4J5YA

Crystal structure of hfq from pseudomonas aeruginosa in complex with atp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
molecule keywords Protein hfq
total genus 14
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4j5yA00
4JLIA 2DXTA 2RD1A 3RKYA 5GAOm 3EFSA 3RESA 4HT9A 4V2SA 4EMKA 5GANj 1BIBA 3JCMh 5GAMh 1JRIA 4C92F 5LJ3g 1I4K1 3BFMA 4M77B 2DEQA 4RCBA 2JN0A 3JCMV 5GMKh 4M7DD 4EMHA 4M7DC 2EJ9A 4M7DA 3FB9A 2FYKA 2E64A 2ZGWA 4PJOD 1I5LA 5GAN2 4X9DA 3V8LA 4F7UA 5I21A 3JB9J 4PJOA 4M77F 5GAOq 3RUXA 4C8QD 3JB9F 4XTYA 2CGHA 3RKXA 5LJ5g 3M4GA 3FJPA 1WNLA 1KQ1A 3SWNC 1MGQA 5GMKe 5GMKi 4XTUA 1D3BB 3PGGA 4M77D 4Y91A 3JCMQ 4C92E 5GAN4 2VC8A 5GANe 5DY9A 3RIRA 4F7UF 1I81A 3HSBA 2FB7A 5GANg 5GAN5 4XQ3A 4M77A 4MMKA 4PNOA 3JB9H 3JCMf 2EAYA 1Y96A 5GAMf 3L1AA 3JB9G 2YLCA 3INZA 4PJOB 5GAMj 3QUIA 4C92D 4M77E 4M7AG 1WQWA 2E65A 4NOYA 5GAOr 4N0AA 5GAOp 4A53A 2VXEA 1N9SA 1U1TA 1B34B 2DVEA 2I2LA 2DTIA 4J6YA 4XU1A 4C92B 4F7UB 5GAOn 3FIFA 4X9CA 4M78B 3AHUA 1YCYA 2E41A 4JRKA 5LJ3e 5LJ5h 3V8JA 4M78G 5GAN7 4M78C 1LNXA 4RCCA 3V8KA 5GAN8 4M7AA 4F7UE 2DKGA 4PJOE 3JB9D 4QVDA 4M7DG 4QVCA 2EJGA 2HNIA 4A54A 4M7AC 4WF2A 5GAMe 3JCMe 4C8QA 5CAIA 3RERA 1X01A 4M7AD 4XTXA 1LJOA 5LJ5f 4M78F 4PJOC 4M7DE 1U1SA 5LJ3d 5LJ5d 4M75E 2QTXA 4M75B 2VXFA 4EMGA 3JCMP 1HK9A 4C8QE 5GANf 3JCMJ 3BW1A 4M75G 4C8QC 4M7AF 2E10A 4EMKC 2RA2A 4XTVA 1WQ7A 4XU3A 4NL3A 4DQ2A 2DTOA 4J5YA 2DZCA 1Y96B 3JCMW 5GMKl 1WPYA 1KQ2A 3SWNB 5LJ5e 4M78A 4J6XA 2YLBA 5GAN3 5LJ3j 3JCMg 5GAMg 4C92A 5LJ3h 3JCMd 3HFNA 3SB2A 5GAMd 1M5Q1 1M8VA 2K57A 4XU2A 4EMKB 4M78E 2EJFA 2DTHA 2YHTA 4JRIA 4N0AC 4NL2A 4MMLA 1B34A 1I8FA 4M75A 3VU3C 3V7CA 1HXDA 2Y90A 4XTZA 4C8QB 5GANd 3QO3A 1LOJA 3BDUA 4J6WA 4M75C 1N9RA 4C8QG 1JBMA 4F7UG 5GMKm 3GIBA 4M7DF 3L2ZA 4M7DB 4M75D 5GMKj 1BIAA 3QHSA 2DXUA 4M77G 4M7AE 5GAOl 3EFRA 4M7AB 4PJOF 3V7RA 4M77C 3JCMc 3HFOA 4OP0A 5GAN6 1D3BA 4M75F 5GANh 4HA8A 4M78D 2DJZA 4HT8A 3RKWA 4C8QF 4XTWA 2E1HA 2RB6A 3SWNA 3JCMX 1TH7A 3JB9I 4C92G 5LJ5j 2EWNA 3BY7A 3JCMb 1H641 4XU0A 4JUVA 4C92C 4PJOG 3QSUA 2RM4A 5LJ3f 2DZ9A 3V7SA
chains in the Genus database with same CATH superfamily
2RPNA 2RHZA 3ZFJA 4OMNA 4V2SA 5CKHA 4BI8B 2DL3A 1E6GA 3RNJA 3CCQQ 1BCOA 3VRZA 2KVQG 2FZGB 1RUWA 3OW2A 1OPLA 4M7DA 3FDRA 4C5IA 4X9DA 3V8LA 4F7UA 2AK5A 1HSQA 3I5SA 4C8QD 1YBYA 2JTFA 4GLMA 5GMKe 1KQ1A 3SWNC 4XTUA 1VQPT 2LTOA 1VA7A 2E4HA 2E70A 3CCEQ 3JB9G 5CQYA 1VQ6T 2RHIA 2XK0A 3HPWA 1YHQT 2HL3A 1XNIA 2DTIA 4DBQA 5HK3A 2KROA 1BYMA 2QG9B 4O6JA 1XOVA 4KUDK 4X1VA 4M7AA 4RTXA 4M7DG 3GLXA 2BZ8A 1WJRA 4XTXA 2DD5A 4AG2C 5LJ3d 1NJIC 4M75E 4J9BA 3PIPA 2LT4A 1NEBA 2W0ZA 2E10A 2JOYA 3OYMA 1UJYA 5GMKl 1SEMA 3G1JA 1NPPA 3M0QA 2AKLA 1SHGA 2PTKA 3GP8A 4OF1A 4BY6B 2NLUA 2C0OA 2LQKA 2BTTA 4M77G 2EYYA 4HVVA 3CXCS 5GANh 1VQNQ 1TH7A 3OYFA 2F2VA 4CC2A 4FYYB 5LJ3f 1K73U 1WJQA 2BUDA 2HMAA 1KQSS 1CKBA 1X6GA 1AWWA 3L2VA 2IG0A 3GPLA 3NTHA 3MKDA 4FSSA 4JLGA 2X35A 2F69A 4AT1B 2CP2A 5CKEA 3VUBA 5KE2A 2COZA 3CC2Q 2OTJT 3VJPA 3FJPA 1NEGA 4E47A 5GAN4 1XJWB 5KYWA 1WZOA 2GF7A 1VQ4A 3JCMf 2CP3A 1KD1U 1K8AU 4JJCA 4DA4A 5IHKA 2EKOA 2I2LA 5EC7A 1G3WA 3V8JA 2EYXA 2XICA 1T3SA 3RR6A 4F04B 3VS3A 3CMAT 4LD9K 3L2WA 3OBWA 2RQUA 3HP9A 1VQ6Q 1U06A 1VQOT 4KGVB 2R57A 1RACB 1M30A 4XTVA 1WQ7A 3G71A 1WPYA 1OPKA 2C0TA 1Q81C 2LCCA 3LLRA 2DX1A 2KSSA 1RABB 3HKSA 2O4XB 5IXBA 1D1CA 5GMKj 4II1A 1BIAA 4BDZA 2J05A 2F5TX 5GAOl 1ZUYA 2XG8D 2DBKA 1SRMA 4RKUE 1FYNA 2A3LA 2GGRA 2P84A 3H0HA 1ABQA 1VQ7Q 2QK0A 2JMAA 2W10A 1K9MR 1BI3A 1G3SA 2RQTA 1OZ3A 5GAMh 4ELZC 4ZN3A 1MNEA 2KT1A 2VB6A 4IUUA 2KNBB 3QZ9B 2PUOB 1D0XA 4FM4B 2NUPB 2PVDB 2DIGA 4GLKA 4D6WA 4E7LA 2OTJQ 4Q5WA 4RTTA 2Y4XA 1YIJQ 3META 2Y4YA 2EQUA 3E1SA 3UATA 2HQEA 3OYGA 4KRTA 5DY9A 3MHXA 3C94A 2ED1A 2LP5A 1I81A 2IPOB 2ESWA 2GNCA 4LDXA 1RL2A 2M0OA 3I56A 1V1CA 2HKQB 5GAMj 3QUIA 1I1JA 1WHKA 1I5OB 3HRSA 1T0HA 3CC2T 5IH2A 3AHUA 2YRCA 1JXMA 1K8AR 2I0NA 3PFSA 4QVDA 2E5KA 4AFQC 1LJOA 1UGQB 4M78F 4DOVA 5LJ5d 2PZ1A 1QW1A 4UC4A 1MHNA 2VXFA 4M75G 1VIEA 2QQ9A 4Z89A 2JTEA 2RA2A 4IIOA 4DQ2A 5IXFA 5M9OA 5LJ3j 1D0ZA 5CO7A 4DOWA 1OULA 1WHGA 4FT2A 3BDUA 3C0CA 3NFCA 3CCQT 3EG0A 2A28A 3A5ZB 4PJOF 2KR3A 4M77C 3X26B 1Y7XA 2M02A 3ZEHA 1OQKA 4ATOA 2RB6A 4OB1B 2DL5A 1UGRB 1AT1B 3JB9I 4CRIA 1Y07A 4C92C 3MEWA 2FRYA 1TUCA 1BIBA 1EFNA 3BFMA 5I22A 1VOMA 3EG9B 4L59A 5GJWB 2XMFA 3OYLA 1ACMB 2FYKA 2YWWA 1I5LA 1BI1A 1O75A 2DIQA 2ROLA 4TVRA 3E19A 3OY9A 2CT4A 4DEXA 1SKUB 2CKKA 3PGGA 3CD6Q 1M1FA 3P8DA 1OEBA 1NLOC 3VS5A 1K1ZA 1Y96A 1OOTA 2PVOB 2ZZDA 4R55A 2BE7D 3REAB 5HK0A 1R77A 2RK1A 2P0PA 5CKBA 3M58A 4FIBA 2VUBA 2QQRA 3I55T 1SSHA 3OSVA 3OS0A 2FPFA 4J8OA 2NUTA 2IIMA 4WF2A 1JXOA 3UPUA 3UA6A 1Q81R 3JCMP 2JUFA 2O9SA 4GY5A 1EZZB 4JDSA 2OX7A 1AD5A 2K3XA 5KCOA 2CSIA 1QCOA 3PVQA 4FU6A 2D0NA 2DBMA 2CYZB 2KRMA 3P8HA 3KXTA 4XTZA 1QVFA 3NGPA 2EQKA 1K0SA 1SPKA 3WVDB 4M7AB 3CCVT 3X20B 3HFOA 2G3RA 1VIFA 4HVWA 4QVZA 1Q86C 3CBMA 1AVZC 5LJ5j 3M0PA 2EW3A 3JCMb 2QA4T 2JMCA 3OA6A 2XIDA 5GAOm 5FROA 2O9VA 2KE9A 1RI0A 3DLMA 1ZSGA 2RQVA 1D1AA 2XU8A 1UJ0A 4WCIA 2RK2A 3M4YA 2YUOA 1VQ8Q 3E2UA 3MP8A 2GQIA 2DO3A 5AYFA 3REBB 1YITT 3PMIA 2LNHB 4IUTA 3RDVA 4JRPA 3VS4A 1GRIA 1S72T 3M55A 2HSEB 4JRQA 2J6KA 1R0CB 1PKSA 4E7KA 2LJ0A 1WQWA 2ROTA 2V8JA 2RH2A 4LDVA 2AIRB 1J3TA 2NWMA 1S72A 1TG0A 4XAXB 4M78C 2H3EB 4R56A 2K79A 2SRCA 1NZ9A 3SD4A 1SRLA 2JW4A 1Q82R 2EJGA 2KRSA 1IZ6A 4C8QA 3BE3A 2FVUA 5FWCA 4PJOC 4F16A 1NYGA 1KC8U 2XHCA 4A4GA 3JCMJ 2RF0A 3G7ZA 3MP1A 1NE8A 1ZQ1A 2CT3A 1M1KC 3OMGA 2GQVA 3HFNA 1QLYA 1BCMA 1YWPA 1YJWT 1B34A 2GTJA 2CUBA 2E3HA 2DXUA 3EGDB 3V7RA 5A0GA 5IHNA 1YJNT 2V1RA 2QQBA 2O88A 3NPFA 4C0GA 2X4WA 2HL5C 5CCAA 2EWNA 2K6DA 2VKNA 2P4RA 2RD1A 1YJ9A 4EMKA 4C92F 3OS1A 3H6ZA 2DE0X 4BACA 1N8RC 2M16A 2KGTA 3JCMV 3EH2A 2H3JA 1M2OA 3NMZC 3OYDA 1WHHA 3VS1A 4BB7A 4RTUA 3L2UA 1PHTA 4J9HA 2RI2A 3A8MB 4O5VA 2DXCA 1MMGA 1YJ9T 3QDRB 3F70A 4IUQA 4JJDA 3CCLQ 3G6EA 3CC7Q 1VYUA 1PCXA 2NUPA 1VQ9Q 4AFUC 1MGQA 1GL5A 4Y91A 1MUZA 4BE1A 1QQJA 1X2KA 3ASKA 3RIRA 2A37A 2FB7A 2L3QA 4M77A 4PNOA 5D6WA 2MI6A 3FEOA 4HXJA 1OYXA 2MWOA 4J9FA 2AHJB 4M77E 4ZTJA 4PLIA 1SF9A 4JS5A 5L8RE 1AZGB 1C0MA 2E5QA 1N9SA 1PRMC 1B34B 1E6HA 1U1TA 2O01E 1VQ6A 3PMTA 3MJXA 1RI9A 2YSQA 4PJNA 3VS0A 3BDLA 2COWA 6AT1B 2DKGA 3JB9D 1BB9A 2EFIA 2KY9A 2B8AA 3JV3A 5FW9A 4FYXB 4DBHA 1OX8A 1UECA 4OMLA 2CZ1B 1ZUUA 2MAMA 3TQ7P 1S1NA 1WX6A 2JVVA 3FLGA 2V26A 3T9NA 4NL3A 4J5YA 3UF4A 2RJCA 3CBPA 1VUBA 2D0QB 3UWNA 1E7OA 5IHIA 1YJWQ 1KD1R 3FRNA 4B9WA 3OYEA 4XU2A 4C5HA 8AT1B 4JRIA 4N0AC 2HAXA 3MPUB 3QO3A 4J6WA 4ZTFA 2DVJA 2EPDA 2JXBA 4PFPA 2PVGB 1YIJT 3EG9A 1IRXA 4FYWB 4PJJA 5KYXB 3CD6A 2DA9A 2V8IA 4N4HA 2JTMA 3CXCA 2YT6A 2ZPFB 3OYKA 3BY7A 2L3SA 2DILA 4PJOG 3QSUA 5GANf 1KD1C 4PK4A 1P92A 1VQLT 3EFSA 3OS2A 3KBGA 5DLOA 2L3PA 1I0CA 1I4K1 1WGSA 1IREB 1HJDA 3S3MA 1PWTA 2HCKA 2YRVA 1CSKA 1G5VA 3QPHA 2KRNA 2P4TA 5IT9E 1Y71A 3CCET 3RMSA 3JB9J 3RUXA 4XTYA 5LJ5g 3RKXA 1YCSB 3PTAA 4OMMA 5D7UA 3CCMA 3CCLA 5DM7R 1RADB 2QGGA 1M3CA 2RO0A 2QASA 4JPBW 2QEXA 2F2XA 1X75C 2CREA 4A53A 3QIIA 2KDSA 5IN1A 2DVEA 1YJWA 1PG5B 2RHYA 1U8RA 1KC8R 2K5FA 5LJ5h 1WHLA 4M78G 1RAIB 4E7JA 1LNXA 2ED0A 1UB4A 2RJEA 2RMOA 4LDUA 4M7AD 2VGNA 4EMGA 1VQ5A 2C06A 3N5BB 2QYZA 1TU0B 1KK7A 2EYWA 1Y96B 1ZSZA 2DXBA 2HKNA 1M90U 1WI7A 3I5RA 1CKAA 2YLBA 5KCHA 1VQMT 1YI2Q 2KI7A 2LVMA 5FU7B 4NL2A 2K3YA 1I8FA 4C8QB 1QVPA 2H8HA 1UHCA 3MEUA 4AFZC 4M7DF 2GFAA 3EFRA 1D3BA 4MZTA 3G6ET 3CC7A 5A0LA 2J7IA 1TWBA 3OQ5A 1VQ9A 1AZEA 2KEAA 1QCFA 1H641 4JUVA 3LYIA 1K0XA 1HD3A 3ER0A 3URGA 1M3BA 2GTOA 4PJLA 1S72Q 1VQKA 3OYNA 2DYBA 3JRZA 4VUBA 1PNJA 3JSCA 2M9UA 3OW2P 5HKCA 3CCSA 4FW2A 4BD3A 5CIUA 4FW1A 4HKEA 2NUTB 1TXQA 3EHRA 3M57A 3DB3A 3JCMQ 2VC8A 3L2QA 1ZSZB 3HSBA 2ZCFB 2V8KA 4MMKA 4OMPA 2JM8A 4JJBA 4C92D 1C1AA 1M1KR 5GAOp 1VYTA 2K3BA 5CR2A 3NTIA 4IURA 1RAGB 2JS0A 1FMWA 3VS6A 3KFVA 5GAN8 1XTDA 3M9QA 5CKDA 4PJOE 4DBRA 1H8KA 3RERA 1QKWA 4D8DA 2QTVA 4J9DA 2ENMA 4YTLA 4B9XA 1K9MU 2YUPA 1GCQA 2R5MA 1KQ2A 5LJ5e 3O5ZA 2K9GA 2VVKA 3JCMg 1WLPB 2MWPA 4M4ZA 2E3IA 2E6NA 2JM9A 2EJFA 4MMLA 4OMQA 3CPWP 4C0DB 4C8QG 3S3OA 1AWXA 1Q82C 2AT1B 2FL7A 1VQ7T 4ME7A 1EIFA 3CQTA 1NJIU 1VQPQ 2MIOA 3VS2A 4RMOA 3CCSQ 1KQSP 1YHQA 2O31A 1SSFA 4HVUA 3CPWS 3RBBB 2DMOA 4RTVA 4JJNK 5LJ3g 5I2MA 2X4JA 1AOJA 2EQMA 2JN0A 2V1QA 2DL8A 4KGZB 2FPEA 4M7DD 1UHFA 4J9IA 3OSSC 1PSEA 3FB9A 2E64A 1YNZA 2VGMA 1M2VA 3OMCA 4AMCA 4IIMA 5KYUB 2C0IA 4J9CA 2GBQA 1M27C 2RI3A 1N27A 2XDPA 3E9GA 2LCSA 4MZMA 5GAMf 4JZ3A 2B86A 2ECZA 2LNVA 1K73R 1VQOQ 1IXDA 1EX4A 3X28B 4CI0C 4N0AA 2L5QA 3MEAA 2AZVA 4IUVA 3A8OB 1X6BA 3LH0A 4OVAA 4XU1A 4F7UB 1G3TA 2CH4W 2ZPGB 4J9GA 4JRKA 1M9SA 1SHFA 3LW5E 2DNUA 1ZBJA 3V8KA 3MO8A 2LCLA 5GAMe 4FCYA 1X01A 3PE0A 4M7DE 3S6WA 3E9FA 3CMAQ 3Q1JA 5GJVB 3EG2A 1K9AA 1BBZA 3M56A 4RTYA 1NJIR 1Q82U 1M1GA 3OYHA 4RG8A 4ORZA 1FMKA 1QMCA 1W2BA 4EMKB 1VQKQ 1KHIA 5EG2A 1FXXA 4BI4A 3VV0A 4F7UG 3HRUA 5FRMA 4M7DB 3CCEA 2LJ1A 3CBOA 2GFUA 4M7AE 1QVGP 2P0QA 3EFOA 3M5AA 4M78D 3RKWA 2MMPA 4C92G 5J3BA 4A4HA 3GNFB 3V7SA 4JLIA 2D8JA 3RKYA 2X3XD 3OYBA 5FWBA 2VWFA 4EDUA 5FRNA 2FEIA 4QQ6A 5GMKh 5FLXE 1TSFA 1PC0A 4QQDA 2JS2A 4PJOD 3OS5A 2VV5A 2DETA 4PJOA 2EYQA 4NS5A 3KUFA 1ARKA 4QQGA 1MV3A 3NTKA 1WFWA 4F7UF 1KSWA 3CCUQ 1M90R 1B3QA 1R0BG 3L1AA 4LUDA 2EQJA 3INZA 1F1BB 4KH1B 3M0SA 3QBYA 4K11A 1JO8A 3M59A 2EGCA 4LUEA 2HBWA 1WXUA 2BE9B 3IQLA 2HEQA 1AEYA 1QWEA 5I11A 1PD1A 1JJ2S 3WXMB 2WSFE 3A8HB 1VQ7A 1BI2A 1HYOA 1W2BS 2BZXA 4Y28E 3EGXB 2DM1A 5J39A 4EMKC 1K73C 3H0IA 2VASA 1VQKT 5KYNA 5LJ3h 4ZGDB 5D6YA 4KULA 3OBYA 2RHXA 1VQMQ 4CC4B 4JS4A 3MEVA 1KHCA 5FU6C 1JBMA 5ECAA 2QQSA 1VQ5Q 2XKOC 4CC7A 3I56Q 4LE9A 2MF2A 1PM3A 7AT1B 4M75F 1IHWA 4XTWA 3EGXA 1AHJB 2FRWA 3I9QA 3PVLA 3CMET 3S3NA 1VQ8T 2CP6A 1YIJA 2K57A 3GIBA 5GANj 1WDXA 2KAFA 2LX7A 3PT9A 2IVWA 4M7DC 2NYSA 1VQ8A 1ZUKA 2HBPA 2KK4A 1OZ2A 4BI3A 5GAN2 3G4SQ 4KUIA 1W2BP 4X34A 2ZPIB 2OAUA 1NYFA 1UTIA 3NHNA 3X24B 5GANg 1JU5C 2F2WA 1YITQ 3CCQA 3C4SA 5GAOr 1MMDA 1N8RU 2CZ0B 5GAOn 4J6YA 4FYVB 2KYBA 4KT0E 4B6MA 5LJ3e 3UA7A 1X6OA 5KYUA 1BKBA 2L2PA 1X43A 3DB4A 5IAYA 4RTWA 2HNIA 3CCUT 2BKDN 2QA4A 1GCPA 1WHJA 2RI5A 4D8KA 3G6EQ 3CMAA 2OTLT 4M75B 2HZYA 4C0DC 1SG5A 3TVTA 3ZL7C 4C8QE 2D6FA 2K2MA 1RAEB 3VYHB 2G6FX 2EQIA 4Z02A 1TTHB 1GBQA 2EVRA 1G8XA 1NM7A 1PRLC 3EH1A 4A4KA 3TU4K 1YJNQ 3EG3A 1ZLMA 3EHQA 4PLLA 5CKFA 1PD0A 2DPPB 1VQ5T 3CCMQ 1HXDA 2Y90A 2COYA 4M75C 3I56T 4ELYC 4M75D 4ANJA 3LH5A 2XD0A 1RLQC 1T0JA 3JCMc 2RNAA 2LT1A 5GAN6 4HT8A 2QDLA 2DF6A 1FWZA 1N8RR 3EG1A 4BE0A 2ZPHB 2CUDA 1OX9A 2DZ9A 2MPXC 3EAEA 1O9SA 5L23A 4E7HA 4XK8E 4HCBA 3I55A 2DAQA 4F17A 1UGPB 3JCMh 3M0RA 2DEQA 5CQXA 3G71T 2DYIA 3EFOB 3X25B 1ZSZC 1U5SA 2LDMA 5DLQE 1FMVA 4HCZA 3I55Q 4HCKA 1YITA 3QXEB 2DK3A 4F14A 4BUGA 3EGUA 3JB9F 3D7SB 4GBQA 4J7FA 4PL6A 3CCRQ 2K2VA 3VUZA 1N5ZA 3A98A 2DFUA 1N6AA 1PSFA 2ZPBB 3CEYA 3JB9H 2K7AA 2X4YA 3MCAB 2FZCB 1YN8A 2X51A 4PJOB 1Q86R 2PUKB 1TUDA 4NOYA 1JQQA 1B7TA 4M78B 1YCYA 2JZ2A 2E41A 2KQWA 5KYWB 1YJNA 1YHQQ 2R5AA 4EIKA 4F7UE 5A0DA 3JAME 1UUEA 2ATCB 4L5GA 5LJ5f 2LC4A 4R0KA 2CP0A 2QTXA 5FU6B 3M0UA 1HK9A 2O2OA 1Q7YC 3BW1A 4C8QC 2QA4Q 2CDTA 5FU7C 2DTOA 3JCMW 3QJYA 4C92A 5KYYB 5GAMd 3ME9A 3UT1A 2FPDA 1GXIE 4BDYA 2PU9B 2OAWA 5GANd 2P0KA 3DKMA 1JJ2A 3J81E 3TSZA 4MZPA 3CXCP 1G83A 1ABOA 2CSQA 2FO0A 4HA8A 1YP5A 1TS9A 2PNIA 3SWNA 1LCKA 1Q7YR 1RLPC 2DRMA 5J26A 2HDAA 2NUZA 4C0FA 2BIVA 1M90C 3PNWC 4CC3A 1NPRA 1K8AC 2EKHA 4HT9A 1QKXA 1RAAB 2DEUA 2YRDA 5C6SA 1TOVA 4RCBA 4OMOA 2K5IA 2QAZA 2OTJA 1VQPA 1NBEB 2EJ9A 3CC4T 1U3OA 4OB2B 4DEYA 4M77F 1H3HA 1Y57A 3CCUA 1JEGA 3P8BB 2D8HA 3QJ6A 2EGAA 2VYTA 2LRQA 4QKUA 3FC3A 2ABLA 3H8ZA 1Q95G 1IB8A 2KYMA 1NLPC 1WXBA 3CCJA 2YLCA 1VYVA 2E12A 1UEBA 2CZ7B 2CS7A 3GNGA 2WSCE 4X9CA 2EBPA 1Q7YU 3CCRT 1K9MC 4RCCA 4WTOB 2LJ3A 3LX7A 4LNPA 1VQOA 4E7ZA 2O4XA 4QVCA 1Z9ZA 5CAIA 2MOXA 2K5LA 3CMEA 3QG1A 2QQAA 4M7AF 4BE2A 1H3ZA 3CCRA 2OI3A 2HQXA 4OMFB 4E7SA 5GAN3 1UDLA 4J6XA 2RHUA 5GAMg 3CPFA 3JCMd 2KT8A 1M8VA 4N4IA 3M54A 1WXTA 2GCXA 5I21A 4M75A 1WIEA 1ZA1B 2DRKA 4HCCA 1LOJA 4KBMB 1RAHB 3R6NA 2RJFA 3RMQA 4PKCC 3CCJQ 2M51A 3G4SA 2CH4A 2JT4A 3SHWA 3VRYA 4PFOA 4OP0A 2QGFB 3C12A 3CCLT 2DJZA 3QZ5B 4FSXA 2DJQA 3VKIA 2YDLA 2MK5A 4QT7A 2KBTA 2L3RA 3I35A 1QCNA 4IUPA 2HQHA 4Y92A 2QEXT 2FHDA 2L0AA 2RM4A 3M0TA 1UFFA 1V29B 4M77B 3OYJA 3CCVQ 1UG1A 3AT1B 2LQNA 1NG2A 5AT1B 3FJ5A 3LWHA 3R6OA 3O8VA 1WJSA 1OU9A 1K76A 4Z8AA 3A8LB 2CGHA 4PFZA 4QW2A 2OTLA 2FG0A 1WNLA 3QYHB 5GMKi 1JJ2P 4C92E 3QWYA 5I2SA 3QDFA 3TCJA 1M4ZA 1T3LA 1VQMA 2CP5A 4XQ3A 2XI9A 3OYCA 3CC2A 5HY6A 1X27A 8ATCB 5A2QE 4MDXA 4M7AG 4OGCA 2LZ6B 4N4GA 2VXEA 2X3WD 3FIFA 3TSWA 3QWXX 1UE9A 1W6XA 2M0YA 2LQ8A 1Z9QA 2CP7A 5CVIA 2LMJA 4A54A 3JCMe 1KQSA 1VQLA 1ZA2B 2RN8A 1U1SA 1QWFA 4MDWA 5KE3A 2YUNA 2X9HA 4KH0B 3H0FA 2D9TA 2MCNA 1IHVA 3L42A 5KYXA 3GBQA 4XU3A 4LDYA 1A0NB 4OB3B 3HL8A 4ZN1A 4J7IA 2AKKA 1QVFS 2DTHA 1OV3A 2J6OA 3VU3C 1QVGA 1ZX6A 3V7CA 5KH6A 3CCST 4A63B 3L2ZA 3HRTA 1QVFP 1Q86U 3CC4A 4LXCA 2RQWA 3J80E 1UGVA 3TEEA 1KIKA 2DL4A 2YUQA 4C8QF 2QEXQ 1C6VX 3JCMX 1DJ7B 3VS7A 3LWIA 1QP3A 4XU0A 1Q81U 1I07A 1IGQA 1IGUA 2DXTA 4AG1C 2FZKB 1D0YA 1JRIA 4A4FA 5D6XA 3DLLA 1W4SA 4EMHA 3H9NA 3G71Q 2X4XA 1UGSB 2L8DA 1OU8A 1GBRA 1GFCA 1YWOA 1YFNA 2WACA 4EPCA 2OJ2A 2A0FB 2DLPA 2K4YA 1QP2A 5GAOq 3PIOA 1LVKA 1D3BB 3CPWA 2Z0WA 4C5GA 3CMEQ 4ZNXA 5GAN5 3CC4Q 4C5EA 1X2QA 3HHTB 1QVGS 3GOXA 1WHMA 1H92A 2A36A 1KC8C 4FL6A 2BZYA 2E65A 2E6ZA 4KGXB 3A1PA 4FT4A 2R58A 1TUGB 1BI0A 2EYZA 2QI2A 1B07A 3CC7T 5GAN7 2EIFA 2LQWA 3OB9A 3OYIA 1KJWA 4LN2A 3G4ST 4M7AC 3TREA 4RG2A 4L6V5 2QXFA 2JNGA 1JB0E 5C0MA 4E7IA 1IO6A 1M8MA 1V76A 1D1BA 2ZPEB 2DZCA 3EGDA 2RQRA 2PQWA 3HTRA 9ATCB 3SB2A 1WYXA 2JJ9A 2YHTA 3QKJA 2XDDA 3M53A 2DL7A 2SEMA 4P5NA 1MMNA 3QHSA 4JZ4A 2CZ6B 4ESRA 3L2RA 1WA7A 1Y0MA 1ZBXA 1VQNA 2YXYA 2E1HA 2A7YA 3A8GB 4OB0B 1M1KU 3SEMA 2OTLQ 3CD6T 2QDYB 2DD4A 2F5KA 2RJDA 3GF5A 3ULRB 3CCJT 1MV0B 2XDBA 3OW2S 4PJMA 3RESA 1G2BA 1YJ9Q 5KYYA 1VQNT 2WSEE 3J7AF 1ZHIA 4BY6C 4RTZA 1OI1A 2ZGWA 2KXCA 3THKA 4A4EA 3M4GA 3ZBDA 3VYGA 4IKFA 1AWOA 4M77D 5GANe 3H41A 2AZSA 2D1XA 1LPLA 2EAYA 1AWJA 1K4US 2A08A 4RUGA 1MMAA 1VQ9T 1G3YA 1R8OB 4C92B 1W1FA 4OGEA 2ZAEA 4C0ZA 2F1LA 2M1HA 4ZGJB 1YI2A 3SDZA 1GCQC 1GFDA 1W70A 3LGFA 3SFMA 1M2VB 1XQHA 3OYAA 2DERA 4LD6A 3UDCA 4Z88A 2LX9A 4ZGEB 1VQ4T 2L89A 4DBFA 1YI2T 3U23A 3LGLA 3SWNB 4M78A 1D09B 2HSPA 3CCMT 3CCVA 1X69A 5LL6S 2MYSA 2J06A 1M5Q1 4M78E 1M3AA 4J83A 1RAFB 1FX7A 1MNDA 1N9RA 5GMKm 4AFSC 2EGEA 3WVEB 3OYYA 5CK9A 4E6RA 1KG1A 1PKTA 1VQLQ 2J6FA 1KFZA 2KMTA 3C95A 5HCKA 2HD0A 1BK2A 2KXDA 3MP6A 4J9EA 4E2FB 1VQ4Q 1BU1A 3QYGB 4LDWA
chains in the Genus database with same CATH topology
2XIDA 4C0FA 2RHZA 2BIVA 3ZFJA 5FROA 5GAOm 3PNWC 1K8AC 1NPRA 1M90C 4V2SA 4HT9A 5CKHA 1RI0A 3DLMA 4BI8B 4JJNK 5LJ3g 5I2MA 2X4JA 5C6SA 2KVQG 2XU8A 2EQMA 2JN0A 4RCBA 2RK2A 3OW2A 3M4YA 2K5IA 4M7DD 2OTJA 3OSSC 3MP8A 1VQPA 2EJ9A 4M7DA 1PSEA 3FB9A 3FDRA 3CC4T 2E64A 4OB2B 4C5IA 2DO3A 5AYFA 4X9DA 3V8LA 4F7UA 4M77F 2VGMA 4C8QD 1YITT 1YBYA 3OMCA 3PMIA 2JTFA 3CCUA 5GMKe 1KQ1A 3P8BB 4IUTA 3SWNC 3QJ6A 4XTUA 4JRPA 1VQPT 2LTOA 2VYTA 2LRQA 1S72T 2RI3A 3FC3A 1N27A 2XDPA 3E9GA 3H8ZA 4MZMA 3M55A 2E70A 5GAMf 3JB9G 4JRQA 3CCJA 4E7KA 2YLCA 2LNVA 5CQYA 1VQ6T 1WQWA 2E12A 2V8JA 3X28B 4CI0C 1UEBA 4N0AA 2CZ7B 2L5QA 3MEAA 2RHIA 2CS7A 2RH2A 2XK0A 3HPWA 4IUVA 3A8OB 3GNGA 3LH0A 4LDVA 4OVAA 4XU1A 1YHQT 1XNIA 4F7UB 2DTIA 1G3TA 2WSCE 2ZPGB 4X9CA 5HK3A 1BYMA 4JRKA 1M9SA 1Q7YU 1S72A 3CCRT 4XAXB 4O6JA 1XOVA 4M78C 4R56A 3LW5E 1K9MC 4KUDK 4RCCA 3V8KA 3MO8A 4M7AA 3LX7A 1NZ9A 3SD4A 1VQOA 4M7DG 4QVCA 2O4XA 2EJGA 1IZ6A 2LCLA 5GAMe 4C8QA 5CAIA 1X01A 3GLXA 4XTXA 1WJRA 2DD5A 2FVUA 2K5LA 3S6WA 4M7DE 4PJOC 3E9FA 5LJ3d 1NJIC 4M75E 3CMEA 1KC8U 2XHCA 3Q1JA 4A4GA 3PIPA 3JCMJ 2LT4A 3QG1A 2QQAA 4M7AF 4BE2A 2E10A 3G7ZA 3M56A 3MP1A 1NE8A 1H3ZA 2JOYA 3CCRA 3OYMA 1ZQ1A 2HQXA 5GMKl 4OMFB 1M1KC 1Q82U 1M1GA 5GAN3 4J6XA 3OYHA 4RG8A 2RHUA 1NPPA 5GAMg 3CPFA 3OMGA 2GQVA 3JCMd 3HFNA 1M8VA 3GP8A 4N4IA 1W2BA 3M54A 4EMKB 1KHIA 4OF1A 2GCXA 5EG2A 5I21A 1YJWT 1B34A 4M75A 1FXXA 4HCCA 4BI4A 1LOJA 3VV0A 4F7UG 3HRUA 2NLUA 4KBMB 4BY6B 2LQKA 5FRMA 4M7DB 3CCEA 2RJFA 3RMQA 2DXUA 3CBOA 4PKCC 2GFUA 4M77G 4M7AE 3G4SA 3V7RA 5A0GA 2P0QA 3CXCS 1YJNT 4OP0A 5GANh 3C12A 2QQBA 3M5AA 4M78D 2DJZA 3QZ5B 3CCLT 4FSXA 3RKWA 3VKIA 4C0GA 2MMPA 2L3RA 1TH7A 2X4WA 4C92G 5CCAA 2EWNA 4IUPA 5J3BA 4A4HA 2FHDA 3OYFA 2QEXT 2RM4A 5LJ3f 1K73U 1WJQA 2BUDA 3GNFB 3V7SA 4JLIA 1KQSS 2RD1A 3RKYA 1YJ9A 3OYBA 4EDUA 5FRNA 4EMKA 4C92F 3OS1A 1V29B 3H6ZA 4M77B 3L2VA 4BACA 1N8RC 3OYJA 2M16A 2IG0A 4QQ6A 3JCMV 3GPLA 5GMKh 3NTHA 5FLXE 2H3JA 4JLGA 3OYDA 2X35A 2F69A 4QQDA 3LWHA 4BB7A 3L2UA 3R6OA 5CKEA 3O8VA 4PJOD 1WJSA 2RI2A 3OS5A 2VV5A 3A8MB 4O5VA 3VUBA 5KE2A 2DXCA 1YJ9T 4PJOA 2EYQA 3QDRB 3A8LB 2OTJT 3F70A 2CGHA 4IUQA 4QW2A 4NS5A 3G6EA 2OTLA 3KUFA 3VJPA 3FJPA 1WNLA 3QYHB 1MGQA 4E47A 4QQGA 5GMKi 4Y91A 5GAN4 4C92E 5I2SA 3NTKA 3TCJA 4BE1A 1M4ZA 1VQMA 3ASKA 3RIRA 2GF7A 4F7UF 2FB7A 1VQ4A 4XQ3A 4M77A 4PNOA 5D6WA 2MI6A 2XI9A 3JCMf 3FEOA 3OYCA 3L1AA 1KD1U 3CC2A 5HY6A 1K8AU 1OYXA 2MWOA 2EQJA 3INZA 2AHJB 5A2QE 4MDXA 4M77E 4DA4A 4M7AG 4OGCA 4PLIA 4ZTJA 3QBYA 4JS5A 5L8RE 2EKOA 2E5QA 4N4GA 2VXEA 3M59A 1N9SA 1U1TA 1B34B 2O01E 2I2LA 3FIFA 1VQ6A 1G3WA 3PMTA 3V8JA 2XICA 2LQ8A 3BDLA 1JJ2S 3WXMB 2WSFE 2DKGA 3JB9D 3A8HB 5CVIA 2EFIA 2KY9A 1BI2A 4A54A 1W2BS 1VQ7A 3CMAT 4LD9K 3JCMe 1KQSA 1VQLA 2B8AA 3L2WA 1U1SA 3OBWA 3HP9A 4MDWA 5KE3A 2CZ1B 2MAMA 4Y28E 1VQOT 2D9TA 5J39A 2R57A 3L42A 2JVVA 4EMKC 3FLGA 1WQ7A 4XTVA 4XU3A 3T9NA 4NL3A 1K73C 4J5YA 4LDYA 3G71A 2RJCA 1WPYA 3CBPA 1VUBA 2D0QB 4OB3B 3UWNA 3HL8A 1VQKT 4ZN1A 5LJ3h 4J7IA 4ZGDB 3FRNA 1Q81C 5D6YA 2LCCA 4KULA 3OBYA 4B9WA 4XU2A 4C5HA 3OYEA 1QVFS 4JRIA 2DTHA 3LLRA 4N0AC 2RHXA 2KSSA 3VU3C 2HAXA 1QVGA 4JS4A 3V7CA 3MEVA 3HKSA 3QO3A 4J6WA 1KHCA 2O4XB 5FU6C 5KH6A 1JBMA 3CCST 2QQSA 4ZTFA 3L2ZA 3HRTA 5GMKj 2XKOC 4II1A 1BIAA 2PVGB 4BDZA 1YIJT 1Q86U 2F5TX 3CC4A 5GAOl 2MF2A 2XG8D 3J80E 3TEEA 4M75F 4RKUE 3CD6A 2V8IA 4C8QF 2A3LA 4N4HA 4XTWA 2JTMA 3CXCA 1AHJB 3JCMX 1DJ7B 2ZPFB 3LWIA 3OYKA 3BY7A 3S3NA 1QP3A 4XU0A 3CMET 1Q81U 1VQ8T 4PJOG 1YIJA 3QSUA 2K57A 5GANf 3GIBA 1KD1C 2DXTA 1P92A 1VQLT 3EFSA 3OS2A 1BI3A 1G3SA 3KBGA 5DLOA 5GANj 1OZ3A 5GAMh 1JRIA 4A4FA 4ELZC 1I4K1 5D6XA 4ZN3A 1WGSA 1IREB 2KAFA 4IUUA 3DLLA 1W4SA 3QZ9B 4EMHA 3S3MA 2PUOB 4FM4B 2PVDB 3PT9A 2DIGA 2IVWA 2YRVA 4GLKA 4D6WA 2X4XA 1UGSB 4M7DC 4E7LA 2L8DA 4Q5WA 1VQ8A 2HBPA 2KK4A 1OZ2A 3QPHA 2P4TA 5IT9E 2Y4XA 1Y71A 3META 4BI3A 2Y4YA 2EQUA 5GAN2 3RMSA 3CCET 3JB9J 3E1SA 4KUIA 2WACA 3RUXA 4EPCA 4X34A 4XTYA 3RKXA 2K4YA 5LJ5g 2ZPIB 2HQEA 1QP2A 2OAUA 3OYGA 5GAOq 3PIOA 3PTAA 1D3BB 3CPWA 5DY9A 3MHXA 3X24B 3C94A 4C5GA 3CCMA 3CCLA 1I81A 5GANg 5GAN5 4C5EA 5DM7R 4LDXA 1RL2A 2M0OA 3HHTB 1QVGS 3GOXA 3I56A 2RO0A 1KC8C 5GAMj 3QUIA 4FL6A 2QEXA 3CCQA 3C4SA 2E65A 2E6ZA 5GAOr 1X75C 4FT4A 2R58A 3HRSA 3QIIA 4A53A 1BI0A 2CZ0B 1N8RU 2KDSA 5IN1A 2DVEA 4J6YA 5GAOn 3CC2T 2QI2A 3AHUA 1YJWA 2RHYA 1U8RA 4KT0E 2K5FA 5LJ3e 5LJ5h 3CC7T 4M78G 1X6OA 5GAN7 4E7JA 1BKBA 2EIFA 1LNXA 1G5VA 3OB9A 3DB4A 3OYIA 1UB4A 3PFSA 5IAYA 2RJEA 4QVDA 3G4ST 2HNIA 3CCUT 4M7AC 2BKDN 2QA4A 3TREA 4LDUA 4M7AD 2RI5A 1LJOA 1UGQB 2VGNA 4M78F 4RG2A 3CMAA 4DOVA 5LJ5d 2OTLT 1QW1A 2QXFA 4L6V5 2VXFA 1MHNA 4M75B 4UC4A 2JNGA 1JB0E 4C0DC 4C8QE 4EMGA 4M75G 1VIEA 2QQ9A 5C0MA 4E7IA 3N5BB 3VYHB 1VQ5A 2C06A 2RA2A 4DQ2A 2ZPEB 2DZCA 1Y96B 4Z02A 2DXBA 1M90U 5M9OA 2YLBA 5LJ3j 5KCHA 2PQWA 1VQMT 4A4KA 3TU4K 5CKFA 2LVMA 3SB2A 4PLLA 5CO7A 5FU7B 4DOWA 4NL2A 2YHTA 2DPPB 2K3YA 1VQ5T 1I8FA 4C8QB 3QKJA 1HXDA 1QVPA 2Y90A 4FT2A 2XDDA 3M53A 3BDUA 4M75C 3I56T 3MEUA 4P5NA 4M7DF 4ELYC 4M75D 3NFCA 3CCQT 3QHSA 2CZ6B 2XD0A 3L2RA 2GFAA 3EFRA 3A5ZB 4PJOF 4M77C 3JCMc 3X26B 1Y7XA 2LT1A 3ZEHA 5GAN6 1D3BA 1ZBXA 1VQNA 4HT8A 4MZTA 4ATOA 2E1HA 2A7YA 3G6ET 3A8GB 2RB6A 4OB0B 4OB1B 1M1KU 3CC7A 1UGRB 5A0LA 1FWZA 3OQ5A 2QDYB 1VQ9A 3CD6T 3JB9I 2DD4A 4CRIA 2F5KA 2RJDA 4BE0A 1Y07A 2ZPHB 1H641 3GF5A 4LDWA 4C92C 3CCJT 3LYIA 2DZ9A 2XDBA 3MEWA 3OW2S 3EAEA 3ER0A 3URGA 1O9SA 4E7HA 4XK8E 4HCBA 3RESA 3I55A 2DAQA 1BIBA 1UGPB 3JCMh 1VQKA 3BFMA 1VQNT 3OYNA 2DEQA 5CQXA 3G71T 3X25B 4L59A 2WSEE 3J7AF 3JRZA 2LDMA 4VUBA 3OYLA 1ZHIA 4HCZA 5DLQE 4BY6C 3JSCA 1OI1A 2FYKA 2M9UA 2ZGWA 1YITA 3QXEB 1I5LA 1BI1A 2DK3A 1O75A 5HKCA 2DIQA 4TVRA 4A4EA 4BUGA 3CCSA 3E19A 3OY9A 3JB9F 4BD3A 5CIUA 4J7FA 3M4GA 4PL6A 3ZBDA 2K2VA 4HKEA 3VUZA 3VYGA 4IKFA 2CKKA 3PGGA 3M57A 4M77D 3DB3A 3JCMQ 2VC8A 5GANe 3L2QA 1N6AA 3HSBA 1PSFA 2ZCFB 1M1FA 3P8DA 2V8KA 2ZPBB 3CEYA 4MMKA 3JB9H 2X4YA 3MCAB 2EAYA 1Y96A 2PVOB 2ZZDA 4PJOB 4C92D 2PUKB 4NOYA 1VQ9T 1G3YA 5GAOp 4R55A 1R8OB 5HK0A 4C92B 5CR2A 2RK1A 2P0PA 3NTIA 4M78B 4IURA 4OGEA 1YCYA 2JZ2A 2E41A 2KQWA 5CKBA 3M58A 4C0ZA 1YJNA 2M1HA 4FIBA 2VUBA 4ZGJB 1YI2A 2QQRA 3I55T 2R5AA 3SDZA 5GAN8 1XTDA 3M9QA 3OSVA 4F7UE 5A0DA 5CKDA 3JAME 4J8OA 3OS0A 4PJOE 3LGFA 4L5GA 3SFMA 4WF2A 3RERA 1XQHA 3OYAA 5LJ5f 3UPUA 2LC4A 4LD6A 3UDCA 2QTXA 5FU6B 3JCMP 4YTLA 2JUFA 1HK9A 2LX9A 1Q7YC 3BW1A 4C8QC 4GY5A 4ZGEB 1VQ4T 4B9XA 2L89A 1K9MU 4JDSA 5FU7C 1YI2T 2K3XA 2DTOA 3JCMW 3LGLA 2R5MA 5KCOA 3SWNB 5LJ5e 4M78A 1KQ2A 3QJYA 3CCMT 3JCMg 2MWPA 4C92A 3CCVA 5LL6S 5GAMd 4FU6A 2E6NA 1M5Q1 3ME9A 2CYZB 3UT1A 4M78E 2EJFA 3P8HA 1GXIE 4J83A 4MMLA 1FX7A 4BDYA 3KXTA 2PU9B 4XTZA 5GANd 2P0KA 3DKMA 4C0DB 4C8QG 3J81E 1N9RA 5GMKm 1JJ2A 3S3OA 1QVFA 3WVEB 3OYYA 2EQKA 1Q82C 3WVDB 5CK9A 2FL7A 1VQ7T 4M7AB 3CCVT 1KG1A 4MZPA 3X20B 3HFOA 4HA8A 2KMTA 2G3RA 1VIFA 4QVZA 4ME7A 1EIFA 3C95A 1Q86C 3CBMA 2HD0A 2D6FA 1NJIU 3SWNA 4RMOA 5LJ5j 3MP6A 3JCMb 1YHQA 2QA4T 1SSFA 3CPWS 3QYGB 3OA6A 4JUVA 5J26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLI A;  2DXT A;  2RD1 A;  3RKY A;  5GAO m;  3EFS A;  3RES A;  4HT9 A;  4V2S A;  4EMK A;  5GAN j;  1BIB A;  3JCM h;  5GAM h;  1JRI A;  4C92 F;  5LJ3 g;  1I4K 1;  3BFM A;  4M77 B;  2DEQ A;  4RCB A;  2JN0 A;  3JCM V;  5GMK h;  4M7D D;  4EMH A;  4M7D C;  2EJ9 A;  4M7D A;  3FB9 A;  2FYK A;  2E64 A;  2ZGW A;  4PJO D;  1I5L A;  5GAN 2;  4X9D A;  3V8L A;  4F7U A;  5I21 A;  3JB9 J;  4PJO A;  4M77 F;  5GAO q;  3RUX A;  4C8Q D;  3JB9 F;  4XTY A;  2CGH A;  3RKX A;  5LJ5 g;  3M4G A;  3FJP A;  1WNL A;  1KQ1 A;  3SWN C;  1MGQ A;  5GMK e;  5GMK i;  4XTU A;  1D3B B;  3PGG A;  4M77 D;  4Y91 A;  3JCM Q;  4C92 E;  5GAN 4;  2VC8 A;  5GAN e;  5DY9 A;  3RIR A;  4F7U F;  1I81 A;  3HSB A;  2FB7 A;  5GAN g;  5GAN 5;  4XQ3 A;  4M77 A;  4MMK A;  4PNO A;  3JB9 H;  3JCM f;  2EAY A;  1Y96 A;  5GAM f;  3L1A A;  3JB9 G;  2YLC A;  3INZ A;  4PJO B;  5GAM j;  3QUI A;  4C92 D;  4M77 E;  4M7A G;  1WQW A;  2E65 A;  4NOY A;  5GAO r;  4N0A A;  5GAO p;  4A53 A;  2VXE A;  1N9S A;  1U1T A;  1B34 B;  2DVE A;  2I2L A;  2DTI A;  4J6Y A;  4XU1 A;  4C92 B;  4F7U B;  5GAO n;  3FIF A;  4X9C A;  4M78 B;  3AHU A;  1YCY A;  2E41 A;  4JRK A;  5LJ3 e;  5LJ5 h;  3V8J A;  4M78 G;  5GAN 7;  4M78 C;  1LNX A;  4RCC A;  3V8K A;  5GAN 8;  4M7A A;  4F7U E;  2DKG A;  4PJO E;  3JB9 D;  4QVD A;  4M7D G;  4QVC A;  2EJG A;  2HNI A;  4A54 A;  4M7A C;  4WF2 A;  5GAM e;  3JCM e;  4C8Q A;  5CAI A;  3RER A;  1X01 A;  4M7A D;  4XTX A;  1LJO A;  5LJ5 f;  4M78 F;  4PJO C;  4M7D E;  1U1S A;  5LJ3 d;  5LJ5 d;  4M75 E;  2QTX A;  4M75 B;  2VXF A;  4EMG A;  3JCM P;  1HK9 A;  4C8Q E;  5GAN f;  3JCM J;  3BW1 A;  4M75 G;  4C8Q C;  4M7A F;  2E10 A;  4EMK C;  2RA2 A;  4XTV A;  1WQ7 A;  4XU3 A;  4NL3 A;  4DQ2 A;  2DTO A;  4J5Y A;  2DZC A;  1Y96 B;  3JCM W;  5GMK l;  1WPY A;  1KQ2 A;  3SWN B;  5LJ5 e;  4M78 A;  4J6X A;  2YLB A;  5GAN 3;  5LJ3 j;  3JCM g;  5GAM g;  4C92 A;  5LJ3 h;  3JCM d;  3HFN A;  3SB2 A;  5GAM d;  1M5Q 1;  1M8V A;  2K57 A;  4XU2 A;  4EMK B;  4M78 E;  2EJF A;  2DTH A;  2YHT A;  4JRI A;  4N0A C;  4NL2 A;  4MML A;  1B34 A;  1I8F A;  4M75 A;  3VU3 C;  3V7C A;  1HXD A;  2Y90 A;  4XTZ A;  4C8Q B;  5GAN d;  3QO3 A;  1LOJ A;  3BDU A;  4J6W A;  4M75 C;  1N9R A;  4C8Q G;  1JBM A;  4F7U G;  5GMK m;  3GIB A;  4M7D F;  3L2Z A;  4M7D B;  4M75 D;  5GMK j;  1BIA A;  3QHS A;  2DXU A;  4M77 G;  4M7A E;  5GAO l;  3EFR A;  4M7A B;  4PJO F;  3V7R A;  4M77 C;  3JCM c;  3HFO A;  4OP0 A;  5GAN 6;  1D3B A;  4M75 F;  5GAN h;  4HA8 A;  4M78 D;  2DJZ A;  4HT8 A;  3RKW A;  4C8Q F;  4XTW A;  2E1H A;  2RB6 A;  3SWN A;  3JCM X;  1TH7 A;  3JB9 I;  4C92 G;  5LJ5 j;  2EWN A;  3BY7 A;  3JCM b;  1H64 1;  4XU0 A;  4JUV A;  4C92 C;  4PJO G;  3QSU A;  2RM4 A;  5LJ3 f;  2DZ9 A;  3V7S A; 
#chains in the Genus database with same CATH topology
 2RPN A;  2RHZ A;  3ZFJ A;  4OMN A;  4V2S A;  5CKH A;  4BI8 B;  2DL3 A;  1E6G A;  3RNJ A;  3CCQ Q;  1BCO A;  3VRZ A;  2KVQ G;  2FZG B;  1RUW A;  3OW2 A;  1OPL A;  4M7D A;  3FDR A;  4C5I A;  4X9D A;  3V8L A;  4F7U A;  2AK5 A;  1HSQ A;  3I5S A;  4C8Q D;  1YBY A;  2JTF A;  4GLM A;  5GMK e;  1KQ1 A;  3SWN C;  4XTU A;  1VQP T;  2LTO A;  1VA7 A;  2E4H A;  2E70 A;  3CCE Q;  3JB9 G;  5CQY A;  1VQ6 T;  2RHI A;  2XK0 A;  3HPW A;  1YHQ T;  2HL3 A;  1XNI A;  2DTI A;  4DBQ A;  5HK3 A;  2KRO A;  1BYM A;  2QG9 B;  4O6J A;  1XOV A;  4KUD K;  4X1V A;  4M7A A;  4RTX A;  4M7D G;  3GLX A;  2BZ8 A;  1WJR A;  4XTX A;  2DD5 A;  4AG2 C;  5LJ3 d;  1NJI C;  4M75 E;  4J9B A;  3PIP A;  2LT4 A;  1NEB A;  2W0Z A;  2E10 A;  2JOY A;  3OYM A;  1UJY A;  5GMK l;  1SEM A;  3G1J A;  1NPP A;  3M0Q A;  2AKL A;  1SHG A;  2PTK A;  3GP8 A;  4OF1 A;  4BY6 B;  2NLU A;  2C0O A;  2LQK A;  2BTT A;  4M77 G;  2EYY A;  4HVV A;  3CXC S;  5GAN h;  1VQN Q;  1TH7 A;  3OYF A;  2F2V A;  4CC2 A;  4FYY B;  5LJ3 f;  1K73 U;  1WJQ A;  2BUD A;  2HMA A;  1KQS S;  1CKB A;  1X6G A;  1AWW A;  3L2V A;  2IG0 A;  3GPL A;  3NTH A;  3MKD A;  4FSS A;  4JLG A;  2X35 A;  2F69 A;  4AT1 B;  2CP2 A;  5CKE A;  3VUB A;  5KE2 A;  2COZ A;  3CC2 Q;  2OTJ T;  3VJP A;  3FJP A;  1NEG A;  4E47 A;  5GAN 4;  1XJW B;  5KYW A;  1WZO A;  2GF7 A;  1VQ4 A;  3JCM f;  2CP3 A;  1KD1 U;  1K8A U;  4JJC A;  4DA4 A;  5IHK A;  2EKO A;  2I2L A;  5EC7 A;  1G3W A;  3V8J A;  2EYX A;  2XIC A;  1T3S A;  3RR6 A;  4F04 B;  3VS3 A;  3CMA T;  4LD9 K;  3L2W A;  3OBW A;  2RQU A;  3HP9 A;  1VQ6 Q;  1U06 A;  1VQO T;  4KGV B;  2R57 A;  1RAC B;  1M30 A;  4XTV A;  1WQ7 A;  3G71 A;  1WPY A;  1OPK A;  2C0T A;  1Q81 C;  2LCC A;  3LLR A;  2DX1 A;  2KSS A;  1RAB B;  3HKS A;  2O4X B;  5IXB A;  1D1C A;  5GMK j;  4II1 A;  1BIA A;  4BDZ A;  2J05 A;  2F5T X;  5GAO l;  1ZUY A;  2XG8 D;  2DBK A;  1SRM A;  4RKU E;  1FYN A;  2A3L A;  2GGR A;  2P84 A;  3H0H A;  1ABQ A;  1VQ7 Q;  2QK0 A;  2JMA A;  2W10 A;  1K9M R;  1BI3 A;  1G3S A;  2RQT A;  1OZ3 A;  5GAM h;  4ELZ C;  4ZN3 A;  1MNE A;  2KT1 A;  2VB6 A;  4IUU A;  2KNB B;  3QZ9 B;  2PUO B;  1D0X A;  4FM4 B;  2NUP B;  2PVD B;  2DIG A;  4GLK A;  4D6W A;  4E7L A;  2OTJ Q;  4Q5W A;  4RTT A;  2Y4X A;  1YIJ Q;  3MET A;  2Y4Y A;  2EQU A;  3E1S A;  3UAT A;  2HQE A;  3OYG A;  4KRT A;  5DY9 A;  3MHX A;  3C94 A;  2ED1 A;  2LP5 A;  1I81 A;  2IPO B;  2ESW A;  2GNC A;  4LDX A;  1RL2 A;  2M0O A;  3I56 A;  1V1C A;  2HKQ B;  5GAM j;  3QUI A;  1I1J A;  1WHK A;  1I5O B;  3HRS A;  1T0H A;  3CC2 T;  5IH2 A;  3AHU A;  2YRC A;  1JXM A;  1K8A R;  2I0N A;  3PFS A;  4QVD A;  2E5K A;  4AFQ C;  1LJO A;  1UGQ B;  4M78 F;  4DOV A;  5LJ5 d;  2PZ1 A;  1QW1 A;  4UC4 A;  1MHN A;  2VXF A;  4M75 G;  1VIE A;  2QQ9 A;  4Z89 A;  2JTE A;  2RA2 A;  4IIO A;  4DQ2 A;  5IXF A;  5M9O A;  5LJ3 j;  1D0Z A;  5CO7 A;  4DOW A;  1OUL A;  1WHG A;  4FT2 A;  3BDU A;  3C0C A;  3NFC A;  3CCQ T;  3EG0 A;  2A28 A;  3A5Z B;  4PJO F;  2KR3 A;  4M77 C;  3X26 B;  1Y7X A;  2M02 A;  3ZEH A;  1OQK A;  4ATO A;  2RB6 A;  4OB1 B;  2DL5 A;  1UGR B;  1AT1 B;  3JB9 I;  4CRI A;  1Y07 A;  4C92 C;  3MEW A;  2FRY A;  1TUC A;  1BIB A;  1EFN A;  3BFM A;  5I22 A;  1VOM A;  3EG9 B;  4L59 A;  5GJW B;  2XMF A;  3OYL A;  1ACM B;  2FYK A;  2YWW A;  1I5L A;  1BI1 A;  1O75 A;  2DIQ A;  2ROL A;  4TVR A;  3E19 A;  3OY9 A;  2CT4 A;  4DEX A;  1SKU B;  2CKK A;  3PGG A;  3CD6 Q;  1M1F A;  3P8D A;  1OEB A;  1NLO C;  3VS5 A;  1K1Z A;  1Y96 A;  1OOT A;  2PVO B;  2ZZD A;  4R55 A;  2BE7 D;  3REA B;  5HK0 A;  1R77 A;  2RK1 A;  2P0P A;  5CKB A;  3M58 A;  4FIB A;  2VUB A;  2QQR A;  3I55 T;  1SSH A;  3OSV A;  3OS0 A;  2FPF A;  4J8O A;  2NUT A;  2IIM A;  4WF2 A;  1JXO A;  3UPU A;  3UA6 A;  1Q81 R;  3JCM P;  2JUF A;  2O9S A;  4GY5 A;  1EZZ B;  4JDS A;  2OX7 A;  1AD5 A;  2K3X A;  5KCO A;  2CSI A;  1QCO A;  3PVQ A;  4FU6 A;  2D0N A;  2DBM A;  2CYZ B;  2KRM A;  3P8H A;  3KXT A;  4XTZ A;  1QVF A;  3NGP A;  2EQK A;  1K0S A;  1SPK A;  3WVD B;  4M7A B;  3CCV T;  3X20 B;  3HFO A;  2G3R A;  1VIF A;  4HVW A;  4QVZ A;  1Q86 C;  3CBM A;  1AVZ C;  5LJ5 j;  3M0P A;  2EW3 A;  3JCM b;  2QA4 T;  2JMC A;  3OA6 A;  2XID A;  5GAO m;  5FRO A;  2O9V A;  2KE9 A;  1RI0 A;  3DLM A;  1ZSG A;  2RQV A;  1D1A A;  2XU8 A;  1UJ0 A;  4WCI A;  2RK2 A;  3M4Y A;  2YUO A;  1VQ8 Q;  3E2U A;  3MP8 A;  2GQI A;  2DO3 A;  5AYF A;  3REB B;  1YIT T;  3PMI A;  2LNH B;  4IUT A;  3RDV A;  4JRP A;  3VS4 A;  1GRI A;  1S72 T;  3M55 A;  2HSE B;  4JRQ A;  2J6K A;  1R0C B;  1PKS A;  4E7K A;  2LJ0 A;  1WQW A;  2ROT A;  2V8J A;  2RH2 A;  4LDV A;  2AIR B;  1J3T A;  2NWM A;  1S72 A;  1TG0 A;  4XAX B;  4M78 C;  2H3E B;  4R56 A;  2K79 A;  2SRC A;  1NZ9 A;  3SD4 A;  1SRL A;  2JW4 A;  1Q82 R;  2EJG A;  2KRS A;  1IZ6 A;  4C8Q A;  3BE3 A;  2FVU A;  5FWC A;  4PJO C;  4F16 A;  1NYG A;  1KC8 U;  2XHC A;  4A4G A;  3JCM J;  2RF0 A;  3G7Z A;  3MP1 A;  1NE8 A;  1ZQ1 A;  2CT3 A;  1M1K C;  3OMG A;  2GQV A;  3HFN A;  1QLY A;  1BCM A;  1YWP A;  1YJW T;  1B34 A;  2GTJ A;  2CUB A;  2E3H A;  2DXU A;  3EGD B;  3V7R A;  5A0G A;  5IHN A;  1YJN T;  2V1R A;  2QQB A;  2O88 A;  3NPF A;  4C0G A;  2X4W A;  2HL5 C;  5CCA A;  2EWN A;  2K6D A;  2VKN A;  2P4R A;  2RD1 A;  1YJ9 A;  4EMK A;  4C92 F;  3OS1 A;  3H6Z A;  2DE0 X;  4BAC A;  1N8R C;  2M16 A;  2KGT A;  3JCM V;  3EH2 A;  2H3J A;  1M2O A;  3NMZ C;  3OYD A;  1WHH A;  3VS1 A;  4BB7 A;  4RTU A;  3L2U A;  1PHT A;  4J9H A;  2RI2 A;  3A8M B;  4O5V A;  2DXC A;  1MMG A;  1YJ9 T;  3QDR B;  3F70 A;  4IUQ A;  4JJD A;  3CCL Q;  3G6E A;  3CC7 Q;  1VYU A;  1PCX A;  2NUP A;  1VQ9 Q;  4AFU C;  1MGQ A;  1GL5 A;  4Y91 A;  1MUZ A;  4BE1 A;  1QQJ A;  1X2K A;  3ASK A;  3RIR A;  2A37 A;  2FB7 A;  2L3Q A;  4M77 A;  4PNO A;  5D6W A;  2MI6 A;  3FEO A;  4HXJ A;  1OYX A;  2MWO A;  4J9F A;  2AHJ B;  4M77 E;  4ZTJ A;  4PLI A;  1SF9 A;  4JS5 A;  5L8R E;  1AZG B;  1C0M A;  2E5Q A;  1N9S A;  1PRM C;  1B34 B;  1E6H A;  1U1T A;  2O01 E;  1VQ6 A;  3PMT A;  3MJX A;  1RI9 A;  2YSQ A;  4PJN A;  3VS0 A;  3BDL A;  2COW A;  6AT1 B;  2DKG A;  3JB9 D;  1BB9 A;  2EFI A;  2KY9 A;  2B8A A;  3JV3 A;  5FW9 A;  4FYX B;  4DBH A;  1OX8 A;  1UEC A;  4OML A;  2CZ1 B;  1ZUU A;  2MAM A;  3TQ7 P;  1S1N A;  1WX6 A;  2JVV A;  3FLG A;  2V26 A;  3T9N A;  4NL3 A;  4J5Y A;  3UF4 A;  2RJC A;  3CBP A;  1VUB A;  2D0Q B;  3UWN A;  1E7O A;  5IHI A;  1YJW Q;  1KD1 R;  3FRN A;  4B9W A;  3OYE A;  4XU2 A;  4C5H A;  8AT1 B;  4JRI A;  4N0A C;  2HAX A;  3MPU B;  3QO3 A;  4J6W A;  4ZTF A;  2DVJ A;  2EPD A;  2JXB A;  4PFP A;  2PVG B;  1YIJ T;  3EG9 A;  1IRX A;  4FYW B;  4PJJ A;  5KYX B;  3CD6 A;  2DA9 A;  2V8I A;  4N4H A;  2JTM A;  3CXC A;  2YT6 A;  2ZPF B;  3OYK A;  3BY7 A;  2L3S A;  2DIL A;  4PJO G;  3QSU A;  5GAN f;  1KD1 C;  4PK4 A;  1P92 A;  1VQL T;  3EFS A;  3OS2 A;  3KBG A;  5DLO A;  2L3P A;  1I0C A;  1I4K 1;  1WGS A;  1IRE B;  1HJD A;  3S3M A;  1PWT A;  2HCK A;  2YRV A;  1CSK A;  1G5V A;  3QPH A;  2KRN A;  2P4T A;  5IT9 E;  1Y71 A;  3CCE T;  3RMS A;  3JB9 J;  3RUX A;  4XTY A;  5LJ5 g;  3RKX A;  1YCS B;  3PTA A;  4OMM A;  5D7U A;  3CCM A;  3CCL A;  5DM7 R;  1RAD B;  2QGG A;  1M3C A;  2RO0 A;  2QAS A;  4JPB W;  2QEX A;  2F2X A;  1X75 C;  2CRE A;  4A53 A;  3QII A;  2KDS A;  5IN1 A;  2DVE A;  1YJW A;  1PG5 B;  2RHY A;  1U8R A;  1KC8 R;  2K5F A;  5LJ5 h;  1WHL A;  4M78 G;  1RAI B;  4E7J A;  1LNX A;  2ED0 A;  1UB4 A;  2RJE A;  2RMO A;  4LDU A;  4M7A D;  2VGN A;  4EMG A;  1VQ5 A;  2C06 A;  3N5B B;  2QYZ A;  1TU0 B;  1KK7 A;  2EYW A;  1Y96 B;  1ZSZ A;  2DXB A;  2HKN A;  1M90 U;  1WI7 A;  3I5R A;  1CKA A;  2YLB A;  5KCH A;  1VQM T;  1YI2 Q;  2KI7 A;  2LVM A;  5FU7 B;  4NL2 A;  2K3Y A;  1I8F A;  4C8Q B;  1QVP A;  2H8H A;  1UHC A;  3MEU A;  4AFZ C;  4M7D F;  2GFA A;  3EFR A;  1D3B A;  4MZT A;  3G6E T;  3CC7 A;  5A0L A;  2J7I A;  1TWB A;  3OQ5 A;  1VQ9 A;  1AZE A;  2KEA A;  1QCF A;  1H64 1;  4JUV A;  3LYI A;  1K0X A;  1HD3 A;  3ER0 A;  3URG A;  1M3B A;  2GTO A;  4PJL A;  1S72 Q;  1VQK A;  3OYN A;  2DYB A;  3JRZ A;  4VUB A;  1PNJ A;  3JSC A;  2M9U A;  3OW2 P;  5HKC A;  3CCS A;  4FW2 A;  4BD3 A;  5CIU A;  4FW1 A;  4HKE A;  2NUT B;  1TXQ A;  3EHR A;  3M57 A;  3DB3 A;  3JCM Q;  2VC8 A;  3L2Q A;  1ZSZ B;  3HSB A;  2ZCF B;  2V8K A;  4MMK A;  4OMP A;  2JM8 A;  4JJB A;  4C92 D;  1C1A A;  1M1K R;  5GAO p;  1VYT A;  2K3B A;  5CR2 A;  3NTI A;  4IUR A;  1RAG B;  2JS0 A;  1FMW A;  3VS6 A;  3KFV A;  5GAN 8;  1XTD A;  3M9Q A;  5CKD A;  4PJO E;  4DBR A;  1H8K A;  3RER A;  1QKW A;  4D8D A;  2QTV A;  4J9D A;  2ENM A;  4YTL A;  4B9X A;  1K9M U;  2YUP A;  1GCQ A;  2R5M A;  1KQ2 A;  5LJ5 e;  3O5Z A;  2K9G A;  2VVK A;  3JCM g;  1WLP B;  2MWP A;  4M4Z A;  2E3I A;  2E6N A;  2JM9 A;  2EJF A;  4MML A;  4OMQ A;  3CPW P;  4C0D B;  4C8Q G;  3S3O A;  1AWX A;  1Q82 C;  2AT1 B;  2FL7 A;  1VQ7 T;  4ME7 A;  1EIF A;  3CQT A;  1NJI U;  1VQP Q;  2MIO A;  3VS2 A;  4RMO A;  3CCS Q;  1KQS P;  1YHQ A;  2O31 A;  1SSF A;  4HVU A;  3CPW S;  3RBB B;  2DMO A;  4RTV A;  4JJN K;  5LJ3 g;  5I2M A;  2X4J A;  1AOJ A;  2EQM A;  2JN0 A;  2V1Q A;  2DL8 A;  4KGZ B;  2FPE A;  4M7D D;  1UHF A;  4J9I A;  3OSS C;  1PSE A;  3FB9 A;  2E64 A;  1YNZ A;  2VGM A;  1M2V A;  3OMC A;  4AMC A;  4IIM A;  5KYU B;  2C0I A;  4J9C A;  2GBQ A;  1M27 C;  2RI3 A;  1N27 A;  2XDP A;  3E9G A;  2LCS A;  4MZM A;  5GAM f;  4JZ3 A;  2B86 A;  2ECZ A;  2LNV A;  1K73 R;  1VQO Q;  1IXD A;  1EX4 A;  3X28 B;  4CI0 C;  4N0A A;  2L5Q A;  3MEA A;  2AZV A;  4IUV A;  3A8O B;  1X6B A;  3LH0 A;  4OVA A;  4XU1 A;  4F7U B;  1G3T A;  2CH4 W;  2ZPG B;  4J9G A;  4JRK A;  1M9S A;  1SHF A;  3LW5 E;  2DNU A;  1ZBJ A;  3V8K A;  3MO8 A;  2LCL A;  5GAM e;  4FCY A;  1X01 A;  3PE0 A;  4M7D E;  3S6W A;  3E9F A;  3CMA Q;  3Q1J A;  5GJV B;  3EG2 A;  1K9A A;  1BBZ A;  3M56 A;  4RTY A;  1NJI R;  1Q82 U;  1M1G A;  3OYH A;  4RG8 A;  4ORZ A;  1FMK A;  1QMC A;  1W2B A;  4EMK B;  1VQK Q;  1KHI A;  5EG2 A;  1FXX A;  4BI4 A;  3VV0 A;  4F7U G;  3HRU A;  5FRM A;  4M7D B;  3CCE A;  2LJ1 A;  3CBO A;  2GFU A;  4M7A E;  1QVG P;  2P0Q A;  3EFO A;  3M5A A;  4M78 D;  3RKW A;  2MMP A;  4C92 G;  5J3B A;  4A4H A;  3GNF B;  3V7S A;  4JLI A;  2D8J A;  3RKY A;  2X3X D;  3OYB A;  5FWB A;  2VWF A;  4EDU A;  5FRN A;  2FEI A;  4QQ6 A;  5GMK h;  5FLX E;  1TSF A;  1PC0 A;  4QQD A;  2JS2 A;  4PJO D;  3OS5 A;  2VV5 A;  2DET A;  4PJO A;  2EYQ A;  4NS5 A;  3KUF A;  1ARK A;  4QQG A;  1MV3 A;  3NTK A;  1WFW A;  4F7U F;  1KSW A;  3CCU Q;  1M90 R;  1B3Q A;  1R0B G;  3L1A A;  4LUD A;  2EQJ A;  3INZ A;  1F1B B;  4KH1 B;  3M0S A;  3QBY A;  4K11 A;  1JO8 A;  3M59 A;  2EGC A;  4LUE A;  2HBW A;  1WXU A;  2BE9 B;  3IQL A;  2HEQ A;  1AEY A;  1QWE A;  5I11 A;  1PD1 A;  1JJ2 S;  3WXM B;  2WSF E;  3A8H B;  1VQ7 A;  1BI2 A;  1HYO A;  1W2B S;  2BZX A;  4Y28 E;  3EGX B;  2DM1 A;  5J39 A;  4EMK C;  1K73 C;  3H0I A;  2VAS A;  1VQK T;  5KYN A;  5LJ3 h;  4ZGD B;  5D6Y A;  4KUL A;  3OBY A;  2RHX A;  1VQM Q;  4CC4 B;  4JS4 A;  3MEV A;  1KHC A;  5FU6 C;  1JBM A;  5ECA A;  2QQS A;  1VQ5 Q;  2XKO C;  4CC7 A;  3I56 Q;  4LE9 A;  2MF2 A;  1PM3 A;  7AT1 B;  4M75 F;  1IHW A;  4XTW A;  3EGX A;  1AHJ B;  2FRW A;  3I9Q A;  3PVL A;  3CME T;  3S3N A;  1VQ8 T;  2CP6 A;  1YIJ A;  2K57 A;  3GIB A;  5GAN j;  1WDX A;  2KAF A;  2LX7 A;  3PT9 A;  2IVW A;  4M7D C;  2NYS A;  1VQ8 A;  1ZUK A;  2HBP A;  2KK4 A;  1OZ2 A;  4BI3 A;  5GAN 2;  3G4S Q;  4KUI A;  1W2B P;  4X34 A;  2ZPI B;  2OAU A;  1NYF A;  1UTI A;  3NHN A;  3X24 B;  5GAN g;  1JU5 C;  2F2W A;  1YIT Q;  3CCQ A;  3C4S A;  5GAO r;  1MMD A;  1N8R U;  2CZ0 B;  5GAO n;  4J6Y A;  4FYV B;  2KYB A;  4KT0 E;  4B6M A;  5LJ3 e;  3UA7 A;  1X6O A;  5KYU A;  1BKB A;  2L2P A;  1X43 A;  3DB4 A;  5IAY A;  4RTW A;  2HNI A;  3CCU T;  2BKD N;  2QA4 A;  1GCP A;  1WHJ A;  2RI5 A;  4D8K A;  3G6E Q;  3CMA A;  2OTL T;  4M75 B;  2HZY A;  4C0D C;  1SG5 A;  3TVT A;  3ZL7 C;  4C8Q E;  2D6F A;  2K2M A;  1RAE B;  3VYH B;  2G6F X;  2EQI A;  4Z02 A;  1TTH B;  1GBQ A;  2EVR A;  1G8X A;  1NM7 A;  1PRL C;  3EH1 A;  4A4K A;  3TU4 K;  1YJN Q;  3EG3 A;  1ZLM A;  3EHQ A;  4PLL A;  5CKF A;  1PD0 A;  2DPP B;  1VQ5 T;  3CCM Q;  1HXD A;  2Y90 A;  2COY A;  4M75 C;  3I56 T;  4ELY C;  4M75 D;  4ANJ A;  3LH5 A;  2XD0 A;  1RLQ C;  1T0J A;  3JCM c;  2RNA A;  2LT1 A;  5GAN 6;  4HT8 A;  2QDL A;  2DF6 A;  1FWZ A;  1N8R R;  3EG1 A;  4BE0 A;  2ZPH B;  2CUD A;  1OX9 A;  2DZ9 A;  2MPX C;  3EAE A;  1O9S A;  5L23 A;  4E7H A;  4XK8 E;  4HCB A;  3I55 A;  2DAQ A;  4F17 A;  1UGP B;  3JCM h;  3M0R A;  2DEQ A;  5CQX A;  3G71 T;  2DYI A;  3EFO B;  3X25 B;  1ZSZ C;  1U5S A;  2LDM A;  5DLQ E;  1FMV A;  4HCZ A;  3I55 Q;  4HCK A;  1YIT A;  3QXE B;  2DK3 A;  4F14 A;  4BUG A;  3EGU A;  3JB9 F;  3D7S B;  4GBQ A;  4J7F A;  4PL6 A;  3CCR Q;  2K2V A;  3VUZ A;  1N5Z A;  3A98 A;  2DFU A;  1N6A A;  1PSF A;  2ZPB B;  3CEY A;  3JB9 H;  2K7A A;  2X4Y A;  3MCA B;  2FZC B;  1YN8 A;  2X51 A;  4PJO B;  1Q86 R;  2PUK B;  1TUD A;  4NOY A;  1JQQ A;  1B7T A;  4M78 B;  1YCY A;  2JZ2 A;  2E41 A;  2KQW A;  5KYW B;  1YJN A;  1YHQ Q;  2R5A A;  4EIK A;  4F7U E;  5A0D A;  3JAM E;  1UUE A;  2ATC B;  4L5G A;  5LJ5 f;  2LC4 A;  4R0K A;  2CP0 A;  2QTX A;  5FU6 B;  3M0U A;  1HK9 A;  2O2O A;  1Q7Y C;  3BW1 A;  4C8Q C;  2QA4 Q;  2CDT A;  5FU7 C;  2DTO A;  3JCM W;  3QJY A;  4C92 A;  5KYY B;  5GAM d;  3ME9 A;  3UT1 A;  2FPD A;  1GXI E;  4BDY A;  2PU9 B;  2OAW A;  5GAN d;  2P0K A;  3DKM A;  1JJ2 A;  3J81 E;  3TSZ A;  4MZP A;  3CXC P;  1G83 A;  1ABO A;  2CSQ A;  2FO0 A;  4HA8 A;  1YP5 A;  1TS9 A;  2PNI A;  3SWN A;  1LCK A;  1Q7Y R;  1RLP C;  2DRM A;  5J26 A;  2HDA A;  2NUZ A;  4C0F A;  2BIV A;  1M90 C;  3PNW C;  4CC3 A;  1NPR A;  1K8A C;  2EKH A;  4HT9 A;  1QKX A;  1RAA B;  2DEU A;  2YRD A;  5C6S A;  1TOV A;  4RCB A;  4OMO A;  2K5I A;  2QAZ A;  2OTJ A;  1VQP A;  1NBE B;  2EJ9 A;  3CC4 T;  1U3O A;  4OB2 B;  4DEY A;  4M77 F;  1H3H A;  1Y57 A;  3CCU A;  1JEG A;  3P8B B;  2D8H A;  3QJ6 A;  2EGA A;  2VYT A;  2LRQ A;  4QKU A;  3FC3 A;  2ABL A;  3H8Z A;  1Q95 G;  1IB8 A;  2KYM A;  1NLP C;  1WXB A;  3CCJ A;  2YLC A;  1VYV A;  2E12 A;  1UEB A;  2CZ7 B;  2CS7 A;  3GNG A;  2WSC E;  4X9C A;  2EBP A;  1Q7Y U;  3CCR T;  1K9M C;  4RCC A;  4WTO B;  2LJ3 A;  3LX7 A;  4LNP A;  1VQO A;  4E7Z A;  2O4X A;  4QVC A;  1Z9Z A;  5CAI A;  2MOX A;  2K5L A;  3CME A;  3QG1 A;  2QQA A;  4M7A F;  4BE2 A;  1H3Z A;  3CCR A;  2OI3 A;  2HQX A;  4OMF B;  4E7S A;  5GAN 3;  1UDL A;  4J6X A;  2RHU A;  5GAM g;  3CPF A;  3JCM d;  2KT8 A;  1M8V A;  4N4I A;  3M54 A;  1WXT A;  2GCX A;  5I21 A;  4M75 A;  1WIE A;  1ZA1 B;  2DRK A;  4HCC A;  1LOJ A;  4KBM B;  1RAH B;  3R6N A;  2RJF A;  3RMQ A;  4PKC C;  3CCJ Q;  2M51 A;  3G4S A;  2CH4 A;  2JT4 A;  3SHW A;  3VRY A;  4PFO A;  4OP0 A;  2QGF B;  3C12 A;  3CCL T;  2DJZ A;  3QZ5 B;  4FSX A;  2DJQ A;  3VKI A;  2YDL A;  2MK5 A;  4QT7 A;  2KBT A;  2L3R A;  3I35 A;  1QCN A;  4IUP A;  2HQH A;  4Y92 A;  2QEX T;  2FHD A;  2L0A A;  2RM4 A;  3M0T A;  1UFF A;  1V29 B;  4M77 B;  3OYJ A;  3CCV Q;  1UG1 A;  3AT1 B;  2LQN A;  1NG2 A;  5AT1 B;  3FJ5 A;  3LWH A;  3R6O A;  3O8V A;  1WJS A;  1OU9 A;  1K76 A;  4Z8A A;  3A8L B;  2CGH A;  4PFZ A;  4QW2 A;  2OTL A;  2FG0 A;  1WNL A;  3QYH B;  5GMK i;  1JJ2 P;  4C92 E;  3QWY A;  5I2S A;  3QDF A;  3TCJ A;  1M4Z A;  1T3L A;  1VQM A;  2CP5 A;  4XQ3 A;  2XI9 A;  3OYC A;  3CC2 A;  5HY6 A;  1X27 A;  8ATC B;  5A2Q E;  4MDX A;  4M7A G;  4OGC A;  2LZ6 B;  4N4G A;  2VXE A;  2X3W D;  3FIF A;  3TSW A;  3QWX X;  1UE9 A;  1W6X A;  2M0Y A;  2LQ8 A;  1Z9Q A;  2CP7 A;  5CVI A;  2LMJ A;  4A54 A;  3JCM e;  1KQS A;  1VQL A;  1ZA2 B;  2RN8 A;  1U1S A;  1QWF A;  4MDW A;  5KE3 A;  2YUN A;  2X9H A;  4KH0 B;  3H0F A;  2D9T A;  2MCN A;  1IHV A;  3L42 A;  5KYX A;  3GBQ A;  4XU3 A;  4LDY A;  1A0N B;  4OB3 B;  3HL8 A;  4ZN1 A;  4J7I A;  2AKK A;  1QVF S;  2DTH A;  1OV3 A;  2J6O A;  3VU3 C;  1QVG A;  1ZX6 A;  3V7C A;  5KH6 A;  3CCS T;  4A63 B;  3L2Z A;  3HRT A;  1QVF P;  1Q86 U;  3CC4 A;  4LXC A;  2RQW A;  3J80 E;  1UGV A;  3TEE A;  1KIK A;  2DL4 A;  2YUQ A;  4C8Q F;  2QEX Q;  1C6V X;  3JCM X;  1DJ7 B;  3VS7 A;  3LWI A;  1QP3 A;  4XU0 A;  1Q81 U;  1I07 A;  1IGQ A;  1IGU A;  2DXT A;  4AG1 C;  2FZK B;  1D0Y A;  1JRI A;  4A4F A;  5D6X A;  3DLL A;  1W4S A;  4EMH A;  3H9N A;  3G71 Q;  2X4X A;  1UGS B;  2L8D A;  1OU8 A;  1GBR A;  1GFC A;  1YWO A;  1YFN A;  2WAC A;  4EPC A;  2OJ2 A;  2A0F B;  2DLP A;  2K4Y A;  1QP2 A;  5GAO q;  3PIO A;  1LVK A;  1D3B B;  3CPW A;  2Z0W A;  4C5G A;  3CME Q;  4ZNX A;  5GAN 5;  3CC4 Q;  4C5E A;  1X2Q A;  3HHT B;  1QVG S;  3GOX A;  1WHM A;  1H92 A;  2A36 A;  1KC8 C;  4FL6 A;  2BZY A;  2E65 A;  2E6Z A;  4KGX B;  3A1P A;  4FT4 A;  2R58 A;  1TUG B;  1BI0 A;  2EYZ A;  2QI2 A;  1B07 A;  3CC7 T;  5GAN 7;  2EIF A;  2LQW A;  3OB9 A;  3OYI A;  1KJW A;  4LN2 A;  3G4S T;  4M7A C;  3TRE A;  4RG2 A;  4L6V 5;  2QXF A;  2JNG A;  1JB0 E;  5C0M A;  4E7I A;  1IO6 A;  1M8M A;  1V76 A;  1D1B A;  2ZPE B;  2DZC A;  3EGD A;  2RQR A;  2PQW A;  3HTR A;  9ATC B;  3SB2 A;  1WYX A;  2JJ9 A;  2YHT A;  3QKJ A;  2XDD A;  3M53 A;  2DL7 A;  2SEM A;  4P5N A;  1MMN A;  3QHS A;  4JZ4 A;  2CZ6 B;  4ESR A;  3L2R A;  1WA7 A;  1Y0M A;  1ZBX A;  1VQN A;  2YXY A;  2E1H A;  2A7Y A;  3A8G B;  4OB0 B;  1M1K U;  3SEM A;  2OTL Q;  3CD6 T;  2QDY B;  2DD4 A;  2F5K A;  2RJD A;  3GF5 A;  3ULR B;  3CCJ T;  1MV0 B;  2XDB A;  3OW2 S;  4PJM A;  3RES A;  1G2B A;  1YJ9 Q;  5KYY A;  1VQN T;  2WSE E;  3J7A F;  1ZHI A;  4BY6 C;  4RTZ A;  1OI1 A;  2ZGW A;  2KXC A;  3THK A;  4A4E A;  3M4G A;  3ZBD A;  3VYG A;  4IKF A;  1AWO A;  4M77 D;  5GAN e;  3H41 A;  2AZS A;  2D1X A;  1LPL A;  2EAY A;  1AWJ A;  1K4U S;  2A08 A;  4RUG A;  1MMA A;  1VQ9 T;  1G3Y A;  1R8O B;  4C92 B;  1W1F A;  4OGE A;  2ZAE A;  4C0Z A;  2F1L A;  2M1H A;  4ZGJ B;  1YI2 A;  3SDZ A;  1GCQ C;  1GFD A;  1W70 A;  3LGF A;  3SFM A;  1M2V B;  1XQH A;  3OYA A;  2DER A;  4LD6 A;  3UDC A;  4Z88 A;  2LX9 A;  4ZGE B;  1VQ4 T;  2L89 A;  4DBF A;  1YI2 T;  3U23 A;  3LGL A;  3SWN B;  4M78 A;  1D09 B;  2HSP A;  3CCM T;  3CCV A;  1X69 A;  5LL6 S;  2MYS A;  2J06 A;  1M5Q 1;  4M78 E;  1M3A A;  4J83 A;  1RAF B;  1FX7 A;  1MND A;  1N9R A;  5GMK m;  4AFS C;  2EGE A;  3WVE B;  3OYY A;  5CK9 A;  4E6R A;  1KG1 A;  1PKT A;  1VQL Q;  2J6F A;  1KFZ A;  2KMT A;  3C95 A;  5HCK A;  2HD0 A;  1BK2 A;  2KXD A;  3MP6 A;  4J9E A;  4E2F B;  1VQ4 Q;  1BU1 A;  3QYG B;  4LDW A; 
#chains in the Genus database with same CATH homology
 2XID A;  4C0F A;  2RHZ A;  2BIV A;  3ZFJ A;  5FRO A;  5GAO m;  3PNW C;  1K8A C;  1NPR A;  1M90 C;  4V2S A;  4HT9 A;  5CKH A;  1RI0 A;  3DLM A;  4BI8 B;  4JJN K;  5LJ3 g;  5I2M A;  2X4J A;  5C6S A;  2KVQ G;  2XU8 A;  2EQM A;  2JN0 A;  4RCB A;  2RK2 A;  3OW2 A;  3M4Y A;  2K5I A;  4M7D D;  2OTJ A;  3OSS C;  3MP8 A;  1VQP A;  2EJ9 A;  4M7D A;  1PSE A;  3FB9 A;  3FDR A;  3CC4 T;  2E64 A;  4OB2 B;  4C5I A;  2DO3 A;  5AYF A;  4X9D A;  3V8L A;  4F7U A;  4M77 F;  2VGM A;  4C8Q D;  1YIT T;  1YBY A;  3OMC A;  3PMI A;  2JTF A;  3CCU A;  5GMK e;  1KQ1 A;  3P8B B;  4IUT A;  3SWN C;  3QJ6 A;  4XTU A;  4JRP A;  1VQP T;  2LTO A;  2VYT A;  2LRQ A;  1S72 T;  2RI3 A;  3FC3 A;  1N27 A;  2XDP A;  3E9G A;  3H8Z A;  4MZM A;  3M55 A;  2E70 A;  5GAM f;  3JB9 G;  4JRQ A;  3CCJ A;  4E7K A;  2YLC A;  2LNV A;  5CQY A;  1VQ6 T;  1WQW A;  2E12 A;  2V8J A;  3X28 B;  4CI0 C;  1UEB A;  4N0A A;  2CZ7 B;  2L5Q A;  3MEA A;  2RHI A;  2CS7 A;  2RH2 A;  2XK0 A;  3HPW A;  4IUV A;  3A8O B;  3GNG A;  3LH0 A;  4LDV A;  4OVA A;  4XU1 A;  1YHQ T;  1XNI A;  4F7U B;  2DTI A;  1G3T A;  2WSC E;  2ZPG B;  4X9C A;  5HK3 A;  1BYM A;  4JRK A;  1M9S A;  1Q7Y U;  1S72 A;  3CCR T;  4XAX B;  4O6J A;  1XOV A;  4M78 C;  4R56 A;  3LW5 E;  1K9M C;  4KUD K;  4RCC A;  3V8K A;  3MO8 A;  4M7A A;  3LX7 A;  1NZ9 A;  3SD4 A;  1VQO A;  4M7D G;  4QVC A;  2O4X A;  2EJG A;  1IZ6 A;  2LCL A;  5GAM e;  4C8Q A;  5CAI A;  1X01 A;  3GLX A;  4XTX A;  1WJR A;  2DD5 A;  2FVU A;  2K5L A;  3S6W A;  4M7D E;  4PJO C;  3E9F A;  5LJ3 d;  1NJI C;  4M75 E;  3CME A;  1KC8 U;  2XHC A;  3Q1J A;  4A4G A;  3PIP A;  3JCM J;  2LT4 A;  3QG1 A;  2QQA A;  4M7A F;  4BE2 A;  2E10 A;  3G7Z A;  3M56 A;  3MP1 A;  1NE8 A;  1H3Z A;  2JOY A;  3CCR A;  3OYM A;  1ZQ1 A;  2HQX A;  5GMK l;  4OMF B;  1M1K C;  1Q82 U;  1M1G A;  5GAN 3;  4J6X A;  3OYH A;  4RG8 A;  2RHU A;  1NPP A;  5GAM g;  3CPF A;  3OMG A;  2GQV A;  3JCM d;  3HFN A;  1M8V A;  3GP8 A;  4N4I A;  1W2B A;  3M54 A;  4EMK B;  1KHI A;  4OF1 A;  2GCX A;  5EG2 A;  5I21 A;  1YJW T;  1B34 A;  4M75 A;  1FXX A;  4HCC A;  4BI4 A;  1LOJ A;  3VV0 A;  4F7U G;  3HRU A;  2NLU A;  4KBM B;  4BY6 B;  2LQK A;  5FRM A;  4M7D B;  3CCE A;  2RJF A;  3RMQ A;  2DXU A;  3CBO A;  4PKC C;  2GFU A;  4M77 G;  4M7A E;  3G4S A;  3V7R A;  5A0G A;  2P0Q A;  3CXC S;  1YJN T;  4OP0 A;  5GAN h;  3C12 A;  2QQB A;  3M5A A;  4M78 D;  2DJZ A;  3QZ5 B;  3CCL T;  4FSX A;  3RKW A;  3VKI A;  4C0G A;  2MMP A;  2L3R A;  1TH7 A;  2X4W A;  4C92 G;  5CCA A;  2EWN A;  4IUP A;  5J3B A;  4A4H A;  2FHD A;  3OYF A;  2QEX T;  2RM4 A;  5LJ3 f;  1K73 U;  1WJQ A;  2BUD A;  3GNF B;  3V7S A;  4JLI A;  1KQS S;  2RD1 A;  3RKY A;  1YJ9 A;  3OYB A;  4EDU A;  5FRN A;  4EMK A;  4C92 F;  3OS1 A;  1V29 B;  3H6Z A;  4M77 B;  3L2V A;  4BAC A;  1N8R C;  3OYJ A;  2M16 A;  2IG0 A;  4QQ6 A;  3JCM V;  3GPL A;  5GMK h;  3NTH A;  5FLX E;  2H3J A;  4JLG A;  3OYD A;  2X35 A;  2F69 A;  4QQD A;  3LWH A;  4BB7 A;  3L2U A;  3R6O A;  5CKE A;  3O8V A;  4PJO D;  1WJS A;  2RI2 A;  3OS5 A;  2VV5 A;  3A8M B;  4O5V A;  3VUB A;  5KE2 A;  2DXC A;  1YJ9 T;  4PJO A;  2EYQ A;  3QDR B;  3A8L B;  2OTJ T;  3F70 A;  2CGH A;  4IUQ A;  4QW2 A;  4NS5 A;  3G6E A;  2OTL A;  3KUF A;  3VJP A;  3FJP A;  1WNL A;  3QYH B;  1MGQ A;  4E47 A;  4QQG A;  5GMK i;  4Y91 A;  5GAN 4;  4C92 E;  5I2S A;  3NTK A;  3TCJ A;  4BE1 A;  1M4Z A;  1VQM A;  3ASK A;  3RIR A;  2GF7 A;  4F7U F;  2FB7 A;  1VQ4 A;  4XQ3 A;  4M77 A;  4PNO A;  5D6W A;  2MI6 A;  2XI9 A;  3JCM f;  3FEO A;  3OYC A;  3L1A A;  1KD1 U;  3CC2 A;  5HY6 A;  1K8A U;  1OYX A;  2MWO A;  2EQJ A;  3INZ A;  2AHJ B;  5A2Q E;  4MDX A;  4M77 E;  4DA4 A;  4M7A G;  4OGC A;  4PLI A;  4ZTJ A;  3QBY A;  4JS5 A;  5L8R E;  2EKO A;  2E5Q A;  4N4G A;  2VXE A;  3M59 A;  1N9S A;  1U1T A;  1B34 B;  2O01 E;  2I2L A;  3FIF A;  1VQ6 A;  1G3W A;  3PMT A;  3V8J A;  2XIC A;  2LQ8 A;  3BDL A;  1JJ2 S;  3WXM B;  2WSF E;  2DKG A;  3JB9 D;  3A8H B;  5CVI A;  2EFI A;  2KY9 A;  1BI2 A;  4A54 A;  1W2B S;  1VQ7 A;  3CMA T;  4LD9 K;  3JCM e;  1KQS A;  1VQL A;  2B8A A;  3L2W A;  1U1S A;  3OBW A;  3HP9 A;  4MDW A;  5KE3 A;  2CZ1 B;  2MAM A;  4Y28 E;  1VQO T;  2D9T A;  5J39 A;  2R57 A;  3L42 A;  2JVV A;  4EMK C;  3FLG A;  1WQ7 A;  4XTV A;  4XU3 A;  3T9N A;  4NL3 A;  1K73 C;  4J5Y A;  4LDY A;  3G71 A;  2RJC A;  1WPY A;  3CBP A;  1VUB A;  2D0Q B;  4OB3 B;  3UWN A;  3HL8 A;  1VQK T;  4ZN1 A;  5LJ3 h;  4J7I A;  4ZGD B;  3FRN A;  1Q81 C;  5D6Y A;  2LCC A;  4KUL A;  3OBY A;  4B9W A;  4XU2 A;  4C5H A;  3OYE A;  1QVF S;  4JRI A;  2DTH A;  3LLR A;  4N0A C;  2RHX A;  2KSS A;  3VU3 C;  2HAX A;  1QVG A;  4JS4 A;  3V7C A;  3MEV A;  3HKS A;  3QO3 A;  4J6W A;  1KHC A;  2O4X B;  5FU6 C;  5KH6 A;  1JBM A;  3CCS T;  2QQS A;  4ZTF A;  3L2Z A;  3HRT A;  5GMK j;  2XKO C;  4II1 A;  1BIA A;  2PVG B;  4BDZ A;  1YIJ T;  1Q86 U;  2F5T X;  3CC4 A;  5GAO l;  2MF2 A;  2XG8 D;  3J80 E;  3TEE A;  4M75 F;  4RKU E;  3CD6 A;  2V8I A;  4C8Q F;  2A3L A;  4N4H A;  4XTW A;  2JTM A;  3CXC A;  1AHJ B;  3JCM X;  1DJ7 B;  2ZPF B;  3LWI A;  3OYK A;  3BY7 A;  3S3N A;  1QP3 A;  4XU0 A;  3CME T;  1Q81 U;  1VQ8 T;  4PJO G;  1YIJ A;  3QSU A;  2K57 A;  5GAN f;  3GIB A;  1KD1 C;  2DXT A;  1P92 A;  1VQL T;  3EFS A;  3OS2 A;  1BI3 A;  1G3S A;  3KBG A;  5DLO A;  5GAN j;  1OZ3 A;  5GAM h;  1JRI A;  4A4F A;  4ELZ C;  1I4K 1;  5D6X A;  4ZN3 A;  1WGS A;  1IRE B;  2KAF A;  4IUU A;  3DLL A;  1W4S A;  3QZ9 B;  4EMH A;  3S3M A;  2PUO B;  4FM4 B;  2PVD B;  3PT9 A;  2DIG A;  2IVW A;  2YRV A;  4GLK A;  4D6W A;  2X4X A;  1UGS B;  4M7D C;  4E7L A;  2L8D A;  4Q5W A;  1VQ8 A;  2HBP A;  2KK4 A;  1OZ2 A;  3QPH A;  2P4T A;  5IT9 E;  2Y4X A;  1Y71 A;  3MET A;  4BI3 A;  2Y4Y A;  2EQU A;  5GAN 2;  3RMS A;  3CCE T;  3JB9 J;  3E1S A;  4KUI A;  2WAC A;  3RUX A;  4EPC A;  4X34 A;  4XTY A;  3RKX A;  2K4Y A;  5LJ5 g;  2ZPI B;  2HQE A;  1QP2 A;  2OAU A;  3OYG A;  5GAO q;  3PIO A;  3PTA A;  1D3B B;  3CPW A;  5DY9 A;  3MHX A;  3X24 B;  3C94 A;  4C5G A;  3CCM A;  3CCL A;  1I81 A;  5GAN g;  5GAN 5;  4C5E A;  5DM7 R;  4LDX A;  1RL2 A;  2M0O A;  3HHT B;  1QVG S;  3GOX A;  3I56 A;  2RO0 A;  1KC8 C;  5GAM j;  3QUI A;  4FL6 A;  2QEX A;  3CCQ A;  3C4S A;  2E65 A;  2E6Z A;  5GAO r;  1X75 C;  4FT4 A;  2R58 A;  3HRS A;  3QII A;  4A53 A;  1BI0 A;  2CZ0 B;  1N8R U;  2KDS A;  5IN1 A;  2DVE A;  4J6Y A;  5GAO n;  3CC2 T;  2QI2 A;  3AHU A;  1YJW A;  2RHY A;  1U8R A;  4KT0 E;  2K5F A;  5LJ3 e;  5LJ5 h;  3CC7 T;  4M78 G;  1X6O A;  5GAN 7;  4E7J A;  1BKB A;  2EIF A;  1LNX A;  1G5V A;  3OB9 A;  3DB4 A;  3OYI A;  1UB4 A;  3PFS A;  5IAY A;  2RJE A;  4QVD A;  3G4S T;  2HNI A;  3CCU T;  4M7A C;  2BKD N;  2QA4 A;  3TRE A;  4LDU A;  4M7A D;  2RI5 A;  1LJO A;  1UGQ B;  2VGN A;  4M78 F;  4RG2 A;  3CMA A;  4DOV A;  5LJ5 d;  2OTL T;  1QW1 A;  2QXF A;  4L6V 5;  2VXF A;  1MHN A;  4M75 B;  4UC4 A;  2JNG A;  1JB0 E;  4C0D C;  4C8Q E;  4EMG A;  4M75 G;  1VIE A;  2QQ9 A;  5C0M A;  4E7I A;  3N5B B;  3VYH B;  1VQ5 A;  2C06 A;  2RA2 A;  4DQ2 A;  2ZPE B;  2DZC A;  1Y96 B;  4Z02 A;  2DXB A;  1M90 U;  5M9O A;  2YLB A;  5LJ3 j;  5KCH A;  2PQW A;  1VQM T;  4A4K A;  3TU4 K;  5CKF A;  2LVM A;  3SB2 A;  4PLL A;  5CO7 A;  5FU7 B;  4DOW A;  4NL2 A;  2YHT A;  2DPP B;  2K3Y A;  1VQ5 T;  1I8F A;  4C8Q B;  3QKJ A;  1HXD A;  1QVP A;  2Y90 A;  4FT2 A;  2XDD A;  3M53 A;  3BDU A;  4M75 C;  3I56 T;  3MEU A;  4P5N A;  4M7D F;  4ELY C;  4M75 D;  3NFC A;  3CCQ T;  3QHS A;  2CZ6 B;  2XD0 A;  3L2R A;  2GFA A;  3EFR A;  3A5Z B;  4PJO F;  4M77 C;  3JCM c;  3X26 B;  1Y7X A;  2LT1 A;  3ZEH A;  5GAN 6;  1D3B A;  1ZBX A;  1VQN A;  4HT8 A;  4MZT A;  4ATO A;  2E1H A;  2A7Y A;  3G6E T;  3A8G B;  2RB6 A;  4OB0 B;  4OB1 B;  1M1K U;  3CC7 A;  1UGR B;  5A0L A;  1FWZ A;  3OQ5 A;  2QDY B;  1VQ9 A;  3CD6 T;  3JB9 I;  2DD4 A;  4CRI A;  2F5K A;  2RJD A;  4BE0 A;  1Y07 A;  2ZPH B;  1H64 1;  3GF5 A;  4LDW A;  4C92 C;  3CCJ T;  3LYI A;  2DZ9 A;  2XDB A;  3MEW A;  3OW2 S;  3EAE A;  3ER0 A;  3URG A;  1O9S A;  4E7H A;  4XK8 E;  4HCB A;  3RES A;  3I55 A;  2DAQ A;  1BIB A;  1UGP B;  3JCM h;  1VQK A;  3BFM A;  1VQN T;  3OYN A;  2DEQ A;  5CQX A;  3G71 T;  3X25 B;  4L59 A;  2WSE E;  3J7A F;  3JRZ A;  2LDM A;  4VUB A;  3OYL A;  1ZHI A;  4HCZ A;  5DLQ E;  4BY6 C;  3JSC A;  1OI1 A;  2FYK A;  2M9U A;  2ZGW A;  1YIT A;  3QXE B;  1I5L A;  1BI1 A;  2DK3 A;  1O75 A;  5HKC A;  2DIQ A;  4TVR A;  4A4E A;  4BUG A;  3CCS A;  3E19 A;  3OY9 A;  3JB9 F;  4BD3 A;  5CIU A;  4J7F A;  3M4G A;  4PL6 A;  3ZBD A;  2K2V A;  4HKE A;  3VUZ A;  3VYG A;  4IKF A;  2CKK A;  3PGG A;  3M57 A;  4M77 D;  3DB3 A;  3JCM Q;  2VC8 A;  5GAN e;  3L2Q A;  1N6A A;  3HSB A;  1PSF A;  2ZCF B;  1M1F A;  3P8D A;  2V8K A;  2ZPB B;  3CEY A;  4MMK A;  3JB9 H;  2X4Y A;  3MCA B;  2EAY A;  1Y96 A;  2PVO B;  2ZZD A;  4PJO B;  4C92 D;  2PUK B;  4NOY A;  1VQ9 T;  1G3Y A;  5GAO p;  4R55 A;  1R8O B;  5HK0 A;  4C92 B;  5CR2 A;  2RK1 A;  2P0P A;  3NTI A;  4M78 B;  4IUR A;  4OGE A;  1YCY A;  2JZ2 A;  2E41 A;  2KQW A;  5CKB A;  3M58 A;  4C0Z A;  1YJN A;  2M1H A;  4FIB A;  2VUB A;  4ZGJ B;  1YI2 A;  2QQR A;  3I55 T;  2R5A A;  3SDZ A;  5GAN 8;  1XTD A;  3M9Q A;  3OSV A;  4F7U E;  5A0D A;  5CKD A;  3JAM E;  4J8O A;  3OS0 A;  4PJO E;  3LGF A;  4L5G A;  3SFM A;  4WF2 A;  3RER A;  1XQH A;  3OYA A;  5LJ5 f;  3UPU A;  2LC4 A;  4LD6 A;  3UDC A;  2QTX A;  5FU6 B;  3JCM P;  4YTL A;  2JUF A;  1HK9 A;  2LX9 A;  1Q7Y C;  3BW1 A;  4C8Q C;  4GY5 A;  4ZGE B;  1VQ4 T;  4B9X A;  2L89 A;  1K9M U;  4JDS A;  5FU7 C;  1YI2 T;  2K3X A;  2DTO A;  3JCM W;  3LGL A;  2R5M A;  5KCO A;  3SWN B;  5LJ5 e;  4M78 A;  1KQ2 A;  3QJY A;  3CCM T;  3JCM g;  2MWP A;  4C92 A;  3CCV A;  5LL6 S;  5GAM d;  4FU6 A;  2E6N A;  1M5Q 1;  3ME9 A;  2CYZ B;  3UT1 A;  4M78 E;  2EJF A;  3P8H A;  1GXI E;  4J83 A;  4MML A;  1FX7 A;  4BDY A;  3KXT A;  2PU9 B;  4XTZ A;  5GAN d;  2P0K A;  3DKM A;  4C0D B;  4C8Q G;  3J81 E;  1N9R A;  5GMK m;  1JJ2 A;  3S3O A;  1QVF A;  3WVE B;  3OYY A;  2EQK A;  1Q82 C;  3WVD B;  5CK9 A;  2FL7 A;  1VQ7 T;  4M7A B;  3CCV T;  1KG1 A;  4MZP A;  3X20 B;  3HFO A;  4HA8 A;  2KMT A;  2G3R A;  1VIF A;  4QVZ A;  4ME7 A;  1EIF A;  3C95 A;  1Q86 C;  3CBM A;  2HD0 A;  2D6F A;  1NJI U;  3SWN A;  4RMO A;  5LJ5 j;  3MP6 A;  3JCM b;  1YHQ A;  2QA4 T;  1SSF A;  3CPW S;  3QYG B;  3OA6 A;  4JUV A;  5J26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...