1I8FA

The crystal structure of a heptameric archaeal sm protein: implications for the eukaryotic snrnp core
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
ATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE SNRNP SM-LIKE PROTEIN
publication title The crystal structure of a heptameric archaeal Sm protein: Implications for the eukaryotic snRNP core.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Structural genomics
total genus 13
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2001-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1i8fA00
5GAMd 4M7DE 1BIBA 4M7DF 4N0AA 3JCMb 5I21A 4M7AC 3V7SA 4XTUA 4XTWA 4PJOD 3JCMQ 3JB9D 4J6XA 4M78C 1BIAA 5GAMh 2RD1A 4M78E 3SWNA 5GANe 1WQWA 4M78F 1WQ7A 4PJOA 3RKYA 4XQ3A 2EWNA 2E64A 4QVDA 4RCCA 4JLIA 1M5Q1 5GAOq 2FB7A 5GMKl 1KQ2A 4M7DB 4PJOG 4NL3A 3JB9G 1WNLA 4WF2A 1TH7A 3L2ZA 4C8QD 3JCMd 4RCBA 3JB9I 4M77D 3V8LA 5GANf 3SWNB 4M78B 5GMKm 4XU1A 3RUXA 5GAN7 2DJZA 4XTXA 3JCMP 4C8QA 4M77E 3BFMA 1U1SA 4M77A 3JCMh 4M7DC 3V7RA 4A53A 4N0AC 2I2LA 3BY7A 4JRIA 5GAN2 1Y96A 2DXTA 5LJ5j 1HK9A 5LJ3f 4C8QG 3HFOA 5LJ5e 3SWNC 3JB9J 3BW1A 4M77G 1I8FA 4JUVA 4JRKA 4MMLA 5DY9A 3VU3C 4PJOC 4PJOE 2VXEA 3JCMV 2DKGA 1U1TA 4XU3A 4PJOF 4M75D 4EMKA 4F7UA 5LJ5g 5GAOr 3JB9F 2DTOA 4XTVA 1B34A 1N9SA 2EAYA 1H641 1D3BA 4M77B 3V7CA 4M75A 5GAMj 4QVCA 2CGHA 5GANd 2DEQA 3RKWA 1JRIA 2YLCA 2DXUA 4F7UG 3JCMW 5GMKh 1Y96B 3M4GA 4HA8A 5GAMg 2E1HA 2HNIA 4HT9A 4X9CA 4M7AD 1KQ1A 2EJGA 4M75G 5CAIA 3AHUA 4C8QC 4PJOB 2DTIA 4M77C 4C8QE 4HT8A 3BDUA 2Y90A 4C8QF 5GAN6 4X9DA 5LJ3d 4M7AA 4M77F 1N9RA 4NL2A 1D3BB 3FB9A 4XTZA 3V8JA 4C92D 3EFRA 1I5LA 3EFSA 2DTHA 4DQ2A 5GAN4 5GAN5 2VXFA 5LJ3h 4M7AG 4J6YA 4C92A 3JCMe 3QO3A 2DZ9A 4F7UE 5GAN3 2FYKA 4F7UF 3JCMg 1LJOA 1HXDA 3V8KA 4M75C 4C8QB 5GAOp 4V2SA 4M75E 3QSUA 4C92G 3HFNA 4M75F 5GAMe 3RERA 1WPYA 4MMKA 3QHSA 4EMGA 3HSBA 2DVEA 1JBMA 1LNXA 4NOYA 5LJ5f 4M7DD 4XU2A 1M8VA 2ZGWA 3L1AA 1X01A 5GANh 4J5YA 2EJ9A 4M7DA 3SB2A 2E10A 4A54A 4EMKB 4F7UB 4M7AE 2YLBA 4J6WA 4M78D 5GMKj 5GMKe 2EJFA 4M7AF 1B34B 2DZCA 3FJPA 5GAN8 5GAMf 4M75B 3JCMX 5GANj 4M78A 4EMHA 2RA2A 4M7DG 4PNOA 5GAOl 4C92C 4C92E 5GANg 3JCMJ 4C92F 4EMKC 3QUIA 5GMKi 2E65A 3JCMc 2YHTA 4M78G 1I81A 5GAOn 1LOJA 5GAOm 3FIFA 2JN0A 2K57A 3PGGA 4M7AB 3RKXA 5LJ3e 5LJ3j 5LJ5d 4XU0A 3RESA 1I4K1 4XTYA 2RM4A 5LJ3g 3INZA 4Y91A 3JB9H 2RB6A 5LJ5h 3RIRA 4OP0A 2VC8A 1YCYA 1MGQA 4C92B 3JCMf 2QTXA 2E41A 3GIBA
chains in the Genus database with same CATH superfamily
5DLOA 3BE3A 2RMOA 1BIAA 2X4WA 5FWBA 5GANe 1LCKA 2XICA 1UGVA 2WSEE 4BY6B 2CP7A 4BD3A 5A0DA 1ZBJA 2LVMA 3OS2A 2J6KA 2RNAA 3RMQA 1QCOA 3HFOA 4MDXA 3LWHA 2EQUA 2ZZDA 2L3RA 5DM7R 1A0NB 4EDUA 1YHQA 1KFZA 3JRZA 4J9BA 2DERA 2HNIA 3L2UA 2O4XA 2AKKA 4F17A 2L2PA 3M0SA 2K7AA 1TXQA 1AVZC 4BDZA 2GTJA 4NL2A 2C0TA 1VQOA 5CQXA 2M0OA 3TSZA 2MI6A 2CDTA 2I0NA 1K73U 1VQLT 2LRQA 2ECZA 2LQ8A 2LX7A 5GAN3 2E6ZA 4F7UF 3VV0A 3OYHA 4C8QB 2KRMA 1UE9A 3Q1JA 1D0YA 3DB4A 1R0BG 1VQLQ 3UWNA 2O01E 4N4HA 1Q82C 1NJIC 1N8RR 3G4SA 5GAN8 3VS5A 4M75B 2LTOA 4DEXA 3VUZA 5FRMA 1M3CA 4JLGA 4M7DG 1IHWA 3OYYA 4AFZC 5I11A 1AHJB 1YI2T 1S72T 2J06A 2KT8A 2CS7A 1SHGA 2D1XA 4Y91A 1YI2Q 2QQAA 3L2VA 4OP0A 2QK0A 1S72Q 2L5QA 3BDLA 2V26A 1MMAA 2ZPBB 2HQEA 3UPUA 2KAFA 1VQ9T 2CP3A 1CSKA 1WQ7A 4A4FA 3CCLA 2E64A 5KYXA 4FM4B 1VQOT 1KIKA 3EG2A 3PNWC 1PHTA 2FB7A 4E7LA 2VYTA 3CCMT 1YITT 2HL5C 2XK0A 1VQ9Q 1WNLA 1OZ3A 3ZBDA 1T0JA 2QA4T 3SWNB 5GMKm 4DEYA 2YWWA 3CXCP 2O88A 3CCMQ 1KD1U 4M7DC 1YITQ 1JXMA 3H8ZA 4IUTA 1HK9A 2KEAA 5LJ3f 2QA4Q 2CZ6B 2FPDA 3EH2A 5DY9A 2EKHA 2P84A 1E6HA 3CCUA 1H641 3I9QA 2DXUA 3NHNA 5FU6B 3JCMW 2E3HA 1J3TA 3OSVA 1OULA 1JJ2A 1BKBA 3M9QA 4PJOB 4ZNXA 5D6XA 1VQ5T 4E7IA 2D0QB 4AT1B 1VQKA 1X27A 2DO3A 2NUZA 3G6ET 2LQNA 4J83A 1HXDA 1OV3A 2E70A 4C92G 1JJ2S 1VQ5Q 4A4EA 2F2VA 3URGA 2ZGWA 4Y28E 3G6EQ 4J5YA 3M4YA 3QKJA 4M7AF 1ZLMA 4JRQA 1PSFA 1X69A 1VQ6A 3TU4K 3EFOB 2DRKA 2KROA 1VQ7T 2R57A 1AZEA 3OYGA 1PWTA 2XKOC 1UFFA 2K57A 2XDBA 3I35A 2KT1A 3CCJA 2JVVA 1M9SA 1PNJA 4LE9A 2DK3A 2EYXA 1VQ7Q 2A08A 1MGQA 2QTXA 4QQ6A 4C5GA 2F2WA 3CCQT 2DIQA 1QWFA 2K4YA 1KHIA 1H92A 2LQWA 2JNGA 4JRPA 1K73C 1ZHIA 2JW4A 2HCKA 2JOYA 2PUKB 3CCQQ 2YRCA 3A5ZB 1AWOA 2OTLT 4M78B 1WJQA 3REAB 1WA7A 3C12A 1NPPA 1QVFA 1P92A 4ZGDB 3TVTA 1UB4A 3VUBA 1BI0A 2ROTA 2KE9A 2OTLQ 3QBYA 4OMFB 4M77G 4MMLA 3A1PA 1KG1A 1BI2A 5CR2A 5HKCA 1N9SA 3OA6A 2PVOB 1YIJT 5CQYA 2PQWA 3HP9A 1M1KR 1QVFS 1B07A 2BZYA 4JS5A 3QWYA 3CCJT 1YIJQ 1N9RA 2ENMA 2HSPA 3OY9A 1D3BB 4XTZA 2LJ3A 2OX7A 5GAN5 5LJ3h 4ZTFA 4OB0B 1Z9ZA 4EPCA 2K79A 2QQ9A 1N27A 2L3QA 4E7ZA 1SRLA 3QSUA 1RAIB 4J9GA 3MEVA 2R5MA 2VKNA 1WPYA 1NBEB 3ZL7C 4PK4A 1YJNA 4X34A 5FROA 3CMAA 3VS4A 3FJPA 4LD9K 4EMHA 3CEYA 4Y92A 1M3AA 1PRLC 1PD0A 3PGGA 1X2KA 2KYBA 4BY6C 5LJ3g 1OZ2A 2E12A 3PVLA 3OYNA 3CCVA 1RLQC 1I0CA 1YJ9A 1WYXA 2PTKA 1RAEB 1X6OA 1QW1A 1HYOA 4CC3A 4R55A 2DL5A 2EIFA 3I55A 4AG1C 2GFUA 2M1HA 2EQIA 4LDUA 4GY5A 3A98A 3CCRQ 2AIRB 1TH7A 2DX1A 4C8QD 3JCMd 4FSXA 3OMCA 3GBQA 2CYZB 4XTXA 4C8QA 3M0QA 3QPHA 4OVAA 1ACMB 2CP0A 4J7IA 4BDYA 3JB9J 1VOMA 2WACA 3N5BB 1BK2A 4M75D 1N8RC 4XTVA 4PFOA 2C0IA 2K5LA 3V7CA 1H3HA 4M75A 2E5KA 1YWPA 3CBPA 4JS4A 4AFSC 2NUPB 3KFVA 3P8BB 4C8QC 3AHUA 2DTIA 2EQJA 4Z02A 3C94A 2JMCA 3E9FA 2JUFA 4BI8B 2PVGB 4B9XA 1IGQA 1M2VB 2Y4XA 5KYNA 1VYVA 1BCOA 4FW1A 3EGDB 3V8KA 4M75C 1PSEA 4UC4A 3HRSA 1M8MA 3MPUB 3VKIA 5CK9A 2DVJA 3SHWA 2WSFE 1M8VA 4N4GA 2F1LA 2K5IA 1ARKA 4C0GA 1C6VX 1JU5C 2HZYA 2EJFA 2D6FA 3TSWA 5GAMf 3JCMX 1C1AA 1NYGA 2VGMA 4DOVA 1E7OA 3P8DA 5GMKi 4RTUA 4DBRA 2JMAA 5GAOm 5LJ3j 1MNDA 3VJPA 5LJ3e 4BI3A 2AHJB 5HY6A 2FHDA 3DLMA 4O5VA 1M27C 2OTJT 3CCST 4IIMA 1AT1B 3OS5A 2K2VA 1UGPB 2EQKA 4M7DF 2FO0A 3RNJA 4PJOD 3JCMQ 3JB9D 2KRNA 4MZMA 2D0NA 2QEXA 1Q81R 3CCSQ 2OTJQ 1WQWA 1VYUA 4PJOA 5CCAA 1FMWA 4NS5A 3CC7T 5CKFA 4J9DA 5GAOq 5GMKl 2RQUA 1OI1A 4DA4A 2EGEA 2DBMA 3CC7Q 1LVKA 2F5KA 2MK5A 3M57A 4II1A 2CH4A 3SD4A 1OX9A 4BUGA 5FU6C 1WZOA 1TUGB 5GAN2 2A37A 4OMPA 3EG1A 1VQ4T 3M55A 5D7UA 2LCSA 2DEUA 2XIDA 4PJOC 1YJWA 1VYTA 1QVGP 2CGHA 1VQ4Q 3RKWA 1GXIE 3OYKA 2XD0A 1HJDA 1QCNA 3MKDA 1OU9A 4DBHA 1IRXA 3PIOA 1K1ZA 2VASA 2RJDA 4C5IA 3TCJA 1UG1A 4J6YA 3DB3A 1KSWA 3QO3A 2M0YA 1QWEA 4CC4B 3QHSA 1VA7A 1FYNA 2KXCA 2LJ0A 4NOYA 4DBFA 1JEGA 4CC7A 3EG0A 1PKSA 2QGGA 4EMKB 2DMOA 5ECAA 4M78D 1GBQA 3CBOA 4M78A 4FT2A 2J7IA 4PNOA 8ATCB 1PC0A 4C92F 3M0PA 3H0IA 3QYGB 5DLQE 5KYYB 2M51A 2RH2A 2DILA 2WSCE 4J9IA 2J6OA 4C0ZA 2F5TX 1Y7XA 4OMQA 3X24B 3M58A 1UDLA 5IH2A 4N0AA 5I21A 2IIMA 2CKKA 1M1KC 4PJJA 4M78C 5GAMh 4VUBA 1MV3A 4F04B 3VS7A 1Q81U 4M4ZA 1XTDA 2FZGB 3CD6Q 3C4SA 2FEIA 2FPFA 5HCKA 3PVQA 4OMNA 3RR6A 3NPFA 5CIUA 4N0AC 4ZN1A 1VQLA 4AMCA 2RI2A 1Y96A 2X35A 4PFZA 4IIOA 1XJWB 2JXBA 4JDSA 4JRKA 1X75C 1W4SA 4E7SA 1U1TA 2Y4YA 1OPLA 2EGAA 2V1QA 4ME7A 3O5ZA 1AWXA 2COYA 2JT4A 4M77B 1WHLA 3SEMA 1C0MA 2MOXA 2RO0A 2O9VA 5GAMg 2E1HA 2MCNA 5I2MA 1KD1R 1O9SA 5L8RE 1RAAB 4M77F 2YUPA 1V76A 4BB7A 2PZ1A 1AD5A 1YI2A 2FL7A 1WHGA 3EFSA 4DQ2A 2HBWA 1S72A 1ZA2B 1T3LA 3J7AF 1GBRA 3MO8A 1K76A 1X6GA 4ANJA 4IURA 3KXTA 1VQ9A 1ZSZB 3SB2A 2NYSA 4F7UB 1M2OA 4J6WA 1SRMA 4RUGA 4BE0A 2LDMA 1JXOA 3CCMA 3TEEA 4R56A 1AZGB 1YITA 3OS0A 5KYWB 2E65A 4Z88A 2QA4A 3ME9A 3G71T 3PMTA 3GIBA 1Y57A 2QDYB 3OYCA 3RBBB 1UGQB 3PTAA 3CPWS 1G3YA 3G71Q 2RD1A 1ABOA 2NUPA 2VWFA 1BU1A 4A4HA 4KUDK 2DYIA 2VV5A 1SSFA 1WHMA 1WJSA 2GFAA 3LW5E 1AOJA 1TUCA 1JO8A 4LD6A 5IN1A 2DL7A 2KDSA 2RK2A 3JV3A 4RMOA 1VQ5A 3S3NA 2L3SA 3LH0A 4IKFA 1PG5B 2EW3A 3G6EA 2GNCA 3OYLA 2EFIA 1R0CB 4QKUA 4WTOB 2VXEA 2DKGA 5GAOr 2B86A 2DTOA 1T0HA 4J9FA 3FEOA 5GAMj 4KBMB 3I56T 2JS0A 5GMKh 4QW2A 4X9CA 3J80E 2EJGA 3MP1A 4C8QE 1QMCA 1BI1A 4KGVB 3I56Q 3LWIA 3OYEA 1VQ7A 2CSIA 5GAN4 2DXCA 2A28A 3RMSA 4J9EA 2L8DA 4M75E 1Q81C 1NEGA 3PT9A 1BI3A 3TREA 1Q7YC 3HSBA 2ABLA 2YUOA 1KC8U 3VRZA 2HQHA 3H0FA 8AT1B 3LYIA 3CCQA 1VQ8T 3OYJA 2X4XA 3HHTB 2QGFB 3OBYA 4QQDA 2RA2A 4C0FA 5GAOl 2X3WD 1T3SA 2ZPIB 2DIGA 1VQ8Q 2OTLA 3FIFA 2BZXA 4M7AB 3CC4T 4PJLA 1K9AA 4HVWA 5A0LA 2QQBA 3JB9H 1K0XA 2E41A 3OYMA 1WDXA 2YT6A 4QT7A 3CC4Q 1I07A 1M3BA 2MAMA 2XMFA 3VS0A 1D1BA 2DBKA 2M16A 1JJ2P 1YIJA 2ESWA 1SEMA 1AEYA 5I22A 1KQ2A 1U8RA 3EH1A 1JQQA 5J26A 4RCBA 2LJ1A 1G3SA 2P4TA 4OB3B 1EZZB 2DJZA 3IQLA 4JPBW 5HK3A 2KSSA 3EGXA 5L23A 4PJOE 3LGLA 4RTZA 4EMKA 2JTFA 2ZCFB 3OQ5A 3EHQA 5GJVB 3X28B 2HD0A 4IUVA 1JRIA 2HDAA 5KYUB 3VS3A 4ATOA 3MEUA 4CRIA 5KYYA 1WGSA 3L2WA 1ZX6A 2OI3A 1IXDA 2VVKA 4QVZA 3EFRA 3REBB 3E19A 1QCFA 3OSSC 4MZTA 1ZUYA 3EG3A 2QQRA 4HXJA 2R5AA 3NFCA 2RJCA 3OYBA 2LZ6B 2EYWA 5LJ5f 4XK8E 5FWCA 2EJ9A 1RAHB 5AYFA 3CCRA 2GQIA 3TQ7P 5GMKj 5GMKe 2QYZA 2CH4W 2RHZA 2KQWA 2CUDA 4E47A 5IT9E 3JCMJ 1M1FA 2FZCB 4E6RA 5CVIA 3JCMc 1QVFP 1IGUA 3QIIA 2EVRA 4JZ3A 4R0KA 2M02A 1G2BA 2RQRA 5AT1B 5EG2A 2RHUA 1K8AU 3CCET 4OMOA 4FYWB 1KD1C 4M78E 4RTWA 1Q86U 3JSCA 1WHJA 1M30A 3CCEQ 3SFMA 4D6WA 1D1CA 3HPWA 4PKCC 1XQHA 3OS1A 5GANf 2J6FA 2YRVA 4KH1B 2K3BA 2LNHB 2RN8A 3V7RA 2AT1B 1G5VA 1X2QA 5FRNA 2DXTA 4A4GA 4C8QG 3BW1A 3CCRT 1WFWA 2COZA 2E3IA 2G3RA 4F7UA 3NTHA 5A2QE 2DPPB 3A8GB 2P4RA 1UTIA 2O31A 2IVWA 2OAWA 5KYWA 4M75G 1FMVA 1U5SA 3E9GA 4B6MA 5CAIA 2A7YA 2YXYA 3DLLA 2PUOB 3BDUA 5LJ3d 1D0XA 2JS2A 2MF2A 2HL3A 1NYFA 2VXFA 1RABB 1D1AA 2O4XB 4FT4A 2PU9B 1OQKA 3I5RA 2OTJA 3CCSA 2K6DA 1VQPT 2R58A 1W6XA 2JM9A 3A8MB 3FDRA 4XAXB 3UDCA 2LT4A 1UGRB 3QJYA 2IPOB 1VQPQ 1MNEA 3CC7A 1TUDA 1K9MU 3AT1B 3E2UA 3H6ZA 4FYXB 1QKXA 4O6JA 3RKXA 1K4US 3OB9A 2CP5A 4KT0E 2RB6A 5LJ5h 1GFCA 1VQ4A 3VS6A 1OYXA 2HMAA 1G8XA 5IXBA 3V7SA 5FW9A 4PLIA 4XTUA 1BBZA 4LDYA 1IZ6A 3SWNA 4GLKA 1CKBA 1M5Q1 1ZBXA 3VRYA 4M7DB 4PJOG 4Z8AA 3JB9G 2YUQA 1YJ9Q 2RJFA 5CKHA 4E7JA 1QQJA 2MWPA 1GFDA 1PKTA 2CP2A 2BIVA 5GAN7 2FZKB 2LCLA 2XDDA 2GQVA 3WVDB 3MEAA 1VIFA 4A53A 1IB8A 3I55Q 4J7FA 3CPFA 3CC2T 2D9TA 1QP2A 3FRNA 3VYGA 2HAXA 2BKDN 3SWNC 4L6V5 4JUVA 4BI4A 2B8AA 3NTKA 5LJ5g 5IHKA 4ZTJA 1UHCA 1KK7A 4PJNA 2RQWA 4OGCA 3CC2Q 1BCMA 2DNUA 4M7AD 2XHCA 2V1RA 2CZ7B 4A4KA 3OBWA 3MHXA 5GAN6 4M7AA 1HSQA 3FB9A 2LP5A 2MMPA 2ED1A 2C06A 5KH6A 1LPLA 2FYKA 3META 1MHNA 2DJQA 2GCXA 2EBPA 3UT1A 2SEMA 4LUDA 1B3QA 3EFOA 4RG8A 3FJ5A 3L1AA 3CD6A 2KR3A 1NLOC 3H0HA 1MMDA 1B34B 5EC7A 2DZCA 2DF6A 1W2BA 3OW2A 1FWZA 5GANg 4LDXA 4LXCA 2G6FX 2YHTA 4M78G 1I81A 5GAOn 1NZ9A 2DETA 2KY9A 2AZSA 2MYSA 2COWA 1Q82U 1NJIU 3HL8A 1RUWA 4C92B 1W2BS 1BIBA 3ZFJA 4BACA 3OW2S 5KYUA 4XTWA 3SDZA 1IO6A 4HKEA 4FL6A 3RKYA 4XQ3A 4JJNK 2GGRA 2L0AA 1YFNA 4KULA 4XU1A 2P0PA 3OYFA 4LNPA 5J3BA 4HCBA 1TS9A 5LJ5j 5LJ5e 3CD6T 3LX7A 3MP6A 3EGUA 1SSHA 4IUPA 1PRMC 3UF4A 2YDLA 4JJCA 6AT1B 1D3BA 1VQMT 5KE3A 4QVCA 1NEBA 1VQNT 1Y0MA 3CMET 2FPEA 4ESRA 4C0DB 4OGEA 3L42A 1VQMQ 1SKUB 1VQNQ 3HKSA 3CMEQ 4J9HA 2DTHA 4RTTA 3M54A 3S3MA 4LN2A 2BUDA 1R8OB 2V8JA 1RI9A 3GNFB 2FVUA 3G71A 1LJOA 3M0RA 2H3JA 2AZVA 2L89A 2P0KA 1UGSB 1YCSB 2VB6A 4J9CA 5M9OA 1M1GA 1Y07A 1B7TA 2RI5A 4C5EA 3L2RA 5GANj 3M59A 2EPDA 4D8DA 2KBTA 2PVDB 4CI0C 1Q95G 2K3XA 2D8HA 1MMNA 3C95A 3I5SA 4XU0A 1KC8R 2EYZA 2CT3A 4XTYA 3RESA 2O2OA 2LC4A 3GF5A 4K11A 1RLPC 1AWWA 2JTEA 2QI2A 5GAMd 1NLPC 1WX6A 4ORZA 1RACB 2HBPA 2YRDA 4FU6A 4JZ4A 1I5OB 2KGTA 3I56A 4HCKA 1SPKA 4RCCA 3CPWA 4J8OA 4AFQC 4X1VA 1PCXA 4FCYA 1NG2A 1RADB 1SHFA 5IAYA 1TU0B 2KXDA 2RF0A 3M5AA 4TVRA 2JZ2A 4M77E 5C6SA 4ZGJB 2RI3A 1UEBA 4LDVA 3UATA 3PIPA 1RL2A 4F16A 3JCMV 2KK4A 1TG0A 2E6NA 1GL5A 5IXFA 2LT1A 2DEQA 1M2VA 4L59A 1VQ8A 3CPWP 2E4HA 4ZN3A 3RDVA 4OMLA 4HT8A 3EGDA 4C8QF 2VGNA 3KUFA 3L2QA 4EIKA 2RHYA 5GJWB 2AKLA 3CC4A 4F7UE 1ZQ1A 3GLXA 3CXCA 1H8KA 1TWBA 1BYMA 4M75F 5GAMe 1K0SA 3P8HA 4EMGA 1I1JA 1LNXA 4M7DD 2LCCA 4Z89A 4FYVB 2KYMA 2A36A 1YHQT 4HCCA 4M7DA 2ROLA 1BB9A 1MUZA 3FC3A 2AK5A 1QKWA 3CXCS 1WHHA 2X4YA 2L3PA 1YHQQ 5HK0A 5KCOA 4ZGEB 3VYHB 1KHCA 2QTVA 2CT4A 1I4K1 2GF7A 3EG9B 3H9NA 1VQOQ 3D7SB 2ZPEB 3JCMf 2QASA 2HKNA 1GCPA 1M90R 1FXXA 1PM3A 3A8OB 1Y71A 3HTRA 4L5GA 2SRCA 4QVDA 3G4ST 2FRYA 4RG2A 4C5HA 4LUEA 1CKAA 2X3XD 2NUTB 2ZPGB 3V8LA 3G4SQ 2KMTA 2HSEB 2KVQG 3GPLA 1K8AR 1X43A 2DL3A 2I2LA 2DA9A 4RKUE 3ULRB 1VUBA 1Q86R 4RTXA 1YP5A 4A63B 4PJOF 3JB9F 1YNZA 1B34A 2EAYA 3UA6A 1FMKA 3CCLT 1W1FA 4FIBA 4KUIA 1DJ7B 1QP3A 1KQ1A 1D0ZA 3QZ9B 4JJDA 2Y90A 2JTMA 3CCLQ 2CUBA 3V8JA 4C92D 2C0OA 1N8RU 4C92A 5FU7B 1R77A 3HRUA 1OX8A 3LH5A 4P5NA 2CZ1B 5D6WA 2ZPFB 5IHIA 5CKDA 4RTYA 1IHVA 3CCUT 2DVEA 3CCEA 2MIOA 4A54A 3MP8A 4M7AE 1OPKA 3CCUQ 4CC2A 4C92C 2DM1A 1X6BA 1U06A 3PFSA 1SF9A 4EMKC 1WXUA 3R6OA 2HKQB 5KCHA 3M53A 1LOJA 1VQKT 3MEWA 1OOTA 3M0TA 3M56A 1MV0B 1GRIA 2NWMA 1H3ZA 1JB0E 2BZ8A 5CKEA 1VQKQ 3JCMb 5A0GA 1K9MR 1O75A 2QQSA 2KRSA 1M90U 2RK1A 4MDWA 4M78F 5FLXE 1EIFA 2W0ZA 1VQ6T 1RI0A 2X4JA 3E1SA 1OEBA 1N5ZA 1WJRA 3PE0A 3JB9I 2KI7A 4M77D 3JAME 1VQ6Q 3H41A 2W10A 3BFMA 4M77A 3JCMh 2DL4A 2RHXA 3BY7A 4JRIA 3J81E 2DRMA 4C0DC 1YBYA 2ZAEA 4YTLA 3CCJQ 1VQPA 2O9SA 4XU3A 4OF1A 1XOVA 2D8JA 4PL6A 3ER0A 3MJXA 4ELZC 4F7UG 3QG1A 1Y96B 4HCZA 1TOVA 3X26B 4BE1A 3UA7A 3LGFA 4M77C 4PFPA 2V8IA 2BE9B 1KC8C 1F1BB 5CO7A 1KJWA 2DFUA 4E2FB 3NGPA 2EKOA 5IHNA 4F14A 2QAZA 1ZSZA 2K9GA 3JCMg 4LDWA 4V2SA 4GLMA 4MMKA 1U3OA 1WXBA 1PD1A 2OJ2A 3VS2A 3GP8A 3VS1A 5CKBA 1S1NA 3G1JA 2X9HA 3MCAB 2A0FB 2EYQA 2J05A 1RAFB 1KQSA 1YWOA 1ZSZC 3QUIA 3X25B 2DL8A 1QLYA 1XNIA 4WCIA 4FSSA 4GBQA 2P0QA 3CQTA 2RM4A 4OB2B 1QVPA 3QDFA 3QYHB 3CC2A 2PNIA 3O8VA 2VC8A 4KGZB 3A8LB 2XG8D 3R6NA 3GOXA 4Q5WA 1KQSS 1NE8A 2XU8A 4RTVA 1YJNT 4J6XA 1G3WA 2LMJA 2Z0WA 3CMAT 1WLPB 1ZSGA 2YSQA 4JLIA 2NLUA 2ATCB 4D8KA 2GTOA 3M0UA 1N6AA 2DAQA 1YJNQ 2K3YA 2RQVA 4NL3A 2MWOA 5J39A 1KQSP 1Q82R 4WF2A 3CMAQ 1NJIR 3L2ZA 2XDPA 1AWJA 3RUXA 2F2XA 3JCMP 1G3TA 1M1KU 5C0MA 4ELYC 1TTHB 4DOWA 3F70A 3NMZC 2XI9A 3CCVT 1VIEA 2LX9A 1I8FA 1YJ9T 3VU3C 2IG0A 3G7ZA 9ATCB 2GBQA 3LLRA 1UJ0A 1EFNA 2E5QA 2QG9B 3I55T 3CCVQ 2BTTA 2LQKA 2YLCA 3T9NA 3M4GA 4HA8A 3A8HB 4HT9A 4BE2A 1ZUKA 2RQTA 4JJBA 3THKA 4X9DA 5KYXB 1ZUUA 3EG9A 1UUEA 2EYYA 4KGXB 4M7AG 4KRTA 3ZEHA 3JCMe 2FG0A 4E7HA 1G83A 1M90C 5GAOp 3HFNA 3RERA 1JBMA 1NM7A 5GANh 3QZ5B 3S6WA 2E10A 3QXEB 2YLBA 1QVGA 2BE7D 5I2SA 3OMGA 2NUTA 4MZPA 3DKMA 4FYYB 1K8AC 1Q7YR 2CREA 2M9UA 3HRTA 1WHKA 1WXTA 3OYIA 2HQXA 1Q86C 5LJ5d 1HD3A 2CZ0B 1QVGS 2JM8A 2X51A 4DBQA 3RIRA 1WIEA 2DE0X 2DD5A 1UECA 4M7DE 2RHIA 3WVEB 4M7AC 2EGCA 1YN8A 1IREB 4FW2A 1VQMA 2EWNA 1E6GA 1UJYA 2QXFA 1VQNA 1ZA1B 4B9WA 4PLLA 2H8HA 3WXMB 2OAUA 4AFUC 3CMEA 1OU8A 4IUUA 1MMGA 2VUBA 1TSFA 3QDRB 3C0CA 3KBGA 1GCQA 1FX7A 3U23A 3S3OA 4KH0B 3FLGA 1WI7A 2DYBA 1U1SA 2DXBA 4N4IA 3EHRA 1W70A 2CSQA 4PJMA 2LNVA 2F69A 1ABQA 3QWXX 2EQMA 2ED0A 2H3EB 3X20B 2QEXT 7AT1B 1M4ZA 5GANd 1W2BP 1GCQC 3OYDA 3CBMA 1Z9QA 3QJ6A 3OW2P 2RPNA 3EGXB 5FU7C 3PMIA 1V29B 2FRWA 2DD4A 2QEXQ 2DLPA 2ZPHB 1UHFA 5KE2A 2RJEA 1K73R 1I5LA 4AG2C 2JJ9A 2HEQA 2DZ9A 2KNBB 1K9MC 2K5FA 4HVVA 4E7KA 1YJWT 2QDLA 2A3LA 3NTIA 2CP6A 3ASKA 4IUQA 4OB1B 4XU2A 1X01A 5D6YA 2V8KA 5LL6S 1V1CA 1YJWQ 2YUNA 4HVUA 2K2MA 4QQGA 4C92E 1D09B 4OMMA 1NPRA 1RAGB 1Q7YU 2JN0A 3OYAA 3EAEA 3INZA 1EX4A 1SG5A 2MPXC 3GNGA 1YCYA
chains in the Genus database with same CATH topology
2K2VA 1UGPB 2EQKA 5EG2A 2RHUA 5DLOA 4M7DF 1K8AU 1FXXA 3CCET 4PJOD 3JCMQ 3JB9D 2QEXA 1BIAA 2X4WA 3A8OB 1Y71A 4MZMA 4M78E 1KD1C 5GANe 1WQWA 4L5GA 4PJOA 2XICA 5CCAA 4NS5A 1Q86U 4QVDA 2WSEE 5CKFA 4BY6B 3G4ST 3CC7T 5GAOq 3JSCA 4BD3A 4RG2A 1M8VA 3SFMA 5GMKl 4C5HA 4D6WA 3HPWA 4PKCC 1XQHA 1OI1A 3OS1A 2ZPGB 5A0DA 4DA4A 3V8LA 5GANf 2LVMA 2KMTA 2F5KA 2YRVA 3OS2A 3M57A 4II1A 2KVQG 3GPLA 3SD4A 3RMQA 3V7RA 2I2LA 4BUGA 5FU6C 1G5VA 5FRNA 4RKUE 5GAN2 2DXTA 1VUBA 1VQ4T 3M55A 4A4GA 4C8QG 3HFOA 2XIDA 4MDXA 3BW1A 2EQUA 3LWHA 3CCRT 4PJOC 4BE1A 4PJOF 2G3RA 1YJWA 2ZZDA 4F7UA 3JB9F 2L3RA 3NTHA 1B34A 5A2QE 2EAYA 2DPPB 5DM7R 3A8GB 2CGHA 3CCLT 3RKWA 4EDUA 1YHQA 2IVWA 4FIBA 3JRZA 1GXIE 4KUIA 2HNIA 3L2UA 1DJ7B 1QP3A 2O4XA 3OYKA 1KQ1A 4M75G 2XD0A 5CAIA 3E9GA 2A7YA 3DLLA 3QZ9B 2PUOB 3BDUA 2Y90A 2JTMA 5LJ3d 4BDZA 3PIOA 4NL2A 3V8JA 1VQOA 5CQXA 2M0OA 4C92D 2MF2A 2RJDA 4C5IA 1N8RU 2MI6A 2VXFA 3TCJA 1K73U 4J6YA 4C92A 1VQLT 2LRQA 2LQ8A 3DB3A 3QO3A 2O4XB 4FT4A 5FU7B 2PU9B 5GAN3 2E6ZA 3HRUA 4F7UF 3VV0A 4P5NA 3OYHA 4C8QB 3CCSA 2OTJA 2CZ1B 5D6WA 2ZPFB 5CKDA 3Q1JA 2R58A 1VQPT 3DB4A 3QHSA 3CCUT 3A8MB 2DVEA 3FDRA 4NOYA 4XAXB 3CCEA 3UDCA 3UWNA 2LT4A 1UGRB 2O01E 4N4HA 4A54A 3QJYA 4EMKB 3MP8A 4M7AE 4M78D 1Q82C 1NJIC 3G4SA 3CC7A 5GAN8 4M75B 3CBOA 4M78A 2LTOA 1K9MU 3VUZA 5FRMA 4M7DG 4JLGA 4FT2A 4PNOA 4C92C 3OYYA 4C92F 3PFSA 1AHJB 4EMKC 3H6ZA 1YI2T 3QYGB 5DLQE 3R6OA 2RH2A 4O6JA 5KCHA 3M53A 1LOJA 1S72T 2WSCE 1VQKT 3RKXA 4C0ZA 3OB9A 3MEWA 3M56A 2CS7A 2F5TX 4KT0E 4Y91A 1Y7XA 2RB6A 5LJ5h 1H3ZA 2QQAA 3L2VA 4OP0A 1JB0E 1VQ4A 3X24B 1OYXA 3M58A 5CKEA 4N0AA 3JCMb 5A0GA 2L5QA 5I21A 3V7SA 3BDLA 1O75A 4PLIA 4XTUA 2CKKA 2QQSA 4LDYA 1M1KC 2ZPBB 2HQEA 3UPUA 2KAFA 4M78C 1VQ9T 5GAMh 1IZ6A 4VUBA 2RK1A 4MDWA 4M78F 3SWNA 1M90U 1WQ7A 4A4FA 4GLKA 5FLXE 3CCLA 1EIFA 2E64A 4FM4B 1VQOT 1Q81U 1RI0A 1VQ6T 1M5Q1 2X4JA 1XTDA 3PNWC 2FB7A 3E1SA 4E7LA 1ZBXA 2VYTA 3CCMT 4M7DB 1YITT 4PJOG 1WJRA 2XK0A 3JB9G 1WNLA 3C4SA 1OZ3A 2RJFA 5CKHA 3ZBDA 4E7JA 2MWPA 3JB9I 4M77D 2QA4T 3SWNB 5GMKm 2BIVA 3JAME 5GAN7 2LCLA 2XDDA 2GQVA 3WVDB 3BFMA 3MEAA 4M77A 5CIUA 3JCMh 1KD1U 1VIFA 4A53A 4N0AC 4M7DC 4J7FA 2RHXA 3BY7A 3CPFA 4ZN1A 4JRIA 2D9TA 3J81E 1VQLA 3CC2T 1QP2A 2RI2A 3H8ZA 1Y96A 2X35A 3FRNA 3VYGA 4IUTA 2HAXA 1HK9A 2BKDN 5LJ3f 4C0DC 1YBYA 3SWNC 2CZ6B 4L6V5 4JUVA 4JDSA 4JRKA 4YTLA 5DY9A 1X75C 1W4SA 2B8AA 3NTKA 1U1TA 4XU3A 2Y4YA 4BI4A 5LJ5g 4ZTJA 1VQPA 4ME7A 4OGCA 3CCUA 4OF1A 1H641 1XOVA 4M77B 4PL6A 3ER0A 4ELZC 2DXUA 2RO0A 4F7UG 5FU6B 3JCMW 3QG1A 1Y96B 5GAMg 4HCZA 2E1HA 3OSVA 4M7AD 5I2MA 2XHCA 1BKBA 3X26B 1JJ2A 1O9SA 3M9QA 2CZ7B 5L8RE 3LGFA 3OBWA 4M77C 4A4KA 3MHXA 5GAN6 4M7AA 2V8IA 1KC8C 4M77F 3FB9A 4BB7A 5CO7A 1YI2A 2FL7A 5D6XA 2MMPA 3EFSA 1VQ5T 4DQ2A 4E7IA 2D0QB 2EKOA 1S72A 1VQKA 2DO3A 2C06A 5KH6A 2FYKA 3META 3G6ET 4J83A 3JCMg 4LDWA 1HXDA 1MHNA 2GCXA 4V2SA 3J7AF 2E70A 4C92G 3MO8A 3UT1A 1JJ2S 4A4EA 4MMKA 4RG8A 3URGA 4IURA 2ZGWA 4Y28E 3L1AA 3GP8A 4J5YA 3KXTA 1VQ9A 3M4YA 3CD6A 3SB2A 5CKBA 4F7UB 3QKJA 4J6WA 4M7AF 4JRQA 1B34B 1PSFA 3MCAB 2DZCA 2EYQA 4BE0A 1VQ6A 1W2BA 2LDMA 3TU4K 1KQSA 3CCMA 1FWZA 3TEEA 4R56A 3OW2A 1YITA 5GANg 3OS0A 4LDXA 3QUIA 2R57A 1VQ7T 2E65A 3X25B 3OYGA 2YHTA 4M78G 1I81A 2XKOC 5GAOn 2QA4A 1NZ9A 2XDBA 1XNIA 2K57A 3ME9A 3CCJA 2KY9A 2JVVA 1M9SA 2P0QA 3G71T 3PMTA 2RM4A 2DK3A 4OB2B 1QVPA 3QYHB 1Q82U 1NJIU 3CC2A 3HL8A 3O8VA 2VC8A 1MGQA 2QTXA 3A8LB 2XG8D 4C92B 3GOXA 4QQ6A 4Q5WA 2QDYB 1W2BS 3OYCA 1KQSS 1BIBA 1NE8A 2XU8A 3ZFJA 4BACA 3OW2S 1UGQB 4C5GA 3PTAA 4XTWA 3CPWS 1YJNT 3SDZA 1G3YA 4J6XA 1G3WA 3CCQT 2RD1A 2DIQA 3CMAT 4HKEA 4FL6A 3RKYA 2K4YA 4XQ3A 4A4HA 1KHIA 4KUDK 2VV5A 4JLIA 1SSFA 2JNGA 2NLUA 4JRPA 1K73C 1N6AA 1ZHIA 4JJNK 2DAQA 1WJSA 2GFAA 2K3YA 4NL3A 2JOYA 2MWOA 3LW5E 5J39A 2PUKB 4WF2A 3A5ZB 4LD6A 3L2ZA 5IN1A 2XDPA 2KDSA 2OTLT 4M78B 4KULA 2RK2A 4XU1A 2P0PA 3RUXA 3JCMP 4RMOA 1G3TA 1WJQA 1M1KU 5C0MA 3OYFA 1VQ5A 5J3BA 3S3NA 3C12A 4ELYC 4HCBA 3LH0A 1NPPA 1QVFA 1P92A 4IKFA 4ZGDB 1UB4A 3VUBA 4DOWA 3F70A 1BI0A 5LJ5j 3G6EA 2XI9A 5LJ5e 3CCVT 3QBYA 4OMFB 3OYLA 1VIEA 2EFIA 2LX9A 1I8FA 3LX7A 3MP6A 4M77G 4MMLA 3VU3C 1YJ9T 3CD6T 2VXEA 1KG1A 2DKGA 4IUPA 2IG0A 3G7ZA 5GAOr 2DTOA 1BI2A 3LLRA 5CR2A 5HKCA 1N9SA 3OA6A 3FEOA 1D3BA 2PVOB 5KE3A 1VQMT 2E5QA 5GAMj 1YIJT 5CQYA 4QVCA 4KBMB 3I56T 1VQNT 3I55T 2PQWA 2YLCA 2LQKA 3CMET 3T9NA 5GMKh 4QW2A 3M4GA 4HA8A 3A8HB 4HT9A 3HP9A 4BE2A 4X9CA 1QVFS 3J80E 2EJGA 4C0DB 4OGEA 3MP1A 4JS5A 3L42A 4C8QE 3CCJT 1BI1A 4X9DA 1N9RA 3HKSA 3OY9A 3LWIA 1D3BB 4XTZA 3OYEA 1VQ7A 2DTHA 5GAN4 2DXCA 3M54A 5GAN5 5LJ3h 3S3MA 4ZTFA 2BUDA 1R8OB 3RMSA 2V8JA 4OB0B 4M7AG 3ZEHA 3JCMe 3GNFB 4EPCA 4E7HA 1M90C 2FVUA 2QQ9A 3G71A 1N27A 1LJOA 5GAOp 2L8DA 2H3JA 4M75E 1Q81C 3QSUA 3HFNA 3RERA 3PT9A 1BI3A 3MEVA 2R5MA 3GIBA 2L89A 1WPYA 2P0KA 1UGSB 3TREA 1Q7YC 3HSBA 1JBMA 1KC8U 5M9OA 1YJNA 5GANh 3QZ5B 3LYIA 4X34A 1M1GA 3S6WA 1Y07A 2E10A 3QXEB 5FROA 3CMAA 2YLBA 3OYJA 3CCQA 1QVGA 1VQ8T 2RI5A 5I2SA 2X4XA 3HHTB 3OBYA 3OMGA 3FJPA 4C5EA 4MZPA 3L2RA 4LD9K 4QQDA 5GANj 3DKMA 3M59A 2RA2A 4EMHA 4C0FA 5GAOl 2ZPIB 3CEYA 1K8AC 2DIGA 2PVDB 2M9UA 3HRTA 4CI0C 2K3XA 2OTLA 3OYIA 2HQXA 3FIFA 1Q86C 3C95A 3PGGA 4M7AB 5LJ5d 3CC4T 4XU0A 3RESA 4XTYA 5A0LA 2LC4A 3GF5A 5LJ3g 2CZ0B 2QQBA 4BY6C 1QVGS 3JB9H 1OZ2A 2E12A 3RIRA 2DD5A 3OYNA 3CCVA 2QI2A 2E41A 5GAMd 3OYMA 4M7DE 2RHIA 3WVEB 4M7AC 1YJ9A 1IREB 1X6OA 1QW1A 2MAMA 2HBPA 4FU6A 4R55A 1VQMA 2M16A 1YIJA 2EWNA 2EIFA 3I56A 2QXFA 1VQNA 3I55A 4RCCA 2GFUA 2M1HA 4J8OA 4PLLA 3WXMB 2OAUA 4B9WA 3CMEA 4LDUA 4IUUA 3CPWA 4GY5A 2VUBA 1KQ2A 3QDRB 1U8RA 3KBGA 5IAYA 1FX7A 1TH7A 3S3OA 3M5AA 4TVRA 5J26A 4C8QD 4RCBA 3FLGA 3JCMd 4FSXA 3OMCA 1G3SA 2P4TA 4OB3B 2JZ2A 2CYZB 2DJZA 4XTXA 4C8QA 4M77E 1U1SA 2DXBA 5C6SA 5HK3A 4N4IA 4ZGJB 2RI3A 3QPHA 1UEBA 2KSSA 4LDVA 4OVAA 4J7IA 3PIPA 4BDYA 3JB9J 2LNVA 2WACA 1RL2A 2F69A 3N5BB 4PJOE 3LGLA 3JCMV 4EMKA 2KK4A 2EQMA 4M75D 2E6NA 2JTFA 2ZCFB 3OQ5A 3X20B 4XTVA 2QEXT 1N8RC 3X28B 2K5LA 3V7CA 2HD0A 4M75A 4IUVA 1M4ZA 2DEQA 2LT1A 3CBPA 1JRIA 5GANd 3OYDA 3CBMA 4L59A 3QJ6A 4ATOA 5FU7C 1VQ8A 3MEUA 3PMIA 4CRIA 1V29B 4JS4A 2DD4A 4ZN3A 1WGSA 3P8BB 4C8QC 3AHUA 2DTIA 3L2WA 4HT8A 2EQJA 2ZPHB 4Z02A 4C8QF 3C94A 3E9FA 2JUFA 5KE2A 2RJEA 2VGNA 4BI8B 3KUFA 2PVGB 4QVZA 3L2QA 3EFRA 1I5LA 4B9XA 2RHYA 3E19A 2Y4XA 3OSSC 4MZTA 3CC4A 2DZ9A 2QQRA 4F7UE 1ZQ1A 2K5FA 1K9MC 3GLXA 2R5AA 3CXCA 3V8KA 4M75C 1PSEA 4UC4A 4E7KA 3HRSA 1BYMA 4M75F 5GAMe 1YJWT 3NFCA 2RJCA 3OYBA 2A3LA 3VKIA 3P8HA 4EMGA 5CK9A 3NTIA 3ASKA 1LNXA 2WSFE 2LCCA 4IUQA 4OB1B 4XK8E 4XU2A 5LJ5f 4M7DD 4N4GA 2K5IA 1X01A 5D6YA 2EJ9A 2V8KA 4C0GA 1YHQT 4HCCA 5AYFA 4M7DA 5LL6S 3CCRA 5GMKj 5GMKe 2EJFA 3FC3A 2D6FA 5GAMf 3JCMX 2RHZA 2KQWA 3CXCS 2VGMA 4QQGA 4DOVA 4E47A 2X4YA 4C92E 3P8DA 5IT9E 3JCMJ 1M1FA 1NPRA 5HK0A 5GMKi 5CVIA 3JCMc 5KCOA 1Q7YU 3QIIA 4ZGEB 5GAOm 2JN0A 3VJPA 5LJ3e 5LJ3j 3OYAA 3VYHB 1KHCA 4BI3A 2AHJB 1I4K1 5HY6A 2FHDA 2GF7A 3DLMA 3EAEA 4O5VA 3INZA 2OTJT 3CCST 4PJOB 3GNGA 2ZPEB 1YCYA 3JCMf 3OS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM d;  4M7D E;  1BIB A;  4M7D F;  4N0A A;  3JCM b;  5I21 A;  4M7A C;  3V7S A;  4XTU A;  4XTW A;  4PJO D;  3JCM Q;  3JB9 D;  4J6X A;  4M78 C;  1BIA A;  5GAM h;  2RD1 A;  4M78 E;  3SWN A;  5GAN e;  1WQW A;  4M78 F;  1WQ7 A;  4PJO A;  3RKY A;  4XQ3 A;  2EWN A;  2E64 A;  4QVD A;  4RCC A;  4JLI A;  1M5Q 1;  5GAO q;  2FB7 A;  5GMK l;  1KQ2 A;  4M7D B;  4PJO G;  4NL3 A;  3JB9 G;  1WNL A;  4WF2 A;  1TH7 A;  3L2Z A;  4C8Q D;  3JCM d;  4RCB A;  3JB9 I;  4M77 D;  3V8L A;  5GAN f;  3SWN B;  4M78 B;  5GMK m;  4XU1 A;  3RUX A;  5GAN 7;  2DJZ A;  4XTX A;  3JCM P;  4C8Q A;  4M77 E;  3BFM A;  1U1S A;  4M77 A;  3JCM h;  4M7D C;  3V7R A;  4A53 A;  4N0A C;  2I2L A;  3BY7 A;  4JRI A;  5GAN 2;  1Y96 A;  2DXT A;  5LJ5 j;  1HK9 A;  5LJ3 f;  4C8Q G;  3HFO A;  5LJ5 e;  3SWN C;  3JB9 J;  3BW1 A;  4M77 G;  1I8F A;  4JUV A;  4JRK A;  4MML A;  5DY9 A;  3VU3 C;  4PJO C;  4PJO E;  2VXE A;  3JCM V;  2DKG A;  1U1T A;  4XU3 A;  4PJO F;  4M75 D;  4EMK A;  4F7U A;  5LJ5 g;  5GAO r;  3JB9 F;  2DTO A;  4XTV A;  1B34 A;  1N9S A;  2EAY A;  1H64 1;  1D3B A;  4M77 B;  3V7C A;  4M75 A;  5GAM j;  4QVC A;  2CGH A;  5GAN d;  2DEQ A;  3RKW A;  1JRI A;  2YLC A;  2DXU A;  4F7U G;  3JCM W;  5GMK h;  1Y96 B;  3M4G A;  4HA8 A;  5GAM g;  2E1H A;  2HNI A;  4HT9 A;  4X9C A;  4M7A D;  1KQ1 A;  2EJG A;  4M75 G;  5CAI A;  3AHU A;  4C8Q C;  4PJO B;  2DTI A;  4M77 C;  4C8Q E;  4HT8 A;  3BDU A;  2Y90 A;  4C8Q F;  5GAN 6;  4X9D A;  5LJ3 d;  4M7A A;  4M77 F;  1N9R A;  4NL2 A;  1D3B B;  3FB9 A;  4XTZ A;  3V8J A;  4C92 D;  3EFR A;  1I5L A;  3EFS A;  2DTH A;  4DQ2 A;  5GAN 4;  5GAN 5;  2VXF A;  5LJ3 h;  4M7A G;  4J6Y A;  4C92 A;  3JCM e;  3QO3 A;  2DZ9 A;  4F7U E;  5GAN 3;  2FYK A;  4F7U F;  3JCM g;  1LJO A;  1HXD A;  3V8K A;  4M75 C;  4C8Q B;  5GAO p;  4V2S A;  4M75 E;  3QSU A;  4C92 G;  3HFN A;  4M75 F;  5GAM e;  3RER A;  1WPY A;  4MMK A;  3QHS A;  4EMG A;  3HSB A;  2DVE A;  1JBM A;  1LNX A;  4NOY A;  5LJ5 f;  4M7D D;  4XU2 A;  1M8V A;  2ZGW A;  3L1A A;  1X01 A;  5GAN h;  4J5Y A;  2EJ9 A;  4M7D A;  3SB2 A;  2E10 A;  4A54 A;  4EMK B;  4F7U B;  4M7A E;  2YLB A;  4J6W A;  4M78 D;  5GMK j;  5GMK e;  2EJF A;  4M7A F;  1B34 B;  2DZC A;  3FJP A;  5GAN 8;  5GAM f;  4M75 B;  3JCM X;  5GAN j;  4M78 A;  4EMH A;  2RA2 A;  4M7D G;  4PNO A;  5GAO l;  4C92 C;  4C92 E;  5GAN g;  3JCM J;  4C92 F;  4EMK C;  3QUI A;  5GMK i;  2E65 A;  3JCM c;  2YHT A;  4M78 G;  1I81 A;  5GAO n;  1LOJ A;  5GAO m;  3FIF A;  2JN0 A;  2K57 A;  3PGG A;  4M7A B;  3RKX A;  5LJ3 e;  5LJ3 j;  5LJ5 d;  4XU0 A;  3RES A;  1I4K 1;  4XTY A;  2RM4 A;  5LJ3 g;  3INZ A;  4Y91 A;  3JB9 H;  2RB6 A;  5LJ5 h;  3RIR A;  4OP0 A;  2VC8 A;  1YCY A;  1MGQ A;  4C92 B;  3JCM f;  2QTX A;  2E41 A;  3GIB A; 
#chains in the Genus database with same CATH topology
 5DLO A;  3BE3 A;  2RMO A;  1BIA A;  2X4W A;  5FWB A;  5GAN e;  1LCK A;  2XIC A;  1UGV A;  2WSE E;  4BY6 B;  2CP7 A;  4BD3 A;  5A0D A;  1ZBJ A;  2LVM A;  3OS2 A;  2J6K A;  2RNA A;  3RMQ A;  1QCO A;  3HFO A;  4MDX A;  3LWH A;  2EQU A;  2ZZD A;  2L3R A;  5DM7 R;  1A0N B;  4EDU A;  1YHQ A;  1KFZ A;  3JRZ A;  4J9B A;  2DER A;  2HNI A;  3L2U A;  2O4X A;  2AKK A;  4F17 A;  2L2P A;  3M0S A;  2K7A A;  1TXQ A;  1AVZ C;  4BDZ A;  2GTJ A;  4NL2 A;  2C0T A;  1VQO A;  5CQX A;  2M0O A;  3TSZ A;  2MI6 A;  2CDT A;  2I0N A;  1K73 U;  1VQL T;  2LRQ A;  2ECZ A;  2LQ8 A;  2LX7 A;  5GAN 3;  2E6Z A;  4F7U F;  3VV0 A;  3OYH A;  4C8Q B;  2KRM A;  1UE9 A;  3Q1J A;  1D0Y A;  3DB4 A;  1R0B G;  1VQL Q;  3UWN A;  2O01 E;  4N4H A;  1Q82 C;  1NJI C;  1N8R R;  3G4S A;  5GAN 8;  3VS5 A;  4M75 B;  2LTO A;  4DEX A;  3VUZ A;  5FRM A;  1M3C A;  4JLG A;  4M7D G;  1IHW A;  3OYY A;  4AFZ C;  5I11 A;  1AHJ B;  1YI2 T;  1S72 T;  2J06 A;  2KT8 A;  2CS7 A;  1SHG A;  2D1X A;  4Y91 A;  1YI2 Q;  2QQA A;  3L2V A;  4OP0 A;  2QK0 A;  1S72 Q;  2L5Q A;  3BDL A;  2V26 A;  1MMA A;  2ZPB B;  2HQE A;  3UPU A;  2KAF A;  1VQ9 T;  2CP3 A;  1CSK A;  1WQ7 A;  4A4F A;  3CCL A;  2E64 A;  5KYX A;  4FM4 B;  1VQO T;  1KIK A;  3EG2 A;  3PNW C;  1PHT A;  2FB7 A;  4E7L A;  2VYT A;  3CCM T;  1YIT T;  2HL5 C;  2XK0 A;  1VQ9 Q;  1WNL A;  1OZ3 A;  3ZBD A;  1T0J A;  2QA4 T;  3SWN B;  5GMK m;  4DEY A;  2YWW A;  3CXC P;  2O88 A;  3CCM Q;  1KD1 U;  4M7D C;  1YIT Q;  1JXM A;  3H8Z A;  4IUT A;  1HK9 A;  2KEA A;  5LJ3 f;  2QA4 Q;  2CZ6 B;  2FPD A;  3EH2 A;  5DY9 A;  2EKH A;  2P84 A;  1E6H A;  3CCU A;  1H64 1;  3I9Q A;  2DXU A;  3NHN A;  5FU6 B;  3JCM W;  2E3H A;  1J3T A;  3OSV A;  1OUL A;  1JJ2 A;  1BKB A;  3M9Q A;  4PJO B;  4ZNX A;  5D6X A;  1VQ5 T;  4E7I A;  2D0Q B;  4AT1 B;  1VQK A;  1X27 A;  2DO3 A;  2NUZ A;  3G6E T;  2LQN A;  4J83 A;  1HXD A;  1OV3 A;  2E70 A;  4C92 G;  1JJ2 S;  1VQ5 Q;  4A4E A;  2F2V A;  3URG A;  2ZGW A;  4Y28 E;  3G6E Q;  4J5Y A;  3M4Y A;  3QKJ A;  4M7A F;  1ZLM A;  4JRQ A;  1PSF A;  1X69 A;  1VQ6 A;  3TU4 K;  3EFO B;  2DRK A;  2KRO A;  1VQ7 T;  2R57 A;  1AZE A;  3OYG A;  1PWT A;  2XKO C;  1UFF A;  2K57 A;  2XDB A;  3I35 A;  2KT1 A;  3CCJ A;  2JVV A;  1M9S A;  1PNJ A;  4LE9 A;  2DK3 A;  2EYX A;  1VQ7 Q;  2A08 A;  1MGQ A;  2QTX A;  4QQ6 A;  4C5G A;  2F2W A;  3CCQ T;  2DIQ A;  1QWF A;  2K4Y A;  1KHI A;  1H92 A;  2LQW A;  2JNG A;  4JRP A;  1K73 C;  1ZHI A;  2JW4 A;  2HCK A;  2JOY A;  2PUK B;  3CCQ Q;  2YRC A;  3A5Z B;  1AWO A;  2OTL T;  4M78 B;  1WJQ A;  3REA B;  1WA7 A;  3C12 A;  1NPP A;  1QVF A;  1P92 A;  4ZGD B;  3TVT A;  1UB4 A;  3VUB A;  1BI0 A;  2ROT A;  2KE9 A;  2OTL Q;  3QBY A;  4OMF B;  4M77 G;  4MML A;  3A1P A;  1KG1 A;  1BI2 A;  5CR2 A;  5HKC A;  1N9S A;  3OA6 A;  2PVO B;  1YIJ T;  5CQY A;  2PQW A;  3HP9 A;  1M1K R;  1QVF S;  1B07 A;  2BZY A;  4JS5 A;  3QWY A;  3CCJ T;  1YIJ Q;  1N9R A;  2ENM A;  2HSP A;  3OY9 A;  1D3B B;  4XTZ A;  2LJ3 A;  2OX7 A;  5GAN 5;  5LJ3 h;  4ZTF A;  4OB0 B;  1Z9Z A;  4EPC A;  2K79 A;  2QQ9 A;  1N27 A;  2L3Q A;  4E7Z A;  1SRL A;  3QSU A;  1RAI B;  4J9G A;  3MEV A;  2R5M A;  2VKN A;  1WPY A;  1NBE B;  3ZL7 C;  4PK4 A;  1YJN A;  4X34 A;  5FRO A;  3CMA A;  3VS4 A;  3FJP A;  4LD9 K;  4EMH A;  3CEY A;  4Y92 A;  1M3A A;  1PRL C;  1PD0 A;  3PGG A;  1X2K A;  2KYB A;  4BY6 C;  5LJ3 g;  1OZ2 A;  2E12 A;  3PVL A;  3OYN A;  3CCV A;  1RLQ C;  1I0C A;  1YJ9 A;  1WYX A;  2PTK A;  1RAE B;  1X6O A;  1QW1 A;  1HYO A;  4CC3 A;  4R55 A;  2DL5 A;  2EIF A;  3I55 A;  4AG1 C;  2GFU A;  2M1H A;  2EQI A;  4LDU A;  4GY5 A;  3A98 A;  3CCR Q;  2AIR B;  1TH7 A;  2DX1 A;  4C8Q D;  3JCM d;  4FSX A;  3OMC A;  3GBQ A;  2CYZ B;  4XTX A;  4C8Q A;  3M0Q A;  3QPH A;  4OVA A;  1ACM B;  2CP0 A;  4J7I A;  4BDY A;  3JB9 J;  1VOM A;  2WAC A;  3N5B B;  1BK2 A;  4M75 D;  1N8R C;  4XTV A;  4PFO A;  2C0I A;  2K5L A;  3V7C A;  1H3H A;  4M75 A;  2E5K A;  1YWP A;  3CBP A;  4JS4 A;  4AFS C;  2NUP B;  3KFV A;  3P8B B;  4C8Q C;  3AHU A;  2DTI A;  2EQJ A;  4Z02 A;  3C94 A;  2JMC A;  3E9F A;  2JUF A;  4BI8 B;  2PVG B;  4B9X A;  1IGQ A;  1M2V B;  2Y4X A;  5KYN A;  1VYV A;  1BCO A;  4FW1 A;  3EGD B;  3V8K A;  4M75 C;  1PSE A;  4UC4 A;  3HRS A;  1M8M A;  3MPU B;  3VKI A;  5CK9 A;  2DVJ A;  3SHW A;  2WSF E;  1M8V A;  4N4G A;  2F1L A;  2K5I A;  1ARK A;  4C0G A;  1C6V X;  1JU5 C;  2HZY A;  2EJF A;  2D6F A;  3TSW A;  5GAM f;  3JCM X;  1C1A A;  1NYG A;  2VGM A;  4DOV A;  1E7O A;  3P8D A;  5GMK i;  4RTU A;  4DBR A;  2JMA A;  5GAO m;  5LJ3 j;  1MND A;  3VJP A;  5LJ3 e;  4BI3 A;  2AHJ B;  5HY6 A;  2FHD A;  3DLM A;  4O5V A;  1M27 C;  2OTJ T;  3CCS T;  4IIM A;  1AT1 B;  3OS5 A;  2K2V A;  1UGP B;  2EQK A;  4M7D F;  2FO0 A;  3RNJ A;  4PJO D;  3JCM Q;  3JB9 D;  2KRN A;  4MZM A;  2D0N A;  2QEX A;  1Q81 R;  3CCS Q;  2OTJ Q;  1WQW A;  1VYU A;  4PJO A;  5CCA A;  1FMW A;  4NS5 A;  3CC7 T;  5CKF A;  4J9D A;  5GAO q;  5GMK l;  2RQU A;  1OI1 A;  4DA4 A;  2EGE A;  2DBM A;  3CC7 Q;  1LVK A;  2F5K A;  2MK5 A;  3M57 A;  4II1 A;  2CH4 A;  3SD4 A;  1OX9 A;  4BUG A;  5FU6 C;  1WZO A;  1TUG B;  5GAN 2;  2A37 A;  4OMP A;  3EG1 A;  1VQ4 T;  3M55 A;  5D7U A;  2LCS A;  2DEU A;  2XID A;  4PJO C;  1YJW A;  1VYT A;  1QVG P;  2CGH A;  1VQ4 Q;  3RKW A;  1GXI E;  3OYK A;  2XD0 A;  1HJD A;  1QCN A;  3MKD A;  1OU9 A;  4DBH A;  1IRX A;  3PIO A;  1K1Z A;  2VAS A;  2RJD A;  4C5I A;  3TCJ A;  1UG1 A;  4J6Y A;  3DB3 A;  1KSW A;  3QO3 A;  2M0Y A;  1QWE A;  4CC4 B;  3QHS A;  1VA7 A;  1FYN A;  2KXC A;  2LJ0 A;  4NOY A;  4DBF A;  1JEG A;  4CC7 A;  3EG0 A;  1PKS A;  2QGG A;  4EMK B;  2DMO A;  5ECA A;  4M78 D;  1GBQ A;  3CBO A;  4M78 A;  4FT2 A;  2J7I A;  4PNO A;  8ATC B;  1PC0 A;  4C92 F;  3M0P A;  3H0I A;  3QYG B;  5DLQ E;  5KYY B;  2M51 A;  2RH2 A;  2DIL A;  2WSC E;  4J9I A;  2J6O A;  4C0Z A;  2F5T X;  1Y7X A;  4OMQ A;  3X24 B;  3M58 A;  1UDL A;  5IH2 A;  4N0A A;  5I21 A;  2IIM A;  2CKK A;  1M1K C;  4PJJ A;  4M78 C;  5GAM h;  4VUB A;  1MV3 A;  4F04 B;  3VS7 A;  1Q81 U;  4M4Z A;  1XTD A;  2FZG B;  3CD6 Q;  3C4S A;  2FEI A;  2FPF A;  5HCK A;  3PVQ A;  4OMN A;  3RR6 A;  3NPF A;  5CIU A;  4N0A C;  4ZN1 A;  1VQL A;  4AMC A;  2RI2 A;  1Y96 A;  2X35 A;  4PFZ A;  4IIO A;  1XJW B;  2JXB A;  4JDS A;  4JRK A;  1X75 C;  1W4S A;  4E7S A;  1U1T A;  2Y4Y A;  1OPL A;  2EGA A;  2V1Q A;  4ME7 A;  3O5Z A;  1AWX A;  2COY A;  2JT4 A;  4M77 B;  1WHL A;  3SEM A;  1C0M A;  2MOX A;  2RO0 A;  2O9V A;  5GAM g;  2E1H A;  2MCN A;  5I2M A;  1KD1 R;  1O9S A;  5L8R E;  1RAA B;  4M77 F;  2YUP A;  1V76 A;  4BB7 A;  2PZ1 A;  1AD5 A;  1YI2 A;  2FL7 A;  1WHG A;  3EFS A;  4DQ2 A;  2HBW A;  1S72 A;  1ZA2 B;  1T3L A;  3J7A F;  1GBR A;  3MO8 A;  1K76 A;  1X6G A;  4ANJ A;  4IUR A;  3KXT A;  1VQ9 A;  1ZSZ B;  3SB2 A;  2NYS A;  4F7U B;  1M2O A;  4J6W A;  1SRM A;  4RUG A;  4BE0 A;  2LDM A;  1JXO A;  3CCM A;  3TEE A;  4R56 A;  1AZG B;  1YIT A;  3OS0 A;  5KYW B;  2E65 A;  4Z88 A;  2QA4 A;  3ME9 A;  3G71 T;  3PMT A;  3GIB A;  1Y57 A;  2QDY B;  3OYC A;  3RBB B;  1UGQ B;  3PTA A;  3CPW S;  1G3Y A;  3G71 Q;  2RD1 A;  1ABO A;  2NUP A;  2VWF A;  1BU1 A;  4A4H A;  4KUD K;  2DYI A;  2VV5 A;  1SSF A;  1WHM A;  1WJS A;  2GFA A;  3LW5 E;  1AOJ A;  1TUC A;  1JO8 A;  4LD6 A;  5IN1 A;  2DL7 A;  2KDS A;  2RK2 A;  3JV3 A;  4RMO A;  1VQ5 A;  3S3N A;  2L3S A;  3LH0 A;  4IKF A;  1PG5 B;  2EW3 A;  3G6E A;  2GNC A;  3OYL A;  2EFI A;  1R0C B;  4QKU A;  4WTO B;  2VXE A;  2DKG A;  5GAO r;  2B86 A;  2DTO A;  1T0H A;  4J9F A;  3FEO A;  5GAM j;  4KBM B;  3I56 T;  2JS0 A;  5GMK h;  4QW2 A;  4X9C A;  3J80 E;  2EJG A;  3MP1 A;  4C8Q E;  1QMC A;  1BI1 A;  4KGV B;  3I56 Q;  3LWI A;  3OYE A;  1VQ7 A;  2CSI A;  5GAN 4;  2DXC A;  2A28 A;  3RMS A;  4J9E A;  2L8D A;  4M75 E;  1Q81 C;  1NEG A;  3PT9 A;  1BI3 A;  3TRE A;  1Q7Y C;  3HSB A;  2ABL A;  2YUO A;  1KC8 U;  3VRZ A;  2HQH A;  3H0F A;  8AT1 B;  3LYI A;  3CCQ A;  1VQ8 T;  3OYJ A;  2X4X A;  3HHT B;  2QGF B;  3OBY A;  4QQD A;  2RA2 A;  4C0F A;  5GAO l;  2X3W D;  1T3S A;  2ZPI B;  2DIG A;  1VQ8 Q;  2OTL A;  3FIF A;  2BZX A;  4M7A B;  3CC4 T;  4PJL A;  1K9A A;  4HVW A;  5A0L A;  2QQB A;  3JB9 H;  1K0X A;  2E41 A;  3OYM A;  1WDX A;  2YT6 A;  4QT7 A;  3CC4 Q;  1I07 A;  1M3B A;  2MAM A;  2XMF A;  3VS0 A;  1D1B A;  2DBK A;  2M16 A;  1JJ2 P;  1YIJ A;  2ESW A;  1SEM A;  1AEY A;  5I22 A;  1KQ2 A;  1U8R A;  3EH1 A;  1JQQ A;  5J26 A;  4RCB A;  2LJ1 A;  1G3S A;  2P4T A;  4OB3 B;  1EZZ B;  2DJZ A;  3IQL A;  4JPB W;  5HK3 A;  2KSS A;  3EGX A;  5L23 A;  4PJO E;  3LGL A;  4RTZ A;  4EMK A;  2JTF A;  2ZCF B;  3OQ5 A;  3EHQ A;  5GJV B;  3X28 B;  2HD0 A;  4IUV A;  1JRI A;  2HDA A;  5KYU B;  3VS3 A;  4ATO A;  3MEU A;  4CRI A;  5KYY A;  1WGS A;  3L2W A;  1ZX6 A;  2OI3 A;  1IXD A;  2VVK A;  4QVZ A;  3EFR A;  3REB B;  3E19 A;  1QCF A;  3OSS C;  4MZT A;  1ZUY A;  3EG3 A;  2QQR A;  4HXJ A;  2R5A A;  3NFC A;  2RJC A;  3OYB A;  2LZ6 B;  2EYW A;  5LJ5 f;  4XK8 E;  5FWC A;  2EJ9 A;  1RAH B;  5AYF A;  3CCR A;  2GQI A;  3TQ7 P;  5GMK j;  5GMK e;  2QYZ A;  2CH4 W;  2RHZ A;  2KQW A;  2CUD A;  4E47 A;  5IT9 E;  3JCM J;  1M1F A;  2FZC B;  4E6R A;  5CVI A;  3JCM c;  1QVF P;  1IGU A;  3QII A;  2EVR A;  4JZ3 A;  4R0K A;  2M02 A;  1G2B A;  2RQR A;  5AT1 B;  5EG2 A;  2RHU A;  1K8A U;  3CCE T;  4OMO A;  4FYW B;  1KD1 C;  4M78 E;  4RTW A;  1Q86 U;  3JSC A;  1WHJ A;  1M30 A;  3CCE Q;  3SFM A;  4D6W A;  1D1C A;  3HPW A;  4PKC C;  1XQH A;  3OS1 A;  5GAN f;  2J6F A;  2YRV A;  4KH1 B;  2K3B A;  2LNH B;  2RN8 A;  3V7R A;  2AT1 B;  1G5V A;  1X2Q A;  5FRN A;  2DXT A;  4A4G A;  4C8Q G;  3BW1 A;  3CCR T;  1WFW A;  2COZ A;  2E3I A;  2G3R A;  4F7U A;  3NTH A;  5A2Q E;  2DPP B;  3A8G B;  2P4R A;  1UTI A;  2O31 A;  2IVW A;  2OAW A;  5KYW A;  4M75 G;  1FMV A;  1U5S A;  3E9G A;  4B6M A;  5CAI A;  2A7Y A;  2YXY A;  3DLL A;  2PUO B;  3BDU A;  5LJ3 d;  1D0X A;  2JS2 A;  2MF2 A;  2HL3 A;  1NYF A;  2VXF A;  1RAB B;  1D1A A;  2O4X B;  4FT4 A;  2PU9 B;  1OQK A;  3I5R A;  2OTJ A;  3CCS A;  2K6D A;  1VQP T;  2R58 A;  1W6X A;  2JM9 A;  3A8M B;  3FDR A;  4XAX B;  3UDC A;  2LT4 A;  1UGR B;  3QJY A;  2IPO B;  1VQP Q;  1MNE A;  3CC7 A;  1TUD A;  1K9M U;  3AT1 B;  3E2U A;  3H6Z A;  4FYX B;  1QKX A;  4O6J A;  3RKX A;  1K4U S;  3OB9 A;  2CP5 A;  4KT0 E;  2RB6 A;  5LJ5 h;  1GFC A;  1VQ4 A;  3VS6 A;  1OYX A;  2HMA A;  1G8X A;  5IXB A;  3V7S A;  5FW9 A;  4PLI A;  4XTU A;  1BBZ A;  4LDY A;  1IZ6 A;  3SWN A;  4GLK A;  1CKB A;  1M5Q 1;  1ZBX A;  3VRY A;  4M7D B;  4PJO G;  4Z8A A;  3JB9 G;  2YUQ A;  1YJ9 Q;  2RJF A;  5CKH A;  4E7J A;  1QQJ A;  2MWP A;  1GFD A;  1PKT A;  2CP2 A;  2BIV A;  5GAN 7;  2FZK B;  2LCL A;  2XDD A;  2GQV A;  3WVD B;  3MEA A;  1VIF A;  4A53 A;  1IB8 A;  3I55 Q;  4J7F A;  3CPF A;  3CC2 T;  2D9T A;  1QP2 A;  3FRN A;  3VYG A;  2HAX A;  2BKD N;  3SWN C;  4L6V 5;  4JUV A;  4BI4 A;  2B8A A;  3NTK A;  5LJ5 g;  5IHK A;  4ZTJ A;  1UHC A;  1KK7 A;  4PJN A;  2RQW A;  4OGC A;  3CC2 Q;  1BCM A;  2DNU A;  4M7A D;  2XHC A;  2V1R A;  2CZ7 B;  4A4K A;  3OBW A;  3MHX A;  5GAN 6;  4M7A A;  1HSQ A;  3FB9 A;  2LP5 A;  2MMP A;  2ED1 A;  2C06 A;  5KH6 A;  1LPL A;  2FYK A;  3MET A;  1MHN A;  2DJQ A;  2GCX A;  2EBP A;  3UT1 A;  2SEM A;  4LUD A;  1B3Q A;  3EFO A;  4RG8 A;  3FJ5 A;  3L1A A;  3CD6 A;  2KR3 A;  1NLO C;  3H0H A;  1MMD A;  1B34 B;  5EC7 A;  2DZC A;  2DF6 A;  1W2B A;  3OW2 A;  1FWZ A;  5GAN g;  4LDX A;  4LXC A;  2G6F X;  2YHT A;  4M78 G;  1I81 A;  5GAO n;  1NZ9 A;  2DET A;  2KY9 A;  2AZS A;  2MYS A;  2COW A;  1Q82 U;  1NJI U;  3HL8 A;  1RUW A;  4C92 B;  1W2B S;  1BIB A;  3ZFJ A;  4BAC A;  3OW2 S;  5KYU A;  4XTW A;  3SDZ A;  1IO6 A;  4HKE A;  4FL6 A;  3RKY A;  4XQ3 A;  4JJN K;  2GGR A;  2L0A A;  1YFN A;  4KUL A;  4XU1 A;  2P0P A;  3OYF A;  4LNP A;  5J3B A;  4HCB A;  1TS9 A;  5LJ5 j;  5LJ5 e;  3CD6 T;  3LX7 A;  3MP6 A;  3EGU A;  1SSH A;  4IUP A;  1PRM C;  3UF4 A;  2YDL A;  4JJC A;  6AT1 B;  1D3B A;  1VQM T;  5KE3 A;  4QVC A;  1NEB A;  1VQN T;  1Y0M A;  3CME T;  2FPE A;  4ESR A;  4C0D B;  4OGE A;  3L42 A;  1VQM Q;  1SKU B;  1VQN Q;  3HKS A;  3CME Q;  4J9H A;  2DTH A;  4RTT A;  3M54 A;  3S3M A;  4LN2 A;  2BUD A;  1R8O B;  2V8J A;  1RI9 A;  3GNF B;  2FVU A;  3G71 A;  1LJO A;  3M0R A;  2H3J A;  2AZV A;  2L89 A;  2P0K A;  1UGS B;  1YCS B;  2VB6 A;  4J9C A;  5M9O A;  1M1G A;  1Y07 A;  1B7T A;  2RI5 A;  4C5E A;  3L2R A;  5GAN j;  3M59 A;  2EPD A;  4D8D A;  2KBT A;  2PVD B;  4CI0 C;  1Q95 G;  2K3X A;  2D8H A;  1MMN A;  3C95 A;  3I5S A;  4XU0 A;  1KC8 R;  2EYZ A;  2CT3 A;  4XTY A;  3RES A;  2O2O A;  2LC4 A;  3GF5 A;  4K11 A;  1RLP C;  1AWW A;  2JTE A;  2QI2 A;  5GAM d;  1NLP C;  1WX6 A;  4ORZ A;  1RAC B;  2HBP A;  2YRD A;  4FU6 A;  4JZ4 A;  1I5O B;  2KGT A;  3I56 A;  4HCK A;  1SPK A;  4RCC A;  3CPW A;  4J8O A;  4AFQ C;  4X1V A;  1PCX A;  4FCY A;  1NG2 A;  1RAD B;  1SHF A;  5IAY A;  1TU0 B;  2KXD A;  2RF0 A;  3M5A A;  4TVR A;  2JZ2 A;  4M77 E;  5C6S A;  4ZGJ B;  2RI3 A;  1UEB A;  4LDV A;  3UAT A;  3PIP A;  1RL2 A;  4F16 A;  3JCM V;  2KK4 A;  1TG0 A;  2E6N A;  1GL5 A;  5IXF A;  2LT1 A;  2DEQ A;  1M2V A;  4L59 A;  1VQ8 A;  3CPW P;  2E4H A;  4ZN3 A;  3RDV A;  4OML A;  4HT8 A;  3EGD A;  4C8Q F;  2VGN A;  3KUF A;  3L2Q A;  4EIK A;  2RHY A;  5GJW B;  2AKL A;  3CC4 A;  4F7U E;  1ZQ1 A;  3GLX A;  3CXC A;  1H8K A;  1TWB A;  1BYM A;  4M75 F;  5GAM e;  1K0S A;  3P8H A;  4EMG A;  1I1J A;  1LNX A;  4M7D D;  2LCC A;  4Z89 A;  4FYV B;  2KYM A;  2A36 A;  1YHQ T;  4HCC A;  4M7D A;  2ROL A;  1BB9 A;  1MUZ A;  3FC3 A;  2AK5 A;  1QKW A;  3CXC S;  1WHH A;  2X4Y A;  2L3P A;  1YHQ Q;  5HK0 A;  5KCO A;  4ZGE B;  3VYH B;  1KHC A;  2QTV A;  2CT4 A;  1I4K 1;  2GF7 A;  3EG9 B;  3H9N A;  1VQO Q;  3D7S B;  2ZPE B;  3JCM f;  2QAS A;  2HKN A;  1GCP A;  1M90 R;  1FXX A;  1PM3 A;  3A8O B;  1Y71 A;  3HTR A;  4L5G A;  2SRC A;  4QVD A;  3G4S T;  2FRY A;  4RG2 A;  4C5H A;  4LUE A;  1CKA A;  2X3X D;  2NUT B;  2ZPG B;  3V8L A;  3G4S Q;  2KMT A;  2HSE B;  2KVQ G;  3GPL A;  1K8A R;  1X43 A;  2DL3 A;  2I2L A;  2DA9 A;  4RKU E;  3ULR B;  1VUB A;  1Q86 R;  4RTX A;  1YP5 A;  4A63 B;  4PJO F;  3JB9 F;  1YNZ A;  1B34 A;  2EAY A;  3UA6 A;  1FMK A;  3CCL T;  1W1F A;  4FIB A;  4KUI A;  1DJ7 B;  1QP3 A;  1KQ1 A;  1D0Z A;  3QZ9 B;  4JJD A;  2Y90 A;  2JTM A;  3CCL Q;  2CUB A;  3V8J A;  4C92 D;  2C0O A;  1N8R U;  4C92 A;  5FU7 B;  1R77 A;  3HRU A;  1OX8 A;  3LH5 A;  4P5N A;  2CZ1 B;  5D6W A;  2ZPF B;  5IHI A;  5CKD A;  4RTY A;  1IHV A;  3CCU T;  2DVE A;  3CCE A;  2MIO A;  4A54 A;  3MP8 A;  4M7A E;  1OPK A;  3CCU Q;  4CC2 A;  4C92 C;  2DM1 A;  1X6B A;  1U06 A;  3PFS A;  1SF9 A;  4EMK C;  1WXU A;  3R6O A;  2HKQ B;  5KCH A;  3M53 A;  1LOJ A;  1VQK T;  3MEW A;  1OOT A;  3M0T A;  3M56 A;  1MV0 B;  1GRI A;  2NWM A;  1H3Z A;  1JB0 E;  2BZ8 A;  5CKE A;  1VQK Q;  3JCM b;  5A0G A;  1K9M R;  1O75 A;  2QQS A;  2KRS A;  1M90 U;  2RK1 A;  4MDW A;  4M78 F;  5FLX E;  1EIF A;  2W0Z A;  1VQ6 T;  1RI0 A;  2X4J A;  3E1S A;  1OEB A;  1N5Z A;  1WJR A;  3PE0 A;  3JB9 I;  2KI7 A;  4M77 D;  3JAM E;  1VQ6 Q;  3H41 A;  2W10 A;  3BFM A;  4M77 A;  3JCM h;  2DL4 A;  2RHX A;  3BY7 A;  4JRI A;  3J81 E;  2DRM A;  4C0D C;  1YBY A;  2ZAE A;  4YTL A;  3CCJ Q;  1VQP A;  2O9S A;  4XU3 A;  4OF1 A;  1XOV A;  2D8J A;  4PL6 A;  3ER0 A;  3MJX A;  4ELZ C;  4F7U G;  3QG1 A;  1Y96 B;  4HCZ A;  1TOV A;  3X26 B;  4BE1 A;  3UA7 A;  3LGF A;  4M77 C;  4PFP A;  2V8I A;  2BE9 B;  1KC8 C;  1F1B B;  5CO7 A;  1KJW A;  2DFU A;  4E2F B;  3NGP A;  2EKO A;  5IHN A;  4F14 A;  2QAZ A;  1ZSZ A;  2K9G A;  3JCM g;  4LDW A;  4V2S A;  4GLM A;  4MMK A;  1U3O A;  1WXB A;  1PD1 A;  2OJ2 A;  3VS2 A;  3GP8 A;  3VS1 A;  5CKB A;  1S1N A;  3G1J A;  2X9H A;  3MCA B;  2A0F B;  2EYQ A;  2J05 A;  1RAF B;  1KQS A;  1YWO A;  1ZSZ C;  3QUI A;  3X25 B;  2DL8 A;  1QLY A;  1XNI A;  4WCI A;  4FSS A;  4GBQ A;  2P0Q A;  3CQT A;  2RM4 A;  4OB2 B;  1QVP A;  3QDF A;  3QYH B;  3CC2 A;  2PNI A;  3O8V A;  2VC8 A;  4KGZ B;  3A8L B;  2XG8 D;  3R6N A;  3GOX A;  4Q5W A;  1KQS S;  1NE8 A;  2XU8 A;  4RTV A;  1YJN T;  4J6X A;  1G3W A;  2LMJ A;  2Z0W A;  3CMA T;  1WLP B;  1ZSG A;  2YSQ A;  4JLI A;  2NLU A;  2ATC B;  4D8K A;  2GTO A;  3M0U A;  1N6A A;  2DAQ A;  1YJN Q;  2K3Y A;  2RQV A;  4NL3 A;  2MWO A;  5J39 A;  1KQS P;  1Q82 R;  4WF2 A;  3CMA Q;  1NJI R;  3L2Z A;  2XDP A;  1AWJ A;  3RUX A;  2F2X A;  3JCM P;  1G3T A;  1M1K U;  5C0M A;  4ELY C;  1TTH B;  4DOW A;  3F70 A;  3NMZ C;  2XI9 A;  3CCV T;  1VIE A;  2LX9 A;  1I8F A;  1YJ9 T;  3VU3 C;  2IG0 A;  3G7Z A;  9ATC B;  2GBQ A;  3LLR A;  1UJ0 A;  1EFN A;  2E5Q A;  2QG9 B;  3I55 T;  3CCV Q;  2BTT A;  2LQK A;  2YLC A;  3T9N A;  3M4G A;  4HA8 A;  3A8H B;  4HT9 A;  4BE2 A;  1ZUK A;  2RQT A;  4JJB A;  3THK A;  4X9D A;  5KYX B;  1ZUU A;  3EG9 A;  1UUE A;  2EYY A;  4KGX B;  4M7A G;  4KRT A;  3ZEH A;  3JCM e;  2FG0 A;  4E7H A;  1G83 A;  1M90 C;  5GAO p;  3HFN A;  3RER A;  1JBM A;  1NM7 A;  5GAN h;  3QZ5 B;  3S6W A;  2E10 A;  3QXE B;  2YLB A;  1QVG A;  2BE7 D;  5I2S A;  3OMG A;  2NUT A;  4MZP A;  3DKM A;  4FYY B;  1K8A C;  1Q7Y R;  2CRE A;  2M9U A;  3HRT A;  1WHK A;  1WXT A;  3OYI A;  2HQX A;  1Q86 C;  5LJ5 d;  1HD3 A;  2CZ0 B;  1QVG S;  2JM8 A;  2X51 A;  4DBQ A;  3RIR A;  1WIE A;  2DE0 X;  2DD5 A;  1UEC A;  4M7D E;  2RHI A;  3WVE B;  4M7A C;  2EGC A;  1YN8 A;  1IRE B;  4FW2 A;  1VQM A;  2EWN A;  1E6G A;  1UJY A;  2QXF A;  1VQN A;  1ZA1 B;  4B9W A;  4PLL A;  2H8H A;  3WXM B;  2OAU A;  4AFU C;  3CME A;  1OU8 A;  4IUU A;  1MMG A;  2VUB A;  1TSF A;  3QDR B;  3C0C A;  3KBG A;  1GCQ A;  1FX7 A;  3U23 A;  3S3O A;  4KH0 B;  3FLG A;  1WI7 A;  2DYB A;  1U1S A;  2DXB A;  4N4I A;  3EHR A;  1W70 A;  2CSQ A;  4PJM A;  2LNV A;  2F69 A;  1ABQ A;  3QWX X;  2EQM A;  2ED0 A;  2H3E B;  3X20 B;  2QEX T;  7AT1 B;  1M4Z A;  5GAN d;  1W2B P;  1GCQ C;  3OYD A;  3CBM A;  1Z9Q A;  3QJ6 A;  3OW2 P;  2RPN A;  3EGX B;  5FU7 C;  3PMI A;  1V29 B;  2FRW A;  2DD4 A;  2QEX Q;  2DLP A;  2ZPH B;  1UHF A;  5KE2 A;  2RJE A;  1K73 R;  1I5L A;  4AG2 C;  2JJ9 A;  2HEQ A;  2DZ9 A;  2KNB B;  1K9M C;  2K5F A;  4HVV A;  4E7K A;  1YJW T;  2QDL A;  2A3L A;  3NTI A;  2CP6 A;  3ASK A;  4IUQ A;  4OB1 B;  4XU2 A;  1X01 A;  5D6Y A;  2V8K A;  5LL6 S;  1V1C A;  1YJW Q;  2YUN A;  4HVU A;  2K2M A;  4QQG A;  4C92 E;  1D09 B;  4OMM A;  1NPR A;  1RAG B;  1Q7Y U;  2JN0 A;  3OYA A;  3EAE A;  3INZ A;  1EX4 A;  1SG5 A;  2MPX C;  3GNG A;  1YCY A; 
#chains in the Genus database with same CATH homology
 2K2V A;  1UGP B;  2EQK A;  5EG2 A;  2RHU A;  5DLO A;  4M7D F;  1K8A U;  1FXX A;  3CCE T;  4PJO D;  3JCM Q;  3JB9 D;  2QEX A;  1BIA A;  2X4W A;  3A8O B;  1Y71 A;  4MZM A;  4M78 E;  1KD1 C;  5GAN e;  1WQW A;  4L5G A;  4PJO A;  2XIC A;  5CCA A;  4NS5 A;  1Q86 U;  4QVD A;  2WSE E;  5CKF A;  4BY6 B;  3G4S T;  3CC7 T;  5GAO q;  3JSC A;  4BD3 A;  4RG2 A;  1M8V A;  3SFM A;  5GMK l;  4C5H A;  4D6W A;  3HPW A;  4PKC C;  1XQH A;  1OI1 A;  3OS1 A;  2ZPG B;  5A0D A;  4DA4 A;  3V8L A;  5GAN f;  2LVM A;  2KMT A;  2F5K A;  2YRV A;  3OS2 A;  3M57 A;  4II1 A;  2KVQ G;  3GPL A;  3SD4 A;  3RMQ A;  3V7R A;  2I2L A;  4BUG A;  5FU6 C;  1G5V A;  5FRN A;  4RKU E;  5GAN 2;  2DXT A;  1VUB A;  1VQ4 T;  3M55 A;  4A4G A;  4C8Q G;  3HFO A;  2XID A;  4MDX A;  3BW1 A;  2EQU A;  3LWH A;  3CCR T;  4PJO C;  4BE1 A;  4PJO F;  2G3R A;  1YJW A;  2ZZD A;  4F7U A;  3JB9 F;  2L3R A;  3NTH A;  1B34 A;  5A2Q E;  2EAY A;  2DPP B;  5DM7 R;  3A8G B;  2CGH A;  3CCL T;  3RKW A;  4EDU A;  1YHQ A;  2IVW A;  4FIB A;  3JRZ A;  1GXI E;  4KUI A;  2HNI A;  3L2U A;  1DJ7 B;  1QP3 A;  2O4X A;  3OYK A;  1KQ1 A;  4M75 G;  2XD0 A;  5CAI A;  3E9G A;  2A7Y A;  3DLL A;  3QZ9 B;  2PUO B;  3BDU A;  2Y90 A;  2JTM A;  5LJ3 d;  4BDZ A;  3PIO A;  4NL2 A;  3V8J A;  1VQO A;  5CQX A;  2M0O A;  4C92 D;  2MF2 A;  2RJD A;  4C5I A;  1N8R U;  2MI6 A;  2VXF A;  3TCJ A;  1K73 U;  4J6Y A;  4C92 A;  1VQL T;  2LRQ A;  2LQ8 A;  3DB3 A;  3QO3 A;  2O4X B;  4FT4 A;  5FU7 B;  2PU9 B;  5GAN 3;  2E6Z A;  3HRU A;  4F7U F;  3VV0 A;  4P5N A;  3OYH A;  4C8Q B;  3CCS A;  2OTJ A;  2CZ1 B;  5D6W A;  2ZPF B;  5CKD A;  3Q1J A;  2R58 A;  1VQP T;  3DB4 A;  3QHS A;  3CCU T;  3A8M B;  2DVE A;  3FDR A;  4NOY A;  4XAX B;  3CCE A;  3UDC A;  3UWN A;  2LT4 A;  1UGR B;  2O01 E;  4N4H A;  4A54 A;  3QJY A;  4EMK B;  3MP8 A;  4M7A E;  4M78 D;  1Q82 C;  1NJI C;  3G4S A;  3CC7 A;  5GAN 8;  4M75 B;  3CBO A;  4M78 A;  2LTO A;  1K9M U;  3VUZ A;  5FRM A;  4M7D G;  4JLG A;  4FT2 A;  4PNO A;  4C92 C;  3OYY A;  4C92 F;  3PFS A;  1AHJ B;  4EMK C;  3H6Z A;  1YI2 T;  3QYG B;  5DLQ E;  3R6O A;  2RH2 A;  4O6J A;  5KCH A;  3M53 A;  1LOJ A;  1S72 T;  2WSC E;  1VQK T;  3RKX A;  4C0Z A;  3OB9 A;  3MEW A;  3M56 A;  2CS7 A;  2F5T X;  4KT0 E;  4Y91 A;  1Y7X A;  2RB6 A;  5LJ5 h;  1H3Z A;  2QQA A;  3L2V A;  4OP0 A;  1JB0 E;  1VQ4 A;  3X24 B;  1OYX A;  3M58 A;  5CKE A;  4N0A A;  3JCM b;  5A0G A;  2L5Q A;  5I21 A;  3V7S A;  3BDL A;  1O75 A;  4PLI A;  4XTU A;  2CKK A;  2QQS A;  4LDY A;  1M1K C;  2ZPB B;  2HQE A;  3UPU A;  2KAF A;  4M78 C;  1VQ9 T;  5GAM h;  1IZ6 A;  4VUB A;  2RK1 A;  4MDW A;  4M78 F;  3SWN A;  1M90 U;  1WQ7 A;  4A4F A;  4GLK A;  5FLX E;  3CCL A;  1EIF A;  2E64 A;  4FM4 B;  1VQO T;  1Q81 U;  1RI0 A;  1VQ6 T;  1M5Q 1;  2X4J A;  1XTD A;  3PNW C;  2FB7 A;  3E1S A;  4E7L A;  1ZBX A;  2VYT A;  3CCM T;  4M7D B;  1YIT T;  4PJO G;  1WJR A;  2XK0 A;  3JB9 G;  1WNL A;  3C4S A;  1OZ3 A;  2RJF A;  5CKH A;  3ZBD A;  4E7J A;  2MWP A;  3JB9 I;  4M77 D;  2QA4 T;  3SWN B;  5GMK m;  2BIV A;  3JAM E;  5GAN 7;  2LCL A;  2XDD A;  2GQV A;  3WVD B;  3BFM A;  3MEA A;  4M77 A;  5CIU A;  3JCM h;  1KD1 U;  1VIF A;  4A53 A;  4N0A C;  4M7D C;  4J7F A;  2RHX A;  3BY7 A;  3CPF A;  4ZN1 A;  4JRI A;  2D9T A;  3J81 E;  1VQL A;  3CC2 T;  1QP2 A;  2RI2 A;  3H8Z A;  1Y96 A;  2X35 A;  3FRN A;  3VYG A;  4IUT A;  2HAX A;  1HK9 A;  2BKD N;  5LJ3 f;  4C0D C;  1YBY A;  3SWN C;  2CZ6 B;  4L6V 5;  4JUV A;  4JDS A;  4JRK A;  4YTL A;  5DY9 A;  1X75 C;  1W4S A;  2B8A A;  3NTK A;  1U1T A;  4XU3 A;  2Y4Y A;  4BI4 A;  5LJ5 g;  4ZTJ A;  1VQP A;  4ME7 A;  4OGC A;  3CCU A;  4OF1 A;  1H64 1;  1XOV A;  4M77 B;  4PL6 A;  3ER0 A;  4ELZ C;  2DXU A;  2RO0 A;  4F7U G;  5FU6 B;  3JCM W;  3QG1 A;  1Y96 B;  5GAM g;  4HCZ A;  2E1H A;  3OSV A;  4M7A D;  5I2M A;  2XHC A;  1BKB A;  3X26 B;  1JJ2 A;  1O9S A;  3M9Q A;  2CZ7 B;  5L8R E;  3LGF A;  3OBW A;  4M77 C;  4A4K A;  3MHX A;  5GAN 6;  4M7A A;  2V8I A;  1KC8 C;  4M77 F;  3FB9 A;  4BB7 A;  5CO7 A;  1YI2 A;  2FL7 A;  5D6X A;  2MMP A;  3EFS A;  1VQ5 T;  4DQ2 A;  4E7I A;  2D0Q B;  2EKO A;  1S72 A;  1VQK A;  2DO3 A;  2C06 A;  5KH6 A;  2FYK A;  3MET A;  3G6E T;  4J83 A;  3JCM g;  4LDW A;  1HXD A;  1MHN A;  2GCX A;  4V2S A;  3J7A F;  2E70 A;  4C92 G;  3MO8 A;  3UT1 A;  1JJ2 S;  4A4E A;  4MMK A;  4RG8 A;  3URG A;  4IUR A;  2ZGW A;  4Y28 E;  3L1A A;  3GP8 A;  4J5Y A;  3KXT A;  1VQ9 A;  3M4Y A;  3CD6 A;  3SB2 A;  5CKB A;  4F7U B;  3QKJ A;  4J6W A;  4M7A F;  4JRQ A;  1B34 B;  1PSF A;  3MCA B;  2DZC A;  2EYQ A;  4BE0 A;  1VQ6 A;  1W2B A;  2LDM A;  3TU4 K;  1KQS A;  3CCM A;  1FWZ A;  3TEE A;  4R56 A;  3OW2 A;  1YIT A;  5GAN g;  3OS0 A;  4LDX A;  3QUI A;  2R57 A;  1VQ7 T;  2E65 A;  3X25 B;  3OYG A;  2YHT A;  4M78 G;  1I81 A;  2XKO C;  5GAO n;  2QA4 A;  1NZ9 A;  2XDB A;  1XNI A;  2K57 A;  3ME9 A;  3CCJ A;  2KY9 A;  2JVV A;  1M9S A;  2P0Q A;  3G71 T;  3PMT A;  2RM4 A;  2DK3 A;  4OB2 B;  1QVP A;  3QYH B;  1Q82 U;  1NJI U;  3CC2 A;  3HL8 A;  3O8V A;  2VC8 A;  1MGQ A;  2QTX A;  3A8L B;  2XG8 D;  4C92 B;  3GOX A;  4QQ6 A;  4Q5W A;  2QDY B;  1W2B S;  3OYC A;  1KQS S;  1BIB A;  1NE8 A;  2XU8 A;  3ZFJ A;  4BAC A;  3OW2 S;  1UGQ B;  4C5G A;  3PTA A;  4XTW A;  3CPW S;  1YJN T;  3SDZ A;  1G3Y A;  4J6X A;  1G3W A;  3CCQ T;  2RD1 A;  2DIQ A;  3CMA T;  4HKE A;  4FL6 A;  3RKY A;  2K4Y A;  4XQ3 A;  4A4H A;  1KHI A;  4KUD K;  2VV5 A;  4JLI A;  1SSF A;  2JNG A;  2NLU A;  4JRP A;  1K73 C;  1N6A A;  1ZHI A;  4JJN K;  2DAQ A;  1WJS A;  2GFA A;  2K3Y A;  4NL3 A;  2JOY A;  2MWO A;  3LW5 E;  5J39 A;  2PUK B;  4WF2 A;  3A5Z B;  4LD6 A;  3L2Z A;  5IN1 A;  2XDP A;  2KDS A;  2OTL T;  4M78 B;  4KUL A;  2RK2 A;  4XU1 A;  2P0P A;  3RUX A;  3JCM P;  4RMO A;  1G3T A;  1WJQ A;  1M1K U;  5C0M A;  3OYF A;  1VQ5 A;  5J3B A;  3S3N A;  3C12 A;  4ELY C;  4HCB A;  3LH0 A;  1NPP A;  1QVF A;  1P92 A;  4IKF A;  4ZGD B;  1UB4 A;  3VUB A;  4DOW A;  3F70 A;  1BI0 A;  5LJ5 j;  3G6E A;  2XI9 A;  5LJ5 e;  3CCV T;  3QBY A;  4OMF B;  3OYL A;  1VIE A;  2EFI A;  2LX9 A;  1I8F A;  3LX7 A;  3MP6 A;  4M77 G;  4MML A;  3VU3 C;  1YJ9 T;  3CD6 T;  2VXE A;  1KG1 A;  2DKG A;  4IUP A;  2IG0 A;  3G7Z A;  5GAO r;  2DTO A;  1BI2 A;  3LLR A;  5CR2 A;  5HKC A;  1N9S A;  3OA6 A;  3FEO A;  1D3B A;  2PVO B;  5KE3 A;  1VQM T;  2E5Q A;  5GAM j;  1YIJ T;  5CQY A;  4QVC A;  4KBM B;  3I56 T;  1VQN T;  3I55 T;  2PQW A;  2YLC A;  2LQK A;  3CME T;  3T9N A;  5GMK h;  4QW2 A;  3M4G A;  4HA8 A;  3A8H B;  4HT9 A;  3HP9 A;  4BE2 A;  4X9C A;  1QVF S;  3J80 E;  2EJG A;  4C0D B;  4OGE A;  3MP1 A;  4JS5 A;  3L42 A;  4C8Q E;  3CCJ T;  1BI1 A;  4X9D A;  1N9R A;  3HKS A;  3OY9 A;  3LWI A;  1D3B B;  4XTZ A;  3OYE A;  1VQ7 A;  2DTH A;  5GAN 4;  2DXC A;  3M54 A;  5GAN 5;  5LJ3 h;  3S3M A;  4ZTF A;  2BUD A;  1R8O B;  3RMS A;  2V8J A;  4OB0 B;  4M7A G;  3ZEH A;  3JCM e;  3GNF B;  4EPC A;  4E7H A;  1M90 C;  2FVU A;  2QQ9 A;  3G71 A;  1N27 A;  1LJO A;  5GAO p;  2L8D A;  2H3J A;  4M75 E;  1Q81 C;  3QSU A;  3HFN A;  3RER A;  3PT9 A;  1BI3 A;  3MEV A;  2R5M A;  3GIB A;  2L89 A;  1WPY A;  2P0K A;  1UGS B;  3TRE A;  1Q7Y C;  3HSB A;  1JBM A;  1KC8 U;  5M9O A;  1YJN A;  5GAN h;  3QZ5 B;  3LYI A;  4X34 A;  1M1G A;  3S6W A;  1Y07 A;  2E10 A;  3QXE B;  5FRO A;  3CMA A;  2YLB A;  3OYJ A;  3CCQ A;  1QVG A;  1VQ8 T;  2RI5 A;  5I2S A;  2X4X A;  3HHT B;  3OBY A;  3OMG A;  3FJP A;  4C5E A;  4MZP A;  3L2R A;  4LD9 K;  4QQD A;  5GAN j;  3DKM A;  3M59 A;  2RA2 A;  4EMH A;  4C0F A;  5GAO l;  2ZPI B;  3CEY A;  1K8A C;  2DIG A;  2PVD B;  2M9U A;  3HRT A;  4CI0 C;  2K3X A;  2OTL A;  3OYI A;  2HQX A;  3FIF A;  1Q86 C;  3C95 A;  3PGG A;  4M7A B;  5LJ5 d;  3CC4 T;  4XU0 A;  3RES A;  4XTY A;  5A0L A;  2LC4 A;  3GF5 A;  5LJ3 g;  2CZ0 B;  2QQB A;  4BY6 C;  1QVG S;  3JB9 H;  1OZ2 A;  2E12 A;  3RIR A;  2DD5 A;  3OYN A;  3CCV A;  2QI2 A;  2E41 A;  5GAM d;  3OYM A;  4M7D E;  2RHI A;  3WVE B;  4M7A C;  1YJ9 A;  1IRE B;  1X6O A;  1QW1 A;  2MAM A;  2HBP A;  4FU6 A;  4R55 A;  1VQM A;  2M16 A;  1YIJ A;  2EWN A;  2EIF A;  3I56 A;  2QXF A;  1VQN A;  3I55 A;  4RCC A;  2GFU A;  2M1H A;  4J8O A;  4PLL A;  3WXM B;  2OAU A;  4B9W A;  3CME A;  4LDU A;  4IUU A;  3CPW A;  4GY5 A;  2VUB A;  1KQ2 A;  3QDR B;  1U8R A;  3KBG A;  5IAY A;  1FX7 A;  1TH7 A;  3S3O A;  3M5A A;  4TVR A;  5J26 A;  4C8Q D;  4RCB A;  3FLG A;  3JCM d;  4FSX A;  3OMC A;  1G3S A;  2P4T A;  4OB3 B;  2JZ2 A;  2CYZ B;  2DJZ A;  4XTX A;  4C8Q A;  4M77 E;  1U1S A;  2DXB A;  5C6S A;  5HK3 A;  4N4I A;  4ZGJ B;  2RI3 A;  3QPH A;  1UEB A;  2KSS A;  4LDV A;  4OVA A;  4J7I A;  3PIP A;  4BDY A;  3JB9 J;  2LNV A;  2WAC A;  1RL2 A;  2F69 A;  3N5B B;  4PJO E;  3LGL A;  3JCM V;  4EMK A;  2KK4 A;  2EQM A;  4M75 D;  2E6N A;  2JTF A;  2ZCF B;  3OQ5 A;  3X20 B;  4XTV A;  2QEX T;  1N8R C;  3X28 B;  2K5L A;  3V7C A;  2HD0 A;  4M75 A;  4IUV A;  1M4Z A;  2DEQ A;  2LT1 A;  3CBP A;  1JRI A;  5GAN d;  3OYD A;  3CBM A;  4L59 A;  3QJ6 A;  4ATO A;  5FU7 C;  1VQ8 A;  3MEU A;  3PMI A;  4CRI A;  1V29 B;  4JS4 A;  2DD4 A;  4ZN3 A;  1WGS A;  3P8B B;  4C8Q C;  3AHU A;  2DTI A;  3L2W A;  4HT8 A;  2EQJ A;  2ZPH B;  4Z02 A;  4C8Q F;  3C94 A;  3E9F A;  2JUF A;  5KE2 A;  2RJE A;  2VGN A;  4BI8 B;  3KUF A;  2PVG B;  4QVZ A;  3L2Q A;  3EFR A;  1I5L A;  4B9X A;  2RHY A;  3E19 A;  2Y4X A;  3OSS C;  4MZT A;  3CC4 A;  2DZ9 A;  2QQR A;  4F7U E;  1ZQ1 A;  2K5F A;  1K9M C;  3GLX A;  2R5A A;  3CXC A;  3V8K A;  4M75 C;  1PSE A;  4UC4 A;  4E7K A;  3HRS A;  1BYM A;  4M75 F;  5GAM e;  1YJW T;  3NFC A;  2RJC A;  3OYB A;  2A3L A;  3VKI A;  3P8H A;  4EMG A;  5CK9 A;  3NTI A;  3ASK A;  1LNX A;  2WSF E;  2LCC A;  4IUQ A;  4OB1 B;  4XK8 E;  4XU2 A;  5LJ5 f;  4M7D D;  4N4G A;  2K5I A;  1X01 A;  5D6Y A;  2EJ9 A;  2V8K A;  4C0G A;  1YHQ T;  4HCC A;  5AYF A;  4M7D A;  5LL6 S;  3CCR A;  5GMK j;  5GMK e;  2EJF A;  3FC3 A;  2D6F A;  5GAM f;  3JCM X;  2RHZ A;  2KQW A;  3CXC S;  2VGM A;  4QQG A;  4DOV A;  4E47 A;  2X4Y A;  4C92 E;  3P8D A;  5IT9 E;  3JCM J;  1M1F A;  1NPR A;  5HK0 A;  5GMK i;  5CVI A;  3JCM c;  5KCO A;  1Q7Y U;  3QII A;  4ZGE B;  5GAO m;  2JN0 A;  3VJP A;  5LJ3 e;  5LJ3 j;  3OYA A;  3VYH B;  1KHC A;  4BI3 A;  2AHJ B;  1I4K 1;  5HY6 A;  2FHD A;  2GF7 A;  3DLM A;  3EAE A;  4O5V A;  3INZ A;  2OTJ T;  3CCS T;  4PJO B;  3GNG A;  2ZPE B;  1YCY A;  3JCM f;  3OS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...