5I11A

Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain t114s-q128r mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNSEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain T114S-Q128R mutant
rcsb
source organism Gallus gallus
total genus 6
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5i11A00
1X6GA 2D0NA 2W10A 4Z8AA 1AD5A 3R6NA 4RTYA 2SRCA 2M51A 2ENMA 2LJ3A 4F16A 1CKBA 3I9QA 2MCNA 1VYVA 4IIMA 3EHQA 4RTWA 1UECA 1HD3A 4OMNA 2CSQA 1S1NA 3EG1A 1T0JA 2AK5A 2GGRA 2JS0A 4RTVA 2DRMA 3QWYA 2CREA 2V1RA 3REBB 4CC3A 1IO6A 2FPDA 2EW3A 2CUDA 1MV3A 1WXBA 2YUNA 3EG0A 2NUZA 1WI7A 1K4US 3VS1A 2AKLA 1H3HA 4AFUC 1YP5A 2KE9A 2J05A 1RLPC 1GBQA 4HVUA 1AWXA 2KXCA 2LZ6B 2OI3A 1YN8A 2J6FA 4E6RA 2AZVA 2BZ8A 3VS0A 4OMOA 1Y0MA 2FPFA 2HSPA 2RNAA 3ULRB 1SEMA 2A36A 4RTXA 1RLQC 3UATA 2IIMA 4DEXA 4AFSC 2BZYA 2O2OA 4KRTA 4JPBW 1NYGA 2CDTA 2DBKA 2KT1A 2GBQA 2KGTA 2YSQA 4WCIA 3VS3A 2A08A 2K79A 1CKAA 1HSQA 1G83A 1M27C 3I5RA 4ORZA 4D8KA 1RI9A 2K2MA 1AZEA 1I0CA 4AG1C 1AWOA 3TVTA 2GNCA 2CUBA 1Z9ZA 2GTOA 1W70A 3UA6A 2EYXA 3VRYA 2AKKA 1M3BA 1Z9QA 2RQTA 3M0UA 2J7IA 1XOVA 1U06A 1SRMA 2RF0A 3U23A 5ECAA 4RTZA 1MV0B 2L0AA 1UFFA 3VS7A 1BK2A 1ZUUA 2EGAA 2PTKA 4GLMA 1GFCA 5HCKA 1NLPC 2O31A 1K0XA 1OOTA 2A37A 3NMZC 3PVLA 1ZBJA 4ZNXA 4CC7A 2NWMA 1PKTA 2KRSA 2DF6A 4OMMA 1NEGA 1WX6A 4F17A 2DE0X 2DL5A 1AWJA 2EVRA 2ROLA 1PHTA 2FPEA 4OMPA 2DVJA 1PKSA 1QLYA 1SSHA 1WIEA 2DMOA 3QWXX 1X69A 1EFNA 4J9DA 3RBBB 2RQRA 1ZX6A 3UF4A 1J3TA 2O9SA 3UA7A 2OAWA 1T0HA 1UDLA 1UJ0A 4J9HA 2DL3A 1ZUKA 2JMAA 2EGEA 2EYYA 1E6GA 4X1VA 2DLPA 3PVQA 1KFZA 2L3QA 5IHIA 1TUDA 1SHGA 2M0YA 3M0TA 4K11A 1GCPA 2DYBA 2KT8A 2VWFA 2BZXA 2LP5A 1W1FA 1I07A 1SRLA 2DBMA 3TSZA 4Z89A 2EQIA 2EGCA 1GFDA 3M0PA 2J6OA 3SHWA 3EHRA 2KYBA 3CQTA 2VVKA 2G6FX 5FWBA 1OV3A 5IHNA 2RQUA 2EYWA 4FSSA 2EBPA 1PRLC 2CSIA 3M0SA 1AWWA 2JW4A 4HVWA 2B86A 2DL7A 5GJWB 4LNPA 3H0FA 3NPFA 3EGUA 1X43A 1E6HA 2DJQA 2LJ0A 1GCQC 1UE9A 1WA7A 1UHFA 2KYMA 1NEBA 2KRMA 1AVZC 1X27A 4J9IA 1CSKA 2EPDA 1PNJA 2K3BA 2DILA 4JZ3A 1YWPA 2K9GA 2HDAA 4IIOA 2ED0A 2RQVA 1T3SA 2LMJA 1M8MA 4QT7A 2JT4A 2DNUA 5IXFA 2L2PA 4J9GA 2D8HA 4RTTA 1MUZA 5L23A 1TG0A 3VS2A 1WYXA 2YT6A 2LX7A 4Z88A 3A98A 2AZSA 4OMQA 1VYUA 1JO8A 2YUPA 3VS6A 5I22A 2RQWA 4ESRA 1JQQA 2KEAA 2QDLA 4HCKA 3EG2A 1VYTA 1BBZA 2FO0A 2PNIA 1ZLMA 2KR3A 4A63B 1JEGA 4D8DA 1NG2A 1GBRA 1WLPB 3VS5A 2ED1A 2FG0A 2LQNA 2X3XD 1NLOC 1NM7A 2EYZA 1ABQA 2JXBA 1W6XA 1QWEA 3M0QA 2ESWA 2KXDA 1SHFA 3I35A 2VKNA 2P4RA 1FMKA 1OPLA 1K1ZA 3JV3A 2E5KA 4LN2A 1U5SA 2YUOA 2RPNA 1U3OA 2C0IA 2ABLA 1GCQA 1WXUA 4OMLA 3THKA 3O5ZA 2H8HA 4LE9A 2BTTA 1ABOA 1RUWA 1FYNA 2MIOA 2RN8A 4RTUA 4LUEA 1UUEA 5GJVB 3M0RA 1K9AA 3H41A 2J6KA 4AFZC 1H8KA 1BB9A 1N5ZA 2W0ZA 2PZ1A 1UJYA 1I1JA 4J9BA 4J9CA 4J9EA 4HXJA 2CT3A 1UTIA 1GRIA 3I5SA 2K7AA 3H0HA 4LUDA 1TUCA 1WXTA 2HBWA 3KFVA 2YDLA 2KROA 4EIKA 1JXMA 2JM9A 1UGVA 4M4ZA 2C0TA 4JZ4A 2X3WD 2J06A 1X6BA 2DL8A 2DX1A 2MOXA 1M3AA 2D8JA 1LCKA 2SEMA 1GL5A 1K76A 1PWTA 4Y92A 1YNZA 4JJDA 2HEQA 2XMFA 1M3CA 1OPKA 1H92A 2DA9A 1KIKA 3GBQA 1E7OA 1B3QA 5FW9A 4GBQA 4AG2C 4CC2A 1B07A 1X2KA 2A28A 3VRZA 1QKXA 2ROTA 2JMCA 1KSWA 1X2QA 2CH4A 3H0IA 3SEMA 4F14A 2D1XA 2EKHA 4HVVA 2JTEA 2DRKA 2ECZA 1K0SA 4DEYA 1KJWA 2FEIA 2JM8A 1PRMC 2OJ2A 5I11A 1ARKA 5IH2A 2YUQA 5IHKA 2F2WA 3FJ5A 2JS2A 2LCSA 3C0CA 2FRWA 2DL4A 1YWOA 1G2BA 1A0NB 1UG1A 2FRYA 1V1CA 1VA7A 4RUGA 2CT4A 4R0KA 3EG3A 1YCSB 2GQIA 2K6DA 1BU1A 3LH5A 3RNJA 1OEBA 2KBTA 1AZGB 1QKWA 2V1QA 5EC7A 2O88A 1UHCA 1WDXA 3REAB 2CH4W 1ZSGA 3PE0A 2KNBB 1NYFA 1AOJA 2C0OA 1HJDA 2LJ1A 1JU5C 3VS4A 3IQLA 2O9VA 1SPKA 2F2XA 2I0NA 3TSWA 1AEYA 1M30A 1ZUYA 2RMOA 4AFQC 1Y57A 2DM1A 2LNHB 1QCFA 2F2VA 1QWFA 3NGPA 3NHNA 5IXBA 5FWCA 3ZL7C 2L3SA 4JJCA 1T3LA 1JXOA 2L3PA 4CC4B 2KRNA 1WFWA 2LQWA 4JJBA 2GTJA 4J9FA 2HCKA
chains in the Genus database with same CATH superfamily
1YBYA 2D0NA 4QQGA 2DERA 1FMWA 3I55A 1AD5A 4TVRA 4C8QA 1NE8A 2RJFA 3CCJT 4F16A 2MI6A 5CKHA 2PU9B 3QBYA 4FW1A 2MAMA 2RI3A 2RHZA 1K8AU 3OYNA 2JN0A 1U1TA 1OULA 2DRMA 3REBB 5LJ5j 1BI2A 3HTRA 4C8QB 5HK0A 1WHLA 2CUDA 4PLIA 5LJ5f 1WXBA 2YUNA 4PJOF 1NPRA 3CCMQ 1WI7A 5CCAA 1N9RA 3R6OA 1VIEA 3L2QA 2O4XA 3A8MB 1M1GA 1RLPC 1M1KC 2EAYA 2KXCA 3BE3A 3CCUA 2MWPA 5HKCA 2J6FA 4A4EA 4A4GA 2BZ8A 3VS0A 2JUFA 2FPFA 3JCMc 1SEMA 4F7UE 2A36A 2LX9A 3EH1A 4BE1A 2YLCA 3QXEB 4FYXB 3OBYA 4C92G 4E7KA 3LYIA 1M2VA 4CI0C 1WJSA 2XG8D 5GANg 4WCIA 4MDXA 3OQ5A 3VS3A 5D6YA 3VYHB 2A08A 1M27C 2K79A 3I5RA 1VQ5A 3CCRT 2DIQA 3JSCA 2GNCA 1Z9ZA 4XU1A 3M57A 3QKJA 2QQAA 1W70A 2RI2A 2GCXA 2LCCA 2AKKA 5KYUB 2HKNA 2RF0A 3OW2P 1NJIC 2E1HA 1AT1B 4M75G 4LD9K 1K73R 1NLPC 1MMDA 1K0XA 1OOTA 3NMZC 4ZNXA 1ZBJA 3X24B 2QEXT 3OSVA 1WX6A 1Q86R 1AWJA 4Z02A 3CC7Q 2EVRA 2CZ6B 2ROLA 3DLLA 2FPEA 3KBGA 1YJWA 1PKSA 4JDSA 3MHXA 3OYAA 5DLOA 1Q82R 5KE3A 4J9DA 4EMKB 2D0QB 1ZX6A 2X35A 3UA7A 1UDLA 1UJ0A 3FJPA 2DL3A 3ME9A 2RO0A 2HKQB 4PJOE 2L3QA 3JCMW 2L8DA 4K11A 2DYBA 2KT8A 3AHUA 2VASA 2BZXA 2LP5A 1D0ZA 1BIAA 1KD1R 4IUUA 4XTUA 2EQIA 5GAN8 3M0PA 5A0DA 2VVKA 3CCJA 3G4SA 2G6FX 5FWBA 2RM4A 2O01E 3RR6A 4QKUA 1YI2A 4FYWB 1EIFA 2QA4Q 2RQUA 2EBPA 1TUGB 2CSIA 3FB9A 3M0SA 3OYFA 1YITA 2NUPB 3HL8A 2JW4A 1PC0A 5GJWB 3M56A 3QYGB 4LNPA 3NPFA 3CCMT 5GAMe 1E6HA 4NL2A 3UWNA 1UE9A 2QI2A 2DIGA 3GF5A 4PFOA 1WA7A 1UGPB 1UHFA 1VQ6Q 1X27A 1CSKA 4BDZA 2P0QA 3EFOA 1OX8A 2K3BA 4JZ3A 2NLUA 4C8QG 1F1BB 2EJ9A 3L2WA 3CPWP 2RQVA 1T3SA 1VUBA 1OZ2A 2JT4A 2DNUA 3L42A 4J9GA 2D8HA 2VXFA 3BDLA 3C4SA 2RK2A 4RKUE 2QASA 1IXDA 4Z88A 2CKKA 1H3ZA 2D6FA 1JO8A 3BDUA 5I22A 4ESRA 2CP0A 5CVIA 2X4JA 3BFMA 1VYTA 4FSXA 2RI5A 5A0LA 1JEGA 4D8DA 1NG2A 1SKUB 1GBRA 1WLPB 1KHCA 2X3XD 4WTOB 2ESWA 7AT1B 2FZGB 1SHFA 3TCJA 3I55Q 1IB8A 2KVQG 1QVFA 4BI3A 1MMAA 2M0OA 3JV3A 3L2VA 4RCCA 2DTIA 4ANJA 2C06A 2YUOA 1XNIA 2RPNA 2VGMA 3E19A 1WXUA 3CC7T 3OYEA 3M53A 4LDYA 3O5ZA 2H8HA 4LE9A 1WHHA 4GY5A 4RTUA 4V2SA 4LUEA 1UUEA 5GJVB 3H41A 2J6KA 2D9TA 1H8KA 1G3SA 2OAUA 2PZ1A 1FWZA 2GFAA 1UJYA 1M1FA 3FIFA 2E64A 4J9BA 2COYA 1M9SA 1GXIE 3ASKA 4BUGA 2E12A 2RK1A 4KUIA 1BI1A 3CMEA 3CCUQ 4OB2B 4DBQA 1PG5B 3KFVA 4M4ZA 1B34B 2J06A 1X6BA 3G6ET 2QQSA 1Q81U 2DL8A 2DX1A 1P92A 3ZBDA 1M3AA 2PVGB 1TWBA 5LJ3g 2SEMA 4C5HA 5GAMd 1K76A 4M7DB 4Y28E 4EMKC 1QVFS 4A4KA 1M3CA 1QQJA 2A0FB 2DXUA 1H92A 1WQ7A 2QA4T 2DA9A 5I2SA 1VQ5Q 2EJFA 3CCQT 3CC2Q 3GBQA 3RMSA 2VYTA 1VQ7Q 3M4GA 1E7OA 5FW9A 2LT1A 2DD5A 1X2KA 3VRZA 1QKXA 2ROTA 3X28B 3RIRA 2KMTA 4MMLA 3CCMA 3G71Q 1VQ6T 2EKHA 1VQLQ 2COZA 3JRZA 2OJ2A 1ARKA 1W4SA 2F2WA 1KC8U 2FRWA 4C5IA 5J39A 1D0YA 1VA7A 2OTLQ 3S3NA 3JB9H 2CT4A 1RAIB 4QQDA 3EG3A 1JBMA 1TXQA 2RHYA 1QW1A 2KBTA 1QKWA 5EC7A 1K8AC 3QJYA 3G7ZA 1IGUA 4M77F 3JCMJ 1ZSGA 3PE0A 2KNBB 3LGLA 4ZN1A 3KXTA 1N8RU 2C0OA 4F7UA 1VQ8Q 3L2ZA 1D1CA 4PLLA 2O9VA 4L5GA 1SPKA 2F2XA 4JRIA 1AEYA 1M30A 3VV0A 4XQ3A 2K2VA 3I55T 4R56A 2F2VA 3NHNA 2F1LA 5FWCA 4E7JA 2KRNA 2NUTA 3HP9A 4M78F 1PD1A 3G4SQ 1TTHB 4BE2A 4J9FA 2AT1B 2CS7A 3OYYA 1YI2Q 3CD6Q 3CPWA 3A1PA 4B9WA 5KYYA 1YITQ 1ZQ1A 1BCMA 2MCNA 4HCCA 3EHQA 2ATCB 4M7AA 3C95A 1ZSZA 4OMNA 4ZGDB 5GAMj 2AK5A 2JS0A 5C6SA 4A54A 1I81A 5LJ5g 3CCUT 3JCMe 4C92B 2DZ9A 3LWHA 3GOXA 4J8OA 2CREA 2V1RA 4CC3A 1IO6A 3WXMB 2FPDA 2PUOB 2MMPA 3DLMA 6AT1B 3EG0A 1PCXA 1Q7YU 3H8ZA 3FEOA 1UGSB 5GAMh 1Y96A 1EZZB 1LOJA 2P84A 2OI3A 4PJOA 4LDVA 1VQ5T 4M75B 1KQSP 1SSFA 4F04B 1Y0MA 5FU7B 3CBMA 3CC2T 2RNAA 2MYSA 4YTLA 1QVGP 1RLQC 3H6ZA 3UATA 2IIMA 3JB9F 2YRVA 3N5BB 4CRIA 3E2UA 4M77E 3MO8A 4JPBW 1NYGA 2DBKA 2KT1A 4M78C 1AHJB 4J7IA 4M7DG 4PFPA 2X51A 1TH7A 4Q5WA 3G71T 4PJLA 4KH0B 1JJ2P 2DFUA 4D8KA 1AZEA 1OI1A 4VUBA 4M7DC 2X4WA 1M3BA 3L2RA 1XOVA 4KT0E 3CBOA 2XU8A 3OYIA 2IPOB 4LD6A 5KYXA 2OTLT 2YRDA 1YJWT 4O5VA 4M78E 1UFFA 1BK2A 3FDRA 1GFCA 5HCKA 4M7AD 4JS5A 3PVLA 4HCZA 2FZKB 3EG9B 1PKTA 2Y4XA 1M1KR 4UC4A 2CP2A 2DL5A 5GANe 3CXCP 2HQXA 4OGEA 2ZGWA 3RKXA 5FROA 3VKIA 2PVDB 4OMPA 3CMEQ 1WIEA 4ZTJA 3SWNA 1M2OA 1X69A 1EFNA 3EGDA 2RQRA 3EGXB 3LLRA 3OYMA 1XJWB 3SFMA 1T0HA 5A2QE 1QCOA 4PJOD 1LPLA 1PM3A 3QUIA 1VQMQ 3HRTA 1E6GA 3CCLA 4X1VA 2EQKA 3OA6A 3MP1A 4DA4A 3PIOA 1TUDA 3G4ST 3M0TA 3A8OB 4P5NA 1YI2T 4RG8A 3V8KA 1V76A 3CD6T 1HK9A 4J7FA 1NJIR 5GAN5 4Z89A 5KCOA 3ZEHA 2JZ2A 1YITT 1GFDA 4R55A 1R0CB 1VQOA 3EHRA 2KYBA 3VUBA 2FZCB 1ZA1B 4XU2A 4F7UG 1G3WA 4AT1B 1D0XA 1AWWA 1G5VA 1C0MA 3S3OA 2HL5C 3H0FA 3EGUA 1X43A 2AHJB 3OS1A 1SF9A 4Y91A 3RKWA 2KDSA 2EPDA 1PNJA 2FVUA 2O4XB 2DILA 1YWPA 2HDAA 4B6MA 1RABB 1OU8A 3CC2A 4C92C 4RTTA 2HNIA 5L23A 1YFNA 1MUZA 3TEEA 1VQ7A 4M7AG 1WNLA 3HPWA 3RKYA 1KQ2A 3CPFA 2FHDA 3A98A 4X9CA 1I8FA 2RQWA 1M2VB 2QDLA 3G71A 3A8HB 3EG2A 2PNIA 1VQLA 3WVDB 4A63B 5GANd 1MNEA 5DM7R 4KGZB 3PTAA 4M75C 2ED1A 2LQNA 1M90U 3META 2JXBA 3OYHA 2RH2A 1VQNA 1W6XA 1QWEA 3INZA 2VC8A 4IUVA 5FLXE 1Q81C 1UGQB 3I35A 5J3BA 2QQ9A 2OTLA 3A8LB 4PJOG 1K1ZA 3OYGA 2E5KA 4IURA 1K9MU 2HSEB 1WPYA 2RA2A 2C0IA 1GCQA 3BY7A 3EAEA 1Q95G 4C0ZA 5A0GA 2ZPBB 3QPHA 3CMET 3UDCA 1QVGA 1ABOA 1RUWA 2RN8A 4C8QF 1UGRB 2JTMA 1VQ8A 2GQVA 1C6VX 4OB3B 2W0ZA 3MEAA 2I2LA 2X4XA 3V8JA 1VQMT 1JJ2A 1IHVA 4N4HA 3GLXA 2HZYA 4J9EA 2CT3A 1GRIA 3A5ZB 2MF2A 1WHJA 2DVEA 2K7AA 3H0HA 2MPXC 5GAOn 1KC8C 4PFZA 2YDLA 2DZCA 2JM9A 3CD6A 2E6ZA 1QP3A 3RUXA 3V8LA 2R5AA 4NS5A 1YNZA 1MMNA 2XMFA 3LX7A 1VQPQ 2DD4A 1KIKA 4PNOA 5AYFA 1N8RC 1YIJQ 1W2BA 2BIVA 4E7IA 3MEUA 1S72Q 4CC2A 1YCYA 1WJQA 2K5IA 1KSWA 2OTJA 3V7CA 2CH4A 2P4TA 3SEMA 4F14A 3GP8A 2JTEA 3QZ5B 1K0SA 5LJ3e 2E65A 4LDXA 1KJWA 2WSEE 1X75C 4C8QC 4D6WA 1NZ9A 4XTXA 3MCAB 2XICA 1VQ9Q 2JS2A 3CCSA 3LGFA 1N9SA 3C0CA 3EFOB 4OMFB 1U8RA 1A0NB 1QCNA 2LNVA 2ZPIB 2HBPA 4JS4A 4RUGA 5GANj 4E7LA 2E4HA 4R0KA 4OF1A 5GMKj 2GQIA 2K6DA 2RJEA 2E41A 3RNJA 1WHKA 1AZGB 2V1QA 2YRCA 3MJXA 2MK5A 4C8QE 1WDXA 3JCMV 3REAB 2EIFA 3SDZA 4BI8B 5GAN4 3CCLQ 2P0KA 5GANh 1I5LA 1HJDA 4L6V5 3OYKA 3QJ6A 5GMKi 2I0NA 2XIDA 5GMKh 4NL3A 1ZUYA 1Q7YC 4AFQC 1BI3A 2DM1A 2LNHB 4M77A 2EWNA 4E7ZA 5IXBA 4EMGA 1TOVA 1VQOQ 5M9OA 2L3PA 1WFWA 4C5GA 2LQWA 4LXCA 2HCKA 2LCLA 2DXBA 2W10A 2K3YA 4Z8AA 3H9NA 3I56Q 4RTYA 4HA8A 2SRCA 2M51A 1QP2A 2ENMA 4M78A 5I21A 1CKBA 3I9QA 3URGA 1VYVA 4IIMA 2HAXA 1KQ1A 3OW2A 1HD3A 2CSQA 4JUVA 1K8AR 2DEUA 1VQMA 1QVPA 4RTVA 4MZMA 5D6XA 1B7TA 3PT9A 4IUPA 3QWYA 2QK0A 1RADB 1MV3A 4PJJA 1K4US 3VS1A 1JRIA 1H3HA 5I2MA 4AFUC 3CMAA 2CP5A 2LVMA 1LVKA 2JVVA 2LZ6B 4E6RA 2AZVA 3M5AA 2ZAEA 4ELYC 5LJ3d 2OX7A 3ULRB 3P8DA 3E1SA 1VIFA 3OS0A 1YIJT 2VUBA 1S72T 4M77D 5LJ5e 5CQYA 2O2OA 4KRTA 2QGFB 3CCVA 2XHCA 2CDTA 2GBQA 2ZCFB 4FYVB 1VQNQ 3MKDA 1D3BA 4OVAA 1CKAA 1G83A 1RI9A 1I0CA 4AG1C 1AWOA 3TVTA 3OW2S 2EYXA 1VQ9T 1RL2A 1Z9QA 4BI4A 3M0UA 3P8HA 2J7IA 2DKGA 8ATCB 3U23A 1VQKA 5ECAA 3OY9A 4RTZA 2L0AA 4M78D 3PNWC 4JJNK 1LNXA 1ZUUA 2EGAA 4GLMA 1K73U 1D3BB 1WQWA 2O31A 5GMKl 2A37A 3KUFA 1R0BG 2NWMA 2KRSA 2DF6A 4OMMA 1NEGA 1Q86U 3CCLT 2XI9A 2QYZA 2DVJA 3NFCA 4XK8E 5IT9E 4XTWA 2EKOA 3QWXX 4EDUA 4IUTA 2VGNA 4B9XA 1Q82U 4RCBA 4F7UB 2LT4A 2OAWA 4J9HA 2JMAA 1ZUKA 1VQOT 2EGEA 4A53A 3M54A 1UEBA 4M7DF 2DLPA 5C0MA 4DOWA 1KFZA 2YHTA 1SHGA 3D7SB 1GCPA 2LDMA 1WGSA 1KHIA 2NUTB 3I56T 2DBMA 5KH6A 2HD0A 5GAMf 1KD1U 3TSZA 4ZGEB 4KGXB 1UB4A 3PIPA 2EGCA 5CK9A 4KBMB 5HY6A 2E70A 5CQXA 2L89A 3JB9D 4PKCC 3CQTA 3X25B 2M1HA 4E47A 5KYYB 2OTJQ 3J7AF 3DKMA 5KCHA 4M7AB 1ZSZB 2QQBA 3UT1A 3NTKA 4J6WA 1BYMA 4FSSA 1PRLC 1WJRA 4M77G 1M90C 3CCSQ 2B86A 5LJ3j 5LL6S 4A4HA 1RAGB 5HK3A 4QQ6A 2LJ0A 3P8BB 2LRQA 1VQ7T 4DBHA 1PD0A 2KYMA 1N27A 1NEBA 5CAIA 2KRMA 3M4YA 4J9IA 1RI0A 1IZ6A 2E5QA 2QTXA 1K9MC 3CPWS 4J5YA 3JB9I 4MZPA 2K9GA 1VQPA 5GAOm 1Y96B 4IIOA 2IVWA 4XTVA 4KGVB 3C12A 5LJ3h 4RG2A 1VQLT 4BB7A 3HFNA 4PJOB 3CCEQ 2EFIA 3VS2A 2K3XA 1WYXA 2YT6A 1YIJA 2LX7A 1S72A 1VQNT 1ZBXA 4RMOA 1TSFA 3OSSC 2LQKA 3X20B 5KYWA 1JQQA 2KEAA 3FLGA 3HRSA 3J80E 4HCKA 1BBZA 5GAOl 1ZA2B 3VS5A 2KAFA 3CC4Q 1VQ9A 2FG0A 1NLOC 1NM7A 2EYZA 1ABQA 2YLBA 4JRQA 1V29B 2X4YA 3M0QA 4M7DE 3RMQA 2JOYA 3EFRA 2P4RA 3FC3A 2BKDN 2Z0WA 5KYXB 1VQ8T 4DOVA 5KYWB 4LN2A 2E6NA 2E3IA 1U5SA 4QVCA 2PQWA 4NOYA 1U3OA 2K5LA 2ABLA 3VU3C 2E3HA 2V8KA 3THKA 3RERA 3Q1JA 4A4FA 2V8IA 2QQRA 4C92F 2BTTA 2RB6A 4ME7A 4BY6B 3JB9G 3LH0A 1N5ZA 3SWNB 3JCMd 4WF2A 2ZPEB 3E9GA 4M7AF 2EQMA 3EGDB 2V8JA 2CP7A 3CMAQ 1MHNA 3S6WA 1UTIA 2DEQA 3DB3A 4GLKA 1G3TA 2XDPA 4HT8A 4FYYB 3I5SA 4LUDA 4M75F 1WXTA 1N6AA 2DO3A 2HBWA 2KROA 1WHMA 2C0TA 3DB4A 2QTVA 1M8VA 2X3WD 2H3EB 1Q81R 1D1BA 1EX4A 3I56A 1LCKA 3JCMP 8AT1B 3RDVA 3CCVQ 1PWTA 4Y92A 4JJDA 2DAQA 1RAEB 2OTJT 5GAN3 2LTOA 2KI7A 3TU4K 1QVFP 4N0AC 1NPPA 3CCST 4KULA 4GBQA 1KG1A 3MP8A 1OZ3A 4AG2C 2A28A 1VQKQ 4FW2A 2JMCA 2JTFA 4DQ2A 5LJ5h 5CO7A 2BE7D 2D1XA 4HVVA 5KYUA 2M9UA 4FT4A 2ECZA 2FEIA 3HRUA 2JM8A 3QDRB 3OYDA 1PRMC 3NTHA 3MP6A 2YUQA 5IH2A 2LCSA 1SG5A 3VJPA 3OBWA 1KC8R 2H3JA 2DYIA 4FU6A 4QVZA 4M7AC 1YWOA 3PMTA 3EFSA 4OGCA 1ZSZC 3CCET 1UG1A 2FRYA 1TU0B 1V1CA 2DXCA 3O8VA 1M5Q1 3QDFA 1YCSB 2F5TX 3F70A 4C92E 5FU7C 1O75A 1BU1A 1X01A 1FMVA 1OEBA 2BUDA 4C8QD 2XD0A 2O88A 2LQ8A 2CP6A 2CH4W 1I5OB 2CZ7B 1N8RR 4M7AE 3CC4T 4FCYA 4EMKA 1JU5C 3VS4A 2DK3A 2K5FA 2YXYA 2MWOA 4HKEA 4PJOC 3UPUA 3TQ7P 1KQSA 2PVOB 1OQKA 4M75E 1WZOA 3OB9A 3NGPA 3V7RA 3ZL7C 2L3SA 1JXOA 4CC4B 4MDWA 1KK7A 1RACB 3JCMf 1Y7XA 2KK4A 1X6GA 2NYSA 5CKDA 3R6NA 2R5MA 1D1AA 1IREB 3ZFJA 2LJ3A 3HKSA 5GAOp 1HYOA 4PJNA 3A8GB 4RTWA 3JCMh 1UECA 1H641 1S1NA 2DPPB 3EG1A 3CMAT 1T0JA 1YJNA 2GGRA 4PK4A 1G3YA 2NUPA 3G6EQ 4XU0A 2XK0A 2X9HA 5D7UA 2R58A 3C94A 2EW3A 3SB2A 4LDUA 2LC4A 2JJ9A 2EYQA 2NUZA 1Q7YR 3CXCA 1VQ4Q 1K73C 2AKLA 2GF7A 3CCVT 3EH2A 3CCQQ 1YP5A 4BY6C 1KQSS 2KE9A 2J05A 4HVUA 1AWXA 1IGQA 3SWNC 1YN8A 1QVGS 1BI0A 1Q86C 4O6JA 4OMOA 2HSPA 4RTXA 4DBRA 2M16A 4JLGA 4DBFA 4DEXA 4AFSC 2BZYA 1Q82C 1Y71A 3QYHB 1JJ2S 1VQKT 3GNFB 2KGTA 5GAN2 2YSQA 3M59A 2IG0A 2G3RA 1HSQA 1RAHB 4ORZA 1O9SA 2K2MA 1Y07A 2ZPHB 5GANf 2CUBA 2GTOA 2CGHA 3UA6A 3VRYA 2RQTA 2KQWA 2K4YA 2COWA 3L1AA 1U06A 1SRMA 1YHQQ 1MV0B 1KD1C 1PSEA 2YWWA 4PL6A 3VS7A 2PTKA 3CCEA 3T9NA 1MMGA 2P0PA 3VUZA 3CCRA 3CXCS 4CC7A 5KE2A 1M1KU 2DJZA 1W2BS 4F17A 2DE0X 1YJ9Q 1FX7A 2DTHA 1JB0E 1ACMB 1PHTA 4ZN3A 4ZTFA 3J81E 1FXXA 2DTOA 4BD3A 1QLYA 1SSHA 2DMOA 5GAOr 3CC4A 2VXEA 1I4K1 3RBBB 2QEXA 5CKBA 3OYCA 3UF4A 4C0GA 4C5EA 1J3TA 2O9SA 2FYKA 2EQJA 2F5KA 2EYYA 4M77B 3VYGA 4KH1B 2FL7A 4QVDA 2QDYB 3PVQA 5FU6B 5IHIA 1OX9A 1B34A 2M0YA 5GAMg 2VWFA 3OYJA 3OMCA 4MMKA 1IRXA 1W1FA 1C1AA 1NJIU 1I07A 1SRLA 5IN1A 2Y4YA 4M7DA 3V7SA 4HT9A 2J6OA 1X6OA 5GAN7 1MNDA 4EMHA 3SHWA 1QMCA 3GNGA 1MGQA 3MPUB 3MEVA 1OV3A 4M78B 5IHNA 2A7YA 4X9DA 4IKFA 2ZZDA 2L5QA 2EYWA 5CIUA 5FRMA 2HQHA 1VQPT 3NTIA 4HVWA 2DL7A 3PGGA 2QG9B 3RESA 1RAFB 2DJQA 1VQ4T 3CBPA 4C0DB 4XAXB 4BE0A 1GCQC 4JLIA 3ER0A 3HHTB 3E9FA 3JAME 1AVZC 4AMCA 4ELZC 3QIIA 5FRNA 5CKFA 2QXFA 2XDDA 2ZPFB 2RHIA 4FT2A 2AIRB 2ED0A 3G1JA 3HSBA 5GMKm 1WHGA 2LMJA 1M8MA 2M02A 4QT7A 5IXFA 2L2PA 5CKEA 3M58A 3LWIA 3QZ9B 1BCOA 1TG0A 2XKOC 2RJDA 1IHWA 3QHSA 4FL6A 1DJ7B 2QAZA 4J6XA 2AZSA 4OMQA 1VYUA 4OP0A 4KUDK 2YUPA 3VS6A 2FO0A 1ZLMA 2KR3A 1YJWQ 3TREA 1BKBA 2FB7A 1RAAB 3MEWA 1YHQT 4FIBA 4BACA 4M7DD 1M90R 3S3MA 1OU9A 2EQUA 2KXDA 2PUKB 3HFOA 3QG1A 2DXTA 3CEYA 2VKNA 2RHUA 1FMKA 1OPLA 2WSFE 1VOMA 3JCMb 1D09B 4LDWA 4X34A 1TS9A 5DLQE 3GPLA 4IUQA 3PMIA 1K9MR 2CP3A 1YJ9T 2Y90A 3QSUA 1XTDA 4OMLA 2VB6A 1YJNQ 4N0AA 2XDBA 4L59A 2VV5A 1R8OB 1FYNA 3OS2A 2MIOA 5AT1B 2K57A 3LW5E 3M0RA 3WVEB 1K9AA 5GAN6 4AFZC 3CCJQ 2DETA 4PJMA 1BB9A 1ZHIA 5L8RE 2B8AA 4C92A 3CC7A 1I1JA 3GIBA 4J9CA 4HXJA 4MZTA 1TUCA 4E7SA 3M55A 4EIKA 1JXMA 1UGVA 4JZ4A 2E10A 4II1A 4ZGJB 4N4GA 2MOXA 2D8JA 9ATCB 1GL5A 5IAYA 3OYBA 2JNGA 3AT1B 4M75A 3QO3A 5J26A 2HEQA 3OS5A 5LJ3f 2L3RA 1OPKA 5LJ5d 3L2UA 3FRNA 1BIBA 1U1SA 4M77C 1OYXA 3G6EA 5FU6C 5D6WA 1B3QA 4QW2A 1LJOA 1B07A 3JCMX 2WSCE 1X2QA 2RD1A 3H0IA 4M78G 3SD4A 1VQ4A 2QA4A 1R77A 2CZ0B 5KYNA 3CCRQ 1XQHA 3CCQA 2DRKA 3X26B 4DEYA 3JCMQ 4E2FB 4XU3A 5I11A 2BE9B 5IHKA 4OB1B 3FJ5A 4XTZA 4N4IA 3JB9J 5DY9A 2HQEA 4EPCA 5CR2A 2DL4A 1G2BA 2F69A 2R57A 2QGGA 2KSSA 2CYZB 1HXDA 3EG9A 2WACA 4C0FA 3OMGA 5EG2A 1VQ6A 3M9QA 4ATOA 4C92D 4F7UF 4J83A 2HMAA 4XTYA 4HCBA 3LH5A 1PSFA 1NBEB 4C0DC 2QEXQ 1UHCA 2A3LA 4JRPA 2EJGA 2KY9A 1NYFA 2GFUA 1AOJA 4E7HA 2LJ1A 3EGXA 3OYLA 3IQLA 2CZ1B 3TSWA 1G8XA 4BDYA 1YHQA 2RMOA 3BW1A 1Y57A 4JRKA 1QCFA 4M75D 2ZPGB 1QWFA 5GAOq 4J6YA 3JCMg 5GMKe 1W2BP 4JJCA 1T3LA 4OB0B 1M4ZA 4JJBA 2HL3A 2RHXA 4FM4B 2V26A 2GTJA 2RJCA 3PFSA 1YJNT 1GBQA 1YJ9A
chains in the Genus database with same CATH topology
1X6GA 2D0NA 2W10A 4Z8AA 1AD5A 3R6NA 4RTYA 2SRCA 2M51A 2ENMA 2LJ3A 4F16A 1CKBA 3I9QA 2MCNA 1VYVA 4IIMA 3EHQA 4RTWA 1UECA 1HD3A 4OMNA 2CSQA 1S1NA 3EG1A 1T0JA 2AK5A 2GGRA 2JS0A 4RTVA 2DRMA 3QWYA 2CREA 2V1RA 3REBB 4CC3A 1IO6A 2FPDA 2EW3A 2CUDA 1MV3A 1WXBA 2YUNA 3EG0A 2NUZA 1WI7A 1K4US 3VS1A 2AKLA 1H3HA 4AFUC 1YP5A 2KE9A 2J05A 1RLPC 1GBQA 4HVUA 1AWXA 2KXCA 2LZ6B 2OI3A 1YN8A 2J6FA 4E6RA 2AZVA 2BZ8A 3VS0A 4OMOA 1Y0MA 2FPFA 2HSPA 2RNAA 3ULRB 1SEMA 2A36A 4RTXA 1RLQC 3UATA 2IIMA 4DEXA 4AFSC 2BZYA 2O2OA 4KRTA 4JPBW 1NYGA 2CDTA 2DBKA 2KT1A 2GBQA 2KGTA 2YSQA 4WCIA 3VS3A 2A08A 2K79A 1CKAA 1HSQA 1G83A 1M27C 3I5RA 4ORZA 4D8KA 1RI9A 2K2MA 1AZEA 1I0CA 4AG1C 1AWOA 3TVTA 2GNCA 2CUBA 1Z9ZA 2GTOA 1W70A 3UA6A 2EYXA 3VRYA 2AKKA 1M3BA 1Z9QA 2RQTA 3M0UA 2J7IA 1XOVA 1U06A 1SRMA 2RF0A 3U23A 5ECAA 4RTZA 1MV0B 2L0AA 1UFFA 3VS7A 1BK2A 1ZUUA 2EGAA 2PTKA 4GLMA 1GFCA 5HCKA 1NLPC 2O31A 1K0XA 1OOTA 2A37A 3NMZC 3PVLA 1ZBJA 4ZNXA 4CC7A 2NWMA 1PKTA 2KRSA 2DF6A 4OMMA 1NEGA 1WX6A 4F17A 2DE0X 2DL5A 1AWJA 2EVRA 2ROLA 1PHTA 2FPEA 4OMPA 2DVJA 1PKSA 1QLYA 1SSHA 1WIEA 2DMOA 3QWXX 1X69A 1EFNA 4J9DA 3RBBB 2RQRA 1ZX6A 3UF4A 1J3TA 2O9SA 3UA7A 2OAWA 1T0HA 1UDLA 1UJ0A 4J9HA 2DL3A 1ZUKA 2JMAA 2EGEA 2EYYA 1E6GA 4X1VA 2DLPA 3PVQA 1KFZA 2L3QA 5IHIA 1TUDA 1SHGA 2M0YA 3M0TA 4K11A 1GCPA 2DYBA 2KT8A 2VWFA 2BZXA 2LP5A 1W1FA 1I07A 1SRLA 2DBMA 3TSZA 4Z89A 2EQIA 2EGCA 1GFDA 3M0PA 2J6OA 3SHWA 3EHRA 2KYBA 3CQTA 2VVKA 2G6FX 5FWBA 1OV3A 5IHNA 2RQUA 2EYWA 4FSSA 2EBPA 1PRLC 2CSIA 3M0SA 1AWWA 2JW4A 4HVWA 2B86A 2DL7A 5GJWB 4LNPA 3H0FA 3NPFA 3EGUA 1X43A 1E6HA 2DJQA 2LJ0A 1GCQC 1UE9A 1WA7A 1UHFA 2KYMA 1NEBA 2KRMA 1AVZC 1X27A 4J9IA 1CSKA 2EPDA 1PNJA 2K3BA 2DILA 4JZ3A 1YWPA 2K9GA 2HDAA 4IIOA 2ED0A 2RQVA 1T3SA 2LMJA 1M8MA 4QT7A 2JT4A 2DNUA 5IXFA 2L2PA 4J9GA 2D8HA 4RTTA 1MUZA 5L23A 1TG0A 3VS2A 1WYXA 2YT6A 2LX7A 4Z88A 3A98A 2AZSA 4OMQA 1VYUA 1JO8A 2YUPA 3VS6A 5I22A 2RQWA 4ESRA 1JQQA 2KEAA 2QDLA 4HCKA 3EG2A 1VYTA 1BBZA 2FO0A 2PNIA 1ZLMA 2KR3A 4A63B 1JEGA 4D8DA 1NG2A 1GBRA 1WLPB 3VS5A 2ED1A 2FG0A 2LQNA 2X3XD 1NLOC 1NM7A 2EYZA 1ABQA 2JXBA 1W6XA 1QWEA 3M0QA 2ESWA 2KXDA 1SHFA 3I35A 2VKNA 2P4RA 1FMKA 1OPLA 1K1ZA 3JV3A 2E5KA 4LN2A 1U5SA 2YUOA 2RPNA 1U3OA 2C0IA 2ABLA 1GCQA 1WXUA 4OMLA 3THKA 3O5ZA 2H8HA 4LE9A 2BTTA 1ABOA 1RUWA 1FYNA 2MIOA 2RN8A 4RTUA 4LUEA 1UUEA 5GJVB 3M0RA 1K9AA 3H41A 2J6KA 4AFZC 1H8KA 1BB9A 1N5ZA 2W0ZA 2PZ1A 1UJYA 1I1JA 4J9BA 4J9CA 4J9EA 4HXJA 2CT3A 1UTIA 1GRIA 3I5SA 2K7AA 3H0HA 4LUDA 1TUCA 1WXTA 2HBWA 3KFVA 2YDLA 2KROA 4EIKA 1JXMA 2JM9A 1UGVA 4M4ZA 2C0TA 4JZ4A 2X3WD 2J06A 1X6BA 2DL8A 2DX1A 2MOXA 1M3AA 2D8JA 1LCKA 2SEMA 1GL5A 1K76A 1PWTA 4Y92A 1YNZA 4JJDA 2HEQA 2XMFA 1M3CA 1OPKA 1H92A 2DA9A 1KIKA 3GBQA 1E7OA 1B3QA 5FW9A 4GBQA 4AG2C 4CC2A 1B07A 1X2KA 2A28A 3VRZA 1QKXA 2ROTA 2JMCA 1KSWA 1X2QA 2CH4A 3H0IA 3SEMA 4F14A 2D1XA 2EKHA 4HVVA 2JTEA 2DRKA 2ECZA 1K0SA 4DEYA 1KJWA 2FEIA 2JM8A 1PRMC 2OJ2A 5I11A 1ARKA 5IH2A 2YUQA 5IHKA 2F2WA 3FJ5A 2JS2A 2LCSA 3C0CA 2FRWA 2DL4A 1YWOA 1G2BA 1A0NB 1UG1A 2FRYA 1V1CA 1VA7A 4RUGA 2CT4A 4R0KA 3EG3A 1YCSB 2GQIA 2K6DA 1BU1A 3LH5A 3RNJA 1OEBA 2KBTA 1AZGB 1QKWA 2V1QA 5EC7A 2O88A 1UHCA 1WDXA 3REAB 2CH4W 1ZSGA 3PE0A 2KNBB 1NYFA 1AOJA 2C0OA 1HJDA 2LJ1A 1JU5C 3VS4A 3IQLA 2O9VA 1SPKA 2F2XA 2I0NA 3TSWA 1AEYA 1M30A 1ZUYA 2RMOA 4AFQC 1Y57A 2DM1A 2LNHB 1QCFA 2F2VA 1QWFA 3NGPA 3NHNA 5IXBA 5FWCA 3ZL7C 2L3SA 4JJCA 1T3LA 1JXOA 2L3PA 4CC4B 2KRNA 1WFWA 2LQWA 4JJBA 2GTJA 4J9FA 2HCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6G A;  2D0N A;  2W10 A;  4Z8A A;  1AD5 A;  3R6N A;  4RTY A;  2SRC A;  2M51 A;  2ENM A;  2LJ3 A;  4F16 A;  1CKB A;  3I9Q A;  2MCN A;  1VYV A;  4IIM A;  3EHQ A;  4RTW A;  1UEC A;  1HD3 A;  4OMN A;  2CSQ A;  1S1N A;  3EG1 A;  1T0J A;  2AK5 A;  2GGR A;  2JS0 A;  4RTV A;  2DRM A;  3QWY A;  2CRE A;  2V1R A;  3REB B;  4CC3 A;  1IO6 A;  2FPD A;  2EW3 A;  2CUD A;  1MV3 A;  1WXB A;  2YUN A;  3EG0 A;  2NUZ A;  1WI7 A;  1K4U S;  3VS1 A;  2AKL A;  1H3H A;  4AFU C;  1YP5 A;  2KE9 A;  2J05 A;  1RLP C;  1GBQ A;  4HVU A;  1AWX A;  2KXC A;  2LZ6 B;  2OI3 A;  1YN8 A;  2J6F A;  4E6R A;  2AZV A;  2BZ8 A;  3VS0 A;  4OMO A;  1Y0M A;  2FPF A;  2HSP A;  2RNA A;  3ULR B;  1SEM A;  2A36 A;  4RTX A;  1RLQ C;  3UAT A;  2IIM A;  4DEX A;  4AFS C;  2BZY A;  2O2O A;  4KRT A;  4JPB W;  1NYG A;  2CDT A;  2DBK A;  2KT1 A;  2GBQ A;  2KGT A;  2YSQ A;  4WCI A;  3VS3 A;  2A08 A;  2K79 A;  1CKA A;  1HSQ A;  1G83 A;  1M27 C;  3I5R A;  4ORZ A;  4D8K A;  1RI9 A;  2K2M A;  1AZE A;  1I0C A;  4AG1 C;  1AWO A;  3TVT A;  2GNC A;  2CUB A;  1Z9Z A;  2GTO A;  1W70 A;  3UA6 A;  2EYX A;  3VRY A;  2AKK A;  1M3B A;  1Z9Q A;  2RQT A;  3M0U A;  2J7I A;  1XOV A;  1U06 A;  1SRM A;  2RF0 A;  3U23 A;  5ECA A;  4RTZ A;  1MV0 B;  2L0A A;  1UFF A;  3VS7 A;  1BK2 A;  1ZUU A;  2EGA A;  2PTK A;  4GLM A;  1GFC A;  5HCK A;  1NLP C;  2O31 A;  1K0X A;  1OOT A;  2A37 A;  3NMZ C;  3PVL A;  1ZBJ A;  4ZNX A;  4CC7 A;  2NWM A;  1PKT A;  2KRS A;  2DF6 A;  4OMM A;  1NEG A;  1WX6 A;  4F17 A;  2DE0 X;  2DL5 A;  1AWJ A;  2EVR A;  2ROL A;  1PHT A;  2FPE A;  4OMP A;  2DVJ A;  1PKS A;  1QLY A;  1SSH A;  1WIE A;  2DMO A;  3QWX X;  1X69 A;  1EFN A;  4J9D A;  3RBB B;  2RQR A;  1ZX6 A;  3UF4 A;  1J3T A;  2O9S A;  3UA7 A;  2OAW A;  1T0H A;  1UDL A;  1UJ0 A;  4J9H A;  2DL3 A;  1ZUK A;  2JMA A;  2EGE A;  2EYY A;  1E6G A;  4X1V A;  2DLP A;  3PVQ A;  1KFZ A;  2L3Q A;  5IHI A;  1TUD A;  1SHG A;  2M0Y A;  3M0T A;  4K11 A;  1GCP A;  2DYB A;  2KT8 A;  2VWF A;  2BZX A;  2LP5 A;  1W1F A;  1I07 A;  1SRL A;  2DBM A;  3TSZ A;  4Z89 A;  2EQI A;  2EGC A;  1GFD A;  3M0P A;  2J6O A;  3SHW A;  3EHR A;  2KYB A;  3CQT A;  2VVK A;  2G6F X;  5FWB A;  1OV3 A;  5IHN A;  2RQU A;  2EYW A;  4FSS A;  2EBP A;  1PRL C;  2CSI A;  3M0S A;  1AWW A;  2JW4 A;  4HVW A;  2B86 A;  2DL7 A;  5GJW B;  4LNP A;  3H0F A;  3NPF A;  3EGU A;  1X43 A;  1E6H A;  2DJQ A;  2LJ0 A;  1GCQ C;  1UE9 A;  1WA7 A;  1UHF A;  2KYM A;  1NEB A;  2KRM A;  1AVZ C;  1X27 A;  4J9I A;  1CSK A;  2EPD A;  1PNJ A;  2K3B A;  2DIL A;  4JZ3 A;  1YWP A;  2K9G A;  2HDA A;  4IIO A;  2ED0 A;  2RQV A;  1T3S A;  2LMJ A;  1M8M A;  4QT7 A;  2JT4 A;  2DNU A;  5IXF A;  2L2P A;  4J9G A;  2D8H A;  4RTT A;  1MUZ A;  5L23 A;  1TG0 A;  3VS2 A;  1WYX A;  2YT6 A;  2LX7 A;  4Z88 A;  3A98 A;  2AZS A;  4OMQ A;  1VYU A;  1JO8 A;  2YUP A;  3VS6 A;  5I22 A;  2RQW A;  4ESR A;  1JQQ A;  2KEA A;  2QDL A;  4HCK A;  3EG2 A;  1VYT A;  1BBZ A;  2FO0 A;  2PNI A;  1ZLM A;  2KR3 A;  4A63 B;  1JEG A;  4D8D A;  1NG2 A;  1GBR A;  1WLP B;  3VS5 A;  2ED1 A;  2FG0 A;  2LQN A;  2X3X D;  1NLO C;  1NM7 A;  2EYZ A;  1ABQ A;  2JXB A;  1W6X A;  1QWE A;  3M0Q A;  2ESW A;  2KXD A;  1SHF A;  3I35 A;  2VKN A;  2P4R A;  1FMK A;  1OPL A;  1K1Z A;  3JV3 A;  2E5K A;  4LN2 A;  1U5S A;  2YUO A;  2RPN A;  1U3O A;  2C0I A;  2ABL A;  1GCQ A;  1WXU A;  4OML A;  3THK A;  3O5Z A;  2H8H A;  4LE9 A;  2BTT A;  1ABO A;  1RUW A;  1FYN A;  2MIO A;  2RN8 A;  4RTU A;  4LUE A;  1UUE A;  5GJV B;  3M0R A;  1K9A A;  3H41 A;  2J6K A;  4AFZ C;  1H8K A;  1BB9 A;  1N5Z A;  2W0Z A;  2PZ1 A;  1UJY A;  1I1J A;  4J9B A;  4J9C A;  4J9E A;  4HXJ A;  2CT3 A;  1UTI A;  1GRI A;  3I5S A;  2K7A A;  3H0H A;  4LUD A;  1TUC A;  1WXT A;  2HBW A;  3KFV A;  2YDL A;  2KRO A;  4EIK A;  1JXM A;  2JM9 A;  1UGV A;  4M4Z A;  2C0T A;  4JZ4 A;  2X3W D;  2J06 A;  1X6B A;  2DL8 A;  2DX1 A;  2MOX A;  1M3A A;  2D8J A;  1LCK A;  2SEM A;  1GL5 A;  1K76 A;  1PWT A;  4Y92 A;  1YNZ A;  4JJD A;  2HEQ A;  2XMF A;  1M3C A;  1OPK A;  1H92 A;  2DA9 A;  1KIK A;  3GBQ A;  1E7O A;  1B3Q A;  5FW9 A;  4GBQ A;  4AG2 C;  4CC2 A;  1B07 A;  1X2K A;  2A28 A;  3VRZ A;  1QKX A;  2ROT A;  2JMC A;  1KSW A;  1X2Q A;  2CH4 A;  3H0I A;  3SEM A;  4F14 A;  2D1X A;  2EKH A;  4HVV A;  2JTE A;  2DRK A;  2ECZ A;  1K0S A;  4DEY A;  1KJW A;  2FEI A;  2JM8 A;  1PRM C;  2OJ2 A;  5I11 A;  1ARK A;  5IH2 A;  2YUQ A;  5IHK A;  2F2W A;  3FJ5 A;  2JS2 A;  2LCS A;  3C0C A;  2FRW A;  2DL4 A;  1YWO A;  1G2B A;  1A0N B;  1UG1 A;  2FRY A;  1V1C A;  1VA7 A;  4RUG A;  2CT4 A;  4R0K A;  3EG3 A;  1YCS B;  2GQI A;  2K6D A;  1BU1 A;  3LH5 A;  3RNJ A;  1OEB A;  2KBT A;  1AZG B;  1QKW A;  2V1Q A;  5EC7 A;  2O88 A;  1UHC A;  1WDX A;  3REA B;  2CH4 W;  1ZSG A;  3PE0 A;  2KNB B;  1NYF A;  1AOJ A;  2C0O A;  1HJD A;  2LJ1 A;  1JU5 C;  3VS4 A;  3IQL A;  2O9V A;  1SPK A;  2F2X A;  2I0N A;  3TSW A;  1AEY A;  1M30 A;  1ZUY A;  2RMO A;  4AFQ C;  1Y57 A;  2DM1 A;  2LNH B;  1QCF A;  2F2V A;  1QWF A;  3NGP A;  3NHN A;  5IXB A;  5FWC A;  3ZL7 C;  2L3S A;  4JJC A;  1T3L A;  1JXO A;  2L3P A;  4CC4 B;  2KRN A;  1WFW A;  2LQW A;  4JJB A;  2GTJ A;  4J9F A;  2HCK A; 
#chains in the Genus database with same CATH topology
 1YBY A;  2D0N A;  4QQG A;  2DER A;  1FMW A;  3I55 A;  1AD5 A;  4TVR A;  4C8Q A;  1NE8 A;  2RJF A;  3CCJ T;  4F16 A;  2MI6 A;  5CKH A;  2PU9 B;  3QBY A;  4FW1 A;  2MAM A;  2RI3 A;  2RHZ A;  1K8A U;  3OYN A;  2JN0 A;  1U1T A;  1OUL A;  2DRM A;  3REB B;  5LJ5 j;  1BI2 A;  3HTR A;  4C8Q B;  5HK0 A;  1WHL A;  2CUD A;  4PLI A;  5LJ5 f;  1WXB A;  2YUN A;  4PJO F;  1NPR A;  3CCM Q;  1WI7 A;  5CCA A;  1N9R A;  3R6O A;  1VIE A;  3L2Q A;  2O4X A;  3A8M B;  1M1G A;  1RLP C;  1M1K C;  2EAY A;  2KXC A;  3BE3 A;  3CCU A;  2MWP A;  5HKC A;  2J6F A;  4A4E A;  4A4G A;  2BZ8 A;  3VS0 A;  2JUF A;  2FPF A;  3JCM c;  1SEM A;  4F7U E;  2A36 A;  2LX9 A;  3EH1 A;  4BE1 A;  2YLC A;  3QXE B;  4FYX B;  3OBY A;  4C92 G;  4E7K A;  3LYI A;  1M2V A;  4CI0 C;  1WJS A;  2XG8 D;  5GAN g;  4WCI A;  4MDX A;  3OQ5 A;  3VS3 A;  5D6Y A;  3VYH B;  2A08 A;  1M27 C;  2K79 A;  3I5R A;  1VQ5 A;  3CCR T;  2DIQ A;  3JSC A;  2GNC A;  1Z9Z A;  4XU1 A;  3M57 A;  3QKJ A;  2QQA A;  1W70 A;  2RI2 A;  2GCX A;  2LCC A;  2AKK A;  5KYU B;  2HKN A;  2RF0 A;  3OW2 P;  1NJI C;  2E1H A;  1AT1 B;  4M75 G;  4LD9 K;  1K73 R;  1NLP C;  1MMD A;  1K0X A;  1OOT A;  3NMZ C;  4ZNX A;  1ZBJ A;  3X24 B;  2QEX T;  3OSV A;  1WX6 A;  1Q86 R;  1AWJ A;  4Z02 A;  3CC7 Q;  2EVR A;  2CZ6 B;  2ROL A;  3DLL A;  2FPE A;  3KBG A;  1YJW A;  1PKS A;  4JDS A;  3MHX A;  3OYA A;  5DLO A;  1Q82 R;  5KE3 A;  4J9D A;  4EMK B;  2D0Q B;  1ZX6 A;  2X35 A;  3UA7 A;  1UDL A;  1UJ0 A;  3FJP A;  2DL3 A;  3ME9 A;  2RO0 A;  2HKQ B;  4PJO E;  2L3Q A;  3JCM W;  2L8D A;  4K11 A;  2DYB A;  2KT8 A;  3AHU A;  2VAS A;  2BZX A;  2LP5 A;  1D0Z A;  1BIA A;  1KD1 R;  4IUU A;  4XTU A;  2EQI A;  5GAN 8;  3M0P A;  5A0D A;  2VVK A;  3CCJ A;  3G4S A;  2G6F X;  5FWB A;  2RM4 A;  2O01 E;  3RR6 A;  4QKU A;  1YI2 A;  4FYW B;  1EIF A;  2QA4 Q;  2RQU A;  2EBP A;  1TUG B;  2CSI A;  3FB9 A;  3M0S A;  3OYF A;  1YIT A;  2NUP B;  3HL8 A;  2JW4 A;  1PC0 A;  5GJW B;  3M56 A;  3QYG B;  4LNP A;  3NPF A;  3CCM T;  5GAM e;  1E6H A;  4NL2 A;  3UWN A;  1UE9 A;  2QI2 A;  2DIG A;  3GF5 A;  4PFO A;  1WA7 A;  1UGP B;  1UHF A;  1VQ6 Q;  1X27 A;  1CSK A;  4BDZ A;  2P0Q A;  3EFO A;  1OX8 A;  2K3B A;  4JZ3 A;  2NLU A;  4C8Q G;  1F1B B;  2EJ9 A;  3L2W A;  3CPW P;  2RQV A;  1T3S A;  1VUB A;  1OZ2 A;  2JT4 A;  2DNU A;  3L42 A;  4J9G A;  2D8H A;  2VXF A;  3BDL A;  3C4S A;  2RK2 A;  4RKU E;  2QAS A;  1IXD A;  4Z88 A;  2CKK A;  1H3Z A;  2D6F A;  1JO8 A;  3BDU A;  5I22 A;  4ESR A;  2CP0 A;  5CVI A;  2X4J A;  3BFM A;  1VYT A;  4FSX A;  2RI5 A;  5A0L A;  1JEG A;  4D8D A;  1NG2 A;  1SKU B;  1GBR A;  1WLP B;  1KHC A;  2X3X D;  4WTO B;  2ESW A;  7AT1 B;  2FZG B;  1SHF A;  3TCJ A;  3I55 Q;  1IB8 A;  2KVQ G;  1QVF A;  4BI3 A;  1MMA A;  2M0O A;  3JV3 A;  3L2V A;  4RCC A;  2DTI A;  4ANJ A;  2C06 A;  2YUO A;  1XNI A;  2RPN A;  2VGM A;  3E19 A;  1WXU A;  3CC7 T;  3OYE A;  3M53 A;  4LDY A;  3O5Z A;  2H8H A;  4LE9 A;  1WHH A;  4GY5 A;  4RTU A;  4V2S A;  4LUE A;  1UUE A;  5GJV B;  3H41 A;  2J6K A;  2D9T A;  1H8K A;  1G3S A;  2OAU A;  2PZ1 A;  1FWZ A;  2GFA A;  1UJY A;  1M1F A;  3FIF A;  2E64 A;  4J9B A;  2COY A;  1M9S A;  1GXI E;  3ASK A;  4BUG A;  2E12 A;  2RK1 A;  4KUI A;  1BI1 A;  3CME A;  3CCU Q;  4OB2 B;  4DBQ A;  1PG5 B;  3KFV A;  4M4Z A;  1B34 B;  2J06 A;  1X6B A;  3G6E T;  2QQS A;  1Q81 U;  2DL8 A;  2DX1 A;  1P92 A;  3ZBD A;  1M3A A;  2PVG B;  1TWB A;  5LJ3 g;  2SEM A;  4C5H A;  5GAM d;  1K76 A;  4M7D B;  4Y28 E;  4EMK C;  1QVF S;  4A4K A;  1M3C A;  1QQJ A;  2A0F B;  2DXU A;  1H92 A;  1WQ7 A;  2QA4 T;  2DA9 A;  5I2S A;  1VQ5 Q;  2EJF A;  3CCQ T;  3CC2 Q;  3GBQ A;  3RMS A;  2VYT A;  1VQ7 Q;  3M4G A;  1E7O A;  5FW9 A;  2LT1 A;  2DD5 A;  1X2K A;  3VRZ A;  1QKX A;  2ROT A;  3X28 B;  3RIR A;  2KMT A;  4MML A;  3CCM A;  3G71 Q;  1VQ6 T;  2EKH A;  1VQL Q;  2COZ A;  3JRZ A;  2OJ2 A;  1ARK A;  1W4S A;  2F2W A;  1KC8 U;  2FRW A;  4C5I A;  5J39 A;  1D0Y A;  1VA7 A;  2OTL Q;  3S3N A;  3JB9 H;  2CT4 A;  1RAI B;  4QQD A;  3EG3 A;  1JBM A;  1TXQ A;  2RHY A;  1QW1 A;  2KBT A;  1QKW A;  5EC7 A;  1K8A C;  3QJY A;  3G7Z A;  1IGU A;  4M77 F;  3JCM J;  1ZSG A;  3PE0 A;  2KNB B;  3LGL A;  4ZN1 A;  3KXT A;  1N8R U;  2C0O A;  4F7U A;  1VQ8 Q;  3L2Z A;  1D1C A;  4PLL A;  2O9V A;  4L5G A;  1SPK A;  2F2X A;  4JRI A;  1AEY A;  1M30 A;  3VV0 A;  4XQ3 A;  2K2V A;  3I55 T;  4R56 A;  2F2V A;  3NHN A;  2F1L A;  5FWC A;  4E7J A;  2KRN A;  2NUT A;  3HP9 A;  4M78 F;  1PD1 A;  3G4S Q;  1TTH B;  4BE2 A;  4J9F A;  2AT1 B;  2CS7 A;  3OYY A;  1YI2 Q;  3CD6 Q;  3CPW A;  3A1P A;  4B9W A;  5KYY A;  1YIT Q;  1ZQ1 A;  1BCM A;  2MCN A;  4HCC A;  3EHQ A;  2ATC B;  4M7A A;  3C95 A;  1ZSZ A;  4OMN A;  4ZGD B;  5GAM j;  2AK5 A;  2JS0 A;  5C6S A;  4A54 A;  1I81 A;  5LJ5 g;  3CCU T;  3JCM e;  4C92 B;  2DZ9 A;  3LWH A;  3GOX A;  4J8O A;  2CRE A;  2V1R A;  4CC3 A;  1IO6 A;  3WXM B;  2FPD A;  2PUO B;  2MMP A;  3DLM A;  6AT1 B;  3EG0 A;  1PCX A;  1Q7Y U;  3H8Z A;  3FEO A;  1UGS B;  5GAM h;  1Y96 A;  1EZZ B;  1LOJ A;  2P84 A;  2OI3 A;  4PJO A;  4LDV A;  1VQ5 T;  4M75 B;  1KQS P;  1SSF A;  4F04 B;  1Y0M A;  5FU7 B;  3CBM A;  3CC2 T;  2RNA A;  2MYS A;  4YTL A;  1QVG P;  1RLQ C;  3H6Z A;  3UAT A;  2IIM A;  3JB9 F;  2YRV A;  3N5B B;  4CRI A;  3E2U A;  4M77 E;  3MO8 A;  4JPB W;  1NYG A;  2DBK A;  2KT1 A;  4M78 C;  1AHJ B;  4J7I A;  4M7D G;  4PFP A;  2X51 A;  1TH7 A;  4Q5W A;  3G71 T;  4PJL A;  4KH0 B;  1JJ2 P;  2DFU A;  4D8K A;  1AZE A;  1OI1 A;  4VUB A;  4M7D C;  2X4W A;  1M3B A;  3L2R A;  1XOV A;  4KT0 E;  3CBO A;  2XU8 A;  3OYI A;  2IPO B;  4LD6 A;  5KYX A;  2OTL T;  2YRD A;  1YJW T;  4O5V A;  4M78 E;  1UFF A;  1BK2 A;  3FDR A;  1GFC A;  5HCK A;  4M7A D;  4JS5 A;  3PVL A;  4HCZ A;  2FZK B;  3EG9 B;  1PKT A;  2Y4X A;  1M1K R;  4UC4 A;  2CP2 A;  2DL5 A;  5GAN e;  3CXC P;  2HQX A;  4OGE A;  2ZGW A;  3RKX A;  5FRO A;  3VKI A;  2PVD B;  4OMP A;  3CME Q;  1WIE A;  4ZTJ A;  3SWN A;  1M2O A;  1X69 A;  1EFN A;  3EGD A;  2RQR A;  3EGX B;  3LLR A;  3OYM A;  1XJW B;  3SFM A;  1T0H A;  5A2Q E;  1QCO A;  4PJO D;  1LPL A;  1PM3 A;  3QUI A;  1VQM Q;  3HRT A;  1E6G A;  3CCL A;  4X1V A;  2EQK A;  3OA6 A;  3MP1 A;  4DA4 A;  3PIO A;  1TUD A;  3G4S T;  3M0T A;  3A8O B;  4P5N A;  1YI2 T;  4RG8 A;  3V8K A;  1V76 A;  3CD6 T;  1HK9 A;  4J7F A;  1NJI R;  5GAN 5;  4Z89 A;  5KCO A;  3ZEH A;  2JZ2 A;  1YIT T;  1GFD A;  4R55 A;  1R0C B;  1VQO A;  3EHR A;  2KYB A;  3VUB A;  2FZC B;  1ZA1 B;  4XU2 A;  4F7U G;  1G3W A;  4AT1 B;  1D0X A;  1AWW A;  1G5V A;  1C0M A;  3S3O A;  2HL5 C;  3H0F A;  3EGU A;  1X43 A;  2AHJ B;  3OS1 A;  1SF9 A;  4Y91 A;  3RKW A;  2KDS A;  2EPD A;  1PNJ A;  2FVU A;  2O4X B;  2DIL A;  1YWP A;  2HDA A;  4B6M A;  1RAB B;  1OU8 A;  3CC2 A;  4C92 C;  4RTT A;  2HNI A;  5L23 A;  1YFN A;  1MUZ A;  3TEE A;  1VQ7 A;  4M7A G;  1WNL A;  3HPW A;  3RKY A;  1KQ2 A;  3CPF A;  2FHD A;  3A98 A;  4X9C A;  1I8F A;  2RQW A;  1M2V B;  2QDL A;  3G71 A;  3A8H B;  3EG2 A;  2PNI A;  1VQL A;  3WVD B;  4A63 B;  5GAN d;  1MNE A;  5DM7 R;  4KGZ B;  3PTA A;  4M75 C;  2ED1 A;  2LQN A;  1M90 U;  3MET A;  2JXB A;  3OYH A;  2RH2 A;  1VQN A;  1W6X A;  1QWE A;  3INZ A;  2VC8 A;  4IUV A;  5FLX E;  1Q81 C;  1UGQ B;  3I35 A;  5J3B A;  2QQ9 A;  2OTL A;  3A8L B;  4PJO G;  1K1Z A;  3OYG A;  2E5K A;  4IUR A;  1K9M U;  2HSE B;  1WPY A;  2RA2 A;  2C0I A;  1GCQ A;  3BY7 A;  3EAE A;  1Q95 G;  4C0Z A;  5A0G A;  2ZPB B;  3QPH A;  3CME T;  3UDC A;  1QVG A;  1ABO A;  1RUW A;  2RN8 A;  4C8Q F;  1UGR B;  2JTM A;  1VQ8 A;  2GQV A;  1C6V X;  4OB3 B;  2W0Z A;  3MEA A;  2I2L A;  2X4X A;  3V8J A;  1VQM T;  1JJ2 A;  1IHV A;  4N4H A;  3GLX A;  2HZY A;  4J9E A;  2CT3 A;  1GRI A;  3A5Z B;  2MF2 A;  1WHJ A;  2DVE A;  2K7A A;  3H0H A;  2MPX C;  5GAO n;  1KC8 C;  4PFZ A;  2YDL A;  2DZC A;  2JM9 A;  3CD6 A;  2E6Z A;  1QP3 A;  3RUX A;  3V8L A;  2R5A A;  4NS5 A;  1YNZ A;  1MMN A;  2XMF A;  3LX7 A;  1VQP Q;  2DD4 A;  1KIK A;  4PNO A;  5AYF A;  1N8R C;  1YIJ Q;  1W2B A;  2BIV A;  4E7I A;  3MEU A;  1S72 Q;  4CC2 A;  1YCY A;  1WJQ A;  2K5I A;  1KSW A;  2OTJ A;  3V7C A;  2CH4 A;  2P4T A;  3SEM A;  4F14 A;  3GP8 A;  2JTE A;  3QZ5 B;  1K0S A;  5LJ3 e;  2E65 A;  4LDX A;  1KJW A;  2WSE E;  1X75 C;  4C8Q C;  4D6W A;  1NZ9 A;  4XTX A;  3MCA B;  2XIC A;  1VQ9 Q;  2JS2 A;  3CCS A;  3LGF A;  1N9S A;  3C0C A;  3EFO B;  4OMF B;  1U8R A;  1A0N B;  1QCN A;  2LNV A;  2ZPI B;  2HBP A;  4JS4 A;  4RUG A;  5GAN j;  4E7L A;  2E4H A;  4R0K A;  4OF1 A;  5GMK j;  2GQI A;  2K6D A;  2RJE A;  2E41 A;  3RNJ A;  1WHK A;  1AZG B;  2V1Q A;  2YRC A;  3MJX A;  2MK5 A;  4C8Q E;  1WDX A;  3JCM V;  3REA B;  2EIF A;  3SDZ A;  4BI8 B;  5GAN 4;  3CCL Q;  2P0K A;  5GAN h;  1I5L A;  1HJD A;  4L6V 5;  3OYK A;  3QJ6 A;  5GMK i;  2I0N A;  2XID A;  5GMK h;  4NL3 A;  1ZUY A;  1Q7Y C;  4AFQ C;  1BI3 A;  2DM1 A;  2LNH B;  4M77 A;  2EWN A;  4E7Z A;  5IXB A;  4EMG A;  1TOV A;  1VQO Q;  5M9O A;  2L3P A;  1WFW A;  4C5G A;  2LQW A;  4LXC A;  2HCK A;  2LCL A;  2DXB A;  2W10 A;  2K3Y A;  4Z8A A;  3H9N A;  3I56 Q;  4RTY A;  4HA8 A;  2SRC A;  2M51 A;  1QP2 A;  2ENM A;  4M78 A;  5I21 A;  1CKB A;  3I9Q A;  3URG A;  1VYV A;  4IIM A;  2HAX A;  1KQ1 A;  3OW2 A;  1HD3 A;  2CSQ A;  4JUV A;  1K8A R;  2DEU A;  1VQM A;  1QVP A;  4RTV A;  4MZM A;  5D6X A;  1B7T A;  3PT9 A;  4IUP A;  3QWY A;  2QK0 A;  1RAD B;  1MV3 A;  4PJJ A;  1K4U S;  3VS1 A;  1JRI A;  1H3H A;  5I2M A;  4AFU C;  3CMA A;  2CP5 A;  2LVM A;  1LVK A;  2JVV A;  2LZ6 B;  4E6R A;  2AZV A;  3M5A A;  2ZAE A;  4ELY C;  5LJ3 d;  2OX7 A;  3ULR B;  3P8D A;  3E1S A;  1VIF A;  3OS0 A;  1YIJ T;  2VUB A;  1S72 T;  4M77 D;  5LJ5 e;  5CQY A;  2O2O A;  4KRT A;  2QGF B;  3CCV A;  2XHC A;  2CDT A;  2GBQ A;  2ZCF B;  4FYV B;  1VQN Q;  3MKD A;  1D3B A;  4OVA A;  1CKA A;  1G83 A;  1RI9 A;  1I0C A;  4AG1 C;  1AWO A;  3TVT A;  3OW2 S;  2EYX A;  1VQ9 T;  1RL2 A;  1Z9Q A;  4BI4 A;  3M0U A;  3P8H A;  2J7I A;  2DKG A;  8ATC B;  3U23 A;  1VQK A;  5ECA A;  3OY9 A;  4RTZ A;  2L0A A;  4M78 D;  3PNW C;  4JJN K;  1LNX A;  1ZUU A;  2EGA A;  4GLM A;  1K73 U;  1D3B B;  1WQW A;  2O31 A;  5GMK l;  2A37 A;  3KUF A;  1R0B G;  2NWM A;  2KRS A;  2DF6 A;  4OMM A;  1NEG A;  1Q86 U;  3CCL T;  2XI9 A;  2QYZ A;  2DVJ A;  3NFC A;  4XK8 E;  5IT9 E;  4XTW A;  2EKO A;  3QWX X;  4EDU A;  4IUT A;  2VGN A;  4B9X A;  1Q82 U;  4RCB A;  4F7U B;  2LT4 A;  2OAW A;  4J9H A;  2JMA A;  1ZUK A;  1VQO T;  2EGE A;  4A53 A;  3M54 A;  1UEB A;  4M7D F;  2DLP A;  5C0M A;  4DOW A;  1KFZ A;  2YHT A;  1SHG A;  3D7S B;  1GCP A;  2LDM A;  1WGS A;  1KHI A;  2NUT B;  3I56 T;  2DBM A;  5KH6 A;  2HD0 A;  5GAM f;  1KD1 U;  3TSZ A;  4ZGE B;  4KGX B;  1UB4 A;  3PIP A;  2EGC A;  5CK9 A;  4KBM B;  5HY6 A;  2E70 A;  5CQX A;  2L89 A;  3JB9 D;  4PKC C;  3CQT A;  3X25 B;  2M1H A;  4E47 A;  5KYY B;  2OTJ Q;  3J7A F;  3DKM A;  5KCH A;  4M7A B;  1ZSZ B;  2QQB A;  3UT1 A;  3NTK A;  4J6W A;  1BYM A;  4FSS A;  1PRL C;  1WJR A;  4M77 G;  1M90 C;  3CCS Q;  2B86 A;  5LJ3 j;  5LL6 S;  4A4H A;  1RAG B;  5HK3 A;  4QQ6 A;  2LJ0 A;  3P8B B;  2LRQ A;  1VQ7 T;  4DBH A;  1PD0 A;  2KYM A;  1N27 A;  1NEB A;  5CAI A;  2KRM A;  3M4Y A;  4J9I A;  1RI0 A;  1IZ6 A;  2E5Q A;  2QTX A;  1K9M C;  3CPW S;  4J5Y A;  3JB9 I;  4MZP A;  2K9G A;  1VQP A;  5GAO m;  1Y96 B;  4IIO A;  2IVW A;  4XTV A;  4KGV B;  3C12 A;  5LJ3 h;  4RG2 A;  1VQL T;  4BB7 A;  3HFN A;  4PJO B;  3CCE Q;  2EFI A;  3VS2 A;  2K3X A;  1WYX A;  2YT6 A;  1YIJ A;  2LX7 A;  1S72 A;  1VQN T;  1ZBX A;  4RMO A;  1TSF A;  3OSS C;  2LQK A;  3X20 B;  5KYW A;  1JQQ A;  2KEA A;  3FLG A;  3HRS A;  3J80 E;  4HCK A;  1BBZ A;  5GAO l;  1ZA2 B;  3VS5 A;  2KAF A;  3CC4 Q;  1VQ9 A;  2FG0 A;  1NLO C;  1NM7 A;  2EYZ A;  1ABQ A;  2YLB A;  4JRQ A;  1V29 B;  2X4Y A;  3M0Q A;  4M7D E;  3RMQ A;  2JOY A;  3EFR A;  2P4R A;  3FC3 A;  2BKD N;  2Z0W A;  5KYX B;  1VQ8 T;  4DOV A;  5KYW B;  4LN2 A;  2E6N A;  2E3I A;  1U5S A;  4QVC A;  2PQW A;  4NOY A;  1U3O A;  2K5L A;  2ABL A;  3VU3 C;  2E3H A;  2V8K A;  3THK A;  3RER A;  3Q1J A;  4A4F A;  2V8I A;  2QQR A;  4C92 F;  2BTT A;  2RB6 A;  4ME7 A;  4BY6 B;  3JB9 G;  3LH0 A;  1N5Z A;  3SWN B;  3JCM d;  4WF2 A;  2ZPE B;  3E9G A;  4M7A F;  2EQM A;  3EGD B;  2V8J A;  2CP7 A;  3CMA Q;  1MHN A;  3S6W A;  1UTI A;  2DEQ A;  3DB3 A;  4GLK A;  1G3T A;  2XDP A;  4HT8 A;  4FYY B;  3I5S A;  4LUD A;  4M75 F;  1WXT A;  1N6A A;  2DO3 A;  2HBW A;  2KRO A;  1WHM A;  2C0T A;  3DB4 A;  2QTV A;  1M8V A;  2X3W D;  2H3E B;  1Q81 R;  1D1B A;  1EX4 A;  3I56 A;  1LCK A;  3JCM P;  8AT1 B;  3RDV A;  3CCV Q;  1PWT A;  4Y92 A;  4JJD A;  2DAQ A;  1RAE B;  2OTJ T;  5GAN 3;  2LTO A;  2KI7 A;  3TU4 K;  1QVF P;  4N0A C;  1NPP A;  3CCS T;  4KUL A;  4GBQ A;  1KG1 A;  3MP8 A;  1OZ3 A;  4AG2 C;  2A28 A;  1VQK Q;  4FW2 A;  2JMC A;  2JTF A;  4DQ2 A;  5LJ5 h;  5CO7 A;  2BE7 D;  2D1X A;  4HVV A;  5KYU A;  2M9U A;  4FT4 A;  2ECZ A;  2FEI A;  3HRU A;  2JM8 A;  3QDR B;  3OYD A;  1PRM C;  3NTH A;  3MP6 A;  2YUQ A;  5IH2 A;  2LCS A;  1SG5 A;  3VJP A;  3OBW A;  1KC8 R;  2H3J A;  2DYI A;  4FU6 A;  4QVZ A;  4M7A C;  1YWO A;  3PMT A;  3EFS A;  4OGC A;  1ZSZ C;  3CCE T;  1UG1 A;  2FRY A;  1TU0 B;  1V1C A;  2DXC A;  3O8V A;  1M5Q 1;  3QDF A;  1YCS B;  2F5T X;  3F70 A;  4C92 E;  5FU7 C;  1O75 A;  1BU1 A;  1X01 A;  1FMV A;  1OEB A;  2BUD A;  4C8Q D;  2XD0 A;  2O88 A;  2LQ8 A;  2CP6 A;  2CH4 W;  1I5O B;  2CZ7 B;  1N8R R;  4M7A E;  3CC4 T;  4FCY A;  4EMK A;  1JU5 C;  3VS4 A;  2DK3 A;  2K5F A;  2YXY A;  2MWO A;  4HKE A;  4PJO C;  3UPU A;  3TQ7 P;  1KQS A;  2PVO B;  1OQK A;  4M75 E;  1WZO A;  3OB9 A;  3NGP A;  3V7R A;  3ZL7 C;  2L3S A;  1JXO A;  4CC4 B;  4MDW A;  1KK7 A;  1RAC B;  3JCM f;  1Y7X A;  2KK4 A;  1X6G A;  2NYS A;  5CKD A;  3R6N A;  2R5M A;  1D1A A;  1IRE B;  3ZFJ A;  2LJ3 A;  3HKS A;  5GAO p;  1HYO A;  4PJN A;  3A8G B;  4RTW A;  3JCM h;  1UEC A;  1H64 1;  1S1N A;  2DPP B;  3EG1 A;  3CMA T;  1T0J A;  1YJN A;  2GGR A;  4PK4 A;  1G3Y A;  2NUP A;  3G6E Q;  4XU0 A;  2XK0 A;  2X9H A;  5D7U A;  2R58 A;  3C94 A;  2EW3 A;  3SB2 A;  4LDU A;  2LC4 A;  2JJ9 A;  2EYQ A;  2NUZ A;  1Q7Y R;  3CXC A;  1VQ4 Q;  1K73 C;  2AKL A;  2GF7 A;  3CCV T;  3EH2 A;  3CCQ Q;  1YP5 A;  4BY6 C;  1KQS S;  2KE9 A;  2J05 A;  4HVU A;  1AWX A;  1IGQ A;  3SWN C;  1YN8 A;  1QVG S;  1BI0 A;  1Q86 C;  4O6J A;  4OMO A;  2HSP A;  4RTX A;  4DBR A;  2M16 A;  4JLG A;  4DBF A;  4DEX A;  4AFS C;  2BZY A;  1Q82 C;  1Y71 A;  3QYH B;  1JJ2 S;  1VQK T;  3GNF B;  2KGT A;  5GAN 2;  2YSQ A;  3M59 A;  2IG0 A;  2G3R A;  1HSQ A;  1RAH B;  4ORZ A;  1O9S A;  2K2M A;  1Y07 A;  2ZPH B;  5GAN f;  2CUB A;  2GTO A;  2CGH A;  3UA6 A;  3VRY A;  2RQT A;  2KQW A;  2K4Y A;  2COW A;  3L1A A;  1U06 A;  1SRM A;  1YHQ Q;  1MV0 B;  1KD1 C;  1PSE A;  2YWW A;  4PL6 A;  3VS7 A;  2PTK A;  3CCE A;  3T9N A;  1MMG A;  2P0P A;  3VUZ A;  3CCR A;  3CXC S;  4CC7 A;  5KE2 A;  1M1K U;  2DJZ A;  1W2B S;  4F17 A;  2DE0 X;  1YJ9 Q;  1FX7 A;  2DTH A;  1JB0 E;  1ACM B;  1PHT A;  4ZN3 A;  4ZTF A;  3J81 E;  1FXX A;  2DTO A;  4BD3 A;  1QLY A;  1SSH A;  2DMO A;  5GAO r;  3CC4 A;  2VXE A;  1I4K 1;  3RBB B;  2QEX A;  5CKB A;  3OYC A;  3UF4 A;  4C0G A;  4C5E A;  1J3T A;  2O9S A;  2FYK A;  2EQJ A;  2F5K A;  2EYY A;  4M77 B;  3VYG A;  4KH1 B;  2FL7 A;  4QVD A;  2QDY B;  3PVQ A;  5FU6 B;  5IHI A;  1OX9 A;  1B34 A;  2M0Y A;  5GAM g;  2VWF A;  3OYJ A;  3OMC A;  4MMK A;  1IRX A;  1W1F A;  1C1A A;  1NJI U;  1I07 A;  1SRL A;  5IN1 A;  2Y4Y A;  4M7D A;  3V7S A;  4HT9 A;  2J6O A;  1X6O A;  5GAN 7;  1MND A;  4EMH A;  3SHW A;  1QMC A;  3GNG A;  1MGQ A;  3MPU B;  3MEV A;  1OV3 A;  4M78 B;  5IHN A;  2A7Y A;  4X9D A;  4IKF A;  2ZZD A;  2L5Q A;  2EYW A;  5CIU A;  5FRM A;  2HQH A;  1VQP T;  3NTI A;  4HVW A;  2DL7 A;  3PGG A;  2QG9 B;  3RES A;  1RAF B;  2DJQ A;  1VQ4 T;  3CBP A;  4C0D B;  4XAX B;  4BE0 A;  1GCQ C;  4JLI A;  3ER0 A;  3HHT B;  3E9F A;  3JAM E;  1AVZ C;  4AMC A;  4ELZ C;  3QII A;  5FRN A;  5CKF A;  2QXF A;  2XDD A;  2ZPF B;  2RHI A;  4FT2 A;  2AIR B;  2ED0 A;  3G1J A;  3HSB A;  5GMK m;  1WHG A;  2LMJ A;  1M8M A;  2M02 A;  4QT7 A;  5IXF A;  2L2P A;  5CKE A;  3M58 A;  3LWI A;  3QZ9 B;  1BCO A;  1TG0 A;  2XKO C;  2RJD A;  1IHW A;  3QHS A;  4FL6 A;  1DJ7 B;  2QAZ A;  4J6X A;  2AZS A;  4OMQ A;  1VYU A;  4OP0 A;  4KUD K;  2YUP A;  3VS6 A;  2FO0 A;  1ZLM A;  2KR3 A;  1YJW Q;  3TRE A;  1BKB A;  2FB7 A;  1RAA B;  3MEW A;  1YHQ T;  4FIB A;  4BAC A;  4M7D D;  1M90 R;  3S3M A;  1OU9 A;  2EQU A;  2KXD A;  2PUK B;  3HFO A;  3QG1 A;  2DXT A;  3CEY A;  2VKN A;  2RHU A;  1FMK A;  1OPL A;  2WSF E;  1VOM A;  3JCM b;  1D09 B;  4LDW A;  4X34 A;  1TS9 A;  5DLQ E;  3GPL A;  4IUQ A;  3PMI A;  1K9M R;  2CP3 A;  1YJ9 T;  2Y90 A;  3QSU A;  1XTD A;  4OML A;  2VB6 A;  1YJN Q;  4N0A A;  2XDB A;  4L59 A;  2VV5 A;  1R8O B;  1FYN A;  3OS2 A;  2MIO A;  5AT1 B;  2K57 A;  3LW5 E;  3M0R A;  3WVE B;  1K9A A;  5GAN 6;  4AFZ C;  3CCJ Q;  2DET A;  4PJM A;  1BB9 A;  1ZHI A;  5L8R E;  2B8A A;  4C92 A;  3CC7 A;  1I1J A;  3GIB A;  4J9C A;  4HXJ A;  4MZT A;  1TUC A;  4E7S A;  3M55 A;  4EIK A;  1JXM A;  1UGV A;  4JZ4 A;  2E10 A;  4II1 A;  4ZGJ B;  4N4G A;  2MOX A;  2D8J A;  9ATC B;  1GL5 A;  5IAY A;  3OYB A;  2JNG A;  3AT1 B;  4M75 A;  3QO3 A;  5J26 A;  2HEQ A;  3OS5 A;  5LJ3 f;  2L3R A;  1OPK A;  5LJ5 d;  3L2U A;  3FRN A;  1BIB A;  1U1S A;  4M77 C;  1OYX A;  3G6E A;  5FU6 C;  5D6W A;  1B3Q A;  4QW2 A;  1LJO A;  1B07 A;  3JCM X;  2WSC E;  1X2Q A;  2RD1 A;  3H0I A;  4M78 G;  3SD4 A;  1VQ4 A;  2QA4 A;  1R77 A;  2CZ0 B;  5KYN A;  3CCR Q;  1XQH A;  3CCQ A;  2DRK A;  3X26 B;  4DEY A;  3JCM Q;  4E2F B;  4XU3 A;  5I11 A;  2BE9 B;  5IHK A;  4OB1 B;  3FJ5 A;  4XTZ A;  4N4I A;  3JB9 J;  5DY9 A;  2HQE A;  4EPC A;  5CR2 A;  2DL4 A;  1G2B A;  2F69 A;  2R57 A;  2QGG A;  2KSS A;  2CYZ B;  1HXD A;  3EG9 A;  2WAC A;  4C0F A;  3OMG A;  5EG2 A;  1VQ6 A;  3M9Q A;  4ATO A;  4C92 D;  4F7U F;  4J83 A;  2HMA A;  4XTY A;  4HCB A;  3LH5 A;  1PSF A;  1NBE B;  4C0D C;  2QEX Q;  1UHC A;  2A3L A;  4JRP A;  2EJG A;  2KY9 A;  1NYF A;  2GFU A;  1AOJ A;  4E7H A;  2LJ1 A;  3EGX A;  3OYL A;  3IQL A;  2CZ1 B;  3TSW A;  1G8X A;  4BDY A;  1YHQ A;  2RMO A;  3BW1 A;  1Y57 A;  4JRK A;  1QCF A;  4M75 D;  2ZPG B;  1QWF A;  5GAO q;  4J6Y A;  3JCM g;  5GMK e;  1W2B P;  4JJC A;  1T3L A;  4OB0 B;  1M4Z A;  4JJB A;  2HL3 A;  2RHX A;  4FM4 B;  2V26 A;  2GTJ A;  2RJC A;  3PFS A;  1YJN T;  1GBQ A;  1YJ9 A; 
#chains in the Genus database with same CATH homology
 1X6G A;  2D0N A;  2W10 A;  4Z8A A;  1AD5 A;  3R6N A;  4RTY A;  2SRC A;  2M51 A;  2ENM A;  2LJ3 A;  4F16 A;  1CKB A;  3I9Q A;  2MCN A;  1VYV A;  4IIM A;  3EHQ A;  4RTW A;  1UEC A;  1HD3 A;  4OMN A;  2CSQ A;  1S1N A;  3EG1 A;  1T0J A;  2AK5 A;  2GGR A;  2JS0 A;  4RTV A;  2DRM A;  3QWY A;  2CRE A;  2V1R A;  3REB B;  4CC3 A;  1IO6 A;  2FPD A;  2EW3 A;  2CUD A;  1MV3 A;  1WXB A;  2YUN A;  3EG0 A;  2NUZ A;  1WI7 A;  1K4U S;  3VS1 A;  2AKL A;  1H3H A;  4AFU C;  1YP5 A;  2KE9 A;  2J05 A;  1RLP C;  1GBQ A;  4HVU A;  1AWX A;  2KXC A;  2LZ6 B;  2OI3 A;  1YN8 A;  2J6F A;  4E6R A;  2AZV A;  2BZ8 A;  3VS0 A;  4OMO A;  1Y0M A;  2FPF A;  2HSP A;  2RNA A;  3ULR B;  1SEM A;  2A36 A;  4RTX A;  1RLQ C;  3UAT A;  2IIM A;  4DEX A;  4AFS C;  2BZY A;  2O2O A;  4KRT A;  4JPB W;  1NYG A;  2CDT A;  2DBK A;  2KT1 A;  2GBQ A;  2KGT A;  2YSQ A;  4WCI A;  3VS3 A;  2A08 A;  2K79 A;  1CKA A;  1HSQ A;  1G83 A;  1M27 C;  3I5R A;  4ORZ A;  4D8K A;  1RI9 A;  2K2M A;  1AZE A;  1I0C A;  4AG1 C;  1AWO A;  3TVT A;  2GNC A;  2CUB A;  1Z9Z A;  2GTO A;  1W70 A;  3UA6 A;  2EYX A;  3VRY A;  2AKK A;  1M3B A;  1Z9Q A;  2RQT A;  3M0U A;  2J7I A;  1XOV A;  1U06 A;  1SRM A;  2RF0 A;  3U23 A;  5ECA A;  4RTZ A;  1MV0 B;  2L0A A;  1UFF A;  3VS7 A;  1BK2 A;  1ZUU A;  2EGA A;  2PTK A;  4GLM A;  1GFC A;  5HCK A;  1NLP C;  2O31 A;  1K0X A;  1OOT A;  2A37 A;  3NMZ C;  3PVL A;  1ZBJ A;  4ZNX A;  4CC7 A;  2NWM A;  1PKT A;  2KRS A;  2DF6 A;  4OMM A;  1NEG A;  1WX6 A;  4F17 A;  2DE0 X;  2DL5 A;  1AWJ A;  2EVR A;  2ROL A;  1PHT A;  2FPE A;  4OMP A;  2DVJ A;  1PKS A;  1QLY A;  1SSH A;  1WIE A;  2DMO A;  3QWX X;  1X69 A;  1EFN A;  4J9D A;  3RBB B;  2RQR A;  1ZX6 A;  3UF4 A;  1J3T A;  2O9S A;  3UA7 A;  2OAW A;  1T0H A;  1UDL A;  1UJ0 A;  4J9H A;  2DL3 A;  1ZUK A;  2JMA A;  2EGE A;  2EYY A;  1E6G A;  4X1V A;  2DLP A;  3PVQ A;  1KFZ A;  2L3Q A;  5IHI A;  1TUD A;  1SHG A;  2M0Y A;  3M0T A;  4K11 A;  1GCP A;  2DYB A;  2KT8 A;  2VWF A;  2BZX A;  2LP5 A;  1W1F A;  1I07 A;  1SRL A;  2DBM A;  3TSZ A;  4Z89 A;  2EQI A;  2EGC A;  1GFD A;  3M0P A;  2J6O A;  3SHW A;  3EHR A;  2KYB A;  3CQT A;  2VVK A;  2G6F X;  5FWB A;  1OV3 A;  5IHN A;  2RQU A;  2EYW A;  4FSS A;  2EBP A;  1PRL C;  2CSI A;  3M0S A;  1AWW A;  2JW4 A;  4HVW A;  2B86 A;  2DL7 A;  5GJW B;  4LNP A;  3H0F A;  3NPF A;  3EGU A;  1X43 A;  1E6H A;  2DJQ A;  2LJ0 A;  1GCQ C;  1UE9 A;  1WA7 A;  1UHF A;  2KYM A;  1NEB A;  2KRM A;  1AVZ C;  1X27 A;  4J9I A;  1CSK A;  2EPD A;  1PNJ A;  2K3B A;  2DIL A;  4JZ3 A;  1YWP A;  2K9G A;  2HDA A;  4IIO A;  2ED0 A;  2RQV A;  1T3S A;  2LMJ A;  1M8M A;  4QT7 A;  2JT4 A;  2DNU A;  5IXF A;  2L2P A;  4J9G A;  2D8H A;  4RTT A;  1MUZ A;  5L23 A;  1TG0 A;  3VS2 A;  1WYX A;  2YT6 A;  2LX7 A;  4Z88 A;  3A98 A;  2AZS A;  4OMQ A;  1VYU A;  1JO8 A;  2YUP A;  3VS6 A;  5I22 A;  2RQW A;  4ESR A;  1JQQ A;  2KEA A;  2QDL A;  4HCK A;  3EG2 A;  1VYT A;  1BBZ A;  2FO0 A;  2PNI A;  1ZLM A;  2KR3 A;  4A63 B;  1JEG A;  4D8D A;  1NG2 A;  1GBR A;  1WLP B;  3VS5 A;  2ED1 A;  2FG0 A;  2LQN A;  2X3X D;  1NLO C;  1NM7 A;  2EYZ A;  1ABQ A;  2JXB A;  1W6X A;  1QWE A;  3M0Q A;  2ESW A;  2KXD A;  1SHF A;  3I35 A;  2VKN A;  2P4R A;  1FMK A;  1OPL A;  1K1Z A;  3JV3 A;  2E5K A;  4LN2 A;  1U5S A;  2YUO A;  2RPN A;  1U3O A;  2C0I A;  2ABL A;  1GCQ A;  1WXU A;  4OML A;  3THK A;  3O5Z A;  2H8H A;  4LE9 A;  2BTT A;  1ABO A;  1RUW A;  1FYN A;  2MIO A;  2RN8 A;  4RTU A;  4LUE A;  1UUE A;  5GJV B;  3M0R A;  1K9A A;  3H41 A;  2J6K A;  4AFZ C;  1H8K A;  1BB9 A;  1N5Z A;  2W0Z A;  2PZ1 A;  1UJY A;  1I1J A;  4J9B A;  4J9C A;  4J9E A;  4HXJ A;  2CT3 A;  1UTI A;  1GRI A;  3I5S A;  2K7A A;  3H0H A;  4LUD A;  1TUC A;  1WXT A;  2HBW A;  3KFV A;  2YDL A;  2KRO A;  4EIK A;  1JXM A;  2JM9 A;  1UGV A;  4M4Z A;  2C0T A;  4JZ4 A;  2X3W D;  2J06 A;  1X6B A;  2DL8 A;  2DX1 A;  2MOX A;  1M3A A;  2D8J A;  1LCK A;  2SEM A;  1GL5 A;  1K76 A;  1PWT A;  4Y92 A;  1YNZ A;  4JJD A;  2HEQ A;  2XMF A;  1M3C A;  1OPK A;  1H92 A;  2DA9 A;  1KIK A;  3GBQ A;  1E7O A;  1B3Q A;  5FW9 A;  4GBQ A;  4AG2 C;  4CC2 A;  1B07 A;  1X2K A;  2A28 A;  3VRZ A;  1QKX A;  2ROT A;  2JMC A;  1KSW A;  1X2Q A;  2CH4 A;  3H0I A;  3SEM A;  4F14 A;  2D1X A;  2EKH A;  4HVV A;  2JTE A;  2DRK A;  2ECZ A;  1K0S A;  4DEY A;  1KJW A;  2FEI A;  2JM8 A;  1PRM C;  2OJ2 A;  5I11 A;  1ARK A;  5IH2 A;  2YUQ A;  5IHK A;  2F2W A;  3FJ5 A;  2JS2 A;  2LCS A;  3C0C A;  2FRW A;  2DL4 A;  1YWO A;  1G2B A;  1A0N B;  1UG1 A;  2FRY A;  1V1C A;  1VA7 A;  4RUG A;  2CT4 A;  4R0K A;  3EG3 A;  1YCS B;  2GQI A;  2K6D A;  1BU1 A;  3LH5 A;  3RNJ A;  1OEB A;  2KBT A;  1AZG B;  1QKW A;  2V1Q A;  5EC7 A;  2O88 A;  1UHC A;  1WDX A;  3REA B;  2CH4 W;  1ZSG A;  3PE0 A;  2KNB B;  1NYF A;  1AOJ A;  2C0O A;  1HJD A;  2LJ1 A;  1JU5 C;  3VS4 A;  3IQL A;  2O9V A;  1SPK A;  2F2X A;  2I0N A;  3TSW A;  1AEY A;  1M30 A;  1ZUY A;  2RMO A;  4AFQ C;  1Y57 A;  2DM1 A;  2LNH B;  1QCF A;  2F2V A;  1QWF A;  3NGP A;  3NHN A;  5IXB A;  5FWC A;  3ZL7 C;  2L3S A;  4JJC A;  1T3L A;  1JXO A;  2L3P A;  4CC4 B;  2KRN A;  1WFW A;  2LQW A;  4JJB A;  2GTJ A;  4J9F A;  2HCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...