3T9NA

Crystal structure of a membrane protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
269
structure length
266
Chain Sequence
YDIKAVKFLLDVLKILIIAFIGIKFADFLIYRFYKLYSKSKIQLPQRKIDTLTSLTKNAVRYIIYFLAGASILKLFNIDMTSLLAVAGIGSLAIGFGAQNLVKDMISGFFIIFEDQFSVGDYVTINGISGTVEEIGLRVTKIRGFSDGLHIIPNGEIKMVTNLTKDSMMAVVNIAFPIDEDVDKIIEGLQEICEEVKKSRDEGPTVLGITDMQDSKLVIMVYAKTQPMQKWAVERDIRYRVKKMFDQKNISFPYPRTTVILSEKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and molecular mechanism of an anion-selective mechanosensitive channel of small conductance
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Membrane protein
molecule keywords Small-conductance mechanosensitive channel
total genus 80
structure length 266
sequence length 269
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3t9nA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t9nA03
2AW0A 3HHLB 1OQ3A 1FVSA 1WD6A 1JK9B 2GA7A 2LDIA 2W4PA 1YJVA 3KNGA 3F44A 4HH0A 1APSA 1CC7A 3VTIA 1TL4A 1JWWA 3T9NA 1FD8A 3HX9A 2N4DA 3BM7A 2HFNA 4DPOA 5B0FA 1SB6A 3QGPA 4HH1A 5B09A 1FE4A 3KG0A 4NPOA 2FHMA 2IFXA 4A4JA 2QLWA 3LO3A 5B0DA 1TR0A 1N5SA 5B08A 2OFGX 5F0UA 1CPZA 2AJ0A 1Y9OA 1Q4RA 2PGCA 2XMWA 2ZDOA 1P6TA 2GFFA 3GZ7A 1VIEA 4Y2IA 3BR8A 3HDSA 2P4TA 2XMMA 2OFHX 3HHLA 2K1RB 2XMUA 3BN7A 2BYCA 1N5VA 2OD6A 1OPZA 5A6WA 4A48A 4U9RA 1YG0A 1V3ZA 1YJUA 1FVQA 5B0GA 4Y2KA 2RSQA 2IYGA 1RJJA 3TRGA 1ULRA 3CJKB 1VIFA 2ASYA 2GQVA 2FTRA 3I9ZA 1GXUA 2XMKA 3KG1A 4OJGA 2RMLA 2XMVA 4YEAA 1N5TA 1FESA 2GGPA 5A6PA 2ROEA 2XMJA 3CJKA 2BBEA 1AFJA 3DCAA 3BF4A 1URRA 2N7YA 4FNHA 4YDXA 1OQ6A 1QUPA 1SI9A 1AFIA 2ZDPA 2W4DA 3BB5A 5B0AA 1KVJA 1SQEA 4Q2LA 2OAUA 1N5QA 2EW9A 2HLTA 2K1RA 2L3MA 2RILA 4ZOSA 3HHLD 4HL9A 2LQBA 1Y0HA 2BJEA 4F67A 1U7LA 1X0PA 2VV5A 1IUJA 1R6YA 1Q8LA 2RH2A 2LQ9A 3UDCA 1YJRA 5K9FA 3E8OA 1MWZA 2QIFA 3FRYA 5KAKA 3LGMA 5T7LA 2HFOA 1W2IA 3HF5A 2FB0A 1P8GA 4ZA1A 1YJTA 1LQ9A 2CRLA 5F0WA 2N4CA 4HI1A 2ROPA 1Q53A 2IYIA 1Y3JA 2ACYA 3K7RA 3DXSX 5B0BA 2BJDA 1Y3KA 2KYZA 3BDEA 1OSDA 4OJHA 4A46A 1TL5A 2GGPB 4NL5A 3BGUA 2RK2A 5IXUA 4FNIA 2QLXA 2OP5A 2XMTA 3TOQA 5T7LB 3FGVA 3FMBA 2BUNA 3SFMA 1YRXA 2AP6A 2G9OA 2QYCA 3MCSA 1FE0A 2AJ1A 4DN9A 1AW0A 2K7JA 4EFAC 3KKFA 3HHLC 2K7KA 1K0VA 3WDOA 2Q3PA 1MWYA 1XBWA 4A47A 1S6OA 2OMOA 3IWLA 3QMQA 5B0CA 4HI2A 1KQKA 4OIXA 2K2PA 2PD1A 2HLUA 2FIUA 1FEEA 2RK1A 2GO8A 2OD4A 1VQYA 2KT3A 4OJ1A 1X7VA 2JDJA 1KVIA 2RU9A 2GCFA 2KT2A 3HFKA 3LGNA 2HIQA 4QOTA 4Y2MA 4DL0C 1TZ0A 2W4CA 2LXFA 1TUVA 1CC8A 1Q8BA 3TNVA 4Q2MA 1S6UA 1GXTA 3IWXA 4OJ3A 1X8DA 2HQIA 3MZIA 2ROGA 1VQSA 2GV1A 2OKQA 2VH7A 5B0EA 2KKHA
chains in the Genus database with same CATH superfamily
3FEYB 2X4WA 1XQIA 1WG1A 4DU7A 1U49A 1CKAA 2BE2B 3DLJA 1CPZA 2XDPA 3ISNC 1OX9A 4JPBW 3P3DA 4CIOA 2GQIA 1EX8A 3SSRA 1YGYA 2KG0A 3M30B 3EGUA 3EICA 4IIMA 1L5UA 2EJ9A 4M5HA 3BQ1A 5GMEA 5LSLA 3WX4A 3FRNA 1RKIA 2OLWA 4IG0A 1ZLMA 2CUDA 1LNXA 4FW2A 3TAPA 4IKAA 4GC7A 3ZTPA 4MZPA 2OUGA 4QZVB 2BJEA 2E1CA 4KH0B 4C92G 3QIPA 5J2NA 4XU0A 6AT1B 2D69A 1P8GA 4K4TA 2F63A 3SWNA 1YJ9T 4ZLNA 2CP0A 6FD1A 2KR3A 2V8HA 4Z37A 4PKCC 4TLRA 4FBUA 4FNIA 5T7LB 1ZAXA 3DLKA 1KK7A 5C2GA 1WLPB 2RHQB 3BFMA 3FC9A 2CG8A 2OI2A 1NE8A 4IG3A 1TV6B 1KFSA 2VQFF 1EIFA 2JXBA 2J9DA 4M8LA 1TZ0A 4WE1B 3MM6A 2GNKA 1ZH5A 2JRSA 2BJ9A 4ME7A 2C0IA 3ME9A 3VZHA 3NGDA 2CZ7B 1WD6A 2RO0A 4E47A 4CM0A 2PE8A 2RQMA 4IOBA 5DGBA 1TL4A 2DERA 4OYBA 2XO7A 2WAQD 2L2PA 3SDEA 1LWFA 2IAJB 2QN6B 2DEUA 5KFSA 3J7YI 4NEYA 2B5JA 4LFAJ 5IAYA 1PBUA 3CJ2A 4WF2A 4Y2KA 3TRGA 5EN1A 3CBPA 1VQ8A 4C3KA 2OH2A 1IB8A 5ECAA 4B3OA 4DR4J 2J9EA 3R7SB 5LL6S 1U45A 2DNYA 3SCLE 4Q2LA 4WFAQ 3G86A 2NUTA 1WKKA 3FRYA 3RZAA 2KQWA 2YY3A 1TL7B 4ZP6A 1R77A 2KXHA 1ZM2A 1QE1B 1RI9A 5J3BA 2E5GA 3OTOF 1HI0P 3DXSX 1K8AC 4URSA 2QEXT 3CDBA 3QO3A 1VBYA 2ZBIA 3QFHA 1UGRB 2ZPEB 5D4OA 3HSGA 2M2BA 4OHZA 1D09B 3K5NA 3W5YA 2MHEA 4X4QA 3D67A 5JMNA 2DGVA 4ZTJA 3ZEHA 1GMWA 2HBYB 2FDNA 2RB6A 2ZZDA 4RMOA 1SEMA 2FZGB 2CQ3A 1G83A 2E64A 2DNRA 1WF2A 4OZLA 2BM1A 1LK5A 1IXKA 4H4MA 3PW4A 2YWHA 3AH6A 5H9FK 1VGYA 3JCMg 2DVJA 2Z30B 2Y9HA 3ZZPA 1F9FA 2W7OA 2ZZMA 3E9FA 3CIZA 3A8HB 2DIGA 3RBZA 4QQ6A 2H54B 2EWHA 1YG0A 2CNNB 4YHHF 2EGEA 2OPSA 3FZBA 1E6GA 1LNQA 1T03A 4ZVUB 5J1NA 4F2SA 3PX4A 5CR2A 4ZJQA 2LQ8A 1FMWA 4X64J 1T9VA 3N5FA 3RB3A 1R6YA 1MHNA 5KFGA 2AGOA 4IUTA 2O01C 2ZH4A 4DXLA 1D8ZA 1WHJA 1YJTA 2BJ3A 4CC4B 4DR3J 2HVHA 2JZ2A 5B0BA 4HTJA 3K2YA 1M5SA 3EX7B 1RU2A 3E3XA 4QR1A 3M58A 3O1LA 4MFBB 4P7TA 1TK8A 4IYQA 2R2SA 3DGVA 2D1XA 1VCTA 3QPHA 3NOGA 2VBZA 4PG5A 2RI3A 2KT8A 4RW8B 3KDNA 5IN1A 3JCMJ 4RBUA 3KK3B 1PKTA 4OHYA 2QX0A 2HAXA 2MZRA 3W5ZA 1D3BA 1WORA 2QMWA 3HFNA 4M95A 4JDSA 1CC7A 1NK9A 1JXOA 4PJNA 1IWGA 3NRBA 3C94A 1TR0A 3PKMA 1R0BG 3DB3A 3BGOP 2JVVA 2X1BA 3EVOA 5K14A 2XLJA 1UW4A 2V2KA 3CC7Q 1LW2A 4IH6A 5GMKe 3QYGB 1DURA 1W26A 3VQTA 3UT1A 2DYBA 2FD2A 3TZZA 2DL4A 1FT8A 4IIOA 1GAOA 4KB7A 5CAAA 3CT9A 5KT3A 3SCJE 1D9FA 2K5FA 4J9CA 2BZ2A 3J7A1 3RU0A 4PWDA 1B3QA 1QDUB 1S5ZA 5E3RA 1SKRA 2QQBA 4N5SA 1M27C 3KNAA 1B7TA 4YY3J 1PJ6A 1R8HA 4P75A 4LNPA 2J6FA 4NI2A 4JI0J 4DWIA 2VBYA 3V6JA 1VJQA 4LIWA 1JXVA 4EYIB 1BQMA 3HFVA 2OX7A 2MQLA 5KG6A 2IVWA 3HTRA 1S6PB 1UPPA 3BYRA 4IFYB 2JNGA 3C95A 4QYZK 4PXEA 3LGFA 4JI3J 4M7DE 1WDXA 1IKWB 5GANe 3J7Z5 3MECA 1VUBA 1M90C 1BIBA 5KH6A 4DCPB 5LSOA 1PSEA 3EH1A 2XYPB 3RMSA 1J2VA 4F04B 1Y71A 2W1BA 2RJZA 1MUZA 4YR2A 3FC3A 1RTDB 2Y8YA 2HGMA 2RD5C 1UKUA 1Q82C 2FJVA 5A2QE 3FFIA 4LXCA 1GL5A 5GAN8 3HSDA 4DFPA 2BQ3A 5A6PA 1LKZA 1C1BA 1HQUB 1Q1KA 4U9RA 2C2KB 4WKRA 4DV1J 1A0NB 1SV5A 3UVJA 4J9IA 2KTQA 4UQTA 3Q8PB 4NLWA 5IWAJ 2B8PA 2IM0A 4TVAB 3PE0A 4CLFA 2ZH8A 1JLGA 4LF4J 4FNHA 1OX8A 4K5RA 4XU1A 4C8QD 1T9WA 1N5QA 3EJMA 1Y96B 1WZOA 2CPXA 1FTRA 3RKWA 4RKUE 3M5AA 4TU9A 1Q86T 3ZNUA 3CCRQ 4P73A 4ZPDA 1V9OA 3KJFB 4NA2A 3FCVA 3CEYA 3TUJC 1ZAVA 1GCQC 2VXEA 2XMTA 2NYIA 3GWCA 3EDQB 2VG6A 5LJ3d 5IHIA 1I94J 1UECA 2EK6A 3D0HE 4HKEA 4JI6J 1Z4UA 2BKOA 2YX4A 4I7FB 3PCOB 4ZP7A 2LCCA 2BKPA 3FFIB 1F5CA 2C3MA 3KHHA 1XEZA 3C3LA 1FK9B 2P9GA 2UVVA 4ATOA 3IBWA 4HHHA 3JB9k 1S1TB 4J91A 4R5PB 2DXBA 3RRHA 3H42A 2FJEB 3MMAA 1N6AA 1JKHB 1QLNA 5KFJA 2XS5A 3TX0A 3NS5A 5F3TA 1RTJB 4M5DA 3GIBA 2Y0SD 3M8QA 2JHEA 2FHKA 3I56Q 1WQWA 1OMSA 2PVDB 2OFHX 3SFGA 1F9HA 2CREA 2VGNA 2MKYA 4JI2J 3GIRA 3MP8A 4ZVQB 4KBIA 4M75E 5LJ5g 1U2CA 3V2UC 3C14B 3Q8YA 4C8KA 3OHAA 1ZUUA 2DHSA 5KCHA 3V7CA 3D28A 5H9EK 1IKYB 3D3BJ 4F67A 4WYLA 1YWPA 2W25A 5GAN3 2FZKB 4RU2A 2KDSA 1SJFA 3THVA 1PJ7A 2BKDN 1JLFB 2KG1A 3K5MA 2OSQA 2L41A 5L23A 3C66A 4KY3A 4MKVA 5IXUA 2R4FA 1M5KC 2ZZNA 3T1HJ 3FRZA 2FVPA 3OYYA 1MGQA 3CTRA 4K4UA 6FDRA 3PKYA 2DFUA 2FB7A 2COLA 4H54A 1I1JA 1RUSA 2UXBJ 1IBLJ 4Q5WA 1JX4A 2R8HA 4C3MA 1Q16B 1B0VA 3M30A 3ULHA 2FYXA 3FEXB 2VHGA 2WBRA 4QVCA 1QQJA 5B0FA 1TL1B 3LLRA 2HNZB 3JSBA 3JSRA 1YBUA 3CC4S 1RT1B 4WF9Q 5KYWA 3LGHA 4E7IA 4PL6A 3BR8A 1R0AA 1WFWA 1G3TA 2NUHA 5KCOA 1H73A 1YJUA 1N8RR 4NLTA 3PY8A 2RMLA 3TVZA 5KFNA 2HK2A 2ZC4A 3CCVQ 4C9DA 3QSYB 4FT4A 4EIKA 2HQCA 3GJSB 4MK7A 4O4GA 4PQUB 1TKTB 4WP3A 2VC0A 4YB6A 2KVQG 5GAEU 4DBFA 4OLOA 3UE2A 2FPHX 4LF8J 2N4CA 3W8PA 1WC6A 1SVDA 1NU4A 3W2VB 4OHXA 1B34B 1HFEL 1ZM3A 3MM9A 2LNVA 2ZNYA 2BRLA 1LW0A 2AZSA 2FHDA 1LXNA 3HT3A 3ZXWA 1VQ5A 3I55S 5IXBA 3CMAQ 4CLZA 2ZM6J 2CP6A 4AT1B 2KT3A 7FDRA 3GU0A 1ZA1B 4JRPA 4JOUA 3BDLA 1Q86R 2MIOA 1TUVA 3O2IA 2RRNA 5D0HA 4GMKA 4MJKA 3OSVA 3NNCA 3CCJT 2LJ3A 1WGSA 1OOTA 1QAXA 4OHWA 4ZVTB 3I82A 1KHVA 4JI5F 1RAIB 5I3QA 2HWHA 4NLUA 1VQNA 3CPWP 1Z2LA 1EETB 4ECZA 4K0KF 3GLXA 2ZE2B 5GANg 4DV3F 1KC8T 4XK8E 1H3HA 3GFHA 4DV4F 1X5PA 1BI0A 1G3SA 4OX6A 4KKOB 3EGZA 2QRRA 4ZVSB 4FXDA 3BR9A 2V1RA 1IKXA 1UEUA 1QUPA 2GFUA 1QVGP 2C42A 3DRSA 3CCEQ 1AUSL 1K44A 2UXCJ 3GF5A 3LH0A 4HDHA 3VAHA 4DHVA 4O23A 4PJOE 3UN5A 4RNHA 2BJ8A 3M9MB 3LW5C 3QZ7A 3ET6B 3L2RA 3CCSQ 3TOQA 4L6V3 3AOAA 2HQEA 4JP8A 3AFGA 2DXFA 4EFAC 1JRIA 3CF5Q 1IWAA 3A8JA 2ESWA 4RW9A 1VQ6T 1JQGA 2HS0A 1KQKA 5HK3A 2W2NP 3KK2B 1YTYA 3R7BB 2JL9A 1VQYA 4K4YA 5E41A 4DQQA 4LF1A 3CC7S 4Y65A 1N4LA 5FU7B 1W7WA 2XDBA 2IM3A 2G1HA 2FEIA 4N56A 5ETLA 3I0SA 4ZS6A 1VJWA 4X4SA 1IHWA 1CJTA 3JSYA 4JI5J 1SG5A 4RWXA 2C22A 2HBRB 2R9LA 1NEEA 5CKFA 3E19A 4A8OA 4M7DD 5CZXA 3GYGA 1PYTA 4J90A 2A6MA 5JVHQ 2JEIA 5KFLA 4F7UA 2X51A 1O75A 4LMZA 2ZFHA 5K8OA 2ZVIA 4IQXA 1WDTA 4J9SA 5GAN5 3EGDA 4M77F 2XS7A 4LDWA 3G9CA 2K1RA 1RAEB 2QI2A 2XLIA 2CQ0A 2AQ4A 5DLQE 2Z0WA 2BOPA 1V5IB 4NCGA 5LJ5h 2J0XA 3HRUA 5GANj 2B0GA 4V2SA 1YIJT 4BC9A 2DNMA 1Z1ZA 3PRBA 2JEJA 1RWKB 1RWMB 5J2NB 2RNAA 2DR5A 2B56A 3VAJA 1K0VA 2PQWA 2KE9A 1IKVA 1S49A 1UHCA 1K0XA 4L3KA 1SJ3P 1E6VB 4HVUA 4P2MA 3Q8VA 4Z7CA 2VYTA 3CO0P 3US5A 2QEXA 1KRPA 1U1LA 1RUWA 5ETQA 1G5VA 4IQMA 2ROGA 4BUGA 3VWSA 4PCQA 1XR6A 2HRTA 1KHWA 4OHVA 3HJVA 1QP2A 3M8ZA 1UP1A 2QO3A 3IR5B 4DEYA 3LW5E 4DPOA 1FRKA 2HNZA 3NBPA 1K9MT 1N54B 3VGTA 2R8GA 2G2OA 2ZVSA 1NM7A 3H9NA 2JT4A 4C0FA 2MSTA 2AZVA 5FU7C 1HYSA 5GAN2 1IXDA 3L7OA 4M4ZA 4ECWA 3BO2A 1EFNA 2IAJA 4ED3A 1KLMA 2B6AA 2CZ1B 1N33J 3CD7A 2FPEA 5KT6A 3S01A 2IDEA 3QNWB 4Y3CA 5A0YA 3UR0A 4LSZB 4B3SJ 3RR7A 2DNNA 3QZ9B 4B9TA 1Q82R 1DHMA 1VQ4T 3MDFA 3KK1A 2HVEA 1NHUA 1YWXA 1PCXA 4DBQA 4OX8A 3U7JA 3PM9A 1KSWA 3CJ3A 1R8BA 3RBBB 4J7IA 2DGSA 4JYAF 4JRIA 3GG1A 3JQJA 4DPWA 2XI9A 1BI3A 1VQOT 3BKUA 5FU6C 1X01A 3TSWA 4C11A 2WCXA 1ITPA 2B3TB 5CO7A 1RA6A 2RJCA 4IOAQ 3R5CA 5KOWA 3DOKB 4XTZA 3CMET 3OPKA 2DR7A 4DSJA 1D3WA 1M8MA 5F9LA 3UR3C 3V6KA 3L9ZA 4J9FA 1RT6B 2EFNA 4P5NA 1X4AA 4Y91A 2LDYA 2MGZA 2CYZB 2ZOMA 2V9KA 2LRQA 2UU9F 1XNQJ 4C92B 3DLEA 4JS5A 3UDLA 3G2XA 4OGCA 1NAQA 3CMAA 5GAN6 5FLXE 4KIAA 3T5LA 3K57A 1OYXA 5KFVA 3F70A 1S1WB 2P4RA 4UT4A 2RQCA 3IGVA 1CJVB 4RL1A 3CGIA 4LUBA 3UW1A 5KFBA 1ACMB 3L95X 5D0EA 3UD3P 2EPDA 2CWKA 3D6HB 1M3AA 1BY9A 3RBXA 2GGPA 3KG4A 3R97A 1VQNQ 3BF4A 1HNZJ 1SC6A 2VIHA 5GMKa 1HSQA 5LMNJ 5J2PA 4EMKA 3OSNA 3LP2A 4M5DB 2LC4A 1FNOA 4ZLJA 3AJDA 2B86A 2V34A 2HGLA 1TXQA 3BREA 1RHMB 3M9NB 4KQZA 1M2VB 5CKHA 3CMES 2DZ9A 1WQ7A 1S76D 1NSAA 5F8NA 3MAHA 4F26A 1I51B 4ZKAA 4A4GA 1S57A 3EH2A 1PBAA 3EAEA 1YI2T 4IH5A 1YJNA 1R8AA 1K9MR 2O88A 1VA7A 2W24A 4OFZA 5L1IA 2HIQA 3MCAB 4GRSA 2HS4A 1UWBB 3C6TA 3W5XA 3QIDA 3P5BP 5A6WA 3KYLA 1WXBA 4WFXA 2DA9A 2GHVC 4DR3F 2ZGWA 2EWNA 4EYHB 5KG2A 2YKNA 2CZ4A 3CJQA 2UU9J 4RTVA 3TUPA 5EC7A 2AKLA 1F5BA 4MYUA 5ETOA 3ZTSA 1IREB 4CO3A 2DH9A 1WF1A 2IVMA 5AE2A 4YB7A 4BCAA 5EHHA 2XMJA 2CFXA 4QIGA 4RNNA 4IFVB 3X25B 5CCMA 4MIAA 3GV7B 2QEXS 1RT4A 3GE9A 1MWZA 2W8KA 2D41A 2XNRA 3R1HA 3QFWA 1U0HA 2KRBA 2CVEA 2K7AA 3ETOA 1XR7A 1HJDA 1YBTA 3OR1B 4M7AF 2MQQA 4DUYJ 1KQSP 2LT1A 2QSFA 2YNFA 2K4YA 2HZCA 1FWKA 2K7JA 3M2VB 2ZH2A 3SSSA 1M1KT 4JI3F 2OSRA 1R3NA 4UC4A 4PQUA 4ATNA 1UWAA 2R7TA 2MSSA 1PD0A 1HIYA 1SIZA 3ILJA 1G2BA 4NZ0A 1SBRA 1YCYA 1CBKA 1RTIB 3M8PA 4A4KA 1AZGB 4M7AC 1F2GA 3HFKA 1EARA 2YRVA 2RJDA 2C2EA 3MTKA 2MMPA 1HWJA 2OTLT 1RACB 3G6EQ 1PSDA 1HD0A 3PV8A 4F3QA 4IUPA 1U2RA 3QYYA 3UPFA 1R89A 3A3OB 1NLKL 1ABOA 2RA2A 2N3OA 5AE3A 3KG0A 2W8LA 3CJSA 4B9MA 1IGUA 1C1CA 2HFSA 1J27A 4XU3A 1AB8A 1WWHA 2DTIA 3QBCA 3NWGA 2I38A 3S6WA 3DU6A 1VYAA 2DIVA 1TK5A 2MWPA 1AFIA 3F56A 1IVZA 1ZM4A 2CG4A 5DY9A 4NXMJ 4DR2J 1D1CA 2Y8WA 3RGIA 1WSRA 2N3LA 3X1LB 3G4SS 1S99A 2EG1A 4K8RA 2XHWA 5A0GA 3PRDA 3KUFA 4KKOA 4Y34A 2DEQA 4R55A 4HVVA 4KT0C 4C8QG 2OMLA 1ZQ1A 1T7PA 3HL8A 3H5YA 3ZNJ1 2HLUA 4DS4A 2L48A 5K5MA 4I67A 5C6SA 4NZ6A 2D74B 2W4CA 4J9KA 2EFVA 1EETA 2CP5A 2W9CA 2V2VA 3FBEA 1VQ5T 3UCUP 1KN6A 2X3GA 1VQ9A 3PHTA 5DQIA 4M7DF 2XD0A 3H0HA 5JUMA 1FD8A 1BC6A 3R1LA 1N34J 2DNOA 1XJWB 2RS8A 2VA2A 4WK3A 4RBTA 1VQ8S 2IFXA 1WYXA 2Y3YA 2EGCA 5HANA 5G0RA 5L9XA 4N4HA 2FUG9 3O44A 3QLHB 2DL5A 3OYEA 2KM8C 1VQNS 2A3LA 5DG8A 4CCHA 2OTJS 4NEZA 2U2FA 3AQOA 1Y11A 5HN0A 1S9FA 4C97A 3U27A 1MNDA 3RERA 4BD3A 2DVEA 2RDIA 2E1RA 4N41A 3J80Y 4M7DA 2CNKB 4B3TJ 2KO1A 4RW9B 2A2DA 1GRIA 2ENMA 2V8PA 2CZ0B 2YRDA 2HG4A 4HHJA 5MAOA 2DM1A 4A8KA 3UNYA 1RI0A 2K3YA 4BDPA 4DV7J 2RK2A 1VQ7T 3CD6S 3PDNA 2WHOA 1FJCA 1OPLA 1LW2B 2M51A 1BQXA 1Q81C 1G1XA 2QFIA 3QZ5B 1C2PA 3DDIA 1Y07A 1T11A 3G82A 2C0TA 5D15A 3JSCA 3AA9A 2ZM6F 5KYNA 3G1JA 5E0OA 4WXWA 3G8SA 1VQ6A 3HHLB 2B5JB 2W4PA 1YJVA 3PRVA 4OB1B 1U1MA 4R8UA 1WOOA 4M7AD 2JVOA 4QPXA 4E2FB 2SEMA 1M4ZA 2QAZA 3KJVA 3R8YA 3CC4A 4RWWA 4ZCIA 3EFRA 3SZ2A 1MMAA 3E9GA 1U6FA 4CLSA 4DQSA 1GXUA 2WVBA 1AWXA 2ZPFB 4RU9A 4BE1A 2XHCA 2AEFA 2V4QA 4DSIA 1BU1A 3MR3A 4ELVA 1X4BA 4TVRA 3KLFA 3VYGA 1D1UA 2JFDA 3CMEA 3NCRA 4Y28E 3NTKA 1C4AA 1YJRA 1WG4A 3HCXA 1WIEA 1GTHA 5I42A 3PNIA 1SKUB 5F8LA 4I2QB 1IBMJ 2OHDA 3JS9A 1SSFA 4FIBA 5KFIA 2F5TX 4HHUA 3JB9H 3AJ1A 1PHTA 1W2BR 2QA1A 5HK4A 2C3OA 3SEOA 2Z2ZA 4R56A 4E7JA 4PUOA 1ZOTA 4MMOA 1I0CA 3KK1B 3CPFA 3H25A 5KTQA 1IN0A 1FTCA 5C7PA 3TUZC 2HAIA 4DL0C 4LDXA 2NZ4A 3P49B 3KLVA 2E41A 4WBFA 2AEMA 3LWMA 1KNZA 3MM5B 4RUHA 4KGKA 1QMCA 3EG0A 3CW2C 2OAWA 4UQGA 4G3IA 4NZ7A 4FM4B 2QYZA 4M75F 2D0QB 2VG6B 2O4XA 3Q86A 1S10A 2E5HA 3D2WA 4W90B 3AD8C 1QVGS 3IRWP 2E1MC 3GZ7A 5CCLA 3G6EA 5AXLA 2YSQA 1IQTA 2NLUA 3BGRA 3MMJA 3N6NA 2RSQA 2VF3A 4RW6A 4ZVOB 5HBMB 1SC4B 4YR0A 1VQOS 5D3GB 2RPNA 4AL6A 3MEVA 4F4ZA 5HCKA 1UGSB 3D66A 1Z2ZA 4I1TA 2XDDA 4MZTA 2LMJA 3Q24A 3QT8A 3UQSA 1B4SA 4B9SA 5I22A 1UGVA 4MAKA 1XR5A 2EYQA 4K4XA 5C42B 3H5SA 3PFEA 4HT7A 3O3LA 4FW1A 4B3OB 1RT6A 1VQKS 2MGZB 2WVDA 1SHFA 1P9QC 4WYWA 5KFFA 1C1BB 1HQUA 1N5YB 4OZ3A 4M5NA 2OPRA 3CCRA 1BGXT 3RNJA 2X1AA 1VQ7Q 1M3BA 1NKCA 1D1AA 1WHXA 1ZYQA 2HWTA 5L8RE 2YLCA 1X43A 3LF0A 1UEBA 2EQUA 4A53A 3THKA 3KHLA 5LJ5j 3PTAA 1PNJA 3URGA 3LTOA 3CCWA 3NHNA 2XCAA 1JNZB 3R6NA 4LN2A 1F9EB 3MURP 4Q8EA 1QAIA 3VALA 1IBKJ 2DCLA 3Q8RB 3LUYA 3META 3EGXA 3PXGa 3I0SB 1UPMB 3V4IA 3V8KA 3RR6A 3KJQB 4CO5A 3UN2A 1QCOA 4WK1A 4IRKA 3A8IA 1NB7A 4NL3A 2RI5A 4XPEA 2CSIA 2FTRA 2FPFA 1RTHA 4O6JA 2P6TA 1F5AA 2CDQA 5K8NA 3NGPA 4YDXA 5FRMA 1KVJA 4LDYA 2E5LF 3KDOA 1G6BA 1HNIB 1NCLA 3DRPA 3PYEA 3NL0A 2HEKA 3BYPA 1NNDA 3ILLA 4HCBA 2KI7A 4L74A 3VV0A 5DGAA 2GIRA 3A12A 4P10A 2K5IA 3CC2A 3HT0A 3WDOA 2NLWA 4PJOF 3H98A 2PN6A 4J6XA 3EFOA 1GEHA 3V6DB 1Z9QA 3V4IB 2Y0BB 3NGKA 1RLCL 4OJ1A 1XC9A 4X4PA 4ZGEB 5L8RC 1PKUA 1FRXA 4X65J 2X4YA 3WZ0A 3QKJA 3B4MA 1S72A 4IRDA 4M75D 2JMAA 4TQRA 1X4CA 4PLIA 4FN5A 2JS0A 2EKHA 2PUKB 1KS2A 3IR6B 2DILA 3G87A 2X1GA 1LWEA 1J5OA 4O3OA 3BGLA 2VPYB 3OYJA 1VQMT 4EBEA 1KFZA 2BYCA 3V81B 3ZTOA 1YBYA 4JRQA 3QWYA 1URNA 5U47A 1AZSA 4RNOA 2CZ9A 3JCMQ 3IAM9 3O5ZA 1DQ8A 2E1AA 4J9DA 3DOMA 1T3LA 4X62F 1C0TA 3E01B 4QU6A 3OYLA 2K06A 2XY6A 2DGUA 2LQBA 1Q8LA 1FCAA 2CT4A 2V8VA 3DRXA 2F8HA 4HT8A 1YHQQ 4E7LA 5DJBA 3TVYA 2GTJA 3JAMU 2LEAA 3GQCA 4H4MB 4I2QA 2IYIA 2RHZA 2NUPB 3MCNA 4NLVA 4R25A 2V8GA 3OYFA 2VKRA 1QKXA 1KD1C 1BXNA 2CPYA 3ZZTA 1LV5A 1E6HA 3C15B 2FVQA 2EJFA 3OBWA 4HT9A 2XMFA 2RUSA 3QRPA 5ETVA 2D3O1 1PSFA 2QA2A 2RD1A 3MMCA 2DHGA 1WJRA 4AXIA 1X8DA 4ED5A 3MPVA 4AL5A 1ZX6A 1HWUA 5KFRA 2K6DA 2HVDA 1TKTA 2V2QA 2BW2A 3O8WA 3SCKE 3RR8A 5L1JA 5LJ5Y 4L5GA 1Q79A 4F7UF 1S0VA 3MEDA 3TAQA 2HRUA 3M0SA 3VS5A 5DQGA 3MEKA 1CULB 2UXCF 2JEFA 3AOCA 1IBMF 4O3RA 1XNQF 2OPPA 4LR9A 1LJOA 1S1UA 5ETMA 5IQQA 4MKYA 1QUVA 4JJNK 1BI1A 3JB9J 2QL7B 3QT6A 2HBQB 3HD1A 2ACMA 5IH2A 3I55A 1VRUB 3M6XA 1EIYB 1IR1A 2CQBA 2E7XA 3DCAA 1S1VA 4QQGA 1JEGA 4FDFA 3POTA 1SQEA 2EW9A 2E5JA 4EBCA 3CB4A 1HHSA 5HMXA 2DKGA 2FRYA 1REVB 3I35A 4M7AE 3RAXA 2HSPA 4L75A 1S1XA 4MH8A 3JSMB 4LFBJ 1U8WA 1RP5A 3M2UB 3H2UB 2GJFA 2KRSA 1FHTA 2SXLA 1JLGB 3KLGB 4PYDA 3SFUA 1ZM9A 4PWWA 5BR8F 3VR1A 3IWLA 3TJAA 3VAKA 1K73U 3K89A 4OP0A 4CDIA 2JLGA 3RRKA 1N8RT 5C25A 2QLBB 1KVIA 2KYMA 3EGDB 4PXCA 4RNMA 4DV0F 2BZ8A 1IKXB 4ANJA 4LFAF 3HP6A 3IWXA 2ZHBA 4KPYA 4JUVA 1I1GA 3LP1A 2YUPA 1YDLA 2LFVA 2ZUGA 1KQSS 4CO0A 4M77B 3KLEA 1S97A 2WRMA 3NOCA 7FD1A 4QWAA 3MAAB 3OFGA 3AODA 1H38A 2K3BA 1HHQA 5CYMB 1KONA 1Q82U 2LMIA 4RTZA 3OMCA 2XMWA 1WHYA 3VU3C 5I11A 1NLPC 4PJOD 1ZS6A 3OYIA 2I9SA 2X3DA 5KOXA 2JUFA 2D9PA 1PRMC 4IO9Q 4AG2C 3G71A 4F14A 1URRA 5T41A 1S59A 4M63A 3WVDB 3AT1B 4LF7J 1FWPA 1CLFA 1HNVB 3M0TA 1TL7A 5GAOn 4F0KA 2YWFA 4PLLA 2K79A 4K59A 5A0DA 4NOHA 4DR6F 1U6BA 5J39A 4RG8A 4I4BA 2ABLA 2V26A 1JNRB 2V4JB 3L2QA 1AROP 1JLAA 1I5OB 2EQMA 1XMBA 3PVXA 2OPQA 5HKCA 4ZCLA 3KJNB 2HBPA 3ZFVA 3M1VB 4MIBA 4ES2A 3H2VE 4J9RA 1XOVA 2HKQB 2QV6A 2V68A 4MYTA 3I9V9 4DX7A 4X4OA 1VQ9S 5FD1A 1FNMA 4JI7J 2CSQA 2V8JA 1FA0A 1FDBA 1FVSA 4PJMA 3GILA 1WJ9A 1EQMA 4D3HA 2RHIA 4J37A 1M5Q1 2KYBA 1Q7YC 2L9WA 2LX7A 1HMVB 4DZDA 5DG9A 3REAB 1RBLA 1QTNB 2Q66A 2OFGX 4K2XA 3CMAS 2E65A 3OYBA 5IM0A 1NYGA 1TVRB 2N82B 4B17A 1AZSB 1T03B 4NA3A 2JC0A 1YJ9S 2XMKA 4USIA 3QGIA 1BQMB 4EBDA 4U6PA 2M0YA 3HLUA 3KXTA 5HJYA 3IFEA 2XSFA 3Q1JA 1S6PA 2RKIB 2LP4A 4BACA 4LR7A 3HHKA 4NE9C 2AGPA 5AJ3J 3IG1B 3THPA 1M1KU 3LGMA 2E9ZA 4LRFA 4F2RA 4GY5A 2RRBA 4JS4A 2RRAA 1Y10A 4NCBA 1HBOA 2E4HA 2HHPA 1CQNA 3LP1B 4DEZA 2GIQA 1RADB 1P9YA 3L2ZA 3P8DA 2RHYA 1U2FA 4WTYA 3QJLA 4DV2F 2VQEJ 4HI2A 2MOXA 3QYHB 3QZ8A 2UXDJ 2RK1A 5GMKh 2JFKA 1B07A 4ECUA 1WEZA 5A0YB 5CQYA 1BMQB 3LA0A 1JLQB 4R8UB 4KULA 4J9BA 3W2VA 2LVMA 3VS0A 1FRMA 1I6JA 1H6KX 3LP0A 2KYXA 2IMWP 2K2MA 1UFWA 1NHKL 2WB4A 2ADCA 3IS9B 4LFBF 3KJVB 5KFDA 1HPZB 3WIVA 4TN2A 1K4US 2ZJPQ 2ED1A 3DRRB 1M3CA 4H4KC 4BBYA 3H0PA 5GAHU 2XSJB 3S3MA 3IXQA 4JI6F 1TKXB 2ASYA 4I2PB 5E3PA 1G8XA 3HFOA 2ROEA 2BACA 3BO4A 2E12A 2MQ8A 4ZGJB 4CTAA 1DFDA 2ZWPA 4FVCA 4OZ1A 1SL2A 3B8HA 2Z8QA 5GADI 3ZZYA 1GFWB 2CP7A 5CD4A 4CT8A 3PO4A 1IO6A 4ZVPB 2QASA 4M7DB 4P71A 2HQHA 3OTDA 3OTBA 3FGVA 3H41A 1B0TA 1KEKA 3H2LA 2QQAA 1CKBA 1RT3A 3NXZA 2GAGC 4OMMA 4B3RF 3GFZA 2JM8A 1S0MA 1EHWA 3PW5A 1F2HA 2LU1A 1ZUKA 1QVFA 2JDJA 1TFWA 2DNHA 2YNIA 4C8ZA 1UGPB 1A6LA 1I8FA 4OJ3A 2M3DA 2ZBCA 4EZ6A 3ISND 5HVFA 4B3MF 2HL5C 4F36A 3MHXA 3KLEB 3ZZUA 4HH0A 1VQ4A 2MQNA 2KXCA 2EVRA 1JJHA 3BV8A 5LMNF 3OSSC 1SXLA 2G0IA 2VFVA 2FLOA 3GJRB 3S7RA 3HHNB 1NXIA 1VDHA 4RKUC 3K58A 3WX8A 4JI8J 4DV6F 4C7QA 5KYYA 3IA0A 1FFWB 3VS6A 1N0UA 2YBVA 3UD5A 3IQLA 2WK4A 3GJTB 4RG2A 2YH0A 1YP5A 3QJPA 4ECRA 4WIIA 1BUXA 3GFXA 2VASA 1R27B 1T02A 2W9BB 1HBNA 2Z2YB 2WOMA 2VG5A 2JLEA 4BI3A 3W7BA 2IRXA 1M1HA 2ZKTA 4RCBA 3LOUA 2WVCA 1GQEA 3G71Q 4AFUC 1KFDA 3E2EA 2DH7A 1OU8A 3J7AF 1NDPA 2B9XA 4C3LA 1JLCB 1LOJA 4DOZA 1FNXH 1NLOC 1ZBXA 4KE5A 3KLGA 2CGHA 1YITT 4FYVB 3W2WA 1KSPA 3T19A 1SPKA 4N4IA 4YB5A 5KFEA 2CDTA 4WZQA 3VVUA 2LCWA 3HI9A 3DRRA 1Q81R 1HYOA 3SDEB 2VFUA 2RUGA 1TMMA 2DXUA 5GAMj 4U8YA 5F9NA 2V8DA 2COWA 1M1GA 4XPCA 4H4OB 2FJWA 1UJYA 5HQ8A 2Q43A 4F0HA 5HMWA 4OL8A 4X1VA 1WC5A 3M54A 2VUBA 1N9RA 2PNIA 3HHTB 4DFJA 1HBNB 2K57A 3EZUA 3OTCA 1UB4A 3CCMT 4C8QA 1MG7A 3UN3A 2YQ0A 1P6TA 1PG5B 4N7TA 3M2VA 3CMAT 1QY7A 2FO0A 2KU7A 5LL6d 4BY6B 5KFZA 4KRWA 1YJNT 5KE3A 4F4KA 1RTIA 3TI0A 4DV6J 2GIFA 4HT5A 4DX6A 2D3UA 2BQUA 3JYTA 1UA1A 1NRKA 1UE9A 1XWLA 3PIOA 2Z2MA 1XNRF 3KFWX 3D6MB 3AHPA 3EG9B 2B9WA 3RW7A 4FF2A 3WQPA 4Q8FA 1UTIA 1FX7A 3DHWC 1KG1A 3OTEA 2D3ZA 5ETRA 3MCOA 2P0KA 4B3MJ 4DLEA 3RUBL 1AW0A 3QGGA 3GIIA 1WOSA 3T6BA 2WVEA 5IXFA 4IH7A 3GIJA 1JJ2R 3C0CA 4W98A 4A8QA 2A18A 3VGUA 1BWVA 1YSJA 4M7AG 4O3PA 1C0UA 1T9XA 2OPRB 1X9WA 1D0ZA 2MJNA 3CD6T 1VQ7S 3WC0A 4O0NA 2MLXA 3TARA 3GLJA 4FS1A 3LAMA 1U8SA 3LH2S 4ILRA 2ZCFB 2M0GB 2QA4T 2J8AA 1GFCA 3TAMB 4M78A 2PA3A 1XMOJ 3OS2A 3FSXA 1YJNS 2CJXB 3NMZC 2A36A 3M53A 2YUQA 1MV0B 4OI0A 2J7UA 2O01E 4KBMB 1S6QB 3M1VA 2GJ2A 4DR4F 2BE2A 3MMBA 1S1XB 2DY1A 2UXDF 1VIFA 3EGVA 5DETA 1B99A 4KFBA 1RE1B 3AXKA 2QLJB 1QVFP 1NBEB 3EG2A 3B54A 1T3SA 3TJ9A 3OW2A 3F41A 1NK4A 2AGQA 2JH3A 1NMEB 2V1QA 1O6XA 2QIFA 1T0HA 2AYEA 1SV5B 1W2IA 3OSPA 2C3UA 3E1SA 3TVTA 4X66F 4URQU 1U1TA 4DG1B 1EKRA 2E29A 4DQ2A 2FGCA 2GGPB 2Z4PA 2FHJD 2CKWA 4IO1A 2QLXA 4A4FA 3TO8A 3HHLC 3HZEA 4NXNJ 2YX1A 4LQ9A 1VRTB 2DCUB 3EZOA 4OIXA 2YUNA 3LP2B 2DTJA 4LSNA 3QO9B 4OZNA 1I07A 1HNVA 3SI8A 4PJJA 4M78C 2GO8A 2DBBA 3NGUA 1VQ6S 3L2WA 1S9EA 2FJDB 3DXBA 1NK7A 1H3ZA 2OPSB 4DV3J 3HVAA 2HQIA 4QR0A 2KJVA 3MAQA 1RT7B 4JI8F 3SWNC 3GTYX 1OYDA 1SHGA 2HZAA 1WC4A 2HDAA 5D4LA 2PTKA 1KQ1A 4JV0A 3JB9I 5H9FJ 3I31A 2MKKA 4DR2F 3M2RA 3DLEB 2W10A 3QSUA 4YN3B 1VQ6Q 5A2QU 4OF1A 1OPZA 5DDOC 1UGQB 1V3ZA 2IMOA 4OVAA 3ZZRA 4ELTA 1VQ4Q 1RABB 1BQNA 3DOKA 1XMQJ 3JCMd 5CH7B 1T9YA 1NDLA 4FVMA 4OX9F 2FRWA 1RTJA 2NXJA 4JJDA 1LFWA 3VAFA 1O51A 3GOXA 3WHIA 5FU6B 3GV5B 2D3OR 4M94A 1JJ4A 3GJQB 4CC7A 2IJNA 3KHRA 4HI1A 2L9NA 2R3VA 3BDEA 2XWXA 2NQPA 2EEYA 2YPYA 1HI1A 5CA5A 4J8OA 3MF5A 2ASLA 3ISZA 3HP9A 3MJXA 3TWZA 4PXDA 1RA7A 3QMQA 2DIQA 4ZVFA 1L3VA 5DDPC 2XMAA 4QKUA 4ENOA 4OYMA 5DLFA 4DU8A 2DNZA 5GAMd 5ITHA 1HQ2A 5CHCB 1BLUA 1F3VA 3EPGA 3ENAA 5DDRC 3IMQJ 1SCJB 1C6VX 2ALZA 3I56A 4GKJF 4P2XA 4ELUA 1IRXA 2AW0A 1QCFA 3QLHA 1NKBA 5J2PB 3F44A 3TSZA 1RHRB 3G6XA 4F4AA 2GAHC 2K3KA 1N6QA 5GMKm 4F16A 3MUVP 1BE4A 2QLWA 4TQSA 4QYRA 5HP1A 2BZXA 2GTOA 1T3OA 1FFGB 3BDPA 3F73A 2Q79A 1N0VC 4M5IA 3QDRB 4B6MA 1VC5A 2V6AA 4I64A 4UZCA 2MMYA 3G4SA 2IBOA 1PO6A 2XWYA 3MM6B 1B7YB 1M1KC 5GAGI 2O9VA 4ETXA 2PA8D 4ER8A 4PK4A 4FBTA 1SJ1A 1YNZA 3RBEA 2JX2A 4PFOA 5LJ5d 4OQJA 4IUVA 2CQCA 3CCQQ 1MV3A 3VV2B 4KSEB 3IGNA 1PGZA 1VQLQ 2YKPA 2DR6A 3QQCD 1VQLT 3BQ2A 1TP7A 4N77A 1G3OA 3W9IA 4C8QC 1QM9A 2HWIA 1FE0A 3TA2A 2HKEA 1SKSA 3ZZ0A 1RI7A 1HNXF 3OXLA 2VU5A 4IDKB 2XLKA 2HQXA 3ZTRA 2VXFA 3SQGB 1RBOB 1RCOB 2ECZA 2LJ1A 3BBFA 3MGJA 4XTTA 3D7SB 2F3JA 1UJ5A 1YRUA 5G4DA 2YKOA 1RHJB 2RQ4A 4CLLA 2Y1IA 3CCMS 4IFVA 3MR2A 3L4BC 5D0RA 2H48B 2QQSA 2DXDA 5KFUA 4FYWB 1TKZA 1Q7LB 4J7CA 2AJ0A 1BIAA 4JI2F 1M30A 2YVSA 2QQRA 4YS2A 1EKSA 4C0DB 2EAYA 2XG8D 2CP3A 1VQOA 3RDVA 3JCMV 4ZVGA 3VJPA 2COZA 4C5HA 1B7FA 2RILA 4JV5J 2VC8A 2E7WA 1FKAF 2L3SA 2O2OA 1NEGA 5KYWB 2FJXA 3D1OA 2LQJA 2HFOA 2HRYA 3FBFA 4WFNQ 2O66A 3PJ9A 4QWDA 4WIQA 3OL9A 2CPDA 3P45B 2YWGA 1WJSA 2AT1B 3SCIE 4WCEQ 2CJ9A 1RCXB 3ZFJA 4I0WA 3CULA 5CKEA 1S6OA 4FSSA 1XMQF 2BIVA 4XTXA 4UOFA 1VYUA 3CJ0A 2W9BA 1M2OA 3Q23A 2RHSB 4PG8A 1SJRA 2DEJA 2AJ4A 4EU0A 3NTHA 4CLTA 2NREA 4BLGA 1Q82T 2DL8A 3IO1A 3P96A 4FZVA 4U8VA 5GAOr 2HEQA 2E6ZA 2EKYA 2DRAA 4KGMA 2NUPA 1KOOA 3K5PA 2EBEA 1FXXA 5THWA 1NSPA 3N28A 4GVBA 2W2MP 1ZPVA 3KUEA 2HD0A 2H5IB 2G6FX 4ED2A 1D9DA 1TG0A 3UDEA 4YP3A 5LT5A 3DLLA 4K2JA 3CCEA 4U7CA 2RQVA 3V7RA 3C16A 3DU5A 1ULRA 2E5LJ 3LQVA 1QVGA 3CCQT 4JI4F 2DRDA 2YWKA 3FUYA 5IM0B 5A2QY 4MMKA 1H2UX 4USMA 2MZ1A 1YJ9A 3CCSA 1HW9A 3OTOJ 1NM2A 2UV8G 4HL9A 1HBMA 3QPIA 1QAJA 1IUJA 2OELA 1XK8A 1NPRA 5BYSA 2C3YA 2EKNA 2CZ6B 2QDYB 3LWIA 4HVWA 2QJ3A 4ED7A 5GAOm 3N5BB 2RHUA 3HZGA 3HVRA 4A8MP 4UUWA 2PT0A 2ZBRA 2XEXA 2JMCA 1V5VA 2BJ7A 4N8OA 2SRCA 3MMBB 3VS1A 2LX9A 2ZPGB 2NYHA 2F2VA 2VD3A 2VQEF 2F1LA 4PPDA 2NZCA 2EG2A 5IT9Y 3OQ2A 1FMVA 5AXMA 2CYYA 4LF5J 5F8MA 3R7NB 4RCCA 2ZE2A 3N9UC 1JLBA 2DD5A 5ADZA 4C5EA 4PAAA 4OZ5A 4EO8A 4B02A 2PC6A 3N6MA 4JI0F 1H0HB 4RTXA 1DLOB 2PUOB 3KLHB 3NTIA 5GANd 2OD6A 1VOMA 2VGMA 4JB8B 1IKWA 1WOPA 4UY85 1BQNB 4G1QA 2R58A 3EM1A 3MEEA 4RUAA 5F8JA 2VPXB 4X9CA 2FJBB 2WB1D 1Y0HA 3OXFA 3HPOA 1YJ7A 4ITSA 2B9YA 4AYBD 3MAAA 3NKYA 3CJRA 3OR1A 4V19X 3UA6A 2CPHA 4I6AA 2MZTA 2LQWA 1TV6A 3OVSA 1DZ5A 8AT1B 5IV4A 3HJFA 2LXIA 5CK9A 4DR1F 5CCAA 4DSKA 4O3QA 2R7WA 2Q3PA 2LU2A 1NB2A 2IJRA 3CCLT 3ETMA 2RE1A 4DSEA 3IRXA 3SQGA 4LIRA 4TXSA 5LJ3e 3ONQA 4EPCA 1RT3B 4P74A 2DGOA 4U96A 3UI3A 2JNJA 4XDDA 3FZ2A 4QVZA 4C11B 5RUBA 4AMCA 3AXMA 2VH7A 5L1KA 2XBPA 3VQSA 4C8QB 4MDXA 2EBPA 1V76A 4NI2B 1O8BA 4OI2A 2A28A 1PD1A 3M8RA 4JJCA 2WZ1A 1N6QB 4CI0C 2V69A 1U1RA 1G7CB 4OYAA 4CO4A 5E2QA 2OTLS 2PMHA 2OEKA 3JTOA 4ICLB 1FK9A 3FQKA 2Y1RI 1N5TA 2UVRA 4QW2A 3TJ8A 4HYKA 4FF1A 1GK8A 3A8EA 3M0QA 1W70A 1IR2A 4DR1J 2YDLA 4DR6J 3D4JA 2LXUA 1JLEA 2HGNA 1XQHA 4MZMA 2VDIA 1Y5IB 2DF6A 5HK0A 3W1YC 2DZCA 2GVDA 4OI3A 2UUAF 1YRTA 3BPDA 4ZLLA 2IA0A 3EVMA 2BJDA 2C0OA 1D9AA 2LQNA 3TQ7P 4LE9A 4IRCA 3DLGB 3M32B 4X64F 1YQHA 4AL7A 2KFZA 2RQRA 1SSHA 1D3BB 1OY6A 1VMBA 4GBQA 3R6GB 3RAQA 5HMZA 1HL6A 4G65A 1HNIA 5B0CA 2I8EA 2MJUA 1JXEA 3TZWA 2PD1A 4DDFA 1S0NA 4DL6A 5A8WA 2GCFA 1TELA 3QJJA 4J9GA 3JCMe 1RB0A 3FEOA 4N4GA 1B70B 4J9OA 1VQ9T 3QWXX 2NXNA 2QXFA 1JXMA 1RT2A 2AKWB 1OQ3A 1YJWA 1JJ2P 2K5LA 5GVQA 2EFPA 3RUXA 4WFBQ 4QQBA 2OGUA 3TQ1A 3HXMA 3MR5A 2MB0B 2QTWA 8ATCB 3UWTA 3CCQS 2RF2A 4B9WA 4R0JA 3DMJA 3G71T 5CQGA 3JCMb 5J2MA 2XIDA 1CS4A 1FJGF 2HIYA 4FXVA 2V8IA 1R31A 3DOLB 1VFJA 4P72A 1SUQA 2J6KA 4OMFG 1IQZA 4CQ1A 3U1LA 2H4YB 1N56A 3E51A 2YNGB 1K8AT 2LQKA 3M56A 4ZOSA 1QWFA 3CC7T 1Y57A 4BDYA 2NSCA 3VVTA 2VV5A 2KAFA 2CS7A 1YJNQ 1T05A 5GAGU 2C2NA 3JAME 3OD2A 1ELOA 3QWUA 1IM6A 3CD0A 3DKMA 4ECTA 1YCSB 4A8YA 3CXCS 1S7IA 1R0AB 4B3TF 1U26A 4A46A 3BGUA 2IY5B 3D0IE 4XK8C 3G6VA 1MU2A 3PR4A 3V8LA 2KZMA 2J05A 1VBKA 2GBQA 3KMQA 5D0GA 3GP8A 4EMKB 1TVRA 4DL4A 1H2VZ 2FYKA 2KT2A 3UFCX 4HVZA 3BSNA 1A0OB 1RXOB 5HP1B 4AG1C 4X4NA 3D9BA 4IOCQ 5C24B 3CC2S 5DLOA 2E1PA 4RUBA 1T3NA 4WU3A 1H7XA 4TY8A 5IZHA 3MPDA 2ZD1A 4UTGA 2JJ9A 5M2RA 2V4RA 1WX6A 3G6ES 2KK4A 2ZBQA 4KPCA 1L3KA 3RIRA 2GS8A 4WZMA 2DVIA 1Q7YU 1FXLA 1Q4RA 1KVKA 3W60A 3FKBA 4NL2A 4A48A 2JVRA 2F7VA 1Q0NA 1DRZA 2B4PA 5HAOA 3GPLA 5D7UA 3CJKB 5KFYA 1MU2B 4ZDNA 3R2DJ 2PFFB 4YEAA 1MN7A 3UNGC 1UA0A 1XN9A 3JCMW 2UUWA 1OY9A 2F8MA 1TUGB 2VWFA 4LF9F 2HBWA 2ZPHB 2CQDA 3T1YF 4ZPAA 4LRDA 3L7UA 1MROB 3GB0A 3T1AA 2RQKA 3FB9A 4DR7J 3LANA 3CDWA 2QZ8A 5BYQA 4L73A 5GMDA 4JI7F 3M0UA 2V63A 3A4TA 4RX6A 5AJ3F 2DLPA 2XZWA 1CEZA 1A9NB 3BDUA 4F4YA 1IBCB 2CJYB 4GLMA 1KR4A 1RT5A 1KQ2A 2E7VA 2DGXA 3E2UA 2ZHOA 1N88A 4YTLA 3GCWP 1N27A 1S4EA 2CWXA 3W61A 3BW1A 1GCQA 3QBYA 4L59A 4MDWA 3S1TA 1KBRA 5CYQA 2CKKA 2DHAA 4USUA 1K9MC 3CCVT 4XDCA 2KKHA 2D9OA 5A8RA 2EC0A 4A54A 3EVWA 2GQQA 1FX2A 5KYUA 2C2OB 2J7WA 3PIPA 1VHIA 1VQLS 2XCPA 2R42A 2L0AA 1K73R 3CWJA 4KO0A 3H6ZA 2I5JA 2KN4A 4A8WA 1NK8A 2O9SA 3VGSA 2XMMA 4C6AA 5EUHA 3THTA 4FYYB 3GYXB 2ZJQQ 3LWHA 2MZJA 2BOAA 3OMGA 4USJC 5K14B 3CPWS 5D4PA 2BBEA 2MWOA 1N8RC 2BTTA 2MYFA 2DNGA 2D1CA 1GFDA 4KHRA 2Z58B 1HLWA 2D8HA 1ZHIA 2VUGA 2HHWA 4KYZA 2NXCA 3OS5A 4J9LA 5BYRA 2DY9A 4JI4J 3CCLQ 1JLQA 4M78E 3VS3A 2IHR1 1S7HA 5LMUF 2O1PA 2DGTA 3QT5A 4M78F 3VF0B 1ROFA 4MK9A 2M7SA 2OD4A 2C2MB 3MD3A 3O8VA 1U25A 1QKWA 3M7VA 1YI2S 3G8TA 1VQKQ 3SBMA 4LF8F 3OUYB 1VQPS 3X3UA 2FLPA 3BKTA 2DGWA 2MZQA 4CH0S 1APSA 5F8GA 3DOMB 2AV5A 2QLFB 4M75B 2XY5A 3PEJA 3A8MB 4OYOA 2X35A 1D8YA 4CT9A 4RNFA 2VVKA 3DGPB 2MY8A 1VQNT 2GFFA 2JW4A 3QT7A 1N5VA 1X2KA 3RYLA 2NXUA 3I0RA 3BPSP 4A8XA 5HLFA 1Q81T 3DHXA 1S1NA 1B34A 2GGRA 4GKKJ 5MLCV 1N32J 4F17A 2E70A 4NASA 3A8KA 1LW0B 1U1PA 1RLPC 1DJ0A 4LF2A 1HARA 4ZA1A 1DTTB 2UP1A 1R0CB 4NLQA 3UA7A 5HO4A 2J06A 3AAWB 1K73T 1KOHA 5GAN4 3PIOQ 4DR5J 4ZGDB 2P0QA 2DHXA 2MPUA 1YIJS 4U7UD 1L3SA 3I6PA 2L5QA 2CPJA 3GMGA 3I5BA 1VRUA 2G0JA 1VQSA 1KIKA 1N5ZA 2BEFA 4C92F 1V3RA 2EYYA 4HA8A 2NSBA 3BEGB 2W2PP 2X4XA 3KTQA 5E3QA 5EDWA 1LWFB 1ZTWA 4L72B 2N4DA 3AJ2A 3HKSA 1XTDA 4XAXB 4EGLA 1EP4A 3LO3A 4DCJB 3DLGA 3M32A 3ZTQA 3CCJS 1Y5NB 3G82B 1Y9OA 5KFTA 4CLKA 2D0NA 3OYKA 3CMEQ 3BN7A 1AWOA 4DPXA 4AFZC 3H8ZA 3PG9A 5F8IA 3K5LA 3H0IA 1G3WA 5IC4B 2KMTA 5GAEI 2F1FA 1UTAA 3IM9A 2O67A 3ULRB 3CXCP 3MEGA 1VQKT 4C92A 2D9TA 3OFEA 2VONA 1AZEA 4NMXA 3G4ST 1FERA 3Q0AA 2FLLA 3DRPB 2F65A 2CQPA 1BCMA 3H4DA 3CD6Q 1VQ5Q 4J9UE 1QSSA 4C2MA 1KTQA 4X65F 2XB2D 4R0KA 3LALA 3OUYA 3GNGA 2I2LA 5IT4A 2LP5A 1OQKA 1YJWT 2RS2A 3NAIA 1WHLA 1XBWA 5EX0A 4M75A 2M9UA 4KUDK 5KG3A 2ZPIB 1C0UB 2LECA 2VKZG 2ZPBB 2A0FB 5AXKA 4C0GA 4K4VA 2RMOA 4C0DC 1SRMA 2C2RA 3N6LA 1GXTA 1VQ5S 4LD9K 2MZSA 3HHDA 2R8IA 2F9DA 4QCLA 3FCWA 2RKIA 1FRIA 4KT0E 2JWNA 3MR7A 3T9NA 4WFZA 4X4RA 1FI4A 3CDEA 5IS2A 5DG7A 4X4UA 2RQUA 2ERRA 4USVA 1J5OB 3M6WA 2MAMA 3ER0A 2AMCB 3R2CJ 3PW2A 1B0PA 1V1CA 2ATLA 1MN9A 2XMUA 4ECQA 4G1PA 1TAUA 1HI8A 2B4VA 3OLAA 1S1VB 3C6TB 1RT2B 4N76A 3DDKA 3PIPQ 1SH2A 2JTFA 4OJGA 1S9GA 2VPWB 3CJKA 4FT2A 3DRYA 1K9MU 3C4SA 4RLEA 1M1FA 2N7YA 2KXNB 2P0PA 3BSAA 2K9GA 3CCET 5C24A 2YT6A 1RZMA 3A5ZB 3L2VA 4DI6A 2VFSA 1FF2A 2ZD1B 1LQ9A 1DTQB 2W7PA 3CPWA 1XNRJ 5M9OA 3ZZOA 4C8LA 2N7CA 4CH1A 3IS9A 3K8WA 2J0QD 2OIHA 3A13A 2EBGA 3PYDA 5IT0A 2YTCA 1JJ2A 3MM5A 1IR0A 1RHKB 2VZ9A 2COYA 3R6LB 5L39A 2OMOA 4JLIA 3AHUA 2WOMB 1UZHA 1UDLA 4NLRA 3VKIA 4WP9A 3W9JA 3N79A 4TLQA 3C2PA 3SEMA 3MPYA 1LPLA 3MM7B 3NNAA 1UG1A 1S77D 1AWWA 4CNZA 3MEDB 1SJ4P 2RQTA 3C12A 3HX9A 4MIWA 3I87A 4J9EA 1QD1A 3M8YA 4S0MA 3L3CA 3D6TB 4DFMA 3CUNA 1E7OA 1EJ7L 1WJQA 2K1RB 3T5JA 3A3PB 4PKDB 2VL1A 4IDKA 5GAMf 4I68A 1VIXA 2DXTA 2XK0A 4PPZA 4DOWA 2ZH3A 2EXUA 2P8IA 1BD6A 3CXCR 2HKNA 2ZHAA 1LK7A 4F25A 1HNXJ 2CPFA 1C4CA 5C42A 2AYBA 4PWDB 4OI1A 4ZMMA 5LOQA 2FVCA 3P4UB 4E7HA 3X24B 1WDDA 1DBDA 3FBCA 2BABA 4ZITA 5A8RB 4MK8A 3ZZZA 5EWEA 4DR7F 4X34A 3CC2Q 1Q7YR 2IVYA 4ANCA 3E8OA 3EMTA 4ETZA 3CCRS 4NYZA 2ZZTA 4MTPA 1TH7A 2HZYA 2VOOA 4OZ2A 2RT3A 4DA4A 4F7VA 1W25A 1TAQA 3W66A 5KG0A 2IRYA 4FKYA 1E6YA 3MCSA 3CIMA 2DXCA 2QYCA 1HQEA 4HH1A 1KQSR 4KJIA 1MSWD 1S72Q 2GF7A 2P6SA 3X26B 2R5MA 2DKOB 1PC4A 1W1FA 1S1TA 2R7QA 5DRKA 2P5VA 1GXLA 2FHJA 1BWEA 3Q22A 5JXSA 1CJUA 1AXQA 2CQ1A 4B9UA 5HBMA 3BM7A 5D6WA 2CP2A 2CT3A 3I56S 2MCNA 3A8OB 2LDMA 4PJOA 1Q81U 5KFXA 2ZC3A 4XIUA 4ECSA 1GBQA 3D6FB 2JC1A 4CYUA 1OO0B 2J6TA 2F4VF 2AX0A 2ZOGA 4H4KA 3OL7A 2QG9B 3O5TB 1AD5A 1NYFA 1KD1T 3R3TA 1YHQA 4DZ6A 1E6YB 2CQIA 1R6VA 5BXIA 4YB1P 1FESA 5CIUA 1SH0A 2XNQA 4FL6A 4LREA 2YRCA 4ICLA 2ZH9A 3EXYA 4QBUA 4EK2A 4M7DG 3BY7A 4J6WA 2IVFB 2H3JA 4KC5A 5LXRA 3HPWA 2CPZA 5CVIA 4E98A 2J6OA 2PFDA 1X5TA 4DS5A 1JLAB 1OSDA 4TU7A 1TL5A 3D3CJ 4WP8A 4DBRA 1S79A 4P6QA 4X9DA 1ZAWA 1Q86C 2C3PA 4B9LA 4HACB 4NYPA 1Z9ZA 4ORZA 2L9DA 1G4CA 3C16B 3EHQA 3I56T 1NJIT 1VRQC 4DUZJ 2CIMA 1PWTA 3NPFA 5HL7Q 1RGVA 1QCNA 1VQMS 2DAQA 3GSIA 2GVZB 4Y2CA 1UHFA 4QU7A 4A8FA 2HQFA 3OS0A 4OGEA 3CJ5A 2PVGB 1NKEA 3KNGA 2V67A 4D8KA 1VRTA 2MKIA 2E5IA 2L8DA 4USHA 3UDVA 1RKJA 4ZIWA 2LNHB 1W4SA 3GR0A 4KGXB 1X6GA 3PO5A 1FWZA 4C0BA 2DRKA 4LD6A 4BWMA 1UW9A 3PX6A 5JVGQ 4AFSC 2KVIA 3ADAC 3TUIC 1RTZA 1R8CA 3CCMQ 3OQ5A 3N0VA 2HNIA 1S6QA 4N8NA 3Q89A 1ZZFA 2EQJA 4AD6A 3T6JA 2Y1LB 5D3GA 1QLYA 2YKAA 3GV8B 3FQLA 4FU6A 1GCPA 2JEGA 3DLLQ 4P2FA 2W01A 4ZTFA 3D68A 2HHQA 4ECXA 3S3OA 1SIWB 4OYWA 2J6SA 4H4OA 3RJMB 3KLIB 1Y7XA 4AQYJ 5L9NA 2CZVC 4RZRA 5ETSA 3DFEA 2JLFA 4DX5A 1M5HA 4NMLA 2IJFA 2PMZD 2WBMA 1FDDA 5CYJA 4Y2MA 3WIUA 4ZHRB 1KD1R 1EAYC 2ED0A 2AWZA 4JRKA 2X3WD 2A10A 4QJVA 2LDIA 2AX1A 2OO4A 2J7KA 1RWWB 1KTVA 1TQLA 1GXIE 4KGZB 3CCUS 4ANDA 4NCGB 1TU0B 5GAN7 4LUEA 1AYEA 4QR2A 5HROA 2VA3A 2R2TA 2ABYA 4Y92A 3CCES 5IQ6A 1L3UA 1RYRA 2ROTA 1YITS 3DM2A 2WVFA 2DNUA 2EW3A 3IM8A 1JIHA 1PC5A 2DBKA 3VUZA 4Z7YA 2K2VA 3FJ2A 1YWOA 3J81E 2X9HA 4HDGA 4QPTA 2AJ2A 3QIPB 3MR6A 2XQCA 2ZH5A 1NPPA 4A4HA 1F0XA 2BKNA 1IGQA 2KXFA 3S8SA 3NGRA 2AD9A 5LJ5e 2XG8A 1M90R 2CRLA 2DK2A 3OB9A 1SF9A 4ED8A 4K50A 1HWIA 1XMOF 3OW2R 1JBMA 2MKHA 5H1SV 5SUHA 2G9OA 1P92A 4RW6B 2VODA 3ENQA 3VZIA 4IUQA 3SQOP 3DYAA 2M4MA 2IIHA 4JZ4A 5I2SA 2DTHA 5GAMh 1O5JA 3ICLA 4DN0A 2FC8A 3EFOB 2ZNZA 3ITHB 3UCZP 4QIWD 4M5GA 4DJBA 5FJ4A 2HNYB 4PJOB 1SL1A 3VAIA 5M2PA 2HL3A 1LVKA 2AKKA 3POTB 2GVDB 2OJ2A 2F4VJ 5DO2A 1RAFB 1RYSA 4JI1F 5LSRA 1FE4A 2VJUA 4C8MA 1NHVA 1H7WA 2QDLA 2XZTB 1T0TV 3X28B 3DLHA 4NS5A 4LFCJ 3IN5A 2RF0A 4ED4A 4DL7A 4PUOB 3LP0B 4M78G 1NDCA 1GMVA 4X2BA 2AZ1A 1IBLF 1FDNA 3HRTA 2KY9A 1YITQ 4MFBA 1V3SA 1S12A 2FZCB 5KFPA 3BO3A 1MMNA 3CDAA 2FJAB 2R7SA 3GP9A 4E7KA 3BB5A 3BSOA 3N5BA 5E5NA 2VB6A 4ZP9A 1OWXA 2V2ZA 2GMHA 4A63B 1J5EJ 3R5DA 4QIEA 1X6OA 2Y4XA 3CCVA 5FWBA 1BCOA 2HHTA 3CJTA 3CSKA 5T14A 3ILOA 3PJWA 1NSKL 1N48A 1OY8A 1RTHB 2CQ2A 5FROA 1SUQB 2YNFB 1VQ9Q 3QXEB 3ENWA 5B7WA 4C92E 3M2RB 3M4XA 3G8QA 4OZJA 4QWEA 3GYNA 4KV8B 2YNGA 1HMVA 2HQ3A 3C15A 1VQ4S 4P7VA 4Q2MA 2UUAJ 3JTPA 2GV1A 2YXLA 2ZOFA 2XULA 3V7SA 5KFWA 1ZSZB 2FLNA 2YNHB 5DLGA 5J2QB 2EPIA 1SB6A 2Y4YA 2WSEC 4O5VA 1MLAA 2VOPA 4U67Q 4C0ZA 2D8JA 5KAKA 2PVOB 1RU1A 1YJWQ 4KFBB 1U4BA 4ZN3A 4EWTA 3R6OA 4PXBA 4GKKF 2BMBA 3MP6A 1SC1B 2RVJA 2M88A 3LPYA 4O3NA 2WSEE 4NCAA 1GBRA 3LH5A 1G2EA 4M7DC 4JV1A 2E44A 5K9FA 4CZCA 2CPIA 5IT9E 4MKBA 3ELHA 5DM7Q 1W2BS 3FJPA 4Z02A 2G2ZA 8RUCA 5LXYA 2DO4A 4F02A 3FSYA 2DGQA 1LOUA 3QJ6A 3RBDA 3KK3A 2DD4A 1KHIA 1HBMB 3SYZA 2R57A 1UFLA 4J9QA 2A2CA 2GC8A 2HFUA 1JMTA 3DDNA 3PW7A 1MW7A 1CC8A 2VBWA 1T9TA 1S6UA 1OEBA 1PYOB 3CEDA 1PAUB 1OSCA 2XSJA 3W8GA 3LYIA 1I4K1 3W2WB 3PFSA 2IA6A 2DJWA 1KKHA 4IR1A 3HULA 1U06A 3VAGA 4TNOA 4QT7A 2YQ3A 3R9LA 1CS4B 4OMFB 4BC7A 3KLFB 5IOLA 4O0IA 1N36F 3AOBA 1UL3A 4M5LA 1R43A 2KHCA 4O3SA 4OYXA 2KB2A 4XQ3A 3FJ5A 2RIJA 2ZDPA 4PR6A 2DO0A 3QAUA 3M8PB 1RK8A 2JS2A 4NWBA 2WACA 2GCXA 3K8VA 2KT5A 1CSKA 3ENVA 2BX6A 4GLKA 4M75C 4WKYA 3U02A 5KT4A 1GTEA 4K4WA 3NNHA 4GKJJ 3SXLA 3UCGA 2KZZA 1NK6A 1CG2A 2LQ5A 2NUZA 2NR0A 2JOQA 2MKCA 3EG1A 2YQ1A 3CO9A 2I2YA 1M90U 5SZTA 1WEXA 1UZDA 1QSYA 3IBFB 4DL5A 3I32A 4QOTA 2ILZA 4NLGA 5I3UB 1C1AA 5HATA 1GH8A 4ZHRA 2E66A 2WSFE 1K8AR 3CCRT 3M8SA 4DV7F 4JI1J 4CTAB 4L6V5 4FP9A 1QVPA 3QUIA 1WTBA 2HSEB 3R5BA 3NCPA 1FYNA 1A7GE 3U23A 1WEYA 2F5KA 4KGVB 3VAMA 4YDDB 4RUCA 4Z8AA 4Y2IA 5IHNA 4CP5A 4JLGA 4X84A 1ARKA 2JJ4D 3KOAA 3VUBA 4ZJLA 2E3IA 1NJXA 1UUEA 2W4DA 2MQOA 4Q0BA 2HFVA 1EX4A 3MOJB 2A3JA 3PFOA 1M2VA 2CUYA 2UUTA 4C8OA 1HQEB 1JJCB 4OZ0A 3MOZA 2H5JB 1Y3JA 4K11A 5KFCA 3FDSA 4F7UB 1N52B 2KYZA 3H8YA 3DGPA 3H0FA 3EDRB 5DM6Q 4NRTA 1FO1A 3I4HX 2GVZA 4ZLPA 5DQHA 1WSVA 1LWCB 1CJKB 2JOYA 2R7OA 3I0RB 1X4DA 3ILIA 1NK0A 4FCYA 4WJBA 1AOJA 2E5QA 3TQEA 5LJ3Y 1NJZA 2VJVA 3DKDA 2Q1LA 1LXJA 3EWGA 4YQWA 1N9SA 1X69A 2F4FA 3CCLA 3J80U 3V81A 3FDRA 4ID5A 1IHVA 2MLZA 3WXMB 4F8RA 3VHQA 1NPKA 4TYAA 3CC2T 1ZETA 4CC2A 5ETPA 2AF6A 3MPWA 3DLBA 1ZBTA 1D0EA 3L2UA 1AWJA 2YUOA 1WNEA 3WBZA 4C0HA 3E01A 1JB0C 1RWUA 5IC6B 4OYZA 3RKXA 1RT7A 3MD1A 1HBUA 1UFFA 3TA1A 3I9ZA 3NFCA 3BGRB 4IG0B 1GX6A 2B51A 5D78A 3MTJA 4EMKC 1UEVA 5KT7A 3V4MA 2XGQA 3WVEB 1RAOA 2C2ZB 1RHQB 3CVKA 1FMKA 2M02A 4OMQA 2HMAA 2XM3A 3JQKA 3DI6B 3MWBA 1TL3B 3FIFA 4M75G 1RDRA 2MI6A 2XO6A 3P8HA 1YRXA 1JJ2S 2DX1A 3TZXA 2YX7A 3CCUQ 3OFHA 1W2BA 1FKPB 4ZNXA 3G6ET 2ZEJA 2BRKA 3CJ8A 4F3MA 4D8DA 3CCZA 4UOGA 4LF6F 3J81U 1R8OB 2KI2A 4LT6A 4B3RJ 4DPUA 5LJ3h 4M78B 1WG5A 3HHEA 5F8HA 2WTFA 4DUZF 4WE1A 1HBUB 2FL7A 3IR7B 4NLOA 3UD4P 1HR0J 2FC9A 2EFQA 3TCJA 3KMSA 2R2UA 4QVDA 4DBHA 1KHCA 1WI6A 2KNBB 1RLQC 2WSCE 1M5VC 3A8GB 1N8RU 3JCMX 4ECVA 1ZZNA 1U1QA 4YY3F 1TK0A 3RRGA 3CCST 4F4WA 5B0DA 3H40A 3OYAA 2PI5A 2BJ1A 2ZDOA 5DZ7A 1MWQA 4FYDA 2J9CA 3AD7C 2QA4G 3MP1A 4DV0J 1X27A 2A37A 3FSIA 4DFKA 5DDQC 4QIVA 3CDUA 5I4MA 4KV8A 2BUDA 2H65B 3J81j 2CJKA 2VQFJ 2DMOA 1VYTA 4DSFA 5M2UA 3IRXB 1WA7A 5HQLA 5L46A 2Z2LA 2J7IA 3I55T 2F9JA 3NGTA 1UVIA 1ZSZA 2JTMA 1XIQA 4WCIA 4J83A 3NP5A 3OW2P 1M5OC 4IUUA 1OU9A 2NPIA 1UJ0A 2BANB 5LJ3g 1H3DA 3AB2B 4CO2A 2IM1A 2M9KA 1JXLA 1S0OA 1YKWA 2Y90A 3QJYA 2FIUA 5ETTA 2DTOA 4O44A 2X1FA 3T1HF 2JTEA 2P9CA 4G1IA 3TREA 2NS1B 3MEGB 1B3TA 2FG0A 2IDLA 1X4EA 3PVQA 2POKA 1TOVA 1PRLC 3TX8A 5EWFA 3TYTA 3L42A 4BI4A 2EYXA 3I55Q 4KH1B 4E7SA 5EX3A 3VTIA 2AEJA 1TFYA 5HROB 3REBB 1RWNB 1CJUB 1EP4B 3GNFB 4UUXA 4M77C 2PI4A 4O4RA 2HBZB 1GMWD 2AJQA 3OFFA 4I6YA 2VKNA 4C5GA 1ICEB 1JLEB 5EWGA 1X6BA 3EXCX 3PACA 1SPBP 4BDZA 4WFYA 1VQPQ 2RAQA 2MKJA 1HD3A 1FDAA 1QWEA 1FRJA 3OYDA 2HNDA 3R5JB 2QL5B 1NJIU 3M57A 2IYGA 3RTVA 2P2CB 3H59A 2WONB 4OX9J 2LZ6B 4Q45A 3OBIA 1U47A 4NYOA 4DUTA 3QWPA 1DY3A 1TKZB 1NJYA 2CUBA 4O44B 3NMAA 4JYAJ 4OMOA 4ES1A 1RT1A 4RBVA 3Q2SC 4URGA 4LDVA 4DL3A 1TSFA 3M55A 2DD8S 2A1BA 4V1Ak 2W2QP 4OB2B 3MI7X 3PHEA 2QA4S 4OYPA 3OYNA 1UMJA 4I69A 4PEOA 2O3DA 2JSXA 3PMTA 3GPAA 5KT5A 1NG2A 5AE1A 3HVTB 1KQFB 1CJVA 3KBGA 4HR2A 3SHWA 5IWAF 3DMJB 3CQTA 3LWLA 3CCJQ 2GJIA 3D1HA 1OULA 1Q5VA 4ESRA 4F4XA 1U24A 3EHRA 5CYMA 7AT1B 3DOLA 1LWXA 2MTLA 2I6WA 3UPUA 1FJGJ 2JN0A 5C0MA 1RWXB 4FYXB 3W63A 4C8QE 1JWWA 2A08A 1CJTB 3C14A 2XI3A 3HVWA 1U48A 1MROA 2RHXA 4PG6A 2R7XA 1VQOQ 3MM9B 4JV2A 2PMWA 1EQ0A 4G6VB 4LF7F 3KUHA 2A6OA 4RW7B 4ZPBA 2F2XA 1KD1U 3VS2A 3OA6A 5K20B 1QAYA 2KL8A 4RW4A 2KT1A 2L08A 4ZK7M 1KP6A 3UWNA 3AY0A 4BY6C 3VRZA 1SC3B 4X4VA 4EEYA 2EYWA 3K17A 3QSIA 5BR8J 4I7FA 4NLDA 4Q7AA 2UZAA 2QA4Q 3FNNA 1K9AA 4ED6A 1AT1B 1Q78A 1AVZC 3B82A 2GMLA 3BH7B 1KLNA 2UUBF 2KBTA 3DB4A 1VBXA 1VLYA 5H9EJ 2C28A 2B7CB 2HVZA 2HHUA 3VS4A 5KFKA 3JB9D 2K2PA 1DQAA 2HZVA 4RW7A 4RJVA 2NUTB 1HHTP 1HW8A 3H7HB 1UFKA 3M4GA 1O9SA 2XTJP 1WPYA 2DR8A 1Y0MA 1QSLA 3DLMA 4U95A 5J2QA 2W2OP 4RR5A 4RW4B 1K0SA 2VG5B 5CXTA 3FEZA 1ABQA 4UOCA 3CCUA 4P52A 2Q6BA 4ID8A 2CA9A 3RW6A 1W6XA 4R0EA 4CC3A 1H98A 5KG7A 1FRLA 3V8JA 4TU8A 2HYIB 5GJVB 2AHOB 4CH7A 1RTDA 2Z57B 4HLBA 1M0SA 3BZQA 1JB0E 3P6YC 3TVKA 3N01A 2GZOA 1I81A 4OI6A 4OLPA 4LF9J 1RWPB 2QK0A 1CSJA 1HNZF 4IKFA 3R5AA 2ATCB 2DXEA 2LCLA 2OJ3A 3NS7B 4BWJA 2ZITA 1M1KR 2IG0A 4LDUA 3HSJA 2Z56B 4ELYC 2VICA 1RWVB 2PZ1A 2OAUA 2ALYB 2M5YA 4QWBA 4RPFA 3GFYA 3SMZA 3PT9A 5HLFB 3A3NB 1YIJA 1VQMA 3MEUA 2XKOC 5T7LA 5CYQB 4E8UA 4VUBA 4NXMF 2E9TA 1RAAB 1Q53A 3HO1A 3V5RA 4G1QB 2IM2A 1SKWA 2QGFB 3UF4A 4WU2A 1J5EF 3I5SA 5IV3A 1N5YA 1X0FA 4DPTA 1M5PC 1OJ4A 5A76A 1Q8IA 4K4ZA 2HAFA 3AQPA 4IURA 5KFHA 4CRIA 2MKSA 1FKPA 4B9NA 2R7RA 5K8PA 3H5XA 1NO8A 2RU9A 2FHOB 3LGLA 3GONA 1C0MA 3DNCA 1TUWA 1ZSGA 4ZVHA 1QE1A 2MEWA 2GNCA 1D0YA 4M5JA 4CYUB 4Z89A 1U1NA 2GW8A 2QL9B 4I2PA 4BI8B 3DRSB 3PNWC 2B7BB 4LBHA 4CRJA 3J7YU 4LVOP 1F3FA 2XGPA 2H1YA 4LQ3A 1PKSA 4USTA 1ZPWX 5C2CA 2J6UA 4RO0A 4LF5F 2DH8A 2IBKA 3CMQA 3ET6A 3R5GA 4PQAA 4DV4J 1K47A 1NH7A 5L38A 4USWA 4KRTA 5GANh 2BM0A 4TY9A 2CADA 1KJWA 1VQPA 1T05B 1OIAA 2DJQA 1F60B 5FLXU 1Y96A 1MMGA 3TAMA 5D8HB 2YWEA 3V6HA 1BKBA 4M77A 2GX8A 3K7RA 1KC8C 2OTJA 3M9OB 3GIMA 5G0RB 4DN9A 4M7AB 2P9EA 3FCHA 5I3UA 2DPIA 2PEBA 1VR6A 3GSDA 5D6XA 5HSPA 3ZL7C 3BS9A 1QTMA 4U7UK 4NLYA 2RDDA 4I6WA 3FBBA 4Y2AA 3G6YA 2D6FA 4CLYA 3QG1A 3CBMA 4C0OC 3BJYA 1VLOA 2ZH1A 1T8EA 3L09A 5KYUB 1NH8A 2E10A 3MM8A 2BQRA 3OYHA 1HNWF 2EJGA 3KXDA 1WXUA 3UO0A 2MPXC 2KJWA 1K1SA 3BH6B 3QIIA 2HPUA 4PJOC 3HKZD 2GQ2A 2BANA 3MFHA 1TKDA 3QDFA 1FXDA 1HKAA 3QO9A 3MM7A 5HI7A 4ZCMA 2KSSA 3VGVA 2G0CA 2DHHA 1S9EB 1REVA 4M7AA 5I2MA 4CM2A 1YJWS 5KT2A 2BXJA 4OMPA 4GO5X 5DZ6A 1HYSB 3CXCA 3Q8UA 2F2WA 3QGHA 2NYSA 2KRMA 2RB7A 2LQ9A 4OMNA 1JLCA 3CBOA 3W64A 2B6AB 2J76E 2VDHA 4DQPA 1CJKA 3RESA 2B8QA 1ZA2B 3PVLA 1HD1A 9ATCB 1X4FA 2MQPA 3LX7A 3OS1A 4ILMA 1DAXA 2OP5A 3A8LB 3INZA 2BUNA 3JQMA 2EQIA 1MMDA 1TMJA 1SH3A 3W3SA 1WHHA 2CVIA 5CKDA 4JZ3A 2DETA 2ASDA 1X75C 2KDOA 4FSXA 3PR5B 1EB0A 4XU2A 1K76A 4K5SA 5E3CA 4BHQA 1IJFB 1OPKA 2BDPA 4NA1A 4FKXA 1HXDA 1U0SA 2GHPA 4B08A 1MMLA 1T95A 2R8KA 5GAMg 3Q83A 1WUUA 3LAKA 4LRAA 2BE7D 2OPPB 3QGPA 5LJ5f 2CH4W 2QEXQ 2OPQB 4ZN1A 4KAIA 2I5JB 4NOYA 1UVJA 3HRSA 2QQ9A 4KHMA 5K8MA 3ZBDA 4J6YA 2H4WB 2G1DA 5CZVA 3DYAB 3I96A 1SQFA 1CVJA 4Q43A 4ZPWR 2LT4A 3TU4K 3FLGA 2J0SD 4ILLA 4E7ZA 1QP3A 2YWWA 3ASKA 1OQ6A 1WI8A 1SI9A 2LVWA 2DNKA 5ETKA 1I94F 1YX2A 2HLTA 3M05A 2DEIA 1U5SA 2RF2B 5A8KB 2B9EA 3H20A 1RBAA 4UW2A 1IKVB 9RUBA 3I9QA 1PIEA 3TP2A 2FVSA 3BSCA 3OJUA 4C92C 1YITA 2IIMA 3TZYA 1WNLA 4II1A 1U1SA 1C0TB 2XI2A 4L3NA 5IT9U 4NL5A 1Y5LB 4EI2A 5ETNA 2CXEA 3MM8B 3MFIA 2FPDA 3OXGA 3VS7A 3BE3A 2XY7A 2R2RA 2EVZA 2J5AA 4MT1A 2HQGA 2DL3A 1WC0A 1U8RA 2E6NA 2KXDA 2HMIA 1LEOA 4QYZJ 4NRUA 2FQQB 1IJEB 3EZ5A 2EYZA 5A0LA 2MDAA 4LRCA 4K4SA 3MKDA 3TEGA 5EGYA 3GIKA 2LTOA 4K0KJ 2XZDB 2OKQA 5J26A 5GAOq 3GCXP 1BB9A 4CI0B 3OT9A 3SWNB 3JCMc 2X7IA 4RTWA 1QVFR 3PX0A 2R7UA 2FGOA 1UWBA 1ZSZC 4PJOG 2M8HA 2YHTA 3A98A 2PIIA 4XAKA 4F3OA 4DV5J 2QSWA 4DLGA 2MF2A 4HCKA 3M9QA 3T3FA 3IAS9 3RMQA 3H4BA 5J1EB 1B64A 4TY8B 5KG5A 4PG4A 5KYXA 3U1MA 3C46A 1M90T 5A8WB 2J8SA 1VS3A 2Q6CA 4MKAA 4Y0FA 2V5HG 2BA9A 5HVGA 4C48A 2ZWOA 3J81Y 1HA1A 3QRQA 2H5EA 2FVUA 4XTYA 2NXEA 1IZ6A 2UXBF 1X5OA 1Q86U 1UVNA 3D1QA 4DF4A 2K7KA 2IRUA 1UVLA 3RAMA 1WI7A 2AK5A 4ZPVR 4BB7A 2V8KA 1AA1B 1DJ7B 5J2MB 2HVIA 4PFZA 1E6VA 3IP0A 5KG1A 4X4TA 2OEJA 3I5CA 1LWCA 1S1WA 2LLZA 3H90A 5F41A 4DL2A 4Z88A 2OTJQ 2KM8B 1YHQS 1KQGB 4Q5VA 3BGFA 2K3XA 2DYIA 4A4EA 3MUTP 3KHGA 3OBYA 3J80E 1JLFA 1PCAA 3R27A 1RWOB 2OTJT 3QATA 2HFNA 2QE5A 2CJAA 2E9RX 2OTLA 2QFJA 3CNQP 4FF4A 2G4BA 1Y00A 2XYGB 2O31A 4FPIA 1FWLA 2DPPB 2G3RA 2ILYA 3AB4B 1Q7YT 3WC2A 1K1ZA 3JB9F 2B4OA 2CNLB 4A8SA 3PYGA 5GAMe 2R5AA 2VC1A 2OI3A 5HQMA 1NJWA 2YKMA 2DB1A 1RISA 1PAEX 2L3MA 2UUCJ 3SDZA 2GFAA 2ZBPA 5LJ3j 5FWCA 1YFNA 1TWBA 2WSCC 1TL1A 1RT5B 4ZVRB 1FRHA 2BZYA 1N34F 1Y7PA 3FK4A 1AEYA 3JYTB 2J0WA 3QAEA 2ACYA 3CCTA 4CO1A 3HM9A 1YK9A 4UF4A 4DG1A 5KE2A 4DSLA 1OPIA 1YHQT 2DR9A 3VYHB 1Y4ZB 3RB4A 5GMKi 1KQSA 3T1YJ 4EMDA 1WHGA 3TEEA 3CE8A 1UVKA 2V4JA 2DYAA 1C1CB 2EFOA 2ROLA 2K3IA 3LGNA 4NXNF 1WHVA 2NUUG 4LSNB 1VIOA 3JRZA 4J9MA 3EG3A 2RJFA 1Q8BA 1X4HA 4RUGA 4LSLB 3CD5A 3AA8A 3EE3A 2YKMB 4LVNP 2GQCA 4J9NA 4PZVA 5IHKA 5FDLA 1P1TA 1BYMA 2PSZA 4N47A 5KYYB 2H3EB 5F0UA 1X60A 2G2YA 3RB6A 1LCKA 1N33F 4E6RA 4KTQA 2J9DE 1YZ6A 4C8YA 2GQVA 1VQLA 3KG1A 5AYFA 1FXRA 3HKWA 2C2DA 2RQWA 1NZ8A 2LA4A 3W9HA 4YHHJ 1AFJA 4LBPA 1VI7A 3MMCB 2C1EB 5B0AA 4B9VA 4GO7X 1I5LA 5AXNA 4ZVEA 2F40A 1U7LA 1WTFA 3MEWA 1WC1A 3JXOA 4M77G 1YVFA 1M9SA 2CQHA 2VFRA 2ROPA 5HMYA 2M70A 3CJ4A 1Y3KA 5FIIA 3NS6A 1HWKA 1U1OA 2ZH7A 2QGGA 5HY6A 2DRMA 2I0NA 2WW4A 1UJ4A 3C19A 2AJ1A 1X2QA 1LWEB 4DCOB 3NEKA 4ZJOA 2IC3A 3UATA 3OVBA 2DISA 2DJZA 1S72T 2XC9A 1HBOB 3J7AN 1SL0A 3HVTA 4FPRA 2KRRA 3SSQA 3CPWR 2LXFA 4GVBB 4OYIA 2DE0X 4J9VA 3CCSS 4D6WA 1N36J 3ZO7A 1H8KA 4C98A 4C4WA 2EFIA 1YLXA 4EUVA 4KR0B 4XTWA 2RU3A 1RL2A 3MXHP 1IBKF 3CC7A 3IBCB 4WWSA 1U1KA 3JSMA 3C6UA 2JZ5A 1I3OB 1VQ8T 2CPEA 4R5PA 4TYBA 3HHLA 3MMAB 2M52A 4QQDA 3CD6A 1FVQA 2EI5A 4NLXA 1V6HA 3NY0A 1NZAA 1WKJA 1F6TA 2L3PA 3PGGA 2DIUA 3PMIA 1NUEA 1K0TA 4Q0BB 1BI2