4J5YA

Crystal structure of hfq from pseudomonas aeruginosa in complex with atp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
total genus 14
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4j5yA00
4MMLA 4V2SA 3JCMh 3SWNC 5GAMe 4QVDA 1HXDA 1M5Q1 2QTXA 4M78B 4M7AG 3SWNA 4F7UG 3EFSA 2RM4A 5LJ5h 1KQ2A 2JN0A 1N9RA 2DTOA 4PJOF 3JCMb 3AHUA 3L1AA 4M7AB 4M7DA 3JCMg 4HT9A 4M7DB 4C92F 3FJPA 4M77C 1JRIA 4Y91A 3V7RA 4C8QE 5LJ3e 3GIBA 4XU3A 1D3BB 3JCMd 4M77A 2DZ9A 2FYKA 1HK9A 3INZA 5LJ5g 2EWNA 2RA2A 4C8QD 2CGHA 5GANh 1TH7A 5GAN5 5GMKj 4M75F 5GMKh 1KQ1A 1BIAA 5DY9A 5LJ5d 2RB6A 4HA8A 4J6XA 4JRKA 2DXUA 4WF2A 3JCMc 4M77F 4M78C 4NL3A 4M7AA 4PJOE 5GAOp 2DTIA 5GANg 4RCCA 4C92E 4XTWA 3JCMe 1YCYA 1M8VA 2Y90A 4EMKA 3QHSA 1I5LA 4M7AC 4JUVA 5GANd 1N9SA 3JB9I 4M7DC 2DKGA 4EMKB 5GAOm 2DTHA 3EFRA 4J6WA 1U1SA 5GAN7 2EJGA 4F7UA 5LJ5e 3RESA 3JCMP 5GAN3 1LJOA 4M75E 2DZCA 4J5YA 4M78F 4C8QG 2RD1A 4XU0A 3BFMA 4RCBA 4F7UB 4XQ3A 1D3BA 4M75D 2E10A 3QO3A 4M77E 5GAOl 5GAOr 3JB9H 5GAMf 4C8QB 3V8JA 4EMHA 4M7AF 2DJZA 5GAOn 4M7DF 3BY7A 5GANe 4QVCA 1I81A 4XTYA 1BIBA 1H641 5GMKe 4PJOG 3BW1A 2VC8A 4J6YA 3V7CA 3BDUA 4C92G 2YLCA 2E65A 4M78E 1WQWA 2EJ9A 5LJ3f 4EMKC 1WNLA 1LOJA 4A54A 3JCMW 4PJOD 4X9CA 5CAIA 3FB9A 4M75G 3JB9F 4C92D 5GAOq 3HSBA 1I4K1 3FIFA 4A53A 4M7DE 4OP0A 4C8QC 4M77G 2FB7A 2VXEA 3SB2A 2I2LA 5I21A 4JRIA 2EJFA 2HNIA 4XTXA 4C8QA 1U1TA 3PGGA 1LNXA 3JCMf 4XU1A 2DEQA 4XTZA 3RIRA 4F7UF 4N0AA 4M77D 5GMKi 3M4GA 3RKXA 5GAN4 5GMKm 4NOYA 5LJ3d 5LJ5f 1X01A 4C8QF 5GAN2 3JCMJ 4M78G 3L2ZA 4X9DA 5GAN8 3V8KA 5GAMj 5GAMh 3JB9D 4PJOB 3RKYA 4C92A 1Y96B 2DVEA 5GMKl 3HFNA 4PNOA 3VU3C 3QUIA 3JCMX 4C92B 4M7DG 2YHTA 4M78D 5LJ5j 3RERA 4M75C 5GAN6 3SWNB 5GANf 3JB9J 1B34A 4HT8A 4M7AE 4F7UE 3V8LA 2EAYA 3JCMQ 4M75A 5GAMg 1I8FA 1B34B 4DQ2A 4M7AD 3HFOA 2E1HA 2E41A 4M75B 5LJ3h 5LJ3j 4M7DD 5GAMd 3V7SA 4XU2A 4JLIA 2VXFA 5GANj 4M77B 4N0AC 4XTVA 2DXTA 2E64A 4MMKA 3JCMV 1JBMA 4NL2A 4XTUA 3JB9G 3QSUA 5LJ3g 2ZGWA 2K57A 4PJOC 1WPYA 2YLBA 1MGQA 3RUXA 4EMGA 1WQ7A 4PJOA 4C92C 4M78A 1Y96A 3RKWA
chains in the Genus database with same CATH superfamily
3JCMh 3SWNC 1M5Q1 1J3TA 1JJ2S 4E7LA 2ROTA 2RM4A 2GCXA 4PJOF 2IG0A 3OYEA 1B3QA 4ANJA 4BI4A 2B8AA 2CP2A 1VQNQ 1NJIU 4ELYC 1QKXA 2EWNA 2RK2A 1UFFA 3JCMc 2HD0A 4NL3A 1UE9A 2FRYA 4RG2A 2HMAA 4Q5WA 1IRXA 1G5VA 2AHJB 3FJ5A 3I56Q 4B9WA 4HCCA 2HKQB 2DTHA 4ORZA 2M9UA 5IAYA 4CC2A 2RD1A 1UGPB 1NJIC 4XK8E 5GAOr 4M77E 4EIKA 1SHGA 3OYDA 2KYMA 3CMAT 5IHIA 3BDUA 4J9IA 2NUZA 3OYBA 3L2UA 4BE1A 2YLCA 2HDAA 1U06A 1UUEA 4EMKC 2DLPA 3SFMA 2FPDA 4PLIA 1T0HA 3QJYA 4JJBA 4C92D 1UHCA 1IGQA 2DL7A 2HZYA 1OU8A 1W2BA 1VQPT 1V29B 3PGGA 1T0JA 3E9GA 3LLRA 2E4HA 5ECAA 2RQUA 2V8KA 1FMWA 3CMAA 3M53A 5GAMh 3H6ZA 5CO7A 2O88A 2NUTA 2DYBA 2AIRB 1B7TA 2MCNA 3OQ5A 7AT1B 2DNUA 3QXEB 4DQ2A 2QQ9A 2E1HA 2HBPA 3M5AA 2ABLA 4KULA 1U8RA 1FXXA 1VQPA 5CKBA 3EG9B 1U5SA 1A0NB 2ESWA 4HVUA 4DBHA 2BE7D 1PCXA 1YJ9T 1D3BB 2P0PA 5KYNA 2LDMA 4C0ZA 2V1RA 2KNBB 5LJ5d 2DILA 1XTDA 1B07A 4BE0A 1BI1A 3SDZA 3EGDA 2A37A 1JO8A 1YIJQ 4RCCA 3X26B 1K9MR 2EKHA 1YCYA 3C95A 1I5LA 2KYBA 4M7AC 2QASA 4M7DC 3SHWA 5GAN7 3WXMB 1QVFP 1LJOA 4LUDA 3MO8A 1AT1B 2QDLA 4PFZA 2DJQA 3EG1A 1VQMA 3X25B 1FYNA 2BIVA 2F5TX 2CUDA 1YJ9A 2A3LA 2FRWA 3A5ZB 2HBWA 4OMQA 2HL3A 3HL8A 2RHIA 4X9CA 1AZGB 3FB9A 5FU7B 1TUGB 2VKNA 1D09B 2E6ZA 2L3PA 1QCFA 4C8QC 2PVOB 1UG1A 1Q7YU 2H3JA 1LNXA 3EFOB 5GMKm 5LJ5f 2SEMA 3EHRA 1M30A 4X9DA 1UGRB 2RO0A 1KC8R 5GMKl 5FRMA 3NTIA 3RR6A 3JCMX 4ESRA 3S3OA 5CCAA 3UT1A 1MMAA 1Q7YC 1VQMQ 3IQLA 1QCNA 2JMAA 2MIOA 1IZ6A 1AEYA 4OB0B 4MDXA 5LJ3g 3J80E 4EDUA 2AZVA 2K5FA 4EPCA 2D6FA 5KH6A 4FYYB 4M78B 1YWPA 4J9HA 1RABB 2JN0A 2DTOA 3M54A 2ECZA 4HT9A 3CCVT 1VQ7T 1WDXA 2KQWA 2L89A 3CXCS 4A4KA 3VRZA 4FU6A 4M77F 2YUQA 2WSCE 2P4RA 3UATA 1Q82U 4HCBA 1VQ4T 2LX9A 4F14A 1BI3A 3NTKA 3JCMP 1QWEA 1NPRA 4HXJA 4PK4A 4M75D 3OYLA 3JB9H 3HP9A 4C0FA 2M02A 3G71T 3CCVA 1VQKT 1M3AA 3VS7A 1VQ7A 1MMNA 1YI2T 2CP0A 1Q82C 2OAWA 4QQGA 4JJNK 2A0FB 1LOJA 4PJOD 1VIEA 2A7YA 4CC7A 1JXOA 2YSQA 3HSBA 1VQ4A 2KXDA 3SB2A 1D1BA 1TTHB 5FWCA 1YWOA 3I9QA 3CCEA 2XMFA 2RF0A 1SSFA 2XDDA 2YUOA 4ZN1A 2DA9A 5GAN2 2FPFA 4IUPA 4JRPA 1TSFA 4OF1A 3G71A 2D1XA 1D0XA 3LGLA 5IH2A 1VQKA 2RI2A 3A8LB 3H0IA 1YI2A 1VQOT 4C92B 3RERA 4FW1A 4JDSA 3VJPA 1WLPB 3N5BB 4RTXA 1K73R 3O5ZA 3A98A 1G83A 3H41A 3CCSQ 2D8JA 1PSFA 5D6XA 1K9AA 3TSZA 1KQ2A 3S3MA 1MMGA 4V2SA 3MEAA 1VQ6Q 3SWNA 2DE0X 2GTOA 2LVMA 2EFIA 4KUIA 2DIGA 3RMQA 5CIUA 3CCEQ 1VQOA 3V7RA 4Y91A 5EC7A 4O5VA 2KVQG 1PD1A 2DAQA 2HCKA 3M0RA 4GLMA 5IN1A 4B6MA 4QKUA 2RNAA 5CK9A 1SRLA 2QGFB 2QDYB 2ROLA 1KC8U 2J6OA 5LJ5e 5GAN3 4M75E 3GF5A 4XU0A 4F7UB 3CD6Q 3META 3A1PA 3L2VA 3TQ7P 2JTFA 4LNPA 4QVCA 3NMZC 1VUBA 2K7AA 2KAFA 2EYXA 1Q81R 2EYYA 1W2BS 1NE8A 1BI0A 2WACA 5GAOq 2JVVA 2G6FX 4J83A 1OI1A 4DBRA 5HK0A 4J7IA 2F2WA 5HCKA 2NWMA 2LMJA 2JMCA 4OMLA 3E2UA 2YRVA 3V8KA 3LH5A 3JB9D 2CP7A 2J6KA 2V1QA 1VQ5T 2EQKA 3C12A 2KGTA 3PTAA 3JB9J 3CCQA 4IUQA 2NUPB 2PUOB 4HVVA 3TREA 1X43A 3QWYA 2O9VA 1BK2A 1WJQA 3EG9A 2K3BA 1RACB 2O4XA 1RAEB 2YLBA 1MGQA 4EMGA 4ATOA 1M4ZA 1Y71A 5KYXB 1PC0A 4FYXB 2CKKA 1RI9A 1OX8A 3NHNA 2MAMA 3OYMA 3UDCA 5CQYA 3U23A 1JJ2P 1VQ5A 1V76A 1ZHIA 3CCLA 4CRIA 3PT9A 2LT1A 2VVKA 2CGHA 5IXFA 1ARKA 3EGXB 4ZNXA 9ATCB 3VS6A 2XIDA 1G3TA 1JU5C 1WZOA 1PG5B 3ME9A 2J06A 4M7AA 2EJGA 4JZ3A 4J5YA 4OMNA 4XQ3A 4ZGDB 1PHTA 4EMHA 2JT4A 1GCQA 3OYHA 5A0DA 2W10A 1MV3A 2KY9A 1AHJB 3CCUQ 4RTTA 1QCOA 2F5KA 2LJ3A 4LDVA 1M1KR 1SEMA 4GLKA 2DL8A 3A8MB 1GRIA 2H3EB 3CCLQ 1OZ3A 5DM7R 2QEXQ 4C8QA 3CC4T 4XU1A 1VIFA 3EFOA 4OVAA 2EVRA 3CMEQ 1NLPC 4M77D 1QLYA 4AFUC 2D0QB 2K9GA 4PJOB 2ZPBB 3OYYA 3VUZA 3V8LA 4BE2A 1KD1U 1I1JA 2WSFE 4C5IA 3HFOA 4O6JA 1MNEA 2FZGB 2AT1B 4C5EA 4PJMA 2K6DA 4J9DA 4XTUA 3KFVA 2HQEA 1N8RU 1P92A 3CC4A 1WQ7A 4M78A 4J7FA 1W4SA 2BZYA 4M7AG 4KGXB 4AFZC 1G2BA 3M0SA 3MP6A 2EQMA 1KD1C 1OU9A 5LJ5h 5CVIA 1QVGA 4LDUA 1E7OA 2D0NA 2VASA 4D8DA 4IUTA 3H0FA 4DEYA 2FYKA 2EQUA 1D0YA 3OBWA 4M75F 1N8RC 5DY9A 1RI0A 1AZEA 2FZKB 5CQXA 4FSXA 1X27A 1YITQ 4RKUE 5GANg 1X6BA 1C1AA 1YHQT 1R8OB 3MEWA 3G6ET 4MZTA 1K8AC 4M4ZA 4Z8AA 4J6WA 1QP3A 3L2RA 1ACMB 2V8IA 4C8QG 4RCBA 3DB4A 2LQNA 4QW2A 1HSQA 3VS3A 1X2KA 3SEMA 4DOWA 4XTYA 1YBYA 4ZGEB 1IXDA 3VS2A 2XG8D 1KJWA 2LQWA 2OX7A 2VYTA 3J7AF 5M9OA 4HVWA 4M7DE 3C4SA 1YHQA 1NBEB 2BE9B 4FCYA 2VXEA 2JOYA 3OMGA 2JXBA 2HKNA 3X28B 3JAME 3NGPA 1EIFA 3KUFA 2DVJA 3PNWC 4NOYA 3LH0A 4M78G 3FC3A 3S6WA 2C0TA 4C92A 2VWFA 3FDRA 2YHTA 1QP2A 5GAN6 1K76A 1VA7A 3MHXA 2BZ8A 2EAYA 5D6YA 4BDYA 4TVRA 2FL7A 2QA4T 3NTHA 1KSWA 6AT1B 1HYOA 1T3LA 1WIEA 4PLLA 1LVKA 4R55A 3JRZA 2XDBA 4RTWA 2HQXA 2EIFA 2M0YA 2JM8A 3TCJA 3CPFA 1Y96A 4F16A 1PD0A 3MEVA 3A8GB 2LNVA 3HKSA 4BACA 2CSQA 4UC4A 1TU0B 3OY9A 2CZ1B 2JTMA 4KGZB 5GJVB 4A4HA 4DOVA 1FMKA 4HKEA 5DLOA 4C5HA 1TH7A 2DO3A 2PUKB 2OTJT 3CCMT 1Q86U 2QA4A 2VV5A 3G4ST 2RPNA 4KUDK 1M8VA 1QVPA 4YTLA 3RBBB 3ZL7C 4IUVA 5I2MA 1IREB 1U1SA 4ELZC 4F7UA 3OW2A 1RAHB 5IT9E 1UGVA 1M2VB 5GAOn 1GL5A 1Q86C 1TXQA 2ATCB 1I81A 1VQ9T 2HSEB 3CMAQ 3P8BB 1WHMA 4C92G 2MF2A 4BD3A 2OTJA 3CCMA 3G7ZA 1KQSA 1N27A 3JB9F 3G4SA 2VGNA 4E6RA 2K4YA 2E3IA 3ZEHA 4E47A 2LX7A 2LQKA 1SF9A 1GCQC 3VS4A 2NYSA 1VQPQ 2GF7A 3M4GA 3DB3A 5FU7C 2GBQA 2DRKA 2CREA 2JM9A 2DL4A 1Q95G 3M9QA 1B34B 1UJ0A 2OTLT 2E5QA 1BCOA 5GANj 4M77B 1HD3A 2QQAA 1JBMA 3ZFJA 1WHHA 3HHTB 1KFZA 2A08A 1VYTA 3GIBA 3LW5E 5LJ3d 3E19A 4QVDA 2KI7A 5HK3A 5AT1B 4F7UG 2P0QA 4E7ZA 4E7JA 2CH4W 2CP5A 4JS4A 3JCMg 2EGAA 4F17A 3GP8A 3FJPA 1JRIA 2DF6A 1ZUYA 2CZ6B 2VGMA 3NFCA 2EKOA 3EGXA 1YJ9Q 2YRDA 2RHUA 1GFCA 3QKJA 2OTLA 3E1SA 2E12A 4M78C 2JJ9A 4BI3A 2M0OA 3CCRT 2EYQA 1BB9A 3EFRA 2ZPIB 2F1LA 1YNZA 2E5KA 2W0ZA 1BCMA 4M7AF 4M7DF 5J26A 1BIBA 4IIMA 2DM1A 1KK7A 1OQKA 5LJ3f 2QQSA 1NPPA 1ZSZB 1RAAB 1AWWA 4A53A 4OP0A 3CCRA 1MMDA 3GNFB 4Z02A 4MDWA 4LE9A 2KXCA 2PVGB 1G3SA 2XK0A 3GLXA 2CZ0B 2Z0WA 5LL6S 4HCZA 4C8QF 4N4GA 1PRMC 2K2MA 4KGVB 3M57A 4CC3A 1WYXA 1OX9A 5C6SA 2MI6A 1N5ZA 2J05A 2O31A 4DBFA 5I22A 3O8VA 5IXBA 4IIOA 5GAMg 3CC7T 4Y28E 1YFNA 2HQHA 1OEBA 2A36A 2VXFA 2HEQA 4MMKA 3QSUA 4K11A 2R5MA 1VYVA 1QVGS 2X35A 4C92C 2CP3A 1HXDA 4PJJA 3PIPA 3F70A 3MCAB 4JLGA 1XQHA 1WJRA 1K9MU 1TUDA 3QBYA 3VRYA 1CSKA 1OV3A 8AT1B 3UA7A 1NYGA 4JS5A 2X3WD 3CCVQ 1WXBA 1VQ7Q 3CC7A 3GBQA 2FO0A 4BY6C 2LC4A 3CCJT 2E70A 2DXUA 4FIBA 1LPLA 1UHFA 4BY6B 3J81E 3LYIA 2YRCA 4JPBW 1VQ4Q 4QT7A 1K9MC 2RQVA 1UECA 1S72T 1KG1A 2MYSA 3I5RA 2DERA 1RLQC 3C94A 4PJOG 5J39A 3G71Q 3OYAA 2RQRA 1VQKQ 1YI2Q 2X3XD 1RAFB 2L3RA 3CCJA 1M9SA 5I2SA 5CAIA 2NUTB 2R58A 1SRMA 3G1JA 2MOXA 3FIFA 1IB8A 4FT2A 3H9NA 2R57A 2Y4XA 2LCLA 2MK5A 1RLPC 1S72A 2K3XA 3DLLA 2CP6A 4L5GA 1QWFA 1ZLMA 2QI2A 3CBOA 1YJNT 1UB4A 1ZA2B 3OYCA 1KHCA 3EGUA 1OZ2A 1GCPA 3OSSC 2V26A 1KC8C 1BBZA 5A0LA 2F2XA 2JS0A 1VQOQ 4R0KA 1WXTA 4ME7A 5LJ3j 4KBMB 4XU2A 4D8KA 2AKLA 2FPEA 1V1CA 2RMOA 4II1A 1M90R 2E64A 3JCMV 1M27C 3EGDB 2JUFA 3HRTA 3OYNA 2KMTA 2AK5A 4ZGJB 2DMOA 1YJNA 3Q1JA 2KT1A 2YWWA 3TU4K 2PTKA 1N9RA 4FL6A 3LWHA 1BYMA 3L1AA 2XDPA 3EH1A 5LJ3e 2IIMA 3OSVA 2DZ9A 1AWOA 1SHFA 2EW3A 4DEXA 1JQQA 3CPWP 2L3SA 3OW2S 2JW4A 1VQ8T 2QG9B 1ABOA 1IHVA 1R0CB 3JB9I 1YJWT 1K4US 1NJIR 3M0TA 4PJLA 2GTJA 5FRNA 1D3BA 2M1HA 4PKCC 3QO3A 1M2VA 2QYZA 2P84A 4JJCA 2COZA 2DL3A 1KQSS 4J6YA 1EFNA 2E65A 2ZCFB 4OMOA 1NEGA 3VUBA 3CCQQ 1VQLT 1VQ8A 2FB7A 4CI0C 2LZ6B 4RTVA 1YJWA 4A4EA 3I55T 3RIRA 5GAN4 3MP1A 3L2WA 1K73U 2M16A 4OB1B 3CC2T 3L2ZA 4E7SA 4J9EA 2AKKA 5KYWB 2KE9A 1R77A 3OBYA 4M75C 1B34A 2PU9B 3REAB 4WTOB 3OS2A 1VQ5Q 1NZ9A 1AD5A 2KEAA 4M7AD 4M75B 4M7DD 1VQLA 2ZPEB 2LNHB 1WX6A 1N6AA 3FLGA 4LD6A 1EZZB 2EPDA 1K73C 2HSPA 4X1VA 4PJOC 2RJFA 2KR3A 2RJDA 3VV0A 3RUXA 5KE3A 3I35A 4PJNA 4LD9K 5J3BA 4JJDA 4IURA 1VQNT 2O9SA 5CKFA 2H8HA 3OMCA 4AFSC 5KCHA 2QAZA 4KH0B 3RDVA 2LCCA 3X24B 1H3ZA 1TUCA 3JV3A 1Y7XA 2Y4YA 4C8QD 2JZ2A 5GAN5 4HCKA 4KRTA 5GMKj 1BIAA 2CUBA 4BDZA 1D0ZA 3QZ9B 4E7IA 2LP5A 2MMPA 4WF2A 2L3QA 2NLUA 1YN8A 3I56T 2PVDB 1Q81U 5GANd 3BE3A 2K5IA 1RL2A 1PM3A 4QQ6A 2E10A 5I11A 1QVFA 4FSSA 5KYUB 2A28A 2DJZA 5HY6A 1VQNA 3BY7A 1H641 5GMKe 3LWIA 3P8HA 2B86A 3V7CA 3EHQA 3X20B 1ZSZA 1Q81C 4A54A 4RTZA 2C0IA 2KBTA 2CS7A 5FROA 3I56A 4M77G 1RAGB 2RJEA 4XTXA 4FYWB 2RH2A 2PQWA 1QQJA 3CBMA 4RMOA 3OS1A 4N0AA 3CC4Q 2G3RA 2CSIA 2RHXA 2K79A 3L2QA 1G8XA 2KRSA 1D1CA 1MUZA 3VU3C 4OGEA 1IO6A 2FZCB 1Q7YR 3R6NA 5DLQE 3SWNB 5GANf 4M7AE 3MP8A 2DXBA 3G6EA 2RI5A 5LJ3h 3E9FA 1QKWA 1K0XA 5FU6C 3H0HA 1D1AA 1KIKA 2RQWA 2X4YA 3UA6A 3EG2A 3M59A 3VYHB 5FU6B 2GFAA 3OB9A 3P8DA 3QDFA 2YXYA 2DBKA 1Y57A 1Z9ZA 1QW1A 4Z88A 3QG1A 3LX7A 4E7KA 1H8KA 2X4XA 3EAEA 2F69A 3JCMb 1ZA1B 2GFUA 4MZPA 3DLMA 1BI2A 4C8QE 2QGGA 3INZA 2E6NA 3OYFA 1YIJT 4HA8A 4J6XA 4JRKA 4BUGA 1CKBA 3CEYA 5GAOp 2DTIA 4E7HA 1M8MA 2ED1A 1YHQQ 3G6EQ 4EMKB 1UDLA 5CKDA 1NM7A 4FYVB 1X69A 2L5QA 2IPOB 2F2VA 2DD4A 1M1KU 1X2QA 3V8JA 5A0GA 1Q82R 2ZPFB 1WI7A 3MEUA 4FT4A 2YDLA 3CBPA 3ZBDA 1XNIA 4M78E 2RJCA 1W6XA 2XI9A 1YIJA 1ABQA 3PE0A 3CXCP 1E6GA 3OA6A 2E3HA 1I4K1 3UPUA 1M1KC 2LRQA 4D6WA 3HRSA 4IUUA 3T9NA 2LQ8A 5FW9A 1O9SA 1TS9A 4J9BA 1M1GA 5KYYB 4BB7A 3JCMJ 1XOVA 2C0OA 2BZXA 2O4XB 3PVQA 2PNIA 2DVEA 1FMVA 1NYFA 1RADB 2CDTA 4GBQA 1VQMT 2DEUA 2V8JA 2RQTA 3JCMQ 4X34A 1OPKA 1GBRA 4OMMA 2DPPB 2E41A 2LJ1A 1UJYA 2DL5A 4JLIA 3FEOA 2QA4Q 2COYA 2OJ2A 1I0CA 1PWTA 1PNJA 2JTEA 2K57A 2RN8A 4WCIA 1N9SA 2ZPGB 2BUDA 3CQTA 2EGCA 5D6WA 1VQ9A 2YUNA 4VUBA 3HTRA 1QVGP 3SD4A 3REBB 2X9HA 1YCSB 2NUPA 1AWXA 1X75C 3ER0A 4M7AB 4M7DB 3VKIA 4M77C 2DX1A 1QMCA 3QIIA 3JCMd 2AZSA 2JS2A 5LJ5g 2ZAEA 1Y0MA 2EBPA 4LDXA 5GMKh 1M2OA 1DJ7B 1K1ZA 5C0MA 2OTJQ 3CCMQ 1MNDA 1WHJA 2L0AA 5KYXA 1YP5A 4C92E 2L8DA 4P5NA 3G4SQ 2EGEA 1IGUA 2SRCA 4DBQA 3FRNA 3BFMA 3I5SA 5L8RE 4C8QB 2GNCA 5D7UA 5GANe 3TSWA 4LN2A 4N4IA 2RK1A 1VQ9Q 4QQDA 2D9TA 4JRQA 4QVZA 1JB0E 2DRMA 1WNLA 1I5OB 1MV0B 1UGSB 2XD0A 2KK4A 2EJFA 4LDYA 2J7IA 2JNGA 1U1TA 3JCMf 4XTZA 5GMKi 1WHLA 5A2QE 2DD5A 5KYWA 1GFDA 1GBQA 2P4TA 2EQIA 3ASKA 3M55A 5GAN8 3NPFA 3QWXX 5FLXE 1ZSZC 3WVDB 4OMFB 1ZQ1A 1AVZC 3HFNA 1SKUB 2M51A 1RUWA 3QYGB 4RTUA 2X4WA 1W2BP 4F7UE 4M75A 3MKDA 3QDRB 4PL6A 5GAMd 3EG3A 2COWA 3CCST 1TG0A 3QYHB 4N0AC 2OTLQ 2OAUA 3RMSA 2DBMA 1NLOC 1WPYA 4PFPA 4HT8A 3RESA 4PJOA 1VQ6T 1PKTA 3RKWA 3CPWA 3KXTA 5IHKA 2QK0A 2QTXA 4MZMA 3PMTA 4C5GA 3D7SB 5KCOA 4AFQC 3CCET 1JEGA 4JZ4A 2C06A 2VB6A 1ZSGA 1NEBA 1S1NA 2MWOA 1W1FA 1JJ2A 1BU1A 2RA2A 2FG0A 2XICA 1ZBJA 3CCSA 4RG8A 4Z89A 4AG1C 1XJWB 1WFWA 3VS0A 3R6OA 3DKMA 1G3YA 1QVFS 5GJWB 1VYUA 1E6HA 2RI3A 3OW2P 2DKGA 3CCRQ 2KDSA 1KHIA 3CD6T 1VQ6A 2K5LA 4M78F 4L59A 5KYUA 3VS1A 5GAMf 2DETA 1RAIB 2KSSA 4B9XA 3OYIA 3HRUA 2VC8A 2K2VA 4AMCA 1KQSP 3TEEA 1MHNA 2O2OA 3OS5A 3A8HB 2ENMA 4M75G 3OYGA 1TOVA 1R0BG 4N4HA 4FW2A 1GXIE 1H3HA 2I2LA 5IHNA 4JRIA 1M3BA 1WHGA 2VUBA 2HNIA 2DIQA 3QJ6A 3CD6A 2DEQA 3GOXA 4OGCA 1OULA 1X01A 4Y92A 2MWPA 1G3WA 1HJDA 2LCSA 4LDWA 3OS0A 1Y96B 2R5AA 3QUIA 5LJ5j 3MJXA 1M3CA 1PKSA 1I8FA 2EYWA 4KT0E 3V7SA 1K0SA 3CC7Q 3RNJA 2XHCA 1I07A 4R56A 2ZGWA 3H8ZA 2CT3A 3VS5A 2J6FA 1KD1R 4MMLA 1ZBXA 8ATCB 2QXFA 4ZTJA 3BDLA 3AHUA 4ZN3A 5FWBA 3A8OB 4C92F 3VYGA 5KE2A 1N8RR 3QPHA 3JSCA 1WGSA 2X51A 5GANh 2KT8A 1KQ1A 2RHYA 2GQIA 4AT1B 2RB6A 3QZ5B 1C0MA 4A4FA 4PJOE 1X6OA 1CKAA 3CCQT 3CCJQ 1K8AR 2KRNA 1VOMA 4E2FB 1EX4A 3JCMe 2Y90A 4EMKA 2ZPHB 4JUVA 4J9GA 3MPUB 2OI3A 5HKCA 2L2PA 4IKFA 2FEIA 4PFOA 2DZCA 1M1FA 1S72Q 2BTTA 1WA7A 5CKEA 2QTVA 4A63B 3PVLA 2WSEE 3CCUT 1PRLC 3WVEB 1WQWA 4OB2B 2FHDA 1ZUKA 1TWBA 4A4GA 3JCMW 2DXCA 3GPLA 3CCLT 3M4YA 1C6VX 1IHWA 2ZZDA 2QEXT 2K3YA 2CT4A 4RTYA 4FM4B 4J9CA 3CMET 2KRMA 3UF4A 3M58A 2DK3A 4C0GA 4RUGA 1W70A 2CH4A 2IVWA 2XU8A 4F7UF 5KYYA 3RKXA 2HAXA 2FVUA 1WJSA 2PZ1A 3PFSA 2D8HA 1FX7A 1UEBA 5GAMj 4DA4A 3M0UA 2HL5C 1YJNQ 3CCUA 2CZ7B 1X6GA 3S3NA 4NS5A 4BI8B 2O01E 2DYIA 4J8OA 3PMIA 3C0CA 1T3SA 3THKA 2QEXA 4OMPA 2DFUA 3JB9G 4NL2A 3CMEA 2EQJA 2ED0A 2QQRA 3OYJA 5GAMe 1OPLA 4F04B 1LCKA 3EFSA 1SPKA 3ULRB 4M7DA 4KH1B 1NG2A 1UTIA 2I0NA 2YT6A 1OOTA 1Y07A 3M56A 4XU3A 2MPXC 1SSHA 2YUPA 4M77A 1HK9A 3PIOA 2LT4A 3OYKA 1U3OA 1YITT 4L6V5 4LXCA 4AG2C 3LGFA 3L42A 1JXMA 3I55A 3HPWA 1WXUA 4XTWA 3QHSA 5AYFA 3CC2A 1VQ8Q 5GAOm 3CXCA 1YJWQ 1SG5A 1Q86R 1FWZA 3EG0A 1ZUUA 3M0PA 4CC4B 5GAOl 4C0DC 3TVTA 1AWJA 4LUEA 3BW1A 1UGQB 4C0DB 1ZX6A 5L23A 1BKBA 2EJ9A 4GY5A 3GNGA 1YITA 2KROA 2RHZA 2GQVA 2LJ0A 5CKHA 1VQLQ 4XAXB 2CYZB 5I21A 2EYZA 3AT1B 1OYXA 1H92A 3URGA 1F1BB 4J9FA 3I55Q 4OB3B 2X4JA 2BKDN 2GGRA 2XKOC 1M90U 1WHKA 3RKYA 3CC2Q 3EH2A 4PNOA 4M7DG 4M78D 1K8AU 5CR2A 5EG2A 1O75A 2LTOA 3M0QA 2P0KA 3KBGA 3UWNA 3CPWS 2QQBA 4XTVA 2DXTA 4ZTFA 1PSEA 1M90C 1Z9QA 1AOJA
chains in the Genus database with same CATH topology
1M4ZA 3JCMh 1Y71A 3SWNC 1HXDA 1M5Q1 5D6WA 1VQ9A 1JJ2S 2CKKA 4VUBA 4E7LA 3PIPA 3F70A 2RM4A 3SD4A 2MAMA 3OYMA 3UDCA 2GCXA 3MCAB 4JLGA 1XQHA 1X75C 1WJRA 2IG0A 3ER0A 5CQYA 4PJOF 4M7AB 3OYEA 1K9MU 3QBYA 4M7DB 3VKIA 1VQ5A 4M77C 4BI4A 2B8AA 3QIIA 4JS5A 1ZHIA 4ELYC 3JCMd 4CRIA 5LJ5g 1NJIU 3PT9A 3CCLA 2LT1A 2EWNA 2CGHA 3CC7A 4LDXA 5GMKh 2RK2A 4BY6C 2LC4A 1DJ7B 3CCJT 5C0MA 2E70A 2DXUA 3JCMc 2XIDA 1G3TA 2HD0A 4NL3A 4FIBA 4RG2A 4Q5WA 4BY6B 4C92E 2L8DA 3J81E 1G5VA 3LYIA 4P5NA 2AHJB 3ME9A 4B9WA 4HCCA 2DTHA 1K9MC 4M7AA 2EJGA 2M9UA 4J5YA 5IAYA 1S72T 1KG1A 2RD1A 3FRNA 3BFMA 1UGPB 1NJIC 4XQ3A 4ZGDB 4XK8E 5GAOr 5L8RE 4M77E 4C8QB 4EMHA 3OYDA 3OYHA 3CMAT 5GANe 5A0DA 3C94A 4PJOG 5J39A 3BDUA 3OYAA 4N4IA 2RK1A 3OYBA 3L2UA 2KY9A 1AHJB 2YLCA 4QQDA 2D9TA 4BE1A 4JRQA 4QVZA 1JB0E 2F5KA 4LDVA 1WNLA 4EMKC 2L3RA 3CCJA 1M9SA 3SFMA 5I2SA 4PLIA 5CAIA 2R58A 3QJYA 4GLKA 4C92D 3FIFA 4FT2A 3A8MB 1UGSB 2XD0A 2R57A 1OZ3A 2KK4A 2Y4XA 1W2BA 5DM7R 2EJFA 4LDYA 4C8QA 1VQPT 2JNGA 1U1TA 2LCLA 1V29B 3PGGA 3CC4T 3JCMf 4XU1A 1VIFA 4OVAA 1S72A 2K3XA 3E9GA 4XTZA 4L5GA 5GMKi 3LLRA 4M77D 5A2QE 3DLLA 2DD5A 2QI2A 3CBOA 2V8KA 2P4TA 1YJNT 3ASKA 2D0QB 3M55A 5GAN8 1UB4A 3CMAA 5FLXE 3M53A 1KHCA 5GAMh 3H6ZA 3OYCA 2ZPBB 4PJOB 1OZ2A 3WVDB 4OMFB 1ZQ1A 3HFNA 3OYYA 5CO7A 3OSSC 3VUZA 1KC8C 5A0LA 3QYGB 2X4WA 3OQ5A 4F7UE 3V8LA 4BE2A 1KD1U 4M75A 3QXEB 4DQ2A 3QDRB 2WSFE 2QQ9A 3HFOA 4ME7A 2E1HA 2HBPA 4C5IA 5LJ3j 3M5AA 4O6JA 4PL6A 4KBMB 4XU2A 5GAMd 4KULA 3CCST 3QYHB 4II1A 4N0AC 4C5EA 2OAUA 2E64A 3JCMV 3RMSA 1U8RA 4XTUA 1FXXA 1VQPA 2HQEA 1N8RU 1WPYA 5CKBA 1P92A 3CC4A 4HT8A 1WQ7A 3RESA 4PJOA 4M78A 1VQ6T 3RKWA 4J7FA 3CPWA 3KXTA 2JUFA 4HT9A 3HRTA 1W4SA 2QTXA 2KMTA 4MZMA 3PMTA 4ZGJB 3OYNA 4M7AG 1YJNA 3Q1JA 4C5GA 3MP6A 2EQMA 5KCOA 3TU4K 5LJ5h 1KD1C 3CCET 5CVIA 1N9RA 4FL6A 3LWHA 1BYMA 3L1AA 2XDPA 1QVGA 2C06A 4LDUA 4IUTA 1YJ9T 5LJ3e 1D3BB 2MWOA 2P0PA 2DZ9A 2FYKA 3OSVA 1JJ2A 2EQUA 2LDMA 2RA2A 4C0ZA 3OBWA 4M75F 1N8RC 5DY9A 1RI0A 5LJ5d 1XTDA 2XICA 5CQXA 4BE0A 4FSXA 1BI1A 3CCSA 3SDZA 4RG8A 3OW2S 4RKUE 5GANg 4RCCA 3R6OA 3DKMA 3X26B 1YHQT 1G3YA 1R8OB 3MEWA 3G6ET 1VQ8T 1YCYA 3C95A 4MZTA 1QVFS 1I5LA 4M7AC 2RI3A 3JB9I 1YJWT 1K8AC 4M7DC 2DKGA 3CD6T 2KDSA 1KHIA 4J6WA 1QP3A 5GAN7 3WXMB 3L2RA 1VQ6A 2K5LA 1LJOA 4M78F 2V8IA 3MO8A 4C8QG 4L59A 4RCBA 3DB4A 4QW2A 5FRNA 1D3BA 2M1HA 4PKCC 3QO3A 5GAMf 1VQMA 3X25B 4DOWA 2KSSA 1KQSS 2BIVA 2F5TX 4XTYA 4B9XA 3OYIA 3HRUA 1YJ9A 2VC8A 1YBYA 2K2VA 4J6YA 4ZGEB 2A3LA 3A5ZB 2XG8D 2E65A 2ZCFB 3TEEA 3VUBA 1MHNA 3HL8A 2VYTA 3OS5A 2RHIA 3A8HB 3FB9A 4X9CA 5FU7B 5M9OA 3J7AF 4M75G 1VQLT 2E6ZA 3OYGA 4M7DE 4N4HA 3C4SA 1YHQA 1VQ8A 4C8QC 1GXIE 2FB7A 2VXEA 2I2LA 2JOYA 2PVOB 3OMGA 2VUBA 4JRIA 4CI0C 2HNIA 1YJWA 1Q7YU 2DIQA 3QJ6A 3CD6A 2H3JA 3X28B 1LNXA 3JAME 1EIFA 2DEQA 4A4EA 3I55T 3GOXA 3RIRA 4OGCA 3KUFA 3MP1A 3PNWC 5GAN4 5GMKm 3L2WA 4NOYA 5LJ5f 1X01A 2M16A 4OB1B 1K73U 2MWPA 3LH0A 4M78G 3L2ZA 1G3WA 4X9DA 3S6WA 3FC3A 3CC2T 1UGRB 2RO0A 4LDWA 4C92A 5GMKl 1Y96B 3NTIA 3OS0A 5FRMA 2R5AA 3FDRA 3QUIA 3OBYA 3JCMX 2YHTA 3S3OA 5LJ5j 1QP2A 4M75C 5GAN6 5CCAA 3UT1A 3MHXA 1B34A 2PU9B 3OS2A 2EAYA 5D6YA 1I8FA 4BDYA 1NZ9A 4TVRA 1Q7YC 2FL7A 4M7AD 4M75B 2QA4T 3NTHA 4KT0E 4M7DD 3V7SA 1VQLA 2ZPEB 4LD6A 1N6AA 3FLGA 1IZ6A 2XHCA 4OB0B 1K73C 4PLLA 4MDXA 4R56A 4R55A 3JRZA 5LJ3g 2ZGWA 3H8ZA 2XDBA 4PJOC 2HQXA 2RJFA 3J80E 2EIFA 2RJDA 3VV0A 3RUXA 3TCJA 4EDUA 3CPFA 5KE3A 2D6FA 2K5FA 1Y96A 4EPCA 4MMLA 1ZBXA 5KH6A 4M78B 3MEVA 2QXFA 4LD9K 4ZTJA 3A8GB 2JN0A 3BDLA 2DTOA 3M54A 2LNVA 5J3BA 3AHUA 4ZN3A 3HKSA 4BACA 4IURA 4UC4A 1VQNT 5CKFA 3OMCA 3A8OB 5KCHA 4C92F 3VYGA 2CZ1B 2JTMA 4A4HA 3OY9A 4DOVA 2LCCA 5KE2A 3X24B 3CCVT 1VQ7T 4HKEA 2OTJT 3QPHA 1H3ZA 3JSCA 5DLOA 4C5HA 1WGSA 1Y7XA 2KQWA 2Y4YA 4C8QD 5GANh 2JZ2A 1TH7A 5GAN5 2DO3A 2PUKB 2L89A 5GMKj 1KQ1A 1BIAA 2RHYA 3CCMT 2QA4A 1Q86U 2VV5A 3CXCS 3QZ9B 4A4KA 2RB6A 4BDZA 4FU6A 4E7IA 3QZ5B 2MMPA 4WF2A 4M77F 4A4FA 2NLUA 4PJOE 2WSCE 1X6OA 3CCQT 1Q82U 4HCBA 3G4ST 1VQ4T 2LX9A 3I56T 4KUDK 2PVDB 3JCMe 1QVPA 1M8VA 4YTLA 2Y90A 4EMKA 2ZPHB 4IUVA 4JUVA 5GANd 1BI3A 1Q81U 5I2MA 5HKCA 1IREB 3NTKA 1U1SA 4ELZC 4F7UA 3JCMP 4IKFA 2K5IA 1RL2A 2DZCA 3OW2A 1NPRA 1M1FA 4M75D 2E10A 4QQ6A 3OYLA 5IT9E 1QVFA 3JB9H 3HP9A 5CKEA 2DJZA 5HY6A 4C0FA 5GAOn 1VQNA 1Q86C 3G71T 2WSEE 3BY7A 3CCVA 1I81A 1VQ9T 1VQKT 1H641 5GMKe 3LWIA 3CCUT 1YI2T 1VQ7A 3P8HA 3P8BB 1Q82C 3V7CA 4C92G 3WVEB 2MF2A 3X20B 1WQWA 4OB2B 2FHDA 4QQGA 4BD3A 3CCMA 4JJNK 2OTJA 1Q81C 1LOJA 3G7ZA 4A54A 4A4GA 1VIEA 3JCMW 4PJOD 2DXCA 3GPLA 1KQSA 3CCLT 1N27A 2A7YA 2CS7A 3M4YA 3JB9F 3HSBA 3G4SA 2VGNA 5FROA 2ZZDA 2QEXT 1VQ4A 3I56A 2K3YA 4M77G 2K4YA 3SB2A 2RJEA 4FM4B 3ZEHA 4E47A 3CMET 4XTXA 2RH2A 2LQKA 3M58A 2DK3A 2PQWA 4C0GA 3CCEA 3CBMA 4RMOA 2IVWA 3OS1A 1SSFA 2GF7A 2XU8A 4F7UF 4N0AA 2XDDA 3M4GA 3RKXA 2G3RA 2RHXA 4ZN1A 2HAXA 5GAN2 2FVUA 4IUPA 3L2QA 1WJSA 3DB3A 3PFSA 4OF1A 4JRPA 1FX7A 1UEBA 5GAMj 3G71A 5FU7C 3LGLA 4DA4A 1VQKA 2RI2A 3CCUA 2CZ7B 3A8LB 1YI2A 3VU3C 4OGEA 1VQOT 4C92B 3RERA 5DLQE 3SWNB 5GANf 3S3NA 4NS5A 4M7AE 3M9QA 4JDSA 4BI8B 3VJPA 3MP8A 2DXBA 1B34B 3G6EA 2O01E 2RI5A 5LJ3h 4J8OA 3N5BB 3PMIA 2E5QA 2OTLT 3E9FA 5GANj 2QEXA 4M77B 5FU6C 2QQAA 1JBMA 4NL2A 3CMEA 3JB9G 1PSFA 2X4YA 3ZFJA 5D6XA 2EQJA 3M59A 3VYHB 3HHTB 5FU6B 2GFAA 3OB9A 3P8DA 3GIBA 2QQRA 3LW5E 5LJ3d 3OYJA 3E19A 3S3MA 1KQ2A 4V2SA 5GAMe 4QVDA 3MEAA 1QW1A 3QG1A 3SWNA 5HK3A 3LX7A 4F7UG 2P0QA 3EFSA 4E7KA 2X4XA 3EAEA 2LVMA 4E7JA 4JS4A 4M7DA 2EFIA 2F69A 4KUIA 3JCMb 2GFUA 3JCMg 2DIGA 4MZPA 3RMQA 3GP8A 5CIUA 3DLMA 3FJPA 3V7RA 1JRIA 1BI2A 4Y91A 1VQOA 2CZ6B 4C8QE 2VGMA 1Y07A 3M56A 4XU3A 3NFCA 4M77A 2EKOA 1HK9A 3INZA 3PIOA 2E6NA 2LT4A 4O5VA 2KVQG 3OYKA 3OYFA 2DAQA 2RHUA 3QKJA 1YITT 4L6V5 1YIJT 3E1SA 2OTLA 4HA8A 4J6XA 4JRKA 2E12A 4BUGA 5IN1A 3CEYA 3LGFA 4M78C 3L42A 5CK9A 4BI3A 5GAOp 2DTIA 3I55A 2M0OA 4E7HA 3HPWA 4XTWA 3CCRT 2EYQA 3QHSA 5AYFA 2QDYB 3CC2A 4EMKB 5GAOm 3EFRA 1KC8U 3CXCA 2ZPIB 5CKDA 5LJ5e 5GAN3 4M75E 2L5QA 3GF5A 4XU0A 4F7UB 2DD4A 1M1KU 1FWZA 3META 5GAOl 4C0DC 3V8JA 3L2VA 5A0GA 2JTFA 4M7AF 4M7DF 5J26A 2ZPFB 4QVCA 1VUBA 1BIBA 3MEUA 4FT4A 3BW1A 1UGQB 4C0DB 2KAFA 3CBPA 3ZBDA 1BKBA 1XNIA 1W2BS 4M78E 2RJCA 2EJ9A 4GY5A 5LJ3f 3GNGA 2XI9A 1NE8A 1YITA 1YIJA 1BI0A 2QQSA 1NPPA 2RHZA 3OA6A 2GQVA 2WACA 5GAOq 2JVVA 1I4K1 5CKHA 4A53A 4J83A 1OI1A 4OP0A 3UPUA 1M1KC 3CCRA 2LRQA 4XAXB 4D6WA 2CYZB 5I21A 3HRSA 5HK0A 4J7IA 3GNFB 4Z02A 4MDWA 4IUUA 3T9NA 1OYXA 2LQ8A 1O9SA 3URGA 2PVGB 1G3SA 2XK0A 3GLXA 2CZ0B 1M1GA 5LL6S 4HCZA 4BB7A 4C8QF 3JCMJ 1XOVA 4N4GA 2YRVA 2X4JA 2BKDN 4OB3B 2O4XB 2XKOC 1M90U 3M57A 3V8KA 3JB9D 3RKYA 2DVEA 4PNOA 5C6SA 1VQ5T 2EQKA 2MI6A 4M7DG 4M78D 3C12A 3PTAA 1K8AU 3O8VA 1VQMT 3JB9J 5CR2A 2V8JA 3CCQA 5GAMg 4IUQA 3JCMQ 3CC7T 2PUOB 4X34A 4Y28E 3TREA 2DPPB 5EG2A 1O75A 2E41A 2LTOA 2P0KA 3KBGA 3UWNA 3CPWS 2QQBA 4JLIA 2VXFA 3FEOA 4XTVA 1WJQA 2DXTA 4MMKA 4ZTFA 3QSUA 1PSEA 2R5MA 2K57A 1M90C 2O4XA 1QVGS 2YLBA 1MGQA 2X35A 4EMGA 1N9SA 4C92C 2ZPGB 2BUDA 4ATOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MML A;  4V2S A;  3JCM h;  3SWN C;  5GAM e;  4QVD A;  1HXD A;  1M5Q 1;  2QTX A;  4M78 B;  4M7A G;  3SWN A;  4F7U G;  3EFS A;  2RM4 A;  5LJ5 h;  1KQ2 A;  2JN0 A;  1N9R A;  2DTO A;  4PJO F;  3JCM b;  3AHU A;  3L1A A;  4M7A B;  4M7D A;  3JCM g;  4HT9 A;  4M7D B;  4C92 F;  3FJP A;  4M77 C;  1JRI A;  4Y91 A;  3V7R A;  4C8Q E;  5LJ3 e;  3GIB A;  4XU3 A;  1D3B B;  3JCM d;  4M77 A;  2DZ9 A;  2FYK A;  1HK9 A;  3INZ A;  5LJ5 g;  2EWN A;  2RA2 A;  4C8Q D;  2CGH A;  5GAN h;  1TH7 A;  5GAN 5;  5GMK j;  4M75 F;  5GMK h;  1KQ1 A;  1BIA A;  5DY9 A;  5LJ5 d;  2RB6 A;  4HA8 A;  4J6X A;  4JRK A;  2DXU A;  4WF2 A;  3JCM c;  4M77 F;  4M78 C;  4NL3 A;  4M7A A;  4PJO E;  5GAO p;  2DTI A;  5GAN g;  4RCC A;  4C92 E;  4XTW A;  3JCM e;  1YCY A;  1M8V A;  2Y90 A;  4EMK A;  3QHS A;  1I5L A;  4M7A C;  4JUV A;  5GAN d;  1N9S A;  3JB9 I;  4M7D C;  2DKG A;  4EMK B;  5GAO m;  2DTH A;  3EFR A;  4J6W A;  1U1S A;  5GAN 7;  2EJG A;  4F7U A;  5LJ5 e;  3RES A;  3JCM P;  5GAN 3;  1LJO A;  4M75 E;  2DZC A;  4J5Y A;  4M78 F;  4C8Q G;  2RD1 A;  4XU0 A;  3BFM A;  4RCB A;  4F7U B;  4XQ3 A;  1D3B A;  4M75 D;  2E10 A;  3QO3 A;  4M77 E;  5GAO l;  5GAO r;  3JB9 H;  5GAM f;  4C8Q B;  3V8J A;  4EMH A;  4M7A F;  2DJZ A;  5GAO n;  4M7D F;  3BY7 A;  5GAN e;  4QVC A;  1I81 A;  4XTY A;  1BIB A;  1H64 1;  5GMK e;  4PJO G;  3BW1 A;  2VC8 A;  4J6Y A;  3V7C A;  3BDU A;  4C92 G;  2YLC A;  2E65 A;  4M78 E;  1WQW A;  2EJ9 A;  5LJ3 f;  4EMK C;  1WNL A;  1LOJ A;  4A54 A;  3JCM W;  4PJO D;  4X9C A;  5CAI A;  3FB9 A;  4M75 G;  3JB9 F;  4C92 D;  5GAO q;  3HSB A;  1I4K 1;  3FIF A;  4A53 A;  4M7D E;  4OP0 A;  4C8Q C;  4M77 G;  2FB7 A;  2VXE A;  3SB2 A;  2I2L A;  5I21 A;  4JRI A;  2EJF A;  2HNI A;  4XTX A;  4C8Q A;  1U1T A;  3PGG A;  1LNX A;  3JCM f;  4XU1 A;  2DEQ A;  4XTZ A;  3RIR A;  4F7U F;  4N0A A;  4M77 D;  5GMK i;  3M4G A;  3RKX A;  5GAN 4;  5GMK m;  4NOY A;  5LJ3 d;  5LJ5 f;  1X01 A;  4C8Q F;  5GAN 2;  3JCM J;  4M78 G;  3L2Z A;  4X9D A;  5GAN 8;  3V8K A;  5GAM j;  5GAM h;  3JB9 D;  4PJO B;  3RKY A;  4C92 A;  1Y96 B;  2DVE A;  5GMK l;  3HFN A;  4PNO A;  3VU3 C;  3QUI A;  3JCM X;  4C92 B;  4M7D G;  2YHT A;  4M78 D;  5LJ5 j;  3RER A;  4M75 C;  5GAN 6;  3SWN B;  5GAN f;  3JB9 J;  1B34 A;  4HT8 A;  4M7A E;  4F7U E;  3V8L A;  2EAY A;  3JCM Q;  4M75 A;  5GAM g;  1I8F A;  1B34 B;  4DQ2 A;  4M7A D;  3HFO A;  2E1H A;  2E41 A;  4M75 B;  5LJ3 h;  5LJ3 j;  4M7D D;  5GAM d;  3V7S A;  4XU2 A;  4JLI A;  2VXF A;  5GAN j;  4M77 B;  4N0A C;  4XTV A;  2DXT A;  2E64 A;  4MMK A;  3JCM V;  1JBM A;  4NL2 A;  4XTU A;  3JB9 G;  3QSU A;  5LJ3 g;  2ZGW A;  2K57 A;  4PJO C;  1WPY A;  2YLB A;  1MGQ A;  3RUX A;  4EMG A;  1WQ7 A;  4PJO A;  4C92 C;  4M78 A;  1Y96 A;  3RKW A; 
#chains in the Genus database with same CATH topology
 3JCM h;  3SWN C;  1M5Q 1;  1J3T A;  1JJ2 S;  4E7L A;  2ROT A;  2RM4 A;  2GCX A;  4PJO F;  2IG0 A;  3OYE A;  1B3Q A;  4ANJ A;  4BI4 A;  2B8A A;  2CP2 A;  1VQN Q;  1NJI U;  4ELY C;  1QKX A;  2EWN A;  2RK2 A;  1UFF A;  3JCM c;  2HD0 A;  4NL3 A;  1UE9 A;  2FRY A;  4RG2 A;  2HMA A;  4Q5W A;  1IRX A;  1G5V A;  2AHJ B;  3FJ5 A;  3I56 Q;  4B9W A;  4HCC A;  2HKQ B;  2DTH A;  4ORZ A;  2M9U A;  5IAY A;  4CC2 A;  2RD1 A;  1UGP B;  1NJI C;  4XK8 E;  5GAO r;  4M77 E;  4EIK A;  1SHG A;  3OYD A;  2KYM A;  3CMA T;  5IHI A;  3BDU A;  4J9I A;  2NUZ A;  3OYB A;  3L2U A;  4BE1 A;  2YLC A;  2HDA A;  1U06 A;  1UUE A;  4EMK C;  2DLP A;  3SFM A;  2FPD A;  4PLI A;  1T0H A;  3QJY A;  4JJB A;  4C92 D;  1UHC A;  1IGQ A;  2DL7 A;  2HZY A;  1OU8 A;  1W2B A;  1VQP T;  1V29 B;  3PGG A;  1T0J A;  3E9G A;  3LLR A;  2E4H A;  5ECA A;  2RQU A;  2V8K A;  1FMW A;  3CMA A;  3M53 A;  5GAM h;  3H6Z A;  5CO7 A;  2O88 A;  2NUT A;  2DYB A;  2AIR B;  1B7T A;  2MCN A;  3OQ5 A;  7AT1 B;  2DNU A;  3QXE B;  4DQ2 A;  2QQ9 A;  2E1H A;  2HBP A;  3M5A A;  2ABL A;  4KUL A;  1U8R A;  1FXX A;  1VQP A;  5CKB A;  3EG9 B;  1U5S A;  1A0N B;  2ESW A;  4HVU A;  4DBH A;  2BE7 D;  1PCX A;  1YJ9 T;  1D3B B;  2P0P A;  5KYN A;  2LDM A;  4C0Z A;  2V1R A;  2KNB B;  5LJ5 d;  2DIL A;  1XTD A;  1B07 A;  4BE0 A;  1BI1 A;  3SDZ A;  3EGD A;  2A37 A;  1JO8 A;  1YIJ Q;  4RCC A;  3X26 B;  1K9M R;  2EKH A;  1YCY A;  3C95 A;  1I5L A;  2KYB A;  4M7A C;  2QAS A;  4M7D C;  3SHW A;  5GAN 7;  3WXM B;  1QVF P;  1LJO A;  4LUD A;  3MO8 A;  1AT1 B;  2QDL A;  4PFZ A;  2DJQ A;  3EG1 A;  1VQM A;  3X25 B;  1FYN A;  2BIV A;  2F5T X;  2CUD A;  1YJ9 A;  2A3L A;  2FRW A;  3A5Z B;  2HBW A;  4OMQ A;  2HL3 A;  3HL8 A;  2RHI A;  4X9C A;  1AZG B;  3FB9 A;  5FU7 B;  1TUG B;  2VKN A;  1D09 B;  2E6Z A;  2L3P A;  1QCF A;  4C8Q C;  2PVO B;  1UG1 A;  1Q7Y U;  2H3J A;  1LNX A;  3EFO B;  5GMK m;  5LJ5 f;  2SEM A;  3EHR A;  1M30 A;  4X9D A;  1UGR B;  2RO0 A;  1KC8 R;  5GMK l;  5FRM A;  3NTI A;  3RR6 A;  3JCM X;  4ESR A;  3S3O A;  5CCA A;  3UT1 A;  1MMA A;  1Q7Y C;  1VQM Q;  3IQL A;  1QCN A;  2JMA A;  2MIO A;  1IZ6 A;  1AEY A;  4OB0 B;  4MDX A;  5LJ3 g;  3J80 E;  4EDU A;  2AZV A;  2K5F A;  4EPC A;  2D6F A;  5KH6 A;  4FYY B;  4M78 B;  1YWP A;  4J9H A;  1RAB B;  2JN0 A;  2DTO A;  3M54 A;  2ECZ A;  4HT9 A;  3CCV T;  1VQ7 T;  1WDX A;  2KQW A;  2L89 A;  3CXC S;  4A4K A;  3VRZ A;  4FU6 A;  4M77 F;  2YUQ A;  2WSC E;  2P4R A;  3UAT A;  1Q82 U;  4HCB A;  1VQ4 T;  2LX9 A;  4F14 A;  1BI3 A;  3NTK A;  3JCM P;  1QWE A;  1NPR A;  4HXJ A;  4PK4 A;  4M75 D;  3OYL A;  3JB9 H;  3HP9 A;  4C0F A;  2M02 A;  3G71 T;  3CCV A;  1VQK T;  1M3A A;  3VS7 A;  1VQ7 A;  1MMN A;  1YI2 T;  2CP0 A;  1Q82 C;  2OAW A;  4QQG A;  4JJN K;  2A0F B;  1LOJ A;  4PJO D;  1VIE A;  2A7Y A;  4CC7 A;  1JXO A;  2YSQ A;  3HSB A;  1VQ4 A;  2KXD A;  3SB2 A;  1D1B A;  1TTH B;  5FWC A;  1YWO A;  3I9Q A;  3CCE A;  2XMF A;  2RF0 A;  1SSF A;  2XDD A;  2YUO A;  4ZN1 A;  2DA9 A;  5GAN 2;  2FPF A;  4IUP A;  4JRP A;  1TSF A;  4OF1 A;  3G71 A;  2D1X A;  1D0X A;  3LGL A;  5IH2 A;  1VQK A;  2RI2 A;  3A8L B;  3H0I A;  1YI2 A;  1VQO T;  4C92 B;  3RER A;  4FW1 A;  4JDS A;  3VJP A;  1WLP B;  3N5B B;  4RTX A;  1K73 R;  3O5Z A;  3A98 A;  1G83 A;  3H41 A;  3CCS Q;  2D8J A;  1PSF A;  5D6X A;  1K9A A;  3TSZ A;  1KQ2 A;  3S3M A;  1MMG A;  4V2S A;  3MEA A;  1VQ6 Q;  3SWN A;  2DE0 X;  2GTO A;  2LVM A;  2EFI A;  4KUI A;  2DIG A;  3RMQ A;  5CIU A;  3CCE Q;  1VQO A;  3V7R A;  4Y91 A;  5EC7 A;  4O5V A;  2KVQ G;  1PD1 A;  2DAQ A;  2HCK A;  3M0R A;  4GLM A;  5IN1 A;  4B6M A;  4QKU A;  2RNA A;  5CK9 A;  1SRL A;  2QGF B;  2QDY B;  2ROL A;  1KC8 U;  2J6O A;  5LJ5 e;  5GAN 3;  4M75 E;  3GF5 A;  4XU0 A;  4F7U B;  3CD6 Q;  3MET A;  3A1P A;  3L2V A;  3TQ7 P;  2JTF A;  4LNP A;  4QVC A;  3NMZ C;  1VUB A;  2K7A A;  2KAF A;  2EYX A;  1Q81 R;  2EYY A;  1W2B S;  1NE8 A;  1BI0 A;  2WAC A;  5GAO q;  2JVV A;  2G6F X;  4J83 A;  1OI1 A;  4DBR A;  5HK0 A;  4J7I A;  2F2W A;  5HCK A;  2NWM A;  2LMJ A;  2JMC A;  4OML A;  3E2U A;  2YRV A;  3V8K A;  3LH5 A;  3JB9 D;  2CP7 A;  2J6K A;  2V1Q A;  1VQ5 T;  2EQK A;  3C12 A;  2KGT A;  3PTA A;  3JB9 J;  3CCQ A;  4IUQ A;  2NUP B;  2PUO B;  4HVV A;  3TRE A;  1X43 A;  3QWY A;  2O9V A;  1BK2 A;  1WJQ A;  3EG9 A;  2K3B A;  1RAC B;  2O4X A;  1RAE B;  2YLB A;  1MGQ A;  4EMG A;  4ATO A;  1M4Z A;  1Y71 A;  5KYX B;  1PC0 A;  4FYX B;  2CKK A;  1RI9 A;  1OX8 A;  3NHN A;  2MAM A;  3OYM A;  3UDC A;  5CQY A;  3U23 A;  1JJ2 P;  1VQ5 A;  1V76 A;  1ZHI A;  3CCL A;  4CRI A;  3PT9 A;  2LT1 A;  2VVK A;  2CGH A;  5IXF A;  1ARK A;  3EGX B;  4ZNX A;  9ATC B;  3VS6 A;  2XID A;  1G3T A;  1JU5 C;  1WZO A;  1PG5 B;  3ME9 A;  2J06 A;  4M7A A;  2EJG A;  4JZ3 A;  4J5Y A;  4OMN A;  4XQ3 A;  4ZGD B;  1PHT A;  4EMH A;  2JT4 A;  1GCQ A;  3OYH A;  5A0D A;  2W10 A;  1MV3 A;  2KY9 A;  1AHJ B;  3CCU Q;  4RTT A;  1QCO A;  2F5K A;  2LJ3 A;  4LDV A;  1M1K R;  1SEM A;  4GLK A;  2DL8 A;  3A8M B;  1GRI A;  2H3E B;  3CCL Q;  1OZ3 A;  5DM7 R;  2QEX Q;  4C8Q A;  3CC4 T;  4XU1 A;  1VIF A;  3EFO A;  4OVA A;  2EVR A;  3CME Q;  1NLP C;  4M77 D;  1QLY A;  4AFU C;  2D0Q B;  2K9G A;  4PJO B;  2ZPB B;  3OYY A;  3VUZ A;  3V8L A;  4BE2 A;  1KD1 U;  1I1J A;  2WSF E;  4C5I A;  3HFO A;  4O6J A;  1MNE A;  2FZG B;  2AT1 B;  4C5E A;  4PJM A;  2K6D A;  4J9D A;  4XTU A;  3KFV A;  2HQE A;  1N8R U;  1P92 A;  3CC4 A;  1WQ7 A;  4M78 A;  4J7F A;  1W4S A;  2BZY A;  4M7A G;  4KGX B;  4AFZ C;  1G2B A;  3M0S A;  3MP6 A;  2EQM A;  1KD1 C;  1OU9 A;  5LJ5 h;  5CVI A;  1QVG A;  4LDU A;  1E7O A;  2D0N A;  2VAS A;  4D8D A;  4IUT A;  3H0F A;  4DEY A;  2FYK A;  2EQU A;  1D0Y A;  3OBW A;  4M75 F;  1N8R C;  5DY9 A;  1RI0 A;  1AZE A;  2FZK B;  5CQX A;  4FSX A;  1X27 A;  1YIT Q;  4RKU E;  5GAN g;  1X6B A;  1C1A A;  1YHQ T;  1R8O B;  3MEW A;  3G6E T;  4MZT A;  1K8A C;  4M4Z A;  4Z8A A;  4J6W A;  1QP3 A;  3L2R A;  1ACM B;  2V8I A;  4C8Q G;  4RCB A;  3DB4 A;  2LQN A;  4QW2 A;  1HSQ A;  3VS3 A;  1X2K A;  3SEM A;  4DOW A;  4XTY A;  1YBY A;  4ZGE B;  1IXD A;  3VS2 A;  2XG8 D;  1KJW A;  2LQW A;  2OX7 A;  2VYT A;  3J7A F;  5M9O A;  4HVW A;  4M7D E;  3C4S A;  1YHQ A;  1NBE B;  2BE9 B;  4FCY A;  2VXE A;  2JOY A;  3OMG A;  2JXB A;  2HKN A;  3X28 B;  3JAM E;  3NGP A;  1EIF A;  3KUF A;  2DVJ A;  3PNW C;  4NOY A;  3LH0 A;  4M78 G;  3FC3 A;  3S6W A;  2C0T A;  4C92 A;  2VWF A;  3FDR A;  2YHT A;  1QP2 A;  5GAN 6;  1K76 A;  1VA7 A;  3MHX A;  2BZ8 A;  2EAY A;  5D6Y A;  4BDY A;  4TVR A;  2FL7 A;  2QA4 T;  3NTH A;  1KSW A;  6AT1 B;  1HYO A;  1T3L A;  1WIE A;  4PLL A;  1LVK A;  4R55 A;  3JRZ A;  2XDB A;  4RTW A;  2HQX A;  2EIF A;  2M0Y A;  2JM8 A;  3TCJ A;  3CPF A;  1Y96 A;  4F16 A;  1PD0 A;  3MEV A;  3A8G B;  2LNV A;  3HKS A;  4BAC A;  2CSQ A;  4UC4 A;  1TU0 B;  3OY9 A;  2CZ1 B;  2JTM A;  4KGZ B;  5GJV B;  4A4H A;  4DOV A;  1FMK A;  4HKE A;  5DLO A;  4C5H A;  1TH7 A;  2DO3 A;  2PUK B;  2OTJ T;  3CCM T;  1Q86 U;  2QA4 A;  2VV5 A;  3G4S T;  2RPN A;  4KUD K;  1M8V A;  1QVP A;  4YTL A;  3RBB B;  3ZL7 C;  4IUV A;  5I2M A;  1IRE B;  1U1S A;  4ELZ C;  4F7U A;  3OW2 A;  1RAH B;  5IT9 E;  1UGV A;  1M2V B;  5GAO n;  1GL5 A;  1Q86 C;  1TXQ A;  2ATC B;  1I81 A;  1VQ9 T;  2HSE B;  3CMA Q;  3P8B B;  1WHM A;  4C92 G;  2MF2 A;  4BD3 A;  2OTJ A;  3CCM A;  3G7Z A;  1KQS A;  1N27 A;  3JB9 F;  3G4S A;  2VGN A;  4E6R A;  2K4Y A;  2E3I A;  3ZEH A;  4E47 A;  2LX7 A;  2LQK A;  1SF9 A;  1GCQ C;  3VS4 A;  2NYS A;  1VQP Q;  2GF7 A;  3M4G A;  3DB3 A;  5FU7 C;  2GBQ A;  2DRK A;  2CRE A;  2JM9 A;  2DL4 A;  1Q95 G;  3M9Q A;  1B34 B;  1UJ0 A;  2OTL T;  2E5Q A;  1BCO A;  5GAN j;  4M77 B;  1HD3 A;  2QQA A;  1JBM A;  3ZFJ A;  1WHH A;  3HHT B;  1KFZ A;  2A08 A;  1VYT A;  3GIB A;  3LW5 E;  5LJ3 d;  3E19 A;  4QVD A;  2KI7 A;  5HK3 A;  5AT1 B;  4F7U G;  2P0Q A;  4E7Z A;  4E7J A;  2CH4 W;  2CP5 A;  4JS4 A;  3JCM g;  2EGA A;  4F17 A;  3GP8 A;  3FJP A;  1JRI A;  2DF6 A;  1ZUY A;  2CZ6 B;  2VGM A;  3NFC A;  2EKO A;  3EGX A;  1YJ9 Q;  2YRD A;  2RHU A;  1GFC A;  3QKJ A;  2OTL A;  3E1S A;  2E12 A;  4M78 C;  2JJ9 A;  4BI3 A;  2M0O A;  3CCR T;  2EYQ A;  1BB9 A;  3EFR A;  2ZPI B;  2F1L A;  1YNZ A;  2E5K A;  2W0Z A;  1BCM A;  4M7A F;  4M7D F;  5J26 A;  1BIB A;  4IIM A;  2DM1 A;  1KK7 A;  1OQK A;  5LJ3 f;  2QQS A;  1NPP A;  1ZSZ B;  1RAA B;  1AWW A;  4A53 A;  4OP0 A;  3CCR A;  1MMD A;  3GNF B;  4Z02 A;  4MDW A;  4LE9 A;  2KXC A;  2PVG B;  1G3S A;  2XK0 A;  3GLX A;  2CZ0 B;  2Z0W A;  5LL6 S;  4HCZ A;  4C8Q F;  4N4G A;  1PRM C;  2K2M A;  4KGV B;  3M57 A;  4CC3 A;  1WYX A;  1OX9 A;  5C6S A;  2MI6 A;  1N5Z A;  2J05 A;  2O31 A;  4DBF A;  5I22 A;  3O8V A;  5IXB A;  4IIO A;  5GAM g;  3CC7 T;  4Y28 E;  1YFN A;  2HQH A;  1OEB A;  2A36 A;  2VXF A;  2HEQ A;  4MMK A;  3QSU A;  4K11 A;  2R5M A;  1VYV A;  1QVG S;  2X35 A;  4C92 C;  2CP3 A;  1HXD A;  4PJJ A;  3PIP A;  3F70 A;  3MCA B;  4JLG A;  1XQH A;  1WJR A;  1K9M U;  1TUD A;  3QBY A;  3VRY A;  1CSK A;  1OV3 A;  8AT1 B;  3UA7 A;  1NYG A;  4JS5 A;  2X3W D;  3CCV Q;  1WXB A;  1VQ7 Q;  3CC7 A;  3GBQ A;  2FO0 A;  4BY6 C;  2LC4 A;  3CCJ T;  2E70 A;  2DXU A;  4FIB A;  1LPL A;  1UHF A;  4BY6 B;  3J81 E;  3LYI A;  2YRC A;  4JPB W;  1VQ4 Q;  4QT7 A;  1K9M C;  2RQV A;  1UEC A;  1S72 T;  1KG1 A;  2MYS A;  3I5R A;  2DER A;  1RLQ C;  3C94 A;  4PJO G;  5J39 A;  3G71 Q;  3OYA A;  2RQR A;  1VQK Q;  1YI2 Q;  2X3X D;  1RAF B;  2L3R A;  3CCJ A;  1M9S A;  5I2S A;  5CAI A;  2NUT B;  2R58 A;  1SRM A;  3G1J A;  2MOX A;  3FIF A;  1IB8 A;  4FT2 A;  3H9N A;  2R57 A;  2Y4X A;  2LCL A;  2MK5 A;  1RLP C;  1S72 A;  2K3X A;  3DLL A;  2CP6 A;  4L5G A;  1QWF A;  1ZLM A;  2QI2 A;  3CBO A;  1YJN T;  1UB4 A;  1ZA2 B;  3OYC A;  1KHC A;  3EGU A;  1OZ2 A;  1GCP A;  3OSS C;  2V26 A;  1KC8 C;  1BBZ A;  5A0L A;  2F2X A;  2JS0 A;  1VQO Q;  4R0K A;  1WXT A;  4ME7 A;  5LJ3 j;  4KBM B;  4XU2 A;  4D8K A;  2AKL A;  2FPE A;  1V1C A;  2RMO A;  4II1 A;  1M90 R;  2E64 A;  3JCM V;  1M27 C;  3EGD B;  2JUF A;  3HRT A;  3OYN A;  2KMT A;  2AK5 A;  4ZGJ B;  2DMO A;  1YJN A;  3Q1J A;  2KT1 A;  2YWW A;  3TU4 K;  2PTK A;  1N9R A;  4FL6 A;  3LWH A;  1BYM A;  3L1A A;  2XDP A;  3EH1 A;  5LJ3 e;  2IIM A;  3OSV A;  2DZ9 A;  1AWO A;  1SHF A;  2EW3 A;  4DEX A;  1JQQ A;  3CPW P;  2L3S A;  3OW2 S;  2JW4 A;  1VQ8 T;  2QG9 B;  1ABO A;  1IHV A;  1R0C B;  3JB9 I;  1YJW T;  1K4U S;  1NJI R;  3M0T A;  4PJL A;  2GTJ A;  5FRN A;  1D3B A;  2M1H A;  4PKC C;  3QO3 A;  1M2V A;  2QYZ A;  2P84 A;  4JJC A;  2COZ A;  2DL3 A;  1KQS S;  4J6Y A;  1EFN A;  2E65 A;  2ZCF B;  4OMO A;  1NEG A;  3VUB A;  3CCQ Q;  1VQL T;  1VQ8 A;  2FB7 A;  4CI0 C;  2LZ6 B;  4RTV A;  1YJW A;  4A4E A;  3I55 T;  3RIR A;  5GAN 4;  3MP1 A;  3L2W A;  1K73 U;  2M16 A;  4OB1 B;  3CC2 T;  3L2Z A;  4E7S A;  4J9E A;  2AKK A;  5KYW B;  2KE9 A;  1R77 A;  3OBY A;  4M75 C;  1B34 A;  2PU9 B;  3REA B;  4WTO B;  3OS2 A;  1VQ5 Q;  1NZ9 A;  1AD5 A;  2KEA A;  4M7A D;  4M75 B;  4M7D D;  1VQL A;  2ZPE B;  2LNH B;  1WX6 A;  1N6A A;  3FLG A;  4LD6 A;  1EZZ B;  2EPD A;  1K73 C;  2HSP A;  4X1V A;  4PJO C;  2RJF A;  2KR3 A;  2RJD A;  3VV0 A;  3RUX A;  5KE3 A;  3I35 A;  4PJN A;  4LD9 K;  5J3B A;  4JJD A;  4IUR A;  1VQN T;  2O9S A;  5CKF A;  2H8H A;  3OMC A;  4AFS C;  5KCH A;  2QAZ A;  4KH0 B;  3RDV A;  2LCC A;  3X24 B;  1H3Z A;  1TUC A;  3JV3 A;  1Y7X A;  2Y4Y A;  4C8Q D;  2JZ2 A;  5GAN 5;  4HCK A;  4KRT A;  5GMK j;  1BIA A;  2CUB A;  4BDZ A;  1D0Z A;  3QZ9 B;  4E7I A;  2LP5 A;  2MMP A;  4WF2 A;  2L3Q A;  2NLU A;  1YN8 A;  3I56 T;  2PVD B;  1Q81 U;  5GAN d;  3BE3 A;  2K5I A;  1RL2 A;  1PM3 A;  4QQ6 A;  2E10 A;  5I11 A;  1QVF A;  4FSS A;  5KYU B;  2A28 A;  2DJZ A;  5HY6 A;  1VQN A;  3BY7 A;  1H64 1;  5GMK e;  3LWI A;  3P8H A;  2B86 A;  3V7C A;  3EHQ A;  3X20 B;  1ZSZ A;  1Q81 C;  4A54 A;  4RTZ A;  2C0I A;  2KBT A;  2CS7 A;  5FRO A;  3I56 A;  4M77 G;  1RAG B;  2RJE A;  4XTX A;  4FYW B;  2RH2 A;  2PQW A;  1QQJ A;  3CBM A;  4RMO A;  3OS1 A;  4N0A A;  3CC4 Q;  2G3R A;  2CSI A;  2RHX A;  2K79 A;  3L2Q A;  1G8X A;  2KRS A;  1D1C A;  1MUZ A;  3VU3 C;  4OGE A;  1IO6 A;  2FZC B;  1Q7Y R;  3R6N A;  5DLQ E;  3SWN B;  5GAN f;  4M7A E;  3MP8 A;  2DXB A;  3G6E A;  2RI5 A;  5LJ3 h;  3E9F A;  1QKW A;  1K0X A;  5FU6 C;  3H0H A;  1D1A A;  1KIK A;  2RQW A;  2X4Y A;  3UA6 A;  3EG2 A;  3M59 A;  3VYH B;  5FU6 B;  2GFA A;  3OB9 A;  3P8D A;  3QDF A;  2YXY A;  2DBK A;  1Y57 A;  1Z9Z A;  1QW1 A;  4Z88 A;  3QG1 A;  3LX7 A;  4E7K A;  1H8K A;  2X4X A;  3EAE A;  2F69 A;  3JCM b;  1ZA1 B;  2GFU A;  4MZP A;  3DLM A;  1BI2 A;  4C8Q E;  2QGG A;  3INZ A;  2E6N A;  3OYF A;  1YIJ T;  4HA8 A;  4J6X A;  4JRK A;  4BUG A;  1CKB A;  3CEY A;  5GAO p;  2DTI A;  4E7H A;  1M8M A;  2ED1 A;  1YHQ Q;  3G6E Q;  4EMK B;  1UDL A;  5CKD A;  1NM7 A;  4FYV B;  1X69 A;  2L5Q A;  2IPO B;  2F2V A;  2DD4 A;  1M1K U;  1X2Q A;  3V8J A;  5A0G A;  1Q82 R;  2ZPF B;  1WI7 A;  3MEU A;  4FT4 A;  2YDL A;  3CBP A;  3ZBD A;  1XNI A;  4M78 E;  2RJC A;  1W6X A;  2XI9 A;  1YIJ A;  1ABQ A;  3PE0 A;  3CXC P;  1E6G A;  3OA6 A;  2E3H A;  1I4K 1;  3UPU A;  1M1K C;  2LRQ A;  4D6W A;  3HRS A;  4IUU A;  3T9N A;  2LQ8 A;  5FW9 A;  1O9S A;  1TS9 A;  4J9B A;  1M1G A;  5KYY B;  4BB7 A;  3JCM J;  1XOV A;  2C0O A;  2BZX A;  2O4X B;  3PVQ A;  2PNI A;  2DVE A;  1FMV A;  1NYF A;  1RAD B;  2CDT A;  4GBQ A;  1VQM T;  2DEU A;  2V8J A;  2RQT A;  3JCM Q;  4X34 A;  1OPK A;  1GBR A;  4OMM A;  2DPP B;  2E41 A;  2LJ1 A;  1UJY A;  2DL5 A;  4JLI A;  3FEO A;  2QA4 Q;  2COY A;  2OJ2 A;  1I0C A;  1PWT A;  1PNJ A;  2JTE A;  2K57 A;  2RN8 A;  4WCI A;  1N9S A;  2ZPG B;  2BUD A;  3CQT A;  2EGC A;  5D6W A;  1VQ9 A;  2YUN A;  4VUB A;  3HTR A;  1QVG P;  3SD4 A;  3REB B;  2X9H A;  1YCS B;  2NUP A;  1AWX A;  1X75 C;  3ER0 A;  4M7A B;  4M7D B;  3VKI A;  4M77 C;  2DX1 A;  1QMC A;  3QII A;  3JCM d;  2AZS A;  2JS2 A;  5LJ5 g;  2ZAE A;  1Y0M A;  2EBP A;  4LDX A;  5GMK h;  1M2O A;  1DJ7 B;  1K1Z A;  5C0M A;  2OTJ Q;  3CCM Q;  1MND A;  1WHJ A;  2L0A A;  5KYX A;  1YP5 A;  4C92 E;  2L8D A;  4P5N A;  3G4S Q;  2EGE A;  1IGU A;  2SRC A;  4DBQ A;  3FRN A;  3BFM A;  3I5S A;  5L8R E;  4C8Q B;  2GNC A;  5D7U A;  5GAN e;  3TSW A;  4LN2 A;  4N4I A;  2RK1 A;  1VQ9 Q;  4QQD A;  2D9T A;  4JRQ A;  4QVZ A;  1JB0 E;  2DRM A;  1WNL A;  1I5O B;  1MV0 B;  1UGS B;  2XD0 A;  2KK4 A;  2EJF A;  4LDY A;  2J7I A;  2JNG A;  1U1T A;  3JCM f;  4XTZ A;  5GMK i;  1WHL A;  5A2Q E;  2DD5 A;  5KYW A;  1GFD A;  1GBQ A;  2P4T A;  2EQI A;  3ASK A;  3M55 A;  5GAN 8;  3NPF A;  3QWX X;  5FLX E;  1ZSZ C;  3WVD B;  4OMF B;  1ZQ1 A;  1AVZ C;  3HFN A;  1SKU B;  2M51 A;  1RUW A;  3QYG B;  4RTU A;  2X4W A;  1W2B P;  4F7U E;  4M75 A;  3MKD A;  3QDR B;  4PL6 A;  5GAM d;  3EG3 A;  2COW A;  3CCS T;  1TG0 A;  3QYH B;  4N0A C;  2OTL Q;  2OAU A;  3RMS A;  2DBM A;  1NLO C;  1WPY A;  4PFP A;  4HT8 A;  3RES A;  4PJO A;  1VQ6 T;  1PKT A;  3RKW A;  3CPW A;  3KXT A;  5IHK A;  2QK0 A;  2QTX A;  4MZM A;  3PMT A;  4C5G A;  3D7S B;  5KCO A;  4AFQ C;  3CCE T;  1JEG A;  4JZ4 A;  2C06 A;  2VB6 A;  1ZSG A;  1NEB A;  1S1N A;  2MWO A;  1W1F A;  1JJ2 A;  1BU1 A;  2RA2 A;  2FG0 A;  2XIC A;  1ZBJ A;  3CCS A;  4RG8 A;  4Z89 A;  4AG1 C;  1XJW B;  1WFW A;  3VS0 A;  3R6O A;  3DKM A;  1G3Y A;  1QVF S;  5GJW B;  1VYU A;  1E6H A;  2RI3 A;  3OW2 P;  2DKG A;  3CCR Q;  2KDS A;  1KHI A;  3CD6 T;  1VQ6 A;  2K5L A;  4M78 F;  4L59 A;  5KYU A;  3VS1 A;  5GAM f;  2DET A;  1RAI B;  2KSS A;  4B9X A;  3OYI A;  3HRU A;  2VC8 A;  2K2V A;  4AMC A;  1KQS P;  3TEE A;  1MHN A;  2O2O A;  3OS5 A;  3A8H B;  2ENM A;  4M75 G;  3OYG A;  1TOV A;  1R0B G;  4N4H A;  4FW2 A;  1GXI E;  1H3H A;  2I2L A;  5IHN A;  4JRI A;  1M3B A;  1WHG A;  2VUB A;  2HNI A;  2DIQ A;  3QJ6 A;  3CD6 A;  2DEQ A;  3GOX A;  4OGC A;  1OUL A;  1X01 A;  4Y92 A;  2MWP A;  1G3W A;  1HJD A;  2LCS A;  4LDW A;  3OS0 A;  1Y96 B;  2R5A A;  3QUI A;  5LJ5 j;  3MJX A;  1M3C A;  1PKS A;  1I8F A;  2EYW A;  4KT0 E;  3V7S A;  1K0S A;  3CC7 Q;  3RNJ A;  2XHC A;  1I07 A;  4R56 A;  2ZGW A;  3H8Z A;  2CT3 A;  3VS5 A;  2J6F A;  1KD1 R;  4MML A;  1ZBX A;  8ATC B;  2QXF A;  4ZTJ A;  3BDL A;  3AHU A;  4ZN3 A;  5FWB A;  3A8O B;  4C92 F;  3VYG A;  5KE2 A;  1N8R R;  3QPH A;  3JSC A;  1WGS A;  2X51 A;  5GAN h;  2KT8 A;  1KQ1 A;  2RHY A;  2GQI A;  4AT1 B;  2RB6 A;  3QZ5 B;  1C0M A;  4A4F A;  4PJO E;  1X6O A;  1CKA A;  3CCQ T;  3CCJ Q;  1K8A R;  2KRN A;  1VOM A;  4E2F B;  1EX4 A;  3JCM e;  2Y90 A;  4EMK A;  2ZPH B;  4JUV A;  4J9G A;  3MPU B;  2OI3 A;  5HKC A;  2L2P A;  4IKF A;  2FEI A;  4PFO A;  2DZC A;  1M1F A;  1S72 Q;  2BTT A;  1WA7 A;  5CKE A;  2QTV A;  4A63 B;  3PVL A;  2WSE E;  3CCU T;  1PRL C;  3WVE B;  1WQW A;  4OB2 B;  2FHD A;  1ZUK A;  1TWB A;  4A4G A;  3JCM W;  2DXC A;  3GPL A;  3CCL T;  3M4Y A;  1C6V X;  1IHW A;  2ZZD A;  2QEX T;  2K3Y A;  2CT4 A;  4RTY A;  4FM4 B;  4J9C A;  3CME T;  2KRM A;  3UF4 A;  3M58 A;  2DK3 A;  4C0G A;  4RUG A;  1W70 A;  2CH4 A;  2IVW A;  2XU8 A;  4F7U F;  5KYY A;  3RKX A;  2HAX A;  2FVU A;  1WJS A;  2PZ1 A;  3PFS A;  2D8H A;  1FX7 A;  1UEB A;  5GAM j;  4DA4 A;  3M0U A;  2HL5 C;  1YJN Q;  3CCU A;  2CZ7 B;  1X6G A;  3S3N A;  4NS5 A;  4BI8 B;  2O01 E;  2DYI A;  4J8O A;  3PMI A;  3C0C A;  1T3S A;  3THK A;  2QEX A;  4OMP A;  2DFU A;  3JB9 G;  4NL2 A;  3CME A;  2EQJ A;  2ED0 A;  2QQR A;  3OYJ A;  5GAM e;  1OPL A;  4F04 B;  1LCK A;  3EFS A;  1SPK A;  3ULR B;  4M7D A;  4KH1 B;  1NG2 A;  1UTI A;  2I0N A;  2YT6 A;  1OOT A;  1Y07 A;  3M56 A;  4XU3 A;  2MPX C;  1SSH A;  2YUP A;  4M77 A;  1HK9 A;  3PIO A;  2LT4 A;  3OYK A;  1U3O A;  1YIT T;  4L6V 5;  4LXC A;  4AG2 C;  3LGF A;  3L42 A;  1JXM A;  3I55 A;  3HPW A;  1WXU A;  4XTW A;  3QHS A;  5AYF A;  3CC2 A;  1VQ8 Q;  5GAO m;  3CXC A;  1YJW Q;  1SG5 A;  1Q86 R;  1FWZ A;  3EG0 A;  1ZUU A;  3M0P A;  4CC4 B;  5GAO l;  4C0D C;  3TVT A;  1AWJ A;  4LUE A;  3BW1 A;  1UGQ B;  4C0D B;  1ZX6 A;  5L23 A;  1BKB A;  2EJ9 A;  4GY5 A;  3GNG A;  1YIT A;  2KRO A;  2RHZ A;  2GQV A;  2LJ0 A;  5CKH A;  1VQL Q;  4XAX B;  2CYZ B;  5I21 A;  2EYZ A;  3AT1 B;  1OYX A;  1H92 A;  3URG A;  1F1B B;  4J9F A;  3I55 Q;  4OB3 B;  2X4J A;  2BKD N;  2GGR A;  2XKO C;  1M90 U;  1WHK A;  3RKY A;  3CC2 Q;  3EH2 A;  4PNO A;  4M7D G;  4M78 D;  1K8A U;  5CR2 A;  5EG2 A;  1O75 A;  2LTO A;  3M0Q A;  2P0K A;  3KBG A;  3UWN A;  3CPW S;  2QQB A;  4XTV A;  2DXT A;  4ZTF A;  1PSE A;  1M90 C;  1Z9Q A;  1AOJ A; 
#chains in the Genus database with same CATH homology
 1M4Z A;  3JCM h;  1Y71 A;  3SWN C;  1HXD A;  1M5Q 1;  5D6W A;  1VQ9 A;  1JJ2 S;  2CKK A;  4VUB A;  4E7L A;  3PIP A;  3F70 A;  2RM4 A;  3SD4 A;  2MAM A;  3OYM A;  3UDC A;  2GCX A;  3MCA B;  4JLG A;  1XQH A;  1X75 C;  1WJR A;  2IG0 A;  3ER0 A;  5CQY A;  4PJO F;  4M7A B;  3OYE A;  1K9M U;  3QBY A;  4M7D B;  3VKI A;  1VQ5 A;  4M77 C;  4BI4 A;  2B8A A;  3QII A;  4JS5 A;  1ZHI A;  4ELY C;  3JCM d;  4CRI A;  5LJ5 g;  1NJI U;  3PT9 A;  3CCL A;  2LT1 A;  2EWN A;  2CGH A;  3CC7 A;  4LDX A;  5GMK h;  2RK2 A;  4BY6 C;  2LC4 A;  1DJ7 B;  3CCJ T;  5C0M A;  2E70 A;  2DXU A;  3JCM c;  2XID A;  1G3T A;  2HD0 A;  4NL3 A;  4FIB A;  4RG2 A;  4Q5W A;  4BY6 B;  4C92 E;  2L8D A;  3J81 E;  1G5V A;  3LYI A;  4P5N A;  2AHJ B;  3ME9 A;  4B9W A;  4HCC A;  2DTH A;  1K9M C;  4M7A A;  2EJG A;  2M9U A;  4J5Y A;  5IAY A;  1S72 T;  1KG1 A;  2RD1 A;  3FRN A;  3BFM A;  1UGP B;  1NJI C;  4XQ3 A;  4ZGD B;  4XK8 E;  5GAO r;  5L8R E;  4M77 E;  4C8Q B;  4EMH A;  3OYD A;  3OYH A;  3CMA T;  5GAN e;  5A0D A;  3C94 A;  4PJO G;  5J39 A;  3BDU A;  3OYA A;  4N4I A;  2RK1 A;  3OYB A;  3L2U A;  2KY9 A;  1AHJ B;  2YLC A;  4QQD A;  2D9T A;  4BE1 A;  4JRQ A;  4QVZ A;  1JB0 E;  2F5K A;  4LDV A;  1WNL A;  4EMK C;  2L3R A;  3CCJ A;  1M9S A;  3SFM A;  5I2S A;  4PLI A;  5CAI A;  2R58 A;  3QJY A;  4GLK A;  4C92 D;  3FIF A;  4FT2 A;  3A8M B;  1UGS B;  2XD0 A;  2R57 A;  1OZ3 A;  2KK4 A;  2Y4X A;  1W2B A;  5DM7 R;  2EJF A;  4LDY A;  4C8Q A;  1VQP T;  2JNG A;  1U1T A;  2LCL A;  1V29 B;  3PGG A;  3CC4 T;  3JCM f;  4XU1 A;  1VIF A;  4OVA A;  1S72 A;  2K3X A;  3E9G A;  4XTZ A;  4L5G A;  5GMK i;  3LLR A;  4M77 D;  5A2Q E;  3DLL A;  2DD5 A;  2QI2 A;  3CBO A;  2V8K A;  2P4T A;  1YJN T;  3ASK A;  2D0Q B;  3M55 A;  5GAN 8;  1UB4 A;  3CMA A;  5FLX E;  3M53 A;  1KHC A;  5GAM h;  3H6Z A;  3OYC A;  2ZPB B;  4PJO B;  1OZ2 A;  3WVD B;  4OMF B;  1ZQ1 A;  3HFN A;  3OYY A;  5CO7 A;  3OSS C;  3VUZ A;  1KC8 C;  5A0L A;  3QYG B;  2X4W A;  3OQ5 A;  4F7U E;  3V8L A;  4BE2 A;  1KD1 U;  4M75 A;  3QXE B;  4DQ2 A;  3QDR B;  2WSF E;  2QQ9 A;  3HFO A;  4ME7 A;  2E1H A;  2HBP A;  4C5I A;  5LJ3 j;  3M5A A;  4O6J A;  4PL6 A;  4KBM B;  4XU2 A;  5GAM d;  4KUL A;  3CCS T;  3QYH B;  4II1 A;  4N0A C;  4C5E A;  2OAU A;  2E64 A;  3JCM V;  3RMS A;  1U8R A;  4XTU A;  1FXX A;  1VQP A;  2HQE A;  1N8R U;  1WPY A;  5CKB A;  1P92 A;  3CC4 A;  4HT8 A;  1WQ7 A;  3RES A;  4PJO A;  4M78 A;  1VQ6 T;  3RKW A;  4J7F A;  3CPW A;  3KXT A;  2JUF A;  4HT9 A;  3HRT A;  1W4S A;  2QTX A;  2KMT A;  4MZM A;  3PMT A;  4ZGJ B;  3OYN A;  4M7A G;  1YJN A;  3Q1J A;  4C5G A;  3MP6 A;  2EQM A;  5KCO A;  3TU4 K;  5LJ5 h;  1KD1 C;  3CCE T;  5CVI A;  1N9R A;  4FL6 A;  3LWH A;  1BYM A;  3L1A A;  2XDP A;  1QVG A;  2C06 A;  4LDU A;  4IUT A;  1YJ9 T;  5LJ3 e;  1D3B B;  2MWO A;  2P0P A;  2DZ9 A;  2FYK A;  3OSV A;  1JJ2 A;  2EQU A;  2LDM A;  2RA2 A;  4C0Z A;  3OBW A;  4M75 F;  1N8R C;  5DY9 A;  1RI0 A;  5LJ5 d;  1XTD A;  2XIC A;  5CQX A;  4BE0 A;  4FSX A;  1BI1 A;  3CCS A;  3SDZ A;  4RG8 A;  3OW2 S;  4RKU E;  5GAN g;  4RCC A;  3R6O A;  3DKM A;  3X26 B;  1YHQ T;  1G3Y A;  1R8O B;  3MEW A;  3G6E T;  1VQ8 T;  1YCY A;  3C95 A;  4MZT A;  1QVF S;  1I5L A;  4M7A C;  2RI3 A;  3JB9 I;  1YJW T;  1K8A C;  4M7D C;  2DKG A;  3CD6 T;  2KDS A;  1KHI A;  4J6W A;  1QP3 A;  5GAN 7;  3WXM B;  3L2R A;  1VQ6 A;  2K5L A;  1LJO A;  4M78 F;  2V8I A;  3MO8 A;  4C8Q G;  4L59 A;  4RCB A;  3DB4 A;  4QW2 A;  5FRN A;  1D3B A;  2M1H A;  4PKC C;  3QO3 A;  5GAM f;  1VQM A;  3X25 B;  4DOW A;  2KSS A;  1KQS S;  2BIV A;  2F5T X;  4XTY A;  4B9X A;  3OYI A;  3HRU A;  1YJ9 A;  2VC8 A;  1YBY A;  2K2V A;  4J6Y A;  4ZGE B;  2A3L A;  3A5Z B;  2XG8 D;  2E65 A;  2ZCF B;  3TEE A;  3VUB A;  1MHN A;  3HL8 A;  2VYT A;  3OS5 A;  2RHI A;  3A8H B;  3FB9 A;  4X9C A;  5FU7 B;  5M9O A;  3J7A F;  4M75 G;  1VQL T;  2E6Z A;  3OYG A;  4M7D E;  4N4H A;  3C4S A;  1YHQ A;  1VQ8 A;  4C8Q C;  1GXI E;  2FB7 A;  2VXE A;  2I2L A;  2JOY A;  2PVO B;  3OMG A;  2VUB A;  4JRI A;  4CI0 C;  2HNI A;  1YJW A;  1Q7Y U;  2DIQ A;  3QJ6 A;  3CD6 A;  2H3J A;  3X28 B;  1LNX A;  3JAM E;  1EIF A;  2DEQ A;  4A4E A;  3I55 T;  3GOX A;  3RIR A;  4OGC A;  3KUF A;  3MP1 A;  3PNW C;  5GAN 4;  5GMK m;  3L2W A;  4NOY A;  5LJ5 f;  1X01 A;  2M16 A;  4OB1 B;  1K73 U;  2MWP A;  3LH0 A;  4M78 G;  3L2Z A;  1G3W A;  4X9D A;  3S6W A;  3FC3 A;  3CC2 T;  1UGR B;  2RO0 A;  4LDW A;  4C92 A;  5GMK l;  1Y96 B;  3NTI A;  3OS0 A;  5FRM A;  2R5A A;  3FDR A;  3QUI A;  3OBY A;  3JCM X;  2YHT A;  3S3O A;  5LJ5 j;  1QP2 A;  4M75 C;  5GAN 6;  5CCA A;  3UT1 A;  3MHX A;  1B34 A;  2PU9 B;  3OS2 A;  2EAY A;  5D6Y A;  1I8F A;  4BDY A;  1NZ9 A;  4TVR A;  1Q7Y C;  2FL7 A;  4M7A D;  4M75 B;  2QA4 T;  3NTH A;  4KT0 E;  4M7D D;  3V7S A;  1VQL A;  2ZPE B;  4LD6 A;  1N6A A;  3FLG A;  1IZ6 A;  2XHC A;  4OB0 B;  1K73 C;  4PLL A;  4MDX A;  4R56 A;  4R55 A;  3JRZ A;  5LJ3 g;  2ZGW A;  3H8Z A;  2XDB A;  4PJO C;  2HQX A;  2RJF A;  3J80 E;  2EIF A;  2RJD A;  3VV0 A;  3RUX A;  3TCJ A;  4EDU A;  3CPF A;  5KE3 A;  2D6F A;  2K5F A;  1Y96 A;  4EPC A;  4MML A;  1ZBX A;  5KH6 A;  4M78 B;  3MEV A;  2QXF A;  4LD9 K;  4ZTJ A;  3A8G B;  2JN0 A;  3BDL A;  2DTO A;  3M54 A;  2LNV A;  5J3B A;  3AHU A;  4ZN3 A;  3HKS A;  4BAC A;  4IUR A;  4UC4 A;  1VQN T;  5CKF A;  3OMC A;  3A8O B;  5KCH A;  4C92 F;  3VYG A;  2CZ1 B;  2JTM A;  4A4H A;  3OY9 A;  4DOV A;  2LCC A;  5KE2 A;  3X24 B;  3CCV T;  1VQ7 T;  4HKE A;  2OTJ T;  3QPH A;  1H3Z A;  3JSC A;  5DLO A;  4C5H A;  1WGS A;  1Y7X A;  2KQW A;  2Y4Y A;  4C8Q D;  5GAN h;  2JZ2 A;  1TH7 A;  5GAN 5;  2DO3 A;  2PUK B;  2L89 A;  5GMK j;  1KQ1 A;  1BIA A;  2RHY A;  3CCM T;  2QA4 A;  1Q86 U;  2VV5 A;  3CXC S;  3QZ9 B;  4A4K A;  2RB6 A;  4BDZ A;  4FU6 A;  4E7I A;  3QZ5 B;  2MMP A;  4WF2 A;  4M77 F;  4A4F A;  2NLU A;  4PJO E;  2WSC E;  1X6O A;  3CCQ T;  1Q82 U;  4HCB A;  3G4S T;  1VQ4 T;  2LX9 A;  3I56 T;  4KUD K;  2PVD B;  3JCM e;  1QVP A;  1M8V A;  4YTL A;  2Y90 A;  4EMK A;  2ZPH B;  4IUV A;  4JUV A;  5GAN d;  1BI3 A;  1Q81 U;  5I2M A;  5HKC A;  1IRE B;  3NTK A;  1U1S A;  4ELZ C;  4F7U A;  3JCM P;  4IKF A;  2K5I A;  1RL2 A;  2DZC A;  3OW2 A;  1NPR A;  1M1F A;  4M75 D;  2E10 A;  4QQ6 A;  3OYL A;  5IT9 E;  1QVF A;  3JB9 H;  3HP9 A;  5CKE A;  2DJZ A;  5HY6 A;  4C0F A;  5GAO n;  1VQN A;  1Q86 C;  3G71 T;  2WSE E;  3BY7 A;  3CCV A;  1I81 A;  1VQ9 T;  1VQK T;  1H64 1;  5GMK e;  3LWI A;  3CCU T;  1YI2 T;  1VQ7 A;  3P8H A;  3P8B B;  1Q82 C;  3V7C A;  4C92 G;  3WVE B;  2MF2 A;  3X20 B;  1WQW A;  4OB2 B;  2FHD A;  4QQG A;  4BD3 A;  3CCM A;  4JJN K;  2OTJ A;  1Q81 C;  1LOJ A;  3G7Z A;  4A54 A;  4A4G A;  1VIE A;  3JCM W;  4PJO D;  2DXC A;  3GPL A;  1KQS A;  3CCL T;  1N27 A;  2A7Y A;  2CS7 A;  3M4Y A;  3JB9 F;  3HSB A;  3G4S A;  2VGN A;  5FRO A;  2ZZD A;  2QEX T;  1VQ4 A;  3I56 A;  2K3Y A;  4M77 G;  2K4Y A;  3SB2 A;  2RJE A;  4FM4 B;  3ZEH A;  4E47 A;  3CME T;  4XTX A;  2RH2 A;  2LQK A;  3M58 A;  2DK3 A;  2PQW A;  4C0G A;  3CCE A;  3CBM A;  4RMO A;  2IVW A;  3OS1 A;  1SSF A;  2GF7 A;  2XU8 A;  4F7U F;  4N0A A;  2XDD A;  3M4G A;  3RKX A;  2G3R A;  2RHX A;  4ZN1 A;  2HAX A;  5GAN 2;  2FVU A;  4IUP A;  3L2Q A;  1WJS A;  3DB3 A;  3PFS A;  4OF1 A;  4JRP A;  1FX7 A;  1UEB A;  5GAM j;  3G71 A;  5FU7 C;  3LGL A;  4DA4 A;  1VQK A;  2RI2 A;  3CCU A;  2CZ7 B;  3A8L B;  1YI2 A;  3VU3 C;  4OGE A;  1VQO T;  4C92 B;  3RER A;  5DLQ E;  3SWN B;  5GAN f;  3S3N A;  4NS5 A;  4M7A E;  3M9Q A;  4JDS A;  4BI8 B;  3VJP A;  3MP8 A;  2DXB A;  1B34 B;  3G6E A;  2O01 E;  2RI5 A;  5LJ3 h;  4J8O A;  3N5B B;  3PMI A;  2E5Q A;  2OTL T;  3E9F A;  5GAN j;  2QEX A;  4M77 B;  5FU6 C;  2QQA A;  1JBM A;  4NL2 A;  3CME A;  3JB9 G;  1PSF A;  2X4Y A;  3ZFJ A;  5D6X A;  2EQJ A;  3M59 A;  3VYH B;  3HHT B;  5FU6 B;  2GFA A;  3OB9 A;  3P8D A;  3GIB A;  2QQR A;  3LW5 E;  5LJ3 d;  3OYJ A;  3E19 A;  3S3M A;  1KQ2 A;  4V2S A;  5GAM e;  4QVD A;  3MEA A;  1QW1 A;  3QG1 A;  3SWN A;  5HK3 A;  3LX7 A;  4F7U G;  2P0Q A;  3EFS A;  4E7K A;  2X4X A;  3EAE A;  2LVM A;  4E7J A;  4JS4 A;  4M7D A;  2EFI A;  2F69 A;  4KUI A;  3JCM b;  2GFU A;  3JCM g;  2DIG A;  4MZP A;  3RMQ A;  3GP8 A;  5CIU A;  3DLM A;  3FJP A;  3V7R A;  1JRI A;  1BI2 A;  4Y91 A;  1VQO A;  2CZ6 B;  4C8Q E;  2VGM A;  1Y07 A;  3M56 A;  4XU3 A;  3NFC A;  4M77 A;  2EKO A;  1HK9 A;  3INZ A;  3PIO A;  2E6N A;  2LT4 A;  4O5V A;  2KVQ G;  3OYK A;  3OYF A;  2DAQ A;  2RHU A;  3QKJ A;  1YIT T;  4L6V 5;  1YIJ T;  3E1S A;  2OTL A;  4HA8 A;  4J6X A;  4JRK A;  2E12 A;  4BUG A;  5IN1 A;  3CEY A;  3LGF A;  4M78 C;  3L42 A;  5CK9 A;  4BI3 A;  5GAO p;  2DTI A;  3I55 A;  2M0O A;  4E7H A;  3HPW A;  4XTW A;  3CCR T;  2EYQ A;  3QHS A;  5AYF A;  2QDY B;  3CC2 A;  4EMK B;  5GAO m;  3EFR A;  1KC8 U;  3CXC A;  2ZPI B;  5CKD A;  5LJ5 e;  5GAN 3;  4M75 E;  2L5Q A;  3GF5 A;  4XU0 A;  4F7U B;  2DD4 A;  1M1K U;  1FWZ A;  3MET A;  5GAO l;  4C0D C;  3V8J A;  3L2V A;  5A0G A;  2JTF A;  4M7A F;  4M7D F;  5J26 A;  2ZPF B;  4QVC A;  1VUB A;  1BIB A;  3MEU A;  4FT4 A;  3BW1 A;  1UGQ B;  4C0D B;  2KAF A;  3CBP A;  3ZBD A;  1BKB A;  1XNI A;  1W2B S;  4M78 E;  2RJC A;  2EJ9 A;  4GY5 A;  5LJ3 f;  3GNG A;  2XI9 A;  1NE8 A;  1YIT A;  1YIJ A;  1BI0 A;  2QQS A;  1NPP A;  2RHZ A;  3OA6 A;  2GQV A;  2WAC A;  5GAO q;  2JVV A;  1I4K 1;  5CKH A;  4A53 A;  4J83 A;  1OI1 A;  4OP0 A;  3UPU A;  1M1K C;  3CCR A;  2LRQ A;  4XAX B;  4D6W A;  2CYZ B;  5I21 A;  3HRS A;  5HK0 A;  4J7I A;  3GNF B;  4Z02 A;  4MDW A;  4IUU A;  3T9N A;  1OYX A;  2LQ8 A;  1O9S A;  3URG A;  2PVG B;  1G3S A;  2XK0 A;  3GLX A;  2CZ0 B;  1M1G A;  5LL6 S;  4HCZ A;  4BB7 A;  4C8Q F;  3JCM J;  1XOV A;  4N4G A;  2YRV A;  2X4J A;  2BKD N;  4OB3 B;  2O4X B;  2XKO C;  1M90 U;  3M57 A;  3V8K A;  3JB9 D;  3RKY A;  2DVE A;  4PNO A;  5C6S A;  1VQ5 T;  2EQK A;  2MI6 A;  4M7D G;  4M78 D;  3C12 A;  3PTA A;  1K8A U;  3O8V A;  1VQM T;  3JB9 J;  5CR2 A;  2V8J A;  3CCQ A;  5GAM g;  4IUQ A;  3JCM Q;  3CC7 T;  2PUO B;  4X34 A;  4Y28 E;  3TRE A;  2DPP B;  5EG2 A;  1O75 A;  2E41 A;  2LTO A;  2P0K A;  3KBG A;  3UWN A;  3CPW S;  2QQB A;  4JLI A;  2VXF A;  3FEO A;  4XTV A;  1WJQ A;  2DXT A;  4MMK A;  4ZTF A;  3QSU A;  1PSE A;  2R5M A;  2K57 A;  1M90 C;  2O4X A;  1QVG S;  2YLB A;  1MGQ A;  2X35 A;  4EMG A;  1N9S A;  4C92 C;  2ZPG B;  2BUD A;  4ATO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...