2K9GA

Solution structure of the third sh3 domain of the cin85 adapter protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
SMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH3 domain-containing kinase-binding protein 1
publication title Solution structure of the Sh3-C domain of Cin85
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k9gA00
2FPEA 3KFVA 1UG1A 5I11A 2J06A 2BZ8A 1NYFA 2DNUA 1WI7A 1JEGA 3TVTA 1VYUA 4OMLA 3M0SA 1NLPC 4Y92A 4K11A 2FG0A 2ED1A 1PWTA 2FO0A 2JTEA 3VS2A 2O31A 3QWYA 2GTJA 2DL5A 2K6DA 1FYNA 4IIMA 1Z9ZA 3VS6A 2AKKA 4QT7A 2I0NA 1UDLA 1WDXA 2A28A 4CC3A 2DRKA 2EYZA 2DJQA 2FRWA 2RQWA 4WCIA 2H8HA 3VS1A 4CC4B 4OMPA 2KYBA 1K1ZA 4LNPA 4RTXA 2CUDA 2KBTA 2O88A 1KSWA 2GTOA 1NG2A 1JXOA 1H92A 2OAWA 1U5SA 2HCKA 5L23A 2DRMA 1JXMA 3IQLA 3NMZC 3I5RA 2YUOA 3QWXX 1K0SA 1G83A 4JZ3A 4RTZA 1UTIA 2CT4A 1K0XA 1UHFA 3VRYA 4AG2C 1AOJA 2LJ0A 2VWFA 1RLPC 4AFSC 4LUEA 1NEGA 3ZL7C 2AZVA 1ZUUA 2GGRA 4J9EA 3EG2A 2SRCA 5IHKA 2J6FA 2K7AA 1B3QA 3VS3A 2L3SA 1SHGA 4J9FA 2BTTA 4RTYA 2KNBB 1J3TA 1WIEA 4ORZA 1BU1A 1UUEA 2AZSA 3VS5A 1VYTA 3NGPA 2M51A 2ABLA 1YN8A 1BB9A 1UE9A 3UA6A 2NWMA 3H0HA 1TUCA 2B86A 1UGVA 1PNJA 1ZLMA 2AKLA 4J9BA 2FPFA 4F17A 1AEYA 2IIMA 2DM1A 1ZSGA 1M8MA 2DL4A 1H3HA 2ESWA 2DL8A 1WX6A 2EYXA 2V1QA 2KXDA 2PZ1A 1GFDA 2RQRA 2OI3A 5HCKA 4JJCA 1W70A 1X2KA 5FWBA 1T3SA 2ECZA 2XMFA 1OV3A 2MCNA 3I9QA 3H0IA 3I35A 2YUPA 2A37A 3TSWA 4ZNXA 1QKWA 2KR3A 2EBPA 2K3BA 3TSZA 2KYMA 1TUDA 2G6FX 1EFNA 1OPKA 1OPLA 2PTKA 1GRIA 2HDAA 1X2QA 2KRMA 1T0HA 2O9VA 2EGAA 1KIKA 1YWOA 3JV3A 1W6XA 1NYGA 2RNAA 2J6OA 4OMNA 2DLPA 4RTWA 1AWXA 4HVVA 1SSHA 2EYYA 3M0UA 2LZ6B 3EHRA 4JJDA 1UJYA 1X43A 5GJVB 1AWJA 2F2VA 5IXFA 1E7OA 4HCKA 4LN2A 3I5SA 2YUNA 4OMMA 2ED0A 3VRZA 4OMQA 2L3QA 5IXBA 3PVQA 2CREA 2LX7A 3UA7A 3UATA 2YUQA 2EPDA 2KT8A 3PVLA 3EG3A 4EIKA 2LCSA 1UECA 4AFUC 4LE9A 4HVWA 1SRMA 4KRTA 5GJWB 2D0NA 4Z8AA 2J7IA 1X6BA 5EC7A 1RI9A 2BZYA 2BZXA 1N5ZA 2DL3A 4HXJA 4D8DA 1HSQA 1ABQA 2DX1A 2JXBA 2ROLA 2YT6A 3GBQA 2ROTA 1QCFA 1UFFA 2LNHB 4CC7A 1V1CA 1KFZA 4F16A 1JU5C 4AFZC 2PNIA 2CUBA 2A36A 1QKXA 2W0ZA 2DILA 2E5KA 2O9SA 2CT3A 1HJDA 1U3OA 3EGUA 3FJ5A 1GBRA 1JO8A 2RQUA 3REBB 2KT1A 2LQNA 1WFWA 1PRLC 1BK2A 3H0FA 4J9CA 2DBMA 1QLYA 4DEXA 1Y57A 2AK5A 1M30A 1SHFA 1ZUYA 2HBWA 3SHWA 4RTTA 1I0CA 2CSIA 2HEQA 3SEMA 3U23A 1GFCA 1WLPB 4ESRA 3R6NA 1YWPA 1SRLA 1PRMC 1CKAA 1ZUKA 1JQQA 1RLQC 1OOTA 2KRNA 2YDLA 1T0JA 2EGEA 1IO6A 2CH4W 1GCQC 2CSQA 3C0CA 3VS7A 2X3XD 2K79A 1NEBA 3EG1A 3EG0A 1BBZA 2JT4A 4F14A 1CKBA 1GCPA 1WYXA 1K76A 3EHQA 5ECAA 1B07A 2EVRA 1GBQA 3CQTA 2JMAA 2DF6A 2FEIA 2J6KA 2JS2A 1K4US 4J9HA 1CSKA 3REAB 2RQTA 1M3BA 3UF4A 1X27A 4E6RA 4RTVA 1ARKA 1H8KA 1PHTA 3LH5A 1I07A 2L3PA 2EQIA 2DA9A 2SEMA 4OMOA 1MV3A 5FWCA 2F2WA 3M0RA 4DEYA 1WXBA 2F2XA 1KJWA 2DYBA 2JW4A 2C0OA 2KEAA 1AD5A 2EW3A 3PE0A 1UJ0A 2JM8A 1YNZA 2EGCA 1VYVA 4R0KA 2D1XA 2RQVA 4D8KA 1RUWA 2DVJA 1TG0A 2EKHA 2DMOA 1Z9QA 1HD3A 2NUZA 1LCKA 1K9AA 4RTUA 2LJ1A 4J9DA 2L2PA 1G2BA 3M0PA 1QWEA 1ZBJA 2EYWA 2LQWA 3O5ZA 4AG1C 4AFQC 2C0IA 1S1NA 1AWOA 1NM7A 2RF0A 2LMJA 3THKA 2GNCA 4Z89A 1SEMA 4A63B 2RMOA 1U06A 2LJ3A 2DE0X 1YP5A 1T3LA 2JMCA 4GLMA 1MUZA 2KE9A 5FW9A 2DBKA 2W10A 2HSPA 1WXTA 2GQIA 2QDLA 1M27C 5I22A 1VA7A 1WXUA 1E6GA 5IH2A 2K9GA 2OJ2A 1UHCA 2A08A 1ZX6A 2P4RA 1NLOC 1X6GA 2C0TA 1ABOA 2GBQA 3ULRB 2V1RA 1FMKA 3VS0A 2VVKA 2J05A 2JS0A 1GCQA 2KROA 2L0AA 2K2MA 2FPDA 1I1JA 3RNJA 2ENMA 2O2OA 1M3AA 3M0TA 2KRSA 2M0YA 1AZGB 2MIOA 2LP5A 4Z88A 1M3CA 3M0QA 1AWWA 3H41A 2RN8A 1OEBA 2VKNA 2DL7A 2CH4A 2RPNA 1Y0MA 1W1FA 1MV0B 1WA7A 3VS4A 1XOVA 2CDTA 2KGTA 4RUGA 1A0NB 4JJBA 1AVZC 5IHIA 1SPKA 4CC2A 3NHNA 1QWFA 1X69A 4JPBW 5IHNA 2KXCA 4J9IA 2FRYA 2MOXA 1E6HA 4J9GA 4JZ4A 2D8HA 3A98A 1PKSA 2D8JA 2YSQA 4M4ZA 1PKTA 1YCSB 2X3WD 4FSSA 3RBBB 4LUDA 4HVUA 1AZEA 4IIOA 4X1VA 1GL5A 2JM9A 4GBQA 3NPFA
chains in the Genus database with same CATH superfamily
2V8KA 5I11A 2F69A 5LJ5h 1PD0A 5GANj 4M78A 2BZ8A 3V7CA 1M1KR 1JEGA 1ZA1B 4A4GA 4A53A 4XU0A 1Q81U 4Y92A 1NLPC 2R57A 2FG0A 3CC4T 2O31A 5GAN2 1VQMQ 3JCMX 3VV0A 4M77E 1WHMA 1QMCA 4M78F 2B8AA 2YWWA 4QQGA 4KGXB 1FMWA 2NUTA 3EG9B 5GAMg 1Z9ZA 3JCMW 3VS6A 4EPCA 2HQXA 2DTOA 2I0NA 2XICA 2EYZA 2DJQA 1VQKT 5KCOA 2X9HA 4XTZA 2FRWA 9ATCB 2H8HA 4CC4B 4OMPA 1VQ7T 1K1ZA 4EMKB 2CUDA 4P5NA 2HAXA 5HKCA 4E7JA 3L2WA 2JNGA 4AMCA 5L23A 2DRMA 4OGCA 4BI3A 4PJOA 3IQLA 3I5RA 1YFNA 4M75D 4ANJA 1Y71A 1K0XA 4AG2C 2LJ0A 4PJOF 1O75A 2CGHA 1RLPC 2DYIA 4AFSC 2HZYA 4LUEA 2RO0A 2GGRA 2OTLT 4JS5A 4XTXA 3VS3A 3TU4K 4PJOC 2GCXA 3LH0A 3OMGA 3L2UA 2V26A 1BU1A 5GAOq 1VQ5T 2O01E 1LVKA 3NGPA 2ABLA 2ZPEB 5GANg 4C8QE 4JRKA 1BB9A 1UE9A 5KH6A 3H0HA 1KHIA 5I2MA 3C12A 4PJLA 3M53A 1RI0A 5FU7C 1NJIC 4EMGA 1M8MA 3I55Q 4E2FB 1Y96B 1WX6A 2OTJA 2OI3A 3MEWA 3FB9A 1R0BG 3Q1JA 4MMKA 3LX7A 5CIUA 3I9QA 1S72A 1YBYA 3I35A 1VQ6A 2QQ9A 5CQYA 3GPLA 1QVGA 2A37A 4M78B 5A0DA 1MNEA 1RABB 4C92G 4ZNXA 1QKWA 3F70A 5GAMf 5GAN7 3EFSA 3S3NA 3VYGA 2KYMA 1TUDA 1U1SA 3MEUA 4OP0A 4LD9K 2QDYB 2YLBA 2M1HA 2HBPA 2Y90A 3A8OB 1N9SA 4XTUA 5CCAA 1PD1A 1W6XA 4FYYB 2RNAA 2J6OA 3CC2Q 1C6VX 4DBQA 4RTWA 4JRIA 1AWXA 4HVVA 1M1FA 3EHRA 2DXBA 1AWJA 2QQBA 1JJ2S 1DJ7B 1E7OA 3BDUA 4ZN1A 2E64A 2NUPB 4C8QG 3CMAQ 4IUTA 1WHLA 4C0DB 5IXBA 1OULA 2CREA 1Q7YR 1SKUB 2LX7A 1K8AC 2H3EB 5FU6B 2HQHA 3EG3A 3PGGA 3SDZA 3JAME 2LCSA 3EGXA 1UECA 2DVEA 4AFUC 4GY5A 4HVWA 1SRMA 1R8OB 2XDBA 1M90R 2D0QB 5GJWB 8ATCB 2D0NA 3X28B 2J7IA 3VUBA 4M7DB 4ATOA 2XK0A 5GANf 1W4SA 1HSQA 5GAN8 2CP2A 1VQ9Q 5A2QE 2JXBA 3GNGA 2MI6A 1OX9A 3V7SA 2LNHB 1RACB 1KHCA 4PK4A 2JOYA 1KFZA 3ME9A 1YJNT 2W0ZA 2DILA 2O9SA 4PJOD 3CD6T 5KYUA 1KQSP 2LCLA 1WGSA 2RB6A 3OYHA 4LDUA 4B6MA 1M30A 2RJEA 2RH2A 1YI2A 1N8RC 3CCVT 2QA4T 2R58A 3U23A 1WLPB 2XKOC 2K5LA 4M7AB 2M16A 5CKBA 1ZUKA 3JB9F 3LLRA 2ZZDA 2QI2A 4OB2B 1OQKA 2CH4W 1I4K1 1VQMT 1MGQA 1GCQC 2RA2A 3FJPA 1Y07A 1BIAA 3C0CA 3SD4A 3MEAA 4RG8A 1FMVA 3CCSQ 1QP2A 4M75E 4O5VA 2QYZA 3WVEB 2GQVA 2JT4A 1GCPA 1K76A 1GBQA 2DF6A 2E6ZA 1KD1U 5IT9E 2RQTA 1M3BA 5D7UA 4BE2A 4DQ2A 4E6RA 1BCOA 1RAGB 1N6AA 1UGQB 1SF9A 2HD0A 1NJIR 2L3PA 2DA9A 3CCRA 3QYHB 3HTRA 3QZ9B 3MP8A 2DYBA 3DLMA 5GAN3 4ELZC 1YI2Q 5GAN6 3HHTB 5GMKl 1Q95G 3PE0A 1UGSB 4E7IA 4BI4A 2D1XA 4D8KA 1D1AA 2EIFA 2QK0A 4M77B 3O8VA 5EG2A 4TVRA 4A4EA 1WHKA 3OYLA 1K9AA 4HT8A 2LJ1A 3MO8A 3FRNA 3CC7A 2XHCA 1S1NA 1AWOA 2MK5A 4Z89A 3OYEA 2RMOA 1U06A 2ZCFB 3I55T 2GQIA 3N5BB 3SWNA 3FEOA 4VUBA 3GOXA 5GAMd 1AT1B 3QHSA 2VGMA 4KGVB 3V8LA 3G71A 2C0TA 1X6GA 2GBQA 1ABOA 1FMKA 1TU0B 4E7LA 2J05A 3G4SA 3HFNA 1K8AR 2K2MA 1I1JA 4BDZA 3SWNC 2ENMA 2KRSA 1B34A 4Z88A 2M0OA 2EFIA 1OEBA 2VKNA 4J7FA 1QVGP 4C8QB 1W1FA 2LTOA 1RADB 1WA7A 5A0LA 1RAFB 1XOVA 2O4XA 4RUGA 4A4FA 4L59A 3RIRA 3CC2T 4CC2A 2CP7A 1SPKA 1X69A 3M4YA 2KXCA 4J9IA 2FRYA 2MAMA 4FSXA 3PTAA 1VQNA 3JB9D 2DAQA 2BKDN 3CC7Q 4BACA 4FSSA 3RBBB 3J80E 4NL3A 3CMAT 1M8VA 2P4TA 1AZEA 4IIOA 3EGDB 5D6WA 1IB8A 3G6EA 5GANd 1UG1A 1RAAB 3CCEA 1Q82C 4PJOE 3KUFA 3MP6A 4DOWA 3TVTA 4K11A 5AYFA 1PWTA 1TWBA 2FO0A 1BI3A 1WJQA 1N8RR 5A0GA 3G71Q 1YHQA 5LJ5e 5CKHA 4PFZA 1WJRA 3A5ZB 4FW1A 4IIMA 1VQPQ 1VQ9T 3BE3A 4QT7A 3OSSC 1WDXA 3GLXA 4CC3A 4A4HA 3CPFA 1X75C 2RQWA 4A4KA 3AHUA 4L5GA 3DLLA 2E5QA 4M78G 3CCQA 1NPRA 2O88A 1YJWQ 3A8MB 1NG2A 1D3BB 4BUGA 2WSCE 2HCKA 4II1A 3P8BB 3JCMg 4ELYC 1YCYA 1ACMB 5GMKj 4HKEA 2CP3A 5KYYA 3BY7A 4RTZA 3ZEHA 2CT4A 1UHFA 1IGUA 4JUVA 1AOJA 3LWIA 4XTYA 4C0GA 2L3RA 3OBYA 3OS2A 1ZUUA 1KK7A 2SRCA 4F04B 5IHKA 2K7AA 3G6EQ 2L3SA 1SHGA 5HY6A 2BTTA 3L1AA 4RTYA 2KNBB 1KG1A 2NLUA 4RCBA 3CBPA 2AZSA 3JCMc 4KULA 3I56A 1YN8A 3UA6A 4J6XA 1KQSS 1TUCA 3CCST 1ZSZA 4PLIA 1KQSA 1N27A 2AKLA 4J9BA 5LJ3j 2KAFA 2DM1A 1U1TA 3E19A 2FYKA 4FCYA 2YLCA 4BY6C 2EYXA 2PZ1A 4M7DG 1GFDA 2MF2A 2RQRA 3T9NA 3OYAA 5HK0A 3OA6A 1ZSZC 3QJ6A 4JJCA 4B9WA 1W70A 5GMKm 3CCQQ 1X2KA 2QAZA 3E9GA 5FWBA 2ECZA 2DXUA 2MCNA 3H0IA 3D7SB 4N0AC 2A7YA 3TSWA 4MDWA 2BE7D 2EAYA 5GMKh 2KR3A 4OB1B 3V7RA 1YI2T 4QQDA 3V8KA 2PVOB 2PTKA 1VQ4A 1GRIA 7AT1B 3J7AF 5GAMh 2KVQG 2O9VA 3ZFJA 1NPPA 1YWOA 3QIIA 4M75B 1NYGA 3E2UA 2K3XA 3JB9J 4OMNA 1WHHA 1N9RA 2DLPA 3I56Q 3M0UA 1R0CB 3CPWP 1YJ9Q 5KYNA 3JCMf 5GJVB 1OZ3A 2F2VA 2I2LA 2COYA 5IXFA 4M7AG 3R6OA 1Q7YU 3CMEQ 5LJ3h 3OQ5A 2ED0A 3FDRA 4EDUA 3PVQA 2QXFA 3OMCA 3RKXA 3UA7A 1K9MU 2YUQA 5LJ3g 3PVLA 2WSEE 1M90U 4PFOA 4N4GA 2K2VA 3H9NA 1KQ2A 4Z8AA 2EQMA 5EC7A 2CZ0B 2BZYA 1WJSA 2DL3A 4HXJA 4D8DA 2R5MA 2BIVA 1ABQA 1SG5A 2DX1A 5I21A 2ROTA 1QCFA 1UFFA 4CC7A 3OW2A 5GANh 5KCHA 5HK3A 4FYXB 4C5EA 4F16A 1JU5C 2D6FA 5J3BA 3G7ZA 1QKXA 4Y28E 2E5KA 4J83A 5KYWB 2CT3A 4B9XA 1U3OA 3FJ5A 2LQNA 1PRLC 4C0DC 3RKYA 3H0FA 1LJOA 1QLYA 2DIQA 4IUUA 3CC7T 2R5AA 2DEUA 1ZHIA 3PFSA 4M77G 2GFUA 2LCCA 4DBHA 5CO7A 4E7ZA 3HKSA 4C5HA 3CCUA 2JVVA 2E4HA 4RTTA 2P0QA 4XU2A 3C95A 4BD3A 3M56A 4QVCA 4CRIA 4F7UA 4ME7A 4LDYA 4ESRA 1SRLA 3EFOB 2HKQB 1QVGS 1T0JA 4F7UF 2MWOA 3G71T 1HYOA 3FLGA 2PVDB 1Y7XA 2DO3A 3UWNA 1VQPT 2VB6A 4O6JA 2RHXA 2K79A 2QTVA 3EG1A 4F14A 1BBZA 1NE8A 3PMIA 4QVDA 1WYXA 3EHQA 4Y91A 1B07A 2NUTB 1MMAA 2JMAA 4QKUA 5C0MA 1YITA 1QVFP 2J6KA 1VIFA 2V8JA 3TREA 4XQ3A 1OU9A 2XD0A 4A54A 1M1GA 2CYZB 1YJWT 5LJ3f 1VIEA 2E70A 1NJIU 3QPHA 3EH1A 3JSCA 3URGA 1G5VA 1UGRB 2CP5A 1KC8C 3TCJA 2L89A 4OMOA 1MV3A 2D9TA 1TS9A 5D6XA 5DLQE 1WXBA 2WSFE 4OMFB 3QXEB 1D0YA 3SFMA 5GAOn 4PJOB 2JW4A 3CCUQ 2KEAA 1AD5A 2EW3A 1K9MR 2OTJQ 3LGLA 1VYVA 3CXCP 3G6ET 1RUWA 3CEYA 1TG0A 2EKHA 1ZBXA 3RESA 1S72Q 3OYKA 4RTUA 1VQ6Q 4J9DA 1G2BA 4JLGA 3M0PA 1ZBJA 2LQWA 4AG1C 5CQXA 2C0IA 5FU7B 2LT4A 2ZPBB 2CZ6B 1NM7A 5GAOl 5D6YA 4Q5WA 4A63B 1M2VA 1YP5A 2DERA 4GLMA 2KE9A 1M27C 2QTXA 2L8DA 3MJXA 5I22A 1VA7A 3P8HA 2YHTA 3JB9H 3CCQT 5LL6S 3RERA 4C0ZA 2OJ2A 1WHGA 3OYCA 2P4RA 3ULRB 3A1PA 1K8AU 4BB7A 4XTVA 2GF7A 3LW5E 2E1HA 1JRIA 3QKJA 1GCQA 4JRPA 3RR6A 1BI0A 4C92A 1BKBA 2MIOA 2LP5A 1D1CA 3M0QA 4D6WA 3H41A 3MP1A 1UGPB 2CH4A 3JCMd 3CCJA 3CCLA 2E3HA 4C92F 2KGTA 2IPOB 3A8HB 3KXTA 1OYXA 1PG5B 2BUDA 3NHNA 3I56T 3HRUA 3HFOA 4C0FA 2ZPHB 4C92C 1E6HA 4JZ4A 1YJ9T 4J6YA 3CC4A 3M55A 3A98A 4DOVA 2D8JA 4M4ZA 3CMET 2LDMA 2LX9A 4LUDA 4HVUA 4HCCA 1LNXA 3JCMP 1GL5A 4FM4B 2P84A 4GBQA 3NPFA 4KBMB 2FPEA 2FHDA 3QG1A 4ZGDB 3SB2A 1VQKA 1WI7A 4BE0A 4FT2A 2VC8A 1N8RU 3FC3A 1VYUA 2PUOB 3M0SA 1VQ7A 2XI9A 2ED1A 2DK3A 4XU3A 3VS2A 2E65A 3QWYA 2GTJA 3X26B 2LVMA 2CZ1B 3EGXB 4C8QC 1FYNA 5GAN5 4OVAA 3CPWS 3L2RA 3QO3A 1UDLA 4PLLA 3TQ7P 2A28A 3CPWA 3M57A 2DD4A 2COWA 3VS1A 4RTXA 2RI2A 2OTLA 3CCJQ 2GTOA 1JXOA 2RI5A 3OW2P 2DZCA 1K73C 4FT4A 2KY9A 4FYVB 1JXMA 1VQ5A 5KYUB 2RJCA 2E41A 2YUOA 3HRSA 2JJ9A 3QWXX 2NYSA 1XTDA 4JZ3A 1UTIA 1UEBA 1HK9A 2VWFA 1BI1A 3CBMA 4L6V5 3JCMJ 4M75G 3HP9A 1NEGA 1ZA2B 2YRCA 2DXCA 2F5TX 4J9EA 3EG2A 3EAEA 1B3QA 3HSBA 1J3TA 4ORZA 1TOVA 1UUEA 1QVPA 3VS5A 1VYTA 2M51A 1YIJA 3VU3C 2DFUA 2RHIA 3CCRQ 2E10A 2B86A 1UGVA 1QCOA 3S3OA 4XTWA 5LJ3d 1R77A 5GMKi 3ZBDA 4M77D 1AEYA 1M1KC 1QP3A 1M2OA 1PC0A 1MNDA 4E7KA 1ZSGA 2X51A 3PMTA 3DB3A 5L8RE 2V1QA 2KXDA 3MHXA 2G3RA 4FIBA 1PSEA 3H6ZA 1T3SA 4E47A 2EWNA 2XMFA 2VYTA 2RHZA 2M9UA 2RHYA 3JCMb 2YUPA 4C92D 2EKOA 1LOJA 1RAHB 2ZGWA 4C5IA 1NBEB 1XNIA 1MMGA 2FZGB 3RMQA 4ZN3A 3CCUT 2Y4YA 3TSZA 2OTJT 1EFNA 1OPKA 2DKGA 2DZ9A 1BI2A 5GAOm 2KRMA 5GMKe 1T0HA 2LQKA 1QVFS 2FL7A 2A0FB 1FX7A 3M4GA 3JV3A 2JTFA 1S72T 1QVFA 1VQ6T 1OX8A 3G4SQ 1YIJQ 5KYXA 1X43A 5GAMe 2VXFA 2CP6A 4C8QD 3I5SA 2YUNA 2K5IA 3L42A 4JLIA 5CAIA 5FLXE 3OB9A 4OMQA 3VRZA 1BYMA 3JCMh 3VUZA 2X35A 2KT8A 4XAXB 3GIBA 3H8ZA 3CXCS 3OS5A 2Z0WA 2FVUA 5LJ3e 3GP8A 1G3WA 1SSFA 4FW2A 4LXCA 2F5KA 3CXCA 3M58A 1YJNA 4C5GA 2QQRA 3SWNB 3CD6A 1B7TA 1VQNQ 1Q82U 4OF1A 4F7UE 2QEXA 1Q86C 1PCXA 3E1SA 4RG2A 2ROLA 3GBQA 1VQOA 3CCMA 3ASKA 4EMKA 4FU6A 4FL6A 4RMOA 3CCVA 3CCEQ 2QA4A 2PNIA 2PUKB 1B34B 1M9SA 1IGQA 1ZQ1A 2EQUA 2LC4A 1BCMA 2KT1A 1YHQQ 4PJOG 1WFWA 5GANe 4UC4A 3OYJA 1BK2A 2EJ9A 4EMKC 4J9CA 3OS1A 2DBMA 3OYNA 2O4XB 1Y57A 2ATCB 3L2VA 1SHFA 1ZUYA 4N0AA 1Q81C 2KDSA 1AHJB 1JB0E 2HEQA 5CVIA 3SEMA 1GFCA 2HL3A 1K73R 1C1AA 3R6NA 4JRQA 4ZTFA 3PT9A 4R55A 4IUQA 3UPUA 1EZZB 1OOTA 1RLQC 2KRNA 3JB9I 1QQJA 2IVWA 2CZ7B 1VOMA 3M59A 3NTIA 3VS7A 3C94A 4WTOB 2CP0A 2MYSA 2ZPGB 3EFRA 2QEXQ 3A8LB 1Y96A 4JS4A 3EG0A 1CKBA 3UT1A 1VQOQ 3CCMQ 1WNLA 1OU8A 4E7HA 2JUFA 2RD1A 1OI1A 2RK1A 3CCJT 3ER0A 3QUIA 2GFAA 1HXDA 3UF4A 5J26A 1H3ZA 1X27A 2E3IA 4RTVA 1H8KA 2P0KA 3E9FA 3LH5A 4XU1A 3X24B 2DXTA 3META 1I07A 5LJ5g 5FWCA 1IREB 2F2WA 4DEYA 2F2XA 1KJWA 3M9QA 4M78C 1UJ0A 1D0ZA 5KYYB 2RQVA 2DVJA 1O9SA 2PQWA 3I55A 2PU9B 1MMDA 4BDYA 2L2PA 3CCRT 2K3YA 3LWHA 1QWEA 2EYWA 4C92E 1Q82R 2VGNA 3OW2S 4AFQC 2NUPA 1RAEB 2FZCB 2RHUA 1WPYA 2CKKA 5GAOr 2E12A 2YRVA 2RF0A 4BY6B 3THKA 1VQLA 2ZAEA 1SEMA 2LJ3A 1VQ4Q 1T3LA 1ZSZB 3HPWA 1MUZA 4QVZA 4EMHA 5FW9A 2DBKA 2W10A 2HSPA 3QDRB 2QDLA 3JRZA 4RKUE 5C6SA 3JCMV 4M7DA 3NTHA 3JCMQ 1E6GA 2K9GA 4OB3B 4PKCC 1P92A 1G8XA 5FU6C 5FROA 1OZ2A 2V1RA 2DIGA 3CC2A 4MZTA 2JS0A 2L0AA 3OBWA 4M7DF 3RNJA 2HQEA 3M0TA 4KUIA 2OX7A 4M7DC 1I5OB 3CMAA 1M5Q1 5J39A 2DL7A 2KMTA 2RPNA 1Y0MA 1MV0B 4IUPA 1Q86R 2CDTA 5IAYA 5DLOA 1A0NB 3PIPA 4JJBA 1PSFA 1AVZC 5IHIA 3G4ST 1RL2A 1QWFA 4JPBW 5CKEA 1YIJT 4J9GA 2JN0A 3PNWC 2D8HA 3OYIA 1U8RA 5LJ5f 1FWZA 4IUVA 2KQWA 1PKTA 1YCSB 2X3WD 3JB9G 1VQ9A 4BI8B 2XU8A 1VQLQ 4M7AA 3RMSA 3INZA 3KFVA 2J06A 1V29B 1NYFA 2DNUA 5FRNA 2EJFA 4M7AF 4OMLA 2JTEA 1G3SA 2HKNA 1Q81R 1I5LA 3S3MA 1VQNT 4M7AC 3NFCA 3AT1B 3QBYA 2DL5A 3QSUA 1WHJA 2K6DA 2XDDA 2AT1B 1H641 2AKKA 1VQ8A 1TTHB 2DRKA 2QGGA 3BFMA 3CCET 3X20B 3HRTA 4WCIA 4M78D 5KE2A 1JJ2A 4HCBA 2KYBA 2V8IA 2ZPIB 4LNPA 2KBTA 1D09B 3TEEA 1KSWA 1YHQT 3MKDA 4J7IA 1H92A 2KSSA 1WZOA 2XIDA 3QYGB 2OAWA 1U5SA 2JTMA 4HA8A 4KUDK 2PVGB 3NMZC 1EIFA 2BE9B 3CCSA 1K0SA 1TXQA 1G83A 4PL6A 4X9CA 4M77A 1UB4A 3VRYA 2CS7A 2KK4A 4PJJA 1YITQ 3M54A 3DKMA 1KC8U 4IURA 2QG9B 4X34A 3ZL7C 2AZVA 4V2SA 2J6FA 5I2SA 3RUXA 4J9FA 3RKWA 4M77F 4BE1A 1WIEA 4F7UB 2X4XA 3BDLA 3PIOA 2X4YA 4M77C 1GXIE 3OYBA 2DD5A 2NWMA 2X4WA 4GLKA 1PNJA 5DY9A 1ZLMA 2QEXT 4PJMA 2FPFA 2VUBA 2LQ8A 4F17A 2IIMA 2XDPA 1KD1C 1VQOT 4QW2A 3CCMT 1VQ8Q 3OSVA 2OAUA 4KH1B 3WVDB 4M7DD 2DL4A 1H3HA 4J8OA 2ESWA 2DL8A 4ZTJA 2WACA 5HCKA 1XJWB 4X9DA 3MPUB 1OV3A 4ZGJB 1VUBA 2ZPFB 4CI0C 1W2BP 3VKIA 1X6OA 2YXYA 4KT0E 2K5FA 4C8QA 2EBPA 2K3BA 4PNOA 3P8DA 2G6FX 1OPLA 2M02A 1WQ7A 2L5QA 2HSEB 2HDAA 3HL8A 1X2QA 4C8QF 2IG0A 2EGAA 1KIKA 1I81A 2JZ2A 1FXXA 1SSHA 2EYYA 3C4SA 2LZ6B 3LGFA 6AT1B 4JJDA 2YRDA 4M7AD 1UJYA 3EGDA 3NTKA 2RK2A 4HCKA 4RCCA 4DA4A 4LN2A 1VQ4T 1I8FA 4J5YA 4OMMA 1PM3A 2QQAA 3OYYA 1JBMA 2L3QA 3LYIA 1XQHA 4PFPA 2DTIA 4ZGEB 3UATA 3OS0A 3CCLQ 2EPDA 2HMAA 2F1LA 1M2VB 1QW1A 4EIKA 4LE9A 3OYGA 4MZMA 3CC4Q 3JCMe 4KRTA 4QQ6A 4KH0B 2E6NA 1X6BA 1RI9A 2VV5A 1G3YA 4JJNK 2BZXA 1N5ZA 1EX4A 3OY9A 5GAN4 2RI3A 2YT6A 4MDXA 1IXDA 3RDVA 2RJDA 2K4YA 4KGZB 5CKDA 1V1CA 5AT1B 1KC8R 4JDSA 1LPLA 1VQKQ 1D3BA 3A8GB 1IZ6A 2DEQA 2MMPA 4Z02A 1M4ZA 3M5AA 4AFZC 4C92B 2CUBA 5LJ5d 2A36A 1VQ7Q 4XK8E 1HJDA 3EGUA 5CR2A 1GBRA 1JO8A 2RQUA 3REBB 5M9OA 4DEXA 2VXEA 1G3TA 2AK5A 4R56A 3OYMA 2HL5C 4MMLA 4DBRA 2KI7A 2HBWA 2QQSA 2DTHA 3SHWA 1VQPA 1VQLT 1K73U 1I0CA 2CSIA 3DB4A 3UDCA 1F1BB 3L2ZA 4M78E 3S6WA 1YWPA 2OTLQ 4LD6A 3VYHB 1PRMC 1CKAA 1RAIB 4PJNA 4HCZA 1JQQA 2YDLA 2EGEA 1IHWA 1IO6A 1YJWA 2CSQA 1VQ5Q 2DJZA 2AHJB 4J6WA 2C06A 3V8JA 4MZPA 1TH7A 2X3XD 5KE3A 1NEBA 1V76A 5ECAA 2EVRA 2RJFA 3CQTA 4OB0B 4WF2A 2FEIA 2EQKA 2JS2A 3BW1A 1K4US 2QASA 4J9HA 4NS5A 1CSKA 1IRXA 1M1KU 3REAB 3FIFA 4OGEA 1ARKA 1KD1R 1IHVA 1PHTA 4NL2A 2VASA 2AIRB 1JJ2P 2A3LA 2EQIA 2QGFB 2SEMA 8AT1B 2HNIA 4LDXA 2COZA 2XG8D 3WXMB 3M0RA 3CBOA 1YITT 2MPXC 2C0OA 4M7DE 3QZ5B 3MEVA 1D0XA 4LDWA 1TUGB 2JM8A 1YNZA 2EGCA 4YTLA 4M75A 4R0KA 1QCNA 4HT9A 1WQWA 3EG9A 2DMOA 1Z9QA 2EYQA 1HD3A 2NUZA 1LCKA 3VJPA 4N4IA 4M75F 3GF5A 4E7SA 5CKFA 3O5ZA 2EJGA 1MMNA 1MHNA 4IKFA 2X4JA 4M75C 3OYFA 1X01A 2DETA 3EH2A 5DM7R 2LMJA 2GNCA 1VQ8T 4NOYA 2DPPB 2DE0X 2JMCA 3MCAB 2P0PA 5LJ5j 1WXTA 4AT1B 3J81E 1WXUA 1BIBA 5IH2A 3G1JA 2EQJA 5GAMj 2RM4A 1VQMA 1UHCA 3QJYA 2A08A 1ZX6A 2LRQA 1NLOC 2FZKB 2LNVA 2Y4XA 4M7AE 5CK9A 3VS0A 2VVKA 2KROA 2FPDA 2H3JA 4FYWB 1YJ9A 2O2OA 1M3AA 2M0YA 1AZGB 3CMEA 4LDVA 1M3CA 5IN1A 5KYWA 1AWWA 2RN8A 1Q86U 2K57A 3QDFA 3VS4A 1YJNQ 2FB7A 1KQ1A 1D1BA 5GAOp 3CD6Q 1Q7YC 1NZ9A 3L2QA 5IHNA 2MOXA 2LT1A 1K9MC 3X25B 2MWPA 1PKSA 5FRMA 3KBGA 2YSQA 1W2BS 3GNFB 1C0MA 1M90C 4F7UG 1W2BA 4DBFA 3EFOA 5KYXB 3CCVQ 4X1VA 3OYDA 2QA4Q 2JM9A 1TSFA 3CCLT 4N4HA
chains in the Genus database with same CATH topology
2FPEA 3KFVA 1UG1A 5I11A 2J06A 2BZ8A 1NYFA 2DNUA 1WI7A 1JEGA 3TVTA 1VYUA 4OMLA 3M0SA 1NLPC 4Y92A 4K11A 2FG0A 2ED1A 1PWTA 2FO0A 2JTEA 3VS2A 2O31A 3QWYA 2GTJA 2DL5A 2K6DA 1FYNA 4IIMA 1Z9ZA 3VS6A 2AKKA 4QT7A 2I0NA 1UDLA 1WDXA 2A28A 4CC3A 2DRKA 2EYZA 2DJQA 2FRWA 2RQWA 4WCIA 2H8HA 3VS1A 4CC4B 4OMPA 2KYBA 1K1ZA 4LNPA 4RTXA 2CUDA 2KBTA 2O88A 1KSWA 2GTOA 1NG2A 1JXOA 1H92A 2OAWA 1U5SA 2HCKA 5L23A 2DRMA 1JXMA 3IQLA 3NMZC 3I5RA 2YUOA 3QWXX 1K0SA 1G83A 4JZ3A 4RTZA 1UTIA 2CT4A 1K0XA 1UHFA 3VRYA 4AG2C 1AOJA 2LJ0A 2VWFA 1RLPC 4AFSC 4LUEA 1NEGA 3ZL7C 2AZVA 1ZUUA 2GGRA 4J9EA 3EG2A 2SRCA 5IHKA 2J6FA 2K7AA 1B3QA 3VS3A 2L3SA 1SHGA 4J9FA 2BTTA 4RTYA 2KNBB 1J3TA 1WIEA 4ORZA 1BU1A 1UUEA 2AZSA 3VS5A 1VYTA 3NGPA 2M51A 2ABLA 1YN8A 1BB9A 1UE9A 3UA6A 2NWMA 3H0HA 1TUCA 2B86A 1UGVA 1PNJA 1ZLMA 2AKLA 4J9BA 2FPFA 4F17A 1AEYA 2IIMA 2DM1A 1ZSGA 1M8MA 2DL4A 1H3HA 2ESWA 2DL8A 1WX6A 2EYXA 2V1QA 2KXDA 2PZ1A 1GFDA 2RQRA 2OI3A 5HCKA 4JJCA 1W70A 1X2KA 5FWBA 1T3SA 2ECZA 2XMFA 1OV3A 2MCNA 3I9QA 3H0IA 3I35A 2YUPA 2A37A 3TSWA 4ZNXA 1QKWA 2KR3A 2EBPA 2K3BA 3TSZA 2KYMA 1TUDA 2G6FX 1EFNA 1OPKA 1OPLA 2PTKA 1GRIA 2HDAA 1X2QA 2KRMA 1T0HA 2O9VA 2EGAA 1KIKA 1YWOA 3JV3A 1W6XA 1NYGA 2RNAA 2J6OA 4OMNA 2DLPA 4RTWA 1AWXA 4HVVA 1SSHA 2EYYA 3M0UA 2LZ6B 3EHRA 4JJDA 1UJYA 1X43A 5GJVB 1AWJA 2F2VA 5IXFA 1E7OA 4HCKA 4LN2A 3I5SA 2YUNA 4OMMA 2ED0A 3VRZA 4OMQA 2L3QA 5IXBA 3PVQA 2CREA 2LX7A 3UA7A 3UATA 2YUQA 2EPDA 2KT8A 3PVLA 3EG3A 4EIKA 2LCSA 1UECA 4AFUC 4LE9A 4HVWA 1SRMA 4KRTA 5GJWB 2D0NA 4Z8AA 2J7IA 1X6BA 5EC7A 1RI9A 2BZYA 2BZXA 1N5ZA 2DL3A 4HXJA 4D8DA 1HSQA 1ABQA 2DX1A 2JXBA 2ROLA 2YT6A 3GBQA 2ROTA 1QCFA 1UFFA 2LNHB 4CC7A 1V1CA 1KFZA 4F16A 1JU5C 4AFZC 2PNIA 2CUBA 2A36A 1QKXA 2W0ZA 2DILA 2E5KA 2O9SA 2CT3A 1HJDA 1U3OA 3EGUA 3FJ5A 1GBRA 1JO8A 2RQUA 3REBB 2KT1A 2LQNA 1WFWA 1PRLC 1BK2A 3H0FA 4J9CA 2DBMA 1QLYA 4DEXA 1Y57A 2AK5A 1M30A 1SHFA 1ZUYA 2HBWA 3SHWA 4RTTA 1I0CA 2CSIA 2HEQA 3SEMA 3U23A 1GFCA 1WLPB 4ESRA 3R6NA 1YWPA 1SRLA 1PRMC 1CKAA 1ZUKA 1JQQA 1RLQC 1OOTA 2KRNA 2YDLA 1T0JA 2EGEA 1IO6A 2CH4W 1GCQC 2CSQA 3C0CA 3VS7A 2X3XD 2K79A 1NEBA 3EG1A 3EG0A 1BBZA 2JT4A 4F14A 1CKBA 1GCPA 1WYXA 1K76A 3EHQA 5ECAA 1B07A 2EVRA 1GBQA 3CQTA 2JMAA 2DF6A 2FEIA 2J6KA 2JS2A 1K4US 4J9HA 1CSKA 3REAB 2RQTA 1M3BA 3UF4A 1X27A 4E6RA 4RTVA 1ARKA 1H8KA 1PHTA 3LH5A 1I07A 2L3PA 2EQIA 2DA9A 2SEMA 4OMOA 1MV3A 5FWCA 2F2WA 3M0RA 4DEYA 1WXBA 2F2XA 1KJWA 2DYBA 2JW4A 2C0OA 2KEAA 1AD5A 2EW3A 3PE0A 1UJ0A 2JM8A 1YNZA 2EGCA 1VYVA 4R0KA 2D1XA 2RQVA 4D8KA 1RUWA 2DVJA 1TG0A 2EKHA 2DMOA 1Z9QA 1HD3A 2NUZA 1LCKA 1K9AA 4RTUA 2LJ1A 4J9DA 2L2PA 1G2BA 3M0PA 1QWEA 1ZBJA 2EYWA 2LQWA 3O5ZA 4AG1C 4AFQC 2C0IA 1S1NA 1AWOA 1NM7A 2RF0A 2LMJA 3THKA 2GNCA 4Z89A 1SEMA 4A63B 2RMOA 1U06A 2LJ3A 2DE0X 1YP5A 1T3LA 2JMCA 4GLMA 1MUZA 2KE9A 5FW9A 2DBKA 2W10A 2HSPA 1WXTA 2GQIA 2QDLA 1M27C 5I22A 1VA7A 1WXUA 1E6GA 5IH2A 2K9GA 2OJ2A 1UHCA 2A08A 1ZX6A 2P4RA 1NLOC 1X6GA 2C0TA 1ABOA 2GBQA 3ULRB 2V1RA 1FMKA 3VS0A 2VVKA 2J05A 2JS0A 1GCQA 2KROA 2L0AA 2K2MA 2FPDA 1I1JA 3RNJA 2ENMA 2O2OA 1M3AA 3M0TA 2KRSA 2M0YA 1AZGB 2MIOA 2LP5A 4Z88A 1M3CA 3M0QA 1AWWA 3H41A 2RN8A 1OEBA 2VKNA 2DL7A 2CH4A 2RPNA 1Y0MA 1W1FA 1MV0B 1WA7A 3VS4A 1XOVA 2CDTA 2KGTA 4RUGA 1A0NB 4JJBA 1AVZC 5IHIA 1SPKA 4CC2A 3NHNA 1QWFA 1X69A 4JPBW 5IHNA 2KXCA 4J9IA 2FRYA 2MOXA 1E6HA 4J9GA 4JZ4A 2D8HA 3A98A 1PKSA 2D8JA 2YSQA 4M4ZA 1PKTA 1YCSB 2X3WD 4FSSA 3RBBB 4LUDA 4HVUA 1AZEA 4IIOA 4X1VA 1GL5A 2JM9A 4GBQA 3NPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FPE A;  3KFV A;  1UG1 A;  5I11 A;  2J06 A;  2BZ8 A;  1NYF A;  2DNU A;  1WI7 A;  1JEG A;  3TVT A;  1VYU A;  4OML A;  3M0S A;  1NLP C;  4Y92 A;  4K11 A;  2FG0 A;  2ED1 A;  1PWT A;  2FO0 A;  2JTE A;  3VS2 A;  2O31 A;  3QWY A;  2GTJ A;  2DL5 A;  2K6D A;  1FYN A;  4IIM A;  1Z9Z A;  3VS6 A;  2AKK A;  4QT7 A;  2I0N A;  1UDL A;  1WDX A;  2A28 A;  4CC3 A;  2DRK A;  2EYZ A;  2DJQ A;  2FRW A;  2RQW A;  4WCI A;  2H8H A;  3VS1 A;  4CC4 B;  4OMP A;  2KYB A;  1K1Z A;  4LNP A;  4RTX A;  2CUD A;  2KBT A;  2O88 A;  1KSW A;  2GTO A;  1NG2 A;  1JXO A;  1H92 A;  2OAW A;  1U5S A;  2HCK A;  5L23 A;  2DRM A;  1JXM A;  3IQL A;  3NMZ C;  3I5R A;  2YUO A;  3QWX X;  1K0S A;  1G83 A;  4JZ3 A;  4RTZ A;  1UTI A;  2CT4 A;  1K0X A;  1UHF A;  3VRY A;  4AG2 C;  1AOJ A;  2LJ0 A;  2VWF A;  1RLP C;  4AFS C;  4LUE A;  1NEG A;  3ZL7 C;  2AZV A;  1ZUU A;  2GGR A;  4J9E A;  3EG2 A;  2SRC A;  5IHK A;  2J6F A;  2K7A A;  1B3Q A;  3VS3 A;  2L3S A;  1SHG A;  4J9F A;  2BTT A;  4RTY A;  2KNB B;  1J3T A;  1WIE A;  4ORZ A;  1BU1 A;  1UUE A;  2AZS A;  3VS5 A;  1VYT A;  3NGP A;  2M51 A;  2ABL A;  1YN8 A;  1BB9 A;  1UE9 A;  3UA6 A;  2NWM A;  3H0H A;  1TUC A;  2B86 A;  1UGV A;  1PNJ A;  1ZLM A;  2AKL A;  4J9B A;  2FPF A;  4F17 A;  1AEY A;  2IIM A;  2DM1 A;  1ZSG A;  1M8M A;  2DL4 A;  1H3H A;  2ESW A;  2DL8 A;  1WX6 A;  2EYX A;  2V1Q A;  2KXD A;  2PZ1 A;  1GFD A;  2RQR A;  2OI3 A;  5HCK A;  4JJC A;  1W70 A;  1X2K A;  5FWB A;  1T3S A;  2ECZ A;  2XMF A;  1OV3 A;  2MCN A;  3I9Q A;  3H0I A;  3I35 A;  2YUP A;  2A37 A;  3TSW A;  4ZNX A;  1QKW A;  2KR3 A;  2EBP A;  2K3B A;  3TSZ A;  2KYM A;  1TUD A;  2G6F X;  1EFN A;  1OPK A;  1OPL A;  2PTK A;  1GRI A;  2HDA A;  1X2Q A;  2KRM A;  1T0H A;  2O9V A;  2EGA A;  1KIK A;  1YWO A;  3JV3 A;  1W6X A;  1NYG A;  2RNA A;  2J6O A;  4OMN A;  2DLP A;  4RTW A;  1AWX A;  4HVV A;  1SSH A;  2EYY A;  3M0U A;  2LZ6 B;  3EHR A;  4JJD A;  1UJY A;  1X43 A;  5GJV B;  1AWJ A;  2F2V A;  5IXF A;  1E7O A;  4HCK A;  4LN2 A;  3I5S A;  2YUN A;  4OMM A;  2ED0 A;  3VRZ A;  4OMQ A;  2L3Q A;  5IXB A;  3PVQ A;  2CRE A;  2LX7 A;  3UA7 A;  3UAT A;  2YUQ A;  2EPD A;  2KT8 A;  3PVL A;  3EG3 A;  4EIK A;  2LCS A;  1UEC A;  4AFU C;  4LE9 A;  4HVW A;  1SRM A;  4KRT A;  5GJW B;  2D0N A;  4Z8A A;  2J7I A;  1X6B A;  5EC7 A;  1RI9 A;  2BZY A;  2BZX A;  1N5Z A;  2DL3 A;  4HXJ A;  4D8D A;  1HSQ A;  1ABQ A;  2DX1 A;  2JXB A;  2ROL A;  2YT6 A;  3GBQ A;  2ROT A;  1QCF A;  1UFF A;  2LNH B;  4CC7 A;  1V1C A;  1KFZ A;  4F16 A;  1JU5 C;  4AFZ C;  2PNI A;  2CUB A;  2A36 A;  1QKX A;  2W0Z A;  2DIL A;  2E5K A;  2O9S A;  2CT3 A;  1HJD A;  1U3O A;  3EGU A;  3FJ5 A;  1GBR A;  1JO8 A;  2RQU A;  3REB B;  2KT1 A;  2LQN A;  1WFW A;  1PRL C;  1BK2 A;  3H0F A;  4J9C A;  2DBM A;  1QLY A;  4DEX A;  1Y57 A;  2AK5 A;  1M30 A;  1SHF A;  1ZUY A;  2HBW A;  3SHW A;  4RTT A;  1I0C A;  2CSI A;  2HEQ A;  3SEM A;  3U23 A;  1GFC A;  1WLP B;  4ESR A;  3R6N A;  1YWP A;  1SRL A;  1PRM C;  1CKA A;  1ZUK A;  1JQQ A;  1RLQ C;  1OOT A;  2KRN A;  2YDL A;  1T0J A;  2EGE A;  1IO6 A;  2CH4 W;  1GCQ C;  2CSQ A;  3C0C A;  3VS7 A;  2X3X D;  2K79 A;  1NEB A;  3EG1 A;  3EG0 A;  1BBZ A;  2JT4 A;  4F14 A;  1CKB A;  1GCP A;  1WYX A;  1K76 A;  3EHQ A;  5ECA A;  1B07 A;  2EVR A;  1GBQ A;  3CQT A;  2JMA A;  2DF6 A;  2FEI A;  2J6K A;  2JS2 A;  1K4U S;  4J9H A;  1CSK A;  3REA B;  2RQT A;  1M3B A;  3UF4 A;  1X27 A;  4E6R A;  4RTV A;  1ARK A;  1H8K A;  1PHT A;  3LH5 A;  1I07 A;  2L3P A;  2EQI A;  2DA9 A;  2SEM A;  4OMO A;  1MV3 A;  5FWC A;  2F2W A;  3M0R A;  4DEY A;  1WXB A;  2F2X A;  1KJW A;  2DYB A;  2JW4 A;  2C0O A;  2KEA A;  1AD5 A;  2EW3 A;  3PE0 A;  1UJ0 A;  2JM8 A;  1YNZ A;  2EGC A;  1VYV A;  4R0K A;  2D1X A;  2RQV A;  4D8K A;  1RUW A;  2DVJ A;  1TG0 A;  2EKH A;  2DMO A;  1Z9Q A;  1HD3 A;  2NUZ A;  1LCK A;  1K9A A;  4RTU A;  2LJ1 A;  4J9D A;  2L2P A;  1G2B A;  3M0P A;  1QWE A;  1ZBJ A;  2EYW A;  2LQW A;  3O5Z A;  4AG1 C;  4AFQ C;  2C0I A;  1S1N A;  1AWO A;  1NM7 A;  2RF0 A;  2LMJ A;  3THK A;  2GNC A;  4Z89 A;  1SEM A;  4A63 B;  2RMO A;  1U06 A;  2LJ3 A;  2DE0 X;  1YP5 A;  1T3L A;  2JMC A;  4GLM A;  1MUZ A;  2KE9 A;  5FW9 A;  2DBK A;  2W10 A;  2HSP A;  1WXT A;  2GQI A;  2QDL A;  1M27 C;  5I22 A;  1VA7 A;  1WXU A;  1E6G A;  5IH2 A;  2K9G A;  2OJ2 A;  1UHC A;  2A08 A;  1ZX6 A;  2P4R A;  1NLO C;  1X6G A;  2C0T A;  1ABO A;  2GBQ A;  3ULR B;  2V1R A;  1FMK A;  3VS0 A;  2VVK A;  2J05 A;  2JS0 A;  1GCQ A;  2KRO A;  2L0A A;  2K2M A;  2FPD A;  1I1J A;  3RNJ A;  2ENM A;  2O2O A;  1M3A A;  3M0T A;  2KRS A;  2M0Y A;  1AZG B;  2MIO A;  2LP5 A;  4Z88 A;  1M3C A;  3M0Q A;  1AWW A;  3H41 A;  2RN8 A;  1OEB A;  2VKN A;  2DL7 A;  2CH4 A;  2RPN A;  1Y0M A;  1W1F A;  1MV0 B;  1WA7 A;  3VS4 A;  1XOV A;  2CDT A;  2KGT A;  4RUG A;  1A0N B;  4JJB A;  1AVZ C;  5IHI A;  1SPK A;  4CC2 A;  3NHN A;  1QWF A;  1X69 A;  4JPB W;  5IHN A;  2KXC A;  4J9I A;  2FRY A;  2MOX A;  1E6H A;  4J9G A;  4JZ4 A;  2D8H A;  3A98 A;  1PKS A;  2D8J A;  2YSQ A;  4M4Z A;  1PKT A;  1YCS B;  2X3W D;  4FSS A;  3RBB B;  4LUD A;  4HVU A;  1AZE A;  4IIO A;  4X1V A;  1GL5 A;  2JM9 A;  4GBQ A;  3NPF A; 
#chains in the Genus database with same CATH topology
 2V8K A;  5I11 A;  2F69 A;  5LJ5 h;  1PD0 A;  5GAN j;  4M78 A;  2BZ8 A;  3V7C A;  1M1K R;  1JEG A;  1ZA1 B;  4A4G A;  4A53 A;  4XU0 A;  1Q81 U;  4Y92 A;  1NLP C;  2R57 A;  2FG0 A;  3CC4 T;  2O31 A;  5GAN 2;  1VQM Q;  3JCM X;  3VV0 A;  4M77 E;  1WHM A;  1QMC A;  4M78 F;  2B8A A;  2YWW A;  4QQG A;  4KGX B;  1FMW A;  2NUT A;  3EG9 B;  5GAM g;  1Z9Z A;  3JCM W;  3VS6 A;  4EPC A;  2HQX A;  2DTO A;  2I0N A;  2XIC A;  2EYZ A;  2DJQ A;  1VQK T;  5KCO A;  2X9H A;  4XTZ A;  2FRW A;  9ATC B;  2H8H A;  4CC4 B;  4OMP A;  1VQ7 T;  1K1Z A;  4EMK B;  2CUD A;  4P5N A;  2HAX A;  5HKC A;  4E7J A;  3L2W A;  2JNG A;  4AMC A;  5L23 A;  2DRM A;  4OGC A;  4BI3 A;  4PJO A;  3IQL A;  3I5R A;  1YFN A;  4M75 D;  4ANJ A;  1Y71 A;  1K0X A;  4AG2 C;  2LJ0 A;  4PJO F;  1O75 A;  2CGH A;  1RLP C;  2DYI A;  4AFS C;  2HZY A;  4LUE A;  2RO0 A;  2GGR A;  2OTL T;  4JS5 A;  4XTX A;  3VS3 A;  3TU4 K;  4PJO C;  2GCX A;  3LH0 A;  3OMG A;  3L2U A;  2V26 A;  1BU1 A;  5GAO q;  1VQ5 T;  2O01 E;  1LVK A;  3NGP A;  2ABL A;  2ZPE B;  5GAN g;  4C8Q E;  4JRK A;  1BB9 A;  1UE9 A;  5KH6 A;  3H0H A;  1KHI A;  5I2M A;  3C12 A;  4PJL A;  3M53 A;  1RI0 A;  5FU7 C;  1NJI C;  4EMG A;  1M8M A;  3I55 Q;  4E2F B;  1Y96 B;  1WX6 A;  2OTJ A;  2OI3 A;  3MEW A;  3FB9 A;  1R0B G;  3Q1J A;  4MMK A;  3LX7 A;  5CIU A;  3I9Q A;  1S72 A;  1YBY A;  3I35 A;  1VQ6 A;  2QQ9 A;  5CQY A;  3GPL A;  1QVG A;  2A37 A;  4M78 B;  5A0D A;  1MNE A;  1RAB B;  4C92 G;  4ZNX A;  1QKW A;  3F70 A;  5GAM f;  5GAN 7;  3EFS A;  3S3N A;  3VYG A;  2KYM A;  1TUD A;  1U1S A;  3MEU A;  4OP0 A;  4LD9 K;  2QDY B;  2YLB A;  2M1H A;  2HBP A;  2Y90 A;  3A8O B;  1N9S A;  4XTU A;  5CCA A;  1PD1 A;  1W6X A;  4FYY B;  2RNA A;  2J6O A;  3CC2 Q;  1C6V X;  4DBQ A;  4RTW A;  4JRI A;  1AWX A;  4HVV A;  1M1F A;  3EHR A;  2DXB A;  1AWJ A;  2QQB A;  1JJ2 S;  1DJ7 B;  1E7O A;  3BDU A;  4ZN1 A;  2E64 A;  2NUP B;  4C8Q G;  3CMA Q;  4IUT A;  1WHL A;  4C0D B;  5IXB A;  1OUL A;  2CRE A;  1Q7Y R;  1SKU B;  2LX7 A;  1K8A C;  2H3E B;  5FU6 B;  2HQH A;  3EG3 A;  3PGG A;  3SDZ A;  3JAM E;  2LCS A;  3EGX A;  1UEC A;  2DVE A;  4AFU C;  4GY5 A;  4HVW A;  1SRM A;  1R8O B;  2XDB A;  1M90 R;  2D0Q B;  5GJW B;  8ATC B;  2D0N A;  3X28 B;  2J7I A;  3VUB A;  4M7D B;  4ATO A;  2XK0 A;  5GAN f;  1W4S A;  1HSQ A;  5GAN 8;  2CP2 A;  1VQ9 Q;  5A2Q E;  2JXB A;  3GNG A;  2MI6 A;  1OX9 A;  3V7S A;  2LNH B;  1RAC B;  1KHC A;  4PK4 A;  2JOY A;  1KFZ A;  3ME9 A;  1YJN T;  2W0Z A;  2DIL A;  2O9S A;  4PJO D;  3CD6 T;  5KYU A;  1KQS P;  2LCL A;  1WGS A;  2RB6 A;  3OYH A;  4LDU A;  4B6M A;  1M30 A;  2RJE A;  2RH2 A;  1YI2 A;  1N8R C;  3CCV T;  2QA4 T;  2R58 A;  3U23 A;  1WLP B;  2XKO C;  2K5L A;  4M7A B;  2M16 A;  5CKB A;  1ZUK A;  3JB9 F;  3LLR A;  2ZZD A;  2QI2 A;  4OB2 B;  1OQK A;  2CH4 W;  1I4K 1;  1VQM T;  1MGQ A;  1GCQ C;  2RA2 A;  3FJP A;  1Y07 A;  1BIA A;  3C0C A;  3SD4 A;  3MEA A;  4RG8 A;  1FMV A;  3CCS Q;  1QP2 A;  4M75 E;  4O5V A;  2QYZ A;  3WVE B;  2GQV A;  2JT4 A;  1GCP A;  1K76 A;  1GBQ A;  2DF6 A;  2E6Z A;  1KD1 U;  5IT9 E;  2RQT A;  1M3B A;  5D7U A;  4BE2 A;  4DQ2 A;  4E6R A;  1BCO A;  1RAG B;  1N6A A;  1UGQ B;  1SF9 A;  2HD0 A;  1NJI R;  2L3P A;  2DA9 A;  3CCR A;  3QYH B;  3HTR A;  3QZ9 B;  3MP8 A;  2DYB A;  3DLM A;  5GAN 3;  4ELZ C;  1YI2 Q;  5GAN 6;  3HHT B;  5GMK l;  1Q95 G;  3PE0 A;  1UGS B;  4E7I A;  4BI4 A;  2D1X A;  4D8K A;  1D1A A;  2EIF A;  2QK0 A;  4M77 B;  3O8V A;  5EG2 A;  4TVR A;  4A4E A;  1WHK A;  3OYL A;  1K9A A;  4HT8 A;  2LJ1 A;  3MO8 A;  3FRN A;  3CC7 A;  2XHC A;  1S1N A;  1AWO A;  2MK5 A;  4Z89 A;  3OYE A;  2RMO A;  1U06 A;  2ZCF B;  3I55 T;  2GQI A;  3N5B B;  3SWN A;  3FEO A;  4VUB A;  3GOX A;  5GAM d;  1AT1 B;  3QHS A;  2VGM A;  4KGV B;  3V8L A;  3G71 A;  2C0T A;  1X6G A;  2GBQ A;  1ABO A;  1FMK A;  1TU0 B;  4E7L A;  2J05 A;  3G4S A;  3HFN A;  1K8A R;  2K2M A;  1I1J A;  4BDZ A;  3SWN C;  2ENM A;  2KRS A;  1B34 A;  4Z88 A;  2M0O A;  2EFI A;  1OEB A;  2VKN A;  4J7F A;  1QVG P;  4C8Q B;  1W1F A;  2LTO A;  1RAD B;  1WA7 A;  5A0L A;  1RAF B;  1XOV A;  2O4X A;  4RUG A;  4A4F A;  4L59 A;  3RIR A;  3CC2 T;  4CC2 A;  2CP7 A;  1SPK A;  1X69 A;  3M4Y A;  2KXC A;  4J9I A;  2FRY A;  2MAM A;  4FSX A;  3PTA A;  1VQN A;  3JB9 D;  2DAQ A;  2BKD N;  3CC7 Q;  4BAC A;  4FSS A;  3RBB B;  3J80 E;  4NL3 A;  3CMA T;  1M8V A;  2P4T A;  1AZE A;  4IIO A;  3EGD B;  5D6W A;  1IB8 A;  3G6E A;  5GAN d;  1UG1 A;  1RAA B;  3CCE A;  1Q82 C;  4PJO E;  3KUF A;  3MP6 A;  4DOW A;  3TVT A;  4K11 A;  5AYF A;  1PWT A;  1TWB A;  2FO0 A;  1BI3 A;  1WJQ A;  1N8R R;  5A0G A;  3G71 Q;  1YHQ A;  5LJ5 e;  5CKH A;  4PFZ A;  1WJR A;  3A5Z B;  4FW1 A;  4IIM A;  1VQP Q;  1VQ9 T;  3BE3 A;  4QT7 A;  3OSS C;  1WDX A;  3GLX A;  4CC3 A;  4A4H A;  3CPF A;  1X75 C;  2RQW A;  4A4K A;  3AHU A;  4L5G A;  3DLL A;  2E5Q A;  4M78 G;  3CCQ A;  1NPR A;  2O88 A;  1YJW Q;  3A8M B;  1NG2 A;  1D3B B;  4BUG A;  2WSC E;  2HCK A;  4II1 A;  3P8B B;  3JCM g;  4ELY C;  1YCY A;  1ACM B;  5GMK j;  4HKE A;  2CP3 A;  5KYY A;  3BY7 A;  4RTZ A;  3ZEH A;  2CT4 A;  1UHF A;  1IGU A;  4JUV A;  1AOJ A;  3LWI A;  4XTY A;  4C0G A;  2L3R A;  3OBY A;  3OS2 A;  1ZUU A;  1KK7 A;  2SRC A;  4F04 B;  5IHK A;  2K7A A;  3G6E Q;  2L3S A;  1SHG A;  5HY6 A;  2BTT A;  3L1A A;  4RTY A;  2KNB B;  1KG1 A;  2NLU A;  4RCB A;  3CBP A;  2AZS A;  3JCM c;  4KUL A;  3I56 A;  1YN8 A;  3UA6 A;  4J6X A;  1KQS S;  1TUC A;  3CCS T;  1ZSZ A;  4PLI A;  1KQS A;  1N27 A;  2AKL A;  4J9B A;  5LJ3 j;  2KAF A;  2DM1 A;  1U1T A;  3E19 A;  2FYK A;  4FCY A;  2YLC A;  4BY6 C;  2EYX A;  2PZ1 A;  4M7D G;  1GFD A;  2MF2 A;  2RQR A;  3T9N A;  3OYA A;  5HK0 A;  3OA6 A;  1ZSZ C;  3QJ6 A;  4JJC A;  4B9W A;  1W70 A;  5GMK m;  3CCQ Q;  1X2K A;  2QAZ A;  3E9G A;  5FWB A;  2ECZ A;  2DXU A;  2MCN A;  3H0I A;  3D7S B;  4N0A C;  2A7Y A;  3TSW A;  4MDW A;  2BE7 D;  2EAY A;  5GMK h;  2KR3 A;  4OB1 B;  3V7R A;  1YI2 T;  4QQD A;  3V8K A;  2PVO B;  2PTK A;  1VQ4 A;  1GRI A;  7AT1 B;  3J7A F;  5GAM h;  2KVQ G;  2O9V A;  3ZFJ A;  1NPP A;  1YWO A;  3QII A;  4M75 B;  1NYG A;  3E2U A;  2K3X A;  3JB9 J;  4OMN A;  1WHH A;  1N9R A;  2DLP A;  3I56 Q;  3M0U A;  1R0C B;  3CPW P;  1YJ9 Q;  5KYN A;  3JCM f;  5GJV B;  1OZ3 A;  2F2V A;  2I2L A;  2COY A;  5IXF A;  4M7A G;  3R6O A;  1Q7Y U;  3CME Q;  5LJ3 h;  3OQ5 A;  2ED0 A;  3FDR A;  4EDU A;  3PVQ A;  2QXF A;  3OMC A;  3RKX A;  3UA7 A;  1K9M U;  2YUQ A;  5LJ3 g;  3PVL A;  2WSE E;  1M90 U;  4PFO A;  4N4G A;  2K2V A;  3H9N A;  1KQ2 A;  4Z8A A;  2EQM A;  5EC7 A;  2CZ0 B;  2BZY A;  1WJS A;  2DL3 A;  4HXJ A;  4D8D A;  2R5M A;  2BIV A;  1ABQ A;  1SG5 A;  2DX1 A;  5I21 A;  2ROT A;  1QCF A;  1UFF A;  4CC7 A;  3OW2 A;  5GAN h;  5KCH A;  5HK3 A;  4FYX B;  4C5E A;  4F16 A;  1JU5 C;  2D6F A;  5J3B A;  3G7Z A;  1QKX A;  4Y28 E;  2E5K A;  4J83 A;  5KYW B;  2CT3 A;  4B9X A;  1U3O A;  3FJ5 A;  2LQN A;  1PRL C;  4C0D C;  3RKY A;  3H0F A;  1LJO A;  1QLY A;  2DIQ A;  4IUU A;  3CC7 T;  2R5A A;  2DEU A;  1ZHI A;  3PFS A;  4M77 G;  2GFU A;  2LCC A;  4DBH A;  5CO7 A;  4E7Z A;  3HKS A;  4C5H A;  3CCU A;  2JVV A;  2E4H A;  4RTT A;  2P0Q A;  4XU2 A;  3C95 A;  4BD3 A;  3M56 A;  4QVC A;  4CRI A;  4F7U A;  4ME7 A;  4LDY A;  4ESR A;  1SRL A;  3EFO B;  2HKQ B;  1QVG S;  1T0J A;  4F7U F;  2MWO A;  3G71 T;  1HYO A;  3FLG A;  2PVD B;  1Y7X A;  2DO3 A;  3UWN A;  1VQP T;  2VB6 A;  4O6J A;  2RHX A;  2K79 A;  2QTV A;  3EG1 A;  4F14 A;  1BBZ A;  1NE8 A;  3PMI A;  4QVD A;  1WYX A;  3EHQ A;  4Y91 A;  1B07 A;  2NUT B;  1MMA A;  2JMA A;  4QKU A;  5C0M A;  1YIT A;  1QVF P;  2J6K A;  1VIF A;  2V8J A;  3TRE A;  4XQ3 A;  1OU9 A;  2XD0 A;  4A54 A;  1M1G A;  2CYZ B;  1YJW T;  5LJ3 f;  1VIE A;  2E70 A;  1NJI U;  3QPH A;  3EH1 A;  3JSC A;  3URG A;  1G5V A;  1UGR B;  2CP5 A;  1KC8 C;  3TCJ A;  2L89 A;  4OMO A;  1MV3 A;  2D9T A;  1TS9 A;  5D6X A;  5DLQ E;  1WXB A;  2WSF E;  4OMF B;  3QXE B;  1D0Y A;  3SFM A;  5GAO n;  4PJO B;  2JW4 A;  3CCU Q;  2KEA A;  1AD5 A;  2EW3 A;  1K9M R;  2OTJ Q;  3LGL A;  1VYV A;  3CXC P;  3G6E T;  1RUW A;  3CEY A;  1TG0 A;  2EKH A;  1ZBX A;  3RES A;  1S72 Q;  3OYK A;  4RTU A;  1VQ6 Q;  4J9D A;  1G2B A;  4JLG A;  3M0P A;  1ZBJ A;  2LQW A;  4AG1 C;  5CQX A;  2C0I A;  5FU7 B;  2LT4 A;  2ZPB B;  2CZ6 B;  1NM7 A;  5GAO l;  5D6Y A;  4Q5W A;  4A63 B;  1M2V A;  1YP5 A;  2DER A;  4GLM A;  2KE9 A;  1M27 C;  2QTX A;  2L8D A;  3MJX A;  5I22 A;  1VA7 A;  3P8H A;  2YHT A;  3JB9 H;  3CCQ T;  5LL6 S;  3RER A;  4C0Z A;  2OJ2 A;  1WHG A;  3OYC A;  2P4R A;  3ULR B;  3A1P A;  1K8A U;  4BB7 A;  4XTV A;  2GF7 A;  3LW5 E;  2E1H A;  1JRI A;  3QKJ A;  1GCQ A;  4JRP A;  3RR6 A;  1BI0 A;  4C92 A;  1BKB A;  2MIO A;  2LP5 A;  1D1C A;  3M0Q A;  4D6W A;  3H41 A;  3MP1 A;  1UGP B;  2CH4 A;  3JCM d;  3CCJ A;  3CCL A;  2E3H A;  4C92 F;  2KGT A;  2IPO B;  3A8H B;  3KXT A;  1OYX A;  1PG5 B;  2BUD A;  3NHN A;  3I56 T;  3HRU A;  3HFO A;  4C0F A;  2ZPH B;  4C92 C;  1E6H A;  4JZ4 A;  1YJ9 T;  4J6Y A;  3CC4 A;  3M55 A;  3A98 A;  4DOV A;  2D8J A;  4M4Z A;  3CME T;  2LDM A;  2LX9 A;  4LUD A;  4HVU A;  4HCC A;  1LNX A;  3JCM P;  1GL5 A;  4FM4 B;  2P84 A;  4GBQ A;  3NPF A;  4KBM B;  2FPE A;  2FHD A;  3QG1 A;  4ZGD B;  3SB2 A;  1VQK A;  1WI7 A;  4BE0 A;  4FT2 A;  2VC8 A;  1N8R U;  3FC3 A;  1VYU A;  2PUO B;  3M0S A;  1VQ7 A;  2XI9 A;  2ED1 A;  2DK3 A;  4XU3 A;  3VS2 A;  2E65 A;  3QWY A;  2GTJ A;  3X26 B;  2LVM A;  2CZ1 B;  3EGX B;  4C8Q C;  1FYN A;  5GAN 5;  4OVA A;  3CPW S;  3L2R A;  3QO3 A;  1UDL A;  4PLL A;  3TQ7 P;  2A28 A;  3CPW A;  3M57 A;  2DD4 A;  2COW A;  3VS1 A;  4RTX A;  2RI2 A;  2OTL A;  3CCJ Q;  2GTO A;  1JXO A;  2RI5 A;  3OW2 P;  2DZC A;  1K73 C;  4FT4 A;  2KY9 A;  4FYV B;  1JXM A;  1VQ5 A;  5KYU B;  2RJC A;  2E41 A;  2YUO A;  3HRS A;  2JJ9 A;  3QWX X;  2NYS A;  1XTD A;  4JZ3 A;  1UTI A;  1UEB A;  1HK9 A;  2VWF A;  1BI1 A;  3CBM A;  4L6V 5;  3JCM J;  4M75 G;  3HP9 A;  1NEG A;  1ZA2 B;  2YRC A;  2DXC A;  2F5T X;  4J9E A;  3EG2 A;  3EAE A;  1B3Q A;  3HSB A;  1J3T A;  4ORZ A;  1TOV A;  1UUE A;  1QVP A;  3VS5 A;  1VYT A;  2M51 A;  1YIJ A;  3VU3 C;  2DFU A;  2RHI A;  3CCR Q;  2E10 A;  2B86 A;  1UGV A;  1QCO A;  3S3O A;  4XTW A;  5LJ3 d;  1R77 A;  5GMK i;  3ZBD A;  4M77 D;  1AEY A;  1M1K C;  1QP3 A;  1M2O A;  1PC0 A;  1MND A;  4E7K A;  1ZSG A;  2X51 A;  3PMT A;  3DB3 A;  5L8R E;  2V1Q A;  2KXD A;  3MHX A;  2G3R A;  4FIB A;  1PSE A;  3H6Z A;  1T3S A;  4E47 A;  2EWN A;  2XMF A;  2VYT A;  2RHZ A;  2M9U A;  2RHY A;  3JCM b;  2YUP A;  4C92 D;  2EKO A;  1LOJ A;  1RAH B;  2ZGW A;  4C5I A;  1NBE B;  1XNI A;  1MMG A;  2FZG B;  3RMQ A;  4ZN3 A;  3CCU T;  2Y4Y A;  3TSZ A;  2OTJ T;  1EFN A;  1OPK A;  2DKG A;  2DZ9 A;  1BI2 A;  5GAO m;  2KRM A;  5GMK e;  1T0H A;  2LQK A;  1QVF S;  2FL7 A;  2A0F B;  1FX7 A;  3M4G A;  3JV3 A;  2JTF A;  1S72 T;  1QVF A;  1VQ6 T;  1OX8 A;  3G4S Q;  1YIJ Q;  5KYX A;  1X43 A;  5GAM e;  2VXF A;  2CP6 A;  4C8Q D;  3I5S A;  2YUN A;  2K5I A;  3L42 A;  4JLI A;  5CAI A;  5FLX E;  3OB9 A;  4OMQ A;  3VRZ A;  1BYM A;  3JCM h;  3VUZ A;  2X35 A;  2KT8 A;  4XAX B;  3GIB A;  3H8Z A;  3CXC S;  3OS5 A;  2Z0W A;  2FVU A;  5LJ3 e;  3GP8 A;  1G3W A;  1SSF A;  4FW2 A;  4LXC A;  2F5K A;  3CXC A;  3M58 A;  1YJN A;  4C5G A;  2QQR A;  3SWN B;  3CD6 A;  1B7T A;  1VQN Q;  1Q82 U;  4OF1 A;  4F7U E;  2QEX A;  1Q86 C;  1PCX A;  3E1S A;  4RG2 A;  2ROL A;  3GBQ A;  1VQO A;  3CCM A;  3ASK A;  4EMK A;  4FU6 A;  4FL6 A;  4RMO A;  3CCV A;  3CCE Q;  2QA4 A;  2PNI A;  2PUK B;  1B34 B;  1M9S A;  1IGQ A;  1ZQ1 A;  2EQU A;  2LC4 A;  1BCM A;  2KT1 A;  1YHQ Q;  4PJO G;  1WFW A;  5GAN e;  4UC4 A;  3OYJ A;  1BK2 A;  2EJ9 A;  4EMK C;  4J9C A;  3OS1 A;  2DBM A;  3OYN A;  2O4X B;  1Y57 A;  2ATC B;  3L2V A;  1SHF A;  1ZUY A;  4N0A A;  1Q81 C;  2KDS A;  1AHJ B;  1JB0 E;  2HEQ A;  5CVI A;  3SEM A;  1GFC A;  2HL3 A;  1K73 R;  1C1A A;  3R6N A;  4JRQ A;  4ZTF A;  3PT9 A;  4R55 A;  4IUQ A;  3UPU A;  1EZZ B;  1OOT A;  1RLQ C;  2KRN A;  3JB9 I;  1QQJ A;  2IVW A;  2CZ7 B;  1VOM A;  3M59 A;  3NTI A;  3VS7 A;  3C94 A;  4WTO B;  2CP0 A;  2MYS A;  2ZPG B;  3EFR A;  2QEX Q;  3A8L B;  1Y96 A;  4JS4 A;  3EG0 A;  1CKB A;  3UT1 A;  1VQO Q;  3CCM Q;  1WNL A;  1OU8 A;  4E7H A;  2JUF A;  2RD1 A;  1OI1 A;  2RK1 A;  3CCJ T;  3ER0 A;  3QUI A;  2GFA A;  1HXD A;  3UF4 A;  5J26 A;  1H3Z A;  1X27 A;  2E3I A;  4RTV A;  1H8K A;  2P0K A;  3E9F A;  3LH5 A;  4XU1 A;  3X24 B;  2DXT A;  3MET A;  1I07 A;  5LJ5 g;  5FWC A;  1IRE B;  2F2W A;  4DEY A;  2F2X A;  1KJW A;  3M9Q A;  4M78 C;  1UJ0 A;  1D0Z A;  5KYY B;  2RQV A;  2DVJ A;  1O9S A;  2PQW A;  3I55 A;  2PU9 B;  1MMD A;  4BDY A;  2L2P A;  3CCR T;  2K3Y A;  3LWH A;  1QWE A;  2EYW A;  4C92 E;  1Q82 R;  2VGN A;  3OW2 S;  4AFQ C;  2NUP A;  1RAE B;  2FZC B;  2RHU A;  1WPY A;  2CKK A;  5GAO r;  2E12 A;  2YRV A;  2RF0 A;  4BY6 B;  3THK A;  1VQL A;  2ZAE A;  1SEM A;  2LJ3 A;  1VQ4 Q;  1T3L A;  1ZSZ B;  3HPW A;  1MUZ A;  4QVZ A;  4EMH A;  5FW9 A;  2DBK A;  2W10 A;  2HSP A;  3QDR B;  2QDL A;  3JRZ A;  4RKU E;  5C6S A;  3JCM V;  4M7D A;  3NTH A;  3JCM Q;  1E6G A;  2K9G A;  4OB3 B;  4PKC C;  1P92 A;  1G8X A;  5FU6 C;  5FRO A;  1OZ2 A;  2V1R A;  2DIG A;  3CC2 A;  4MZT A;  2JS0 A;  2L0A A;  3OBW A;  4M7D F;  3RNJ A;  2HQE A;  3M0T A;  4KUI A;  2OX7 A;  4M7D C;  1I5O B;  3CMA A;  1M5Q 1;  5J39 A;  2DL7 A;  2KMT A;  2RPN A;  1Y0M A;  1MV0 B;  4IUP A;  1Q86 R;  2CDT A;  5IAY A;  5DLO A;  1A0N B;  3PIP A;  4JJB A;  1PSF A;  1AVZ C;  5IHI A;  3G4S T;  1RL2 A;  1QWF A;  4JPB W;  5CKE A;  1YIJ T;  4J9G A;  2JN0 A;  3PNW C;  2D8H A;  3OYI A;  1U8R A;  5LJ5 f;  1FWZ A;  4IUV A;  2KQW A;  1PKT A;  1YCS B;  2X3W D;  3JB9 G;  1VQ9 A;  4BI8 B;  2XU8 A;  1VQL Q;  4M7A A;  3RMS A;  3INZ A;  3KFV A;  2J06 A;  1V29 B;  1NYF A;  2DNU A;  5FRN A;  2EJF A;  4M7A F;  4OML A;  2JTE A;  1G3S A;  2HKN A;  1Q81 R;  1I5L A;  3S3M A;  1VQN T;  4M7A C;  3NFC A;  3AT1 B;  3QBY A;  2DL5 A;  3QSU A;  1WHJ A;  2K6D A;  2XDD A;  2AT1 B;  1H64 1;  2AKK A;  1VQ8 A;  1TTH B;  2DRK A;  2QGG A;  3BFM A;  3CCE T;  3X20 B;  3HRT A;  4WCI A;  4M78 D;  5KE2 A;  1JJ2 A;  4HCB A;  2KYB A;  2V8I A;  2ZPI B;  4LNP A;  2KBT A;  1D09 B;  3TEE A;  1KSW A;  1YHQ T;  3MKD A;  4J7I A;  1H92 A;  2KSS A;  1WZO A;  2XID A;  3QYG B;  2OAW A;  1U5S A;  2JTM A;  4HA8 A;  4KUD K;  2PVG B;  3NMZ C;  1EIF A;  2BE9 B;  3CCS A;  1K0S A;  1TXQ A;  1G83 A;  4PL6 A;  4X9C A;  4M77 A;  1UB4 A;  3VRY A;  2CS7 A;  2KK4 A;  4PJJ A;  1YIT Q;  3M54 A;  3DKM A;  1KC8 U;  4IUR A;  2QG9 B;  4X34 A;  3ZL7 C;  2AZV A;  4V2S A;  2J6F A;  5I2S A;  3RUX A;  4J9F A;  3RKW A;  4M77 F;  4BE1 A;  1WIE A;  4F7U B;  2X4X A;  3BDL A;  3PIO A;  2X4Y A;  4M77 C;  1GXI E;  3OYB A;  2DD5 A;  2NWM A;  2X4W A;  4GLK A;  1PNJ A;  5DY9 A;  1ZLM A;  2QEX T;  4PJM A;  2FPF A;  2VUB A;  2LQ8 A;  4F17 A;  2IIM A;  2XDP A;  1KD1 C;  1VQO T;  4QW2 A;  3CCM T;  1VQ8 Q;  3OSV A;  2OAU A;  4KH1 B;  3WVD B;  4M7D D;  2DL4 A;  1H3H A;  4J8O A;  2ESW A;  2DL8 A;  4ZTJ A;  2WAC A;  5HCK A;  1XJW B;  4X9D A;  3MPU B;  1OV3 A;  4ZGJ B;  1VUB A;  2ZPF B;  4CI0 C;  1W2B P;  3VKI A;  1X6O A;  2YXY A;  4KT0 E;  2K5F A;  4C8Q A;  2EBP A;  2K3B A;  4PNO A;  3P8D A;  2G6F X;  1OPL A;  2M02 A;  1WQ7 A;  2L5Q A;  2HSE B;  2HDA A;  3HL8 A;  1X2Q A;  4C8Q F;  2IG0 A;  2EGA A;  1KIK A;  1I81 A;  2JZ2 A;  1FXX A;  1SSH A;  2EYY A;  3C4S A;  2LZ6 B;  3LGF A;  6AT1 B;  4JJD A;  2YRD A;  4M7A D;  1UJY A;  3EGD A;  3NTK A;  2RK2 A;  4HCK A;  4RCC A;  4DA4 A;  4LN2 A;  1VQ4 T;  1I8F A;  4J5Y A;  4OMM A;  1PM3 A;  2QQA A;  3OYY A;  1JBM A;  2L3Q A;  3LYI A;  1XQH A;  4PFP A;  2DTI A;  4ZGE B;  3UAT A;  3OS0 A;  3CCL Q;  2EPD A;  2HMA A;  2F1L A;  1M2V B;  1QW1 A;  4EIK A;  4LE9 A;  3OYG A;  4MZM A;  3CC4 Q;  3JCM e;  4KRT A;  4QQ6 A;  4KH0 B;  2E6N A;  1X6B A;  1RI9 A;  2VV5 A;  1G3Y A;  4JJN K;  2BZX A;  1N5Z A;  1EX4 A;  3OY9 A;  5GAN 4;  2RI3 A;  2YT6 A;  4MDX A;  1IXD A;  3RDV A;  2RJD A;  2K4Y A;  4KGZ B;  5CKD A;  1V1C A;  5AT1 B;  1KC8 R;  4JDS A;  1LPL A;  1VQK Q;  1D3B A;  3A8G B;  1IZ6 A;  2DEQ A;  2MMP A;  4Z02 A;  1M4Z A;  3M5A A;  4AFZ C;  4C92 B;  2CUB A;  5LJ5 d;  2A36 A;  1VQ7 Q;  4XK8 E;  1HJD A;  3EGU A;  5CR2 A;  1GBR A;  1JO8 A;  2RQU A;  3REB B;  5M9O A;  4DEX A;  2VXE A;  1G3T A;  2AK5 A;  4R56 A;  3OYM A;  2HL5 C;  4MML A;  4DBR A;  2KI7 A;  2HBW A;  2QQS A;  2DTH A;  3SHW A;  1VQP A;  1VQL T;  1K73 U;  1I0C A;  2CSI A;  3DB4 A;  3UDC A;  1F1B B;  3L2Z A;  4M78 E;  3S6W A;  1YWP A;  2OTL Q;  4LD6 A;  3VYH B;  1PRM C;  1CKA A;  1RAI B;  4PJN A;  4HCZ A;  1JQQ A;  2YDL A;  2EGE A;  1IHW A;  1IO6 A;  1YJW A;  2CSQ A;  1VQ5 Q;  2DJZ A;  2AHJ B;  4J6W A;  2C06 A;  3V8J A;  4MZP A;  1TH7 A;  2X3X D;  5KE3 A;  1NEB A;  1V76 A;  5ECA A;  2EVR A;  2RJF A;  3CQT A;  4OB0 B;  4WF2 A;  2FEI A;  2EQK A;  2JS2 A;  3BW1 A;  1K4U S;  2QAS A;  4J9H A;  4NS5 A;  1CSK A;  1IRX A;  1M1K U;  3REA B;  3FIF A;  4OGE A;  1ARK A;  1KD1 R;  1IHV A;  1PHT A;  4NL2 A;  2VAS A;  2AIR B;  1JJ2 P;  2A3L A;  2EQI A;  2QGF B;  2SEM A;  8AT1 B;  2HNI A;  4LDX A;  2COZ A;  2XG8 D;  3WXM B;  3M0R A;  3CBO A;  1YIT T;  2MPX C;  2C0O A;  4M7D E;  3QZ5 B;  3MEV A;  1D0X A;  4LDW A;  1TUG B;  2JM8 A;  1YNZ A;  2EGC A;  4YTL A;  4M75 A;  4R0K A;  1QCN A;  4HT9 A;  1WQW A;  3EG9 A;  2DMO A;  1Z9Q A;  2EYQ A;  1HD3 A;  2NUZ A;  1LCK A;  3VJP A;  4N4I A;  4M75 F;  3GF5 A;  4E7S A;  5CKF A;  3O5Z A;  2EJG A;  1MMN A;  1MHN A;  4IKF A;  2X4J A;  4M75 C;  3OYF A;  1X01 A;  2DET A;  3EH2 A;  5DM7 R;  2LMJ A;  2GNC A;  1VQ8 T;  4NOY A;  2DPP B;  2DE0 X;  2JMC A;  3MCA B;  2P0P A;  5LJ5 j;  1WXT A;  4AT1 B;  3J81 E;  1WXU A;  1BIB A;  5IH2 A;  3G1J A;  2EQJ A;  5GAM j;  2RM4 A;  1VQM A;  1UHC A;  3QJY A;  2A08 A;  1ZX6 A;  2LRQ A;  1NLO C;  2FZK B;  2LNV A;  2Y4X A;  4M7A E;  5CK9 A;  3VS0 A;  2VVK A;  2KRO A;  2FPD A;  2H3J A;  4FYW B;  1YJ9 A;  2O2O A;  1M3A A;  2M0Y A;  1AZG B;  3CME A;  4LDV A;  1M3C A;  5IN1 A;  5KYW A;  1AWW A;  2RN8 A;  1Q86 U;  2K57 A;  3QDF A;  3VS4 A;  1YJN Q;  2FB7 A;  1KQ1 A;  1D1B A;  5GAO p;  3CD6 Q;  1Q7Y C;  1NZ9 A;  3L2Q A;  5IHN A;  2MOX A;  2LT1 A;  1K9M C;  3X25 B;  2MWP A;  1PKS A;  5FRM A;  3KBG A;  2YSQ A;  1W2B S;  3GNF B;  1C0M A;  1M90 C;  4F7U G;  1W2B A;  4DBF A;  3EFO A;  5KYX B;  3CCV Q;  4X1V A;  3OYD A;  2QA4 Q;  2JM9 A;  1TSF A;  3CCL T;  4N4H A; 
#chains in the Genus database with same CATH homology
 2FPE A;  3KFV A;  1UG1 A;  5I11 A;  2J06 A;  2BZ8 A;  1NYF A;  2DNU A;  1WI7 A;  1JEG A;  3TVT A;  1VYU A;  4OML A;  3M0S A;  1NLP C;  4Y92 A;  4K11 A;  2FG0 A;  2ED1 A;  1PWT A;  2FO0 A;  2JTE A;  3VS2 A;  2O31 A;  3QWY A;  2GTJ A;  2DL5 A;  2K6D A;  1FYN A;  4IIM A;  1Z9Z A;  3VS6 A;  2AKK A;  4QT7 A;  2I0N A;  1UDL A;  1WDX A;  2A28 A;  4CC3 A;  2DRK A;  2EYZ A;  2DJQ A;  2FRW A;  2RQW A;  4WCI A;  2H8H A;  3VS1 A;  4CC4 B;  4OMP A;  2KYB A;  1K1Z A;  4LNP A;  4RTX A;  2CUD A;  2KBT A;  2O88 A;  1KSW A;  2GTO A;  1NG2 A;  1JXO A;  1H92 A;  2OAW A;  1U5S A;  2HCK A;  5L23 A;  2DRM A;  1JXM A;  3IQL A;  3NMZ C;  3I5R A;  2YUO A;  3QWX X;  1K0S A;  1G83 A;  4JZ3 A;  4RTZ A;  1UTI A;  2CT4 A;  1K0X A;  1UHF A;  3VRY A;  4AG2 C;  1AOJ A;  2LJ0 A;  2VWF A;  1RLP C;  4AFS C;  4LUE A;  1NEG A;  3ZL7 C;  2AZV A;  1ZUU A;  2GGR A;  4J9E A;  3EG2 A;  2SRC A;  5IHK A;  2J6F A;  2K7A A;  1B3Q A;  3VS3 A;  2L3S A;  1SHG A;  4J9F A;  2BTT A;  4RTY A;  2KNB B;  1J3T A;  1WIE A;  4ORZ A;  1BU1 A;  1UUE A;  2AZS A;  3VS5 A;  1VYT A;  3NGP A;  2M51 A;  2ABL A;  1YN8 A;  1BB9 A;  1UE9 A;  3UA6 A;  2NWM A;  3H0H A;  1TUC A;  2B86 A;  1UGV A;  1PNJ A;  1ZLM A;  2AKL A;  4J9B A;  2FPF A;  4F17 A;  1AEY A;  2IIM A;  2DM1 A;  1ZSG A;  1M8M A;  2DL4 A;  1H3H A;  2ESW A;  2DL8 A;  1WX6 A;  2EYX A;  2V1Q A;  2KXD A;  2PZ1 A;  1GFD A;  2RQR A;  2OI3 A;  5HCK A;  4JJC A;  1W70 A;  1X2K A;  5FWB A;  1T3S A;  2ECZ A;  2XMF A;  1OV3 A;  2MCN A;  3I9Q A;  3H0I A;  3I35 A;  2YUP A;  2A37 A;  3TSW A;  4ZNX A;  1QKW A;  2KR3 A;  2EBP A;  2K3B A;  3TSZ A;  2KYM A;  1TUD A;  2G6F X;  1EFN A;  1OPK A;  1OPL A;  2PTK A;  1GRI A;  2HDA A;  1X2Q A;  2KRM A;  1T0H A;  2O9V A;  2EGA A;  1KIK A;  1YWO A;  3JV3 A;  1W6X A;  1NYG A;  2RNA A;  2J6O A;  4OMN A;  2DLP A;  4RTW A;  1AWX A;  4HVV A;  1SSH A;  2EYY A;  3M0U A;  2LZ6 B;  3EHR A;  4JJD A;  1UJY A;  1X43 A;  5GJV B;  1AWJ A;  2F2V A;  5IXF A;  1E7O A;  4HCK A;  4LN2 A;  3I5S A;  2YUN A;  4OMM A;  2ED0 A;  3VRZ A;  4OMQ A;  2L3Q A;  5IXB A;  3PVQ A;  2CRE A;  2LX7 A;  3UA7 A;  3UAT A;  2YUQ A;  2EPD A;  2KT8 A;  3PVL A;  3EG3 A;  4EIK A;  2LCS A;  1UEC A;  4AFU C;  4LE9 A;  4HVW A;  1SRM A;  4KRT A;  5GJW B;  2D0N A;  4Z8A A;  2J7I A;  1X6B A;  5EC7 A;  1RI9 A;  2BZY A;  2BZX A;  1N5Z A;  2DL3 A;  4HXJ A;  4D8D A;  1HSQ A;  1ABQ A;  2DX1 A;  2JXB A;  2ROL A;  2YT6 A;  3GBQ A;  2ROT A;  1QCF A;  1UFF A;  2LNH B;  4CC7 A;  1V1C A;  1KFZ A;  4F16 A;  1JU5 C;  4AFZ C;  2PNI A;  2CUB A;  2A36 A;  1QKX A;  2W0Z A;  2DIL A;  2E5K A;  2O9S A;  2CT3 A;  1HJD A;  1U3O A;  3EGU A;  3FJ5 A;  1GBR A;  1JO8 A;  2RQU A;  3REB B;  2KT1 A;  2LQN A;  1WFW A;  1PRL C;  1BK2 A;  3H0F A;  4J9C A;  2DBM A;  1QLY A;  4DEX A;  1Y57 A;  2AK5 A;  1M30 A;  1SHF A;  1ZUY A;  2HBW A;  3SHW A;  4RTT A;  1I0C A;  2CSI A;  2HEQ A;  3SEM A;  3U23 A;  1GFC A;  1WLP B;  4ESR A;  3R6N A;  1YWP A;  1SRL A;  1PRM C;  1CKA A;  1ZUK A;  1JQQ A;  1RLQ C;  1OOT A;  2KRN A;  2YDL A;  1T0J A;  2EGE A;  1IO6 A;  2CH4 W;  1GCQ C;  2CSQ A;  3C0C A;  3VS7 A;  2X3X D;  2K79 A;  1NEB A;  3EG1 A;  3EG0 A;  1BBZ A;  2JT4 A;  4F14 A;  1CKB A;  1GCP A;  1WYX A;  1K76 A;  3EHQ A;  5ECA A;  1B07 A;  2EVR A;  1GBQ A;  3CQT A;  2JMA A;  2DF6 A;  2FEI A;  2J6K A;  2JS2 A;  1K4U S;  4J9H A;  1CSK A;  3REA B;  2RQT A;  1M3B A;  3UF4 A;  1X27 A;  4E6R A;  4RTV A;  1ARK A;  1H8K A;  1PHT A;  3LH5 A;  1I07 A;  2L3P A;  2EQI A;  2DA9 A;  2SEM A;  4OMO A;  1MV3 A;  5FWC A;  2F2W A;  3M0R A;  4DEY A;  1WXB A;  2F2X A;  1KJW A;  2DYB A;  2JW4 A;  2C0O A;  2KEA A;  1AD5 A;  2EW3 A;  3PE0 A;  1UJ0 A;  2JM8 A;  1YNZ A;  2EGC A;  1VYV A;  4R0K A;  2D1X A;  2RQV A;  4D8K A;  1RUW A;  2DVJ A;  1TG0 A;  2EKH A;  2DMO A;  1Z9Q A;  1HD3 A;  2NUZ A;  1LCK A;  1K9A A;  4RTU A;  2LJ1 A;  4J9D A;  2L2P A;  1G2B A;  3M0P A;  1QWE A;  1ZBJ A;  2EYW A;  2LQW A;  3O5Z A;  4AG1 C;  4AFQ C;  2C0I A;  1S1N A;  1AWO A;  1NM7 A;  2RF0 A;  2LMJ A;  3THK A;  2GNC A;  4Z89 A;  1SEM A;  4A63 B;  2RMO A;  1U06 A;  2LJ3 A;  2DE0 X;  1YP5 A;  1T3L A;  2JMC A;  4GLM A;  1MUZ A;  2KE9 A;  5FW9 A;  2DBK A;  2W10 A;  2HSP A;  1WXT A;  2GQI A;  2QDL A;  1M27 C;  5I22 A;  1VA7 A;  1WXU A;  1E6G A;  5IH2 A;  2K9G A;  2OJ2 A;  1UHC A;  2A08 A;  1ZX6 A;  2P4R A;  1NLO C;  1X6G A;  2C0T A;  1ABO A;  2GBQ A;  3ULR B;  2V1R A;  1FMK A;  3VS0 A;  2VVK A;  2J05 A;  2JS0 A;  1GCQ A;  2KRO A;  2L0A A;  2K2M A;  2FPD A;  1I1J A;  3RNJ A;  2ENM A;  2O2O A;  1M3A A;  3M0T A;  2KRS A;  2M0Y A;  1AZG B;  2MIO A;  2LP5 A;  4Z88 A;  1M3C A;  3M0Q A;  1AWW A;  3H41 A;  2RN8 A;  1OEB A;  2VKN A;  2DL7 A;  2CH4 A;  2RPN A;  1Y0M A;  1W1F A;  1MV0 B;  1WA7 A;  3VS4 A;  1XOV A;  2CDT A;  2KGT A;  4RUG A;  1A0N B;  4JJB A;  1AVZ C;  5IHI A;  1SPK A;  4CC2 A;  3NHN A;  1QWF A;  1X69 A;  4JPB W;  5IHN A;  2KXC A;  4J9I A;  2FRY A;  2MOX A;  1E6H A;  4J9G A;  4JZ4 A;  2D8H A;  3A98 A;  1PKS A;  2D8J A;  2YSQ A;  4M4Z A;  1PKT A;  1YCS B;  2X3W D;  4FSS A;  3RBB B;  4LUD A;  4HVU A;  1AZE A;  4IIO A;  4X1V A;  1GL5 A;  2JM9 A;  4GBQ A;  3NPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...