1I8FA

The crystal structure of a heptameric archaeal sm protein: implications for the eukaryotic snrnp core
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
ATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords PUTATIVE SNRNP SM-LIKE PROTEIN
publication title The crystal structure of a heptameric archaeal Sm protein: Implications for the eukaryotic snRNP core.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 13
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2001-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1i8fA00
1JRIA 4A54A 4PJOD 1D3BA 3L2ZA 4M78A 3JCMg 3RKWA 4C92G 5GMKj 3RKYA 4M75A 2RM4A 1LNXA 4M78E 3JCMJ 5GMKh 4M75E 3M4GA 4F7UB 3HFNA 5LJ3g 1WPYA 4XTUA 3V8KA 5DY9A 3HSBA 3SB2A 4QVDA 4C8QC 4EMKC 5LJ5e 2DEQA 4C8QB 4EMKB 4V2SA 2DVEA 4C92F 3JB9H 5GAMg 5GAN2 4HT9A 4XU3A 3SWNA 4N0AA 5GAN6 3PGGA 4C92C 4C92B 4M7AG 5GMKe 3EFRA 2DTIA 1U1SA 5GMKm 3RERA 2E10A 2FYKA 5GMKi 4M7AD 4JRIA 4XTVA 4PNOA 4PJOG 2VC8A 1I8FA 4RCBA 3JCMb 5LJ5j 2EJGA 3VU3C 4QVCA 3V8JA 2RD1A 3JB9D 5GAOl 1HK9A 4XU1A 2DXUA 4NL3A 4M7AF 1N9SA 4M7DG 5LJ5h 2I2LA 3JCMc 3RIRA 4M77D 5LJ5f 1LOJA 1I81A 5GAN7 5GANg 4HA8A 4XQ3A 4M7DD 4PJOF 5LJ5d 5GAN8 1KQ1A 4NL2A 1JBMA 5GAOr 1HXDA 4F7UA 4PJOC 2FB7A 4PJOB 4M7DF 5I21A 3RUXA 2YLCA 3QSUA 4M78D 1N9RA 1WQWA 4C8QA 4EMKA 4F7UE 3JCMe 4MMLA 2E65A 2RA2A 4XTXA 4M75D 3JB9I 2DZ9A 2EWNA 4C8QE 1X01A 4M78F 4C92A 4XTZA 3JB9G 3BY7A 1BIAA 5LJ3e 4C92E 5GAN3 3RESA 1I5LA 4OP0A 2YLBA 4HT8A 3QHSA 3FJPA 4EMGA 4M77G 3JCMP 3QUIA 2DTOA 4A53A 1B34B 2DXTA 1Y96B 2DJZA 3BW1A 1H641 2EJ9A 3JB9F 4M7AC 4M7AB 3JCMh 2DTHA 4RCCA 3JCMf 4JRKA 1TH7A 3INZA 5LJ3j 2DZCA 4M78G 1WQ7A 5GAOq 4M77F 3JCMd 4M7DE 5GAN5 4M75G 4PJOA 1BIBA 2E64A 4M77C 5LJ3h 1M5Q1 4M77B 5GAMj 5LJ3f 2EJFA 4MMKA 4M7DC 4M7DB 1YCYA 4PJOE 2K57A 4EMHA 4F7UG 4M7DA 4JLIA 5LJ3d 5GANe 5GAMh 2E1HA 3V8LA 1U1TA 2E41A 4NOYA 3HFOA 4C8QG 4XTWA 5GMKl 5GAN4 5LJ5g 5GAOm 4M75F 4M78C 4Y91A 2RB6A 1D3BB 4M78B 4DQ2A 5GAMd 3AHUA 3V7CA 4X9DA 3JCMV 1M8VA 4C8QD 4M75C 4M75B 4XU2A 4J6XA 2ZGWA 4F7UF 2JN0A 4XTYA 1WNLA 4J6YA 5GAMe 1LJOA 2DKGA 2Y90A 1B34A 4J5YA 1Y96A 3FB9A 4WF2A 3BFMA 4C92D 3BDUA 4C8QF 5GANj 3RKXA 4M7AA 1I4K1 3EFSA 3L1AA 5GANh 3FIFA 3SWNC 3V7SA 4N0AC 3SWNB 5GANf 4M7AE 2EAYA 1KQ2A 4J6WA 5GAOn 2CGHA 5GANd 3JCMX 2VXFA 1MGQA 4JUVA 2HNIA 2YHTA 4M77A 4XU0A 3JCMQ 5CAIA 2QTXA 4M77E 4X9CA 5GAOp 3JB9J 5GAMf 3GIBA 3JCMW 3V7RA 2VXEA 3QO3A
chains in the Genus database with same CATH superfamily
2FZCB 2MCNA 4ZN1A 1Q7YR 3CC7Q 4GBQA 1LNXA 4N4IA 3A8LB 3T9NA 3LGFA 1KQSS 3SB2A 4QVDA 1NJIC 2DEQA 2B8AA 2OX7A 4J9HA 1YHQA 3VJPA 3I5RA 1JEGA 1IRXA 4FSXA 2A37A 2RHZA 1VQ7A 4JRIA 5AYFA 1I8FA 1UUEA 3E1SA 1KJWA 3RMSA 2PVDB 2NUTA 5GAOl 4XU1A 2DXUA 1WJSA 4LDVA 5FRNA 3LH0A 1VQKA 2KR3A 4XQ3A 4PJOF 1VQ6T 2JW4A 1UGQB 1RABB 2A08A 2VGNA 1A0NB 1SKUB 4C8QA 2LQKA 2IPOB 3JCMe 2DYIA 2DIQA 1GL5A 1M1GA 3OBYA 3JSCA 1ABOA 2EQKA 2DTOA 1NJIU 2ZPBB 1QCFA 1Q81R 2EGEA 3VKIA 4D8KA 1IXDA 3A5ZB 4OMOA 1X6GA 4DA4A 1YCSB 2DRMA 3INZA 4M78G 4XK8E 1I5OB 1GCQC 3JCMd 3M9QA 1YFNA 1OZ2A 4A4HA 2RJFA 2PNIA 1XJWB 4KH0B 4AFUC 3CCJQ 1UJYA 1Y57A 2E4HA 2HMAA 1SF9A 2D1XA 5CVIA 1JQQA 1RUWA 2DMOA 2X35A 4J5YA 4ORZA 4CC3A 1UGSB 3U23A 2HCKA 3PNWC 5GANf 2EAYA 1KQ2A 2Z0WA 1YITQ 2VKNA 3EAEA 3CPWS 1AWJA 4LD6A 2JMAA 2EQIA 4M7DE 3S3OA 4PFZA 2EYXA 4ELZC 2QK0A 2RM4A 4M78E 1MNEA 1IB8A 4DBFA 1K9MC 1ZSZC 3EH2A 5LJ3g 5J26A 2C0TA 5LJ5e 1YHQQ 2DVEA 4C92F 2DJQA 1KHCA 1W6XA 1VQ7Q 4R55A 4PJLA 4PJOG 2XKOC 2XIDA 1HK9A 2DFUA 2RQTA 2I2LA 2PVGB 3C94A 3OW2P 2DM1A 2LX7A 4C5HA 5LJ5d 2PTKA 2FB7A 5I21A 3UPUA 3CCSQ 1X27A 3VS2A 3P8HA 1KQSP 2YUPA 3VRYA 2DXCA 4EIKA 1K76A 3A98A 1TU0B 3WXMB 1YI2Q 3NMZC 1K9MU 1AWXA 2MPXC 3CCUA 1VUBA 1PSFA 5FWBA 1M3CA 3LGLA 3MCAB 3KFVA 4E6RA 3E19A 1VQ6Q 1UJ0A 2RHIA 4J7IA 3CCLT 4AFZC 3URGA 5IN1A 2LJ3A 4M77C 3REBB 3OYYA 4M7DB 4PJOE 4F16A 3I56A 3EG0A 3RNJA 5GMKl 4PFOA 4OB0B 1OULA 4M78B 4X1VA 4E7HA 3SHWA 4OMLA 4XTYA 2RH2A 3SDZA 1SHGA 3OS1A 3BDUA 1VQ9A 1K73U 1I4K1 2J06A 1N5ZA 1U3OA 3SWNC 4QKUA 4C0DC 5HY6A 2RQVA 2DL7A 5ECAA 2CDTA 3OBWA 4OB3B 5CAIA 2K4YA 5FU6B 2ATCB 2RQUA 1NE8A 3R6OA 5GAMf 3A1PA 3OW2A 3X20B 1KD1U 2DL5A 4C92G 3C95A 4HVVA 2QEXT 2OTLT 1RLQC 1M8MA 4E7SA 2GFUA 3H8ZA 3TSWA 1KQSA 1R8OB 2KI7A 2EQMA 1UB4A 4ZGDB 3G6ET 4N0AA 3M56A 3S3MA 1SSHA 1ZUYA 2JUFA 1Q7YC 2QQAA 4A63B 5LJ5j 2MK5A 3CPWP 3KUFA 4LUEA 3CCVQ 2R57A 4ZNXA 3QWXX 5KE2A 5I11A 4KUIA 4LN2A 4PJOB 1ZBXA 1Q82R 3RUXA 1WQWA 2LNHB 4MMLA 5I22A 3CD6A 3MEWA 3S6WA 2QQRA 2HDAA 4PJNA 1WHMA 2DE0X 4C92E 1YJNA 1H3ZA 4J9BA 4BACA 4EPCA 3CCQA 1KSWA 3OSVA 3M0RA 1AHJB 2XMFA 4KGZB 2DTHA 2CZ0B 1MMNA 1O9SA 1VQPQ 5GAN5 2JM8A 2JT4A 2LT1A 5D7UA 3I56Q 5LJ3h 4HVWA 1IGUA 3I55A 1ZX6A 3J80E 4XTWA 1HD3A 2IG0A 1D3BB 1Q81C 3V7CA 4OGEA 1SG5A 1T3SA 4J9EA 4RG8A 2XDBA 2J6KA 4IURA 3X25B 2DIGA 2KDSA 2DRKA 4BY6C 2RHYA 2ECZA 4BDYA 5KYNA 5FU7C 1SEMA 3HRTA 2MI6A 3O8VA 5IHKA 3CPWA 3FEOA 3V7RA 1T0HA 2NYSA 3PE0A 2L3SA 3L2ZA 4M78A 3JCMg 1X6BA 1YIJT 6AT1B 2HAXA 1M2VB 3VUBA 2JOYA 4WCIA 5IHNA 3OYCA 4XTUA 2D8JA 1VQ4Q 3GNFB 2YUQA 1OYXA 4C92B 1Q81U 2DTIA 4OMNA 3CPFA 4AG1C 2GFAA 3G4SA 2J05A 4B6MA 2KVQG 3JB9D 2KE9A 3SD4A 2D8HA 2QGGA 4KGXB 1N9SA 5M9OA 1WYXA 2XU8A 2QEXQ 4HA8A 2CP3A 1AVZC 2OTLQ 2DK3A 1NPPA 2LP5A 3CD6Q 2E3HA 2OJ2A 4L5GA 4F7UE 4FYYB 2EWNA 3PMIA 1QMCA 2HQEA 3H6ZA 1TXQA 2YLBA 2MOXA 3QUIA 3X24B 1FX7A 1VQ5A 2CYZB 2KK4A 2LTOA 3CMAA 3MEVA 2J6FA 3L42A 2VGMA 3PTAA 5I2MA 4RKUE 3I55Q 4PJOA 3OYDA 2ZPGB 1LCKA 1BI1A 4M4ZA 2E41A 2HSPA 4KGVB 2DF6A 5LJ5g 4M75F 1WJQA 2HL3A 1IHWA 2AKLA 4J9IA 5GJVB 1WNLA 4A4FA 2EIFA 2K5IA 1ZA2B 4BI3A 3LYIA 4E7JA 4BE0A 2LDMA 2CGHA 2RMOA 4NS5A 4ZTFA 2K79A 3QIIA 3QJ6A 1WXTA 2XD0A 1WX6A 5GAOq 3G71T 4A54A 4QQDA 3CC4Q 1TS9A 1S72A 1D3BA 1EFNA 3M57A 3LX7A 3X28B 4HXJA 9ATCB 3QYGB 4F7UB 4ATOA 1YJWQ 4Z8AA 4HT9A 4FYXB 4XU3A 5GAN6 2LVMA 3TEEA 2YRVA 3CC2A 2ZPHB 1SPKA 4JS5A 3DB4A 4M77D 1YIJQ 1M2VA 1JBMA 3HHTB 3CXCS 3PVLA 4ESRA 3HTRA 4XTXA 2LJ1A 4C92A 4E7KA 3MEAA 2C0IA 2LC4A 1GBQA 1FMWA 1VQ5Q 2HBPA 4Z88A 2BZYA 1XQHA 1QCNA 4LNPA 2E5KA 3CMAQ 1O75A 1R0BG 4IIOA 4M7AC 3JCMh 4C0ZA 3M58A 4JRKA 1VIEA 2LQWA 2MIOA 4RTYA 2L3PA 4AFSC 4BE2A 2GQIA 4M75G 2F5TX 3EHQA 2E64A 3IQLA 4F17A 5LL6S 3VRZA 1KD1R 3V8LA 1RI0A 4NOYA 3EG3A 1VQMQ 1K4US 1NLPC 1OPKA 2EQUA 2AKKA 2V1QA 3OS2A 4XU2A 4J6XA 1C1AA 1W1FA 2Y90A 3FB9A 1OU9A 4C0GA 3VS0A 4TVRA 2DVJA 3L2QA 3CCET 2GCXA 2YRDA 2BUDA 2KQWA 3OA6A 3V7SA 2FHDA 2AZVA 1OOTA 5CKDA 2NUPA 3CMET 1S72Q 1Q82U 1YWOA 1WA7A 3CCJA 3RKWA 2DA9A 3QZ9B 4FL6A 3TU4K 3PT9A 3JCMJ 2O9VA 4BE1A 2LMJA 4M75E 1QVFS 1KG1A 3V8KA 4Y28E 4C8QC 3ZBDA 1D1BA 2A3LA 4PJJA 1J3TA 2E3IA 1YITA 4OMPA 2DL4A 2VC8A 3MKDA 3VS4A 3VYGA 3VS7A 2KSSA 5LJ5h 2K2MA 1V1CA 3NTKA 1D0YA 2OTJT 2L5QA 2CT3A 2KEAA 5GAOr 2RQWA 4F7UA 2H8HA 4BI8B 2BZ8A 2DXBA 4RG2A 2AIRB 2P0QA 3HRUA 3FDRA 2LQ8A 4DOVA 1ZLMA 1VQKT 1B34B 2DNUA 2KXDA 2CH4W 2K2VA 3ASKA 3NTHA 1UHFA 1YN8A 1PHTA 1U5SA 2YDLA 5LJ3f 3CXCP 4OMMA 3CCSA 1U1TA 3HRSA 2F5KA 3G7ZA 1WHKA 5GAMd 2M0OA 1M30A 1ZHIA 3PFSA 4M75B 3CCRT 1PC0A 2ZGWA 1X6OA 2QGFB 2AT1B 5D6XA 1YI2A 1AWWA 2JS2A 3GF5A 3UF4A 1WLPB 3CBMA 4J83A 1IREB 1MMGA 2L3RA 4UC4A 2COWA 1VQ6A 1B07A 4KH1B 2QQBA 5C6SA 2FRWA 3EGUA 1UFFA 2KYMA 2QTXA 4L59A 5GAOp 3JB9J 3GIBA 3QO3A 1PRMC 5KYYB 2ROLA 4J9DA 4JLGA 4GY5A 1TUGB 1N8RR 2GGRA 3CCMQ 2GNCA 2HL5C 2JMCA 5CKFA 2VYTA 3ER0A 2P0KA 3M53A 3CMEQ 5GMKi 4MZTA 4PNOA 4FIBA 5CQYA 1XTDA 1PM3A 1NEGA 1BI0A 1I1JA 1NYGA 4IUPA 2EYYA 1I81A 3MHXA 1Y7XA 2R5AA 3FJ5A 1KQ1A 4R56A 3M55A 3CXCA 4EDUA 1VQNT 1QVFP 1Q86R 2DILA 3UWNA 2FG0A 1T3LA 4FW2A 3RDVA 3RESA 2V8IA 5KCHA 3DB3A 2BE9B 2COYA 1QKXA 2ZPIB 3I35A 1RAFB 3CCVA 2OTJQ 3HPWA 2RJEA 4LD9K 3A8GB 2HKNA 4JJNK 4FT4A 1U06A 1PKTA 2M0YA 2LQNA 2EPDA 4ELYC 2O2OA 5GAMj 4E7LA 2EJFA 1K73C 4JLIA 4MDXA 3HFOA 3MEUA 4HCZA 3NFCA 3L2VA 5GAOm 4HVUA 4LDWA 4KUDK 4WF2A 1B34A 4A4EA 4PKCC 1OPLA 1BU1A 1S1NA 4QQ6A 1KD1C 5IHIA 3FIFA 4N0AC 1CSKA 2G6FX 1UGVA 1AWOA 4D8DA 1VQPA 2VASA 4IUUA 2YHTA 1VIFA 2CSIA 3PMTA 5KCOA 2L3QA 3FLGA 1QKWA 2QDLA 1M3BA 3CCRQ 4M75A 2GBQA 5KYUB 2VV5A 2DL3A 2MWOA 2EYQA 2E6ZA 1YJ9T 3JRZA 1QVFA 4EMKB 4AT1B 5KH6A 1IO6A 1MUZA 1RAHB 1NLOC 5L8RE 2E10A 1G3TA 2M02A 4M7AD 5CCAA 3OB9A 3VU3C 1MNDA 3V8JA 1FMKA 4M7AF 2NWMA 5KYYA 3MP1A 1K8AR 1VQLT 1JJ2S 2FVUA 4IKFA 1OX8A 2QA4T 4N4HA 2PUOB 7AT1B 3E2UA 3M0UA 1RACB 3OSSC 4E2FB 1VQ4A 1WXBA 3M0PA 3QZ5B 1QLYA 1M1KR 2KT1A 4HKEA 2LX9A 2XG8D 1TUDA 2YUOA 1OX9A 2ED1A 4A4KA 2RK2A 5CQXA 3JCMf 2QG9B 2QEXA 2OTLA 4ZGJB 2L2PA 2SEMA 1VQNQ 4CC4B 4M7DC 3M5AA 1YJNT 1MV3A 3NTIA 3G6EA 2QQ9A 1BKBA 4M78C 3AHUA 2DBKA 4X9DA 3GBQA 4C8QD 2PUKB 4OB1B 3R6NA 3O5ZA 2DX1A 2WSCE 4C8QF 2QI2A 2RO0A 3EFOB 2R5MA 3PVQA 4RTUA 2RPNA 3REAB 2O4XA 3KXTA 1P92A 4E47A 1G2BA 2EVRA 4IIMA 3GPLA 5FU6C 2BKDN 3QG1A 1AOJA 3TCJA 3OW2S 5J39A 2ED0A 2RHUA 2IIMA 3L2WA 1QVGS 5GMKj 1KC8R 1X43A 3E9FA 2I0NA 2VWFA 2WACA 4BUGA 2GQVA 3CCLQ 3OS0A 4PLIA 3OYHA 5GAMg 4AMCA 2G3RA 2CP2A 4M7AG 5GMKm 1NPRA 2CP6A 2V26A 4PJMA 2RD1A 4C5IA 2L0AA 1MMDA 1WHHA 3RIRA 1MHNA 1PG5B 5LJ5f 2GF7A 3CC4A 2CZ1B 3OS5A 4OGCA 1BK2A 2LCCA 3LLRA 5KYUA 3OMGA 4PJOC 4ME7A 2K9GA 2PQWA 1NG2A 3QSUA 3QBYA 2WSFE 2J6OA 2M16A 4EMKA 3M0SA 2MYSA 1YJWA 1H92A 1D1AA 1X01A 2DPPB 3BY7A 3UA6A 1WI7A 1HSQA 3FJPA 1VQLQ 1IHVA 2RF0A 3BW1A 3JB9F 2HZYA 3OYAA 1JO8A 1JJ2P 5EG2A 1YIJA 2DZCA 2QTVA 1NYFA 1T0JA 1M5Q1 5FRMA 3G6EQ 1N8RU 2DLPA 1CKAA 2CP0A 3UATA 4C8QG 1E6GA 4BB7A 4RTWA 2K7AA 3A8OB 4J6YA 1Z9QA 1RI9A 1BCMA 1PNJA 4KULA 2FL7A 4JJCA 4RMOA 3DLMA 1YNZA 1D0XA 1WHLA 3H0IA 4JZ4A 3SFMA 3EHRA 2NUPB 3MPUB 3NGPA 2DO3A 5GAN4 3ZL7C 1Q86U 1VQMA 4F04B 3LW5E 4DEXA 1ABQA 4OMQA 2ROTA 1SRMA 3THKA 3EFOA 3UT1A 3JB9H 2NUZA 2F69A 1AZEA 2W10A 1NM7A 4LUDA 4PL6A 4C92C 1WHGA 5HCKA 1M90R 1G3WA 1PD0A 5KE3A 1N27A 1UECA 3OYNA 1K1ZA 2CZ6B 2XDPA 1ARKA 3OY9A 2CUBA 4Y92A 1JJ2A 2K3BA 2P84A 1QVGP 2VUBA 2FPDA 4A4GA 3M54A 1N9RA 3BE3A 3L2RA 4J9GA 3I5SA 3EH1A 4QQGA 2FEIA 1K8AC 3JB9G 4AFQC 3CC7T 4A53A 2DXTA 1Y96B 3G71A 2IVWA 4RTXA 2MAMA 2ABLA 2MMPA 1YWPA 4M77F 1ZQ1A 2QASA 4FM4B 2JZ2A 1M1KC 4MMKA 1YCYA 2RN8A 5GANe 5GAMh 1PD1A 2EYWA 2CUDA 1G5VA 4OB2B 2XDDA 1EIFA 1VQOT 1Q82C 1QVPA 2FPFA 1VQ8T 2EKHA 3L1AA 1WHJA 1K8AU 2X4JA 2RQRA 1AT1B 1UGRB 5GANd 1MGQA 2E5QA 3QDFA 1FYNA 2ENMA 2A0FB 3JCMW 1UTIA 2HKQB 1PCXA 4FSSA 2AK5A 1QVGA 1RAGB 3P8BB 1V29B 2KGTA 2CT4A 3TVTA 1M1KU 1KK7A 1NBEB 2ZAEA 1WPYA 4XAXB 5FW9A 5DY9A 1WGSA 2P4RA 1AD5A 1V76A 3MP6A 5D6WA 4HCCA 4II1A 1UE9A 5EC7A 3QJYA 2DERA 1G83A 3CCJT 5IH2A 4C5GA 4WTOB 3OQ5A 1KC8C 4XTVA 1QWFA 2EJGA 3M0TA 4QVCA 1OEBA 2VVKA 3CQTA 2KYBA 4OF1A 3RBBB 1LOJA 4M7DD 2E70A 1VA7A 4K11A 3LWIA 3QDRB 4M7DF 3P8DA 2KROA 2CP7A 4M78D 8ATCB 3CBOA 3TSZA 3CCMA 4PK4A 3CCEA 1GFCA 3TREA 4M78F 4FW1A 3WVDB 5IXBA 3MO8A 2K3YA 5CR2A 1ZSGA 2KRSA 4HT8A 3JAME 3CMEA 3G71Q 4IUQA 4M77G 2HD0A 3VS3A 1G3SA 4BDZA 2EGCA 3QKJA 1Y71A 4Z89A 3OYGA 1YHQT 2RI5A 2LJ0A 1VYVA 2XICA 3J7AF 2DL8A 1KC8U 1E7OA 1VQ7T 4QT7A 1BYMA 2ZZDA 4JDSA 2E1HA 3A8MB 4OVAA 4KRTA 2RB6A 1M8VA 2M1HA 1E6HA 4DOWA 3H0HA 1KIKA 2X4WA 5GAMe 5DLOA 4J9CA 1TTHB 1Y96A 5GANj 3BFMA 3RKXA 3EFSA 2DD5A 2X51A 3CCST 2F1LA 2OTJA 2JNGA 4O6JA 2KAFA 4J6WA 1AEYA 3GP8A 2HSEB 3L2UA 1QCOA 5I2SA 1NZ9A 5CKBA 4F14A 4DEYA 3OYLA 4M77E 2XI9A 2K5LA 3OYEA 3CEYA 4LDUA 1YI2T 4PJOD 1W4SA 1IGQA 2DD4A 2RHXA 1RAAB 1VQOQ 2L89A 5D6YA 3VV0A 2COZA 5GMKh 2EFIA 3M4GA 3HFNA 1ZSZB 1VQ8Q 1HYOA 1UHCA 3HSBA 2JTMA 5CIUA 3GNGA 1OU8A 2FRYA 3EFRA 3D7SB 3EGDB 2FZGB 3WVEB 1M27C 4M7DG 2XK0A 1K0SA 2LCSA 3JCMc 1M9SA 2DBMA 2ZCFB 2OI3A 2XHCA 3CCRA 3H0FA 2M51A 1G8XA 1HXDA 3CCEQ 2L8DA 1M90C 2YLCA 2ZPEB 4HCKA 3M4YA 1GRIA 4CC7A 1W2BS 2X4YA 2RI3A 3RR6A 2NLUA 4JS4A 4VUBA 3DKMA 1BBZA 1PKSA 1BI2A 4RTTA 3BDLA 5FLXE 1UG1A 1GBRA 3OMCA 4M77B 2DEUA 3H9NA 3SEMA 1X2QA 2CREA 2KNBB 3PIOA 2GTJA 4DQ2A 3CCVT 4ANJA 4M75C 3AT1B 1F1BB 2JN0A 1M90U 1LJOA 4C92D 2CH4A 2PVOB 2CS7A 4LXCA 4LDXA 2QQSA 2O4XB 3SWNB 4Q5WA 1GCQA 4C0DB 3QPHA 5GAOn 1R0CB 2RJDA 4C0FA 3JCMQ 1PRLC 1VQNA 2D0NA 1BI3A 3ZFJA 3C4SA 3CCUT 2F2VA 2X3XD 1VQKQ 1KHIA 5KYWB 2LZ6B 4J9FA 3S3NA 2KXCA 4L6V5 5C0MA 3LH5A 3ULRB 1VQPT 4V2SA 1RADB 2A7YA 3OYBA 3I56T 4CC2A 5GMKe 5IT9E 2BZXA 4ZN3A 3RERA 1QW1A 2LCLA 1Z9ZA 5A0LA 4NL3A 2O01E 1VQ9T 4N4GA 2W0ZA 3HKSA 1TWBA 3M59A 4IUVA 5GANg 2Y4XA 5GAN8 1WDXA 4GLKA 1WFWA 1B3QA 4KT0E 2X3WD 1ZSZA 1BCOA 1RAIB 1YP5A 2E65A 3CCLA 5DM7R 4B9XA 1M4ZA 3EGDA 2LT4A 5AT1B 5HK3A 4RUGA 1M2OA 1VYTA 1H641 3OYIA 2RI2A 4RCCA 1VQ4T 1LPLA 1GFDA 1WQ7A 1YJ9A 4RTVA 5GJWB 4OMFB 3DLLA 1VYUA 2YRCA 1W2BP 2HQHA 2FPEA 2X4XA 1JXOA 3NHNA 1ZA1B 3JCMV 2JVVA 1C0MA 4F7UF 1GXIE 1M1FA 1RLPC 1VQLA 4D6WA 2P0PA 3HL8A 3CD6T 2HEQA 2QA4A 4FT2A 2JTFA 4PFPA 4M77A 2HNIA 3EG9B 4B9WA 4BY6B 5FU7B 3CCQT 2PU9B 3GOXA 4LE9A 3UDCA 2M9UA 1JRIA 2E12A 1EX4A 2EBPA 2RK1A 1UDLA 2O31A 1DJ7B 5A0GA 5HK0A 4EMKC 2KT8A 4MDWA 3I55T 2FZKB 1HJDA 3SWNA 2DAQA 2EKOA 1ZUKA 2H3JA 1U1SA 3VS1A 2FYKA 2EYZA 3G1JA 3CCUQ 2QDYB 2B86A 2J7IA 3RMQA 5KYWA 2K3XA 1Q95G 2YT6A 3VUZA 1OI1A 3NPFA 2KRMA 1Q7YU 4JJBA 2O9SA 3GLXA 2OAWA 2HBWA 5CKEA 1FMVA 3JB9I 1Y07A 2ESWA 1W2BA 2JS0A 4JRPA 1WXUA 1BB9A 3OYKA 1SRLA 3CC4T 2D0QB 4YTLA 3FRNA 4E7ZA 1N8RC 1D0ZA 1VQ9Q 2KRNA 1H8KA 4JPBW 2D6FA 1OQKA 3QWYA 5IAYA 4E7IA 1IZ6A 2EJ9A 2YXYA 1YJWT 2CSQA 1YJ9Q 4ZGEB 4QW2A 1UGPB 4MZPA 1AZGB 3M0QA 1QQJA 1D09B 1FXXA 1SHFA 3G4ST 4FCYA 2K57A 4JZ3A 4EMHA 4F7UG 1X2KA 4M7DA 3VS5A 4Y91A 3J81E 2Y4YA 2QXFA 1OZ3A 1TOVA 2QAZA 4JJDA 2E6NA 3ME9A 2QA4Q 1M3AA 2R58A 3Q1JA 1Q86C 5GANh 2CKKA 1CKBA 2CZ7B 4M7AE 1FWZA 2F2XA 1OV3A 2VXFA 5A2QE 4XU0A 4X34A 1NJIR 4JRQA 2RNAA 1X69A 1VQ5T 4FYVB 4JUVA 3JV3A 1PWTA 4BD3A 3CMAT 3N5BB 3RKYA 3VYHB 1XOVA 2D9TA 4P5NA 1K9AA 1LVKA 4R0KA 4FU6A 2C0OA 4DBRA 2JM9A 3PGGA 4CI0C 1YJNQ 1D1CA 3EG9A 1PSEA 3CCQQ 1VQMT 1B7TA 2OAUA 3HP9A 4KBMB 1U8RA 2WSEE 2EQJA 2SRCA 1JXMA 1XNIA 2JTEA 5FWCA 4J7FA 3EGXB 2AHJB 4ZTJA 3QYHB 3OYJA 3META 4AG2C 4M75D 3EG2A 2QYZA 1RL2A 4C8QE 1TG0A 3LWHA 2K6DA 5FROA 1S72T 5KYXB 4FYWB 4MZMA 5LJ3e 3VS6A 5GAN3 1WZOA 4OP0A 3QHSA 4EMGA 2V8KA 1UEBA 1X75C 1SSFA 2KMTA 4M7AB 1TH7A 3ZEHA 2BE7D 1BIBA 3CC2T 4BI4A 4RTZA 5LJ3d 3QXEB 4O5VA 1GCPA 2JXBA 4C5EA 4J8OA 1WIEA 3CBPA 1ACMB 1EZZB 2DKGA 2BIVA 1R77A 1TSFA 1N6AA 3PIPA 3TQ7P 2ZPFB 2AZSA 5HKCA 1I0CA 1K9MR 3JCMX 3G4SQ 4GLMA 5CO7A 4IUTA 1G3YA 2MWPA 4X9CA 1ZUUA 2NUTB 3C0CA 1WJRA 2JJ9A 5DLQE 1ZBJA 2BTTA 4QVZA 5CKHA 2O88A 3CC7A 3H41A 4DBQA 2VB6A 2V1RA 4C8QB 2HQXA 2CP5A 5CK9A 2H3EB 5GAN2 3A8HB 4PLLA 2A28A 1JB0E 1MMAA 1K0XA 2MF2A 2GTOA 1K73R 4RCBA 3JCMb 3F70A 2YWWA 1W70A 1QWEA 2RJCA 3KBGA 4LDYA 5J3BA 5GAN7 2LNVA 8AT1B 2F2WA 1QP2A 4NL2A 1VQOA 2KY9A 1JU5C 2RA2A 1VQ8A 2DZ9A 4DBHA 4XTZA 3I9QA 2EW3A 3C12A 2EGAA 3X26B 5IXFA 1BIAA 1H3HA 3E9GA 1I5LA 4CRIA 1VOMA 2P4TA 3JCMP 1Y0MA 1YBYA 2DJZA 3CCMT 3MP8A 2C06A 1I07A 3EG1A 5LJ3j 4Z02A 3FC3A 2K5FA 3EGXA 1YITT 2LRQA 2PZ1A 2YUNA 3UA7A 1C6VX 4HCBA 2DYBA 2YSQA 2KBTA 5KYXA 1QP3A 2X9HA 1TUCA 3MJXA 5A0DA 1NEBA 2DETA 3OYMA 2FO0A 4M7AA 2A36A 1RAEB 1KFZA 3CC2Q 3OYFA 2V8JA 1MV0B 2VXEA 5L23A
chains in the Genus database with same CATH topology
5J39A 3G71T 4A54A 4ZN1A 4QQDA 1S72A 1D3BA 2RHUA 3L2WA 1QVGS 1KHIA 3M57A 5GMKj 3LX7A 1LNXA 4N4IA 3X28B 3S3NA 3E9FA 3A8LB 3QYGB 4F7UB 4ATOA 3T9NA 4L6V5 2WACA 4BUGA 3LGFA 2GQVA 5C0MA 3SB2A 4QVDA 3OS0A 1VQPT 1KQSS 1NJIC 2DEQA 2B8AA 4V2SA 2A7YA 4PLIA 3OYBA 3I56T 3OYHA 5GAMg 4HT9A 2G3RA 4XU3A 1YHQA 5GAN6 2LVMA 3VJPA 4M7AG 5GMKe 5IT9E 4FSXA 3TEEA 4ZN3A 5GMKm 3RERA 1QW1A 2RHZA 2YRVA 1NPRA 3CC2A 2LCLA 1VQ7A 4JRIA 5AYFA 5A0LA 1I8FA 3E1SA 2RD1A 3RMSA 2PVDB 4C5IA 5GAOl 4XU1A 4NL3A 2DXUA 2O01E 2ZPHB 1VQ9T 4N4GA 1WJSA 4LDVA 5FRNA 3HKSA 3DB4A 1MHNA 4M77D 3LH0A 3RIRA 2GF7A 3M59A 4IUVA 5LJ5f 5GANg 1VQKA 2CZ1B 4XQ3A 3OS5A 4PJOF 2Y4XA 4OGCA 5GAN8 3LLRA 2LCCA 1VQ6T 4GLKA 1JBMA 1UGQB 3HHTB 3OMGA 4KT0E 4PJOC 2VGNA 3CXCS 4ME7A 2PQWA 3QSUA 3QBYA 2WSFE 2M16A 4C8QA 2LQKA 4EMKA 1YJWA 3JCMe 2E65A 3CCLA 4XTXA 5DM7R 2DIQA 1X01A 1M4ZA 4B9XA 4C92A 4E7KA 1M1GA 3MEAA 2DPPB 2LC4A 2LT4A 3OBYA 3BY7A 3JSCA 5HK3A 2HBPA 2EQKA 3FJPA 1XQHA 2DTOA 1O75A 1NJIU 2ZPBB 3BW1A 1H641 3OYIA 3JB9F 4M7AC 3JCMh 2RI2A 3VKIA 4C0ZA 3A5ZB 3M58A 4RCCA 4JRKA 3OYAA 1VIEA 3INZA 5EG2A 4DA4A 1VQ4T 1YIJA 2DZCA 4M78G 1WQ7A 4XK8E 3JCMd 4BE2A 4M75G 3M9QA 2F5TX 1YJ9A 2E64A 1M5Q1 1OZ2A 4A4HA 5FRMA 5LL6S 1N8RU 2RJFA 4OMFB 3V8LA 1RI0A 4NOYA 3DLLA 4C8QG 4BB7A 2X4XA 3JCMV 2EQUA 2JVVA 3OS2A 4XU2A 4J6XA 4F7UF 3A8OB 5CVIA 4J6YA 1GXIE 2Y90A 2X35A 4J5YA 3FB9A 1M1FA 1VQLA 4C0GA 1UGSB 2P0PA 3HL8A 4D6WA 4TVRA 3L2QA 3CCET 3CD6T 2GCXA 2QA4A 4KULA 2BUDA 2KQWA 4FT2A 2FL7A 3PNWC 3V7SA 5GANf 3DLMA 4RMOA 2FHDA 2EAYA 1KQ2A 3SFMA 3EAEA 2JTFA 4M77A 2HNIA 4B9WA 4BY6B 5CKDA 3CPWS 4LD6A 5FU7B 3CMET 3CCQT 2DO3A 1Q82U 2PU9B 3GOXA 3UDCA 5GAN4 4M7DE 2M9UA 3S3OA 1JRIA 2E12A 3CCJA 3RKWA 1VQMA 1Q86U 3LW5E 4ELZC 2RK1A 2RM4A 3QZ9B 4FL6A 4M78E 3TU4K 3PT9A 3JCMJ 1DJ7B 4BE1A 4M75E 5A0GA 1K9MC 1QVFS 5LJ3g 1KG1A 3V8KA 5J26A 4Y28E 5HK0A 4C8QC 3ZBDA 4MDWA 3UT1A 4EMKC 5LJ5e 3I55T 2DVEA 4C92F 3JB9H 1KHCA 2F69A 3SWNA 2DAQA 2EKOA 4PL6A 4C92C 2A3LA 2H3JA 1U1SA 1G3WA 4R55A 1YITA 2FYKA 5KE3A 1N27A 3OYNA 4PJOG 2VC8A 2XKOC 2QDYB 2CZ6B 3VYGA 2XDPA 2XIDA 3OY9A 1HK9A 2KSSA 3RMQA 5LJ5h 2I2LA 2PVGB 1JJ2A 3C94A 2K3XA 3NTKA 2OTJT 3VUZA 4C5HA 5LJ5d 2VUBA 2L5QA 1OI1A 5GAOr 1Q7YU 4A4GA 4F7UA 2FB7A 3GLXA 3M54A 4BI8B 5I21A 3UPUA 5CKEA 2DXBA 4RG2A 1N9RA 3L2RA 3P8HA 2P0QA 3HRUA 3JB9I 4QQGA 1Y07A 3FDRA 1W2BA 1K8AC 4JRPA 2DXCA 3JB9G 2LQ8A 4DOVA 3OYKA 3CC4T 1VQKT 2D0QB 4YTLA 3FRNA 3WXMB 3CC7T 1N8RC 1K9MU 3CCUA 4A53A 2DXTA 1B34B 1Y96B 2D6FA 1VUBA 1PSFA 2IVWA 3G71A 5IAYA 4E7IA 2K2VA 3ASKA 1IZ6A 2EJ9A 3LGLA 2MAMA 3MCAB 2MMPA 3E19A 1YJWT 2RHIA 3NTHA 4J7IA 3CCLT 3URGA 4M77F 1ZQ1A 4ZGEB 4QW2A 5IN1A 4FM4B 1UGPB 4M77C 4MZPA 2JZ2A 1M1KC 5LJ3f 3OYYA 1FXXA 4MMKA 3G4ST 1YCYA 4M7DB 4PJOE 2K57A 4EMHA 4F7UG 3I56A 3CCSA 4M7DA 5GANe 5GAMh 1U1TA 3HRSA 5GMKl 2F5KA 1G5VA 3G7ZA 4OB0B 4OB2B 4Y91A 4M78B 5GAMd 2M0OA 3J81E 2Y4YA 4E7HA 1ZHIA 3PFSA 2XDDA 4M75B 3CCRT 2QXFA 1EIFA 2ZGWA 1X6OA 4XTYA 1OZ3A 2RH2A 1VQOT 5D6XA 3SDZA 1YI2A 1Q82C 3OS1A 2E6NA 3BDUA 3GF5A 3ME9A 1K73U 1QVPA 1VQ9A 3CBMA 2R58A 1I4K1 4J83A 1IREB 3Q1JA 1VQ8T 1Q86C 3L1AA 2CKKA 2L3RA 4UC4A 5GANh 3SWNC 1K8AU 1VQ6A 2CZ7B 2X4JA 1FWZA 4C0DC 4M7AE 5HY6A 1UGRB 5GANd 2QQBA 2VXFA 1MGQA 2E5QA 5C6SA 5A2QE 4XU0A 3OBWA 4OB3B 4X34A 5CAIA 2K4YA 5FU6B 2QTXA 4JRQA 4L59A 5GAOp 1NE8A 3JB9J 3R6OA 5GAMf 3GIBA 3JCMW 1VQ5T 3QO3A 4JUVA 3OW2A 3X20B 4BD3A 3CMAT 3N5BB 1KD1U 4C92G 3RKYA 4JLGA 1QVGA 3C95A 4GY5A 3P8BB 1V29B 3VYHB 2QEXT 1XOVA 2OTLT 2D9TA 4P5NA 1M1KU 4XAXB 1WPYA 2GFUA 3H8ZA 5DY9A 1WGSA 3CXCA 1KQSA 1R8OB 2EQMA 5CKFA 1UB4A 3MP6A 2VYTA 4FU6A 3ER0A 5D6WA 4ZGDB 3G6ET 4HCCA 4N0AA 3M56A 3PGGA 4II1A 3S3MA 2P0KA 3M53A 2JUFA 4CI0C 3QJYA 3CCJT 1Q7YC 4C5GA 1PSEA 1VQMT 3OQ5A 5GMKi 1KC8C 4MZTA 4PNOA 2QQAA 4XTVA 4FIBA 5CQYA 1XTDA 2EJGA 2OAUA 3HP9A 4QVCA 5LJ5j 4KBMB 3KUFA 1U8RA 1BI0A 2WSEE 2R57A 4OF1A 2EQJA 4IUPA 1LOJA 1I81A 3MHXA 1Y7XA 5KE2A 2R5AA 4M7DD 2E70A 1KQ1A 1XNIA 4KUIA 4R56A 3LWIA 3M55A 4J7FA 3QDRB 4PJOB 1ZBXA 4M7DF 3P8DA 3RUXA 2AHJB 4M78D 4EDUA 1WQWA 3CBOA 3QYHB 3OYJA 3META 3CCEA 4ZTJA 4MMLA 1VQNT 3CD6A 4M75D 3MEWA 3TREA 1RL2A 2QQRA 3S6WA 3UWNA 4M78F 4C8QE 3LWHA 3WVDB 5FROA 1S72T 3MO8A 2K3YA 4MZMA 5LJ3e 4C92E 5CR2A 5GAN3 3RESA 1YJNA 2V8IA 1H3ZA 5KCHA 4OP0A 3DB3A 4BACA 3JAME 4EPCA 3QHSA 4EMGA 2V8KA 1UEBA 3OSVA 4IUQA 4M77G 3CMEA 3CCQA 1X75C 2HD0A 2ZPIB 1G3SA 1SSFA 4BDZA 1AHJB 2KMTA 3CCVA 3QKJA 4M7AB 2DTHA 2CZ0B 1Y71A 3HPWA 1TH7A 2RJEA 4LD9K 3OYGA 3ZEHA 3A8GB 1YHQT 2RI5A 4JJNK 1O9SA 4FT4A 2XICA 5GAN5 3J7AF 2LT1A 4ELYC 1BIBA 1KC8U 5LJ3h 5GAMj 3CC2T 4BI4A 4E7LA 3I55A 2EJFA 1VQ7T 1K73C 3J80E 1BYMA 2ZZDA 4JDSA 4JLIA 5LJ3d 2E1HA 4MDXA 3QXEB 4O5VA 3A8MB 3HFOA 4OVAA 4XTWA 3MEUA 4HCZA 3NFCA 3L2VA 5GAOm 2IG0A 2RB6A 1D3BB 1Q81C 1M8VA 3V7CA 4OGEA 2M1HA 4C5EA 4LDWA 4KUDK 4J8OA 4DOWA 3CBPA 2X4WA 5GAMe 5DLOA 4RG8A 2DKGA 4WF2A 1B34A 4A4EA 1Y96A 2BIVA 5GANj 3BFMA 3CC4A 1N6AA 4PKCC 3RKXA 3PIPA 2XDBA 4QQ6A 4IURA 3X25B 3EFSA 2DD5A 2ZPFB 1KD1C 3CCST 2OTJA 3FIFA 4N0AC 2DIGA 2JNGA 2KDSA 4O6JA 2KAFA 4J6WA 5HKCA 3JCMX 1VQPA 4BY6C 4IUUA 2RHYA 2YHTA 3L2UA 3GP8A 5CO7A 4BDYA 5I2SA 1VIFA 4IUTA 1NZ9A 3HRTA 5FU7C 1G3YA 2MI6A 2MWPA 3O8VA 3PMTA 4M77E 2XI9A 2K5LA 3FLGA 4X9CA 5KCOA 3FEOA 3OYLA 3CPWA 3V7RA 3OYEA 1WJRA 3CEYA 4LDUA 1YI2T 4PJOD 3L2ZA 4M78A 5DLQE 1W4SA 3JCMg 2DD4A 4QVZA 2RHXA 5CKHA 4M75A 1YIJT 3CC7A 2L89A 2HAXA 5D6YA 3VV0A 2VV5A 3VUBA 2JOYA 2EFIA 2MWOA 3M4GA 2EYQA 2E6ZA 3HFNA 5GMKh 3OYCA 4XTUA 1YJ9T 3JRZA 1QVFA 3HSBA 2JTMA 4C8QB 5CIUA 3GNGA 2HQXA 4EMKB 3GNFB 5CK9A 5GAN2 5KH6A 1OYXA 4C92B 1Q81U 3EFRA 2DTIA 3A8HB 3CPFA 5L8RE 4PLLA 1JB0E 2E10A 1G3TA 4M7AD 2GFAA 2MF2A 5CCAA 3G4SA 3WVEB 4RCBA 3OB9A 3JCMb 3VU3C 2KVQG 3V8JA 3F70A 3SD4A 3CCMA 3JB9D 4M7AF 1VQLT 1N9SA 3MP1A 2RJCA 2XK0A 5M9OA 1JJ2S 4M7DG 3JCMc 1M9SA 2FVUA 2XU8A 3KBGA 4LDYA 5J3BA 4IKFA 5GAN7 2LNVA 4HA8A 2ZCFB 2QA4T 4N4HA 2XHCA 2PUOB 3CCRA 1QP2A 2DK3A 4NL2A 1VQOA 4HT8A 1HXDA 1NPPA 2L8DA 1M90C 2YLCA 2KY9A 2ZPEB 4L5GA 3OSSC 4F7UE 2RA2A 1VQ8A 1VQ4A 3M4YA 2DZ9A 1W2BS 2X4YA 2EWNA 3PMIA 3QZ5B 4XTZA 2RI3A 2HQEA 2NLUA 3C12A 3H6ZA 3X26B 4JS4A 1BIAA 4VUBA 3E9GA 3DKMA 1I5LA 4CRIA 2YLBA 4HKEA 2LX9A 3OA6A 2XG8D 2P4TA 3QUIA 3JCMP 3X24B 1FX7A 1YBYA 2CYZB 1VQ5A 1BI2A 2DJZA 2KK4A 3CCMT 4A4KA 2LTOA 3MP8A 3CMAA 3MEVA 2C06A 2RK2A 5CQXA 3JCMf 3L42A 5LJ3j 2VGMA 3BDLA 4Z02A 5FLXE 3FC3A 2QEXA 2OTLA 3PTAA 4JS5A 5I2MA 2K5FA 3OMCA 4RKUE 4ZGJB 3OYDA 4PJOA 5CKBA 4M77B 1YITT 2LRQA 2ZPGB 4M7DC 3M5AA 1YJNT 1BI1A 3NTIA 3G6EA 2E41A 2QQ9A 4HCBA 3PIOA 5LJ5g 1BKBA 4M75F 4M78C 1WJQA 4DQ2A 3AHUA 1QP3A 3CCVT 4X9DA 4C8QD 4M75C 5A0DA 2PUKB 4OB1B 2JN0A 1WNLA 1M90U 1LJOA 4A4FA 2WSCE 4C92D 3OYMA 4C8QF 2QI2A 2RO0A 2EIFA 2K5IA 2R5MA 2PVOB 2CS7A 4LDXA 4M7AA 4BI3A 3LYIA 4E7JA 2QQSA 2O4XB 4BE0A 2O4XA 3SWNB 3KXTA 4Q5WA 4C0DB 1P92A 3QPHA 2LDMA 4E47A 5GAOn 2CGHA 3OYFA 2RJDA 4C0FA 2V8JA 4NS5A 3JCMQ 3GPLA 5FU6C 1VQNA 2BKDN 1BI3A 3ZFJA 3QIIA 3C4SA 3QG1A 3QJ6A 3TCJA 2XD0A 3CCUT 4ZTFA 2VXEA 3OW2S 5GAOq
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRI A;  4A54 A;  4PJO D;  1D3B A;  3L2Z A;  4M78 A;  3JCM g;  3RKW A;  4C92 G;  5GMK j;  3RKY A;  4M75 A;  2RM4 A;  1LNX A;  4M78 E;  3JCM J;  5GMK h;  4M75 E;  3M4G A;  4F7U B;  3HFN A;  5LJ3 g;  1WPY A;  4XTU A;  3V8K A;  5DY9 A;  3HSB A;  3SB2 A;  4QVD A;  4C8Q C;  4EMK C;  5LJ5 e;  2DEQ A;  4C8Q B;  4EMK B;  4V2S A;  2DVE A;  4C92 F;  3JB9 H;  5GAM g;  5GAN 2;  4HT9 A;  4XU3 A;  3SWN A;  4N0A A;  5GAN 6;  3PGG A;  4C92 C;  4C92 B;  4M7A G;  5GMK e;  3EFR A;  2DTI A;  1U1S A;  5GMK m;  3RER A;  2E10 A;  2FYK A;  5GMK i;  4M7A D;  4JRI A;  4XTV A;  4PNO A;  4PJO G;  2VC8 A;  1I8F A;  4RCB A;  3JCM b;  5LJ5 j;  2EJG A;  3VU3 C;  4QVC A;  3V8J A;  2RD1 A;  3JB9 D;  5GAO l;  1HK9 A;  4XU1 A;  2DXU A;  4NL3 A;  4M7A F;  1N9S A;  4M7D G;  5LJ5 h;  2I2L A;  3JCM c;  3RIR A;  4M77 D;  5LJ5 f;  1LOJ A;  1I81 A;  5GAN 7;  5GAN g;  4HA8 A;  4XQ3 A;  4M7D D;  4PJO F;  5LJ5 d;  5GAN 8;  1KQ1 A;  4NL2 A;  1JBM A;  5GAO r;  1HXD A;  4F7U A;  4PJO C;  2FB7 A;  4PJO B;  4M7D F;  5I21 A;  3RUX A;  2YLC A;  3QSU A;  4M78 D;  1N9R A;  1WQW A;  4C8Q A;  4EMK A;  4F7U E;  3JCM e;  4MML A;  2E65 A;  2RA2 A;  4XTX A;  4M75 D;  3JB9 I;  2DZ9 A;  2EWN A;  4C8Q E;  1X01 A;  4M78 F;  4C92 A;  4XTZ A;  3JB9 G;  3BY7 A;  1BIA A;  5LJ3 e;  4C92 E;  5GAN 3;  3RES A;  1I5L A;  4OP0 A;  2YLB A;  4HT8 A;  3QHS A;  3FJP A;  4EMG A;  4M77 G;  3JCM P;  3QUI A;  2DTO A;  4A53 A;  1B34 B;  2DXT A;  1Y96 B;  2DJZ A;  3BW1 A;  1H64 1;  2EJ9 A;  3JB9 F;  4M7A C;  4M7A B;  3JCM h;  2DTH A;  4RCC A;  3JCM f;  4JRK A;  1TH7 A;  3INZ A;  5LJ3 j;  2DZC A;  4M78 G;  1WQ7 A;  5GAO q;  4M77 F;  3JCM d;  4M7D E;  5GAN 5;  4M75 G;  4PJO A;  1BIB A;  2E64 A;  4M77 C;  5LJ3 h;  1M5Q 1;  4M77 B;  5GAM j;  5LJ3 f;  2EJF A;  4MMK A;  4M7D C;  4M7D B;  1YCY A;  4PJO E;  2K57 A;  4EMH A;  4F7U G;  4M7D A;  4JLI A;  5LJ3 d;  5GAN e;  5GAM h;  2E1H A;  3V8L A;  1U1T A;  2E41 A;  4NOY A;  3HFO A;  4C8Q G;  4XTW A;  5GMK l;  5GAN 4;  5LJ5 g;  5GAO m;  4M75 F;  4M78 C;  4Y91 A;  2RB6 A;  1D3B B;  4M78 B;  4DQ2 A;  5GAM d;  3AHU A;  3V7C A;  4X9D A;  3JCM V;  1M8V A;  4C8Q D;  4M75 C;  4M75 B;  4XU2 A;  4J6X A;  2ZGW A;  4F7U F;  2JN0 A;  4XTY A;  1WNL A;  4J6Y A;  5GAM e;  1LJO A;  2DKG A;  2Y90 A;  1B34 A;  4J5Y A;  1Y96 A;  3FB9 A;  4WF2 A;  3BFM A;  4C92 D;  3BDU A;  4C8Q F;  5GAN j;  3RKX A;  4M7A A;  1I4K 1;  3EFS A;  3L1A A;  5GAN h;  3FIF A;  3SWN C;  3V7S A;  4N0A C;  3SWN B;  5GAN f;  4M7A E;  2EAY A;  1KQ2 A;  4J6W A;  5GAO n;  2CGH A;  5GAN d;  3JCM X;  2VXF A;  1MGQ A;  4JUV A;  2HNI A;  2YHT A;  4M77 A;  4XU0 A;  3JCM Q;  5CAI A;  2QTX A;  4M77 E;  4X9C A;  5GAO p;  3JB9 J;  5GAM f;  3GIB A;  3JCM W;  3V7R A;  2VXE A;  3QO3 A; 
#chains in the Genus database with same CATH topology
 2FZC B;  2MCN A;  4ZN1 A;  1Q7Y R;  3CC7 Q;  4GBQ A;  1LNX A;  4N4I A;  3A8L B;  3T9N A;  3LGF A;  1KQS S;  3SB2 A;  4QVD A;  1NJI C;  2DEQ A;  2B8A A;  2OX7 A;  4J9H A;  1YHQ A;  3VJP A;  3I5R A;  1JEG A;  1IRX A;  4FSX A;  2A37 A;  2RHZ A;  1VQ7 A;  4JRI A;  5AYF A;  1I8F A;  1UUE A;  3E1S A;  1KJW A;  3RMS A;  2PVD B;  2NUT A;  5GAO l;  4XU1 A;  2DXU A;  1WJS A;  4LDV A;  5FRN A;  3LH0 A;  1VQK A;  2KR3 A;  4XQ3 A;  4PJO F;  1VQ6 T;  2JW4 A;  1UGQ B;  1RAB B;  2A08 A;  2VGN A;  1A0N B;  1SKU B;  4C8Q A;  2LQK A;  2IPO B;  3JCM e;  2DYI A;  2DIQ A;  1GL5 A;  1M1G A;  3OBY A;  3JSC A;  1ABO A;  2EQK A;  2DTO A;  1NJI U;  2ZPB B;  1QCF A;  1Q81 R;  2EGE A;  3VKI A;  4D8K A;  1IXD A;  3A5Z B;  4OMO A;  1X6G A;  4DA4 A;  1YCS B;  2DRM A;  3INZ A;  4M78 G;  4XK8 E;  1I5O B;  1GCQ C;  3JCM d;  3M9Q A;  1YFN A;  1OZ2 A;  4A4H A;  2RJF A;  2PNI A;  1XJW B;  4KH0 B;  4AFU C;  3CCJ Q;  1UJY A;  1Y57 A;  2E4H A;  2HMA A;  1SF9 A;  2D1X A;  5CVI A;  1JQQ A;  1RUW A;  2DMO A;  2X35 A;  4J5Y A;  4ORZ A;  4CC3 A;  1UGS B;  3U23 A;  2HCK A;  3PNW C;  5GAN f;  2EAY A;  1KQ2 A;  2Z0W A;  1YIT Q;  2VKN A;  3EAE A;  3CPW S;  1AWJ A;  4LD6 A;  2JMA A;  2EQI A;  4M7D E;  3S3O A;  4PFZ A;  2EYX A;  4ELZ C;  2QK0 A;  2RM4 A;  4M78 E;  1MNE A;  1IB8 A;  4DBF A;  1K9M C;  1ZSZ C;  3EH2 A;  5LJ3 g;  5J26 A;  2C0T A;  5LJ5 e;  1YHQ Q;  2DVE A;  4C92 F;  2DJQ A;  1KHC A;  1W6X A;  1VQ7 Q;  4R55 A;  4PJL A;  4PJO G;  2XKO C;  2XID A;  1HK9 A;  2DFU A;  2RQT A;  2I2L A;  2PVG B;  3C94 A;  3OW2 P;  2DM1 A;  2LX7 A;  4C5H A;  5LJ5 d;  2PTK A;  2FB7 A;  5I21 A;  3UPU A;  3CCS Q;  1X27 A;  3VS2 A;  3P8H A;  1KQS P;  2YUP A;  3VRY A;  2DXC A;  4EIK A;  1K76 A;  3A98 A;  1TU0 B;  3WXM B;  1YI2 Q;  3NMZ C;  1K9M U;  1AWX A;  2MPX C;  3CCU A;  1VUB A;  1PSF A;  5FWB A;  1M3C A;  3LGL A;  3MCA B;  3KFV A;  4E6R A;  3E19 A;  1VQ6 Q;  1UJ0 A;  2RHI A;  4J7I A;  3CCL T;  4AFZ C;  3URG A;  5IN1 A;  2LJ3 A;  4M77 C;  3REB B;  3OYY A;  4M7D B;  4PJO E;  4F16 A;  3I56 A;  3EG0 A;  3RNJ A;  5GMK l;  4PFO A;  4OB0 B;  1OUL A;  4M78 B;  4X1V A;  4E7H A;  3SHW A;  4OML A;  4XTY A;  2RH2 A;  3SDZ A;  1SHG A;  3OS1 A;  3BDU A;  1VQ9 A;  1K73 U;  1I4K 1;  2J06 A;  1N5Z A;  1U3O A;  3SWN C;  4QKU A;  4C0D C;  5HY6 A;  2RQV A;  2DL7 A;  5ECA A;  2CDT A;  3OBW A;  4OB3 B;  5CAI A;  2K4Y A;  5FU6 B;  2ATC B;  2RQU A;  1NE8 A;  3R6O A;  5GAM f;  3A1P A;  3OW2 A;  3X20 B;  1KD1 U;  2DL5 A;  4C92 G;  3C95 A;  4HVV A;  2QEX T;  2OTL T;  1RLQ C;  1M8M A;  4E7S A;  2GFU A;  3H8Z A;  3TSW A;  1KQS A;  1R8O B;  2KI7 A;  2EQM A;  1UB4 A;  4ZGD B;  3G6E T;  4N0A A;  3M56 A;  3S3M A;  1SSH A;  1ZUY A;  2JUF A;  1Q7Y C;  2QQA A;  4A63 B;  5LJ5 j;  2MK5 A;  3CPW P;  3KUF A;  4LUE A;  3CCV Q;  2R57 A;  4ZNX A;  3QWX X;  5KE2 A;  5I11 A;  4KUI A;  4LN2 A;  4PJO B;  1ZBX A;  1Q82 R;  3RUX A;  1WQW A;  2LNH B;  4MML A;  5I22 A;  3CD6 A;  3MEW A;  3S6W A;  2QQR A;  2HDA A;  4PJN A;  1WHM A;  2DE0 X;  4C92 E;  1YJN A;  1H3Z A;  4J9B A;  4BAC A;  4EPC A;  3CCQ A;  1KSW A;  3OSV A;  3M0R A;  1AHJ B;  2XMF A;  4KGZ B;  2DTH A;  2CZ0 B;  1MMN A;  1O9S A;  1VQP Q;  5GAN 5;  2JM8 A;  2JT4 A;  2LT1 A;  5D7U A;  3I56 Q;  5LJ3 h;  4HVW A;  1IGU A;  3I55 A;  1ZX6 A;  3J80 E;  4XTW A;  1HD3 A;  2IG0 A;  1D3B B;  1Q81 C;  3V7C A;  4OGE A;  1SG5 A;  1T3S A;  4J9E A;  4RG8 A;  2XDB A;  2J6K A;  4IUR A;  3X25 B;  2DIG A;  2KDS A;  2DRK A;  4BY6 C;  2RHY A;  2ECZ A;  4BDY A;  5KYN A;  5FU7 C;  1SEM A;  3HRT A;  2MI6 A;  3O8V A;  5IHK A;  3CPW A;  3FEO A;  3V7R A;  1T0H A;  2NYS A;  3PE0 A;  2L3S A;  3L2Z A;  4M78 A;  3JCM g;  1X6B A;  1YIJ T;  6AT1 B;  2HAX A;  1M2V B;  3VUB A;  2JOY A;  4WCI A;  5IHN A;  3OYC A;  4XTU A;  2D8J A;  1VQ4 Q;  3GNF B;  2YUQ A;  1OYX A;  4C92 B;  1Q81 U;  2DTI A;  4OMN A;  3CPF A;  4AG1 C;  2GFA A;  3G4S A;  2J05 A;  4B6M A;  2KVQ G;  3JB9 D;  2KE9 A;  3SD4 A;  2D8H A;  2QGG A;  4KGX B;  1N9S A;  5M9O A;  1WYX A;  2XU8 A;  2QEX Q;  4HA8 A;  2CP3 A;  1AVZ C;  2OTL Q;  2DK3 A;  1NPP A;  2LP5 A;  3CD6 Q;  2E3H A;  2OJ2 A;  4L5G A;  4F7U E;  4FYY B;  2EWN A;  3PMI A;  1QMC A;  2HQE A;  3H6Z A;  1TXQ A;  2YLB A;  2MOX A;  3QUI A;  3X24 B;  1FX7 A;  1VQ5 A;  2CYZ B;  2KK4 A;  2LTO A;  3CMA A;  3MEV A;  2J6F A;  3L42 A;  2VGM A;  3PTA A;  5I2M A;  4RKU E;  3I55 Q;  4PJO A;  3OYD A;  2ZPG B;  1LCK A;  1BI1 A;  4M4Z A;  2E41 A;  2HSP A;  4KGV B;  2DF6 A;  5LJ5 g;  4M75 F;  1WJQ A;  2HL3 A;  1IHW A;  2AKL A;  4J9I A;  5GJV B;  1WNL A;  4A4F A;  2EIF A;  2K5I A;  1ZA2 B;  4BI3 A;  3LYI A;  4E7J A;  4BE0 A;  2LDM A;  2CGH A;  2RMO A;  4NS5 A;  4ZTF A;  2K79 A;  3QII A;  3QJ6 A;  1WXT A;  2XD0 A;  1WX6 A;  5GAO q;  3G71 T;  4A54 A;  4QQD A;  3CC4 Q;  1TS9 A;  1S72 A;  1D3B A;  1EFN A;  3M57 A;  3LX7 A;  3X28 B;  4HXJ A;  9ATC B;  3QYG B;  4F7U B;  4ATO A;  1YJW Q;  4Z8A A;  4HT9 A;  4FYX B;  4XU3 A;  5GAN 6;  2LVM A;  3TEE A;  2YRV A;  3CC2 A;  2ZPH B;  1SPK A;  4JS5 A;  3DB4 A;  4M77 D;  1YIJ Q;  1M2V A;  1JBM A;  3HHT B;  3CXC S;  3PVL A;  4ESR A;  3HTR A;  4XTX A;  2LJ1 A;  4C92 A;  4E7K A;  3MEA A;  2C0I A;  2LC4 A;  1GBQ A;  1FMW A;  1VQ5 Q;  2HBP A;  4Z88 A;  2BZY A;  1XQH A;  1QCN A;  4LNP A;  2E5K A;  3CMA Q;  1O75 A;  1R0B G;  4IIO A;  4M7A C;  3JCM h;  4C0Z A;  3M58 A;  4JRK A;  1VIE A;  2LQW A;  2MIO A;  4RTY A;  2L3P A;  4AFS C;  4BE2 A;  2GQI A;  4M75 G;  2F5T X;  3EHQ A;  2E64 A;  3IQL A;  4F17 A;  5LL6 S;  3VRZ A;  1KD1 R;  3V8L A;  1RI0 A;  4NOY A;  3EG3 A;  1VQM Q;  1K4U S;  1NLP C;  1OPK A;  2EQU A;  2AKK A;  2V1Q A;  3OS2 A;  4XU2 A;  4J6X A;  1C1A A;  1W1F A;  2Y90 A;  3FB9 A;  1OU9 A;  4C0G A;  3VS0 A;  4TVR A;  2DVJ A;  3L2Q A;  3CCE T;  2GCX A;  2YRD A;  2BUD A;  2KQW A;  3OA6 A;  3V7S A;  2FHD A;  2AZV A;  1OOT A;  5CKD A;  2NUP A;  3CME T;  1S72 Q;  1Q82 U;  1YWO A;  1WA7 A;  3CCJ A;  3RKW A;  2DA9 A;  3QZ9 B;  4FL6 A;  3TU4 K;  3PT9 A;  3JCM J;  2O9V A;  4BE1 A;  2LMJ A;  4M75 E;  1QVF S;  1KG1 A;  3V8K A;  4Y28 E;  4C8Q C;  3ZBD A;  1D1B A;  2A3L A;  4PJJ A;  1J3T A;  2E3I A;  1YIT A;  4OMP A;  2DL4 A;  2VC8 A;  3MKD A;  3VS4 A;  3VYG A;  3VS7 A;  2KSS A;  5LJ5 h;  2K2M A;  1V1C A;  3NTK A;  1D0Y A;  2OTJ T;  2L5Q A;  2CT3 A;  2KEA A;  5GAO r;  2RQW A;  4F7U A;  2H8H A;  4BI8 B;  2BZ8 A;  2DXB A;  4RG2 A;  2AIR B;  2P0Q A;  3HRU A;  3FDR A;  2LQ8 A;  4DOV A;  1ZLM A;  1VQK T;  1B34 B;  2DNU A;  2KXD A;  2CH4 W;  2K2V A;  3ASK A;  3NTH A;  1UHF A;  1YN8 A;  1PHT A;  1U5S A;  2YDL A;  5LJ3 f;  3CXC P;  4OMM A;  3CCS A;  1U1T A;  3HRS A;  2F5K A;  3G7Z A;  1WHK A;  5GAM d;  2M0O A;  1M30 A;  1ZHI A;  3PFS A;  4M75 B;  3CCR T;  1PC0 A;  2ZGW A;  1X6O A;  2QGF B;  2AT1 B;  5D6X A;  1YI2 A;  1AWW A;  2JS2 A;  3GF5 A;  3UF4 A;  1WLP B;  3CBM A;  4J83 A;  1IRE B;  1MMG A;  2L3R A;  4UC4 A;  2COW A;  1VQ6 A;  1B07 A;  4KH1 B;  2QQB A;  5C6S A;  2FRW A;  3EGU A;  1UFF A;  2KYM A;  2QTX A;  4L59 A;  5GAO p;  3JB9 J;  3GIB A;  3QO3 A;  1PRM C;  5KYY B;  2ROL A;  4J9D A;  4JLG A;  4GY5 A;  1TUG B;  1N8R R;  2GGR A;  3CCM Q;  2GNC A;  2HL5 C;  2JMC A;  5CKF A;  2VYT A;  3ER0 A;  2P0K A;  3M53 A;  3CME Q;  5GMK i;  4MZT A;  4PNO A;  4FIB A;  5CQY A;  1XTD A;  1PM3 A;  1NEG A;  1BI0 A;  1I1J A;  1NYG A;  4IUP A;  2EYY A;  1I81 A;  3MHX A;  1Y7X A;  2R5A A;  3FJ5 A;  1KQ1 A;  4R56 A;  3M55 A;  3CXC A;  4EDU A;  1VQN T;  1QVF P;  1Q86 R;  2DIL A;  3UWN A;  2FG0 A;  1T3L A;  4FW2 A;  3RDV A;  3RES A;  2V8I A;  5KCH A;  3DB3 A;  2BE9 B;  2COY A;  1QKX A;  2ZPI B;  3I35 A;  1RAF B;  3CCV A;  2OTJ Q;  3HPW A;  2RJE A;  4LD9 K;  3A8G B;  2HKN A;  4JJN K;  4FT4 A;  1U06 A;  1PKT A;  2M0Y A;  2LQN A;  2EPD A;  4ELY C;  2O2O A;  5GAM j;  4E7L A;  2EJF A;  1K73 C;  4JLI A;  4MDX A;  3HFO A;  3MEU A;  4HCZ A;  3NFC A;  3L2V A;  5GAO m;  4HVU A;  4LDW A;  4KUD K;  4WF2 A;  1B34 A;  4A4E A;  4PKC C;  1OPL A;  1BU1 A;  1S1N A;  4QQ6 A;  1KD1 C;  5IHI A;  3FIF A;  4N0A C;  1CSK A;  2G6F X;  1UGV A;  1AWO A;  4D8D A;  1VQP A;  2VAS A;  4IUU A;  2YHT A;  1VIF A;  2CSI A;  3PMT A;  5KCO A;  2L3Q A;  3FLG A;  1QKW A;  2QDL A;  1M3B A;  3CCR Q;  4M75 A;  2GBQ A;  5KYU B;  2VV5 A;  2DL3 A;  2MWO A;  2EYQ A;  2E6Z A;  1YJ9 T;  3JRZ A;  1QVF A;  4EMK B;  4AT1 B;  5KH6 A;  1IO6 A;  1MUZ A;  1RAH B;  1NLO C;  5L8R E;  2E10 A;  1G3T A;  2M02 A;  4M7A D;  5CCA A;  3OB9 A;  3VU3 C;  1MND A;  3V8J A;  1FMK A;  4M7A F;  2NWM A;  5KYY A;  3MP1 A;  1K8A R;  1VQL T;  1JJ2 S;  2FVU A;  4IKF A;  1OX8 A;  2QA4 T;  4N4H A;  2PUO B;  7AT1 B;  3E2U A;  3M0U A;  1RAC B;  3OSS C;  4E2F B;  1VQ4 A;  1WXB A;  3M0P A;  3QZ5 B;  1QLY A;  1M1K R;  2KT1 A;  4HKE A;  2LX9 A;  2XG8 D;  1TUD A;  2YUO A;  1OX9 A;  2ED1 A;  4A4K A;  2RK2 A;  5CQX A;  3JCM f;  2QG9 B;  2QEX A;  2OTL A;  4ZGJ B;  2L2P A;  2SEM A;  1VQN Q;  4CC4 B;  4M7D C;  3M5A A;  1YJN T;  1MV3 A;  3NTI A;  3G6E A;  2QQ9 A;  1BKB A;  4M78 C;  3AHU A;  2DBK A;  4X9D A;  3GBQ A;  4C8Q D;  2PUK B;  4OB1 B;  3R6N A;  3O5Z A;  2DX1 A;  2WSC E;  4C8Q F;  2QI2 A;  2RO0 A;  3EFO B;  2R5M A;  3PVQ A;  4RTU A;  2RPN A;  3REA B;  2O4X A;  3KXT A;  1P92 A;  4E47 A;  1G2B A;  2EVR A;  4IIM A;  3GPL A;  5FU6 C;  2BKD N;  3QG1 A;  1AOJ A;  3TCJ A;  3OW2 S;  5J39 A;  2ED0 A;  2RHU A;  2IIM A;  3L2W A;  1QVG S;  5GMK j;  1KC8 R;  1X43 A;  3E9F A;  2I0N A;  2VWF A;  2WAC A;  4BUG A;  2GQV A;  3CCL Q;  3OS0 A;  4PLI A;  3OYH A;  5GAM g;  4AMC A;  2G3R A;  2CP2 A;  4M7A G;  5GMK m;  1NPR A;  2CP6 A;  2V26 A;  4PJM A;  2RD1 A;  4C5I A;  2L0A A;  1MMD A;  1WHH A;  3RIR A;  1MHN A;  1PG5 B;  5LJ5 f;  2GF7 A;  3CC4 A;  2CZ1 B;  3OS5 A;  4OGC A;  1BK2 A;  2LCC A;  3LLR A;  5KYU A;  3OMG A;  4PJO C;  4ME7 A;  2K9G A;  2PQW A;  1NG2 A;  3QSU A;  3QBY A;  2WSF E;  2J6O A;  2M16 A;  4EMK A;  3M0S A;  2MYS A;  1YJW A;  1H92 A;  1D1A A;  1X01 A;  2DPP B;  3BY7 A;  3UA6 A;  1WI7 A;  1HSQ A;  3FJP A;  1VQL Q;  1IHV A;  2RF0 A;  3BW1 A;  3JB9 F;  2HZY A;  3OYA A;  1JO8 A;  1JJ2 P;  5EG2 A;  1YIJ A;  2DZC A;  2QTV A;  1NYF A;  1T0J A;  1M5Q 1;  5FRM A;  3G6E Q;  1N8R U;  2DLP A;  1CKA A;  2CP0 A;  3UAT A;  4C8Q G;  1E6G A;  4BB7 A;  4RTW A;  2K7A A;  3A8O B;  4J6Y A;  1Z9Q A;  1RI9 A;  1BCM A;  1PNJ A;  4KUL A;  2FL7 A;  4JJC A;  4RMO A;  3DLM A;  1YNZ A;  1D0X A;  1WHL A;  3H0I A;  4JZ4 A;  3SFM A;  3EHR A;  2NUP B;  3MPU B;  3NGP A;  2DO3 A;  5GAN 4;  3ZL7 C;  1Q86 U;  1VQM A;  4F04 B;  3LW5 E;  4DEX A;  1ABQ A;  4OMQ A;  2ROT A;  1SRM A;  3THK A;  3EFO A;  3UT1 A;  3JB9 H;  2NUZ A;  2F69 A;  1AZE A;  2W10 A;  1NM7 A;  4LUD A;  4PL6 A;  4C92 C;  1WHG A;  5HCK A;  1M90 R;  1G3W A;  1PD0 A;  5KE3 A;  1N27 A;  1UEC A;  3OYN A;  1K1Z A;  2CZ6 B;  2XDP A;  1ARK A;  3OY9 A;  2CUB A;  4Y92 A;  1JJ2 A;  2K3B A;  2P84 A;  1QVG P;  2VUB A;  2FPD A;  4A4G A;  3M54 A;  1N9R A;  3BE3 A;  3L2R A;  4J9G A;  3I5S A;  3EH1 A;  4QQG A;  2FEI A;  1K8A C;  3JB9 G;  4AFQ C;  3CC7 T;  4A53 A;  2DXT A;  1Y96 B;  3G71 A;  2IVW A;  4RTX A;  2MAM A;  2ABL A;  2MMP A;  1YWP A;  4M77 F;  1ZQ1 A;  2QAS A;  4FM4 B;  2JZ2 A;  1M1K C;  4MMK A;  1YCY A;  2RN8 A;  5GAN e;  5GAM h;  1PD1 A;  2EYW A;  2CUD A;  1G5V A;  4OB2 B;  2XDD A;  1EIF A;  1VQO T;  1Q82 C;  1QVP A;  2FPF A;  1VQ8 T;  2EKH A;  3L1A A;  1WHJ A;  1K8A U;  2X4J A;  2RQR A;  1AT1 B;  1UGR B;  5GAN d;  1MGQ A;  2E5Q A;  3QDF A;  1FYN A;  2ENM A;  2A0F B;  3JCM W;  1UTI A;  2HKQ B;  1PCX A;  4FSS A;  2AK5 A;  1QVG A;  1RAG B;  3P8B B;  1V29 B;  2KGT A;  2CT4 A;  3TVT A;  1M1K U;  1KK7 A;  1NBE B;  2ZAE A;  1WPY A;  4XAX B;  5FW9 A;  5DY9 A;  1WGS A;  2P4R A;  1AD5 A;  1V76 A;  3MP6 A;  5D6W A;  4HCC A;  4II1 A;  1UE9 A;  5EC7 A;  3QJY A;  2DER A;  1G83 A;  3CCJ T;  5IH2 A;  4C5G A;  4WTO B;  3OQ5 A;  1KC8 C;  4XTV A;  1QWF A;  2EJG A;  3M0T A;  4QVC A;  1OEB A;  2VVK A;  3CQT A;  2KYB A;  4OF1 A;  3RBB B;  1LOJ A;  4M7D D;  2E70 A;  1VA7 A;  4K11 A;  3LWI A;  3QDR B;  4M7D F;  3P8D A;  2KRO A;  2CP7 A;  4M78 D;  8ATC B;  3CBO A;  3TSZ A;  3CCM A;  4PK4 A;  3CCE A;  1GFC A;  3TRE A;  4M78 F;  4FW1 A;  3WVD B;  5IXB A;  3MO8 A;  2K3Y A;  5CR2 A;  1ZSG A;  2KRS A;  4HT8 A;  3JAM E;  3CME A;  3G71 Q;  4IUQ A;  4M77 G;  2HD0 A;  3VS3 A;  1G3S A;  4BDZ A;  2EGC A;  3QKJ A;  1Y71 A;  4Z89 A;  3OYG A;  1YHQ T;  2RI5 A;  2LJ0 A;  1VYV A;  2XIC A;  3J7A F;  2DL8 A;  1KC8 U;  1E7O A;  1VQ7 T;  4QT7 A;  1BYM A;  2ZZD A;  4JDS A;  2E1H A;  3A8M B;  4OVA A;  4KRT A;  2RB6 A;  1M8V A;  2M1H A;  1E6H A;  4DOW A;  3H0H A;  1KIK A;  2X4W A;  5GAM e;  5DLO A;  4J9C A;  1TTH B;  1Y96 A;  5GAN j;  3BFM A;  3RKX A;  3EFS A;  2DD5 A;  2X51 A;  3CCS T;  2F1L A;  2OTJ A;  2JNG A;  4O6J A;  2KAF A;  4J6W A;  1AEY A;  3GP8 A;  2HSE B;  3L2U A;  1QCO A;  5I2S A;  1NZ9 A;  5CKB A;  4F14 A;  4DEY A;  3OYL A;  4M77 E;  2XI9 A;  2K5L A;  3OYE A;  3CEY A;  4LDU A;  1YI2 T;  4PJO D;  1W4S A;  1IGQ A;  2DD4 A;  2RHX A;  1RAA B;  1VQO Q;  2L89 A;  5D6Y A;  3VV0 A;  2COZ A;  5GMK h;  2EFI A;  3M4G A;  3HFN A;  1ZSZ B;  1VQ8 Q;  1HYO A;  1UHC A;  3HSB A;  2JTM A;  5CIU A;  3GNG A;  1OU8 A;  2FRY A;  3EFR A;  3D7S B;  3EGD B;  2FZG B;  3WVE B;  1M27 C;  4M7D G;  2XK0 A;  1K0S A;  2LCS A;  3JCM c;  1M9S A;  2DBM A;  2ZCF B;  2OI3 A;  2XHC A;  3CCR A;  3H0F A;  2M51 A;  1G8X A;  1HXD A;  3CCE Q;  2L8D A;  1M90 C;  2YLC A;  2ZPE B;  4HCK A;  3M4Y A;  1GRI A;  4CC7 A;  1W2B S;  2X4Y A;  2RI3 A;  3RR6 A;  2NLU A;  4JS4 A;  4VUB A;  3DKM A;  1BBZ A;  1PKS A;  1BI2 A;  4RTT A;  3BDL A;  5FLX E;  1UG1 A;  1GBR A;  3OMC A;  4M77 B;  2DEU A;  3H9N A;  3SEM A;  1X2Q A;  2CRE A;  2KNB B;  3PIO A;  2GTJ A;  4DQ2 A;  3CCV T;  4ANJ A;  4M75 C;  3AT1 B;  1F1B B;  2JN0 A;  1M90 U;  1LJO A;  4C92 D;  2CH4 A;  2PVO B;  2CS7 A;  4LXC A;  4LDX A;  2QQS A;  2O4X B;  3SWN B;  4Q5W A;  1GCQ A;  4C0D B;  3QPH A;  5GAO n;  1R0C B;  2RJD A;  4C0F A;  3JCM Q;  1PRL C;  1VQN A;  2D0N A;  1BI3 A;  3ZFJ A;  3C4S A;  3CCU T;  2F2V A;  2X3X D;  1VQK Q;  1KHI A;  5KYW B;  2LZ6 B;  4J9F A;  3S3N A;  2KXC A;  4L6V 5;  5C0M A;  3LH5 A;  3ULR B;  1VQP T;  4V2S A;  1RAD B;  2A7Y A;  3OYB A;  3I56 T;  4CC2 A;  5GMK e;  5IT9 E;  2BZX A;  4ZN3 A;  3RER A;  1QW1 A;  2LCL A;  1Z9Z A;  5A0L A;  4NL3 A;  2O01 E;  1VQ9 T;  4N4G A;  2W0Z A;  3HKS A;  1TWB A;  3M59 A;  4IUV A;  5GAN g;  2Y4X A;  5GAN 8;  1WDX A;  4GLK A;  1WFW A;  1B3Q A;  4KT0 E;  2X3W D;  1ZSZ A;  1BCO A;  1RAI B;  1YP5 A;  2E65 A;  3CCL A;  5DM7 R;  4B9X A;  1M4Z A;  3EGD A;  2LT4 A;  5AT1 B;  5HK3 A;  4RUG A;  1M2O A;  1VYT A;  1H64 1;  3OYI A;  2RI2 A;  4RCC A;  1VQ4 T;  1LPL A;  1GFD A;  1WQ7 A;  1YJ9 A;  4RTV A;  5GJW B;  4OMF B;  3DLL A;  1VYU A;  2YRC A;  1W2B P;  2HQH A;  2FPE A;  2X4X A;  1JXO A;  3NHN A;  1ZA1 B;  3JCM V;  2JVV A;  1C0M A;  4F7U F;  1GXI E;  1M1F A;  1RLP C;  1VQL A;  4D6W A;  2P0P A;  3HL8 A;  3CD6 T;  2HEQ A;  2QA4 A;  4FT2 A;  2JTF A;  4PFP A;  4M77 A;  2HNI A;  3EG9 B;  4B9W A;  4BY6 B;  5FU7 B;  3CCQ T;  2PU9 B;  3GOX A;  4LE9 A;  3UDC A;  2M9U A;  1JRI A;  2E12 A;  1EX4 A;  2EBP A;  2RK1 A;  1UDL A;  2O31 A;  1DJ7 B;  5A0G A;  5HK0 A;  4EMK C;  2KT8 A;  4MDW A;  3I55 T;  2FZK B;  1HJD A;  3SWN A;  2DAQ A;  2EKO A;  1ZUK A;  2H3J A;  1U1S A;  3VS1 A;  2FYK A;  2EYZ A;  3G1J A;  3CCU Q;  2QDY B;  2B86 A;  2J7I A;  3RMQ A;  5KYW A;  2K3X A;  1Q95 G;  2YT6 A;  3VUZ A;  1OI1 A;  3NPF A;  2KRM A;  1Q7Y U;  4JJB A;  2O9S A;  3GLX A;  2OAW A;  2HBW A;  5CKE A;  1FMV A;  3JB9 I;  1Y07 A;  2ESW A;  1W2B A;  2JS0 A;  4JRP A;  1WXU A;  1BB9 A;  3OYK A;  1SRL A;  3CC4 T;  2D0Q B;  4YTL A;  3FRN A;  4E7Z A;  1N8R C;  1D0Z A;  1VQ9 Q;  2KRN A;  1H8K A;  4JPB W;  2D6F A;  1OQK A;  3QWY A;  5IAY A;  4E7I A;  1IZ6 A;  2EJ9 A;  2YXY A;  1YJW T;  2CSQ A;  1YJ9 Q;  4ZGE B;  4QW2 A;  1UGP B;  4MZP A;  1AZG B;  3M0Q A;  1QQJ A;  1D09 B;  1FXX A;  1SHF A;  3G4S T;  4FCY A;  2K57 A;  4JZ3 A;  4EMH A;  4F7U G;  1X2K A;  4M7D A;  3VS5 A;  4Y91 A;  3J81 E;  2Y4Y A;  2QXF A;  1OZ3 A;  1TOV A;  2QAZ A;  4JJD A;  2E6N A;  3ME9 A;  2QA4 Q;  1M3A A;  2R58 A;  3Q1J A;  1Q86 C;  5GAN h;  2CKK A;  1CKB A;  2CZ7 B;  4M7A E;  1FWZ A;  2F2X A;  1OV3 A;  2VXF A;  5A2Q E;  4XU0 A;  4X34 A;  1NJI R;  4JRQ A;  2RNA A;  1X69 A;  1VQ5 T;  4FYV B;  4JUV A;  3JV3 A;  1PWT A;  4BD3 A;  3CMA T;  3N5B B;  3RKY A;  3VYH B;  1XOV A;  2D9T A;  4P5N A;  1K9A A;  1LVK A;  4R0K A;  4FU6 A;  2C0O A;  4DBR A;  2JM9 A;  3PGG A;  4CI0 C;  1YJN Q;  1D1C A;  3EG9 A;  1PSE A;  3CCQ Q;  1VQM T;  1B7T A;  2OAU A;  3HP9 A;  4KBM B;  1U8R A;  2WSE E;  2EQJ A;  2SRC A;  1JXM A;  1XNI A;  2JTE A;  5FWC A;  4J7F A;  3EGX B;  2AHJ B;  4ZTJ A;  3QYH B;  3OYJ A;  3MET A;  4AG2 C;  4M75 D;  3EG2 A;  2QYZ A;  1RL2 A;  4C8Q E;  1TG0 A;  3LWH A;  2K6D A;  5FRO A;  1S72 T;  5KYX B;  4FYW B;  4MZM A;  5LJ3 e;  3VS6 A;  5GAN 3;  1WZO A;  4OP0 A;  3QHS A;  4EMG A;  2V8K A;  1UEB A;  1X75 C;  1SSF A;  2KMT A;  4M7A B;  1TH7 A;  3ZEH A;  2BE7 D;  1BIB A;  3CC2 T;  4BI4 A;  4RTZ A;  5LJ3 d;  3QXE B;  4O5V A;  1GCP A;  2JXB A;  4C5E A;  4J8O A;  1WIE A;  3CBP A;  1ACM B;  1EZZ B;  2DKG A;  2BIV A;  1R77 A;  1TSF A;  1N6A A;  3PIP A;  3TQ7 P;  2ZPF B;  2AZS A;  5HKC A;  1I0C A;  1K9M R;  3JCM X;  3G4S Q;  4GLM A;  5CO7 A;  4IUT A;  1G3Y A;  2MWP A;  4X9C A;  1ZUU A;  2NUT B;  3C0C A;  1WJR A;  2JJ9 A;  5DLQ E;  1ZBJ A;  2BTT A;  4QVZ A;  5CKH A;  2O88 A;  3CC7 A;  3H41 A;  4DBQ A;  2VB6 A;  2V1R A;  4C8Q B;  2HQX A;  2CP5 A;  5CK9 A;  2H3E B;  5GAN 2;  3A8H B;  4PLL A;  2A28 A;  1JB0 E;  1MMA A;  1K0X A;  2MF2 A;  2GTO A;  1K73 R;  4RCB A;  3JCM b;  3F70 A;  2YWW A;  1W70 A;  1QWE A;  2RJC A;  3KBG A;  4LDY A;  5J3B A;  5GAN 7;  2LNV A;  8AT1 B;  2F2W A;  1QP2 A;  4NL2 A;  1VQO A;  2KY9 A;  1JU5 C;  2RA2 A;  1VQ8 A;  2DZ9 A;  4DBH A;  4XTZ A;  3I9Q A;  2EW3 A;  3C12 A;  2EGA A;  3X26 B;  5IXF A;  1BIA A;  1H3H A;  3E9G A;  1I5L A;  4CRI A;  1VOM A;  2P4T A;  3JCM P;  1Y0M A;  1YBY A;  2DJZ A;  3CCM T;  3MP8 A;  2C06 A;  1I07 A;  3EG1 A;  5LJ3 j;  4Z02 A;  3FC3 A;  2K5F A;  3EGX A;  1YIT T;  2LRQ A;  2PZ1 A;  2YUN A;  3UA7 A;  1C6V X;  4HCB A;  2DYB A;  2YSQ A;  2KBT A;  5KYX A;  1QP3 A;  2X9H A;  1TUC A;  3MJX A;  5A0D A;  1NEB A;  2DET A;  3OYM A;  2FO0 A;  4M7A A;  2A36 A;  1RAE B;  1KFZ A;  3CC2 Q;  3OYF A;  2V8J A;  1MV0 B;  2VXE A;  5L23 A; 
#chains in the Genus database with same CATH homology
 5J39 A;  3G71 T;  4A54 A;  4ZN1 A;  4QQD A;  1S72 A;  1D3B A;  2RHU A;  3L2W A;  1QVG S;  1KHI A;  3M57 A;  5GMK j;  3LX7 A;  1LNX A;  4N4I A;  3X28 B;  3S3N A;  3E9F A;  3A8L B;  3QYG B;  4F7U B;  4ATO A;  3T9N A;  4L6V 5;  2WAC A;  4BUG A;  3LGF A;  2GQV A;  5C0M A;  3SB2 A;  4QVD A;  3OS0 A;  1VQP T;  1KQS S;  1NJI C;  2DEQ A;  2B8A A;  4V2S A;  2A7Y A;  4PLI A;  3OYB A;  3I56 T;  3OYH A;  5GAM g;  4HT9 A;  2G3R A;  4XU3 A;  1YHQ A;  5GAN 6;  2LVM A;  3VJP A;  4M7A G;  5GMK e;  5IT9 E;  4FSX A;  3TEE A;  4ZN3 A;  5GMK m;  3RER A;  1QW1 A;  2RHZ A;  2YRV A;  1NPR A;  3CC2 A;  2LCL A;  1VQ7 A;  4JRI A;  5AYF A;  5A0L A;  1I8F A;  3E1S A;  2RD1 A;  3RMS A;  2PVD B;  4C5I A;  5GAO l;  4XU1 A;  4NL3 A;  2DXU A;  2O01 E;  2ZPH B;  1VQ9 T;  4N4G A;  1WJS A;  4LDV A;  5FRN A;  3HKS A;  3DB4 A;  1MHN A;  4M77 D;  3LH0 A;  3RIR A;  2GF7 A;  3M59 A;  4IUV A;  5LJ5 f;  5GAN g;  1VQK A;  2CZ1 B;  4XQ3 A;  3OS5 A;  4PJO F;  2Y4X A;  4OGC A;  5GAN 8;  3LLR A;  2LCC A;  1VQ6 T;  4GLK A;  1JBM A;  1UGQ B;  3HHT B;  3OMG A;  4KT0 E;  4PJO C;  2VGN A;  3CXC S;  4ME7 A;  2PQW A;  3QSU A;  3QBY A;  2WSF E;  2M16 A;  4C8Q A;  2LQK A;  4EMK A;  1YJW A;  3JCM e;  2E65 A;  3CCL A;  4XTX A;  5DM7 R;  2DIQ A;  1X01 A;  1M4Z A;  4B9X A;  4C92 A;  4E7K A;  1M1G A;  3MEA A;  2DPP B;  2LC4 A;  2LT4 A;  3OBY A;  3BY7 A;  3JSC A;  5HK3 A;  2HBP A;  2EQK A;  3FJP A;  1XQH A;  2DTO A;  1O75 A;  1NJI U;  2ZPB B;  3BW1 A;  1H64 1;  3OYI A;  3JB9 F;  4M7A C;  3JCM h;  2RI2 A;  3VKI A;  4C0Z A;  3A5Z B;  3M58 A;  4RCC A;  4JRK A;  3OYA A;  1VIE A;  3INZ A;  5EG2 A;  4DA4 A;  1VQ4 T;  1YIJ A;  2DZC A;  4M78 G;  1WQ7 A;  4XK8 E;  3JCM d;  4BE2 A;  4M75 G;  3M9Q A;  2F5T X;  1YJ9 A;  2E64 A;  1M5Q 1;  1OZ2 A;  4A4H A;  5FRM A;  5LL6 S;  1N8R U;  2RJF A;  4OMF B;  3V8L A;  1RI0 A;  4NOY A;  3DLL A;  4C8Q G;  4BB7 A;  2X4X A;  3JCM V;  2EQU A;  2JVV A;  3OS2 A;  4XU2 A;  4J6X A;  4F7U F;  3A8O B;  5CVI A;  4J6Y A;  1GXI E;  2Y90 A;  2X35 A;  4J5Y A;  3FB9 A;  1M1F A;  1VQL A;  4C0G A;  1UGS B;  2P0P A;  3HL8 A;  4D6W A;  4TVR A;  3L2Q A;  3CCE T;  3CD6 T;  2GCX A;  2QA4 A;  4KUL A;  2BUD A;  2KQW A;  4FT2 A;  2FL7 A;  3PNW C;  3V7S A;  5GAN f;  3DLM A;  4RMO A;  2FHD A;  2EAY A;  1KQ2 A;  3SFM A;  3EAE A;  2JTF A;  4M77 A;  2HNI A;  4B9W A;  4BY6 B;  5CKD A;  3CPW S;  4LD6 A;  5FU7 B;  3CME T;  3CCQ T;  2DO3 A;  1Q82 U;  2PU9 B;  3GOX A;  3UDC A;  5GAN 4;  4M7D E;  2M9U A;  3S3O A;  1JRI A;  2E12 A;  3CCJ A;  3RKW A;  1VQM A;  1Q86 U;  3LW5 E;  4ELZ C;  2RK1 A;  2RM4 A;  3QZ9 B;  4FL6 A;  4M78 E;  3TU4 K;  3PT9 A;  3JCM J;  1DJ7 B;  4BE1 A;  4M75 E;  5A0G A;  1K9M C;  1QVF S;  5LJ3 g;  1KG1 A;  3V8K A;  5J26 A;  4Y28 E;  5HK0 A;  4C8Q C;  3ZBD A;  4MDW A;  3UT1 A;  4EMK C;  5LJ5 e;  3I55 T;  2DVE A;  4C92 F;  3JB9 H;  1KHC A;  2F69 A;  3SWN A;  2DAQ A;  2EKO A;  4PL6 A;  4C92 C;  2A3L A;  2H3J A;  1U1S A;  1G3W A;  4R55 A;  1YIT A;  2FYK A;  5KE3 A;  1N27 A;  3OYN A;  4PJO G;  2VC8 A;  2XKO C;  2QDY B;  2CZ6 B;  3VYG A;  2XDP A;  2XID A;  3OY9 A;  1HK9 A;  2KSS A;  3RMQ A;  5LJ5 h;  2I2L A;  2PVG B;  1JJ2 A;  3C94 A;  2K3X A;  3NTK A;  2OTJ T;  3VUZ A;  4C5H A;  5LJ5 d;  2VUB A;  2L5Q A;  1OI1 A;  5GAO r;  1Q7Y U;  4A4G A;  4F7U A;  2FB7 A;  3GLX A;  3M54 A;  4BI8 B;  5I21 A;  3UPU A;  5CKE A;  2DXB A;  4RG2 A;  1N9R A;  3L2R A;  3P8H A;  2P0Q A;  3HRU A;  3JB9 I;  4QQG A;  1Y07 A;  3FDR A;  1W2B A;  1K8A C;  4JRP A;  2DXC A;  3JB9 G;  2LQ8 A;  4DOV A;  3OYK A;  3CC4 T;  1VQK T;  2D0Q B;  4YTL A;  3FRN A;  3WXM B;  3CC7 T;  1N8R C;  1K9M U;  3CCU A;  4A53 A;  2DXT A;  1B34 B;  1Y96 B;  2D6F A;  1VUB A;  1PSF A;  2IVW A;  3G71 A;  5IAY A;  4E7I A;  2K2V A;  3ASK A;  1IZ6 A;  2EJ9 A;  3LGL A;  2MAM A;  3MCA B;  2MMP A;  3E19 A;  1YJW T;  2RHI A;  3NTH A;  4J7I A;  3CCL T;  3URG A;  4M77 F;  1ZQ1 A;  4ZGE B;  4QW2 A;  5IN1 A;  4FM4 B;  1UGP B;  4M77 C;  4MZP A;  2JZ2 A;  1M1K C;  5LJ3 f;  3OYY A;  1FXX A;  4MMK A;  3G4S T;  1YCY A;  4M7D B;  4PJO E;  2K57 A;  4EMH A;  4F7U G;  3I56 A;  3CCS A;  4M7D A;  5GAN e;  5GAM h;  1U1T A;  3HRS A;  5GMK l;  2F5K A;  1G5V A;  3G7Z A;  4OB0 B;  4OB2 B;  4Y91 A;  4M78 B;  5GAM d;  2M0O A;  3J81 E;  2Y4Y A;  4E7H A;  1ZHI A;  3PFS A;  2XDD A;  4M75 B;  3CCR T;  2QXF A;  1EIF A;  2ZGW A;  1X6O A;  4XTY A;  1OZ3 A;  2RH2 A;  1VQO T;  5D6X A;  3SDZ A;  1YI2 A;  1Q82 C;  3OS1 A;  2E6N A;  3BDU A;  3GF5 A;  3ME9 A;  1K73 U;  1QVP A;  1VQ9 A;  3CBM A;  2R58 A;  1I4K 1;  4J83 A;  1IRE B;  3Q1J A;  1VQ8 T;  1Q86 C;  3L1A A;  2CKK A;  2L3R A;  4UC4 A;  5GAN h;  3SWN C;  1K8A U;  1VQ6 A;  2CZ7 B;  2X4J A;  1FWZ A;  4C0D C;  4M7A E;  5HY6 A;  1UGR B;  5GAN d;  2QQB A;  2VXF A;  1MGQ A;  2E5Q A;  5C6S A;  5A2Q E;  4XU0 A;  3OBW A;  4OB3 B;  4X34 A;  5CAI A;  2K4Y A;  5FU6 B;  2QTX A;  4JRQ A;  4L59 A;  5GAO p;  1NE8 A;  3JB9 J;  3R6O A;  5GAM f;  3GIB A;  3JCM W;  1VQ5 T;  3QO3 A;  4JUV A;  3OW2 A;  3X20 B;  4BD3 A;  3CMA T;  3N5B B;  1KD1 U;  4C92 G;  3RKY A;  4JLG A;  1QVG A;  3C95 A;  4GY5 A;  3P8B B;  1V29 B;  3VYH B;  2QEX T;  1XOV A;  2OTL T;  2D9T A;  4P5N A;  1M1K U;  4XAX B;  1WPY A;  2GFU A;  3H8Z A;  5DY9 A;  1WGS A;  3CXC A;  1KQS A;  1R8O B;  2EQM A;  5CKF A;  1UB4 A;  3MP6 A;  2VYT A;  4FU6 A;  3ER0 A;  5D6W A;  4ZGD B;  3G6E T;  4HCC A;  4N0A A;  3M56 A;  3PGG A;  4II1 A;  3S3M A;  2P0K A;  3M53 A;  2JUF A;  4CI0 C;  3QJY A;  3CCJ T;  1Q7Y C;  4C5G A;  1PSE A;  1VQM T;  3OQ5 A;  5GMK i;  1KC8 C;  4MZT A;  4PNO A;  2QQA A;  4XTV A;  4FIB A;  5CQY A;  1XTD A;  2EJG A;  2OAU A;  3HP9 A;  4QVC A;  5LJ5 j;  4KBM B;  3KUF A;  1U8R A;  1BI0 A;  2WSE E;  2R57 A;  4OF1 A;  2EQJ A;  4IUP A;  1LOJ A;  1I81 A;  3MHX A;  1Y7X A;  5KE2 A;  2R5A A;  4M7D D;  2E70 A;  1KQ1 A;  1XNI A;  4KUI A;  4R56 A;  3LWI A;  3M55 A;  4J7F A;  3QDR B;  4PJO B;  1ZBX A;  4M7D F;  3P8D A;  3RUX A;  2AHJ B;  4M78 D;  4EDU A;  1WQW A;  3CBO A;  3QYH B;  3OYJ A;  3MET A;  3CCE A;  4ZTJ A;  4MML A;  1VQN T;  3CD6 A;  4M75 D;  3MEW A;  3TRE A;  1RL2 A;  2QQR A;  3S6W A;  3UWN A;  4M78 F;  4C8Q E;  3LWH A;  3WVD B;  5FRO A;  1S72 T;  3MO8 A;  2K3Y A;  4MZM A;  5LJ3 e;  4C92 E;  5CR2 A;  5GAN 3;  3RES A;  1YJN A;  2V8I A;  1H3Z A;  5KCH A;  4OP0 A;  3DB3 A;  4BAC A;  3JAM E;  4EPC A;  3QHS A;  4EMG A;  2V8K A;  1UEB A;  3OSV A;  4IUQ A;  4M77 G;  3CME A;  3CCQ A;  1X75 C;  2HD0 A;  2ZPI B;  1G3S A;  1SSF A;  4BDZ A;  1AHJ B;  2KMT A;  3CCV A;  3QKJ A;  4M7A B;  2DTH A;  2CZ0 B;  1Y71 A;  3HPW A;  1TH7 A;  2RJE A;  4LD9 K;  3OYG A;  3ZEH A;  3A8G B;  1YHQ T;  2RI5 A;  4JJN K;  1O9S A;  4FT4 A;  2XIC A;  5GAN 5;  3J7A F;  2LT1 A;  4ELY C;  1BIB A;  1KC8 U;  5LJ3 h;  5GAM j;  3CC2 T;  4BI4 A;  4E7L A;  3I55 A;  2EJF A;  1VQ7 T;  1K73 C;  3J80 E;  1BYM A;  2ZZD A;  4JDS A;  4JLI A;  5LJ3 d;  2E1H A;  4MDX A;  3QXE B;  4O5V A;  3A8M B;  3HFO A;  4OVA A;  4XTW A;  3MEU A;  4HCZ A;  3NFC A;  3L2V A;  5GAO m;  2IG0 A;  2RB6 A;  1D3B B;  1Q81 C;  1M8V A;  3V7C A;  4OGE A;  2M1H A;  4C5E A;  4LDW A;  4KUD K;  4J8O A;  4DOW A;  3CBP A;  2X4W A;  5GAM e;  5DLO A;  4RG8 A;  2DKG A;  4WF2 A;  1B34 A;  4A4E A;  1Y96 A;  2BIV A;  5GAN j;  3BFM A;  3CC4 A;  1N6A A;  4PKC C;  3RKX A;  3PIP A;  2XDB A;  4QQ6 A;  4IUR A;  3X25 B;  3EFS A;  2DD5 A;  2ZPF B;  1KD1 C;  3CCS T;  2OTJ A;  3FIF A;  4N0A C;  2DIG A;  2JNG A;  2KDS A;  4O6J A;  2KAF A;  4J6W A;  5HKC A;  3JCM X;  1VQP A;  4BY6 C;  4IUU A;  2RHY A;  2YHT A;  3L2U A;  3GP8 A;  5CO7 A;  4BDY A;  5I2S A;  1VIF A;  4IUT A;  1NZ9 A;  3HRT A;  5FU7 C;  1G3Y A;  2MI6 A;  2MWP A;  3O8V A;  3PMT A;  4M77 E;  2XI9 A;  2K5L A;  3FLG A;  4X9C A;  5KCO A;  3FEO A;  3OYL A;  3CPW A;  3V7R A;  3OYE A;  1WJR A;  3CEY A;  4LDU A;  1YI2 T;  4PJO D;  3L2Z A;  4M78 A;  5DLQ E;  1W4S A;  3JCM g;  2DD4 A;  4QVZ A;  2RHX A;  5CKH A;  4M75 A;  1YIJ T;  3CC7 A;  2L89 A;  2HAX A;  5D6Y A;  3VV0 A;  2VV5 A;  3VUB A;  2JOY A;  2EFI A;  2MWO A;  3M4G A;  2EYQ A;  2E6Z A;  3HFN A;  5GMK h;  3OYC A;  4XTU A;  1YJ9 T;  3JRZ A;  1QVF A;  3HSB A;  2JTM A;  4C8Q B;  5CIU A;  3GNG A;  2HQX A;  4EMK B;  3GNF B;  5CK9 A;  5GAN 2;  5KH6 A;  1OYX A;  4C92 B;  1Q81 U;  3EFR A;  2DTI A;  3A8H B;  3CPF A;  5L8R E;  4PLL A;  1JB0 E;  2E10 A;  1G3T A;  4M7A D;  2GFA A;  2MF2 A;  5CCA A;  3G4S A;  3WVE B;  4RCB A;  3OB9 A;  3JCM b;  3VU3 C;  2KVQ G;  3V8J A;  3F70 A;  3SD4 A;  3CCM A;  3JB9 D;  4M7A F;  1VQL T;  1N9S A;  3MP1 A;  2RJC A;  2XK0 A;  5M9O A;  1JJ2 S;  4M7D G;  3JCM c;  1M9S A;  2FVU A;  2XU8 A;  3KBG A;  4LDY A;  5J3B A;  4IKF A;  5GAN 7;  2LNV A;  4HA8 A;  2ZCF B;  2QA4 T;  4N4H A;  2XHC A;  2PUO B;  3CCR A;  1QP2 A;  2DK3 A;  4NL2 A;  1VQO A;  4HT8 A;  1HXD A;  1NPP A;  2L8D A;  1M90 C;  2YLC A;  2KY9 A;  2ZPE B;  4L5G A;  3OSS C;  4F7U E;  2RA2 A;  1VQ8 A;  1VQ4 A;  3M4Y A;  2DZ9 A;  1W2B S;  2X4Y A;  2EWN A;  3PMI A;  3QZ5 B;  4XTZ A;  2RI3 A;  2HQE A;  2NLU A;  3C12 A;  3H6Z A;  3X26 B;  4JS4 A;  1BIA A;  4VUB A;  3E9G A;  3DKM A;  1I5L A;  4CRI A;  2YLB A;  4HKE A;  2LX9 A;  3OA6 A;  2XG8 D;  2P4T A;  3QUI A;  3JCM P;  3X24 B;  1FX7 A;  1YBY A;  2CYZ B;  1VQ5 A;  1BI2 A;  2DJZ A;  2KK4 A;  3CCM T;  4A4K A;  2LTO A;  3MP8 A;  3CMA A;  3MEV A;  2C06 A;  2RK2 A;  5CQX A;  3JCM f;  3L42 A;  5LJ3 j;  2VGM A;  3BDL A;  4Z02 A;  5FLX E;  3FC3 A;  2QEX A;  2OTL A;  3PTA A;  4JS5 A;  5I2M A;  2K5F A;  3OMC A;  4RKU E;  4ZGJ B;  3OYD A;  4PJO A;  5CKB A;  4M77 B;  1YIT T;  2LRQ A;  2ZPG B;  4M7D C;  3M5A A;  1YJN T;  1BI1 A;  3NTI A;  3G6E A;  2E41 A;  2QQ9 A;  4HCB A;  3PIO A;  5LJ5 g;  1BKB A;  4M75 F;  4M78 C;  1WJQ A;  4DQ2 A;  3AHU A;  1QP3 A;  3CCV T;  4X9D A;  4C8Q D;  4M75 C;  5A0D A;  2PUK B;  4OB1 B;  2JN0 A;  1WNL A;  1M90 U;  1LJO A;  4A4F A;  2WSC E;  4C92 D;  3OYM A;  4C8Q F;  2QI2 A;  2RO0 A;  2EIF A;  2K5I A;  2R5M A;  2PVO B;  2CS7 A;  4LDX A;  4M7A A;  4BI3 A;  3LYI A;  4E7J A;  2QQS A;  2O4X B;  4BE0 A;  2O4X A;  3SWN B;  3KXT A;  4Q5W A;  4C0D B;  1P92 A;  3QPH A;  2LDM A;  4E47 A;  5GAO n;  2CGH A;  3OYF A;  2RJD A;  4C0F A;  2V8J A;  4NS5 A;  3JCM Q;  3GPL A;  5FU6 C;  1VQN A;  2BKD N;  1BI3 A;  3ZFJ A;  3QII A;  3C4S A;  3QG1 A;  3QJ6 A;  3TCJ A;  2XD0 A;  3CCU T;  4ZTF A;  2VXE A;  3OW2 S;  5GAO q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...