3T9NA

Crystal structure of a membrane protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
269
structure length
266
Chain Sequence
YDIKAVKFLLDVLKILIIAFIGIKFADFLIYRFYKLYSKSKIQLPQRKIDTLTSLTKNAVRYIIYFLAGASILKLFNIDMTSLLAVAGIGSLAIGFGAQNLVKDMISGFFIIFEDQFSVGDYVTINGISGTVEEIGLRVTKIRGFSDGLHIIPNGEIKMVTNLTKDSMMAVVNIAFPIDEDVDKIIEGLQEICEEVKKSRDEGPTVLGITDMQDSKLVIMVYAKTQPMQKWAVERDIRYRVKKMFDQKNISFPYPRTTVILSEKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Small-conductance mechanosensitive channel
publication title Structure and molecular mechanism of an anion-selective mechanosensitive channel of small conductance
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
total genus 80
structure length 266
sequence length 269
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3t9nA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t9nA03
1AFIA 4OJ1A 2RK1A 5B0DA 4FNHA 2XMUA 2OAUA 1MWYA 3KKFA 2G9OA 1KQKA 1Y3JA 2RH2A 1AFJA 2HFNA 4Q2MA 1SQEA 2K1RA 3KG0A 2AW0A 1Q4RA 2RU9A 1LQ9A 2OFGX 2W4CA 1VQYA 2BBEA 4YDXA 2BUNA 3SFMA 1WD6A 4DN9A 2KYZA 3BN7A 3HF5A 3KNGA 2IFXA 3HFKA 1ULRA 2CRLA 1S6UA 3FRYA 4DL0C 1KVJA 2AP6A 5T7LA 1CC7A 1XBWA 1OPZA 1RJJA 1Q8LA 1U7LA 2PGCA 4ZA1A 1CPZA 1GXUA 2K7JA 2L3MA 2XMKA 2QYCA 2XMWA 3F44A 4HL9A 1KVIA 4Y2MA 1YJVA 2ACYA 2GA7A 1AW0A 1SB6A 2K7KA 2AJ1A 4A46A 2BYCA 3BM7A 4A47A 4HH1A 2LDIA 3CJKB 1S6OA 1YJUA 2GCFA 2RMLA 4A48A 1FEEA 2OKQA 1IUJA 2RILA 3HHLB 2HLUA 1QUPA 2JDJA 1OQ6A 1X7VA 2ASYA 2VH7A 2RK2A 3UDCA 4HH0A 1YJRA 2N7YA 3LO3A 3VTIA 3QGPA 1N5TA 2AJ0A 5IXUA 2GGPA 1N5SA 2OP5A 1YJTA 2LQBA 2QLXA 3TRGA 1APSA 2KT3A 2OMOA 1OQ3A 2IYGA 2PD1A 4ZOSA 1SI9A 2FTRA 1Y3KA 1Y0HA 2HIQA 2XMMA 5B0GA 1FVQA 3I9ZA 2W4DA 5F0WA 4FNIA 1TR0A 1FESA 2FHMA 2ZDPA 4A4JA 2ROEA 5B0AA 3HDSA 3IWXA 1N5VA 2OD4A 1GXTA 3FGVA 4U9RA 2GQVA 1JWWA 3BB5A 3TOQA 1FE4A 5A6PA 1JK9B 1VIFA 2HFOA 5B0FA 1R6YA 1URRA 4NPOA 1FD8A 4OIXA 3MZIA 2LQ9A 1TUVA 2Q3PA 2VV5A 1MWZA 1YG0A 2K1RB 3DXSX 3BF4A 3BR8A 3HHLD 5B0EA 5A6WA 3GZ7A 1TL5A 2GV1A 2KKHA 2QLWA 2ROPA 4HI2A 4Q2LA 1VIEA 4F67A 2OD6A 2XMJA 5B0CA 2RSQA 5B08A 3CJKA 2FB0A 1P8GA 3BGUA 1OSDA 1W2IA 2QIFA 3HHLA 5K9FA 5KAKA 3MCSA 5B09A 1VQSA 2GFFA 3KG1A 3BDEA 2GO8A 3K7RA 4NL5A 5T7LB 1FVSA 2BJEA 4HI1A 1Y9OA 4OJ3A 3TNVA 1TZ0A 2BJDA 2HLTA 3LGMA 1FE0A 2OFHX 1X0PA 4OJHA 1X8DA 2P4TA 1CC8A 2W4PA 2ZDOA 4Y2IA 2ROGA 1P6TA 2XMVA 1TL4A 3HX9A 3DCAA 2EW9A 3FMBA 2HQIA 5B0BA 4Y2KA 4DPOA 2K2PA 2LXFA 1YRXA 2XMTA 1V3ZA 2FIUA 3HHLC 1Q53A 2N4CA 4OJGA 4YEAA 4EFAC 1Q8BA 1N5QA 2GGPB 2KT2A 1K0VA 3WDOA 3QMQA 2N4DA 5F0UA 3E8OA 3T9NA 3IWLA 3LGNA 4QOTA 2IYIA
chains in the Genus database with same CATH superfamily
3GFXA 1VQOS 3OHAA 1RGVA 2IRYA 2JLFA 3KKFA 5MAOA 3T6BA 2RRBA 2OTLA 1SJ4P 3GBQA 4TVRA 2F1LA 4EMGA 4LE9A 3RRKA 3HF5A 4F3QA 5LJ5j 3QIPB 2LKZA 5HCKA 4ME7A 4FF2A 4M7AB 4JI5J 1K73R 2BE2B 1CKBA 1HI0P 1NM7A 5BYQA 3GP9A 4QCLA 3OYMA 1LCKA 3HFVA 3NKYA 2NXNA 1KQFB 4ECZA 4XTTA 3QSYB 3SYZA 1PO6A 4CH7A 2ZBPA 1IR1A 1VQ5T 2MWOA 4TYAA 2ZWOA 3CJ3A 2ABYA 3SMZA 2QT7A 3OR2B 2NUPA 1NZ9A 4PJOE 3V6DA 5JMNA 3BKTA 2RQ4A 3DKDA 3THKA 2NXCA 4ELUA 2Y1RI 2P4RA 2H5IB 2NXEA 2HZAA 3BR9A 2R7SA 5I42A 3H0FA 3TA2A 1Y07A 5HBMB 1X9WA 3KUEA 4DX7A 3TWZA 1WG5A 2JMCA 1LWEB 3KLHB 1BWVA 1XR5A 4I2PB 3C2PA 4MFBA 2O4XB 1UZDA 3DMJA 1Y9OA 2NSBA 2AKLA 2OJ3A 4KT0C 2O01C 2KFZA 1N0VC 4LSLB 2DRKA 2E44A 4JI6F 5LJ3g 1TV6A 3MR7A 4DR3J 3PX6A 2H48B 1VIXA 5D0HA 4DWIA 1W1FA 2QJ3A 4OGEA 2HNZA 5DQHA 2G9OA 1QVGP 3CJ8A 2DNHA 4C8OA 1ACMB 3K59A 1PC5A 3HFZB 3CCRT 4GVBA 2VJUA 3M4XA 5AXLA 1X4BA 4DQIA 2A3LA 4C3MA 4TVAB 4NZ7A 3AXMA 4HL9A 4NYZA 4R5PA 4PG4A 4C11B 1MLAA 2H8HA 2CJYB 2HQFA 2JTEA 4AL5A 2E12A 3H5UA 2IBKA 1R8HA 1K0SA 3JCMc 4EMHA 1TUDA 2DIUA 2W9BB 3FZ2A 3O1LA 3VU3C 2W2OP 2HSPA 1U09A 5LL6S 2PD1A 1TKTB 5D77A 3ET6A 3BREA 3QZ8A 2CPEA 4DUZJ 1IO6A 3QNWB 3V4MA 2OI2A 5KTQA 5E3QA 4ZNXA 1OI1A 4DV0J 1HW9A 1KJWA 3TP2A 1MMNA 4MIBA 3WVEB 3LP0A 2CSQA 2X4WA 1FA0A 3CCVT 1AZSA 5IAYA 4WKYA 1T05A 3L42A 3ONQA 2V2QA 4C8YA 4ICLB 2QMWA 5CKDA 4URGA 3QZ7A 4LF8F 1UGRB 4D8DA 3KK3A 4OYWA 3GQCA 4B17A 2W9AA 1ABOA 2EKOA 2V67A 3GU0A 2IRUA 3NTIA 3HRTA 1P9QC 3V5RA 2QO3A 5AXMA 5IT9Y 1I8FA 3O3LA 2LQWA 2MPUA 2ZBRA 1Q81C 2OO4A 1VQ5S 4PG5A 3A8JA 4PJOC 3GYGA 2HEKA 5GAN6 3P4UB 3QBYA 1RWNB 2DXBA 1K1SA 2BV3A 2CDRB 2W2NP 4QPXA 3O8VA 1HWUA 2RNEA 1OYDA 1Q81U 1G3OA 1XOVA 4X34A 3KK1B 3X20B 1B0PA 1TK8A 1L3VA 1RWPB 4CT8A 2HAFA 1J27A 2UU9F 5DJBA 2DR9A 3ZZTA 2FJEB 1BCOA 2F5GA 4Y2MA 3K5NA 2HURA 3PJXA 2BXJA 4U6PA 3P8HA 1BY9A 1OQ6A 1NLKL 2W2QP 1OX9A 1HBOA 2KRSA 4FVCA 2UV8A 3OBYA 4CLPA 2JSXA 4CLZA 2AZ3A 3G71A 3PW7A 1VQLQ 2CPIA 2BANB 2R8IA 3DRSA 2BQ3A 1KLMA 1FXDA 4RW8B 1HYOA 2E4HA 3A8IA 2E1HA 3MEEA 4LFBF 1PCAA 2XQCA 3CCRS 2BJ1A 4KO0A 4OFZA 4NS5A 4IKFA 5GANj 3DGVA 2ZNZA 2DO0A 3DGPA 3BFMA 3HVAA 2EWHA 2XMVA 4MKBA 3RERA 1WOPA 4OX7A 5B0BA 2LXFA 2GJ2A 3AD7C 4EU0A 3W5YA 2GVZB 2GJFA 3PHEA 4QVCA 4BLGA 2B5JA 3D2WA 3EG9A 5J39A 2QEXA 5IM0B 1WORA 4XO0A 4C8QG 1KD1T 1QSYA 1M1KT 1M90T 4ZCKA 2QA4A 2XYGB 4IUFA 2Y1JA 3EH1A 2BIVA 5DG8A 2CREA 1V9OA 3C66A 2MGZA 2X35A 2BACA 1RWKB 4C8QF 1WX6A 1ELOA 1JQGA 4LSNB 3W63A 4DV3J 3CCVS 1NG2A 4JDSA 1L3TA 2VODA 4C3KA 1KHVA 2CUBA 4BWJA 3PYDA 2FLLA 3FCVA 3M8PA 2E1AA 4DEZA 4F4AA 3D6MB 2WOMB 4DBHA 3UN2A 2YNFA 2KRBA 4CLKA 2ZGWA 2WVCA 4B9UA 2OD4A 5M9OA 2EW3A 5B0FA 3M57A 4RCBA 1U8SA 3I4PA 3QFWA 2ZHBA 5KT7A 1S1XB 4QZVB 2FEIA 4JI4F 2A2DA 5LM7E 3TVYA 1XJWB 4DF8A 2J8SA 3JCMQ 4J6WA 4GC6A 3R27A 1RTIB 2HK3A 3RKYA 3HULA 4Y2IA 3MXHP 4EMKA 5KH6A 1PSEA 3NAHA 4OI1A 3JQJA 1RTZA 2CIMA 2OEJA 1K0VA 1UEUA 4Z88A 2Z30B 1NM2A 4M5DB 4AQYJ 1H72C 2LMJA 3EAEA 2YX7A 3UN5A 4EGLA 5ETRA 2AZVA 3O5TB 2RB7A 3P96A 4L3NA 5LL6d 3H4DA 1WC4A 1C0MA 4N7TA 5A76A 3HP9A 4L3KA 3QGGA 4J8OA 1U7LA 3T5LA 1J3TA 4M7DG 2AGPA 4UC4A 2OPSB 3GV5B 3FCHA 2ZD1B 5J2QA 2PVOB 4QIFA 4O0IA 1GCPA 4G3IA 4FT2A 2HVHA 4GBQA 2NYIA 1HW8A 4RU9A 4B3MF 1N9RA 4M7DF 4RLEA 1IXKA 3KMSA 2DM1A 1RT7B 2WTFA 4JRQA 2LQKA 3SWNB 1I3OB 3U1MA 2KQWA 3NNAA 2V8PA 3RKWA 2IA6A 3UCZP 3NEKA 5KYXA 2K1RB 3O2IA 2LTOA 3OYCA 1JNZB 5GAOp 1K8AC 2CADA 5A2QE 4RNMA 5CZVA 4LXCA 3JCMP 1KDNA 4ZITA 2HWIA 1LK7A 1K8AU 2IJFA 3OL7A 4X4TA 1SHFA 1FI4A 3VF0B 4X62J 4M8LA 5BJRA 2YY3A 3FKBA 3CSKA 1OWXA 3OSPA 2V69A 2EGCA 3E9FA 2C2ZB 3LPYA 4X65F 2NWMA 1J5OA 1S0NA 2AW0A 3SFMA 4AFUC 2V63A 1ZTTA 1WQ7A 4L72B 3UA6A 3AJ1A 4KY3A 4F4KA 5GAN7 1HLWA 1IGUA 3T1HJ 2DJWA 1RKJA 3KLIB 2CQPA 1KEKA 3CXCA 2A7YA 1QE1A 1QCNA 4LFAJ 5HQ8A 3V8KA 2VC8A 3N5BA 5DLGA 2EPIA 2M0GB 1X4FA 2HFVA 2HVDA 4E8UA 3G6VA 3PKMA 1CJVB 1S72A 2BZ2A 3OW2A 1JJ2P 4RBVA 2G0IA 1UA0A 3CCQA 1Q86C 1X01A 1Q7YT 3WBZA 3I5BA 4CZCA 4OI2A 1VQ7A 2EFNA 2XMFA 5FDLA 2JXBA 4M5GA 1VQMA 4PG7A 4ZPVR 3OJUA 2EC0A 4MDXA 1VS3A 3THPA 2HHWA 3MCSA 1K1QA 3SSQA 3I56A 3CF5Q 2RI3A 3J7AF 3TI0A 1TSFA 3E19A 4ZTJA 4A8MP 4O6JA 4A8QA 3NGPA 2JEIA 4ZPBA 1WELA 4ZLPA 2VFVA 3CJ2A 2C2EA 4HDGA 2NUPB 1D1CA 1QWFA 3V6DB 4JYAF 4JLIA 5GAN5 4CRIA 2PDAA 3DFEA 3E3XA 2VPZB 3KHGA 2CGHA 4A8XA 5I42B 5JVGQ 4ZTFA 4DV2F 1SL0A 3F44A 2NUTA 4FXWA 3MEKA 4MFBB 5HI7A 3DMJB 2F4VJ 1GL5A 2LFVA 1IKXA 2KXNB 4PJJA 2CQCA 1LJOA 4LQ3A 3KJFB 2D8JA 1S1TA 2DJZA 3Q23A 1BE4A 2J0SD 1GX6A 4F4WA 1TV6B 2VKZG 2RJEA 1T9YA 4X9CA 2VC1A 3FJ5A 3W9IA 1SJQA 2YKOA 4M77G 2HNZB 2MB0B 3WC2A 1FJGJ 2KXHA 2ZH4A 4TU8A 4P75A 3E51A 3R5JB 3OQ5A 1RDRA 2QQAA 5KG5A 2X3DA 4GVBB 4Z2XA 3FIFA 3LGHA 2IMWP 4F7UF 3QYYA 5A2QY 3H98A 4WE1A 1H74A 5K20B 3THVA 4M77F 3LF0A 2COZA 2OPPA 2DYAA 4R5PB 3G4SS 1H3HA 4CP5A 4DBRA 5J1PA 1UA1A 2YWKA 2ADCA 1UFLA 4K2JA 4G65A 3M0RA 1XR6A 3U02A 4AXIA 1YJNT 1FT8A 3Q0AA 3VAKA 1VQ4A 4DR4J 4AG1C 3ISND 3ET6B 1JJHA 2D69A 1AFJA 1P92A 2EQUA 4XU1A 1WJ9A 3G71Q 2HKEA 1OZ3A 2RI5A 2EYZA 3CVKA 4U95A 2AJFE 4OI0A 3H59A 3AOCA 3D7SB 3T1AA 1AZSB 4DQ2A 4AFQC 1T05B 2RQWA 1WFWA 4ZVPB 1M2VA 2R7RA 2DGUA 3QGPA 5KFDA 3KK3B 3I0SB 5KG2A 1WEZA 4X4UA 3DXBA 5IHIA 1N8RR 3FMWA 1YHQT 3LTOA 2MQMA 1S6QA 4KC5A 1BUXA 2IY5B 1GXTA 3TUPA 3OYFA 2DGVA 2WB1D 2CZVC 4LR7A 5GMKa 2VPYB 1RAAB 1D8ZA 2QEXQ 4OZ5A 4C0OC 3MTKA 2R8JA 4X4QA 1R8PA 2LEBA 1UGVA 1FWLA 1OSDA 2QA4Q 3PO4A 2IG0A 2GO8A 4WFYA 2HHQA 1IKYA 4OYOA 3AOAA 1K4US 3VWSA 4O5VA 4V1Ak 1HSQA 1S4FA 5KYYA 4IOAQ 3TO8A 2KFNA 1R3NA 1HBOB 4ITSA 1F9HA 1JBMA 3R5CA 4O4RA 4B9TA 3I31A 5AT1B 3PW4A 3G6ET 2HBPA 3M2UA 4V19J 1CQNA 4PJOA 2H65B 4A8WA 2FJXA 3I4HX 5KFKA 3MMAA 4OI3A 1CBKA 3B6BA 2W2PP 4JV5F 3DRSB 1KLMB 3O5ZA 2RA2A 1OO0B 2DYBA 1K0XA 1IBCB 3TUZC 4PUOA 1VQ6T 3BBCA 2PMHA 1KOHA 2L8DA 1WC5A 2ZPFB 4ZGEB 3J80E 4X66F 3MEEB 3ENAA 4KO0B 1F1BB 4M78A 2DIQA 4DEXA 4CLTA 3LANA 5D7UA 2MHEA 1L3UA 4J9DA 3DGPB 1M5Q1 3CMAS 3HVWA 1PWTA 4BS2A 4IG3A 3I35A 4FW1A 4IO1A 3MTJA 2W7OA 3A13A 2QMUB 3TW0A 1WF1A 4DOWA 2YNHA 4NZ6A 2B5JB 3LA0A 3FGVA 1UJ4A 3LP1A 3EG9B 1YJNS 5A6PA 4ED1A 1KHIA 4DV1J 1ITPA 4NOYA 2KI2A 3R9LA 2QLWA 4IUQA 2MKCA 3MAHA 1X6OA 1VQ8T 4O44A 1P8GA 2DGXA 4A8FA 2RH3A 4RNOA 4USHA 2MGZB 1FJEB 3T41A 3GWCA 3R6GB 2XK0A 3GJSB 5LJ5h 4KUIA 5DZ7A 3ETMA 3AJDA 2L48A 1NKEA 3HPWA 3M8PB 2YBVA 3T9NA 3DLJA 3HSDA 4H54A 2V8VA 4PJOD 3VS5A 1B99A 1ZZFA 1YBTA 3M55A 2YNFB 1EX4A 3QGIA 1SQEA 8RUCA 4QQDA 4YHHF 4OMQA 4PFOA 4QIGA 2QA2A 1JLCA 3CDUA 2GIFA 1YI2A 2DNOA 1ROFA 2CPDA 2E9RX 2PA3A 2R7VA 3M5AA 4NA1A 4OZ3A 3G9CA 2A36A 1JXLA 3EGNA 1TAUA 3MHXA 3MCNA 4CNZA 4P71A 3PW5A 3HHEA 1QUPA 1RWOB 2ASYA 3R8YA 4ELTA 3MR3A 2GNCA 1PRMC 4RPFA 3KK2A 2HBRB 4P7VA 5E0OA 4TQSA 4QWEA 2F8HA 1IBMF 2MK5A 2F63A 3T1YF 1W6XA 5KG4A 3KBGA 3UO0A 1NPPA 1OX8A 1RHJB 4DQPA 2E1RA 4A4JA 4UZBA 3LX7A 1UCNA 4G6VB 2YSQA 1HARA 1KFDA 4WU3A 4CLUA 3G6ES 2MKJA 2LQ9A 4ALZA 1RHMB 1S99A 1XN9A 2NS1B 2VF3A 2D9TA 3VALA 2HGMA 1BXNA 1O75A 1L3SA 2KTQA 3IFEA 1BIBA 1VLOA 3MCAB 4DF4A 3RUXA 1VQ6S 1HHQA 1WUUA 1C0TA 1SJ3P 4M75A 4BI8B 3F73A 3J80U 1DQ8A 5J2QB 2K06A 2LCWA 1FRMA 1Q53A 1PHTA 2G2ZA 2CZ4A 3OL6A 2D0QB 1KKHA 2F2XA 2H5EA 4GLKA 4HA8A 5DO2A 1K73T 1F9FA 4URSA 1WD6A 2V34A 2KM8C 3CCQQ 1RT2A 5KYXB 2IHR1 1ZA2B 2VWFA 3CC2T 2P6SA 3FFIA 2IVFB 1U5SA 5AJ3F 5L23A 3NMRA 2KROA 1VQ8S 1VQMQ 1NK6A 3DLBA 3HI9A 2JDJA 2DL3A 3J80Y 2KT1A 1D0YA 5ECAA 1WACA 4FF3A 1T3OA 2DT9A 3H90A 2XG8D 3CMET 1RABB 2M8DB 3C8YA 3I56Q 1A6LA 3EFRA 4QW8A 2FYXA 2QL7B 1TR0A 3ZTQA 4N47A 5HLFA 1CJTA 5GAMj 4PR6A 4YDDB 2DPPB 2FGCA 1FK9A 1URRA 4F17A 3MOZA 1J5OB 4N8OA 1X0FA 2CPHA 5ETMA 3JB9I 2OTJT 3NP5A 4FSXA 1HBNA 2KMTA 2EBPA 1EKRA 2SXLA 4PG8A 2RJDA 4M75D 1KD1C 1E7OA 1M1KC 2EAYA 4WPAA 5KFZA 1M90C 2RN8A 4RWWA 1QE1B 1KD1U 3K5MA 1M1KU 3CXCP 4ED7A 4X9DA 5KFJA 4HCBA 3N5BB 2XCAA 2LZ6B 3CCUA 3JCMJ 1WDTA 2IJNA 2V94A 2GMLA 3QMQA 2CZ1B 1W2BR 1FCAA 5K8PA 1B3TA 1O9SA 2FGOA 1AFIA 1N32J 2DHGA 3OW2P 3M0SA 2QV6A 4TQRA 1F5CA 1SH2A 1FKPA 1KQGB 2X4JA 5FDLB 5E3AA 4ECXA 4F4YA 2A6OA 4XU3A 4JB8B 2EBGA 1M1FA 4PCQA 2JC1A 3CCJA 3JB9G 2VH7A 1VI7A 5BXIA 2FC9A 1RWVB 2OPRA 2HMIA 5GJWB 4XAKA 1I1JA 2MZQA 1S1VA 2IYGA 2MQLA 2BZ8A 2VIHA 4IR9A 4ETZA 5GANh 1UVJA 1YKWA 1HWKA 1QP3A 3K8WA 3CCST 3QT6A 1Y71A 3JB9F 3V81A 2DD8S 3S1TA 1JKHA 3NWGA 4LBHA 2RVJA 2LXUA 3INZA 4JI3F 2J06A 3MD3A 2FLOA 4ED2A 4K5RA 1VQ4Q 3H0HA 4C0GA 1K0TA 4PWWA 3EGVA 3BKFA 4RUGA 3ISZA 1NEGA 3QPHA 4FN5A 3E01A 2V4QA 1TL1A 4NCGA 3CC2S 3TARA 4DV5F 2NUTB 2I1RA 4GKKJ 2L3SA 2C3PA 1YJWT 4QQBA 2ABLA 1IKXB 3AQOA 5EHHA 4RWXA 2EWNA 2V8IA 2BKPA 1S1TB 3CMES 4DZ6A 6FDRA 3DN9A 2XS7A 3BQ0A 2QDYB 3MURP 1RA6A 1XNRJ 4IUUA 1RUSA 1PNJA 3NL0A 4DN9A 2V9WA 4Y2AA 2EJFA 1M1GA 4CLWA 2FVPA 3MOJB 2O1PA 1ZSZA 3ENVA 1RQ0A 4IRCA 2ZH9A 4W4MA 3PR4A 2OTJS 1AWXA 4WP3A 3M9NB 2DNRA 1O5JA 2N3OA 2JC0A 4WE1B 2YPYA 5KFYA 2IM2A 2ZOFA 4K4UA 1MV0B 2OPPB 2CQ4A 3IP0A 4PG6A 2EEYA 3LWLA 2HIQA 3FRNA 3NMAA 4Q43A 4NI2A 1ZBXA 1UFFA 3VUZA 1RT6A 3SFGA 1FFWB 2M16A 3TOQA 3O8WA 3OJSA 4Z02A 1Y4ZB 4OQJA 1WA7A 2N82B 3GZ7A 2JT4A 1N36J 3OB9A 3VAHA 3K0JA 1NK5A 3TYTA 2AYGA 5A0DA 3MJXA 2UXCJ 5IWAF 1NKCA 4FIBA 1P6TA 1G5VA 1QCOA 2QQRA 2J9DE 3TQ1A 1M2VB 2RJZA 4HVVA 2KYBA 3JCMV 4DPWA 3NNHA 4RBTA 2RHZA 2MY7A 2CQBA 1RI0A 4BE0A 1S6QB 1IBLF 2QI2A 2FHKA 1R31A 3CCSS 4O0NA 3KNGA 2F8EX 1YQHA 2DNNA 4LF9J 1Z9ZA 2KG1A 1RTJA 1BU1A 4JYAJ 2MY8A 3QJ6A 3GJRB 3K5OA 1Q7YC 2DKOB 5DG9A 4NXMF 3DDKA 4PJMA 1I94J 1CG2A 5GMKl 4OI4A 4WFAQ 2GNKA 4DL2A 1Q7YU 1F5AA 3M8ZA 1SJFA 3TUJC 4PPZA 1KHWA 3DLGA 3D6TB 2BKDN 1OQ3A 1Y0HA 1EFNA 1T94A 4K2XA 1YJWS 4B3OA 5KYYB 3OYKA 3JTPA 2PMWA 1X4HA 2E9ZA 1M1HA 2GBQA 1T0JA 3N9UC 2M2BA 2IAJA 3OMCA 4PJOB 1PKTA 1H2TZ 4C0HA 5KFIA 2MXYA 3MMAB 3PT9A 5B0CA 3VZHA 1KSWA 4A8OA 1R6VA 4Y91A 4PUOB 1CULA 3KLVA 1LOJA 4BDYA 1YRUA 4YB1P 4FYVB 5LJ5d 1YI2Q 2DD5A 2KRMA 4M78B 1EJ7L 2GQIA 1G2EA 2AT1B 2IVYA 2N4DA 1XEZA 4KGKA 4QJVA 4IG3B 1I4K1 4FNHA 2G1HA 2MZRA 1KQSS 2YNHB 2CJKA 4ZKAA 2AEFA 2XI9A 4JJCA 3LP1B 3M9OB 2LT1A 3Q83A 1OU8A 2YDLA 4ZVFA 2DNUA 2B9XA 3PIOA 2L3MA 3WIUA 4HH1A 1H92A 4O44B 2JRSA 1TTHB 3K17A 2R7OA 4K11A 2EGAA 5HMYA 2GIQA 3QFHA 2RS2A 4DSJA 4F16A 1QMCA 1V6HA 5D4LA 4NL3A 4WCIA 3PY8A 3REBB 4UUXA 3H20A 3T6JA 3NNCA 5IT4A 4QW2A 2XHWA 4J83A 2KJWA 2L0AA 2M0OA 5LJ3j 4JI0F 2RIJA 2ED0A 1JLAA 2FRYA 2J9EA 2D3O1 2HMAA 3V7RA 2KEAA 3FBBA 1JLCB 2ROLA 2VG6A 3B78A 4OLPA 4DS5A 5F8IA 2CPXA 2I6WA 3GNFB 3J81U 3RTVA 3D4JA 3S7RA 4D8KA 3EGDA 1FX4A 2WZ1A 4MYUA 2DITA 3ELHA 5KG0A 3KK2B 2CP7A 5LSRA 4CRJA 2YWHA 4RJVA 3F56A 4VUBA 4B08A 4ZDNA 2O31A 1JJ4A 2RU9A 4ECUA 5GMKi 4USIA 3F70A 4QWDA 4K7QA 2DGQA 3D0IE 2P2CB 5J2MA 5DLQE 4DUYJ 3PMIA 4JV5J 1YP5A 1NJIR 4WIIA 5KYUA 3POTA 4K4VA 1T95A 4JI8J 3CD0A 2RQMA 1WTBA 1VQPT 1C0TB 4BY6B 4M75B 1BQXA 1X9MA 2E7VA 4F0MA 4N0AA 5IC6B 4J9LA 4FU6A 2J9CA 1N34F 3OV7A 3ZZZA 2KI7A 9RUBA 3CCUQ 1NYGA 2I9SA 3U27A 4DR6F 3DI6A 4I7FA 1VQ9A 1U1NA 4DU8A 2DXUA 5EGYA 1TL7A 1WKKA 1RAOA 3H41A 1FKAF 2FQQB 3PX0A 1QY7A 5SUHA 1I81A 1RT2B 4WJBA 4YFUA 3QIDA 1BQMA 3FFIB 5GAOl 5CYQA 2HSEB 4LSZB 1KR4A 2G13A 2YKNA 3AAWB 5KG3A 3J7A1 4USTA 1YRXA 3TUIC 4OMPA 2RQKA 3W2VA 2VKNA 5GADU 3KHHA 1VR6A 5CYMA 5F8JA 3CCJQ 4TLQA 1PRLC 4EBCA 2VASA 1H7WA 4QBUA 4C92A 2AEJA 3G86A 5HLFB 3QRRA 1CJTB 1X4CA 2BA9A 2HRYA 2IC3A 4PLLA 2GMHA 1JXMA 2OHDA 1FK9B 4QR2A 4JI7F 1PKUA 5L46A 2XMAA 4QQ6A 3IM9A 1R8OB 1PSDA 1HBNB 4A47A 2LQNA 3W2WA 4DJBA 2XB2D 4RG8A 3CCWA 2DEJA 2H4YB 3GIMA 2EIFA 1M4ZA 4LF7J 2RQCA 3QRQA 4ZN3A 1C1BA 2D8HA 3VS6A 2W24A 3QT5A 4PXBA 2BOAA 4NLXA 4TYBA 4XK8E 3QO9A 4ILRA 5GANd 4UOCA 2NZ4A 2X7IA 3KFVA 2V8DA 5G0RA 3KJVA 4AFZC 1GX5A 1JK9B 3HT3A 1FKOA 3OYYA 2Q1LA 2E7XA 5E2QA 2LXIA 2PU9B 3MPVA 2UUBF 2P9EA 3VJPA 1RCOB 1FKPB 2AX1A 1X69A 4JZ4A 1OSCA 4M4ZA 3J7AN 2PI4A 4CI0C 1T0HA 2HPUA 3RU0A 4J5OA 5D15A 2OPRB 2HMIB 1GFWB 2DVIA 3W5ZA 3WDOA 3PG9A 1VQPS 1PILA 4Q8FA 1S1VB 1R43A 2J0XA 5CD4A 2AX0A 1YBAA 4QVZA 5E5NA 3ZFVA 2VQEF 3V81B 2ERRA 1JKHB 3X28B 2XZTB 3QDRB 2HCKA 2ZJPQ 2OPQA 4NLUA 4TLRA 3S3MA 4FVMA 1NLOC 3CC7T 3CD7A 2M51A 1PCXA 4XQ3A 1N8RT 1UWAA 3DB4A 1Q78A 1KLNA 2LX9A 2QRRA 4PJNA 1TL1B 1YJRA 2BJ8A 5AJ3J 2OP5A 1YJTA 2RRNA 3NGRA 4LQ9A 8AT1B 2M7SA 2EG2A 3CDWA 4P2FA 3TJ9A 4M5MA 1Y00A 3IR6B 1LXNA 3EG2A 2XNQA 2J5AA 2XNRA 4KPCA 3LQVA 4QWBA 1G83A 1SC1B 4C8QE 1B7FA 2HQHA 2HGNA 1ZSZB 3LW5E 1K73C 3CC4T 2C22A 4U7UD 2GW8A 5LJ5Y 1GCQA 5E3RA 5DETA 3N0VA 5AE1A 3OFGA 1U1SA 2KT2A 2UUCF 2NSCA 4XK8C 1IKVA 2CDQA 3IWLA 4CH0S 3EDRB 1M0SA 4NI2B 4N41A 3A3PB 1RT6B 2BBEA 1FMKA 3M0PA 2GQ2A 5M2UA 4BD3A 3NG8A 3VAGA 2DL8A 1NJWA 2JHEA 2EI5A 2H5JB 2B9EA 1IR2A 2GAGC 5CR2A 1YNZA 4P10A 3MR2A 4ZJLA 1ABQA 3OA6A 4BB7A 2DZ9A 1N6AA 3ZNJ1 3ADAC 4BI3A 2C3MA 4DX5A 5D8HB 3S01A 5KFHA 3OYNA 1PIEA 1VQKA 2E10A 5JVHQ 4QIEA 2L9WA 3TANA 1NDKA 1Y96A 1NEEA 3UT1A 1NHVA 4OX8A 2DNPA 1K9AA 1S9FA 1MU2A 2XTJP 2PE8A 3M6UA 1VQSA 2F7VA 1RTJB 3CC7S 1YIJA 2VXFA 4GKJJ 3OYIA 3VGVA 2XZDB 4P2SA 3TA1A 3CXCR 1SG5A 3PIOQ 4OB1B 4TY8A 2LJ3A 1WF2A 2ZITA 3IWNC 4YMEA 3P5TL 5L38A 2QSWA 4HHUA 4M7DE 2XBPA 4DV5J 4N4HA 3DLGB 4JJNK 3IQLA 1G7CB 4B3OB 5FROA 3TQ7P 4ZVRB 3OW2R 2PSZA 1X75C 4EO8A 3RGIA 3EG1A 2XY6A 5M2RA 2B86A 2F4FA 4IO9Q 3CCLA 3WX4A 2IAJB 4C8QC 4XU0A 2WBRA 5GAMh 2BW7A 1MGQA 2AHOB 4GY5A 1NLPC 3RAMA 1AD5A 4DCPB 3LW5C 1CULB 2XS5A 3CC4S 1UJ0A 4IQMA 3BBFA 4LR9A 3QWUA 2FDNA 4J91A 4CM2A 1TUCA 1S48A 3DU6A 1KVKA 3CD6A 3HM9A 1UW4A 1TOVA 3KWMA 2MCNA 1RB0A 3TR5A 5LT5A 1HNZJ 2KK4A 4J37A 4ZVOB 4RTZA 4QQGA 4HR2A 3TZZA 2E41A 2YH0A 4PYDA 3CCET 1LWXA 3K58A 1FXRA 4PK4A 2FB0A 3UCGA 3MMBA 4D3HA 4NMLA 4DV6J 2BJEA 5D6GA 4B9SA 1K9MR 2FB7A 1I07A 4OHVA 3T3FA 1IRXA 3OYBA 1X0PA 5KFWA 2FG0A 3MF5A 3BPDA 3SEMA 2QQ9A 1A9NB 2QQSA 2ZH3A 1KD1R 3KLEB 1M1KR 2MEWA 4P74A 1M8VA 1GTEA 2NLUA 5L9XA 3VR1A 3QWYA 1QVFR 3FSYA 3VAJA 4Y3CA 3R3TA 3LALA 2BUNA 1WGSA 1LWCA 4ER8A 4ZMMA 1Q8KA 3H2LA 2EPDA 2L9NA 1TUGB 1RU2A 1U4BA 1JLAB 4CCHA 4KBMB 2GJIA 2E3HA 4ZIVA 2EFOA 2DCUB 1VQ9Q 2E29A 1XERA 2VG6B 2R5MA 1KG1A 3VTIA 2DIGA 3HSJA 3QGHA 4OYAA 1IBKF 4FXDA 1W4SA 4MIAA 3LPEA 4J5YA 4M7DC 3EGDB 1QVGS 1FVQA 2J9DA 5EWGA 3JB9H 5K8NA 3R6NA 1IM6A 3V8LA 1H0HB 3MD1A 3N5FA 5AE2A 2DPIA 4ELYC 2ZFHA 4F04B 1JX4A 2DO4A 5D4OA 3MZIA 1V3RA 3M0UA 4AFSC 5EWFA 3QJYA 5EC7A 4MK9A 1M3CA 1QSSA 1B34A 1SH0A 1MMDA 3G1JA 1SHGA 1SC3B 1BLUA 5J2MB 4OYZA 3PNWC 4EUVA 4LDYA 5LOQA 2CDTA 1X6GA 4N5SA 3I9QA 5KYUB 3POTB 3VAMA 3D54A 3A4TA 4EFAC 2FJWA 4LF4F 3QLHA 3META 2C3YA 4USUA 4OZLA 2CQDA 5HK0A 1NRKA 2I0XA 3HMJG 4NLGA 1CLFA 4KYZA 4DR7J 4XAXB 2K79A 5EUHA 1YJ9T 2AQ4A 3EM1A 1VQYA 4DFPA 3WZ0A 1BGXT 3QSUA 1NSKL 2C3OA 3FRYA 4OF1A 3DI6B 2FVUA 2AP6A 3RB6A 2DH8A 3KLFA 4F7UE 2PZ1A 4I7FB 5H9FK 4JRPA 1TL7B 2GA7A 1S76D 1YHQA 4M77E 1IR0A 3BDUA 3CCES 1YZ6A 4J9RA 3DLHA 1W25A 1MMAA 2J6TA 3MI7X 1BQMB 4XDCA 3UDCA 2Z57B 5CYQB 2N7YA 1UJ6A 1J5EJ 2YKNB 4I4BA 4ZHRA 4LFCF 5DY9A 4DCJB 3AQPA 3LP2A 4ZVHA 3DHXA 2D6FA 4LF5F 5CYMB 3CDAA 4C92B 1K47A 3OYHA 2I2LA 2LEAA 2YWFA 3HSZA 1FRIA 2V4JA 4KFBA 1M30A 3CWJA 2IC3B 2FHDA 1WI8A 2JTMA 1T8EA 3H8YA 1X5OA 2LQJA 2QXFA 2CH4W 1T3NA 3NXZA 1X31C 3FDSA 3FEZA 4HLBA 4FPIA 4OMNA 1X8DA 4DG1A 1TL4A 3W2WB 3JCMh 1M3BA 5CQGA 4J9CA 2QZ8A 2I8EA 4RG2A 3FNNA 1C1BB 2KBTA 1AA1B 3CPFA 1NK4A 4NLQA 3QO9B 3NCQA 3FC9A 1SC6A 2CKWA 2LNVA 1NSAA 1RWXB 4YY3J 4JI1J 3GFHA 5G0RB 3KJVB 5DM7R 3SEOA 5HQMA 2YNIA 4FYWB 1FKOB 2VICA 3BQ1A 5KT3A 2VGNA 2BUDA 4A46A 4J9KA 3BE3A 1W7WA 2MTLA 4F2SA 3I5SA 3H4BA 5IH2A 3CDBA 3TVKA 1UVNA 4C5EA 5KCHA 2BQRA 3JXOA 3SCKE 1TFYA 2GQVA 3W8GA 4JI2J 1T9UA 4HT8A 2C0OA 1Q5VA 3TU4K 1RT1A 1JLFA 1SQGA 3A8GB 2CPYA 1YJ9S 3UDEA 2IA0A 1VBXA 1W2IA 3LH2S 2CFXA 2I5JA 3K8VA 4M77C 2DR6A 3VS2A 4A8KA 1D0XA 4K4WA 2DETA 2VD3A 4Y65A 4MK7A 1REVA 5C2GA 3BSOA 4DMZA 5KT6A 4ZVEA 2Y4XA 1F3VA 2PEHA 3Q8UA 2CQ0A 4CO5A 1NJYA 2CH4A 2IYIA 3UFCX 2UUWA 2QX0A 3OVAA 4NMXA 1V29B 1P9YA 3DRPA 3PACA 3THTA 2DAQA 2KXFA 1IWAA 7FD1A 3SI8A 2V2KA 5HATA 3IGVA 1ZAWA 9ATCB 3ZZPA 3SZ2A 2HIYA 1RJJA 4CYUA 2K7JA 2HYIB 1MN9A 3I82A 3M8YA 5I4MA 1HKAA 5LJ3h 4M78G 3HO1A 4LF6F 3ENWA 1B07A 1RAGB 3DOKA 1ZUKA 1UFKA 2XLIA 4UZCA 2KT3A 5KCOA 5I3UA 2UXDF 1VMBA 3MAAA 1YIJQ 4C98A 1UVKA 1FESA 1FWKA 1EHWA 4M78F 3M7VA 4OB0B 1IKVB 2HGLA 2OTLT 3WIVA 1VQNT 3L2ZA 1HPZA 5RUBA 4X4NA 1IHVA 3SSSA 2W8LA 2UVRA 4DSKA 2W1BA 2H3EB 1ZUUA 2VG7A 3MM7B 1OQKA 1V1CA 5KFRA 1R8CA 1IQTA 1SV5A 3KHRA 2ZDOA 2FZCB 2QL5B 2A3JA 3R5DA 3DLLA 2Z8QA 3D68A 4Y0FA 5CCLA 3QAUA 3FMBA 4Y2KA 4DPOA 2VDHA 3A5ZB 4DU7A 2DD4A 4ERDA 3K5LA 1SL1A 5LJ5f 3RBDA 2PNIA 3Q8RB 1WXUA 3W8PA 3FBEA 2HK2A 1RUWA 2RJCA 2IM3A 2VONA 3BDPA 3ZBDA 4B3TJ 1MNEA 3FSIA 3BEGB 1WOOA 5F8HA 1Y96B 3CD6Q 4HXJA 3ZO7A 3RR7A 2AD9A 1V76A 4P52A 2E5QA 5GAMd 3CPWR 1JNRB 3BSAA 1Q95G 2BYCA 1GXLA 2VQFJ 1HL6A 1IREB 1MU2B 4M7AE 2GCFA 4A48A 1FEEA 2AYBA 3AA8A 2JN0A 8ATCB 1QAIA 3J81j 5C0MA 3P6YC 4X4OA 4Q0BA 4OI6A 2R7QA 1KOOA 4J9HA 2FVQA 4TY8B 4DL3A 3UQSA 2OTJA 4G1PA 1OY6A 4DR5J 2J76E 4JUVA 1Y5NB 1G6BA 2J6KA 3PHTA 3B82A 1WI6A 1G3TA 2CJXB 4R0KA 5JXSA 2ZOMA 4P73A 3JCMW 3QJLA 2OLWA 4WZMA 3AHPA 2XMJA 1X5PA 4KGMA 5KE3A 2XWXA 5A0YA 1UWBA 2YPZA 3TEGA 2EBEA 3MEVA 2YVSA 1RYRA 3EMTA 1TKDA 3Q89A 4FZVA 2IJRA 3GB0A 1S10A 4E7ZA 2UXBJ 1JJ2S 2A08A 2JMAA 1WHGA 1WJSA 4E7KA 5LMUF 2XDBA 1U06A 1PG5B 2RHQB 5CZXA 1A0OB 2A1BA 5HP1A 1N8RC 4R8UA 4BC9A 3R5GA 4M75F 4ZVTB 1SBRA 1WHXA 2L5QA 5KFBA 1RACB 1SIZA 1N8RU 1NJIT 2OTLS 3EXYA 1ZM4A 2E64A 4NLOA 2OX7A 4H4KC 4BBYA 2E1CA 2B8PA 4N76A 4NLDA 4Z89A 2ROTA 4ILMA 4Z7YA 5J2NB 1HHTP 3OFEA 2HWHA 4C8QA 1ZPVA 3MMBB 4CC4B 3CCSA 3IBFB 3CMQA 1RAJA 1WNLA 2VVKA 2O66A 4LNPA 4GO5X 2A18A 5IZHA 4YB6A 4YR0A 5E3CA 4C5IA 4DR2F 5D4NA 3EUNA 1RLQC 3HKWA 5ETLA 2ATLA 4R0EA 3MAQA 1Q16B 1FWPA 1QAXA 5D0EA 4LIRA 1S57A 1FNOA 3GJQB 1DTQA 3PFSA 2LQ8A 4BDZA 3AY0A 3MMCA 1OJ4A 4ZVQB 1TL5A 4MAKA 1YJWA 3OL9A 1LWCB 3AJ2A 5GADI 2H4WB 2E5IA 3CNQP 4KRWA 1U6BA 1B7TA 2MQOA 4WTOB 4HI1A 2PTKA 4M7AC 1VLYA 4F3OA 4CNYA 3CUNA 4KH0B 1U49A 4C4WA 3IBWA 1TKXA 3W61A 2ZH7A 1S0OA 2CP2A 5KFTA 4J9UE 1YHQQ 1RLPC 4WYLA 2AJ2A 4J7CA 4IKAA 4EZ9A 3A8EA 5K14A 3GFYA 2K2MA 6FD1A 2WACA 1C2PA 3KDOA 2K9GA 2DY1A 3BN7A 3DLEA 4DV7F 3JCMg 4OYIA 3ME9A 4C8QD 2E7WA 4GLMA 1GNKA 2ESWA 3V6HA 1B34B 3X25B 1QVPA 1IUJA 3OPKA 3R7BB 4IFYA 3NGSA 2NQPA 3MM6A 2DYIA 1VBYA 2F2WA 2QDLA 2GGPA 4DPYA 2AKKA 3N4WA 2GMJA 2QLXA 3Q22A 4NEYA 4GVLA 2QEXT 4FNIA 1AT1B 4ZLLA 4M7DA 3QLHB 2HFSA 4ATOA 2VPXB 3VS0A 3A8OB 1XK8A 5GANf 4P72A 5HANA 2B4UA 3FEXB 1VQ6Q 3OXLA 1D0EA 3A1PA 2WSFE 2M8HA 1KC8T 2G1DA 5D0RA 3TQEA 2RQVA 3V8JA 3KLFB 1IVZA 2J0WA 4RUBA 2HLTA 1HNXF 3JS9A 4WZQA 2QN6B 2YUOA 3N6LA 3I0RA 1H6KX 2CS7A 3JCMd 1U3OA 2G4BA 2KYXA 2VG5A 2QG9B 1WNEA 4HTJA 3QATA 1CJKA 1T11A 2I0NA 4ZHRB 1FFSB 2ASJA 2ILYA 3P45B 2A10A 3LP2B 3Q8YA 2RH2A 1RKIA 1CVJA 2QYGA 1LQ9A 1M9SA 1YWPA 3RR8A 5GAOr 1U6FA 2KT8A 1H3ZA 3T5KA 4NXNF 2O9VA 2V4JB 3OYEA 1IJFB 4KFBB 1KTVA 2CPFA 5BYSA 3G87A 5M2PA 3NS5A 3GILA 3JAME 2WRMA 1KFZA 1Z2ZA 4R0JA 1X7VA 2FZGB 4HCZA 4F3MA 4QR0A 1YRTA 4CLSA 4DSIA 3OMGA 2DNGA 2RMOA 4L73A 4DG1B 5B0DA 4M7DD 3Q1JA 2ZPBB 3GG0A 4JOUA 2R7TA 1HR0F 3BBBA 5KFAA 1RK8A 1MSWD 4YQWA 1IBKJ 1WXBA 1BIAA 4KB7A 4KKOA 4JBCA 2V0NA 3I55A 4USWA 1OYXA 3D0HE 1ARKA 4DBFA 4MK8A 4J9PA 2DTOA 2HAXA 3LGFA 2IDEA 2RHXA 2YNIB 2WONA 3MR6A 3OSVA 1UGSB 2DRDA 1UG1A 2DCLA 1KIKA 3MUTP 2ECZA 2QSFA 5E7OB 2K2PA 3SDEA 3JYTA 3L4BC 2HHUA 4C0ZA 3UR3C 4DZDA 4G1QA 3OTOJ 4JV1A 3IS9A 4YP3A 1CKAA 1FTCA 4B3RJ 3QSIA 1F9EB 2ZE2A 2QEXS 2PMZD 3HVRA 3GYXB 2RQRA 2X1FA 4RBUA 5GMKe 4I68A 2QA4S 5IHKA 4MMKA 4EEYA 1E6YA 5GMKm 2YKAA 3FB9A 1RT1B 1ZAVA 4PZVA 1JLFB 2HD0A 2WSFC 1FX7A 1XNQF 4ZPDA 1EQMA 4L59A 5LJ3d 4A63B 3OTBA 2I5JB 3L9ZA 3TAQA 1REVB 3EGXA 1MMLA 4L76A 3URGA 1QKXA 3OLAA 1BK2A 3DLLQ 3GG1A 4CI0B 1HK9A 1NPRA 4NWBA 4USMA 4ED4A 4W98A 3IG1A 2X1BA 3H0PA 4F50A 3DRPB 1YG0A 4LF5J 4RNFA 5KG7A 3BJYA 2DNLA 3N6MA 3HHLA 1YWOA 2QTXA 4F02A 2D9OA 4EYIB 3E1SA 4CYUB 2WVFA 1Z2LA 2LECA 2M88A 2E1PA 1SC4B 2V9KA 1S72T 4RR5A 4ZCIA 1UJYA 2NPIA 3JAMU 1BC6A 1GMUA 1B0TA 2MMYA 1NH7A 4K0KJ 1HNWJ 1LWFA 3DOKB 3L7OA 3HLUA 4WBFA 4CO3A 5ETNA 5I3UB 1U26A 1N5YA 3OYLA 3MAAB 1KONA 3UE2A 3EYZA 3FJPA 1VQ7T 2DERA 2ZH1A 4TKTA 3VGTA 1XMQJ 1FMVA 1VQMT 4NLVA 2KYZA 3OFHA 2OTJQ 5KFMA 3TAPA 1S6UA 1HPZB 1Z4UA 3QAEA 3QKJA 2GZOA 1OZ2A 1UMJA 4NYPA 3I56T 2VA2A 2VG7B 1T9XA 2F1FA 1H38A 3JAMY 1KQSR 1SV5B 2EFPA 2ED1A 4PNOA 1FEHA 3M8QA 3MM8A 1FD2A 2O88A 4RTWA 3HSBA 4IH7A 4UUWA 4M5KA 2HHHF 2QFIA 1K9MT 1TUWA 2RDIA 5ETSA 3HHLD 1QWEA 4QU7A 2NR0A 3GCXP 4P2XA 3TX8A 5J2PA 2K5LA 2VHGA 1HWJA 4OZJA 1VC6A 1SSHA 1LXJA 1IGQA 4M77D 3DOMA 1JLEA 3LWHA 2D3OR 1QSLA 3E2EA 4XTVA 2RHUA 5BR8J 3CO9A 5GAHU 3OHBA 2CG4A 4M5LA 4Q0BB 3CCSQ 4DUTA 2M9KA 4N56A 2D1XA 2OEKA 4YB5A 2GCXA 2EFVA 2XLJA 3D0GE 1Y3JA 1W26A 3EX7B 1PBAA 5DQGA 4ESRA 4CH1A 1FMWA 3SWNC 1Y7XA 3UD3P 2Q79A 4AL6A 1HNIA 2RQUA 1TU0B 3MP8A 2IVMA 4PRFA 5A0YB 1UWBB 4ECQA 3CXCS 1TMJA 1RHQB 1YJWQ 1NU4A 4Y00A 2MSTA 2XULA 2FY1A 4JI5F 3CJTA 3H5YA 2PC6A 2ZPGB 4DCOB 5FU6B 3RB3A 1GTHA 4UQTA 2I38A 4OX6A 5B0GA 1VQ4T 1S72S 3HKSA 1LW2A 2B4OA 3OW2S 2ATCB 3MUVP 4C5GA 1HIYA 1MN7A 2LCLA 5HP1B 1VYVA 1RHUB 2UXDJ 1ZM3A 4R8UB 4C0FA 3AH6A 3DXSX 1VUBA 4J9VA 1VQ7S 4F4ZA 1TK0A 4EIKA 5GAOm 5IQQA 2LCSA 1VQMS 4ED8A 2GFFA 2ZH8A 3LGMA 3PNIA 3I56S 4MKAA 3QXEB 5F3TA 4C8QB 2M3DA 2HDAA 3DLMA 4GRSA 5HY6A 1N5QA 3T9ZA 2MZJA 4RUHA 3EGWB 4DFJA 2X1GA 3CC7A 2EG1A 1X5SA 2K7AA 2RDDA 4Q2MA 2BKNA 4B02A 4DR3F 1M5HA 1VC0A 1ULRA 1DTQB 4X4SA 3MMCB 1BHNA 2CG8A 5HKCA 5KFLA 1ZZNA 3FDRA 4C92F 2QYCA 3R2DJ 5IN1A 2K3YA 4H4KA 1X6BA 2G0CA 3M59A 4IG0A 3OYAA 4OYBA 1N5TA 4RTXA 5EN1A 2XO7A 2ZPEB 2V8JA 2Q66A 1TKXB 4KPYA 4LRBA 1GMVA 1QVFS 3M58A 4BACA 2FHJA 3MECA 3DHWC 3EJMA 1GXIE 1YJ7A 5K14B 1HBMA 3D6HB 4ES2A 4BE2A 4IDKA 3HHDA 4WP8A 2HFUA 4XTZA 4XTXA 1U2FA 3TX0A 4JLGA 4OMFG 4C8KA 3SBMA 4DUZF 5F41A 4QWCA 1UHCA 4LMZA 5K9FA 2LQ5A 4KHPJ 2CYYA 3UD4P 2DEQA 5D78A 2R7WA 3OS2A 2P4TA 4A8YA 1RXOB 3M4YA 4RKUE 4P6QA 2MOXA 4IFYB 1GEHA 3JSRA 1HXDA 5CQYA 3MM6B 1YBYA 3F0NA 2L3PA 2ZC4A 2CP0A 3JCMb 1QTNB 2GGPB 2ASDA 1YCSB 3G4ST 2IRXA 4K5SA 1Q5YA 3GIRA 4DR1J 1VQ4S 1UGQB 2HFNA 1UVMA 2X3XD 4M7DB 1D0ZA 2CZ0B 1T02A 4QPTA 4IH5A 3S6WA 3BH7B 4ZGDB 1H8KA 2OI3A 3I55Q 2AWZA 2J7UA 4OB3B 3M0TA 4OHXA 2HS4A 5LJ3Y 2JS0A 1S49A 1RTDA 5FJ4A 2HLUA 2QYZA 3BSNA 2FHJD 1Q82R 3I0RB 1H2UX 1F0XA 2E6NA 2VG5B 4OP0A 2YNGA 2ZM6J 1CJKB 1RCXB 3PRBA 3EFOA 4JV0A 4ZPAA 2JNJA 3NPFA 4ZJOA 4OIXA 2OJ2A 2JJ9A 2RNAA 2MMPA 1YI2T 1O51A 1Q0NA 4KULA 1UECA 3ZFJA 4B9VA 2ZEJA 4LBIA 3BDEA 2BJ7A 1FVSA 5CIUA 1YCYA 2JW4A 4FL6A 1TZ0A 3TEHB 1R0BG 1P1LA 3G96A 2ZWPA 1CC8A 1NJIC 2CQGA 5FWBA 1Q8IA 2C3UA 3HX9A 4S0MA 4HCKA 1NJIU 1EIYB 1HA1A 2PIIA 3VQTA 1WYXA 3FZBA 3U23A 4KKOB 2CNLB 2PVGB 1F60B 1CQMA 2DGWA 1OPZA 1IHWA 3RUBL 2XMKA 4QWAA 3M9MB 3ILJA 2K7KA 4F7UG 3P8DA 1HI1A 1YJUA 3MMJA 2DISA 2ZJQQ 2WONB 2E5LF 1M3AA 2DR7A 2XCPA 3BQ2A 2Y3YA 4RKUC 3RW6A 2PI5A 2BQUA 1B70B 4I56A 3SDEB 5CXTA 4K4ZA 4ANJA 1B3QA 3JYTB 3CCEA 2F2VA 4EYHB 4G1QB 4A4EA 3IS9B 3CMAT 3PFOA 2COWA 1JWWA 4LDVA 4NPOA 1UTAA 3TEEA 2K6DA 4FS2A 3PV8A 2MKYA 2VDIA 3JSBA 5K8OA 4PPDA 1VOMA 4UQGA 5B08A 2XO6A 3KFWX 1E6YB 2FPFA 2W7PA 2HFZA 3QO3A 2GQQA 2EQMA 2UP1A 2BX6A 3CCMA 4NCBA 2R5AA 5C2CA 1NK7A 2OELA 4J9QA 3PJ9A 2EW9A 2ZBCA 4AYBD 4F8RA 1VGYA 1Y7PA 3QPIA 1FTRA 3G82A 3RBXA 2DHAA 3J7YU 2HW3A 1S97A 2LT4A 3LP0B 2R57A 3RBEA 4NLPA 3EGXB 3ZTSA 2RHIA 2XGPA 2HZCA 5IV4A 4WFNQ 2MF2A 4E7JA 2IIMA 1NAQA 4B3SF 3ZEHA 4KUDK 3IG1B 4AQYF 4AXJA 4LF1A 4FW2A 1YI2S 4PABA 2X51A 2LDIA 1LKZA 3NBPA 2CA9A 3HHLB 3QJPA 5GAMf 3CDEA 3P3DA 1RHKB 3X1LB 2A2CA 3PW2A 1PJ7A 1HHSA 4ZVGA 1XTZA 4HHJA 1KC8C 2X3GA 1NDLA 1QAYA 1QLYA 3JQMA 4J7FA 3JB9D 2DNYA 4UTGA 1LWFB 3J7Z5 1G3YA 2DK2A 1KC8U 2COLA 1WG1A 1S6PA 1N5YB 1R6YA 4NA3A 2CWXA 5I2MA 2DO3A 3PXGa 1DQAA 1W2BA 2VBZA 3MKDA 2RSQA 2ZVSA 3W66A 4K4XA 2CQ2A 4JI6J 2P5VA 5AXKA 2B56A 2XZWA 3U1NA 3CCJT 4OJ3A 3GONA 3E2UA 1JXOA 4DS4A 1VDHA 4X4RA 5F8GA 1PM3A 2W01A 1YJ9A 3GNGA 2XLKA 4ELZC 5HMXA 3SDZA 1LFWA 2ZHAA 1EARA 4H4OA 1BWEA 2RB6A 3RJMB 5CKHA 4PXDA 4X62F 4L75A 4B9WA 5KFQA 3IN5A 3M8QB 4WFBQ 2LYVA 2C0IA 4LVNP 5B7WA 4WFXA 2MHNA 2K57A 3MM8B 4MH8A 5ADZA 1M5PC 5ETKA 2HWTA 2JFDA 1LVKA 1VYUA 1LFPA 2P6TA 1WSRA 4OV6A 3A8LB 3DLKA 1D3WA 1KVIA 1TELA 5J2PB 1LV5A 1RBOB 2WAQD 4ANDA 1JQQA 4Q8EA 3DOMB 1JLEB 3EWGA 4HKQA 2K3BA 2CP3A 3T1HF 2FPHX 5FD1A 4C8ZA 3AFGA 3MM5A 1FERA 4RW9A 1YITA 4LFAF 3FCWA 5G4DA 4WK3A 2FTRA 2XI2A 4PL6A 4V19X 5DDQC 3Q24A 2ZC3A 4J9IA 1R27B 2XY7A 1VK8A 3G8SA 4B9LA 4C6AA 6AT1B 2QTWA 2VPWB 2B4VA 2QC3A 1VFJA 4D3GA 1XNIA 2DRAA 3BR8A 2D3ZA 1HI8A 1FRHA 4LF8J 3CC7Q 1HWIA 1N33F 2DPJA 1T9VA 1DZ5A 1F2HA 4O3OA 1OPLA 3CPWS 2GFUA 5C6SA 1ZM2A 4QYRA 5B09A 3B4MA 1QVGR 3EHRA 5KT4A 1SCJB 1WDDA 1HNIB 4FKXA 1X43A 4J90A 2VFTA 4TN2A 3ULHA 1N54B 4A4FA 4NLSA 2DVJA 2D74B 3D67A 5H9FJ 3SXLA 3VRYA 4ZVSB 1WTFA 2YRDA 3VGSA 2COYA 5CYJA 1LW2B 4LREA 3LGLA 1D9FA 2UU9J 2CAJA 2HQ3A 2E6ZA 4LUBA 4A4KA 4RTTA 2ALZA 4GC7A 2AYEA 4XTWA 5GAEI 2D41A 4EMKB 1QQJA 2R9LA 3HL8A 2HQXA 2XG8A 4ZA1A 2DB1A 3SCIE 1WOSA 3EZUA 1NDCA 4CDIA 4B9NA 3N79A 1RADB 4M7AG 3CCJS 3TCJA 3W3SA 4BI4A 4LR8A 4WFZA 2JFKA 4Z37A 3HRUA 4U8YA 2K3KA 2HNDA 2F4VF 3FEYB 4KR0B 3UA7A 2DGOA 2HRUA 2RM4A 3EE3A 5IC4B 4M7AF 2MPXC 2MDAA 4LFBJ 5LXRA 3RMQA 2DY9A 2M4MA 4RNHA 4KHMA 2K8GA 2A0FB 3LOUA 3C94A 4PQUA 2LP5A 2E9TA 2Q43A 1DRZA 3I9V9 1FJGF 3BN4A 4IRDA 1LEOA 2QLJB 1HJDA 3GCWP 4F25A 1ZLMA 2NUHA 2JX2A 1FJCA 2P9GA 2W25A 3SQOP 4LDUA 4MDWA 3HJFA 4L6V5 4IG0B 2CQHA 2YWGA 4JPBW 2JEGA 5A8WA 4FDFA 3WVDB 3SCJE 4NLWA 5DDRC 1JXVA 2CNKB 1IM4A 2Z2MA 3MECB 1YTYA 5L9NA 2V6AA 4XPEA 1I5OB 4F2RA 4EWTA 2WW4A 1HBMB 2FJAB 1NYFA 2R8GA 4DR4F 4IUVA 5C24A 3KJNB 2XWYA 1WC3A 4IDKB 2F40A 4M5NA 2LDMA 3EDQB 4RW6A 3NGDA 5CKBA 1UE9A 1JMTA 4HVUA 5HVHA 1R7IA 1RYSA 2AGOA 3GIJA 2BR0A 3QWXX 2RMLA 3ISNC 1N5ZA 3LH0A 2APOA 2KVQG 1K9MC 3ZNUA 2LJ0A 1VQNA 2F9JA 2FJBB 1SI9A 4PWDA 1K9MU 4LIWA 4N4GA 3GP8A 2CZ7B 3VUBA 2NYSA 5GVQA 4DOVA 1NPKA 3FVYA 2XHCA 5HJYA 4JI4J 3KXTA 1U1TA 1JEGA 2WHOA 2AIRB 4LUDA 1GT8A 1T0TV 1AUDA 2KKHA 3H2UB 4LRDA 5KFXA 4N77A 1H7XA 3WC0A 3VS3A 3MEDA 3UNYA 1S5ZA 2HZVA 3UCUP 3SSRA 1AEYA 3JTOA 4FXVA 2EYYA 2GIRA 1RTDB 3GV7B 2R7UA 1V3ZA 5HMZA 2VKRA 2EFQA 1AB8A 2CKKA 3RR6A 2FC8A 5F8LA 1SKRA 4HVWA 4C2MA 4M78E 4A54A 3U1LA 1K76A 2YNGB 1U2CA 2HNYA 2J8AA 2IPOB 1MMGA 3EFOB 5HJXA 3CCEQ 3QJJA 2MZSA 1FRLA 3PVLA 3GIKA 4RTVA 2MQQA 1HD3A 4YR2A 1SB6A 1PC4A 4ANEA 2QK0A 3NLCA 4B3MJ 3JCMX 3EHQA 1S9GA 3BH6B 1JB0E 2AEMA 5KFSA 1NB7A 3SIPB 5LJ3f 2MKSA 2VZ9A 4WYWA 2F69A 2HRTA 2VYTA 2Z0WA 3C46A 1WWHA 2DJQA 3CCMQ 3PFEA 2FLPA 4DX8H 4C0DC 1OS5A 1FXXA 1WEXA 1C1CA 1FD8A 2R2SA 1GFCA 1KFSA 2I2YA 2YKPA 1G4CA 4AUKA 4ZIWA 4DV1F 2DRMA 5IT9U 2M02A 2GTJA 3MEAA 3LWIA 3S6EA 1TKZA 5D6WA 2HS0A 2DGSA 3HPOA 1DLOA 3D3CJ 1TWBA 3GR0A 4X65J 4NCAA 2QL9B 2YQ3A 2YUQA 1S7IA 5H1SV 1VQOA 4BDPA 3UATA 2RHYA 1EKSA 2YLCA 4E7SA 5F8NA 1KQ1A 3KG0A 3I0SA 5SZTA 1WI7A 1VQ9T 4ETXA 5AXNA 4J9SA 1CSKA 2YX4A 4WKRA 2PUOB 4I2QA 3W5XA 3HHKA 2F8MA 2K5IA 2PGCA 5D4PA 1O6XA 1HQ2A 4OZ1A 5J3BA 2PA8D 2WVBA 3PKYA 2CT3A 2H1YA 5I3PA 2XS2A 5DQIA 5FRMA 1OY9A 3FQLA 3RAQA 5EG2A 3LO3A 2Z0GA 2JEFA 4XU2A 3K5PA 1ZS6A 4DV4F 2XC9A 1D09B 1FWZA 2WB4A 3VAFA 4ES3A 3NGUA 4DXLA 4NOHA 3T5HA 4Y6IA 4M78C 2E5KA 4E7IA 3WXMB 3G82B 4M75E 3T5JA 2HNIA 1AVZC 1YJ9Q 1KS2A 3K89A 2PQWA 3IMQJ 4C7QA 2FJDB 4CQ1A 2QASA 2Q3PA 2VC0A 2B9WA 1LW0A 4X4PA 2DRBA 2OD6A 5J1NA 2W8KA 5GAHI 3UNGC 4ZP6A 1M27C 2YLBA 2EFIA 1UJ5A 2LA6A 2B6AA 2DNQA 3FK4A 3NBPB 2P8IA 1HMVA 3TZYA 1JB0C 2XSFA 5KFUA 1IN0A 3GLJA 3J81E 1D3BA 1I6JA 3NAIA 1O0PA 4W92B 3VKIA 2FRWA 1IKWA 1WDXA 2W9CA 3MFIA 1YITQ 2IBOA 1HWLA 1X4GA 4DV2J 1IKYB 4CIOA 1S6PB 1MWQA 1KVJA 1JJ2R 5A8RA 3D9BA 3NY0A 1A7GE 3R7NB 3AXKA 5HROA 1S0VA 1VA7A 1W2BP 4YOEA 2RUGA 2Y1LB 1CS4A 5A0GA 3LH5A 3DB3A 3M2UB 2OUGA 2Q6CA 2WK4A 2DKGA 3REAB 1AUSL 2LQBA 2E5LJ 1TS9A 1R8BA 2E5GA 3SHWA 2XYPB 3JTNA 4H4OB 1SQFA 3GR1A 5D0GA 2DH9A 1ZTWA 1SPBP 4HCCA 1OULA 2AZ1A 3J7ZT 5IV3A 4KIAA 2RQTA 1ZA1B 5A6WA 2OSQA 4DL7A 3PX4A 1VQ9S 4ZS6A 4A4GA 4BUGA 4CTAA 1NJZA 1H98A 2B7CB 3DLKB 4ZPCA 5I2SA 1RAFB 5KYWA 3MR5A 1S1UA 2HKNA 1S1WA 2R8KA 4Y28E 3LAMA 2J6SA 5ETOA 3IA0A 3CD5A 2HQIA 3GPAA 4D6WA 2HHSA 2YXYA 3AHUA 1VQ5A 1SRLA 3MM5B 4RW9B 2A37A 1C0UA 5FIIA 4PWUA 2KZMA 4BY6C 4M75C 1MWYA 3TJAA 4DI6A 2RS8A 2B0GA 2DVEA 1GAOA 2BVZA 3VRZA 4GMKA 1N32F 1LPLA 3ZZRA 1TH7A 1NNDA 2CNOB 1PYOB 5CD4H 3FUYA 1U45A 2VA3A 4J6YA 1G2BA 2ACYA 4EI2A 4B3SJ 5CHCB 3PVXA 1IXDA 4PQAA 1RZMA 4XTUA 1ZOTA 2KFYA 2OMOA 2AF6A 2GVDA 1D1BA 3ENQA 3U7JA 1UGPB 3QT7A 2PN6A 1EQ0A 3M30A 3CE8A 2KT5A 2EK6A 2WBMA 2ROEA 4L6V3 1N5VA 5GAGI 2LCCA 5KFPA 4IIOA 4J9NA 3QUIA 1VIFA 2KAFA 3KDNA 2EC2A 1U8RA 1UPMB 2X3WD 2Y0SD 2WW8A 3BGOP 3CCRA 3ASKA 1PGZA 1WHYA 3UD5A 3RB4A 4JV2A 1MV3A 2ZOGA 4RW4A 4YS2A 2RF2A 4J9FA 5J1EA 3MCOA 2QE5A 1X4AA 3KMQA 3PEHA 3RRGA 4NZ0A 2ROGA 1URNA 3NCPA 2RD5C 1ICEB 3VGUA 4GKKF 3ZTOA 1VQKT 2OTLQ 4HTIA 1S9EA 4J9MA 5GAN2 3M05A 3J81Y 3EH2A 2GGRA 1VQNQ 2HNDB 3F41A 2IMOA 2P0KA 5KFEA 4X66J 3RAXA 3QG1A 1XR7A 3L2QA 3EGZA 4Q7AA 1SL2A 3HD2A 3L2WA 1XNRF 2UZAA 4AL7A 4PQUB 3CCVA 1BMQB 1YIJT 1Q82T 4WTYA 3RMSA 4EBDA 3KJQB 1VISA 2DHXA 5FU7C 4Y28C 2RHSB 4C48A 3ZZ0A 1UPPA 2HQGA 1QKWA 4WWSA 3IM8A 4F0KA 4ZP9A 1QLNA 5A8WB 2NUZA 2RI2A 4O3NA 4KGVB 3BGRA 2UVVA 1U2RA 4O3QA 2ZZMA 4E7LA 1M5SA 4JRKA 2B8QA 3MO8A 3CCLT 2J6UA 1BI0A 3PRDA 5C24B 4MYTA 5FRNA 3W64A 4RW6B 4DLEA 3Q8VA 3SQGA 4ID8A 1RAEB 1HQUA 1N33J 1Y11A 4OZNA 3G8TA 1N36F 2DBMA 1Q86U 1OOTA 2ZH2A 4RUAA 2UXCF 3UWTA 5HVGA 3VVUA 2M5YA 3CD6T 4YHHJ 2DEIA 4PWDB 1DJ0A 4K59A 2EQKA 1RI9A 2VOOA 3SV4A 3UPUA 1L5UA 5KFFA 2W0ZA 3OY9A 1NUEA 2DEUA 3OL8A 4IOBA 2IFXA 4JP8A 1NK0A 1QAJA 3D3BJ 3H0IA 3TJ8A 1AWOA 3V7SA 3RRHA 1MW7A 5KT2A 3IXQA 3R6LB 2HHPA 3MEDB 4LF9F 3Q8SB 1IBMJ 2DXEA 3PM9A 3T1YJ 4DEYA 4PYAA 3ETOA 5H9EK 2PUKB 2QMXA 2NXJA 1FHTA 1ZSZC 4CWBA 1I94F 3I6PA 4FCYA 2J6FA 1WSVA 2W7AA 2R4FA 4DFMA 4TXSA 4E0DA 4DA4A 2ZDPA 3VCDA 2D3UA 1B64A 3OYDA 5A2QU 1VQKS 4FYDA 1KC8R 1VJQA 2HVZA 1VQOQ 2ZH5A 1UUEA 3BO2A 2HNYB 2R2UA 3MEGA 4HI2A 1KK7A 1QVFA 1ZX6A 1OPKA 3DM2A 1UB4A 3J7YI 4CO0A 1H73A 3EG3A 1JRIA 1U24A 3US5A 3C6UA 1YIJS 1R0CB 1N56A 2HVIA 3DCAA 2EFGA 1SH3A 4R55A 1AXQA 3MM9A 1S9GB 1UETA 3CJ0A 3IRXA 3MCMA 1N27A 3BY7A 2C2DA 1M2OA 3SV3A 1NCLA 3PMTA 5CQXA 1PAEX 3CULA 1UDLA 3KHLA 3IAS9 5LSLA 3E01B 4JS4A 4ED5A 2XICA 4NCGB 2FPEA 3FJ2A 5T41A 1WHLA 2UV8G 1C1CB 3UI3A 1NJXA 4ZGJB 5KFVA 4OLOA 5KT5A 1VCTA 1ZBTA 3ILLA 2DH7A 1NDPA 1T03A 4LDXA 2XMWA 2Z56B 2MQPA 3CCLS 3R6OA 4CC7A 3W1YC 2GHVC 1UVIA 2AKWB 2RILA 1OV3A 2KXDA 1F3FA 4KBIA 3K2YA 3PYFA 1TKZB 1V3SA 1DLOB 1N52B 1OPIA 1RLDA 2ZPHB 3HFNA 4QT7A 2EYWA 1DQ9A 1H641 3BPSP 4M63A 1ZPWX 3UWNA 3GE9A 4TNOA 2CJBA 4PKCC 4U9RA 3CD6S 4UW2A 4OGCA 4X1VA 5GMKj 2U2FA 1RT4A 1VIEA 2O5DA 1GH8A 2CSIA 1U0HA 1C1AA 4I2QB 3QIIA 1RT3A 3GV8B 3C15A 2RRAA 2QA4G 2C2KB 4Y92A 2LP4A 2YQ0A 5DDPC 2KO1A 2XSJA 1WHJA 2N7CA 1SKSA 3QDFA 1QCFA 4NE9C 4LBPA 1XMOF 3MPWA 4Q5VA 2MJNA 1UFWA 2CVIA 2DXFA 1VRTA 2YRVA 4NLRA 3HSGA 4IURA 2YTCA 4II1A 1DJ7B 5A0LA 4KJIA 1LW0B 1MROA 1B7YB 2MYSA 3FBCA 4UY85 2DXTA 2B6AB 4DUYF 4IUPA 3FQKA 3JB9J 3ILOA 4NEZA 3CCTA 1HMVB 4JI8F 4XPCA 1E6HA 4JI3J 3A12A 2EYQA 5U47A 2K3IA 1D3BB 2XDPA 3OXFA 1VQ5Q 1TAQA 1IKWB 2W9CB 4P5NA 3AB4B 3GIBA 3HK2A 4CO2A 3HT0A 2BRLA 1WZOA 1X2QA 1XIQA 4NLYA 5GAN8 4C92E 1NHUA 2MSSA 3KUGA 1WIEA 5A8RB 1RE1B 2NPFA 5L39A 3G4SA 1OU9A 2CPJA 5HROB 5J26A 3OYJA 2XGQA 2JM9A 3CEYA 1CS4B 1X4DA 3RYLA 3BS9A 2PO4A 2EVZA 2JM8A 4IUTA 2N4CA 4A53A 2J6OA 1FXLA 3H2VE 1DTTA 2EKHA 3CTRA 5CA5A 4O3RA 2B43A 1UW9A 4ZLNA 1BI2A 3V6KA 3I5CA 2AK5A 5KFGA 2YWWA 2KGTA 3A98A 4BE1A 4ECVA 2ZJRQ 1JLGA 1K44A 3ZTRA 2KU7A 3I32A 2B9YA 1JXEA 4HT9A 2M1HA 4CTAB 2RF0A 5DM6Q 5CKFA 1YHQS 2RT3A 4MMOA 1U1QA 3CCRQ 5KYWB 3SB2A 2OIHA 1KSPA 4PFZA 1S1UB 1S1WB 2CJ9A 3VVTA 1NZ8A 3ITHA 4V2SA 2NUUG 4A4HA 4LF7F 2DFUA 4M78D 4YN3B 2HBYB 5F9NA 3HDSA 3M32A 1C0UB 4DV4J 2ZZTA 3S3NA 3D1OA 1KNZA 2Z2YB 3CIMA 2GC8A 5HMWA 1PSFA 5HVFA 2C06A 3E9GA 4N0AC 1WPYA 2C2RA 5IWAJ 1V5VA 2FO0A 2OMLA 2Z2ZA 3VZIA 1QTMA 2ZBQA 1FX2A 1NXIA 1FYNA 4UT4A 2M9UA 5CO7A 3C3LA 3DKMA 2F9DA 4R25A 3WX8A 3G6XA 2W4PA 1N4LA 4FBTA 1IWGA 4A8SA 3DDIA 4DQQA 3CCVQ 3QWPA 3MPYA 3M54A 1IBLJ 2POKA 4BHQA 3TREA 1VYAA 2GVDB 2JEJA 3GLXA 4O23A 1R77A 3C0CA 3M30B 2OSRA 3CB4A 1YGYA 4I6WA 2D0NA 1PC0A 4YDXA 1E6VA 1SUQA 4NXMJ 2NLWA 1P27B 5HAOA 3M0QA 3NMZC 2MJUA 1NSPA 4C92C 3UW1A 1CPZA 4B9MA 2YHTA 1Y5LB 2X9HA 1FNMA 2AYMA 3OLBA 3UDLA 1S72Q 3CMAA 2DL7A 3SD4A 2ZHOA 1NK8A 4QYZK 4RW4B 3OFFA 2RF2B 5J1EB 3GJTB 4OV1A 3C4SA 2JZ2A 4E2FB 2XEXA 2FPDA 1VQ7Q 1RT5A 1YJNA 1U02A 1FDAA 4DHVA 4K4SA 3IBCB 4RZRA 4M94A 1S9EB 3BO4A 1T3LA 2EGEA 3IC1A 2R2RA 5LJ5e 3KLGA 5IXBA 2YWEA 1KN6A 2EQJA 3OTCA 1RTHA 4O4GA 2K3XA 4DSLA 1HYSA 2BJDA 4CLYA 3L7UA 2EYXA 3CPWA 3VS1A 4N8NA 2VJVA 1D9DA 3NTKA 2ZZDA 1S59A 1WLPB 3T19A 3QYGB 2XD0A 4C97A 5GAN3 2CUYA 3IRWP 4KGZB 3C19A 2RK1A 1VQLT 3TVTA 3OS5A 1WC0A 2DXDA 2ZKUA 1KQKA 5HL7Q 1SVDA 5KFOA 1QD1A 3BGRB 3NRBA 1AYEA 1M90U 4DL0C 3MEUA 3D66A 4XIUA 1WHVA 4KQZA 2KSSA 2HQCA 4HHHA 2DX1A 4OB2B 3W2VB 3M4GA 4DBQA 2EQIA 3OUYA 2DL4A 3M6XA 3H42A 2JWNA 3SQGB 5JJBA 3MWBA 1UHFA 1HQUB 2ZPIB 1Q81R 3HFOA 1N6QA 1C4AA 3AD8C 5FWCA 3NGKA 2W4DA 4JI0J 2RU3A 2FHMA 5A8KA 1ZBJA 3C12A 2UUTA 1CJUA 2KM8B 5CABA 4OMOA 3KXDA 3G6EA 1Z9QA 4C5HA 1FNXH 4K8RA 3NTHA 1SSFA 2VFUA 2E65A 3L09A 4IYQA 1R0AA 3UVJA 4DLGA 3OSSC 1VQ6A 2HG4A 4USVA 1YBUA 1TL3A 3FBFA 2AJ4A 2DF6A 2OFHX 4ZK7M 4ATNA 4NRTA 5IHNA 1RWWB 1SKUB 3HHNB 2HBZB 4QVDA 3WQPA 1I1GA 2E5JA 2DTHA 3MP1A 3B8HA 5HK4A 4GKJF 4LJMA 2QGGA 2Y1IA 3RZAA 5I22A 1GCQC 3QRPA 1WJRA 3KTQA 1WKLA 1HD1A 2DBKA 3TAMA 2V2ZA 1G8XA 1XMBA 1ZH5A 2V68A 2JH3A 2YUPA 2MWPA 2HHVA 3MEGB 3GSIA 3HJVA 1VQ8A 3DM2B 4ED0A 3HVTA 2F5KA 5IT0A 1SIWB 4LD6A 3BW1A 1QVFP 1B0VA 3H9NA 5DGAA 2XDDA 4P7TA 3C6UB 1N34J 2RE1A 1PD0A 2V5HG 2DTJA 5CCMA 2OPQB 4DR6J 3MM9B 1EZZB 3RKXA 1UAWA 3IRXB 1QJHA 2RKIA 3A3OB 2HKQB 1VQLS 4IR1A 4AD6A 3CQTA 1DAXA 5B0EA 1X60A 1Y5IB 5E3PA 4J7IA 5HQLA 5T14A 4NL2A 1HNZF 4C8LA 2DZCA 1UEKA 4ECWA 1T03B 3GF5A 4F26A 4PJOG 3R1HA 1NBEB 3P8BB 1CEZA 1AZGB 2AV5A 1FRJA 2AJQA 3VS4A 1VK3A 4RNNA 4DV6F 2DA9A 3KNAA 2FIUA 4ILLA 1JIHA 3V4IA 2DMOA 2BKOA 3E8OA 1VJWA 2LLZA 1Q82C 4FM4B 4PJOF 3M6VA 2VGMA 2FHOB 4JI7J 2E1MC 3R1LA 1Q82U 2IM1A 1EP4A 2JNGA 3IO1A 5CKEA 2L3QA 4C0DB 2OGUA 1CC7A 1FRXA 2BW2A 2G2OA 1RT4B 2EJ9A 1YK9A 3NCRA 1U0HB 5GANe 4B9XA 3HHTB 2K4YA 1RT3B 4ECRA 3C15B 2JOYA 3SFUA 2X1AA 4C8MA 1TXQA 2JVOA 5LJ5g 1GK8A 1S12A 3G4SQ 4F7VA 5DM7Q 1UEBA 1ZQ1A 2H3JA 2XSJB 3I9ZA 1B4SA 2CJAA 1X4EA 2RJFA 1LNQA 4OL8A 1D9AA 7AT1B 3ZL7C 2UUBJ 5C25A 1WEYA 5L1JA 4FF1A 2C2NA 4KAIA 1VRTB 3ILIA 5D3GA 1UKUA 3CJKA 3BGUA 2VBXA 3CC2A 3EVWA 4LT6A 2H9ZA 1DY3A 4JRIA 2JJ4D 1MROB 2RAQA 1T7PA 1FE0A 2KE9A 1U47A 1YZ7A 1XWLA 2MKKA 4I6AA 1X9SA 2XMTA 3P49B 3C16A 3OVBA 3CMEA 4Q5WA 2LX7A 4UOFA 4G1IA 4LF2A 2VQEJ 2KHDA 4UOGA 3PGGA 2BE7D 1LK5A 3I55T 3VHQA 5F9LA 3ZZUA 4FPRA 1K8AR 3MHYA 1G3WA 1RP5A 2SEMA 4KTQA 1ZYQA 4NX9A 1I51B 4DR7F 1XQHA 4FYXB 1KP6A 4DSEA 3EG0A 2XKOC 1ZM9A 4U7UK 2DXCA 3O6QA 1RI7A 3OQ2A 3S8SA 4HH0A 4YUDA 3V6JA 2AJ0A 4UY8T 1HNVA 4E7HA 2CT4A 4FYYB 4XDDA 2RD1A 1MG7A 2VUBA 3H25A 2A6MA 1UVLA 3D1QA 1J5EF 1WF0A 3OBIA 1DTTB 3EPIA 3PIPA 1VHIA 2RUSA 4M75G 3KLEA 2L2PA 3CJ5A 3G7ZA 4FF4A 5IQ6A 5AYFA 3C14A 2YUNA 3EVMA 1MHNA 2YT6A 3NS7B 2EXUA 4PKDB 4GO7X 2MKIA 2QA1A 5KAKA 2VL1A 1GBRA 1NK9A 3VS7A 1WKJA 3TZWA 1JLGB 3M8WA 2ZAEA 2V2VA 2UUCJ 4LD9K 4KV8A 4OJHA 2N3LA 5KOXA 1U1KA 3IAM9 3EICA 2RPNA 2VOPA 1Q86R 3DC2A 2UVWA 3CMAQ 1GQEA 3ITHB 2KVQE 5KE2A 2CPZA 4N4IA 4LRCA 4JS5A 3M32B 2EJGA 2XY5A 2LVMA 4IOCQ 3HFKA 1XMOJ 1NE8A 1YJNQ 2AHJB 2VFRA 2KDOA 4YY3F 4JI1F 3Q8PB 3CJRA 3QQCD 5ETVA 4ID5A 1G3SA 3H5SA 2DNZA 2ZH6A 2J7IA 4P9SA 2DK3A 5IXUA 1MNDA 2XMMA 3KUHA 4NA2A 1AOJA 4X2BA 4RUCA 3BB5A 3L7PA 3EFSA 3BGLA 5EWEA 2ZNYA 3HCXA 4MTPA 3M2VA 1RWUA 3I55S 3G71T 2LVWA 3FRZA 1A0NB 2VBWA 1E6VB 1VRUA 1SUQB 2B8AA 4JI2F 4X4VA 1GRIA 3L1AA 2UUAF 4E6RA 4R56A 3L2VA 3CCZA 4EMDA 2PVDB 2KZZA 1R89A 3QZ9B 2DGTA 4BC7A 3TNVA 5KG1A 2BRKA 2VB6A 4PFPA 1U25A 3VV2B 4CC3A 4WU2A 2PFFB 1M8MA 1WG4A 2QFJA 7FDRA 3UN3A 3AD9C 3LUYA 1RLCL 5I11A 1GFDA 1KQSA 5GANg 2YKQA 2B4PA 5K5MA 1QP2A 4LDWA 1RT5B 2KNBB 2M0YA 5GAEU 1YFNA 3BSCA 5ETTA 1Q79A 1Q1KA 3RBZA 4I69A 2E3IA 3KLGB 3G6EQ 2E5HA 3GIIA 4ENOA 2QA4T 3ER0A 1AWJA 2JUFA 1RTHB 1PD1A 2PT0A 4O4GB 1BQNA 5GMKh 1P1TA 1HYSB 1ZAXA 2C42A 1RAHB 4Y2CA 4FSSA 3H40A 2ZKTA 2DE0X 3PE0A 4OMMA 3MPUB 5DGBA 1WHHA 2GHPA 3CPWP 5CAAA 3HRSA 3H8ZA 1EETA 3OSNA 3CJ4A 1SKWA 1RU1A 1JLQA 3M2RA 1Y10A 2VFSA 4CC2A 2Q6BA 2MAMA 3NGTA 1U0SA 1EB0A 1EAYC 2OAWA 2DNMA 5CH7B 3AODA 3TSWA 4DPXA 3K7RA 1RAIB 4EBEA 3QT8A 4QU6A 4KGXB 4BCAA 4O3PA 3O44A 3DRXA 3OUYB 4ZPTR 2LU2A 1VQ8Q 1SXLA 2CP5A 3NOGA 3P5BP 4IFVA 2O9SA 3NOCA 3CGIA 1N6QB 1M5KC 4OX9F 5FU7B 2XMUA 2LEPA 5A8KB 1CJUB 4PJLA 2YQ1A 4KHRA 3RNJA 2R58A 3CJSA 1BB9A 2X4YA 5T7LA 1RBAA 4C92D 1MUZA 2AGQA 4B3TF 3CIZA 3QZ5B 1EX8A 3G71S 3TSZA 3AOBA 1R0AB 3UVJB 3BZQA 5EX0A 3VV0A 1TL3B 1IZ6A 3IGNA 4NRUA 3HP6A 2VQFF 2O2OA 2KY9A 3B4DA 2JVRA 1Y3KA 5F0WA 4DFKA 3MEWA 5AE3A 5F3ZA 5L1LA 3VQSA 4WF2A 2D7SA 3IR7B 1D1UA 4PLIA 2HS3A 1NH8A 4DR5F 4NYOA 3TAMB 2W2MP 2YRCA 4DSFA 2LC4A 5DG7A 4EDUA 2LDYA 3H6ZA 4ECSA 4E47A 4USJC 4CLFA 3HZEA 5DDOC 4LF4J 3HVTB 2KRRA 3C95A 2FJVA 1R8AA 3OXGA 1CSJA 4OZ2A 2PFDA 3G6YA 1NEBA 4OJGA 2AU0A 1S79A 5JUMA 1RHRB 3OR1A 4ECTA 4QOTA 2D1CA 1YDLA 2UXBF 4KRTA 3FEOA 5I21A 1WC1A 3BGFA 2E66A 5HO4A 4J9BA 2ADBA 3UF4A 5C42A 2PEBA 1Q4RA 4IIMA 1VYTA 1PKSA 4BWMA 4EO6A 1UEVA 2ZVIA 2RKIB 1YSJA 3Q86A 1K73U 1V5IB 1PYTA 3NHNA 2CQIA 1TVRA 4MKYA 1VIOA 4LFCJ 3AA9A 3MDFA 4QIWD 2HEQA 4KSEB 5LMNF 3K57A 1D1AA 3GMGA 5I3QA 4RO0A 3Q8QB 3CC2Q 1O8BA 1KBRA 4HACA 3UDVA 3MUMP 4X64F 2Y9HA 2KHCA 3MM7A 2QAZA 4QR1A 1XC9A 3NS6A 3H5XA 1TG0A 4WIQA 2WSCE 2EKYA 3V4IB 2V1QA 2KH9A 3ZZOA 4F7UA 4RX6A 4CO1A 1SF9A 3A1YG 2LA4A 4M77A 3CMEQ 1AHJB 1GBQA 3LYIA 2GAHC 2BJ3A 1HBUA 1HQEA 4YR3A 3QYHB 1N88A 3CCQT 1EP4B 2B51A 3L3CA 4MZPA 2CP6A 3GYNA 1E6GA 2KB2A 2OEMA 3QHSA 3S3OA 5THWA 5DZ6A 3DDNA 3MPDA 2ACMA 2YKMA 3JQKA 2MZTA 3X26B 1GMWA 3JSMA 3DRRA 2XM3A 1VQPA 2LRQA 3HZGA 4HVZA 1DURA 2NYHA 1YN8A 3UR0A 3N01A 2BZXA 3M1VA 4DPUA 5FU6C 3R2CJ 4M5IA 4ZJQA 2CNNB 1VBKA 2IIHA 4TY9A 3PTAA 2W4CA 1JLBA 5C25B 1FRKA 4MT1A 2CRLA 1T9TA 3TZXA 2M52A 1BCMA 4ECYA 3PIPQ 5FW9A 1GXUA 4AG2C 4DDFA 3I5RA 4KH1B 2QLBB 5D3GB 3A8MB 3CJKB 5DLFA 2AMCB 1VHFA 2RK2A 2CQ3A 1Y57A 1KTQA 1OYEA 2FVCA 4F36A 4ZP7A 4LRAA 3W65A 2QGFB 4ZCMA 2WSEE 2QLFB 3FSXA 4DQRA 2IVWA 4HT5A 1XQIA 2Y8YA 4OYMA 1RWMB 3C16B 1BD6A 4DL6A 1FFGB 4KE5A 1TMMA 4H4MA 3LWMA 4NASA 4PEOA 2UVUA 4U8VA 2ZZNA 2R7XA 2ROPA 3ZTPA 1C6VX 3C6TA 1KRPA 4I67A 1NKBA 2BDPA 4O3SA 4L5GA 4MZMA 1RSCA 5GMDA 5IFMA 2FVSA 2HHXA 5FLXE 2IM0A 1GMWD 1M5VC 2VBYA 2EVRA 4DQSA 2H51B 1PBUA 4RW7A 5J2NA 1HNVB 1G1XA 2WSCC 4DL4A 2GHWA 3RESA 3V7CA 4J9EA 2DL5A 3MFHA 3PDNA