 A;  4F14 A;  4DBH A;  1ZUK A;  1EX4 A;  2RI5 A;  4CRI A;  2H8H A;  2HD0 A;  5GAN d;  4OML A;  2NLU A;  1E6H A;  2LX7 A;  1FX7 A;  4GLM A;  3C0C A;  1RAH B;  4M7D E;  3CCR Q;  1Q7Y U;  2COY A;  2EBP A;  3J7A F;  3M59 A;  2RK1 A;  4M7A F;  1S72 Q;  2LNV A;  3OYN A;  4AT1 B;  2RM4 A;  2YUQ A;  1VQ7 Q;  2G6F X;  2P0P A;  2L0A A;  3MPU B;  5GMK j;  3SFM A;  3PMT A;  3EG2 A;  3A1P A;  1BCO A;  8AT1 B;  3JCM d;  2KT1 A;  3UPU A;  1NPP A;  1FYN A;  2VAS A;  1NEG A;  1D0X A;  3H6Z A;  1W4S A;  1C1A A;  1YHQ T;  5IN1 A;  1FXX A;  1N6A A;  2D0Q B;  5I22 A;  3QWY A;  3X28 B;  4OB2 B;  4C92 C;  1VQ9 Q;  3M0U A;  1JB0 E;  3RDV A;  1CSK A;  2DM1 A;  3RES A;  3QDF A;  1K9M C;  1BI0 A;  4LD9 K;  1BIB A;  2F2V A;  3LWI A;  3A8H B;  1S1N A;  1V29 B;  2GTJ A;  1T0H A;  3BE3 A;  2CRE A;  3QSU A;  1V76 A;  3OMC A;  2P0K A;  4XQ3 A;  2EFI A;  1KQ1 A;  1KHC A;  2JMA A;  2VVK A;  3EG9 A;  3G4S Q;  2P0Q A;  4J7I A;  2QA4 Q;  1U1S A;  2M1H A;  1OU9 A;  4M7D B;  2FG0 A;  2JS0 A;  3OYC A;  1K73 U;  2LJ1 A;  3LX7 A;  3OS2 A;  2OI3 A;  2YDL A;  3CBM A;  3CPW A;  2RH2 A;  3CC4 T;  4RTT A;  1M1K R;  1M1K U;  4UC4 A;  3HFN A;  1K73 C;  2KVQ G;  3SEM A;  1VQL Q;  3F70 A;  3GOX A;  2GGR A;  1M30 A;  3QG1 A;  3ZBD A;  4Y91 A;  2EQI A;  1I81 A;  1I1J A;  2FVU A;  2DXB A;  5FRN A;  2DIL A;  1MGQ A;  2MAM A;  1K9M R;  1Q82 R;  1G3T A;  3FJP A;  5HK3 A;  1YNZ A;  3GPL A;  1U06 A;  2HQE A;  2BZX A;  3EG1 A;  3Q1J A;  3TCJ A;  1ZSZ B;  2HBP A;  2RQT A;  2D1X A;  4PNO A;  1Y57 A;  1VQO A;  3VS0 A;  1SKU B;  4ZNX A;  2B86 A;  4FM4 B;  2X35 A;  2WSC E;  3JSC A;  2HNI A;  1VQP T;  2CS7 A;  4C92 F;  4ZTJ A;  4J5Y A;  1MMG A;  2PZ1 A;  2KAF A;  3CC2 Q;  2QYZ A;  4PJL A;  3CEY A;  5LJ3 g;  4M77 B;  2BIV A;  1QVG P;  3LWH A;  2QG9 B;  2E3H A;  3UA6 A;  1KFZ A;  1MMN A;  2QGF B;  1K8A R;  4BUG A;  1XJW B;  2RJD A;  4JJC A;  2LDM A;  4FT2 A;  1X75 C;  1B7T A;  1N8R R;  1D3B B;  5GMK i;  1EFN A;  2GFA A;  4C8Q A;  5LJ5 e;  1WXU A;  2P84 A;  4MZP A;  4DEY A;  1W2B A;  4ZN1 A;  3TEE A;  5CCA A;  4M7A D;  4BB7 A;  2RI2 A;  2EYX A;  2EIF A;  1VQO Q;  1Q86 R;  1WYX A;  1VQM A;  1K8A C;  3HRU A;  3CC7 Q;  2KXD A;  3ER0 A;  1N5Z A;  2QEX A;  1OI1 A;  2VXE A;  4RUG A;  4M78 G;  3M0S A;  4RTW A;  1X01 A;  3QHS A;  1NYF A;  3QJY A;  2O2O A;  2R5A A;  2M9U A;  1RAD B;  3V8J A;  3PGG A; 
#chains in the Genus database with same CATH homology
 1VYT A;  2LJ3 A;  1K0X A;  2E5K A;  2QDL A;  2DA9 A;  2KYB A;  4RTY A;  1WX6 A;  2AK5 A;  2AZS A;  1SHG A;  1TG0 A;  2J6O A;  3IQL A;  1KJW A;  2DRM A;  1PNJ A;  2DNU A;  1H3H A;  1WXT A;  1AOJ A;  4IIO A;  4Y92 A;  1RLQ C;  2JTE A;  2P4R A;  4AFU C;  1ABQ A;  2ROL A;  2DL4 A;  2ENM A;  5IHI A;  3EG0 A;  1JU5 C;  2RQR A;  4E6R A;  2A37 A;  4RTZ A;  2RNA A;  4M4Z A;  1OEB A;  2ECZ A;  1SPK A;  3FJ5 A;  3THK A;  2CDT A;  3EHQ A;  2LJ0 A;  3KFV A;  1ABO A;  1OPK A;  2EW3 A;  1UTI A;  1FMK A;  1H92 A;  1JO8 A;  2BZY A;  4J9E A;  1WIE A;  4A63 B;  2D8J A;  1WI7 A;  4D8D A;  1UGV A;  2D0N A;  2ESW A;  4LN2 A;  3VS6 A;  2IIM A;  2SEM A;  1YWO A;  1PKT A;  2AKK A;  4QT7 A;  2X3W D;  2CH4 A;  2LZ6 B;  1I0C A;  3H41 A;  1Z9Z A;  3ZL7 C;  4JJB A;  2EGC A;  2NWM A;  1K9A A;  1AD5 A;  2ED1 A;  3CQT A;  3UF4 A;  4J9C A;  1UHF A;  3QWX X;  1YWP A;  4DEX A;  3O5Z A;  3TSW A;  1GCP A;  3NMZ C;  1X6B A;  1AEY A;  2DL5 A;  1BB9 A;  1SRM A;  1GCQ A;  1T0J A;  2L3P A;  3I9Q A;  3EHR A;  1U5S A;  1KSW A;  2KRO A;  5FW9 A;  2I0N A;  2D8H A;  1KIK A;  3ULR B;  1UEC A;  4AFQ C;  3VS3 A;  1GRI A;  2CH4 W;  1OV3 A;  2ED0 A;  4J9B A;  5IHN A;  2HCK A;  2KGT A;  4KRT A;  3M0T A;  1M3C A;  1UFF A;  2JM9 A;  2L3S A;  2C0O A;  2FEI A;  1UJ0 A;  1WXB A;  1QWF A;  1ZSG A;  2W0Z A;  2LQN A;  2DBK A;  3PE0 A;  3JV3 A;  3REB B;  3I5R A;  1W6X A;  1OOT A;  4J9F A;  3VS1 A;  4ESR A;  1Y0M A;  2OAW A;  2X3X D;  4OMM A;  2LQW A;  1VA7 A;  4OMP A;  3EG3 A;  4AFS C;  1M8M A;  1MUZ A;  1RUW A;  4CC4 B;  5L23 A;  1MV0 B;  2ABL A;  5IHK A;  2A28 A;  3REA B;  1OPL A;  2KR3 A;  1AVZ C;  2DBM A;  2MIO A;  4RTX A;  1UE9 A;  1V1C A;  2KBT A;  2A08 A;  2K6D A;  4OMO A;  1AWO A;  1AWJ A;  1VYV A;  1SEM A;  5FWB A;  4CC3 A;  2GNC A;  3M0R A;  1RLP C;  1YP5 A;  1AZE A;  4ORZ A;  1Z9Q A;  4EIK A;  2LNH B;  2LP5 A;  5GJV B;  1HJD A;  3M0P A;  1QKX A;  2EYZ A;  1AWX A;  4RTV A;  3M0Q A;  2EYY A;  1K1Z A;  1TUC A;  1UG1 A;  4J9D A;  1X2Q A;  3GBQ A;  2DRK A;  1ZUU A;  4LNP A;  2K3B A;  2DE0 X;  1GFC A;  1X27 A;  1BK2 A;  1JQQ A;  1JEG A;  1CKB A;  1NYG A;  3SHW A;  1BBZ A;  3PVQ A;  2RN8 A;  3VS4 A;  1K4U S;  2JM8 A;  4HVV A;  1NLO C;  1QWE A;  1K0S A;  2C0I A;  2EGA A;  2RQW A;  2CUB A;  2KNB B;  2DX1 A;  4J9I A;  4F17 A;  2KT8 A;  1GBR A;  2EPD A;  1GCQ C;  4JJD A;  2DYB A;  3I5S A;  3UA7 A;  2J6K A;  1U3O A;  2BZ8 A;  4F14 A;  1I07 A;  1X43 A;  1ZUK A;  4HCK A;  4D8K A;  2H8H A;  1A0N B;  1PWT A;  4OML A;  1BU1 A;  1XOV A;  2KRS A;  1ZLM A;  1E6H A;  2LX7 A;  5ECA A;  1B07 A;  2MOX A;  3H0H A;  4GLM A;  2L3Q A;  3C0C A;  4X1V A;  2YSQ A;  1MV3 A;  5I11 A;  5FWC A;  4AFZ C;  2PTK A;  1LCK A;  3VRY A;  1T3S A;  3H0F A;  2GQI A;  2V1Q A;  2HEQ A;  2RQU A;  2EBP A;  2K7A A;  1SSH A;  4JZ3 A;  1AWW A;  1QKW A;  2HDA A;  2KXC A;  4IIM A;  1WLP B;  2DVJ A;  2YUQ A;  2G6F X;  2FO0 A;  2L0A A;  2A36 A;  2LMJ A;  3EGU A;  1IO6 A;  1WFW A;  2CSQ A;  1WDX A;  2O9V A;  3EG2 A;  4FSS A;  1T3L A;  2KT1 A;  1HSQ A;  2DF6 A;  2CSI A;  1YN8 A;  3TSZ A;  1ZX6 A;  1FYN A;  2FPE A;  2FRY A;  4RTU A;  2VWF A;  1NEG A;  1PRM C;  1WA7 A;  2EKH A;  1ZBJ A;  5HCK A;  5I22 A;  3QWY A;  4OMN A;  1M3B A;  2DLP A;  4R0K A;  2F2W A;  3M0U A;  2RPN A;  5IH2 A;  3UAT A;  1X69 A;  1CSK A;  2DM1 A;  2F2V A;  2W10 A;  4AG1 C;  4JZ4 A;  3PVL A;  3LH5 A;  1S1N A;  2EGE A;  1JXO A;  1JXM A;  2VKN A;  3I35 A;  2GTJ A;  4LUD A;  1T0H A;  2CRE A;  1ARK A;  2JS2 A;  2FPF A;  1PKS A;  1GBQ A;  2YUP A;  2YUO A;  2JMA A;  2VVK A;  2FRW A;  1G2B A;  3R6N A;  1H8K A;  2ROT A;  3RNJ A;  4J9H A;  2AKL A;  3RBB B;  2NUZ A;  1J3T A;  1SRL A;  2M51 A;  2FG0 A;  2JS0 A;  2DL7 A;  2LJ1 A;  2DJQ A;  2OI3 A;  2YDL A;  2AZV A;  1M27 C;  2EVR A;  3NGP A;  1W70 A;  1NG2 A;  1B3Q A;  3TVT A;  4RTT A;  1G83 A;  4F16 A;  1UHC A;  4OMQ A;  2GTO A;  4LUE A;  3SEM A;  4HVW A;  2GGR A;  1M30 A;  2K79 A;  2RMO A;  2RF0 A;  1QCF A;  2JW4 A;  2EQI A;  5GJW B;  1TUD A;  1I1J A;  4CC2 A;  1VYU A;  1M3A A;  2DIL A;  1UJY A;  3VS5 A;  2J05 A;  2KRM A;  2DL8 A;  2K9G A;  1NEB A;  2BTT A;  2DL3 A;  1YNZ A;  1QLY A;  1U06 A;  1CKA A;  2V1R A;  2BZX A;  3EG1 A;  2GBQ A;  1UDL A;  2RQT A;  4Z8A A;  2D1X A;  1YCS B;  1Y57 A;  2L2P A;  1AZG B;  3VS0 A;  2KYM A;  4HVU A;  5IXF A;  2O31 A;  4ZNX A;  2LCS A;  2J06 A;  1RI9 A;  2B86 A;  2HBW A;  3NPF A;  2J6F A;  2KRN A;  1UUE A;  2F2X A;  4AG2 C;  3H0I A;  2O88 A;  1NM7 A;  2YT6 A;  2HSP A;  2PZ1 A;  1ZUY A;  4Z89 A;  1GFD A;  1K76 A;  2C0T A;  1X6G A;  2O9S A;  1E7O A;  4GBQ A;  3U23 A;  1SHF A;  2JMC A;  3UA6 A;  1KFZ A;  2JXB A;  4HXJ A;  2DMO A;  4JJC A;  2FPD A;  3VS2 A;  2CT4 A;  2SRC A;  1GL5 A;  2J7I A;  4Z88 A;  1EFN A;  4J9G A;  4WCI A;  1NLP C;  1WXU A;  3VS7 A;  4DEY A;  2EYX A;  2EYW A;  1E6G A;  3A98 A;  1WYX A;  2PNI A;  4CC7 A;  2KE9 A;  2KXD A;  4LE9 A;  2YUN A;  2JT4 A;  1W1F A;  2CUD A;  2RQV A;  1N5Z A;  1HD3 A;  4RUG A;  4JPB W;  1X2K A;  3M0S A;  1PHT A;  4RTW A;  3VRZ A;  2CT3 A;  2K2M A;  2KEA A;  1NYF A;  2M0Y A;  2O2O A;  2OJ2 A;  3NHN A;  1PRL C;  2MCN A;  4K11 A;  5EC7 A;  5IXB A;  2XMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...