3T9NA

Crystal structure of a membrane protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
269
structure length
266
Chain Sequence
YDIKAVKFLLDVLKILIIAFIGIKFADFLIYRFYKLYSKSKIQLPQRKIDTLTSLTKNAVRYIIYFLAGASILKLFNIDMTSLLAVAGIGSLAIGFGAQNLVKDMISGFFIIFEDQFSVGDYVTINGISGTVEEIGLRVTKIRGFSDGLHIIPNGEIKMVTNLTKDSMMAVVNIAFPIDEDVDKIIEGLQEICEEVKKSRDEGPTVLGITDMQDSKLVIMVYAKTQPMQKWAVERDIRYRVKKMFDQKNISFPYPRTTVILSEKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small-conductance mechanosensitive channel
publication title Structure and molecular mechanism of an anion-selective mechanosensitive channel of small conductance
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Membrane protein
total genus 80
structure length 266
sequence length 269
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3t9nA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t9nA03
3HDSA 3LGMA 3BM7A 1KVJA 2IFXA 1VQSA 4HI1A 5B0BA 1YRXA 4OIXA 4A46A 3KG1A 1P6TA 2HQIA 2K1RB 3K7RA 5B0GA 1FESA 1Q53A 5B08A 1YJTA 2XMJA 3I9ZA 2VV5A 4DPOA 2KYZA 2IYIA 1YJUA 2RK2A 2BUNA 1GXTA 4HL9A 1N5TA 3GZ7A 5T7LB 2QLWA 5B09A 3BDEA 2LDIA 1FD8A 1IUJA 2W4DA 1VQYA 2VH7A 1FVQA 3MCSA 3TOQA 1U7LA 2GQVA 1QUPA 3T9NA 2QLXA 3LO3A 2OFGX 3BN7A 1Y9OA 4HI2A 3CJKA 3VTIA 1AW0A 2BJEA 4U9RA 2PD1A 2AJ1A 1LQ9A 2LXFA 1VIFA 2XMUA 1CC8A 2GGPA 2XMTA 2AP6A 3HF5A 1V3ZA 1AFIA 1CC7A 2KT3A 1S6UA 5F0WA 1Q8BA 1TUVA 5KAKA 2P4TA 2LQ9A 3TRGA 2N4DA 2FTRA 4ZOSA 5B0CA 1JWWA 2BJDA 3BR8A 1N5SA 2AW0A 2OP5A 4DN9A 1TZ0A 2OKQA 3CJKB 1OQ6A 2QYCA 1SI9A 1K0VA 1Y3JA 5A6WA 2K7KA 4A47A 4HH0A 1KQKA 4A48A 1P8GA 2FHMA 2GGPB 3IWXA 1URRA 4OJHA 4QOTA 4F67A 1KVIA 2FIUA 3FRYA 2EW9A 4YDXA 5B0EA 3UDCA 1CPZA 2OD6A 2PGCA 3E8OA 2ROEA 4ZA1A 1YJVA 1RJJA 2N4CA 1XBWA 1Y3KA 2HIQA 2ROGA 3BF4A 1APSA 3BB5A 1YG0A 4A4JA 2G9OA 2XMKA 4OJGA 2OD4A 3BGUA 3HHLC 3KG0A 2N7YA 3QMQA 4YEAA 1TL5A 2BBEA 2OMOA 5F0UA 2FB0A 1FVSA 2HLUA 2GFFA 2ZDPA 2IYGA 2OAUA 2K2PA 1OQ3A 2RSQA 5B0AA 3HHLD 2RU9A 2ZDOA 3QGPA 2XMMA 1AFJA 3KKFA 3LGNA 1N5VA 3TNVA 1MWYA 1R6YA 2BYCA 5K9FA 2RK1A 1N5QA 2RILA 2W4PA 5B0FA 2W4CA 2OFHX 2XMWA 1WD6A 3FMBA 3DCAA 1Q4RA 3FGVA 2JDJA 1ULRA 3HHLA 1X8DA 2HLTA 2L3MA 4EFAC 2Q3PA 1MWZA 1JK9B 3HFKA 4Y2MA 3SFMA 5A6PA 2ASYA 1W2IA 2XMVA 4Y2KA 2GV1A 3KNGA 2GO8A 1VIEA 5IXUA 2GA7A 1FE4A 5B0DA 1OSDA 1X7VA 2HFOA 4HH1A 4DL0C 2K1RA 2LQBA 2ROPA 3IWLA 1FEEA 4NPOA 2ACYA 3WDOA 1Y0HA 3HX9A 3MZIA 1Q8LA 1OPZA 4OJ3A 4Q2MA 3F44A 4Q2LA 1S6OA 5T7LA 4FNIA 1SB6A 1X0PA 1YJRA 2QIFA 3HHLB 4NL5A 2KT2A 2K7JA 2CRLA 1TL4A 1SQEA 2RMLA 2AJ0A 3DXSX 1TR0A 2RH2A 2KKHA 4OJ1A 1FE0A 1GXUA 4FNHA 4Y2IA 2GCFA 2HFNA
chains in the Genus database with same CATH superfamily
1JLEA 1QAYA 2V50A 3QO9B 1C6VX 1FXRA 1F5CA 2V8GA 4HTIA 4MYUA 4J90A 2BJ8A 2J6TA 3I0RA 2IC3A 1K4US 1W6XA 5JVGQ 1PRLC 4WZQA 3KK3B 5GAMj 2E41A 1UETA 3U1NA 1VIFA 4ED3A 4N77A 2J9DE 1X2QA 4OB1B 1M90R 1HNIA 3CBOA 1CJTB 1Q8IA 4IR1A 3AAWB 4OZNA 2G2YA 2ZVIA 2E4HA 5C42A 2EFPA 4Z88A 4CLUA 1GX5A 4RW9A 2ZJQQ 3GB0A 3UATA 4J91A 1QLYA 1K0SA 1RCXB 4R8UA 1SKSA 1SBRA 4OHYA 2RF0A 4RW7B 1CQMA 5C7PA 1OX8A 4FPIA 5J2PA 4KUDK 1FXDA 1OQ3A 3D5MA 3KFVA 2W2PP 4MKBA 4QBUA 1IKYA 3NFCA 5IZHA 1YHQT 2Q3PA 3GYXB 2DZ9A 3SIPB 4B9VA 3A5ZB 4OI1A 1FJGJ 2VYTA 2CDTA 4NOHA 1JLBA 3GIRA 2IIMA 2KYBA 2C3PA 3D1OA 4A4KA 2ENMA 5KFLA 1S72S 1QLNA 4QR0A 3E1SA 2Z0WA 3P5BP 2J6OA 1OJ4A 2RHXA 5E3PA 2DRBA 3GMGA 1MMAA 2COLA 2V1QA 1BI2A 3NGPA 3KG1A 4ZLJA 5J3BA 1AWOA 4KO0A 1EETB 2MSSA 4O3RA 2XI3A 3N5BA 5ADZA 1ZM2A 3OYKA 4P52A 5ETLA 1UVIA 2NUTA 1BBZA 3MP6A 2K9GA 2KL8A 1XOVA 3DB4A 2J0QD 2CJ9A 2MYSA 5LJ5e 1RBAA 5J39A 1TXQA 8ATCB 5FRMA 1HHQA 3T1HF 4QIVA 2FVCA 3UDCA 2QMUB 4GLMA 2YRVA 1Y11A 3K58A 5L1JA 1NJZA 2OH2A 2AYMA 4X1VA 2L3SA 1OIAA 4YN3B 2RSQA 3T5LA 2DNKA 3KK2A 1FO1A 1FMWA 3V7SA 3CD5A 4N0AC 4C8QF 4DBQA 4N8OA 1VIEA 1BCOA 4TU7A 2RT3A 1HFEL 2D8JA 2V34A 5T7LA 5D0RA 2R7SA 5I2MA 3OY9A 3ISNC 3EGUA 1YIJQ 2R8KA 4X66F 4QQDA 3UQSA 3GSDA 1N5YB 4F50A 2JHEA 3HP6A 3G6VA 1KFDA 2BE2A 4FXWA 4FF3A 2VQEF 2KG0A 2LJ0A 3HD1A 2RJEA 3LGLA 2UVWA 1LNQA 2PQWA 1R8CA 3EG2A 1HBMA 2D1CA 3SQOP 2VQFF 3SCLE 3DFEA 4F36A 5HVGA 3BGRA 5KFVA 4Q5WA 3PR4A 4DA4A 3BSCA 4DS4A 2OPPA 1IHVA 3NGSA 4E7HA 2JJ4D 2MLXA 2V1RA 4CI0C 2YY3A 3TA2A 2DGVA 1S59A 2HNDA 2GFUA 5CKDA 2VJUA 1VQNQ 1WDTA 1I5OB 5KFIA 2HZVA 3VF0B 2ZH3A 1KQFB 1VUBA 2YVSA 2CAJA 2EGAA 1RCOB 3G6XA 1S1XB 4R0JA 5GVQA 4GC6A 1ARKA 4M5KA 1U48A 3I5SA 3BYPA 2FY8A 2IRXA 2EEYA 4HXJA 5H1SV 1HR0F 3T41A 1HW8A 3LGFA 1R0BG 2KO1A 4F0MA 2CRLA 1HLWA 2NXJA 3RR6A 1X5OA 1X4CA 4LF7J 3DHXA 2DGWA 3AJ2A 1T9YA 1NLPC 2ZNYA 4JI0J 2HVDA 3A98A 2KXHA 4PFOA 3VTIA 4NA2A 3IRXA 4M7AD 3C95A 1I3OB 2YWGA 3D6MB 1GT8A 1ABOA 4WK1A 1XNRJ 2AP6A 4DUTA 3UDLA 2KT3A 5F8GA 4XU2A 2GGRA 3DOMB 2FVSA 2RQCA 2ASJA 3PIOQ 4M7AG 2C3MA 3T1YF 4C2MA 2F63A 4LDVA 4OJHA 4KRWA 5FIIA 3BPDA 4QZVB 3MM8B 3OL8A 2KB2A 4WFBQ 1ZSGA 2CYZB 2MQNA 3OXFA 3A8IA 3ZNJ1 4USVA 5THWA 3IWNC 1OQKA 1VBKA 3AD8C 3V4MA 2RJZA 3H25A 5E0OA 1XTZA 4RUCA 3I32A 5C25B 4LDUA 3M0TA 1VQKQ 3CTRA 4E6RA 1WQ7A 3AJDA 4ZCMA 3BSOA 3A3PB 1F9EB 1N6AA 2HHTA 3EGVA 3R97A 5GMKj 3NY0A 2CP7A 1XNQF 3CC2S 2ALYB 3PKMA 1U2CA 3IMQJ 4LRAA 1U1TA 1O8BA 1K73T 4D3HA 3AOBA 3PCOB 3OL6A 1RADB 2RMLA 1ZHIA 3BQ0A 4M5IA 1WLPB 3BW1A 2RHIA 3RAXA 2AJQA 3GONA 2JWNA 2OTLA 3VS7A 4Y6IA 4M75E 1QW1A 3CC4A 4PWDA 4QJVA 4YHHJ 4NLPA 5D4LA 2P4RA 2DD5A 4AG2C 1UGVA 1K73C 5D3GB 4X4SA 4Y65A 4M7DC 2QL9B 1RWUA 4LF6F 3TO8A 3J7Z5 1VS3A 3C66A 5F41A 3I55A 4YTLA 1I6JA 2OSRA 1GBQA 4QW9A 4WFZA 2HQDA 4FS1A 2R3VA 3KUFA 4M75B 1HQ2A 4JUVA 2CNLB 1JXOA 2FD2A 1N8RT 4HH0A 1LWEB 5GAOr 4VUBA 2HVIA 3MCMA 1HQEA 1NEGA 1FRHA 1TKZB 1WNEA 3FKBA 1WACA 1RBLA 1PGZA 1H3HA 2EBPA 5CYJA 2WRMA 2NUHA 2QQBA 1FVSA 3Q89A 1WI6A 1N8RC 4I7FB 1SXLA 3JCMP 2APOA 1IGQA 3R6GB 3IP0A 3H8YA 2Z30B 2FVRA 4RG2A 1GNKA 3TX0A 2LNVA 1WG4A 4K4YA 3CXCS 2W7AA 4X4VA 5DLFA 4F7UA 1LW0A 3RAQA 2P6TA 2K1RA 3TCJA 2F1FA 2L9WA 3UA6A 1E6VB 1Q78A 2RRNA 1VBYA 3QLHB 3TSWA 1RTJB 2X4JA 2CQ2A 3J81E 1DZ5A 3ENWA 2EBGA 2O31A 4CO1A 4FW2A 1UJ0A 4CC2A 2R2SA 2XHCA 1RHKB 4B17A 3UE2A 1PSFA 4IUTA 4BI4A 2BA9A 4K50A 4C8QE 1YJ9Q 2MOXA 3I5RA 2CZ1B 1WJSA 2IYIA 5J1EA 2A7YA 2HHQA 5B09A 4NYZA 3QDFA 3LUYA 2C2KB 1KQGB 3RR7A 2CJBA 4OMMA 3SQGA 1YITS 3DLKA 3WX4A 2D1XA 3LP2A 3H6ZA 4J9OA 5KFXA 4DX5A 4ANDA 2FLPA 1YSJA 3AOAA 3BBBA 2COZA 4RWXA 3B6BA 1D8YA 3QRQA 2ZBCA 1TK0A 1VRTB 1YP5A 1NE8A 4IFYB 2UUTA 3EE3A 4OVAA 4EMKC 3MEEA 3TEEA 2RQ4A 2D3O1 3AH6A 3G8QA 1I81A 2G0CA 1M5VC 3M54A 1V29B 4JYAJ 2ASDA 2RI3A 2VPXB 4IQMA 2RKIB 4FYYB 4OV6A 2V6AA 2X4XA 1AZSA 2DHSA 4RTWA 2WB1D 2MEWA 4FXDA 4LR8A 1HHTP 2DE0X 2I5JB 2DNHA 1TUDA 2EBEA 3RR8A 2I38A 1RAEB 1LPLA 3MMBB 2XC9A 3MZIA 3KLEA 4I2PA 1HBUB 2M1HA 2ZJPQ 1W2BA 2LX9A 3LGMA 5KT3A 3GIBA 2QRRA 1U24A 2OTJQ 2Z58B 3TAMB 3HKWA 1OPIA 2BUNA 2VVKA 5IOLA 1FJGF 1WC1A 2LDIA 1AROP 2FLOA 1YJWT 2FJDB 1G8XA 3PACA 4F0KA 2E1CA 2VC0A 2EK1A 4X34A 1Y7PA 4ECTA 3PRVA 5G0RA 1HNXJ 2LQNA 3LP0A 2IA0A 2O88A 2D69A 4KY3A 4C8NA 3OMGA 5IHIA 3CDWA 2Y90A 1WOOA 1KQKA 3H0HA 3C6TA 4CNYA 1BI0A 1XBWA 4PJOD 1IKXB 2RRAA 2HHSA 3HFOA 3JCMX 2IM1A 1VQOA 2D6FA 1C4CA 5BJRA 3D3BJ 2EGEA 4PEOA 4ELYC 3POTA 3SDEB 2AJ4A 1VLOA 3ZEHA 4MT1A 1CJUB 5DM6Q 5KFBA 1A0NB 5IFMA 3TWZA 3WQPA 4PWUA 1H3ZA 1I1GA 5L46A 4DL0C 2ZVSA 1KNZA 1JQGA 4ZGDB 2I1RA 1SCJB 2B51A 4Z2XA 3KMQA 6FDRA 4LIRA 4DOWA 5E33A 3K5LA 1M2OA 4P71A 5C24B 4CQ1A 2ZPGB 2QMXA 3ISND 1HMVA 4ES2A 3N28A 1PG5B 2GIRA 2DCUB 4HDGA 5H9FJ 2RI2A 2AV5A 3TEGA 1G4CA 1ZPWX 3M05A 2VL1A 2GAHC 4ERDA 1RTZA 3U27A 2F8HA 1S7IA 4C92C 1YHQQ 1VQPA 2DYAA 1UFWA 3GV5B 2HQGA 1T9XA 1IBMJ 2N4DA 2E9RX 4DCJB 5AXLA 4LF5J 1DJ7B 2GIFA 1EP4A 3PGGA 2JLFA 1CS4A 1X5SA 3ELHA 4F16A 5HK0A 4A48A 2NZ4A 1VQMT 1PSDA 2P6SA 3UN5A 2DA9A 4ED6A 1TL7B 2E9ZA 4DL4A 5KT4A 2KT5A 2ED0A 4X4PA 4WFXA 1NUEA 2CP5A 4AQYJ 5GAN4 1HNVB 1R7IA 2GFFA 2OAUA 5HJYA 2B7BB 2EQJA 1KEKA 1FNMA 1S57A 3CCQA 1UVLA 4DG1A 4HCBA 2VFUA 3MCOA 2CPXA 4FL6A 2XYPB 1EX4A 4GO5X 1S6QA 2I8EA 4DN0A 2LDMA 1M1KT 3L9ZA 4F8RA 4ELTA 5KCOA 2HFOA 4JV0A 1RYRA 3G6ES 4K4WA 1KOOA 1WSVA 4U7UK 5LJ5f 2R4FA 4C3MA 4J9DA 2VODA 4QYZK 5IT9E 4ZLNA 1KC8C 1LEOA 1VQ4A 2MF2A 2HHVA 2BQRA 1Y10A 3IFEA 4ZPCA 2W7PA 1R0AA 3H2UB 3MGJA 3I9ZA 2HKNA 1HBOB 2H4YB 3QO3A 3HJFA 1RT3A 2K5LA 4JI5J 3TQ7P 1WF2A 1QAIA 3HP9A 3E01A 1TL1B 2C42A 1B3QA 1V9OA 1IM6A 2EYYA 1U6FA 5A8WB 3P45B 4Y28C 2AZ1A 3C16A 3CDAA 4I67A 1ZA1B 3AODA 5J2QA 4F4XA 4HT9A 4JI0F 3L3CA 4PG6A 3CO0P 1RWWB 4V2SA 2KE9A 2VOPA 1OO0B 2EVZA 3NAHA 5GANj 1XNRF 1SEMA 2RM4A 3CMAA 3BSAA 1PC0A 5EDWA 3OW2A 3R27A 1FWZA 5E5NA 2EC0A 4DSLA 3G71S 1CSKA 3KKFA 1GFCA 5GJVB 2ZBPA 4DV3J 2B56A 1NJIR 2CQBA 4J37A 4CH0S 1J5OA 4OI3A 2PMZD 3RUBL 3W3SA 3RB4A 2E7XA 4NYOA 4DUZJ 4E98A 3PV8A 3D0IE 3D66A 2PA8D 3PX0A 3H8ZA 1VQ6A 2YT6A 1S49A 1ZETA 2BM1A 1M4ZA 1OSCA 4RW4B 3M4YA 2HYIB 3C2PA 2K06A 2WSCC 4NMXA 1RT2A 2AJ0A 4MKYA 1I5LA 1U1SA 2MQ8A 2MZ1A 3CCRS 1U06A 2HFUA 1RAIB 3SCIE 5KYWA 4DWIA 3VS1A 3HT3A 1U1KA 4LBIA 1JIHA 4QIGA 2RJFA 5KFCA 2J7KA 3TJ9A 1KD1R 2V2QA 4WKYA 4PJNA 4LDWA 2YX1A 4PUOA 4IG3B 4M7DD 4ZP9A 2HVEA 4IQXA 1WG5A 3PZPA 2EQUA 5DQIA 1UE9A 2YLCA 2N3OA 4CH7A 4YHHF 1NCLA 1FX2A 3M0SA 2Y8YA 1KLMB 4Q8EA 1URRA 4X4QA 1IKVB 4M7DG 4M7AF 3E8OA 4JI4F 2E7WA 3JAMU 1O75A 3E3XA 1WHMA 3QHSA 2VG5A 3OL7A 1RHQB 1NHVA 5K20B 2BBEA 2HGNA 3LH5A 2RU3A 2EYZA 4NS5A 4I64A 1QJHA 5J2MA 3Q2SC 1WOSA 3QPIA 4JV1A 1T02A 2OI3A 4IDKA 4MMLA 1YWOA 1MN7A 1Q4RA 3BSNA 3HPWA 3KJNB 1JJHA 2ZKUA 3PT9A 4J6XA 2YQ0A 3JSRA 1G1XA 5LMNJ 2JTFA 2P0PA 2FPHX 2VONA 5KFJA 2X7IA 3AB4B 2A10A 2GZOA 3VCDA 2YNFA 1Q7YU 1O6XA 4CM0A 1NG2A 1H2TZ 4OX9J 4AFSC 1TKXB 4BE2A 1RBOB 2D41A 3GBQA 2HEKA 1NH8A 4HEA9 1ZTWA 1VC6A 1LWCA 2FJVA 1SHFA 3CC7S 2Q6CA 2K5FA 3W2WB 1QSLA 1C0UB 3UD3P 2GGPA 2MY8A 3G9CA 1FTRA 1V3ZA 4WP9A 2YUQA 1T9TA 2FZKB 4LXCA 1HD3A 1OQ6A 3HZGA 3A13A 3M6UA 4M7DA 3NGTA 4ZLPA 2QEXT 4AL5A 2AYGA 2LTOA 2G13A 2FIUA 2JZ2A 3LOUA 1PC5A 4FYVB 2O5DA 3CD7A 5U47A 5LJ5j 2IMOA 4FF4A 5M2UA 4L76A 2ABLA 2ZC4A 1SL0A 5I22A 2XMKA 3A8HB 4TQRA 2DO0A 3UW1A 3VAJA 4WU3A 1VQ8S 1FX4A 2CPYA 1NK7A 1DARA 1UFFA 2XI9A 5K9FA 2XMWA 5GAN7 1WD6A 1QVFA 2SEMA 3NWRA 3EICA 3UA7A 4C48A 5FU7B 1RTIA 2GW8A 2UU9J 1WELA 2M51A 5B0DA 4UT4A 3RERA 4LSNA 2ACYA 3DGVA 4JYAF 2QASA 2M7SA 2NPFA 2E44A 2MZRA 3MEAA 4NXMJ 2GQIA 1V3SA 3CCSA 3FC9A 4LR9A 3JSBA 5CD4H 4MYTA 3CJQA 3M30B 2DR9A 5F3TA 1NK9A 1EX8A 2DR6A 3GV7B 3T9NA 4IKAA 4XO0A 4L59A 1MHNA 1X60A 1EJ7L 4WE1A 4CM2A 1ZX6A 1PJ6A 3VS5A 4FXVA 1Q81R 1W2BP 2DMOA 1UECA 2HBYB 2DEJA 3HTRA 1UGQB 1XMBA 1KG1A 4OFZA 3EPGA 2BOAA 1UEKA 2KJWA 2WOMB 1I07A 3MM6B 5IV3A 2RF2A 3RW7A 4PG5A 3LALA 2Q6BA 1HNXF 4FBUA 2G0JA 3CPWA 1HQUA 1GL5A 4OZ1A 3EZOA 2R7XA 5D3GA 1NEEA 3M8PB 3PR5B 3FSXA 3ILIA 4EMKA 1FYNA 3D6FB 2CQDA 1FNXH 3JAME 1U0HA 2ZGWA 2ZOMA 3CCEA 2ZBIA 2HVZA 4JS5A 2LRQA 1SKUB 5D8HB 4KR0B 3EPIA 3HCXA 4K59A 2LT4A 1S1WA 2DNZA 3C6UB 4M5MA 3MAAA 2FVUA 1TK5A 2V8JA 1VI7A 2P0QA 4ECXA 1WC0A 1IXKA 4OGCA 5FRNA 1BQNB 6AT1B 5CYQA 2V9WA 4C92D 3DOKB 1ZS6A 3K5MA 4LD9K 4ANJA 1N34J 4U8VA 2X3XD 1JLFA 3CCJT 1R8HA 4G3IA 3KXTA 1Q82R 4M5GA 2YUNA 4C92G 2B43A 4KT0E 5D6WA 3B4MA 1GQEA 3EG0A 1ITPA 1YIJS 1MMDA 4ID5B 4AE5A 4E7SA 2HFVA 4LF5F 2QYZA 2R8GA 1KS2A 5HK4A 1YJWQ 1N5VA 4M78G 4GVBB 2KVQG 4F04B 3E9GA 4PJOF 2EFQA 1S9GA 3RYLA 4KKOB 5H9EJ 4EYIB 5HO4A 3KBGA 3VYHB 2MK5A 4AQYF 3SWNB 4JRKA 1ZZNA 2DHGA 3O5ZA 3CCZA 5KG7A 3GNGA 1ZA2B 1CULA 3ZZPA 2M0OA 1XERA 5KG3A 3QNWB 1TV6B 1RT7A 4RX6A 2ROTA 1UGPB 4EZ6A 5HKCA 2MQQA 2DVJA 2M02A 2CG8A 2QTXA 4DU7A 1M1GA 4F2SA 1VQNS 1T03B 5ETTA 2EI5A 4J9BA 1IUJA 2RHSB 2W4DA 4B3RJ 2NUUG 3IG1B 1G3OA 2Y0SD 3CCUT 2XS2A 4WTYA 4AT1B 1U2FA 4NMLA 3CCLA 2LQ9A 5D4NA 1Q1KA 4B3OB 2LQKA 3LQVA 1K0VA 1NPKA 4K7QA 2RHYA 3RDVA 1OX9A 2DIQA 3GILA 3TQEA 4C92A 4JUZA 3OR1A 4JI5F 2R7UA 1JLCB 2MLYA 1DLOB 2OPSA 1VK3A 5HATA 1IR1A 4M78A 4XK8E 3FCVA 4GC7A 5A8RB 4ZIVA 2VB6A 3CD6T 3PW4A 2JDJA 4CLZA 1TH7A 1S9EA 1WXBA 2E3HA 3PE0A 5CZXA 1FDDA 2JEIA 4ER8A 2QXFA 4I6WA 1VQ7T 1RLCL 2W2QP 4C7QA 3LAMA 3OW2P 2IMWP 3R6OA 3AQPA 1VQMQ 1ZSZB 5EX0A 4DV3F 3HSBA 1VQSA 3TJAA 1XK8A 3KJQB 2DXFA 3JQMA 1T0JA 2XSFA 4QR2A 4DUZF 1SQFA 5HN0A 4QW8A 1T0HA 3V81A 3BN7A 5HROA 1Y0MA 1LQ9A 3Q8QB 1FRMA 5GAGI 2BACA 4AFZC 4JS4A 1VQKS 3CWJA 1Q86T 2MKYA 4J9FA 3I56A 4CLTA 2L08A 3KDOA 3K5OA 4MFBB 4ZJOA 4F67A 2EG1A 3BQ1A 3OYHA 3FRYA 5B0EA 2BEFA 3FDSA 2GVDB 2CQHA 4OMFB 3D0HE 3ULRB 3KFWX 2ZH5A 5HP1A 1VQLA 2AU0A 2E1HA 2IVWA 1Q86C 2PFDA 3V6DB 1TFWA 2F8MA 2V8DA 2K2PA 3Q1JA 1FJ7A 1R31A 2XHWA 1RISA 1ZZFA 4Q0BB 4OV1A 2CADA 2CNNB 1MWYA 3FNNA 2FHJD 2RK1A 2ZPFB 2ROLA 3WZ0A 2DGQA 1VBXA 1R77A 2N82B 2J9CA 3HFKA 2LEAA 3QJJA 4UOFA 1VDHA 4Y2KA 2FGOA 2XI2A 1WJQA 3W60A 4NX9A 4J7IA 1SKWA 4QR1A 2ROPA 2DEIA 4IR9A 1UWBA 4EBDA 3DU5A 1RXOB 1SHGA 4LF4J 3E19A 3FBCA 3DMJB 2YRCA 4C5GA 4CCHA 1M3AA 3DXBA 2CQCA 1RI7A 5A0GA 4X2BA 1E6YA 4HT8A 2MPXC 3JS9A 1VQYA 5LMNF 3QIPA 2CZ9A 2ATLA 2IAJB 3NNHA 1QVGA 2BRLA 2ZPIB 3VUBA 1YI2A 3R5JB 3QXEB 3MAHA 4NA3A 2K3KA 3SEOA 3R1HA 1YJNA 2KNBB 2UUWA 4DMZA 2XBPA 3EFSA 4DV7J 5I11A 2FPDA 3IBWA 4OX9F 3QFWA 5LJ3j 3R5BA 2AJ2A 1E6GA 2ED1A 3BREA 1P8GA 1WNLA 3EG3A 1NK6A 2CYYA 1N6QA 3VYGA 5KG1A 1D9FA 2FB7A 3RB3A 2KRMA 1TU0B 1YG0A 4BB7A 2E1PA 4K4XA 3ZZZA 1XNIA 2JRSA 2FB0A 1K9AA 4WIIA 2AK5A 3ZTRA 4PJMA 2GHPA 2LA4A 4ECVA 4RU9A 5L1LA 4HCKA 3T3FA 3RRKA 1YJ9S 1P1LA 4RPFA 2C2OB 4FF1A 2GQCA 5KFTA 2EJGA 3VALA 1DRZA 3A1YG 1BQXA 3MI7X 3MKDA 3H5UA 2Z8QA 3PIPA 4UQGA 4F4YA 2H5EA 2AHJB 4V19X 2XB2D 2H54B 1S0MA 4Q2LA 1HI0P 3H42A 2DD8S 4X84A 4DV4J 3I5CA 4JLIA 4NOYA 4QKUA 1QVFP 4C3KA 5J2NB 2IDLA 3Q8UA 4PJOE 3OQ2A 2DF6A 2JFDA 3AB2B 2MY7A 3DKMA 1FESA 1JNZB 4JI7J 2RK2A 3BDEA 2UU9F 1RAGB 2D0QB 4M5DA 2QSFA 2EXUA 5I2SA 4M75C 4JPBW 3Q86A 2V94A 4HVVA 1DTQA 5GAN6 2IVMA 5I3QA 3HMJG 3W5XA 4NXMF 3MUTP 3OYIA 2AEFA 1SI9A 2MAMA 2HQXA 1IO6A 4C0DB 1K73U 1HW9A 4YDXA 4DL5A 3I5BA 3CPFA 4M5JA 5BR8J 1UZDA 1C0MA 3NCQA 2KAFA 1RA6A 3HHLC 1H98A 1SH2A 7FDRA 1BQMB 3CJ5A 5L38A 4DBHA 1S1TB 3GYGA 4K4TA 3JCMg 4TYBA 3ZFVA 2OTJS 4CTAB 4MTPA 2EC2A 1VYUA 4P2FA 2R58A 4ZIWA 4PPDA 2LJ1A 5DG8A 3VS6A 2HLTA 4LQ3A 2COYA 3CJ3A 4IFVA 2ASYA 2BQUA 2EJ9A 1G3YA 3RMSA 4GKJJ 4QU7A 3M2RB 1N8RU 1BI3A 5LSLA 5KFOA 3CPWP 2QEXQ 4ENOA 2EKHA 1X0PA 4M77E 3UWNA 3GOXA 1BLUA 3PYEA 1S72A 4J9QA 4AMCA 1RT5A 4ZPBA 2IFXA 2CDRB 1C0TB 1LVKA 3D4JA 2ZD1B 4OZ0A 3OUYB 1KQ2A 2KYZA 4QPTA 3DGPA 3OSSC 2HZAA 3IS9B 4AUKA 3S7RA 4X62J 2O4XB 3AQOA 5L8RE 1QDUB 4M77B 4C8QC 2CREA 2RE1A 5D7UA 3VS0A 2BW7A 3U1MA 4WU2A 1V76A 4YR3A 1D0XA 4GVLA 3RBZA 4DV5J 1YWXA 5AT1B 3BH7B 3KOAA 4RW8A 2OPQB 1K8AC 3VGVA 1BY9A 2KTQA 5L23A 1KQSS 2AX0A 1RWKB 3EDRB 1C1CB 2KMTA 4ZTJA 4HACA 4J9GA 4ATOA 3IR6B 3GFXA 1D3BA 4JJCA 4DUYJ 2R5MA 3UCZP 1Q79A 4A8YA 4PQUB 2HLUA 4I0WA 1SIZA 1PAUB 3KLHA 2V8HA 3BO3A 1Z9ZA 4L72B 1N34F 1AZGB 3MD1A 5LMUJ 4Y2MA 5AJ3F 1Y07A 2YKMA 1FMKA 2N7CA 4N56A 1YHQS 1WC4A 4R5PA 2CG4A 4EGLA 2AMCB 2QG9B 2DTJA 2LZ6B 3FZ2A 3KLIB 3NWGA 3M2UB 3A8GB 2UXCJ 4DF8A 1MW7A 4KULA 3K8WA 3ETOA 4TY8A 1QE1B 2RQWA 3HHDA 3QGGA 3K0JA 3FB9A 3THKA 2XZDB 1Q5VA 5EWFA 3T5JA 5J1PA 2LCLA 2HVHA 1RHJB 4ECYA 1R8PA 4DV1J 1HPZA 2BZ8A 2HDAA 5JXSA 1NZ8A 1UGSB 4ZPWR 2C22A 3FEOA 1TZ0A 2CPFA 4LDXA 2H65B 4WFYA 2J9EA 2P8IA 1NJWA 1BB9A 1D9DA 1Z9QA 3DDKA 2BXJA 3ZZYA 1HHSA 2ECZA 5KG2A 4B3RF 1UMJA 2ROEA 2X3GA 2HIQA 4U7CA 3FRZA 5KTQA 2BUDA 4OHVA 3NBPB 2J9DA 1NLKL 3O3LA 1RWXB 2ZDOA 1WDXA 2AJFE 4MIAA 4CC7A 3L09A 2O66A 3NAIA 1X6GA 4MZPA 2HSPA 1T05B 4YR0A 4H4KA 5GAMg 1S6PB 2AEMA 1FE4A 4FIBA 1OYEA 1UPPA 3ZZOA 1NKCA 1DAXA 4BY6B 2LP4A 2CP3A 3P8DA 2G1DA 4YB6A 4IRCA 1IQTA 3CCJQ 2VG6A 1TL4A 2HK3A 1KTQA 2RB7A 3LW5E 3M8QB 4KFBA 4MK8A 2CH4A 3RBBB 3PNWC 2XSJB 3H0IA 3EJMA 4HI1A 1R8OB 4BLGA 2E9TA 1DQ9A 2UUAJ 4O3SA 2Y1IA 4MMKA 4YY3J 2F5TX 2W0ZA 2GQVA 4O6JA 3CB4A 3IRWP 3MCNA 2W9BB 5LJ3Y 1VOMA 1JLEB 1WC6A 4KUIA 1ZLMA 2HBWA 1EFNA 2ZH9A 5F8JA 2YH0A 3I0RB 2IC3B 4FN5A 2PA3A 2CQIA 1EKSA 3KUHA 2I6WA 5EWGA 4NXNJ 4A8KA 2FPEA 1KFSA 1N88A 1Z4UA 3OMCA 1HNIB 4RTXA 4Z7YA 3A8OB 5C42B 5A0YA 1FX7A 4YEAA 2A2DA 2K7AA 4OYBA 4RW9B 2DL3A 5KOXA 2KI7A 4R8UB 2GJIA 4L75A 4G1PA 2UXDJ 2W4PA 4F3MA 4PG4A 3HK2A 3W9JA 1XC9A 1DBDA 2C2NA 3CCUQ 4B9LA 5J2PB 3B82A 3MOZA 3DHWC 5CCLA 2HNZA 2WBRA 3NEKA 4FZVA 2HD0A 4J9LA 4DSFA 4HKQA 1Y4ZB 1IKYB 1FXLA 4X64J 3CC2A 3S8SA 2EKYA 5E7OB 4RG8A 3Q24A 4NI2A 2GCFA 1JLBB 3B78A 2VFRA 4ECRA 1PKTA 5KYYB 2DHXA 4DDFA 1VIXA 2EKOA 2OFGX 3CD6Q 3HVAA 1SPKA 2HMIA 3SYZA 1QUVA 2XMTA 2NSBA 4KO0B 1K9MR 5KAKA 2YKPA 3VGUA 2QFJA 1B07A 4ZP6A 5AXKA 3N5BB 3D68A 1HYSA 1VQ7Q 2J0XA 4F4WA 2QT7A 2HRYA 1FKAF 4D8KA 3MEDA 2NUTB 5BXIA 4ECQA 1QVGP 2DGUA 4RZRA 5K5MA 2DERA 4ILLA 2WZ1A 1NB7A 1WHVA 4RBUA 4DV7F 3OYLA 5B0AA 2J05A 3JXOA 1WGSA 4YB7A 2KHCA 3ZO7A 5EC7A 2QGFB 5DQHA 1IKWA 3M32A 4UOCA 3SI8A 1NJIT 2I2YA 4LUDA 3P4UB 4F17A 3UNYA 2WVCA 3VAHA 3CXCA 2WACA 3VRYA 3VV2B 3M2VA 3KK2B 3M8ZA 1XTDA 2HBPA 1F6TA 3SCJE 2QE5A 3DRSA 2CWXA 2Q43A 1SRMA 2KKHA 3QJYA 3LA0A 3R7NB 4A63B 1B4SA 4KTQA 1JU5C 2DZCA 5A0LA 5T7LB 4F4AA 1EAYC 2DGSA 3GPAA 2DTOA 1Y9OA 2PVOB 5IT0A 3PFSA 2Q1LA 1KD1T 1YITA 2GVZA 4DV4F 2LCCA 4LN2A 2O1PA 4M75D 4QPXA 4M94A 1P92A 2OEJA 4C9DA 3W8GA 2P5VA 1V5IB 3Q8RB 1YBTA 1SJ1A 3OYMA 4JI7F 3ZL7C 3AA8A 3N01A 4N8NA 1HBMB 1F60B 1MMLA 4H4MA 4M75G 4LF9J 2FY1A 5CZVA 1TSFA 2ZH6A 5FWBA 2EAYA 4ZPAA 1BD6A 3GPLA 3BGRB 1RKJA 2MJUA 2YQ3A 3QMQA 2OPPB 3LP1A 5E2QA 5FLXE 3FVYA 4JI8J 2YBVA 2EFVA 2EFGA 2WAQD 3MOJB 3HHLD 2HNDB 3P5TL 3GQCA 4F0HA 3CJ0A 1Z2LA 4GKKJ 1VA7A 1YDLA 4OZJA 4A8SA 3OT9A 1HNZJ 2DNPA 1U8WA 1UFLA 5BR8F 1AT1B 2GF7A 4LBHA 4TQSA 4HH1A 1Y96A 3M55A 2IVFB 3OSPA 2LNHB 1FEEA 1MLAA 2O9VA 4Q2MA 4CO2A 2PMHA 1KVKA 4W90B 1M3BA 2FPFA 2VKZG 2HHWA 2CPJA 3O5TB 2QLBB 2UZAA 4DPOA 1KFZA 1KN6A 3V6DA 2ZBQA 2MYFA 1N5TA 4WFAQ 4ICLB 1E6HA 1FMVA 1X6OA 1K1QA 4GKJF 2XNQA 1IN0A 1SH3A 2DGTA 5C6SA 3J7ZT 3D67A 2HHUA 2LA6A 4CYUA 2HL5C 2JOYA 3TVYA 1RGVA 3TRGA 1EIYB 2DITA 3CCWA 3HKSA 3AY0A 2YXYA 4DFKA 3IRXB 2DH9A 4LR7A 3EGXA 2EGCA 2F40A 1F9HA 2YKOA 1UAWA 3FC3A 2CNOB 3HT0A 4C8QG 1HBNA 2NPIA 1OULA 3FEYB 2W9CA 3JCMh 4KIAA 3EDQB 1C1BA 2ACMA 2SRCA 2ADCA 4DV5F 2NXNA 1WA7A 2X35A 1G2BA 2RQRA 2XMMA 5HI7A 1NHUA 5IH2A 2RQMA 4WP3A 1GBRA 1ICEB 1PRMC 3N0VA 5BYQA 5IT4A 2XMAA 3I87A 5I3UA 4DLEA 4DV2J 2LQWA 2F2XA 3HHLA 3IQLA 2BZYA 1N36J 4L3KA 2NYHA 3W5ZA 3PEHA 4KH1B 3KK1A 4EEYA 4ANCA 4PXCA 1YCYA 3UR0A 3FBBA 1VFJA 3G4ST 2RQUA 2LLZA 5LMUF 3M9QA 5ETQA 3L95X 5GAN8 3LF0A 2QLWA 1NMEB 4JJBA 1U02A 4O5VA 5ETVA 3V7RA 5GAOp 2J7WA 3TVKA 4MIBA 1PBUA 1YJWS 4PWDB 2UP1A 4DJBA 4NLTA 1LWFA 1BHNA 5GAGU 2UXCF 1UZHA 1Q81T 1S1UA 4GY5A 3LPEA 2I9SA 2H5JB 4C8QA 2HWTA 5KCHA 2XGPA 5E3QA 2AZSA 3VGSA 1WXTA 2B3TB 5GADI 3CULA 5CO7A 3L42A 5ETKA 2E6NA 2VHGA 1S9FA 2CQGA 1YCSB 4X65J 1XR5A 1HQEB 2YTCA 4ITSA 4DF4A 2ZKTA 1MROA 3L2WA 1IJFB 3URGA 3KLVA 4PNOA 2R8IA 2R5AA 4F7UE 2QK0A 4PLLA 4FYWB 2VUGA 3I0SA 4B9SA 3RIRA 3BV8A 3V2UC 2DTIA 5KG6A 1BI1A 2QAZA 3Q0AA 5DRKA 1FNOA 4OB0B 1RWOB 3NCPA 3EGDA 2HQHA 3G6EA 3RTVA 3OYBA 1TAUA 2JUFA 5HSPA 3B4DA 3C94A 5D4OA 2HFNA 4F7UB 1LW0B 1TKTA 5KYXA 3IN5A 2K1RB 1REVA 5B08A 3OBIA 3MEWA 2JFKA 1GXTA 1VQ9T 1N52B 1P9QC 3ADAC 4HHUA 3R5GA 4JRPA 6FD1A 3M57A 2BVZA 3GLXA 1HSQA 1H7XA 5J1EB 2CPEA 5GMDA 4B9XA 3UVJA 1VC0A 2V63A 2KEAA 3TZXA 1VRUA 1W26A 1SF9A 2NCKL 2WK4A 3SQGB 4AXJA 2UUAF 3DLKB 2EFOA 1VYAA 1U3OA 4YY3F 3LP2B 4DL2A 3WIUA 1R8BA 2WCXA 3HVTA 4ZA1A 1KQ1A 1IRXA 2W7OA 3GIKA 4ZCLA 3T9ZA 2OD4A 2HRTA 1VQMS 2BW2A 2L9DA 3QG1A 1GMUA 4KE5A 3X3UA 1PC4A 2J7UA 2XDDA 3WIVA 4KT0C 5GAMh 3SHWA 3G71A 2K6DA 3W61A 1ZOTA 2D3UA 4NXNF 3VS4A 4P5NA 3MEEB 1M2VA 3SWNC 5FROA 2A3LA 1X8DA 2L3MA 3N5FA 1W2BR 5KH6A 1H72C 1F3VA 2CZVC 4EUVA 2AT1B 1AZSB 3MCAB 2JT4A 2QA1A 2YKNA 1RE1B 1G6BA 4AFFA 3MP1A 1LV5A 4OJ1A 3VU3C 2BE7D 1BE4A 2E5LJ 5GMKi 1JQQA 3CBPA 1VHIA 3CCRA 4OHWA 1HKAA 4BHQA 3KLEB 4I2PB 2ATCB 3TOQA 1WC3A 4HI2A 1XJWB 3IGVA 3BEGB 4X64F 5ITHA 3REAB 5DS7A 3KHHA 1BKBA 3HRUA 3JSMA 2J6FA 4DI6A 2EWHA 3D0GE 3TZZA 3QJ6A 4K5SA 1N5SA 4DN9A 4RR5A 1OPLA 2K4YA 4B3SJ 2C2DA 3QAEA 3PXGa 4JI6F 3HI9A 5G0RB 1X75C 3LP0B 2DHAA 1PYTA 2DNQA 4DL3A 1J3TA 2AHOB 1D09B 1URNA 3C6TB 3A3NB 2DH7A 2PSZA 1B7YB 3OYAA 4ECSA 1OS5A 2JVOA 3N6MA 2X4WA 2DNLA 4UW2A 4XK8C 4ZHRA 3TVZA 3MWBA 3AJ1A 3DRXA 3POTB 3VS3A 4J8OA 5DQGA 4OJ3A 2L0AA 1AWXA 4AXIA 2JEFA 1X01A 4O3OA 3JCMd 4GO7X 4G6VB 1J2VA 4ZVOB 1WSRA 3ET6A 3OXGA 3M0RA 2IRUA 4QIEA 3H5YA 1R27B 3NRBA 1S12A 3CNQP 4O4RA 1GXLA 3CXCP 2DFUA 2DRKA 3BY7A 1GCQC 4A54A 1UFKA 4DQIA 4R0EA 4DR1J 2NREA 3RKWA 1HMVB 4J9MA 4JJDA 3PKYA 3CC7A 2KH9A 1QSSA 3DNCA 4PJLA 1N9RA 1HNWF 1KBRA 2R7TA 4ZOSA 1GMWD 4BE1A 1ZAWA 2MZSA 4F14A 3GU0A 3E9FA 2XG8D 5CQYA 2G6FX 1KVIA 1NSKL 4DCPB 1W25A 1CJKA 4FKXA 3LANA 4XTVA 1G5VA 1EP4B 5IWAJ 2G1HA 5FD1A 1CS4B 1RT1A 4M5HA 2XYHB 1N54B 3H2VE 1VQ8A 4WK3A 1RABB 5IV4A 2HEQA 2QJ3A 2MHEA 1FKPA 4IH5A 5F9NA 4LBPA 4LF9F 3HFNA 3OSNA 1Q86U 2HBQB 2EPDA 2K3YA 5E3CA 4FCYA 2NLWA 4DG1B 4JI8F 3OS2A 4MK7A 2NYSA 1Y0HA 1S6QB 1S1VA 1SQEA 1HK9A 3M6XA 2MDAA 5A0DA 4JBCA 3OTOJ 4DSKA 4IRDA 4KC5A 2KROA 3J7YI 2YKQA 4H54A 2DO4A 1HNZF 3K7RA 4IUVA 3BGFA 3JB9k 1NDPA 5GANg 5CHCB 3CGIA 2C0TA 4CLYA 5L1IA 2LEBA 2ZZTA 1X5TA 1R0AB 1RB0A 3NMRA 3QBCA 5EGYA 5MLCV 5L1KA 3VZHA 2JOQA 3VQTA 4A8FA 2XQCA 1RT3B 3HXMA 5IM0A 3OW2R 3E01B 1S0NA 3M59A 3S1TA 4UC4A 4KSEB 2HZYA 2PGCA 1GMWA 3C16B 3ICLA 2QEXS 2ADBA 4M75F 3WC2A 2XG8A 2RVJA 3QYYA 4I4BA 3BN4A 2JLEA 1BYMA 5J2QB 2ASLA 2ZM6J 1SQGA 2H48B 1N32J 5KYYA 4DQ2A 1WYXA 1KHWA 3OS0A 1WJ9A 1K1ZA 4C8MA 3DLHA 1EHWA 2MKIA 4Q8FA 3X25B 1IWGA 4ME7A 1X7VA 1WTBA 1XWLA 1J5OB 2RH3A 2X1AA 2XWXA 3CSKA 3RU0A 3C14A 4DV2F 1N56A 3BE3A 1WI8A 1UVMA 5GAMd 1FJCA 1SSFA 2EYWA 3RMQA 3O1LA 4PJOC 1RT2B 1IXDA 1RDRA 1AW0A 1F0XA 2KRRA 1TKDA 5KYWB 4CLPA 3L2VA 1TUVA 5GMKh 1OYXA 1ZM9A 1VQ5T 4DZ6A 3QUIA 3AXMA 2GTOA 3MM5A 2AD9A 4PUOB 5D4PA 1TP7A 4QOTA 3IR5B 4DX8H 1FK9A 9RUBA 4RNNA 2QA4T 3SZ2A 4KV8A 1F3FA 3MR2A 2X51A 3GYNA 3C0CA 2RS8A 4IO1A 2ZITA 4C0FA 2V2KA 2CSIA 1JMTA 4O0NA 4A4GA 2PZ1A 3CCVT 2L3RA 3QGPA 4G65A 1YIJA 2IM3A 4TYAA 3AOCA 2AYEA 3S3OA 1RLDA 5KT5A 2VG5B 5T41A 3T1AA 2DR8A 4NL3A 2XMFA 4ZVHA 4XTWA 4ZPVR 2I0NA 5J2MB 2RD5C 2D7SA 3UCGA 4IDKB 1QKXA 4OI6A 4DU8A 1M1HA 4OX8A 4PYAA 2LKZA 4NZ6A 1VK8A 2F1LA 4WTOB 2CSQA 1KONA 2U1AA 2DIGA 3TANA 3PYDA 4GLKA 4DOVA 2OUGA 4J7FA 1Z1ZA 5LJ5g 4OZ5A 2V4JA 4M77C 3KJFB 3SXLA 4RTYA 4OHZA 1N9SA 2DNOA 2YNFB 1FERA 2BM0A 1K73R 5ETPA 1U7LA 4QCLA 5IN1A 1VQNA 4WCIA 1X4AA 2ZOFA 3GE9A 2PC6A 3L2UA 1G7CB 3EG9A 4K0KJ 3BGOP 1EB0A 5L8RC 2P4TA 4QQGA 4CDIA 1LKZA 2G2OA 3J81U 1LWCB 3M4GA 2YWFA 2GGPB 1P9YA 1T7PA 1HI8A 2Y0BB 2IG0A 3G4SQ 1QVFR 2KT8A 1NZAA 4BE0A 4AYBD 2OJ2A 3J7AN 3CCJS 4M7DB 5DDPC 1RI0A 2QI2A 4D6WA 2MKJA 3CW2C 1FDNA 2CNKB 3R7SB 1N8RR 4DPTA 4U67Q 4KGVB 2VOOA 4CLKA 2CQ4A 2BX6A 1AZEA 4AL7A 3QATA 1K8AU 4LF2A 3OTBA 2KYMA 4ICLA 2XZTB 3FCWA 1N0UA 1N5QA 4QWEA 2VFTA 4G1IA 4E2FB 2HG4A 3IO1A 1JXVA 2OMLA 5CKEA 1QY7A 1W2IA 2R8JA 2VD3A 1LK5A 1YVFA 3HFVA 4XQ3A 1JJCB 4L6V3 4LFBJ 4YQWA 2IY5B 4C0ZA 5KFGA 3O2IA 2KK4A 2VASA 3K57A 1RTIB 4M95A 2KRBA 3VGTA 4PABA 4A46A 4LSNB 3PIOA 3L2QA 2MZTA 2DNMA 2H4WB 2DXEA 3ITHA 3H4DA 1B7TA 4U96A 2A37A 1SL1A 1DY3A 4ECUA 1BGXT 3V5RA 2C3YA 4E7ZA 1F5AA 5F0WA 4WJBA 2ZH1A 5D6XA 3NTHA 3H90A 2E5LF 3CCUS 1VQKA 2O3DA 3M56A 4WF9Q 5KT6A 4HR2A 3CPWR 4WP8A 5KFEA 4WE1B 5CH7B 3N4WA 2A1BA 3HPOA 2DXTA 4LD6A 4ZN3A 3GP8A 3TQ1A 1APSA 1TVRA 3M0QA 2M3DA 4FM4B 2A6OA 3KTQA 4DEYA 1VQ9Q 2ZH8A 2MKHA 1RLQC 3OJUA 4GMKA 3LWMA 3MXHP 4B3SF 2RF2B 1H2UX 2W4CA 4RKUE 3M0PA 2BZ2A 4YUDA 1GEHA 4BY6C 1RAHB 4EPCA 2IM0A 5E3AA 2ZZMA 3R5AA 3TUPA 2XKOC 3CD6S 1RSCA 2D74B 1MSWD 2LC4A 3SB2A 1HQUB 4J9NA 4LUEA 4C97A 4XDDA 3EUNA 2B8QA 1YX2A 4C98A 1U1OA 1QAJA 3LAKA 1YN8A 4ES1A 3QRPA 4EMKB 3H2LA 1VQ7S 1UJ4A 3LTOA 1U0HB 3EMTA 4O3NA 5B0BA 3QIDA 5K8OA 4M7AA 5J26A 4NLSA 1T3NA 2W01A 3LW5C 3KLGA 4LSLA 2YWKA 3RRHA 1HXDA 1S1WB 4G1QA 4CWBA 3VAIA 2YH1A 1SJQA 5IC6B 3DLJA 2IDEA 1FRKA 3MAAB 1CQNA 4OX7A 5IAYA 4QYZJ 4QWCA 4XDCA 2FG0A 1NPPA 4QVZA 4JI3J 1UVKA 3U1LA 1YJVA 1UHFA 4DR1F 4LRDA 5CYQB 1U8SA 5KG0A 3G6YA 4DR5J 2ZE2A 1UJ6A 3BDLA 3QBYA 4M5NA 3D6TB 2ZPBB 1D1AA 2L3PA 2WVBA 4DR4J 5CCAA 5EG2A 1JLFB 3W2VA 4C11A 3LGNA 1PBAA 3JB9J 2R9LA 3AD7C 4KRTA 3PW0A 1YJ9A 4CNZA 4B9TA 2CKKA 1P27B 3BKUA 4C3LA 2PE8A 4W92B 1QCNA 3H0FA 4RTUA 2RB6A 3ZZ0A 3D3CJ 1SSHA 4CP5A 4IKFA 3IWLA 4NPOA 2O2OA 1NBEB 3TUZC 2QGGA 1CG2A 1S9GB 4K2JA 5FLXY 4IOAQ 5GMKe 3OYCA 3RBEA 2J0SD 1UW9A 2XY7A 3TREA 4LQ9A 1S10A 1U1NA 5KFQA 2ESWA 3L7OA 1PJ7A 1U1PA 1CULB 2E5JA 2L89A 3CJKA 2IJFA 2J6KA 2HL3A 1RT7B 5HCKA 2LXFA 1FWKA 3N79A 2RPNA 5LL6S 2K2MA 2B5JA 2B8AA 4TVAB 3C15A 3OTOF 2JVVA 2XO7A 1K1SA 1K9MT 1GCQA 1JX4A 1T3LA 4QT7A 1FKOA 2VBXA 5IT9U 3JSCA 3RBXA 1YNZA 3G82A 2FHMA 4OB3B 3HSDA 2LQJA 2CKWA 3W1YC 4RLEA 3IM9A 3HHTB 2LU1A 4M78E 5D6YA 3M5AA 2B0GA 4LFAJ 1K9MC 3AA9A 3JTNA 3DLGA 3THVA 5GADU 2CFXA 2CJYB 2IBOA 3RZAA 1LK7A 5EX3A 4C92B 2DM1A 4YP3A 3OR1B 3HZEA 2E5GA 2EYQA 3FQKA 1AUDA 4PG8A 2OTJA 1HWIA 2OPSB 2E1MC 3AHUA 2XY6A 2PT0A 3H0PA 2HWIA 2MLZA 1V6HA 4M78B 3P49B 1OSDA 2I0XA 1SB6A 1S9EB 3MPWA 2E1AA 3TR5A 1KC8R 5GANh 5KFMA 4ETXA 5KFSA 1H2VZ 1X4BA 4OYIA 3W64A 3EHQA 4K8RA 1X9WA 4LJMA 4MZTA 1KIKA 1N27A 4C8OA 2PD1A 1D9AA 1YLXA 2BMBA 1NJIU 2XNRA 3ILJA 2CPHA 2VFSA 4RUHA 2YX4A 1JXMA 5MAOA 5E41A 3V81B 4M63A 5HROB 2LMJA 2LMIA 5CAIA 1U6ZA 4PJOG 2Z2ZA 1BIBA 1DHMA 1VBZA 1KQSA 1QP2A 3B8HA 1XR6A 2KN4A 4ELUA 1GTEA 3RAMA 3OSVA 2YQ1A 3C3LA 1UJYA 1FCAA 2DT9A 1WHJA 8RUCA 4H4OA 2FJWA 3RESA 2GIQA 1PKSA 4CRIA 2YX7A 2E3IA 5HP1B 2F2VA 1HD0A 1KD1U 3Q8PB 4MIWA 4IOBA 2QLFB 4F02A 3A8JA 3OFGA 1U5SA 2J76E 4USMA 2OSQA 4A4FA 1O51A 1F1BB 4RCCA 1M1FA 3OXLA 2VA2A 4EWTA 2ZH2A 1NKBA 1JBMA 1OPZA 1LWXA 1YHQA 5LJ3g 1I51B 2HFSA 1MU2A 2BRKA 1QVGR 1F2GA 2CQ0A 1M5Q1 2EQKA 3PYGA 3H9NA 1NDCA 3EYZA 2VQEJ 2DNNA 1UWBB 1FFSB 1RT4A 1T3SA 1IBLJ 3PDNA 4A8QA 4M77D 2CDQA 1RAFB 2QLXA 3FSIA 3EFOA 1T3OA 1IVZA 2NLUA 4I1TA 3DLLA 3Q83A 3MEUA 1E6YB 1H6KX 1S5ZA 4Q43A 3ZTPA 3DLLQ 4JRQA 2Z2YB 3QIPB 4M77G 4UF4A 4PJOA 4ZCIA 3IBFB 1TWBA 3EGWB 5A6WA 3A4TA 4R0KA 4XTYA 4NLVA 2WW8A 3A8LB 3VVUA 3OYYA 4NL2A 4C8ZA 1PNJA 5KFAA 1KSWA 3M9MB 3QT7A 2A0FB 4RMOA 3MHYA 2WSEE 2JW4A 5JVHQ 2XD0A 4ZTFA 1UL3A 3KMSA 4QVDA 2IHR1 4ZK7M 2WW4A 1RWMB 1N6QB 4ID8A 3GG0A 4KHRA 3JQKA 2FRYA 2FHOB 4JV5J 1YZ6A 5HAOA 4N0AA 3WXMB 1L3UA 1M1KC 4YS2A 2DXCA 1JK9B 3L7UA 3M4XA 1VQ5Q 1JJ2S 1N0VC 5DDQC 2VKNA 4RNFA 2OTLT 3CC4T 4FNIA 3ENAA 3FMWA 5LJ5h 4ZJLA 4F25A 2QA4Q 3DLBA 2OPRA 2V8PA 2LVMA 2QQ9A 3I55T 3PX4A 1H641 2KVIA 2YUOA 4LF7F 1LW2A 2J0WA 4XU1A 3EXYA 4DFJA 3CCVQ 3BQ2A 4E0DA 5E3RA 2LXUA 2VG7A 4KB7A 4UY8T 4LFBF 2ZNZA 4OQJA 3QDRB 1RTDA 1RLPC 4WBFA 2MQPA 4M5DB 4MDWA 3EWGA 2QL5B 2OHDA 3DRYA 4C0BA 4HVZA 5D6GA 2ZBRA 1KJWA 2F5KA 4QIWD 1DTQB 1G3WA 4DFPA 4ED2A 1PKUA 1GXIE 4WYWA 1FRXA 3MM9A 2BANA 2N7YA 2POKA 2RQKA 4O44A 3M0UA 2DK2A 3KUEA 1I4K1 2DB1A 2IJNA 1KDNA 4CLFA 1JLAA 4X4OA 2DX1A 3DRPA 3L2ZA 2UVVA 1ZBXA 2RNEA 3DLEA 1VMBA 1CEZA 3CIMA 4LSZB 1XNQJ 4N41A 3VKIA 3PO5A 1WORA 2E29A 2E5IA 4ZVEA 2LQBA 4NA1A 2DXUA 1AHJB 2L2PA 3NP5A 2AKLA 4OYWA 3CJ2A 2A2CA 2KXFA 3GIIA 1G2EA 4IFVB 3OVBA 4P6QA 2CP6A 4RBVA 3VAFA 3J7YU 4LUBA 4TY9A 3PHTA 4ZCKA 4WWSA 4DLGA 4LF6J 4LF8J 4EMGA 3U02A 2FEIA 3O6QA 1WIEA 1RT5B 1TK8A 3FDRA 1D1BA 4P2XA 3R6NA 4ZS6A 3HM9A 3QPHA 1W70A 2OLWA 3DGPB 5M9OA 3OYFA 3IA0A 5FDLA 4IUFA 1BXNA 3T6JA 2PNIA 5D0GA 2OX7A 3MFIA 3GFYA 5GANd 3JCMJ 1FRJA 2JS2A 2GO9A 4DPWA 5HVHA 1R8AA 3TAQA 2GMLA 2CZ0B 3FBFA 3NOCA 2VA3A 1VGYA 5KFFA 4RW8B 1FWPA 5L9NA 1PAEX 1H73A 2MCNA 2RU9A 2XK0A 2VPZB 5F8LA 3I35A 3JCMQ 4HACB 4F2RA 1D3BB 2V2ZA 4JI3F 5KFWA 2RMOA 2H5IB 3DOLA 3R5CA 1H92A 2K5IA 4DR5F 2KFZA 2HSEB 2DJWA 4D3GA 4AD6A 3KLHB 3QGHA 3RNJA 1XMQJ 1RA7A 1RAJA 1Y00A 4DR4F 3Q22A 3G86A 4FYXB 4LVNP 2DHHA 1WHYA 1ZUKA 3JB9F 3PEJA 2YKMB 4P10A 3MUVP 1NH7A 3TUIC 4M1KA 1UJ5A 1MV0B 1NB2A 4LFCJ 4R5PB 4HL9A 1YJUA 1RU2A 4CO0A 4BUGA 3AXKA 3CCMQ 1UVNA 4NLWA 2HKEA 4DPUA 3UT1A 1NYFA 1JLQA 2EYXA 2HNYA 2YLBA 4ZMMA 2XMUA 1SUQA 2A6MA 4TY8B 1PWTA 3M8RA 3LWIA 1T0TV 1N4LA 1ZUUA 1NK8A 2PTKA 1FWLA 4RTZA 3O8WA 3Q2TC 1U26A 2R7RA 1HPZB 4L74A 2ILYA 2QQSA 1VQOT 1O5JA 1XMOJ 3NMZC 2JN0A 2CP2A 4JRIA 1W1FA 1OU9A 2WTFA 3TU4K 5LL6d 3MAQA 4HT7A 2RIJA 2VBYA 2HZCA 4Z8AA 5B7WA 1DURA 4USUA 4DOZA 3SCKE 4JV2A 2CVEA 3KLFA 3E2UA 5GAOq 3C8YA 4UOGA 3I96A 3Q8YA 3UPUA 4QU6A 1WHWA 1IREB 2CP0A 5DM7R 2DEUA 5DLGA 4LFAF 3C46A 4UOHA 3M1VA 5FU6C 3H4BA 4N47A 4BDZA 4IO9Q 2H3EB 1FTCA 2PVDB 2C1EB 4DXLA 3HDSA 3PFOA 2SXLA 3KWMA 3FUYA 7AT1B 1VQPT 4RW6A 2WHOA 1BIAA 2VDHA 3QWUA 2VG6B 3ENQA 2DL4A 3UDVA 5EUHA 1RHUB 4KFBB 3UD4P 1KRPA 3FJ5A 4WPAA 1QD1A 2FJEB 1LOUA 2ZC3A 1DTTA 3H5SA 2ZAEA 5A2QY 3RKXA 3QWYA 2KM8B 1EIFA 5LJ5d 3TW0A 3EZUA 3X26B 2X3WD 1JO8A 2DL8A 4O3PA 2C2MB 2ALZA 2D9TA 2BQ3A 5DZ6A 2XO6A 3CCQT 3DKDA 4U6PA 3VV0A 2ZPEB 4ZLLA 3KG0A 4PPZA 1X43A 4N5SA 1WEXA 2EWNA 3AFGA 1OWXA 5BYRA 5C0MA 4CLLA 1TL3A 4HVUA 4PK4A 4A8XA 5HMWA 4KBIA 3ZTOA 1IHWA 3W63A 5A0YB 1KQSP 1V1CA 4TU9A 1A9NB 2OIHA 1VQ4T 4ED5A 1AD5A 2CZ4A 3GJQB 3BO2A 2LECA 2Y3YA 1MWQA 5CD4A 4OP0A 3CD0A 1Q8KA 2HNZB 3IBCB 4IG0A 2VGMA 2GCXA 1M90T 3OL9A 4E7IA 1YGYA 4HHJA 1WKLA 3HHNB 2DNYA 2EPIA 4NI2B 5CKFA 1T9UA 4MJKA 2W1BA 4K5RA 5I21A 1BMQB 2XICA 2CPDA 1M90C 5FW9A 3T19A 1YJWA 4TKTA 1IBMF 4JI1J 1UEBA 3PW5A 3VWSA 1FEHA 3QAUA 3CMAT 1U49A 3MMAA 2HMIB 3FJPA 3US5A 1GAOA 2KGTA 1OMSA 1IBLF 2AX1A 4ED1A 1CSJA 2YNIA 1JEGA 1U1MA 4IIOA 2DGXA 3HULA 2LVWA 1Q86R 2C2EA 3AHPA 1L3VA 2RD1A 2FO0A 2UV8G 1HYSB 3F0NA 3HSGA 3KJVA 2DPJA 3MEDB 5HMZA 3CXCR 1T9VA 1W4SA 3THTA 3MECA 3P6YC 3MURP 4DR7J 3A8MB 1VQ6T 2FHDA 2G4BA 4EU0A 1G83A 1UUEA 2V67A 2MQOA 1PSEA 3PX6A 5LJ3h 4Z7CA 5KFPA 4K11A 2JSXA 3D1QA 4Y0FA 2G0IA 3VAMA 3INZA 1WXUA 1IKWB 1NRKA 3JTOA 3M32B 2CWKA 1CKAA 1JKHB 3PRBA 2ZUAA 5D0EA 4FNHA 3MMCA 4I2QA 4JV5F 5CVIA 3DM2A 1L3SA 2YWHA 2H8HA 3DB3A 3OTEA 3M2VB 1YKWA 3UO0A 2QA2A 2WSFE 3G4SS 5DDRC 2L48A 4DX7A 1RT6A 1UWAA 2B6AA 3DRSB 4BD3A 3L4BC 3PJXA 4OI4A 2D9PA 3J7A1 3M8YA 2DVEA 1I94J 4AL6A 3EM1A 3MHXA 3M7VA 1M8MA 2BR0A 3KHLA 2Y1RI 4NCBA 5I42A 4C0GA 1WHLA 2VUBA 1GX6A 2K79A 2H51B 2BJ7A 2X9HA 1D1CA 3I4HX 4M77F 1MMNA 2DXBA 3VR1A 3RRGA 2DKGA 1KR4A 2Y1LB 2GVZB 4FPRA 3LYIA 2UV8A 1IWAA 4KJIA 3VZIA 4TVRA 5F3ZA 4OMLA 4Q44A 2B9EA 4DL7A 3EXCX 2AWZA 3VUZA 1TELA 1VQMA 2LJ3A 4MK9A 9ATCB 4NZ7A 3J7AF 1HIYA 4H4MB 3ULHA 3EG1A 1UGRB 2A08A 1PO6A 4JI2J 1S0VA 1S0OA 1VYVA 4II1A 2NQPA 1MNEA 3LP1B 4N4HA 1ZAVA 4XPEA 2E7VA 1SV5A 4HDHA 1WHHA 1T9WA 1YRUA 4OHXA 4E7KA 3HVWA 1LOJA 2MGZA 1QP3A 1NXIA 2PMWA 2K3XA 4LT6A 2NUPA 1KTVA 3DYAA 2B4OA 1M5SA 2MPUA 3G8TA 4NLXA 4QVCA 1Y96B 4Y2AA 1OI1A 3ISZA 5LJ5Y 3X1LB 4LNPA 3QWXX 5CYMA 2DRAA 2VH7A 4DBRA 4Q7AA 4W98A 4F7UG 2UUCJ 2X1BA 2B9YA 2FZGB 2M0YA 3OR2A 4CO3A 4OL8A 4ELZC 1VQ9S 2JM9A 5DJBA 2O01E 2MKKA 2B4UA 1WG1A 4NCGA 4DX6A 2AGQA 2MTLA 1FA0A 2ZH7A 2DTHA 5LSRA 1FRIA 2UVRA 2FDNA 3BR9A 2RDDA 3PVXA 2VC8A 4HHHA 2OTLQ 5D77A 4Y00A 1WX6A 1B0VA 2VU5A 3CC4Q 4ELVA 4CYUB 4JI4J 4X9DA 2LCWA 4OYPA 4LF8F 2KZMA 2NWMA 1SJRA 1PD1A 5A8KA 2K3IA 2IPOB 4EBEA 4URQU 3I55Q 4FW1A 3K17A 4FSSA 3EGXB 2GJ2A 5JUMA 4E7LA 2YSQA 3MM7A 3MTKA 1AFJA 1HBNB 1HJDA 2HQCA 5ETOA 2W9CB 3FFIA 1C1BB 1FFGB 3H98A 4P2SA 3K5NA 3QT6A 3OVAA 3CCST 1MV3A 3QZ5B 1WDDA 4DR3J 4WXWA 3HX9A 3TP2A 2BV3A 4KGXB 5I3UB 2CJXB 2M2BA 3UN2A 3HHLB 2PUKB 1B34A 2RHUA 4J5YA 5KYUA 1X27A 4NLDA 3VS2A 3CQTA 1DQAA 1LJOA 5HBMA 2RAQA 3KK1B 2KR3A 5KG5A 2E66A 2LQ8A 4BWMA 4RNOA 1KHIA 4NASA 1XMQF 1OV3A 3TJ8A 5GAN3 1TOVA 2QZ8A 2AJ1A 1BCMA 1H8KA 2CQPA 1X0FA 2MJNA 2Z56B 1S99A 2COWA 4O0IA 3CMES 3GCWP 5FWCA 3LH0A 1K8AR 4LFCF 3NLCA 2V4RA 3FIFA 1M8VA 3PFEA 1UW4A 2WBMA 1R89A 2J7IA 2FGCA 2K8GA 3M9OB 4WXOA 5GMKl 1LWFB 1Y3KA 2F4FA 1DJ0A 2XU8A 1S1UB 3A8EA 2FHJA 1VCTA 3T5HA 2RO0A 4C8QB 3MEGA 2CH4W 2DNUA 4PG7A 1ROFA 3GJSB 1KHCA 1CJVA 1ZBTA 3I9V9 3CCET 3DCAA 1U4BA 2OI2A 3MP8A 3D54A 5GJWB 1XMOF 4F7VA 3QFHA 2XLKA 3P8BB 2GO8A 3DI6A 3RKYA 4RKUC 1WFWA 4C4WA 4OZ2A 4TLQA 2XS5A 2KZZA 1MROB 4J9VA 5KFZA 2AIRB 1NZ9A 1PYSB 1AVZC 1JJ2R 4C5HA 3I0SB 1JJ4A 2GBQA 4MKAA 5DY9A 5HK3A 3OBYA 3EGDB 1AEYA 4HT5A 5A76A 1ZAXA 1IR2A 3JYTA 2CGHA 3GP9A 1NDKA 1TKTB 5KYXB 5LJ3d 1REVB 1GCPA 2D8HA 5GANf 2JXBA 3RGIA 5K14A 4O4GA 4UTGA 3F56A 1IR0A 2GHVC 4A47A 4MKVA 5LJ3e 2N4CA 1RJJA 1QCOA 3UVJB 2V5HG 2NZCA 1OOTA 1VRUB 3QKJA 4JZ3A 1RQ0A 2YKAA 3EVOA 4PXEA 2QEXA 2CT3A 2ZDPA 4USWA 4XTTA 1QQJA 1WTFA 3HVTB 3Q8VA 1R43A 3OVSA 2VBWA 1RTHA 5HANA 1WKKA 5A6PA 3OA6A 3PW7A 4OLPA 2UUBJ 2LU2A 2WONA 1FXXA 3I5AA 1VISA 3V4IA 2DL7A 5IHNA 2Z2MA 1VQOQ 1M2VB 4N76A 4K4VA 3PY8A 1JLGA 2YPZA 4UUWA 2QTWA 5AXNA 3M8WA 2Y1JA 1VR6A 2DIVA 4IUQA 5JMNA 5M2PA 3C12A 1RWNB 2YKNB 3CCLT 3RW6A 4OMNA 3S6EA 1GTHA 2C3UA 1PD0A 1KHVA 5HL7Q 4OGEA 1NK0A 1U1LA 4ESRA 3DRRA 4OYAA 1Q95G 4DHVA 2NS1B 1B0TA 4UZCA 2FYXA 1HD1A 1YBUA 5CIUA 2VF3A 3OS5A 4LVOP 1CVJA 5CR2A 2N3LA 5DETA 2QV6A 1S76D 2YDLA 5CKHA 2YNHA 4J9KA 4B6MA 2H1YA 2DK3A 3NG8A 3K5PA 1SH0A 4PR6A 4Z02A 3CCTA 3I82A 3JSMB 1ZH5A 3V8KA 3R8YA 1PHTA 3NGDA 3EVWA 1WC5A 4NWBA 1S79A 1VQPQ 3MPDA 2XYGB 3TI0A 4ZJQA 1WUUA 2JMAA 2YNGA 4JI1F 4KHPJ 4M78C 1OZ3A 1LCKA 1NSQA 4DV0J 4DPXA 1S4FA 3FZBA 3UPFA 2HAXA 1WWHA 2V8VA 1HWLA 2B4PA 2JMCA 1KLNA 4I69A 2ILZA 3I9QA 1K9MU 3A12A 3QO9A 4DCOB 4DSIA 3WDOA 2AZVA 3GG1A 3MJXA 4OMPA 4ZHRB 3CEYA 2I2LA 2LCSA 2HURA 2XDPA 1TG0A 2V2VA 4JOUA 3CCQQ 3KK3A 4DR7F 4ZVGA 1NLOC 1KC8T 2PVGB 3CDUA 3KNAA 4I56A 3M9NB 1B70B 3FQLA 3IAM9 1U0SA 1ZUYA 1CJTA 3I56T 1R0CB 2FLNA 2XS7A 1T95A 2HHXA 2DR5A 3ET6B 2KI2A 3ZBDA 1RACB 4EO6A 3BPSP 4CT8A 2FRWA 3O44A 3CJSA 2AEJA 2L41A 4RW7A 4UUXA 2QQAA 2MQLA 3G87A 3LGHA 4L3NA 4OYMA 1NU4A 2E1RA 1VQLT 5J1NA 1VQ4Q 1NNDA 4ZGJB 1R3NA 2B4VA 1H0HB 2DL5A 3CVKA 3VRZA 3MPUB 1NSAA 3JTPA 2MWPA 1VQ5S 5LXYA 5KT2A 4HTJA 1AA1B 4PXBA 4ZN1A 5IS2A 5GAOl 2HQEA 3J80Y 1RHRB 1I94F 2NR0A 2A18A 3E2EA 4QQ6A 1ZM3A 2QA4S 3VQSA 3CCJA 3UI3A 2VC1A 5JJBA 2JM8A 4JLGA 3TNVA 3WX8A 2QSWA 1CJKB 2ZHAA 5B0FA 5GAEI 3OFFA 4I68A 3CCVS 1UHCA 3UD5A 4XIUA 4RNMA 4V19J 3FLGA 1RT1B 1GK8A 1QKWA 2R7OA 1X4HA 2M4MA 2PN6A 3TZYA 1QTMA 3QZ7A 4PJJA 3CMAQ 3F44A 1GRIA 1EETA 1FKPB 3SV4A 1QCFA 2GX8A 5FLXU 1FE0A 5ETSA 5HQMA 2W10A 2RS2A 2R2TA 4JI2F 2DVIA 1YI2T 1JRIA 1YJNT 1YJTA 1RK8A 3FRNA 1PCXA 4J9IA 4BWJA 4PLIA 3GR1A 3ZZTA 4Q45A 4FSXA 3GZ7A 4S0MA 3EFRA 1S1VB 5GAN2 4M4ZA 1VQ6Q 4AG1C 2ZH4A 2FC8A 3NOGA 2AGOA 1M27C 3Q8SB 3MD3A 2EG2A 5HMXA 5D78A 4FU6A 5EN1A 3PRDA 1L5UA 3S3NA 4IOCQ 3CCUA 2D3OR 4PKCC 4RL1A 5F8IA 2UUCF 3KXDA 2ROGA 2VWFA 2ZZNA 2ZCFB 2KSSA 2KRNA 4NLQA 5IM0B 2J6SA 2OMOA 4Y91A 4XTXA 5C5JA 3PM9A 3M6WA 3OLAA 1R6YA 2BKOA 2WSEC 3FCHA 3L1AA 1AYEA 3W9IA 2MMPA 5HQ8A 1UA0A 4WZMA 4LMZA 3FEZA 2M16A 2XMVA 1EKRA 3CD6A 4MAKA 3AT1B 2KHDA 1QWFA 1N5YA 3CO9A 4F3OA 4CO4A 4ETZA 2VBZA 3CEDA 4PXDA 4NL5A 1TUCA 3DXSX 2DNGA 2RH2A 2QFIA 1PM3A 3OD2A 4LF4F 1O9SA 1VQ7A 1M1KU 1S77D 1M5OC 3FJ2A 3ZXWA 1NKEA 2MI6A 4LIWA 1SC4B 2KXNB 3ILLA 4HA8A 3H5XA 4OI2A 1UEVA 4HYKA 5AYFA 3NPFA 3LO3A 3P96A 3W7BA 4DR3F 1OYDA 3D7SB 2H3JA 3C14B 4F4KA 4F7UF 4DQPA 4P72A 1C4AA 1NEBA 1NDLA 2KFYA 2ERRA 3M53A 3TZWA 3WVDB 1VJQA 2XWYA 3MPYA 4E7JA 1WI7A 1SPBP 4J9EA 1FT8A 2HPUA 2RI5A 4JJNK 2E5QA 3MEVA 4KGZB 3OBWA 5CKBA 1JKHA 1S1XA 4GRSA 4OJGA 1RP5A 1TL5A 4FDFA 1SVDA 3MM5B 5DZ7A 5DGBA 1FK9B 4A4HA 4L6V5 4KV8B 4FF2A 4B9UA 4F4ZA 1NJIC 5H9FK 1A6LA 3CCMS 3GFHA 4EI2A 3K2YA 3GNFB 2DJQA 1S72T 4NCAA 4RUBA 4I6AA 3GIMA 2FUG9 1X5PA 2JH3A 2IIHA 2MXYA 4P7VA 5HLFB 2V26A 2BJ1A 3SEMA 2BZXA 4Y2IA 1D8ZA 4ATNA 2E5HA 2EKNA 4NRUA 1Q5YA 2UXBJ 2HW3A 2AKKA 3R2DJ 3QQCD 4RUGA 2K57A 2F2WA 4J9SA 2HGLA 2NXEA 4EO8A 2QDLA 4J6YA 3G7ZA 2D9OA 3DOMA 2F4VJ 1D0ZA 3BBCA 1KD1C 4OYOA 4USHA 1EQ0A 1D3WA 1F2HA 2V4JB 4ZP8A 2R7WA 3MM8A 1QTNB 3IC1A 3CCSQ 3MR3A 3JCMc 2IM2A 3PMIA 3GFZA 3G1JA 2Z57B 3UWTA 3IM8A 3OHAA 4QIFA 2E10A 2MIOA 3EG9B 1NO8A 5C25A 2OD6A 3H40A 2G2ZA 4UQTA 4DL6A 3G2XA 5ECAA 1UTIA 2CZ7B 4PRFA 2XCPA 1CBKA 2CVIA 2C28A 1WHXA 1UP1A 4KYZA 3W66A 1Q7LB 1ZPVA 4KHMA 2RUGA 3CF5Q 2LP5A 1MN9A 3J81j 4ED4A 3OYEA 3TARA 2J6UA 5CABA 3D1HA 3OJSA 3V6KA 2AZ3A 2CA9A 1H7WA 2L8DA 4OF1A 3OB9A 3HHEA 2V9KA 1BWVA 2BJ3A 3MFHA 1EARA 5GMKm 2J5AA 1LNXA 4PYDA 2GAGC 2MSTA 2F9JA 1L3TA 4X4TA 1WKJA 2V69A 3BM7A 3F41A 1P1TA 4HLBA 3EH1A 2HFZA 1VIOA 4RTVA 1W7WA 2AQ4A 2UUBF 2GQQA 2DIUA 4M75A 2QL7B 4X62F 3CCEQ 5F8HA 4KH0B 2DGOA 5KT7A 4NE9C 1WHKA 2FJBB 1LWEA 2P9CA 2RQVA 1N48A 2PO4A 4Y92A 3NTIA 2JJ9A 1TKZA 1OY8A 2WVFA 3QRRA 3ITHB 2LX7A 2UVUA 4P74A 4R55A 4CC4B 1S1NA 2HK2A 2KFNA 5FU7C 1Q7YR 2Y4XA 4I7FA 3DDIA 1HWKA 2HNIA 2BOPA 2V68A 1X69A 5K8PA 2C2ZB 5CAAA 4LE9A 2AF6A 1DQ8A 1SRLA 2A36A 3V8JA 4DUYF 3M8SA 2YWWA 4FS2A 2C2RA 2EVRA 3GTYX 3QIIA 3EGZA 1U1RA 2BYCA 1B99A 1E6VA 2BKDN 1TVRB 4F26A 2JNGA 3QLHA 1A0OB 3JCMW 1RTJA 3PJWA 4ZITA 4M78D 1UDLA 2HAFA 4N7TA 4PL6A 5AJ3J 5LXRA 2IJRA 4H4KC 2QQRA 5I3PA 1YRTA 2XGQA 1LXNA 1UKUA 4ZVUB 2Y9HA 2DXDA 2HHHJ 2FC9A 1WZOA 2QIFA 2ZPHB 4KHPF 4NLGA 2CUBA 2HQ3A 1AUSL 2HWHA 4YMEA 4M7AE 3VJPA 2P9EA 4DV0F 3U23A 1N33J 1QWEA 2GNKA 3BKTA 3IR7B 3EH2A 5LJ3f 1SL2A 1CLFA 2PEHA 1YZ7A 3QYGB 4DEZA 2HQFA 2M52A 5IQ6A 2KM8C 4C5EA 4B9WA 4DV1F 4M7AB 4KPCA 1RUSA 2W24A 1IBKJ 1Q81C 2X3DA 3KLGB 4LSLB 1VRTA 5B0CA 3V7CA 4IFYA 3TSZA 2DY1A 1M5HA 2ZWPA 5DO2A 3W65A 1Y3JA 4G1QB 4FYDA 3VHQA 1V5VA 2VZ9A 1MGQA 1I1JA 2E6ZA 2RKIA 2RA2A 4IURA 4NLUA 3QGIA 1D0YA 2I5JA 3GCXP 2RDIA 2OGUA 3CCLQ 5ETMA 2HHPA 3REBB 3MMBA 2ZE2B 2MKCA 4C5IA 1UPMB 4IUUA 4R56A 3CC2T 4P7TA 1NYGA 1HBUA 3TAPA 4OYXA 3RG6A 4DZDA 3KHGA 1Q16B 3OHBA 4IH7A 3W2VB 4C11B 4J9CA 1R6VA 2KG1A 1OY6A 5ETRA 3CJ4A 4C8YA 3TAMA 2JVRA 2QYGA 5CK9A 1JJ2A 4U95A 1NK4A 1YJRA 3SFUA 1JNRB 3PO4A 3EZ5A 3SSRA 2FVQA 4MMOA 1ZQ1A 1Q53A 4KPYA 2XMJA 2P0KA 3HVRA 3QSUA 1FDAA 2ZHOA 1RU1A 1TUGB 4FT4A 4YFUA 4DFMA 4USIA 2WVDA 3BJYA 1ACMB 3HHKA 2GMJA 1Q82T 4WFNQ 3PW2A 1K0TA 1IKXA 2G3RA 3BR8A 4ZKAA 2CPZA 3CJKB 3V6HA 2M8HA 1JB0E 4ED0A 4ZVSB 1X4FA 5DDOC 3JV3A 1AXQA 4PAAA 2B5JB 1CPZA 3C15B 1Q82C 4BDYA 2YWEA 3SDEA 3HRTA 2G9OA 5HVFA 4E8UA 1CJUA 3L7PA 1FKOB 1M90U 1TTHB 3G82B 3KUGA 2D0NA 3I56Q 2RUSA 1HL6A 1SJ4P 4C0HA 1Y71A 2R7VA 2UXDF 3FMBA 1QSYA 1QVPA 5AE3A 3FGVA 1UTAA 3MR7A 3DLGB 1MWZA 2C0IA 3NS7B 4LF1A 2KRSA 5C24A 3BYRA 2RRBA 3KNGA 1VQLQ 3DN9A 3SV3A 2EIFA 2CS7A 4ANEA 3CMET 3DC2A 4NEYA 3CUNA 3N9UC 2AKWB 1UG1A 4NLYA 5GAOm 2OTLS 2Y4YA 3TX8A 3CC4S 5CQXA 1AWWA 2ABYA 2GMHA 4LREA 3OFHA 1YITT 2CIMA 5BYSA 4EK2A 1WEYA 3EAEA 2VXFA 2HS4A 4WF2A 1TMMA 3I55S 4DBFA 1MG7A 2WSFC 4NEZA 1Y5LB 2ZJRQ 3OTCA 3C4SA 1F9FA 1WOPA 2F8EX 1KQSR 2OAWA 3R5DA 1AFIA 3GSIA 2FLLA 4EDUA 1ZYQA 1NK5A 3D28A 1TL7A 2Z0GA 4P73A 2MQMA 2FTRA 3QT8A 1U1QA 4OX6A 1X2KA 4ZP7A 4NLOA 3G96A 5A2QU 1HNVA 4XTZA 3K89A 3R9LA 1PILA 5GAHI 1RL2A 1FHTA 3NS6A 3SMZA 3MTJA 1Z2ZA 4CT9A 3BF4A 5DGAA 4KGMA 1YI2Q 3PVQA 2JEJA 1YJNQ 3E51A 1ZSZC 3NTKA 3J81Y 1GH8A 4ED8A 4USTA 4A8WA 4J9HA 4HKEA 3T5KA 2NUZA 4NYPA 4JB8B 4ZVQB 1K76A 2PI5A 1IGUA 2MZJA 3TYTA 4EBCA 3A3OB 4M7DF 4C8KA 4H4OB 2HBRB 2RDJA 3NNCA 2CUYA 2VKRA 4X4NA 4F3QA 4KAIA 3BBFA 4J9UE 3EX7B 2VFVA 2IBKA 2GNCA 5IC4B 7FD1A 3JCMe 5KFRA 1HBOA 3EHRA 2DNRA 1Y7XA 2DISA 2IA6A 2DYIA 3KHRA 1TL1A 1T11A 2HIYA 3GJTB 5A8WA 2QN6B 2HGMA 2LQ5A 4XTUA 1MU2B 3R1LA 2XIDA 3LLRA 1PIEA 2GC8A 4Y3CA 1NPRA 5HJXA 2BJEA 2JL9A 3PIPQ 2DCLA 2DKOB 4I6YA 5CA5A 3RB0A 3X28B 2RJDA 1RT4B 2NXUA 2DD4A 1BU1A 4LDYA 1IZ6A 4OMOA 4A53A 2O01C 2UXBF 5H9EK 3EFOB 2GS8A 2XLIA 4CZCA 2B8PA 2OELA 2F4VF 4ED7A 4W4MA 2BJ9A 2PDAA 4A4JA 2HS0A 4PJOB 3PVLA 2RN8A 3GWCA 1RAAB 2HS3A 1M5KC 3FEXB 1LFPA 4FKYA 1KOHA 1S7HA 2F9DA 1H38A 2DJZA 2DH8A 4GKKF 2DBMA 4RW4A 1K44A 2M0GB 3NS5A 2QC3A 4RBTA 4MDXA 3BFMA 3SFMA 3MPVA 5HMYA 4J5OA 4ZVTB 4C0OC 2C3OA 4EMHA 3HJVA 3W62A 4YDDB 2FHKA 2RHZA 3S3MA 1EQMA 2R2UA 1W2BS 2KT2A 1I0CA 4PKDB 3WVEB 2H9ZA 2XEXA 3FBEA 4USKA 5KFUA 2VPWB 4IG3A 1C1AA 2W2NP 1TMJA 1SC3B 4IRKA 4BI8B 3MCSA 2CUDA 3TA0A 3B54A 2X1GA 4FP9A 4A4EA 2OPRB 4ILRA 3WHIA 1MUZA 1KLMA 2KBTA 1IKVA 1LW2B 3OYGA 1Q8BA 1S72Q 2QMWA 1G3SA 5T14A 2EQMA 2VG7B 3CDEA 2MMYA 3CMQA 4PFPA 4ALZA 2ZHBA 4EYHB 1K8AT 2RJCA 5AE2A 1IQZA 1HA1A 3MEKA 3QJLA 4M8LA 1JXEA 4UY85 1LFWA 1RTDB 2CT4A 4NLRA 4LRFA 4R25A 2JS0A 1NM2A 1VQOS 4CI0B 1F5BA 3QT5A 1UVJA 4OMQA 1YWPA 2ZFHA 5KG4A 5GAOn 2WVEA 1VRQC 4B3TJ 3PHEA 2EFNA 4J7CA 4QWBA 2GQ2A 3MF5A 4XAXB 3U7JA 2FJAB 5A2QE 3MM9B 4A8MP 2JTMA 2GTJA 2BANB 4K2XA 1X9SA 1ULRA 5GAEU 2CZ6B 4X9CA 4JDSA 3G6ET 4O44B 3VAKA 2QTVA 1N36F 1MNDA 3F73A 4V1Ak 4IUPA 2FZCB 1RZMA 2GA7A 1TKXA 4FBTA 1JLAB 2CJKA 1RYSA 1S6OA 1X4EA 3DRPB 4OI0A 3PJ9A 3OFEA 2A3JA 3DLEB 4CIOA 1QAXA 4C0DC 4OIXA 3W2WA 1C0UA 5GAMe 2Z4PA 3R7BB 2KXDA 2DYBA 2VDIA 2F3JA 2KY9A 1QUPA 3H41A 3PG9A 1FJEB 1DFDA 1VQPS 2J06A 3LPYA 2HHHF 3D2WA 3JRZA 1ZM4A 2OEKA 1S6UA 1WF1A 4ZGEB 2E64A 3ETMA 1N33F 3F70A 2LXIA 4BC7A 2DO3A 1SJ3P 4MH8A 5M2RA 1AOJA 2VGNA 2W9AA 2O67A 5AE1A 5HLFA 3OS1A 5FDLB 3MO8A 3H7HB 3G71T 2W8LA 4K4UA 1EZZB 3ZFJA 1IBKF 2FQQB 3CCQS 2R42A 5IT9Y 2YUPA 3JB9I 3PMTA 2DLPA 4DEXA 4X65F 3NHNA 3HSJA 4TLRA 2E5KA 1HI1A 2BABA 3UNGC 4QQBA 4D8DA 2U2FA 2OJ3A 1ABQA 2EW3A 4C92F 4UZBA 3M30A 3OQ5A 1XEZA 1U45A 2PIIA 3CCRT 2W2MP 4TXSA 2M9UA 2D3ZA 1J5EJ 3V8LA 5K8NA 5GMEA 1VQ4S 3SSSA 2M5YA 2MHNA 3IAS9 3DOLB 5GMKa 1XIQA 4M78F 4Z89A 3T6BA 1KVJA 2YXLA 3FSYA 4M7DE 2EFIA 3D9BA 2DEQA 1WF0A 2Z2LA 2IRYA 2M9KA 2KJVA 4PCQA 3WBZA 4Y34A 3G4SA 4HCCA 2X4YA 1JJ2P 3BDPA 5IXBA 3BS9A 1TUWA 4U8YA 2WOMA 4O23A 1B0PA 3MM6A 5KE2A 3QWPA 1HARA 2OKQA 4ZPDA 1XQHA 4DV6J 1JLQB 2K7KA 1WPYA 3PYFA 5DM7Q 2HNYB 2E12A 1SUQB 4IYQA 4ZVPB 1OU8A 2KXCA 1D1UA 2HKQB 5SZTA 3I31A 5G4DA 3CMAS 4KBMB 3OW2S 3BDUA 3M8PA 2LYVA 2ZZDA 3RBDA 5LOQA 2MZQA 1QM9A 1SC6A 1FDBA 4WYLA 3X24B 3MDFA 1TFYA 1SIWB 2FL7A