4J5YA

Crystal structure of hfq from pseudomonas aeruginosa in complex with atp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Protein hfq
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 14
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4j5yA00
4M7DD 4NL2A 3RKWA 5LJ5j 2E1HA 4EMGA 3JCMb 1I5LA 2DKGA 2YHTA 5LJ5d 3SWNC 5GAN7 4M7AF 1MGQA 5GAN4 2K57A 5LJ5g 5GMKm 1YCYA 3QSUA 4C92E 2DZCA 5LJ3j 4M7AA 4PJOF 5GMKl 2RM4A 4M75F 3V8JA 4M7DF 5LJ3g 2VXFA 2DJZA 1LOJA 4M7AG 4Y91A 4M7AB 1Y96A 2QTXA 1HXDA 3FJPA 4XTUA 4PJOA 2DTOA 2FYKA 5CAIA 4M7DA 4OP0A 4C8QC 3AHUA 3INZA 5GAMh 4WF2A 4M77C 1Y96B 4PJOG 5GANh 4PJOB 4PNOA 2VXEA 3BDUA 4M75G 4M75B 5LJ5f 3HFNA 5LJ5e 4M7DG 4C92D 4M7DB 5GMKe 2YLCA 1H641 3JB9D 3RKYA 4M78D 4JRIA 2CGHA 3JCMV 5GAN6 5LJ3f 5LJ3e 3JCMQ 4XTWA 4F7UE 5GMKj 4V2SA 2EAYA 2JN0A 4XU1A 3EFRA 4EMKB 4A53A 3JCMh 3JB9J 4X9DA 4C92F 3V8LA 4F7UA 2VC8A 1I8FA 5GAN5 3JB9F 2E64A 4M7AC 4M78F 3EFSA 3RUXA 2DXTA 5GAOr 4M78E 4C92A 5GAMd 4MMLA 4RCCA 5GANd 4M78A 4PJOC 5GAMg 3JB9H 2RB6A 1JRIA 2EJFA 4M75C 4C92G 5GANg 1U1TA 4C92B 1KQ1A 2EJGA 3JCMW 3V8KA 4M7DC 3JB9G 4JRKA 4A54A 1LNXA 2RA2A 3L2ZA 3M4GA 4JLIA 3FB9A 2E65A 4RCBA 4J6YA 4XU2A 5GAN2 3JCMc 3L1AA 4N0AC 3RESA 1U1SA 2DVEA 4EMKC 3VU3C 1KQ2A 3JCMd 4XTZA 4HT9A 5GAOp 2I2LA 4F7UF 5GMKi 3GIBA 3JCMg 1B34A 3HSBA 4XTXA 1N9SA 2EWNA 1WQ7A 5GAMe 5GAMf 4QVCA 5GAOm 4XTVA 3JCMP 1JBMA 5GANe 5GANf 4HA8A 1LJOA 2DXUA 4C8QE 1B34B 2YLBA 3BW1A 4M77E 5LJ3h 4J6XA 4DQ2A 1WPYA 3BY7A 5GAMj 4F7UG 4XU0A 1BIAA 4C92C 4F7UB 5GANj 2RD1A 1N9RA 2HNIA 4M77A 5GAOq 4HT8A 2EJ9A 4MMKA 4J6WA 4X9CA 3RKXA 2E10A 3RERA 3JCMf 3JCMe 3FIFA 3QO3A 4M78G 4M78B 1D3BA 2DTIA 1I4K1 4C8QD 3RIRA 4NL3A 4M77D 3SWNA 1TH7A 5GAOn 4M7AE 3PGGA 4XQ3A 1D3BB 3SB2A 5GAN8 4NOYA 3QUIA 1WNLA 1WQWA 3SWNB 3V7CA 5LJ5h 5DY9A 1M8VA 5GMKh 4J5YA 5LJ3d 3V7SA 4PJOE 2ZGWA 4M75E 5GAN3 2DEQA 4M7DE 4C8QF 1BIBA 1M5Q1 2E41A 5I21A 4QVDA 4M77F 3JCMX 1HK9A 2DTHA 5GAOl 2DZ9A 4M75A 4JUVA 3JB9I 2Y90A 3JCMJ 3QHSA 1X01A 4C8QA 4M7AD 3V7RA 1I81A 3BFMA 4M78C 3HFOA 4XTYA 4EMHA 4C8QG 2FB7A 4XU3A 4C8QB 4N0AA 4M77G 4M77B 4EMKA 4PJOD 4M75D
chains in the Genus database with same CATH superfamily
1I5LA 5CQYA 2BTTA 5GAN4 1T3SA 5LJ5g 4M4ZA 1YCYA 2ROLA 3OYYA 1KC8R 3BE3A 2RH2A 2VXFA 3WVEB 4JJBA 1OX8A 4E7HA 1UG1A 3LH5A 2KR3A 3BDUA 4PNOA 2OJ2A 2YUOA 5LJ5e 2F1LA 1H641 5GJWB 5J26A 4JRIA 2EYQA 3CCMT 2F5TX 2J6KA 4EMKB 3I35A 2FRWA 2DAQA 3OS5A 4Z02A 1FMWA 2HBWA 4FW1A 3TQ7P 1VQ4T 2FZGB 3HPWA 2YRVA 3CCEA 1IGQA 3VS2A 5KYWB 4RTZA 3M0QA 4BE2A 1KQ1A 4PLIA 3R6NA 2YUQA 3OSSC 5J39A 4JLIA 2KBTA 1O9SA 1KQSA 1NJIR 3FRNA 4N0AC 3RESA 3TREA 1ZBXA 4RTUA 3TU4K 2CP6A 2LX7A 1TS9A 2KEAA 3FDRA 1NLPC 5CIUA 3VS7A 3EG0A 1W6XA 1GRIA 2E4HA 2HBPA 5IXFA 4AFQC 4FYVB 4M77A 1TSFA 3LLRA 4J9FA 2COWA 1YITT 4B9XA 1VQOT 4JPBW 4R55A 4AG1C 1XTDA 1IREB 3SWNA 1VQKA 3RBBB 1N6AA 2QQRA 2FPDA 2HQEA 1ZUYA 2CS7A 2O01E 3PT9A 4KRTA 3SD4A 3A1PA 3JCMX 3Q1JA 1NG2A 2PQWA 2YT6A 1X01A 1PD0A 5FWBA 2DL4A 2LP5A 1I81A 1K8AR 1YJ9T 2H3EB 3A8OB 2CT3A 4FYWB 3A8MB 3RR6A 5D6XA 2EGEA 2NUPB 2DZCA 3VYGA 3CCUA 3A5ZB 4Y91A 1E6HA 3FJPA 4XTUA 2J06A 5FLXE 4LE9A 2CP3A 3OMGA 4QQDA 3MP8A 3HFNA 1SRMA 3OYJA 2CZ0B 1W70A 3OW2P 1ZSZB 1QKXA 1X27A 2DL3A 2VKNA 3C0CA 1NEGA 3JB9J 4IIMA 1BI0A 3CCST 3EH2A 1IB8A 3JB9F 4J8OA 2HQXA 3RUXA 1D1BA 1YIJQ 4AMCA 4GLKA 3G71Q 3F70A 1G3SA 5KYUA 5GAMg 2CP0A 1M1KC 1HD3A 1H3HA 2JT4A 4NS5A 3G6EQ 1U5SA 1JXMA 2O31A 5A0GA 3M0RA 3H0FA 4PJLA 3L1AA 2KYBA 4F04B 2DVEA 3DKMA 3LWIA 3FEOA 2KT8A 2HD0A 3E1SA 2QGGA 4QQGA 1QCFA 1PKSA 1R8OB 1C1AA 5GAMe 3OYBA 2FG0A 2GCXA 1ZLMA 2EGAA 4K11A 1WHGA 4M77E 3T9NA 2KRSA 2AZVA 5KYXA 5GANj 2Z0WA 2RHYA 4OMFB 3QDRB 5FU6B 3CMET 1G8XA 4LUDA 3QO3A 1WJQA 2DTIA 4CI0C 2V26A 5KYNA 3X26B 5HCKA 4D8KA 1HSQA 1YHQT 3L2QA 1VQLQ 4ZGJB 3EG9A 2JJ9A 3V7CA 3SWNB 2C0IA 3CCQT 2IIMA 2XDPA 2JOYA 4AT1B 1S72Q 5GAOl 3LYIA 1OEBA 3BFMA 1V1CA 4C8QG 5KCOA 2OI3A 2DRMA 1YWPA 1Q7YC 3X28B 3OYMA 2OTLA 4GY5A 3CCVQ 1WJSA 4A4EA 1YI2T 2DD5A 3VRYA 1M2VB 1AT1B 3QPHA 4C0FA 2K3YA 4OMNA 4M7AG 1TTHB 4N4IA 1QCNA 3AHUA 3PVQA 3I55T 3EG2A 3CBPA 2LVMA 2L3QA 1NZ9A 1IHWA 3GBQA 1R77A 3GLXA 2CGHA 3CC4Q 5LJ3f 4V2SA 3OY9A 2RHZA 4X9DA 3ZEHA 2RO0A 4IUTA 1U8RA 5GAN5 2VGNA 3MPUB 4LDXA 3LGFA 4ANJA 2LJ0A 4PJOC 4OB3B 4DOWA 4C92G 1WI7A 4CC4B 2R58A 5FU7C 2K4YA 3OBWA 3L2ZA 1X6OA 3CMAA 1LPLA 3RMQA 2I2LA 4F7UF 3GIBA 3HSBA 1N9SA 1W2BS 1K1ZA 1JB0E 2JUFA 3NTHA 4J6XA 1UFFA 2M0OA 4XU0A 1BIAA 3ULRB 1G83A 2EJ9A 1OULA 2DETA 4FT4A 5KYXB 2YUNA 3CC7T 3A8LB 4J7IA 4HCCA 1SHFA 2EKHA 3CCLA 2YXYA 3M55A 1ZA2B 1WNLA 1TXQA 1KD1U 3CD6A 1UJ0A 2DYBA 3MHXA 2QI2A 4C8QA 1M1FA 1H92A 3EGDA 1QWEA 1UEBA 1Z9QA 4OMQA 2KK4A 2LCCA 3OS1A 3NTIA 4PJOD 5EG2A 2ECZA 2GBQA 2LT1A 2NUZA 5LJ5j 3OYFA 1RI9A 1YNZA 4HVVA 1VQ8A 1M4ZA 4ZN1A 1KHIA 1W2BA 4M7AA 4M75F 3PMIA 2CUBA 4DBHA 1KC8C 1QW1A 2DJZA 2W10A 2DA9A 2DTOA 3REBB 1M90R 3O8VA 4PLLA 4OP0A 1OZ2A 4PJNA 3LW5E 5FRNA 2IVWA 2VXEA 4WTOB 4M7DG 2EFIA 4O6JA 1CKBA 3CC2T 1YBYA 5IN1A 2RHUA 3VV0A 5GMKj 2CP2A 4ZNXA 3KUFA 3EFRA 3S6WA 3QIIA 3O5ZA 2XK0A 2L3PA 4C92A 4M78A 4JS5A 2MK5A 1LCKA 3G71T 1VQ6T 3CCMQ 4RG2A 4E7JA 3L2UA 1BI1A 1PCXA 2QQSA 3CXCA 4EMKC 4QKUA 3G6ET 1TUGB 4J9BA 2ZPHB 1QMCA 4UC4A 2I0NA 5GAOp 1VQ4Q 2E5QA 2XHCA 1EX4A 5KE3A 1MNDA 3JCMP 2RHXA 1JU5C 2MMPA 3BW1A 4JS4A 1FX7A 2DEUA 1Q82U 1YJWQ 3H0HA 4LXCA 4B9WA 1M1KR 1Q81U 2HAXA 1IGUA 2L0AA 3MP6A 1PD1A 4RTYA 1V29B 2G6FX 1FMKA 1VYVA 1G3YA 2JMAA 4J9EA 4BY6B 2DIQA 4PJJA 3H9NA 2GGRA 1Z9ZA 2C0TA 2F2WA 1RAIB 3CPWS 1VQLT 4DOVA 1S1NA 3U23A 2RI3A 3FC3A 1YITQ 2DXBA 5AYFA 4E7IA 1VQOQ 2OTJA 4KGXB 5A0LA 1WHJA 4EMHA 4C8QB 1K8AC 3EGDB 1NM7A 4J9GA 1UECA 1P92A 2CSIA 3UDCA 2VWFA 1OI1A 1OV3A 4FSXA 3CCVT 4BD3A 4M7AB 1YJ9Q 4M7DA 4DEXA 4IUUA 3INZA 2BKDN 1PKTA 2EKOA 5L23A 3E2UA 3CCJT 2B8AA 2K5IA 3JCMV 5GAN6 4L5GA 4LD6A 4Y28E 1VQPA 4J83A 4ME7A 1W4SA 4DEYA 4F7UA 3THKA 1I8FA 3NFCA 2V8IA 4M78E 3VRZA 3CPWA 4HKEA 4HVWA 4E7ZA 3LH0A 2EQIA 2O4XA 2E3IA 4JRQA 4C92B 3OYAA 2KMTA 4R0KA 3R6OA 3FB9A 4J6YA 2LTOA 1ZSZC 2PNIA 4N4HA 3G4ST 3CCSQ 3S3MA 2L3SA 3VJPA 3BDLA 2DLPA 2ZCFB 2R57A 1X2QA 2HCKA 1IO6A 1MMGA 2AHJB 2DL7A 2HNIA 2XMFA 1Y0MA 3CCEQ 5IAYA 1AOJA 5HY6A 1D09B 3DLLA 1AWOA 2H3JA 3QYGB 1X2KA 5KCHA 2KXDA 1OZ3A 2M51A 5LJ5h 2ZPFB 4C0ZA 2H8HA 2JXBA 2X4WA 4RKUE 4M75A 3CMEQ 1KG1A 5FU6C 2CZ1B 5M9OA 2CH4A 1M9SA 3EHRA 1K73U 4M77G 2X9HA 3ASKA 2EW3A 4EIKA 1YHQQ 2FHDA 1OOTA 1DJ7B 2E1HA 3SWNC 3CCQQ 1K76A 4FL6A 2NYSA 5CKDA 2FZKB 2ATCB 2XICA 2DL5A 2ESWA 1M8MA 2NLUA 4M7DB 3I56A 2DO3A 2RJCA 3VUBA 4X34A 4F7UE 1YI2Q 2KDSA 4XU1A 1MHNA 1ZX6A 1GXIE 1Y7XA 2XKOC 4IKFA 3I55Q 4MMLA 1OPLA 2E6ZA 3SEMA 2VYTA 1H8KA 2KE9A 2QA4A 3OYIA 1U1TA 3V8KA 1YJNA 1D0YA 1LNXA 2QTVA 5GAN2 1Q86U 1WA7A 1BBZA 2RK2A 2MPXC 5GAOm 4BB7A 4HCBA 5GANf 1UDLA 2GTOA 5LJ3h 1NYFA 3EGXA 3PE0A 2D0QB 3MP1A 4HT8A 1N9RA 4MZPA 2RQWA 4MMKA 2M9UA 1Y07A 4J6WA 2V8KA 1O75A 1WHKA 1YJWT 2X4XA 1D3BA 1KSWA 3G1JA 3DB4A 3OYDA 1N8RR 3M0SA 3NMZC 4IUPA 2D1XA 1UGRB 3PFSA 1VQ7A 2RJEA 4OMLA 4J5YA 1G2BA 4M75E 2FZCB 2V8JA 1M5Q1 1IXDA 4QVDA 1HK9A 1VYTA 2AKLA 1QVGP 2QEXA 3M4YA 3CC7Q 4Z8AA 1GCPA 2HSPA 2X3XD 4XTYA 2HL5C 2JTMA 3EHQA 4RTTA 1YCSB 3NTKA 2RJFA 3PVLA 3OBYA 2JMCA 2DK3A 3AT1B 5GMKm 1VQ9A 3QSUA 2VUBA 1VQ5T 3V8JA 4OB0B 5LJ3g 1VQNT 2E6NA 3MEWA 1X6GA 3H8ZA 2RN8A 1BKBA 1M90C 5GAMh 2YRCA 3LGLA 4AFSC 3RKYA 1VQMA 5LJ3e 1PSEA 3JCMQ 3OMCA 2LCLA 3PMTA 4C0DB 1SG5A 3C94A 2ZZDA 4OB1B 1PC0A 1X75C 3SDZA 2F5KA 2KQWA 4RCCA 2A37A 3CC2Q 1ZHIA 3WXMB 4FYXB 2LQNA 1M3BA 3QWYA 5CCAA 4ELZC 3JRZA 1PM3A 4ZGDB 2A3LA 4OF1A 1AZEA 4AFUC 3GOXA 1WQ7A 1M30A 2VVKA 5CKBA 3EH1A 2M0YA 4ORZA 1VQ6Q 5GAOq 3EGXB 1KC8U 2E10A 3UT1A 3JCMf 2DVJA 3CCET 5I11A 1I4K1 1D3BB 2VGMA 5GAN8 2A0FB 2K2VA 2EQUA 1PRMC 1TG0A 2CP7A 2DXCA 2GNCA 2D6FA 2P0PA 4QW2A 1KD1R 4N0AA 5FROA 4M77B 3MEVA 4BY6C 1AHJB 4MZMA 3QJYA 2RI5A 3M59A 4F14A 4PJOF 2PVOB 1NJIU 2RM4A 3L42A 4J9DA 4HCZA 1JQQA 1VQKT 4C8QC 3OYCA 1KK7A 2XU8A 1JO8A 2WSFE 3OSVA 1EIFA 3X20B 1GBRA 2NUTA 1G3WA 1UHCA 1V76A 4JLGA 4XTWA 5IHIA 2LCSA 3NPFA 1ZA1B 2YSQA 2D0NA 3VS3A 4BACA 2EIFA 1VYUA 3S3NA 1WXUA 1KQSP 4M7AC 1PSFA 1GFDA 2KRNA 3HTRA 5GANd 4XK8E 3JCMW 3CCJQ 1UUEA 3DB3A 3JB9G 5CKFA 3CCUT 1BU1A 2GTJA 5FW9A 1QVFS 3H6ZA 1B34A 2DMOA 4JJDA 1AEYA 4ZN3A 1TU0B 4C92C 2YRDA 2RD1A 2P0QA 2Y4YA 2GF7A 2EYWA 3G4SQ 4M78G 5KYUB 4P5NA 4C8QD 3RIRA 1OU8A 3UPUA 1Q82R 2NWMA 2EBPA 1YIJA 1Q81R 4KUIA 5IXBA 2GFAA 3MEAA 2DD4A 3V7SA 4A4KA 2DEQA 1HJDA 2F2VA 3G6EA 1KHCA 2DTHA 2PTKA 4XAXB 2Y90A 2K3BA 2K5LA 3H41A 5D6WA 4M7AD 3V7RA 1UHFA 2FB7A 3CQTA 2QQBA 2DBKA 4Z89A 2LX9A 2DF6A 1MNEA 2L5QA 5GAN7 1OX9A 1JJ2S 1T0JA 3EG9B 4BDYA 1RAGB 2MCNA 4FIBA 1ZBJA 3WVDB 3GP8A 2V1RA 4KT0E 3OYNA 4DA4A 3UA7A 4C92D 3KFVA 4M78D 2CZ7B 2FPFA 2EAYA 1GCQC 3MJXA 2C0OA 1K9MU 4KGZB 3L2WA 1S72A 2LJ3A 2WSCE 4CC3A 1NYGA 1RAAB 4F17A 5FWCA 3EFSA 1XJWB 2RMOA 2OTLT 2JTEA 4M7DC 1YFNA 4JRKA 1R0BG 2PU9B 2JS2A 3JCMd 1OYXA 4RG8A 2JW4A 1NBEB 4AG2C 4DBRA 2MOXA 3DLMA 1WX6A 4E7LA 1VQPQ 4QVCA 1VOMA 3GF5A 1B34B 4JJNK 4HXJA 4F7UG 1ARKA 2QQ9A 3CC4A 3TSWA 2QASA 5KYYA 3HRTA 5C6SA 2QYZA 1B07A 2K79A 1E6GA 1N8RC 3CMAT 2DX1A 2KROA 2DM1A 2DBMA 4A4HA 2CYZB 4OMOA 1UGPB 1RADB 3P8BB 1RAEB 4KH0B 4XU3A 4E7SA 3OYLA 4M7DD 4JZ3A 2JS0A 2GQIA 1WXTA 5I2SA 4BI4A 5LJ3j 1K73R 4HVUA 1QKWA 4RUGA 1SPKA 4F16A 1EZZB 3CCLT 3UF4A 3SFMA 1UJYA 1HYOA 4OMPA 2QK0A 4OGEA 3CD6T 3MEUA 4M75G 3OS2A 2R5AA 1I1JA 1WFWA 2KVQG 1BI3A 3EAEA 4Y92A 2CKKA 2KSSA 1VQ5Q 4HCKA 2P4TA 2JN0A 4BI8B 3M53A 8AT1B 3UWNA 1VQNQ 2AZSA 2ZPBB 2O9SA 2A36A 3OB9A 2OX7A 3OYGA 1NE8A 3D7SB 3I5SA 1UB4A 2M1HA 2FVUA 3JB9H 1TWBA 5DM7R 2EJFA 1FXXA 5GANg 1G3TA 3I9QA 1VQ8T 2D8HA 3OA6A 1BCMA 4XU2A 2E65A 1T0HA 2E5KA 1MMNA 1IHVA 3TCJA 4C0DC 5ECAA 3CCRA 5GMKi 5LL6S 3MKDA 4KBMB 4RTXA 5GANe 5GAMj 2KNBB 2BZ8A 1Y57A 4ELYC 4M78B 4ATOA 1KIKA 4IURA 1ZSGA 2HL3A 5L8RE 3M0TA 4NOYA 3QUIA 3P8DA 3QWXX 1PWTA 3CBOA 2G3RA 4FYYB 1QP3A 2GQVA 3A98A 4PJOE 2L8DA 2K2MA 4QQ6A 2O9VA 2DZ9A 4PFZA 3OW2S 3CCMA 4OGCA 3JV3A 1M27C 2HDAA 1W2BP 5CKEA 2ED1A 1KD1C 4X1VA 4EMKA 1VQ4A 1RAFB 2BIVA 1QWFA 5IHNA 1JXOA 3QG1A 3QXEB 1GBQA 1WGSA 3TEEA 3X24B 2X3WD 4E6RA 1YWOA 2P4RA 1LOJA 2QTXA 5CAIA 4MDWA 1FWZA 4M77C 2PVDB 2K3XA 3VS6A 3TSZA 1M1KU 2ZPIB 4BE1A 1YITA 1VQKQ 2AKKA 1VQOA 3EFOA 1ABOA 3CXCP 4EPCA 1SKUB 1WJRA 2LJ1A 2ZAEA 3J7AF 2DFUA 2RA2A 4LD9K 2RNAA 3JCMc 1U1SA 3HKSA 3C4SA 5A0DA 3ZFJA 4XTZA 3OYEA 3JCMg 2RHIA 5CR2A 2KT1A 5GJVB 4XTVA 4PKCC 1YJ9A 4E47A 1U06A 2RI2A 2FO0A 3BY7A 1UGSB 1VQPT 4F7UB 2HZYA 1NLOC 1WDXA 3CCUQ 4X9CA 2RQTA 3JCMe 3HHTB 3A8HB 5HK3A 2O4XB 1SSHA 1RLQC 3TVTA 2NUPA 2J7IA 4M77D 4Z88A 1TH7A 1Q82C 1D1AA 2COZA 1WQWA 2DE0X 1Q81C 2FL7A 5FRMA 1Q7YU 2DRKA 4GLMA 4JUVA 2JM9A 3HL8A 4RTWA 4BE0A 3JCMJ 3VS4A 3QJ6A 1F1BB 2OAWA 3OS0A 3CCSA 1ZSZA 1QCOA 4QT7A 1GL5A 3JCMb 2BE9B 2DKGA 2YHTA 4C5GA 1MGQA 1U3OA 4JZ4A 2COYA 5HK0A 4D6WA 1SEMA 2MAMA 1T3LA 3C12A 4LDYA 3QDFA 1FYNA 1ZQ1A 3VYHB 4DBFA 2Y4XA 1BK2A 2RK1A 1QLYA 2LQ8A 2WSEE 2KGTA 4DBQA 4M75B 5GMKe 3CPWP 2YLCA 3RDVA 1D1CA 2CP5A 3M5AA 2X4YA 2AT1B 4PFPA 2QG9B 2DJQA 4FM4B 4L59A 3JSCA 1LVKA 3V8LA 3CMEA 2E64A 2EYXA 2VB6A 3EFOB 2KRMA 3J81E 3L2VA 1YHQA 1VIEA 2XDDA 1J3TA 1M2OA 4ZTFA 3CCQA 2KXCA 2LQKA 1KFZA 1Y71A 2GFUA 1YN8A 4HT9A 3NGPA 5HKCA 3N5BB 3FJ5A 3RNJA 3I56T 4HA8A 2A28A 2OTLQ 2DILA 1IZ6A 3SHWA 4JRPA 3PNWC 2AIRB 3A8GB 3MO8A 2JNGA 4WCIA 4CRIA 5IHKA 3RERA 1A0NB 2XI9A 1YI2A 1N5ZA 4MDXA 4BUGA 2KI7A 2QGFB 4BDZA 2A7YA 1CKAA 1M2VA 1RL2A 3SB2A 2QA4T 3REAB 2DNUA 1YJNT 5CK9A 3H0IA 1M8VA 3I55A 3GPLA 2XD0A 1XNIA 1ACMB 1B7TA 4C8QF 1BIBA 1GFCA 4ZGEB 2QQAA 1JEGA 4LDWA 1RABB 3P8HA 1VIFA 2CDTA 1WIEA 4NL2A 1K0SA 3RKWA 2VASA 4M7AF 2XDBA 3CMAQ 2V1QA 3E9GA 2ENMA 5I22A 1YP5A 2MYSA 1K73C 3NHNA 2FEIA 2PVGB 5EC7A 3UA6A 2PUKB 4PK4A 2EYYA 1IRXA 3EGUA 3OQ5A 1VQ7T 1UGQB 5C0MA 5LJ5f 2XIDA 4R56A 3EG3A 2ABLA 1MV0B 3META 3M9QA 5IH2A 3M56A 1I5OB 2QEXT 4II1A 2RQUA 2HKQB 4C92F 1OPKA 3CCLQ 2PZ1A 4M78F 3CC7A 3CD6Q 2KY9A 2MWPA 1N8RU 1VQ9T 1NPPA 1X69A 1JRIA 3HP9A 1K9MR 3LX7A 2EJGA 2K7AA 1C0MA 1MUZA 4YTLA 4KUDK 2MI6A 2LMJA 3VU3C 1BI2A 4KGVB 4L6V5 2P0KA 3M57A 4N4GA 1R0CB 4RTVA 1AD5A 1MV3A 3QYHB 1VQMT 2PUOB 2M02A 4C5EA 4OB2B 1VQ8Q 1Q86C 4O5VA 3ME9A 1XQHA 2KAFA 2E70A 4LNPA 1RLPC 1BCOA 1RACB 2VV5A 2LQWA 3FIFA 4OVAA 1PG5B 1M3CA 2KYMA 4D8DA 3IQLA 2EVRA 1K8AU 3UATA 2ZGWA 3QZ9B 2EQMA 1TOVA 5I21A 2F2XA 3CC2A 4LN2A 4PL6A 1H3ZA 2ZPGB 4M78C 4EDUA 2O2OA 3PIOA 1PRLC 1ABQA 4IIOA 4QVZA 1UE9A 2IG0A 4J9CA 2X51A 3VS5A 4EMGA 3ZL7C 1B3QA 1WHMA 2QAZA 5D6YA 3G71A 5GMKl 1VQ6A 3VUZA 4M7DF 2MF2A 2JVVA 4CC7A 1Y96A 3J80E 2IPOB 2LNHB 5KE2A 2K5FA 4FT2A 5I2MA 4PJOG 1SRLA 6AT1B 2W0ZA 4IUQA 3JB9D 2C06A 3MCAB 4E2FB 1QVFA 4A53A 2SRCA 5AT1B 2JTFA 2QXFA 2VC8A 2DXTA 3FLGA 4GBQA 1Q95G 1KQ2A 4KULA 2RF0A 4E7KA 1XOVA 4JDSA 2HMAA 2OTJQ 1VQLA 2J6OA 3L2RA 4JJCA 1FMVA 2EWNA 2NUTB 2EQKA 5GAMf 1ZUUA 1JBMA 1LJOA 2DXUA 3ZBDA 3I5RA 4DQ2A 2P84A 1EFNA 1N27A 2EYZA 1AWXA 3QKJA 1KJWA 1RAHB 3URGA 5CKHA 3PTAA 3M0PA 3JAME 2D9TA 3CXCS 4BI3A 2EGCA 3CCVA 3PGGA 4XQ3A 2R5MA 4C5HA 2DL8A 4A63B 1OQKA 3CCRQ 2RPNA 1JJ2A 3M54A 2E41A 2YDLA 1CSKA 3CCJA 2HQHA 3QHSA 2LZ6B 1SSFA 2E12A 2CSQA 4LUEA 1SF9A 1NPRA 1UGVA 1QP2A 1D0XA 5LJ5d 2K57A 5A2QE 1G5VA 1AZGB 1MMDA 1WLPB 2FPEA 1X43A 4A4FA 1PNJA 2L2PA 1HXDA 2EQJA 4PJOA 3G4SA 2FYKA 1YIJT 2RQRA 4PJMA 2L89A 2SEMA 1Y96B 4LDUA 5GANh 4J9HA 1RI0A 4VUBA 4A4GA 1NJIC 2DERA 1UTIA 4OMMA 3X25B 4ZTJA 2CZ6B 5GAOr 4ESRA 2LDMA 4M75C 1SHGA 5CQXA 4A54A 4RCBA 2JM8A 5DLQE 1WZOA 1M3AA 1QVGS 2MIOA 2AK5A 2BUDA 4FW2A 3E9FA 8ATCB 4C8QE 1M1GA 3PIPA 2YLBA 3HRUA 1NEBA 2DYIA 2LNVA 2HEQA 1S72T 4B6MA 3CPFA 4NL3A 3S3OA 5CVIA 1GCQA 4M7AE 1E7OA 3ER0A 2HKNA 1VUBA 3I56Q 1AVZC 2RQVA 2RJDA 5DLOA 1K0XA 2CREA 2B86A 5LJ3d 5GAN3 1I0CA 3HRSA 3OYHA 4M77F 2HSEB 1WXBA 3GNGA 2EPDA 4FU6A 3JB9I 1Q86R 1QVFP 4TVRA 3VS1A 3HFOA 5D7UA 2MWOA 2QA4Q 4M75D 1Q7YR 1YJNQ 3EG1A 5KYYB 4J9IA 1M90U 1QVGA 3CC4T 2BE7D 4C92E 1QQJA 4IUVA 3G7ZA 2BZYA 4J7FA 5CO7A 2J05A 5KH6A 2ED0A 2OAUA 2M16A 1D0ZA 1I07A 2QDYB 7AT1B 4WF2A 4PJOB 5J3BA 1AWWA 3GNFB 3M0UA 4PFOA 5FU7B 4C5IA 1ZUKA 2DPPB 1K4US 1VA7A 1C6VX 2LC4A 3JCMh 2QDLA 4FSSA 9ATCB 3OYKA 5KYWA 1YJWA 1X6BA 3M58A 3C95A 1VQ7Q 2FRYA 2K6DA 2ZPEB 5GAMd 4C0GA 1PHTA 2RB6A 1RUWA 4KH1B 3E19A 1JJ2P 2LRQA 1K9MC 3M4GA 3RMSA 2QEXQ 2F69A 2OTJT 1MMAA 5IT9E 4XTXA 2E3HA 2O88A 1QVPA 3QZ5B 1WHHA 2A08A 2WACA 4AFZC 3CEYA 2X4JA 1VQ9Q 1TUDA 1WPYA 4FCYA 2D8JA 2J6FA 1BYMA 2YUPA 1AWJA 2CH4W 3OW2A 2LT4A 3RKXA 3VS0A 4LDVA 3LWHA 1VQ5A 1WYXA 2YWWA 1W1FA 2K9GA 1VQNA 1OU9A 3CBMA 5GAOn 2CUDA 4CC2A 1TUCA 1VQMQ 3KXTA 5DY9A 5GMKh 1BB9A 4M7DE 2CT4A 2DIGA 1WHLA 2ROTA 2XG8D 4MZTA 2X35A 3CCRT 2BZXA 2L3RA 1K9AA 4RMOA 3VKIA 1KQSS 3KBGA 3QBYA 4Q5WA 2JZ2A
chains in the Genus database with same CATH topology
4NL2A 3RKWA 1P92A 1I5LA 2L5QA 5GAN7 5CQYA 2XDBA 4M7AF 5GAN4 5LJ5g 1YCYA 1JJ2S 3E9GA 3OYYA 3UDCA 2RH2A 1OI1A 1K73C 4FSXA 3CCVT 2VXFA 3WVEB 4BD3A 4M7AB 4BDYA 2PVGB 4M7DA 2PUKB 4IUUA 4E7HA 3INZA 3OQ5A 4FIBA 1VQ7T 1UGQB 3WVDB 4PNOA 3GP8A 3BDUA 4KT0E 5C0MA 2XIDA 2BKDN 5LJ5f 5LJ5e 4R56A 4C92D 2EKOA 3OYNA 4DA4A 1H641 3META 3M9QA 3CCJT 5J26A 2B8AA 3M56A 2K5IA 4JRIA 4M78D 3JCMV 4L5GA 4LD6A 2EYQA 5GAN6 2QEXT 3CCMT 2CZ7B 2F5TX 4Y28E 1VQPA 4II1A 4J83A 2EAYA 4EMKB 1K9MU 4ME7A 3L2WA 1S72A 1W4SA 2DAQA 2WSCE 4C92F 3OS5A 4F7UA 4Z02A 1I8FA 1VQ4T 3NFCA 4M78F 2V8IA 3EFSA 3CC7A 4M78E 3HPWA 2YRVA 4HKEA 3CPWA 3CCEA 2KY9A 3LH0A 2MWPA 1N8RU 2OTLT 2O4XA 1VQ9T 1NPPA 1JRIA 4BE2A 4JRQA 3HP9A 4M7DC 3LX7A 1KQ1A 2EJGA 4C92B 3OYAA 2KMTA 4PLIA 3R6OA 3OSSC 4JRKA 5J39A 4PJOB 4JLIA 3FB9A 1O9SA 4J6YA 1KQSA 2LTOA 3FRNA 4N0AC 4N4HA 3RESA 3TREA 1ZBXA 4YTLA 3G4ST 2MI6A 4KUDK 2PU9B 3VU3C 3TU4K 3JCMd 1OYXA 4RG8A 1BI2A 4L6V5 3S3MA 2P0KA 3M57A 4N4GA 3DLMA 3FDRA 4E7LA 5CIUA 4QVCA 3GF5A 3VJPA 3BDLA 3QYHB 2ZCFB 2R57A 1B34B 1VQMT 2PUOB 2HBPA 4C5EA 4JJNK 4OB2B 2AHJB 4F7UG 1Q86C 4O5VA 3ME9A 2HNIA 4M77A 3LLRA 1XQHA 2KAFA 5IAYA 2E70A 2QQ9A 1YITT 3CC4A 5HY6A 4B9XA 1VQOT 3FIFA 2VV5A 3HRTA 4OVAA 4R55A 3DLLA 5C6SA 1XTDA 2H3JA 1IREB 3SWNA 3QYGB 1VQKA 5KCHA 1N6AA 1OZ3A 2QQRA 1N8RC 5LJ5h 1K8AU 2HQEA 2CS7A 2ZPFB 2ZGWA 3QZ9B 2EQMA 2O01E 3PT9A 3SD4A 4C0ZA 3CMAT 5I21A 3JCMX 2X4WA 4A4HA 4RKUE 3Q1JA 4M75A 2CYZB 3CC2A 2PQWA 1KG1A 4PL6A 5FU6C 1X01A 2ZPGB 1H3ZA 1UGPB 3P8BB 2CZ1B 1I81A 4M78C 4EDUA 5M9OA 1M9SA 1YJ9T 1K73U 3PIOA 4XU3A 4M77G 3A8OB 3ASKA 4QVZA 3OYLA 2FHDA 4M7DD 2IG0A 1DJ7B 2E1HA 4EMGA 3SWNC 5I2SA 3A8MB 5D6XA 4BI4A 2DZCA 5LJ3j 4FL6A 5D6YA 3G71A 5GMKl 1VQ6A 3VUZA 4M7DF 3VYGA 3CCUA 2MF2A 2JVVA 3A5ZB 5CKDA 4Y91A 1Y96A 3FJPA 4XTUA 5KE2A 3J80E 3CCLT 2XICA 3SFMA 5FLXE 3OMGA 2K5FA 4FT2A 4OGEA 4QQDA 5I2MA 4PJOG 3MEUA 3MP8A 4M75G 2NLUA 3CD6T 3HFNA 4M7DB 3OS2A 4IUQA 3I56A 2R5AA 2DO3A 2RJCA 3JB9D 3OYJA 3VUBA 2KVQG 1BI3A 3EAEA 3MCAB 4X34A 2C06A 2CKKA 2CZ0B 2KSSA 4F7UE 2P4TA 2KDSA 2JN0A 4XU1A 4BI8B 1MHNA 3M53A 1QVFA 3UWNA 4A53A 3JB9J 1GXIE 1BI0A 3CCST 2JTFA 2QXFA 2VC8A 3JB9F 2ZPBB 1Y7XA 4J8OA 2HQXA 2XKOC 3RUXA 2DXTA 3FLGA 3OB9A 4IKFA 3OYGA 4GLKA 1NE8A 3F70A 1G3SA 4MMLA 1UB4A 2M1HA 2FVUA 2E6ZA 5GAMg 3JB9H 2VYTA 5DM7R 2EJFA 1FXXA 4KULA 4NS5A 5GANg 1G3TA 1U1TA 3OYIA 2QA4A 1VQ8T 3V8KA 1YJNA 4E7KA 1XOVA 4JDSA 3OA6A 1LNXA 5GAN2 4XU2A 5A0GA 2E65A 3L1AA 1VQLA 2DVEA 1Q86U 3DKMA 3LWIA 3FEOA 3TCJA 4C0DC 3L2RA 2HD0A 3E1SA 3CCRA 4QQGA 5GMKi 5LL6S 2RK2A 1R8OB 2EWNA 2EQKA 4KBMB 5GAMe 5GAMf 4BB7A 5GAOm 2GCXA 1JBMA 5GANe 5GANf 3OYBA 1LJOA 2DXUA 4HCBA 4M77E 3T9NA 3ZBDA 5LJ3h 4DQ2A 5GAMj 2D0QB 3MP1A 5GANj 4HT8A 1N9RA 4MZPA 4MMKA 1N27A 2M9UA 2RHYA 4OMFB 1Y07A 4J6WA 3QDRB 3QKJA 5FU6B 3CMET 3URGA 4ELYC 2V8KA 1O75A 5CKHA 3PTAA 3QO3A 3JAME 2X4XA 2D9TA 1D3BA 4M78B 3CXCS 1WJQA 2DTIA 1YJWT 4BI3A 4CI0C 4ATOA 4IURA 3DB4A 3CCVA 3X26B 3OYDA 3PGGA 4XQ3A 2R5MA 1YHQT 3L2QA 5L8RE 4ZGJB 4NOYA 3QUIA 3P8DA 4IUPA 1UGRB 4C5HA 3V7CA 3CBOA 3PFSA 2G3RA 3SWNB 1VQ7A 2RJEA 3CCQT 1QP3A 2GQVA 4J5YA 1JJ2A 3M54A 4PJOE 2XDPA 2JOYA 2L8DA 2V8JA 4M75E 1M5Q1 2E41A 4QVDA 4QQ6A 3CCJA 1HK9A 5GAOl 2DZ9A 3LYIA 3OW2S 3QHSA 4OGCA 2QEXA 3M4YA 3CCMA 1SSFA 2E12A 3BFMA 4XTYA 4C8QG 5CKEA 2JTMA 5KCOA 1KD1C 4EMKA 1VQ4A 2BIVA 3NTKA 2RJFA 1NPRA 1M8VA 1QP2A 3QG1A 3QXEB 3OBYA 1Q7YC 2DK3A 3X28B 5LJ5d 3OYMA 2OTLA 2K57A 1WGSA 4GY5A 3TEEA 5GMKm 1VQ9A 3X24B 3QSUA 5A2QE 1G5VA 2VUBA 1WJSA 4A4EA 1VQ5T 1YI2T 2DD5A 3V8JA 4OB0B 5LJ3g 1VQNT 3QPHA 4A4FA 1LOJA 2E6NA 2K3YA 4C0FA 4M7AG 2QTXA 3MEWA 1HXDA 2EQJA 4PJOA 3G4SA 3H8ZA 2FYKA 5CAIA 1YIJT 4N4IA 1BKBA 1M90C 3AHUA 4MDWA 2L89A 5GAMh 1FWZA 4M77C 1Y96B 4LDUA 5GANh 3I55T 3CBPA 1RI0A 2LVMA 4VUBA 2PVDB 2K3XA 3LGLA 1NZ9A 4A4GA 1NJIC 3RKYA 1VQMA 3GLXA 2CGHA 1M1KU 5LJ3f 5LJ3e 1PSEA 3JCMQ 4V2SA 3OMCA 2LCLA 2ZPIB 3OY9A 2RHZA 3PMTA 4BE1A 3X25B 4C0DB 3C94A 4X9DA 4ZTJA 1YITA 3ZEHA 2RO0A 2ZZDA 4IUTA 1VQOA 2CZ6B 2VGNA 4OB1B 5GAN5 1U8RA 5GAOr 1X75C 3SDZA 4EPCA 4LDXA 3LGFA 2F5KA 2KQWA 4RCCA 2LDMA 4PJOC 4OB3B 4DOWA 1WJRA 4M75C 5CQXA 4C92G 2R58A 5FU7C 3J7AF 1ZHIA 2K4YA 2RA2A 3L2ZA 3OBWA 4RCBA 3WXMB 5DLQE 4A54A 4LD9K 1X6OA 3JCMc 3CMAA 5CCAA 4ELZC 1U1SA 3HKSA 3JRZA 4ZGDB 3C4SA 5A0DA 1QVGS 3ZFJA 1KQ2A 4XTZA 3RMQA 2A3LA 4OF1A 2I2LA 4F7UF 3GIBA 3OYEA 3JCMg 3HSBA 2RHIA 1N9SA 5CR2A 3GOXA 1W2BS 1WQ7A 2BUDA 4XTVA 3E9FA 1JB0E 4PKCC 1YJ9A 4E47A 5CKBA 1M1GA 4C8QE 2JUFA 2RI2A 3PIPA 2YLBA 3NTHA 3HRUA 4J6XA 3BY7A 1UGSB 2M0OA 1VQPT 4XU0A 1BIAA 4F7UB 1M1KC 5GAOq 2LNVA 2EJ9A 1S72T 4X9CA 1KC8U 4FT4A 2E10A 3CPFA 3UT1A 3JCMf 3JCMe 3HHTB 3A8HB 3CC7T 5HK3A 2O4XB 3A8LB 4J7IA 3CCET 4HCCA 1I4K1 4NL3A 4M77D 3S3OA 1TH7A 5CVIA 4M7AE 3ER0A 3CCLA 1D3BB 2VGMA 1VUBA 5GAN8 1Q82C 3M55A 1WNLA 1WQWA 2RJDA 5DLOA 2K2VA 2EQUA 1Q81C 1KD1U 3CD6A 5LJ3d 2FL7A 5GAN3 3MHXA 5FRMA 3HRSA 2QI2A 2DXCA 4M77F 3OYHA 1Q7YU 3GNGA 4FU6A 4JUVA 3HL8A 3JB9I 4BE0A 3JCMJ 4C8QA 1M1FA 4TVRA 2D6FA 1UEBA 3QJ6A 2P0PA 3HFOA 4QW2A 2KK4A 3OS0A 3CCSA 2LCCA 4N0AA 3OS1A 5FROA 4M77B 3NTIA 4PJOD 2MWOA 5EG2A 4M75D 2LT1A 3MEVA 5LJ5j 3OYFA 4BY6C 3JCMb 1AHJB 2DKGA 2YHTA 4MZMA 4C5GA 1M90U 1MGQA 3QJYA 1QVGA 2RI5A 3M59A 3CC4T 4C92E 1VQ8A 1M4ZA 4ZN1A 4D6WA 1KHIA 5HK0A 2MAMA 1W2BA 4PJOF 3C12A 4IUVA 4M7AA 2PVOB 4LDYA 2RM4A 3PMIA 4M75F 3G7ZA 1KC8C 3L42A 1NJIU 1QW1A 4HCZA 4J7FA 2DJZA 5CO7A 1VQKT 1ZQ1A 2DTOA 3VYHB 5KH6A 2OAUA 2M16A 2Y4XA 3O8VA 4PLLA 2RK1A 4OP0A 4C8QC 2QDYB 1OZ2A 4WF2A 3OYCA 3LW5E 2LQ8A 2WSEE 2WSFE 2XU8A 2IVWA 2VXEA 3OSVA 4M75B 5J3BA 3GNFB 5FRNA 4M7DG 5GMKe 2EFIA 2YLCA 1EIFA 4O6JA 3X20B 5FU7B 1G3WA 4C5IA 2DPPB 3M5AA 3CC2T 2X4YA 1YBYA 4JLGA 5IN1A 2RHUA 3VV0A 4XTWA 5GMKj 3KUFA 3EFRA 4FM4B 3S6WA 4L59A 4BACA 2LC4A 3JSCA 2EIFA 3JCMh 3V8LA 3CMEA 3S3NA 3QIIA 3OYKA 2E64A 4M7AC 1PSFA 1YJWA 3M58A 2XK0A 3C95A 4C92A 2ZPEB 5GAMd 3J81E 5GANd 4M78A 4C0GA 3L2VA 4JS5A 2RB6A 1YHQA 4XK8E 3E19A 1VIEA 2XDDA 3JCMW 2LRQA 3DB3A 3JB9G 1K9MC 4ZTFA 3G71T 1VQ6T 5CKFA 3CCQA 3M4GA 3RMSA 4RG2A 4E7JA 3CCUT 2LQKA 3L2UA 1BI1A 2QQSA 1Y71A 3CXCA 4EMKC 2F69A 2GFUA 3G6ET 2ZPHB 4UC4A 4HT9A 2OTJT 5GAOp 1QVFS 2E5QA 3H6ZA 5IT9E 1B34A 4XTXA 5HKCA 3N5BB 2XHCA 5KE3A 1QVPA 3QZ5B 3JCMP 3I56T 4HA8A 2RHXA 2MMPA 2WACA 1IZ6A 3BW1A 2X4JA 3CEYA 1FX7A 4ZN3A 4JRPA 3PNWC 4JS4A 1WPYA 3A8GB 4C92C 1Q82U 2RD1A 3MO8A 2P0QA 1BYMA 2JNGA 4CRIA 4B9WA 2HAXA 1Q81U 2Y4YA 3OW2A 2GF7A 2LT4A 3RKXA 3MP6A 3RERA 4LDVA 2XI9A 3LWHA 4M78G 1YI2A 1VQ5A 4MDXA 4BUGA 1V29B 4P5NA 4C8QD 3RIRA 1VQNA 3CBMA 5GAOn 3UPUA 4BDZA 2A7YA 1RL2A 1G3YA 3SB2A 2QA4T 1YIJA 4BY6B 2DIQA 4KUIA 1YJNT 5CK9A 3KXTA 5DY9A 2GFAA 3MEAA 2DD4A 5GMKh 3V7SA 3I55A 1XNIA 3GPLA 2XD0A 4A4KA 2DEQA 3CPWS 4C8QF 4M7DE 1BIBA 2DIGA 4DOVA 1VQLT 2XG8D 3G6EA 4MZTA 1KHCA 2DTHA 2RI3A 2X35A 3FC3A 2DXBA 4XAXB 3CCRT 2Y90A 5AYFA 4E7IA 2OTJA 2L3RA 2K5LA 5D6WA 4ZGEB 5A0LA 4M7AD 2QQAA 3V7RA 4RMOA 4LDWA 3VKIA 4EMHA 3P8HA 2FB7A 4C8QB 2QQBA 1K8AC 1KQSS 3KBGA 1VIFA 3QBYA 2LX9A 4Q5WA 2JZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D D;  4NL2 A;  3RKW A;  5LJ5 j;  2E1H A;  4EMG A;  3JCM b;  1I5L A;  2DKG A;  2YHT A;  5LJ5 d;  3SWN C;  5GAN 7;  4M7A F;  1MGQ A;  5GAN 4;  2K57 A;  5LJ5 g;  5GMK m;  1YCY A;  3QSU A;  4C92 E;  2DZC A;  5LJ3 j;  4M7A A;  4PJO F;  5GMK l;  2RM4 A;  4M75 F;  3V8J A;  4M7D F;  5LJ3 g;  2VXF A;  2DJZ A;  1LOJ A;  4M7A G;  4Y91 A;  4M7A B;  1Y96 A;  2QTX A;  1HXD A;  3FJP A;  4XTU A;  4PJO A;  2DTO A;  2FYK A;  5CAI A;  4M7D A;  4OP0 A;  4C8Q C;  3AHU A;  3INZ A;  5GAM h;  4WF2 A;  4M77 C;  1Y96 B;  4PJO G;  5GAN h;  4PJO B;  4PNO A;  2VXE A;  3BDU A;  4M75 G;  4M75 B;  5LJ5 f;  3HFN A;  5LJ5 e;  4M7D G;  4C92 D;  4M7D B;  5GMK e;  2YLC A;  1H64 1;  3JB9 D;  3RKY A;  4M78 D;  4JRI A;  2CGH A;  3JCM V;  5GAN 6;  5LJ3 f;  5LJ3 e;  3JCM Q;  4XTW A;  4F7U E;  5GMK j;  4V2S A;  2EAY A;  2JN0 A;  4XU1 A;  3EFR A;  4EMK B;  4A53 A;  3JCM h;  3JB9 J;  4X9D A;  4C92 F;  3V8L A;  4F7U A;  2VC8 A;  1I8F A;  5GAN 5;  3JB9 F;  2E64 A;  4M7A C;  4M78 F;  3EFS A;  3RUX A;  2DXT A;  5GAO r;  4M78 E;  4C92 A;  5GAM d;  4MML A;  4RCC A;  5GAN d;  4M78 A;  4PJO C;  5GAM g;  3JB9 H;  2RB6 A;  1JRI A;  2EJF A;  4M75 C;  4C92 G;  5GAN g;  1U1T A;  4C92 B;  1KQ1 A;  2EJG A;  3JCM W;  3V8K A;  4M7D C;  3JB9 G;  4JRK A;  4A54 A;  1LNX A;  2RA2 A;  3L2Z A;  3M4G A;  4JLI A;  3FB9 A;  2E65 A;  4RCB A;  4J6Y A;  4XU2 A;  5GAN 2;  3JCM c;  3L1A A;  4N0A C;  3RES A;  1U1S A;  2DVE A;  4EMK C;  3VU3 C;  1KQ2 A;  3JCM d;  4XTZ A;  4HT9 A;  5GAO p;  2I2L A;  4F7U F;  5GMK i;  3GIB A;  3JCM g;  1B34 A;  3HSB A;  4XTX A;  1N9S A;  2EWN A;  1WQ7 A;  5GAM e;  5GAM f;  4QVC A;  5GAO m;  4XTV A;  3JCM P;  1JBM A;  5GAN e;  5GAN f;  4HA8 A;  1LJO A;  2DXU A;  4C8Q E;  1B34 B;  2YLB A;  3BW1 A;  4M77 E;  5LJ3 h;  4J6X A;  4DQ2 A;  1WPY A;  3BY7 A;  5GAM j;  4F7U G;  4XU0 A;  1BIA A;  4C92 C;  4F7U B;  5GAN j;  2RD1 A;  1N9R A;  2HNI A;  4M77 A;  5GAO q;  4HT8 A;  2EJ9 A;  4MMK A;  4J6W A;  4X9C A;  3RKX A;  2E10 A;  3RER A;  3JCM f;  3JCM e;  3FIF A;  3QO3 A;  4M78 G;  4M78 B;  1D3B A;  2DTI A;  1I4K 1;  4C8Q D;  3RIR A;  4NL3 A;  4M77 D;  3SWN A;  1TH7 A;  5GAO n;  4M7A E;  3PGG A;  4XQ3 A;  1D3B B;  3SB2 A;  5GAN 8;  4NOY A;  3QUI A;  1WNL A;  1WQW A;  3SWN B;  3V7C A;  5LJ5 h;  5DY9 A;  1M8V A;  5GMK h;  4J5Y A;  5LJ3 d;  3V7S A;  4PJO E;  2ZGW A;  4M75 E;  5GAN 3;  2DEQ A;  4M7D E;  4C8Q F;  1BIB A;  1M5Q 1;  2E41 A;  5I21 A;  4QVD A;  4M77 F;  3JCM X;  1HK9 A;  2DTH A;  5GAO l;  2DZ9 A;  4M75 A;  4JUV A;  3JB9 I;  2Y90 A;  3JCM J;  3QHS A;  1X01 A;  4C8Q A;  4M7A D;  3V7R A;  1I81 A;  3BFM A;  4M78 C;  3HFO A;  4XTY A;  4EMH A;  4C8Q G;  2FB7 A;  4XU3 A;  4C8Q B;  4N0A A;  4M77 G;  4M77 B;  4EMK A;  4PJO D;  4M75 D; 
#chains in the Genus database with same CATH topology
 1I5L A;  5CQY A;  2BTT A;  5GAN 4;  1T3S A;  5LJ5 g;  4M4Z A;  1YCY A;  2ROL A;  3OYY A;  1KC8 R;  3BE3 A;  2RH2 A;  2VXF A;  3WVE B;  4JJB A;  1OX8 A;  4E7H A;  1UG1 A;  3LH5 A;  2KR3 A;  3BDU A;  4PNO A;  2OJ2 A;  2YUO A;  5LJ5 e;  2F1L A;  1H64 1;  5GJW B;  5J26 A;  4JRI A;  2EYQ A;  3CCM T;  2F5T X;  2J6K A;  4EMK B;  3I35 A;  2FRW A;  2DAQ A;  3OS5 A;  4Z02 A;  1FMW A;  2HBW A;  4FW1 A;  3TQ7 P;  1VQ4 T;  2FZG B;  3HPW A;  2YRV A;  3CCE A;  1IGQ A;  3VS2 A;  5KYW B;  4RTZ A;  3M0Q A;  4BE2 A;  1KQ1 A;  4PLI A;  3R6N A;  2YUQ A;  3OSS C;  5J39 A;  4JLI A;  2KBT A;  1O9S A;  1KQS A;  1NJI R;  3FRN A;  4N0A C;  3RES A;  3TRE A;  1ZBX A;  4RTU A;  3TU4 K;  2CP6 A;  2LX7 A;  1TS9 A;  2KEA A;  3FDR A;  1NLP C;  5CIU A;  3VS7 A;  3EG0 A;  1W6X A;  1GRI A;  2E4H A;  2HBP A;  5IXF A;  4AFQ C;  4FYV B;  4M77 A;  1TSF A;  3LLR A;  4J9F A;  2COW A;  1YIT T;  4B9X A;  1VQO T;  4JPB W;  4R55 A;  4AG1 C;  1XTD A;  1IRE B;  3SWN A;  1VQK A;  3RBB B;  1N6A A;  2QQR A;  2FPD A;  2HQE A;  1ZUY A;  2CS7 A;  2O01 E;  3PT9 A;  4KRT A;  3SD4 A;  3A1P A;  3JCM X;  3Q1J A;  1NG2 A;  2PQW A;  2YT6 A;  1X01 A;  1PD0 A;  5FWB A;  2DL4 A;  2LP5 A;  1I81 A;  1K8A R;  1YJ9 T;  2H3E B;  3A8O B;  2CT3 A;  4FYW B;  3A8M B;  3RR6 A;  5D6X A;  2EGE A;  2NUP B;  2DZC A;  3VYG A;  3CCU A;  3A5Z B;  4Y91 A;  1E6H A;  3FJP A;  4XTU A;  2J06 A;  5FLX E;  4LE9 A;  2CP3 A;  3OMG A;  4QQD A;  3MP8 A;  3HFN A;  1SRM A;  3OYJ A;  2CZ0 B;  1W70 A;  3OW2 P;  1ZSZ B;  1QKX A;  1X27 A;  2DL3 A;  2VKN A;  3C0C A;  1NEG A;  3JB9 J;  4IIM A;  1BI0 A;  3CCS T;  3EH2 A;  1IB8 A;  3JB9 F;  4J8O A;  2HQX A;  3RUX A;  1D1B A;  1YIJ Q;  4AMC A;  4GLK A;  3G71 Q;  3F70 A;  1G3S A;  5KYU A;  5GAM g;  2CP0 A;  1M1K C;  1HD3 A;  1H3H A;  2JT4 A;  4NS5 A;  3G6E Q;  1U5S A;  1JXM A;  2O31 A;  5A0G A;  3M0R A;  3H0F A;  4PJL A;  3L1A A;  2KYB A;  4F04 B;  2DVE A;  3DKM A;  3LWI A;  3FEO A;  2KT8 A;  2HD0 A;  3E1S A;  2QGG A;  4QQG A;  1QCF A;  1PKS A;  1R8O B;  1C1A A;  5GAM e;  3OYB A;  2FG0 A;  2GCX A;  1ZLM A;  2EGA A;  4K11 A;  1WHG A;  4M77 E;  3T9N A;  2KRS A;  2AZV A;  5KYX A;  5GAN j;  2Z0W A;  2RHY A;  4OMF B;  3QDR B;  5FU6 B;  3CME T;  1G8X A;  4LUD A;  3QO3 A;  1WJQ A;  2DTI A;  4CI0 C;  2V26 A;  5KYN A;  3X26 B;  5HCK A;  4D8K A;  1HSQ A;  1YHQ T;  3L2Q A;  1VQL Q;  4ZGJ B;  3EG9 A;  2JJ9 A;  3V7C A;  3SWN B;  2C0I A;  3CCQ T;  2IIM A;  2XDP A;  2JOY A;  4AT1 B;  1S72 Q;  5GAO l;  3LYI A;  1OEB A;  3BFM A;  1V1C A;  4C8Q G;  5KCO A;  2OI3 A;  2DRM A;  1YWP A;  1Q7Y C;  3X28 B;  3OYM A;  2OTL A;  4GY5 A;  3CCV Q;  1WJS A;  4A4E A;  1YI2 T;  2DD5 A;  3VRY A;  1M2V B;  1AT1 B;  3QPH A;  4C0F A;  2K3Y A;  4OMN A;  4M7A G;  1TTH B;  4N4I A;  1QCN A;  3AHU A;  3PVQ A;  3I55 T;  3EG2 A;  3CBP A;  2LVM A;  2L3Q A;  1NZ9 A;  1IHW A;  3GBQ A;  1R77 A;  3GLX A;  2CGH A;  3CC4 Q;  5LJ3 f;  4V2S A;  3OY9 A;  2RHZ A;  4X9D A;  3ZEH A;  2RO0 A;  4IUT A;  1U8R A;  5GAN 5;  2VGN A;  3MPU B;  4LDX A;  3LGF A;  4ANJ A;  2LJ0 A;  4PJO C;  4OB3 B;  4DOW A;  4C92 G;  1WI7 A;  4CC4 B;  2R58 A;  5FU7 C;  2K4Y A;  3OBW A;  3L2Z A;  1X6O A;  3CMA A;  1LPL A;  3RMQ A;  2I2L A;  4F7U F;  3GIB A;  3HSB A;  1N9S A;  1W2B S;  1K1Z A;  1JB0 E;  2JUF A;  3NTH A;  4J6X A;  1UFF A;  2M0O A;  4XU0 A;  1BIA A;  3ULR B;  1G83 A;  2EJ9 A;  1OUL A;  2DET A;  4FT4 A;  5KYX B;  2YUN A;  3CC7 T;  3A8L B;  4J7I A;  4HCC A;  1SHF A;  2EKH A;  3CCL A;  2YXY A;  3M55 A;  1ZA2 B;  1WNL A;  1TXQ A;  1KD1 U;  3CD6 A;  1UJ0 A;  2DYB A;  3MHX A;  2QI2 A;  4C8Q A;  1M1F A;  1H92 A;  3EGD A;  1QWE A;  1UEB A;  1Z9Q A;  4OMQ A;  2KK4 A;  2LCC A;  3OS1 A;  3NTI A;  4PJO D;  5EG2 A;  2ECZ A;  2GBQ A;  2LT1 A;  2NUZ A;  5LJ5 j;  3OYF A;  1RI9 A;  1YNZ A;  4HVV A;  1VQ8 A;  1M4Z A;  4ZN1 A;  1KHI A;  1W2B A;  4M7A A;  4M75 F;  3PMI A;  2CUB A;  4DBH A;  1KC8 C;  1QW1 A;  2DJZ A;  2W10 A;  2DA9 A;  2DTO A;  3REB B;  1M90 R;  3O8V A;  4PLL A;  4OP0 A;  1OZ2 A;  4PJN A;  3LW5 E;  5FRN A;  2IVW A;  2VXE A;  4WTO B;  4M7D G;  2EFI A;  4O6J A;  1CKB A;  3CC2 T;  1YBY A;  5IN1 A;  2RHU A;  3VV0 A;  5GMK j;  2CP2 A;  4ZNX A;  3KUF A;  3EFR A;  3S6W A;  3QII A;  3O5Z A;  2XK0 A;  2L3P A;  4C92 A;  4M78 A;  4JS5 A;  2MK5 A;  1LCK A;  3G71 T;  1VQ6 T;  3CCM Q;  4RG2 A;  4E7J A;  3L2U A;  1BI1 A;  1PCX A;  2QQS A;  3CXC A;  4EMK C;  4QKU A;  3G6E T;  1TUG B;  4J9B A;  2ZPH B;  1QMC A;  4UC4 A;  2I0N A;  5GAO p;  1VQ4 Q;  2E5Q A;  2XHC A;  1EX4 A;  5KE3 A;  1MND A;  3JCM P;  2RHX A;  1JU5 C;  2MMP A;  3BW1 A;  4JS4 A;  1FX7 A;  2DEU A;  1Q82 U;  1YJW Q;  3H0H A;  4LXC A;  4B9W A;  1M1K R;  1Q81 U;  2HAX A;  1IGU A;  2L0A A;  3MP6 A;  1PD1 A;  4RTY A;  1V29 B;  2G6F X;  1FMK A;  1VYV A;  1G3Y A;  2JMA A;  4J9E A;  4BY6 B;  2DIQ A;  4PJJ A;  3H9N A;  2GGR A;  1Z9Z A;  2C0T A;  2F2W A;  1RAI B;  3CPW S;  1VQL T;  4DOV A;  1S1N A;  3U23 A;  2RI3 A;  3FC3 A;  1YIT Q;  2DXB A;  5AYF A;  4E7I A;  1VQO Q;  2OTJ A;  4KGX B;  5A0L A;  1WHJ A;  4EMH A;  4C8Q B;  1K8A C;  3EGD B;  1NM7 A;  4J9G A;  1UEC A;  1P92 A;  2CSI A;  3UDC A;  2VWF A;  1OI1 A;  1OV3 A;  4FSX A;  3CCV T;  4BD3 A;  4M7A B;  1YJ9 Q;  4M7D A;  4DEX A;  4IUU A;  3INZ A;  2BKD N;  1PKT A;  2EKO A;  5L23 A;  3E2U A;  3CCJ T;  2B8A A;  2K5I A;  3JCM V;  5GAN 6;  4L5G A;  4LD6 A;  4Y28 E;  1VQP A;  4J83 A;  4ME7 A;  1W4S A;  4DEY A;  4F7U A;  3THK A;  1I8F A;  3NFC A;  2V8I A;  4M78 E;  3VRZ A;  3CPW A;  4HKE A;  4HVW A;  4E7Z A;  3LH0 A;  2EQI A;  2O4X A;  2E3I A;  4JRQ A;  4C92 B;  3OYA A;  2KMT A;  4R0K A;  3R6O A;  3FB9 A;  4J6Y A;  2LTO A;  1ZSZ C;  2PNI A;  4N4H A;  3G4S T;  3CCS Q;  3S3M A;  2L3S A;  3VJP A;  3BDL A;  2DLP A;  2ZCF B;  2R57 A;  1X2Q A;  2HCK A;  1IO6 A;  1MMG A;  2AHJ B;  2DL7 A;  2HNI A;  2XMF A;  1Y0M A;  3CCE Q;  5IAY A;  1AOJ A;  5HY6 A;  1D09 B;  3DLL A;  1AWO A;  2H3J A;  3QYG B;  1X2K A;  5KCH A;  2KXD A;  1OZ3 A;  2M51 A;  5LJ5 h;  2ZPF B;  4C0Z A;  2H8H A;  2JXB A;  2X4W A;  4RKU E;  4M75 A;  3CME Q;  1KG1 A;  5FU6 C;  2CZ1 B;  5M9O A;  2CH4 A;  1M9S A;  3EHR A;  1K73 U;  4M77 G;  2X9H A;  3ASK A;  2EW3 A;  4EIK A;  1YHQ Q;  2FHD A;  1OOT A;  1DJ7 B;  2E1H A;  3SWN C;  3CCQ Q;  1K76 A;  4FL6 A;  2NYS A;  5CKD A;  2FZK B;  2ATC B;  2XIC A;  2DL5 A;  2ESW A;  1M8M A;  2NLU A;  4M7D B;  3I56 A;  2DO3 A;  2RJC A;  3VUB A;  4X34 A;  4F7U E;  1YI2 Q;  2KDS A;  4XU1 A;  1MHN A;  1ZX6 A;  1GXI E;  1Y7X A;  2XKO C;  4IKF A;  3I55 Q;  4MML A;  1OPL A;  2E6Z A;  3SEM A;  2VYT A;  1H8K A;  2KE9 A;  2QA4 A;  3OYI A;  1U1T A;  3V8K A;  1YJN A;  1D0Y A;  1LNX A;  2QTV A;  5GAN 2;  1Q86 U;  1WA7 A;  1BBZ A;  2RK2 A;  2MPX C;  5GAO m;  4BB7 A;  4HCB A;  5GAN f;  1UDL A;  2GTO A;  5LJ3 h;  1NYF A;  3EGX A;  3PE0 A;  2D0Q B;  3MP1 A;  4HT8 A;  1N9R A;  4MZP A;  2RQW A;  4MMK A;  2M9U A;  1Y07 A;  4J6W A;  2V8K A;  1O75 A;  1WHK A;  1YJW T;  2X4X A;  1D3B A;  1KSW A;  3G1J A;  3DB4 A;  3OYD A;  1N8R R;  3M0S A;  3NMZ C;  4IUP A;  2D1X A;  1UGR B;  3PFS A;  1VQ7 A;  2RJE A;  4OML A;  4J5Y A;  1G2B A;  4M75 E;  2FZC B;  2V8J A;  1M5Q 1;  1IXD A;  4QVD A;  1HK9 A;  1VYT A;  2AKL A;  1QVG P;  2QEX A;  3M4Y A;  3CC7 Q;  4Z8A A;  1GCP A;  2HSP A;  2X3X D;  4XTY A;  2HL5 C;  2JTM A;  3EHQ A;  4RTT A;  1YCS B;  3NTK A;  2RJF A;  3PVL A;  3OBY A;  2JMC A;  2DK3 A;  3AT1 B;  5GMK m;  1VQ9 A;  3QSU A;  2VUB A;  1VQ5 T;  3V8J A;  4OB0 B;  5LJ3 g;  1VQN T;  2E6N A;  3MEW A;  1X6G A;  3H8Z A;  2RN8 A;  1BKB A;  1M90 C;  5GAM h;  2YRC A;  3LGL A;  4AFS C;  3RKY A;  1VQM A;  5LJ3 e;  1PSE A;  3JCM Q;  3OMC A;  2LCL A;  3PMT A;  4C0D B;  1SG5 A;  3C94 A;  2ZZD A;  4OB1 B;  1PC0 A;  1X75 C;  3SDZ A;  2F5K A;  2KQW A;  4RCC A;  2A37 A;  3CC2 Q;  1ZHI A;  3WXM B;  4FYX B;  2LQN A;  1M3B A;  3QWY A;  5CCA A;  4ELZ C;  3JRZ A;  1PM3 A;  4ZGD B;  2A3L A;  4OF1 A;  1AZE A;  4AFU C;  3GOX A;  1WQ7 A;  1M30 A;  2VVK A;  5CKB A;  3EH1 A;  2M0Y A;  4ORZ A;  1VQ6 Q;  5GAO q;  3EGX B;  1KC8 U;  2E10 A;  3UT1 A;  3JCM f;  2DVJ A;  3CCE T;  5I11 A;  1I4K 1;  1D3B B;  2VGM A;  5GAN 8;  2A0F B;  2K2V A;  2EQU A;  1PRM C;  1TG0 A;  2CP7 A;  2DXC A;  2GNC A;  2D6F A;  2P0P A;  4QW2 A;  1KD1 R;  4N0A A;  5FRO A;  4M77 B;  3MEV A;  4BY6 C;  1AHJ B;  4MZM A;  3QJY A;  2RI5 A;  3M59 A;  4F14 A;  4PJO F;  2PVO B;  1NJI U;  2RM4 A;  3L42 A;  4J9D A;  4HCZ A;  1JQQ A;  1VQK T;  4C8Q C;  3OYC A;  1KK7 A;  2XU8 A;  1JO8 A;  2WSF E;  3OSV A;  1EIF A;  3X20 B;  1GBR A;  2NUT A;  1G3W A;  1UHC A;  1V76 A;  4JLG A;  4XTW A;  5IHI A;  2LCS A;  3NPF A;  1ZA1 B;  2YSQ A;  2D0N A;  3VS3 A;  4BAC A;  2EIF A;  1VYU A;  3S3N A;  1WXU A;  1KQS P;  4M7A C;  1PSF A;  1GFD A;  2KRN A;  3HTR A;  5GAN d;  4XK8 E;  3JCM W;  3CCJ Q;  1UUE A;  3DB3 A;  3JB9 G;  5CKF A;  3CCU T;  1BU1 A;  2GTJ A;  5FW9 A;  1QVF S;  3H6Z A;  1B34 A;  2DMO A;  4JJD A;  1AEY A;  4ZN3 A;  1TU0 B;  4C92 C;  2YRD A;  2RD1 A;  2P0Q A;  2Y4Y A;  2GF7 A;  2EYW A;  3G4S Q;  4M78 G;  5KYU B;  4P5N A;  4C8Q D;  3RIR A;  1OU8 A;  3UPU A;  1Q82 R;  2NWM A;  2EBP A;  1YIJ A;  1Q81 R;  4KUI A;  5IXB A;  2GFA A;  3MEA A;  2DD4 A;  3V7S A;  4A4K A;  2DEQ A;  1HJD A;  2F2V A;  3G6E A;  1KHC A;  2DTH A;  2PTK A;  4XAX B;  2Y90 A;  2K3B A;  2K5L A;  3H41 A;  5D6W A;  4M7A D;  3V7R A;  1UHF A;  2FB7 A;  3CQT A;  2QQB A;  2DBK A;  4Z89 A;  2LX9 A;  2DF6 A;  1MNE A;  2L5Q A;  5GAN 7;  1OX9 A;  1JJ2 S;  1T0J A;  3EG9 B;  4BDY A;  1RAG B;  2MCN A;  4FIB A;  1ZBJ A;  3WVD B;  3GP8 A;  2V1R A;  4KT0 E;  3OYN A;  4DA4 A;  3UA7 A;  4C92 D;  3KFV A;  4M78 D;  2CZ7 B;  2FPF A;  2EAY A;  1GCQ C;  3MJX A;  2C0O A;  1K9M U;  4KGZ B;  3L2W A;  1S72 A;  2LJ3 A;  2WSC E;  4CC3 A;  1NYG A;  1RAA B;  4F17 A;  5FWC A;  3EFS A;  1XJW B;  2RMO A;  2OTL T;  2JTE A;  4M7D C;  1YFN A;  4JRK A;  1R0B G;  2PU9 B;  2JS2 A;  3JCM d;  1OYX A;  4RG8 A;  2JW4 A;  1NBE B;  4AG2 C;  4DBR A;  2MOX A;  3DLM A;  1WX6 A;  4E7L A;  1VQP Q;  4QVC A;  1VOM A;  3GF5 A;  1B34 B;  4JJN K;  4HXJ A;  4F7U G;  1ARK A;  2QQ9 A;  3CC4 A;  3TSW A;  2QAS A;  5KYY A;  3HRT A;  5C6S A;  2QYZ A;  1B07 A;  2K79 A;  1E6G A;  1N8R C;  3CMA T;  2DX1 A;  2KRO A;  2DM1 A;  2DBM A;  4A4H A;  2CYZ B;  4OMO A;  1UGP B;  1RAD B;  3P8B B;  1RAE B;  4KH0 B;  4XU3 A;  4E7S A;  3OYL A;  4M7D D;  4JZ3 A;  2JS0 A;  2GQI A;  1WXT A;  5I2S A;  4BI4 A;  5LJ3 j;  1K73 R;  4HVU A;  1QKW A;  4RUG A;  1SPK A;  4F16 A;  1EZZ B;  3CCL T;  3UF4 A;  3SFM A;  1UJY A;  1HYO A;  4OMP A;  2QK0 A;  4OGE A;  3CD6 T;  3MEU A;  4M75 G;  3OS2 A;  2R5A A;  1I1J A;  1WFW A;  2KVQ G;  1BI3 A;  3EAE A;  4Y92 A;  2CKK A;  2KSS A;  1VQ5 Q;  4HCK A;  2P4T A;  2JN0 A;  4BI8 B;  3M53 A;  8AT1 B;  3UWN A;  1VQN Q;  2AZS A;  2ZPB B;  2O9S A;  2A36 A;  3OB9 A;  2OX7 A;  3OYG A;  1NE8 A;  3D7S B;  3I5S A;  1UB4 A;  2M1H A;  2FVU A;  3JB9 H;  1TWB A;  5DM7 R;  2EJF A;  1FXX A;  5GAN g;  1G3T A;  3I9Q A;  1VQ8 T;  2D8H A;  3OA6 A;  1BCM A;  4XU2 A;  2E65 A;  1T0H A;  2E5K A;  1MMN A;  1IHV A;  3TCJ A;  4C0D C;  5ECA A;  3CCR A;  5GMK i;  5LL6 S;  3MKD A;  4KBM B;  4RTX A;  5GAN e;  5GAM j;  2KNB B;  2BZ8 A;  1Y57 A;  4ELY C;  4M78 B;  4ATO A;  1KIK A;  4IUR A;  1ZSG A;  2HL3 A;  5L8R E;  3M0T A;  4NOY A;  3QUI A;  3P8D A;  3QWX X;  1PWT A;  3CBO A;  2G3R A;  4FYY B;  1QP3 A;  2GQV A;  3A98 A;  4PJO E;  2L8D A;  2K2M A;  4QQ6 A;  2O9V A;  2DZ9 A;  4PFZ A;  3OW2 S;  3CCM A;  4OGC A;  3JV3 A;  1M27 C;  2HDA A;  1W2B P;  5CKE A;  2ED1 A;  1KD1 C;  4X1V A;  4EMK A;  1VQ4 A;  1RAF B;  2BIV A;  1QWF A;  5IHN A;  1JXO A;  3QG1 A;  3QXE B;  1GBQ A;  1WGS A;  3TEE A;  3X24 B;  2X3W D;  4E6R A;  1YWO A;  2P4R A;  1LOJ A;  2QTX A;  5CAI A;  4MDW A;  1FWZ A;  4M77 C;  2PVD B;  2K3X A;  3VS6 A;  3TSZ A;  1M1K U;  2ZPI B;  4BE1 A;  1YIT A;  1VQK Q;  2AKK A;  1VQO A;  3EFO A;  1ABO A;  3CXC P;  4EPC A;  1SKU B;  1WJR A;  2LJ1 A;  2ZAE A;  3J7A F;  2DFU A;  2RA2 A;  4LD9 K;  2RNA A;  3JCM c;  1U1S A;  3HKS A;  3C4S A;  5A0D A;  3ZFJ A;  4XTZ A;  3OYE A;  3JCM g;  2RHI A;  5CR2 A;  2KT1 A;  5GJV B;  4XTV A;  4PKC C;  1YJ9 A;  4E47 A;  1U06 A;  2RI2 A;  2FO0 A;  3BY7 A;  1UGS B;  1VQP T;  4F7U B;  2HZY A;  1NLO C;  1WDX A;  3CCU Q;  4X9C A;  2RQT A;  3JCM e;  3HHT B;  3A8H B;  5HK3 A;  2O4X B;  1SSH A;  1RLQ C;  3TVT A;  2NUP A;  2J7I A;  4M77 D;  4Z88 A;  1TH7 A;  1Q82 C;  1D1A A;  2COZ A;  1WQW A;  2DE0 X;  1Q81 C;  2FL7 A;  5FRM A;  1Q7Y U;  2DRK A;  4GLM A;  4JUV A;  2JM9 A;  3HL8 A;  4RTW A;  4BE0 A;  3JCM J;  3VS4 A;  3QJ6 A;  1F1B B;  2OAW A;  3OS0 A;  3CCS A;  1ZSZ A;  1QCO A;  4QT7 A;  1GL5 A;  3JCM b;  2BE9 B;  2DKG A;  2YHT A;  4C5G A;  1MGQ A;  1U3O A;  4JZ4 A;  2COY A;  5HK0 A;  4D6W A;  1SEM A;  2MAM A;  1T3L A;  3C12 A;  4LDY A;  3QDF A;  1FYN A;  1ZQ1 A;  3VYH B;  4DBF A;  2Y4X A;  1BK2 A;  2RK1 A;  1QLY A;  2LQ8 A;  2WSE E;  2KGT A;  4DBQ A;  4M75 B;  5GMK e;  3CPW P;  2YLC A;  3RDV A;  1D1C A;  2CP5 A;  3M5A A;  2X4Y A;  2AT1 B;  4PFP A;  2QG9 B;  2DJQ A;  4FM4 B;  4L59 A;  3JSC A;  1LVK A;  3V8L A;  3CME A;  2E64 A;  2EYX A;  2VB6 A;  3EFO B;  2KRM A;  3J81 E;  3L2V A;  1YHQ A;  1VIE A;  2XDD A;  1J3T A;  1M2O A;  4ZTF A;  3CCQ A;  2KXC A;  2LQK A;  1KFZ A;  1Y71 A;  2GFU A;  1YN8 A;  4HT9 A;  3NGP A;  5HKC A;  3N5B B;  3FJ5 A;  3RNJ A;  3I56 T;  4HA8 A;  2A28 A;  2OTL Q;  2DIL A;  1IZ6 A;  3SHW A;  4JRP A;  3PNW C;  2AIR B;  3A8G B;  3MO8 A;  2JNG A;  4WCI A;  4CRI A;  5IHK A;  3RER A;  1A0N B;  2XI9 A;  1YI2 A;  1N5Z A;  4MDX A;  4BUG A;  2KI7 A;  2QGF B;  4BDZ A;  2A7Y A;  1CKA A;  1M2V A;  1RL2 A;  3SB2 A;  2QA4 T;  3REA B;  2DNU A;  1YJN T;  5CK9 A;  3H0I A;  1M8V A;  3I55 A;  3GPL A;  2XD0 A;  1XNI A;  1ACM B;  1B7T A;  4C8Q F;  1BIB A;  1GFC A;  4ZGE B;  2QQA A;  1JEG A;  4LDW A;  1RAB B;  3P8H A;  1VIF A;  2CDT A;  1WIE A;  4NL2 A;  1K0S A;  3RKW A;  2VAS A;  4M7A F;  2XDB A;  3CMA Q;  2V1Q A;  3E9G A;  2ENM A;  5I22 A;  1YP5 A;  2MYS A;  1K73 C;  3NHN A;  2FEI A;  2PVG B;  5EC7 A;  3UA6 A;  2PUK B;  4PK4 A;  2EYY A;  1IRX A;  3EGU A;  3OQ5 A;  1VQ7 T;  1UGQ B;  5C0M A;  5LJ5 f;  2XID A;  4R56 A;  3EG3 A;  2ABL A;  1MV0 B;  3MET A;  3M9Q A;  5IH2 A;  3M56 A;  1I5O B;  2QEX T;  4II1 A;  2RQU A;  2HKQ B;  4C92 F;  1OPK A;  3CCL Q;  2PZ1 A;  4M78 F;  3CC7 A;  3CD6 Q;  2KY9 A;  2MWP A;  1N8R U;  1VQ9 T;  1NPP A;  1X69 A;  1JRI A;  3HP9 A;  1K9M R;  3LX7 A;  2EJG A;  2K7A A;  1C0M A;  1MUZ A;  4YTL A;  4KUD K;  2MI6 A;  2LMJ A;  3VU3 C;  1BI2 A;  4KGV B;  4L6V 5;  2P0K A;  3M57 A;  4N4G A;  1R0C B;  4RTV A;  1AD5 A;  1MV3 A;  3QYH B;  1VQM T;  2PUO B;  2M02 A;  4C5E A;  4OB2 B;  1VQ8 Q;  1Q86 C;  4O5V A;  3ME9 A;  1XQH A;  2KAF A;  2E70 A;  4LNP A;  1RLP C;  1BCO A;  1RAC B;  2VV5 A;  2LQW A;  3FIF A;  4OVA A;  1PG5 B;  1M3C A;  2KYM A;  4D8D A;  3IQL A;  2EVR A;  1K8A U;  3UAT A;  2ZGW A;  3QZ9 B;  2EQM A;  1TOV A;  5I21 A;  2F2X A;  3CC2 A;  4LN2 A;  4PL6 A;  1H3Z A;  2ZPG B;  4M78 C;  4EDU A;  2O2O A;  3PIO A;  1PRL C;  1ABQ A;  4IIO A;  4QVZ A;  1UE9 A;  2IG0 A;  4J9C A;  2X51 A;  3VS5 A;  4EMG A;  3ZL7 C;  1B3Q A;  1WHM A;  2QAZ A;  5D6Y A;  3G71 A;  5GMK l;  1VQ6 A;  3VUZ A;  4M7D F;  2MF2 A;  2JVV A;  4CC7 A;  1Y96 A;  3J80 E;  2IPO B;  2LNH B;  5KE2 A;  2K5F A;  4FT2 A;  5I2M A;  4PJO G;  1SRL A;  6AT1 B;  2W0Z A;  4IUQ A;  3JB9 D;  2C06 A;  3MCA B;  4E2F B;  1QVF A;  4A53 A;  2SRC A;  5AT1 B;  2JTF A;  2QXF A;  2VC8 A;  2DXT A;  3FLG A;  4GBQ A;  1Q95 G;  1KQ2 A;  4KUL A;  2RF0 A;  4E7K A;  1XOV A;  4JDS A;  2HMA A;  2OTJ Q;  1VQL A;  2J6O A;  3L2R A;  4JJC A;  1FMV A;  2EWN A;  2NUT B;  2EQK A;  5GAM f;  1ZUU A;  1JBM A;  1LJO A;  2DXU A;  3ZBD A;  3I5R A;  4DQ2 A;  2P84 A;  1EFN A;  1N27 A;  2EYZ A;  1AWX A;  3QKJ A;  1KJW A;  1RAH B;  3URG A;  5CKH A;  3PTA A;  3M0P A;  3JAM E;  2D9T A;  3CXC S;  4BI3 A;  2EGC A;  3CCV A;  3PGG A;  4XQ3 A;  2R5M A;  4C5H A;  2DL8 A;  4A63 B;  1OQK A;  3CCR Q;  2RPN A;  1JJ2 A;  3M54 A;  2E41 A;  2YDL A;  1CSK A;  3CCJ A;  2HQH A;  3QHS A;  2LZ6 B;  1SSF A;  2E12 A;  2CSQ A;  4LUE A;  1SF9 A;  1NPR A;  1UGV A;  1QP2 A;  1D0X A;  5LJ5 d;  2K57 A;  5A2Q E;  1G5V A;  1AZG B;  1MMD A;  1WLP B;  2FPE A;  1X43 A;  4A4F A;  1PNJ A;  2L2P A;  1HXD A;  2EQJ A;  4PJO A;  3G4S A;  2FYK A;  1YIJ T;  2RQR A;  4PJM A;  2L89 A;  2SEM A;  1Y96 B;  4LDU A;  5GAN h;  4J9H A;  1RI0 A;  4VUB A;  4A4G A;  1NJI C;  2DER A;  1UTI A;  4OMM A;  3X25 B;  4ZTJ A;  2CZ6 B;  5GAO r;  4ESR A;  2LDM A;  4M75 C;  1SHG A;  5CQX A;  4A54 A;  4RCB A;  2JM8 A;  5DLQ E;  1WZO A;  1M3A A;  1QVG S;  2MIO A;  2AK5 A;  2BUD A;  4FW2 A;  3E9F A;  8ATC B;  4C8Q E;  1M1G A;  3PIP A;  2YLB A;  3HRU A;  1NEB A;  2DYI A;  2LNV A;  2HEQ A;  1S72 T;  4B6M A;  3CPF A;  4NL3 A;  3S3O A;  5CVI A;  1GCQ A;  4M7A E;  1E7O A;  3ER0 A;  2HKN A;  1VUB A;  3I56 Q;  1AVZ C;  2RQV A;  2RJD A;  5DLO A;  1K0X A;  2CRE A;  2B86 A;  5LJ3 d;  5GAN 3;  1I0C A;  3HRS A;  3OYH A;  4M77 F;  2HSE B;  1WXB A;  3GNG A;  2EPD A;  4FU6 A;  3JB9 I;  1Q86 R;  1QVF P;  4TVR A;  3VS1 A;  3HFO A;  5D7U A;  2MWO A;  2QA4 Q;  4M75 D;  1Q7Y R;  1YJN Q;  3EG1 A;  5KYY B;  4J9I A;  1M90 U;  1QVG A;  3CC4 T;  2BE7 D;  4C92 E;  1QQJ A;  4IUV A;  3G7Z A;  2BZY A;  4J7F A;  5CO7 A;  2J05 A;  5KH6 A;  2ED0 A;  2OAU A;  2M16 A;  1D0Z A;  1I07 A;  2QDY B;  7AT1 B;  4WF2 A;  4PJO B;  5J3B A;  1AWW A;  3GNF B;  3M0U A;  4PFO A;  5FU7 B;  4C5I A;  1ZUK A;  2DPP B;  1K4U S;  1VA7 A;  1C6V X;  2LC4 A;  3JCM h;  2QDL A;  4FSS A;  9ATC B;  3OYK A;  5KYW A;  1YJW A;  1X6B A;  3M58 A;  3C95 A;  1VQ7 Q;  2FRY A;  2K6D A;  2ZPE B;  5GAM d;  4C0G A;  1PHT A;  2RB6 A;  1RUW A;  4KH1 B;  3E19 A;  1JJ2 P;  2LRQ A;  1K9M C;  3M4G A;  3RMS A;  2QEX Q;  2F69 A;  2OTJ T;  1MMA A;  5IT9 E;  4XTX A;  2E3H A;  2O88 A;  1QVP A;  3QZ5 B;  1WHH A;  2A08 A;  2WAC A;  4AFZ C;  3CEY A;  2X4J A;  1VQ9 Q;  1TUD A;  1WPY A;  4FCY A;  2D8J A;  2J6F A;  1BYM A;  2YUP A;  1AWJ A;  2CH4 W;  3OW2 A;  2LT4 A;  3RKX A;  3VS0 A;  4LDV A;  3LWH A;  1VQ5 A;  1WYX A;  2YWW A;  1W1F A;  2K9G A;  1VQN A;  1OU9 A;  3CBM A;  5GAO n;  2CUD A;  4CC2 A;  1TUC A;  1VQM Q;  3KXT A;  5DY9 A;  5GMK h;  1BB9 A;  4M7D E;  2CT4 A;  2DIG A;  1WHL A;  2ROT A;  2XG8 D;  4MZT A;  2X35 A;  3CCR T;  2BZX A;  2L3R A;  1K9A A;  4RMO A;  3VKI A;  1KQS S;  3KBG A;  3QBY A;  4Q5W A;  2JZ2 A; 
#chains in the Genus database with same CATH homology
 4NL2 A;  3RKW A;  1P92 A;  1I5L A;  2L5Q A;  5GAN 7;  5CQY A;  2XDB A;  4M7A F;  5GAN 4;  5LJ5 g;  1YCY A;  1JJ2 S;  3E9G A;  3OYY A;  3UDC A;  2RH2 A;  1OI1 A;  1K73 C;  4FSX A;  3CCV T;  2VXF A;  3WVE B;  4BD3 A;  4M7A B;  4BDY A;  2PVG B;  4M7D A;  2PUK B;  4IUU A;  4E7H A;  3INZ A;  3OQ5 A;  4FIB A;  1VQ7 T;  1UGQ B;  3WVD B;  4PNO A;  3GP8 A;  3BDU A;  4KT0 E;  5C0M A;  2XID A;  2BKD N;  5LJ5 f;  5LJ5 e;  4R56 A;  4C92 D;  2EKO A;  3OYN A;  4DA4 A;  1H64 1;  3MET A;  3M9Q A;  3CCJ T;  5J26 A;  2B8A A;  3M56 A;  2K5I A;  4JRI A;  4M78 D;  3JCM V;  4L5G A;  4LD6 A;  2EYQ A;  5GAN 6;  2QEX T;  3CCM T;  2CZ7 B;  2F5T X;  4Y28 E;  1VQP A;  4II1 A;  4J83 A;  2EAY A;  4EMK B;  1K9M U;  4ME7 A;  3L2W A;  1S72 A;  1W4S A;  2DAQ A;  2WSC E;  4C92 F;  3OS5 A;  4F7U A;  4Z02 A;  1I8F A;  1VQ4 T;  3NFC A;  4M78 F;  2V8I A;  3EFS A;  3CC7 A;  4M78 E;  3HPW A;  2YRV A;  4HKE A;  3CPW A;  3CCE A;  2KY9 A;  3LH0 A;  2MWP A;  1N8R U;  2OTL T;  2O4X A;  1VQ9 T;  1NPP A;  1JRI A;  4BE2 A;  4JRQ A;  3HP9 A;  4M7D C;  3LX7 A;  1KQ1 A;  2EJG A;  4C92 B;  3OYA A;  2KMT A;  4PLI A;  3R6O A;  3OSS C;  4JRK A;  5J39 A;  4PJO B;  4JLI A;  3FB9 A;  1O9S A;  4J6Y A;  1KQS A;  2LTO A;  3FRN A;  4N0A C;  4N4H A;  3RES A;  3TRE A;  1ZBX A;  4YTL A;  3G4S T;  2MI6 A;  4KUD K;  2PU9 B;  3VU3 C;  3TU4 K;  3JCM d;  1OYX A;  4RG8 A;  1BI2 A;  4L6V 5;  3S3M A;  2P0K A;  3M57 A;  4N4G A;  3DLM A;  3FDR A;  4E7L A;  5CIU A;  4QVC A;  3GF5 A;  3VJP A;  3BDL A;  3QYH B;  2ZCF B;  2R57 A;  1B34 B;  1VQM T;  2PUO B;  2HBP A;  4C5E A;  4JJN K;  4OB2 B;  2AHJ B;  4F7U G;  1Q86 C;  4O5V A;  3ME9 A;  2HNI A;  4M77 A;  3LLR A;  1XQH A;  2KAF A;  5IAY A;  2E70 A;  2QQ9 A;  1YIT T;  3CC4 A;  5HY6 A;  4B9X A;  1VQO T;  3FIF A;  2VV5 A;  3HRT A;  4OVA A;  4R55 A;  3DLL A;  5C6S A;  1XTD A;  2H3J A;  1IRE B;  3SWN A;  3QYG B;  1VQK A;  5KCH A;  1N6A A;  1OZ3 A;  2QQR A;  1N8R C;  5LJ5 h;  1K8A U;  2HQE A;  2CS7 A;  2ZPF B;  2ZGW A;  3QZ9 B;  2EQM A;  2O01 E;  3PT9 A;  3SD4 A;  4C0Z A;  3CMA T;  5I21 A;  3JCM X;  2X4W A;  4A4H A;  4RKU E;  3Q1J A;  4M75 A;  2CYZ B;  3CC2 A;  2PQW A;  1KG1 A;  4PL6 A;  5FU6 C;  1X01 A;  2ZPG B;  1H3Z A;  1UGP B;  3P8B B;  2CZ1 B;  1I81 A;  4M78 C;  4EDU A;  5M9O A;  1M9S A;  1YJ9 T;  1K73 U;  3PIO A;  4XU3 A;  4M77 G;  3A8O B;  3ASK A;  4QVZ A;  3OYL A;  2FHD A;  4M7D D;  2IG0 A;  1DJ7 B;  2E1H A;  4EMG A;  3SWN C;  5I2S A;  3A8M B;  5D6X A;  4BI4 A;  2DZC A;  5LJ3 j;  4FL6 A;  5D6Y A;  3G71 A;  5GMK l;  1VQ6 A;  3VUZ A;  4M7D F;  3VYG A;  3CCU A;  2MF2 A;  2JVV A;  3A5Z B;  5CKD A;  4Y91 A;  1Y96 A;  3FJP A;  4XTU A;  5KE2 A;  3J80 E;  3CCL T;  2XIC A;  3SFM A;  5FLX E;  3OMG A;  2K5F A;  4FT2 A;  4OGE A;  4QQD A;  5I2M A;  4PJO G;  3MEU A;  3MP8 A;  4M75 G;  2NLU A;  3CD6 T;  3HFN A;  4M7D B;  3OS2 A;  4IUQ A;  3I56 A;  2R5A A;  2DO3 A;  2RJC A;  3JB9 D;  3OYJ A;  3VUB A;  2KVQ G;  1BI3 A;  3EAE A;  3MCA B;  4X34 A;  2C06 A;  2CKK A;  2CZ0 B;  2KSS A;  4F7U E;  2P4T A;  2KDS A;  2JN0 A;  4XU1 A;  4BI8 B;  1MHN A;  3M53 A;  1QVF A;  3UWN A;  4A53 A;  3JB9 J;  1GXI E;  1BI0 A;  3CCS T;  2JTF A;  2QXF A;  2VC8 A;  3JB9 F;  2ZPB B;  1Y7X A;  4J8O A;  2HQX A;  2XKO C;  3RUX A;  2DXT A;  3FLG A;  3OB9 A;  4IKF A;  3OYG A;  4GLK A;  1NE8 A;  3F70 A;  1G3S A;  4MML A;  1UB4 A;  2M1H A;  2FVU A;  2E6Z A;  5GAM g;  3JB9 H;  2VYT A;  5DM7 R;  2EJF A;  1FXX A;  4KUL A;  4NS5 A;  5GAN g;  1G3T A;  1U1T A;  3OYI A;  2QA4 A;  1VQ8 T;  3V8K A;  1YJN A;  4E7K A;  1XOV A;  4JDS A;  3OA6 A;  1LNX A;  5GAN 2;  4XU2 A;  5A0G A;  2E65 A;  3L1A A;  1VQL A;  2DVE A;  1Q86 U;  3DKM A;  3LWI A;  3FEO A;  3TCJ A;  4C0D C;  3L2R A;  2HD0 A;  3E1S A;  3CCR A;  4QQG A;  5GMK i;  5LL6 S;  2RK2 A;  1R8O B;  2EWN A;  2EQK A;  4KBM B;  5GAM e;  5GAM f;  4BB7 A;  5GAO m;  2GCX A;  1JBM A;  5GAN e;  5GAN f;  3OYB A;  1LJO A;  2DXU A;  4HCB A;  4M77 E;  3T9N A;  3ZBD A;  5LJ3 h;  4DQ2 A;  5GAM j;  2D0Q B;  3MP1 A;  5GAN j;  4HT8 A;  1N9R A;  4MZP A;  4MMK A;  1N27 A;  2M9U A;  2RHY A;  4OMF B;  1Y07 A;  4J6W A;  3QDR B;  3QKJ A;  5FU6 B;  3CME T;  3URG A;  4ELY C;  2V8K A;  1O75 A;  5CKH A;  3PTA A;  3QO3 A;  3JAM E;  2X4X A;  2D9T A;  1D3B A;  4M78 B;  3CXC S;  1WJQ A;  2DTI A;  1YJW T;  4BI3 A;  4CI0 C;  4ATO A;  4IUR A;  3DB4 A;  3CCV A;  3X26 B;  3OYD A;  3PGG A;  4XQ3 A;  2R5M A;  1YHQ T;  3L2Q A;  5L8R E;  4ZGJ B;  4NOY A;  3QUI A;  3P8D A;  4IUP A;  1UGR B;  4C5H A;  3V7C A;  3CBO A;  3PFS A;  2G3R A;  3SWN B;  1VQ7 A;  2RJE A;  3CCQ T;  1QP3 A;  2GQV A;  4J5Y A;  1JJ2 A;  3M54 A;  4PJO E;  2XDP A;  2JOY A;  2L8D A;  2V8J A;  4M75 E;  1M5Q 1;  2E41 A;  4QVD A;  4QQ6 A;  3CCJ A;  1HK9 A;  5GAO l;  2DZ9 A;  3LYI A;  3OW2 S;  3QHS A;  4OGC A;  2QEX A;  3M4Y A;  3CCM A;  1SSF A;  2E12 A;  3BFM A;  4XTY A;  4C8Q G;  5CKE A;  2JTM A;  5KCO A;  1KD1 C;  4EMK A;  1VQ4 A;  2BIV A;  3NTK A;  2RJF A;  1NPR A;  1M8V A;  1QP2 A;  3QG1 A;  3QXE B;  3OBY A;  1Q7Y C;  2DK3 A;  3X28 B;  5LJ5 d;  3OYM A;  2OTL A;  2K57 A;  1WGS A;  4GY5 A;  3TEE A;  5GMK m;  1VQ9 A;  3X24 B;  3QSU A;  5A2Q E;  1G5V A;  2VUB A;  1WJS A;  4A4E A;  1VQ5 T;  1YI2 T;  2DD5 A;  3V8J A;  4OB0 B;  5LJ3 g;  1VQN T;  3QPH A;  4A4F A;  1LOJ A;  2E6N A;  2K3Y A;  4C0F A;  4M7A G;  2QTX A;  3MEW A;  1HXD A;  2EQJ A;  4PJO A;  3G4S A;  3H8Z A;  2FYK A;  5CAI A;  1YIJ T;  4N4I A;  1BKB A;  1M90 C;  3AHU A;  4MDW A;  2L89 A;  5GAM h;  1FWZ A;  4M77 C;  1Y96 B;  4LDU A;  5GAN h;  3I55 T;  3CBP A;  1RI0 A;  2LVM A;  4VUB A;  2PVD B;  2K3X A;  3LGL A;  1NZ9 A;  4A4G A;  1NJI C;  3RKY A;  1VQM A;  3GLX A;  2CGH A;  1M1K U;  5LJ3 f;  5LJ3 e;  1PSE A;  3JCM Q;  4V2S A;  3OMC A;  2LCL A;  2ZPI B;  3OY9 A;  2RHZ A;  3PMT A;  4BE1 A;  3X25 B;  4C0D B;  3C94 A;  4X9D A;  4ZTJ A;  1YIT A;  3ZEH A;  2RO0 A;  2ZZD A;  4IUT A;  1VQO A;  2CZ6 B;  2VGN A;  4OB1 B;  5GAN 5;  1U8R A;  5GAO r;  1X75 C;  3SDZ A;  4EPC A;  4LDX A;  3LGF A;  2F5K A;  2KQW A;  4RCC A;  2LDM A;  4PJO C;  4OB3 B;  4DOW A;  1WJR A;  4M75 C;  5CQX A;  4C92 G;  2R58 A;  5FU7 C;  3J7A F;  1ZHI A;  2K4Y A;  2RA2 A;  3L2Z A;  3OBW A;  4RCB A;  3WXM B;  5DLQ E;  4A54 A;  4LD9 K;  1X6O A;  3JCM c;  3CMA A;  5CCA A;  4ELZ C;  1U1S A;  3HKS A;  3JRZ A;  4ZGD B;  3C4S A;  5A0D A;  1QVG S;  3ZFJ A;  1KQ2 A;  4XTZ A;  3RMQ A;  2A3L A;  4OF1 A;  2I2L A;  4F7U F;  3GIB A;  3OYE A;  3JCM g;  3HSB A;  2RHI A;  1N9S A;  5CR2 A;  3GOX A;  1W2B S;  1WQ7 A;  2BUD A;  4XTV A;  3E9F A;  1JB0 E;  4PKC C;  1YJ9 A;  4E47 A;  5CKB A;  1M1G A;  4C8Q E;  2JUF A;  2RI2 A;  3PIP A;  2YLB A;  3NTH A;  3HRU A;  4J6X A;  3BY7 A;  1UGS B;  2M0O A;  1VQP T;  4XU0 A;  1BIA A;  4F7U B;  1M1K C;  5GAO q;  2LNV A;  2EJ9 A;  1S72 T;  4X9C A;  1KC8 U;  4FT4 A;  2E10 A;  3CPF A;  3UT1 A;  3JCM f;  3JCM e;  3HHT B;  3A8H B;  3CC7 T;  5HK3 A;  2O4X B;  3A8L B;  4J7I A;  3CCE T;  4HCC A;  1I4K 1;  4NL3 A;  4M77 D;  3S3O A;  1TH7 A;  5CVI A;  4M7A E;  3ER0 A;  3CCL A;  1D3B B;  2VGM A;  1VUB A;  5GAN 8;  1Q82 C;  3M55 A;  1WNL A;  1WQW A;  2RJD A;  5DLO A;  2K2V A;  2EQU A;  1Q81 C;  1KD1 U;  3CD6 A;  5LJ3 d;  2FL7 A;  5GAN 3;  3MHX A;  5FRM A;  3HRS A;  2QI2 A;  2DXC A;  4M77 F;  3OYH A;  1Q7Y U;  3GNG A;  4FU6 A;  4JUV A;  3HL8 A;  3JB9 I;  4BE0 A;  3JCM J;  4C8Q A;  1M1F A;  4TVR A;  2D6F A;  1UEB A;  3QJ6 A;  2P0P A;  3HFO A;  4QW2 A;  2KK4 A;  3OS0 A;  3CCS A;  2LCC A;  4N0A A;  3OS1 A;  5FRO A;  4M77 B;  3NTI A;  4PJO D;  2MWO A;  5EG2 A;  4M75 D;  2LT1 A;  3MEV A;  5LJ5 j;  3OYF A;  4BY6 C;  3JCM b;  1AHJ B;  2DKG A;  2YHT A;  4MZM A;  4C5G A;  1M90 U;  1MGQ A;  3QJY A;  1QVG A;  2RI5 A;  3M59 A;  3CC4 T;  4C92 E;  1VQ8 A;  1M4Z A;  4ZN1 A;  4D6W A;  1KHI A;  5HK0 A;  2MAM A;  1W2B A;  4PJO F;  3C12 A;  4IUV A;  4M7A A;  2PVO B;  4LDY A;  2RM4 A;  3PMI A;  4M75 F;  3G7Z A;  1KC8 C;  3L42 A;  1NJI U;  1QW1 A;  4HCZ A;  4J7F A;  2DJZ A;  5CO7 A;  1VQK T;  1ZQ1 A;  2DTO A;  3VYH B;  5KH6 A;  2OAU A;  2M16 A;  2Y4X A;  3O8V A;  4PLL A;  2RK1 A;  4OP0 A;  4C8Q C;  2QDY B;  1OZ2 A;  4WF2 A;  3OYC A;  3LW5 E;  2LQ8 A;  2WSE E;  2WSF E;  2XU8 A;  2IVW A;  2VXE A;  3OSV A;  4M75 B;  5J3B A;  3GNF B;  5FRN A;  4M7D G;  5GMK e;  2EFI A;  2YLC A;  1EIF A;  4O6J A;  3X20 B;  5FU7 B;  1G3W A;  4C5I A;  2DPP B;  3M5A A;  3CC2 T;  2X4Y A;  1YBY A;  4JLG A;  5IN1 A;  2RHU A;  3VV0 A;  4XTW A;  5GMK j;  3KUF A;  3EFR A;  4FM4 B;  3S6W A;  4L59 A;  4BAC A;  2LC4 A;  3JSC A;  2EIF A;  3JCM h;  3V8L A;  3CME A;  3S3N A;  3QII A;  3OYK A;  2E64 A;  4M7A C;  1PSF A;  1YJW A;  3M58 A;  2XK0 A;  3C95 A;  4C92 A;  2ZPE B;  5GAM d;  3J81 E;  5GAN d;  4M78 A;  4C0G A;  3L2V A;  4JS5 A;  2RB6 A;  1YHQ A;  4XK8 E;  3E19 A;  1VIE A;  2XDD A;  3JCM W;  2LRQ A;  3DB3 A;  3JB9 G;  1K9M C;  4ZTF A;  3G71 T;  1VQ6 T;  5CKF A;  3CCQ A;  3M4G A;  3RMS A;  4RG2 A;  4E7J A;  3CCU T;  2LQK A;  3L2U A;  1BI1 A;  2QQS A;  1Y71 A;  3CXC A;  4EMK C;  2F69 A;  2GFU A;  3G6E T;  2ZPH B;  4UC4 A;  4HT9 A;  2OTJ T;  5GAO p;  1QVF S;  2E5Q A;  3H6Z A;  5IT9 E;  1B34 A;  4XTX A;  5HKC A;  3N5B B;  2XHC A;  5KE3 A;  1QVP A;  3QZ5 B;  3JCM P;  3I56 T;  4HA8 A;  2RHX A;  2MMP A;  2WAC A;  1IZ6 A;  3BW1 A;  2X4J A;  3CEY A;  1FX7 A;  4ZN3 A;  4JRP A;  3PNW C;  4JS4 A;  1WPY A;  3A8G B;  4C92 C;  1Q82 U;  2RD1 A;  3MO8 A;  2P0Q A;  1BYM A;  2JNG A;  4CRI A;  4B9W A;  2HAX A;  1Q81 U;  2Y4Y A;  3OW2 A;  2GF7 A;  2LT4 A;  3RKX A;  3MP6 A;  3RER A;  4LDV A;  2XI9 A;  3LWH A;  4M78 G;  1YI2 A;  1VQ5 A;  4MDX A;  4BUG A;  1V29 B;  4P5N A;  4C8Q D;  3RIR A;  1VQN A;  3CBM A;  5GAO n;  3UPU A;  4BDZ A;  2A7Y A;  1RL2 A;  1G3Y A;  3SB2 A;  2QA4 T;  1YIJ A;  4BY6 B;  2DIQ A;  4KUI A;  1YJN T;  5CK9 A;  3KXT A;  5DY9 A;  2GFA A;  3MEA A;  2DD4 A;  5GMK h;  3V7S A;  3I55 A;  1XNI A;  3GPL A;  2XD0 A;  4A4K A;  2DEQ A;  3CPW S;  4C8Q F;  4M7D E;  1BIB A;  2DIG A;  4DOV A;  1VQL T;  2XG8 D;  3G6E A;  4MZT A;  1KHC A;  2DTH A;  2RI3 A;  2X35 A;  3FC3 A;  2DXB A;  4XAX B;  3CCR T;  2Y90 A;  5AYF A;  4E7I A;  2OTJ A;  2L3R A;  2K5L A;  5D6W A;  4ZGE B;  5A0L A;  4M7A D;  2QQA A;  3V7R A;  4RMO A;  4LDW A;  3VKI A;  4EMH A;  3P8H A;  2FB7 A;  4C8Q B;  2QQB A;  1K8A C;  1KQS S;  3KBG A;  1VIF A;  3QBY A;  2LX9 A;  4Q5W A;  2JZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...