3T9NA

Crystal structure of a membrane protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
269
structure length
266
Chain Sequence
b'YDIKAVKFLLDVLKILIIAFIGIKFADFLIYRFYKLYSKSKIQLPQRKIDTLTSLTKNAVRYIIYFLAGASILKLFNIDMTSLLAVAGIGSLAIGFGAQNLVKDMISGFFIIFEDQFSVGDYVTINGISGTVEEIGLRVTKIRGFSDGLHIIPNGEIKMVTNLTKDSMMAVVNIAFPIDEDVDKIIEGLQEICEEVKKSRDEGPTVLGITDMQDSKLVIMVYAKTQPMQKWAVERDIRYRVKKMFDQKNISFPYPRTTVILSEKKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small-conductance mechanosensitive channel
publication title Structure and molecular mechanism of an anion-selective mechanosensitive channel of small conductance
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Membrane protein
total genus 80
structure length 266
sequence length 269
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3t9nA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t9nA03
1OSDA 4F67A 3TRGA 2XMTA 3HF5A 3KG0A 1VQSA 2EW9A 2LXFA 1TZ0A 2OFHX 3MZIA 1KVIA 3BGUA 4OJ3A 1YJTA 3E8OA 1LQ9A 3HHLD 1R6YA 3HHLC 2Q3PA 3CJKA 2LQBA 4Y2IA 3FGVA 1Q8BA 3HDSA 2VH7A 3LGNA 1SQEA 2XMMA 1YJVA 3HHLB 1CC7A 2G9OA 3QMQA 5B0DA 1TUVA 1AFJA 5IXUA 1GXTA 4EFAC 5K9FA 2XMUA 4DN9A 1P8GA 2K2PA 3HHLA 1XBWA 1GXUA 1MWZA 1Y0HA 1OQ6A 4A48A 1Q53A 2XMVA 1V3ZA 2OAUA 2RU9A 2N4CA 2N7YA 3SFMA 5B0FA 2RK1A 3BM7A 1TL4A 2ASYA 1Q8LA 3T9NA 3CJKB 1OQ3A 2GGPB 3VTIA 4OJHA 5B0BA 1P6TA 4ZA1A 1FEEA 5B0GA 4YDXA 2W4CA 3BDEA 2K1RA 2FHMA 3FMBA 1N5SA 2KT3A 2GGPA 2IYIA 2XMWA 2IYGA 2HQIA 2GO8A 2GQVA 2BJEA 1U7LA 2AJ1A 2ROEA 4A4JA 2BBEA 1FVQA 2IFXA 2OD6A 2QLXA 3I9ZA 5B09A 5B0EA 1X8DA 4ZOSA 1VQYA 5KAKA 3UDCA 1AFIA 3K7RA 3QGPA 2RMLA 1FVSA 1Y3JA 2XMKA 2ROGA 4DL0C 1VIFA 4HL9A 1X7VA 2PD1A 2OD4A 2BJDA 3BF4A 4OJ1A 2FIUA 2HFNA 2GCFA 2QYCA 2XMJA 2K7JA 2BYCA 4DPOA 4OIXA 5B08A 2K7KA 2K1RB 3KNGA 4Q2MA 1JWWA 5T7LA 2JDJA 1SI9A 2HFOA 1YJUA 1Y9OA 2N4DA 1KVJA 2P4TA 2HIQA 4HI1A 3LO3A 3BR8A 3KG1A 2LDIA 2AJ0A 2QIFA 4QOTA 2RK2A 1N5VA 1URRA 2HLUA 1TR0A 2L3MA 3GZ7A 1WD6A 4NL5A 2RSQA 1X0PA 1YJRA 2W4DA 5A6PA 4HH1A 5B0AA 2KYZA 2HLTA 2PGCA 2OMOA 1N5QA 4FNIA 1S6UA 3HFKA 2VV5A 5A6WA 3BB5A 4Y2MA 1Q4RA 2ACYA 3IWXA 1VIEA 2CRLA 1YRXA 2QLWA 5F0UA 1JK9B 1S6OA 5B0CA 1SB6A 1FESA 3FRYA 1IUJA 2KT2A 5T7LB 2GV1A 5F0WA 2OKQA 1OPZA 3DXSX 1APSA 3F44A 3KKFA 4NPOA 2FTRA 2RH2A 2LQ9A 4HI2A 1N5TA 3TNVA 1K0VA 1CC8A 1CPZA 2ZDOA 4U9RA 2ZDPA 4Q2LA 1W2IA 2GA7A 3IWLA 1KQKA 4OJGA 1FE0A 2ROPA 1FE4A 1TL5A 2W4PA 4FNHA 4Y2KA 2OP5A 1QUPA 2AP6A 2OFGX 1Y3KA 3HX9A 3MCSA 2KKHA 3DCAA 4YEAA 3TOQA 1ULRA 1RJJA 3LGMA 4A46A 2AW0A 2RILA 4HH0A 2FB0A 1FD8A 3WDOA 2GFFA 3BN7A 4A47A 1AW0A 1YG0A 2BUNA 1MWYA
chains in the Genus database with same CATH superfamily
3OR2B 2AGPA 2UUCF 5EDWA 3Q2TC 1PSFA 5F41A 3MAAA 1TK8A 2J0WA 3T41A 3O5ZA 2LA6A 2HS3A 2HHXA 1CG2A 3M1VB 4ZPDA 3DRRA 2CGHA 2BQUA 3IBWA 3HMJG 2ROTA 4IRCA 2ZEJA 4NEZA 4B3OA 3WVDB 1JX4A 3CMAA 4NX9A 2F4VF 2R2RA 2C3UA 2C2OB 5D78A 1QLNA 4C0ZA 2DXEA 2J06A 2MGZA 1U8WA 2AGOA 1HJDA 1UVMA 2HHUA 4LVNP 5EN1A 4PFPA 3RKYA 5A8WA 1CJVA 4JJDA 3OSNA 5DO2A 2XK0A 2ZBPA 3BYRA 1L3VA 4HA8A 3I6PA 4EBDA 1X9WA 5JMNA 1WF0A 2ZUAA 3C3LA 1VS3A 4QU6A 3QZ9B 4OVAA 4B08A 3IA0A 3C6TA 4Y92A 3RRKA 2MY8A 2QSWA 2K79A 4BE1A 4FF2A 2VBYA 3MMAA 1UEBA 1K73C 2KY9A 4QW2A 4EBEA 3TQ7P 5C25A 5DG7A 3GJQB 1Z1ZA 4C92B 2XMMA 3GWCA 3OTEA 3HD1A 4OYMA 4MIAA 2F7VA 2KG0A 2DRAA 1GBRA 4FBTA 1Y0HA 1HBUA 4PEOA 1WJ9A 4WFXA 4WIQA 3R1LA 2DD8S 3B4DA 3ETOA 1PILA 3ZFJA 1HBNA 3DLEA 1AWJA 2CDQA 3AXKA 4KHPF 2QTXA 1NB7A 2BR0A 1T3NA 2J0XA 3RR7A 2H4WB 2F40A 1YP5A 2BKPA 2G0JA 1IR0A 1KK7A 3DLMA 2XYHB 3H98A 3G6VA 5KFEA 1VLYA 2EPIA 1NHKL 2DR5A 5KYNA 1UVKA 3UWNA 2HLUA 4AL7A 3TZWA 4NL5A 3I4PA 4AL6A 4TLRA 2MZ1A 1QWEA 1IBCB 3G6EA 5IXBA 1EKSA 5IT9U 4KH0B 5I42A 1LVKA 2P6SA 1B34A 3PR4A 1RT3B 3I56S 2E10A 2DNPA 3IR5B 2OELA 1FF2A 4C8LA 5KG6A 2FLLA 2R4FA 4QYRA 1ZSZC 4IFVB 1TL5A 5GAGI 4VUBA 4IFYA 4AXIA 3J7YU 4DL6A 3CPWR 3M8SA 2KEAA 5H9EJ 1TFYA 1YZ7A 2ZVIA 3CIZA 1BE4A 1TXQA 2OFHX 3GV8B 4OMMA 2R9LA 5L1LA 4PYDA 2VFTA 2M8DB 5I21A 3H5SA 1SQEA 1YJVA 1TG0A 3VS2A 5K8OA 5LL6S 2MLZA 1WI8A 4LDUA 2ASYA 3CE8A 3SSRA 5B0BA 2C3YA 2OI3A 1T3SA 4J9UE 3KHLA 4F50A 3OYLA 1E6YA 2GQVA 3R5CA 1SKSA 3QSIA 2WSFC 5KFJA 1VQYA 2B3TB 2RHUA 3HRUA 1VI7A 5FRNA 2VPYB 3TCJA 4BDZA 3Q8UA 1VQLQ 3LGLA 5LJ5g 4M95A 3ILOA 1N34F 2DIQA 3DYAB 5HKCA 4PG5A 3I5CA 3OQ5A 2WBRA 1VK3A 4RCBA 5CCMA 4JI5J 4F3QA 5IV3A 3T19A 2YNGA 2B7BB 4RKUE 1S6PA 3KHHA 4LE9A 2Y9HA 2HQEA 5CYQA 2M0YA 2OEMA 5KFOA 5FJ4A 1OX8A 4KB7A 1ACMB 1VDHA 5D0RA 4QW9A 2CFXA 2GTJA 1A9NB 4Y34A 1T02A 3CC2Q 2OPSA 4RG8A 4ECVA 2AT1B 2RILA 3WDOA 1TSFA 4AQYJ 3I55Q 1C2PA 2FJXA 2MXYA 3OYNA 5C2GA 1WEXA 2CZVC 1M1FA 2HHTA 4J9QA 1WGSA 1IKWB 1YHQS 2A10A 4X4OA 3VGUA 2QL5B 1HD0A 4NRTA 3HHLA 1DQ8A 2XMVA 4KO0B 4ZP8A 1PC5A 2E7WA 2B4PA 4ELVA 3SWNA 1NK7A 3QYHB 2RJZA 5CKBA 3RUXA 4KGKA 1YZ6A 4A4GA 3MEDA 4UW2A 2YSQA 3N4WA 2EBGA 2IYGA 2L8DA 4YB6A 4EO8A 2M16A 1DQ9A 5D77A 1Y71A 1QM9A 4Y3CA 2BABA 2GTOA 1G3TA 3MUVP 4KSEB 3NHNA 4M7DC 1KIKA 3V4IA 2P8IA 5JVHQ 1C1BA 5GAHI 2W2NP 3E9GA 3NTKA 2UUWA 2CSQA 1YI2Q 5A8KA 1X6OA 2YHTA 2LCSA 1CKBA 2HCKA 4MK9A 3CCRA 2XEXA 1D8ZA 1QJHA 3VALA 5DM6Q 2O3DA 2HVZA 3OFGA 4CH7A 2RQMA 5MLCV 1HNIA 3A3NB 4JV2A 2V8KA 1UJ6A 5LJ3e 2FB0A 3FKBA 3PW4A 1LQ9A 2NPIA 5KFPA 2RF2A 3HF5A 2DR8A 4DUTA 4TLQA 1CJTB 1S99A 1G3OA 4R5PB 2IAJB 2E1CA 3RNJA 2G9OA 3DOLB 3JCMh 4ELYC 1HD3A 1RISA 4LF2A 4O44B 4ZTFA 1C4CA 3REBB 1S1TB 2PI4A 3NKYA 3UCUP 3LH5A 4AFUC 4NLQA 1ZA2B 2D9PA 3VTIA 2OMLA 4UOGA 4WZMA 4RTUA 1YLXA 2CKWA 3RB6A 3W9JA 2P2CB 2NSCA 3AA8A 3WHIA 3CCRT 2XHWA 2UXBF 3QGPA 2K3YA 3L2RA 3V6DA 4M75C 1ZM4A 4Q5WA 3C15B 2K7JA 2ZHBA 1RKIA 5KFMA 3FDSA 1ZH5A 3M4YA 3IRXB 4OI0A 2M2BA 3LW5C 2BVZA 3FEXB 1WXUA 2DH7A 3FBBA 3PIOA 4OYBA 4K59A 1SUQB 1S72S 4DR6F 4U8VA 2RVJA 3VAMA 2F8HA 2D1XA 1W4SA 2W2QP 4N0AC 1OIAA 1LW2B 4OZ0A 3QRQA 2RDDA 4LF7J 3LP0B 4QIEA 4TU9A 2Z30B 3OS2A 4X4RA 2C42A 3DDIA 1X5SA 4JI2F 2OO4A 2JH3A 2A18A 3OMGA 2IDLA 3CJTA 2R7WA 4J9LA 1AW0A 1B99A 4USVA 4CLKA 4FBUA 2W2PP 4ECYA 2B43A 2AJQA 1NPKA 3DGPB 4FYXB 1QUVA 4R0EA 2RNAA 2AHJB 2MTLA 4JZ4A 5IXUA 4QWAA 4ZP7A 2EYYA 3H40A 1M2OA 2NZ4A 3EG3A 1RQ0A 5ETRA 3BO3A 2X1GA 2D69A 2JC1A 3QKJA 1U49A 2DL4A 4OZ3A 4OX9J 2QZ8A 3MMCB 4PXDA 3OTDA 2O4XB 3F56A 4YY3F 2DB1A 1X7VA 1N8RU 2CJAA 3L1AA 1TKTB 3VAKA 1X2QA 4RNNA 3ZNUA 3CO0P 1AT1B 1U1OA 3KK1A 1VYVA 2J0SD 4OB1B 1T8EA 2J0QD 5KFHA 4FYWB 4IKAA 1UE9A 2VKNA 1G8XA 2F2WA 1J3TA 4JUVA 1X5TA 3HP9A 5FDLA 2HL3A 1KFDA 1LW0B 3CD6T 2EYZA 3CD7A 1I5OB 1LK5A 3N01A 1KFSA 3TX0A 1ZETA 1UGPB 1FX4A 1S9EA 2KNBB 2HRTA 1FWLA 4ZLJA 2LMIA 3QWPA 4HHUA 4XU1A 1U02A 4E0DA 3CB4A 2GVZB 1LPLA 3L09A 3MZIA 2LT1A 5IM0A 4HEA9 3DI6A 3LPYA 1Q8BA 1DFDA 3OY9A 3MDFA 1F6TA 1NMEB 2HVHA 2DPPB 5HP1A 2IJRA 2RF0A 3DU5A 2EKNA 2Y8WA 4ECQA 1LV5A 3AAWB 1UW4A 4DV5F 3F70A 2FHDA 2XZDB 2CP2A 7FD1A 1IZ6A 2CQ4A 1X01A 4B9WA 3JSMB 2HKQB 4KJIA 2V8IA 3IMQJ 4Y2AA 2YTCA 4DV0J 4M7AB 5H9EK 2R7OA 2CP6A 5L1IA 2RQWA 3FVYA 2CQGA 5A6WA 2F3JA 1IRXA 3QIDA 3S3MA 1S1NA 1ZSZA 2I0XA 4IO1A 1BB9A 1IVZA 1WEZA 3H4BA 1ITPA 1OYDA 2CIMA 2RM4A 4ZPAA 5D6WA 4JUZA 3C0CA 4M78G 1Q7YU 2GIQA 4DSEA 4M5GA 5D3GB 4YB1P 2KHDA 2HMAA 3W66A 3BREA 4EU0A 4JV5F 2GIFA 1I94F 2XO6A 5A0DA 5CH7B 5L46A 1VQNT 2SXLA 4MTPA 2I8EA 4I2QB 4ZPCA 3VYHB 3OXFA 4R0KA 5IT0A 1S1VB 3NWRA 1EJ7L 2DKGA 3D5MA 5CQGA 3M4GA 1D3BB 4CO3A 4CRJA 1HBMA 3EGUA 2YVSA 3UD4P 2P84A 2GCXA 5EWGA 3I0SA 1K9MT 2M4MA 5GADU 2CG4A 1M3CA 4CI0C 5H9FJ 3KLGB 5LJ5d 1IKYA 2RQ4A 2Y1JA 2J5AA 2YH1A 4DLGA 4OLPA 1I07A 5LMNJ 2HAXA 1U2CA 1JJ2P 4XTUA 3R2CJ 2B8PA 5GMKj 3HSZA 1A0NB 4AL5A 4MAKA 2JDJA 1W2BP 1YCYA 1JB0E 2ED0A 2MK5A 2X1AA 2XO7A 4TYBA 1HW9A 3LLRA 1RE1B 3JCMX 3DLGA 1JJ4A 2EQKA 2MQLA 1J5EF 4MIWA 4XTWA 1FDNA 6FD1A 2WSEC 2KYMA 4ED0A 2E5IA 1MV0B 4Q44A 3M2VB 2GAGC 1SHFA 2W8KA 1TUCA 3LP2A 3LP1B 1KQ1A 1OU9A 2QX0A 1NK4A 1UJ0A 3QT7A 3M6WA 2B5JA 3NMZC 2DISA 4M77D 1KOOA 3N6MA 2CUDA 1XMQJ 2RHQB 1IHWA 1FRXA 3KFWX 2J7WA 2NR0A 4Y2KA 2W9AA 1MNDA 4I1TA 2ZVSA 2DBBA 1T0JA 9RUBA 2RQKA 1KEKA 1N6QA 2K6DA 3W5XA 2HMIA 2VG7B 2IY5B 1MMNA 2Q6BA 1FNXH 3KHRA 2JNGA 1J5OA 2V2VA 1I3OB 1B7FA 2E44A 3CXCR 1Q79A 3PVLA 3A8EA 2PUKB 4TXSA 4HVVA 4E98A 1UWAA 4M5DB 2UXDF 2K2PA 2ALYB 2CQCA 4ZIVA 2LC4A 2GS8A 4UY8T 2YPYA 4IRKA 4QWBA 2W7PA 1SSFA 3CCRQ 3DGVA 4LR7A 2CQDA 3LAMA 4ECUA 2LQJA 4DF4A 3CCST 1F5BA 4M7DA 3FQLA 3OTCA 4HDHA 2YLCA 5DDOC 3A98A 2FHJA 3QGHA 2NXNA 2MQOA 3OMCA 1V1CA 2UXCF 4M78F 3E51A 2KM8B 4IQXA 2VXFA 2WACA 5FU6C 2BJDA 3UPUA 3CCZA 1GXIE 4KH1B 2K57A 5LJ3f 1S1WB 1F60B 2AYGA 3GZ7A 3UE2A 4DN0A 4YP3A 4OMFG 1NHVA 2X3WD 4DQRA 1BIBA 1YJ9T 3TA1A 1GMUA 4WFYA 3KLFB 1U6BA 4C3LA 3UI3A 3DXSX 1TKZB 4DUYJ 2ZZTA 2DGOA 4RTXA 2J9EA 1OYEA 4ZPWR 4GRSA 4YMEA 3UN5A 2E3HA 3OFHA 4XTZA 1M0SA 3GFHA 2Z2MA 1WQ7A 3JQKA 2J6SA 3EGVA 2VPWB 3EFSA 3N6NA 2ILYA 3OS0A 2ZC3A 5KFWA 4PZVA 1HPZB 3MECA 3J7A1 4Y2IA 5KT2A 2M02A 3TZZA 4OX8A 3AXMA 3UNYA 1MG7A 2I6WA 3MPUB 4ELUA 5FW9A 5GAGU 3QAUA 3BJYA 2Z0WA 4DMZA 3T9NA 4F02A 1PBUA 4M75A 3V8KA 5LJ3j 4LSZB 1QVGR 2NYSA 2MY7A 3A8LB 4XDDA 1NXIA 2LRQA 4GKJF 2ZH3A 5ITHA 2OLWA 2A6MA 2D41A 4NXMJ 1NLKL 2RHIA 2OPPA 4N0AA 3DOKB 1AUDA 3Q8YA 4WK1A 2MOXA 3M54A 1Q4RA 1S7IA 2MKSA 1VRTA 4Q8FA 1DAXA 3HSGA 3EG1A 1N54B 2XZTB 4DL5A 5ETOA 2RJEA 3NBPA 2CADA 4TVAB 2RH2A 2DHXA 5EGYA 1YIJS 4B9UA 4RTVA 2AEMA 5KOWA 4DV7F 2HEQA 1HHTP 1UA1A 4H54A 4CH1A 4IDKB 1WYXA 2O9VA 3I56A 1TKXA 3G8QA 2LEBA 4Z7YA 4ME7A 4PUOA 5KFTA 3KLIA 2V4JB 3CJKA 4DQ2A 2EFQA 3HDSA 1QAJA 5C24B 1Q8KA 4ZPBA 2DVIA 2DXFA 5DY9A 3RB0A 2I5JB 2PUOB 2J7KA 1UMJA 3UDEA 1GXUA 3SV4A 1FDDA 3JYTA 4KT0C 1AA1B 1JXOA 1RI0A 2QK0A 4WCEQ 2GGPB 2R2UA 3IAS9 5HL7Q 3DDNA 1S79A 5B0GA 3R6OA 1GNKA 2C2ZB 1SC4B 3DLKB 1WG1A 4NZ0A 1NJIU 2BM1A 2L3PA 2BBEA 3IG1B 4MZTA 4EMKB 4Y2CA 4OMPA 3SFGA 5KYXB 4OJ1A 2BZYA 2QGGA 3GIJA 4KHRA 1U1TA 2JS2A 3M8PB 2FJVA 2CZ6B 2M9KA 2R7XA 2ZCFB 2V63A 4JI0J 1H3DA 4DG1B 3D3BJ 2NZCA 4DHVA 1K1QA 3D67A 1Q0NA 4F7UG 1TUDA 2IJNA 1SB6A 2CPXA 4MJKA 4C0HA 3ZBDA 3RZAA 4J9SA 4DR4F 3PT9A 1UEUA 1KJWA 5K8MA 3VZHA 2IC3B 1NH7A 2HZAA 2ASLA 5FU7C 5GAHU 1HYSB 2IM0A 5SZTA 5M2PA 1QE1A 2C3PA 4ZCMA 2OTLS 3THTA 4ECSA 2HHWA 2JFKA 1VQOS 2XGPA 2QYZA 4GY5A 3EGNA 3H2VE 4J9CA 1HD1A 2HURA 2VL1A 2CJQA 4XTVA 4F8RA 1OSCA 4ELTA 3MP8A 2CH4A 1T7PA 1FJGJ 3G2XA 4YR2A 3FC9A 2OUGA 2J05A 4QVZA 3JSCA 1RWPB 5ETLA 4FS2A 4DR7J 2UVUA 4IUFA 3IFEA 2OSRA 3VGVA 1GX6A 1KNZA 5E5NA 3FFIA 4LDWA 3CCMS 5BXIA 2WCXA 1U06A 3VUBA 3CQTA 4M8LA 1ZZNA 4MT1A 4BD3A 2BQRA 2JJ9A 4L6V5 3OS5A 3OSPA 1CJKA 1UAWA 3EVOA 2HD0A 1PIEA 4IOAQ 5AE3A 2OMOA 2V1RA 1U09A 2ZD1B 1X4CA 5GAN2 1U1KA 5D4OA 1Q81T 2EGEA 2DR9A 2Y8YA 4XAXB 3G8TA 4EMGA 1NK5A 4OQJA 5HROB 1H38A 2HGLA 4UOHA 3ULRB 4P7VA 2D3O1 2UUAF 3RESA 4LVOP 4B9SA 3KOAA 2X4JA 2CZ7B 1SV5B 3URGA 3Q8QB 1SRMA 3GYXB 3KLHA 1EARA 4RW4B 2YNFA 5GAMe 4URSA 2CA9A 1NYFA 4LF5J 4P7TA 1QD1A 1IB8A 4LBHA 1WOSA 4QIFA 1K9MU 4TY8B 2RE1A 3BDEA 4F7UF 5D0EA 4A8YA 3CCLA 1QKXA 1YX2A 4USIA 3R27A 4UT4A 2W9BA 4ICLB 1JQQA 3TARA 2MQMA 2V8VA 2C0TA 2BDPA 4ZDNA 3RBZA 5GAN8 1YJUA 4RX6A 1YJ9Q 4DV6F 1UJYA 4C9DA 5KG0A 4LF6J 4C8QB 5GMKh 1JLFA 2ZAEA 3HHTB 2VQFJ 3MEEA 4ZMMA 1IUJA 3GB0A 1EQMA 3M2UA 3OL9A 1OQKA 2IM1A 3OYJA 2FVPA 1W1FA 2ZDOA 2WSCE 4ZNXA 4DCOB 2QAZA 1S72A 2G2OA 4O3SA 1HXDA 2ZH7A 2P9EA 5LSOA 2CJKA 4KUDK 1E6GA 2I0NA 4NA3A 4JJNK 1RT6A 4N56A 3CCLT 2HBWA 2MI6A 3MKDA 3BKFA 3QT5A 2O67A 4K4WA 1S0OA 3A4TA 1FK9B 1HL6A 4EFAC 3DDKA 4UF4A 5L1KA 3LQVA 3CDEA 4UOFA 1G7CB 3INZA 1BIAA 2DVJA 2WBMA 4RW6A 2O2OA 4DUZJ 1RLDA 1SF9A 3LGHA 2KBTA 4DR5J 4RZRA 2BJEA 2PMWA 3TAMA 2EFGA 5FLXY 1RYSA 4URQU 2KT1A 4PJOG 5DLFA 2MJUA 3H42A 3VS4A 4LSLB 1PC0A 5E41A 2NXEA 2ZUGA 2C2RA 1VQMS 4PWWA 2KH9A 3UW1A 3T6JA 1Z2ZA 5LJ3g 3MM5B 2AJFE 4KKOA 2EFNA 2B6AA 1IWGA 3EGXB 3NGPA 1PJ6A 4DSLA 2V2QA 5J1NA 4B9XA 4DX5A 4XAKA 4QJVA 4J9FA 1DARA 4LFAF 4ZHRA 1JLQB 3EGDA 2GF7A 1Q86C 4LF9J 1RWUA 3C6UA 4DCJB 3RMSA 1OU8A 1MROB 4XU0A 2QEXS 1TOVA 4A54A 3QO9B 1UEKA 3SDZA 1VQSA 2LXFA 4WZQA 1R6YA 2YNHB 3DRYA 1D9FA 4LXCA 2LEAA 2AQ4A 1U24A 4HDGA 5CKEA 3MM7A 4GO5X 2VC0A 5IH2A 2DRKA 2FD2A 1D1CA 4BC7A 3IBFB 2VXEA 2VQEF 2V8GA 2AX1A 1SC6A 2DH8A 3T5KA 4W4MA 4DZ6A 2RPNA 1TL3B 3WIVA 4OZ1A 1ZQ1A 3QGGA 4M78E 3TA2A 1M1KR 3HPOA 5B09A 3FRNA 5KYWB 1FKOA 1IREB 4HT9A 3D1HA 4LJMA 3E9FA 3X24B 3M05A 3NGRA 4QR0A 5HJYA 3G9CA 1CULA 1IKVA 3W5ZA 2HEKA 3W2WB 3O2IA 4M63A 4C0FA 2M70A 3QZ7A 1I4K1 3DKDA 1T9WA 4Y28C 2PU9B 1YCSB 1NB2A 4DS5A 2CZ0B 2IVYA 1JLBB 4RPFA 1N0VC 4P74A 1EFNA 3KDNA 4AYBD 1VR6A 1JRIA 3C95A 3SDEB 4C0DC 1XR7A 1IGQA 1U48A 2W4PA 3JAME 3CJ8A 3GU0A 3JS9A 1YITA 3PR5B 1IN0A 1KD1C 4J9PA 3R7BB 3JXOA 4UQGA 2ACMA 3NAIA 5KFAA 3MM6A 2VHGA 4PJOF 4BY6C 2E12A 3HHLD 3GIIA 5GMEA 5GANe 4CZCA 5D6GA 2XNRA 2DO0A 1UZDA 1YRTA 2R57A 1FXLA 2GNCA 1TUVA 3UWTA 2E5QA 2DRMA 1M90C 4M77B 2QL9B 5HMXA 2VPXB 3K5MA 1VQKS 1CSJA 3QAEA 5L9XA 3VVUA 5J2PA 4C6AA 1RTDB 2L3SA 3TEGA 2NCKL 4HCCA 5T14A 3FNNA 1N5SA 3HKWA 2ZPFB 2OHDA 3EGWB 2EFVA 4X4TA 5J2MA 5DJBA 2GW8A 3D7SB 4PAAA 4WTOB 3MM8A 2DD4A 1N5YB 4GBQA 4XIUA 1XTZA 2EFPA 4LF4J 1YSJA 1VBXA 2KE9A 4TN2A 2DBMA 2HNZB 1U47A 1YITT 2GMHA 1EP4A 2CP7A 2JT4A 2DITA 4I7FB 1X9SA 4X64F 4LFCJ 2JEFA 4DV3J 1S6OA 2YKPA 3SXLA 3HI9A 1WHWA 3X28B 3UDLA 3T3FA 3EYZA 4B9MA 1DTQA 5IQQA 4M94A 2DL3A 2BKOA 1VQ9T 1TK0A 1QUPA 2OFGX 3EX7B 2D7SA 2JFDA 1T03B 4A4FA 4JRKA 3JQJA 4IG0B 2HHPA 4P52A 4F4WA 2JEIA 4YS2A 1VHIA 1C1CB 4DBHA 1KS2A 5KYUB 4IH6A 1N32J 3M9MB 2BANB 1BUXA 3I0RA 1UG1A 3PIPA 2GFAA 3R3TA 2PNIA 2V8DA 3L7PA 1R89A 1ZAWA 2V67A 1KWMA 4JDSA 1J27A 5CIUA 4DOWA 2JLGA 5CYMA 4ZA1A 4DFKA 3OW2S 2VC8A 3TYTA 3MUMP 5E3RA 5ETKA 5DQIA 3QT8A 5CKHA 2W9CB 3N5BB 2BMBA 1LXNA 4HT7A 1VQLS 1M3AA 4JLIA 3RKXA 1RK8A 4LIWA 2DL5A 1CEZA 2GJ2A 3ZXWA 2EQUA 3SQOP 2N7CA 3R1HA 3O5TB 2B0GA 2CS7A 2H1YA 1HYOA 3Q86A 3MPVA 4Y65A 4A8MP 1U26A 2BW2A 5KFBA 3GNGA 4OI2A 1YBAA 2JTMA 3J81j 3WX8A 2EVRA 4Q2LA 3CCLQ 2FLPA 3AT1B 3CC2S 2RQUA 2HG4A 5DZ6A 1UFFA 2OEKA 3MEGA 4M78B 3MP1A 3EDRB 1B0VA 4DV1J 3TRGA 4CC7A 3I55S 2ZZNA 3SCKE 4LDVA 3M30A 1YJWA 1WDTA 3EVWA 3J81Y 2VOOA 3M2RA 3QO3A 4DSFA 2RO0A 3GR0A 2YLBA 1RBOB 2L9NA 1IQTA 5F8NA 2RMOA 2X51A 1AWWA 4O4GB 1RZMA 1V3ZA 3PMIA 2OAUA 1HNZF 1MV3A 5JUMA 4XK8E 2E5LJ 1UGSB 3TEEA 2AZ1A 2BZ8A 4OYIA 1WHMA 1H92A 1HI1A 3WX4A 2VJVA 4UUXA 1UDLA 4DR3J 4JP8A 5HN0A 2I1RA 4L3NA 1R8HA 3KLEA 3J80Y 2MKIA 3MM9A 4LMZA 4B3RF 3E01B 2PC6A 4NLVA 3THKA 5GAMj 4ZPVR 3NGSA 4DPTA 3V4MA 3BR8A 2WONB 1I81A 4YN3B 2QFJA 3VHQA 1K8AR 1YI2S 5DDRC 2DE0X 4DR2F 4BS2A 1IBKF 2E9ZA 4R8UB 4J37A 4K4SA 1YJWT 1S57A 4UQTA 4C92G 3NXZA 3MJXA 5DGBA 3FIFA 5DS7A 5C6SA 1GXLA 2KJVA 2YKQA 4G1PA 3LWMA 3BYPA 2DGXA 4DU8A 2EW3A 4GKKJ 3UVJA 2VFUA 4P9SA 1RT5A 5DGAA 1NHUA 3CJRA 2ESWA 3OYCA 1QP3A 1WI6A 5KFYA 3QIPA 4GMKA 1KSWA 4ANJA 5GVQA 3VAIA 1SPBP 2D74B 1WJQA 1REVB 4EEYA 5C42A 3K8WA 1YIJA 1B3TA 4RR5A 4NZ7A 4KHMA 3SEOA 2LNHB 3AH6A 4G6VB 2KN4A 2FRYA 2FPHX 3VF0B 3DN9A 2W10A 2IHR1 2UUCJ 5D4LA 3M1VA 4IIOA 2WVBA 4F7UE 3DLLQ 4K4UA 3N28A 2EGAA 2IVWA 2KVQG 2X4YA 4QIVA 5E3PA 4EGLA 1VMBA 5LJ3d 3CXCP 3OUYB 2EFOA 1KRPA 1UVIA 4HL9A 1C0UB 3D28A 1WC4A 2K1RB 4Z8AA 3OBWA 3SD4A 1ZM9A 3M6XA 2ILZA 2F4VJ 4BE2A 4RLEA 2NUHA 4X84A 1R0AB 1PKUA 2WOMB 4FN5A 5IOLA 1G3WA 3DLHA 3CCJT 4DL3A 4OMFB 3NP5A 3FRYA 5E0OA 4CT9A 4BDPA 4RUGA 4CYUA 3VJPA 3GR1A 1NZ8A 3EH2A 4LUEA 3HJFA 3CW2C 3HLUA 4QCLA 2J9DE 4PG8A 4A4KA 1AZSB 4DZDA 5J1EB 2XHCA 3IWNC 5JXSA 3ETMA 1GFWB 5I3UB 3OJUA 1GCQC 2VODA 1N9SA 4F14A 4NMLA 5KAKA 2VBZA 3HJVA 2MJNA 2Q79A 3AD9C 4NYOA 1X4AA 4MMOA 5GAOn 4M5HA 2YQ0A 4BI8B 3FC3A 2B8QA 2VB6A 1PSDA 3LA0A 4HT5A 2NREA 1Y11A 1U0HA 1GFDA 1MU2B 2OTLA 2E1AA 3TJAA 3MMJA 3CDUA 4PRFA 1HBOA 1SEMA 1VQOA 2NUPA 5JVGQ 2DGWA 1LWXA 2C2MB 4BDYA 2D1CA 4C92F 3EICA 2HQIA 4HT8A 1IBMF 1NSKL 2V6AA 1PG5B 1N88A 1YITQ 5LXRA 5F8IA 1TH7A 2EFIA 1VA7A 3QSUA 4B3OB 1NDLA 2SRCA 1QY7A 4ESRA 1QSLA 2ZKUA 3UA6A 2OGUA 3DXBA 2Z4PA 3L3CA 4KHPJ 2G4BA 3PYDA 1OJ4A 4K50A 4E2FB 1SKWA 2CQHA 5GANf 4II1A 4ID8A 1TQLA 3LYIA 1RAJA 3A13A 3RW6A 1QVGP 4PXBA 1M5OC 1DZ5A 2DZCA 1RT3A 2PFFB 1K0VA 4OX6A 1R31A 1S1XA 2YWWA 2P0QA 2EJGA 4IFVA 1N33F 1RTJB 4XTTA 4NYZA 1HNVB 3DLBA 4P5NA 2VVKA 4RCCA 1S9FA 1EIFA 1ZPWX 4DCPB 5IXFA 3C6TB 2RRNA 1NJYA 3KXTA 1LEOA 2FY1A 3UT1A 3OYIA 1M30A 1GMWA 2CPZA 2E7VA 2N7YA 4M7DD 1ZHIA 2FHJD 4JI3F 3JCMe 2K3IA 2PT0A 1NBEB 1NJXA 2KT8A 1DTTA 4FYDA 2R2TA 2DNYA 4NI2A 3RU0A 4CNZA 1S49A 1FVQA 2IFXA 1HBUB 2EQJA 3GFZA 3SB2A 1XNQF 4FS1A 3ZEHA 2EKOA 2GCFA 3DLEB 3HFVA 1KQFB 3AD7C 1JWWA 4L72B 2K7KA 1AWOA 3MD3A 4O4RA 2ATLA 3EM1A 2GHPA 2VASA 4USHA 4OV6A 2YBVA 3IR7B 3PIPQ 3CBPA 3V5RA 3EXYA 3UD3P 4X4VA 3EPGA 1BC6A 1VIEA 3S1TA 1U25A 2EJ9A 1XK8A 2MSSA 1N34J 3OS1A 3GCXP 3GSIA 2LVMA 2Z0GA 1WA7A 5KG5A 3FRZA 2HRYA 4DOVA 4RMOA 4KRTA 1D8YA 3NLCA 4F4YA 4PJOE 2RQRA 2XULA 3A8JA 5D4PA 3JCMc 1F2HA 2O01E 1SJRA 4LSNB 1UB4A 1P27B 1HK9A 2VBWA 3ZC4A 4C3MA 2MEWA 2VH7A 3ZZPA 4C5IA 3H6ZA 1IKWA 2HAFA 2CNNB 4M75D 4KGZB 4EYHB 1D0ZA 3M9OB 2PA8D 2XIDA 3OHAA 1RHMB 3ZFVA 4JPBW 4CNYA 3O1LA 4ETZA 2DNLA 1Q86R 1OMSA 1WNEA 3C14B 2OI2A 1FA0A 3RAXA 2UVWA 3RJMB 3NG8A 2QT7A 3TAQA 2VYTA 5A0GA 2HL5C 1YJWQ 3TEHB 5D0HA 2LDIA 4C98A 1WD6A 4K8RA 3LX7A 5IFMA 4HVUA 4RNOA 2J8SA 3CUNA 3GMGA 3OPKA 3OL7A 2I2YA 3M9NB 1VQMA 2AU0A 4FF1A 3R6LB 3VV2B 2DTIA 1U6FA 1CPZA 4LD9K 1Y7PA 2C2KB 4AG2C 2V4RA 2YNGB 2H5EA 1X4DA 1Y07A 2BZXA 3D1QA 3BQ1A 1BBZA 2VG6A 3HD2A 3KJFB 2Q1LA 4X4QA 1LNQA 1G2EA 5HVHA 4NLSA 4QIWD 2J7IA 2FLOA 1SHGA 3M7VA 3HZEA 2OPSB 1CJTA 2XY7A 4IG3A 3VGTA 4F3OA 1QVFR 3EHQA 3A12A 1XBWA 2IAJA 1SVDA 3DOLA 3HKSA 1R6VA 2K7AA 4FKYA 2RU9A 4P2MA 2DCLA 1C0TA 4O44A 1K76A 2ZH4A 1RLQC 1GQEA 3SHWA 1XR6A 4CO4A 1NKCA 3ZL7C 4DLEA 2DNKA 3AHPA 4OB0B 3EGZA 1TTHB 1FRHA 3OT9A 1S5ZA 3MEKA 1VQMT 1KD1R 4EDUA 3BPSP 3ZZRA 5GMKm 3CJ3A 2R8GA 3MO8A 3VAFA 1RBAA 1P1TA 3MEDB 4A53A 1S0MA 1NRKA 2FJBB 2YKAA 1ZM3A 3C15A 1YIJQ 2FHKA 3CCJQ 4N7TA 5M2RA 2DH9A 1RWWB 3CJQA 3IRXA 1YJRA 5E3QA 3HRTA 2UXBJ 1QP2A 2PGCA 1M90R 1C6VX 1RGVA 4OL8A 2E4HA 2VV5A 3BB5A 1KHWA 1JK9B 1SUQA 1B0PA 2FJAB 1C1BB 3S01A 1BQNB 4WKRA 2MWPA 4NPOA 5IZHA 2QG9B 5DG8A 3JSYA 3QJYA 5A8KB 2YDLA 3LP0A 1JJCB 2BJ9A 4E7JA 4DR6J 3JB9I 1UJ5A 5KE3A 4Q5VA 1N36F 3VU3C 4FVMA 2HWIA 3I82A 1Q7YC 4X65F 3QRRA 2K2MA 4F4ZA 1PCXA 4KE5A 4HHHA 3JB9G 1B7TA 1WHYA 5LSRA 5EX0A 4JI2J 2B7CB 2LQWA 3DC2A 2UUTA 2QV6A 2PI5A 1ZOTA 3W2VA 2IA6A 4M7AG 2ZJRQ 2YUOA 1S7HA 2KO1A 2YWGA 2ZNYA 2DNQA 4O6JA 2ENMA 3PO5A 1JB0C 4J9NA 1IXKA 2PVDB 5GMDA 4F2RA 4E6RA 4XU3A 3K7RA 1VQKA 4ZVFA 1MUZA 2O4XA 4ANCA 2ZOGA 1C4AA 1JJ2S 4LF1A 2DPJA 4DL4A 2WTFA 2ATCB 3RBDA 3CD6S 2BW7A 1W2BS 4E7ZA 2J7UA 3ICLA 4EWTA 1JLCB 5CKFA 2JL9A 1H2UX 3ITHB 1WDDA 4B17A 5F0WA 2M9UA 1GCQA 1FYNA 2KXFA 2RHXA 3NCQA 2ZBRA 2OPQA 2BJ7A 3EE3A 3AQPA 3RB3A 2OP5A 1FWZA 2EK6A 1OPIA 4W92B 4YUDA 2YQ3A 1GEHA 1MSWD 1OY8A 1X5PA 1RHQB 2BOPA 3TUPA 2J6TA 1KVIA 2OPRA 2RQTA 3VVTA 3BBBA 1NH8A 3EG0A 2DY9A 3OYHA 2VD3A 4DSIA 2DAQA 4DV4F 1DURA 2BTTA 4FXDA 3GFYA 3CMQA 5ETSA 3H8ZA 1P1LA 3TQEA 4WP9A 2CJXB 4K4XA 2VKZG 1MN9A 4PXCA 2XS5A 2JW4A 3KUFA 4K11A 5FWBA 2VJUA 3GLJA 2HGNA 2QQAA 3Q8SB 4I67A 4L74A 4YQWA 1BI0A 1VIFA 3MR3A 1F9EB 5K8PA 3DLJA 4NL2A 2HDAA 4DQPA 4WE1B 3JSMA 4DV5J 3JV3A 1TR0A 4OHZA 1FJEB 5GAOr 2LNVA 3I5AA 2R7QA 4BBYA 5RUBA 3JB9F 4KIAA 3H25A 1IGUA 5GANg 4RTZA 1M5SA 2C0OA 3BQ2A 3KK1B 2EQIA 1RWMB 1SBRA 4OMOA 1U1MA 2KFZA 5J2QA 1VQNS 3CF5Q 4M7AF 4FT4A 2HQDA 1BYMA 3NGTA 4PJJA 1JQGA 2DEQA 1T9VA 1D9AA 5GMKa 1YG0A 3X26B 1WHKA 4KFBB 2D3ZA 2XMTA 3BSAA 4J9HA 3HPWA 1KC8R 1S9EB 1W70A 3HHLC 1IKXA 2JS0A 3K8VA 3R5DA 1S1VA 3QRPA 3H0HA 2FY8A 3CC2A 4JV5J 2HQCA 3SWNC 1I94J 4F7VA 4Y91A 3L95X 1YJ7A 3A5ZB 3MCNA 2DJQA 5IM0B 4C92E 4DF8A 3S7RA 3KLGA 4QR1A 4ILMA 1AOJA 4ED3A 2DGTA 3NMRA 1SH3A 3HSBA 2V94A 1HKAA 3PX0A 4LNPA 3G4ST 1KQSP 2HFNA 4DPOA 4M5MA 2KAFA 1WOPA 1WC5A 2UU9F 4F17A 1OZ2A 2RD1A 3M56A 3I5RA 2KZMA 2PE8A 4ZK7M 2BRKA 3HO1A 3PEJA 5LXYA 5IT9Y 3MF5A 3VRYA 4N8OA 2O66A 4OZ5A 2KVQE 3TSWA 1J5EJ 2FG0A 2F5GA 2H54B 4MKAA 2AW0A 2CQ0A 3OVAA 4ZGDB 2CKKA 4I68A 1SJ3P 1QSSA 2F2VA 1QSYA 3H5YA 3W8GA 3MCMA 4FF3A 1PC4A 1S1UB 2RKIB 2RDJA 1QW1A 2OH2A 1RCXB 1VQPT 2WVEA 3LW5E 4QQGA 1N52B 5AXKA 3FGVA 3G1JA 1R8PA 3A8KA 4HLBA 2QL7B 2QC3A 4ZVOB 3LUYA 1RT7A 3CCSS 3MUTP 1Z9ZA 1BI1A 1K8AT 1RT1A 4P72A 1RAIB 3FJ5A 3CCEA 5HMWA 2D8HA 1VQMQ 1JIHA 1FNOA 2FHMA 4Q45A 2UXDJ 4A8WA 2V8HA 3I0SB 2NLWA 3GONA 4FW1A 3RRHA 3QJJA 1NJIC 3JCMb 2HIYA 1IKYB 4HI1A 4HVZA 1YJ9S 2NWMA 5GAMd 5FLXU 4JRQA 2DNZA 1QVPA 3VQTA 3PKYA 2UXCJ 4ZPTR 1ABOA 3L4BC 2AX0A 2QA4A 3OQ2A 2HQXA 2HW3A 4YOEA 1SJQA 2IVMA 4BHQA 2FEIA 2C0IA 4MYUA 3DHXA 1RTIA 4NLGA 4PFZA 2BEFA 2L08A 2LQ9A 4ZP9A 3DLGB 4XTYA 1AEYA 1TL7B 4I56A 2LP5A 2CP5A 4OI6A 3VWSA 4FF4A 2RAQA 2ZKTA 3PW0A 3MCAB 3CCET 1M5HA 1RT4A 5FLXE 5AJ3F 1UCNA 5KFKA 1LFWA 2M51A 1DJ7B 2DR7A 4JRIA 2QDLA 4NLOA 1RT2A 1HPZA 1N8RT 3OW2R 2KSSA 1N6QB 4U7UD 1TP7A 2HMIB 3JRZA 3PY8A 4JOUA 4C0GA 2RH3A 1GRIA 1H2TZ 1Q8LA 2XDBA 2HZVA 1K0TA 3OBIA 1S9GB 2J76E 5HMYA 4O3RA 4FDFA 1YBTA 1IJFB 2XM3A 2QA4T 3Q8RB 2HNDB 2AD9A 3BDLA 4R56A 1XNIA 1FVSA 1F9FA 2Z58B 1TFWA 3G7ZA 2DERA 4AG1C 2WHOA 2XMJA 5JJBA 5K14A 4WBFA 5KOXA 1V5IB 5J26A 1DLOA 1GCPA 2COWA 4M7DB 1RBLA 1AWXA 3BSNA 1FDBA 4IUTA 3M4XA 5KT4A 4RL1A 1GH8A 4USKA 2KZZA 4K5RA 1UJ4A 3ZTPA 4Z88A 3NWGA 4GKJJ 3THVA 3EZUA 2M3DA 4O0NA 3OSSC 2CNKB 3VAGA 2KXCA 2C3MA 1WTBA 4EYIB 1Q8IA 4C3KA 4HH0A 1VQKQ 3BY7A 4PKDB 2X35A 1OSDA 1M1KU 3B8HA 4KC5A 3X25B 1JO8A 3W3SA 1T9TA 3CC4T 4C8YA 4LBIA 2GIRA 2XSJB 1LWFB 3JAMY 4DV7J 1HR0F 1XN9A 2V4JA 5KFVA 2E70A 2DIUA 2YUPA 1TVRB 4E7SA 5C24A 4KV8B 4DX7A 3FSYA 1YGYA 1G3SA 4KPCA 1Q5VA 4WF9Q 3MECB 4H4KA 3NGKA 3DRPB 3P45B 2BX6A 2GGPA 1PM3A 1ZBJA 4B9TA 2RUSA 4A4JA 5C2CA 1K0SA 3BKUA 1K9MC 1YDLA 2E7XA 1M8MA 3IG1A 2LJ0A 2VKRA 4AFZC 3RYLA 4CLYA 1BY9A 4UTGA 5DLOA 1Q7YT 5KYXA 2EWNA 4M75B 2V50A 3DMJA 2E9TA 3M58A 2K5FA 2E5KA 1YBYA 3M8PA 3CC7A 5HQMA 3OL6A 4PPDA 2XG8D 2WW4A 3U1LA 4BC9A 2FGOA 1BI3A 4DG1A 3K59A 3QPHA 2CQIA 1FRKA 2GV1A 3OXGA 5GMKe 3HSJA 1LWEB 2PA3A 3K5LA 4RW7A 3NFCA 1M1HA 2OTJT 2KK4A 2XYGB 2XY5A 1L3TA 5CCAA 1YQHA 2P4RA 1PYOB 4QPTA 2AYBA 4TQRA 1VRTB 4O23A 3FBEA 4PJLA 5M9OA 4DR4J 3MURP 3NBPB 1HYSA 2R7SA 1X4HA 3CCTA 1U1NA 2DL8A 2KXDA 3VRZA 3M0QA 4CLTA 3JTOA 1TKXB 1ARKA 3PMTA 5LMUF 1OULA 4C8QG 1CVJA 1RI9A 3KLIB 4LFBF 3CJKB 4N41A 3K57A 3CC7T 5I22A 1P6TA 4DL7A 1QLYA 3G4SQ 1UTAA 2LT4A 3GP9A 2FJWA 1YK9A 2DK3A 1NG2A 2G2ZA 3R7SB 2W0ZA 3UD5A 3JYTB 3M55A 4N47A 3HT0A 2KFNA 2YKMB 3BF4A 2KXHA 4MKYA 3D6MB 3K17A 4EPCA 1RLPC 2FGCA 2O9SA 5GANd 1BQMB 2A2CA 3M0SA 3D6FB 2ABYA 1HARA 3EWGA 2E66A 2C06A 4YB5A 3V81A 1A7GE 2Y1LB 5KFNA 1WJRA 2QASA 3QFWA 1YNZA 3GBQA 3QQCD 4HTJA 2ZD1A 6FDRA 2VFRA 2YRVA 4DFPA 1SJ4P 1F9HA 3BQ0A 3U23A 1QAXA 5IWAJ 2BJ8A 1T05B 2QSFA 3MTKA 5IN1A 2BM0A 3UR0A 2C2DA 2E9RX 2KDSA 1B70B 1FXDA 4GC7A 1FFWB 1TZ0A 1IBLF 3IAM9 2CZ4A 4WP8A 5LJ5e 3PXGa 4RW4A 4WKYA 2YKOA 1QDUB 5H1SV 2XICA 1QE1B 3H59A 5ETMA 2RHYA 2XNQA 2UUAJ 3BO2A 4C11A 2VDIA 3SFUA 5CABA 3J81U 2A6OA 4LN2A 4C8MA 4OJHA 3C16B 5HLFB 4TY8A 2H3JA 1S4FA 1WI7A 5F8LA 4M5KA 1V5VA 2BZ2A 4RWWA 2IRUA 2GQCA 2MDAA 4DJBA 2KTQA 1NK8A 1SI9A 3ZO7A 4PLLA 2M0OA 2DF6A 3W62A 4NYPA 3QFHA 2HZYA 3J81E 3J80U 2FC8A 2K9GA 3OYEA 2DTHA 3M0UA 1XMOF 2C1EB 2YXLA 2JHEA 4JS4A 2BJ3A 4M7AE 3KK3B 4L3KA 3CCEQ 5GAOm 2MLXA 3H0PA 5CD4H 3TUZC 3ZTQA 5LOQA 1JXLA 4AT1B 2MF2A 4C8QF 1KVKA 3CCLS 3KNAA 2FRWA 1H73A 3LWIA 2A37A 1OO0B 2MLYA 2UV8G 3IP0A 2IRYA 4QT7A 4F67A 1CBKA 3J80E 2DTJA 1SL2A 4XDCA 2BA9A 5AXNA 4KGVB 4MFBB 4H4OA 1GFCA 2X3DA 4WFAQ 4B9LA 4ENOA 4ZIWA 2QA4Q 3HL8A 4J9IA 1NK6A 1K8AU 3QYGB 5IHIA 1MMDA 3MHXA 2HHHF 2YNFB 1N48A 1JKHA 4JI4F 4DV2F 4G3IA 4CI0B 3CCQA 1LWCA 2QO3A 3CPFA 3SCLE 1CS4A 1PWTA 1RU1A 3PW2A 4J9OA 4GC6A 1N0UA 2L89A 3KDOA 3OJSA 4LSLA 3IN5A 1RABB 2KR3A 2VC1A 3IR6B 2MHEA 4NCGA 2W9BB 1PJ5A 3K5NA 2A28A 4ZVRB 3Q22A 3PM9A 3FUYA 1S0NA 1JXMA 2DHGA 1JJ2A 3JTPA 3PJ9A 3D4JA 3Q0AA 3MP6A 2KRSA 3VZIA 5G0RA 4Q0BA 4M77G 2DZ9A 3V6KA 1UWBA 1SJ1A 2WK4A 2YX4A 3TAPA 3CD6A 1W2BA 1K1ZA 2LX9A 2B86A 4Y6IA 3IM8A 3CCWA 1JLFB 3J7ZT 2JRSA 4X4NA 5I11A 2MQNA 1N9RA 1WF1A 2YQ1A 3MEEB 1ULRA 4DPYA 2EAYA 2MWOA 1EKRA 3M2UB 2FDNA 4LFAJ 4BWMA 4OJ3A 3E19A 3CCQT 1UZHA 1GMWD 1NJIT 3NRBA 1FJCA 5L23A 1Q82R 2JTFA 3AFGA 5B0DA 2XDPA 1L3UA 1GXTA 1AZEA 4J9DA 2WVFA 2GO9A 4DFJA 2KU7A 2XWXA 3QLHB 4OYOA 2KDOA 4MK8A 3SIPB 3PRDA 3ELHA 1VRQC 3FB9A 4RNFA 2LXUA 3ILJA 1YRUA 4P73A 2G1HA 4F0MA 1VYUA 1TL3A 1WACA 3BFMA 3H7HB 2MPXC 3PCOB 4RW6B 4OMLA 5KE2A 1WSVA 3I5BA 2ZJPQ 2VQEJ 3L2QA 2EKHA 1HQ2A 3BEGB 5KYWA 1QVFP 3EHRA 5FU6B 4NLTA 4ZVTB 2X4WA 1NDCA 1ICEB 3GG0A 2LJ1A 1OX9A 3Q2SC 1UGRB 2XS7A 4JI1F 1U1PA 1I51B 1AHJB 5BJRA 1WHLA 3QGIA 3CMEA 2EVZA 5CQXA 3GIBA 1SSHA 1VQ6T 5HK3A 3ASKA 2JTEA 3W5YA 4KKOB 2A36A 2B6AB 2KRBA 4M4ZA 3VGSA 3EG9B 2K8GA 3BSOA 5DM7Q 3SBMA 1Q81C 4Z7CA 3KK2A 2MAMA 1TMMA 1S97A 3QJLA 5E3CA 3X3UA 1F3FA 2FL7A 3ULHA 4XK8C 3BDPA 1VQNA 3EAEA 5HI7A 1FRMA 3EGDB 2XGQA 1FDAA 3ZZOA 5IAYA 3QSYB 2ZHAA 3CC7Q 1BHNA 2YWKA 1RHUB 3CJ2A 1P8GA 4JYAF 2AIRB 3HFZB 4KULA 2VBXA 5GMKl 1NNDA 1GMVA 2FUG9 2DL7A 4LQ9A 3LANA 4D3HA 4NZ6A 3T6BA 2GO8A 1GTHA 3MM7B 4M77F 2DX1A 1RI7A 4IH7A 5AXLA 2IMWP 2ZFHA 3CWJA 3CMET 4F4KA 2K2VA 1AFIA 4EI2A 4NXNF 3QWUA 1YITS 5A8RA 2KYXA 4ES3A 2FZKB 3BGRA 3FJ2A 4WFBQ 5CVIA 3QATA 4KBIA 4Q2MA 3MOJB 5T7LA 2LQKA 1YN8A 3U7JA 1KSPA 1KC8T 1T9UA 1VQ5T 1FWKA 2YNIB 4JI7F 1MLAA 4WFNQ 4PR6A 1FO1A 2XI9A 1ZSGA 3GJSB 2HVIA 2E64A 1VQ9S 2W1BA 1CULB 3DRSA 2V4QA 3T1HF 2JLEA 1OPZA 1XIQA 1WHVA 2P9GA 1XR5A 1QTNB 1NK9A 4K0KF 1ZPVA 4MK7A 2F1LA 4PKCC 1K0XA 4AUKA 3M0PA 3PO4A 4V19X 4C48A 4ED1A 4DFMA 2JC0A 4BLGA 1ZX6A 3MI7X 2HNYB 4QYZK 2YRDA 3QZ5B 2K3KA 3JSRA 2DO4A 4PXEA 3QJPA 4IG0A 4OYZA 6AT1B 4WYLA 3CBMA 2PVOB 5CHCB 2GX8A 2DRDA 2HVDA 1JLAA 3W9HA 1BMQB 2BANA 2LLZA 3QNWB 3I31A 2Z2LA 1UPPA 5HQLA 5HAOA 2G0CA 4IR1A 1VRUA 4ZVHA 5EUHA 1NKBA 1M5Q1 3G82B 1LOJA 4ED8A 4B3TF 3MM6B 2LCWA 4I6WA 3W1YC 3P8HA 3DRXA 4CO2A 4XQ3A 2G3RA 3QT6A 3GF5A 4FSXA 3I9V9 4RNHA 1IJEB 2EYXA 1U7LA 3FBFA 4DEZA 3CCSA 2RQVA 2OD6A 2ZWPA 1FHTA 4ZOSA 3P5TL 1K47A 2YKNB 1W2BR 5EX3A 5J2PB 4QKUA 3CXCS 1NDPA 2QI2A 2Y1RI 3S3OA 4Q8EA 1XOVA 3FEZA 4NCBA 1O51A 3QZ8A 3R8YA 4ED6A 4NLYA 4FNIA 4CO1A 1QAIA 2F1FA 4J90A 3BBFA 1YRXA 5C7PA 1EX8A 4FT2A 2HS0A 3T1YF 4BUGA 1YJ9A 3JCMd 1X2KA 1LKZA 4FIBA 3NS6A 4HI2A 3RR6A 4AFFA 1EP4B 3P3DA 1HW8A 2MKYA 1X6BA 4I69A 2H5JB 2RRAA 1PAUB 2W2MP 3KJVA 5FU7B 2Y0SD 3PE0A 1K1SA 1MWYA 2DA9A 1Q86U 4M78A 1DTQB 2Y3YA 1U8SA 4KTQA 3E8OA 3C2PA 4PL6A 3DFEA 2ZPHB 3P5BP 4WWSA 1UFLA 2CPEA 2DNRA 3Q83A 2O1PA 4Q7AA 3H2UB 2MCNA 2O31A 2IMOA 2CNOB 3BZQA 4UZCA 4DI6A 2B4VA 5EC7A 4CQ1A 4G1IA 1K73R 3I0RB 2NLUA 1FT8A 5DG9A 2R42A 2ZZMA 1VLOA 3SQGB 4WF2A 2HBYB 1H7XA 1HNZJ 2OD4A 3WBZA 5LJ5j 4J8OA 4D8DA 4CTAA 3E01A 2HZCA 4F16A 4YB7A 2VF3A 2XTJP 4ZVEA 1YJWS 2KRRA 3WXMB 2JM8A 1UKUA 1U2RA 3CCUA 4P2FA 3EG2A 1YWXA 1SH0A 4M1KA 4NLDA 3NNHA 5AXMA 2VFSA 1S6UA 2RS2A 2PTKA 4B3RJ 2CQPA 3MEAA 1HA1A 1OPLA 2YPZA 3H8YA 1WXBA 2L41A 1YTYA 4X2BA 4I64A 1Y5LB 3OR1A 2VUBA 4FSSA 5LJ5Y 1DY3A 1OZ3A 1QVGS 1O8BA 2M5YA 3TQ1A 2FPEA 2L3RA 4P2SA 3OYDA 3ZTOA 3JCMP 4DR2J 3CCQQ 1IBKJ 4N8NA 3QG1A 3NNAA 3BN7A 1GX5A 4UUWA 2ZPGB 2W8LA 1RHRB 3IM9A 3A1PA 1O75A 1RHKB 4J9EA 4DR1F 2BACA 4CLZA 4NL3A 2VU5A 3OFFA 1MNEA 4RTTA 3M8ZA 3MEGB 2DT9A 3V7SA 2DM1A 4CO0A 3VKIA 1ZM2A 2R7TA 2GQIA 4K4YA 1HQUA 3RG6A 3DB4A 3BM7A 5GJWB 1M90U 3M2RB 3MFHA 2QA1A 1V29B 3CCUT 2YX1A 3PW5A 1WJSA 3CD6Q 2XMWA 2AZ3A 3OLAA 2XMKA 1TL1B 3H0IA 1SL1A 2ZE2B 2GZOA 3OUYA 2VONA 1RLCL 1AYEA 5KYYA 2OEJA 2W24A 3EZOA 3T9ZA 1VCTA 4LBPA 1X9MA 3CCJS 3RAQA 3CPWA 4L5GA 2RK2A 4OYPA 2FLNA 1NSPA 3M8WA 3KLEB 5HO4A 1Y10A 2CYZB 5HBMA 4ILLA 4Y2MA 4PABA 2WOMA 3ER0A 1OS5A 2DNOA 2KFYA 3R5AA 4PJOC 3FLGA 1NKEA 4C8QE 2JZ2A 3VV0A 4J7IA 1CC8A 2GMLA 1EETA 3A1YG 4X66F 2ZPEB 2PN6A 2CDRB 2B9EA 3CCVA 2Y0BB 1G1XA 1JLEA 2MHNA 4A47A 5I3UA 3M32B 3TUJC 3DM2B 2VG5B 4ED5A 3UVJB 3D54A 4ES1A 1RT5B 4UY85 4F0HA 1KHCA 1ZA1B 3ENVA 3QMQA 5BR8F 2FQQB 2MYFA 3LF0A 3VR1A 1NU4A 2V26A 1MU2A 5B0FA 3CMEQ 3GNFB 5KCOA 1BGXT 2Z57B 3UPFA 3G87A 4EMHA 2K3XA 8AT1B 3T1AA 2CDTA 2B9XA 1M5VC 5C5JA 1URNA 1G6BA 2NUZA 1VQ5Q 2IIMA 2Q6CA 1PJ7A 1ZBTA 2QA2A 4QPXA 3OW2P 2N3OA 1EQ0A 2X9HA 3JCMW 1VQNQ 1KVJA 3GTYX 2VFVA 3CCVT 3GLXA 3LO3A 1UW9A 3PTWA 1IR1A 5A6PA 1IBMJ 3MTJA 4EIKA 1AXQA 3QHSA 3PDNA 5KFSA 3B78A 1NEBA 1AUSL 5EG2A 3UFCX 2XLIA 3HT3A 4IUVA 1J2VA 4ZLLA 1D0YA 5CK9A 4K2JA 1YJNT 4PQUB 1D09B 2DGQA 2LDYA 2W2OP 3GOXA 1LFPA 1WF2A 5A0YA 4Y00A 3EVMA 2ZDPA 3MFIA 3OYAA 1XNRJ 3NOGA 4IR9A 2RS8A 5J3BA 4BI4A 4F2SA 2HK2A 2GQ2A 3JCMQ 4CYUB 4HTIA 4JI8F 4L75A 1SG5A 1RTJA 1L5UA 4H4MA 1HNVA 1I1JA 4TVRA 1B3QA 2ECZA 2XMFA 4RUAA 4B3SF 8ATCB 1UFWA 1REGX 1HSQA 5KG4A 1F3VA 1N33J 4OYXA 2COLA 4B02A 4XU2A 5GAOp 2XB2D 5LT5A 4J9RA 2YH0A 2IPOB 2HS4A 4DS4A 2XI3A 4HYKA 3CMAT 3NCPA 2RI3A 4OZNA 1FERA 4JI6F 3JTNA 2WW8A 3IS9A 2QXFA 4EO6A 1U0HB 5J2NB 5K8NA 5ETPA 4IOCQ 1HBOB 3LAKA 4F3MA 3GPAA 1NUEA 5GAN6 2NUPB 2QDYB 2E5HA 5C0MA 4JI3J 1DRZA 4J7FA 2FZGB 4HKQA 4OB2B 3Q24A 4R55A 3MHYA 1C1AA 1KC8U 1TUGB 4NS5A 1N5QA 2H65B 1XNQJ 2EI5A 3ZZ0A 1M9SA 1E6VA 2UUBF 3MMBB 2P9CA 2L48A 1APSA 3MR6A 2MQPA 4DDFA 4BACA 3KYLA 1U45A 4O0IA 1NJWA 2K06A 2GA7A 1RTHA 2M0GB 3MWBA 3TW0A 4F7UA 1M2VB 1G5VA 4C0DB 1WFWA 3D6HB 3CCSQ 1U1RA 3I5SA 2LA4A 3AQOA 3RAMA 3DU6A 2JWNA 1X4FA 1ELOA 2FVUA 1CQMA 3NS5A 1N6AA 3CPWP 1YVFA 3X1LB 3FEYB 1NYGA 1S1XB 4ILRA 2FJEB 4BCAA 2MPUA 4BY6B 2H8HA 4LSNA 3M0RA 3HK2A 1JU5C 2OJ2A 2CAJA 1TV6B 4ZITA 3WVEB 3THPA 2UVRA 3L7OA 3CD5A 1CJUA 3IXQA 2JUFA 2Q43A 3PACA 3SMZA 5IV4A 2LECA 2E1PA 4M77E 5IT9E 1RB0A 4IH5A 4PJMA 2CWKA 3SZ2A 1HQEA 2Z2YB 2ROEA 1VQ7A 1S6QA 1U0SA 2EG2A 2J9DA 1FMWA 2G6FX 3OA6A 3C14A 2E29A 1VGYA 3VS3A 2FIUA 5D6YA 1NO8A 1RA7A 2O88A 1RUWA 1FKPA 3O44A 1DTTB 1WXTA 2B4OA 2V8PA 4J7CA 4NI2B 2BKDN 1ZUYA 2XY6A 3G6ET 3MPWA 1VQ4A 2EC0A 2E5GA 3HFKA 5I2SA 2DJZA 2D8JA 5F0UA 3P8BB 3LH2S 2QMUB 1RADB 3A8GB 2WB1D 3BR9A 2CPIA 2H5IB 1QCOA 1HLWA 1FE4A 2EGCA 2HFUA 1TS9A 3OXLA 1JNRB 1VIXA 1WHXA 3FEOA 2LCCA 2LEPA 4J83A 3KTQA 2QLFB 1VQ7T 3F0NA 2ZJQQ 1EAYC 4CM0A 4X9DA 1MN7A 3KFVA 2DHAA 3CCUQ 2MQ8A 1VOMA 2XWYA 4MZMA 2HQHA 2VGNA 2RNEA 2RUGA 1H8KA 2RK1A 4NCAA 5CQYA 4ORZA 3UCGA 5DDQC 2KGTA 4YDXA 2UZAA 2FZCB 4OHVA 1VQ4T 2BE2A 3MEUA 2R2SA 1X69A 1PD0A 3I35A 3V7CA 1WHGA 1JLGB 3DNCA 3GJTB 1FX7A 1M27C 2OIHA 3I87A 4Y0FA 4ZJOA 1Q81R 2P6TA 3DLLA 1GTEA 5E7OB 4LR8A 2U1AA 2CREA 4EUVA 2BYCA 3QBCA 1NPRA 1URRA 4KYZA 2CWXA 1Q82T 5B7WA 2ZH2A 5LJ5h 3RBEA 1U1SA 4WXWA 3MXHP 4I6AA 1KDNA 2CQ1A 5A76A 3RDVA 4ZCLA 3OLBA 4NEYA 4CLWA 3QBYA 2LTOA 3W64A 1BQNA 1DHMA 5HY6A 3ILIA 2P0KA 1OPKA 2DXDA 3HX9A 1HHQA 1PYSB 2PMZD 1OI1A 4OZ2A 3EMTA 1N5ZA 1KQGB 1RWKB 2XC9A 3R6NA 4HXJA 3PNIA 5GJVB 1OY9A 1BCOA 4C92C 1Y96B 1OWXA 3NGDA 1T94A 4QW8A 1S59A 4ZVUB 4DPUA 5IC6B 2AEJA 1R8CA 1S0VA 1WKKA 1N36J 1SL0A 4X65J 2VG6B 3ADAC 3POTA 2JN0A 3JAMU 1R77A 3PFSA 3UA7A 3GE9A 4IG3B 4ZJLA 4QQ6A 1ZAVA 4L73A 3CCVQ 1C0TB 4TU8A 1RAHB 2DLPA 5AE1A 1WDXA 3IGVA 4IIMA 4YDDB 2VGMA 3PVXA 1ZAXA 1KLMA 1BK2A 5AYFA 2HFOA 1KQSS 2HIQA 1FCAA 1YJNQ 3OHBA 5GAOl 4E7LA 5F3TA 1N5VA 4PJOA 4PWDA 2YWFA 4DOZA 4PJNA 4G1QB 4PWUA 2DGUA 1RSCA 1T9XA 4YHHF 2XMAA 4V1Ak 3ZZUA 2QMXA 1JLCA 3PNWC 4J9GA 2D3OR 2VUGA 3ZTSA 4O3QA 4V2SA 2PIIA 3OTOF 3ITHA 4DXLA 1EHWA 1UUEA 1SQFA 2NXUA 4J6WA 1FE0A 2ROPA 3IRWP 4MH8A 4U6PA 5LSLA 1VQ9A 3FSXA 4X4SA 1EZZB 3G71A 2KYBA 2PFDA 1D3WA 1AB8A 5KFCA 1VJWA 4RW9B 2LX7A 4HACA 3CMAQ 1HNXF 1RACB 4LD6A 1Q1KA 5J39A 1UHCA 2KB2A 1UVNA 2A08A 1SRLA 2A7YA 4OYWA 5KT7A 2W4CA 2CPJA 2XYPB 3VUZA 3N0VA 1R0CB 4FZVA 4DV4J 5D7UA 4ZGEB 2UVVA 5GAN3 3W2VB 4MIBA 4O3PA 4ID5B 3H9NA 3FK4A 3PTAA 3VS5A 2BQ3A 4C8QD 4OGCA 3NY0A 3M8QB 4WE1A 3US5A 2YUQA 3L2WA 4TNOA 2NUTB 2W4DA 3G71T 3ZZZA 5KFRA 2R7UA 5F8HA 4FL6A 2ACYA 3CXCA 3H2LA 1PD1A 3MEWA 4OI1A 1FX2A 1LK7A 2FO0A 2AMCB 1KHIA 2WVCA 1JJHA 4CCHA 3ET6B 4PG4A 1W26A 3M6UA 4MKBA 3JB9J 3HXMA 1Q95G 4C0BA 3NGUA 4K4ZA 4KFBA 3V6JA 3BGUA 2OPQB 4CP5A 3KXDA 1R8BA 2K5IA 5D6XA 1HWKA 3ZZTA 2LVWA 1FFSB 4IQMA 3GG1A 2V9WA 3UQSA 1ZS6A 3ISNC 1RWXB 4MYTA 3IO1A 2OPRB 4CIOA 4N4HA 4IUQA 4ZKAA 1U6ZA 2ED1A 3G4SS 2QMWA 2JLFA 4I2PB 2MB0B 2M52A 4KPYA 4FM4B 3CO9A 4DEXA 4UZBA 4MDWA 2M88A 3I9ZA 5K5MA 3EFRA 1X31C 2N82B 2ZBIA 5GAMf 4ERDA 2GVDA 3G6EQ 2XG8A 2ZNZA 5L1JA 3G6YA 4C5HA 4USJC 1HMVA 4J91A 3CJ4A 4LDXA 1GL5A 2DVEA 1Y5IB 5CZXA 1H3HA 3Q1JA 4F36A 2ZC4A 1EB0A 2XS2A 3F44A 2R7RA 3AB2B 4B3MF 3NEKA 2UU9J 3KUGA 3ONQA 1K73T 3BGFA 3GILA 1V6HA 1VQPS 2O5DA 1D9DA 1Z2LA 1VQ7Q 4DQSA 3N79A 3LGMA 4C8ZA 1IR2A 3G86A 3OYGA 3TJ9A 4OHWA 1QVGA 5J2QB 1NZ9A 4X62F 1Q78A 1S1UA 4ZP6A 2RKIA 4DWIA 2E3IA 2W7AA 4P75A 2HK3A 4NRUA 2XZWA 1X4EA 1M1KC 3MGJA 1VQ4Q 4GVBA 4RW8B 4DN9A 3OFEA 4M7DG 4F4AA 4LF8F 4X4PA 1XQIA 3BS9A 3OYKA 2RDIA 4N76A 2XBPA 1IKXB 5AT1B 3Q8VA 2QQRA 2AKLA 4E7KA 2FYKA 1GBQA 3LWHA 3DOMB 2C2EA 3KMQA 3EFOA 5ETVA 4NLRA 2W7OA 2MMPA 2GQQA 3O8VA 2CPFA 4QOTA 2ABLA 3D9BA 3G96A 4YR3A 4O3OA 4WU2A 1D1BA 4ZVQB 4K5SA 4PCQA 1NM7A 2PMHA 4RO0A 2MKKA 1O9SA 5IQ6A 2DO3A 1VBKA 3CCJA 3OR2A 3KHGA 2ZPBB 3CCES 3GCWP 3RGIA 1LJOA 2DXUA 2MZJA 1TL7A 2ZH1A 2VIHA 2Z56B 4ITSA 2Y90A 4M5LA 3BGOP 3D68A 4RG2A 3E3XA 3HVTB 2HHVA 5KG2A 4A8QA 3HHKA 2DEJA 5KFIA 2YT6A 2J6FA 3MEVA 2ZWOA 1A6LA 4M75G 1VFJA 3HKZD 4HHJA 4J5OA 5AJ3J 3K2YA 3VAJA 2F5KA 2QA4S 3UATA 4RKUC 3EUNA 2ZM6F 1V76A 2DILA 4OMQA 1S9GA 1KG1A 2B9WA 1WWHA 5M2UA 2CUYA 1RT7B 4U95A 3A8MB 4J9KA 1RT1B 2HBQB 2HNDA 3G6XA 3CDBA 1HNWF 1LCKA 1IHVA 2MSTA 3BO4A 3NNCA 3ISZA 3JCMV 1QWFA 3BN4A 3P4UB 2VPZB 3TO8A 2EBEA 4ZVSB 1S48A 2CYYA 2C3OA 2RSQA 2YX7A 4RJVA 2YXYA 5A0LA 4RUBA 2K4YA 5B0AA 3MR5A 4L59A 4PPZA 3SSSA 3MOZA 3P96A 1XMBA 2KRMA 5ADZA 1Q82U 2RI2A 2XDDA 1M3BA 3LWLA 4M7DF 1SJFA 4QVCA 4B9VA 4PG6A 3CC4S 2X1FA 3EXCX 4C92A 1OEBA 1BKBA 1PAEX 3TZYA 5D0GA 4N4GA 4HCBA 2VICA 3NTHA 2XCAA 3EH1A 1R8AA 3MAAB 1RTIB 3CULA 2MZRA 1VC5A 5T41A 2DK2A 3C94A 1F0XA 1WPYA 2DBKA 1FD2A 3W60A 3PFOA 3AA9A 2XSJA 1LWFA 2LP4A 3RMQA 1JNZB 5HATA 3DRRB 1RT4B 1BCMA 4CRIA 1TVRA 1WQWA 1RUSA 4M5IA 2D3UA 3HHEA 4KV8A 2RQCA 3RIRA 1IO6A 1F5CA 4DPXA 1FEEA 3PJXA 1HR0J 1RT2B 3B6BA 3JSBA 2N3LA 3DRPA 2L2PA 4URGA 2JJ4D 1YWPA 1RYRA 4ED4A 2MGZB 4TYAA 3PIOQ 4OV1A 3BGLA 2AGQA 1VQ9Q 2W25A 1LOUA 3VS6A 3HP6A 3G71Q 3FZ2A 4ZVPB 4ANEA 3VS1A 3CEYA 3C12A 2H3EB 2CG8A 5L8RE 4M7AC 3UO0A 2DYBA 3OYBA 1VQ8S 3AODA 5A8WB 2DKOB 1CJVB 1TELA 3TA0A 2Y4YA 2X3GA 2OTJS 1H6KX 1R0BG 2CRLA 4NLUA 2IBKA 3R97A 4A8XA 5K14B 4A8OA 3U02A 4QU7A 4M75F 1DLOB 2QRRA 3HZGA 2C22A 3B4MA 4U9RA 2LKZA 2NSBA 2LFVA 1LWEA 3FCVA 2I38A 4M78D 5LJ3Y 2ZOFA 3J7AF 2OSQA 1MHNA 4A46A 3Q23A 3MMAB 1MWQA 4DA4A 3PGGA 2E1HA 2FJDB 3HTRA 5C25B 4W98A 4CC3A 1WIEA 1WKJA 1ZZFA 2NXCA 3KG4A 1RXOB 3CC7S 2DRBA 1I6JA 3EDQB 4XPCA 1ZTWA 2EJFA 4L76A 4RU2A 1I8FA 4ANDA 1HBNB 3SFMA 1KP6A 1Z4UA 2R7VA 4YFUA 3CSKA 1QAYA 3DYAA 4C8NA 4LREA 1BXNA 1K8AC 2DY1A 1X8DA 1SC3B 2RIJA 2HSPA 3EZ5A 5LMUJ 2QQBA 4LFBJ 2YKMA 2LQ5A 2KI7A 3TJ8A 5KFGA 3TR5A 1RTZA 2CXEA 2CQBA 3RTVA 1BWEA 1BQMA 4TKTA 1U3OA 2AWZA 5I42B 1B34B 2JVVA 4NWBA 5KFFA 1VBYA 4O5VA 4FPIA 3DMJB 1B07A 4E47A 2EK1A 2QTWA 4ECRA 2I2LA 2J6OA 2J6UA 4ZGJB 3S8SA 2F2XA 4ETXA 3M8RA 4IFYB 3JQMA 3A8IA 1T9YA 3I56T 2KKHA 2E1RA 4RUCA 3CD0A 1FD8A 1H0HB 1T05A 4KO0A 3TVZA 2EW9A 4RW7B 1PRMC 3OYFA 2HKEA 2V2ZA 5HANA 4JV0A 2X7IA 3RB4A 3LALA 4OLOA 3GIKA 2EWHA 1UTIA 2GHWA 4ALZA 1OQ6A 5A2QY 4A63B 5CD4A 2COZA 1IBLJ 3N5FA 2DHSA 2EYQA 1MMGA 1PGZA 2GMJA 1E6YB 1U1QA 1SCJB 2ERRA 2XQCA 1Z9QA 2ZOMA 1N8RC 3C16A 5HLFA 4ZLPA 2KM8C 2IRXA 4JI5F 3FJPA 3KLVA 3L2ZA 2FVQA 4ER8A 2JOYA 5CAAA 1Y57A 5GAMg 2A3JA 4DEYA 1HI0P 1QVFS 1RP5A 2HVEA 1YHQA 1HWJA 4BWJA 2HLTA 1X27A 1S6PB 2CP3A 2D9OA 2H48B 5F9NA 2IA0A 5I2MA 5ETTA 5CYQB 4NE9C 5B0CA 4YR0A 4WFZA 4AQYF 3VCDA 4IURA 2QFIA 3KK3A 1U1LA 3OYMA 4ED2A 3V7RA 1T95A 3V81B 3SCIE 3MR2A 4U7UK 1XMOJ 1K73U 4R5PA 3N6LA 1VHFA 5IWAF 1ZLMA 2ASDA 1RWVB 1SC1B 1ZUKA 1S1TA 1UPMB 5LL6d 1R3NA 2QE5A 5F8JA 4ELZC 2LJ3A 2JM9A 1WTFA 1N27A 3A3OB 1K9AA 3HHLB 4MFBA 5DLGA 2FHOB 1MWZA 2R8HA 3SWNB 1NSAA 5H9FK 1PKSA 5CO7A 1M1GA 2QTVA 3QPIA 3ZZYA 4IUPA 1KHVA 2BV3A 3KUHA 1TWBA 4RBUA 4A4HA 2HQFA 1YHQT 5KT6A 3S6EA 1ZUUA 1U8RA 1WX6A 2KT3A 4KQZA 2FVCA 2KVIA 2FC9A 3D2WA 1HWUA 3CGIA 2DGVA 1UGVA 1KTQA 2RJDA 4C11B 2E6ZA 3V4IB 4DQQA 3FBCA 2V34A 3NAHA 1VIOA 2GJIA 2HHHJ 5KT5A 5KFLA 4JI4J 4DV2J 1Y9OA 3KJQB 1LW2A 2XLKA 2MKJA 1VISA 3PVQA 5IT4A 3C19A 3PYEA 1GT8A 2NYHA 4N77A 5KG3A 1M1KT 1R43A 1DBDA 1NCLA 1NAQA 2MKCA 2IM2A 3ENAA 3BH6B 4ATOA 1KQSA 2IG0A 3VAHA 1HNIB 4OB3B 1N5TA 4A4EA 2B8AA 3W61A 1KFZA 1WSRA 3DGPA 1QQJA 1PCAA 3CCQS 1OY6A 2AP6A 5DETA 2RF2B 2R5MA 1LXJA 5FROA 3I32A 4G65A 4WCIA 3WZ0A 1BLUA 2R8JA 2YRCA 1FRJA 3KWMA 3PV8A 3AJ2A 4H4KC 3MMCA 3TP2A 3M5AA 1F1BB 1T0HA 4K4VA 2GHVC 4XTXA 2V5HG 3OBYA 2QJ3A 4KRWA 4K4TA 3BH7B 1TKTA 4H4OB 3QLHA 2J9CA 1WORA 3NPFA 1FEHA 4EMKC 2PZ1A 2C2NA 1W7WA 3V6DB 4YY3J 4IKFA 1VYAA 3GQCA 3MCOA 2QN6B 4FCYA 5IHKA 5E3AA 3ILLA 2NXJA 4JB8B 4D6WA 4WTYA 1E7OA 1JKHB 5FD1A 5IHNA 3RUBL 1LW0A 1VJQA 1UGQB 2QIFA 2D0NA 1LWCB 4LF7F 3GYGA 2WSFE 2PQWA 1IM4A 1VQ6S 1CS4B 1TK5A 3C46A 2ZITA 3S6WA 4CWBA 3AHUA 1UA0A 3T5LA 4GO7X 2YWEA 4LRBA 1WZOA 2GVZA 4MMLA 1S72T 4NCGB 3HHNB 1BWVA 2QGFB 1W2IA 4JI1J 3QWYA 4A8FA 1X5OA 2VA3A 1X6GA 1Y3KA 2Z2ZA 3AB4B 1RJJA 4DQIA 5EWEA 5KFQA 2KI2A 1AROP 5G0RB 3EG9A 4Q0BB 1UWBB 2M7SA 2CJYB 1DJ0A 1K4US 1O5JA 2AYMA 4WK3A 5BYQA 1XWLA 3V8LA 2PVGB 4U8YA 2EYWA 2XLJA 3HHDA 1XQHA 4LUBA 4OX9F 4TQSA 2HQGA 2RI5A 3SCJE 1FMVA 4Z02A 3M0TA 3GIMA 5L39A 2ZH6A 5CCLA 2D0QB 5KFZA 1UECA 3CMES 3CBOA 1XTDA 2CZ9A 1OYXA 5I3QA 3FCHA 2X4XA 2Z8QA 3TVYA 2NYIA 4CO5A 4LT6A 4V19J 4NMXA 2CNLB 2LQNA 4JYAJ 2R5AA 4M7AA 1MW7A 2DXBA 2HBPA 1VQ5S 2PD1A 1MMAA 2DTOA 3OVBA 1ZTTA 5GAN4 3G4SA 1VYTA 1HI8A 2N4DA 4P71A 1C0MA 2AJ0A 3TSZA 2G1DA 1FJ7A 2X1BA 4CLLA 1NZAA 3L2VA 2AYEA 3PX6A 3WIUA 5D3GA 3RKWA 3JCMf 1KKHA 4NXNJ 1FNMA 3I9QA 2DIVA 3J7AN 3U1NA 1T0TV 2YNIA 5FDLB 2KROA 4M7DE 4DBQA 4Z37A 3I56Q 4GVLA 3OV7A 1PYTA 2HFVA 4QBUA 5LJ3h 4I2QA 2NQPA 5AE2A 3JCMJ 3HVAA 8RUCA 1DQAA 2RB6A 5I4MA 2HPUA 5DRKA 5DDPC 4JI7J 2HBRB 1D3BA 5HMZA 3NS7B 3M53A 3I96A 3L42A 3CDAA 2LZ6B 4OI3A 1WHJA 1G3YA 2DEUA 3T1HJ 3DI6B 3PZPA 3IBCB 2HNYA 3O3LA 2JMAA 4DSKA 5L9NA 3H4DA 4K0KJ 2HKNA 3LTOA 1VQPA 2B9YA 1PSEA 2FPDA 3PHTA 4J5YA 3KK2B 1F5AA 5HP1B 2RB7A 1CKAA 3ENWA 2A0FB 1W6XA 3D0HE 4ZCKA 4R25A 2NS1B 1H74A 3F73A 3GSDA 3EPIA 3BPDA 3G82A 1TL4A 1JBMA 1BU1A 1V3SA 1CQNA 3PRBA 4DV0F 5F9LA 2CQ3A 1KQSR 2DR6A 1Y3JA 4B3TJ 1B4SA 5CZVA 2RA2A 1SIWB 3M2VA 3R2DJ 2DYIA 2YKNA 3LP1A 3BDUA 5IS2A 4C8QC 1WEYA 2CH4W 3HULA 3KBGA 4KGMA 4HH1A 1ZSZB 2L5QA 1LNXA 1K44A 1FMKA 5A8RB 2GC8A 4M75E 3V2UC 2L9WA 3BGRB 1UFKA 4UOCA 1TUWA 1FESA 5T7LB 4JBCA 2PO4A 2APOA 1T3OA 2DXCA 2VG7A 1YKWA 4RBVA 3TNVA 1S4EA 1GAOA 2PEBA 2ZZDA 1M5KC 2V69A 3DCAA 5FRMA 4N4IA 2BIVA 3DRSB 4KR0B 3T1YJ 4M5DA 1RHJB 2C28A 1NE8A 3KG0A 2JEJA 4Z2XA 4I4BA 2CPYA 1HBMB 2AF6A 2R8KA 7AT1B 5CKDA 5EWFA 1FTCA 2Q66A 4LDYA 1X0FA 1YHQQ 2CQ2A 3QDFA 4K7QA 3K5OA 3CVKA 5SUHA 2A3LA 1NLOC 3BBCA 5LMNF 2XI2A 1RAGB 5KFUA 3UF4A 4OZJA 1YFNA 3O6QA 1JLAB 4TY9A 1CLFA 2LU2A 3VS0A 4CLFA 1S1WA 3AY0A 2AV5A 1VRUB 4C8OA 4CC2A 1VUBA 4AMCA 3SQGA 2DFUA 2F4FA 4C5GA 4PJOD 3HSDA 1I1GA 3KLFA 1H72C 1TKZA 1AD5A 4CLPA 1XMQF 2EBPA 2KYZA 2X3XD 2FPFA 3NL0A 3LP2B 2V1QA 1VC6A 2LQ8A 1SPKA 1Y4ZB 4FPRA 2B5JB 2H4YB 4IUUA 2F69A 1UL3A 3QUIA 1XJWB 1YBUA 4OI4A 1KQKA 2XU8A 2Y1IA 4HVWA 1O6XA 2HWTA 5HVFA 4DX6A 2BUDA 2ROLA 3H41A 3KG1A 3H5XA 1ZYQA 1H7WA 1UETA 2VA2A 1J5OB 2BOAA 2HSEB 4B6MA 1Q81U 3PG9A 2AKKA 1FXRA 1SH2A 4CLUA 3CC4A 1A0OB 3MAHA 1U2FA 4P6QA 1RKJA 3H0FA 3KJVB 2OX7A 3CCUS 2EXUA 4RUHA 1VC0A 4RTYA 1CSKA 5CA5A 1FFGB 2DCUB 5HCKA 2VOPA 4DR1J 4X34A 5DQHA 1HFEL 3FDRA 1Q7LB 2D9TA 2OAWA 1Y5NB 2GAHC 1D0XA 4HCKA 3DOKA 1W25A 4M5JA 1EIYB 3H20A 3W65A 3L7UA 1TL1A 4MMKA 4LRAA 3NTIA 2ZE2A 2P5VA 2H51B 2J8AA 2HYIB 4JS5A 4DUYF 1QMCA 5DZ7A 2Y4XA 3FMWA 2ZH8A 4N5SA 2PSZA 1S72Q 1B7YB 1P92A 3HVWA 5BYRA 3IC1A 4OHXA 4CTAB 4IDKA 4IO9Q 3UNGC 4RU9A 1KC8C 2VZ9A 1VQ8A 2GBQA 3CIMA 4E7HA 2RD5C 3FZBA 2CJ9A 2OTJA 4ZCIA 2HHQA 2I5JA 2B4UA 5BYSA 3OR1B 5ECAA 1JMTA 2MZTA 5THWA 3M32A 4EBCA 3DM2A 2AJ4A 4X66J 2VG5A 3R7NB 4JZ3A 4O3NA 4M77C 3CPWS 4W90B 3HCXA 3QXEB 3DLKA 4RNMA 1KQ2A 5HK0A 4KGXB 4EMKA 4I6YA 3META 1WLPB 1KLNA 4KBMB 5BR8J 3M9QA 2WSCC 2AJ1A 4NXMF 2ZBCA 2CP0A 3CCVS 1GK8A 1SKUB 3E2UA 4CC4B 1HQUB 2MZQA 1NLPC 1VQ8T 2F8EX 2GFUA 1UHFA 3RR8A 3OD2A 1WC6A 1RL2A 2OPPB 1YJNS 4JRPA 3MPDA 4MKVA 1P9QC 5FIIA 2IC3A 2XD0A 2W01A 2K3BA 1PHTA 4FYVB 1BQXA 4ED7A 4IRDA 1WC0A 2RHZA 3QYYA 5KYYB 2B56A 3OB9A 2GGRA 2WVDA 5E33A 4USUA 4PQUA 7FDRA 4NOYA 1N8RR 4OJGA 2G13A 5HBMB 1D0EA 2WSEE 1G4CA 1UP1A 2HFSA 3K0JA 2VDHA 2DNGA 4AXJA 4XO0A 5KG7A 3A8OB 4J9BA 4NA1A 2HFZA 5KT3A 1YIJT 3PHEA 4JJBA 3CNQP 4PUOB 3C66A 2JNJA 4S0MA 4Z89A 3PFEA 4OGEA 4QYZJ 3T5JA 3SV3A 3K5PA 1EETB 2IIHA 4USMA 5F8MA 2BRLA 3H5UA 3X20B 2EKYA 3CMAS 4I0WA 1S77D 1JLEB 4YTLA 3CJSA 4X1VA 4WU3A 5HSPA 1RAEB 2WRMA 2XMUA 3PW7A 4A48A 1VBZA 1Q53A 1OOTA 4JI8J 2WB4A 3BKTA 2XKOC 2V2KA 2AEFA 4RBTA 4U96A 3WC0A 1RWNB 5GAEI 4WPAA 4B3SJ 3LGFA 2CUBA 1RA6A 4BB7A 2F9DA 3WC2A 2MZSA 4JI0F 2QLXA 1NEEA 5B0EA 4FU6A 3UDCA 4USWA 2RMLA 3WQPA 1MGQA 2CPHA 5J2NA 2QQ9A 3W7BA 2JVRA 2AK5A 4HCZA 1PNJA 3KNGA 3P6YC 1ROFA 4JI6J 2BKNA 2IJFA 1X43A 4ECWA 1X0PA 1VQPQ 4U67Q 2DNHA 3TUIC 2V8JA 4DX8H 4QVDA 5HROA 1Q86T 3JCMg 3QIIA 1KTVA 3QJ6A 4KY3A 5U47A 4BE0A 1Y00A 1TAQA 4CM2A 2U2FA 2LCLA 1QVFA 3MMBA 1QTMA 1SV5A 5D15A 2KMTA 3CCMA 4M78C 3L9ZA 1EX4A 4AD6A 1UEVA 4PYAA 3MCSA 1XNRF 4CDIA 3NOCA 3BSCA 2EC2A 2UUBJ 4C2MA 1M2VA 2FVRA 3UDVA 2GFFA