4J5YA

Crystal structure of hfq from pseudomonas aeruginosa in complex with atp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
b'GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
total genus 14
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4j5yA00
5GAN6 1N9SA 4J6YA 4M77E 3V8JA 4M77A 1D3BA 3JCMg 4EMKA 5GAMg 4M78C 3JCMd 2DKGA 4MMLA 5GAMd 4F7UA 3EFRA 4M7DD 5GANe 3HSBA 4C92C 2DZ9A 3JCMh 5GAMh 4XTUA 1WPYA 5LJ3e 4M75D 4J5YA 4M75E 2E64A 3RKYA 4C8QC 4M78A 4NL3A 4M7AC 3JCMX 5GAN2 4M7DB 4C92E 3SWNB 5GAOl 3V7CA 4C92A 4MMKA 4X9DA 4XU3A 3JCMW 4V2SA 2QTXA 5GAOp 4HT8A 4PJOC 4QVCA 4C8QA 3JB9G 4M7AE 3RIRA 1TH7A 4M7AA 3JCMc 2DXTA 5GMKi 4M77D 1U1TA 4XTYA 5LJ5e 1LNXA 4J6WA 4XTXA 5GANg 2FYKA 5GAN4 5GANd 3JB9F 3RERA 2DTIA 2JN0A 1U1SA 3RUXA 3SB2A 3JCMf 5GAMf 4M7DG 1LOJA 1B34B 3RKXA 4F7UE 2YLBA 1N9RA 4RCCA 5LJ3g 5GAMj 5GANh 4PJOA 3GIBA 2VC8A 3BFMA 5LJ3d 3L2ZA 2DJZA 4M75G 3JCMV 4M77B 2FB7A 4Y91A 2E41A 5GMKm 5LJ3h 4M7DF 3M4GA 4M78D 4EMGA 1Y96A 4JRKA 3INZA 5DY9A 3V8KA 3QHSA 3VU3C 2RB6A 4M78E 3V7SA 1H641 4C92D 1M8VA 4M75F 3BDUA 4XU1A 2K57A 2ZGWA 2CGHA 4JLIA 2DZCA 2E65A 3JCMP 5GAN3 3JB9H 3PGGA 3SWNC 4M75B 4M7AD 5LJ5g 5GMKe 2RA2A 3FJPA 4C8QE 5LJ5d 4M77G 4C92B 2RD1A 2EAYA 4J6XA 5LJ5h 1X01A 1I81A 4F7UG 5GANf 3RKWA 2E10A 2DVEA 4N0AC 5GANj 4M77F 4HT9A 1YCYA 4PJOD 5GAOm 2EJGA 3SWNA 4M7AB 2DXUA 4X9CA 3V7RA 2EJFA 2Y90A 5LJ3f 1I4K1 1HXDA 3V8LA 4EMHA 4F7UF 3JCMQ 5LJ3j 4RCBA 5GAOq 4M78G 1JRIA 1D3BB 2DTHA 4EMKB 1I8FA 4C92G 4N0AA 4F7UB 1WQ7A 1HK9A 4DQ2A 2I2LA 4OP0A 4XU2A 4M78F 1MGQA 4PJOE 3HFOA 5GMKl 3JB9J 4C92F 4NOYA 1BIAA 4M7AG 3EFSA 1B34A 3L1AA 4XQ3A 5I21A 5GAN8 4C8QD 3JCMJ 1I5LA 5GMKh 4M78B 4M7DC 2HNIA 5LJ5f 2DEQA 3JB9I 5LJ5j 3AHUA 1WNLA 4C8QF 3BY7A 2EJ9A 1BIBA 4M7AF 4M75C 4NL2A 4PJOG 2YLCA 4A53A 5GAN5 1JBMA 1KQ2A 4M7DE 2RM4A 4C8QB 3JCMe 5GAMe 5GAOr 4XTZA 4M7DA 3QSUA 5GAN7 1LJOA 4PJOF 1WQWA 4A54A 2VXFA 4XU0A 3QO3A 4M75A 3HFNA 3RESA 1KQ1A 4XTVA 4JUVA 1M5Q1 2YHTA 3QUIA 4PJOB 3FB9A 4M77C 3JCMb 2DTOA 4EMKC 2VXEA 4HA8A 4PNOA 4JRIA 4WF2A 5CAIA 4XTWA 5GAOn 4C8QG 3BW1A 4QVDA 5GMKj 3FIFA 1Y96B 2EWNA 3JB9D 2E1HA
chains in the Genus database with same CATH superfamily
3PNWC 2P4TA 5GAN6 1U06A 2XMFA 1QWEA 3ULRB 4PFPA 1VQNQ 2X3XD 1IZ6A 1VQ6A 3RMSA 3JAME 1WPYA 3P8DA 3OS1A 2J6FA 3I56T 3RNJA 2QA4A 3JCMX 4LDWA 3CPWS 5FROA 3JCMW 3VUZA 2RO0A 1SKUB 1T3SA 2KRNA 1LNXA 1K9AA 2R5AA 2L3QA 3JB9F 4AFZC 4IKFA 5GAMj 2RJCA 1OZ3A 2CZ6B 5LJ3d 5IXBA 1TUCA 1JQQA 5LJ3h 3M4GA 1E6GA 1OU8A 4JRKA 1E6HA 2K6DA 1LPLA 2FL7A 3INZA 1H641 2RN8A 3CCMQ 1Q81R 2GFUA 2KRSA 4JLIA 2WACA 3FRNA 2O9VA 5J26A 2F1LA 2O9SA 3FEOA 3MKDA 1FMVA 2CDTA 3VS3A 2L3PA 1YI2T 4M7AB 3V8LA 1VQ9T 1VQLT 5GAOq 4L5GA 5A0LA 5D7UA 4LD9K 5KYUB 2G6FX 1K0XA 1T3LA 1IB8A 1MGQA 2V8IA 3HTRA 3VS7A 2RI3A 2CZ7B 2HNIA 1WXUA 1D1CA 2XICA 2DEQA 4RG2A 1OPKA 2WSFE 2Z0WA 3JB9I 2RHZA 1C0MA 1K9MR 1K8AR 1W2BP 1RADB 1VQPA 4PJOF 4M4ZA 5IT9E 4BI4A 3GLXA 2F69A 1M1FA 2RQWA 2QQBA 3MCAB 3NTKA 4YTLA 3REBB 3OYDA 2EKHA 4EDUA 1OPLA 4WF2A 2A08A 4C0ZA 2E70A 2IG0A 3DB3A 1YI2A 3EGXB 2LQ8A 4E7SA 2LDMA 2OTJT 2QTVA 4B9WA 2KROA 1HJDA 2HSPA 4ZGDB 1U8RA 4M75E 4M7AC 4RTXA 3META 1JJ2A 1VQ4Q 1Y07A 2RJDA 2DFUA 3HRUA 2QTXA 3PVQA 2NUTA 3JB9G 2LJ3A 4XTXA 3CC4T 1VQ9Q 3JCMf 4DBHA 1N6AA 2YLBA 4PJOA 3HHTB 4DOVA 1PHTA 1OZ2A 1SSFA 5KCOA 1SHGA 1YJ9Q 2YUNA 3AT1B 4AMCA 1G3WA 4RMOA 4PJLA 1OOTA 4BE0A 2CP6A 4WTOB 3JB9H 1YITA 2HEQA 2HKNA 1QWFA 2AZSA 3OBYA 4OMNA 4JLGA 2J06A 1YCYA 3H0IA 3QXEB 5A0DA 4JDSA 1VQ5T 2DTHA 1I8FA 2QQSA 2XG8D 3CMET 1K76A 2X4JA 4LNPA 4XU2A 1FXXA 3L2VA 3CC4A 4K11A 2SRCA 2R5MA 4C8QD 4IIOA 1I5LA 2EGEA 4LDXA 1BIBA 2ROLA 1AZEA 2YRDA 4PJOG 2K4YA 2DBMA 3G4ST 1R0CB 4X34A 3CC7T 1Q95G 2KEAA 1NYGA 2L0AA 2BUDA 2MIOA 1OV3A 3QUIA 1Q82R 2DXBA 4LN2A 3CCQQ 3CCEQ 2SEMA 2DTOA 1BCMA 4HA8A 1WHGA 3HRTA 5GAOn 1MV0B 4JPBW 1IREB 2E1HA 4RTYA 4KRTA 1M90C 1KQSA 3H0FA 1AWJA 1TU0B 3R6NA 5GAMd 4E7HA 5GAMh 2NLUA 1VQKQ 3OA6A 1YJNA 1K73U 1V29B 3SFMA 1ZQ1A 5KYWA 3CC2A 2JTEA 3M0TA 4RG8A 5I11A 2CS7A 4LDVA 2CT4A 1BYMA 3GF5A 3G4SA 1WA7A 2QDLA 4XTYA 3CC7A 5GAN4 3SB2A 4Z02A 5CCAA 4HCKA 2HL5C 4HXJA 3BFMA 3E2UA 1IGQA 4MDWA 1P92A 1SEMA 2CT3A 1Y96A 1SRLA 2RB6A 1M8MA 3G71A 2EYWA 5M9OA 4ELYC 3E9GA 3WVEB 3SWNC 4C8QE 2QASA 1KK7A 4A4GA 1ZX6A 1X01A 4CRIA 3RMQA 2COZA 4JJBA 4F7UF 1I4K1 2MOXA 1G5VA 3CBMA 2DE0X 5AT1B 2HCKA 1WXBA 4R56A 2XDDA 2ABLA 2JJ9A 3LH5A 3MHXA 2DJQA 4ME7A 3U23A 1MMAA 1QVFA 2ZPHB 2OTLQ 1RABB 4M7AF 4F14A 4RUGA 3JCMe 3C95A 1AOJA 1NZ9A 3QSUA 3OW2P 4A54A 2PVGB 4FU6A 2X51A 5CR2A 3LX7A 5A2QE 2YHTA 2HBWA 1Q81U 2NYSA 2ZPBB 3KXTA 5GMKj 2WSEE 4JJNK 2A28A 1I81A 2EWNA 3JB9D 4WCIA 2QDYB 2ZPFB 1Q7YR 2KDSA 3EGUA 4MMLA 4J7IA 4F7UA 3NHNA 2HMAA 2EQJA 4XK8E 1WYXA 4OF1A 2KXCA 4MDXA 2J6OA 1RAIB 3CCUT 1RLQC 1VQMQ 1OI1A 1W4SA 2FO0A 1RAFB 4M7AA 4GY5A 4J8OA 4FW1A 4E2FB 3CCJQ 3S3NA 1K9MU 2EW3A 1QQJA 2L5QA 1K8AU 5C6SA 3GIBA 2C0TA 5IHIA 1WJQA 1SRMA 2QQRA 2FPDA 3GNGA 2XI9A 4JJDA 3PMTA 2GFAA 1PSEA 4C92B 4LUDA 4JZ3A 2AT1B 1NM7A 1OQKA 3ZL7C 4F7UG 1NJIR 5GANf 1RAAB 3RKWA 4PJOD 3CPFA 1VQ7T 2M02A 3H41A 3ASKA 1UGPB 1B3QA 3NFCA 2YT6A 3S3MA 1NYFA 4PKCC 1Z9ZA 4Z8AA 4M7AG 3EFSA 1AWOA 1PD0A 2CP3A 1K4US 2DD4A 4KBMB 4GLMA 3M0PA 5FRMA 4J9DA 1KQ2A 2NUTB 1D0XA 1LJOA 3X24B 2VB6A 2AKKA 1WGSA 1Q86R 2KK4A 2KT1A 1KQ1A 4JUVA 4OVAA 4PJOB 3FB9A 3TU4K 2YUOA 2AK5A 3N5BB 3FIFA 3OYCA 4XTUA 3QBYA 4J6YA 2VWFA 2O4XA 2A36A 4JS5A 4C5GA 4M78C 1X27A 5IH2A 3I55Q 2CYZB 4C92C 2GF7A 3ME9A 5CIUA 3CXCP 1M1KR 4BY6B 5CKHA 2E3HA 4JRQA 4M7DB 4AT1B 3EGDA 2CP2A 1ZSGA 1ABOA 4Z88A 4RTWA 2LNHB 4HVWA 3L2UA 4J6WA 4LXCA 1VQ7Q 1I07A 2OI3A 4PJOE 2H3JA 5KE3A 1JJ2S 3NTIA 1PM3A 4OB3B 1DJ7B 5KYYA 1G3SA 1M3CA 1S72Q 4QVZA 2DAQA 2HSEB 1WLPB 1Q82U 2HBPA 1F1BB 3CCVT 1QW1A 4J9IA 3H8ZA 4KUDK 1X2QA 2QG9B 3M5AA 1YHQA 2MK5A 3CMAT 4HCCA 1M3AA 1XQHA 2EJGA 3SWNA 3URGA 1X2KA 1YIJT 4IUVA 4ZGJB 5AYFA 3THKA 4QQGA 2LT1A 3GNFB 1RI9A 3L1AA 2M0YA 4ANJA 4M7DC 4E47A 5GMKh 5LJ5f 2DVJA 3TSZA 4LDUA 2J05A 2JM9A 4PL6A 3H9NA 1WHMA 2QGGA 2O88A 2RK1A 2Y4XA 5FU7B 3OYJA 3TVTA 3MEVA 2YRVA 3RESA 4N4HA 1QCFA 3QDFA 3LGLA 1N8RR 1QCNA 5KE2A 1VQ6T 1VIEA 5CAIA 2KVQG 4XTWA 2M16A 3CMAA 1WHKA 1Y96B 2QA4T 9ATCB 3V8JA 1X6OA 3VUBA 1AVZC 3EFRA 5GANe 4OGEA 1I0CA 4ELZC 1VOMA 2D6FA 2JUFA 3G6EA 1CSKA 4A4KA 2DK3A 3M58A 1XTDA 4X9DA 1T0JA 3CCVQ 1KQSS 2EIFA 5D6WA 1VQNA 2E6NA 1YCSB 2VKNA 2EQUA 2EYQA 2LJ1A 1X75C 2HDAA 4M77B 1VQOA 3V8KA 5FU7C 2DL4A 2RHXA 3VU3C 2V1QA 1NBEB 2JZ2A 4FM4B 1QCOA 2L3SA 5DLQE 1NPPA 4M7AD 1TSFA 1N27A 4C0GA 4AFSC 4BDZA 3A8LB 1TG0A 3UATA 3GBQA 5KH6A 1VQ8Q 3UA7A 3EG2A 3VKIA 3OYMA 1Q7YU 2RQRA 2K7AA 7AT1B 1HXDA 2CH4W 4E6RA 3CCMA 2EVRA 4F7UB 2FZGB 2H3EB 4M78F 3L2RA 1VQPT 1PRMC 3PE0A 4C92F 2QXFA 4QKUA 4BB7A 1TOVA 2E3IA 3BY7A 1GFDA 3OBWA 2F2XA 2MF2A 2RJEA 1Y71A 2IPOB 3QYHB 3CD6A 2VGMA 2ATCB 2GTJA 1UJ0A 3I5RA 2Y4YA 1QVFS 4M77C 4ZN1A 2GNCA 2ZZDA 4QVDA 3PVLA 2K5IA 1K73C 1ZUYA 3I9QA 2LQKA 5FLXE 2XDPA 4DOWA 1TS9A 1NJIU 3DLLA 1U3OA 2JMAA 2D8JA 3OS5A 2EBPA 3I56Q 2E6ZA 1OX9A 1UECA 1SHFA 4M78A 4O6JA 5GAN2 3VV0A 1FYNA 1YNZA 4C92A 4MMKA 1W2BA 2KQWA 2DMOA 4M7AE 2DLPA 4KGVB 3VYGA 5LJ5e 2L2PA 1T0HA 1YJWT 1N9RA 1YITT 2JMCA 1M90R 1G83A 5GMKm 4M7DF 2R58A 1Q86U 3OYKA 3MP1A 1BI0A 4FSSA 4ATOA 4EPCA 2M0OA 3LWHA 1GCPA 4E7JA 1YI2Q 2DBKA 3JV3A 2P4RA 1VQLQ 1X43A 2RI5A 2EJFA 2ED0A 2KYBA 5CQYA 2KE9A 1D0ZA 4M78G 2O4XB 4LDYA 4C92G 1K0SA 4DEYA 2DRMA 1YJWA 3EH2A 1D09B 1M27C 2HKQB 3EGDB 2EJ9A 4M75C 1WFWA 2BZYA 2K3XA 2FZCB 3VRYA 4M7DA 5I2MA 1WQWA 2MMPA 2KXDA 3REAB 3HL8A 2RQVA 3HFNA 2PUKB 4XTVA 1MMDA 1FMKA 2PZ1A 3A8GB 5KYYB 1YJNT 3VS0A 4BI8B 3CC2T 1D1AA 2J7IA 2OTJQ 1BBZA 3EG3A 3PMIA 5FU6C 3JCMg 1SG5A 4IUQA 4A63B 1G3YA 5I2SA 3CCQA 3CCEA 1QVGP 1AT1B 5IHKA 4IUPA 2RH2A 4R55A 3SWNB 2RJFA 1D0YA 2VYTA 1QP3A 2CH4A 2HL3A 3EG0A 5EC7A 1K8AC 3WVDB 3RIRA 3CC4Q 1UHFA 2QQ9A 3VYHB 1NEBA 3G71T 1RAEB 5EG2A 5GMKi 3CCRA 1VQKA 3RERA 4M7DG 4HCZA 5L23A 1EFNA 3D7SB 4E7KA 1KHCA 2XHCA 4Y91A 2L3RA 1R77A 2RNAA 3A8OB 2FPEA 4J9CA 2DILA 3G1JA 4CI0C 1NG2A 1KC8R 3TREA 4ZTJA 2ZAEA 2E5KA 1BI3A 1N8RU 3PGGA 3FJPA 4E7ZA 3EHQA 3NTHA 4N0AC 3GOXA 3A5ZB 4M77F 4FIBA 1VQ5Q 5LJ3f 4EMHA 3S6WA 1H92A 2MWOA 3FDRA 3VRZA 3CMEQ 1AHJB 2BIVA 3CPWP 1AWXA 1UTIA 2EQMA 5IXFA 1HK9A 2CP7A 2RHYA 1Y57A 3HFOA 3CC2Q 3BE3A 5HCKA 2D0NA 3MPUB 2MAMA 3M59A 3G4SQ 3DKMA 4NL2A 3C12A 4BD3A 4FYVB 4RKUE 3CC7Q 2RM4A 2DYIA 1RL2A 2XK0A 4KGZB 1TTHB 1M5Q1 2O01E 2KR3A 2HQEA 5I22A 3G71Q 2OTLA 1WDXA 4M77A 4OB0B 5J3BA 2JS0A 2X35A 4C0DC 1WHLA 4OB1B 1PSFA 4C8QC 5CKEA 2LC4A 2EGAA 5GAOl 4C5IA 4XU3A 3OW2A 2P0QA 5CQXA 1Z9QA 4HT8A 2QYZA 2MCNA 2ZPIB 2DXTA 4RTZA 2FYKA 3PIOA 4FYWB 2DF6A 1Q82C 1JXOA 1LVKA 2CUDA 2LMJA 2ECZA 2V1RA 2QGFB 1UGRB 4FT4A 4M78D 2YRCA 1VQMA 4C92D 4M75F 1RLPC 1JB0E 2X4XA 3RDVA 4A4EA 2ZPGB 2KSSA 3O5ZA 1Y0MA 4M77G 1AZGB 2EAYA 1FX7A 2GQVA 1KD1R 2CP5A 4VUBA 4MZTA 1IRXA 3I5SA 1ZA1B 2K5FA 4JJCA 4J83A 2GGRA 4RCBA 1KSWA 1RACB 4L6V5 1ABQA 3A1PA 4DBQA 1UG1A 2ZPEB 4M78B 4BUGA 1EIFA 2E12A 5KYXB 3ZFJA 1QMCA 3MEUA 1M90U 3E1SA 4M75A 3QJ6A 1M4ZA 4LD6A 4J9GA 2PQWA 1G2BA 1MNEA 4JRIA 1BCOA 4J9EA 4GBQA 3M55A 3TSWA 5D6YA 1ZBXA 3CCSA 3QWXX 2XD0A 4JRPA 4M7DD 3HSBA 1VYTA 1CKBA 3OYAA 2CP0A 2DYBA 1EX4A 5LJ3e 3DB4A 5CO7A 2LQNA 3CCUQ 2E64A 2LNVA 4C92E 1GRIA 3QPHA 2AIRB 4BDYA 3HPWA 4ZGEB 1B7TA 3MEAA 2K3BA 4CC7A 4IUUA 3I55A 5GANg 1RI0A 2VV5A 2QEXA 2BTTA 1U1SA 2QAZA 5GAMf 2FRWA 1LOJA 3X26B 1W2BS 2EYZA 1WXTA 4M75G 2KT8A 2CREA 1YHQT 1EZZB 3OYIA 1TXQA 2EGCA 3BDUA 3EFOB 4R0KA 2FVUA 5KYNA 3CXCA 2JVVA 1HD3A 4ORZA 2EPDA 2PVDB 2MYSA 2KRMA 1X69A 1S72A 4OGCA 2QK0A 1CKAA 2K2MA 3QG1A 3H0HA 2DL7A 3OQ5A 1SSHA 4N0AA 1VYUA 4A4HA 3IQLA 2JS2A 2EYYA 4RTUA 1BIAA 4UC4A 1TWBA 2GBQA 3QIIA 1IHWA 2RI2A 2M1HA 4C8QF 2X3WD 1UGQB 4A53A 4M7DE 2YXYA 1R8OB 1ZSZC 2DX1A 3CCLT 1ZUKA 3OSSC 1OULA 5ECAA 2VVKA 1KC8U 2E4HA 1NJIC 3G6ET 1A0NB 4F17A 1RAGB 3JRZA 1C6VX 3J7AF 2OJ2A 2EFIA 4E7IA 2H8HA 3JCMd 2VUBA 1PWTA 3JCMh 4FCYA 1YHQQ 1VQNT 4II1A 3OS0A 1OX8A 3M57A 1M1GA 1V76A 1W6XA 1G8XA 1UGVA 3A98A 2X9HA 2F2VA 1VQOT 4C8QA 1VA7A 4KUIA 1QVPA 3OYBA 3M53A 5HK0A 4M77D 3CCLA 3M56A 5IAYA 2IIMA 1Q86C 1NLPC 4AFQC 3LYIA 2DJZA 3A8HB 3UA6A 3KBGA 3QKJA 4OMFB 1J3TA 2KI7A 5DY9A 1JXMA 4MZPA 4KH0B 4KULA 5GAN3 1HSQA 3CCMT 5IHNA 3OYGA 5LJ5g 1PNJA 4P5NA 3CMAQ 1IO6A 3R6OA 5GANj 1YIJQ 3V7RA 3LWIA 1WJRA 3A8MB 1M2VB 1JRIA 2O31A 3G6EQ 4KGXB 2D0QB 1BKBA 3KFVA 5GMKl 3SD4A 3CD6T 4J9FA 1VQ8A 2BE7D 1PKTA 4PFOA 5DLOA 2LCCA 2RQUA 1G3TA 3SDZA 2COYA 3EAEA 1WZOA 4N4IA 3EG9A 5GAMe 1RAHB 5GAOr 2J6KA 3UWNA 3M0RA 3LW5E 1IGUA 2NWMA 4KH1B 1VQ6Q 2LQWA 1VQOQ 4L59A 1B07A 4HVVA 1WHHA 2C0OA 1BI2A 4EMKC 4PNOA 2QA4Q 4JS4A 2DL5A 5CKFA 3EH1A 3PT9A 2HD0A 3MP8A 4Y92A 2YSQA 4M77E 3S3OA 1D3BA 4HKEA 1KD1U 2PVOB 2DKGA 3KUFA 3Q1JA 5CKDA 2CSIA 1PCXA 4M75D 3QWYA 1W70A 2D9TA 4OMMA 2KYMA 4FW2A 2FHDA 1BI1A 2KBTA 5HY6A 4BE1A 1ZUUA 4ZTFA 1VQ4T 3OSVA 5FWCA 1TUGB 1UHCA 1GBRA 2FRYA 1YP5A 3TQ7P 1IXDA 3I56A 4HCBA 2PNIA 3UT1A 1M9SA 4F7UE 1QP2A 2F5KA 4RCCA 5FRNA 1N8RC 1V1CA 4OMOA 3OW2S 4EMGA 4OMPA 1M8VA 2HZYA 2DA9A 2VGNA 3CD6Q 1W1FA 2ZGWA 5FWBA 5FW9A 1YJ9T 5KYXA 1H3ZA 1ZBJA 4M75B 4ZNXA 4DBRA 4Z89A 2BZXA 1UEBA 2DPPB 1YN8A 2DVEA 2P0PA 2OAWA 3OB9A 3L2QA 2DERA 2M51A 4AG1C 3NGPA 1VQ4A 3MEWA 1VQPQ 1H3HA 4JZ4A 2A7YA 4PK4A 3TCJA 2OAUA 4DQ2A 1MNDA 1MUZA 5FU6B 4OB2B 1PKSA 1B34A 2XKOC 5HK3A 2FPFA 2B8AA 1VQ9A 1VQLA 2DD5A 1YWPA 1NE8A 5LJ5j 3LH0A 5D6XA 1JJ2P 4AG2C 3G7ZA 4XU0A 3BDLA 1YJ9A 2XIDA 4DEXA 4BE2A 2DM1A 1M1KU 1ZSZA 2VXEA 1KFZA 4E7LA 3CCQT 3CCET 2I0NA 2ENMA 3QZ5B 3MP6A 4HVUA 1M2OA 1ZA2B 3H6ZA 2JTFA 1MV3A 1D1BA 1NLOC 1Q81C 3EFOA 3FC3A 1ZLMA 2LJ0A 2A0FB 2DNUA 3CCRT 4NL3A 1VQKT 3RKYA 1IHVA 3LLRA 3V7CA 3HP9A 4FL6A 2DEUA 5HKCA 2OTJA 2YDLA 5GAOp 4QVCA 1UB4A 1YJWQ 2CUBA 2YUQA 2LCSA 3F70A 1YITQ 1JU5C 2A3LA 5GANd 2DTIA 2AKLA 3JSCA 4BI3A 4CC3A 5GANh 2R57A 2VC8A 3NMZC 2BE9B 4O5VA 2FG0A 4FYXB 1MMGA 2PUOB 3L42A 3V7SA 4XU1A 2K57A 2EKOA 2BZ8A 2M9UA 3RR6A 3JCMP 1K9MC 1M30A 1QKXA 1QVGA 4F04B 1AWWA 2PTKA 2FZKB 1PC0A 2RD1A 1XNIA 4J6XA 3OS2A 4J9BA 4J9HA 4HT9A 4OMLA 3VS1A 1Y7XA 2DRKA 4X9CA 3JCMQ 2LX7A 1MMNA 1OU9A 3QYGB 1KG1A 2DL3A 2LTOA 3CXCS 2V26A 4QW2A 4OP0A 3OY9A 6AT1B 1KQSP 1LCKA 2C0IA 2JT4A 2V8JA 5CKBA 2KMTA 4XQ3A 1SPKA 2MI6A 1WNLA 2RF0A 3RBBB 1WX6A 4C0DB 1VQ5A 2MWPA 1GCQC 2FEIA 3CMEA 3EHRA 5GAN5 1JBMA 3OYFA 2OTLT 2E5QA 2IVWA 4C8QB 3CCRQ 4XTZA 2DETA 2NUPB 1UDLA 2VXFA 2GTOA 2AZVA 2XDBA 2A37A 1YJNQ 5IN1A 3JCMb 2F5TX 1AD5A 4C5EA 2PU9B 3CPWA 2LCLA 1TUDA 4LUEA 3T9NA 4EMKA 4ZN3A 3GPLA 3WXMB 2EQKA 3UPUA 3VS2A 2K9GA 2RHUA 4C5HA 4D8KA 2WSCE 1BB9A 3QJYA 1GXIE 2LRQA 3E19A 1C1AA 2LZ6B 2LT4A 1VQMT 3VS6A 1M2VA 2O2OA 4PJMA 2JN0A 2EYXA 1MHNA 5LJ3g 3CCJT 1JEGA 4IIMA 1UUEA 3QZ9B 2E41A 4NS5A 3M4YA 2XU8A 4FSXA 3QHSA 1QVFP 1PD1A 3EG9B 3PFSA 1S1NA 4QQ6A 4PLLA 4DBFA 8ATCB 5GMKe 5LJ5d 1UJYA 3C0CA 1WI7A 5LJ5h 4QQDA 4KT0E 8AT1B 3M54A 2DXUA 1WJSA 4D8DA 2MPXC 4RTVA 1D3BB 1WQ7A 2ZCFB 2X4WA 1U5SA 1UE9A 3SHWA 3TEEA 2P84A 3JB9J 1X6GA 3OYHA 3CCJA 3OYEA 1VUBA 1O9SA 2HQXA 4CC2A 1R0BG 4IURA 2D1XA 3M0UA 1KC8C 1QKWA 5CVIA 5GAN7 2QI2A 2DO3A 1X6BA 3QO3A 3CCST 3NPFA 2NUZA 4B9XA 2RPNA 2RQTA 4C0FA 2KY9A 3OYYA 1PRLC 2V8KA 2P0KA 1UFFA 1N9SA 3QDRB 5KYUA 1OYXA 3M0SA 2ESWA 1I1JA 1ACMB 3I55T 4X1VA 1QLYA 3EG1A 1GL5A 3C94A 3UF4A 2QEXT 4J5YA 1KIKA 1HYOA 3PTAA 4ESRA 3X25B 4V2SA 2ED1A 4N4GA 2JW4A 1TH7A 3VJPA 5A0GA 3JCMc 1U1TA 1KJWA 2RHIA 5DM7R 3RUXA 1WHJA 2RK2A 3OMGA 3M9QA 1B34B 3RKXA 3ZEHA 2DL8A 3CCUA 1N5ZA 3L2ZA 4PFZA 3JCMV 2CZ0B 4AFUC 2RMOA 2OX7A 3ER0A 3EGXA 4M78E 1S72T 2E65A 2VASA 2LP5A 4MZMA 2JM8A 2RA2A 2LX9A 4FT2A 1ZSZB 3FLGA 2E10A 3ZBDA 3FJ5A 2L89A 5GAOm 3DLMA 3CCSQ 2Y90A 2JXBA 1YBYA 3I35A 5LJ3j 1GBQA 1AEYA 5CK9A 2JTMA 5GJWB 5GJVB 2I2LA 3OYNA 4BACA 1M3BA 4B6MA 4GLKA 4IUTA 4PLIA 2DXCA 5GAN8 1Q7YC 3JCMJ 4EIKA 1VQ7A 1VIFA 5KCHA 5J39A 3M0QA 3AHUA 1ARKA 3L2WA 3J80E 2YLCA 4J7FA 1O75A 2QEXQ 1FWZA 3VS4A 2C06A 3CEYA 3PIPA 2JNGA 4FYYB 4OMQA 1GCQA 4Y28E 1OEBA 1JO8A 3CQTA 2QQAA 4PJJA 3MJXA 1KD1C 1GFCA 2F2WA 5C0MA 2K5LA 1I5OB 3GP8A 4PJNA 3O8VA 2JOYA 4LE9A 2D8HA 3C4SA 2GCXA 1XOVA 2K79A 5LL6S 1SF9A 4A4FA 5GAMg 2DIGA 3E9FA 4D6WA 1FMWA 1NPRA 1YWOA 1KHIA 2DZ9A 2YWWA 2CSQA 1BU1A 3P8HA 2HAXA 2KGTA 1E7OA 1VYVA 2W10A 3SEMA 2L8DA 4Q5WA 1H8KA 4PJOC 1K1ZA 2EQIA 2DIQA 4QT7A 4RTTA 2HQHA 3HRSA 3UDCA 3LGFA 2FB7A 3CBOA 4DA4A 4XAXB 2CGHA 3P8BB 2DZCA 4BY6C 3X20B 1ZHIA 1BK2A 5KYWB 1RUWA 2AHJB 2ROTA 2NUPA 5L8RE 1PG5B 4F16A 1VQ8T 1K73R 2K2VA 2G3RA 3X28B 3OMCA 4EMKB 3CCVA 1QVGS 2KNBB 2CZ1B 4NOYA 2COWA 5I21A 3MO8A 1YIJA 2YUPA 1YFNA 2BKDN 4TVRA 3CBPA 1M1KC 3J81E 2X4YA 3CCLQ 1UGSB 1NEGA 2K3YA 2W0ZA 1WIEA 2CKKA 4CC4B 3OYLA 2KAFA 1XJWB 2GQIA 3HKSA 2LVMA 4C8QG 3BW1A 2B86A 3VS5A
chains in the Genus database with same CATH topology
3PNWC 2P4TA 3QBYA 5GAN6 4J6YA 3H6ZA 2O4XA 2JTFA 4M77A 4JS5A 4C5GA 4OB0B 4M78C 2CYZB 5J3BA 4C92C 2X35A 4C0DC 2GF7A 1IZ6A 1Q81C 1VQ6A 3FC3A 3RMSA 3JAME 1WPYA 3ME9A 3P8DA 4OB1B 1PSFA 5CIUA 3OS1A 3I56T 3CCRT 4BY6B 5CKHA 5CKEA 3RKYA 4C8QC 4NL3A 4JRQA 1VQKT 2QA4A 2LC4A 4LDWA 3JCMX 3CPWS 3LLRA 4M7DB 5GAOl 3V7CA 3HP9A 4FL6A 4C5IA 4XU3A 5FROA 3OW2A 3JCMW 5HKCA 2P0QA 5CQXA 2OTJA 5GAOp 4HT8A 4QVCA 3VUZA 1UB4A 2ZPIB 2RO0A 2DXTA 3F70A 3L2UA 1LNXA 4J6WA 2FYKA 2A3LA 2R5AA 5GANd 3JB9F 2DTIA 4IKFA 3PIOA 3JSCA 4PJOE 4BI3A 5GAMj 2H3JA 2RJCA 5KE3A 5GANh 1Q82C 1JJ2S 1OZ3A 3NTIA 2R57A 2CZ6B 2VC8A 4OB3B 1DJ7B 5LJ3d 1G3SA 5LJ3h 4O5VA 3M4GA 1UGRB 4FT4A 4M78D 4JRKA 3INZA 2FL7A 2PUOB 2DAQA 3L42A 4QVZA 3V7SA 1H641 4C92D 1VQMA 4M75F 4XU1A 1JB0E 2K57A 2GFUA 4JLIA 2X4XA 4A4EA 2EKOA 2M9UA 1Q82U 2HBPA 2ZPGB 3JCMP 2WACA 2KSSA 3FRNA 5J26A 1K9MC 3CCVT 1QVGA 1QW1A 3FEOA 4M77G 2RD1A 2EAYA 1FX7A 1XNIA 2GQVA 3H8ZA 4J6XA 4KUDK 3OS2A 4VUBA 3M5AA 4MZTA 1YHQA 3CMAT 4HCCA 4HT9A 1XQHA 1YI2T 2EJGA 1Y7XA 2K5FA 4X9CA 4M7AB 3SWNA 3URGA 3V8LA 4J83A 1VQ9T 3JCMQ 1VQLT 5GAOq 4L5GA 4RCBA 1YIJT 4IUVA 5A0LA 4ZGJB 3QYGB 4LD9K 1KG1A 4L6V5 2LTOA 5AYFA 3CXCS 4QW2A 4OP0A 3OY9A 1MGQA 2V8IA 4QQGA 2LT1A 3GNFB 2V8JA 2ZPEB 5CKBA 2KMTA 3L1AA 4XQ3A 4M7DC 2RI3A 2MI6A 4M78B 2CZ7B 2HNIA 2XICA 4BUGA 1EIFA 4E47A 2DEQA 4RG2A 2WSFE 5LJ5f 3JB9I 1WNLA 2E12A 4C0DB 4LDUA 2RHZA 1VQ5A 2MWPA 4PL6A 3ZFJA 3CMEA 5GAN5 1JBMA 3OYFA 2OTLT 2RK1A 2Y4XA 5FU7B 2E5QA 2IVWA 4C8QB 3OYJA 4XTZA 1VQPA 4PJOF 5IT9E 3MEUA 4BI4A 3GLXA 2VXFA 3MEVA 2F69A 2YRVA 1M90U 2XDBA 3E1SA 1M1FA 4M75A 3QJ6A 3RESA 4N4HA 2QQBA 3MCAB 3NTKA 1M4ZA 4LD6A 4YTLA 3LGLA 5IN1A 3OYDA 2PQWA 3JCMb 4EDUA 5KE2A 1VQ6T 1VIEA 4JRIA 4WF2A 5CAIA 2KVQG 4XTWA 2M16A 2F5TX 4C0ZA 4C5EA 3CMAA 2E70A 1Y96B 2IG0A 2PU9B 3DB3A 3CPWA 1YI2A 2QA4T 2LQ8A 2LCLA 3V8JA 3M55A 2LDMA 5D6YA 3T9NA 1ZBXA 4EMKA 4ZN3A 3CCSA 2XD0A 1X6OA 3VUBA 3GPLA 4JRPA 3WXMB 3EFRA 4M7DD 5GANe 4OGEA 3HSBA 2EQKA 4ELZC 3UPUA 4B9WA 3OYAA 2RHUA 2D6FA 2JUFA 4C5HA 3G6EA 5LJ3e 3DB4A 5CO7A 4ZGDB 4A4KA 2DK3A 2WSCE 4M75E 2E64A 2LNVA 1U8RA 4M7AC 3M58A 3META 1JJ2A 4C92E 1Y07A 1XTDA 3QJYA 4X9DA 2RJDA 3HRUA 1GXIE 1KQSS 3QPHA 2LRQA 3E19A 2QTXA 2EIFA 4BDYA 3HPWA 2LT4A 3JB9G 1VQMT 4ZGEB 3MEAA 5D6WA 4IUUA 3I55A 2E6NA 1VQNA 4XTXA 5GANg 3CC4T 1RI0A 2VV5A 2QEXA 2EQUA 2JN0A 3JCMf 1U1SA 2EYQA 5GAMf 1LOJA 1N6AA 2YLBA 1MHNA 5LJ3g 3CCJT 4PJOA 3X26B 1W2BS 1X75C 3HHTB 4DOVA 4M75G 4M77B 1OZ2A 3QZ9B 2E41A 4NS5A 1VQOA 3M4YA 2XU8A 1SSFA 4FSXA 3V8KA 1YHQT 3QHSA 5FU7C 3VU3C 2RHXA 5KCOA 3OYIA 3BDUA 2JZ2A 4FM4B 1G3WA 4RMOA 2FVUA 3PFSA 4BE0A 5DLQE 4QQ6A 4PLLA 3JB9H 1NPPA 3CXCA 1YITA 4M7AD 5GMKe 2JVVA 1N27A 4C0GA 5LJ5d 4BDZA 3A8LB 3OBYA 5KH6A 5LJ5h 4QQDA 2PVDB 4KT0E 4JLGA 3VKIA 1Q7YU 3OYMA 1YCYA 1S72A 3M54A 2DXUA 1WJSA 4OGCA 1HXDA 3QXEB 5A0DA 3QG1A 4JDSA 3CCMA 3OQ5A 1VQ5T 1D3BB 2DTHA 1I8FA 4N0AA 2QQSA 2XG8D 4F7UB 1WQ7A 3CMET 4A4HA 2X4JA 3L2VA 2ZCFB 1FXXA 2X4WA 4M78F 4XU2A 3L2RA 1VQPT 3TEEA 3JB9J 4C92F 3CC4A 2QXFA 1BIAA 4UC4A 3OYHA 4C8QD 2R5MA 1I5LA 4BB7A 3QIIA 3CCJA 2RI2A 3OYEA 1VUBA 2M1HA 4C8QF 1O9SA 3BY7A 4LDXA 1BIBA 1UGQB 2HQXA 3OBWA 4PJOG 2OTJT 4A53A 2MF2A 2RJEA 2K4YA 4IURA 4M7DE 3G4ST 1R8OB 1KC8C 4X34A 5CVIA 5GAN7 2QI2A 3CC7T 3CCLT 1Y71A 2DO3A 3QYHB 3CD6A 3QO3A 3OSSC 3CCST 2BUDA 2VGMA 4B9XA 3QUIA 4C0FA 2Y4YA 2DXBA 1QVFS 4M77C 2KY9A 2DTOA 4ZN1A 1KC8U 3OYYA 4HA8A 1NJIC 3HRTA 3G6ET 2ZZDA 5GAOn 4QVDA 3JRZA 2V8KA 1IREB 3J7AF 2E1HA 2P0KA 2K5IA 1K73C 2LQKA 1N9SA 2EFIA 3QDRB 5FLXE 4E7IA 2XDPA 1M90C 1KQSA 4DOWA 3JCMd 1NJIU 2VUBA 5GAMd 3DLLA 1OYXA 4E7HA 3JCMh 5GAMh 3OS5A 2NLUA 3OA6A 2E6ZA 3I55T 1YJNA 1K73U 1V29B 3SFMA 1ZQ1A 3C94A 4II1A 1VQNT 3OS0A 2QEXT 4J5YA 3M57A 4M78A 1M1GA 4O6JA 3CC2A 5GAN2 3VV0A 3PTAA 1W2BA 4C92A 4MMKA 4RG8A 2KQWA 2CS7A 3X25B 4LDVA 4V2SA 1BYMA 1VQOT 4N4GA 4C8QA 4M7AE 3GF5A 3G4SA 1TH7A 1QVPA 4KUIA 3VJPA 5A0GA 3VYGA 3JCMc 3M53A 5HK0A 4M77D 3OYBA 1U1TA 4XTYA 5LJ5e 3CC7A 3CCLA 3M56A 5IAYA 1YJWT 2RHIA 5GAN4 5DM7R 1Q86C 3RUXA 2RK2A 3SB2A 4Z02A 3OMGA 5CCAA 3M9QA 1B34B 3RKXA 3ZEHA 1N9RA 1YITT 3CCUA 3LYIA 3BFMA 3L2ZA 1P92A 2DJZA 4MDWA 3A8HB 3JCMV 5GMKm 2CZ0B 4M7DF 3KBGA 3QKJA 4OMFB 1Y96A 2R58A 5DY9A 1Q86U 2RB6A 3ER0A 4M78E 3OYKA 3MP1A 3G71A 1S72T 1BI0A 4ATOA 4MZPA 5M9OA 2E65A 4ELYC 3E9GA 4KULA 3WVEB 4EPCA 2M0OA 5GAN3 3CCMT 3OYGA 3SWNC 3LWHA 4MZMA 5LJ5g 2RA2A 4C8QE 4P5NA 2LX9A 4FT2A 4E7JA 4A4GA 1X01A 1KD1U 4CRIA 3FLGA 2E10A 3RMQA 3R6OA 5GANj 3ZBDA 2L89A 5GAOm 3DLMA 2RI5A 3V7RA 3LWIA 1WJRA 2EJFA 2Y90A 4F7UF 1I4K1 1YBYA 3A8MB 5CQYA 5LJ3j 4M78G 1JRIA 2O4XB 5CK9A 1G5VA 3CBMA 4LDYA 4C92G 2JTMA 2D0QB 2I2LA 4R56A 2XDDA 3OYNA 4BACA 1BKBA 3MHXA 5GMKl 1YJWA 3SD4A 3CD6T 4GLKA 4IUTA 4ME7A 2DXCA 4PLIA 5GAN8 3JCMJ 1Q7YC 1VQ8A 1VQ7A 1VIFA 5KCHA 5J39A 1QVFA 2ZPHB 3AHUA 2EJ9A 5DLOA 4M7AF 2LCCA 3L2WA 4M75C 1G3TA 3J80E 2YLCA 4J7FA 3SDZA 1O75A 2K3XA 3EAEA 3JCMe 4M7DA 4N4IA 5GAMe 3C95A 5GAOr 1NZ9A 3QSUA 3UWNA 5I2MA 1FWZA 1WQWA 3LW5E 2MMPA 4A54A 2C06A 3HL8A 2PVGB 3CEYA 3PIPA 4FU6A 2JNGA 3HFNA 2PUKB 5CR2A 4XTVA 3LX7A 4Y28E 5A2QE 2YHTA 4L59A 2QQAA 3A8GB 1Q81U 1KD1C 4EMKC 2ZPBB 1BI2A 4PNOA 1YJNT 3KXTA 4JS4A 5CKFA 5GMKj 2WSEE 3PT9A 4JJNK 4BI8B 3CC2T 2EWNA 1I81A 2HD0A 2K5LA 5C0MA 3MP8A 3GP8A 3O8VA 3JB9D 2JOYA 3C4SA 2QDYB 2GCXA 3PMIA 4M77E 5FU6C 3S3OA 1XOVA 5LL6S 2ZPFB 1D3BA 3JCMg 4A4FA 4HKEA 2DIGA 3E9FA 2PVOB 4D6WA 5GAMg 2DKGA 2KDSA 1NPRA 3KUFA 4IUQA 4J7IA 1KHIA 4MMLA 4F7UA 2DZ9A 3Q1JA 5CKDA 2EQJA 4M75D 1G3YA 4XK8E 3P8HA 5I2SA 3CCQA 3CCEA 2D9TA 2HAXA 4OF1A 4IUPA 2RH2A 4R55A 3SWNB 4MDXA 2RJFA 2FHDA 2VYTA 3CCUT 1QP3A 1BI1A 4BE1A 5HY6A 4ZTFA 1VQ4T 2L8DA 4Q5WA 3OSVA 1OI1A 4PJOC 1K8AC 3WVDB 3RIRA 1W4SA 4M7AA 2QQ9A 3VYHB 3G71T 5EG2A 5GMKi 4GY5A 2DIQA 4J8OA 3S3NA 3I56A 3CCRA 1VQKA 3RERA 4HCBA 4M7DG 3HRSA 5GMKh 1K9MU 4HCZA 1M9SA 3UT1A 2L5QA 1QP2A 2F5KA 4RCCA 4F7UE 1K8AU 5FRNA 3UDCA 5C6SA 3GIBA 4E7KA 1KHCA 1N8RC 2XHCA 3LGFA 2FB7A 4Y91A 1WJQA 3OW2S 3CBOA 4EMGA 2L3RA 2QQRA 4DA4A 1M8VA 3A8OB 4XAXB 2VGNA 3GNGA 4CI0C 2ZGWA 2CGHA 3TREA 3P8BB 4ZTJA 2DZCA 2XI9A 4BY6C 3X20B 1BI3A 1YJ9T 1ZHIA 1N8RU 1H3ZA 3PGGA 4M75B 3PMTA 2GFAA 3FJPA 1PSEA 2AHJB 4C92B 1UEBA 2DPPB 4F7UG 5GANf 3RKWA 5L8RE 3NTHA 4N0AC 2DVEA 2P0PA 3GOXA 3A5ZB 4M77F 3CPFA 4PJOD 1VQ8T 3OB9A 4FIBA 5LJ3f 4EMHA 2K2VA 3L2QA 1VQ7T 3S6WA 2G3RA 3X28B 2MWOA 3FDRA 3ASKA 1VQ4A 1AHJB 3OMCA 2BIVA 4EMKB 1UGPB 3MEWA 3CCVA 2A7YA 2EQMA 1HK9A 3NFCA 2OAUA 3TCJA 4DQ2A 1QVGS 3S3MA 2RHYA 4PKCC 3HFOA 2CZ1B 4NOYA 4OB2B 5FU6B 3EFSA 1B34A 2XKOC 5I21A 4M7AG 5HK3A 2B8AA 1VQ9A 1VQLA 2MAMA 2DD5A 5LJ5j 1NE8A 2DD4A 3MO8A 1YIJA 3LH0A 3M59A 2BKDN 3DKMA 4KBMB 3C12A 4NL2A 4TVRA 4BD3A 4RKUE 5D6XA 3CBPA 1M1KC 3J81E 5FRMA 2X4YA 1KQ2A 1UGSB 2RM4A 3G7ZA 2K3YA 1LJOA 3X24B 4XU0A 1RL2A 3BDLA 1WGSA 2CKKA 1YJ9A 2XK0A 2XIDA 4BE2A 2KK4A 1KQ1A 4JUVA 3OYLA 4OVAA 1M5Q1 2KAFA 1M1KU 4PJOB 3FB9A 2O01E 2HQEA 3TU4K 2VXEA 3HKSA 2LVMA 4E7LA 3N5BB 4C8QG 3BW1A 3CCQT 2OTLA 3FIFA 3CCET 3QZ5B 3OYCA 3MP6A 4XTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 6;  1N9S A;  4J6Y A;  4M77 E;  3V8J A;  4M77 A;  1D3B A;  3JCM g;  4EMK A;  5GAM g;  4M78 C;  3JCM d;  2DKG A;  4MML A;  5GAM d;  4F7U A;  3EFR A;  4M7D D;  5GAN e;  3HSB A;  4C92 C;  2DZ9 A;  3JCM h;  5GAM h;  4XTU A;  1WPY A;  5LJ3 e;  4M75 D;  4J5Y A;  4M75 E;  2E64 A;  3RKY A;  4C8Q C;  4M78 A;  4NL3 A;  4M7A C;  3JCM X;  5GAN 2;  4M7D B;  4C92 E;  3SWN B;  5GAO l;  3V7C A;  4C92 A;  4MMK A;  4X9D A;  4XU3 A;  3JCM W;  4V2S A;  2QTX A;  5GAO p;  4HT8 A;  4PJO C;  4QVC A;  4C8Q A;  3JB9 G;  4M7A E;  3RIR A;  1TH7 A;  4M7A A;  3JCM c;  2DXT A;  5GMK i;  4M77 D;  1U1T A;  4XTY A;  5LJ5 e;  1LNX A;  4J6W A;  4XTX A;  5GAN g;  2FYK A;  5GAN 4;  5GAN d;  3JB9 F;  3RER A;  2DTI A;  2JN0 A;  1U1S A;  3RUX A;  3SB2 A;  3JCM f;  5GAM f;  4M7D G;  1LOJ A;  1B34 B;  3RKX A;  4F7U E;  2YLB A;  1N9R A;  4RCC A;  5LJ3 g;  5GAM j;  5GAN h;  4PJO A;  3GIB A;  2VC8 A;  3BFM A;  5LJ3 d;  3L2Z A;  2DJZ A;  4M75 G;  3JCM V;  4M77 B;  2FB7 A;  4Y91 A;  2E41 A;  5GMK m;  5LJ3 h;  4M7D F;  3M4G A;  4M78 D;  4EMG A;  1Y96 A;  4JRK A;  3INZ A;  5DY9 A;  3V8K A;  3QHS A;  3VU3 C;  2RB6 A;  4M78 E;  3V7S A;  1H64 1;  4C92 D;  1M8V A;  4M75 F;  3BDU A;  4XU1 A;  2K57 A;  2ZGW A;  2CGH A;  4JLI A;  2DZC A;  2E65 A;  3JCM P;  5GAN 3;  3JB9 H;  3PGG A;  3SWN C;  4M75 B;  4M7A D;  5LJ5 g;  5GMK e;  2RA2 A;  3FJP A;  4C8Q E;  5LJ5 d;  4M77 G;  4C92 B;  2RD1 A;  2EAY A;  4J6X A;  5LJ5 h;  1X01 A;  1I81 A;  4F7U G;  5GAN f;  3RKW A;  2E10 A;  2DVE A;  4N0A C;  5GAN j;  4M77 F;  4HT9 A;  1YCY A;  4PJO D;  5GAO m;  2EJG A;  3SWN A;  4M7A B;  2DXU A;  4X9C A;  3V7R A;  2EJF A;  2Y90 A;  5LJ3 f;  1I4K 1;  1HXD A;  3V8L A;  4EMH A;  4F7U F;  3JCM Q;  5LJ3 j;  4RCB A;  5GAO q;  4M78 G;  1JRI A;  1D3B B;  2DTH A;  4EMK B;  1I8F A;  4C92 G;  4N0A A;  4F7U B;  1WQ7 A;  1HK9 A;  4DQ2 A;  2I2L A;  4OP0 A;  4XU2 A;  4M78 F;  1MGQ A;  4PJO E;  3HFO A;  5GMK l;  3JB9 J;  4C92 F;  4NOY A;  1BIA A;  4M7A G;  3EFS A;  1B34 A;  3L1A A;  4XQ3 A;  5I21 A;  5GAN 8;  4C8Q D;  3JCM J;  1I5L A;  5GMK h;  4M78 B;  4M7D C;  2HNI A;  5LJ5 f;  2DEQ A;  3JB9 I;  5LJ5 j;  3AHU A;  1WNL A;  4C8Q F;  3BY7 A;  2EJ9 A;  1BIB A;  4M7A F;  4M75 C;  4NL2 A;  4PJO G;  2YLC A;  4A53 A;  5GAN 5;  1JBM A;  1KQ2 A;  4M7D E;  2RM4 A;  4C8Q B;  3JCM e;  5GAM e;  5GAO r;  4XTZ A;  4M7D A;  3QSU A;  5GAN 7;  1LJO A;  4PJO F;  1WQW A;  4A54 A;  2VXF A;  4XU0 A;  3QO3 A;  4M75 A;  3HFN A;  3RES A;  1KQ1 A;  4XTV A;  4JUV A;  1M5Q 1;  2YHT A;  3QUI A;  4PJO B;  3FB9 A;  4M77 C;  3JCM b;  2DTO A;  4EMK C;  2VXE A;  4HA8 A;  4PNO A;  4JRI A;  4WF2 A;  5CAI A;  4XTW A;  5GAO n;  4C8Q G;  3BW1 A;  4QVD A;  5GMK j;  3FIF A;  1Y96 B;  2EWN A;  3JB9 D;  2E1H A; 
#chains in the Genus database with same CATH topology
 3PNW C;  2P4T A;  5GAN 6;  1U06 A;  2XMF A;  1QWE A;  3ULR B;  4PFP A;  1VQN Q;  2X3X D;  1IZ6 A;  1VQ6 A;  3RMS A;  3JAM E;  1WPY A;  3P8D A;  3OS1 A;  2J6F A;  3I56 T;  3RNJ A;  2QA4 A;  3JCM X;  4LDW A;  3CPW S;  5FRO A;  3JCM W;  3VUZ A;  2RO0 A;  1SKU B;  1T3S A;  2KRN A;  1LNX A;  1K9A A;  2R5A A;  2L3Q A;  3JB9 F;  4AFZ C;  4IKF A;  5GAM j;  2RJC A;  1OZ3 A;  2CZ6 B;  5LJ3 d;  5IXB A;  1TUC A;  1JQQ A;  5LJ3 h;  3M4G A;  1E6G A;  1OU8 A;  4JRK A;  1E6H A;  2K6D A;  1LPL A;  2FL7 A;  3INZ A;  1H64 1;  2RN8 A;  3CCM Q;  1Q81 R;  2GFU A;  2KRS A;  4JLI A;  2WAC A;  3FRN A;  2O9V A;  5J26 A;  2F1L A;  2O9S A;  3FEO A;  3MKD A;  1FMV A;  2CDT A;  3VS3 A;  2L3P A;  1YI2 T;  4M7A B;  3V8L A;  1VQ9 T;  1VQL T;  5GAO q;  4L5G A;  5A0L A;  5D7U A;  4LD9 K;  5KYU B;  2G6F X;  1K0X A;  1T3L A;  1IB8 A;  1MGQ A;  2V8I A;  3HTR A;  3VS7 A;  2RI3 A;  2CZ7 B;  2HNI A;  1WXU A;  1D1C A;  2XIC A;  2DEQ A;  4RG2 A;  1OPK A;  2WSF E;  2Z0W A;  3JB9 I;  2RHZ A;  1C0M A;  1K9M R;  1K8A R;  1W2B P;  1RAD B;  1VQP A;  4PJO F;  4M4Z A;  5IT9 E;  4BI4 A;  3GLX A;  2F69 A;  1M1F A;  2RQW A;  2QQB A;  3MCA B;  3NTK A;  4YTL A;  3REB B;  3OYD A;  2EKH A;  4EDU A;  1OPL A;  4WF2 A;  2A08 A;  4C0Z A;  2E70 A;  2IG0 A;  3DB3 A;  1YI2 A;  3EGX B;  2LQ8 A;  4E7S A;  2LDM A;  2OTJ T;  2QTV A;  4B9W A;  2KRO A;  1HJD A;  2HSP A;  4ZGD B;  1U8R A;  4M75 E;  4M7A C;  4RTX A;  3MET A;  1JJ2 A;  1VQ4 Q;  1Y07 A;  2RJD A;  2DFU A;  3HRU A;  2QTX A;  3PVQ A;  2NUT A;  3JB9 G;  2LJ3 A;  4XTX A;  3CC4 T;  1VQ9 Q;  3JCM f;  4DBH A;  1N6A A;  2YLB A;  4PJO A;  3HHT B;  4DOV A;  1PHT A;  1OZ2 A;  1SSF A;  5KCO A;  1SHG A;  1YJ9 Q;  2YUN A;  3AT1 B;  4AMC A;  1G3W A;  4RMO A;  4PJL A;  1OOT A;  4BE0 A;  2CP6 A;  4WTO B;  3JB9 H;  1YIT A;  2HEQ A;  2HKN A;  1QWF A;  2AZS A;  3OBY A;  4OMN A;  4JLG A;  2J06 A;  1YCY A;  3H0I A;  3QXE B;  5A0D A;  4JDS A;  1VQ5 T;  2DTH A;  1I8F A;  2QQS A;  2XG8 D;  3CME T;  1K76 A;  2X4J A;  4LNP A;  4XU2 A;  1FXX A;  3L2V A;  3CC4 A;  4K11 A;  2SRC A;  2R5M A;  4C8Q D;  4IIO A;  1I5L A;  2EGE A;  4LDX A;  1BIB A;  2ROL A;  1AZE A;  2YRD A;  4PJO G;  2K4Y A;  2DBM A;  3G4S T;  1R0C B;  4X34 A;  3CC7 T;  1Q95 G;  2KEA A;  1NYG A;  2L0A A;  2BUD A;  2MIO A;  1OV3 A;  3QUI A;  1Q82 R;  2DXB A;  4LN2 A;  3CCQ Q;  3CCE Q;  2SEM A;  2DTO A;  1BCM A;  4HA8 A;  1WHG A;  3HRT A;  5GAO n;  1MV0 B;  4JPB W;  1IRE B;  2E1H A;  4RTY A;  4KRT A;  1M90 C;  1KQS A;  3H0F A;  1AWJ A;  1TU0 B;  3R6N A;  5GAM d;  4E7H A;  5GAM h;  2NLU A;  1VQK Q;  3OA6 A;  1YJN A;  1K73 U;  1V29 B;  3SFM A;  1ZQ1 A;  5KYW A;  3CC2 A;  2JTE A;  3M0T A;  4RG8 A;  5I11 A;  2CS7 A;  4LDV A;  2CT4 A;  1BYM A;  3GF5 A;  3G4S A;  1WA7 A;  2QDL A;  4XTY A;  3CC7 A;  5GAN 4;  3SB2 A;  4Z02 A;  5CCA A;  4HCK A;  2HL5 C;  4HXJ A;  3BFM A;  3E2U A;  1IGQ A;  4MDW A;  1P92 A;  1SEM A;  2CT3 A;  1Y96 A;  1SRL A;  2RB6 A;  1M8M A;  3G71 A;  2EYW A;  5M9O A;  4ELY C;  3E9G A;  3WVE B;  3SWN C;  4C8Q E;  2QAS A;  1KK7 A;  4A4G A;  1ZX6 A;  1X01 A;  4CRI A;  3RMQ A;  2COZ A;  4JJB A;  4F7U F;  1I4K 1;  2MOX A;  1G5V A;  3CBM A;  2DE0 X;  5AT1 B;  2HCK A;  1WXB A;  4R56 A;  2XDD A;  2ABL A;  2JJ9 A;  3LH5 A;  3MHX A;  2DJQ A;  4ME7 A;  3U23 A;  1MMA A;  1QVF A;  2ZPH B;  2OTL Q;  1RAB B;  4M7A F;  4F14 A;  4RUG A;  3JCM e;  3C95 A;  1AOJ A;  1NZ9 A;  3QSU A;  3OW2 P;  4A54 A;  2PVG B;  4FU6 A;  2X51 A;  5CR2 A;  3LX7 A;  5A2Q E;  2YHT A;  2HBW A;  1Q81 U;  2NYS A;  2ZPB B;  3KXT A;  5GMK j;  2WSE E;  4JJN K;  2A28 A;  1I81 A;  2EWN A;  3JB9 D;  4WCI A;  2QDY B;  2ZPF B;  1Q7Y R;  2KDS A;  3EGU A;  4MML A;  4J7I A;  4F7U A;  3NHN A;  2HMA A;  2EQJ A;  4XK8 E;  1WYX A;  4OF1 A;  2KXC A;  4MDX A;  2J6O A;  1RAI B;  3CCU T;  1RLQ C;  1VQM Q;  1OI1 A;  1W4S A;  2FO0 A;  1RAF B;  4M7A A;  4GY5 A;  4J8O A;  4FW1 A;  4E2F B;  3CCJ Q;  3S3N A;  1K9M U;  2EW3 A;  1QQJ A;  2L5Q A;  1K8A U;  5C6S A;  3GIB A;  2C0T A;  5IHI A;  1WJQ A;  1SRM A;  2QQR A;  2FPD A;  3GNG A;  2XI9 A;  4JJD A;  3PMT A;  2GFA A;  1PSE A;  4C92 B;  4LUD A;  4JZ3 A;  2AT1 B;  1NM7 A;  1OQK A;  3ZL7 C;  4F7U G;  1NJI R;  5GAN f;  1RAA B;  3RKW A;  4PJO D;  3CPF A;  1VQ7 T;  2M02 A;  3H41 A;  3ASK A;  1UGP B;  1B3Q A;  3NFC A;  2YT6 A;  3S3M A;  1NYF A;  4PKC C;  1Z9Z A;  4Z8A A;  4M7A G;  3EFS A;  1AWO A;  1PD0 A;  2CP3 A;  1K4U S;  2DD4 A;  4KBM B;  4GLM A;  3M0P A;  5FRM A;  4J9D A;  1KQ2 A;  2NUT B;  1D0X A;  1LJO A;  3X24 B;  2VB6 A;  2AKK A;  1WGS A;  1Q86 R;  2KK4 A;  2KT1 A;  1KQ1 A;  4JUV A;  4OVA A;  4PJO B;  3FB9 A;  3TU4 K;  2YUO A;  2AK5 A;  3N5B B;  3FIF A;  3OYC A;  4XTU A;  3QBY A;  4J6Y A;  2VWF A;  2O4X A;  2A36 A;  4JS5 A;  4C5G A;  4M78 C;  1X27 A;  5IH2 A;  3I55 Q;  2CYZ B;  4C92 C;  2GF7 A;  3ME9 A;  5CIU A;  3CXC P;  1M1K R;  4BY6 B;  5CKH A;  2E3H A;  4JRQ A;  4M7D B;  4AT1 B;  3EGD A;  2CP2 A;  1ZSG A;  1ABO A;  4Z88 A;  4RTW A;  2LNH B;  4HVW A;  3L2U A;  4J6W A;  4LXC A;  1VQ7 Q;  1I07 A;  2OI3 A;  4PJO E;  2H3J A;  5KE3 A;  1JJ2 S;  3NTI A;  1PM3 A;  4OB3 B;  1DJ7 B;  5KYY A;  1G3S A;  1M3C A;  1S72 Q;  4QVZ A;  2DAQ A;  2HSE B;  1WLP B;  1Q82 U;  2HBP A;  1F1B B;  3CCV T;  1QW1 A;  4J9I A;  3H8Z A;  4KUD K;  1X2Q A;  2QG9 B;  3M5A A;  1YHQ A;  2MK5 A;  3CMA T;  4HCC A;  1M3A A;  1XQH A;  2EJG A;  3SWN A;  3URG A;  1X2K A;  1YIJ T;  4IUV A;  4ZGJ B;  5AYF A;  3THK A;  4QQG A;  2LT1 A;  3GNF B;  1RI9 A;  3L1A A;  2M0Y A;  4ANJ A;  4M7D C;  4E47 A;  5GMK h;  5LJ5 f;  2DVJ A;  3TSZ A;  4LDU A;  2J05 A;  2JM9 A;  4PL6 A;  3H9N A;  1WHM A;  2QGG A;  2O88 A;  2RK1 A;  2Y4X A;  5FU7 B;  3OYJ A;  3TVT A;  3MEV A;  2YRV A;  3RES A;  4N4H A;  1QCF A;  3QDF A;  3LGL A;  1N8R R;  1QCN A;  5KE2 A;  1VQ6 T;  1VIE A;  5CAI A;  2KVQ G;  4XTW A;  2M16 A;  3CMA A;  1WHK A;  1Y96 B;  2QA4 T;  9ATC B;  3V8J A;  1X6O A;  3VUB A;  1AVZ C;  3EFR A;  5GAN e;  4OGE A;  1I0C A;  4ELZ C;  1VOM A;  2D6F A;  2JUF A;  3G6E A;  1CSK A;  4A4K A;  2DK3 A;  3M58 A;  1XTD A;  4X9D A;  1T0J A;  3CCV Q;  1KQS S;  2EIF A;  5D6W A;  1VQN A;  2E6N A;  1YCS B;  2VKN A;  2EQU A;  2EYQ A;  2LJ1 A;  1X75 C;  2HDA A;  4M77 B;  1VQO A;  3V8K A;  5FU7 C;  2DL4 A;  2RHX A;  3VU3 C;  2V1Q A;  1NBE B;  2JZ2 A;  4FM4 B;  1QCO A;  2L3S A;  5DLQ E;  1NPP A;  4M7A D;  1TSF A;  1N27 A;  4C0G A;  4AFS C;  4BDZ A;  3A8L B;  1TG0 A;  3UAT A;  3GBQ A;  5KH6 A;  1VQ8 Q;  3UA7 A;  3EG2 A;  3VKI A;  3OYM A;  1Q7Y U;  2RQR A;  2K7A A;  7AT1 B;  1HXD A;  2CH4 W;  4E6R A;  3CCM A;  2EVR A;  4F7U B;  2FZG B;  2H3E B;  4M78 F;  3L2R A;  1VQP T;  1PRM C;  3PE0 A;  4C92 F;  2QXF A;  4QKU A;  4BB7 A;  1TOV A;  2E3I A;  3BY7 A;  1GFD A;  3OBW A;  2F2X A;  2MF2 A;  2RJE A;  1Y71 A;  2IPO B;  3QYH B;  3CD6 A;  2VGM A;  2ATC B;  2GTJ A;  1UJ0 A;  3I5R A;  2Y4Y A;  1QVF S;  4M77 C;  4ZN1 A;  2GNC A;  2ZZD A;  4QVD A;  3PVL A;  2K5I A;  1K73 C;  1ZUY A;  3I9Q A;  2LQK A;  5FLX E;  2XDP A;  4DOW A;  1TS9 A;  1NJI U;  3DLL A;  1U3O A;  2JMA A;  2D8J A;  3OS5 A;  2EBP A;  3I56 Q;  2E6Z A;  1OX9 A;  1UEC A;  1SHF A;  4M78 A;  4O6J A;  5GAN 2;  3VV0 A;  1FYN A;  1YNZ A;  4C92 A;  4MMK A;  1W2B A;  2KQW A;  2DMO A;  4M7A E;  2DLP A;  4KGV B;  3VYG A;  5LJ5 e;  2L2P A;  1T0H A;  1YJW T;  1N9R A;  1YIT T;  2JMC A;  1M90 R;  1G83 A;  5GMK m;  4M7D F;  2R58 A;  1Q86 U;  3OYK A;  3MP1 A;  1BI0 A;  4FSS A;  4ATO A;  4EPC A;  2M0O A;  3LWH A;  1GCP A;  4E7J A;  1YI2 Q;  2DBK A;  3JV3 A;  2P4R A;  1VQL Q;  1X43 A;  2RI5 A;  2EJF A;  2ED0 A;  2KYB A;  5CQY A;  2KE9 A;  1D0Z A;  4M78 G;  2O4X B;  4LDY A;  4C92 G;  1K0S A;  4DEY A;  2DRM A;  1YJW A;  3EH2 A;  1D09 B;  1M27 C;  2HKQ B;  3EGD B;  2EJ9 A;  4M75 C;  1WFW A;  2BZY A;  2K3X A;  2FZC B;  3VRY A;  4M7D A;  5I2M A;  1WQW A;  2MMP A;  2KXD A;  3REA B;  3HL8 A;  2RQV A;  3HFN A;  2PUK B;  4XTV A;  1MMD A;  1FMK A;  2PZ1 A;  3A8G B;  5KYY B;  1YJN T;  3VS0 A;  4BI8 B;  3CC2 T;  1D1A A;  2J7I A;  2OTJ Q;  1BBZ A;  3EG3 A;  3PMI A;  5FU6 C;  3JCM g;  1SG5 A;  4IUQ A;  4A63 B;  1G3Y A;  5I2S A;  3CCQ A;  3CCE A;  1QVG P;  1AT1 B;  5IHK A;  4IUP A;  2RH2 A;  4R55 A;  3SWN B;  2RJF A;  1D0Y A;  2VYT A;  1QP3 A;  2CH4 A;  2HL3 A;  3EG0 A;  5EC7 A;  1K8A C;  3WVD B;  3RIR A;  3CC4 Q;  1UHF A;  2QQ9 A;  3VYH B;  1NEB A;  3G71 T;  1RAE B;  5EG2 A;  5GMK i;  3CCR A;  1VQK A;  3RER A;  4M7D G;  4HCZ A;  5L23 A;  1EFN A;  3D7S B;  4E7K A;  1KHC A;  2XHC A;  4Y91 A;  2L3R A;  1R77 A;  2RNA A;  3A8O B;  2FPE A;  4J9C A;  2DIL A;  3G1J A;  4CI0 C;  1NG2 A;  1KC8 R;  3TRE A;  4ZTJ A;  2ZAE A;  2E5K A;  1BI3 A;  1N8R U;  3PGG A;  3FJP A;  4E7Z A;  3EHQ A;  3NTH A;  4N0A C;  3GOX A;  3A5Z B;  4M77 F;  4FIB A;  1VQ5 Q;  5LJ3 f;  4EMH A;  3S6W A;  1H92 A;  2MWO A;  3FDR A;  3VRZ A;  3CME Q;  1AHJ B;  2BIV A;  3CPW P;  1AWX A;  1UTI A;  2EQM A;  5IXF A;  1HK9 A;  2CP7 A;  2RHY A;  1Y57 A;  3HFO A;  3CC2 Q;  3BE3 A;  5HCK A;  2D0N A;  3MPU B;  2MAM A;  3M59 A;  3G4S Q;  3DKM A;  4NL2 A;  3C12 A;  4BD3 A;  4FYV B;  4RKU E;  3CC7 Q;  2RM4 A;  2DYI A;  1RL2 A;  2XK0 A;  4KGZ B;  1TTH B;  1M5Q 1;  2O01 E;  2KR3 A;  2HQE A;  5I22 A;  3G71 Q;  2OTL A;  1WDX A;  4M77 A;  4OB0 B;  5J3B A;  2JS0 A;  2X35 A;  4C0D C;  1WHL A;  4OB1 B;  1PSF A;  4C8Q C;  5CKE A;  2LC4 A;  2EGA A;  5GAO l;  4C5I A;  4XU3 A;  3OW2 A;  2P0Q A;  5CQX A;  1Z9Q A;  4HT8 A;  2QYZ A;  2MCN A;  2ZPI B;  2DXT A;  4RTZ A;  2FYK A;  3PIO A;  4FYW B;  2DF6 A;  1Q82 C;  1JXO A;  1LVK A;  2CUD A;  2LMJ A;  2ECZ A;  2V1R A;  2QGF B;  1UGR B;  4FT4 A;  4M78 D;  2YRC A;  1VQM A;  4C92 D;  4M75 F;  1RLP C;  1JB0 E;  2X4X A;  3RDV A;  4A4E A;  2ZPG B;  2KSS A;  3O5Z A;  1Y0M A;  4M77 G;  1AZG B;  2EAY A;  1FX7 A;  2GQV A;  1KD1 R;  2CP5 A;  4VUB A;  4MZT A;  1IRX A;  3I5S A;  1ZA1 B;  2K5F A;  4JJC A;  4J83 A;  2GGR A;  4RCB A;  1KSW A;  1RAC B;  4L6V 5;  1ABQ A;  3A1P A;  4DBQ A;  1UG1 A;  2ZPE B;  4M78 B;  4BUG A;  1EIF A;  2E12 A;  5KYX B;  3ZFJ A;  1QMC A;  3MEU A;  1M90 U;  3E1S A;  4M75 A;  3QJ6 A;  1M4Z A;  4LD6 A;  4J9G A;  2PQW A;  1G2B A;  1MNE A;  4JRI A;  1BCO A;  4J9E A;  4GBQ A;  3M55 A;  3TSW A;  5D6Y A;  1ZBX A;  3CCS A;  3QWX X;  2XD0 A;  4JRP A;  4M7D D;  3HSB A;  1VYT A;  1CKB A;  3OYA A;  2CP0 A;  2DYB A;  1EX4 A;  5LJ3 e;  3DB4 A;  5CO7 A;  2LQN A;  3CCU Q;  2E64 A;  2LNV A;  4C92 E;  1GRI A;  3QPH A;  2AIR B;  4BDY A;  3HPW A;  4ZGE B;  1B7T A;  3MEA A;  2K3B A;  4CC7 A;  4IUU A;  3I55 A;  5GAN g;  1RI0 A;  2VV5 A;  2QEX A;  2BTT A;  1U1S A;  2QAZ A;  5GAM f;  2FRW A;  1LOJ A;  3X26 B;  1W2B S;  2EYZ A;  1WXT A;  4M75 G;  2KT8 A;  2CRE A;  1YHQ T;  1EZZ B;  3OYI A;  1TXQ A;  2EGC A;  3BDU A;  3EFO B;  4R0K A;  2FVU A;  5KYN A;  3CXC A;  2JVV A;  1HD3 A;  4ORZ A;  2EPD A;  2PVD B;  2MYS A;  2KRM A;  1X69 A;  1S72 A;  4OGC A;  2QK0 A;  1CKA A;  2K2M A;  3QG1 A;  3H0H A;  2DL7 A;  3OQ5 A;  1SSH A;  4N0A A;  1VYU A;  4A4H A;  3IQL A;  2JS2 A;  2EYY A;  4RTU A;  1BIA A;  4UC4 A;  1TWB A;  2GBQ A;  3QII A;  1IHW A;  2RI2 A;  2M1H A;  4C8Q F;  2X3W D;  1UGQ B;  4A53 A;  4M7D E;  2YXY A;  1R8O B;  1ZSZ C;  2DX1 A;  3CCL T;  1ZUK A;  3OSS C;  1OUL A;  5ECA A;  2VVK A;  1KC8 U;  2E4H A;  1NJI C;  3G6E T;  1A0N B;  4F17 A;  1RAG B;  3JRZ A;  1C6V X;  3J7A F;  2OJ2 A;  2EFI A;  4E7I A;  2H8H A;  3JCM d;  2VUB A;  1PWT A;  3JCM h;  4FCY A;  1YHQ Q;  1VQN T;  4II1 A;  3OS0 A;  1OX8 A;  3M57 A;  1M1G A;  1V76 A;  1W6X A;  1G8X A;  1UGV A;  3A98 A;  2X9H A;  2F2V A;  1VQO T;  4C8Q A;  1VA7 A;  4KUI A;  1QVP A;  3OYB A;  3M53 A;  5HK0 A;  4M77 D;  3CCL A;  3M56 A;  5IAY A;  2IIM A;  1Q86 C;  1NLP C;  4AFQ C;  3LYI A;  2DJZ A;  3A8H B;  3UA6 A;  3KBG A;  3QKJ A;  4OMF B;  1J3T A;  2KI7 A;  5DY9 A;  1JXM A;  4MZP A;  4KH0 B;  4KUL A;  5GAN 3;  1HSQ A;  3CCM T;  5IHN A;  3OYG A;  5LJ5 g;  1PNJ A;  4P5N A;  3CMA Q;  1IO6 A;  3R6O A;  5GAN j;  1YIJ Q;  3V7R A;  3LWI A;  1WJR A;  3A8M B;  1M2V B;  1JRI A;  2O31 A;  3G6E Q;  4KGX B;  2D0Q B;  1BKB A;  3KFV A;  5GMK l;  3SD4 A;  3CD6 T;  4J9F A;  1VQ8 A;  2BE7 D;  1PKT A;  4PFO A;  5DLO A;  2LCC A;  2RQU A;  1G3T A;  3SDZ A;  2COY A;  3EAE A;  1WZO A;  4N4I A;  3EG9 A;  5GAM e;  1RAH B;  5GAO r;  2J6K A;  3UWN A;  3M0R A;  3LW5 E;  1IGU A;  2NWM A;  4KH1 B;  1VQ6 Q;  2LQW A;  1VQO Q;  4L59 A;  1B07 A;  4HVV A;  1WHH A;  2C0O A;  1BI2 A;  4EMK C;  4PNO A;  2QA4 Q;  4JS4 A;  2DL5 A;  5CKF A;  3EH1 A;  3PT9 A;  2HD0 A;  3MP8 A;  4Y92 A;  2YSQ A;  4M77 E;  3S3O A;  1D3B A;  4HKE A;  1KD1 U;  2PVO B;  2DKG A;  3KUF A;  3Q1J A;  5CKD A;  2CSI A;  1PCX A;  4M75 D;  3QWY A;  1W70 A;  2D9T A;  4OMM A;  2KYM A;  4FW2 A;  2FHD A;  1BI1 A;  2KBT A;  5HY6 A;  4BE1 A;  1ZUU A;  4ZTF A;  1VQ4 T;  3OSV A;  5FWC A;  1TUG B;  1UHC A;  1GBR A;  2FRY A;  1YP5 A;  3TQ7 P;  1IXD A;  3I56 A;  4HCB A;  2PNI A;  3UT1 A;  1M9S A;  4F7U E;  1QP2 A;  2F5K A;  4RCC A;  5FRN A;  1N8R C;  1V1C A;  4OMO A;  3OW2 S;  4EMG A;  4OMP A;  1M8V A;  2HZY A;  2DA9 A;  2VGN A;  3CD6 Q;  1W1F A;  2ZGW A;  5FWB A;  5FW9 A;  1YJ9 T;  5KYX A;  1H3Z A;  1ZBJ A;  4M75 B;  4ZNX A;  4DBR A;  4Z89 A;  2BZX A;  1UEB A;  2DPP B;  1YN8 A;  2DVE A;  2P0P A;  2OAW A;  3OB9 A;  3L2Q A;  2DER A;  2M51 A;  4AG1 C;  3NGP A;  1VQ4 A;  3MEW A;  1VQP Q;  1H3H A;  4JZ4 A;  2A7Y A;  4PK4 A;  3TCJ A;  2OAU A;  4DQ2 A;  1MND A;  1MUZ A;  5FU6 B;  4OB2 B;  1PKS A;  1B34 A;  2XKO C;  5HK3 A;  2FPF A;  2B8A A;  1VQ9 A;  1VQL A;  2DD5 A;  1YWP A;  1NE8 A;  5LJ5 j;  3LH0 A;  5D6X A;  1JJ2 P;  4AG2 C;  3G7Z A;  4XU0 A;  3BDL A;  1YJ9 A;  2XID A;  4DEX A;  4BE2 A;  2DM1 A;  1M1K U;  1ZSZ A;  2VXE A;  1KFZ A;  4E7L A;  3CCQ T;  3CCE T;  2I0N A;  2ENM A;  3QZ5 B;  3MP6 A;  4HVU A;  1M2O A;  1ZA2 B;  3H6Z A;  2JTF A;  1MV3 A;  1D1B A;  1NLO C;  1Q81 C;  3EFO A;  3FC3 A;  1ZLM A;  2LJ0 A;  2A0F B;  2DNU A;  3CCR T;  4NL3 A;  1VQK T;  3RKY A;  1IHV A;  3LLR A;  3V7C A;  3HP9 A;  4FL6 A;  2DEU A;  5HKC A;  2OTJ A;  2YDL A;  5GAO p;  4QVC A;  1UB4 A;  1YJW Q;  2CUB A;  2YUQ A;  2LCS A;  3F70 A;  1YIT Q;  1JU5 C;  2A3L A;  5GAN d;  2DTI A;  2AKL A;  3JSC A;  4BI3 A;  4CC3 A;  5GAN h;  2R57 A;  2VC8 A;  3NMZ C;  2BE9 B;  4O5V A;  2FG0 A;  4FYX B;  1MMG A;  2PUO B;  3L42 A;  3V7S A;  4XU1 A;  2K57 A;  2EKO A;  2BZ8 A;  2M9U A;  3RR6 A;  3JCM P;  1K9M C;  1M30 A;  1QKX A;  1QVG A;  4F04 B;  1AWW A;  2PTK A;  2FZK B;  1PC0 A;  2RD1 A;  1XNI A;  4J6X A;  3OS2 A;  4J9B A;  4J9H A;  4HT9 A;  4OML A;  3VS1 A;  1Y7X A;  2DRK A;  4X9C A;  3JCM Q;  2LX7 A;  1MMN A;  1OU9 A;  3QYG B;  1KG1 A;  2DL3 A;  2LTO A;  3CXC S;  2V26 A;  4QW2 A;  4OP0 A;  3OY9 A;  6AT1 B;  1KQS P;  1LCK A;  2C0I A;  2JT4 A;  2V8J A;  5CKB A;  2KMT A;  4XQ3 A;  1SPK A;  2MI6 A;  1WNL A;  2RF0 A;  3RBB B;  1WX6 A;  4C0D B;  1VQ5 A;  2MWP A;  1GCQ C;  2FEI A;  3CME A;  3EHR A;  5GAN 5;  1JBM A;  3OYF A;  2OTL T;  2E5Q A;  2IVW A;  4C8Q B;  3CCR Q;  4XTZ A;  2DET A;  2NUP B;  1UDL A;  2VXF A;  2GTO A;  2AZV A;  2XDB A;  2A37 A;  1YJN Q;  5IN1 A;  3JCM b;  2F5T X;  1AD5 A;  4C5E A;  2PU9 B;  3CPW A;  2LCL A;  1TUD A;  4LUE A;  3T9N A;  4EMK A;  4ZN3 A;  3GPL A;  3WXM B;  2EQK A;  3UPU A;  3VS2 A;  2K9G A;  2RHU A;  4C5H A;  4D8K A;  2WSC E;  1BB9 A;  3QJY A;  1GXI E;  2LRQ A;  3E19 A;  1C1A A;  2LZ6 B;  2LT4 A;  1VQM T;  3VS6 A;  1M2V A;  2O2O A;  4PJM A;  2JN0 A;  2EYX A;  1MHN A;  5LJ3 g;  3CCJ T;  1JEG A;  4IIM A;  1UUE A;  3QZ9 B;  2E41 A;  4NS5 A;  3M4Y A;  2XU8 A;  4FSX A;  3QHS A;  1QVF P;  1PD1 A;  3EG9 B;  3PFS A;  1S1N A;  4QQ6 A;  4PLL A;  4DBF A;  8ATC B;  5GMK e;  5LJ5 d;  1UJY A;  3C0C A;  1WI7 A;  5LJ5 h;  4QQD A;  4KT0 E;  8AT1 B;  3M54 A;  2DXU A;  1WJS A;  4D8D A;  2MPX C;  4RTV A;  1D3B B;  1WQ7 A;  2ZCF B;  2X4W A;  1U5S A;  1UE9 A;  3SHW A;  3TEE A;  2P84 A;  3JB9 J;  1X6G A;  3OYH A;  3CCJ A;  3OYE A;  1VUB A;  1O9S A;  2HQX A;  4CC2 A;  1R0B G;  4IUR A;  2D1X A;  3M0U A;  1KC8 C;  1QKW A;  5CVI A;  5GAN 7;  2QI2 A;  2DO3 A;  1X6B A;  3QO3 A;  3CCS T;  3NPF A;  2NUZ A;  4B9X A;  2RPN A;  2RQT A;  4C0F A;  2KY9 A;  3OYY A;  1PRL C;  2V8K A;  2P0K A;  1UFF A;  1N9S A;  3QDR B;  5KYU A;  1OYX A;  3M0S A;  2ESW A;  1I1J A;  1ACM B;  3I55 T;  4X1V A;  1QLY A;  3EG1 A;  1GL5 A;  3C94 A;  3UF4 A;  2QEX T;  4J5Y A;  1KIK A;  1HYO A;  3PTA A;  4ESR A;  3X25 B;  4V2S A;  2ED1 A;  4N4G A;  2JW4 A;  1TH7 A;  3VJP A;  5A0G A;  3JCM c;  1U1T A;  1KJW A;  2RHI A;  5DM7 R;  3RUX A;  1WHJ A;  2RK2 A;  3OMG A;  3M9Q A;  1B34 B;  3RKX A;  3ZEH A;  2DL8 A;  3CCU A;  1N5Z A;  3L2Z A;  4PFZ A;  3JCM V;  2CZ0 B;  4AFU C;  2RMO A;  2OX7 A;  3ER0 A;  3EGX A;  4M78 E;  1S72 T;  2E65 A;  2VAS A;  2LP5 A;  4MZM A;  2JM8 A;  2RA2 A;  2LX9 A;  4FT2 A;  1ZSZ B;  3FLG A;  2E10 A;  3ZBD A;  3FJ5 A;  2L89 A;  5GAO m;  3DLM A;  3CCS Q;  2Y90 A;  2JXB A;  1YBY A;  3I35 A;  5LJ3 j;  1GBQ A;  1AEY A;  5CK9 A;  2JTM A;  5GJW B;  5GJV B;  2I2L A;  3OYN A;  4BAC A;  1M3B A;  4B6M A;  4GLK A;  4IUT A;  4PLI A;  2DXC A;  5GAN 8;  1Q7Y C;  3JCM J;  4EIK A;  1VQ7 A;  1VIF A;  5KCH A;  5J39 A;  3M0Q A;  3AHU A;  1ARK A;  3L2W A;  3J80 E;  2YLC A;  4J7F A;  1O75 A;  2QEX Q;  1FWZ A;  3VS4 A;  2C06 A;  3CEY A;  3PIP A;  2JNG A;  4FYY B;  4OMQ A;  1GCQ A;  4Y28 E;  1OEB A;  1JO8 A;  3CQT A;  2QQA A;  4PJJ A;  3MJX A;  1KD1 C;  1GFC A;  2F2W A;  5C0M A;  2K5L A;  1I5O B;  3GP8 A;  4PJN A;  3O8V A;  2JOY A;  4LE9 A;  2D8H A;  3C4S A;  2GCX A;  1XOV A;  2K79 A;  5LL6 S;  1SF9 A;  4A4F A;  5GAM g;  2DIG A;  3E9F A;  4D6W A;  1FMW A;  1NPR A;  1YWO A;  1KHI A;  2DZ9 A;  2YWW A;  2CSQ A;  1BU1 A;  3P8H A;  2HAX A;  2KGT A;  1E7O A;  1VYV A;  2W10 A;  3SEM A;  2L8D A;  4Q5W A;  1H8K A;  4PJO C;  1K1Z A;  2EQI A;  2DIQ A;  4QT7 A;  4RTT A;  2HQH A;  3HRS A;  3UDC A;  3LGF A;  2FB7 A;  3CBO A;  4DA4 A;  4XAX B;  2CGH A;  3P8B B;  2DZC A;  4BY6 C;  3X20 B;  1ZHI A;  1BK2 A;  5KYW B;  1RUW A;  2AHJ B;  2ROT A;  2NUP A;  5L8R E;  1PG5 B;  4F16 A;  1VQ8 T;  1K73 R;  2K2V A;  2G3R A;  3X28 B;  3OMC A;  4EMK B;  3CCV A;  1QVG S;  2KNB B;  2CZ1 B;  4NOY A;  2COW A;  5I21 A;  3MO8 A;  1YIJ A;  2YUP A;  1YFN A;  2BKD N;  4TVR A;  3CBP A;  1M1K C;  3J81 E;  2X4Y A;  3CCL Q;  1UGS B;  1NEG A;  2K3Y A;  2W0Z A;  1WIE A;  2CKK A;  4CC4 B;  3OYL A;  2KAF A;  1XJW B;  2GQI A;  3HKS A;  2LVM A;  4C8Q G;  3BW1 A;  2B86 A;  3VS5 A; 
#chains in the Genus database with same CATH homology
 3PNW C;  2P4T A;  3QBY A;  5GAN 6;  4J6Y A;  3H6Z A;  2O4X A;  2JTF A;  4M77 A;  4JS5 A;  4C5G A;  4OB0 B;  4M78 C;  2CYZ B;  5J3B A;  4C92 C;  2X35 A;  4C0D C;  2GF7 A;  1IZ6 A;  1Q81 C;  1VQ6 A;  3FC3 A;  3RMS A;  3JAM E;  1WPY A;  3ME9 A;  3P8D A;  4OB1 B;  1PSF A;  5CIU A;  3OS1 A;  3I56 T;  3CCR T;  4BY6 B;  5CKH A;  5CKE A;  3RKY A;  4C8Q C;  4NL3 A;  4JRQ A;  1VQK T;  2QA4 A;  2LC4 A;  4LDW A;  3JCM X;  3CPW S;  3LLR A;  4M7D B;  5GAO l;  3V7C A;  3HP9 A;  4FL6 A;  4C5I A;  4XU3 A;  5FRO A;  3OW2 A;  3JCM W;  5HKC A;  2P0Q A;  5CQX A;  2OTJ A;  5GAO p;  4HT8 A;  4QVC A;  3VUZ A;  1UB4 A;  2ZPI B;  2RO0 A;  2DXT A;  3F70 A;  3L2U A;  1LNX A;  4J6W A;  2FYK A;  2A3L A;  2R5A A;  5GAN d;  3JB9 F;  2DTI A;  4IKF A;  3PIO A;  3JSC A;  4PJO E;  4BI3 A;  5GAM j;  2H3J A;  2RJC A;  5KE3 A;  5GAN h;  1Q82 C;  1JJ2 S;  1OZ3 A;  3NTI A;  2R57 A;  2CZ6 B;  2VC8 A;  4OB3 B;  1DJ7 B;  5LJ3 d;  1G3S A;  5LJ3 h;  4O5V A;  3M4G A;  1UGR B;  4FT4 A;  4M78 D;  4JRK A;  3INZ A;  2FL7 A;  2PUO B;  2DAQ A;  3L42 A;  4QVZ A;  3V7S A;  1H64 1;  4C92 D;  1VQM A;  4M75 F;  4XU1 A;  1JB0 E;  2K57 A;  2GFU A;  4JLI A;  2X4X A;  4A4E A;  2EKO A;  2M9U A;  1Q82 U;  2HBP A;  2ZPG B;  3JCM P;  2WAC A;  2KSS A;  3FRN A;  5J26 A;  1K9M C;  3CCV T;  1QVG A;  1QW1 A;  3FEO A;  4M77 G;  2RD1 A;  2EAY A;  1FX7 A;  1XNI A;  2GQV A;  3H8Z A;  4J6X A;  4KUD K;  3OS2 A;  4VUB A;  3M5A A;  4MZT A;  1YHQ A;  3CMA T;  4HCC A;  4HT9 A;  1XQH A;  1YI2 T;  2EJG A;  1Y7X A;  2K5F A;  4X9C A;  4M7A B;  3SWN A;  3URG A;  3V8L A;  4J83 A;  1VQ9 T;  3JCM Q;  1VQL T;  5GAO q;  4L5G A;  4RCB A;  1YIJ T;  4IUV A;  5A0L A;  4ZGJ B;  3QYG B;  4LD9 K;  1KG1 A;  4L6V 5;  2LTO A;  5AYF A;  3CXC S;  4QW2 A;  4OP0 A;  3OY9 A;  1MGQ A;  2V8I A;  4QQG A;  2LT1 A;  3GNF B;  2V8J A;  2ZPE B;  5CKB A;  2KMT A;  3L1A A;  4XQ3 A;  4M7D C;  2RI3 A;  2MI6 A;  4M78 B;  2CZ7 B;  2HNI A;  2XIC A;  4BUG A;  1EIF A;  4E47 A;  2DEQ A;  4RG2 A;  2WSF E;  5LJ5 f;  3JB9 I;  1WNL A;  2E12 A;  4C0D B;  4LDU A;  2RHZ A;  1VQ5 A;  2MWP A;  4PL6 A;  3ZFJ A;  3CME A;  5GAN 5;  1JBM A;  3OYF A;  2OTL T;  2RK1 A;  2Y4X A;  5FU7 B;  2E5Q A;  2IVW A;  4C8Q B;  3OYJ A;  4XTZ A;  1VQP A;  4PJO F;  5IT9 E;  3MEU A;  4BI4 A;  3GLX A;  2VXF A;  3MEV A;  2F69 A;  2YRV A;  1M90 U;  2XDB A;  3E1S A;  1M1F A;  4M75 A;  3QJ6 A;  3RES A;  4N4H A;  2QQB A;  3MCA B;  3NTK A;  1M4Z A;  4LD6 A;  4YTL A;  3LGL A;  5IN1 A;  3OYD A;  2PQW A;  3JCM b;  4EDU A;  5KE2 A;  1VQ6 T;  1VIE A;  4JRI A;  4WF2 A;  5CAI A;  2KVQ G;  4XTW A;  2M16 A;  2F5T X;  4C0Z A;  4C5E A;  3CMA A;  2E70 A;  1Y96 B;  2IG0 A;  2PU9 B;  3DB3 A;  3CPW A;  1YI2 A;  2QA4 T;  2LQ8 A;  2LCL A;  3V8J A;  3M55 A;  2LDM A;  5D6Y A;  3T9N A;  1ZBX A;  4EMK A;  4ZN3 A;  3CCS A;  2XD0 A;  1X6O A;  3VUB A;  3GPL A;  4JRP A;  3WXM B;  3EFR A;  4M7D D;  5GAN e;  4OGE A;  3HSB A;  2EQK A;  4ELZ C;  3UPU A;  4B9W A;  3OYA A;  2RHU A;  2D6F A;  2JUF A;  4C5H A;  3G6E A;  5LJ3 e;  3DB4 A;  5CO7 A;  4ZGD B;  4A4K A;  2DK3 A;  2WSC E;  4M75 E;  2E64 A;  2LNV A;  1U8R A;  4M7A C;  3M58 A;  3MET A;  1JJ2 A;  4C92 E;  1Y07 A;  1XTD A;  3QJY A;  4X9D A;  2RJD A;  3HRU A;  1GXI E;  1KQS S;  3QPH A;  2LRQ A;  3E19 A;  2QTX A;  2EIF A;  4BDY A;  3HPW A;  2LT4 A;  3JB9 G;  1VQM T;  4ZGE B;  3MEA A;  5D6W A;  4IUU A;  3I55 A;  2E6N A;  1VQN A;  4XTX A;  5GAN g;  3CC4 T;  1RI0 A;  2VV5 A;  2QEX A;  2EQU A;  2JN0 A;  3JCM f;  1U1S A;  2EYQ A;  5GAM f;  1LOJ A;  1N6A A;  2YLB A;  1MHN A;  5LJ3 g;  3CCJ T;  4PJO A;  3X26 B;  1W2B S;  1X75 C;  3HHT B;  4DOV A;  4M75 G;  4M77 B;  1OZ2 A;  3QZ9 B;  2E41 A;  4NS5 A;  1VQO A;  3M4Y A;  2XU8 A;  1SSF A;  4FSX A;  3V8K A;  1YHQ T;  3QHS A;  5FU7 C;  3VU3 C;  2RHX A;  5KCO A;  3OYI A;  3BDU A;  2JZ2 A;  4FM4 B;  1G3W A;  4RMO A;  2FVU A;  3PFS A;  4BE0 A;  5DLQ E;  4QQ6 A;  4PLL A;  3JB9 H;  1NPP A;  3CXC A;  1YIT A;  4M7A D;  5GMK e;  2JVV A;  1N27 A;  4C0G A;  5LJ5 d;  4BDZ A;  3A8L B;  3OBY A;  5KH6 A;  5LJ5 h;  4QQD A;  2PVD B;  4KT0 E;  4JLG A;  3VKI A;  1Q7Y U;  3OYM A;  1YCY A;  1S72 A;  3M54 A;  2DXU A;  1WJS A;  4OGC A;  1HXD A;  3QXE B;  5A0D A;  3QG1 A;  4JDS A;  3CCM A;  3OQ5 A;  1VQ5 T;  1D3B B;  2DTH A;  1I8F A;  4N0A A;  2QQS A;  2XG8 D;  4F7U B;  1WQ7 A;  3CME T;  4A4H A;  2X4J A;  3L2V A;  2ZCF B;  1FXX A;  2X4W A;  4M78 F;  4XU2 A;  3L2R A;  1VQP T;  3TEE A;  3JB9 J;  4C92 F;  3CC4 A;  2QXF A;  1BIA A;  4UC4 A;  3OYH A;  4C8Q D;  2R5M A;  1I5L A;  4BB7 A;  3QII A;  3CCJ A;  2RI2 A;  3OYE A;  1VUB A;  2M1H A;  4C8Q F;  1O9S A;  3BY7 A;  4LDX A;  1BIB A;  1UGQ B;  2HQX A;  3OBW A;  4PJO G;  2OTJ T;  4A53 A;  2MF2 A;  2RJE A;  2K4Y A;  4IUR A;  4M7D E;  3G4S T;  1R8O B;  1KC8 C;  4X34 A;  5CVI A;  5GAN 7;  2QI2 A;  3CC7 T;  3CCL T;  1Y71 A;  2DO3 A;  3QYH B;  3CD6 A;  3QO3 A;  3OSS C;  3CCS T;  2BUD A;  2VGM A;  4B9X A;  3QUI A;  4C0F A;  2Y4Y A;  2DXB A;  1QVF S;  4M77 C;  2KY9 A;  2DTO A;  4ZN1 A;  1KC8 U;  3OYY A;  4HA8 A;  1NJI C;  3HRT A;  3G6E T;  2ZZD A;  5GAO n;  4QVD A;  3JRZ A;  2V8K A;  1IRE B;  3J7A F;  2E1H A;  2P0K A;  2K5I A;  1K73 C;  2LQK A;  1N9S A;  2EFI A;  3QDR B;  5FLX E;  4E7I A;  2XDP A;  1M90 C;  1KQS A;  4DOW A;  3JCM d;  1NJI U;  2VUB A;  5GAM d;  3DLL A;  1OYX A;  4E7H A;  3JCM h;  5GAM h;  3OS5 A;  2NLU A;  3OA6 A;  2E6Z A;  3I55 T;  1YJN A;  1K73 U;  1V29 B;  3SFM A;  1ZQ1 A;  3C94 A;  4II1 A;  1VQN T;  3OS0 A;  2QEX T;  4J5Y A;  3M57 A;  4M78 A;  1M1G A;  4O6J A;  3CC2 A;  5GAN 2;  3VV0 A;  3PTA A;  1W2B A;  4C92 A;  4MMK A;  4RG8 A;  2KQW A;  2CS7 A;  3X25 B;  4LDV A;  4V2S A;  1BYM A;  1VQO T;  4N4G A;  4C8Q A;  4M7A E;  3GF5 A;  3G4S A;  1TH7 A;  1QVP A;  4KUI A;  3VJP A;  5A0G A;  3VYG A;  3JCM c;  3M53 A;  5HK0 A;  4M77 D;  3OYB A;  1U1T A;  4XTY A;  5LJ5 e;  3CC7 A;  3CCL A;  3M56 A;  5IAY A;  1YJW T;  2RHI A;  5GAN 4;  5DM7 R;  1Q86 C;  3RUX A;  2RK2 A;  3SB2 A;  4Z02 A;  3OMG A;  5CCA A;  3M9Q A;  1B34 B;  3RKX A;  3ZEH A;  1N9R A;  1YIT T;  3CCU A;  3LYI A;  3BFM A;  3L2Z A;  1P92 A;  2DJZ A;  4MDW A;  3A8H B;  3JCM V;  5GMK m;  2CZ0 B;  4M7D F;  3KBG A;  3QKJ A;  4OMF B;  1Y96 A;  2R58 A;  5DY9 A;  1Q86 U;  2RB6 A;  3ER0 A;  4M78 E;  3OYK A;  3MP1 A;  3G71 A;  1S72 T;  1BI0 A;  4ATO A;  4MZP A;  5M9O A;  2E65 A;  4ELY C;  3E9G A;  4KUL A;  3WVE B;  4EPC A;  2M0O A;  5GAN 3;  3CCM T;  3OYG A;  3SWN C;  3LWH A;  4MZM A;  5LJ5 g;  2RA2 A;  4C8Q E;  4P5N A;  2LX9 A;  4FT2 A;  4E7J A;  4A4G A;  1X01 A;  1KD1 U;  4CRI A;  3FLG A;  2E10 A;  3RMQ A;  3R6O A;  5GAN j;  3ZBD A;  2L89 A;  5GAO m;  3DLM A;  2RI5 A;  3V7R A;  3LWI A;  1WJR A;  2EJF A;  2Y90 A;  4F7U F;  1I4K 1;  1YBY A;  3A8M B;  5CQY A;  5LJ3 j;  4M78 G;  1JRI A;  2O4X B;  5CK9 A;  1G5V A;  3CBM A;  4LDY A;  4C92 G;  2JTM A;  2D0Q B;  2I2L A;  4R56 A;  2XDD A;  3OYN A;  4BAC A;  1BKB A;  3MHX A;  5GMK l;  1YJW A;  3SD4 A;  3CD6 T;  4GLK A;  4IUT A;  4ME7 A;  2DXC A;  4PLI A;  5GAN 8;  3JCM J;  1Q7Y C;  1VQ8 A;  1VQ7 A;  1VIF A;  5KCH A;  5J39 A;  1QVF A;  2ZPH B;  3AHU A;  2EJ9 A;  5DLO A;  4M7A F;  2LCC A;  3L2W A;  4M75 C;  1G3T A;  3J80 E;  2YLC A;  4J7F A;  3SDZ A;  1O75 A;  2K3X A;  3EAE A;  3JCM e;  4M7D A;  4N4I A;  5GAM e;  3C95 A;  5GAO r;  1NZ9 A;  3QSU A;  3UWN A;  5I2M A;  1FWZ A;  1WQW A;  3LW5 E;  2MMP A;  4A54 A;  2C06 A;  3HL8 A;  2PVG B;  3CEY A;  3PIP A;  4FU6 A;  2JNG A;  3HFN A;  2PUK B;  5CR2 A;  4XTV A;  3LX7 A;  4Y28 E;  5A2Q E;  2YHT A;  4L59 A;  2QQA A;  3A8G B;  1Q81 U;  1KD1 C;  4EMK C;  2ZPB B;  1BI2 A;  4PNO A;  1YJN T;  3KXT A;  4JS4 A;  5CKF A;  5GMK j;  2WSE E;  3PT9 A;  4JJN K;  4BI8 B;  3CC2 T;  2EWN A;  1I81 A;  2HD0 A;  2K5L A;  5C0M A;  3MP8 A;  3GP8 A;  3O8V A;  3JB9 D;  2JOY A;  3C4S A;  2QDY B;  2GCX A;  3PMI A;  4M77 E;  5FU6 C;  3S3O A;  1XOV A;  5LL6 S;  2ZPF B;  1D3B A;  3JCM g;  4A4F A;  4HKE A;  2DIG A;  3E9F A;  2PVO B;  4D6W A;  5GAM g;  2DKG A;  2KDS A;  1NPR A;  3KUF A;  4IUQ A;  4J7I A;  1KHI A;  4MML A;  4F7U A;  2DZ9 A;  3Q1J A;  5CKD A;  2EQJ A;  4M75 D;  1G3Y A;  4XK8 E;  3P8H A;  5I2S A;  3CCQ A;  3CCE A;  2D9T A;  2HAX A;  4OF1 A;  4IUP A;  2RH2 A;  4R55 A;  3SWN B;  4MDX A;  2RJF A;  2FHD A;  2VYT A;  3CCU T;  1QP3 A;  1BI1 A;  4BE1 A;  5HY6 A;  4ZTF A;  1VQ4 T;  2L8D A;  4Q5W A;  3OSV A;  1OI1 A;  4PJO C;  1K8A C;  3WVD B;  3RIR A;  1W4S A;  4M7A A;  2QQ9 A;  3VYH B;  3G71 T;  5EG2 A;  5GMK i;  4GY5 A;  2DIQ A;  4J8O A;  3S3N A;  3I56 A;  3CCR A;  1VQK A;  3RER A;  4HCB A;  4M7D G;  3HRS A;  5GMK h;  1K9M U;  4HCZ A;  1M9S A;  3UT1 A;  2L5Q A;  1QP2 A;  2F5K A;  4RCC A;  4F7U E;  1K8A U;  5FRN A;  3UDC A;  5C6S A;  3GIB A;  4E7K A;  1KHC A;  1N8R C;  2XHC A;  3LGF A;  2FB7 A;  4Y91 A;  1WJQ A;  3OW2 S;  3CBO A;  4EMG A;  2L3R A;  2QQR A;  4DA4 A;  1M8V A;  3A8O B;  4XAX B;  2VGN A;  3GNG A;  4CI0 C;  2ZGW A;  2CGH A;  3TRE A;  3P8B B;  4ZTJ A;  2DZC A;  2XI9 A;  4BY6 C;  3X20 B;  1BI3 A;  1YJ9 T;  1ZHI A;  1N8R U;  1H3Z A;  3PGG A;  4M75 B;  3PMT A;  2GFA A;  3FJP A;  1PSE A;  2AHJ B;  4C92 B;  1UEB A;  2DPP B;  4F7U G;  5GAN f;  3RKW A;  5L8R E;  3NTH A;  4N0A C;  2DVE A;  2P0P A;  3GOX A;  3A5Z B;  4M77 F;  3CPF A;  4PJO D;  1VQ8 T;  3OB9 A;  4FIB A;  5LJ3 f;  4EMH A;  2K2V A;  3L2Q A;  1VQ7 T;  3S6W A;  2G3R A;  3X28 B;  2MWO A;  3FDR A;  3ASK A;  1VQ4 A;  1AHJ B;  3OMC A;  2BIV A;  4EMK B;  1UGP B;  3MEW A;  3CCV A;  2A7Y A;  2EQM A;  1HK9 A;  3NFC A;  2OAU A;  3TCJ A;  4DQ2 A;  1QVG S;  3S3M A;  2RHY A;  4PKC C;  3HFO A;  2CZ1 B;  4NOY A;  4OB2 B;  5FU6 B;  3EFS A;  1B34 A;  2XKO C;  5I21 A;  4M7A G;  5HK3 A;  2B8A A;  1VQ9 A;  1VQL A;  2MAM A;  2DD5 A;  5LJ5 j;  1NE8 A;  2DD4 A;  3MO8 A;  1YIJ A;  3LH0 A;  3M59 A;  2BKD N;  3DKM A;  4KBM B;  3C12 A;  4NL2 A;  4TVR A;  4BD3 A;  4RKU E;  5D6X A;  3CBP A;  1M1K C;  3J81 E;  5FRM A;  2X4Y A;  1KQ2 A;  1UGS B;  2RM4 A;  3G7Z A;  2K3Y A;  1LJO A;  3X24 B;  4XU0 A;  1RL2 A;  3BDL A;  1WGS A;  2CKK A;  1YJ9 A;  2XK0 A;  2XID A;  4BE2 A;  2KK4 A;  1KQ1 A;  4JUV A;  3OYL A;  4OVA A;  1M5Q 1;  2KAF A;  1M1K U;  4PJO B;  3FB9 A;  2O01 E;  2HQE A;  3TU4 K;  2VXE A;  3HKS A;  2LVM A;  4E7L A;  3N5B B;  4C8Q G;  3BW1 A;  3CCQ T;  2OTL A;  3FIF A;  3CCE T;  3QZ5 B;  3OYC A;  3MP6 A;  4XTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...