4J5YA

Crystal structure of hfq from pseudomonas aeruginosa in complex with atp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
molecule keywords Protein hfq
total genus 14
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4j5yA00
4C92B 4M77A 2DZ9A 4M7DG 1N9SA 1BIBA 3JB9J 3RIRA 4F7UE 4MMKA 2YHTA 5GAOn 2DXTA 2YLCA 3JCMb 5GMKi 2Y90A 3L2ZA 2ZGWA 2DTOA 3JB9H 4HT8A 1U1SA 4A54A 5GAN8 1M8VA 2DVEA 3BFMA 4C8QE 4M7DC 2QTXA 5GMKm 3EFSA 5DY9A 2EJ9A 3AHUA 4JUVA 1WQ7A 2JN0A 3FB9A 3QO3A 4EMKC 4M7DD 4C8QD 2CGHA 4J6XA 4XU1A 1D3BA 1WPYA 2E64A 4NOYA 4M7AB 4PJOB 1D3BB 3QHSA 3JB9F 5GAN7 1KQ1A 1LNXA 2FYKA 3HFOA 4M75B 4M77G 5I21A 1U1TA 1MGQA 4C8QG 1I81A 4JLIA 4PNOA 4EMKB 5LJ5g 4HA8A 5LJ5f 5GANf 4XU2A 4Y91A 4QVDA 5GAMg 4M7AC 2I2LA 2RB6A 3RKXA 4PJOC 3V8JA 4M7DB 4J5YA 2DTHA 5GAN6 3SWNB 4RCCA 5GANh 4J6YA 5GANd 4M78C 5CAIA 5LJ5d 3EFRA 3FIFA 4OP0A 4JRIA 4M75F 4V2SA 4XU3A 4WF2A 2RM4A 4M7AA 4NL2A 4JRKA 3BW1A 4M77D 4XTZA 5GAMj 3JB9D 4PJOA 4C92C 3V8KA 4XTXA 3JCMf 4C8QF 3JCMP 2VXFA 4HT9A 1H641 2DTIA 2E1HA 5LJ3f 1BIAA 4M77F 4XQ3A 4XTUA 4F7UB 1M5Q1 1N9RA 5GANe 3JCMQ 5GAOl 1B34B 3JCMV 3JCMc 5GMKl 3SB2A 3JCMe 3JB9G 2E65A 2DKGA 5LJ3e 3HFNA 1WNLA 1LJOA 2RA2A 4EMKA 4M7AE 4X9CA 4PJOE 4QVCA 2RD1A 4M75E 2EWNA 3FJPA 5GAN5 5GAOq 1YCYA 1WQWA 4A53A 3QUIA 4M78E 4M77B 4F7UF 3RKWA 2DJZA 5GAMe 3JB9I 4X9DA 4XTWA 1JRIA 4M75D 3RUXA 1HXDA 5LJ5j 3BDUA 4XU0A 3RKYA 3VU3C 2EJGA 1HK9A 5GMKh 3JCMW 4M7DA 4M7DF 2EAYA 5LJ5e 4C92E 4M78A 5GAOr 5GANj 1I5LA 1B34A 3GIBA 4M75G 4DQ2A 3V7CA 5LJ3j 4F7UG 4J6WA 3RESA 4XTVA 4N0AA 5GAMd 2HNIA 5GAMh 5GAOm 3L1AA 4C92A 3HSBA 3PGGA 4M7AD 4M78F 4PJOD 5GANg 4C8QB 4EMHA 2DXUA 3JCMg 1X01A 2K57A 2VC8A 3V7SA 4C92G 1I8FA 5GMKe 5GAMf 3V8LA 5LJ3g 1TH7A 4M75C 5LJ5h 4NL3A 4RCBA 4M7AF 4PJOF 1JBMA 4N0AC 5GMKj 4EMGA 2E10A 4PJOG 3RERA 1LOJA 4M7AG 1I4K1 3JCMX 5GAN3 1KQ2A 4C92F 3JCMh 2EJFA 4C92D 5GAOp 4C8QC 4M7DE 3JCMd 5LJ3h 3V7RA 3SWNA 4M77C 5LJ3d 4M78G 5GAN2 3BY7A 4M78B 4M77E 5GAN4 3JCMJ 4M75A 2YLBA 3M4GA 3QSUA 2FB7A 4MMLA 4F7UA 4XTYA 2VXEA 1Y96A 4M78D 3INZA 4C8QA 2DEQA 2E41A 3SWNC 2DZCA 1Y96B
chains in the Genus database with same CATH superfamily
4J9EA 3EGXB 1BIBA 3RIRA 4MMKA 1QVFS 2FVUA 1QWEA 1YNZA 1M9SA 3FEOA 1UFFA 2KY9A 2Y90A 2X3WD 3N5BB 5KYNA 4O5VA 3CC4T 4HCZA 1X6OA 4BY6B 2CT4A 1MHNA 1OYXA 3SEMA 1GCQA 1BKBA 1AEYA 3MEWA 4LDWA 2RJDA 2E64A 2JW4A 3HFOA 4JZ4A 3OW2P 4JLIA 2DERA 4HA8A 2HQEA 4QVDA 2GTOA 5GAMg 1KD1C 4JJNK 2RB6A 4ELYC 5FU6B 4J5YA 4KGZB 2DF6A 3REBB 2HKQB 3OYHA 1K4US 2WSFE 1M3CA 1VQ4T 2JJ9A 2LQWA 3EG9A 2J6FA 3S6WA 2XMFA 3ASKA 3UA7A 1UUEA 4XTZA 2ECZA 3M55A 2KDSA 5HY6A 2YXYA 3LGLA 1VQOT 4AFUC 2DX1A 5GJWB 2JTMA 1PG5B 1QP2A 4Y92A 9ATCB 2F2XA 5KYYA 4IUVA 4R0KA 3ZFJA 3EGXA 2AZVA 3H8ZA 2KNBB 3X20B 2HEQA 1M2OA 3UF4A 2ED0A 3QDFA 4N4HA 4BE0A 3IQLA 3VV0A 3CCQQ 4J6WA 3H6ZA 4MZPA 3I35A 1VQ7Q 3H0IA 3NFCA 2QA4A 2D1XA 3QDRB 5CO7A 4PJOD 4LN2A 3CXCS 2QA4T 1SSHA 3M0TA 3HRTA 3RMQA 4ANJA 1UJ0A 3A5ZB 4AFZC 1YI2A 1A0NB 1M2VA 2K6DA 1RAFB 3L2RA 4M75A 5CR2A 2EYWA 1GFDA 4PL6A 3MCAB 4AG2C 3M9QA 4LE9A 1M1KU 4BI4A 3DLLA 4ATOA 4PJNA 4C92B 2LP5A 2YHTA 1QVGP 3ZEHA 2D6FA 2EBPA 2ZPBB 2ZGWA 1KQSP 4KH0B 4E6RA 3TSWA 1H3ZA 2GCXA 1D0ZA 1MMAA 5FU7B 2RN8A 4M7DD 3OYAA 2CGHA 3MEUA 3QYGB 4NOYA 2F69A 3QIIA 4ZTJA 1WHHA 3CPFA 2RNAA 2KYBA 1KQSS 4JRPA 1YBYA 2QG9B 1NLOC 5LJ5d 3CCLA 2KYMA 2KBTA 1G3YA 2HBPA 1ABOA 3CCVA 5CQXA 2MI6A 4NL2A 4YTLA 4Y28E 2DYIA 1T0JA 3S3NA 2O2OA 2SEMA 3JB9G 4PKCC 2NUPB 1YITA 4BI3A 1YITT 2CT3A 5GAOq 1VQ6A 5KYWA 3OS1A 1VQ6T 2GGRA 2NWMA 5A0LA 1VQ5A 3VU3C 1RUWA 2JOYA 1ZA1B 3GLXA 1KHIA 1ZUUA 4LXCA 4DA4A 2K5LA 4FW1A 4A4KA 3CPWS 1N8RC 1K8AR 4KBMB 2E5QA 3MPUB 2XKOC 3MO8A 3CC2A 3LH0A 1OEBA 4C8QB 3JCMg 2K57A 3OYYA 3L2QA 3V8LA 2OTJT 4JPBW 3UWNA 2BE7D 1MMDA 1QCNA 3OYEA 1HJDA 2J05A 1UHFA 2J6OA 4LD6A 3ZBDA 3CMET 2ZPEB 3CD6Q 3JCMJ 3M4GA 4BY6C 2CZ7B 3MP1A 5HKCA 4JZ3A 4C8QA 2DEQA 3CCQT 1WJRA 1I07A 4FYVB 1QVGA 2PVOB 3CCUA 2B86A 1VQ8Q 3M4YA 1N8RR 2K7AA 3EG1A 4DOWA 3CCUT 1FX7A 2P0KA 5A0DA 2VASA 2K9GA 3JB9H 2DVEA 2HL5C 5DY9A 2YWWA 2WACA 1S72T 5AT1B 4FSXA 1BI2A 3G6EA 2QQ9A 1U1TA 5LJ5f 3EHRA 1WLPB 4J9BA 2P0QA 1UGVA 2MAMA 1U3OA 1RACB 2RMOA 3GNGA 1YHQA 2RI3A 4C5EA 4XU3A 1RAHB 2E1HA 2O9VA 3M0UA 3CCLT 2MPXC 5FW9A 4ORZA 1LJOA 3OS2A 2YT6A 2AZSA 3EG3A 2AK5A 2V1QA 1M1GA 1IZ6A 2KRSA 2KXDA 3JB9I 2DYBA 4JJBA 1BB9A 2FPDA 3H0FA 2EGAA 5GMKh 3FDRA 3I56T 2DJQA 2RJCA 5LJ3j 2H3JA 2CREA 4L6V5 3FC3A 5GAMh 1UGPB 2PNIA 3META 2DBMA 2QGGA 4OB1B 1UJYA 4MDWA 1NYFA 2L89A 4C92F 1N6AA 4J9FA 1RABB 3MP8A 4JJDA 4ZN1A 3CCJA 2HBWA 4F14A 2CUBA 3VS1A 3FJ5A 2EYZA 5GAOn 1Q86U 3J7AF 2F1LA 2KEAA 1ZSZB 3E19A 1TG0A 1UB4A 2M51A 3CCQA 2JVVA 4GBQA 1M30A 1VQ8A 3TU4K 1Q7YC 3X25B 1BU1A 4C8QD 5IHKA 1Y0MA 1AZGB 2W0ZA 1W6XA 2XDPA 1D1AA 1AT1B 1Z9QA 2BTTA 2LCLA 2A0FB 1RI9A 4E7ZA 1QW1A 5GANd 4M78C 4HCCA 2W10A 2YUQA 3EAEA 3G6EQ 3G6ET 1ZBJA 4OP0A 3G4SA 1OX8A 3KUFA 1ZQ1A 4C92C 1WDXA 2QK0A 2AKLA 2VXFA 3OYJA 3CCRT 1ZSGA 1XNIA 4LDXA 2EGEA 1VQNA 4P5NA 4A53A 3QUIA 4LDUA 5GAMe 3OW2S 2RH2A 4N4IA 1CSKA 2JNGA 2QASA 1HXDA 2E70A 2D8JA 1ZBXA 4M4ZA 4M7DF 1WXUA 2KE9A 1VQKT 4IKFA 1WHLA 5IXFA 4ME7A 3G71A 3RESA 2RO0A 4HVVA 2JS0A 1AWOA 3G71T 1PD0A 1D09B 1OOTA 1NJIU 2O88A 2BZYA 3GBQA 2K3YA 1LOJA 3PVLA 2DL7A 4C8QC 1XJWB 1TU0B 2A08A 4M78B 2DXCA 2DD4A 3E9GA 1G3SA 3EG0A 4F7UA 2DPPB 4Z88A 2LX7A 5I11A 1AVZC 2CP7A 1NM7A 2J6KA 1VYUA 1PRLC 4FU6A 2YRDA 4KUIA 2MWOA 1MNDA 3VYGA 1SHFA 2CS7A 2M9UA 4E7LA 1G3TA 1YIJQ 5LL6S 1VQ5T 3FB9A 2LQ8A 1K73U 1FWZA 2Z0WA 3CCVQ 3VS3A 5IT9E 2QTVA 4AFQC 2FO0A 4RTUA 3JRZA 4EMKB 1V76A 3GNFB 3EFOB 1VQLT 5FROA 2DTHA 2PUKB 2PZ1A 4Q5WA 4RTWA 2LZ6B 1OULA 2CDTA 1QWFA 2AT1B 2QQSA 2RHXA 4C8QF 1VQPQ 4K11A 1JO8A 2BZ8A 3KXTA 3OQ5A 2L3PA 2VWFA 1BI1A 2X3XD 1OU8A 2RA2A 2NUTB 1NZ9A 1BK2A 4M75E 3CXCA 2XICA 1YJNT 3FLGA 1YJNA 4OGCA 3CMAQ 1GRIA 3OYDA 2A3LA 1VQ7A 2JUFA 2BZXA 2RJEA 2JXBA 1E6GA 3O8VA 3PE0A 2NUZA 1NEGA 4HKEA 4C92A 1MV3A 3QYHB 2RHZA 5ECAA 4EDUA 1G83A 2KRMA 3CCST 1VQKA 2P0PA 1RADB 4M7AF 3CCSA 3OW2A 4CC7A 3JCMh 3VUBA 1LVKA 3F70A 2EIFA 4J7IA 5GAN2 1QP3A 2DEUA 3M0RA 2XI9A 1M4ZA 4M78D 1VIEA 2QGFB 1K76A 3SWNC 3C94A 2CH4A 1OZ3A 2LJ3A 3NTHA 5KYYB 2V8IA 5KYUB 2QQBA 4AFSC 3CC4Q 1ZLMA 2BUDA 2DTOA 2QXFA 1GBQA 3MJXA 2CZ1B 1M1FA 2C0TA 3D7SB 3M56A 4E7JA 2JT4A 1YJWQ 2VKNA 1LNXA 1OX9A 2RQVA 5L23A 2FPEA 2QDYB 1R0CB 4Y91A 2L3RA 2I2LA 1SHGA 2X9HA 4LDVA 2RQWA 1K8AU 2X4XA 2ZPIB 4C0GA 2CP6A 3HTRA 3LW5E 4RTYA 3OA6A 4ZN3A 3M57A 2VV5A 1WNLA 3AT1B 1OPLA 1MUZA 2O4XA 3DLMA 5DLQE 4D6WA 1M8MA 4M77B 2G6FX 5CIUA 2IVWA 5LJ5e 1B07A 1KQSA 2X51A 4QVZA 3EGUA 4HCBA 1PWTA 5CK9A 2OX7A 1PRMC 2HL3A 3SFMA 5FWCA 4JS5A 5J39A 2RI2A 2LCCA 3VRYA 2QYZA 2EPDA 2VC8A 4MZTA 4C92G 3QJ6A 1KD1U 1T3SA 4PJOF 2JM9A 3CCRA 2QI2A 2DRKA 1WJSA 5GJVB 3L2VA 2KT1A 3U23A 1SRLA 4FT4A 1PD1A 1WHKA 1G2BA 1X69A 2VXEA 4J8OA 2KAFA 2LQNA 1GCQC 3MEVA 1W70A 2DXTA 4Z8AA 3TEEA 4E7SA 1O9SA 3H0HA 1YWPA 5KYUA 5GAN8 2DAQA 1OZ2A 3CCEA 1M1KR 3OMGA 1WQ7A 3QWXX 3TVTA 4BACA 2RHIA 3ZL7C 2FYKA 5I21A 1I0CA 1PSFA 3VS7A 2AIRB 3HKSA 3M0QA 1WA7A 4RKUE 5GAN6 1FMVA 4J6YA 3P8HA 4FL6A 4CI0C 3EFRA 2XDDA 1RLPC 2ZPFB 4DBHA 4WF2A 4A63B 1AHJB 2R5AA 3URGA 4HVWA 3PNWC 1C1AA 3JCMf 4R56A 1D1BA 4XQ3A 3OYNA 4XTUA 5GANe 3PTAA 1GXIE 5GMKl 1SRMA 3EGDA 1NG2A 1AD5A 1M1KC 1EZZB 1SG5A 4QVCA 4KULA 2DE0X 1EX4A 3OYFA 5AYFA 3ME9A 4CC4B 8AT1B 1MMNA 1PC0A 1WXTA 1OU9A 3RUXA 3C12A 5LJ5j 3CC7Q 3S3MA 3OBYA 2RPNA 2QA4Q 2VVKA 3PMTA 2JMCA 3OYCA 4C5HA 2F5KA 5GAMd 5L8RE 1YJ9A 3OY9A 4RG8A 2F2VA 1VQNQ 1YJ9T 2WSEE 4M75C 1VYVA 1JBMA 2BE9B 2HDAA 2LQKA 4BD3A 5GAOp 3HRSA 2YSQA 1YI2T 4C5IA 1XOVA 1YJWA 3QHSA 4M77A 1YJWT 2DZ9A 1ARKA 4F7UE 3HP9A 2LT1A 2XU8A 3JCMb 5GMKi 1TUGB 3SD4A 5FU7C 2HCKA 1VQNT 1M8VA 1V29B 4C0ZA 3CBMA 3S3OA 1VQ7T 3AHUA 2ENMA 2RK1A 3E1SA 2QAZA 2LJ0A 2L0AA 3NTKA 1KQ1A 3RNJA 1QVGS 1MGQA 1TOVA 1I81A 3CCET 1KC8R 1JU5C 2LX9A 4A4FA 3I5RA 3L2UA 2CYZB 1PM3A 1J3TA 4M75F 3ER0A 1PKTA 2JZ2A 3DB4A 2EKHA 3A98A 4XTXA 1Q82C 1JXOA 4DEYA 5IHNA 2PU9B 1FMWA 4QW2A 1C0MA 4J7FA 1Q82R 4A4EA 2DFUA 2LMJA 5GAN5 1WQWA 4IUPA 2V8KA 3NMZC 1KIKA 3QJYA 1V1CA 1VQLQ 1OV3A 4M75D 2IIMA 2CP5A 2M0OA 2A36A 5KE3A 3OYGA 1K9MC 2EAYA 1ZA2B 2H3EB 4M78A 1B34A 1QCFA 2FRYA 4E7KA 4OMFB 3OMCA 4XTVA 5KCHA 1H8KA 2EKOA 3HSBA 1OPKA 2HZYA 4DBRA 2PVGB 1T3LA 2GFUA 2GTJA 2C0IA 1VQ6Q 1KK7A 2P4RA 2QEXA 2E3IA 3OBWA 3OSSC 2HQXA 4X1VA 3SWNA 5LJ3d 1WI7A 2EVRA 4PFPA 3TQ7P 4JRQA 4A4HA 2A7YA 1VQOA 5CKFA 1X6BA 2KT8A 4XU1A 5CKHA 3M53A 3PVQA 1MMGA 3CMAA 2FZKB 1YIJA 3CMAT 2MWPA 2WSCE 2GNCA 3L2ZA 2NUPA 1IHWA 4C8QE 3QPHA 4QT7A 5KYXA 4OB2B 2JN0A 2JM8A 5KYWB 4OMPA 2CZ6B 2LNVA 3OYKA 1VQOQ 3TSZA 5GANf 1QVFA 5J26A 1VQ9A 3REAB 2LTOA 2Y4YA 3NTIA 4J9GA 1Q81U 2PTKA 1D0XA 2AHJB 1EFNA 4D8DA 2RQUA 3JB9D 1SPKA 1G8XA 2CP2A 2GF7A 2DL8A 1FXXA 1H641 1N5ZA 3CCRQ 1BIAA 4F7UB 5GAOl 2QDLA 3G71Q 1M5Q1 3JCMQ 2SRCA 2PVDB 3SB2A 2DKGA 1YI2Q 3OYBA 3VYHB 2DETA 4BI8B 2EWNA 1FMKA 1VIFA 2EQMA 1Q86C 2CSQA 2DJZA 1U8RA 2L3QA 2V8JA 4BUGA 1OQKA 1O75A 4UC4A 4OB0B 2YUOA 2JMAA 1Q7YU 3I56A 1KG1A 3M59A 4CRIA 2EYQA 3EHQA 2HNIA 4B9WA 1X2KA 2C0OA 4M78F 3HRUA 4DEXA 3G4SQ 1TH7A 2DL5A 1QMCA 1TTHB 2E10A 4M7AG 4JDSA 1WHJA 2RQTA 3JCMd 1SSFA 3OYMA 4M77C 3BY7A 2O31A 2QEXT 3CCLQ 1JEGA 4HVUA 4F17A 3INZA 5FWBA 3QZ5B 1Y96B 3P8BB 3OS5A 1H3HA 1N9SA 3NHNA 3EG9B 2EFIA 1ABQA 4AMCA 2O4XB 1GBRA 2YLCA 3C95A 4ZGDB 4RMOA 4M7DC 1TUDA 2QTXA 2KQWA 4JUVA 3UPUA 4FYXB 4EMKC 3CCMQ 1EIFA 2LCSA 3LWHA 4PJOB 1D3BB 3EG2A 4KGVB 1RAGB 5FU6C 3A8LB 2KMTA 1QVFP 2VGNA 3VKIA 2RF0A 1X43A 2EQUA 4XU2A 3CC2T 4IURA 1MNEA 1PCXA 1GL5A 2DL4A 3SWNB 4RCCA 3PIPA 1NJIC 1K0XA 2LNHB 2OAWA 3MHXA 4JRIA 4V2SA 2OJ2A 3P8DA 5HK0A 4JRKA 4PJOA 2EGCA 3G4ST 1AZEA 2IPOB 1UGSB 1X2QA 2ATCB 4M77F 2YDLA 1B34B 3JCMV 3J80E 1ACMB 3CQTA 3CCMT 4RTZA 5CQYA 4X9CA 2ZAEA 2YRCA 4B9XA 1QLYA 1M3AA 1BI0A 4LDYA 1KC8U 3EH1A 1JJ2A 5KCOA 3QZ9B 4RTTA 3VS6A 3GOXA 2DMOA 3CCJQ 4AG1C 2EQIA 4DBQA 5GAOm 4HXJA 5GANg 5GMKe 5GAMf 2X4YA 1W2BS 2VB6A 2DIQA 4PJOG 4IIMA 4XAXB 4J9IA 1NBEB 2DIGA 1AWWA 2DNUA 2B8AA 1VQMQ 1B7TA 2R57A 1B3QA 2K3BA 4MMLA 3VS5A 4XTYA 5C6SA 4ZGJB 4EPCA 2DZCA 3CD6T 3LYIA 2XD0A 4PFZA 2GBQA 4FCYA 3CD6A 1TSFA 4Z02A 4OMMA 3VS4A 2RK2A 3BDLA 4FM4B 2ABLA 3WVEB 1RI0A 1RLQC 4M75B 4QQGA 1R77A 1IRXA 1HYOA 5LJ5g 4PK4A 3QKJA 1K0SA 4M7AC 3M0SA 2XHCA 3O5ZA 3I55Q 1AWXA 3M54A 2HQHA 1W4SA 1ZSZC 4J9CA 2AKKA 2E6ZA 3M5AA 4MZMA 2FZCB 3LX7A 2X4WA 2V1RA 1WXBA 4J83A 3JCMP 1M90U 2C06A 5LJ3f 1Q95G 1NYGA 2JTEA 2O9SA 4M7DA 5DLOA 2J06A 3PT9A 1YWOA 4JJCA 2CP0A 1YIJT 4N4GA 2D0NA 1D0YA 1YCYA 1QVPA 4BDYA 1I5OB 1UHCA 3GPLA 2EQJA 3VUZA 2ZPHB 4IUQA 2LDMA 2RJFA 2YUPA 2EJGA 5CCAA 2HSEB 3JCMW 2LVMA 1ZHIA 3JAME 4QQDA 3GP8A 2DL3A 2LRQA 1WFWA 1VQ9T 3DKMA 2M02A 1I8FA 4RCBA 3RERA 1ZUYA 4BDZA 1Q86R 1I4K1 2M0YA 1X27A 3JCMX 4F16A 3V7RA 4RTVA 3X28B 2L2PA 3H9NA 2ED1A 4C0DC 1IREB 3X26B 5FRNA 4CC2A 2F2WA 2MCNA 3SDZA 3MKDA 1UGQB 2YRVA 1WYXA 4A54A 4Z89A 4ESRA 3A8OB 2MMPA 1YITQ 2CKKA 1Y07A 4KUDK 4M7AB 3CBPA 1TWBA 3LLRA 4L59A 2K2MA 1W2BA 3C4SA 2Y4XA 1PKSA 1BI3A 3QG1A 4WTOB 1T0HA 2COZA 4PJOC 3V8JA 4M7DB 1OI1A 1YJNQ 5CAIA 1XQHA 2MOXA 4M7AA 5GAMj 1HD3A 1JJ2S 2KXCA 5KYXB 3CCJT 1GFCA 4FYWB 2HSPA 2K4YA 1VQ4A 1JXMA 5EC7A 2ZZDA 3E2UA 3VRZA 1D1CA 4VUBA 2EW3A 1IHVA 2OTLQ 4PFOA 3CXCP 1JRIA 2DILA 1R8OB 2OTJQ 4GLKA 1WHMA 3RKYA 2ESWA 5GAOr 2NUTA 4DQ2A 5DM7R 1X6GA 1ZSZA 3HL8A 1VQPA 4D8KA 2P84A 2LT4A 3PGGA 4QKUA 1JB0E 2JTFA 1NPPA 1PSEA 3PFSA 3CEYA 5I2MA 3G7ZA 5GMKj 2DVJA 3KFVA 1VYTA 5GAN3 4PJLA 1KQ2A 2XDBA 4E7HA 2XIDA 5LJ3h 3I55T 4M78G 3CCMA 2CZ0B 3MP6A 4IUTA 4M77E 4FW2A 3VJPA 2P4TA 3FRNA 1K1ZA 1YHQQ 2DXBA 1W1FA 5J3BA 2XK0A 4WCIA 2DA9A 8ATCB 3PIOA 4AT1B 3LH5A 4J9DA 3EFOA 4HT8A 1Z9ZA 3EFSA 2EYXA 1S72A 1Q81R 1BBZA 3QO3A 2CP3A 1RAAB 1WJQA 5HK3A 2X35A 1N8RU 3UDCA 5D6XA 3JB9F 1PHTA 1N27A 2DRMA 4C8QG 4LUDA 1KFZA 4PNOA 1NEBA 4L5GA 1WX6A 3WXMB 2K5FA 2BIVA 1WHGA 3CPWP 2K5IA 2GFAA 1U06A 4R55A 2K79A 2DD5A 4LNPA 4GY5A 4HT9A 1WGSA 4LUEA 6AT1B 1N9RA 2KVQG 3I56Q 4BE2A 2E65A 3CC4A 5CVIA 3CCVT 1SF9A 1WZOA 1ZUKA 1NE8A 3BE3A 4C5GA 4OVAA 4F7UF 3L42A 2XG8D 3RKWA 4XTWA 2CUDA 3UA6A 2R5MA 3QWYA 2GQVA 3X24B 1KD1R 1YJ9Q 1H92A 4M75G 5FRMA 3V7CA 4E7IA 3EGDB 4F7UG 2D8HA 2JS2A 4QQ6A 4IIOA 3CBOA 1YCSB 1VQMT 5CKDA 4ZNXA 4OF1A 5LJ5h 3TCJA 4FIBA 3RR6A 2QQAA 4N0AC 1AOJA 4EMGA 2EJFA 4TVRA 4M7DE 1E7OA 2YUNA 1VUBA 3RBBB 4CC3A 1U5SA 4PLLA 5C0MA 1S1NA 5CKBA 1Q82U 2E41A 4ZTFA 4M7DG 2H8HA 1NLPC 1UE9A 1JJ2P 1KJWA 1FYNA 3CCSQ 1U1SA 2J7IA 2MYSA 3DB3A 1VQ8T 1KSWA 3BFMA 5D7UA 3VS2A 2E4HA 3C0CA 1WIEA 4LD9K 4BB7A 2R58A 2HKNA 1QKWA 1K9MU 4IUUA 3ULRB 2IG0A 2L8DA 4KRTA 2K2VA 2QEXQ 1S72Q 5IHIA 4EIKA 5IAYA 1YN8A 3CPWA 4ELZC 2HAXA 3M0PA 1X75C 1TXQA 3BW1A 2VGMA 3T9NA 3HHTB 2OTLA 3JCMc 1YHQT 4KT0E 5LJ3e 3HFNA 3E9FA 1NPRA 2OI3A 1AWJA 1VQ4Q 3A8HB 3HPWA 4M78E 2FPFA 1HSQA 1M27C 4X9DA 4FT2A 1KHCA 5A0GA 3WVDB 4XU0A 4C92E 4FYYB 1UG1A 4MDXA 2ROLA 4OMLA 4II1A 3QXEB 1CKAA 3M58A 1X01A 2NYSA 3OSVA 5LJ3g 5IN1A 2DK3A 2MF2A 4NL3A 3KBGA 2O01E 5EG2A 4XK8E 4RG2A 1Q81C 1TS9A 1PNJA 2E6NA 1IXDA 1LCKA 2FB7A 1QKXA 4OMNA 2M1HA 1M3BA 3A8GB 4PJMA 2RHYA 3VS0A 3EH2A 3CC7T 4DOVA 2FEIA 3UT1A 1K9MR 1QQJA 1RAEB 1C6VX 2ZCFB 3CC7A 4GLMA 3A1PA 3NPFA 2FZGB 2G3RA 2HD0A 2EJ9A 1BCOA 3J81E 1D3BA 1WPYA 3CC2Q 3I9QA 4OGEA 3R6NA 4BE1A 2KSSA 4M77G 2LJ1A 1VQPT 3L2WA 1ZX6A 4KGXB 3OB9A 2DM1A 2PUOB 1JQQA 1LPLA 1IO6A 5FLXE 3CMEA 2CSIA 3PMIA 5IXBA 1G3WA 5I2SA 2E12A 4OMQA 2I0NA 1F1BB 3I55A 4M77D 2X4JA 4J9HA 1Q7YR 3UATA 3V8KA 5D6YA 2HMAA 3I5SA 2A28A 3QBYA 3GIBA 2F5TX 3JCMe 3RMSA 1YFNA 2RI5A 5D6WA 4EMKA 3GF5A 4M7AE 3G1JA 2D9TA 2NLUA 2RD1A 5IH2A 1G5VA 1K73C 4PJJA 4C0FA 1Y57A 3CCUQ 4C0DB 4A4GA 1W2BP 7AT1B 1K9AA 4X34A 5GANj 1I5LA 2L3SA 1K73R 4RUGA 1RAIB 4HCKA 2CH4W 3JSCA 3L1AA 2KGTA 4E2FB 1YP5A 1UDLA 4EMHA 1Y71A 3V7SA 2ZPGB 1SEMA 2D0QB 2EQKA 1BCMA 1P92A 1UGRB 1M2VB 4E47A 1I1JA 2E5KA 4C92D 4B6MA 2KK4A 1QCOA 5GAN4 2YLBA 3OYIA 3CCEQ 2QQRA 2VYTA 3THKA 1VQKQ 2RHUA 2KRNA 1VQ5Q 3JB9J 1VA7A 2MK5A 4OMOA 4OB3B 5CKEA 1MV0B 2BKDN 1NJIR 1TUCA 4NS5A 1IGQA 4RTXA 5GMKm 1VQ9Q 1KC8C 1UEBA 3JV3A 4J6XA 5GAN7 1VQMA 4ZGEB 3RKXA 2GQIA 2L5QA 1R0BG 2KROA 3NGPA 5GANh 5KH6A 1XTDA 2VUBA 5A2QE 3FIFA 1UTIA 1IGUA 2RM4A 5I22A 2OTJA 2M16A 3SHWA 2KI7A 2LC4A 1VQLA 5M9OA 2DTIA 3A8MB 4F04B 2DO3A 1E6HA 4FSSA 2PQWA 2EYYA 2FG0A 4JLGA 4PJOE 1VOMA 3LWIA 4JS4A 2FL7A 3OS0A 1BYMA 3FJPA 2A37A 3LGFA 1Y7XA 4PLIA 2V26A 1GCPA 3BDUA 1HK9A 2KR3A 2DBKA 3OYLA 3Q1JA 1M90R 3TREA 2ROTA 1CKBA 2COYA 1IB8A 4O6JA 3MEAA 4N0AA 2DLPA 2E3HA 1RL2A 4M7AD 3H41A 2DXUA 1UECA 1SKUB 5KE2A 1K8AC 2OAUA 2OTLT 1DJ7B 2FRWA 2MIOA 3QSUA 5HCKA 2RQRA 2K3XA 3R6OA 1Y96A 2COWA 4DBFA 1M90C 2FHDA 3RDVA 3CMEQ 4KH1B
chains in the Genus database with same CATH topology
5J3BA 3CMAA 1BIBA 2XK0A 3RIRA 4FU6A 4MMKA 1QVFS 2FVUA 1YIJA 1M9SA 3FEOA 4KUIA 2KY9A 3CMAT 2MWOA 2MWPA 2WSCE 2Y90A 3N5BB 3L2ZA 4O5VA 3PIOA 3CC4T 3VYGA 2CS7A 4HCZA 4HT8A 2M9UA 4E7LA 1X6OA 4BY6B 4C8QE 1G3TA 3L2QA 5LL6S 1MHNA 1OYXA 3EFSA 3QPHA 1VQ5T 1S72A 1BKBA 3FB9A 2JN0A 2LQ8A 3MEWA 2RJDA 3QO3A 4LDWA 4OB2B 1FWZA 1K73U 1WJQA 5HK3A 2E64A 2X35A 1N8RU 3UDCA 5D6XA 3JB9F 2CZ6B 2LNVA 3OYKA 3HFOA 1N27A 5IT9E 4C8QG 5GANf 3JRZA 4JLIA 4PNOA 4EMKB 1QVFA 4HA8A 5J26A 2HQEA 1VQ9A 4QVDA 5GAMg 1KD1C 4L5GA 2LTOA 2RB6A 3GNFB 3WXMB 4ELYC 5FU6B 4JJNK 1VQLT 5FROA 4J5YA 2DTHA 2K5FA 2PUKB 2Y4YA 3NTIA 2OTJT 4Q5WA 3OYHA 2BIVA 1Q81U 2WSFE 1VQ4T 2K5IA 2AHJB 2GFAA 3S6WA 3ASKA 4R55A 4XTZA 3M55A 3JB9D 2KDSA 2GF7A 2DD5A 5HY6A 2QQSA 2RHXA 4C8QF 4GY5A 1FXXA 4HT9A 1H641 3LGLA 1WGSA 1VQOT 1BIAA 4F7UB 5GAOl 1M5Q1 1N9RA 2JTMA 2KVQG 3JCMQ 3KXTA 2PVDB 4BE2A 3SB2A 2E65A 2DKGA 3OQ5A 3CC4A 1BI1A 5CVIA 3CCVT 1QP2A 2RA2A 3OYBA 1NE8A 1NZ9A 3VYHB 4IUVA 4BI8B 4M75E 2EWNA 3ZFJA 1VIFA 4C5GA 2EQMA 3H8ZA 3CXCA 2XICA 4OVAA 4F7UF 1Q86C 3L42A 2XG8D 1YJNT 3RKWA 3X20B 2DJZA 1U8RA 2V8JA 4XTWA 3FLGA 4BUGA 1YJNA 4OGCA 1O75A 3OYDA 2R5MA 2GQVA 4N4HA 3X24B 2A3LA 1VQ7A 2JUFA 4UC4A 4BE0A 3VV0A 4M75G 4OB0B 5FRMA 3V7CA 4E7IA 2RJEA 1Q7YU 4F7UG 4J6WA 3I56A 1KG1A 3M59A 4CRIA 2EYQA 3O8VA 3H6ZA 4MZPA 3NFCA 4HKEA 2HNIA 4QQ6A 4B9WA 2QA4A 4C92A 3CBOA 3QYHB 2RHZA 3QDRB 4M78F 5CO7A 4PJOD 4EDUA 1VQMT 3HRUA 3CXCS 2QA4T 5CKDA 3CCST 1VQKA 4OF1A 2P0PA 1TH7A 4FIBA 3TCJA 5LJ5h 2QQAA 4M7AF 3CCSA 3OW2A 3HRTA 4N0AC 4M7AG 4EMGA 2E10A 3RMQA 4JDSA 3A5ZB 3JCMh 3VUBA 2EJFA 4TVRA 4M7DE 3F70A 3JCMd 2EIFA 1YI2A 1SSFA 3OYMA 4J7IA 4M77C 5GAN2 1VUBA 3BY7A 3L2RA 4M75A 1QP3A 5CR2A 2XI9A 4PL6A 4PLLA 3MCAB 5C0MA 5CKBA 1M4ZA 3M9QA 4M78D 1VIEA 3INZA 2QEXT 1Q82U 1M1KU 3QZ5B 2E41A 4BI4A 3SWNC 3DLLA 3C94A 1Y96B 4C92B 4ZTFA 4ATOA 1OZ3A 3OS5A 3P8BB 4M7DG 1N9SA 2EFIA 2YHTA 2O4XB 2YLCA 3NTHA 3ZEHA 2V8IA 2D6FA 2QQBA 2ZPBB 2BUDA 2DTOA 2ZGWA 3C95A 4ZGDB 4RMOA 1U1SA 2QXFA 3DB3A 1VQ8T 4M7DC 3BFMA 2QTXA 1H3ZA 2GCXA 2CZ1B 2KQWA 4JUVA 5FU7B 3UPUA 4LD9K 4EMKC 1M1FA 4M7DD 4BB7A 2R58A 1EIFA 3OYAA 2CGHA 3LWHA 3M56A 3MEUA 3QYGB 4NOYA 4PJOB 1D3BB 2F69A 3QIIA 4IUUA 5FU6C 4E7JA 3A8LB 2KMTA 3CPFA 4ZTJA 1LNXA 1K9MU 2VGNA 3VKIA 2IG0A 2L8DA 2K2VA 2QDYB 2EQUA 4XU2A 4Y91A 2L3RA 4IURA 4JRPA 5IAYA 1KQSS 3CC2T 2I2LA 1YBYA 3SWNB 4RCCA 3CPWA 4LDVA 3PIPA 1NJIC 5LJ5d 3CCLA 4ELZC 2HAXA 1G3YA 2HBPA 3MHXA 4JRIA 1K8AU 3CCVA 2X4XA 4V2SA 2ZPIB 3P8DA 1X75C 2MI6A 4NL2A 4JRKA 3BW1A 5CQXA 4C0GA 5HK0A 2VGMA 4PJOA 3T9NA 4YTLA 4Y28E 3G4ST 1UGSB 3HHTB 3S3NA 3LW5E 4M77F 2OTLA 3JB9G 1B34B 4PKCC 3JCMV 3JCMc 3OA6A 1YHQT 3J80E 4ZN3A 3M57A 4KT0E 5LJ3e 3HFNA 3CCMT 2VV5A 3E9FA 1WNLA 1YITA 1NPRA 5CQYA 4BI3A 4X9CA 2O4XA 3DLMA 4B9XA 3A8HB 1YITT 5DLQE 4D6WA 5GAOq 1VQ6A 3HPWA 1BI0A 4M78E 4M77B 4LDYA 1KC8U 4X9DA 4FT2A 3OS1A 1VQ6T 5CIUA 1KHCA 5A0GA 2IVWA 5A0LA 1VQ5A 1JJ2A 3WVDB 4XU0A 3QZ9B 3VU3C 5KCOA 2JOYA 5LJ5e 3GLXA 4C92E 1KQSA 1KHIA 4DA4A 2K5LA 3GOXA 4MDXA 4QVZA 4A4KA 4II1A 4HCBA 3CPWS 5CK9A 1N8RC 4KBMB 2E5QA 5GAOm 2XKOC 3MO8A 3SFMA 3QXEB 4JS5A 3LH0A 5J39A 3CC2A 2RI2A 5GANg 4C8QB 2LCCA 3M58A 1X01A 2K57A 2VC8A 4MZTA 3OSVA 3JCMg 4C92G 3OYYA 5GAMf 3V8LA 5IN1A 2DK3A 2MF2A 3QJ6A 3KBGA 2X4YA 3UWNA 5GMKe 5LJ3g 2DIQA 4PJOF 1W2BS 2O01E 5EG2A 4XK8E 4PJOG 4XAXB 4RG2A 3OYEA 3CCRA 2QI2A 1Q81C 1WJSA 2DIGA 3L2VA 4LD6A 3ZBDA 3CMET 2B8AA 2ZPEB 2E6NA 2R57A 4FT4A 3JCMJ 3M4GA 4BY6C 2FB7A 4MMLA 2CZ7B 3MP1A 4XTYA 5C6SA 5HKCA 2VXEA 2M1HA 3A8GB 4C8QA 2DEQA 4ZGJB 4EPCA 1WJRA 3CCQT 2RHYA 2DZCA 3CD6T 3LYIA 1QVGA 2PVOB 2XD0A 4J8OA 3CCUA 2KAFA 3CC7T 4DOVA 3MEVA 3UT1A 2DXTA 3M4YA 3TEEA 3CD6A 4DOWA 3CCUT 1O9SA 2ZCFB 1FX7A 2P0KA 4Z02A 3CC7A 5A0DA 3JB9H 5GAN8 2DAQA 1OZ2A 2DVEA 2RK2A 3BDLA 4FM4B 2G3RA 3CCEA 5DY9A 2HD0A 2EJ9A 3OMGA 1WQ7A 2WACA 3WVEB 1S72T 3J81E 4BACA 2RHIA 1D3BA 1WPYA 4OGEA 4FSXA 1BI2A 1RI0A 3G6EA 2FYKA 4BE1A 4M75B 2KSSA 4M77G 4QQGA 2QQ9A 5I21A 3L2WA 1VQPT 1U1TA 5LJ5g 1PSFA 3QKJA 5LJ5f 3OB9A 3HKSA 2PUOB 4M7AC 2P0QA 2XHCA 4RKUE 5GAN6 5FLXE 3CMEA 4J6YA 2MAMA 3P8HA 4FL6A 4CI0C 3PMIA 3M54A 1G3WA 5I2SA 2E12A 3GNGA 1YHQA 2RI3A 3EFRA 4C5EA 2XDDA 1W4SA 2ZPFB 4XU3A 4WF2A 3I55A 1AHJB 2E6ZA 2R5AA 2X4JA 3M5AA 4M77D 4MZMA 3PNWC 3LX7A 2X4WA 3URGA 3V8KA 5D6YA 4J83A 3JCMf 3JCMP 1M90U 2C06A 2E1HA 3QBYA 5LJ3f 4XQ3A 4R56A 4XTUA 5GANe 3OYNA 3GIBA 3PTAA 4M7DA 2F5TX 5GMKl 3JCMe 3RMSA 5DLOA 3PT9A 3CCLT 1GXIE 2RI5A 5D6WA 1LJOA 3OS2A 4EMKA 3GF5A 1M1KC 4M7AE 2D9TA 4KULA 4QVCA 1YIJT 4N4GA 2NLUA 2RD1A 3OYFA 1M1GA 1QVPA 1YCYA 3ME9A 5AYFA 4BDYA 1IZ6A 3GPLA 1G5VA 2EQJA 3VUZA 3JB9I 2ZPHB 4IUQA 1K73C 2LDMA 3RUXA 4C0FA 3C12A 2RJFA 5LJ5j 4C0DB 4A4GA 3S3MA 2EJGA 5CCAA 5GMKh 3FDRA 3OBYA 3JCMW 2LVMA 1ZHIA 4X34A 3I56T 5GANj 1I5LA 2RJCA 3JAME 4QQDA 3GP8A 5LJ3j 2H3JA 3PMTA 2LRQA 3OYCA 4C5HA 2F5KA 3JSCA 5GAMd 4L6V5 5L8RE 1YJ9A 3OY9A 3FC3A 5GAMh 4RG8A 3L1AA 1VQ9T 1UGPB 4EMHA 1Y71A 2WSEE 3DKMA 3META 3V7SA 2ZPGB 1YJ9T 1I8FA 2D0QB 4M75C 4OB1B 1KD1U 2EQKA 4MDWA 4RCBA 1JBMA 2L89A 3RERA 1P92A 1UGRB 4BDZA 1I4K1 3JCMX 4E47A 2LQKA 4C92F 4BD3A 5GAOp 4C92D 3HRSA 3V7RA 1N6AA 2KK4A 3MP8A 5GAN4 4ZN1A 2YLBA 3OYIA 1YI2T 3X28B 4C5IA 3CCJA 2QQRA 2VYTA 1XOVA 4C0DC 1YJWA 1IREB 3X26B 3QHSA 5FRNA 4M77A 2RHUA 2DZ9A 1YJWT 3SDZA 3JB9J 4F7UE 5GAOn 3HP9A 1Q86U 1UGQB 4OB3B 3J7AF 2LT1A 2XU8A 5CKEA 3E19A 3SD4A 5GMKi 2BKDN 3JCMb 5FU7C 2YRVA 4NS5A 1UB4A 4A54A 1VQNT 3CCQA 1M8VA 1V29B 3A8OB 5GMKm 2MMPA 2JVVA 2CKKA 1Y07A 4C0ZA 1VQ8A 3CBMA 3S3OA 3TU4K 1Q7YC 1KC8C 3X25B 1VQ7T 4KUDK 1UEBA 3AHUA 2RK1A 3E1SA 4C8QD 4J6XA 4M7AB 3CBPA 3NTKA 3LLRA 5GAN7 1KQ1A 1QVGS 4L59A 2XDPA 1W2BA 3C4SA 1MGQA 2Y4XA 1BI3A 1I81A 3CCET 3QG1A 2LCLA 1VQMA 4ZGEB 4PJOC 3RKXA 2L5QA 3V8JA 4M7DB 5GANh 1OI1A 2LX9A 1QW1A 4A4FA 3L2UA 5KH6A 5GANd 1XTDA 4M78C 4HCCA 5CAIA 2VUBA 3EAEA 1XQHA 2CYZB 5A2QE 3G6ET 3FIFA 4OP0A 4M75F 3ER0A 3G4SA 3DB4A 2JZ2A 2RM4A 4M7AA 5GAMj 3KUFA 2OTJA 1ZQ1A 2M16A 4C92C 4XTXA 1JJ2S 2LC4A 1Q82C 1VQLA 5M9OA 2VXFA 3CCJT 2DTIA 3A8MB 3OYJA 3CCRT 2PU9B 2DO3A 2K4YA 1VQ4A 4QW2A 1XNIA 4J7FA 4A4EA 2ZZDA 2PQWA 4LDXA 1VQNA 4P5NA 4JLGA 4NL3A 4PJOE 3LWIA 4VUBA 4JS4A 2FL7A 3OS0A 1BYMA 5GAN5 3FJPA 3LGFA 1WQWA 4A53A 1Y7XA 4IUPA 3QUIA 4LDUA 2V8KA 4PLIA 3QJYA 5GAMe 3OW2S 1JRIA 2RH2A 4M75D 4N4IA 2JNGA 1HXDA 2E70A 1R8OB 4GLKA 3BDUA 2M0OA 3RKYA 1ZBXA 5KE3A 1HK9A 3OYLA 3OYGA 1K9MC 4M7DF 2EAYA 1VQKT 3Q1JA 4M78A 5GAOr 1B34A 3TREA 4DQ2A 4IKFA 4E7KA 4ME7A 5DM7R 3G71A 4OMFB 3OMCA 4XTVA 2RO0A 3MEAA 4O6JA 3HL8A 4N0AA 3RESA 5KCHA 1VQPA 2EKOA 3G71T 3HSBA 1RL2A 2LT4A 3PGGA 4M7AD 1JB0E 1NJIU 2PVGB 2JTFA 1NPPA 2DXUA 1PSEA 3PFSA 2GFUA 3CEYA 5KE2A 1K8AC 5I2MA 2OAUA 2QEXA 3G7ZA 5GMKj 3OBWA 2K3YA 1LOJA 3OSSC 5GAN3 1KQ2A 2OTLT 2XDBA 2HQXA 4E7HA 2XIDA 4C8QC 1DJ7B 5LJ3h 3SWNA 3I55T 5LJ3d 4M78G 3CCMA 2CZ0B 3MP6A 4IUTA 4M78B 4M77E 3QSUA 2DXCA 4JRQA 2DD4A 3E9GA 3VJPA 1G3SA 2A7YA 4A4HA 2DPPB 4F7UA 2P4TA 3FRNA 1VQOA 2K3XA 3R6OA 1Y96A 5CKFA 2DXBA 1M90C 4XU1A 2FHDA 5CKHA 3M53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 B;  4M77 A;  2DZ9 A;  4M7D G;  1N9S A;  1BIB A;  3JB9 J;  3RIR A;  4F7U E;  4MMK A;  2YHT A;  5GAO n;  2DXT A;  2YLC A;  3JCM b;  5GMK i;  2Y90 A;  3L2Z A;  2ZGW A;  2DTO A;  3JB9 H;  4HT8 A;  1U1S A;  4A54 A;  5GAN 8;  1M8V A;  2DVE A;  3BFM A;  4C8Q E;  4M7D C;  2QTX A;  5GMK m;  3EFS A;  5DY9 A;  2EJ9 A;  3AHU A;  4JUV A;  1WQ7 A;  2JN0 A;  3FB9 A;  3QO3 A;  4EMK C;  4M7D D;  4C8Q D;  2CGH A;  4J6X A;  4XU1 A;  1D3B A;  1WPY A;  2E64 A;  4NOY A;  4M7A B;  4PJO B;  1D3B B;  3QHS A;  3JB9 F;  5GAN 7;  1KQ1 A;  1LNX A;  2FYK A;  3HFO A;  4M75 B;  4M77 G;  5I21 A;  1U1T A;  1MGQ A;  4C8Q G;  1I81 A;  4JLI A;  4PNO A;  4EMK B;  5LJ5 g;  4HA8 A;  5LJ5 f;  5GAN f;  4XU2 A;  4Y91 A;  4QVD A;  5GAM g;  4M7A C;  2I2L A;  2RB6 A;  3RKX A;  4PJO C;  3V8J A;  4M7D B;  4J5Y A;  2DTH A;  5GAN 6;  3SWN B;  4RCC A;  5GAN h;  4J6Y A;  5GAN d;  4M78 C;  5CAI A;  5LJ5 d;  3EFR A;  3FIF A;  4OP0 A;  4JRI A;  4M75 F;  4V2S A;  4XU3 A;  4WF2 A;  2RM4 A;  4M7A A;  4NL2 A;  4JRK A;  3BW1 A;  4M77 D;  4XTZ A;  5GAM j;  3JB9 D;  4PJO A;  4C92 C;  3V8K A;  4XTX A;  3JCM f;  4C8Q F;  3JCM P;  2VXF A;  4HT9 A;  1H64 1;  2DTI A;  2E1H A;  5LJ3 f;  1BIA A;  4M77 F;  4XQ3 A;  4XTU A;  4F7U B;  1M5Q 1;  1N9R A;  5GAN e;  3JCM Q;  5GAO l;  1B34 B;  3JCM V;  3JCM c;  5GMK l;  3SB2 A;  3JCM e;  3JB9 G;  2E65 A;  2DKG A;  5LJ3 e;  3HFN A;  1WNL A;  1LJO A;  2RA2 A;  4EMK A;  4M7A E;  4X9C A;  4PJO E;  4QVC A;  2RD1 A;  4M75 E;  2EWN A;  3FJP A;  5GAN 5;  5GAO q;  1YCY A;  1WQW A;  4A53 A;  3QUI A;  4M78 E;  4M77 B;  4F7U F;  3RKW A;  2DJZ A;  5GAM e;  3JB9 I;  4X9D A;  4XTW A;  1JRI A;  4M75 D;  3RUX A;  1HXD A;  5LJ5 j;  3BDU A;  4XU0 A;  3RKY A;  3VU3 C;  2EJG A;  1HK9 A;  5GMK h;  3JCM W;  4M7D A;  4M7D F;  2EAY A;  5LJ5 e;  4C92 E;  4M78 A;  5GAO r;  5GAN j;  1I5L A;  1B34 A;  3GIB A;  4M75 G;  4DQ2 A;  3V7C A;  5LJ3 j;  4F7U G;  4J6W A;  3RES A;  4XTV A;  4N0A A;  5GAM d;  2HNI A;  5GAM h;  5GAO m;  3L1A A;  4C92 A;  3HSB A;  3PGG A;  4M7A D;  4M78 F;  4PJO D;  5GAN g;  4C8Q B;  4EMH A;  2DXU A;  3JCM g;  1X01 A;  2K57 A;  2VC8 A;  3V7S A;  4C92 G;  1I8F A;  5GMK e;  5GAM f;  3V8L A;  5LJ3 g;  1TH7 A;  4M75 C;  5LJ5 h;  4NL3 A;  4RCB A;  4M7A F;  4PJO F;  1JBM A;  4N0A C;  5GMK j;  4EMG A;  2E10 A;  4PJO G;  3RER A;  1LOJ A;  4M7A G;  1I4K 1;  3JCM X;  5GAN 3;  1KQ2 A;  4C92 F;  3JCM h;  2EJF A;  4C92 D;  5GAO p;  4C8Q C;  4M7D E;  3JCM d;  5LJ3 h;  3V7R A;  3SWN A;  4M77 C;  5LJ3 d;  4M78 G;  5GAN 2;  3BY7 A;  4M78 B;  4M77 E;  5GAN 4;  3JCM J;  4M75 A;  2YLB A;  3M4G A;  3QSU A;  2FB7 A;  4MML A;  4F7U A;  4XTY A;  2VXE A;  1Y96 A;  4M78 D;  3INZ A;  4C8Q A;  2DEQ A;  2E41 A;  3SWN C;  2DZC A;  1Y96 B; 
#chains in the Genus database with same CATH topology
 4J9E A;  3EGX B;  1BIB A;  3RIR A;  4MMK A;  1QVF S;  2FVU A;  1QWE A;  1YNZ A;  1M9S A;  3FEO A;  1UFF A;  2KY9 A;  2Y90 A;  2X3W D;  3N5B B;  5KYN A;  4O5V A;  3CC4 T;  4HCZ A;  1X6O A;  4BY6 B;  2CT4 A;  1MHN A;  1OYX A;  3SEM A;  1GCQ A;  1BKB A;  1AEY A;  3MEW A;  4LDW A;  2RJD A;  2E64 A;  2JW4 A;  3HFO A;  4JZ4 A;  3OW2 P;  4JLI A;  2DER A;  4HA8 A;  2HQE A;  4QVD A;  2GTO A;  5GAM g;  1KD1 C;  4JJN K;  2RB6 A;  4ELY C;  5FU6 B;  4J5Y A;  4KGZ B;  2DF6 A;  3REB B;  2HKQ B;  3OYH A;  1K4U S;  2WSF E;  1M3C A;  1VQ4 T;  2JJ9 A;  2LQW A;  3EG9 A;  2J6F A;  3S6W A;  2XMF A;  3ASK A;  3UA7 A;  1UUE A;  4XTZ A;  2ECZ A;  3M55 A;  2KDS A;  5HY6 A;  2YXY A;  3LGL A;  1VQO T;  4AFU C;  2DX1 A;  5GJW B;  2JTM A;  1PG5 B;  1QP2 A;  4Y92 A;  9ATC B;  2F2X A;  5KYY A;  4IUV A;  4R0K A;  3ZFJ A;  3EGX A;  2AZV A;  3H8Z A;  2KNB B;  3X20 B;  2HEQ A;  1M2O A;  3UF4 A;  2ED0 A;  3QDF A;  4N4H A;  4BE0 A;  3IQL A;  3VV0 A;  3CCQ Q;  4J6W A;  3H6Z A;  4MZP A;  3I35 A;  1VQ7 Q;  3H0I A;  3NFC A;  2QA4 A;  2D1X A;  3QDR B;  5CO7 A;  4PJO D;  4LN2 A;  3CXC S;  2QA4 T;  1SSH A;  3M0T A;  3HRT A;  3RMQ A;  4ANJ A;  1UJ0 A;  3A5Z B;  4AFZ C;  1YI2 A;  1A0N B;  1M2V A;  2K6D A;  1RAF B;  3L2R A;  4M75 A;  5CR2 A;  2EYW A;  1GFD A;  4PL6 A;  3MCA B;  4AG2 C;  3M9Q A;  4LE9 A;  1M1K U;  4BI4 A;  3DLL A;  4ATO A;  4PJN A;  4C92 B;  2LP5 A;  2YHT A;  1QVG P;  3ZEH A;  2D6F A;  2EBP A;  2ZPB B;  2ZGW A;  1KQS P;  4KH0 B;  4E6R A;  3TSW A;  1H3Z A;  2GCX A;  1D0Z A;  1MMA A;  5FU7 B;  2RN8 A;  4M7D D;  3OYA A;  2CGH A;  3MEU A;  3QYG B;  4NOY A;  2F69 A;  3QII A;  4ZTJ A;  1WHH A;  3CPF A;  2RNA A;  2KYB A;  1KQS S;  4JRP A;  1YBY A;  2QG9 B;  1NLO C;  5LJ5 d;  3CCL A;  2KYM A;  2KBT A;  1G3Y A;  2HBP A;  1ABO A;  3CCV A;  5CQX A;  2MI6 A;  4NL2 A;  4YTL A;  4Y28 E;  2DYI A;  1T0J A;  3S3N A;  2O2O A;  2SEM A;  3JB9 G;  4PKC C;  2NUP B;  1YIT A;  4BI3 A;  1YIT T;  2CT3 A;  5GAO q;  1VQ6 A;  5KYW A;  3OS1 A;  1VQ6 T;  2GGR A;  2NWM A;  5A0L A;  1VQ5 A;  3VU3 C;  1RUW A;  2JOY A;  1ZA1 B;  3GLX A;  1KHI A;  1ZUU A;  4LXC A;  4DA4 A;  2K5L A;  4FW1 A;  4A4K A;  3CPW S;  1N8R C;  1K8A R;  4KBM B;  2E5Q A;  3MPU B;  2XKO C;  3MO8 A;  3CC2 A;  3LH0 A;  1OEB A;  4C8Q B;  3JCM g;  2K57 A;  3OYY A;  3L2Q A;  3V8L A;  2OTJ T;  4JPB W;  3UWN A;  2BE7 D;  1MMD A;  1QCN A;  3OYE A;  1HJD A;  2J05 A;  1UHF A;  2J6O A;  4LD6 A;  3ZBD A;  3CME T;  2ZPE B;  3CD6 Q;  3JCM J;  3M4G A;  4BY6 C;  2CZ7 B;  3MP1 A;  5HKC A;  4JZ3 A;  4C8Q A;  2DEQ A;  3CCQ T;  1WJR A;  1I07 A;  4FYV B;  1QVG A;  2PVO B;  3CCU A;  2B86 A;  1VQ8 Q;  3M4Y A;  1N8R R;  2K7A A;  3EG1 A;  4DOW A;  3CCU T;  1FX7 A;  2P0K A;  5A0D A;  2VAS A;  2K9G A;  3JB9 H;  2DVE A;  2HL5 C;  5DY9 A;  2YWW A;  2WAC A;  1S72 T;  5AT1 B;  4FSX A;  1BI2 A;  3G6E A;  2QQ9 A;  1U1T A;  5LJ5 f;  3EHR A;  1WLP B;  4J9B A;  2P0Q A;  1UGV A;  2MAM A;  1U3O A;  1RAC B;  2RMO A;  3GNG A;  1YHQ A;  2RI3 A;  4C5E A;  4XU3 A;  1RAH B;  2E1H A;  2O9V A;  3M0U A;  3CCL T;  2MPX C;  5FW9 A;  4ORZ A;  1LJO A;  3OS2 A;  2YT6 A;  2AZS A;  3EG3 A;  2AK5 A;  2V1Q A;  1M1G A;  1IZ6 A;  2KRS A;  2KXD A;  3JB9 I;  2DYB A;  4JJB A;  1BB9 A;  2FPD A;  3H0F A;  2EGA A;  5GMK h;  3FDR A;  3I56 T;  2DJQ A;  2RJC A;  5LJ3 j;  2H3J A;  2CRE A;  4L6V 5;  3FC3 A;  5GAM h;  1UGP B;  2PNI A;  3MET A;  2DBM A;  2QGG A;  4OB1 B;  1UJY A;  4MDW A;  1NYF A;  2L89 A;  4C92 F;  1N6A A;  4J9F A;  1RAB B;  3MP8 A;  4JJD A;  4ZN1 A;  3CCJ A;  2HBW A;  4F14 A;  2CUB A;  3VS1 A;  3FJ5 A;  2EYZ A;  5GAO n;  1Q86 U;  3J7A F;  2F1L A;  2KEA A;  1ZSZ B;  3E19 A;  1TG0 A;  1UB4 A;  2M51 A;  3CCQ A;  2JVV A;  4GBQ A;  1M30 A;  1VQ8 A;  3TU4 K;  1Q7Y C;  3X25 B;  1BU1 A;  4C8Q D;  5IHK A;  1Y0M A;  1AZG B;  2W0Z A;  1W6X A;  2XDP A;  1D1A A;  1AT1 B;  1Z9Q A;  2BTT A;  2LCL A;  2A0F B;  1RI9 A;  4E7Z A;  1QW1 A;  5GAN d;  4M78 C;  4HCC A;  2W10 A;  2YUQ A;  3EAE A;  3G6E Q;  3G6E T;  1ZBJ A;  4OP0 A;  3G4S A;  1OX8 A;  3KUF A;  1ZQ1 A;  4C92 C;  1WDX A;  2QK0 A;  2AKL A;  2VXF A;  3OYJ A;  3CCR T;  1ZSG A;  1XNI A;  4LDX A;  2EGE A;  1VQN A;  4P5N A;  4A53 A;  3QUI A;  4LDU A;  5GAM e;  3OW2 S;  2RH2 A;  4N4I A;  1CSK A;  2JNG A;  2QAS A;  1HXD A;  2E70 A;  2D8J A;  1ZBX A;  4M4Z A;  4M7D F;  1WXU A;  2KE9 A;  1VQK T;  4IKF A;  1WHL A;  5IXF A;  4ME7 A;  3G71 A;  3RES A;  2RO0 A;  4HVV A;  2JS0 A;  1AWO A;  3G71 T;  1PD0 A;  1D09 B;  1OOT A;  1NJI U;  2O88 A;  2BZY A;  3GBQ A;  2K3Y A;  1LOJ A;  3PVL A;  2DL7 A;  4C8Q C;  1XJW B;  1TU0 B;  2A08 A;  4M78 B;  2DXC A;  2DD4 A;  3E9G A;  1G3S A;  3EG0 A;  4F7U A;  2DPP B;  4Z88 A;  2LX7 A;  5I11 A;  1AVZ C;  2CP7 A;  1NM7 A;  2J6K A;  1VYU A;  1PRL C;  4FU6 A;  2YRD A;  4KUI A;  2MWO A;  1MND A;  3VYG A;  1SHF A;  2CS7 A;  2M9U A;  4E7L A;  1G3T A;  1YIJ Q;  5LL6 S;  1VQ5 T;  3FB9 A;  2LQ8 A;  1K73 U;  1FWZ A;  2Z0W A;  3CCV Q;  3VS3 A;  5IT9 E;  2QTV A;  4AFQ C;  2FO0 A;  4RTU A;  3JRZ A;  4EMK B;  1V76 A;  3GNF B;  3EFO B;  1VQL T;  5FRO A;  2DTH A;  2PUK B;  2PZ1 A;  4Q5W A;  4RTW A;  2LZ6 B;  1OUL A;  2CDT A;  1QWF A;  2AT1 B;  2QQS A;  2RHX A;  4C8Q F;  1VQP Q;  4K11 A;  1JO8 A;  2BZ8 A;  3KXT A;  3OQ5 A;  2L3P A;  2VWF A;  1BI1 A;  2X3X D;  1OU8 A;  2RA2 A;  2NUT B;  1NZ9 A;  1BK2 A;  4M75 E;  3CXC A;  2XIC A;  1YJN T;  3FLG A;  1YJN A;  4OGC A;  3CMA Q;  1GRI A;  3OYD A;  2A3L A;  1VQ7 A;  2JUF A;  2BZX A;  2RJE A;  2JXB A;  1E6G A;  3O8V A;  3PE0 A;  2NUZ A;  1NEG A;  4HKE A;  4C92 A;  1MV3 A;  3QYH B;  2RHZ A;  5ECA A;  4EDU A;  1G83 A;  2KRM A;  3CCS T;  1VQK A;  2P0P A;  1RAD B;  4M7A F;  3CCS A;  3OW2 A;  4CC7 A;  3JCM h;  3VUB A;  1LVK A;  3F70 A;  2EIF A;  4J7I A;  5GAN 2;  1QP3 A;  2DEU A;  3M0R A;  2XI9 A;  1M4Z A;  4M78 D;  1VIE A;  2QGF B;  1K76 A;  3SWN C;  3C94 A;  2CH4 A;  1OZ3 A;  2LJ3 A;  3NTH A;  5KYY B;  2V8I A;  5KYU B;  2QQB A;  4AFS C;  3CC4 Q;  1ZLM A;  2BUD A;  2DTO A;  2QXF A;  1GBQ A;  3MJX A;  2CZ1 B;  1M1F A;  2C0T A;  3D7S B;  3M56 A;  4E7J A;  2JT4 A;  1YJW Q;  2VKN A;  1LNX A;  1OX9 A;  2RQV A;  5L23 A;  2FPE A;  2QDY B;  1R0C B;  4Y91 A;  2L3R A;  2I2L A;  1SHG A;  2X9H A;  4LDV A;  2RQW A;  1K8A U;  2X4X A;  2ZPI B;  4C0G A;  2CP6 A;  3HTR A;  3LW5 E;  4RTY A;  3OA6 A;  4ZN3 A;  3M57 A;  2VV5 A;  1WNL A;  3AT1 B;  1OPL A;  1MUZ A;  2O4X A;  3DLM A;  5DLQ E;  4D6W A;  1M8M A;  4M77 B;  2G6F X;  5CIU A;  2IVW A;  5LJ5 e;  1B07 A;  1KQS A;  2X51 A;  4QVZ A;  3EGU A;  4HCB A;  1PWT A;  5CK9 A;  2OX7 A;  1PRM C;  2HL3 A;  3SFM A;  5FWC A;  4JS5 A;  5J39 A;  2RI2 A;  2LCC A;  3VRY A;  2QYZ A;  2EPD A;  2VC8 A;  4MZT A;  4C92 G;  3QJ6 A;  1KD1 U;  1T3S A;  4PJO F;  2JM9 A;  3CCR A;  2QI2 A;  2DRK A;  1WJS A;  5GJV B;  3L2V A;  2KT1 A;  3U23 A;  1SRL A;  4FT4 A;  1PD1 A;  1WHK A;  1G2B A;  1X69 A;  2VXE A;  4J8O A;  2KAF A;  2LQN A;  1GCQ C;  3MEV A;  1W70 A;  2DXT A;  4Z8A A;  3TEE A;  4E7S A;  1O9S A;  3H0H A;  1YWP A;  5KYU A;  5GAN 8;  2DAQ A;  1OZ2 A;  3CCE A;  1M1K R;  3OMG A;  1WQ7 A;  3QWX X;  3TVT A;  4BAC A;  2RHI A;  3ZL7 C;  2FYK A;  5I21 A;  1I0C A;  1PSF A;  3VS7 A;  2AIR B;  3HKS A;  3M0Q A;  1WA7 A;  4RKU E;  5GAN 6;  1FMV A;  4J6Y A;  3P8H A;  4FL6 A;  4CI0 C;  3EFR A;  2XDD A;  1RLP C;  2ZPF B;  4DBH A;  4WF2 A;  4A63 B;  1AHJ B;  2R5A A;  3URG A;  4HVW A;  3PNW C;  1C1A A;  3JCM f;  4R56 A;  1D1B A;  4XQ3 A;  3OYN A;  4XTU A;  5GAN e;  3PTA A;  1GXI E;  5GMK l;  1SRM A;  3EGD A;  1NG2 A;  1AD5 A;  1M1K C;  1EZZ B;  1SG5 A;  4QVC A;  4KUL A;  2DE0 X;  1EX4 A;  3OYF A;  5AYF A;  3ME9 A;  4CC4 B;  8AT1 B;  1MMN A;  1PC0 A;  1WXT A;  1OU9 A;  3RUX A;  3C12 A;  5LJ5 j;  3CC7 Q;  3S3M A;  3OBY A;  2RPN A;  2QA4 Q;  2VVK A;  3PMT A;  2JMC A;  3OYC A;  4C5H A;  2F5K A;  5GAM d;  5L8R E;  1YJ9 A;  3OY9 A;  4RG8 A;  2F2V A;  1VQN Q;  1YJ9 T;  2WSE E;  4M75 C;  1VYV A;  1JBM A;  2BE9 B;  2HDA A;  2LQK A;  4BD3 A;  5GAO p;  3HRS A;  2YSQ A;  1YI2 T;  4C5I A;  1XOV A;  1YJW A;  3QHS A;  4M77 A;  1YJW T;  2DZ9 A;  1ARK A;  4F7U E;  3HP9 A;  2LT1 A;  2XU8 A;  3JCM b;  5GMK i;  1TUG B;  3SD4 A;  5FU7 C;  2HCK A;  1VQN T;  1M8V A;  1V29 B;  4C0Z A;  3CBM A;  3S3O A;  1VQ7 T;  3AHU A;  2ENM A;  2RK1 A;  3E1S A;  2QAZ A;  2LJ0 A;  2L0A A;  3NTK A;  1KQ1 A;  3RNJ A;  1QVG S;  1MGQ A;  1TOV A;  1I81 A;  3CCE T;  1KC8 R;  1JU5 C;  2LX9 A;  4A4F A;  3I5R A;  3L2U A;  2CYZ B;  1PM3 A;  1J3T A;  4M75 F;  3ER0 A;  1PKT A;  2JZ2 A;  3DB4 A;  2EKH A;  3A98 A;  4XTX A;  1Q82 C;  1JXO A;  4DEY A;  5IHN A;  2PU9 B;  1FMW A;  4QW2 A;  1C0M A;  4J7F A;  1Q82 R;  4A4E A;  2DFU A;  2LMJ A;  5GAN 5;  1WQW A;  4IUP A;  2V8K A;  3NMZ C;  1KIK A;  3QJY A;  1V1C A;  1VQL Q;  1OV3 A;  4M75 D;  2IIM A;  2CP5 A;  2M0O A;  2A36 A;  5KE3 A;  3OYG A;  1K9M C;  2EAY A;  1ZA2 B;  2H3E B;  4M78 A;  1B34 A;  1QCF A;  2FRY A;  4E7K A;  4OMF B;  3OMC A;  4XTV A;  5KCH A;  1H8K A;  2EKO A;  3HSB A;  1OPK A;  2HZY A;  4DBR A;  2PVG B;  1T3L A;  2GFU A;  2GTJ A;  2C0I A;  1VQ6 Q;  1KK7 A;  2P4R A;  2QEX A;  2E3I A;  3OBW A;  3OSS C;  2HQX A;  4X1V A;  3SWN A;  5LJ3 d;  1WI7 A;  2EVR A;  4PFP A;  3TQ7 P;  4JRQ A;  4A4H A;  2A7Y A;  1VQO A;  5CKF A;  1X6B A;  2KT8 A;  4XU1 A;  5CKH A;  3M53 A;  3PVQ A;  1MMG A;  3CMA A;  2FZK B;  1YIJ A;  3CMA T;  2MWP A;  2WSC E;  2GNC A;  3L2Z A;  2NUP A;  1IHW A;  4C8Q E;  3QPH A;  4QT7 A;  5KYX A;  4OB2 B;  2JN0 A;  2JM8 A;  5KYW B;  4OMP A;  2CZ6 B;  2LNV A;  3OYK A;  1VQO Q;  3TSZ A;  5GAN f;  1QVF A;  5J26 A;  1VQ9 A;  3REA B;  2LTO A;  2Y4Y A;  3NTI A;  4J9G A;  1Q81 U;  2PTK A;  1D0X A;  2AHJ B;  1EFN A;  4D8D A;  2RQU A;  3JB9 D;  1SPK A;  1G8X A;  2CP2 A;  2GF7 A;  2DL8 A;  1FXX A;  1H64 1;  1N5Z A;  3CCR Q;  1BIA A;  4F7U B;  5GAO l;  2QDL A;  3G71 Q;  1M5Q 1;  3JCM Q;  2SRC A;  2PVD B;  3SB2 A;  2DKG A;  1YI2 Q;  3OYB A;  3VYH B;  2DET A;  4BI8 B;  2EWN A;  1FMK A;  1VIF A;  2EQM A;  1Q86 C;  2CSQ A;  2DJZ A;  1U8R A;  2L3Q A;  2V8J A;  4BUG A;  1OQK A;  1O75 A;  4UC4 A;  4OB0 B;  2YUO A;  2JMA A;  1Q7Y U;  3I56 A;  1KG1 A;  3M59 A;  4CRI A;  2EYQ A;  3EHQ A;  2HNI A;  4B9W A;  1X2K A;  2C0O A;  4M78 F;  3HRU A;  4DEX A;  3G4S Q;  1TH7 A;  2DL5 A;  1QMC A;  1TTH B;  2E10 A;  4M7A G;  4JDS A;  1WHJ A;  2RQT A;  3JCM d;  1SSF A;  3OYM A;  4M77 C;  3BY7 A;  2O31 A;  2QEX T;  3CCL Q;  1JEG A;  4HVU A;  4F17 A;  3INZ A;  5FWB A;  3QZ5 B;  1Y96 B;  3P8B B;  3OS5 A;  1H3H A;  1N9S A;  3NHN A;  3EG9 B;  2EFI A;  1ABQ A;  4AMC A;  2O4X B;  1GBR A;  2YLC A;  3C95 A;  4ZGD B;  4RMO A;  4M7D C;  1TUD A;  2QTX A;  2KQW A;  4JUV A;  3UPU A;  4FYX B;  4EMK C;  3CCM Q;  1EIF A;  2LCS A;  3LWH A;  4PJO B;  1D3B B;  3EG2 A;  4KGV B;  1RAG B;  5FU6 C;  3A8L B;  2KMT A;  1QVF P;  2VGN A;  3VKI A;  2RF0 A;  1X43 A;  2EQU A;  4XU2 A;  3CC2 T;  4IUR A;  1MNE A;  1PCX A;  1GL5 A;  2DL4 A;  3SWN B;  4RCC A;  3PIP A;  1NJI C;  1K0X A;  2LNH B;  2OAW A;  3MHX A;  4JRI A;  4V2S A;  2OJ2 A;  3P8D A;  5HK0 A;  4JRK A;  4PJO A;  2EGC A;  3G4S T;  1AZE A;  2IPO B;  1UGS B;  1X2Q A;  2ATC B;  4M77 F;  2YDL A;  1B34 B;  3JCM V;  3J80 E;  1ACM B;  3CQT A;  3CCM T;  4RTZ A;  5CQY A;  4X9C A;  2ZAE A;  2YRC A;  4B9X A;  1QLY A;  1M3A A;  1BI0 A;  4LDY A;  1KC8 U;  3EH1 A;  1JJ2 A;  5KCO A;  3QZ9 B;  4RTT A;  3VS6 A;  3GOX A;  2DMO A;  3CCJ Q;  4AG1 C;  2EQI A;  4DBQ A;  5GAO m;  4HXJ A;  5GAN g;  5GMK e;  5GAM f;  2X4Y A;  1W2B S;  2VB6 A;  2DIQ A;  4PJO G;  4IIM A;  4XAX B;  4J9I A;  1NBE B;  2DIG A;  1AWW A;  2DNU A;  2B8A A;  1VQM Q;  1B7T A;  2R57 A;  1B3Q A;  2K3B A;  4MML A;  3VS5 A;  4XTY A;  5C6S A;  4ZGJ B;  4EPC A;  2DZC A;  3CD6 T;  3LYI A;  2XD0 A;  4PFZ A;  2GBQ A;  4FCY A;  3CD6 A;  1TSF A;  4Z02 A;  4OMM A;  3VS4 A;  2RK2 A;  3BDL A;  4FM4 B;  2ABL A;  3WVE B;  1RI0 A;  1RLQ C;  4M75 B;  4QQG A;  1R77 A;  1IRX A;  1HYO A;  5LJ5 g;  4PK4 A;  3QKJ A;  1K0S A;  4M7A C;  3M0S A;  2XHC A;  3O5Z A;  3I55 Q;  1AWX A;  3M54 A;  2HQH A;  1W4S A;  1ZSZ C;  4J9C A;  2AKK A;  2E6Z A;  3M5A A;  4MZM A;  2FZC B;  3LX7 A;  2X4W A;  2V1R A;  1WXB A;  4J83 A;  3JCM P;  1M90 U;  2C06 A;  5LJ3 f;  1Q95 G;  1NYG A;  2JTE A;  2O9S A;  4M7D A;  5DLO A;  2J06 A;  3PT9 A;  1YWO A;  4JJC A;  2CP0 A;  1YIJ T;  4N4G A;  2D0N A;  1D0Y A;  1YCY A;  1QVP A;  4BDY A;  1I5O B;  1UHC A;  3GPL A;  2EQJ A;  3VUZ A;  2ZPH B;  4IUQ A;  2LDM A;  2RJF A;  2YUP A;  2EJG A;  5CCA A;  2HSE B;  3JCM W;  2LVM A;  1ZHI A;  3JAM E;  4QQD A;  3GP8 A;  2DL3 A;  2LRQ A;  1WFW A;  1VQ9 T;  3DKM A;  2M02 A;  1I8F A;  4RCB A;  3RER A;  1ZUY A;  4BDZ A;  1Q86 R;  1I4K 1;  2M0Y A;  1X27 A;  3JCM X;  4F16 A;  3V7R A;  4RTV A;  3X28 B;  2L2P A;  3H9N A;  2ED1 A;  4C0D C;  1IRE B;  3X26 B;  5FRN A;  4CC2 A;  2F2W A;  2MCN A;  3SDZ A;  3MKD A;  1UGQ B;  2YRV A;  1WYX A;  4A54 A;  4Z89 A;  4ESR A;  3A8O B;  2MMP A;  1YIT Q;  2CKK A;  1Y07 A;  4KUD K;  4M7A B;  3CBP A;  1TWB A;  3LLR A;  4L59 A;  2K2M A;  1W2B A;  3C4S A;  2Y4X A;  1PKS A;  1BI3 A;  3QG1 A;  4WTO B;  1T0H A;  2COZ A;  4PJO C;  3V8J A;  4M7D B;  1OI1 A;  1YJN Q;  5CAI A;  1XQH A;  2MOX A;  4M7A A;  5GAM j;  1HD3 A;  1JJ2 S;  2KXC A;  5KYX B;  3CCJ T;  1GFC A;  4FYW B;  2HSP A;  2K4Y A;  1VQ4 A;  1JXM A;  5EC7 A;  2ZZD A;  3E2U A;  3VRZ A;  1D1C A;  4VUB A;  2EW3 A;  1IHV A;  2OTL Q;  4PFO A;  3CXC P;  1JRI A;  2DIL A;  1R8O B;  2OTJ Q;  4GLK A;  1WHM A;  3RKY A;  2ESW A;  5GAO r;  2NUT A;  4DQ2 A;  5DM7 R;  1X6G A;  1ZSZ A;  3HL8 A;  1VQP A;  4D8K A;  2P84 A;  2LT4 A;  3PGG A;  4QKU A;  1JB0 E;  2JTF A;  1NPP A;  1PSE A;  3PFS A;  3CEY A;  5I2M A;  3G7Z A;  5GMK j;  2DVJ A;  3KFV A;  1VYT A;  5GAN 3;  4PJL A;  1KQ2 A;  2XDB A;  4E7H A;  2XID A;  5LJ3 h;  3I55 T;  4M78 G;  3CCM A;  2CZ0 B;  3MP6 A;  4IUT A;  4M77 E;  4FW2 A;  3VJP A;  2P4T A;  3FRN A;  1K1Z A;  1YHQ Q;  2DXB A;  1W1F A;  5J3B A;  2XK0 A;  4WCI A;  2DA9 A;  8ATC B;  3PIO A;  4AT1 B;  3LH5 A;  4J9D A;  3EFO A;  4HT8 A;  1Z9Z A;  3EFS A;  2EYX A;  1S72 A;  1Q81 R;  1BBZ A;  3QO3 A;  2CP3 A;  1RAA B;  1WJQ A;  5HK3 A;  2X35 A;  1N8R U;  3UDC A;  5D6X A;  3JB9 F;  1PHT A;  1N27 A;  2DRM A;  4C8Q G;  4LUD A;  1KFZ A;  4PNO A;  1NEB A;  4L5G A;  1WX6 A;  3WXM B;  2K5F A;  2BIV A;  1WHG A;  3CPW P;  2K5I A;  2GFA A;  1U06 A;  4R55 A;  2K79 A;  2DD5 A;  4LNP A;  4GY5 A;  4HT9 A;  1WGS A;  4LUE A;  6AT1 B;  1N9R A;  2KVQ G;  3I56 Q;  4BE2 A;  2E65 A;  3CC4 A;  5CVI A;  3CCV T;  1SF9 A;  1WZO A;  1ZUK A;  1NE8 A;  3BE3 A;  4C5G A;  4OVA A;  4F7U F;  3L42 A;  2XG8 D;  3RKW A;  4XTW A;  2CUD A;  3UA6 A;  2R5M A;  3QWY A;  2GQV A;  3X24 B;  1KD1 R;  1YJ9 Q;  1H92 A;  4M75 G;  5FRM A;  3V7C A;  4E7I A;  3EGD B;  4F7U G;  2D8H A;  2JS2 A;  4QQ6 A;  4IIO A;  3CBO A;  1YCS B;  1VQM T;  5CKD A;  4ZNX A;  4OF1 A;  5LJ5 h;  3TCJ A;  4FIB A;  3RR6 A;  2QQA A;  4N0A C;  1AOJ A;  4EMG A;  2EJF A;  4TVR A;  4M7D E;  1E7O A;  2YUN A;  1VUB A;  3RBB B;  4CC3 A;  1U5S A;  4PLL A;  5C0M A;  1S1N A;  5CKB A;  1Q82 U;  2E41 A;  4ZTF A;  4M7D G;  2H8H A;  1NLP C;  1UE9 A;  1JJ2 P;  1KJW A;  1FYN A;  3CCS Q;  1U1S A;  2J7I A;  2MYS A;  3DB3 A;  1VQ8 T;  1KSW A;  3BFM A;  5D7U A;  3VS2 A;  2E4H A;  3C0C A;  1WIE A;  4LD9 K;  4BB7 A;  2R58 A;  2HKN A;  1QKW A;  1K9M U;  4IUU A;  3ULR B;  2IG0 A;  2L8D A;  4KRT A;  2K2V A;  2QEX Q;  1S72 Q;  5IHI A;  4EIK A;  5IAY A;  1YN8 A;  3CPW A;  4ELZ C;  2HAX A;  3M0P A;  1X75 C;  1TXQ A;  3BW1 A;  2VGM A;  3T9N A;  3HHT B;  2OTL A;  3JCM c;  1YHQ T;  4KT0 E;  5LJ3 e;  3HFN A;  3E9F A;  1NPR A;  2OI3 A;  1AWJ A;  1VQ4 Q;  3A8H B;  3HPW A;  4M78 E;  2FPF A;  1HSQ A;  1M27 C;  4X9D A;  4FT2 A;  1KHC A;  5A0G A;  3WVD B;  4XU0 A;  4C92 E;  4FYY B;  1UG1 A;  4MDX A;  2ROL A;  4OML A;  4II1 A;  3QXE B;  1CKA A;  3M58 A;  1X01 A;  2NYS A;  3OSV A;  5LJ3 g;  5IN1 A;  2DK3 A;  2MF2 A;  4NL3 A;  3KBG A;  2O01 E;  5EG2 A;  4XK8 E;  4RG2 A;  1Q81 C;  1TS9 A;  1PNJ A;  2E6N A;  1IXD A;  1LCK A;  2FB7 A;  1QKX A;  4OMN A;  2M1H A;  1M3B A;  3A8G B;  4PJM A;  2RHY A;  3VS0 A;  3EH2 A;  3CC7 T;  4DOV A;  2FEI A;  3UT1 A;  1K9M R;  1QQJ A;  1RAE B;  1C6V X;  2ZCF B;  3CC7 A;  4GLM A;  3A1P A;  3NPF A;  2FZG B;  2G3R A;  2HD0 A;  2EJ9 A;  1BCO A;  3J81 E;  1D3B A;  1WPY A;  3CC2 Q;  3I9Q A;  4OGE A;  3R6N A;  4BE1 A;  2KSS A;  4M77 G;  2LJ1 A;  1VQP T;  3L2W A;  1ZX6 A;  4KGX B;  3OB9 A;  2DM1 A;  2PUO B;  1JQQ A;  1LPL A;  1IO6 A;  5FLX E;  3CME A;  2CSI A;  3PMI A;  5IXB A;  1G3W A;  5I2S A;  2E12 A;  4OMQ A;  2I0N A;  1F1B B;  3I55 A;  4M77 D;  2X4J A;  4J9H A;  1Q7Y R;  3UAT A;  3V8K A;  5D6Y A;  2HMA A;  3I5S A;  2A28 A;  3QBY A;  3GIB A;  2F5T X;  3JCM e;  3RMS A;  1YFN A;  2RI5 A;  5D6W A;  4EMK A;  3GF5 A;  4M7A E;  3G1J A;  2D9T A;  2NLU A;  2RD1 A;  5IH2 A;  1G5V A;  1K73 C;  4PJJ A;  4C0F A;  1Y57 A;  3CCU Q;  4C0D B;  4A4G A;  1W2B P;  7AT1 B;  1K9A A;  4X34 A;  5GAN j;  1I5L A;  2L3S A;  1K73 R;  4RUG A;  1RAI B;  4HCK A;  2CH4 W;  3JSC A;  3L1A A;  2KGT A;  4E2F B;  1YP5 A;  1UDL A;  4EMH A;  1Y71 A;  3V7S A;  2ZPG B;  1SEM A;  2D0Q B;  2EQK A;  1BCM A;  1P92 A;  1UGR B;  1M2V B;  4E47 A;  1I1J A;  2E5K A;  4C92 D;  4B6M A;  2KK4 A;  1QCO A;  5GAN 4;  2YLB A;  3OYI A;  3CCE Q;  2QQR A;  2VYT A;  3THK A;  1VQK Q;  2RHU A;  2KRN A;  1VQ5 Q;  3JB9 J;  1VA7 A;  2MK5 A;  4OMO A;  4OB3 B;  5CKE A;  1MV0 B;  2BKD N;  1NJI R;  1TUC A;  4NS5 A;  1IGQ A;  4RTX A;  5GMK m;  1VQ9 Q;  1KC8 C;  1UEB A;  3JV3 A;  4J6X A;  5GAN 7;  1VQM A;  4ZGE B;  3RKX A;  2GQI A;  2L5Q A;  1R0B G;  2KRO A;  3NGP A;  5GAN h;  5KH6 A;  1XTD A;  2VUB A;  5A2Q E;  3FIF A;  1UTI A;  1IGU A;  2RM4 A;  5I22 A;  2OTJ A;  2M16 A;  3SHW A;  2KI7 A;  2LC4 A;  1VQL A;  5M9O A;  2DTI A;  3A8M B;  4F04 B;  2DO3 A;  1E6H A;  4FSS A;  2PQW A;  2EYY A;  2FG0 A;  4JLG A;  4PJO E;  1VOM A;  3LWI A;  4JS4 A;  2FL7 A;  3OS0 A;  1BYM A;  3FJP A;  2A37 A;  3LGF A;  1Y7X A;  4PLI A;  2V26 A;  1GCP A;  3BDU A;  1HK9 A;  2KR3 A;  2DBK A;  3OYL A;  3Q1J A;  1M90 R;  3TRE A;  2ROT A;  1CKB A;  2COY A;  1IB8 A;  4O6J A;  3MEA A;  4N0A A;  2DLP A;  2E3H A;  1RL2 A;  4M7A D;  3H41 A;  2DXU A;  1UEC A;  1SKU B;  5KE2 A;  1K8A C;  2OAU A;  2OTL T;  1DJ7 B;  2FRW A;  2MIO A;  3QSU A;  5HCK A;  2RQR A;  2K3X A;  3R6O A;  1Y96 A;  2COW A;  4DBF A;  1M90 C;  2FHD A;  3RDV A;  3CME Q;  4KH1 B; 
#chains in the Genus database with same CATH homology
 5J3B A;  3CMA A;  1BIB A;  2XK0 A;  3RIR A;  4FU6 A;  4MMK A;  1QVF S;  2FVU A;  1YIJ A;  1M9S A;  3FEO A;  4KUI A;  2KY9 A;  3CMA T;  2MWO A;  2MWP A;  2WSC E;  2Y90 A;  3N5B B;  3L2Z A;  4O5V A;  3PIO A;  3CC4 T;  3VYG A;  2CS7 A;  4HCZ A;  4HT8 A;  2M9U A;  4E7L A;  1X6O A;  4BY6 B;  4C8Q E;  1G3T A;  3L2Q A;  5LL6 S;  1MHN A;  1OYX A;  3EFS A;  3QPH A;  1VQ5 T;  1S72 A;  1BKB A;  3FB9 A;  2JN0 A;  2LQ8 A;  3MEW A;  2RJD A;  3QO3 A;  4LDW A;  4OB2 B;  1FWZ A;  1K73 U;  1WJQ A;  5HK3 A;  2E64 A;  2X35 A;  1N8R U;  3UDC A;  5D6X A;  3JB9 F;  2CZ6 B;  2LNV A;  3OYK A;  3HFO A;  1N27 A;  5IT9 E;  4C8Q G;  5GAN f;  3JRZ A;  4JLI A;  4PNO A;  4EMK B;  1QVF A;  4HA8 A;  5J26 A;  2HQE A;  1VQ9 A;  4QVD A;  5GAM g;  1KD1 C;  4L5G A;  2LTO A;  2RB6 A;  3GNF B;  3WXM B;  4ELY C;  5FU6 B;  4JJN K;  1VQL T;  5FRO A;  4J5Y A;  2DTH A;  2K5F A;  2PUK B;  2Y4Y A;  3NTI A;  2OTJ T;  4Q5W A;  3OYH A;  2BIV A;  1Q81 U;  2WSF E;  1VQ4 T;  2K5I A;  2AHJ B;  2GFA A;  3S6W A;  3ASK A;  4R55 A;  4XTZ A;  3M55 A;  3JB9 D;  2KDS A;  2GF7 A;  2DD5 A;  5HY6 A;  2QQS A;  2RHX A;  4C8Q F;  4GY5 A;  1FXX A;  4HT9 A;  1H64 1;  3LGL A;  1WGS A;  1VQO T;  1BIA A;  4F7U B;  5GAO l;  1M5Q 1;  1N9R A;  2JTM A;  2KVQ G;  3JCM Q;  3KXT A;  2PVD B;  4BE2 A;  3SB2 A;  2E65 A;  2DKG A;  3OQ5 A;  3CC4 A;  1BI1 A;  5CVI A;  3CCV T;  1QP2 A;  2RA2 A;  3OYB A;  1NE8 A;  1NZ9 A;  3VYH B;  4IUV A;  4BI8 B;  4M75 E;  2EWN A;  3ZFJ A;  1VIF A;  4C5G A;  2EQM A;  3H8Z A;  3CXC A;  2XIC A;  4OVA A;  4F7U F;  1Q86 C;  3L42 A;  2XG8 D;  1YJN T;  3RKW A;  3X20 B;  2DJZ A;  1U8R A;  2V8J A;  4XTW A;  3FLG A;  4BUG A;  1YJN A;  4OGC A;  1O75 A;  3OYD A;  2R5M A;  2GQV A;  4N4H A;  3X24 B;  2A3L A;  1VQ7 A;  2JUF A;  4UC4 A;  4BE0 A;  3VV0 A;  4M75 G;  4OB0 B;  5FRM A;  3V7C A;  4E7I A;  2RJE A;  1Q7Y U;  4F7U G;  4J6W A;  3I56 A;  1KG1 A;  3M59 A;  4CRI A;  2EYQ A;  3O8V A;  3H6Z A;  4MZP A;  3NFC A;  4HKE A;  2HNI A;  4QQ6 A;  4B9W A;  2QA4 A;  4C92 A;  3CBO A;  3QYH B;  2RHZ A;  3QDR B;  4M78 F;  5CO7 A;  4PJO D;  4EDU A;  1VQM T;  3HRU A;  3CXC S;  2QA4 T;  5CKD A;  3CCS T;  1VQK A;  4OF1 A;  2P0P A;  1TH7 A;  4FIB A;  3TCJ A;  5LJ5 h;  2QQA A;  4M7A F;  3CCS A;  3OW2 A;  3HRT A;  4N0A C;  4M7A G;  4EMG A;  2E10 A;  3RMQ A;  4JDS A;  3A5Z B;  3JCM h;  3VUB A;  2EJF A;  4TVR A;  4M7D E;  3F70 A;  3JCM d;  2EIF A;  1YI2 A;  1SSF A;  3OYM A;  4J7I A;  4M77 C;  5GAN 2;  1VUB A;  3BY7 A;  3L2R A;  4M75 A;  1QP3 A;  5CR2 A;  2XI9 A;  4PL6 A;  4PLL A;  3MCA B;  5C0M A;  5CKB A;  1M4Z A;  3M9Q A;  4M78 D;  1VIE A;  3INZ A;  2QEX T;  1Q82 U;  1M1K U;  3QZ5 B;  2E41 A;  4BI4 A;  3SWN C;  3DLL A;  3C94 A;  1Y96 B;  4C92 B;  4ZTF A;  4ATO A;  1OZ3 A;  3OS5 A;  3P8B B;  4M7D G;  1N9S A;  2EFI A;  2YHT A;  2O4X B;  2YLC A;  3NTH A;  3ZEH A;  2V8I A;  2D6F A;  2QQB A;  2ZPB B;  2BUD A;  2DTO A;  2ZGW A;  3C95 A;  4ZGD B;  4RMO A;  1U1S A;  2QXF A;  3DB3 A;  1VQ8 T;  4M7D C;  3BFM A;  2QTX A;  1H3Z A;  2GCX A;  2CZ1 B;  2KQW A;  4JUV A;  5FU7 B;  3UPU A;  4LD9 K;  4EMK C;  1M1F A;  4M7D D;  4BB7 A;  2R58 A;  1EIF A;  3OYA A;  2CGH A;  3LWH A;  3M56 A;  3MEU A;  3QYG B;  4NOY A;  4PJO B;  1D3B B;  2F69 A;  3QII A;  4IUU A;  5FU6 C;  4E7J A;  3A8L B;  2KMT A;  3CPF A;  4ZTJ A;  1LNX A;  1K9M U;  2VGN A;  3VKI A;  2IG0 A;  2L8D A;  2K2V A;  2QDY B;  2EQU A;  4XU2 A;  4Y91 A;  2L3R A;  4IUR A;  4JRP A;  5IAY A;  1KQS S;  3CC2 T;  2I2L A;  1YBY A;  3SWN B;  4RCC A;  3CPW A;  4LDV A;  3PIP A;  1NJI C;  5LJ5 d;  3CCL A;  4ELZ C;  2HAX A;  1G3Y A;  2HBP A;  3MHX A;  4JRI A;  1K8A U;  3CCV A;  2X4X A;  4V2S A;  2ZPI B;  3P8D A;  1X75 C;  2MI6 A;  4NL2 A;  4JRK A;  3BW1 A;  5CQX A;  4C0G A;  5HK0 A;  2VGM A;  4PJO A;  3T9N A;  4YTL A;  4Y28 E;  3G4S T;  1UGS B;  3HHT B;  3S3N A;  3LW5 E;  4M77 F;  2OTL A;  3JB9 G;  1B34 B;  4PKC C;  3JCM V;  3JCM c;  3OA6 A;  1YHQ T;  3J80 E;  4ZN3 A;  3M57 A;  4KT0 E;  5LJ3 e;  3HFN A;  3CCM T;  2VV5 A;  3E9F A;  1WNL A;  1YIT A;  1NPR A;  5CQY A;  4BI3 A;  4X9C A;  2O4X A;  3DLM A;  4B9X A;  3A8H B;  1YIT T;  5DLQ E;  4D6W A;  5GAO q;  1VQ6 A;  3HPW A;  1BI0 A;  4M78 E;  4M77 B;  4LDY A;  1KC8 U;  4X9D A;  4FT2 A;  3OS1 A;  1VQ6 T;  5CIU A;  1KHC A;  5A0G A;  2IVW A;  5A0L A;  1VQ5 A;  1JJ2 A;  3WVD B;  4XU0 A;  3QZ9 B;  3VU3 C;  5KCO A;  2JOY A;  5LJ5 e;  3GLX A;  4C92 E;  1KQS A;  1KHI A;  4DA4 A;  2K5L A;  3GOX A;  4MDX A;  4QVZ A;  4A4K A;  4II1 A;  4HCB A;  3CPW S;  5CK9 A;  1N8R C;  4KBM B;  2E5Q A;  5GAO m;  2XKO C;  3MO8 A;  3SFM A;  3QXE B;  4JS5 A;  3LH0 A;  5J39 A;  3CC2 A;  2RI2 A;  5GAN g;  4C8Q B;  2LCC A;  3M58 A;  1X01 A;  2K57 A;  2VC8 A;  4MZT A;  3OSV A;  3JCM g;  4C92 G;  3OYY A;  5GAM f;  3V8L A;  5IN1 A;  2DK3 A;  2MF2 A;  3QJ6 A;  3KBG A;  2X4Y A;  3UWN A;  5GMK e;  5LJ3 g;  2DIQ A;  4PJO F;  1W2B S;  2O01 E;  5EG2 A;  4XK8 E;  4PJO G;  4XAX B;  4RG2 A;  3OYE A;  3CCR A;  2QI2 A;  1Q81 C;  1WJS A;  2DIG A;  3L2V A;  4LD6 A;  3ZBD A;  3CME T;  2B8A A;  2ZPE B;  2E6N A;  2R57 A;  4FT4 A;  3JCM J;  3M4G A;  4BY6 C;  2FB7 A;  4MML A;  2CZ7 B;  3MP1 A;  4XTY A;  5C6S A;  5HKC A;  2VXE A;  2M1H A;  3A8G B;  4C8Q A;  2DEQ A;  4ZGJ B;  4EPC A;  1WJR A;  3CCQ T;  2RHY A;  2DZC A;  3CD6 T;  3LYI A;  1QVG A;  2PVO B;  2XD0 A;  4J8O A;  3CCU A;  2KAF A;  3CC7 T;  4DOV A;  3MEV A;  3UT1 A;  2DXT A;  3M4Y A;  3TEE A;  3CD6 A;  4DOW A;  3CCU T;  1O9S A;  2ZCF B;  1FX7 A;  2P0K A;  4Z02 A;  3CC7 A;  5A0D A;  3JB9 H;  5GAN 8;  2DAQ A;  1OZ2 A;  2DVE A;  2RK2 A;  3BDL A;  4FM4 B;  2G3R A;  3CCE A;  5DY9 A;  2HD0 A;  2EJ9 A;  3OMG A;  1WQ7 A;  2WAC A;  3WVE B;  1S72 T;  3J81 E;  4BAC A;  2RHI A;  1D3B A;  1WPY A;  4OGE A;  4FSX A;  1BI2 A;  1RI0 A;  3G6E A;  2FYK A;  4BE1 A;  4M75 B;  2KSS A;  4M77 G;  4QQG A;  2QQ9 A;  5I21 A;  3L2W A;  1VQP T;  1U1T A;  5LJ5 g;  1PSF A;  3QKJ A;  5LJ5 f;  3OB9 A;  3HKS A;  2PUO B;  4M7A C;  2P0Q A;  2XHC A;  4RKU E;  5GAN 6;  5FLX E;  3CME A;  4J6Y A;  2MAM A;  3P8H A;  4FL6 A;  4CI0 C;  3PMI A;  3M54 A;  1G3W A;  5I2S A;  2E12 A;  3GNG A;  1YHQ A;  2RI3 A;  3EFR A;  4C5E A;  2XDD A;  1W4S A;  2ZPF B;  4XU3 A;  4WF2 A;  3I55 A;  1AHJ B;  2E6Z A;  2R5A A;  2X4J A;  3M5A A;  4M77 D;  4MZM A;  3PNW C;  3LX7 A;  2X4W A;  3URG A;  3V8K A;  5D6Y A;  4J83 A;  3JCM f;  3JCM P;  1M90 U;  2C06 A;  2E1H A;  3QBY A;  5LJ3 f;  4XQ3 A;  4R56 A;  4XTU A;  5GAN e;  3OYN A;  3GIB A;  3PTA A;  4M7D A;  2F5T X;  5GMK l;  3JCM e;  3RMS A;  5DLO A;  3PT9 A;  3CCL T;  1GXI E;  2RI5 A;  5D6W A;  1LJO A;  3OS2 A;  4EMK A;  3GF5 A;  1M1K C;  4M7A E;  2D9T A;  4KUL A;  4QVC A;  1YIJ T;  4N4G A;  2NLU A;  2RD1 A;  3OYF A;  1M1G A;  1QVP A;  1YCY A;  3ME9 A;  5AYF A;  4BDY A;  1IZ6 A;  3GPL A;  1G5V A;  2EQJ A;  3VUZ A;  3JB9 I;  2ZPH B;  4IUQ A;  1K73 C;  2LDM A;  3RUX A;  4C0F A;  3C12 A;  2RJF A;  5LJ5 j;  4C0D B;  4A4G A;  3S3M A;  2EJG A;  5CCA A;  5GMK h;  3FDR A;  3OBY A;  3JCM W;  2LVM A;  1ZHI A;  4X34 A;  3I56 T;  5GAN j;  1I5L A;  2RJC A;  3JAM E;  4QQD A;  3GP8 A;  5LJ3 j;  2H3J A;  3PMT A;  2LRQ A;  3OYC A;  4C5H A;  2F5K A;  3JSC A;  5GAM d;  4L6V 5;  5L8R E;  1YJ9 A;  3OY9 A;  3FC3 A;  5GAM h;  4RG8 A;  3L1A A;  1VQ9 T;  1UGP B;  4EMH A;  1Y71 A;  2WSE E;  3DKM A;  3MET A;  3V7S A;  2ZPG B;  1YJ9 T;  1I8F A;  2D0Q B;  4M75 C;  4OB1 B;  1KD1 U;  2EQK A;  4MDW A;  4RCB A;  1JBM A;  2L89 A;  3RER A;  1P92 A;  1UGR B;  4BDZ A;  1I4K 1;  3JCM X;  4E47 A;  2LQK A;  4C92 F;  4BD3 A;  5GAO p;  4C92 D;  3HRS A;  3V7R A;  1N6A A;  2KK4 A;  3MP8 A;  5GAN 4;  4ZN1 A;  2YLB A;  3OYI A;  1YI2 T;  3X28 B;  4C5I A;  3CCJ A;  2QQR A;  2VYT A;  1XOV A;  4C0D C;  1YJW A;  1IRE B;  3X26 B;  3QHS A;  5FRN A;  4M77 A;  2RHU A;  2DZ9 A;  1YJW T;  3SDZ A;  3JB9 J;  4F7U E;  5GAO n;  3HP9 A;  1Q86 U;  1UGQ B;  4OB3 B;  3J7A F;  2LT1 A;  2XU8 A;  5CKE A;  3E19 A;  3SD4 A;  5GMK i;  2BKD N;  3JCM b;  5FU7 C;  2YRV A;  4NS5 A;  1UB4 A;  4A54 A;  1VQN T;  3CCQ A;  1M8V A;  1V29 B;  3A8O B;  5GMK m;  2MMP A;  2JVV A;  2CKK A;  1Y07 A;  4C0Z A;  1VQ8 A;  3CBM A;  3S3O A;  3TU4 K;  1Q7Y C;  1KC8 C;  3X25 B;  1VQ7 T;  4KUD K;  1UEB A;  3AHU A;  2RK1 A;  3E1S A;  4C8Q D;  4J6X A;  4M7A B;  3CBP A;  3NTK A;  3LLR A;  5GAN 7;  1KQ1 A;  1QVG S;  4L59 A;  2XDP A;  1W2B A;  3C4S A;  1MGQ A;  2Y4X A;  1BI3 A;  1I81 A;  3CCE T;  3QG1 A;  2LCL A;  1VQM A;  4ZGE B;  4PJO C;  3RKX A;  2L5Q A;  3V8J A;  4M7D B;  5GAN h;  1OI1 A;  2LX9 A;  1QW1 A;  4A4F A;  3L2U A;  5KH6 A;  5GAN d;  1XTD A;  4M78 C;  4HCC A;  5CAI A;  2VUB A;  3EAE A;  1XQH A;  2CYZ B;  5A2Q E;  3G6E T;  3FIF A;  4OP0 A;  4M75 F;  3ER0 A;  3G4S A;  3DB4 A;  2JZ2 A;  2RM4 A;  4M7A A;  5GAM j;  3KUF A;  2OTJ A;  1ZQ1 A;  2M16 A;  4C92 C;  4XTX A;  1JJ2 S;  2LC4 A;  1Q82 C;  1VQL A;  5M9O A;  2VXF A;  3CCJ T;  2DTI A;  3A8M B;  3OYJ A;  3CCR T;  2PU9 B;  2DO3 A;  2K4Y A;  1VQ4 A;  4QW2 A;  1XNI A;  4J7F A;  4A4E A;  2ZZD A;  2PQW A;  4LDX A;  1VQN A;  4P5N A;  4JLG A;  4NL3 A;  4PJO E;  3LWI A;  4VUB A;  4JS4 A;  2FL7 A;  3OS0 A;  1BYM A;  5GAN 5;  3FJP A;  3LGF A;  1WQW A;  4A53 A;  1Y7X A;  4IUP A;  3QUI A;  4LDU A;  2V8K A;  4PLI A;  3QJY A;  5GAM e;  3OW2 S;  1JRI A;  2RH2 A;  4M75 D;  4N4I A;  2JNG A;  1HXD A;  2E70 A;  1R8O B;  4GLK A;  3BDU A;  2M0O A;  3RKY A;  1ZBX A;  5KE3 A;  1HK9 A;  3OYL A;  3OYG A;  1K9M C;  4M7D F;  2EAY A;  1VQK T;  3Q1J A;  4M78 A;  5GAO r;  1B34 A;  3TRE A;  4DQ2 A;  4IKF A;  4E7K A;  4ME7 A;  5DM7 R;  3G71 A;  4OMF B;  3OMC A;  4XTV A;  2RO0 A;  3MEA A;  4O6J A;  3HL8 A;  4N0A A;  3RES A;  5KCH A;  1VQP A;  2EKO A;  3G71 T;  3HSB A;  1RL2 A;  2LT4 A;  3PGG A;  4M7A D;  1JB0 E;  1NJI U;  2PVG B;  2JTF A;  1NPP A;  2DXU A;  1PSE A;  3PFS A;  2GFU A;  3CEY A;  5KE2 A;  1K8A C;  5I2M A;  2OAU A;  2QEX A;  3G7Z A;  5GMK j;  3OBW A;  2K3Y A;  1LOJ A;  3OSS C;  5GAN 3;  1KQ2 A;  2OTL T;  2XDB A;  2HQX A;  4E7H A;  2XID A;  4C8Q C;  1DJ7 B;  5LJ3 h;  3SWN A;  3I55 T;  5LJ3 d;  4M78 G;  3CCM A;  2CZ0 B;  3MP6 A;  4IUT A;  4M78 B;  4M77 E;  3QSU A;  2DXC A;  4JRQ A;  2DD4 A;  3E9G A;  3VJP A;  1G3S A;  2A7Y A;  4A4H A;  2DPP B;  4F7U A;  2P4T A;  3FRN A;  1VQO A;  2K3X A;  3R6O A;  1Y96 A;  5CKF A;  2DXB A;  1M90 C;  4XU1 A;  2FHD A;  5CKH A;  3M53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...