3T9NA

Crystal structure of a membrane protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
269
structure length
266
Chain Sequence
b'YDIKAVKFLLDVLKILIIAFIGIKFADFLIYRFYKLYSKSKIQLPQRKIDTLTSLTKNAVRYIIYFLAGASILKLFNIDMTSLLAVAGIGSLAIGFGAQNLVKDMISGFFIIFEDQFSVGDYVTINGISGTVEEIGLRVTKIRGFSDGLHIIPNGEIKMVTNLTKDSMMAVVNIAFPIDEDVDKIIEGLQEICEEVKKSRDEGPTVLGITDMQDSKLVIMVYAKTQPMQKWAVERDIRYRVKKMFDQKNISFPYPRTTVILSEKKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small-conductance mechanosensitive channel
publication title Structure and molecular mechanism of an anion-selective mechanosensitive channel of small conductance
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Membrane protein
total genus 80
structure length 266
sequence length 269
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3t9nA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3t9nA03
2HLUA 3FGVA 1JK9B 5B08A 2HFNA 1N5VA 3KG1A 2W4PA 4NL5A 2P4TA 2KT2A 2QLXA 3E8OA 1VIEA 5A6PA 1X8DA 1FESA 2LXFA 1TL4A 2BJEA 1W2IA 1YJUA 2L3MA 2GA7A 5K9FA 4NPOA 2QIFA 2GV1A 2AW0A 1MWZA 2ZDPA 1TL5A 1YJVA 1N5TA 2ZDOA 5T7LA 2IYGA 4A4JA 2LQ9A 1N5SA 3HFKA 5B09A 2FIUA 1P8GA 1LQ9A 4Y2IA 1AFJA 3SFMA 2PD1A 3BM7A 5B0BA 1K0VA 1TZ0A 3F44A 4DPOA 1MWYA 2N4CA 4OIXA 2K7KA 2BJDA 2QYCA 1Y3KA 1KVJA 2GGPB 3VTIA 3LGNA 2K1RA 3FRYA 2OFHX 3GZ7A 3T9NA 5B0GA 2XMWA 1APSA 3DXSX 2RK2A 5A6WA 4HI2A 3KNGA 4A47A 1OSDA 1Y9OA 2EW9A 5IXUA 1FE4A 2KKHA 3IWXA 1TUVA 1XBWA 2HIQA 2G9OA 2BYCA 2IFXA 1Q8BA 2AP6A 2CRLA 3BN7A 3KKFA 3HDSA 4Y2MA 3HHLC 2FTRA 2AJ0A 3TNVA 1SQEA 1CC7A 3BGUA 2K2PA 4FNIA 2XMVA 2HLTA 3IWLA 3BF4A 3HX9A 1FVQA 2HQIA 1GXTA 1AW0A 4OJ3A 2N4DA 1Y0HA 1OQ6A 5B0AA 3CJKB 2HFOA 5F0WA 1V3ZA 4A48A 1AFIA 2RILA 2QLWA 2GQVA 1FE0A 2OMOA 5B0EA 2AJ1A 2ASYA 3LGMA 1Y3JA 2RMLA 5B0FA 3DCAA 3UDCA 4HH0A 2VH7A 2GGPA 2OP5A 2RK1A 5KAKA 1VIFA 2Q3PA 2W4DA 3QGPA 1X0PA 2RU9A 2OD6A 1KQKA 3WDOA 1VQSA 2IYIA 3TRGA 3LO3A 2JDJA 1KVIA 5B0CA 2ROEA 3BB5A 2OKQA 3HF5A 1JWWA 4HI1A 4FNHA 2GFFA 4Y2KA 1IUJA 1FD8A 3HHLB 2N7YA 1S6OA 1YRXA 3MZIA 1Q53A 1VQYA 3BR8A 4F67A 1URRA 2XMJA 4DN9A 2LDIA 2ROGA 3QMQA 2FHMA 4ZA1A 3HHLD 5B0DA 1GXUA 2OD4A 2LQBA 1S6UA 1CC8A 4Q2MA 4U9RA 1YJRA 1QUPA 1N5QA 4QOTA 3CJKA 4EFAC 4OJHA 1U7LA 4HL9A 4YEAA 1SI9A 1X7VA 2KYZA 1FEEA 2BBEA 2XMKA 4DL0C 1CPZA 4OJGA 5F0UA 1ULRA 4OJ1A 2OAUA 5T7LB 2ROPA 2RSQA 2FB0A 2VV5A 3KG0A 1OPZA 2XMTA 4ZOSA 4A46A 2XMUA 4HH1A 1Q8LA 2GO8A 1Q4RA 2W4CA 4Q2LA 1FVSA 1P6TA 3FMBA 2OFGX 1YG0A 2XMMA 1RJJA 3BDEA 1TR0A 3TOQA 1WD6A 2K7JA 1R6YA 3MCSA 2RH2A 2PGCA 1SB6A 4YDXA 2K1RB 1YJTA 2GCFA 1OQ3A 2ACYA 3HHLA 3K7RA 2BUNA 3I9ZA 2KT3A
chains in the Genus database with same CATH superfamily
1RWVB 5B08A 2B86A 1F0XA 2GTJA 4N5SA 4HVUA 1SKSA 4MFBA 1F5AA 2E3IA 4WFBQ 4A4JA 2UXDF 4OYWA 4X66J 2QLBB 1RADB 2CWXA 2XZDB 4DSLA 1FE4A 3D2WA 3W66A 2NUTB 3ASKA 2KRMA 3I5CA 3DLEB 3PACA 5GADI 3WC2A 3EG2A 3IWNC 2XLIA 4F02A 3CC4T 5JMNA 4QWBA 3R6OA 1OY6A 2HS0A 4CO0A 4U96A 2EFOA 1NSAA 3G4SS 2C1EB 1GAOA 3A5ZB 4PL6A 5C6SA 3ZZ0A 5F8GA 2YWFA 3CC7A 4A4FA 1F3FA 3GPLA 1HL6A 3BB5A 2EYZA 1WEZA 1XNRJ 5SUHA 4LFAF 4ORZA 2RUGA 2LA6A 1HK9A 4CH1A 2DXDA 3ULHA 2HPUA 3D28A 3AD9C 3L2WA 4ZA1A 1QVGA 1SUQA 4JJDA 4M4ZA 4F50A 1RAHB 2HG4A 3G4SA 4TYBA 1Y07A 2LJ3A 2DJWA 1CLFA 3TOQA 2XCAA 3KHGA 4JI6J 1NZAA 1JLEB 3FLGA 3PW0A 2AWZA 2OJ2A 5ETMA 4DR4J 2J7IA 1JJ2S 3MUMP 5HP1A 3GIRA 4JYAF 2RF2B 1DARA 1N5TA 4A4HA 1TKZB 4DV2F 5LM7E 3TEGA 3ZL7C 2BVZA 1M1HA 1F2GA 1S7IA 5LL6d 2D3O1 3D1HA 4DFMA 5B0GA 4CC7A 2F8HA 1FX4A 2EFVA 2DRBA 3ZZOA 2DBKA 1HPZB 2FJEB 3L9ZA 2CRLA 1YI2T 5A0DA 2VQFF 2LTOA 2MK5A 2CQDA 3CTRA 2L0AA 1RT3B 4FNIA 2H51B 3CJKB 1VQ8T 2HAIA 2D8JA 4MIBA 1M8VA 1TL3A 4IUFA 3PMIA 4AD6A 1SJ4P 4JRQA 2R8JA 3GLXA 4PJOD 1KHIA 4P5NA 2P6SA 3GG1A 4ED4A 4NE9C 3IGVA 4H4KC 3CCJS 5FDLA 2MXYA 1U1LA 1TSFA 3PYFA 1VIOA 3CDWA 4RL1A 3CCUT 2V5HG 4J8OA 2CNKB 3VZHA 2ZPGB 1YTYA 3OUYB 1WEXA 2UXBF 3FVYA 4DV3F 3LGFA 2PU9B 4Q2LA 2GHPA 1N0VC 1YG0A 4FW2A 3QLHA 4I69A 3CEYA 1OZ3A 2M1HA 4XTUA 5AE3A 2BX6A 4EMDA 2VFUA 4NZ6A 1BXNA 2KE9A 3JB9D 3R6LB 1QDUB 5D4PA 1PM3A 4QQDA 1I8FA 4EK2A 2BJEA 5L8RC 2ZOMA 3TVKA 2QA4G 1F3VA 2J05A 3K59A 2R7XA 1LQ9A 3BGLA 2XULA 5FROA 5GMKl 4M77E 1X75C 4TXSA 1X4CA 4X1VA 2F4VJ 3NCRA 3W8GA 4XIUA 4B9WA 3JCMb 1AD5A 4TVAB 4KAIA 1FRLA 1GL5A 3MO8A 2C2MB 3I96A 4RTUA 4TY9A 2OO4A 5DDRC 2DM1A 3HHNB 3D7SB 4K4ZA 4RKUC 3I5BA 2FPEA 1KONA 4ALZA 2DTJA 3I0RB 2HLTA 4M7AB 3VS1A 3GYNA 4XTVA 1JB0C 4ZVUB 2NXUA 2MQ8A 1P27B 2KSSA 2E44A 3L09A 1VIFA 3DDIA 3OLBA 2ZKTA 1S4EA 2JHEA 4DG1B 3PM9A 2Q79A 3LP1B 1RAOA 1U0SA 3EFSA 5FJ4A 1DBDA 2NXEA 1H641 3KUFA 4ILMA 4DJBA 4DUZJ 4ECVA 2DNMA 1YJ7A 2HBYB 2XMKA 4JV2A 4OGEA 3HFNA 3CCRT 3P5BP 3W2VB 2RO0A 3W9HA 5KE2A 3QO9A 5CZXA 1TR0A 4WF9Q 5CO7A 4OZ3A 1GK8A 1S1TA 4F4XA 1SH0A 1NK5A 3OVSA 3H4BA 2YUPA 3REAB 1HBUA 2HFSA 3W5ZA 1M5OC 1FRHA 2B4PA 1H2UX 2QRRA 4OYMA 3MD3A 3M9OB 1S1XA 5BYSA 1VQPT 4O0IA 4K4XA 4LF7F 1WA7A 2MYSA 1JLQB 1S77D 2YWEA 3CD6S 2FJAB 3O5TB 4PFPA 2BZ2A 2CPHA 1WEYA 2XLJA 1WOPA 1Q8BA 2DB1A 5K14B 3JCMQ 5KCHA 1D9AA 2CUDA 5D6YA 5GANg 4HH0A 4QYZJ 2Q3PA 2GQCA 2FJBB 2BANA 5E33A 1SV5A 3CCVQ 1M1FA 2HHPA 1EIYB 4QW2A 5LT5A 2QEXA 2MGZA 3CUNA 3HHTB 2XMAA 1M2VB 2DIQA 3GYXB 2R7WA 1NK8A 3E01B 4YP3A 1JLAB 3I0SB 5EWEA 3DGPA 2GO9A 2QX0A 2EYWA 5D4NA 2XMUA 3MMAB 5D4OA 1EP4B 4Z88A 1T0HA 2ROLA 1FRMA 4YR0A 2HKEA 2HZCA 2LKZA 4GY5A 2DLPA 1NM7A 2RQUA 5J2MB 1UFLA 1J5EF 4WP3A 1U24A 2PNIA 4ES3A 1K0TA 1WFWA 5J26A 3WX8A 4RW6B 1HR0F 2V94A 2Y3YA 4Y2IA 1LOJA 4UW2A 2BEFA 2NUPB 2V8VA 1A6LA 5HK4A 4RTTA 4CO2A 1RTHA 5KH6A 2UV8A 3PHTA 5F8LA 1P9QC 1XN9A 4DQIA 4CM2A 3DRSB 2ACMA 1G2EA 2PEHA 1UG1A 1W26A 4M75D 2NXJA 2ZH2A 4JI8J 4F4KA 4QU6A 1TU0B 3L95X 5A8RA 1RK8A 5A8WA 2EFPA 1X4BA 2CZ9A 1C0UA 1JXLA 5F8NA 4C92A 2RK1A 4OYAA 2V1RA 3MOZA 2Z0WA 4II1A 5EWGA 3OTBA 3BDUA 5CABA 1RTJB 3S01A 4L59A 3HHLB 1YRXA 2JEIA 3H5UA 2ZWOA 3ZZUA 3BKTA 4J6YA 1PD0A 2DNQA 2LT1A 4O3SA 2NXNA 4CWBA 1HMVB 2Y0SD 1H7WA 2IRXA 2MPUA 3VAIA 3I4PA 1YIJT 1KQSS 3ZBDA 3PFOA 3CBMA 3OXFA 3FSXA 3RBXA 3SV4A 1Q7YC 3EM1A 1YHQQ 4LVOP 2AQ4A 3D67A 1FYNA 2BA9A 3D0HE 2VWFA 2LJ0A 4K2JA 1TL4A 4RUCA 1B3QA 1PILA 2BDPA 3CCEA 2H54B 1NO8A 3DLMA 2ZOFA 4LT6A 3RBZA 1YJNT 4IUPA 2HKNA 3AJ1A 3CCMS 2EQIA 3HLUA 2K3BA 3AOAA 1KWMA 1T3LA 2L3RA 4C92C 5DZ7A 4USMA 4M7DD 2ZH1A 2GFAA 5I3UB 1XBWA 2QGFB 1M3CA 4M5IA 2ASJA 1NK7A 2LCLA 1BQMA 1ZH5A 3QZ5B 2MF2A 3HX9A 1PCXA 1NEEA 1HWLA 4RBVA 3EHRA 2BV3A 4NEYA 3CCMA 1D1UA 3Q8QB 4LBPA 4RU2A 4E7SA 4NX9A 2KYMA 2OX7A 3JAMU 2PC6A 1EIFA 2C06A 4ZTJA 2W2PP 2G1DA 1UGSB 3MCAB 2C2DA 5J39A 4ZPAA 3THPA 4MFBB 2K3YA 2KT8A 2ZPIB 3QPHA 2O88A 1NB2A 5CYQA 3QFHA 1NJXA 1HSQA 5LSRA 2ZJPQ 2OGUA 2PA8D 4TYAA 4DL6A 4DSIA 2W8KA 4NCAA 4PWDA 1NH8A 1KD1T 1QSLA 2EWHA 3N79A 1OIAA 4EIKA 1RTZA 2AZVA 4O23A 4IKAA 4AXIA 5KFSA 2JS0A 5HAOA 1ZPWX 1ZAWA 1VQOQ 5HQ8A 4P2SA 2BE7D 5B09A 2VA3A 3MFIA 5I3QA 1D0XA 2V8PA 1IM4A 1W4SA 1QUVA 1NDCA 4LD6A 2WAQD 3PVXA 3RB6A 3FQLA 2EJGA 4C0HA 2A6OA 3PR4A 2BRLA 2A2DA 2V26A 1RT2A 2D3OR 4XAKA 1T11A 3BR9A 3JSRA 3VALA 1CJVA 2CH4A 5HMZA 3FJ5A 4CO1A 2OTJT 4DPXA 1JIHA 3DLKA 1VQMQ 3Q23A 3H6ZA 3OR1A 1VQNT 3D4JA 4I7FA 2DD8S 2J6SA 1SUQB 4O0NA 4R0KA 3I5RA 1YJWT 5K8OA 1QLYA 3ME9A 2OMOA 1B99A 1RT7B 4K4TA 1X4HA 6FDRA 3VHQA 4C3MA 1PAUB 1X4EA 1IKVA 4LBIA 1UW4A 5KG5A 2EFIA 1RWOB 1N8RT 1R7IA 3WC0A 2D6FA 5HP1B 3FKBA 3UPUA 3DRPA 3PFEA 5CK9A 5IAYA 1W7WA 2VV5A 1Q5YA 2IVYA 1I4K1 3KLIA 2IAJA 3MP1A 2PFDA 3EGXA 5IHNA 3AFGA 4OI2A 3QSIA 4YDXA 2BQ3A 1G3SA 1WDDA 4KV8A 3DFEA 2MKCA 3X25B 3G6XA 3KG1A 2NS1B 3AD8C 3PMTA 1SIZA 4ZPVR 2L3MA 2CZ0B 1XTDA 3V6KA 1VC6A 1RHRB 4XU1A 2LNVA 4LBHA 1S1WA 4CLWA 2XHCA 3PYEA 4DHVA 1TL3B 2EC0A 3Q22A 4W92B 3W5XA 3V8LA 2VYTA 3KJVA 2DR9A 4C48A 4IG0A 1WNEA 1FERA 5A6WA 3RR7A 5FDLB 2ALZA 2QQRA 1PIEA 1R8PA 2IFXA 2KVQG 4J9DA 5LJ3f 2P8IA 4WBFA 3JCMX 1M30A 2MQPA 3Q8YA 2JRSA 1YITQ 2NLWA 1FMWA 3P8DA 1VOMA 2DNOA 1F1BB 1EX4A 2E3HA 4KTQA 3ZZPA 3IAM9 4XDDA 4CH7A 4R5PA 1Y5LB 2DGXA 2COLA 2H3JA 5IHIA 3TZWA 3QLHB 3VAHA 2RDJA 1U47A 2VG6A 4K8RA 1E6HA 3OMGA 1PCAA 2XK0A 4NMXA 3EZOA 2JTEA 4USTA 3E2UA 2L48A 3RAMA 3UCUP 3MCNA 4BBYA 2PEBA 1FKOA 1NKCA 4HDGA 5DQGA 4ZOSA 3NHNA 1MMLA 3ZTRA 4OB1B 2MSTA 3OHBA 1SQGA 4LREA 1JKHA 4E47A 4A8QA 3B78A 3VS0A 2O5DA 1ZSZA 4EEYA 2RI5A 5K8MA 2CVIA 5L1LA 4OZLA 4UQTA 1WUUA 3M8RA 4P71A 1S9GB 4JV5F 3W8PA 4DU7A 2HL3A 4ZPTR 2UUTA 5IXBA 2XS5A 2HVIA 4K4WA 1TUVA 4M5GA 4FYWB 2NSBA 5DQIA 2HAFA 3MCMA 3W5YA 3CPWS 5HVHA 2X3XD 3D3CJ 2DEUA 1I5LA 3M58A 4B02A 3R1LA 3VS7A 4NXNJ 1H3DA 3MR3A 2AYEA 2MPXC 2OEMA 3PR5B 5CKFA 1K1SA 1XR7A 2KNBB 3U02A 3FBBA 3QO9B 2YKOA 4OHWA 1OS5A 3G71Q 4JI0J 1B64A 1S1TB 4F7UA 4YY3F 2HHHJ 2RF0A 2HVHA 3D3BJ 1HBUB 2IVWA 4M5NA 4KFBA 2HZVA 3EGVA 4BC9A 3MKDA 4C0ZA 5KG2A 1MNEA 4YUDA 1S1XB 2FB0A 3KYLA 2ZH5A 3FFIA 2B43A 2MZSA 2E1MC 3MXHP 3UDEA 1LV5A 1Q82R 4HHUA 4M8LA 5J2NA 4O6JA 1HI8A 4PFZA 3QT6A 2HBZB 2PSZA 3VGTA 3G6EQ 2IJFA 2IJNA 3D9BA 5GAMd 5HVGA 3UE2A 4NYZA 2M51A 3RBDA 4LF5F 2P9CA 3A8KA 1WF0A 4NLXA 4ZMMA 3Q8VA 4EYHB 1VBKA 2BANB 3N5FA 1SV5B 3RNJA 1VJWA 3UQSA 1Y9OA 2E29A 3CO9A 2MGZB 4OVAA 1T9VA 2UV8G 4P10A 3GFYA 4HCBA 1REVA 4KB7A 1QP2A 3HM9A 2RE1A 1BMQB 3LH5A 2CP5A 1G8XA 3KNAA 2ATCB 4BE2A 2QO3A 4C8QF 3HPOA 2I5JA 3DGPB 1RYSA 3OYMA 4U8VA 5KAKA 2DAQA 3LLRA 5JVGQ 1W2BA 1YX2A 3QGPA 3SCIE 4OI1A 1H3HA 3FJ2A 3FEOA 4C92G 2ZOGA 3ZXWA 3WHIA 5FLXU 5HMXA 1RCOB 2H1YA 3D68A 4WFNQ 1QSYA 3MCOA 1RAFB 5KFJA 2ROPA 3M9NB 1M5KC 4OB0B 2P6TA 2VKNA 4LFCF 3LPEA 3PKMA 3RMSA 5M2RA 5LL6S 4C92F 3GIJA 1RTHB 1JLGA 2ZPHB 2GJ2A 2VPWB 3BDPA 1PRMC 1CSKA 3NG8A 2KL8A 4Y92A 2GGRA 2DNZA 4BWMA 4FL6A 1U49A 4UZBA 4LR7A 2XB2D 2QIFA 1NJIC 1NPPA 2HQXA 5FWCA 5A8RB 4L76A 5A8WB 4ANDA 4FKXA 4L74A 4ZVGA 4Q8FA 5AJ3F 1U2CA 3GR1A 4LF8J 1EQ0A 1AYEA 4C92B 3JCMf 3D5MA 2QXFA 3FRYA 1YBYA 3I56Q 1K8AT 3OYCA 2YWHA 5AYFA 1QP3A 1VUBA 3BDLA 3SSSA 2DCUB 4USJC 4D3HA 1SF9A 2YQ1A 1HNZF 4DSKA 2RD5C 4DV6F 2XO7A 1X6GA 3QZ9B 2AEJA 5ECAA 3SEOA 1NSQA 2J0SD 2O31A 3Q89A 2HYIB 4FXVA 3OFGA 2JSXA 1MMAA 5B0CA 3N6LA 2KJVA 3K5OA 3NGSA 2YNIA 5E0OA 1KD1R 2XY7A 2YHTA 3SSRA 3E9FA 4JJCA 4J9QA 2Q1LA 3MPWA 4GVLA 1VLOA 2EAYA 4J9FA 3EFOA 2K5IA 4J90A 1WHKA 7AT1B 2UU9F 5IV3A 4DOWA 2NYHA 2C42A 1TS9A 2H9ZA 1U45A 2MLZA 2PGCA 2ZPBB 2HBPA 2EVZA 1QM9A 3CCLQ 3TQEA 2DIUA 2XYPB 1QCOA 2E5LJ 4M7DE 1S6PA 1U3OA 2RQVA 3CBOA 6FD1A 2PIIA 1KHVA 1FK9A 2GA7A 2LU1A 1MV3A 2AW0A 1KQFB 2EPIA 1BQMB 1QY7A 3CCZA 5E3QA 4ES1A 2PMZD 3IBWA 4E7JA 3CCVS 3LGNA 1UVNA 3GJSB 4DCJB 4A47A 2F9DA 3QIDA 1M1KT 2ZH6A 5DLOA 4NLUA 2LQWA 2R7RA 2CQ4A 4LJMA 4Y2MA 2GAGC 1DAXA 4O4RA 4AL5A 4WXWA 1N8RR 3IRXA 4EBCA 1LXNA 1MMGA 5CYQB 1TL1A 3NS5A 1VQKT 3CCVA 3RG6A 1VQ4Q 2DY9A 3ETOA 2KJWA 1M5PC 1M90U 5HQLA 4OZ1A 2ROEA 4PWDB 4RUAA 1RL2A 5J1EA 4ED6A 4WP8A 4E8UA 2JLFA 2E1CA 1GX5A 3AXKA 2B4OA 2MMPA 3PFSA 1CC8A 4TVRA 2ATLA 1OPZA 4A46A 4P73A 3MPUB 1UL3A 1RT2B 3S1TA 4DUYJ 3O44A 5JXSA 1CJVB 3BO4A 4E98A 1J5OA 2J8SA 1QVFS 4LF9J 1PKSA 3DLKB 3CC2T 3E2EA 3VQTA 3QRQA 4EU0A 4C9DA 4K4SA 3OR1B 3C2PA 5FU7C 4RTVA 2Q43A 4ZLPA 4I7FB 5GAN5 2FZKB 2VPYB 3I5AA 3A98A 2DTOA 1OYEA 1R27B 1KFDA 3CCST 3L2QA 3FJPA 1UHCA 5I42A 5F41A 3HK2A 3PCOB 2E5QA 3CIZA 3WZ0A 4ILLA 4ED0A 4KRTA 1QVFA 2CQ1A 1H74A 2UXCF 1WHGA 1AWWA 2CNNB 3QT5A 4ELYC 5A0YA 3CXCS 4QR2A 1RAAB 4X65J 1SRMA 3DRPB 2BW7A 4R0EA 2LX9A 2CPEA 1VQ7T 3UDCA 5T14A 3KLIB 2IAJB 2RRAA 3RBBB 4QVDA 1YHQS 3EGXB 1NSPA 1PG5B 3QZ7A 1NYGA 4G1PA 4KV8B 3BR8A 3M32A 5GMEA 3OSVA 2PUKB 2Y4XA 2RPNA 4UF4A 3QDRB 4KPCA 2R5MA 2K5LA 2FO0A 2UXDJ 2JJ4D 4DF4A 3JB9H 1D8ZA 3QZ8A 3HJVA 3QGGA 4DL0C 3AT1B 4OJGA 3B4MA 1S1WB 3EZUA 3OW2A 3ILLA 5DG7A 1I94F 4PJMA 1XWLA 1XQHA 1ZHIA 3KJVB 1HWUA 1AROP 4IG0B 2EKNA 4K0KF 3BBBA 5CQXA 5HSPA 4LDVA 3CJ5A 3PW5A 3PXGa 2BZXA 3MGJA 5AXNA 3CC7T 4PJNA 3H8ZA 3TQ7P 2B8PA 4ETXA 2BZ8A 5LXRA 2N4CA 3MAQA 3NWGA 1JO8A 4LF4F 4R5PB 1BI1A 2WVEA 1OX8A 2B7BB 3HPWA 3ET6A 4LFAJ 2RK2A 3I4HX 3H41A 2VG6B 3ZZTA 2F65A 4AYBD 3FEYB 4DBRA 1ZM4A 1SSFA 3IMQJ 1BYMA 1ZETA 3SSQA 3RRHA 2HFOA 3MURP 1FKOB 1M90C 4QWEA 1FKPB 3FBEA 3LGMA 2K8GA 2Q66A 1KOOA 1TL7A 2V8IA 3GNGA 4WTOB 4OP0A 1S49A 3G96A 1YGYA 3P6YC 2BKDN 1JKHB 4OB2B 1EKSA 1FMVA 5F8MA 1VQOS 2NUZA 1ZSZB 2A10A 4JYAJ 2L9WA 3WXMB 4RW4A 2A37A 4DBQA 4F7UG 2XMFA 3JSCA 2L9NA 4X62F 4K4UA 3FB9A 4I1TA 3RB0A 1UB4A 4WZQA 2EJFA 2F40A 3AJDA 3TEEA 4G1QA 5GAMe 4WU3A 3OYHA 2K4YA 3SDEA 1VQOA 1IHVA 1VQMS 3QKJA 5JVHQ 1RACB 1ACMB 4E6RA 3CCQQ 3W62A 2VQFJ 3UW1A 2HVEA 4URQU 1X4FA 1BUXA 3HFKA 4AG1C 4LN2A 2GF7A 1X5OA 5CKHA 3VF0B 1HI1A 1TUCA 4FSSA 3EUNA 1WJRA 3P45B 4N4HA 2RDIA 2XMWA 4TU7A 3OS0A 5IT9E 3HHEA 2MHEA 2CGHA 1Q8IA 3MEUA 2VODA 4F2SA 4F7UB 2FJVA 3SEMA 2PVDB 4X4OA 5GAGU 2KEAA 4J9EA 4KFBB 2WVFA 2UXBJ 1U4BA 2GCXA 4CRIA 4N4GA 4ZLNA 4JI5F 1NPRA 2X1GA 1RYRA 2O01E 3FFIB 4A8KA 2KO1A 1RKJA 3J81E 2CZ4A 3OPKA 4CRJA 3KJFB 5J2NB 1LKZA 3MR6A 1L3VA 1LK7A 3MTKA 1ABOA 3VAFA 1MW7A 2CDQA 4AE5A 4HACA 2AJ2A 4MYTA 3T6JA 4DX6A 2GS8A 4DX7A 3IRWP 2IHR1 4ZLLA 2JJ9A 3VS4A 4DI6A 5C42B 5D7UA 2QQBA 4LF2A 4IQXA 1Q86R 4OI3A 2HHSA 4OX8A 1RISA 4RWWA 5D77A 3OQ5A 1BQXA 3A1PA 1IGQA 1K8AR 3TEHB 3GP9A 1DLOA 1N88A 1YITS 3PX4A 1CBKA 1N9RA 1OU8A 3A8GB 2R7QA 1TFWA 2DR5A 1TKXA 1N32F 3BM7A 3PW4A 4OQJA 2C3PA 1NAQA 3FZBA 4ANJA 2EQJA 3OL6A 5DDQC 2FY8A 2IRYA 3ZTSA 2DXEA 4F25A 3H42A 4O3RA 1S1NA 1FWZA 4BCAA 2P9EA 4J7FA 3JQKA 1XNQF 5GAOl 2F2WA 4KHPF 5KTQA 4BY6B 2Q6CA 1K9AA 2DNUA 1K44A 4WKYA 1T8EA 5ETKA 2GQIA 3PZPA 1VYAA 2AV5A 3T19A 4TKTA 4HT9A 3FSYA 3IG1A 1FMKA 4PWWA 1LPLA 5IWAF 3BEGB 3KBGA 1KDNA 2A7YA 2QGGA 1JLGB 1HWIA 1WKJA 1VYUA 1Y11A 1QVGP 2MKJA 1OZ2A 1Z4UA 5MLCV 1UGVA 3OR2A 5BYQA 2BBEA 2LECA 1VYVA 1XNIA 5KFZA 4GC7A 3V6DA 1GBRA 1FDNA 2VGMA 4ZVPB 1FTRA 2AEFA 3CMEQ 1UEVA 2YKQA 1S72Q 5D15A 3NNAA 4I6AA 2PVOB 4Y28C 1M1KR 1QKWA 2E6NA 2R4FA 3L42A 4F3MA 3T1AA 2QDYB 3LH2S 3KJQB 5HQMA 5BR8J 1W70A 2EFGA 2DILA 2PD1A 1FDAA 2R2SA 2QEXT 3I9QA 1Y4ZB 1K73R 1Y3KA 4RMOA 3P8HA 1SCJB 5FU6C 2WW4A 4UQGA 2OFHX 2QMUB 4ZJOA 2YNIB 1U0HA 2PO4A 2E4HA 2MI6A 3GONA 1IHWA 3NCQA 2VFSA 4DR3J 2V2QA 1WJSA 4UOHA 2IM1A 4U6PA 4DR6J 2NPFA 2DXBA 1H7XA 1W25A 3L2VA 3EFOB 4IUQA 3EVMA 3G71A 1X5TA 1VS3A 1YJ9Q 3Q8RB 3HXMA 2FVPA 4XU0A 3MEGA 3V4IA 4HI1A 3BZQA 3G6ES 1SKUB 2LC4A 3TVZA 2EXUA 5LMUJ 4DR1J 2GVZA 4C5IA 2RJEA 1J5EJ 4OHXA 1S6PB 5LJ3g 2DKGA 4AFFA 1FK9B 7FD1A 1FJCA 1TVRA 1Q7YT 1MWQA 3GBQA 1GFDA 4C8YA 1JBMA 2V6AA 2BM0A 1SL0A 3GJRB 1X2QA 2OJ3A 1G3YA 1HNXF 4HCZA 3G6EA 3DRXA 3D6TB 3F70A 3I55A 1PD1A 2FC8A 1IREB 1K47A 5FU7B 2WSCC 1SEMA 4ECSA 2MKHA 5DO2A 3DKDA 3V5RA 2ZBIA 1Q82U 3IRXB 4IOBA 3QT8A 1TL1B 1Y71A 4DR5J 3E3XA 3TW0A 2JTFA 4HI2A 5D6XA 1U09A 1GMWD 1ZM3A 5CAAA 3OMCA 5J1EB 2OTLT 1FJ7A 1T3SA 2BQRA 1UJYA 4M5HA 5LMNF 2C28A 1FT8A 1RWWB 2XMVA 1OYXA 1UTAA 2XYHB 2RHYA 5D0RA 4DN0A 2XQCA 1N56A 1FA0A 4F04B 1T0TV 1QSSA 1CQNA 4JI2F 3BS9A 1X0PA 3G8TA 4C92D 1KVIA 3IM9A 2J7WA 2JC0A 1PAEX 2JFDA 4B08A 2E1PA 1J5OB 3NGPA 3T5HA 1NSKL 4TLRA 1D0ZA 4WFAQ 1V9OA 1BLUA 2RS8A 3GP8A 2E1RA 2RSQA 2CPFA 1IBMF 1TKTA 2V8KA 2ZPEB 5HROA 1WXUA 3MCSA 1M0SA 4YHHF 4A8XA 4QBUA 1PGZA 2XY6A 1X01A 5I42B 1FXRA 2Y90A 1I6JA 1QVGR 4DU8A 2ZUAA 3GR0A 2GMJA 5EG2A 1QW1A 5ETTA 2M16A 2BQUA 2HNIA 1CG2A 5A0YB 3JSMA 2ASDA 2MWOA 1YI2Q 3I56A 3NFCA 5KFTA 1VQ8Q 4Y00A 4BWJA 1Q79A 2EEYA 2HWHA 1RQ0A 5DZ6A 4EI2A 2WRMA 2EG1A 4XTWA 2CA9A 5E3AA 3K8WA 3DKMA 5GAHU 4A63B 1VI7A 2AP6A 1H0HB 3M32B 3SD4A 3O8VA 4K5RA 1U6ZA 3CCUQ 2N82B 4LDWA 4ECRA 1QE1A 2GNCA 2DO3A 4XQ3A 4JP8A 2CJXB 5I2MA 3CCLS 2L2PA 3PYDA 4FXWA 5KFLA 1O9SA 3VVUA 1KFSA 1GFCA 2VKRA 3EMTA 3UO0A 4LDUA 2HFUA 4M1KA 2LDIA 4GC6A 4XU3A 2AZ3A 1F5BA 2RA2A 2X4YA 2ZBRA 2AHOB 1LXJA 2E6ZA 1ICEB 2HNDA 2J6UA 3JCMJ 1PJ7A 4F4WA 2ZKUA 3DMJA 2JH3A 3CCLA 4F14A 1B7FA 3QAEA 1NM2A 1AWXA 3WQPA 4Y6IA 3ET6B 3T6BA 3UF4A 3GQCA 3M8PB 1X8DA 1Q82C 4OHVA 3ILIA 1UVKA 1WHVA 1T02A 4LF6J 1PBAA 2NZCA 1VQ4S 1H6KX 4PG4A 1TXQA 2LQKA 3A3PB 2B5JA 3RYLA 2ZAEA 1TL7B 5M2PA 1XIQA 4B9SA 4FYXB 1CJUA 1NH7A 2PI5A 4Q7AA 3GJQB 3TVYA 4LRBA 3VAMA 1VIXA 4RW4B 2YUOA 1VQ4A 4N47A 1AB8A 3IC1A 3CJTA 4NL3A 4RTWA 4P75A 4RUBA 1OY9A 2QI2A 3JCMg 4G1QB 3TAMA 3CCRQ 2AU0A 1R8AA 2Z2LA 4C11A 4F4YA 1YN8A 3SDEB 4BC7A 2EK1A 1VQ5A 1N8RU 3OYEA 5LJ5e 5MAOA 3PTAA 3NAHA 4IUTA 2HNZA 2I8EA 2C2OB 1KK7A 1VBZA 3L7PA 5RUBA 1X2KA 4NXMF 3FCWA 3T5KA 2L9DA 3JYTA 2OFGX 4A8MP 4JI1J 2DE0X 4FF1A 2CREA 1VQ6S 3R5DA 1HBMA 3ULRB 4KBMB 1TMJA 1U1TA 1VQPQ 3NS6A 2Y4YA 2HQDA 2W4PA 1S0OA 3M8YA 2MB0B 1MMNA 1WLPB 4J9PA 3LF0A 1N33F 2OELA 2CPJA 3SDZA 4M78A 1TELA 3SV3A 2NR0A 2GFUA 5L8RE 2YVSA 5KFPA 3EHQA 3SB2A 3NMZC 1NUEA 2IIMA 3PEJA 2ABYA 1WWHA 1NJYA 2JOYA 3H20A 4X2BA 4P9SA 2WTFA 2Z57B 3NL0A 3LW5C 2XLKA 2F5GA 3C4SA 1RBLA 5H9FJ 3CWJA 3JQJA 4HACB 2DXUA 5ETNA 1GMVA 2OPSA 3T1HF 1V3ZA 4QYZK 1UAWA 4QIEA 2KFYA 3BBCA 3KUEA 5KFVA 3R9LA 4BUGA 2K6DA 4CYUA 4LIRA 4JI4J 5EDWA 5CQYA 2OKQA 4PJOF 1IWAA 2YRCA 3MEDA 3MP8A 3V4MA 3M2RA 4M77A 3HHDA 4CDIA 2RM4A 1DLOB 2ZZNA 1EHWA 4NCGA 1K1ZA 4LXCA 1U7LA 2UUCF 5KT5A 4JV5J 1SHGA 1IKYA 3TAPA 4QQGA 4M78C 4PYAA 1TKXB 2XM3A 4WCEQ 4MK7A 4ZN3A 2GVDB 3BDEA 4GLKA 3LGLA 2XC9A 3A8HB 4DR7F 3KMSA 2D69A 1M3AA 3M57A 2QLXA 3ILJA 4P7VA 3IXQA 5I4MA 1G6BA 3JB9F 3JCMc 1I51B 2EFQA 3ENVA 2CAJA 3NXZA 4XDCA 9RUBA 4DX5A 2EKYA 4LDXA 1FRJA 5IT0A 2ZHBA 1IR0A 3MEAA 3IG1B 5LJ3Y 1RWMB 3M8ZA 1GXLA 2J9DE 2CQGA 3TZXA 3VAGA 4MKVA 2MIOA 4FBTA 3MTJA 1GXTA 1QTNB 3OR2B 3QSYB 3SWNA 4JS4A 1YNZA 3V6DB 1Q7YR 4MKBA 1PNJA 2HW3A 3PDNA 3J81j 1N52B 2JVRA 2HQ3A 1IRXA 3CO0P 1AOJA 4M5KA 1YIJQ 1KG1A 4D8DA 3CCQS 3ZTOA 1VQYA 2OPRA 4C5GA 2UVUA 4LF5J 1HWKA 4V19J 4QJVA 4QIGA 1F6TA 1U25A 2F1LA 2EBEA 4GMKA 2A08A 4USIA 2QDLA 1F9EB 4C0DC 1YJNQ 1ZSGA 4XPCA 3GOXA 2NQPA 2CWKA 3J80Y 3NS7B 3LWLA 2JOQA 4DPWA 4MIAA 1U0HB 4I6WA 2IC3A 4C3KA 3FRZA 5GJWB 2ZD1B 3X28B 2N7CA 1VISA 1KJWA 2JNJA 1S99A 2KG1A 2I0XA 1GX6A 1WX6A 2JZ2A 3SWNC 2MWPA 1PC0A 3V8KA 4EPCA 3KFVA 1VQ6T 4B3RF 3H2LA 2BW2A 1BKBA 3MEGB 2R2RA 3V4IB 1B7YB 2DYIA 2RHIA 5F3TA 4FF4A 2GVZB 4ECQA 2CQ3A 2ED1A 2JL9A 1EB0A 3ONQA 4PR6A 3TZYA 1TVRB 3VAJA 2G3RA 4LFCJ 2JT4A 4X9DA 4C8LA 4GKKF 4DA4A 4O3OA 1RZMA 2OSRA 1B0VA 2A2CA 2AT1B 1AXQA 1HQUA 3PRDA 1H73A 3J7AN 3UCZP 4BI8B 1S0MA 1SXLA 4U67Q 2JEFA 3M59A 1R0AA 3HVAA 4R56A 1X6OA 2D9TA 1NK9A 4LNPA 1YZ7A 4B9UA 5KFKA 2VG7A 3TVTA 2SRCA 5AJ3J 4HH1A 4IYQA 3C14A 1P6TA 4X4VA 4EGLA 2Y1LB 2CJ9A 2BABA 1H2TZ 3K7RA 4OYIA 4P72A 3V7SA 4ECUA 4P7TA 1VK8A 4P2FA 2YQ3A 3ZTPA 2C3OA 2M4MA 4DV6J 4YOEA 1RUWA 3OA6A 2H65B 4JOUA 4RNFA 2IA6A 2DXFA 1Q86U 5K8PA 2UVVA 2OTJQ 1LEOA 2DVIA 2KI2A 4CO5A 2IM3A 3QO3A 1VQNQ 1TUDA 3OSNA 4LUBA 2JUFA 4RUGA 1R89A 4MJKA 4L6V3 2OPQA 1K8AU 5KFWA 1YJWQ 4IDKA 4J5YA 3KTQA 4E0DA 4RWXA 1XMQF 1T9TA 4RCBA 4C92E 2A6MA 2GIFA 2FQQB 2IVMA 5GAEU 4IRKA 3FEXB 4ZHRA 1GH8A 2C0IA 2ZH8A 1WIEA 4M75F 2NUHA 1FNMA 4B9XA 3TR5A 4M7AA 4ED2A 1XC9A 3EWGA 1VBXA 2UU9J 4OMNA 2M8DB 3CMES 1CKAA 4PKCC 3DDKA 1KFZA 4K7QA 4OI6A 1N5YA 1TKTB 2AGPA 5HROB 2NCKL 3IFEA 1V3SA 5GMKm 2YX7A 3AJ2A 4ZPBA 4LFBF 3MM9A 1KR4A 2IMOA 2N3LA 5KFIA 3ELHA 2FDNA 2CSQA 2AYGA 1RLCL 3JSMB 2IM0A 4NRTA 1S72A 2MZJA 2KAFA 3P96A 2A18A 4F0KA 2KT3A 2HHWA 2VXFA 1BWVA 3OB9A 1CJKA 3A1YG 4YB7A 2O4XA 3OJSA 1NEGA 2KH9A 4RNOA 2OHDA 1PC4A 1SPKA 1S12A 2ZITA 1F5CA 3PY8A 5U47A 5A2QY 5HI7A 1QE1B 4WCIA 4ZNXA 2FL7A 3AH6A 2MHNA 3GFZA 4M7AC 2A3JA 1YJ9S 1SRLA 1QD1A 1M1KU 3T9NA 1JLQA 4AQYJ 1HD0A 3HD1A 3N5BA 3J7Z5 3MEVA 3RDVA 2CPZA 4KUDK 4C3LA 2KHCA 1N34F 5DG8A 4G3IA 2VJUA 3GV5B 1K73U 3NKYA 1W2BP 1I1GA 3KG4A 3PHEA 2HNDB 2FVCA 2VFTA 3U27A 5EGYA 3OY9A 3N4WA 1V5VA 3IS9A 3V6HA 4HLBA 3M56A 4KKOA 2KT1A 4PG8A 5KFHA 5ETLA 4X66F 3MP6A 1S48A 1FEEA 4OMOA 3CC4S 5KFQA 2KROA 2IG0A 2G0CA 2D8HA 2A36A 2PI4A 3K5LA 2CFXA 2B5JB 4KT0C 2XSJA 1CJUB 1Q86C 2UXCJ 2HHVA 4CH0S 3E19A 2DVJA 4DQQA 4W90B 3OT9A 1GFWB 4B9MA 1QCFA 2VPZB 1CQMA 4M78G 4WWSA 1KVJA 1IKWA 4P74A 2MLXA 3MEWA 1FKAF 3R1HA 1SC6A 1WSVA 1M90T 4C11B 4FDFA 2OIHA 3HO1A 1ZZNA 3OTEA 1WC0A 3AXMA 3BGUA 2RJZA 1V3RA 2HNZB 3US5A 1OPIA 1RWPB 4M78F 1BQNA 4WFXA 3M8QA 3ZNUA 2MOXA 4ZJQA 4DPYA 3JYTB 5CCLA 1ZA2B 1MUZA 1HBMB 4K0KJ 3JAME 3M30A 2ZH4A 4IQMA 2N7YA 1UHFA 2B9XA 3LA0A 1AUSL 4C8NA 4PZVA 2DGUA 1SL1A 2KYBA 3PO4A 4LE9A 1T7PA 4YMEA 1YI2S 2L8DA 2FHJA 4M77G 4HDHA 4LIWA 1DJ0A 4M78B 4ZDNA 4LF4J 4OFZA 1VQ8S 2GNKA 1WJ9A 3NP5A 1P1TA 4FF3A 3A8OB 3NGRA 2JTMA 4J9LA 2G4BA 4HHJA 3JSBA 3CE8A 4H4MA 3CCUS 3SCKE 2D74B 4I2QA 2KXDA 3NMRA 3M9MB 1WG4A 2MTLA 1TH7A 3FBCA 4FXDA 3QIIA 2B0GA 2OPSB 1VFJA 4K50A 1LFPA 2J76E 4LUDA 1HNWJ 4CYUB 4BI3A 2V2ZA 2V69A 4JS5A 3P3DA 2PQWA 3JCMP 3OYBA 1FO1A 1BI2A 1U8WA 2L3SA 3NMAA 4FSXA 4C0FA 1K73C 3MEDB 1JU5C 1KS2A 1S9EA 2KDSA 3M2RB 4M77B 3HHLC 3KHHA 2YUNA 4X62J 1UA0A 4PRFA 4NCGB 5F0WA 4CI0B 2M02A 3RUXA 2H8HA 1U1RA 1IKYB 1UFWA 1Y3JA 3DCAA 4K2XA 4V1Ak 4IO1A 2D0NA 2FY1A 2U1AA 2U2FA 4X4QA 4M94A 1TK0A 4AUKA 1NJIR 4CNYA 1ZLMA 3HRUA 2XGQA 3QIPA 2X4XA 2RB7A 4HHHA 4E7ZA 3OFHA 3TAQA 5CHCB 2KM8C 3MR7A 1W2BR 2F4VF 4C0DB 3ZFJA 3POTA 3M6WA 3V7CA 3ER0A 3IA0A 3QGIA 3R2CJ 4LRAA 3U7JA 2O1PA 2QYGA 3RKYA 3UDLA 3H98A 2GW8A 4KJIA 4CP5A 3OYKA 3TQ1A 2V4JA 4ECYA 5EN1A 4J9CA 4JI5J 2DH8A 2E7VA 2J9CA 3W2WA 4OIXA 1Q81C 3SWNB 4IOAQ 3SQGA 2XBPA 4C8OA 1XMBA 5D0HA 3CCRS 4QCLA 3OS1A 3PX6A 4NLGA 4Y2CA 1U2FA 3VRZA 1QVFP 2J5AA 2J8AA 4QVZA 2RQ4A 4DUZF 5LSLA 2RKIB 5GAOn 2OPRB 4L3KA 4F7UE 1JJ4A 2KFNA 2DFUA 3NGKA 1FD2A 1JQQA 3BW1A 3OFEA 2L41A 1VQPS 3CCRA 1XK8A 3WDOA 1RT7A 1H98A 1N6AA 2MJUA 3EDQB 5DM7Q 3KOAA 1UEBA 2D41A 3QT7A 5KT2A 4DV1F 1FJEB 5F9LA 3ISZA 2A1BA 2IC3B 4DQSA 1N32J 4WIIA 3DLHA 2DL7A 3HRSA 1EQMA 3OW2P 3MF5A 4N8OA 1M9SA 4OMQA 1VQPA 1UMJA 2RUSA 1Y10A 2QQ9A 4HA8A 3H59A 4PJLA 3M6VA 4IH7A 2BACA 2G13A 1SKRA 4CLPA 2M7SA 2HGNA 5GAMh 4TU8A 1XNQJ 1K76A 4C5HA 4OMPA 1UETA 2HQHA 1FWPA 5AXMA 2E9ZA 4Z2XA 1JJ2A 3UT1A 1IN0A 3C16A 5D6GA 2KU7A 5J1PA 2VJVA 1VA7A 4PWUA 5GAGI 5IWAJ 1X43A 2WSFE 4V2SA 1MN7A 1NBEB 3JB9I 1BE4A 1HQUB 5GANe 3QHSA 2MY7A 4DEZA 1R0AB 9ATCB 4B3MF 2OAWA 2JVOA 3QRPA 5DLFA 4GLMA 4H54A 2OPPA 2CUYA 1SKWA 2HQFA 5J1NA 3R5CA 1R43A 2VG7B 2RB6A 1V5IB 2VB6A 3C14B 1MG7A 4M7AG 4A8WA 2HCKA 4DL2A 1OJ4A 1WHMA 3CCJA 1WI6A 2CG4A 2DHXA 4F3QA 4B9VA 1NB7A 2MQQA 1PKUA 3J7YU 3G2XA 2ZPFB 4A53A 4N77A 1E6YB 4R8UA 1S6UA 5GAOr 1YBUA 1C6VX 1UKUA 4I6YA 3M6XA 3FEZA 2HSPA 3CC2Q 4FS1A 3R6NA 4M7AF 5DLGA 1AVZC 4X4SA 5FIIA 3EAEA 1RHMB 2OPQB 3PX0A 2QL9B 4IDKB 3RB4A 3TI0A 3CCSQ 1ZOTA 2NYIA 1WI7A 5KFMA 3FCHA 1CS4A 2Y9HA 2M2BA 4ZHRB 3EJMA 4PXDA 2JZ5A 5KG4A 3RW6A 1GEHA 1S9GA 1U5SA 2YY3A 2K1RA 1X60A 1YIJS 1N5YB 4JUZA 1VQ7Q 2DZ9A 1GMUA 2DD4A 1FDDA 3SQOP 5HO4A 2RNAA 3EGZA 2X7IA 5IFMA 2V2KA 1TG0A 2HAXA 3UA7A 1BB9A 3MM9B 3GFHA 3CD7A 4ZITA 2GQVA 2RMLA 1MLAA 3KK3A 1U26A 1YJNS 3NLCA 1AWJA 4JRKA 3LO3A 1HNXJ 3I55T 3A13A 5KT4A 3OTOJ 1QVFR 4IR1A 1BY9A 3B54A 3O3LA 2C2EA 2FVRA 4X34A 1T03A 5FLXE 5I21A 1CJKB 4I67A 2Z2MA 1U48A 5B0DA 2RQKA 3EVWA 2OD4A 3H0PA 2O4XB 4QOTA 4OJHA 1Q7YU 3RTVA 1OULA 4TU9A 1ULRA 1WJQA 4W98A 5GMKj 4MKYA 1C1AA 5FRMA 2W2NP 2JX2A 1WD6A 4YR2A 3CC7Q 2F1FA 2ZM6J 5M9OA 3D0IE 4YTLA 4UOCA 1FXDA 2D1CA 3N5BB 1WF1A 2CS7A 1XERA 3QSUA 3RUBL 5LMNJ 1YJUA 2B6AA 4HVZA 1M90R 1WZOA 4DPUA 2CIMA 2MQLA 5T7LA 2MJNA 2FIUA 4PABA 1Z1ZA 3OW2R 3A8MB 4CO4A 4DCOB 4JI2J 1FRKA 2VFVA 1RI0A 2W9BA 4O44A 4NMLA 1L3SA 1LW0A 2VBXA 3PNIA 4WK1A 1KN6A 4QW8A 1SJRA 4IO9Q 1NK4A 2SXLA 4XK8C 1VJQA 3CD6A 4PXEA 2R7UA 3X26B 1R77A 2DHGA 2D7SA 4DBHA 2K2MA 2VUBA 3IS9B 2CZ6B 2DBBA 1SBRA 4KKOB 4A8OA 5H9EJ 2ZWPA 4B9NA 3S3MA 3H4DA 2WCXA 3D66A 4RU9A 1IBMJ 1JXMA 1HYSA 2YKAA 4FPRA 2RU9A 1VQSA 3DI6A 1Y7XA 3QGHA 4YHHJ 1S6QA 1MNDA 5CKDA 3GB0A 1FD8A 2HVZA 1N0UA 2XSJB 1U8RA 4IKFA 2ROGA 5DGAA 2CUBA 2BXJA 2OTJS 4FYDA 2WSEC 2P0KA 1PJ5A 4ZP8A 4ZVTB 1VQNS 2MZQA 1S59A 3CW2C 1YJWS 4ANEA 3K0JA 1Q82T 1SJ3P 4QIVA 1IKWB 4EZ6A 1GT8A 3UDVA 4EWTA 2HFNA 4OYPA 2HL5C 5A6PA 2V9KA 2XIDA 1FDBA 1T9XA 1MWZA 2FC9A 2ZDOA 2ENMA 2K79A 3F0NA 3N28A 2W7AA 2VBYA 1YJWA 4PK4A 1OWXA 2DO4A 1BQNB 1L3TA 4NLWA 1MV0B 3M8QB 5IM0A 3TJ9A 3VVTA 1NKBA 1KC8R 1HHQA 2G2ZA 1YLXA 2FLOA 1O51A 1HYOA 2QSWA 1P92A 3M30B 3NNHA 2LJ1A 2YKPA 2G2OA 3K5NA 2AJ0A 2RH3A 3DB4A 1U2RA 3T5JA 2GQ2A 1X31C 3AQOA 2ILZA 4ZVSB 1AZEA 2RILA 4MMOA 4HEA9 1Q1KA 1UEUA 3CD5A 4OZNA 5DQHA 3ZNJ1 2DTIA 1T9WA 2AZ1A 1TQLA 1G83A 5FWBA 3DLLA 2O9SA 3DM2A 2XMJA 1Y5IB 4H4MB 1I1JA 5CH7B 2COYA 2V8DA 4I2QB 2F63A 4GVBA 4Q2MA 5D0EA 1UVIA 2EQMA 4HR2A 1G2BA 2KM8B 4KGKA 3CPFA 5KYNA 4OX6A 2RJDA 2WVBA 4RUHA 1UJ5A 2CP0A 1KQSA 2GX8A 1YJTA 2VPXB 1YCSB 3FGVA 1VMBA 2LCCA 4FCYA 2AF6A 5CKEA 2EJ9A 3I32A 2V8JA 3BGOP 1S9EB 2X3WD 3OS5A 2D3ZA 4ZVRB 2QV6A 5GAHI 1QMCA 5C5JA 3NGUA 4XTXA 2Q6BA 2K2VA 3Q2TC 1VQ5T 2M9UA 3ITHA 3WIVA 2HQEA 4I56A 4Y91A 5KE3A 1F9FA 2HS4A 1TWBA 4OMLA 5KFRA 3QIPB 4HTIA 4Z7CA 2H5EA 4LR8A 4NXMJ 2JLEA 1CEZA 1B0PA 1UEKA 3M53A 5GAN7 2W7PA 4E7KA 1RT5A 4ED7A 4OV1A 1QLNA 4QYRA 3C15A 3POTB 1JJCB 3PO5A 2RMOA 2CT4A 3BFMA 5CAIA 2DJZA 3L2RA 3DOLA 2E5HA 3EE3A 1N33J 1XTZA 1K9MU 1MHNA 1NJWA 2VL1A 2LX7A 2V4JB 1WG5A 4JV0A 3EPGA 5D3GA 2I1RA 4F0MA 5H1SV 3LWMA 4OJ1A 3MM7A 4KBIA 3UATA 3W2WB 5HCKA 3SQGB 1FRXA 1SB6A 2ZZMA 1OOTA 2DYBA 4ZVQB 2QEXQ 1NXIA 4DUTA 3LANA 5KFOA 1OY8A 1N5VA 2P4RA 2AYBA 2LXFA 1WHHA 4EMKA 4GO7X 4YB1P 3T1HJ 3NPFA 1FJGF 5ETVA 1HI0P 4YFUA 3RJMB 4M78D 3MI7X 1WHLA 5DS7A 2CPYA 2QYCA 2JEJA 1RAJA 2X35A 2EI5A 3IBCB 4JB8B 1UP1A 5F8IA 4DV7F 3BSAA 3TUZC 2QYZA 3SMZA 2VUGA 4DQRA 3TCJA 2EW9A 4K4VA 1LK5A 5CQGA 2BE2A 2B9EA 4J9OA 5GAMj 1U6FA 1AWOA 2F8MA 4DV0F 2R8GA 5L38A 4PJJA 2L3PA 2VDHA 3RU0A 3BSNA 4F7VA 4PEOA 3DRRA 1IQZA 2W4DA 4OL8A 4ED8A 1KRPA 1SG5A 3CJ4A 5T41A 1O75A 2XSFA 4ZLJA 2W25A 4BLGA 3FUYA 4LSNA 1G3OA 2FJWA 1KKHA 3JB9J 2D1XA 4B3OA 2QQSA 4QW9A 3OD2A 5IT4A 1QUPA 2CADA 4EMKC 3WIUA 5LJ5h 2CZVC 2HVDA 1RI9A 3C16B 3CQTA 3K2YA 3OXGA 2JVVA 4ICLA 3M55A 1CVJA 2QA4S 5KFYA 2DX1A 2BMBA 4Q8EA 4Y65A 2ZVSA 5CYMA 5HN0A 4PJOE 2CSIA 1RTIA 1WTFA 4LR9A 5EX3A 4Y28E 4R25A 3RB3A 1R8BA 5IS2A 4AG2C 2AZSA 2OTLQ 4F4AA 2OPPB 5F9NA 1JLBA 2EYYA 1WG1A 4E2FB 3OSSC 1VCTA 1XQIA 3PG9A 1DY3A 3ZEHA 4A8FA 4J9NA 3H5YA 3IWXA 4OYZA 4NLYA 3GF5A 5D0GA 4N76A 8ATCB 1SQFA 3L7OA 3MM5A 5CCMA 4WXOA 5LXYA 1NHKL 2D9PA 4R8UB 1X9WA 1BI0A 2ZNYA 3EYZA 4CQ1A 4QPXA 2QLFB 2HBRB 1FKPA 2P84A 1X4AA 3EVOA 3EGDB 2CPXA 2E1AA 1K9MC 3B8HA 2VQEJ 1HW8A 4MZTA 5KG3A 2BUDA 4U8YA 2DT9A 3J80U 4I4BA 1TAUA 1CS4B 1YZ6A 1R31A 3DLGA 1M1GA 3S3OA 3D6MB 4ED1A 1ZZFA 3BSOA 3MECA 4Z89A 2J6FA 1NJIU 1R6YA 2K1RB 4PLIA 1UE9A 2MZ1A 3TARA 2HBQB 3KHRA 2QE5A 4JI3F 3CEDA 3RRGA 4EMHA 3URGA 1PYOB 4KIAA 2QLJB 2HK3A 2XHWA 2FGCA 1UUEA 2A0FB 2WSCE 3MAAA 3L4BC 2KVIA 5ETRA 3KK3B 4K59A 1H92A 5LOQA 2EBGA 4LRCA 1RB0A 2DH9A 4A4KA 2E41A 2ZBQA 4TNOA 2DF6A 1YRUA 3EG0A 5DDPC 1U1SA 4JBCA 4NLVA 3B6BA 8AT1B 1T03B 2P0PA 1HXDA 3THVA 3D6FB 3CPWA 3LUYA 1ZSZC 5HY6A 2HIYA 3ENAA 2KY9A 3R97A 2UZAA 3OSPA 2F69A 1VQLS 1PRLC 1QWEA 3PJ9A 3VV2B 5L23A 2MQMA 2R2UA 2M70A 1VQ9T 2DPPB 1OX9A 1RCXB 2COWA 3A3NB 2BJ9A 4DDFA 2H4YB 4KY3A 4NOHA 4UOFA 3ZZRA 1WHWA 4DN9A 5HMWA 4ED3A 2BZYA 2B6AB 4MH8A 1R0BG 5J2PA 4YEAA 3HP9A 2W0ZA 1Z2ZA 4NLTA 5T7LB 1EETA 1Q8LA 3T3FA 5C42A 3G8QA 1M8MA 1FVSA 1HHTP 1OSCA 1RDRA 1VQKS 2W9BB 4O44B 2L5QA 1KQ2A 1LW0B 1XMQJ 2VOPA 4JI7F 4WIQA 2F4FA 4B6MA 4L5GA 3X20B 2W7OA 5L1JA 2EIFA 4GBQA 1SH2A 4B3TJ 5B0BA 1G4CA 2V4QA 4PCQA 5LSOA 1OI1A 1F60B 3TU4K 3QYHB 3PRBA 1HYSB 1HBOA 3M9QA 5F8HA 3DI6B 4KGVB 1S6QB 1L5UA 4F8RA 2QA4T 4A8YA 2GBQA 1G7CB 3Q24A 4LFBJ 1ABQA 1AA1B 3OHAA 1K4US 4YS2A 3O6QA 2K9GA 4FN5A 1S72T 3CC2S 4OV6A 3PE0A 4NI2A 1JMTA 3QG1A 3W1YC 4C8ZA 3TREA 4M7AD 2RHSB 3TSWA 4ZGEB 1KQKA 1O0PA 1ZBXA 1Q78A 4DL3A 1VC5A 3CCSS 2N3OA 2K3KA 3V7RA 2C2NA 4F67A 4TN2A 3MPYA 4LF9F 5LJ3d 1DTTA 3CJRA 3IR5B 3G6VA 4B9TA 2CJBA 4KGZB 4M75E 5GAOm 1YBAA 2CP7A 4NA1A 2MQOA 5A2QU 1Q86T 1EKRA 2CP3A 2QFJA 2AEMA 2KRNA 4GKJF 1VQ7S 1PO6A 4BACA 5IM0B 4RW7A 3KLFA 1RXOB 2KQWA 1JK9B 4XAXB 2DO0A 3GWCA 4FBUA 3E8OA 1N34J 5KT3A 1URNA 4V19X 3JV3A 3CMAT 2LQ8A 3H25A 1LFWA 1LWXA 3OBYA 3NAIA 4J6WA 3S3NA 5GAEI 1RWXB 2ALYB 4BY6C 2YWGA 1IWGA 3DC2A 3ISNC 1BIAA 2ZCFB 1YQHA 5CD4H 4RG8A 3QBYA 1PBUA 1AZSA 2HDAA 3W61A 4EDUA 1BC6A 1Q95G 5DM6Q 5H9FK 1WC5A 3BN7A 3DM2B 3WX4A 2JLGA 4GVBB 1AW0A 2V8GA 2M0GB 3B4DA 3FCVA 1QAJA 3CC7S 1ZAXA 3CJSA 1N9SA 3TJAA 1YFNA 2ESWA 3O1LA 2WBMA 3LWIA 2Z56B 3DB3A 3NGDA 3UFCX 5FRNA 1Q53A 1QVGS 3UR3C 3BO2A 3HFZB 3M54A 1WF2A 2EW3A 1EARA 1HKAA 1VQLT 3UWNA 3TSZA 6AT1B 2G0IA 2G1HA 4KQZA 4R55A 2YWKA 2EYQA 3I35A 4NWBA 1SHFA 4KH1B 2YNHA 2HEQA 2DHAA 3H5XA 4ZKAA 3MM6A 3ITHB 5KT6A 4OB3B 2HGMA 1X5PA 1ZBTA 2BJ1A 3CMQA 3GV7B 3EXYA 2X3DA 3P49B 2ZEJA 2YH1A 4H4KA 1S7HA 2RRBA 1ZYQA 3S7RA 2RN8A 1R0CB 4KPYA 2E9TA 1HW9A 1NMEB 1RT5B 2DIVA 1K73T 2ZHAA 3C15B 4JJBA 3QPIA 2LZ6B 3V6JA 1C1BA 4J83A 2YXYA 1NHUA 1BBZA 3EGUA 3DOLB 1BCOA 2EBPA 2BKPA 3BQ1A 1OEBA 3H5SA 3LW5E 2QLWA 5D3GB 3IR6B 3HULA 3MM7B 1J3TA 2K3IA 1X9MA 4B3SJ 3H2VE 2L89A 4EBEA 5KOWA 2K3XA 4KRWA 2ZH7A 4XU2A 2HSEB 1ZS6A 3C0CA 3HHLD 3B82A 4EMKB 1R6VA 2CG8A 4CLFA 2DHSA 2XWXA 2FHJD 4DL7A 2HEKA 4FW1A 5E3PA 1JNRB 2R58A 3R3TA 2APOA 5FD1A 3OYYA 2LFVA 2QASA 3X24B 4M78E 1Y7PA 2LMJA 3BKFA 2F5TX 4PPZA 3SHWA 3Q0AA 1VQ6Q 3JRZA 1V76A 1Q81T 2BE2B 2E9RX 3PNWC 2DNRA 1RE1B 1TL5A 2EC2A 1DQ9A 4EO8A 2FJXA 5LJ5j 2O66A 1IR1A 2RHXA 2CXEA 3DRRB 2VDIA 1PYSB 1TP7A 4RZRA 4JJNK 1RAEB 2P0QA 2K7AA 1FRIA 4RO0A 5KFAA 3TP2A 4C0BA 4LSNB 2FD2A 1LWFA 1H8KA 4B3OB 3IWLA 4ECTA 1M5HA 2QTVA 3NOGA 3LWHA 1OQ6A 3KK2A 3VUBA 2Y0BB 3N6MA 3CXCA 2B4UA 1KC8U 1RBOB 1FF2A 3D1QA 3JCMd 2WW8A 5GAN3 3IO1A 2CDRB 4D6WA 1UZHA 4OMMA 4ICLB 3GFXA 3CJQA 1YHQA 3C8YA 2DH7A 4ID5A 3QWUA 4F3OA 2DGWA 3VGSA 2CH4W 4QWAA 1FXXA 3FC9A 5CYMB 3J7A1 1PHTA 2NXCA 3H40A 1KOHA 2NSCA 3EPIA 1RTIB 4LD9K 2FYKA 2J9DA 1XJWB 4YQWA 2OSQA 1C0TA 3M8SA 3AA9A 3RERA 3WBZA 1JLBB 1NDLA 3X3UA 3EDRB 5ETQA 2W2OP 2O2OA 3HFOA 1JJHA 5HLFA 4QIWD 3BV8A 3GIKA 2X4WA 2DL5A 2RHZA 2LEAA 3Q83A 1UCNA 3DHXA 3M8PA 4DSFA 2P9GA 1M4ZA 1RI7A 3G4ST 3MM5B 3AB2B 1OYDA 3C6UA 1TK8A 4IFYA 4ER8A 2PA3A 1K0VA 2PE8A 2YRDA 3HT3A 4XTYA 1VLYA 5CD4A 5L1KA 2ROTA 1NDKA 2HHTA 4QT7A 4IH6A 3N0VA 7FDRA 2M8HA 1OSDA 3UCGA 4IRCA 2DNLA 1T3NA 4DV1J 2VFRA 1NK6A 5KFGA 3OL9A 4J9HA 3KKFA 1MSWD 4ERDA 1NKEA 1E7OA 2UUBF 3UD4P 3DLGB 5K20B 2AIRB 4DV2J 2YX4A 2QG9B 1REGX 1PKTA 1ZAVA 1RHUB 2QEXS 3MECB 2IVFB 4Y2AA 4JRIA 4RNNA 1QVPA 2EKOA 2DR6A 4MDXA 4GO5X 5BR8F 1YJRA 3EH1A 3NEKA 4EFAC 4HL9A 4F7UF 4N7TA 5L1IA 2PZ1A 3BGRA 2EVRA 3DU6A 3LYIA 1LOUA 3MAAB 1HNIA 3A8LB 1S1UA 1SC3B 4P52A 3GIBA 4YR3A 1QKXA 4X4UA 2HLUA 5BYRA 3OYAA 5EC7A 4NL5A 1GNKA 2F5KA 4B3MJ 4DR3F 2G2YA 1VQMA 3C6TA 5K9FA 2V67A 2LDYA 2WVCA 5CIUA 1N5ZA 4DR6F 2KN4A 2PMHA 3V81A 2AMCB 5DG9A 3GCXP 1NLOC 3RKWA 2Y8WA 4QZVB 4MMLA 4DV3J 1D1BA 3CCJT 1UVLA 2Y1JA 3MPVA 1IBKF 4PXBA 4J91A 1IM6A 1B0TA 4NLRA 4NA3A 5LMUF 4DR1F 3D0GE 2XG8A 4C8QA 1KC8C 2DD5A 2HRUA 4KE5A 5J2PB 1HNVA 5B0AA 5CYJA 1BI3A 1MN9A 3PTWA 5D78A 1XOVA 1Q7LB 3BY7A 1GMWA 3PJWA 1EETB 3FBFA 3G86A 5LJ3e 4LQ3A 3TRGA 4A4GA 5LJ5d 3W3SA 4JUVA 4PUOA 1S57A 2OTLS 2BOAA 1N54B 2BTTA 2MZRA 3EZ5A 4ZVOB 4DR5F 2QFIA 1RJJA 2EK6A 4ECXA 2GVDA 3AY0A 2AKLA 1IZ6A 2VASA 1HBOB 3QJJA 2BUNA 2LVMA 3EICA 2IRUA 4FT2A 2D3UA 1HWJA 4CM0A 2OTLA 3U1MA 3GIIA 3CCES 3BBFA 4CLUA 4C8QC 2LYVA 1YITA 4C0GA 1ZUYA 2HRYA 5E3RA 1NDPA 3KLEB 5HATA 1UW9A 5DJBA 2IDLA 4AFQC 1PWTA 2L3QA 4KO0A 3VUZA 2DRKA 4DWIA 4LDYA 4NI2B 2VKZG 3G8SA 4M5DA 2JS2A 4X4RA 1TUGB 3VTIA 4J6XA 3W63A 4NZ7A 5SZTA 3VZIA 1Q8KA 1GTEA 1YK9A 4M7AE 2E1HA 2JXBA 5ETOA 3S6EA 4RNHA 1JLCA 3OL7A 1TK5A 3UN3A 4IUUA 5GANh 4KC5A 1VC0A 1X0FA 3RR8A 1DTTB 4DR2F 1YRTA 2LRQA 3DGVA 4MAKA 4F16A 1NK0A 3J7YI 3BGFA 4F4ZA 2Y1IA 2R7OA 3VS2A 3R7SB 4LF7J 3R8YA 3ADAC 4RW7B 3KLFB 1FWKA 4DF8A 3C12A 5GAN4 2ZNZA 4I0WA 3O8WA 5G0RA 3LP2A 2UUAF 4FF2A 3ZTQA 4RX6A 2ASLA 2R42A 3QYYA 4AL6A 1H3ZA 1R8CA 3CD6T 3I5SA 4DL4A 5L39A 4DV4F 5M2UA 3S6WA 2P5VA 2DISA 4ANCA 1YCYA 2YLBA 1JJ2P 1AZSB 3TA1A 3DHWC 2E64A 4KT0E 2Z4PA 2LCSA 2KB2A 2ZD1A 3IM8A 2JW4A 3TA0A 1FFGB 2ZUGA 2X1BA 3U1NA 2DK2A 4ZCMA 3VWSA 3KHLA 4KH0B 1YBTA 4ES2A 3MMJA 3QWPA 1MU2A 2WHOA 2MMYA 4K5SA 3KK1A 3VRYA 1WGSA 2MAMA 4MZMA 2HHQA 4PKDB 4RTZA 2V63A 4M5JA 1SJ1A 4UOGA 4ME7A 4J9VA 4ATOA 3AODA 5GMDA 1F2HA 1HR0J 3RBEA 3M1VA 1I3OB 1HLWA 4RBTA 1T9YA 2FEIA 3AB4B 3EG3A 1N48A 1DJ7B 3GLJA 3HZEA 4ID8A 1I07A 4NLSA 5C2GA 4WKRA 2CZ1B 2C22A 1DRZA 4QR1A 4BDZA 4Y2KA 3GG0A 4OLPA 3QAUA 1E6VA 2YNHB 3MAHA 5J2QA 3MM6B 1UDLA 2FHMA 4ZPDA 4IUVA 2FYXA 5GAMf 3P4UB 4LF6F 1Q81R 2WONA 3TO8A 3M0UA 3NOCA 2KRSA 2MY8A 2YH0A 3M4XA 1PSDA 3Q8SB 2AKKA 3HKWA 4MK9A 2K7JA 1VRQC 1N27A 3CC4Q 5IV4A 1IJEB 1OQ3A 2I6WA 1WHYA 4MYUA 1UVMA 1I5OB 3D6HB 1K1QA 1C1BB 3QBCA 4DFJA 3PIOQ 1UFKA 3VKIA 1RT1A 3JSYA 1UTIA 4C98A 2E12A 3AQPA 2V68A 2BJDA 4Q5VA 2WOMA 3TUPA 2KHDA 2AX1A 4YN3B 4CLYA 4MTPA 4BD3A 2CQ2A 2BYCA 5HBMA 2DPJA 3MMBA 2YDLA 3U1LA 2DRDA 3BH7B 3JCMe 3CCET 3SCLE 3CJ0A 1YWOA 3NY0A 4L3NA 2GTOA 2DRMA 1WOSA 2AJ1A 2ASYA 4JI1F 4BDYA 3F73A 1Y57A 2HMIA 5A0LA 1U02A 5KFCA 1IBLF 1T05A 3VS6A 1RTDA 2VBWA 4YB6A 3JCMW 2BE9B 4DS5A 4HXJA 2J9EA 1O5JA 4AMCA 4DOVA 3CJ8A 3R27A 3M7VA 4BDPA 4USKA 3CCMT 3MD1A 1GXIE 1ZTTA 3MEEA 5AE2A 2CQPA 4KHMA 3FMBA 2XMMA 5GAOq 1XEZA 1IJFB 5CVIA 2QTWA 3GJTB 1KTVA 1UECA 1DQ8A 2XCPA 5I3PA 1RP5A 5E41A 4IURA 3HKZD 1VIEA 1IKXA 4Q0BA 2LXIA 3IR7B 3SIPB 1S0NA 4A4EA 2LQJA 3A8JA 1YJVA 1NZ8A 3KUHA 1LWFB 1XR6A 2EGAA 2DEJA 5AE1A 2YKMA 5KFXA 3KK2B 2J7UA 4JI4F 1HQ2A 3R5GA 1DFDA 1FI4A 2R5AA 4PXCA 5J3BA 2DL3A 2K5FA 3MDFA 3RAXA 4ZS6A 4ID5B 1FHTA 2B4VA 1JJ2R 4X4NA 2FTRA 2RIJA 2EFNA 1CC7A 1NG2A 5CZVA 4OX9F 2HQIA 2CDTA 2LA4A 2ED0A 1C0TB 2V0NA 4K11A 2OP5A 1TKDA 5IT9Y 3HRTA 1GRIA 2CKKA 4RG2A 2PTKA 4Z37A 5HLFB 2AJFE 3Q2SC 1KLMA 3LQVA 1UJ4A 3SFGA 1ZQ1A 2ZHOA 3RMQA 4NLDA 2QA2A 3C3LA 1FJGJ 3OJUA 4JLIA 2DKOB 4NASA 2XI3A 3UD3P 5IC6B 4ZVEA 5KFBA 2FB7A 1VK3A 5KG6A 1YP5A 3Q8UA 3C6UB 4ZN1A 3J81Y 4IFYB 1AT1B 3CVKA 3AA8A 4UC4A 1NYFA 4DV7J 4ZCIA 2NZ4A 2G6FX 4DZ6A 1WPYA 3DOKA 2RH2A 3UA6A 1IXDA 1FNOA 5C2CA 2GCFA 5DRKA 1NZ9A 2ZJRQ 3DYAA 1S97A 1UWAA 4ZPWR 4DV0J 1RHJB 1FXLA 1P8GA 2YX1A 3SFMA 1B34A 4RBUA 2B51A 2QN6B 3QYGB 1WTBA 2CYZB 3CGIA 2UVRA 4MDWA 2EG2A 2K06A 4KULA 3R6GB 3LGHA 3HI9A 3MR5A 2H4WB 2RI2A 2CJQA 2ZZDA 1JXOA 2R8HA 3I55Q 3TA2A 4NS5A 5CR2A 1U1NA 1EJ7L 5EHHA 2IDEA 3UNGC 3IP0A 4C8QG 4Q5WA 2B8QA 1LJOA 2QK0A 2CNOB 5GMKa 3BYRA 1K9MT 1W2BS 3T1YF 4ZGJB 1NEBA 1XMOF 3BGRB 4XTTA 2VGNA 3M0PA 1GCQA 3ENWA 2A3LA 1KQ1A 2MDAA 2MKYA 4NLQA 1HNIB 1RT6A 1S1UB 1NCLA 1SJQA 4ECZA 2RT3A 2VZ9A 4IG3A 3J7ZT 1LWEA 3IQLA 3QNWB 4X64F 1O6XA 2HZYA 3C6TB 3A3OB 2NUUG 2VBZA 3H7HB 4CLLA 2DYAA 3CJ2A 1YDLA 3V81B 1WXTA 1KQSP 1PSFA 3NNCA 2LEPA 1WELA 1T95A 2CKWA 1TMMA 2AJ4A 2V34A 4DSEA 2JN0A 1VQ6A 1OO0B 1RUSA 2AK5A 4RW8A 2DMOA 4C6AA 4L72B 2DGSA 4NOYA 4WFZA 4MK8A 1ROFA 4FYVB 2KK4A 4C8QB 3HSGA 1M5Q1 4Z02A 1HHSA 4M5LA 1HNVB 4URGA 3EH2A 4KGMA 1IB8A 2MQNA 3JS9A 1QJHA 1TV6A 4RKUE 2RI3A 2DXCA 1APSA 3DXSX 1HD1A 2DGTA 1GCQC 1JB0E 1D9DA 3GMGA 3FQKA 2Y1RI 4O4GA 4PUOB 4ZIWA 1RAIB 4ELVA 3D54A 2WSFC 5E2QA 5H9EK 1C0UB 4DFKA 1KEKA 3FK4A 4CIOA 3TX8A 4OZJA 4NYOA 1K0SA 3TUJC 1SPBP 4KYZA 1A9NB 5ETPA 5C25A 2FGOA 2OD6A 1C1CA 3UPFA 2XY5A 2J7KA 2GFFA 1B3TA 1NRKA 4JI3J 2R8IA 5GMKe 3U23A 1JRIA 1LW2A 3DDNA 4MIWA 1RWUA 3QATA 3DNCA 2DRAA 2DXTA 3THKA 2HKQB 3VAKA 2HRTA 1S0VA 1WDXA 4FPIA 2KRBA 5GANj 5KFUA 3OVBA 2KVQE 4USHA 5IQ6A 1HIYA 1UWBA 4KO0B 1A0NB 2RAQA 5L9XA 2HNYA 4M5DB 2LT4A 2FVQA 1RLPC 2AX0A 1MMDA 2FUG9 3THTA 2M52A 2CPIA 2R8KA 3NGTA 1WC1A 4YY3J 2GMLA 4ZK7M 4CLZA 3DRYA 1JLCB 2JFKA 5HMYA 1FTCA 3HFVA 2R7VA 3CULA 4M77C 3PIPQ 3M5AA 4UTGA 4RTYA 4NRUA 4ETZA 2ZC3A 4CI0C 1ELOA 3OYLA 3WVDB 3H9NA 1VHIA 2HURA 3R7BB 4X84A 4CT8A 3FDRA 2H5IB 2E5IA 3Q1JA 4RTXA 3ETMA 4XK8E 1K0XA 2YLCA 5D6WA 2RKIA 3IBFB 1SC4B 5G0RB 3LP2B 3ZO7A 4OJ3A 2CJKA 3KLVA 1N4LA 3W9IA 4USUA 1S4FA 1D9FA 3VS5A 1Q16B 4DLGA 2X1FA 4LF1A 3C95A 2NREA 4JI7J 4U7UK 4FNHA 2GZOA 3BQ2A 2XDDA 1OQKA 4J9BA 1NJIT 2HS3A 3CCQA 1LCKA 1V1CA 2DPIA 4FZVA 2VG5A 2QC3A 2R7TA 4DV5F 1WC3A 2KFZA 3RR6A 2MCNA 2OAUA 3QFWA 2WSEE 2GO8A 4KHRA 2Z58B 2F9JA 1Y0MA 3K89A 4IRDA 4AQYF 4BE1A 2IM2A 3S8SA 4NA2A 5IC4B 2BKNA 2B9WA 4M95A 1QAXA 1VQ5Q 2YNFA 1MU2B 3ZFVA 3KK1B 4WJBA 2DR8A 4NLPA 1RHQB 3KMQA 1TOVA 4O3NA 2HWIA 1N36F 3GPAA 4AT1B 3BREA 1FEHA 2X4JA 3UI3A 3M1VB 1KQSR 1BD6A 3MM8A 4OMFG 2Z0GA 4KSEB 4URSA 2DBMA 2DNHA 3KNGA 2JMCA 3G82A 2QA1A 1E6VB 2FRWA 2YXLA 1C4CA 5J2QB 3HCXA 2CQCA 3ZZZA 3CCWA 3TNVA 3HMJG 2AGQA 4NZ0A 2VC8A 5K8NA 1GQEA 2LXUA 1HD3A 2DGVA 2F2XA 2WONB 1RKIA 1UA1A 1X9SA 4C7QA 4GKJJ 4XPEA 5LJ5f 3R2DJ 4HVVA 1IKVB 1C2PA 3HZGA 3OBIA 2QTXA 1DZ5A 3ISND 5KYXA 1M5SA 2DGQA 3OXLA 1RU2A 4AXJA 4C8KA 3N01A 1WHXA 1HNZJ 3H2UB 1RT1B 1E6YA 5C7PA 1JXVA 3OW2S 5BJRA 4OMFB 1AZGB 4HKQA 5KYUA 3UR0A 3BSCA 3HT0A 3EFRA 2BR0A 2XYGB 4O3PA 2WOMB 4QWDA 3HL8A 2ACYA 3BJYA 2B56A 4NLOA 4CTAA 1G3WA 3R5BA 2RQTA 3GTYX 2LU2A 2CQIA 1X4DA 5HBMB 3MMBB 3LH0A 4M63A 4J7IA 2O67A 3ILOA 4MT1A 1ZPVA 2LQ9A 3SFUA 2ZGWA 2BM1A 1OV3A 2K7KA 3PT9A 5GANd 1WKLA 5C0MA 2DNYA 2HMIB 4ENOA 4I64A 4U95A 1AEYA 3KXTA 4CO3A 1T05B 3G6YA 3F56A 2JM8A 1RTDB 2KMTA 4USVA 3CPWP 4DXLA 4PPDA 1HJDA 3UVJA 3I82A 1DURA 5HVFA 1L3UA 2IIHA 3VU3C 4DZDA 4CZCA 1WKKA 5B0FA 4F36A 3MEEB 1CJTA 1H38A 2RHUA 3CMEA 2V1QA 5GADU 2WACA 2JDJA 1BWEA 2J6KA 2DITA 4Y34A 2MLYA 4FKYA 4C0OC 3META 3HVTA 3R5JB 2YKNA 4X9CA 2X51A 3KDNA 5GAOp 3GV8B 1H72C 4XTZA 1R8OB 2K57A 4J9KA 2FLLA 2KG0A 2H3EB 1IKXB 1GXUA 1FWLA 4Q0BB 5ADZA 3HP6A 5HK3A 1HFEL 4N4IA 2XDBA 2KR3A 3OBWA 3CCVT 4H4OA 2UVWA 2YBVA 3K5MA 5JUMA 1HNWF 2YKMB 1X4GA 2DNGA 2IBKA 3H0FA 3VCDA 2UP1A 1KHCA 2KGTA 4E7LA 3G87A 5F3ZA 4YDDB 3LOUA 4IR9A 2XO6A 4ELTA 1RGVA 3QUIA 3FRNA 5I11A 1PSEA 3BPDA 3NRBA 2GMHA 3H8YA 4G1IA 3M6UA 2JMAA 1BCMA 3M0TA 1S10A 1H2VZ 4D3GA 2ECZA 2V4RA 1K9MR 4W4MA 3SCJE 3ZC4A 3C66A 2MKIA 3SZ2A 1YJ9A 2BJ8A 2WK4A 2G0JA 1TAQA 2V8HA 3C46A 2WZ1A 2M3DA 4ZP6A 1KLMB 1KTQA 2GHWA 4N0AA 5KG0A 3HVRA 1NE8A 3EG9A 2LP5A 2K2PA 2FG0A 2GJFA 4G65A 2HFZA 4HKEA 3RGIA 4XO0A 1KSWA 2GGPA 1Y96A 2NWMA 2FZGB 2KZZA 1FX7A 4FU6A 1U1PA 2KYXA 3DOKB 2YPZA 2FPDA 2DTHA 3L7UA 2B8AA 4IIOA 3DYAB 3VR1A 2D9OA 1S9FA 4JZ3A 1CPZA 3OTDA 2ZBPA 3GILA 4OX7A 3CC4A 1B34B 2W8LA 2UUWA 2M0YA 2VC0A 1EZZB 3HSZA 3KLHA 4UUXA 3TJ8A 3PIOA 2M9KA 1WC4A 4EBDA 1M5VC 1Q81U 1XNRF 3W60A 4MMKA 1WXBA 4ILRA 2O3DA 2QJ3A 4N0AC 3JTPA 2XI9A 1PC5A 3NBPA 1TUWA 1DQAA 3PW2A 1EFNA 1YHQT 1IO6A 4WU2A 1I94J 1W1FA 4ZVHA 4MZPA 2RDDA 4JI6F 4B9LA 1RT6B 1VQ9Q 1MROA 1REVB 2G9OA 4ZIVA 1BK2A 1RA7A 8RUCA 4EZ9A 3NTHA 4IG3B 3BH6B 4GRSA 4DR4F 1LWEB 3BO3A 3GYGA 3OLAA 1KBRA 3L2UA 3GSIA 4KR0B 2I5JB 2QMXA 5C24A 3CIMA 2QL5B 4PJOA 5GAN8 5AT1B 3N6NA 1YWPA 2JWNA 4X4TA 3CBPA 3FSIA 1CKBA 3HF5A 2HGLA 4RW8B 3MZIA 3PV8A 4CLKA 3QMQA 2W1BA 2J06A 3MWBA 3CPWR 2J6OA 4PQUA 5HL7Q 3A4TA 1RT4A 2GIQA 4Q43A 1UFFA 2PVGB 4A54A 1YI2A 2V50A 3UD5A 4OHYA 4M77F 2MEWA 2E70A 5DM7R 3VQSA 4IOCQ 2WB4A 4I2PA 1SH3A 4RPFA 1VQ8A 5KG1A 1TV6B 1NU4A 2PUOB 3EG1A 1Y5NB 1HQEA 3WVEB 1N6QA 4PG7A 3CD0A 2ZJQQ 1KQGB 2SEMA 3LTOA 5G4DA 3QXEB 1OPKA 4O4GB 2F7VA 2UUBJ 2QA4Q 2RS2A 3CCUA 2CQHA 3RZAA 4DX8H 2E5JA 5GAMg 1JLFA 3VGVA 2H5JB 5E3CA 5E5NA 2DNKA 4DPOA 2MKKA 3HKSA 4OYOA 2CNLB 4PJOC 5C25B 4OZ2A 4TY8A 3RIRA 4DLEA 4QIFA 1C1CB 1KC8T 1VQOT 1QAIA 1HA1A 2XS7A 4PNOA 2FLPA 4PLLA 1LW2B 3HDSA 5CCAA 3CSKA 3CF5Q 4WTYA 2GC8A 4JZ4A 2ZE2A 1RAGB 3MFHA 2XGPA 3SYZA 1WNLA 2YRVA 4ED5A 3DLBA 2GIRA 5K5MA 3Q8PB 3G71S 2KRRA 3PJXA 2E66A 3K58A 1UWBB 3JTOA 2BIVA 2X9HA 3SXLA 1E6GA 4QWCA 3H0IA 2YWWA 4VUBA 2HNYB 1VQMT 2I9SA 1VRTA 4PG6A 3JQMA 4JDSA 2NYSA 4DOZA 2LP4A 2XNRA 1PYTA 5EWFA 2W24A 2Y8YA 1X5SA 1X6BA 2ZZTA 2KYZA 2OLWA 1GBQA 1KVKA 3CMAQ 3VYGA 4FM4B 4N41A 1DTQA 3OL8A 4WZMA 1IBKJ 4DEYA 2L08A 3HD2A 1UPPA 2HMAA 3I9ZA 3I55S 3L3CA 2C0OA 3CNQP 3NTIA 4AFSC 1FESA 5HANA 2NLUA 4LMZA 1S79A 4TLQA 3FDSA 4NPOA 3RRKA 1FFWB 2GHVC 3OYJA 3W65A 3CB4A 1VDHA 1C0MA 3TWZA 4N56A 3W7BA 1OMSA 3VYHB 5HJYA 2EQKA 2FZCB 3HHKA 3OTOF 4DQPA 4RJVA 4J9RA 3OYIA 3K17A 3MR2A 2W9CA 1R8HA 1RWNB 2XG8D 4C8QD 3MHYA 1ZM2A 3KJNB 4TQSA 3CXCP 2VG5B 2CP2A 2HQGA 3BF4A 2AD9A 5B7WA 4QU7A 5IHKA 4LSLA 3CDUA 2DL4A 1JEGA 2C0TA 2B9YA 2RJFA 5GAN2 2ZM6F 3MHXA 4D8KA 2IYIA 3TUIC 2DGOA 4QVCA 1VQLQ 2R7SA 5HK0A 3KLGA 1IUJA 1HBNA 5F8JA 1YWXA 2ADCA 1YITT 1UJ6A 2RU3A 3PVQA 3NTKA 3QJ6A 3G1JA 3J80E 2YNFB 4LUEA 2F8EX 4U9RA 1WACA 4KHPJ 2LDMA 2YTCA 2WVDA 1TTHB 1X69A 2VXEA 5CA5A 3P8BB 2KXFA 1D0YA 1QAYA 4HT5A 3MM8B 3O5ZA 5CXTA 2DR7A 5IOLA 3IN5A 1B7TA 2AYMA 4QPTA 3QWXX 1KP6A 2I2LA 1S5ZA 1VQKQ 2QL7B 5IN1A 4OI4A 3G82B 2X3GA 1Q0NA 1D3BA 4DR2J 2E5GA 4ELUA 2DL8A 5KYYA 3I56S 3Q86A 1AFJA 1NLPC 1VGYA 2LMIA 2RVJA 3FC3A 4EUVA 4FYYB 3CDBA 3MEKA 4OLOA 3LP0A 4BS2A 1LWCA 1LNXA 4J9GA 2IA0A 2CVEA 3INZA 3E51A 4OGCA 4M75A 4J5OA 5KFEA 5KYXB 4UT4A 3MPDA 4ZTFA 3HSDA 3NCPA 2UUAJ 4L73A 2Z8QA 1O8BA 3JXOA 2GAHC 3IAS9 2DY1A 2EPDA 3QJLA 2FHOB 2JM9A 2W01A 4Z8AA 1GCPA 5KYUB 1WORA 2GJIA 1SL2A 4DV4J 2CJYB 2C2ZB 5LJ3h 1U1OA 3EGDA 2BJ7A 2CJAA 2IBOA 2CYYA 4CTAB 3TX0A 3BPSP 2DEIA 2LNHB 1FCAA 3L1AA 3JTNA 2DA9A 4JI8F 2B3TB 1M2OA 1SI9A 4C4WA 2HK2A 2XDPA 2ERRA 1LNQA 2W10A 4BE0A 5KFNA 3G71T 2WBRA 4HT8A 4KGXB 5D4LA 4ZJLA 1WDTA 4LRFA 1NPKA 4USWA 2P4TA 4M75C 2GQQA 3JCMV 3DOMA 3TZZA 1BGXT 1W2IA 1SJFA 3DLJA 5HJXA 1A0OB 3PIPA 2EWNA 2GV1A 2OI2A 4PG5A 3GU0A 4A8SA 1IR2A 4P2MA 3UVJB 1N5SA 3QDFA 1VR6A 1KD1U 3NWRA 2XKOC 1YVFA 4ZP7A 2OUGA 3VS3A 2OMLA 4IFVA 4M7DA 2DERA 2XZTB 1CJTB 5L9NA 4EYIB 3OVAA 2XEXA 3G6ET 4DBFA 1IBCB 3BQ0A 1YIJA 2Z2YB 3HVTB 2YKNB 4E7IA 2XICA 1U8SA 2X1AA 4UZCA 2OEKA 5GVQA 5KYWA 1VHFA 4OZ0A 3HVWA 2EKHA 4BB7A 1M27C 1Y0HA 1UPMB 1MGQA 1ZTWA 5B0EA 1RSCA 3LX7A 4J9SA 4H4OB 5BXIA 3OYDA 4RW9A 4OF1A 3K5PA 2HHXA 1YJNA