1I8FA

The crystal structure of a heptameric archaeal sm protein: implications for the eukaryotic snrnp core
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
b'ATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE SNRNP SM-LIKE PROTEIN
publication title The crystal structure of a heptameric archaeal Sm protein: Implications for the eukaryotic snRNP core.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Structural genomics
total genus 13
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2001-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1i8fA00
2DZ9A 4C8QD 4M7DG 3JB9F 1B34A 5LJ3e 1I5LA 2ZGWA 3RIRA 3JB9G 4M77D 3JCMd 3L2ZA 4M78E 4M75D 5LJ3d 5GAMg 4M7AC 5LJ5d 4XTWA 5GMKh 1I8FA 3QSUA 3RERA 3JCMQ 3V7SA 4C8QE 2YLCA 4F7UE 2E41A 2EAYA 2Y90A 4M78A 2I2LA 1KQ1A 1N9RA 1WPYA 4M77E 2DZCA 2RA2A 5DY9A 4M75E 4XTYA 4M7AB 4MMLA 1Y96A 1JRIA 4JUVA 4XU3A 3JCMe 1B34B 4C8QA 4F7UA 4M78F 3BW1A 5CAIA 1U1TA 1LNXA 4M78C 2DTHA 5GMKm 3JCMX 3SB2A 4M77A 3QHSA 4C92F 5LJ5j 4M75A 5GAMj 4NOYA 3SWNA 4C8QF 3JCMW 4C8QC 4QVCA 1M5Q1 4X9CA 4M7AA 3JCMP 1D3BB 3V7CA 3FJPA 4A53A 4M77F 4M78B 4M77C 4M75F 4XTUA 4M75C 1WQ7A 3SWNC 2CGHA 4RCCA 3JCMg 2QTXA 4XU2A 5LJ3g 3QUIA 4QVDA 1Y96B 4C92B 1MGQA 1TH7A 5GMKl 5LJ5g 4C8QB 3HSBA 4F7UB 4PJOD 5LJ5h 3M4GA 5GAMh 4EMGA 3RKXA 5GAOn 4MMKA 3JB9I 4C92E 4M7DD 1D3BA 4M77B 4EMKA 4M75B 5GANe 3SWNB 3AHUA 2EJ9A 4DQ2A 5GAOm 4C92A 4PJOE 4EMKC 4Y91A 4JLIA 3BDUA 3V8LA 5GAMf 4XU0A 5LJ5f 4JRKA 3RKYA 5GAN5 2JN0A 4M7DE 4M7AG 2DKGA 4NL3A 2DTIA 1WNLA 3JCMc 5LJ3j 3V8KA 2RB6A 4C92C 2DXTA 4PJOA 3INZA 1LJOA 3JB9H 2RM4A 2E64A 4EMKB 4XTVA 5GANd 5GAN7 3JCMb 4M7DA 2E1HA 2YHTA 3FB9A 4A54A 1X01A 4PJOF 4N0AA 4PJOC 4M7AD 1BIAA 1LOJA 1N9SA 4XQ3A 2VXFA 3QO3A 3JCMh 3JCMV 5LJ3h 4M7DF 4M78G 4M7DC 1HK9A 3BY7A 2E65A 3VU3C 4J6XA 2EWNA 4N0AC 4X9DA 3FIFA 2EJGA 4C8QG 2DXUA 2EJFA 2E10A 4F7UG 4HT8A 4PJOB 5GMKe 2DTOA 5GAOq 5GANj 4JRIA 3JCMf 2DVEA 4M77G 4M7DB 5LJ3f 4M75G 3JCMJ 3JB9J 3EFSA 2FB7A 5GAOp 4HT9A 1I81A 5GAOr 4NL2A 4WF2A 3L1AA 3HFOA 3PGGA 3V8JA 2DJZA 4HA8A 3V7RA 5GAN3 2VXEA 2VC8A 5GANg 4M7AF 5I21A 5GANh 5GAN6 2FYKA 2HNIA 3JB9D 1BIBA 1HXDA 1WQWA 3BFMA 4XTZA 5GAMd 5GAOl 2YLBA 4V2SA 1H641 5GAN2 4J6YA 2K57A 1U1SA 5GAN8 4PNOA 3GIBA 3RKWA 1I4K1 4C92G 5GANf 4J6WA 5GMKi 4OP0A 5LJ5e 5GAMe 4M7AE 4EMHA 4J5YA 3EFRA 5GAN4 3RUXA 4M78D 4XTXA 5GMKj 2RD1A 1YCYA 4XU1A 4PJOG 4RCBA 4F7UF 1KQ2A 1M8VA 3HFNA 4C92D 2DEQA 3RESA 1JBMA
chains in the Genus database with same CATH superfamily
1AZGB 2ZGWA 2DF6A 3PT9A 2RI5A 2P0PA 2ZCFB 3NTIA 2COYA 2FPDA 4LXCA 1OU8A 1MMGA 1N9RA 2P84A 2XMFA 4F7UA 2NUTB 4M78C 3L42A 2KROA 4C8QF 2CREA 1G2BA 3CCMQ 2LQWA 3CPWS 1Q81R 3FRNA 2JS2A 4IUPA 1VQOQ 1WA7A 4AT1B 2DL8A 2JMCA 2EQUA 1PSFA 1YNZA 3CCMA 2ROTA 3OSSC 2XK0A 5IHIA 4C92A 5EG2A 1VQOA 1KC8C 1OX9A 4RTVA 1M2VB 2CKKA 1YI2T 2J6OA 1FWZA 2C0OA 2RHYA 4E7HA 3X28B 1OEBA 4M7AD 4XQ3A 4L6V5 1IO6A 1MNDA 3FIFA 5FWBA 1TSFA 2DXUA 1VIEA 4QT7A 1NLOC 3Q1JA 2P0KA 4ME7A 2VWFA 1NYFA 2JUFA 1K4US 4C5GA 2X4WA 3A8OB 2E4HA 1EFNA 3QKJA 3OS1A 1WHKA 1HXDA 3FEOA 4B9XA 4OB2B 4E7IA 5IXFA 5GAN8 4PNOA 1X43A 1YHQT 1EX4A 2JNGA 2DERA 2AZSA 2CZ1B 2L3RA 1W1FA 3L2RA 2NLUA 2DD4A 5CIUA 4FSSA 2OAUA 2WSCE 2PUOB 1D1CA 4UC4A 4JRPA 4N4GA 2DLPA 3RMQA 2WSFE 1XJWB 2NUTA 1TS9A 4AFUC 1X6BA 4BACA 1K9MC 2K5LA 4C8QE 1VQNT 1OX8A 5DY9A 3C95A 5D6WA 3LWIA 3G6EQ 2AKLA 5GMKm 5KYWB 1YJNQ 1TOVA 1YJ9T 3OYLA 2LCLA 4ESRA 4IUQA 1UG1A 1M2VA 2CH4A 2AHJB 3G6EA 5IAYA 4M75B 2F2VA 4KUIA 5AYFA 3VS6A 1CKAA 5GAMf 1SHGA 2XIDA 2XKOC 2KRNA 4HVWA 2LNHB 1D0XA 1Q81C 2EYQA 3CMET 4FU6A 1M1KR 1E7OA 4KH0B 4AFSC 1VQ4T 5FU7C 1VQMT 1X01A 3A5ZB 4PJOC 3FDRA 3CD6Q 3G1JA 4M7DF 2X9HA 3OA6A 4J9CA 1ACMB 1ZSZB 1HJDA 4C8QG 2QQSA 2EJFA 5GMKe 3CCLQ 2RJCA 3CD6A 2O9SA 5GAN3 3CC7T 2DXCA 1NEGA 1WZOA 1UDLA 3ZFJA 2KYBA 3CCLA 2MIOA 5IHNA 3I55T 1BU1A 2HZYA 3CCEQ 2ECZA 3OQ5A 1OPLA 2F1LA 1GBRA 5LJ5e 4OB0B 1WIEA 2DIGA 4M78D 1BCOA 1D0YA 3VV0A 4KGVB 3CCEA 1WLPB 4E47A 5L8RE 2E3IA 3META 2QQAA 1AWJA 1TUDA 5KYWA 2JM9A 2EYXA 2YUPA 2DAQA 1AWXA 1XTDA 2YUQA 2XU8A 4GY5A 2X3XD 4B9WA 2M9UA 5CQXA 2AT1B 2I2LA 3I56T 2OAWA 3G4SQ 1AZEA 1U1TA 2MMPA 1PG5B 1D1AA 5GJVB 1WYXA 4M75A 1G5VA 3H41A 2D0QB 1D3BB 3LX7A 2HL3A 3UATA 3MEVA 4LDVA 2LCCA 4FYVB 3SWNC 3G4SA 2CGHA 5LJ5g 1QWEA 3OYIA 1UHFA 5GAMh 1UGPB 1FMWA 2ED1A 3EG0A 3VJPA 4IUVA 2FRYA 2KQWA 4DBFA 1W2BA 3BDUA 4DEYA 4M7DE 2AK5A 2DKGA 1ZSZA 3M0PA 1AD5A 4A63B 2M51A 2VGNA 1N5ZA 4FSXA 5FROA 1QP2A 1R8OB 1VQLT 3MO8A 4J8OA 4AFZC 1SRMA 2KT1A 3FJ5A 3MKDA 3NPFA 3M55A 3JCMf 3UDCA 3L2QA 5GAOr 1ABQA 4QQDA 2F2XA 4VUBA 1UGQB 2CDTA 1QVFA 2VGMA 2KXDA 1H641 5KYUA 1PD1A 1J3TA 2FZKB 4OMFB 1NJIU 2QGGA 5CKDA 2LQKA 3O8VA 2ENMA 4JS4A 1WJQA 4M7DG 1M1GA 1Q82R 1A0NB 2A36A 4RG8A 3L2VA 2JTFA 3NGPA 2CZ6B 4LD9K 3VS2A 1UUEA 3WVEB 1JEGA 1CKBA 4E7ZA 3BW1A 1LNXA 1YN8A 2E3HA 5CKHA 2DD5A 4PKCC 1WXBA 3OYYA 3M0SA 1H8KA 2WACA 3HRUA 3BE3A 2FPFA 4KUDK 2QTXA 1VQKT 1JJ2S 1Y96B 3VS4A 4PJOD 2CZ7B 4PLLA 3JB9I 5KE2A 2OTLA 2D0NA 1M3BA 4Z88A 3VS0A 3S3MA 2DYBA 1VA7A 5GAOm 3VS5A 1FMKA 3NTKA 4HCBA 2HKNA 1UEBA 1QKWA 3OYCA 1YWPA 1WGSA 5GANd 1C0MA 1X6GA 2QASA 4OVAA 1VQ5Q 4J9IA 2RHUA 3TVTA 3JCMh 1WJSA 3OYHA 3TSZA 2RO0A 2ZZDA 3VU3C 2NWMA 4RTZA 1AT1B 2HD0A 1TXQA 3GLXA 2LJ3A 1VQ5A 1BYMA 1OYXA 2BZ8A 2CUBA 1QP3A 2QYZA 3E19A 2FVUA 2QEXQ 2EBPA 3VKIA 3JV3A 4QQGA 3M57A 4OMNA 3T9NA 4MZPA 1NJIR 5GANf 3VRZA 4C0DC 4F16A 3VRYA 2F5TX 2QEXA 1I5OB 2RD1A 1ZLMA 2DA9A 2CP2A 3MEAA 3F70A 3CCVA 3MEUA 2LX9A 5FRNA 5A0DA 1MUZA 4LUDA 3CCSA 4BE0A 4M7AC 4BD3A 1V1CA 2PZ1A 2GGRA 2YRCA 2GQIA 4F7UE 4KGXB 3RMSA 3OYDA 1BCMA 1K0XA 2DE0X 1KHIA 1Y96A 4MMLA 1H92A 2ZAEA 3HHTB 1WHMA 5LJ3e 1M8VA 3P8BB 4CC4B 4OMOA 4P5NA 1Q7YU 2EYWA 4M78B 2EYZA 1WFWA 3L2WA 2CP3A 5GMKl 3SD4A 3CMAQ 2M16A 4C92E 1B07A 2D8HA 2QK0A 1SHFA 3VYHB 3H0FA 3QIIA 4JLIA 4JRKA 3CMAA 2PQWA 1SRLA 1WXUA 1C1AA 2MPXC 1I1JA 5I2MA 2DL7A 4BDZA 1GCQC 1Q81U 3LGFA 2BE7D 3PNWC 1WX6A 4F7UG 2RN8A 2IVWA 2DETA 2QGFB 1UJYA 2QG9B 3JCMJ 3EFSA 1W2BP 1VQ9A 5J39A 4HT9A 3L1AA 2CP0A 2I0NA 4MDWA 3CC4Q 2F2WA 3PE0A 5CKBA 2ZPGB 5GANh 3JB9D 1BIBA 4GBQA 2RHXA 3OYFA 3RDVA 3EG1A 3GPLA 3KUFA 1NPPA 1KFZA 4J9GA 4PLIA 3A1PA 5D6YA 3CC4A 4C92G 1SF9A 5A0LA 2CT3A 1YITT 3THKA 1R0BG 1KQSA 2L5QA 1VQ6T 4RTUA 2KBTA 2DZ9A 4RTYA 3G71T 3S3OA 5LJ3d 4L59A 2EIFA 3EAEA 5FRMA 1GFCA 1MMAA 1NJIC 2HQHA 1T0HA 2PVGB 1QVFP 2E41A 4M78A 3CQTA 1N8RU 1TWBA 4D6WA 2A08A 2KRMA 2CSIA 5KCOA 1Q7YR 2RJDA 1K0SA 2PUKB 3X25B 3JCMW 5GAMj 4X9CA 1IGQA 4M75F 1X75C 2K5IA 1UFFA 3HSBA 1W70A 1B3QA 4EMGA 4X34A 1LCKA 3AHUA 1OZ3A 1CSKA 3EG2A 4ATOA 4AMCA 3M54A 3MP6A 2DTIA 3G7ZA 1JB0E 4DBRA 2K3YA 2EFIA 3ME9A 4CC7A 3DLMA 5A2QE 1X2QA 5IH2A 3H0IA 4XAXB 4FL6A 2P4TA 2CP7A 1F1BB 4LD6A 2GF7A 4PJMA 2W0ZA 2A0FB 5FU7B 2EGEA 3A8MB 4PJOB 4HCKA 1GRIA 2DTOA 1PHTA 3RBBB 1VQOT 1RUWA 3JB9J 4QKUA 1G8XA 2PTKA 1QVGS 3HFOA 3KXTA 2LT1A 2EYYA 5HKCA 1IHWA 2RHIA 1M1KU 4CC2A 2CUDA 3M59A 1P92A 1N27A 2B86A 4BE2A 2J05A 1LPLA 4LNPA 2PU9B 3M0RA 5DLOA 2DEUA 4IUUA 1TUCA 2M0YA 2O4XB 3CCJQ 3RUXA 1V29B 2KGTA 1NEBA 2JOYA 1D09B 3RESA 4JRIA 4JJCA 1QWFA 2L89A 4DOVA 5D7UA 3OYBA 1H3ZA 1ZHIA 5GAMg 4N4IA 3CCJA 5FLXE 3OYMA 3RERA 2JJ9A 1N8RR 3ZL7C 2XDBA 2JTEA 2RA2A 4M75E 2YUNA 2HSPA 3QDFA 4QVZA 2YWWA 1WHHA 1WXTA 4NOYA 2FPEA 4LUEA 1NE8A 1PRMC 4ZTFA 2CP6A 4M77C 2JM8A 9ATCB 2GNCA 3TCJA 4QVDA 1M27C 2K4YA 4DEXA 1Z9ZA 1GXIE 2LX7A 2K79A 2E12A 5I22A 1Q95G 3SWNB 1Q7YC 2EJ9A 1VQ8Q 4BUGA 2K9GA 1T3SA 1WNLA 4DBHA 3CCRQ 3SHWA 4PJOA 4LDXA 2DVJA 2RJEA 3X26B 1VQ8A 1X27A 3G6ET 2MF2A 3OBYA 1YJNT 4F04B 3FC3A 1HK9A 2KI7A 3UA7A 3ULRB 4J6XA 4N0AC 3CCRA 4HT8A 2D8JA 4ELYC 4M75G 1NBEB 1YJ9A 1Y71A 3V8JA 5AT1B 1FYNA 2VC8A 2W10A 1BKBA 2O4XA 2DX1A 4M7AF 3M0QA 2AZVA 1YJWQ 4MZTA 1VQ7Q 2ZPEB 2MAMA 4J6YA 3JSCA 2RNAA 2BUDA 3RR6A 3GP8A 1PC0A 5CKEA 2QI2A 4Z8AA 4E2FB 1YJWA 4PK4A 4XTXA 3CD6T 2V8KA 1VQ7A 4MDXA 1JBMA 2OX7A 3VS7A 5FW9A 2LMJA 3CCLT 1SG5A 2HAXA 3DLLA 1OOTA 2K6DA 4OF1A 3V7SA 3MJXA 1H3HA 1KQ1A 2K7AA 5CKFA 2ATCB 3KFVA 2LQNA 1VYUA 4PFPA 4FCYA 3SWNA 1TTHB 1KQSP 3CCET 3M0UA 3V7CA 3NTHA 3IQLA 4Y92A 2DJQA 3JCMg 1PKTA 2V8JA 1BBZA 1OZ2A 3PIOA 1N8RC 5D6XA 2FZCB 1Q86R 4EPCA 1Q82U 3LYIA 5IHKA 2OTJQ 1JO8A 1K73R 1RI9A 2LTOA 2O2OA 1OU9A 3JRZA 1PD0A 2K2VA 1PM3A 3OMCA 1BK2A 3V8KA 2OTJA 2QA4Q 2BKDN 3UWNA 1UB4A 7AT1B 3G4ST 2L0AA 2YXYA 5L23A 4JRQA 2VXFA 2RF0A 1KD1U 3BY7A 2MWPA 2YSQA 1G3SA 2EKHA 2QA4A 2EJGA 3I56A 3I5SA 2X4JA 1PRLC 1QLYA 1B7TA 5GANj 4C0GA 2AIRB 4D8DA 1ZBJA 1Y7XA 2DIQA 2VASA 2MOXA 3KBGA 3OS0A 1S72Q 4DBQA 5GAN2 3J81E 1U1SA 4J7FA 2NYSA 1MMDA 6AT1B 2SRCA 4JS5A 2XD0A 1S72A 4LDWA 3X24B 4RCBA 4E7JA 3VS1A 1M1KC 4JUVA 2YRVA 4C0DB 4C92D 1HD3A 4ZGDB 4GLKA 5CVIA 1RACB 4M77D 1K1ZA 1W4SA 1TU0B 5LJ5d 4XTWA 2AKKA 3TQ7P 5KCHA 3MP8A 4JDSA 1JXOA 3HL8A 2COZA 4M7AB 4M78F 2JZ2A 2MK5A 4C8QC 4QVCA 3OYNA 2EGAA 1FX7A 1QCNA 4BDYA 5LL6S 2QQ9A 3MEWA 1Y57A 5I2SA 4RCCA 2ZPFB 1PCXA 1MGQA 1TH7A 2KE9A 2X51A 3QYHB 5GAOn 1W2BS 4KT0E 3EGUA 1D3BA 5CR2A 2L3SA 3H8ZA 2KY9A 2EQIA 4Y28E 5LJ5f 2ESWA 3FLGA 4Z02A 1E6GA 5HY6A 2XDDA 2RB6A 2OTLQ 5CCAA 1X6OA 2C0IA 2RM4A 2E64A 1BI0A 2OI3A 2YHTA 1KD1R 1OV3A 2VKNA 3OYJA 2K5FA 2A7YA 4TVRA 2IIMA 2V8IA 1YCSB 2EPDA 1VQPQ 2D1XA 1ZUYA 4WF2A 2KSSA 3CCUQ 4JLGA 5I21A 1VQPA 4KRTA 3BFMA 3GNGA 5ECAA 4BY6C 4HVVA 2KYMA 1D0ZA 4YTLA 2GTOA 2M0OA 3CCUA 2A37A 3I5RA 1PKSA 2DPPB 1VQ5T 1K8AR 4OMQA 1KIKA 2DEQA 4M7AA 3WVDB 2HDAA 1OI1A 4JJBA 1ZA1B 1U06A 3LWHA 4AFQC 3L2ZA 2WSEE 3D7SB 4M78E 3URGA 5GMKh 2LJ0A 2DXBA 3H6ZA 1O9SA 2F69A 2NUPB 3CCVQ 2DZCA 4ORZA 3GF5A 1MHNA 3CCSQ 2QEXT 4FYWB 3TSWA 1M30A 3LGLA 3OYGA 3OW2A 3JCMP 1WHGA 3FJPA 4A53A 1M4ZA 2HSEB 3CXCA 2HBPA 1TG0A 5DM7R 4FYYB 5LJ5h 2JMAA 1M8MA 2ED0A 3OYAA 3QWXX 2DMOA 4CRIA 4DQ2A 2VYTA 3EHRA 4EIKA 3V8LA 3EFOB 2YDLA 3GOXA 1SPKA 1GCQA 4FW1A 1Q82C 3CC2Q 1R77A 4PJOF 1UGVA 2EQKA 1EIFA 2LJ1A 1BIAA 2K2MA 1N9SA 3DB4A 1G3YA 2CS7A 4M78G 4M7DC 1NLPC 4DA4A 4IUTA 4PFOA 3U23A 3LH0A 3CC2A 2GFAA 2RK2A 1RAFB 2R5MA 2DVEA 2XI9A 2JTMA 4A4HA 1GCPA 3CMAT 2R57A 2OJ2A 4NL2A 2RQUA 1IHVA 1KD1C 1UE9A 2LDMA 2FHDA 3TU4K 2KEAA 1PSEA 8AT1B 1RAHB 3CCQQ 2E70A 1VQ9Q 5M9OA 5KH6A 4OB3B 3GIBA 2Y4YA 1ZUKA 4JPBW 2LCSA 3EGXB 4OP0A 4J5YA 3QG1A 3CCQA 5HCKA 4IURA 2DYIA 3A98A 2NUPA 2D6FA 4RUGA 4BB7A 4C8QD 3OYKA 1OULA 2ZPBB 3NFCA 2HQEA 1GBQA 1M2OA 3ZEHA 2H8HA 2YLCA 2HKQB 2XDPA 2VB6A 3CC4T 3MCAB 1K8AC 3UPUA 2X4YA 2L2PA 1NYGA 2L3PA 1YIJQ 2QQBA 4LDUA 5CK9A 4E7LA 1AOJA 1WQ7A 3EFOA 1IREB 2CH4W 4C92B 2ROLA 4A4KA 1YIJA 1M90U 3CBPA 3CPWA 3HKSA 4M77B 3OSVA 2LVMA 3R6NA 4PJOE 2M1HA 4EMKC 2BIVA 3J7AF 3JCMc 1HSQA 1SKUB 3H9NA 1RLQC 1NPRA 3JCMb 2JXBA 2HCKA 1LOJA 1AWOA 2A28A 4OGEA 2CYZB 3VUZA 2O31A 4X9DA 3P8DA 5GJWB 2BE9B 3OB9A 3UF4A 3C12A 4DOWA 1ZQ1A 2E6ZA 2PVDB 2RQTA 5LJ3f 3OMGA 5FU6B 1I81A 2MWOA 4ANJA 2F5KA 5KE3A 3EGXA 3V7RA 3MHXA 1I07A 4C5EA 4WCIA 2HL5C 1M3AA 2X4XA 1VOMA 2FYKA 1IB8A 4AG1C 3EG3A 2DILA 2QXFA 2RPNA 4RTXA 1ZA2B 3RKWA 1KQSS 3CCMT 5CQYA 4KULA 5GAMe 3OS2A 1RABB 2X35A 3CBOA 2CZ0B 4PJOG 3HFNA 3JB9F 3HPWA 4AG2C 3A8HB 3OYEA 1GFDA 1SEMA 1YI2Q 4PL6A 3RNJA 1WI7A 2P4RA 1ZSGA 4XU3A 2GFUA 2K3XA 3A8GB 2DBKA 4F17A 2EQMA 3S3NA 5C6SA 3SB2A 4M77A 5J3BA 4C0FA 1YI2A 1AHJB 1AVZC 1M5Q1 4J7IA 1UGRB 1ZBXA 1G83A 3PIPA 1M90R 1R0CB 3I35A 1Z9QA 3JAME 1YFNA 4IIOA 3CCJT 2JVVA 3M58A 4MZMA 4M7DD 1OQKA 2LRQA 5KYXB 5J26A 1YHQQ 4C92C 3M0TA 1FMVA 3JB9H 1VUBA 4BI8B 3OW2P 3NMZC 3FB9A 4N0AA 4FT4A 2J06A 3CXCP 3JCMV 5LJ3h 2O9VA 4OB1B 2RI2A 1YHQA 1JQQA 3M53A 3AT1B 1Q86U 1S1NA 4OMMA 5KYYB 1NG2A 4O6JA 2GTJA 5GAOq 1K73U 2J7IA 2C06A 3VUBA 5A0GA 4PFZA 3PMTA 1VQNQ 4FM4B 5IT9E 4KBMB 4ZN3A 3TEEA 5GAN6 5GAMd 1WQWA 4XTZA 2XHCA 2ZPHB 5GAOl 1VQ8T 3QXEB 1YJ9Q 3EGDB 1C6VX 3QYGB 1VQNA 3CCRT 1SSHA 5FU6C 1VIFA 2CP5A 5GMKi 1JXMA 4ZGEB 1WHLA 3EFRA 5GMKj 5KYNA 1ZUUA 4C5HA 2O88A 4IIMA 1O75A 2HBWA 2R58A 4KH1B 2YUOA 4LDYA 2KT8A 1XNIA 1YJNA 4C5IA 1I8FA 2CSQA 2Z0WA 1TUGB 5CO7A 1BI1A 3JCMQ 3CMEQ 4GLMA 2H3JA 1U5SA 8ATCB 2BTTA 2YRDA 2EVRA 1VQ4Q 1JRIA 3JCMe 1VQMQ 5HK3A 5CAIA 1YP5A 1YJWT 4NS5A 4ZNXA 1VQ7T 5LJ5j 1KQ2A 1M9SA 5KYXA 4CC3A 3CMEA 2L3QA 1VQ4A 1HYOA 3EHQA 3WXMB 1VQMA 2HQXA 4C8QB 1T3LA 1MV0B 2DK3A 1BB9A 3CC7Q 4J9HA 3MP1A 3EH2A 5FWCA 1V76A 3JB9G 3I55Q 2E6NA 2KXCA 3RKYA 2DL5A 4E7SA 4NL3A 3HRSA 2D9TA 1RAAB 1M90C 1LJOA 5KYYA 4B6MA 3CC7A 1RAIB 1G3TA 3E1SA 2QAZA 1IZ6A 2R5AA 4O5VA 2EKOA 3I55A 1SSFA 3QDRB 1UECA 2COWA 2DRMA 2RHZA 3CPWP 2X3WD 3QBYA 3E9FA 3QPHA 1WJRA 3HRTA 3EGDA 4ZGJB 5DLQE 2FB7A 3PGGA 2OTJT 4HA8A 2MI6A 5KYUB 2KMTA 3I56Q 3S6WA 1RLPC 4J9EA 1AEYA 3QWYA 1QVGP 1QKXA 1QQJA 1T0JA 2Y4XA 3OY9A 3LLRA 2QA4T 1RAEB 4JJDA 4X1VA 1U8RA 2E5KA 4BY6B 4M7AE 4HXJA 1UGSB 4EMHA 5GAN4 1LVKA 2YT6A 3SFMA 4BI4A 1K76A 2RK1A 4N4HA 3RIRA 3M5AA 4HVUA 1ARKA 3JCMd 3QSUA 1N6AA 3EH1A 2CT4A 2ZPIB 2Y90A 1WPYA 2RQWA 2PNIA 1RL2A 1IRXA 2VUBA 4C8QA 1NZ9A 1VQLQ 1S72T 3QHSA 2FL7A 4HKEA 4PJNA 1K8AU 5C0MA 4M75C 2V1QA 1UTIA 2QDLA 4XU2A 1VQLA 2MCNA 2KDSA 3OBWA 3I9QA 4RKUE 3M56A 3UA6A 2J6FA 1JJ2A 4LN2A 5GANe 2DNUA 3ER0A 3SDZA 4Y91A 5GAN5 2JN0A 4M7AG 2HEQA 1QVPA 2K3BA 3REBB 2LQ8A 3INZA 3MPUB 4E6RA 3R6OA 4HCCA 3QJYA 4JZ4A 1ZSZC 4PJJA 4A54A 3QZ9B 2DBMA 3DB3A 1D1BA 3UT1A 4ELZC 4PJLA 2E5QA 2ABLA 1QCOA 2V1RA 2QQRA 2JT4A 1X69A 2RMOA 4F14A 4M7DB 4FT2A 3EG9B 5GAOp 1MNEA 3C94A 1X2KA 2QDYB 4RMOA 3PTAA 3CBMA 1M1FA 1YBYA 4J9BA 5GANg 2KVQG 3PVQA 2HNIA 3P8HA 1Q86C 2DO3A 4Q5WA 1JU5C 2K57A 1K73C 2OTLT 4A4GA 1I4K1 2GBQA 1I0CA 1VQKQ 1NM7A 3BDLA 2EW3A 3QJ6A 2LNVA 4XU1A 4F7UF 3O5ZA 1MV3A 4J6WA 1K9AA 1QVFS 1QCFA 3C4SA 1BI2A 4QQ6A 4L5GA 4RTTA 3ASKA 4FIBA 1UHCA 1VQPT 1VQKA 3L2UA 2L8DA 3HP9A 4K11A 2EAYA 3CEYA 1RADB 2KAFA 4XTYA 4EDUA 2QTVA 2DRKA 1WHJA 3CCUT 4IKFA 1B34B 3JCMX 4J9FA 1E6HA 4C92F 2VV5A 4A4EA 1ZX6A 3NHNA 3H0HA 4M77F 1KC8U 2GQVA 3VS3A 2RI3A 3GBQA 1KG1A 2BZYA 5IXBA 3M4GA 1QMCA 4II1A 3RKXA 1M3CA 2SEMA 4C0ZA 2JS0A 2RQVA 2RJFA 3X20B 4FW2A 2IPOB 4XU0A 1Y0MA 1DJ7B 5LJ3j 3A8LB 4JJNK 3C0CA 3LH5A 1VYTA 1XOVA 4HCZA 4OMPA 4EMKB 5HK0A 5GAN7 3CCVT 4M7DA 4J9DA 1EZZB 2E1HA 3EG9A 3PMIA 2PVOB 3CCST 4Z89A 3QO3A 1BI3A 2MYSA 2HMAA 4FYXB 4LE9A 1XQHA 2E10A 2JW4A 2LP5A 1PNJA 2P0QA 3M4YA 2DL3A 2G3RA 2LC4A 2DFUA 2RH2A 2FEIA 2DJZA 2BZXA 2VXEA 4D8KA 2M02A 2NUZA 4BE1A 2FO0A 2LT4A 3SEMA 3HTRA 1ABOA 3GNFB 1KK7A 1K9MU 2GCXA 3CC2T 1U3OA 3DKMA 1QW1A 4E7KA 2EQJA 1YCYA 2FG0A 1VYVA 5IN1A 4OGCA 1Y07A 1B34A 1YWOA 2C0TA 2LZ6B 2RQRA 1I5LA 1UJ0A 4M75D 4M4ZA 3TREA 4J83A 1KJWA 2IG0A 2KNBB 4A4FA 1KHCA 4WTOB 2VVKA 2J6KA 4OMLA 2G6FX 2DL4A 4M77E 3OW2S 2DTHA 3CCQT 3CXCS 1VQ9T 1KC8R 2B8AA 4JZ3A 4ZTJA 4BI3A 4XTUA 3PVLA 4R56A 5LJ3g 3QUIA 1MMNA 4F7UB 1PWTA 1AWWA 4MMKA 3E9GA 2XICA 3QZ5B 3ZBDA 4EMKA 4XK8E 1IXDA 4R55A 1RI0A 2KRSA 1RAGB 2A3LA 4R0KA 1OPKA 4RTWA 2DXTA 4XTVA 2V26A 1GL5A 5I11A 1YITQ 2EGCA 1VQ6Q 1YIJT 2KR3A 4KGZB 2E65A 2EWNA 1FXXA 3G71Q 3LW5E 4RG2A 1JJ2P 3E2UA 2FRWA 1W6XA 2DM1A 1YITA 4M77G 1VQ6A 3M9QA 2H3EB 3G71A 4ZN1A 4QW2A 1QVGA 3PFSA 4CI0C 3N5BB 2XG8D 2YLBA 4V2SA 3REAB 1K9MR 3VYGA 1IGUA 2O01E 1KSWA 3CPFA 3OS5A 3J80E 1WDXA 5EC7A 1G3WA 2FZGB 2KK4A
chains in the Genus database with same CATH topology
1O75A 3CCVA 3MEUA 4ZGDB 2LX9A 4GLKA 5CVIA 5FRNA 2R58A 5A0DA 2ZGWA 3PT9A 2RI5A 2P0PA 2ZCFB 1XNIA 3NTIA 4LDYA 1W4SA 4M77D 3CCSA 4BE0A 5LJ5d 1YJNA 4XTWA 4BD3A 4M7AC 4C5IA 1I8FA 3MEAA 5CO7A 1BI1A 3JCMQ 4F7UE 5KCHA 3MP8A 4JDSA 3RMSA 3OYDA 2H3JA 3HL8A 1N9RA 4M7AB 1KHIA 1Y96A 1JRIA 4MMLA 3JCMe 3HHTB 5HK3A 5LJ3e 4F7UA 4M78F 5CAIA 1M8VA 4M78C 1YJWT 3P8BB 3L42A 2JZ2A 4P5NA 4NS5A 1VQ7T 5LJ5j 1Q7YU 1KQ2A 4C8QF 1M9SA 4C8QC 4QVCA 3OYNA 4BDYA 1FX7A 3CMEA 5LL6S 2QQ9A 3MEWA 3CPWS 4M78B 1VQ4A 3FRNA 3WXMB 4RCCA 5I2SA 2ZPFB 4IUPA 3L2WA 1VQMA 5GMKl 2HQXA 1MGQA 1TH7A 3SD4A 4C8QB 3QYHB 5GAOn 2M16A 2DK3A 4KT0E 4C92E 2EQUA 1W2BS 1D3BA 1PSFA 5CR2A 3CCMA 3H8ZA 3MP1A 3OSSC 3VYHB 2XK0A 4C92A 2KY9A 4Y28E 5EG2A 3JB9G 1VQOA 3QIIA 4JLIA 5LJ5f 3FLGA 1KC8C 4JRKA 2E6NA 3RKYA 3CMAA 4Z02A 4NL3A 3HRSA 2CKKA 2D9TA 5HY6A 2PQWA 2XDDA 2RB6A 1YI2T 1M90C 5CCAA 1X6OA 1FWZA 1LJOA 2RM4A 3CC7A 2E64A 1BI0A 2RHYA 4E7HA 3X28B 1G3TA 2YHTA 5I2MA 4BDZA 3E1SA 4M7AD 4XQ3A 1IZ6A 2R5AA 4O5VA 2EKOA 4L6V5 1SSFA 3QDRB 2K5FA 3OYJA 3LGFA 3I55A 1Q81U 2A7YA 2RHZA 4TVRA 3PNWC 3FIFA 2V8IA 2DXUA 1VIEA 3E9FA 3QBYA 3QPHA 1WJRA 4F7UG 2IVWA 3HRTA 3Q1JA 2P0KA 4ME7A 2JUFA 4ZGJB 3JCMJ 4C5GA 3EFSA 2FB7A 5DLQE 5J39A 1VQ9A 4HT9A 2X4WA 3A8OB 4WF2A 3L1AA 3PGGA 2OTJT 4HA8A 3QKJA 4MDWA 2MI6A 2KSSA 2KMTA 3OS1A 3S6WA 5CKBA 2ZPGB 4JLGA 5I21A 5GANh 3JB9D 1VQPA 1BIBA 1HXDA 3BFMA 2RHXA 3GNGA 3OYFA 3FEOA 2Y4XA 4B9XA 4OB2B 4BY6C 3OY9A 3KUFA 3GPLA 4E7IA 5GAN8 1NPPA 4PNOA 1YHQT 3LLRA 4PLIA 4YTLA 2JNGA 2QA4T 5D6YA 3CC4A 4C92G 1U8RA 2M0OA 5A0LA 3CCUA 2CZ1B 2L3RA 4BY6B 4M7AE 1UGSB 4EMHA 3L2RA 1YITT 2DPPB 5GAN4 1KQSA 1VQ5T 2L5QA 2NLUA 2DD4A 1VQ6T 5CIUA 2OAUA 2WSCE 3SFMA 2DEQA 4M7AA 2PUOB 4UC4A 2DZ9A 3WVDB 4BI4A 4JRPA 1OI1A 4N4GA 3RMQA 3G71T 2WSFE 2RK1A 4N4HA 3RIRA 3M5AA 3LWHA 3S3OA 3JCMd 3L2ZA 2WSEE 4M78E 5LJ3d 4BACA 4L59A 1K9MC 3URGA 2EIFA 3EAEA 5GMKh 5FRMA 1N6AA 3QSUA 2K5LA 1NJIC 2DXBA 3H6ZA 2PVGB 1O9SA 4C8QE 2E41A 2ZPIB 2Y90A 4M78A 1VQNT 2F69A 1WPYA 2DZCA 3C95A 5D6WA 5DY9A 1RL2A 1N8RU 4D6WA 2VUBA 3GF5A 4C8QA 5KCOA 3LWIA 1MHNA 2RJDA 5GMKm 1NZ9A 2QEXT 1S72T 2PUKB 3LGLA 3QHSA 3X25B 5GAMj 3OYGA 3OW2A 3JCMW 1YJ9T 3OYLA 2LCLA 2FL7A 4HKEA 4X9CA 3JCMP 1K8AU 3FJPA 5C0MA 4A53A 1M4ZA 4IUQA 4M75F 4M75C 3CXCA 2HBPA 4XU2A 1X75C 2K5IA 3HSBA 2AHJB 3G6EA 5DM7R 1VQLA 5LJ5h 2KDSA 3OBWA 4EMGA 4RKUE 3OYAA 5IAYA 3M56A 4X34A 4CRIA 1JJ2A 4M75B 5GANe 3AHUA 3ER0A 4KUIA 5AYFA 1OZ3A 3SDZA 2VYTA 4DQ2A 4Y91A 3V8LA 5GAMf 5GAN5 2JN0A 4ATOA 2XIDA 2XKOC 4M7AG 3M54A 3MP6A 2DTIA 3G7ZA 3GOXA 1QVPA 1Q81C 2EYQA 1JB0E 2LQ8A 3CMET 4FU6A 3INZA 1Q82C 3R6OA 4HCCA 1VQ4T 2K3YA 2EFIA 3ME9A 3QJYA 3DLMA 5FU7C 4A54A 1X01A 3A5ZB 2EQKA 4PJOF 5A2QE 1EIFA 3QZ9B 1BIAA 3FDRA 1N9SA 4FL6A 4XAXB 4PJOC 3DB3A 3DB4A 1G3YA 2CS7A 3UT1A 4M7DF 2P4TA 4M78G 4M7DC 4DA4A 4ELZC 4LD6A 2E5QA 2GF7A 4IUTA 3OA6A 5FU7B 4C8QG 2QQSA 2EJFA 3A8MB 4PJOB 3LH0A 2QQRA 5GMKe 2GFAA 3CC2A 2RK2A 2DTOA 2R5MA 2DVEA 2RJCA 2JTMA 2XI9A 4A4HA 4FT2A 3JB9J 1VQOT 4M7DB 5GAOp 3CD6A 3CMAT 2R57A 3C94A 1QVGS 4NL2A 2QDYB 3HFOA 4RMOA 3PTAA 3CBMA 3KXTA 5GAN3 2LT1A 1KD1C 1M1FA 3CC7T 2DXCA 2LDMA 1YBYA 2FHDA 5GANg 3TU4K 2KVQG 5HKCA 3ZFJA 3CCLA 2HNIA 1PSEA 3P8HA 1Q86C 2DO3A 2RHIA 1M1KU 4Q5WA 2E70A 3I55T 3M59A 2K57A 5M9OA 1K73C 5KH6A 4OB3B 1P92A 3GIBA 2Y4YA 1N27A 2OTLT 3OQ5A 4BE2A 4A4GA 1I4K1 2PU9B 5DLOA 4OP0A 4IUUA 5LJ5e 4OB0B 2O4XB 2DIGA 3QG1A 4J5YA 3CCQA 3RUXA 3BDLA 4M78D 4IURA 3QJ6A 2LNVA 1V29B 4XU1A 4F7UF 2JOYA 2D6FA 3VV0A 4BB7A 4J6WA 3RESA 3CCEA 4JRIA 4E47A 4C8QD 5L8RE 1QVFS 3OYKA 3C4SA 1BI2A 3META 4QQ6A 2L89A 2QQAA 2ZPBB 3ASKA 3NFCA 4FIBA 4L5GA 4DOVA 3OYBA 2HQEA 1H3ZA 1ZHIA 1VQPT 1VQKA 5GAMg 4N4IA 3ZEHA 3L2UA 2DAQA 2L8DA 3CCJA 5FLXE 3OYMA 3RERA 1XTDA 3HP9A 2XU8A 4GY5A 2YLCA 2EAYA 4B9WA 3CEYA 2M9UA 5CQXA 2XDBA 2I2LA 2KAFA 2XDPA 3CC4T 2RA2A 4M75E 4XTYA 4EDUA 3I56T 3MCAB 1K8AC 3CCUT 3UPUA 4IKFA 1B34B 2X4YA 3JCMX 4QVZA 1U1TA 2MMPA 4C0DB 2QQBA 4C92D 4C92F 4M75A 4LDUA 4NOYA 2VV5A 4A4EA 1G5VA 2D0QB 5CK9A 1NE8A 1D3BB 4E7LA 3LX7A 4ZTFA 4M77F 3MEVA 1KC8U 4M77C 4LDVA 2LCCA 1WQ7A 2GQVA 3SWNC 3G4SA 2CGHA 1IREB 3TCJA 2RI3A 4QVDA 4C92B 5LJ5g 4A4KA 2K4YA 1KG1A 1YIJA 3OYIA 3CBPA 3CPWA 3M4GA 3HKSA 5GAMh 1M90U 4II1A 3RKXA 1UGPB 1GXIE 4C0ZA 2E12A 4M77B 3OSVA 3SWNB 2LVMA 1Q7YC 2RJFA 3VJPA 2EJ9A 3X20B 4IUVA 2KQWA 1W2BA 4PJOE 2M1HA 4BUGA 4EMKC 3BDUA 4XU0A 4M7DE 2BIVA 1DJ7B 2DKGA 3J7AF 1WNLA 3JCMc 3A8LB 5LJ3j 4JJNK 3CD6T 4PJOA 4LDXA 1XOVA 2VGNA 4HCZA 4EMKB 5HK0A 1NPRA 4FSXA 3JCMb 5GAN7 2RJEA 5FROA 3CCVT 2E1HA 4M7DA 1QP2A 3X26B 1VQ8A 3PMIA 1R8OB 2PVOB 1LOJA 3G6ET 2MF2A 3CCST 3OBYA 3QO3A 1YJNT 1VQLT 3MO8A 4J8OA 3FC3A 1BI3A 4OGEA 1HK9A 2CYZB 3VUZA 4J6XA 4N0AC 3CCRA 4X9DA 3P8DA 1XQHA 3OB9A 2E10A 3C12A 4HT8A 4DOWA 3M55A 1ZQ1A 2E6ZA 2PVDB 3JCMf 3UDCA 2P0QA 3M4YA 4ELYC 5LJ3f 4M75G 3OMGA 3L2QA 5FU6B 1YJ9A 2G3RA 1Y71A 2LC4A 1I81A 2MWOA 5GAOr 2F5KA 2RH2A 4QQDA 3V8JA 5KE3A 2DJZA 3V7RA 3MHXA 2VXEA 2VC8A 4VUBA 1BKBA 1UGQB 2O4XA 4C5EA 4M7AF 2X4XA 1VQMT 2FYKA 1QVFA 2VGMA 4MZTA 4BE1A 2QXFA 1H641 2MAMA 2ZPEB 4J6YA 2LT4A 3JSCA 2BUDA 3RKWA 3GNFB 1KQSS 3CCMT 3GP8A 5CQYA 1K9MU 2GCXA 5CKEA 2QI2A 4KULA 4OMFB 3CC2T 5GAMe 3OS2A 1NJIU 1YJWA 5CKDA 3DKMA 1QW1A 4XTXA 2LQKA 2EQJA 1YCYA 2CZ0B 2V8KA 2X35A 3CBOA 3O8VA 4PJOG 4E7KA 1VQ7A 4JS4A 4MDXA 3HFNA 1WJQA 4OGCA 1Y07A 1JBMA 5IN1A 4M7DG 1M1GA 3JB9F 1B34A 3HPWA 1I5LA 3A8HB 3OYEA 3CCLT 4M75D 3TREA 4J83A 4RG8A 2IG0A 3L2VA 2HAXA 4A4FA 1KHCA 3DLLA 4OF1A 2JTFA 4PL6A 3V7SA 2CZ6B 4LD9K 1KQ1A 5CKFA 4M77E 3WVEB 4XU3A 2GFUA 2K3XA 3A8GB 3OW2S 3S3NA 2EQMA 3BW1A 5C6SA 1LNXA 2DTHA 3CCQT 5CKHA 3SB2A 2DD5A 4PKCC 4M77A 5J3BA 3CXCS 1VQ9T 4C0FA 3SWNA 3OYYA 2B8AA 1YI2A 1AHJB 1M5Q1 2WACA 4J7IA 1UGRB 4ZTJA 3CCET 3HRUA 3V7CA 1ZBXA 4BI3A 3PIPA 3NTHA 4XTUA 3JCMg 4KUDK 4R56A 3PIOA 2V8JA 2QTXA 1OZ2A 3QUIA 5LJ3g 1Y96B 3JAME 1N8RC 5D6XA 1JJ2S 1VQKT 4F7UB 4EPCA 3CCJT 2CZ7B 2JVVA 3M58A 4PLLA 4PJOD 4MMKA 3E9GA 3JB9I 2XICA 3LYIA 1Q82U 4MZMA 3QZ5B 5KE2A 3ZBDA 4EMKA 2OTLA 2LTOA 4XK8E 4M7DD 2LRQA 3S3MA 4R55A 1VQ8T 3JRZA 1RI0A 5GAOm 2K2VA 3OMCA 3NTKA 4HCBA 2A3LA 5J26A 3V8KA 4C92C 2OTJA 1UEBA 2DXTA 2BKDN 3OYCA 3UWNA 1VUBA 4BI8B 3JB9H 1WGSA 1UB4A 4XTVA 5GANd 3G4ST 3FB9A 4OVAA 4N0AA 4FT4A 4JRQA 2RHUA 2VXFA 3JCMh 3JCMV 1YIJT 1WJSA 5LJ3h 3OYHA 1KD1U 2RO0A 4OB1B 2RI2A 2E65A 2ZZDA 3BY7A 2MWPA 3VU3C 1G3SA 1YHQA 2EWNA 3M53A 2QA4A 1FXXA 2EJGA 1Q86U 3LW5E 4RG2A 3I56A 2X4JA 2HD0A 4O6JA 5GAOq 5GANj 1K73U 1YITA 4M77G 3GLXA 4C0GA 1VQ5A 1BYMA 1VQ6A 3M9QA 2C06A 1OYXA 3VUBA 1Y7XA 5A0GA 3PMTA 2DIQA 4FM4B 5IT9E 1QP3A 4KBMB 4ZN3A 3G71A 4ZN1A 4QW2A 3KBGA 1QVGA 3E19A 3TEEA 3PFSA 5GAN6 2FVUA 3OS0A 5GAMd 1WQWA 4XTZA 2XHCA 2ZPHB 4CI0C 3N5BB 3VKIA 5GAOl 2XG8D 2YLBA 3QXEB 4QQGA 4V2SA 5GAN2 3J81E 3M57A 1U1SA 3VYGA 3QYGB 2O01E 3T9NA 4J7FA 4MZPA 5FU6C 3CCRT 1VQNA 1VIFA 5GANf 4C0DC 5GMKi 2F5TX 3CPFA 3OS5A 3J80E 4ZGEB 3EFRA 2QEXA 4JS5A 2XD0A 1G3WA 2KK4A 5GMKj 1S72A 2RD1A 4LDWA 3X24B 4RCBA 4E7JA 1M1KC 4JUVA 2YRVA 4C5HA 3F70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZ9 A;  4C8Q D;  4M7D G;  3JB9 F;  1B34 A;  5LJ3 e;  1I5L A;  2ZGW A;  3RIR A;  3JB9 G;  4M77 D;  3JCM d;  3L2Z A;  4M78 E;  4M75 D;  5LJ3 d;  5GAM g;  4M7A C;  5LJ5 d;  4XTW A;  5GMK h;  1I8F A;  3QSU A;  3RER A;  3JCM Q;  3V7S A;  4C8Q E;  2YLC A;  4F7U E;  2E41 A;  2EAY A;  2Y90 A;  4M78 A;  2I2L A;  1KQ1 A;  1N9R A;  1WPY A;  4M77 E;  2DZC A;  2RA2 A;  5DY9 A;  4M75 E;  4XTY A;  4M7A B;  4MML A;  1Y96 A;  1JRI A;  4JUV A;  4XU3 A;  3JCM e;  1B34 B;  4C8Q A;  4F7U A;  4M78 F;  3BW1 A;  5CAI A;  1U1T A;  1LNX A;  4M78 C;  2DTH A;  5GMK m;  3JCM X;  3SB2 A;  4M77 A;  3QHS A;  4C92 F;  5LJ5 j;  4M75 A;  5GAM j;  4NOY A;  3SWN A;  4C8Q F;  3JCM W;  4C8Q C;  4QVC A;  1M5Q 1;  4X9C A;  4M7A A;  3JCM P;  1D3B B;  3V7C A;  3FJP A;  4A53 A;  4M77 F;  4M78 B;  4M77 C;  4M75 F;  4XTU A;  4M75 C;  1WQ7 A;  3SWN C;  2CGH A;  4RCC A;  3JCM g;  2QTX A;  4XU2 A;  5LJ3 g;  3QUI A;  4QVD A;  1Y96 B;  4C92 B;  1MGQ A;  1TH7 A;  5GMK l;  5LJ5 g;  4C8Q B;  3HSB A;  4F7U B;  4PJO D;  5LJ5 h;  3M4G A;  5GAM h;  4EMG A;  3RKX A;  5GAO n;  4MMK A;  3JB9 I;  4C92 E;  4M7D D;  1D3B A;  4M77 B;  4EMK A;  4M75 B;  5GAN e;  3SWN B;  3AHU A;  2EJ9 A;  4DQ2 A;  5GAO m;  4C92 A;  4PJO E;  4EMK C;  4Y91 A;  4JLI A;  3BDU A;  3V8L A;  5GAM f;  4XU0 A;  5LJ5 f;  4JRK A;  3RKY A;  5GAN 5;  2JN0 A;  4M7D E;  4M7A G;  2DKG A;  4NL3 A;  2DTI A;  1WNL A;  3JCM c;  5LJ3 j;  3V8K A;  2RB6 A;  4C92 C;  2DXT A;  4PJO A;  3INZ A;  1LJO A;  3JB9 H;  2RM4 A;  2E64 A;  4EMK B;  4XTV A;  5GAN d;  5GAN 7;  3JCM b;  4M7D A;  2E1H A;  2YHT A;  3FB9 A;  4A54 A;  1X01 A;  4PJO F;  4N0A A;  4PJO C;  4M7A D;  1BIA A;  1LOJ A;  1N9S A;  4XQ3 A;  2VXF A;  3QO3 A;  3JCM h;  3JCM V;  5LJ3 h;  4M7D F;  4M78 G;  4M7D C;  1HK9 A;  3BY7 A;  2E65 A;  3VU3 C;  4J6X A;  2EWN A;  4N0A C;  4X9D A;  3FIF A;  2EJG A;  4C8Q G;  2DXU A;  2EJF A;  2E10 A;  4F7U G;  4HT8 A;  4PJO B;  5GMK e;  2DTO A;  5GAO q;  5GAN j;  4JRI A;  3JCM f;  2DVE A;  4M77 G;  4M7D B;  5LJ3 f;  4M75 G;  3JCM J;  3JB9 J;  3EFS A;  2FB7 A;  5GAO p;  4HT9 A;  1I81 A;  5GAO r;  4NL2 A;  4WF2 A;  3L1A A;  3HFO A;  3PGG A;  3V8J A;  2DJZ A;  4HA8 A;  3V7R A;  5GAN 3;  2VXE A;  2VC8 A;  5GAN g;  4M7A F;  5I21 A;  5GAN h;  5GAN 6;  2FYK A;  2HNI A;  3JB9 D;  1BIB A;  1HXD A;  1WQW A;  3BFM A;  4XTZ A;  5GAM d;  5GAO l;  2YLB A;  4V2S A;  1H64 1;  5GAN 2;  4J6Y A;  2K57 A;  1U1S A;  5GAN 8;  4PNO A;  3GIB A;  3RKW A;  1I4K 1;  4C92 G;  5GAN f;  4J6W A;  5GMK i;  4OP0 A;  5LJ5 e;  5GAM e;  4M7A E;  4EMH A;  4J5Y A;  3EFR A;  5GAN 4;  3RUX A;  4M78 D;  4XTX A;  5GMK j;  2RD1 A;  1YCY A;  4XU1 A;  4PJO G;  4RCB A;  4F7U F;  1KQ2 A;  1M8V A;  3HFN A;  4C92 D;  2DEQ A;  3RES A;  1JBM A; 
#chains in the Genus database with same CATH topology
 1AZG B;  2ZGW A;  2DF6 A;  3PT9 A;  2RI5 A;  2P0P A;  2ZCF B;  3NTI A;  2COY A;  2FPD A;  4LXC A;  1OU8 A;  1MMG A;  1N9R A;  2P84 A;  2XMF A;  4F7U A;  2NUT B;  4M78 C;  3L42 A;  2KRO A;  4C8Q F;  2CRE A;  1G2B A;  3CCM Q;  2LQW A;  3CPW S;  1Q81 R;  3FRN A;  2JS2 A;  4IUP A;  1VQO Q;  1WA7 A;  4AT1 B;  2DL8 A;  2JMC A;  2EQU A;  1PSF A;  1YNZ A;  3CCM A;  2ROT A;  3OSS C;  2XK0 A;  5IHI A;  4C92 A;  5EG2 A;  1VQO A;  1KC8 C;  1OX9 A;  4RTV A;  1M2V B;  2CKK A;  1YI2 T;  2J6O A;  1FWZ A;  2C0O A;  2RHY A;  4E7H A;  3X28 B;  1OEB A;  4M7A D;  4XQ3 A;  4L6V 5;  1IO6 A;  1MND A;  3FIF A;  5FWB A;  1TSF A;  2DXU A;  1VIE A;  4QT7 A;  1NLO C;  3Q1J A;  2P0K A;  4ME7 A;  2VWF A;  1NYF A;  2JUF A;  1K4U S;  4C5G A;  2X4W A;  3A8O B;  2E4H A;  1EFN A;  3QKJ A;  3OS1 A;  1WHK A;  1HXD A;  3FEO A;  4B9X A;  4OB2 B;  4E7I A;  5IXF A;  5GAN 8;  4PNO A;  1X43 A;  1YHQ T;  1EX4 A;  2JNG A;  2DER A;  2AZS A;  2CZ1 B;  2L3R A;  1W1F A;  3L2R A;  2NLU A;  2DD4 A;  5CIU A;  4FSS A;  2OAU A;  2WSC E;  2PUO B;  1D1C A;  4UC4 A;  4JRP A;  4N4G A;  2DLP A;  3RMQ A;  2WSF E;  1XJW B;  2NUT A;  1TS9 A;  4AFU C;  1X6B A;  4BAC A;  1K9M C;  2K5L A;  4C8Q E;  1VQN T;  1OX8 A;  5DY9 A;  3C95 A;  5D6W A;  3LWI A;  3G6E Q;  2AKL A;  5GMK m;  5KYW B;  1YJN Q;  1TOV A;  1YJ9 T;  3OYL A;  2LCL A;  4ESR A;  4IUQ A;  1UG1 A;  1M2V A;  2CH4 A;  2AHJ B;  3G6E A;  5IAY A;  4M75 B;  2F2V A;  4KUI A;  5AYF A;  3VS6 A;  1CKA A;  5GAM f;  1SHG A;  2XID A;  2XKO C;  2KRN A;  4HVW A;  2LNH B;  1D0X A;  1Q81 C;  2EYQ A;  3CME T;  4FU6 A;  1M1K R;  1E7O A;  4KH0 B;  4AFS C;  1VQ4 T;  5FU7 C;  1VQM T;  1X01 A;  3A5Z B;  4PJO C;  3FDR A;  3CD6 Q;  3G1J A;  4M7D F;  2X9H A;  3OA6 A;  4J9C A;  1ACM B;  1ZSZ B;  1HJD A;  4C8Q G;  2QQS A;  2EJF A;  5GMK e;  3CCL Q;  2RJC A;  3CD6 A;  2O9S A;  5GAN 3;  3CC7 T;  2DXC A;  1NEG A;  1WZO A;  1UDL A;  3ZFJ A;  2KYB A;  3CCL A;  2MIO A;  5IHN A;  3I55 T;  1BU1 A;  2HZY A;  3CCE Q;  2ECZ A;  3OQ5 A;  1OPL A;  2F1L A;  1GBR A;  5LJ5 e;  4OB0 B;  1WIE A;  2DIG A;  4M78 D;  1BCO A;  1D0Y A;  3VV0 A;  4KGV B;  3CCE A;  1WLP B;  4E47 A;  5L8R E;  2E3I A;  3MET A;  2QQA A;  1AWJ A;  1TUD A;  5KYW A;  2JM9 A;  2EYX A;  2YUP A;  2DAQ A;  1AWX A;  1XTD A;  2YUQ A;  2XU8 A;  4GY5 A;  2X3X D;  4B9W A;  2M9U A;  5CQX A;  2AT1 B;  2I2L A;  3I56 T;  2OAW A;  3G4S Q;  1AZE A;  1U1T A;  2MMP A;  1PG5 B;  1D1A A;  5GJV B;  1WYX A;  4M75 A;  1G5V A;  3H41 A;  2D0Q B;  1D3B B;  3LX7 A;  2HL3 A;  3UAT A;  3MEV A;  4LDV A;  2LCC A;  4FYV B;  3SWN C;  3G4S A;  2CGH A;  5LJ5 g;  1QWE A;  3OYI A;  1UHF A;  5GAM h;  1UGP B;  1FMW A;  2ED1 A;  3EG0 A;  3VJP A;  4IUV A;  2FRY A;  2KQW A;  4DBF A;  1W2B A;  3BDU A;  4DEY A;  4M7D E;  2AK5 A;  2DKG A;  1ZSZ A;  3M0P A;  1AD5 A;  4A63 B;  2M51 A;  2VGN A;  1N5Z A;  4FSX A;  5FRO A;  1QP2 A;  1R8O B;  1VQL T;  3MO8 A;  4J8O A;  4AFZ C;  1SRM A;  2KT1 A;  3FJ5 A;  3MKD A;  3NPF A;  3M55 A;  3JCM f;  3UDC A;  3L2Q A;  5GAO r;  1ABQ A;  4QQD A;  2F2X A;  4VUB A;  1UGQ B;  2CDT A;  1QVF A;  2VGM A;  2KXD A;  1H64 1;  5KYU A;  1PD1 A;  1J3T A;  2FZK B;  4OMF B;  1NJI U;  2QGG A;  5CKD A;  2LQK A;  3O8V A;  2ENM A;  4JS4 A;  1WJQ A;  4M7D G;  1M1G A;  1Q82 R;  1A0N B;  2A36 A;  4RG8 A;  3L2V A;  2JTF A;  3NGP A;  2CZ6 B;  4LD9 K;  3VS2 A;  1UUE A;  3WVE B;  1JEG A;  1CKB A;  4E7Z A;  3BW1 A;  1LNX A;  1YN8 A;  2E3H A;  5CKH A;  2DD5 A;  4PKC C;  1WXB A;  3OYY A;  3M0S A;  1H8K A;  2WAC A;  3HRU A;  3BE3 A;  2FPF A;  4KUD K;  2QTX A;  1VQK T;  1JJ2 S;  1Y96 B;  3VS4 A;  4PJO D;  2CZ7 B;  4PLL A;  3JB9 I;  5KE2 A;  2OTL A;  2D0N A;  1M3B A;  4Z88 A;  3VS0 A;  3S3M A;  2DYB A;  1VA7 A;  5GAO m;  3VS5 A;  1FMK A;  3NTK A;  4HCB A;  2HKN A;  1UEB A;  1QKW A;  3OYC A;  1YWP A;  1WGS A;  5GAN d;  1C0M A;  1X6G A;  2QAS A;  4OVA A;  1VQ5 Q;  4J9I A;  2RHU A;  3TVT A;  3JCM h;  1WJS A;  3OYH A;  3TSZ A;  2RO0 A;  2ZZD A;  3VU3 C;  2NWM A;  4RTZ A;  1AT1 B;  2HD0 A;  1TXQ A;  3GLX A;  2LJ3 A;  1VQ5 A;  1BYM A;  1OYX A;  2BZ8 A;  2CUB A;  1QP3 A;  2QYZ A;  3E19 A;  2FVU A;  2QEX Q;  2EBP A;  3VKI A;  3JV3 A;  4QQG A;  3M57 A;  4OMN A;  3T9N A;  4MZP A;  1NJI R;  5GAN f;  3VRZ A;  4C0D C;  4F16 A;  3VRY A;  2F5T X;  2QEX A;  1I5O B;  2RD1 A;  1ZLM A;  2DA9 A;  2CP2 A;  3MEA A;  3F70 A;  3CCV A;  3MEU A;  2LX9 A;  5FRN A;  5A0D A;  1MUZ A;  4LUD A;  3CCS A;  4BE0 A;  4M7A C;  4BD3 A;  1V1C A;  2PZ1 A;  2GGR A;  2YRC A;  2GQI A;  4F7U E;  4KGX B;  3RMS A;  3OYD A;  1BCM A;  1K0X A;  2DE0 X;  1KHI A;  1Y96 A;  4MML A;  1H92 A;  2ZAE A;  3HHT B;  1WHM A;  5LJ3 e;  1M8V A;  3P8B B;  4CC4 B;  4OMO A;  4P5N A;  1Q7Y U;  2EYW A;  4M78 B;  2EYZ A;  1WFW A;  3L2W A;  2CP3 A;  5GMK l;  3SD4 A;  3CMA Q;  2M16 A;  4C92 E;  1B07 A;  2D8H A;  2QK0 A;  1SHF A;  3VYH B;  3H0F A;  3QII A;  4JLI A;  4JRK A;  3CMA A;  2PQW A;  1SRL A;  1WXU A;  1C1A A;  2MPX C;  1I1J A;  5I2M A;  2DL7 A;  4BDZ A;  1GCQ C;  1Q81 U;  3LGF A;  2BE7 D;  3PNW C;  1WX6 A;  4F7U G;  2RN8 A;  2IVW A;  2DET A;  2QGF B;  1UJY A;  2QG9 B;  3JCM J;  3EFS A;  1W2B P;  1VQ9 A;  5J39 A;  4HT9 A;  3L1A A;  2CP0 A;  2I0N A;  4MDW A;  3CC4 Q;  2F2W A;  3PE0 A;  5CKB A;  2ZPG B;  5GAN h;  3JB9 D;  1BIB A;  4GBQ A;  2RHX A;  3OYF A;  3RDV A;  3EG1 A;  3GPL A;  3KUF A;  1NPP A;  1KFZ A;  4J9G A;  4PLI A;  3A1P A;  5D6Y A;  3CC4 A;  4C92 G;  1SF9 A;  5A0L A;  2CT3 A;  1YIT T;  3THK A;  1R0B G;  1KQS A;  2L5Q A;  1VQ6 T;  4RTU A;  2KBT A;  2DZ9 A;  4RTY A;  3G71 T;  3S3O A;  5LJ3 d;  4L59 A;  2EIF A;  3EAE A;  5FRM A;  1GFC A;  1MMA A;  1NJI C;  2HQH A;  1T0H A;  2PVG B;  1QVF P;  2E41 A;  4M78 A;  3CQT A;  1N8R U;  1TWB A;  4D6W A;  2A08 A;  2KRM A;  2CSI A;  5KCO A;  1Q7Y R;  2RJD A;  1K0S A;  2PUK B;  3X25 B;  3JCM W;  5GAM j;  4X9C A;  1IGQ A;  4M75 F;  1X75 C;  2K5I A;  1UFF A;  3HSB A;  1W70 A;  1B3Q A;  4EMG A;  4X34 A;  1LCK A;  3AHU A;  1OZ3 A;  1CSK A;  3EG2 A;  4ATO A;  4AMC A;  3M54 A;  3MP6 A;  2DTI A;  3G7Z A;  1JB0 E;  4DBR A;  2K3Y A;  2EFI A;  3ME9 A;  4CC7 A;  3DLM A;  5A2Q E;  1X2Q A;  5IH2 A;  3H0I A;  4XAX B;  4FL6 A;  2P4T A;  2CP7 A;  1F1B B;  4LD6 A;  2GF7 A;  4PJM A;  2W0Z A;  2A0F B;  5FU7 B;  2EGE A;  3A8M B;  4PJO B;  4HCK A;  1GRI A;  2DTO A;  1PHT A;  3RBB B;  1VQO T;  1RUW A;  3JB9 J;  4QKU A;  1G8X A;  2PTK A;  1QVG S;  3HFO A;  3KXT A;  2LT1 A;  2EYY A;  5HKC A;  1IHW A;  2RHI A;  1M1K U;  4CC2 A;  2CUD A;  3M59 A;  1P92 A;  1N27 A;  2B86 A;  4BE2 A;  2J05 A;  1LPL A;  4LNP A;  2PU9 B;  3M0R A;  5DLO A;  2DEU A;  4IUU A;  1TUC A;  2M0Y A;  2O4X B;  3CCJ Q;  3RUX A;  1V29 B;  2KGT A;  1NEB A;  2JOY A;  1D09 B;  3RES A;  4JRI A;  4JJC A;  1QWF A;  2L89 A;  4DOV A;  5D7U A;  3OYB A;  1H3Z A;  1ZHI A;  5GAM g;  4N4I A;  3CCJ A;  5FLX E;  3OYM A;  3RER A;  2JJ9 A;  1N8R R;  3ZL7 C;  2XDB A;  2JTE A;  2RA2 A;  4M75 E;  2YUN A;  2HSP A;  3QDF A;  4QVZ A;  2YWW A;  1WHH A;  1WXT A;  4NOY A;  2FPE A;  4LUE A;  1NE8 A;  1PRM C;  4ZTF A;  2CP6 A;  4M77 C;  2JM8 A;  9ATC B;  2GNC A;  3TCJ A;  4QVD A;  1M27 C;  2K4Y A;  4DEX A;  1Z9Z A;  1GXI E;  2LX7 A;  2K79 A;  2E12 A;  5I22 A;  1Q95 G;  3SWN B;  1Q7Y C;  2EJ9 A;  1VQ8 Q;  4BUG A;  2K9G A;  1T3S A;  1WNL A;  4DBH A;  3CCR Q;  3SHW A;  4PJO A;  4LDX A;  2DVJ A;  2RJE A;  3X26 B;  1VQ8 A;  1X27 A;  3G6E T;  2MF2 A;  3OBY A;  1YJN T;  4F04 B;  3FC3 A;  1HK9 A;  2KI7 A;  3UA7 A;  3ULR B;  4J6X A;  4N0A C;  3CCR A;  4HT8 A;  2D8J A;  4ELY C;  4M75 G;  1NBE B;  1YJ9 A;  1Y71 A;  3V8J A;  5AT1 B;  1FYN A;  2VC8 A;  2W10 A;  1BKB A;  2O4X A;  2DX1 A;  4M7A F;  3M0Q A;  2AZV A;  1YJW Q;  4MZT A;  1VQ7 Q;  2ZPE B;  2MAM A;  4J6Y A;  3JSC A;  2RNA A;  2BUD A;  3RR6 A;  3GP8 A;  1PC0 A;  5CKE A;  2QI2 A;  4Z8A A;  4E2F B;  1YJW A;  4PK4 A;  4XTX A;  3CD6 T;  2V8K A;  1VQ7 A;  4MDX A;  1JBM A;  2OX7 A;  3VS7 A;  5FW9 A;  2LMJ A;  3CCL T;  1SG5 A;  2HAX A;  3DLL A;  1OOT A;  2K6D A;  4OF1 A;  3V7S A;  3MJX A;  1H3H A;  1KQ1 A;  2K7A A;  5CKF A;  2ATC B;  3KFV A;  2LQN A;  1VYU A;  4PFP A;  4FCY A;  3SWN A;  1TTH B;  1KQS P;  3CCE T;  3M0U A;  3V7C A;  3NTH A;  3IQL A;  4Y92 A;  2DJQ A;  3JCM g;  1PKT A;  2V8J A;  1BBZ A;  1OZ2 A;  3PIO A;  1N8R C;  5D6X A;  2FZC B;  1Q86 R;  4EPC A;  1Q82 U;  3LYI A;  5IHK A;  2OTJ Q;  1JO8 A;  1K73 R;  1RI9 A;  2LTO A;  2O2O A;  1OU9 A;  3JRZ A;  1PD0 A;  2K2V A;  1PM3 A;  3OMC A;  1BK2 A;  3V8K A;  2OTJ A;  2QA4 Q;  2BKD N;  3UWN A;  1UB4 A;  7AT1 B;  3G4S T;  2L0A A;  2YXY A;  5L23 A;  4JRQ A;  2VXF A;  2RF0 A;  1KD1 U;  3BY7 A;  2MWP A;  2YSQ A;  1G3S A;  2EKH A;  2QA4 A;  2EJG A;  3I56 A;  3I5S A;  2X4J A;  1PRL C;  1QLY A;  1B7T A;  5GAN j;  4C0G A;  2AIR B;  4D8D A;  1ZBJ A;  1Y7X A;  2DIQ A;  2VAS A;  2MOX A;  3KBG A;  3OS0 A;  1S72 Q;  4DBQ A;  5GAN 2;  3J81 E;  1U1S A;  4J7F A;  2NYS A;  1MMD A;  6AT1 B;  2SRC A;  4JS5 A;  2XD0 A;  1S72 A;  4LDW A;  3X24 B;  4RCB A;  4E7J A;  3VS1 A;  1M1K C;  4JUV A;  2YRV A;  4C0D B;  4C92 D;  1HD3 A;  4ZGD B;  4GLK A;  5CVI A;  1RAC B;  4M77 D;  1K1Z A;  1W4S A;  1TU0 B;  5LJ5 d;  4XTW A;  2AKK A;  3TQ7 P;  5KCH A;  3MP8 A;  4JDS A;  1JXO A;  3HL8 A;  2COZ A;  4M7A B;  4M78 F;  2JZ2 A;  2MK5 A;  4C8Q C;  4QVC A;  3OYN A;  2EGA A;  1FX7 A;  1QCN A;  4BDY A;  5LL6 S;  2QQ9 A;  3MEW A;  1Y57 A;  5I2S A;  4RCC A;  2ZPF B;  1PCX A;  1MGQ A;  1TH7 A;  2KE9 A;  2X51 A;  3QYH B;  5GAO n;  1W2B S;  4KT0 E;  3EGU A;  1D3B A;  5CR2 A;  2L3S A;  3H8Z A;  2KY9 A;  2EQI A;  4Y28 E;  5LJ5 f;  2ESW A;  3FLG A;  4Z02 A;  1E6G A;  5HY6 A;  2XDD A;  2RB6 A;  2OTL Q;  5CCA A;  1X6O A;  2C0I A;  2RM4 A;  2E64 A;  1BI0 A;  2OI3 A;  2YHT A;  1KD1 R;  1OV3 A;  2VKN A;  3OYJ A;  2K5F A;  2A7Y A;  4TVR A;  2IIM A;  2V8I A;  1YCS B;  2EPD A;  1VQP Q;  2D1X A;  1ZUY A;  4WF2 A;  2KSS A;  3CCU Q;  4JLG A;  5I21 A;  1VQP A;  4KRT A;  3BFM A;  3GNG A;  5ECA A;  4BY6 C;  4HVV A;  2KYM A;  1D0Z A;  4YTL A;  2GTO A;  2M0O A;  3CCU A;  2A37 A;  3I5R A;  1PKS A;  2DPP B;  1VQ5 T;  1K8A R;  4OMQ A;  1KIK A;  2DEQ A;  4M7A A;  3WVD B;  2HDA A;  1OI1 A;  4JJB A;  1ZA1 B;  1U06 A;  3LWH A;  4AFQ C;  3L2Z A;  2WSE E;  3D7S B;  4M78 E;  3URG A;  5GMK h;  2LJ0 A;  2DXB A;  3H6Z A;  1O9S A;  2F69 A;  2NUP B;  3CCV Q;  2DZC A;  4ORZ A;  3GF5 A;  1MHN A;  3CCS Q;  2QEX T;  4FYW B;  3TSW A;  1M30 A;  3LGL A;  3OYG A;  3OW2 A;  3JCM P;  1WHG A;  3FJP A;  4A53 A;  1M4Z A;  2HSE B;  3CXC A;  2HBP A;  1TG0 A;  5DM7 R;  4FYY B;  5LJ5 h;  2JMA A;  1M8M A;  2ED0 A;  3OYA A;  3QWX X;  2DMO A;  4CRI A;  4DQ2 A;  2VYT A;  3EHR A;  4EIK A;  3V8L A;  3EFO B;  2YDL A;  3GOX A;  1SPK A;  1GCQ A;  4FW1 A;  1Q82 C;  3CC2 Q;  1R77 A;  4PJO F;  1UGV A;  2EQK A;  1EIF A;  2LJ1 A;  1BIA A;  2K2M A;  1N9S A;  3DB4 A;  1G3Y A;  2CS7 A;  4M78 G;  4M7D C;  1NLP C;  4DA4 A;  4IUT A;  4PFO A;  3U23 A;  3LH0 A;  3CC2 A;  2GFA A;  2RK2 A;  1RAF B;  2R5M A;  2DVE A;  2XI9 A;  2JTM A;  4A4H A;  1GCP A;  3CMA T;  2R57 A;  2OJ2 A;  4NL2 A;  2RQU A;  1IHV A;  1KD1 C;  1UE9 A;  2LDM A;  2FHD A;  3TU4 K;  2KEA A;  1PSE A;  8AT1 B;  1RAH B;  3CCQ Q;  2E70 A;  1VQ9 Q;  5M9O A;  5KH6 A;  4OB3 B;  3GIB A;  2Y4Y A;  1ZUK A;  4JPB W;  2LCS A;  3EGX B;  4OP0 A;  4J5Y A;  3QG1 A;  3CCQ A;  5HCK A;  4IUR A;  2DYI A;  3A98 A;  2NUP A;  2D6F A;  4RUG A;  4BB7 A;  4C8Q D;  3OYK A;  1OUL A;  2ZPB B;  3NFC A;  2HQE A;  1GBQ A;  1M2O A;  3ZEH A;  2H8H A;  2YLC A;  2HKQ B;  2XDP A;  2VB6 A;  3CC4 T;  3MCA B;  1K8A C;  3UPU A;  2X4Y A;  2L2P A;  1NYG A;  2L3P A;  1YIJ Q;  2QQB A;  4LDU A;  5CK9 A;  4E7L A;  1AOJ A;  1WQ7 A;  3EFO A;  1IRE B;  2CH4 W;  4C92 B;  2ROL A;  4A4K A;  1YIJ A;  1M90 U;  3CBP A;  3CPW A;  3HKS A;  4M77 B;  3OSV A;  2LVM A;  3R6N A;  4PJO E;  2M1H A;  4EMK C;  2BIV A;  3J7A F;  3JCM c;  1HSQ A;  1SKU B;  3H9N A;  1RLQ C;  1NPR A;  3JCM b;  2JXB A;  2HCK A;  1LOJ A;  1AWO A;  2A28 A;  4OGE A;  2CYZ B;  3VUZ A;  2O31 A;  4X9D A;  3P8D A;  5GJW B;  2BE9 B;  3OB9 A;  3UF4 A;  3C12 A;  4DOW A;  1ZQ1 A;  2E6Z A;  2PVD B;  2RQT A;  5LJ3 f;  3OMG A;  5FU6 B;  1I81 A;  2MWO A;  4ANJ A;  2F5K A;  5KE3 A;  3EGX A;  3V7R A;  3MHX A;  1I07 A;  4C5E A;  4WCI A;  2HL5 C;  1M3A A;  2X4X A;  1VOM A;  2FYK A;  1IB8 A;  4AG1 C;  3EG3 A;  2DIL A;  2QXF A;  2RPN A;  4RTX A;  1ZA2 B;  3RKW A;  1KQS S;  3CCM T;  5CQY A;  4KUL A;  5GAM e;  3OS2 A;  1RAB B;  2X35 A;  3CBO A;  2CZ0 B;  4PJO G;  3HFN A;  3JB9 F;  3HPW A;  4AG2 C;  3A8H B;  3OYE A;  1GFD A;  1SEM A;  1YI2 Q;  4PL6 A;  3RNJ A;  1WI7 A;  2P4R A;  1ZSG A;  4XU3 A;  2GFU A;  2K3X A;  3A8G B;  2DBK A;  4F17 A;  2EQM A;  3S3N A;  5C6S A;  3SB2 A;  4M77 A;  5J3B A;  4C0F A;  1YI2 A;  1AHJ B;  1AVZ C;  1M5Q 1;  4J7I A;  1UGR B;  1ZBX A;  1G83 A;  3PIP A;  1M90 R;  1R0C B;  3I35 A;  1Z9Q A;  3JAM E;  1YFN A;  4IIO A;  3CCJ T;  2JVV A;  3M58 A;  4MZM A;  4M7D D;  1OQK A;  2LRQ A;  5KYX B;  5J26 A;  1YHQ Q;  4C92 C;  3M0T A;  1FMV A;  3JB9 H;  1VUB A;  4BI8 B;  3OW2 P;  3NMZ C;  3FB9 A;  4N0A A;  4FT4 A;  2J06 A;  3CXC P;  3JCM V;  5LJ3 h;  2O9V A;  4OB1 B;  2RI2 A;  1YHQ A;  1JQQ A;  3M53 A;  3AT1 B;  1Q86 U;  1S1N A;  4OMM A;  5KYY B;  1NG2 A;  4O6J A;  2GTJ A;  5GAO q;  1K73 U;  2J7I A;  2C06 A;  3VUB A;  5A0G A;  4PFZ A;  3PMT A;  1VQN Q;  4FM4 B;  5IT9 E;  4KBM B;  4ZN3 A;  3TEE A;  5GAN 6;  5GAM d;  1WQW A;  4XTZ A;  2XHC A;  2ZPH B;  5GAO l;  1VQ8 T;  3QXE B;  1YJ9 Q;  3EGD B;  1C6V X;  3QYG B;  1VQN A;  3CCR T;  1SSH A;  5FU6 C;  1VIF A;  2CP5 A;  5GMK i;  1JXM A;  4ZGE B;  1WHL A;  3EFR A;  5GMK j;  5KYN A;  1ZUU A;  4C5H A;  2O88 A;  4IIM A;  1O75 A;  2HBW A;  2R58 A;  4KH1 B;  2YUO A;  4LDY A;  2KT8 A;  1XNI A;  1YJN A;  4C5I A;  1I8F A;  2CSQ A;  2Z0W A;  1TUG B;  5CO7 A;  1BI1 A;  3JCM Q;  3CME Q;  4GLM A;  2H3J A;  1U5S A;  8ATC B;  2BTT A;  2YRD A;  2EVR A;  1VQ4 Q;  1JRI A;  3JCM e;  1VQM Q;  5HK3 A;  5CAI A;  1YP5 A;  1YJW T;  4NS5 A;  4ZNX A;  1VQ7 T;  5LJ5 j;  1KQ2 A;  1M9S A;  5KYX A;  4CC3 A;  3CME A;  2L3Q A;  1VQ4 A;  1HYO A;  3EHQ A;  3WXM B;  1VQM A;  2HQX A;  4C8Q B;  1T3L A;  1MV0 B;  2DK3 A;  1BB9 A;  3CC7 Q;  4J9H A;  3MP1 A;  3EH2 A;  5FWC A;  1V76 A;  3JB9 G;  3I55 Q;  2E6N A;  2KXC A;  3RKY A;  2DL5 A;  4E7S A;  4NL3 A;  3HRS A;  2D9T A;  1RAA B;  1M90 C;  1LJO A;  5KYY A;  4B6M A;  3CC7 A;  1RAI B;  1G3T A;  3E1S A;  2QAZ A;  1IZ6 A;  2R5A A;  4O5V A;  2EKO A;  3I55 A;  1SSF A;  3QDR B;  1UEC A;  2COW A;  2DRM A;  2RHZ A;  3CPW P;  2X3W D;  3QBY A;  3E9F A;  3QPH A;  1WJR A;  3HRT A;  3EGD A;  4ZGJ B;  5DLQ E;  2FB7 A;  3PGG A;  2OTJ T;  4HA8 A;  2MI6 A;  5KYU B;  2KMT A;  3I56 Q;  3S6W A;  1RLP C;  4J9E A;  1AEY A;  3QWY A;  1QVG P;  1QKX A;  1QQJ A;  1T0J A;  2Y4X A;  3OY9 A;  3LLR A;  2QA4 T;  1RAE B;  4JJD A;  4X1V A;  1U8R A;  2E5K A;  4BY6 B;  4M7A E;  4HXJ A;  1UGS B;  4EMH A;  5GAN 4;  1LVK A;  2YT6 A;  3SFM A;  4BI4 A;  1K76 A;  2RK1 A;  4N4H A;  3RIR A;  3M5A A;  4HVU A;  1ARK A;  3JCM d;  3QSU A;  1N6A A;  3EH1 A;  2CT4 A;  2ZPI B;  2Y90 A;  1WPY A;  2RQW A;  2PNI A;  1RL2 A;  1IRX A;  2VUB A;  4C8Q A;  1NZ9 A;  1VQL Q;  1S72 T;  3QHS A;  2FL7 A;  4HKE A;  4PJN A;  1K8A U;  5C0M A;  4M75 C;  2V1Q A;  1UTI A;  2QDL A;  4XU2 A;  1VQL A;  2MCN A;  2KDS A;  3OBW A;  3I9Q A;  4RKU E;  3M56 A;  3UA6 A;  2J6F A;  1JJ2 A;  4LN2 A;  5GAN e;  2DNU A;  3ER0 A;  3SDZ A;  4Y91 A;  5GAN 5;  2JN0 A;  4M7A G;  2HEQ A;  1QVP A;  2K3B A;  3REB B;  2LQ8 A;  3INZ A;  3MPU B;  4E6R A;  3R6O A;  4HCC A;  3QJY A;  4JZ4 A;  1ZSZ C;  4PJJ A;  4A54 A;  3QZ9 B;  2DBM A;  3DB3 A;  1D1B A;  3UT1 A;  4ELZ C;  4PJL A;  2E5Q A;  2ABL A;  1QCO A;  2V1R A;  2QQR A;  2JT4 A;  1X69 A;  2RMO A;  4F14 A;  4M7D B;  4FT2 A;  3EG9 B;  5GAO p;  1MNE A;  3C94 A;  1X2K A;  2QDY B;  4RMO A;  3PTA A;  3CBM A;  1M1F A;  1YBY A;  4J9B A;  5GAN g;  2KVQ G;  3PVQ A;  2HNI A;  3P8H A;  1Q86 C;  2DO3 A;  4Q5W A;  1JU5 C;  2K57 A;  1K73 C;  2OTL T;  4A4G A;  1I4K 1;  2GBQ A;  1I0C A;  1VQK Q;  1NM7 A;  3BDL A;  2EW3 A;  3QJ6 A;  2LNV A;  4XU1 A;  4F7U F;  3O5Z A;  1MV3 A;  4J6W A;  1K9A A;  1QVF S;  1QCF A;  3C4S A;  1BI2 A;  4QQ6 A;  4L5G A;  4RTT A;  3ASK A;  4FIB A;  1UHC A;  1VQP T;  1VQK A;  3L2U A;  2L8D A;  3HP9 A;  4K11 A;  2EAY A;  3CEY A;  1RAD B;  2KAF A;  4XTY A;  4EDU A;  2QTV A;  2DRK A;  1WHJ A;  3CCU T;  4IKF A;  1B34 B;  3JCM X;  4J9F A;  1E6H A;  4C92 F;  2VV5 A;  4A4E A;  1ZX6 A;  3NHN A;  3H0H A;  4M77 F;  1KC8 U;  2GQV A;  3VS3 A;  2RI3 A;  3GBQ A;  1KG1 A;  2BZY A;  5IXB A;  3M4G A;  1QMC A;  4II1 A;  3RKX A;  1M3C A;  2SEM A;  4C0Z A;  2JS0 A;  2RQV A;  2RJF A;  3X20 B;  4FW2 A;  2IPO B;  4XU0 A;  1Y0M A;  1DJ7 B;  5LJ3 j;  3A8L B;  4JJN K;  3C0C A;  3LH5 A;  1VYT A;  1XOV A;  4HCZ A;  4OMP A;  4EMK B;  5HK0 A;  5GAN 7;  3CCV T;  4M7D A;  4J9D A;  1EZZ B;  2E1H A;  3EG9 A;  3PMI A;  2PVO B;  3CCS T;  4Z89 A;  3QO3 A;  1BI3 A;  2MYS A;  2HMA A;  4FYX B;  4LE9 A;  1XQH A;  2E10 A;  2JW4 A;  2LP5 A;  1PNJ A;  2P0Q A;  3M4Y A;  2DL3 A;  2G3R A;  2LC4 A;  2DFU A;  2RH2 A;  2FEI A;  2DJZ A;  2BZX A;  2VXE A;  4D8K A;  2M02 A;  2NUZ A;  4BE1 A;  2FO0 A;  2LT4 A;  3SEM A;  3HTR A;  1ABO A;  3GNF B;  1KK7 A;  1K9M U;  2GCX A;  3CC2 T;  1U3O A;  3DKM A;  1QW1 A;  4E7K A;  2EQJ A;  1YCY A;  2FG0 A;  1VYV A;  5IN1 A;  4OGC A;  1Y07 A;  1B34 A;  1YWO A;  2C0T A;  2LZ6 B;  2RQR A;  1I5L A;  1UJ0 A;  4M75 D;  4M4Z A;  3TRE A;  4J83 A;  1KJW A;  2IG0 A;  2KNB B;  4A4F A;  1KHC A;  4WTO B;  2VVK A;  2J6K A;  4OML A;  2G6F X;  2DL4 A;  4M77 E;  3OW2 S;  2DTH A;  3CCQ T;  3CXC S;  1VQ9 T;  1KC8 R;  2B8A A;  4JZ3 A;  4ZTJ A;  4BI3 A;  4XTU A;  3PVL A;  4R56 A;  5LJ3 g;  3QUI A;  1MMN A;  4F7U B;  1PWT A;  1AWW A;  4MMK A;  3E9G A;  2XIC A;  3QZ5 B;  3ZBD A;  4EMK A;  4XK8 E;  1IXD A;  4R55 A;  1RI0 A;  2KRS A;  1RAG B;  2A3L A;  4R0K A;  1OPK A;  4RTW A;  2DXT A;  4XTV A;  2V26 A;  1GL5 A;  5I11 A;  1YIT Q;  2EGC A;  1VQ6 Q;  1YIJ T;  2KR3 A;  4KGZ B;  2E65 A;  2EWN A;  1FXX A;  3G71 Q;  3LW5 E;  4RG2 A;  1JJ2 P;  3E2U A;  2FRW A;  1W6X A;  2DM1 A;  1YIT A;  4M77 G;  1VQ6 A;  3M9Q A;  2H3E B;  3G71 A;  4ZN1 A;  4QW2 A;  1QVG A;  3PFS A;  4CI0 C;  3N5B B;  2XG8 D;  2YLB A;  4V2S A;  3REA B;  1K9M R;  3VYG A;  1IGU A;  2O01 E;  1KSW A;  3CPF A;  3OS5 A;  3J80 E;  1WDX A;  5EC7 A;  1G3W A;  2FZG B;  2KK4 A; 
#chains in the Genus database with same CATH homology
 1O75 A;  3CCV A;  3MEU A;  4ZGD B;  2LX9 A;  4GLK A;  5CVI A;  5FRN A;  2R58 A;  5A0D A;  2ZGW A;  3PT9 A;  2RI5 A;  2P0P A;  2ZCF B;  1XNI A;  3NTI A;  4LDY A;  1W4S A;  4M77 D;  3CCS A;  4BE0 A;  5LJ5 d;  1YJN A;  4XTW A;  4BD3 A;  4M7A C;  4C5I A;  1I8F A;  3MEA A;  5CO7 A;  1BI1 A;  3JCM Q;  4F7U E;  5KCH A;  3MP8 A;  4JDS A;  3RMS A;  3OYD A;  2H3J A;  3HL8 A;  1N9R A;  4M7A B;  1KHI A;  1Y96 A;  1JRI A;  4MML A;  3JCM e;  3HHT B;  5HK3 A;  5LJ3 e;  4F7U A;  4M78 F;  5CAI A;  1M8V A;  4M78 C;  1YJW T;  3P8B B;  3L42 A;  2JZ2 A;  4P5N A;  4NS5 A;  1VQ7 T;  5LJ5 j;  1Q7Y U;  1KQ2 A;  4C8Q F;  1M9S A;  4C8Q C;  4QVC A;  3OYN A;  4BDY A;  1FX7 A;  3CME A;  5LL6 S;  2QQ9 A;  3MEW A;  3CPW S;  4M78 B;  1VQ4 A;  3FRN A;  3WXM B;  4RCC A;  5I2S A;  2ZPF B;  4IUP A;  3L2W A;  1VQM A;  5GMK l;  2HQX A;  1MGQ A;  1TH7 A;  3SD4 A;  4C8Q B;  3QYH B;  5GAO n;  2M16 A;  2DK3 A;  4KT0 E;  4C92 E;  2EQU A;  1W2B S;  1D3B A;  1PSF A;  5CR2 A;  3CCM A;  3H8Z A;  3MP1 A;  3OSS C;  3VYH B;  2XK0 A;  4C92 A;  2KY9 A;  4Y28 E;  5EG2 A;  3JB9 G;  1VQO A;  3QII A;  4JLI A;  5LJ5 f;  3FLG A;  1KC8 C;  4JRK A;  2E6N A;  3RKY A;  3CMA A;  4Z02 A;  4NL3 A;  3HRS A;  2CKK A;  2D9T A;  5HY6 A;  2PQW A;  2XDD A;  2RB6 A;  1YI2 T;  1M90 C;  5CCA A;  1X6O A;  1FWZ A;  1LJO A;  2RM4 A;  3CC7 A;  2E64 A;  1BI0 A;  2RHY A;  4E7H A;  3X28 B;  1G3T A;  2YHT A;  5I2M A;  4BDZ A;  3E1S A;  4M7A D;  4XQ3 A;  1IZ6 A;  2R5A A;  4O5V A;  2EKO A;  4L6V 5;  1SSF A;  3QDR B;  2K5F A;  3OYJ A;  3LGF A;  3I55 A;  1Q81 U;  2A7Y A;  2RHZ A;  4TVR A;  3PNW C;  3FIF A;  2V8I A;  2DXU A;  1VIE A;  3E9F A;  3QBY A;  3QPH A;  1WJR A;  4F7U G;  2IVW A;  3HRT A;  3Q1J A;  2P0K A;  4ME7 A;  2JUF A;  4ZGJ B;  3JCM J;  4C5G A;  3EFS A;  2FB7 A;  5DLQ E;  5J39 A;  1VQ9 A;  4HT9 A;  2X4W A;  3A8O B;  4WF2 A;  3L1A A;  3PGG A;  2OTJ T;  4HA8 A;  3QKJ A;  4MDW A;  2MI6 A;  2KSS A;  2KMT A;  3OS1 A;  3S6W A;  5CKB A;  2ZPG B;  4JLG A;  5I21 A;  5GAN h;  3JB9 D;  1VQP A;  1BIB A;  1HXD A;  3BFM A;  2RHX A;  3GNG A;  3OYF A;  3FEO A;  2Y4X A;  4B9X A;  4OB2 B;  4BY6 C;  3OY9 A;  3KUF A;  3GPL A;  4E7I A;  5GAN 8;  1NPP A;  4PNO A;  1YHQ T;  3LLR A;  4PLI A;  4YTL A;  2JNG A;  2QA4 T;  5D6Y A;  3CC4 A;  4C92 G;  1U8R A;  2M0O A;  5A0L A;  3CCU A;  2CZ1 B;  2L3R A;  4BY6 B;  4M7A E;  1UGS B;  4EMH A;  3L2R A;  1YIT T;  2DPP B;  5GAN 4;  1KQS A;  1VQ5 T;  2L5Q A;  2NLU A;  2DD4 A;  1VQ6 T;  5CIU A;  2OAU A;  2WSC E;  3SFM A;  2DEQ A;  4M7A A;  2PUO B;  4UC4 A;  2DZ9 A;  3WVD B;  4BI4 A;  4JRP A;  1OI1 A;  4N4G A;  3RMQ A;  3G71 T;  2WSF E;  2RK1 A;  4N4H A;  3RIR A;  3M5A A;  3LWH A;  3S3O A;  3JCM d;  3L2Z A;  2WSE E;  4M78 E;  5LJ3 d;  4BAC A;  4L59 A;  1K9M C;  3URG A;  2EIF A;  3EAE A;  5GMK h;  5FRM A;  1N6A A;  3QSU A;  2K5L A;  1NJI C;  2DXB A;  3H6Z A;  2PVG B;  1O9S A;  4C8Q E;  2E41 A;  2ZPI B;  2Y90 A;  4M78 A;  1VQN T;  2F69 A;  1WPY A;  2DZC A;  3C95 A;  5D6W A;  5DY9 A;  1RL2 A;  1N8R U;  4D6W A;  2VUB A;  3GF5 A;  4C8Q A;  5KCO A;  3LWI A;  1MHN A;  2RJD A;  5GMK m;  1NZ9 A;  2QEX T;  1S72 T;  2PUK B;  3LGL A;  3QHS A;  3X25 B;  5GAM j;  3OYG A;  3OW2 A;  3JCM W;  1YJ9 T;  3OYL A;  2LCL A;  2FL7 A;  4HKE A;  4X9C A;  3JCM P;  1K8A U;  3FJP A;  5C0M A;  4A53 A;  1M4Z A;  4IUQ A;  4M75 F;  4M75 C;  3CXC A;  2HBP A;  4XU2 A;  1X75 C;  2K5I A;  3HSB A;  2AHJ B;  3G6E A;  5DM7 R;  1VQL A;  5LJ5 h;  2KDS A;  3OBW A;  4EMG A;  4RKU E;  3OYA A;  5IAY A;  3M56 A;  4X34 A;  4CRI A;  1JJ2 A;  4M75 B;  5GAN e;  3AHU A;  3ER0 A;  4KUI A;  5AYF A;  1OZ3 A;  3SDZ A;  2VYT A;  4DQ2 A;  4Y91 A;  3V8L A;  5GAM f;  5GAN 5;  2JN0 A;  4ATO A;  2XID A;  2XKO C;  4M7A G;  3M54 A;  3MP6 A;  2DTI A;  3G7Z A;  3GOX A;  1QVP A;  1Q81 C;  2EYQ A;  1JB0 E;  2LQ8 A;  3CME T;  4FU6 A;  3INZ A;  1Q82 C;  3R6O A;  4HCC A;  1VQ4 T;  2K3Y A;  2EFI A;  3ME9 A;  3QJY A;  3DLM A;  5FU7 C;  4A54 A;  1X01 A;  3A5Z B;  2EQK A;  4PJO F;  5A2Q E;  1EIF A;  3QZ9 B;  1BIA A;  3FDR A;  1N9S A;  4FL6 A;  4XAX B;  4PJO C;  3DB3 A;  3DB4 A;  1G3Y A;  2CS7 A;  3UT1 A;  4M7D F;  2P4T A;  4M78 G;  4M7D C;  4DA4 A;  4ELZ C;  4LD6 A;  2E5Q A;  2GF7 A;  4IUT A;  3OA6 A;  5FU7 B;  4C8Q G;  2QQS A;  2EJF A;  3A8M B;  4PJO B;  3LH0 A;  2QQR A;  5GMK e;  2GFA A;  3CC2 A;  2RK2 A;  2DTO A;  2R5M A;  2DVE A;  2RJC A;  2JTM A;  2XI9 A;  4A4H A;  4FT2 A;  3JB9 J;  1VQO T;  4M7D B;  5GAO p;  3CD6 A;  3CMA T;  2R57 A;  3C94 A;  1QVG S;  4NL2 A;  2QDY B;  3HFO A;  4RMO A;  3PTA A;  3CBM A;  3KXT A;  5GAN 3;  2LT1 A;  1KD1 C;  1M1F A;  3CC7 T;  2DXC A;  2LDM A;  1YBY A;  2FHD A;  5GAN g;  3TU4 K;  2KVQ G;  5HKC A;  3ZFJ A;  3CCL A;  2HNI A;  1PSE A;  3P8H A;  1Q86 C;  2DO3 A;  2RHI A;  1M1K U;  4Q5W A;  2E70 A;  3I55 T;  3M59 A;  2K57 A;  5M9O A;  1K73 C;  5KH6 A;  4OB3 B;  1P92 A;  3GIB A;  2Y4Y A;  1N27 A;  2OTL T;  3OQ5 A;  4BE2 A;  4A4G A;  1I4K 1;  2PU9 B;  5DLO A;  4OP0 A;  4IUU A;  5LJ5 e;  4OB0 B;  2O4X B;  2DIG A;  3QG1 A;  4J5Y A;  3CCQ A;  3RUX A;  3BDL A;  4M78 D;  4IUR A;  3QJ6 A;  2LNV A;  1V29 B;  4XU1 A;  4F7U F;  2JOY A;  2D6F A;  3VV0 A;  4BB7 A;  4J6W A;  3RES A;  3CCE A;  4JRI A;  4E47 A;  4C8Q D;  5L8R E;  1QVF S;  3OYK A;  3C4S A;  1BI2 A;  3MET A;  4QQ6 A;  2L89 A;  2QQA A;  2ZPB B;  3ASK A;  3NFC A;  4FIB A;  4L5G A;  4DOV A;  3OYB A;  2HQE A;  1H3Z A;  1ZHI A;  1VQP T;  1VQK A;  5GAM g;  4N4I A;  3ZEH A;  3L2U A;  2DAQ A;  2L8D A;  3CCJ A;  5FLX E;  3OYM A;  3RER A;  1XTD A;  3HP9 A;  2XU8 A;  4GY5 A;  2YLC A;  2EAY A;  4B9W A;  3CEY A;  2M9U A;  5CQX A;  2XDB A;  2I2L A;  2KAF A;  2XDP A;  3CC4 T;  2RA2 A;  4M75 E;  4XTY A;  4EDU A;  3I56 T;  3MCA B;  1K8A C;  3CCU T;  3UPU A;  4IKF A;  1B34 B;  2X4Y A;  3JCM X;  4QVZ A;  1U1T A;  2MMP A;  4C0D B;  2QQB A;  4C92 D;  4C92 F;  4M75 A;  4LDU A;  4NOY A;  2VV5 A;  4A4E A;  1G5V A;  2D0Q B;  5CK9 A;  1NE8 A;  1D3B B;  4E7L A;  3LX7 A;  4ZTF A;  4M77 F;  3MEV A;  1KC8 U;  4M77 C;  4LDV A;  2LCC A;  1WQ7 A;  2GQV A;  3SWN C;  3G4S A;  2CGH A;  1IRE B;  3TCJ A;  2RI3 A;  4QVD A;  4C92 B;  5LJ5 g;  4A4K A;  2K4Y A;  1KG1 A;  1YIJ A;  3OYI A;  3CBP A;  3CPW A;  3M4G A;  3HKS A;  5GAM h;  1M90 U;  4II1 A;  3RKX A;  1UGP B;  1GXI E;  4C0Z A;  2E12 A;  4M77 B;  3OSV A;  3SWN B;  2LVM A;  1Q7Y C;  2RJF A;  3VJP A;  2EJ9 A;  3X20 B;  4IUV A;  2KQW A;  1W2B A;  4PJO E;  2M1H A;  4BUG A;  4EMK C;  3BDU A;  4XU0 A;  4M7D E;  2BIV A;  1DJ7 B;  2DKG A;  3J7A F;  1WNL A;  3JCM c;  3A8L B;  5LJ3 j;  4JJN K;  3CD6 T;  4PJO A;  4LDX A;  1XOV A;  2VGN A;  4HCZ A;  4EMK B;  5HK0 A;  1NPR A;  4FSX A;  3JCM b;  5GAN 7;  2RJE A;  5FRO A;  3CCV T;  2E1H A;  4M7D A;  1QP2 A;  3X26 B;  1VQ8 A;  3PMI A;  1R8O B;  2PVO B;  1LOJ A;  3G6E T;  2MF2 A;  3CCS T;  3OBY A;  3QO3 A;  1YJN T;  1VQL T;  3MO8 A;  4J8O A;  3FC3 A;  1BI3 A;  4OGE A;  1HK9 A;  2CYZ B;  3VUZ A;  4J6X A;  4N0A C;  3CCR A;  4X9D A;  3P8D A;  1XQH A;  3OB9 A;  2E10 A;  3C12 A;  4HT8 A;  4DOW A;  3M55 A;  1ZQ1 A;  2E6Z A;  2PVD B;  3JCM f;  3UDC A;  2P0Q A;  3M4Y A;  4ELY C;  5LJ3 f;  4M75 G;  3OMG A;  3L2Q A;  5FU6 B;  1YJ9 A;  2G3R A;  1Y71 A;  2LC4 A;  1I81 A;  2MWO A;  5GAO r;  2F5K A;  2RH2 A;  4QQD A;  3V8J A;  5KE3 A;  2DJZ A;  3V7R A;  3MHX A;  2VXE A;  2VC8 A;  4VUB A;  1BKB A;  1UGQ B;  2O4X A;  4C5E A;  4M7A F;  2X4X A;  1VQM T;  2FYK A;  1QVF A;  2VGM A;  4MZT A;  4BE1 A;  2QXF A;  1H64 1;  2MAM A;  2ZPE B;  4J6Y A;  2LT4 A;  3JSC A;  2BUD A;  3RKW A;  3GNF B;  1KQS S;  3CCM T;  3GP8 A;  5CQY A;  1K9M U;  2GCX A;  5CKE A;  2QI2 A;  4KUL A;  4OMF B;  3CC2 T;  5GAM e;  3OS2 A;  1NJI U;  1YJW A;  5CKD A;  3DKM A;  1QW1 A;  4XTX A;  2LQK A;  2EQJ A;  1YCY A;  2CZ0 B;  2V8K A;  2X35 A;  3CBO A;  3O8V A;  4PJO G;  4E7K A;  1VQ7 A;  4JS4 A;  4MDX A;  3HFN A;  1WJQ A;  4OGC A;  1Y07 A;  1JBM A;  5IN1 A;  4M7D G;  1M1G A;  3JB9 F;  1B34 A;  3HPW A;  1I5L A;  3A8H B;  3OYE A;  3CCL T;  4M75 D;  3TRE A;  4J83 A;  4RG8 A;  2IG0 A;  3L2V A;  2HAX A;  4A4F A;  1KHC A;  3DLL A;  4OF1 A;  2JTF A;  4PL6 A;  3V7S A;  2CZ6 B;  4LD9 K;  1KQ1 A;  5CKF A;  4M77 E;  3WVE B;  4XU3 A;  2GFU A;  2K3X A;  3A8G B;  3OW2 S;  3S3N A;  2EQM A;  3BW1 A;  5C6S A;  1LNX A;  2DTH A;  3CCQ T;  5CKH A;  3SB2 A;  2DD5 A;  4PKC C;  4M77 A;  5J3B A;  3CXC S;  1VQ9 T;  4C0F A;  3SWN A;  3OYY A;  2B8A A;  1YI2 A;  1AHJ B;  1M5Q 1;  2WAC A;  4J7I A;  1UGR B;  4ZTJ A;  3CCE T;  3HRU A;  3V7C A;  1ZBX A;  4BI3 A;  3PIP A;  3NTH A;  4XTU A;  3JCM g;  4KUD K;  4R56 A;  3PIO A;  2V8J A;  2QTX A;  1OZ2 A;  3QUI A;  5LJ3 g;  1Y96 B;  3JAM E;  1N8R C;  5D6X A;  1JJ2 S;  1VQK T;  4F7U B;  4EPC A;  3CCJ T;  2CZ7 B;  2JVV A;  3M58 A;  4PLL A;  4PJO D;  4MMK A;  3E9G A;  3JB9 I;  2XIC A;  3LYI A;  1Q82 U;  4MZM A;  3QZ5 B;  5KE2 A;  3ZBD A;  4EMK A;  2OTL A;  2LTO A;  4XK8 E;  4M7D D;  2LRQ A;  3S3M A;  4R55 A;  1VQ8 T;  3JRZ A;  1RI0 A;  5GAO m;  2K2V A;  3OMC A;  3NTK A;  4HCB A;  2A3L A;  5J26 A;  3V8K A;  4C92 C;  2OTJ A;  1UEB A;  2DXT A;  2BKD N;  3OYC A;  3UWN A;  1VUB A;  4BI8 B;  3JB9 H;  1WGS A;  1UB4 A;  4XTV A;  5GAN d;  3G4S T;  3FB9 A;  4OVA A;  4N0A A;  4FT4 A;  4JRQ A;  2RHU A;  2VXF A;  3JCM h;  3JCM V;  1YIJ T;  1WJS A;  5LJ3 h;  3OYH A;  1KD1 U;  2RO0 A;  4OB1 B;  2RI2 A;  2E65 A;  2ZZD A;  3BY7 A;  2MWP A;  3VU3 C;  1G3S A;  1YHQ A;  2EWN A;  3M53 A;  2QA4 A;  1FXX A;  2EJG A;  1Q86 U;  3LW5 E;  4RG2 A;  3I56 A;  2X4J A;  2HD0 A;  4O6J A;  5GAO q;  5GAN j;  1K73 U;  1YIT A;  4M77 G;  3GLX A;  4C0G A;  1VQ5 A;  1BYM A;  1VQ6 A;  3M9Q A;  2C06 A;  1OYX A;  3VUB A;  1Y7X A;  5A0G A;  3PMT A;  2DIQ A;  4FM4 B;  5IT9 E;  1QP3 A;  4KBM B;  4ZN3 A;  3G71 A;  4ZN1 A;  4QW2 A;  3KBG A;  1QVG A;  3E19 A;  3TEE A;  3PFS A;  5GAN 6;  2FVU A;  3OS0 A;  5GAM d;  1WQW A;  4XTZ A;  2XHC A;  2ZPH B;  4CI0 C;  3N5B B;  3VKI A;  5GAO l;  2XG8 D;  2YLB A;  3QXE B;  4QQG A;  4V2S A;  5GAN 2;  3J81 E;  3M57 A;  1U1S A;  3VYG A;  3QYG B;  2O01 E;  3T9N A;  4J7F A;  4MZP A;  5FU6 C;  3CCR T;  1VQN A;  1VIF A;  5GAN f;  4C0D C;  5GMK i;  2F5T X;  3CPF A;  3OS5 A;  3J80 E;  4ZGE B;  3EFR A;  2QEX A;  4JS5 A;  2XD0 A;  1G3W A;  2KK4 A;  5GMK j;  1S72 A;  2RD1 A;  4LDW A;  3X24 B;  4RCB A;  4E7J A;  1M1K C;  4JUV A;  2YRV A;  4C5H A;  3F70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...