2K9GA

Solution structure of the third sh3 domain of the cin85 adapter protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
SMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH3 domain-containing kinase-binding protein 1
publication title Solution structure of the Sh3-C domain of Cin85
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k9gA00
1ZBJA 3SEMA 1U5SA 2LP5A 1YWOA 3M0UA 5FWBA 1G2BA 1GBRA 4AG2C 1K0SA 2EGCA 1SPKA 3C0CA 1W1FA 2FO0A 4RTXA 2BZYA 2FPEA 2VKNA 4AFSC 1UHFA 2YUPA 2CH4W 2ENMA 2KE9A 3TVTA 3VS5A 1X2KA 2NUZA 1PHTA 1SSHA 2LX7A 1E6HA 2RQUA 1JU5C 2FPDA 1J3TA 2M51A 1B3QA 3VRYA 2RF0A 2FRYA 1WFWA 2JT4A 4Z8AA 1I0CA 2J05A 3R6NA 1OPLA 1YWPA 1CKAA 3EHRA 2K79A 3EG3A 1AWOA 2YSQA 1OV3A 2FPFA 3VS7A 2D8HA 2ESWA 1QCFA 4Z89A 2E5KA 4HCKA 2RN8A 2JXBA 4HVWA 4LE9A 4CC3A 2ROTA 2B86A 4M4ZA 1TG0A 4AFUC 4RTWA 2LNHB 1X6BA 2DYBA 1WXBA 5I11A 4CC2A 1GFCA 3REBB 4WCIA 2K6DA 1G83A 1YP5A 4A63B 2K3BA 2O9VA 1ZUUA 2CT3A 2FEIA 4CC4B 2I0NA 3O5ZA 4LUEA 1WDXA 1GFDA 3ULRB 2X3XD 1JQQA 1RUWA 1Z9QA 2LJ3A 3NPFA 4J9EA 2V1QA 1GL5A 3RBBB 3I5SA 2JW4A 3PVLA 2KT1A 5IHIA 2L0AA 1GRIA 1NEBA 1PRMC 2CH4A 3TSWA 2EQIA 5FWCA 1AVZC 2KXCA 1X43A 2KRMA 2K7AA 2FRWA 4GBQA 4J9CA 2HCKA 2BZ8A 1QLYA 4RTYA 2PNIA 5GJVB 2JM9A 4LN2A 4DEXA 3VRZA 2GGRA 2NWMA 3M0TA 2ED0A 2GTJA 2BZXA 2EGAA 1UHCA 1UJ0A 1FMKA 1RI9A 1VYTA 1VA7A 1M3BA 2L3QA 1X27A 2DMOA 3QWYA 1BU1A 4IIMA 1WLPB 2XMFA 4HXJA 4RTZA 1ARKA 2KEAA 1YNZA 1K0XA 2CUDA 1AWXA 1QKXA 2CDTA 1A0NB 2DBMA 2DL4A 1YN8A 4ORZA 3U23A 1M8MA 5IHNA 1OOTA 2KXDA 2EPDA 4RTVA 1WXTA 2KRNA 2W10A 2LJ1A 1NG2A 4E6RA 2DNUA 2GTOA 2W0ZA 4LUDA 2CSIA 3VS3A 1W6XA 1UTIA 2O9SA 1NEGA 5IXFA 1HJDA 1ABOA 1HSQA 2SEMA 3QWXX 2PTKA 3NMZC 2LMJA 2M0YA 3EHQA 4OMQA 2DRMA 2AK5A 1AEYA 2DILA 3ZL7C 2KYMA 2CUBA 2F2VA 1BB9A 1U3OA 2CSQA 2KROA 2L3PA 4RTUA 1MUZA 3EG0A 1M30A 3LH5A 2A37A 4JPBW 4X1VA 1PWTA 2KGTA 1GBQA 3EG2A 2F2WA 4JZ3A 1H3HA 2A36A 1BK2A 2DJQA 1H8KA 2DL5A 1SHGA 2RPNA 3CQTA 5L23A 2EYWA 2CT4A 1AOJA 1UJYA 2RQTA 1WA7A 2BTTA 1ABQA 2J6FA 2L2PA 1SEMA 2LCSA 2DF6A 2JMAA 4F17A 2HBWA 2MOXA 2A28A 1PKTA 2RMOA 1UDLA 1OPKA 2EW3A 1M3AA 4J9BA 1B07A 2DL7A 2AKKA 1KJWA 1N5ZA 4CC7A 2EYXA 4ESRA 2GQIA 1JXMA 2K9GA 2EKHA 2DRKA 2V1RA 3M0PA 1NM7A 2C0OA 4J9HA 1EFNA 2D8JA 2ECZA 3M0RA 3NGPA 4KRTA 4AG1C 3PE0A 1KSWA 1BBZA 2JS2A 4D8DA 2OI3A 1VYUA 1X6GA 1UFFA 2VVKA 1E6GA 3VS1A 2JTEA 3REAB 4JJCA 1QWEA 4JJDA 4D8KA 3I9QA 1M27C 2LQWA 5EC7A 1JXOA 1T3SA 5IHKA 4GLMA 2KT8A 3TSZA 4EIKA 4OMMA 1RLPC 3UA6A 5I22A 1AWJA 1AD5A 1SHFA 2RQWA 1I07A 2DM1A 2AZSA 2MIOA 1U06A 2EYYA 3FJ5A 1PNJA 1T0JA 2LJ0A 1TUCA 1GCQA 1FYNA 5HCKA 1UG1A 1WIEA 2K2MA 2J06A 4J9FA 4FSSA 1NYFA 2G6FX 1NLOC 2X3WD 1V1CA 2RNAA 3VS2A 2DBKA 4QT7A 3UF4A 2YT6A 2RQVA 3SHWA 2RQRA 4F14A 4HVVA 4J9DA 1S1NA 3VS6A 4K11A 2LZ6B 3IQLA 2A08A 3THKA 2DL3A 4Z88A 3UATA 1GCQC 4J9GA 1QKWA 1GCPA 3EGUA 2JMCA 1UECA 3RNJA 1MV3A 4OMOA 4OMNA 2PZ1A 2KBTA 3I35A 2DL8A 1ZUYA 2D0NA 2LQNA 4Y92A 2F2XA 2IIMA 2GBQA 5GJWB 1AZEA 1WYXA 1KIKA 2OJ2A 1ZUKA 1NLPC 4RTTA 3I5RA 4HVUA 2YUNA 1AWWA 1M3CA 2YUOA 1UUEA 1SRLA 2GNCA 2L3SA 2DVJA 4F16A 4DEYA 3EG1A 3H0HA 1KFZA 1ZX6A 2YDLA 4JZ4A 1PKSA 5IH2A 1QWFA 1UGVA 1E7OA 4IIOA 1X2QA 1HD3A 1W70A 2O88A 2OAWA 3M0QA 2ABLA 2AKLA 5IXBA 1WX6A 5ECAA 2CREA 2EYZA 1PRLC 1AZGB 2O31A 5FW9A 2MCNA 1JEGA 1K76A 1T0HA 1XOVA 4OMLA 2HSPA 3H0IA 2DA9A 2ROLA 1SRMA 1Y0MA 2KR3A 3GBQA 1Z9ZA 1YCSB 2DLPA 2HEQA 1H92A 1WXUA 2QDLA 4RUGA 2KYBA 2DX1A 2EBPA 1WI7A 2KRSA 2AZVA 2JS0A 2ED1A 3NHNA 4JJBA 1MV0B 3PVQA 4LNPA 2DE0X 4J9IA 1ZLMA 1K9AA 1NYGA 2C0TA 4ZNXA 1K1ZA 1LCKA 2EVRA 4R0KA 3H0FA 1UE9A 1X69A 3UA7A 2SRCA 3H41A 2FG0A 2D1XA 1CKBA 3A98A 3JV3A 2KNBB 1T3LA 1VYVA 3KFVA 2C0IA 2H8HA 2YUQA 1OEBA 1TUDA 1JO8A 3VS0A 1Y57A 1K4US 2O2OA 1ZSGA 1I1JA 3M0SA 3VS4A 2J7IA 4AFZC 2VWFA 1CSKA 2J6KA 2HDAA 2P4RA 2EGEA 1IO6A 4AFQC 1RLQC 2JM8A 2J6OA 4OMPA
chains in the Genus database with same CATH superfamily
5D7UA 4M75E 1MNDA 3A5ZB 2H3JA 2QQ9A 3ZBDA 3M0UA 5FWBA 3QKJA 3RUXA 3JCMc 2EGCA 4QKUA 4E7ZA 4FYVB 4BDZA 1YFNA 1FX7A 4RTXA 2FPEA 2VKNA 4XTXA 4DQ2A 2FVUA 1X2KA 2P4TA 1YHQQ 1PHTA 3G7ZA 1E6HA 2A7YA 4FYXB 4P5NA 5KYYA 2YRCA 3BE3A 4Z8AA 1KHIA 1KG1A 3OYDA 4N4HA 1Q81U 3R6OA 4M78C 1RAFB 5GAN6 3L42A 3G71Q 3Q1JA 1VQ4Q 4HCKA 5GAN4 2GCXA 3O8VA 4HVWA 4CC3A 1KD1U 4AFUC 3MP6A 1UGRB 4DOWA 3CCUT 2CYZB 1GFCA 3REBB 4WCIA 1G3YA 2K6DA 4A63B 1UGPB 3VJPA 5HK3A 4LDVA 2FEIA 1NZ9A 2QTVA 1HXDA 4CC4B 7AT1B 1QVFS 4LUEA 1WDXA 1RUWA 4BE0A 1VQ9A 1B34B 2LJ3A 2HD0A 2Y90A 3RMQA 3A8HB 1TOVA 3VV0A 3BDLA 1M5Q1 3JB9F 4O5VA 1FMWA 3P8BB 3ME9A 3CCVT 2ATCB 1NEBA 1D3BA 2CH4A 2YXYA 3TSWA 2FYKA 2JOYA 1AVZC 4DBFA 1X43A 3MJXA 2FRWA 2FZCB 4N4GA 4J9CA 3X20B 2BZ8A 2QG9B 4RTYA 3G6ET 4PJOA 5GAN2 2NYSA 1UHCA 4R55A 2CZ1B 3BW1A 1NPPA 5LJ5e 3GF5A 1KQSA 2O4XA 2LC4A 2DMOA 2CKKA 1ARKA 3OYHA 2CUDA 4R56A 5A2QE 1A0NB 1ZA2B 1M90R 4ORZA 4CI0C 1OOTA 5GAN8 3M53A 4RTVA 1AHJB 1N8RR 4M7AF 1YJNA 5GAMg 3S3OA 1Y96A 4PJOE 5CKHA 1YHQT 2QQBA 4EPCA 1VQPQ 3SDZA 3N5BB 1NEGA 2V8IA 4E7JA 2AHJB 2DEQA 1VQOA 1S72Q 3E9GA 3NMZC 3PIOA 1QCNA 2GQVA 4IUPA 3C95A 1RAHB 1AEYA 2F2VA 4E7SA 4M77A 1U3OA 5GAOq 1VQ4T 4RTUA 5KCOA 3LH5A 1PWTA 1VQ5A 2XIDA 5AYFA 4KUIA 1ACMB 1H3HA 2A36A 2K5LA 1BCMA 1BK2A 3M57A 2QGGA 1YI2T 2LDMA 3JCMd 1WGSA 3KBGA 5AT1B 1KC8U 1Q81R 1M8VA 2FB7A 2RQTA 4X9CA 2XKOC 1X6OA 2PVDB 2J6FA 3RIRA 2VC8A 4KH0B 3A8LB 3A8GB 3JCMP 2FZGB 2JMAA 3JCMX 3CD6A 3OYCA 2DIQA 3L2RA 4V2SA 3QYHB 1SG5A 2A28A 1PKTA 3PMTA 4M77E 1OPKA 1QQJA 4J9BA 3GLXA 3RESA 3L2ZA 1KJWA 1M1KR 1PD1A 3OYYA 3OYEA 4E7LA 3V7CA 2DRKA 2RK1A 3FB9A 2OTLA 1VQ6T 3EGDB 3EG9B 2DETA 3NGPA 4AG1C 5GAN3 2XHCA 1H3ZA 1B34A 2BE9B 2OAUA 2QASA 5GAOp 1YCYA 1VQ8A 3HSBA 3OS2A 2QGFB 3TCJA 4JJCA 4BE1A 3CCQT 5GANf 4JJDA 4WTOB 2R57A 4X34A 3JB9D 2ZPEB 3RMSA 4JRQA 1U06A 2EYYA 4LXCA 4XU3A 1UG1A 1R77A 2J06A 2XICA 5KH6A 4FSSA 2E6NA 4M78G 3L2VA 2ZPHB 3CPFA 2VGMA 4M78B 3LX7A 2DBKA 4DBQA 3L2QA 2RQRA 3CCMA 1S72T 3CMAT 1LJOA 2LZ6B 3MEVA 3CMET 5FU6C 3QIIA 3A8OB 3EGUA 4F7UE 2B8AA 1RACB 1W2BP 4JRIA 4DBRA 3X28B 2RB6A 4M7AD 2KBTA 4BE2A 2DIGA 5CCAA 1WJQA 1K73R 1WYXA 2MWPA 1ZUKA 1NLPC 1AWWA 1M9SA 1M3CA 4F16A 3EG1A 3OYJA 4M7AG 5CKEA 2XDBA 4JZ4A 4XQ3A 5IH2A 1QWFA 4M77C 1E7OA 3OYAA 3MHXA 4M7AB 4IIOA 5C6SA 2P0KA 2WSEE 1VQKT 1WZOA 2BE7D 2ABLA 2E12A 1QP3A 4FCYA 3X25B 3G71A 1PRLC 1AZGB 1NJIC 5FW9A 4C8QC 4Z02A 2DA9A 2EFIA 1JJ2S 2XK0A 1R0CB 1YCSB 1Q86R 1IGUA 4PLLA 1YJ9Q 1WXUA 2NUPB 5J39A 4RUGA 2DX1A 1LVKA 3QJYA 2HKQB 3NHNA 4JJBA 2DE0X 4PJMA 2Y4XA 1NYGA 4JLGA 2C0TA 3FIFA 4OB3B 2HBPA 2O01E 2QI2A 1VUBA 2EYQA 4R0KA 1TWBA 3QO3A 1X69A 1AT1B 3UA7A 3EGDA 3EG9A 3A8MB 3A98A 1RABB 4MZMA 1YJNQ 3JV3A 3GIBA 3SWNB 3HFNA 2KNBB 1KK7A 1MHNA 1MMDA 3MKDA 3PTAA 1B7TA 5FROA 3VS4A 1G5VA 2VWFA 3UT1A 2J6KA 4E7IA 4ZTJA 4HCCA 2X51A 2JM8A 3JCMV 3UDCA 4C5EA 4OMPA 1OI1A 2LRQA 1YIJA 2YHTA 2QQAA 3UPUA 3L1AA 2HAXA 1WHMA 1C1AA 1VQ5Q 1IB8A 4KUDK 2M02A 2FO0A 4DOVA 4M78A 2BZYA 9ATCB 1SKUB 4AFSC 1UHFA 2HSEB 4RCBA 2ENMA 2KE9A 3TVTA 3VS5A 3OMCA 2F69A 1JU5C 1J3TA 1OZ3A 4QQ6A 1VQPA 2RF0A 2FRYA 2JT4A 1VQ9T 3OYNA 1I0CA 3CD6Q 2MK5A 1P92A 4C5GA 2YSQA 1OV3A 2E5KA 8AT1B 3OYKA 1QVGA 2RN8A 5D6XA 2ROTA 2EKOA 2CP0A 4M4ZA 2CZ7B 1TG0A 2EJ9A 2DYBA 2QDYB 3A1PA 2DZ9A 1WPYA 4CC2A 2X35A 1YP5A 1O9SA 4MMLA 3CC7Q 1ZUUA 5HK0A 5L8RE 2I0NA 1OYXA 4M7AA 2X3XD 3H8ZA 4A4KA 4J9EA 2JW4A 4JRPA 1V29B 4A4GA 2L3RA 1KC8C 2EQIA 1LOJA 1WHLA 3PNWC 1YJNT 2VB6A 4GBQA 2NUPA 3OSSC 2PNIA 2RD1A 1RADB 4QQGA 3VRZA 2GGRA 3RDVA 5LJ5f 2EGAA 4OB2B 2JVVA 3DB4A 1VQOT 4KGVB 3CCMQ 1RI9A 1WHHA 2QQRA 4A54A 1VA7A 3PFSA 2L3QA 4M7AE 1KQ2A 4IIMA 1WLPB 4J83A 2DXUA 2LT4A 1YNZA 2HMAA 1OULA 1AWXA 3JCMe 4LDUA 3EFSA 1K8AC 3E19A 1YN8A 3SWNA 1VQ5T 4YTLA 2KXDA 4M77G 2EPDA 3J81E 2RJDA 4M7DG 4J6WA 4N0AA 2W10A 3OYMA 2E10A 2LJ1A 4FT2A 4M77B 4M7DB 1NG2A 4E6RA 2DNUA 2RHXA 4LUDA 5FU7C 2LQKA 4MMKA 1UTIA 4OB1B 4C8QG 2Y4YA 1N27A 4HKEA 1HJDA 1KQ1A 4FIBA 2DPPB 4C8QB 3QWXX 2M0YA 4OMQA 4RKUE 3CD6T 1RI0A 1NJIU 2DRMA 2YLBA 3RKYA 3M58A 1VQ7A 2R58A 3CCRQ 2AT1B 1BB9A 5DLQE 4QVCA 2CSQA 1K9MC 4BI4A 2JN0A 2L3PA 4IUUA 4X1VA 2A37A 2OTLT 3EG2A 2F2WA 5GANd 2M0OA 4QQDA 1BI1A 4UC4A 2OX7A 2WACA 2RPNA 3S6WA 3CQTA 4AT1B 5L23A 1BIBA 1VQ8T 2FL7A 4XTYA 2BTTA 2RH2A 1ABQA 1UGSB 1FMVA 2L2PA 1Q7YC 4F17A 3J7AF 1QVFA 3OYLA 2MOXA 1OZ2A 1I81A 2EW3A 2AKKA 4CC7A 2COZA 2EYXA 4ESRA 3VUZA 5KYUA 1JXMA 2DZCA 4HT9A 4F7UG 2D0QB 1WJSA 2EWNA 2V1RA 3QG1A 3DLMA 4J9HA 4F7UB 4EMGA 5LJ3f 2ECZA 3CCEQ 3M0RA 5KYNA 4KRTA 4IUVA 2HL3A 3E2UA 5KYWB 4M7AC 1KSWA 3CCMT 1VYUA 1X6GA 1YJ9A 1UFFA 2VVKA 3QZ5B 1KHCA 1VOMA 4ELYC 5CAIA 3I56Q 4ZGEB 1WNLA 2EJGA 2KI7A 1M27C 3TSZA 1YIJQ 1RAEB 3EGXB 1AWJA 4XK8E 1W2BS 4BB7A 3FJ5A 4WF2A 5GAMf 2LX9A 1PNJA 4E7HA 4PJNA 2LJ0A 1TUCA 2ZZDA 4MDWA 2DO3A 3UWNA 1Q82C 1FYNA 2K2MA 4J9FA 2HQEA 1NYFA 2LVMA 2XDDA 4C92F 2RNAA 3VS2A 4HCZA 5I21A 1X01A 3DB3A 4HVVA 4OGCA 3QDFA 1D1AA 1S1NA 3VS6A 3ZFJA 2JJ9A 1PSEA 2A08A 3F70A 2LT1A 3V8LA 1D09B 1G3TA 4Z88A 3L2UA 1GCQC 3BFMA 3SWNC 4ANJA 2MF2A 2ZCFB 3JCMh 1UECA 4N0AC 3G71T 4A53A 5LJ3j 4M7DA 2D0NA 2DAQA 4EMKB 2RHZA 4M75F 5GJWB 1KIKA 5C0MA 2OJ2A 1VIFA 5GMKj 4RTTA 2HKNA 4C8QA 2CP5A 1VQNA 3S3NA 3HTRA 4ZTFA 1IXDA 3FDRA 2GNCA 2KY9A 2RHYA 1PC0A 2DVJA 3BY7A 3TREA 2CP7A 3I55A 1UGVA 2P0PA 1VIEA 1X2QA 2LCLA 1KD1R 4PKCC 1HD3A 1W70A 4E47A 2AKLA 1WX6A 3QHSA 4L6V5 4M7DE 2O31A 2MCNA 5GMKi 1XOVA 3M5AA 2HSPA 3H0IA 3EH2A 2ROLA 3GBQA 1Z9ZA 2XD0A 1RAGB 2PU9B 2KYBA 4C8QE 3OYFA 1UEBA 2E4HA 2KRSA 1K8AU 3L2WA 2AZVA 3CC7A 4LNPA 2ZGWA 4ME7A 4C0FA 1YIJT 4JJNK 4ELZC 5FU7B 2EVRA 1ZA1B 2X4WA 3JCMb 2E64A 3J80E 1WJRA 1YITA 2DERA 4F7UA 2FG0A 3MEWA 2VGNA 1RL2A 1D0YA 2QXFA 3LWIA 2KDSA 5KYWA 3SB2A 2H8HA 5D6WA 5A0DA 1FXXA 1Y57A 1QVFP 2O2OA 1ZSGA 2F1LA 3FLGA 2J7IA 1K9MU 4E2FB 3JB9G 1VQPT 5EG2A 3M4GA 2V8JA 3P8DA 1R0BG 2VUBA 1QW1A 2EGEA 2PVGB 5GAOr 2EIFA 3EGXA 3E9FA 4HCBA 2J6OA 1VQ7Q 3CPWS 3GOXA 2EQKA 3QBYA 2DJZA 1ZBJA 1YWOA 1G2BA 3GP8A 1GBRA 4AG2C 1TUGB 3VKIA 5DLOA 4FYYB 3E1SA 2DXBA 2RJFA 4C92D 1M2VB 5GMKl 2E41A 1KQSP 1Q7YU 1TU0B 1SSHA 2A0FB 2LX7A 2RQUA 2FPDA 1WHJA 3JB9I 2M51A 1B3QA 3VRYA 2QEXA 1WFWA 2KAFA 5KYXB 5GANj 5GMKm 4KT0E 4PJOF 1XTDA 1QVPA 3WVDB 2J05A 3R6NA 2DD4A 1VQLQ 3EHRA 2K79A 1YJWA 2E70A 2FPFA 4QVDA 2D8HA 2ESWA 4M7DC 4Z89A 4EMKA 3CCRA 2B86A 1OX9A 3M55A 4RTWA 1XNIA 1X75C 1N9SA 2LNHB 1X6BA 4M75D 1KC8R 4QVZA 1WXBA 3OA6A 3CXCS 2EQJA 3URGA 1JJ2A 4Y91A 1Y71A 4HA8A 3OW2S 4BY6B 3JAME 1IHVA 3JB9J 3OW2A 1GFDA 3ULRB 5CQXA 1Z9QA 1Q82U 3M9QA 3NPFA 1XQHA 4PFZA 1LNXA 2KVQG 4PLIA 3RBBB 3PVLA 2RHUA 2L0AA 1GRIA 1PRMC 4FT4A 2V8KA 2XI9A 3OS5A 3OY9A 3RR6A 1R8OB 2HCKA 1NPRA 4J6YA 4PJLA 4LN2A 4DEXA 2NWMA 3LYIA 3M0TA 3LGFA 2GTJA 3RKXA 2K57A 5KE3A 1M4ZA 3CCEA 1JBMA 1MMGA 3LLRA 2L8DA 1X27A 1M1KC 4BI3A 4GLKA 5GANe 1VQ7T 4RTZA 4A4HA 4B9WA 2KEAA 3OMGA 1ZSZC 2L89A 1K0XA 3I56A 3FC3A 3EH1A 4MDXA 3LWHA 1MMNA 2DL4A 3CCSQ 2LQ8A 3FEOA 2KSSA 1M8MA 3U23A 3JCMg 3C12A 4XU2A 1K9MR 3HFOA 2KRNA 4JS4A 4KBMB 5LJ3h 2ZPIB 2W0ZA 2DYIA 4C0DC 2CSIA 3VS3A 1VQNQ 1PSFA 2MAMA 5GMKh 2E5QA 1BYMA 1ABOA 1HSQA 2SEMA 4X9DA 2PTKA 3EHQA 3I55Q 1EIFA 3QUIA 2AK5A 2R5MA 4BI8B 2I2LA 5LJ3d 1O75A 5CKBA 2KROA 3CBOA 4FSXA 2F5TX 1MUZA 3EG0A 1M30A 1M2VA 2HL5C 4VUBA 3DKMA 5A0GA 2KGTA 1GBQA 3OS1A 2DJQA 2DL5A 1UGQB 4LD9K 1SHGA 5KYXA 5KYUB 1YJ9T 3C4SA 2HNIA 1WA7A 2YRDA 5GAMd 2IPOB 2QA4A 3FRNA 4PJOD 1SEMA 4IUTA 2LCSA 3CCLA 2EAYA 1RAAB 4NOYA 3ASKA 5CQYA 4EMKC 4KGZB 1K73C 2LCCA 2D9TA 3CBPA 4JS5A 4KULA 3CCJA 3LH0A 1B07A 2V26A 4J7FA 1N5ZA 1YITQ 2K9GA 2RI3A 2EKHA 5GAN7 1G8XA 3M0PA 4J5YA 2C0OA 2Z0WA 3OBYA 2EQMA 4XTVA 2FZKB 1U1SA 2JS2A 4D8DA 2OI3A 4JLIA 3VS1A 2KK4A 3REAB 5IN1A 4D8KA 2LQWA 5EC7A 1T3SA 5IHKA 2KT8A 4OMMA 4LDWA 1RLPC 4PK4A 3UA6A 2VV5A 3CC4A 2XDPA 1Q86C 1AD5A 2RI5A 2HZYA 3EFOB 1I07A 2E3IA 1D1BA 1JJ2P 1T0JA 2M16A 1GCQA 4J6XA 2CS7A 3G6EQ 3OBWA 2PUOB 2A3LA 2RO0A 1QMCA 2K3XA 4XU0A 1VQNT 4QT7A 3UF4A 4RMOA 5CR2A 3CC2A 2LNVA 5DM7R 2QEXQ 1HK9A 4J9DA 3HRUA 4JDSA 3G4SA 3EFRA 1SF9A 4QW2A 1N9RA 3IQLA 3I55T 1GXIE 2QQSA 3THKA 1ZHIA 1MMAA 5CK9A 3QSUA 5HKCA 5GANh 3WVEB 2QYZA 4RG2A 1YJWQ 1GCPA 2JMCA 3RNJA 4FYWB 4L5GA 4OMOA 3OB9A 2PZ1A 1C0MA 2DL8A 1ZUYA 4RCCA 2LQNA 3GNGA 2IIMA 2GBQA 1TTHB 2FHDA 4LD6A 5LJ5j 3RKWA 4HVUA 2YUNA 3H9NA 2VXEA 2P0QA 5CIUA 3CC7T 4DEYA 4FL6A 3HP9A 3H0HA 2OTJA 3WXMB 2YDLA 1PKSA 2X9HA 2CZ6B 2C06A 4C0ZA 2YRVA 2O88A 3M0QA 1NBEB 1BI0A 1VQLA 2COYA 5IXBA 1YITT 2HQHA 5ECAA 3HL8A 2CREA 3OYGA 3T9NA 1K76A 4OMLA 2GFAA 4GY5A 3V7RA 1M1KU 1YI2Q 1ZSZB 3AT1B 1H92A 3DLLA 3JCMW 2EBPA 4M78F 3X24B 4EMHA 4C92C 2H3EB 2JS0A 2ED1A 2XG8D 3PVQA 1VQMA 1G3SA 1W4SA 4J9IA 1ZLMA 1QVGP 3MEAA 5J26A 4JRKA 5KCHA 4C0DB 1WQWA 2F5KA 2NUTB 3JSCA 1Q95G 3H0FA 1UE9A 2E3HA 2VASA 1VQ6Q 2ZAEA 2D1XA 1CKBA 1D0XA 1W2BA 4BY6C 1T3LA 1VYVA 3V8KA 4LDXA 2C0IA 5CKDA 5LJ3g 1TUDA 1JO8A 4JUVA 2M1HA 3VS0A 1KQSS 3MCAB 1YBYA 4AFZC 1CSKA 2QEXT 4M75C 2HDAA 1OQKA 3CCQQ 2P4RA 3VYHB 1FWZA 4AFQC 1BIAA 2BIVA 4AMCA 3EFOA 1YJWT 4KGXB 4MZPA 1U5SA 3SEMA 5HY6A 3CCRT 2LP5A 2R5AA 3OYIA 1K0SA 4BUGA 1SPKA 3C0CA 1ZQ1A 1W1FA 3CCSA 3NTKA 2YUPA 2CH4W 4DA4A 2DEUA 2NUZA 3CMAQ 1K73U 1UB4A 1NJIR 4F04B 3JB9H 1HYOA 2QA4Q 5CVIA 3CMEQ 3CCLQ 3CEYA 2KMTA 1OPLA 1YWPA 4Y28E 1CKAA 1Y7XA 2RJEA 1XJWB 2ZPGB 3EG3A 1AWOA 3VS7A 3CCJQ 3X26B 1QCFA 1I5OB 5GAMj 2QAZA 2RK2A 2JXBA 1QP2A 4LE9A 2KQWA 1TXQA 1U1TA 4Q5WA 3PIPA 1SSFA 4HT8A 3VU3C 3INZA 3NTHA 4BD3A 1JB0E 3EAEA 5I11A 1G83A 2QTXA 3LGLA 3QZ9B 3AHUA 2K3BA 2O9VA 2CT3A 4NS5A 4EDUA 3CCET 1Q86U 4A4EA 1PG5B 3O5ZA 2D6FA 1JQQA 1MGQA 4OF1A 5IT9E 1VQKQ 3PMIA 4FM4B 1F1BB 2V1QA 3I56T 1GL5A 3I5SA 6AT1B 3CC4Q 2CGHA 2KT1A 3V7SA 5IHIA 4ZN1A 1OX8A 4OGEA 2K4YA 5FWCA 1ZSZA 2KXCA 2KRMA 2K7AA 1JRIA 5I2MA 1BCOA 2PQWA 1QLYA 3CCUA 5GJVB 2YLCA 5LJ3e 2JM9A 3OYBA 2ED0A 2BZXA 3CC2Q 1UJ0A 2CP3A 4M78D 1FMKA 1VYTA 3H6ZA 2RJCA 4J8OA 1M3BA 5GMKe 3G4SQ 4PFOA 3QWYA 1BU1A 2NUTA 2XMFA 4HXJA 2JTFA 3M4YA 1PD0A 5GANg 1QKXA 2CDTA 1I8FA 2DBMA 3JCMQ 2BUDA 4PJOC 3CCVA 2E6ZA 3CPWA 5IHNA 5GAMe 4PNOA 2VXFA 3TQ7P 1BI3A 1WXTA 1Y07A 1IHWA 2JZ2A 2COWA 4MZTA 5J3BA 4IURA 5I2SA 2GTOA 3G6EA 4N4IA 3FJPA 4OP0A 1W6XA 2IVWA 2O9SA 4ZGJB 5LJ5h 1DJ7B 5IXFA 2QA4T 5FLXE 2M9UA 3G1JA 4KH1B 2OTJQ 3CCLT 3QYGB 2LMJA 5A0LA 2E65A 1LPLA 1M90C 5GAN5 2DILA 3ZL7C 2KYMA 2CUBA 3S3MA 2CP6A 3CCJT 1N8RC 4C92G 4BDYA 4PJJA 4LDYA 2XU8A 4JPBW 4C92B 5LJ5d 5CO7A 2JTMA 2P84A 3QXEB 4JZ3A 4FW1A 1IZ6A 3QJ6A 2E1HA 1H8KA 5LL6S 1YHQA 1PCXA 1NE8A 2CT4A 1AOJA 1EX4A 2EYWA 1VQ9Q 3BDUA 1UJYA 4PFPA 3ZEHA 4CRIA 1IGQA 3CXCA 1VQMQ 2DF6A 2HBWA 4ZGDB 4OVAA 3CC4T 5KE2A 2DVEA 2RMOA 3SFMA 3SD4A 4C5IA 4M75G 1UDLA 3GPLA 4E7KA 1M3AA 2YWWA 2DL7A 5GAOn 2DD5A 3GNFB 4II1A 3QPHA 1VQ4A 2PVOB 1I5LA 3LW5E 4M75B 2GQIA 8ATCB 2K2VA 4C0GA 4PL6A 2GF7A 2EJFA 4NL3A 1Q81C 1NM7A 1I4K1 2WSFE 5DY9A 3JRZA 1EFNA 2PUKB 2D8JA 3OS0A 2DTIA 1K8AR 4XAXB 1YI2A 1KD1C 4M77F 3CC2T 3PE0A 1BBZA 4M7DF 3NTIA 3D7SB 3G4ST 4OMFB 1E6GA 2DXTA 2X4YA 4TVRA 2JTEA 3ER0A 1V76A 1QWEA 3I9QA 2DTHA 2IG0A 4XU1A 2K3YA 1JXOA 4C8QF 4GLMA 4EIKA 3VUBA 5I22A 3JCMf 3META 4J7IA 3MEUA 4OB0B 1SHFA 2K5FA 4FU6A 3KUFA 2RQWA 2DM1A 3MO8A 4XTWA 2AZSA 2MIOA 4A4FA 1IRXA 2CZ0B 5HCKA 1WIEA 5D6YA 1WQ7A 2G6FX 1RAIB 3CBMA 1VQ6A 1NLOC 1WHGA 3HKSA 2X3WD 1M1FA 1V1CA 2CP2A 4B9XA 1VQOQ 2JUFA 2YT6A 2RQVA 3M56A 3SHWA 4F14A 1IREB 1BI2A 2OTJT 4K11A 1C6VX 3V8JA 2MPXC 2DL3A 5FRMA 2VYTA 3CCQA 5KYYB 3UATA 2NLUA 4J9GA 3NFCA 1QKWA 1VQLT 2RHIA 2K5IA 2DK3A 4ATOA 1U8RA 1MV3A 1MNEA 3HPWA 3C94A 4OMNA 5GAMh 1TH7A 2GFUA 3I35A 2L5QA 2X4XA 3HRSA 1Q7YR 4Y92A 2F2XA 1H641 2WSCE 1AZEA 1ZBXA 4IUQA 3I5RA 2X4JA 2DXCA 3TEEA 4F7UF 2YUOA 1UUEA 1SRLA 2L3SA 1VQMT 3CMAA 3CPWP 4D6WA 1S72A 3KXTA 3VYGA 1M2OA 1KFZA 2AIRB 2BKDN 1ZX6A 1QVGS 2HQXA 3MPUB 3P8HA 4FW2A 3CMEA 4C92A 2OAWA 5CKFA 2EQUA 2RM4A 2RI2A 2OTLQ 4M78E 3M54A 4NL2A 1BKBA 3MP8A 2EYZA 1JEGA 1T0HA 2DKGA 3RERA 1D3BB 2MYSA 4BACA 2ZPBB 3CCUQ 1SRMA 3JCMJ 1Y0MA 2KR3A 4O6JA 4C5HA 4PJOG 2DLPA 2HEQA 1VQ8Q 2MWOA 2QDLA 5M9OA 1WI7A 4PJOB 1Q82R 1PM3A 1MV0B 1G3WA 1M1GA 4RG8A 3MP1A 2DTOA 2MMPA 1K9AA 2RA2A 3HHTB 2O4XB 2JNGA 1TS9A 4XTUA 4ZNXA 1K1ZA 4M75A 1WHKA 4L59A 4C92E 1VQKA 2QK0A 1LCKA 3HRTA 1D0ZA 3CCVQ 5FRNA 1EZZB 1N6AA 1OU9A 2SRCA 3H41A 3CCST 5FU6B 2DFUA 3M59A 5GAOl 3OSVA 3CXCP 3PT9A 2MI6A 3QDRB 3OQ5A 3KFVA 4ZN3A 2YUQA 1OEBA 1M90U 1TSFA 1K4US 3OW2P 4M77D 1I1JA 3M0SA 1D1CA 4M7DD 4DBHA 1Y96B 1N8RU 4IKFA 3TU4K 1OU8A 2LTOA 5LJ5g 5GAOm 1QCOA 2G3RA 1IO6A 1RLQC 5IAYA 4B6MA 3PGGA 4XTZA 2ZPFB 4C8QD
chains in the Genus database with same CATH topology
1ZBJA 3SEMA 1U5SA 2LP5A 1YWOA 3M0UA 5FWBA 1G2BA 1GBRA 4AG2C 1K0SA 2EGCA 1SPKA 3C0CA 1W1FA 2FO0A 4RTXA 2BZYA 2FPEA 2VKNA 4AFSC 1UHFA 2YUPA 2CH4W 2ENMA 2KE9A 3TVTA 3VS5A 1X2KA 2NUZA 1PHTA 1SSHA 2LX7A 1E6HA 2RQUA 1JU5C 2FPDA 1J3TA 2M51A 1B3QA 3VRYA 2RF0A 2FRYA 1WFWA 2JT4A 4Z8AA 1I0CA 2J05A 3R6NA 1OPLA 1YWPA 1CKAA 3EHRA 2K79A 3EG3A 1AWOA 2YSQA 1OV3A 2FPFA 3VS7A 2D8HA 2ESWA 1QCFA 4Z89A 2E5KA 4HCKA 2RN8A 2JXBA 4HVWA 4LE9A 4CC3A 2ROTA 2B86A 4M4ZA 1TG0A 4AFUC 4RTWA 2LNHB 1X6BA 2DYBA 1WXBA 5I11A 4CC2A 1GFCA 3REBB 4WCIA 2K6DA 1G83A 1YP5A 4A63B 2K3BA 2O9VA 1ZUUA 2CT3A 2FEIA 4CC4B 2I0NA 3O5ZA 4LUEA 1WDXA 1GFDA 3ULRB 2X3XD 1JQQA 1RUWA 1Z9QA 2LJ3A 3NPFA 4J9EA 2V1QA 1GL5A 3RBBB 3I5SA 2JW4A 3PVLA 2KT1A 5IHIA 2L0AA 1GRIA 1NEBA 1PRMC 2CH4A 3TSWA 2EQIA 5FWCA 1AVZC 2KXCA 1X43A 2KRMA 2K7AA 2FRWA 4GBQA 4J9CA 2HCKA 2BZ8A 1QLYA 4RTYA 2PNIA 5GJVB 2JM9A 4LN2A 4DEXA 3VRZA 2GGRA 2NWMA 3M0TA 2ED0A 2GTJA 2BZXA 2EGAA 1UHCA 1UJ0A 1FMKA 1RI9A 1VYTA 1VA7A 1M3BA 2L3QA 1X27A 2DMOA 3QWYA 1BU1A 4IIMA 1WLPB 2XMFA 4HXJA 4RTZA 1ARKA 2KEAA 1YNZA 1K0XA 2CUDA 1AWXA 1QKXA 2CDTA 1A0NB 2DBMA 2DL4A 1YN8A 4ORZA 3U23A 1M8MA 5IHNA 1OOTA 2KXDA 2EPDA 4RTVA 1WXTA 2KRNA 2W10A 2LJ1A 1NG2A 4E6RA 2DNUA 2GTOA 2W0ZA 4LUDA 2CSIA 3VS3A 1W6XA 1UTIA 2O9SA 1NEGA 5IXFA 1HJDA 1ABOA 1HSQA 2SEMA 3QWXX 2PTKA 3NMZC 2LMJA 2M0YA 3EHQA 4OMQA 2DRMA 2AK5A 1AEYA 2DILA 3ZL7C 2KYMA 2CUBA 2F2VA 1BB9A 1U3OA 2CSQA 2KROA 2L3PA 4RTUA 1MUZA 3EG0A 1M30A 3LH5A 2A37A 4JPBW 4X1VA 1PWTA 2KGTA 1GBQA 3EG2A 2F2WA 4JZ3A 1H3HA 2A36A 1BK2A 2DJQA 1H8KA 2DL5A 1SHGA 2RPNA 3CQTA 5L23A 2EYWA 2CT4A 1AOJA 1UJYA 2RQTA 1WA7A 2BTTA 1ABQA 2J6FA 2L2PA 1SEMA 2LCSA 2DF6A 2JMAA 4F17A 2HBWA 2MOXA 2A28A 1PKTA 2RMOA 1UDLA 1OPKA 2EW3A 1M3AA 4J9BA 1B07A 2DL7A 2AKKA 1KJWA 1N5ZA 4CC7A 2EYXA 4ESRA 2GQIA 1JXMA 2K9GA 2EKHA 2DRKA 2V1RA 3M0PA 1NM7A 2C0OA 4J9HA 1EFNA 2D8JA 2ECZA 3M0RA 3NGPA 4KRTA 4AG1C 3PE0A 1KSWA 1BBZA 2JS2A 4D8DA 2OI3A 1VYUA 1X6GA 1UFFA 2VVKA 1E6GA 3VS1A 2JTEA 3REAB 4JJCA 1QWEA 4JJDA 4D8KA 3I9QA 1M27C 2LQWA 5EC7A 1JXOA 1T3SA 5IHKA 4GLMA 2KT8A 3TSZA 4EIKA 4OMMA 1RLPC 3UA6A 5I22A 1AWJA 1AD5A 1SHFA 2RQWA 1I07A 2DM1A 2AZSA 2MIOA 1U06A 2EYYA 3FJ5A 1PNJA 1T0JA 2LJ0A 1TUCA 1GCQA 1FYNA 5HCKA 1UG1A 1WIEA 2K2MA 2J06A 4J9FA 4FSSA 1NYFA 2G6FX 1NLOC 2X3WD 1V1CA 2RNAA 3VS2A 2DBKA 4QT7A 3UF4A 2YT6A 2RQVA 3SHWA 2RQRA 4F14A 4HVVA 4J9DA 1S1NA 3VS6A 4K11A 2LZ6B 3IQLA 2A08A 3THKA 2DL3A 4Z88A 3UATA 1GCQC 4J9GA 1QKWA 1GCPA 3EGUA 2JMCA 1UECA 3RNJA 1MV3A 4OMOA 4OMNA 2PZ1A 2KBTA 3I35A 2DL8A 1ZUYA 2D0NA 2LQNA 4Y92A 2F2XA 2IIMA 2GBQA 5GJWB 1AZEA 1WYXA 1KIKA 2OJ2A 1ZUKA 1NLPC 4RTTA 3I5RA 4HVUA 2YUNA 1AWWA 1M3CA 2YUOA 1UUEA 1SRLA 2GNCA 2L3SA 2DVJA 4F16A 4DEYA 3EG1A 3H0HA 1KFZA 1ZX6A 2YDLA 4JZ4A 1PKSA 5IH2A 1QWFA 1UGVA 1E7OA 4IIOA 1X2QA 1HD3A 1W70A 2O88A 2OAWA 3M0QA 2ABLA 2AKLA 5IXBA 1WX6A 5ECAA 2CREA 2EYZA 1PRLC 1AZGB 2O31A 5FW9A 2MCNA 1JEGA 1K76A 1T0HA 1XOVA 4OMLA 2HSPA 3H0IA 2DA9A 2ROLA 1SRMA 1Y0MA 2KR3A 3GBQA 1Z9ZA 1YCSB 2DLPA 2HEQA 1H92A 1WXUA 2QDLA 4RUGA 2KYBA 2DX1A 2EBPA 1WI7A 2KRSA 2AZVA 2JS0A 2ED1A 3NHNA 4JJBA 1MV0B 3PVQA 4LNPA 2DE0X 4J9IA 1ZLMA 1K9AA 1NYGA 2C0TA 4ZNXA 1K1ZA 1LCKA 2EVRA 4R0KA 3H0FA 1UE9A 1X69A 3UA7A 2SRCA 3H41A 2FG0A 2D1XA 1CKBA 3A98A 3JV3A 2KNBB 1T3LA 1VYVA 3KFVA 2C0IA 2H8HA 2YUQA 1OEBA 1TUDA 1JO8A 3VS0A 1Y57A 1K4US 2O2OA 1ZSGA 1I1JA 3M0SA 3VS4A 2J7IA 4AFZC 2VWFA 1CSKA 2J6KA 2HDAA 2P4RA 2EGEA 1IO6A 4AFQC 1RLQC 2JM8A 2J6OA 4OMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBJ A;  3SEM A;  1U5S A;  2LP5 A;  1YWO A;  3M0U A;  5FWB A;  1G2B A;  1GBR A;  4AG2 C;  1K0S A;  2EGC A;  1SPK A;  3C0C A;  1W1F A;  2FO0 A;  4RTX A;  2BZY A;  2FPE A;  2VKN A;  4AFS C;  1UHF A;  2YUP A;  2CH4 W;  2ENM A;  2KE9 A;  3TVT A;  3VS5 A;  1X2K A;  2NUZ A;  1PHT A;  1SSH A;  2LX7 A;  1E6H A;  2RQU A;  1JU5 C;  2FPD A;  1J3T A;  2M51 A;  1B3Q A;  3VRY A;  2RF0 A;  2FRY A;  1WFW A;  2JT4 A;  4Z8A A;  1I0C A;  2J05 A;  3R6N A;  1OPL A;  1YWP A;  1CKA A;  3EHR A;  2K79 A;  3EG3 A;  1AWO A;  2YSQ A;  1OV3 A;  2FPF A;  3VS7 A;  2D8H A;  2ESW A;  1QCF A;  4Z89 A;  2E5K A;  4HCK A;  2RN8 A;  2JXB A;  4HVW A;  4LE9 A;  4CC3 A;  2ROT A;  2B86 A;  4M4Z A;  1TG0 A;  4AFU C;  4RTW A;  2LNH B;  1X6B A;  2DYB A;  1WXB A;  5I11 A;  4CC2 A;  1GFC A;  3REB B;  4WCI A;  2K6D A;  1G83 A;  1YP5 A;  4A63 B;  2K3B A;  2O9V A;  1ZUU A;  2CT3 A;  2FEI A;  4CC4 B;  2I0N A;  3O5Z A;  4LUE A;  1WDX A;  1GFD A;  3ULR B;  2X3X D;  1JQQ A;  1RUW A;  1Z9Q A;  2LJ3 A;  3NPF A;  4J9E A;  2V1Q A;  1GL5 A;  3RBB B;  3I5S A;  2JW4 A;  3PVL A;  2KT1 A;  5IHI A;  2L0A A;  1GRI A;  1NEB A;  1PRM C;  2CH4 A;  3TSW A;  2EQI A;  5FWC A;  1AVZ C;  2KXC A;  1X43 A;  2KRM A;  2K7A A;  2FRW A;  4GBQ A;  4J9C A;  2HCK A;  2BZ8 A;  1QLY A;  4RTY A;  2PNI A;  5GJV B;  2JM9 A;  4LN2 A;  4DEX A;  3VRZ A;  2GGR A;  2NWM A;  3M0T A;  2ED0 A;  2GTJ A;  2BZX A;  2EGA A;  1UHC A;  1UJ0 A;  1FMK A;  1RI9 A;  1VYT A;  1VA7 A;  1M3B A;  2L3Q A;  1X27 A;  2DMO A;  3QWY A;  1BU1 A;  4IIM A;  1WLP B;  2XMF A;  4HXJ A;  4RTZ A;  1ARK A;  2KEA A;  1YNZ A;  1K0X A;  2CUD A;  1AWX A;  1QKX A;  2CDT A;  1A0N B;  2DBM A;  2DL4 A;  1YN8 A;  4ORZ A;  3U23 A;  1M8M A;  5IHN A;  1OOT A;  2KXD A;  2EPD A;  4RTV A;  1WXT A;  2KRN A;  2W10 A;  2LJ1 A;  1NG2 A;  4E6R A;  2DNU A;  2GTO A;  2W0Z A;  4LUD A;  2CSI A;  3VS3 A;  1W6X A;  1UTI A;  2O9S A;  1NEG A;  5IXF A;  1HJD A;  1ABO A;  1HSQ A;  2SEM A;  3QWX X;  2PTK A;  3NMZ C;  2LMJ A;  2M0Y A;  3EHQ A;  4OMQ A;  2DRM A;  2AK5 A;  1AEY A;  2DIL A;  3ZL7 C;  2KYM A;  2CUB A;  2F2V A;  1BB9 A;  1U3O A;  2CSQ A;  2KRO A;  2L3P A;  4RTU A;  1MUZ A;  3EG0 A;  1M30 A;  3LH5 A;  2A37 A;  4JPB W;  4X1V A;  1PWT A;  2KGT A;  1GBQ A;  3EG2 A;  2F2W A;  4JZ3 A;  1H3H A;  2A36 A;  1BK2 A;  2DJQ A;  1H8K A;  2DL5 A;  1SHG A;  2RPN A;  3CQT A;  5L23 A;  2EYW A;  2CT4 A;  1AOJ A;  1UJY A;  2RQT A;  1WA7 A;  2BTT A;  1ABQ A;  2J6F A;  2L2P A;  1SEM A;  2LCS A;  2DF6 A;  2JMA A;  4F17 A;  2HBW A;  2MOX A;  2A28 A;  1PKT A;  2RMO A;  1UDL A;  1OPK A;  2EW3 A;  1M3A A;  4J9B A;  1B07 A;  2DL7 A;  2AKK A;  1KJW A;  1N5Z A;  4CC7 A;  2EYX A;  4ESR A;  2GQI A;  1JXM A;  2K9G A;  2EKH A;  2DRK A;  2V1R A;  3M0P A;  1NM7 A;  2C0O A;  4J9H A;  1EFN A;  2D8J A;  2ECZ A;  3M0R A;  3NGP A;  4KRT A;  4AG1 C;  3PE0 A;  1KSW A;  1BBZ A;  2JS2 A;  4D8D A;  2OI3 A;  1VYU A;  1X6G A;  1UFF A;  2VVK A;  1E6G A;  3VS1 A;  2JTE A;  3REA B;  4JJC A;  1QWE A;  4JJD A;  4D8K A;  3I9Q A;  1M27 C;  2LQW A;  5EC7 A;  1JXO A;  1T3S A;  5IHK A;  4GLM A;  2KT8 A;  3TSZ A;  4EIK A;  4OMM A;  1RLP C;  3UA6 A;  5I22 A;  1AWJ A;  1AD5 A;  1SHF A;  2RQW A;  1I07 A;  2DM1 A;  2AZS A;  2MIO A;  1U06 A;  2EYY A;  3FJ5 A;  1PNJ A;  1T0J A;  2LJ0 A;  1TUC A;  1GCQ A;  1FYN A;  5HCK A;  1UG1 A;  1WIE A;  2K2M A;  2J06 A;  4J9F A;  4FSS A;  1NYF A;  2G6F X;  1NLO C;  2X3W D;  1V1C A;  2RNA A;  3VS2 A;  2DBK A;  4QT7 A;  3UF4 A;  2YT6 A;  2RQV A;  3SHW A;  2RQR A;  4F14 A;  4HVV A;  4J9D A;  1S1N A;  3VS6 A;  4K11 A;  2LZ6 B;  3IQL A;  2A08 A;  3THK A;  2DL3 A;  4Z88 A;  3UAT A;  1GCQ C;  4J9G A;  1QKW A;  1GCP A;  3EGU A;  2JMC A;  1UEC A;  3RNJ A;  1MV3 A;  4OMO A;  4OMN A;  2PZ1 A;  2KBT A;  3I35 A;  2DL8 A;  1ZUY A;  2D0N A;  2LQN A;  4Y92 A;  2F2X A;  2IIM A;  2GBQ A;  5GJW B;  1AZE A;  1WYX A;  1KIK A;  2OJ2 A;  1ZUK A;  1NLP C;  4RTT A;  3I5R A;  4HVU A;  2YUN A;  1AWW A;  1M3C A;  2YUO A;  1UUE A;  1SRL A;  2GNC A;  2L3S A;  2DVJ A;  4F16 A;  4DEY A;  3EG1 A;  3H0H A;  1KFZ A;  1ZX6 A;  2YDL A;  4JZ4 A;  1PKS A;  5IH2 A;  1QWF A;  1UGV A;  1E7O A;  4IIO A;  1X2Q A;  1HD3 A;  1W70 A;  2O88 A;  2OAW A;  3M0Q A;  2ABL A;  2AKL A;  5IXB A;  1WX6 A;  5ECA A;  2CRE A;  2EYZ A;  1PRL C;  1AZG B;  2O31 A;  5FW9 A;  2MCN A;  1JEG A;  1K76 A;  1T0H A;  1XOV A;  4OML A;  2HSP A;  3H0I A;  2DA9 A;  2ROL A;  1SRM A;  1Y0M A;  2KR3 A;  3GBQ A;  1Z9Z A;  1YCS B;  2DLP A;  2HEQ A;  1H92 A;  1WXU A;  2QDL A;  4RUG A;  2KYB A;  2DX1 A;  2EBP A;  1WI7 A;  2KRS A;  2AZV A;  2JS0 A;  2ED1 A;  3NHN A;  4JJB A;  1MV0 B;  3PVQ A;  4LNP A;  2DE0 X;  4J9I A;  1ZLM A;  1K9A A;  1NYG A;  2C0T A;  4ZNX A;  1K1Z A;  1LCK A;  2EVR A;  4R0K A;  3H0F A;  1UE9 A;  1X69 A;  3UA7 A;  2SRC A;  3H41 A;  2FG0 A;  2D1X A;  1CKB A;  3A98 A;  3JV3 A;  2KNB B;  1T3L A;  1VYV A;  3KFV A;  2C0I A;  2H8H A;  2YUQ A;  1OEB A;  1TUD A;  1JO8 A;  3VS0 A;  1Y57 A;  1K4U S;  2O2O A;  1ZSG A;  1I1J A;  3M0S A;  3VS4 A;  2J7I A;  4AFZ C;  2VWF A;  1CSK A;  2J6K A;  2HDA A;  2P4R A;  2EGE A;  1IO6 A;  4AFQ C;  1RLQ C;  2JM8 A;  2J6O A;  4OMP A; 
#chains in the Genus database with same CATH topology
 5D7U A;  4M75 E;  1MND A;  3A5Z B;  2H3J A;  2QQ9 A;  3ZBD A;  3M0U A;  5FWB A;  3QKJ A;  3RUX A;  3JCM c;  2EGC A;  4QKU A;  4E7Z A;  4FYV B;  4BDZ A;  1YFN A;  1FX7 A;  4RTX A;  2FPE A;  2VKN A;  4XTX A;  4DQ2 A;  2FVU A;  1X2K A;  2P4T A;  1YHQ Q;  1PHT A;  3G7Z A;  1E6H A;  2A7Y A;  4FYX B;  4P5N A;  5KYY A;  2YRC A;  3BE3 A;  4Z8A A;  1KHI A;  1KG1 A;  3OYD A;  4N4H A;  1Q81 U;  3R6O A;  4M78 C;  1RAF B;  5GAN 6;  3L42 A;  3G71 Q;  3Q1J A;  1VQ4 Q;  4HCK A;  5GAN 4;  2GCX A;  3O8V A;  4HVW A;  4CC3 A;  1KD1 U;  4AFU C;  3MP6 A;  1UGR B;  4DOW A;  3CCU T;  2CYZ B;  1GFC A;  3REB B;  4WCI A;  1G3Y A;  2K6D A;  4A63 B;  1UGP B;  3VJP A;  5HK3 A;  4LDV A;  2FEI A;  1NZ9 A;  2QTV A;  1HXD A;  4CC4 B;  7AT1 B;  1QVF S;  4LUE A;  1WDX A;  1RUW A;  4BE0 A;  1VQ9 A;  1B34 B;  2LJ3 A;  2HD0 A;  2Y90 A;  3RMQ A;  3A8H B;  1TOV A;  3VV0 A;  3BDL A;  1M5Q 1;  3JB9 F;  4O5V A;  1FMW A;  3P8B B;  3ME9 A;  3CCV T;  2ATC B;  1NEB A;  1D3B A;  2CH4 A;  2YXY A;  3TSW A;  2FYK A;  2JOY A;  1AVZ C;  4DBF A;  1X43 A;  3MJX A;  2FRW A;  2FZC B;  4N4G A;  4J9C A;  3X20 B;  2BZ8 A;  2QG9 B;  4RTY A;  3G6E T;  4PJO A;  5GAN 2;  2NYS A;  1UHC A;  4R55 A;  2CZ1 B;  3BW1 A;  1NPP A;  5LJ5 e;  3GF5 A;  1KQS A;  2O4X A;  2LC4 A;  2DMO A;  2CKK A;  1ARK A;  3OYH A;  2CUD A;  4R56 A;  5A2Q E;  1A0N B;  1ZA2 B;  1M90 R;  4ORZ A;  4CI0 C;  1OOT A;  5GAN 8;  3M53 A;  4RTV A;  1AHJ B;  1N8R R;  4M7A F;  1YJN A;  5GAM g;  3S3O A;  1Y96 A;  4PJO E;  5CKH A;  1YHQ T;  2QQB A;  4EPC A;  1VQP Q;  3SDZ A;  3N5B B;  1NEG A;  2V8I A;  4E7J A;  2AHJ B;  2DEQ A;  1VQO A;  1S72 Q;  3E9G A;  3NMZ C;  3PIO A;  1QCN A;  2GQV A;  4IUP A;  3C95 A;  1RAH B;  1AEY A;  2F2V A;  4E7S A;  4M77 A;  1U3O A;  5GAO q;  1VQ4 T;  4RTU A;  5KCO A;  3LH5 A;  1PWT A;  1VQ5 A;  2XID A;  5AYF A;  4KUI A;  1ACM B;  1H3H A;  2A36 A;  2K5L A;  1BCM A;  1BK2 A;  3M57 A;  2QGG A;  1YI2 T;  2LDM A;  3JCM d;  1WGS A;  3KBG A;  5AT1 B;  1KC8 U;  1Q81 R;  1M8V A;  2FB7 A;  2RQT A;  4X9C A;  2XKO C;  1X6O A;  2PVD B;  2J6F A;  3RIR A;  2VC8 A;  4KH0 B;  3A8L B;  3A8G B;  3JCM P;  2FZG B;  2JMA A;  3JCM X;  3CD6 A;  3OYC A;  2DIQ A;  3L2R A;  4V2S A;  3QYH B;  1SG5 A;  2A28 A;  1PKT A;  3PMT A;  4M77 E;  1OPK A;  1QQJ A;  4J9B A;  3GLX A;  3RES A;  3L2Z A;  1KJW A;  1M1K R;  1PD1 A;  3OYY A;  3OYE A;  4E7L A;  3V7C A;  2DRK A;  2RK1 A;  3FB9 A;  2OTL A;  1VQ6 T;  3EGD B;  3EG9 B;  2DET A;  3NGP A;  4AG1 C;  5GAN 3;  2XHC A;  1H3Z A;  1B34 A;  2BE9 B;  2OAU A;  2QAS A;  5GAO p;  1YCY A;  1VQ8 A;  3HSB A;  3OS2 A;  2QGF B;  3TCJ A;  4JJC A;  4BE1 A;  3CCQ T;  5GAN f;  4JJD A;  4WTO B;  2R57 A;  4X34 A;  3JB9 D;  2ZPE B;  3RMS A;  4JRQ A;  1U06 A;  2EYY A;  4LXC A;  4XU3 A;  1UG1 A;  1R77 A;  2J06 A;  2XIC A;  5KH6 A;  4FSS A;  2E6N A;  4M78 G;  3L2V A;  2ZPH B;  3CPF A;  2VGM A;  4M78 B;  3LX7 A;  2DBK A;  4DBQ A;  3L2Q A;  2RQR A;  3CCM A;  1S72 T;  3CMA T;  1LJO A;  2LZ6 B;  3MEV A;  3CME T;  5FU6 C;  3QII A;  3A8O B;  3EGU A;  4F7U E;  2B8A A;  1RAC B;  1W2B P;  4JRI A;  4DBR A;  3X28 B;  2RB6 A;  4M7A D;  2KBT A;  4BE2 A;  2DIG A;  5CCA A;  1WJQ A;  1K73 R;  1WYX A;  2MWP A;  1ZUK A;  1NLP C;  1AWW A;  1M9S A;  1M3C A;  4F16 A;  3EG1 A;  3OYJ A;  4M7A G;  5CKE A;  2XDB A;  4JZ4 A;  4XQ3 A;  5IH2 A;  1QWF A;  4M77 C;  1E7O A;  3OYA A;  3MHX A;  4M7A B;  4IIO A;  5C6S A;  2P0K A;  2WSE E;  1VQK T;  1WZO A;  2BE7 D;  2ABL A;  2E12 A;  1QP3 A;  4FCY A;  3X25 B;  3G71 A;  1PRL C;  1AZG B;  1NJI C;  5FW9 A;  4C8Q C;  4Z02 A;  2DA9 A;  2EFI A;  1JJ2 S;  2XK0 A;  1R0C B;  1YCS B;  1Q86 R;  1IGU A;  4PLL A;  1YJ9 Q;  1WXU A;  2NUP B;  5J39 A;  4RUG A;  2DX1 A;  1LVK A;  3QJY A;  2HKQ B;  3NHN A;  4JJB A;  2DE0 X;  4PJM A;  2Y4X A;  1NYG A;  4JLG A;  2C0T A;  3FIF A;  4OB3 B;  2HBP A;  2O01 E;  2QI2 A;  1VUB A;  2EYQ A;  4R0K A;  1TWB A;  3QO3 A;  1X69 A;  1AT1 B;  3UA7 A;  3EGD A;  3EG9 A;  3A8M B;  3A98 A;  1RAB B;  4MZM A;  1YJN Q;  3JV3 A;  3GIB A;  3SWN B;  3HFN A;  2KNB B;  1KK7 A;  1MHN A;  1MMD A;  3MKD A;  3PTA A;  1B7T A;  5FRO A;  3VS4 A;  1G5V A;  2VWF A;  3UT1 A;  2J6K A;  4E7I A;  4ZTJ A;  4HCC A;  2X51 A;  2JM8 A;  3JCM V;  3UDC A;  4C5E A;  4OMP A;  1OI1 A;  2LRQ A;  1YIJ A;  2YHT A;  2QQA A;  3UPU A;  3L1A A;  2HAX A;  1WHM A;  1C1A A;  1VQ5 Q;  1IB8 A;  4KUD K;  2M02 A;  2FO0 A;  4DOV A;  4M78 A;  2BZY A;  9ATC B;  1SKU B;  4AFS C;  1UHF A;  2HSE B;  4RCB A;  2ENM A;  2KE9 A;  3TVT A;  3VS5 A;  3OMC A;  2F69 A;  1JU5 C;  1J3T A;  1OZ3 A;  4QQ6 A;  1VQP A;  2RF0 A;  2FRY A;  2JT4 A;  1VQ9 T;  3OYN A;  1I0C A;  3CD6 Q;  2MK5 A;  1P92 A;  4C5G A;  2YSQ A;  1OV3 A;  2E5K A;  8AT1 B;  3OYK A;  1QVG A;  2RN8 A;  5D6X A;  2ROT A;  2EKO A;  2CP0 A;  4M4Z A;  2CZ7 B;  1TG0 A;  2EJ9 A;  2DYB A;  2QDY B;  3A1P A;  2DZ9 A;  1WPY A;  4CC2 A;  2X35 A;  1YP5 A;  1O9S A;  4MML A;  3CC7 Q;  1ZUU A;  5HK0 A;  5L8R E;  2I0N A;  1OYX A;  4M7A A;  2X3X D;  3H8Z A;  4A4K A;  4J9E A;  2JW4 A;  4JRP A;  1V29 B;  4A4G A;  2L3R A;  1KC8 C;  2EQI A;  1LOJ A;  1WHL A;  3PNW C;  1YJN T;  2VB6 A;  4GBQ A;  2NUP A;  3OSS C;  2PNI A;  2RD1 A;  1RAD B;  4QQG A;  3VRZ A;  2GGR A;  3RDV A;  5LJ5 f;  2EGA A;  4OB2 B;  2JVV A;  3DB4 A;  1VQO T;  4KGV B;  3CCM Q;  1RI9 A;  1WHH A;  2QQR A;  4A54 A;  1VA7 A;  3PFS A;  2L3Q A;  4M7A E;  1KQ2 A;  4IIM A;  1WLP B;  4J83 A;  2DXU A;  2LT4 A;  1YNZ A;  2HMA A;  1OUL A;  1AWX A;  3JCM e;  4LDU A;  3EFS A;  1K8A C;  3E19 A;  1YN8 A;  3SWN A;  1VQ5 T;  4YTL A;  2KXD A;  4M77 G;  2EPD A;  3J81 E;  2RJD A;  4M7D G;  4J6W A;  4N0A A;  2W10 A;  3OYM A;  2E10 A;  2LJ1 A;  4FT2 A;  4M77 B;  4M7D B;  1NG2 A;  4E6R A;  2DNU A;  2RHX A;  4LUD A;  5FU7 C;  2LQK A;  4MMK A;  1UTI A;  4OB1 B;  4C8Q G;  2Y4Y A;  1N27 A;  4HKE A;  1HJD A;  1KQ1 A;  4FIB A;  2DPP B;  4C8Q B;  3QWX X;  2M0Y A;  4OMQ A;  4RKU E;  3CD6 T;  1RI0 A;  1NJI U;  2DRM A;  2YLB A;  3RKY A;  3M58 A;  1VQ7 A;  2R58 A;  3CCR Q;  2AT1 B;  1BB9 A;  5DLQ E;  4QVC A;  2CSQ A;  1K9M C;  4BI4 A;  2JN0 A;  2L3P A;  4IUU A;  4X1V A;  2A37 A;  2OTL T;  3EG2 A;  2F2W A;  5GAN d;  2M0O A;  4QQD A;  1BI1 A;  4UC4 A;  2OX7 A;  2WAC A;  2RPN A;  3S6W A;  3CQT A;  4AT1 B;  5L23 A;  1BIB A;  1VQ8 T;  2FL7 A;  4XTY A;  2BTT A;  2RH2 A;  1ABQ A;  1UGS B;  1FMV A;  2L2P A;  1Q7Y C;  4F17 A;  3J7A F;  1QVF A;  3OYL A;  2MOX A;  1OZ2 A;  1I81 A;  2EW3 A;  2AKK A;  4CC7 A;  2COZ A;  2EYX A;  4ESR A;  3VUZ A;  5KYU A;  1JXM A;  2DZC A;  4HT9 A;  4F7U G;  2D0Q B;  1WJS A;  2EWN A;  2V1R A;  3QG1 A;  3DLM A;  4J9H A;  4F7U B;  4EMG A;  5LJ3 f;  2ECZ A;  3CCE Q;  3M0R A;  5KYN A;  4KRT A;  4IUV A;  2HL3 A;  3E2U A;  5KYW B;  4M7A C;  1KSW A;  3CCM T;  1VYU A;  1X6G A;  1YJ9 A;  1UFF A;  2VVK A;  3QZ5 B;  1KHC A;  1VOM A;  4ELY C;  5CAI A;  3I56 Q;  4ZGE B;  1WNL A;  2EJG A;  2KI7 A;  1M27 C;  3TSZ A;  1YIJ Q;  1RAE B;  3EGX B;  1AWJ A;  4XK8 E;  1W2B S;  4BB7 A;  3FJ5 A;  4WF2 A;  5GAM f;  2LX9 A;  1PNJ A;  4E7H A;  4PJN A;  2LJ0 A;  1TUC A;  2ZZD A;  4MDW A;  2DO3 A;  3UWN A;  1Q82 C;  1FYN A;  2K2M A;  4J9F A;  2HQE A;  1NYF A;  2LVM A;  2XDD A;  4C92 F;  2RNA A;  3VS2 A;  4HCZ A;  5I21 A;  1X01 A;  3DB3 A;  4HVV A;  4OGC A;  3QDF A;  1D1A A;  1S1N A;  3VS6 A;  3ZFJ A;  2JJ9 A;  1PSE A;  2A08 A;  3F70 A;  2LT1 A;  3V8L A;  1D09 B;  1G3T A;  4Z88 A;  3L2U A;  1GCQ C;  3BFM A;  3SWN C;  4ANJ A;  2MF2 A;  2ZCF B;  3JCM h;  1UEC A;  4N0A C;  3G71 T;  4A53 A;  5LJ3 j;  4M7D A;  2D0N A;  2DAQ A;  4EMK B;  2RHZ A;  4M75 F;  5GJW B;  1KIK A;  5C0M A;  2OJ2 A;  1VIF A;  5GMK j;  4RTT A;  2HKN A;  4C8Q A;  2CP5 A;  1VQN A;  3S3N A;  3HTR A;  4ZTF A;  1IXD A;  3FDR A;  2GNC A;  2KY9 A;  2RHY A;  1PC0 A;  2DVJ A;  3BY7 A;  3TRE A;  2CP7 A;  3I55 A;  1UGV A;  2P0P A;  1VIE A;  1X2Q A;  2LCL A;  1KD1 R;  4PKC C;  1HD3 A;  1W70 A;  4E47 A;  2AKL A;  1WX6 A;  3QHS A;  4L6V 5;  4M7D E;  2O31 A;  2MCN A;  5GMK i;  1XOV A;  3M5A A;  2HSP A;  3H0I A;  3EH2 A;  2ROL A;  3GBQ A;  1Z9Z A;  2XD0 A;  1RAG B;  2PU9 B;  2KYB A;  4C8Q E;  3OYF A;  1UEB A;  2E4H A;  2KRS A;  1K8A U;  3L2W A;  2AZV A;  3CC7 A;  4LNP A;  2ZGW A;  4ME7 A;  4C0F A;  1YIJ T;  4JJN K;  4ELZ C;  5FU7 B;  2EVR A;  1ZA1 B;  2X4W A;  3JCM b;  2E64 A;  3J80 E;  1WJR A;  1YIT A;  2DER A;  4F7U A;  2FG0 A;  3MEW A;  2VGN A;  1RL2 A;  1D0Y A;  2QXF A;  3LWI A;  2KDS A;  5KYW A;  3SB2 A;  2H8H A;  5D6W A;  5A0D A;  1FXX A;  1Y57 A;  1QVF P;  2O2O A;  1ZSG A;  2F1L A;  3FLG A;  2J7I A;  1K9M U;  4E2F B;  3JB9 G;  1VQP T;  5EG2 A;  3M4G A;  2V8J A;  3P8D A;  1R0B G;  2VUB A;  1QW1 A;  2EGE A;  2PVG B;  5GAO r;  2EIF A;  3EGX A;  3E9F A;  4HCB A;  2J6O A;  1VQ7 Q;  3CPW S;  3GOX A;  2EQK A;  3QBY A;  2DJZ A;  1ZBJ A;  1YWO A;  1G2B A;  3GP8 A;  1GBR A;  4AG2 C;  1TUG B;  3VKI A;  5DLO A;  4FYY B;  3E1S A;  2DXB A;  2RJF A;  4C92 D;  1M2V B;  5GMK l;  2E41 A;  1KQS P;  1Q7Y U;  1TU0 B;  1SSH A;  2A0F B;  2LX7 A;  2RQU A;  2FPD A;  1WHJ A;  3JB9 I;  2M51 A;  1B3Q A;  3VRY A;  2QEX A;  1WFW A;  2KAF A;  5KYX B;  5GAN j;  5GMK m;  4KT0 E;  4PJO F;  1XTD A;  1QVP A;  3WVD B;  2J05 A;  3R6N A;  2DD4 A;  1VQL Q;  3EHR A;  2K79 A;  1YJW A;  2E70 A;  2FPF A;  4QVD A;  2D8H A;  2ESW A;  4M7D C;  4Z89 A;  4EMK A;  3CCR A;  2B86 A;  1OX9 A;  3M55 A;  4RTW A;  1XNI A;  1X75 C;  1N9S A;  2LNH B;  1X6B A;  4M75 D;  1KC8 R;  4QVZ A;  1WXB A;  3OA6 A;  3CXC S;  2EQJ A;  3URG A;  1JJ2 A;  4Y91 A;  1Y71 A;  4HA8 A;  3OW2 S;  4BY6 B;  3JAM E;  1IHV A;  3JB9 J;  3OW2 A;  1GFD A;  3ULR B;  5CQX A;  1Z9Q A;  1Q82 U;  3M9Q A;  3NPF A;  1XQH A;  4PFZ A;  1LNX A;  2KVQ G;  4PLI A;  3RBB B;  3PVL A;  2RHU A;  2L0A A;  1GRI A;  1PRM C;  4FT4 A;  2V8K A;  2XI9 A;  3OS5 A;  3OY9 A;  3RR6 A;  1R8O B;  2HCK A;  1NPR A;  4J6Y A;  4PJL A;  4LN2 A;  4DEX A;  2NWM A;  3LYI A;  3M0T A;  3LGF A;  2GTJ A;  3RKX A;  2K57 A;  5KE3 A;  1M4Z A;  3CCE A;  1JBM A;  1MMG A;  3LLR A;  2L8D A;  1X27 A;  1M1K C;  4BI3 A;  4GLK A;  5GAN e;  1VQ7 T;  4RTZ A;  4A4H A;  4B9W A;  2KEA A;  3OMG A;  1ZSZ C;  2L89 A;  1K0X A;  3I56 A;  3FC3 A;  3EH1 A;  4MDX A;  3LWH A;  1MMN A;  2DL4 A;  3CCS Q;  2LQ8 A;  3FEO A;  2KSS A;  1M8M A;  3U23 A;  3JCM g;  3C12 A;  4XU2 A;  1K9M R;  3HFO A;  2KRN A;  4JS4 A;  4KBM B;  5LJ3 h;  2ZPI B;  2W0Z A;  2DYI A;  4C0D C;  2CSI A;  3VS3 A;  1VQN Q;  1PSF A;  2MAM A;  5GMK h;  2E5Q A;  1BYM A;  1ABO A;  1HSQ A;  2SEM A;  4X9D A;  2PTK A;  3EHQ A;  3I55 Q;  1EIF A;  3QUI A;  2AK5 A;  2R5M A;  4BI8 B;  2I2L A;  5LJ3 d;  1O75 A;  5CKB A;  2KRO A;  3CBO A;  4FSX A;  2F5T X;  1MUZ A;  3EG0 A;  1M30 A;  1M2V A;  2HL5 C;  4VUB A;  3DKM A;  5A0G A;  2KGT A;  1GBQ A;  3OS1 A;  2DJQ A;  2DL5 A;  1UGQ B;  4LD9 K;  1SHG A;  5KYX A;  5KYU B;  1YJ9 T;  3C4S A;  2HNI A;  1WA7 A;  2YRD A;  5GAM d;  2IPO B;  2QA4 A;  3FRN A;  4PJO D;  1SEM A;  4IUT A;  2LCS A;  3CCL A;  2EAY A;  1RAA B;  4NOY A;  3ASK A;  5CQY A;  4EMK C;  4KGZ B;  1K73 C;  2LCC A;  2D9T A;  3CBP A;  4JS5 A;  4KUL A;  3CCJ A;  3LH0 A;  1B07 A;  2V26 A;  4J7F A;  1N5Z A;  1YIT Q;  2K9G A;  2RI3 A;  2EKH A;  5GAN 7;  1G8X A;  3M0P A;  4J5Y A;  2C0O A;  2Z0W A;  3OBY A;  2EQM A;  4XTV A;  2FZK B;  1U1S A;  2JS2 A;  4D8D A;  2OI3 A;  4JLI A;  3VS1 A;  2KK4 A;  3REA B;  5IN1 A;  4D8K A;  2LQW A;  5EC7 A;  1T3S A;  5IHK A;  2KT8 A;  4OMM A;  4LDW A;  1RLP C;  4PK4 A;  3UA6 A;  2VV5 A;  3CC4 A;  2XDP A;  1Q86 C;  1AD5 A;  2RI5 A;  2HZY A;  3EFO B;  1I07 A;  2E3I A;  1D1B A;  1JJ2 P;  1T0J A;  2M16 A;  1GCQ A;  4J6X A;  2CS7 A;  3G6E Q;  3OBW A;  2PUO B;  2A3L A;  2RO0 A;  1QMC A;  2K3X A;  4XU0 A;  1VQN T;  4QT7 A;  3UF4 A;  4RMO A;  5CR2 A;  3CC2 A;  2LNV A;  5DM7 R;  2QEX Q;  1HK9 A;  4J9D A;  3HRU A;  4JDS A;  3G4S A;  3EFR A;  1SF9 A;  4QW2 A;  1N9R A;  3IQL A;  3I55 T;  1GXI E;  2QQS A;  3THK A;  1ZHI A;  1MMA A;  5CK9 A;  3QSU A;  5HKC A;  5GAN h;  3WVE B;  2QYZ A;  4RG2 A;  1YJW Q;  1GCP A;  2JMC A;  3RNJ A;  4FYW B;  4L5G A;  4OMO A;  3OB9 A;  2PZ1 A;  1C0M A;  2DL8 A;  1ZUY A;  4RCC A;  2LQN A;  3GNG A;  2IIM A;  2GBQ A;  1TTH B;  2FHD A;  4LD6 A;  5LJ5 j;  3RKW A;  4HVU A;  2YUN A;  3H9N A;  2VXE A;  2P0Q A;  5CIU A;  3CC7 T;  4DEY A;  4FL6 A;  3HP9 A;  3H0H A;  2OTJ A;  3WXM B;  2YDL A;  1PKS A;  2X9H A;  2CZ6 B;  2C06 A;  4C0Z A;  2YRV A;  2O88 A;  3M0Q A;  1NBE B;  1BI0 A;  1VQL A;  2COY A;  5IXB A;  1YIT T;  2HQH A;  5ECA A;  3HL8 A;  2CRE A;  3OYG A;  3T9N A;  1K76 A;  4OML A;  2GFA A;  4GY5 A;  3V7R A;  1M1K U;  1YI2 Q;  1ZSZ B;  3AT1 B;  1H92 A;  3DLL A;  3JCM W;  2EBP A;  4M78 F;  3X24 B;  4EMH A;  4C92 C;  2H3E B;  2JS0 A;  2ED1 A;  2XG8 D;  3PVQ A;  1VQM A;  1G3S A;  1W4S A;  4J9I A;  1ZLM A;  1QVG P;  3MEA A;  5J26 A;  4JRK A;  5KCH A;  4C0D B;  1WQW A;  2F5K A;  2NUT B;  3JSC A;  1Q95 G;  3H0F A;  1UE9 A;  2E3H A;  2VAS A;  1VQ6 Q;  2ZAE A;  2D1X A;  1CKB A;  1D0X A;  1W2B A;  4BY6 C;  1T3L A;  1VYV A;  3V8K A;  4LDX A;  2C0I A;  5CKD A;  5LJ3 g;  1TUD A;  1JO8 A;  4JUV A;  2M1H A;  3VS0 A;  1KQS S;  3MCA B;  1YBY A;  4AFZ C;  1CSK A;  2QEX T;  4M75 C;  2HDA A;  1OQK A;  3CCQ Q;  2P4R A;  3VYH B;  1FWZ A;  4AFQ C;  1BIA A;  2BIV A;  4AMC A;  3EFO A;  1YJW T;  4KGX B;  4MZP A;  1U5S A;  3SEM A;  5HY6 A;  3CCR T;  2LP5 A;  2R5A A;  3OYI A;  1K0S A;  4BUG A;  1SPK A;  3C0C A;  1ZQ1 A;  1W1F A;  3CCS A;  3NTK A;  2YUP A;  2CH4 W;  4DA4 A;  2DEU A;  2NUZ A;  3CMA Q;  1K73 U;  1UB4 A;  1NJI R;  4F04 B;  3JB9 H;  1HYO A;  2QA4 Q;  5CVI A;  3CME Q;  3CCL Q;  3CEY A;  2KMT A;  1OPL A;  1YWP A;  4Y28 E;  1CKA A;  1Y7X A;  2RJE A;  1XJW B;  2ZPG B;  3EG3 A;  1AWO A;  3VS7 A;  3CCJ Q;  3X26 B;  1QCF A;  1I5O B;  5GAM j;  2QAZ A;  2RK2 A;  2JXB A;  1QP2 A;  4LE9 A;  2KQW A;  1TXQ A;  1U1T A;  4Q5W A;  3PIP A;  1SSF A;  4HT8 A;  3VU3 C;  3INZ A;  3NTH A;  4BD3 A;  1JB0 E;  3EAE A;  5I11 A;  1G83 A;  2QTX A;  3LGL A;  3QZ9 B;  3AHU A;  2K3B A;  2O9V A;  2CT3 A;  4NS5 A;  4EDU A;  3CCE T;  1Q86 U;  4A4E A;  1PG5 B;  3O5Z A;  2D6F A;  1JQQ A;  1MGQ A;  4OF1 A;  5IT9 E;  1VQK Q;  3PMI A;  4FM4 B;  1F1B B;  2V1Q A;  3I56 T;  1GL5 A;  3I5S A;  6AT1 B;  3CC4 Q;  2CGH A;  2KT1 A;  3V7S A;  5IHI A;  4ZN1 A;  1OX8 A;  4OGE A;  2K4Y A;  5FWC A;  1ZSZ A;  2KXC A;  2KRM A;  2K7A A;  1JRI A;  5I2M A;  1BCO A;  2PQW A;  1QLY A;  3CCU A;  5GJV B;  2YLC A;  5LJ3 e;  2JM9 A;  3OYB A;  2ED0 A;  2BZX A;  3CC2 Q;  1UJ0 A;  2CP3 A;  4M78 D;  1FMK A;  1VYT A;  3H6Z A;  2RJC A;  4J8O A;  1M3B A;  5GMK e;  3G4S Q;  4PFO A;  3QWY A;  1BU1 A;  2NUT A;  2XMF A;  4HXJ A;  2JTF A;  3M4Y A;  1PD0 A;  5GAN g;  1QKX A;  2CDT A;  1I8F A;  2DBM A;  3JCM Q;  2BUD A;  4PJO C;  3CCV A;  2E6Z A;  3CPW A;  5IHN A;  5GAM e;  4PNO A;  2VXF A;  3TQ7 P;  1BI3 A;  1WXT A;  1Y07 A;  1IHW A;  2JZ2 A;  2COW A;  4MZT A;  5J3B A;  4IUR A;  5I2S A;  2GTO A;  3G6E A;  4N4I A;  3FJP A;  4OP0 A;  1W6X A;  2IVW A;  2O9S A;  4ZGJ B;  5LJ5 h;  1DJ7 B;  5IXF A;  2QA4 T;  5FLX E;  2M9U A;  3G1J A;  4KH1 B;  2OTJ Q;  3CCL T;  3QYG B;  2LMJ A;  5A0L A;  2E65 A;  1LPL A;  1M90 C;  5GAN 5;  2DIL A;  3ZL7 C;  2KYM A;  2CUB A;  3S3M A;  2CP6 A;  3CCJ T;  1N8R C;  4C92 G;  4BDY A;  4PJJ A;  4LDY A;  2XU8 A;  4JPB W;  4C92 B;  5LJ5 d;  5CO7 A;  2JTM A;  2P84 A;  3QXE B;  4JZ3 A;  4FW1 A;  1IZ6 A;  3QJ6 A;  2E1H A;  1H8K A;  5LL6 S;  1YHQ A;  1PCX A;  1NE8 A;  2CT4 A;  1AOJ A;  1EX4 A;  2EYW A;  1VQ9 Q;  3BDU A;  1UJY A;  4PFP A;  3ZEH A;  4CRI A;  1IGQ A;  3CXC A;  1VQM Q;  2DF6 A;  2HBW A;  4ZGD B;  4OVA A;  3CC4 T;  5KE2 A;  2DVE A;  2RMO A;  3SFM A;  3SD4 A;  4C5I A;  4M75 G;  1UDL A;  3GPL A;  4E7K A;  1M3A A;  2YWW A;  2DL7 A;  5GAO n;  2DD5 A;  3GNF B;  4II1 A;  3QPH A;  1VQ4 A;  2PVO B;  1I5L A;  3LW5 E;  4M75 B;  2GQI A;  8ATC B;  2K2V A;  4C0G A;  4PL6 A;  2GF7 A;  2EJF A;  4NL3 A;  1Q81 C;  1NM7 A;  1I4K 1;  2WSF E;  5DY9 A;  3JRZ A;  1EFN A;  2PUK B;  2D8J A;  3OS0 A;  2DTI A;  1K8A R;  4XAX B;  1YI2 A;  1KD1 C;  4M77 F;  3CC2 T;  3PE0 A;  1BBZ A;  4M7D F;  3NTI A;  3D7S B;  3G4S T;  4OMF B;  1E6G A;  2DXT A;  2X4Y A;  4TVR A;  2JTE A;  3ER0 A;  1V76 A;  1QWE A;  3I9Q A;  2DTH A;  2IG0 A;  4XU1 A;  2K3Y A;  1JXO A;  4C8Q F;  4GLM A;  4EIK A;  3VUB A;  5I22 A;  3JCM f;  3MET A;  4J7I A;  3MEU A;  4OB0 B;  1SHF A;  2K5F A;  4FU6 A;  3KUF A;  2RQW A;  2DM1 A;  3MO8 A;  4XTW A;  2AZS A;  2MIO A;  4A4F A;  1IRX A;  2CZ0 B;  5HCK A;  1WIE A;  5D6Y A;  1WQ7 A;  2G6F X;  1RAI B;  3CBM A;  1VQ6 A;  1NLO C;  1WHG A;  3HKS A;  2X3W D;  1M1F A;  1V1C A;  2CP2 A;  4B9X A;  1VQO Q;  2JUF A;  2YT6 A;  2RQV A;  3M56 A;  3SHW A;  4F14 A;  1IRE B;  1BI2 A;  2OTJ T;  4K11 A;  1C6V X;  3V8J A;  2MPX C;  2DL3 A;  5FRM A;  2VYT A;  3CCQ A;  5KYY B;  3UAT A;  2NLU A;  4J9G A;  3NFC A;  1QKW A;  1VQL T;  2RHI A;  2K5I A;  2DK3 A;  4ATO A;  1U8R A;  1MV3 A;  1MNE A;  3HPW A;  3C94 A;  4OMN A;  5GAM h;  1TH7 A;  2GFU A;  3I35 A;  2L5Q A;  2X4X A;  3HRS A;  1Q7Y R;  4Y92 A;  2F2X A;  1H64 1;  2WSC E;  1AZE A;  1ZBX A;  4IUQ A;  3I5R A;  2X4J A;  2DXC A;  3TEE A;  4F7U F;  2YUO A;  1UUE A;  1SRL A;  2L3S A;  1VQM T;  3CMA A;  3CPW P;  4D6W A;  1S72 A;  3KXT A;  3VYG A;  1M2O A;  1KFZ A;  2AIR B;  2BKD N;  1ZX6 A;  1QVG S;  2HQX A;  3MPU B;  3P8H A;  4FW2 A;  3CME A;  4C92 A;  2OAW A;  5CKF A;  2EQU A;  2RM4 A;  2RI2 A;  2OTL Q;  4M78 E;  3M54 A;  4NL2 A;  1BKB A;  3MP8 A;  2EYZ A;  1JEG A;  1T0H A;  2DKG A;  3RER A;  1D3B B;  2MYS A;  4BAC A;  2ZPB B;  3CCU Q;  1SRM A;  3JCM J;  1Y0M A;  2KR3 A;  4O6J A;  4C5H A;  4PJO G;  2DLP A;  2HEQ A;  1VQ8 Q;  2MWO A;  2QDL A;  5M9O A;  1WI7 A;  4PJO B;  1Q82 R;  1PM3 A;  1MV0 B;  1G3W A;  1M1G A;  4RG8 A;  3MP1 A;  2DTO A;  2MMP A;  1K9A A;  2RA2 A;  3HHT B;  2O4X B;  2JNG A;  1TS9 A;  4XTU A;  4ZNX A;  1K1Z A;  4M75 A;  1WHK A;  4L59 A;  4C92 E;  1VQK A;  2QK0 A;  1LCK A;  3HRT A;  1D0Z A;  3CCV Q;  5FRN A;  1EZZ B;  1N6A A;  1OU9 A;  2SRC A;  3H41 A;  3CCS T;  5FU6 B;  2DFU A;  3M59 A;  5GAO l;  3OSV A;  3CXC P;  3PT9 A;  2MI6 A;  3QDR B;  3OQ5 A;  3KFV A;  4ZN3 A;  2YUQ A;  1OEB A;  1M90 U;  1TSF A;  1K4U S;  3OW2 P;  4M77 D;  1I1J A;  3M0S A;  1D1C A;  4M7D D;  4DBH A;  1Y96 B;  1N8R U;  4IKF A;  3TU4 K;  1OU8 A;  2LTO A;  5LJ5 g;  5GAO m;  1QCO A;  2G3R A;  1IO6 A;  1RLQ C;  5IAY A;  4B6M A;  3PGG A;  4XTZ A;  2ZPF B;  4C8Q D; 
#chains in the Genus database with same CATH homology
 1ZBJ A;  3SEM A;  1U5S A;  2LP5 A;  1YWO A;  3M0U A;  5FWB A;  1G2B A;  1GBR A;  4AG2 C;  1K0S A;  2EGC A;  1SPK A;  3C0C A;  1W1F A;  2FO0 A;  4RTX A;  2BZY A;  2FPE A;  2VKN A;  4AFS C;  1UHF A;  2YUP A;  2CH4 W;  2ENM A;  2KE9 A;  3TVT A;  3VS5 A;  1X2K A;  2NUZ A;  1PHT A;  1SSH A;  2LX7 A;  1E6H A;  2RQU A;  1JU5 C;  2FPD A;  1J3T A;  2M51 A;  1B3Q A;  3VRY A;  2RF0 A;  2FRY A;  1WFW A;  2JT4 A;  4Z8A A;  1I0C A;  2J05 A;  3R6N A;  1OPL A;  1YWP A;  1CKA A;  3EHR A;  2K79 A;  3EG3 A;  1AWO A;  2YSQ A;  1OV3 A;  2FPF A;  3VS7 A;  2D8H A;  2ESW A;  1QCF A;  4Z89 A;  2E5K A;  4HCK A;  2RN8 A;  2JXB A;  4HVW A;  4LE9 A;  4CC3 A;  2ROT A;  2B86 A;  4M4Z A;  1TG0 A;  4AFU C;  4RTW A;  2LNH B;  1X6B A;  2DYB A;  1WXB A;  5I11 A;  4CC2 A;  1GFC A;  3REB B;  4WCI A;  2K6D A;  1G83 A;  1YP5 A;  4A63 B;  2K3B A;  2O9V A;  1ZUU A;  2CT3 A;  2FEI A;  4CC4 B;  2I0N A;  3O5Z A;  4LUE A;  1WDX A;  1GFD A;  3ULR B;  2X3X D;  1JQQ A;  1RUW A;  1Z9Q A;  2LJ3 A;  3NPF A;  4J9E A;  2V1Q A;  1GL5 A;  3RBB B;  3I5S A;  2JW4 A;  3PVL A;  2KT1 A;  5IHI A;  2L0A A;  1GRI A;  1NEB A;  1PRM C;  2CH4 A;  3TSW A;  2EQI A;  5FWC A;  1AVZ C;  2KXC A;  1X43 A;  2KRM A;  2K7A A;  2FRW A;  4GBQ A;  4J9C A;  2HCK A;  2BZ8 A;  1QLY A;  4RTY A;  2PNI A;  5GJV B;  2JM9 A;  4LN2 A;  4DEX A;  3VRZ A;  2GGR A;  2NWM A;  3M0T A;  2ED0 A;  2GTJ A;  2BZX A;  2EGA A;  1UHC A;  1UJ0 A;  1FMK A;  1RI9 A;  1VYT A;  1VA7 A;  1M3B A;  2L3Q A;  1X27 A;  2DMO A;  3QWY A;  1BU1 A;  4IIM A;  1WLP B;  2XMF A;  4HXJ A;  4RTZ A;  1ARK A;  2KEA A;  1YNZ A;  1K0X A;  2CUD A;  1AWX A;  1QKX A;  2CDT A;  1A0N B;  2DBM A;  2DL4 A;  1YN8 A;  4ORZ A;  3U23 A;  1M8M A;  5IHN A;  1OOT A;  2KXD A;  2EPD A;  4RTV A;  1WXT A;  2KRN A;  2W10 A;  2LJ1 A;  1NG2 A;  4E6R A;  2DNU A;  2GTO A;  2W0Z A;  4LUD A;  2CSI A;  3VS3 A;  1W6X A;  1UTI A;  2O9S A;  1NEG A;  5IXF A;  1HJD A;  1ABO A;  1HSQ A;  2SEM A;  3QWX X;  2PTK A;  3NMZ C;  2LMJ A;  2M0Y A;  3EHQ A;  4OMQ A;  2DRM A;  2AK5 A;  1AEY A;  2DIL A;  3ZL7 C;  2KYM A;  2CUB A;  2F2V A;  1BB9 A;  1U3O A;  2CSQ A;  2KRO A;  2L3P A;  4RTU A;  1MUZ A;  3EG0 A;  1M30 A;  3LH5 A;  2A37 A;  4JPB W;  4X1V A;  1PWT A;  2KGT A;  1GBQ A;  3EG2 A;  2F2W A;  4JZ3 A;  1H3H A;  2A36 A;  1BK2 A;  2DJQ A;  1H8K A;  2DL5 A;  1SHG A;  2RPN A;  3CQT A;  5L23 A;  2EYW A;  2CT4 A;  1AOJ A;  1UJY A;  2RQT A;  1WA7 A;  2BTT A;  1ABQ A;  2J6F A;  2L2P A;  1SEM A;  2LCS A;  2DF6 A;  2JMA A;  4F17 A;  2HBW A;  2MOX A;  2A28 A;  1PKT A;  2RMO A;  1UDL A;  1OPK A;  2EW3 A;  1M3A A;  4J9B A;  1B07 A;  2DL7 A;  2AKK A;  1KJW A;  1N5Z A;  4CC7 A;  2EYX A;  4ESR A;  2GQI A;  1JXM A;  2K9G A;  2EKH A;  2DRK A;  2V1R A;  3M0P A;  1NM7 A;  2C0O A;  4J9H A;  1EFN A;  2D8J A;  2ECZ A;  3M0R A;  3NGP A;  4KRT A;  4AG1 C;  3PE0 A;  1KSW A;  1BBZ A;  2JS2 A;  4D8D A;  2OI3 A;  1VYU A;  1X6G A;  1UFF A;  2VVK A;  1E6G A;  3VS1 A;  2JTE A;  3REA B;  4JJC A;  1QWE A;  4JJD A;  4D8K A;  3I9Q A;  1M27 C;  2LQW A;  5EC7 A;  1JXO A;  1T3S A;  5IHK A;  4GLM A;  2KT8 A;  3TSZ A;  4EIK A;  4OMM A;  1RLP C;  3UA6 A;  5I22 A;  1AWJ A;  1AD5 A;  1SHF A;  2RQW A;  1I07 A;  2DM1 A;  2AZS A;  2MIO A;  1U06 A;  2EYY A;  3FJ5 A;  1PNJ A;  1T0J A;  2LJ0 A;  1TUC A;  1GCQ A;  1FYN A;  5HCK A;  1UG1 A;  1WIE A;  2K2M A;  2J06 A;  4J9F A;  4FSS A;  1NYF A;  2G6F X;  1NLO C;  2X3W D;  1V1C A;  2RNA A;  3VS2 A;  2DBK A;  4QT7 A;  3UF4 A;  2YT6 A;  2RQV A;  3SHW A;  2RQR A;  4F14 A;  4HVV A;  4J9D A;  1S1N A;  3VS6 A;  4K11 A;  2LZ6 B;  3IQL A;  2A08 A;  3THK A;  2DL3 A;  4Z88 A;  3UAT A;  1GCQ C;  4J9G A;  1QKW A;  1GCP A;  3EGU A;  2JMC A;  1UEC A;  3RNJ A;  1MV3 A;  4OMO A;  4OMN A;  2PZ1 A;  2KBT A;  3I35 A;  2DL8 A;  1ZUY A;  2D0N A;  2LQN A;  4Y92 A;  2F2X A;  2IIM A;  2GBQ A;  5GJW B;  1AZE A;  1WYX A;  1KIK A;  2OJ2 A;  1ZUK A;  1NLP C;  4RTT A;  3I5R A;  4HVU A;  2YUN A;  1AWW A;  1M3C A;  2YUO A;  1UUE A;  1SRL A;  2GNC A;  2L3S A;  2DVJ A;  4F16 A;  4DEY A;  3EG1 A;  3H0H A;  1KFZ A;  1ZX6 A;  2YDL A;  4JZ4 A;  1PKS A;  5IH2 A;  1QWF A;  1UGV A;  1E7O A;  4IIO A;  1X2Q A;  1HD3 A;  1W70 A;  2O88 A;  2OAW A;  3M0Q A;  2ABL A;  2AKL A;  5IXB A;  1WX6 A;  5ECA A;  2CRE A;  2EYZ A;  1PRL C;  1AZG B;  2O31 A;  5FW9 A;  2MCN A;  1JEG A;  1K76 A;  1T0H A;  1XOV A;  4OML A;  2HSP A;  3H0I A;  2DA9 A;  2ROL A;  1SRM A;  1Y0M A;  2KR3 A;  3GBQ A;  1Z9Z A;  1YCS B;  2DLP A;  2HEQ A;  1H92 A;  1WXU A;  2QDL A;  4RUG A;  2KYB A;  2DX1 A;  2EBP A;  1WI7 A;  2KRS A;  2AZV A;  2JS0 A;  2ED1 A;  3NHN A;  4JJB A;  1MV0 B;  3PVQ A;  4LNP A;  2DE0 X;  4J9I A;  1ZLM A;  1K9A A;  1NYG A;  2C0T A;  4ZNX A;  1K1Z A;  1LCK A;  2EVR A;  4R0K A;  3H0F A;  1UE9 A;  1X69 A;  3UA7 A;  2SRC A;  3H41 A;  2FG0 A;  2D1X A;  1CKB A;  3A98 A;  3JV3 A;  2KNB B;  1T3L A;  1VYV A;  3KFV A;  2C0I A;  2H8H A;  2YUQ A;  1OEB A;  1TUD A;  1JO8 A;  3VS0 A;  1Y57 A;  1K4U S;  2O2O A;  1ZSG A;  1I1J A;  3M0S A;  3VS4 A;  2J7I A;  4AFZ C;  2VWF A;  1CSK A;  2J6K A;  2HDA A;  2P4R A;  2EGE A;  1IO6 A;  4AFQ C;  1RLQ C;  2JM8 A;  2J6O A;  4OMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...