5I11A

Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain t114s-q128r mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNSEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain T114S-Q128R mutant
rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 6
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5i11A00
2YT6A 1K0SA 1PRMC 2ENMA 2DNUA 2KT8A 1X6BA 3M0TA 1X27A 2MIOA 3I5RA 2ESWA 2RMOA 2D1XA 1NYGA 1VA7A 2JM8A 2OAWA 2DL5A 2LMJA 4AFQC 2JMCA 1UECA 2E5KA 1NEBA 1JU5C 1QWEA 2FG0A 4CC2A 5GJVB 1PHTA 2C0IA 2HEQA 2K3BA 2LNHB 1JQQA 3NPFA 2DRKA 1G83A 3IQLA 3H0IA 1UGVA 1UHCA 1WXUA 1FYNA 1WI7A 2L3SA 5ECAA 2AZSA 1OEBA 2K2MA 3VS7A 2A28A 2A08A 2GTJA 1H92A 2CH4W 2KBTA 2HCKA 3H41A 2EYYA 2NUZA 1M3CA 1H8KA 1BB9A 2JTEA 4D8DA 1UUEA 3VRZA 1GFCA 2PTKA 2JS0A 2RQUA 4QT7A 3THKA 1GL5A 2HDAA 4ZNXA 1I1JA 1WX6A 2J7IA 4J9CA 2FRWA 5FW9A 4JJBA 2YUOA 2X3XD 3ZL7C 1QCFA 2LQWA 2BTTA 2AK5A 2CSQA 2GBQA 4RTWA 3VS3A 3I9QA 2RNAA 1J3TA 2YUNA 3VS1A 1X2KA 2ABLA 3RNJA 1I0CA 2KXDA 4OMQA 2JM9A 3NGPA 4X1VA 2MCNA 1W1FA 3QWYA 2O9VA 1X69A 1BU1A 2K79A 1YN8A 2KE9A 1WXTA 2YUPA 1PNJA 2FPFA 3QWXX 4AG1C 1ZLMA 2VVKA 4ORZA 1SEMA 3M0RA 4RTYA 1BBZA 3PVLA 1JEGA 3EHQA 2KNBB 1WXBA 2RPNA 1KJWA 1W6XA 2EVRA 1T3LA 4J9DA 3ULRB 1H3HA 3UF4A 4AFUC 1OOTA 1VYVA 2AKLA 2DA9A 4RTUA 1MUZA 4RUGA 1HJDA 2F2WA 4JJDA 4J9FA 1WDXA 2VKNA 2O88A 1K4US 1WLPB 3I35A 3UATA 3NHNA 2JS2A 2JMAA 5I22A 2KYMA 4GLMA 2CT3A 1ABOA 3JV3A 1SPKA 1X43A 4OMOA 2A36A 2J06A 1UJ0A 3SEMA 2DYBA 2YDLA 2VWFA 1SRMA 1PKSA 2RQWA 4LUDA 1V1CA 2PZ1A 2KRMA 1G2BA 2GNCA 1AEYA 2L0AA 3EGUA 1GCQA 2F2XA 2PNIA 2SEMA 1WIEA 4RTZA 2LX7A 1HSQA 3A98A 2EGAA 4Y92A 2LP5A 1RI9A 4CC4B 1A0NB 2RN8A 1KSWA 3RBBB 5HCKA 4JZ3A 4J9GA 2DJQA 2CUDA 1WA7A 3TSWA 4EIKA 1KFZA 5IHKA 1IO6A 2DL8A 4F14A 2C0OA 3VS0A 2FRYA 3EHRA 3PE0A 4HXJA 2K9GA 2RQTA 4RTTA 1SSHA 3C0CA 2CSIA 3M0SA 4IIOA 1M3AA 2FEIA 3EG2A 2KGTA 2V1RA 1MV0B 1GFDA 3VS2A 3M0QA 1JO8A 1NLOC 1Y0MA 2CDTA 2OJ2A 1B3QA 1U3OA 3GBQA 1E6HA 4OMLA 4ESRA 1EFNA 1TUCA 2B86A 2EKHA 1YWOA 1YWPA 2EYXA 2W0ZA 2BZ8A 2DILA 5L23A 1QKWA 2BZYA 1SHGA 2X3WD 2XMFA 2K7AA 4WCIA 1M27C 1GCQC 5IXFA 2DVJA 1RLPC 1E6GA 2KEAA 4J9EA 2IIMA 2J6OA 2O2OA 2ROTA 4LN2A 4F16A 2JW4A 2M51A 1LCKA 1JXMA 3REBB 2DMOA 2I0NA 2JXBA 1GCPA 2L3QA 2DBMA 2W10A 1M8MA 3VS5A 1YP5A 2EYWA 1UHFA 1S1NA 1CKAA 2LQNA 4M4ZA 2KROA 4HVWA 3VRYA 2FPEA 2DL4A 2HBWA 2D8JA 2FO0A 1SHFA 1U06A 1KIKA 1PRLC 2ECZA 4RTXA 1NM7A 1XOVA 4JJCA 2L3PA 1Z9ZA 2LJ0A 2C0TA 4A63B 2KRSA 1NLPC 1MV3A 4Z89A 4CC3A 2ED1A 2F2VA 2YUQA 1Y57A 5GJWB 1NYFA 1ZSGA 4Z8AA 4F17A 4IIMA 1AD5A 2CT4A 2DX1A 4JPBW 1PWTA 1Z9QA 1ZBJA 1ZX6A 4LUEA 1AVZC 4E6RA 2EBPA 1X2QA 2H8HA 3KFVA 5I11A 1ZUYA 2GTOA 1PKTA 1B07A 2LJ3A 4HVUA 1E7OA 2SRCA 3M0UA 1U5SA 4AG2C 3EG3A 1JXOA 4K11A 3FJ5A 4OMNA 1RLQC 3UA6A 1WFWA 2DBKA 2YSQA 2DM1A 5FWBA 3M0PA 2D0NA 1AWXA 1UTIA 2QDLA 1AZGB 2EGCA 1UFFA 1K1ZA 1T0HA 4D8KA 4OMMA 1K76A 4HCKA 1YCSB 1SRLA 2EW3A 2MOXA 2J6KA 1UDLA 2AZVA 2DL3A 2DRMA 3I5SA 4R0KA 3NMZC 3H0FA 5IHIA 2D8HA 3EG0A 1CKBA 1WYXA 1T0JA 2LZ6B 1I07A 3TSZA 1VYUA 1AWOA 3CQTA 4DEXA 2EQIA 2LJ1A 2KXCA 2KT1A 4AFZC 2J05A 2EYZA 1TUDA 3LH5A 2J6FA 2P4RA 1GBRA 1HD3A 5IHNA 3O5ZA 2HSPA 4KRTA 2CH4A 1GBQA 1OV3A 4J9IA 1UG1A 3TVTA 1BK2A 2V1QA 2ED0A 3U23A 2O9SA 4DEYA 4J9HA 2KR3A 1W70A 1AWJA 2DF6A 1M3BA 1AOJA 1OPKA 4OMPA 2KRNA 2AKKA 2LCSA 1M30A 1NEGA 1T3SA 2RF0A 2A37A 2L2PA 2GGRA 2CUBA 2EGEA 1OPLA 1ZUKA 1QWFA 2M0YA 2RQRA 1AWWA 1QLYA 3PVQA 1YNZA 3H0HA 3VS6A 2JT4A 4Z88A 4GBQA 3REAB 1K9AA 4RTVA 2G6FX 1X6GA 1ZUUA 2GQIA 4LE9A 2FPDA 1FMKA 2DL7A 2KYBA 1UE9A 1UJYA 2EPDA 1ARKA 4J9BA 1AZEA 1VYTA 2RQVA 5EC7A 4AFSC 1K0XA 2DE0X 2K6DA 1ABQA 5IXBA 2BZXA 2O31A 4CC7A 4LNPA 5IH2A 2NWMA 1N5ZA 5FWCA 3SHWA 3UA7A 1CSKA 1RUWA 4JZ4A 2DLPA 3EG1A 3VS4A 1GRIA 4HVVA 1TG0A 1QKXA 2ROLA 3R6NA 2CREA 2OI3A 1NG2A 4FSSA
chains in the Genus database with same CATH superfamily
2YT6A 1D3BB 3OYFA 2ENMA 2O4XB 4C5IA 3OYIA 1K9MC 1NYGA 2JM8A 2NYSA 2OAWA 1TWBA 2DL5A 2LMJA 4AFQC 2QTVA 1UECA 2E5KA 4V2SA 1XTDA 2IPOB 1MMNA 1QWEA 4CC2A 5I2MA 1PHTA 2HEQA 2K3BA 1JQQA 3H9NA 3NPFA 3JCMX 1G83A 4EMGA 1WXUA 3BDUA 4IUTA 3CPFA 1VQLQ 1Y96A 2FYKA 2LTOA 2K2MA 4BE2A 3HHTB 3JCMh 1EZZB 2CH4W 4OP0A 2COYA 4C92B 1WNLA 1BB9A 2MYSA 2JTEA 3MEWA 3V8KA 3FLGA 3X26B 5GANe 2EYQA 2MF2A 3R6OA 1YBYA 2J7IA 3OSVA 4PJMA 4Y91A 1BI2A 1PSEA 1WGSA 4PJOG 2RI2A 2YUOA 1M1KU 2X3XD 1YJ9T 4XU2A 1D1AA 2ZPEB 3OYJA 3OYGA 5GANj 3QXEB 3CBPA 4M75E 3G71T 1YN8A 3M4GA 1OU8A 4C8QE 3CPWS 2XDDA 3QWXX 1ZLMA 4RTYA 3EGXB 4DOWA 4M78G 2EIFA 3RESA 3CPWP 2XDBA 1JEGA 2RPNA 1W6XA 2EVRA 1UGPB 1VQPT 4J9DA 2HBPA 4E2FB 1VYVA 4LD6A 2DA9A 4RUGA 2F2WA 2M9UA 4J9FA 2QTXA 2VKNA 4Z02A 1WLPB 3NHNA 2M02A 3QPHA 5LJ3e 4M7AG 2JMAA 2KYMA 1Q86C 4M78D 3PIOA 3LGFA 2XG8D 1ABOA 3WXMB 5FRMA 2J06A 1C6VX 1UJ0A 2EWNA 3SEMA 2H3EB 2VWFA 2RQWA 1ACMB 2PZ1A 1Q81C 2YRVA 1NZ9A 2KRMA 1VQ7T 3FC3A 4FCYA 3ER0A 2L0AA 1M1KR 1Y07A 2EJGA 3JAME 3WVEB 5LJ3j 5D6WA 2PNIA 2SEMA 2FZCB 4M7AD 2LX7A 1M8VA 4Y92A 1RI9A 2ZPHB 4MZPA 3X25B 3OYYA 1A0NB 4JZ3A 4PJOF 5GAOp 3CC4T 1WA7A 3LX7A 3A8LB 4J8OA 5GAOn 5C6SA 2FRYA 3EHRA 5LJ5f 4HXJA 1N6AA 4NL2A 3M0SA 2QG9B 2FEIA 3EG2A 3X20B 1OZ3A 1NLOC 5FRNA 4M77E 2RJDA 4ZN3A 3QDRB 4HCCA 3CBOA 1M2VB 2YXYA 4FM4B 4M78F 4LDYA 1M27C 3A8MB 2K5FA 1GCQC 2MAMA 3J81E 4BDYA 1VQKA 1E6GA 1DJ7B 2J6OA 3ZBDA 1QVPA 1LOJA 3GNFB 4HCZA 1LCKA 3JRZA 2JXBA 3AT1B 4JRKA 5LJ5g 4C8QA 1UHFA 2QA4T 2VYTA 1CKAA 2LQNA 2KY9A 1G5VA 3A1PA 3CCSA 1LNXA 2DL4A 3G6EA 5L8RE 1KIKA 2KI7A 2DFUA 4JUVA 3JCMQ 2EFIA 2XK0A 1R8OB 3JCMe 3RKYA 2PQWA 3QSUA 2KRSA 1VQKQ 4JLGA 2GQVA 4FIBA 3CC7T 1PCXA 1BI1A 3HRSA 5CKFA 5A0GA 1ZSGA 4Z8AA 2QQBA 1IRXA 3I55A 1Z9QA 3CCSQ 2OTLT 1ZX6A 1YJNA 3G6EQ 2EBPA 4C0DC 5I11A 3MEUA 2NUPB 1PKTA 2LQ8A 1E7OA 2LVMA 1U5SA 3MCAB 4XTVA 4K11A 4OMNA 4C0DB 3VYGA 1FMVA 2YSQA 2DM1A 3PMTA 5FWBA 4F7UA 2NUTA 3M0PA 3JB9H 2E41A 1UFFA 4D8KA 2DETA 3M5AA 1U8RA 1YCSB 2JTFA 2EW3A 3I55Q 1YJNQ 3I56T 2DRMA 3A8OB 4C92G 2DAQA 2E3IA 3FEOA 1Q7YC 2D8HA 3CCRA 2YRDA 4FL6A 4PJJA 1I07A 2A3LA 3QZ9B 1AWOA 3CQTA 1D09B 1AT1B 3CXCP 3Q1JA 5KYWB 3QDFA 2WSCE 4AFZC 1UEBA 2EYZA 4E7KA 5DM7R 4MDWA 2P4RA 5GAMf 1G3WA 4C92D 1NJIC 3G4SA 1VQNT 2E5QA 2WSFE 2DZCA 1KQSS 5GAN7 3OBWA 1OU9A 4PJOC 3CCRQ 2ED0A 3EGDB 4J6XA 2RHYA 2L89A 1AWJA 3EFRA 4BB7A 4DA4A 2K3YA 2DF6A 2LDMA 3HFOA 1OPKA 2KRNA 2RF0A 2QDYB 3PNWC 4ELYC 3M58A 3JB9G 2GGRA 1BIAA 1QWFA 3G4SQ 5LJ5d 2RQRA 4M7DA 1QLYA 2A7YA 1YNZA 2YWWA 3H0HA 3MHXA 1VQ5T 4M78C 4RTVA 2RJCA 1D0YA 3ASKA 5GAMg 1H641 1ZSZC 2CP5A 2XKOC 2ZPBB 5HK3A 3CCET 1VQ6T 5FU6C 4EPCA 3CC2A 4JS5A 1Y96B 3QG1A 3JB9D 1UJYA 1ZSZB 2FZKB 2EPDA 2EAYA 1YI2A 1Q82U 4GY5A 1UGQB 1TU0B 3MJXA 1NE8A 3OBYA 1IGUA 2FL7A 3SWNB 4LXCA 5IXBA 2PVGB 2BZXA 4JS4A 4BI4A 4C92F 1WHMA 3ME9A 1K73C 1CSKA 1RUWA 4HVVA 1YITT 3OSSC 3CCLT 1WJSA 3TU4K 1PRMC 2AIRB 3CC2Q 1NBEB 2KT8A 3HRTA 2XDPA 1X27A 2ESWA 4FW2A 2D1XA 5DLOA 1VQ9T 4PL6A 1VQ8A 1TH7A 2V8JA 2JMCA 1WHKA 1YI2Q 2K5IA 1JU5C 5GAN5 1ZA1B 2FG0A 3JSCA 5GJVB 2C0IA 2LNHB 1UHCA 4E7LA 1IXDA 1YIJA 2L3SA 5ECAA 1S72T 2H3JA 4E7IA 3UWNA 3OYMA 3ZFJA 5EG2A 1TSFA 6AT1B 3HL8A 2KBTA 3PGGA 3MP8A 2QK0A 3H41A 3JB9F 5CQXA 1VQ4A 1VQ8Q 3MEAA 1H8KA 3TEEA 3E19A 1OX9A 2EJFA 3VRZA 1GFCA 2PTKA 4QT7A 2RQUA 1LJOA 3LH0A 2HDAA 4RG8A 3WVDB 1Q82R 2R57A 3L1AA 4J9CA 2FRWA 4QQGA 1QCOA 1WPYA 5FW9A 2L3RA 2VUBA 4XAXB 1YIJQ 2ZPGB 4JRIA 2F5TX 2AK5A 3LGLA 2GBQA 4ELZC 2M1HA 2RNAA 1RAIB 5GMKh 1J3TA 1Y71A 1X2KA 1I0CA 1VOMA 2KXDA 5GANf 4ZTJA 2JM9A 1KC8U 2HQHA 3NGPA 1VQ4Q 1VQOT 2ZAEA 4X1VA 2MCNA 1W1FA 2E3HA 3FIFA 1BU1A 2RHZA 3L2RA 1WXTA 2X9HA 5KYUB 3HPWA 4A54A 5GAN3 4IUUA 1SEMA 3OMGA 4LDWA 1TXQA 4C0GA 1M1KC 4ZGJB 2KNBB 2RH2A 3CCMA 4BE0A 4FT2A 2BKDN 5FU7B 3EG9A 1T3LA 1H3HA 3OW2S 3CMAT 1FWZA 5GAMd 4AFUC 1OOTA 4DOVA 2V26A 4PFPA 4RTUA 5GMKl 1HJDA 4QQ6A 1KD1U 3TQ7P 1WDXA 3CMET 3I35A 3UATA 3QHSA 2JS2A 9ATCB 1G3SA 4GLMA 3QJ6A 4PFZA 3JV3A 5GANg 1SPKA 4OMOA 2A36A 3J80E 2DYBA 3RR6A 1UB4A 5FLXE 1G2BA 2DTOA 3CCMQ 2GNCA 4LD9K 4EMKC 2FB7A 3HKSA 2KK4A 1KQ1A 3P8DA 5LJ3f 1IB8A 4EMKB 2BIVA 1RL2A 3A98A 2EGAA 4M75B 2LP5A 4CC4B 1KC8R 1HXDA 4C8QB 3RBBB 2CP7A 4XTXA 2CUDA 3TSWA 4DBRA 4C92C 5KCHA 3NTHA 3VV0A 2RQTA 4RTTA 3BDLA 2KGTA 4CI0C 2CS7A 2V1RA 1MV0B 1Y0MA 2LRQA 1I5OB 3M4YA 3GBQA 1E6HA 4ESRA 4M78A 1I5LA 5KE3A 1TUCA 2LT4A 2GFUA 1YWPA 4N0AC 4NS5A 1QKWA 2BZYA 1KD1R 1SHGA 5LJ3g 2HQEA 2X3WD 3OA6A 2XMFA 3VYHB 4WCIA 3M9QA 3HTRA 4OGEA 3MP6A 3OS1A 2IIMA 2EQJA 2O2OA 4JDSA 5DY9A 2C06A 4M7AA 4F16A 2PUOB 1SG5A 2M51A 1UGSB 1JXMA 2D9TA 5I2SA 1GCPA 2DBMA 5GAOq 3VS5A 4PJOD 5CKBA 3OW2A 3TCJA 1S1NA 1QQJA 5CKHA 2P0QA 3VRYA 1JB0E 1QP2A 4PLLA 1U06A 4E47A 3JCMc 1PRLC 4RTXA 1NM7A 1WJQA 3SDZA 1XOVA 3X28B 1Z9ZA 3OYHA 4KUIA 1NLPC 2GF7A 4CRIA 2QQRA 1RAAB 4M77C 3OY9A 3INZA 1BIBA 2X4YA 2ED1A 3OS5A 4OGCA 5KYXA 2JZ2A 3H8ZA 2MPXC 1WHHA 5GJWB 1BCOA 3OS2A 2K57A 3V8JA 4M77B 4F17A 1VQMA 2NLUA 2RB6A 1QVGP 1AD5A 2CT4A 2DX1A 3DB4A 4XU0A 3JCMf 2CP0A 3V8LA 1PWTA 3KBGA 1X2QA 2H8HA 3KFVA 5GMKe 3EFOA 4AG2C 3EG3A 1JXOA 2DIQA 2RA2A 3FJ5A 5GANd 4IUQA 3AHUA 4F7UE 2CP6A 1QCNA 1VQ7A 1AWXA 5D7UA 1M2OA 4RKUE 2EGCA 1K1ZA 1IREB 4OMMA 1VQMQ 1AHJB 1MNEA 4MMKA 2MOXA 4PK4A 5GMKj 2IVWA 2KQWA 3NMZC 2LT1A 2RJEA 4HA8A 3EG0A 1CKBA 1WYXA 1T0JA 4FYXB 4A4KA 3OMCA 3JCMg 5KYYA 4Q5WA 2EQIA 1VQ7Q 2KT1A 1K8AC 2J6FA 4WTOB 2D0QB 3QZ5B 1HD3A 2ZZDA 3O5ZA 4KRTA 3CPWA 2XU8A 2M0OA 3SB2A 2CH4A 1OV3A 5GAN8 1BKBA 1BK2A 2CP2A 4N4GA 1TTHB 2V8KA 3U23A 3CCJT 2LQKA 4DEYA 4J9HA 5LJ3d 1VQKT 5GAN2 1D3BA 1QW1A 4PJLA 2O4XA 1AOJA 2LCSA 5HK0A 4EDUA 1M30A 3HSBA 1T3SA 3DB3A 4QKUA 2A37A 5M9OA 3NTIA 3C94A 1N8RC 1G8XA 1RADB 2CUBA 4M7DE 1AWWA 3L2QA 2JT4A 1Q86U 3REAB 2VXFA 1ZUUA 1M90C 4LE9A 4R56A 3SD4A 2E64A 1HK9A 4QW2A 3E2UA 1Q81U 3G7ZA 2DTHA 2E10A 4X34A 1D0ZA 4ANJA 1ARKA 2DXBA 4C92A 3GLXA 4HT8A 2EKOA 3EH1A 3VJPA 2DE0X 3CD6A 5AT1B 4CC7A 4IURA 5IH2A 1N5ZA 3A5ZB 3FRNA 3EG1A 1X75C 4M75G 4BE1A 2VC8A 1B34B 1TG0A 1QKXA 3OYCA 1F1BB 2E6ZA 1NG2A 4FSSA 5GAN6 4C8QG 2DNUA 3M0TA 3UT1A 1QMCA 3I5RA 5KYNA 1KG1A 2RMOA 2X35A 2B8AA 3CCVA 3S3NA 5CR2A 2QEXT 2CZ7B 5AYFA 3ZEHA 2R5MA 3CXCS 3M56A 3CD6Q 4M75D 2FVUA 3IQLA 3CCUT 3H0IA 3F70A 1FXXA 4A53A 2F69A 3CCRT 4P5NA 2AZSA 3RERA 2HL5C 3I56A 1OEBA 2DO3A 3VS7A 1Q86R 3JCMb 4BACA 2A08A 1R0BG 3EG9B 4Y28E 4E7JA 2EYYA 2NUZA 5CK9A 3JCMd 1M3CA 1M1GA 3CCVQ 4KH0B 1Q81R 2AHJB 5FROA 4KGZB 5CO7A 4FT4A 3G4ST 3CCQA 1OX8A 1I1JA 1MMDA 1WX6A 2HAXA 3RDVA 8ATCB 1RACB 1BCMA 3ZL7C 3I56Q 2LQWA 2EQUA 2CSQA 4OF1A 2PU9B 3E1SA 4RTWA 3VS3A 3I9QA 3C95A 2YUNA 3VS1A 2ABLA 4OMQA 3QBYA 1LVKA 3QWYA 1X69A 2K79A 3OYDA 2A0FB 4KGVB 3CCQQ 1PNJA 4DBFA 3V7RA 2FPFA 2VVKA 4M75F 1D1BA 3M0RA 3JCMJ 1BBZA 4FU6A 3QO3A 5GMKm 3C12A 4M77G 3EHQA 4C8QF 1WXBA 1KJWA 4JRPA 3SWNC 4BY6B 3ULRB 4IKFA 2HL3A 3EAEA 3UF4A 3EH2A 3NTKA 2DZ9A 2QGGA 1WHJA 2KVQG 1OZ2A 1K4US 2K4YA 3RIRA 4XTYA 2GFAA 1M2VA 5KE2A 2ZPIB 2CT3A 4M77D 4A4EA 3OQ5A 2CYZB 4E7ZA 5CKEA 4LUDA 1MHNA 2X51A 1JJ2S 2KSSA 1W2BS 3GIBA 2IG0A 4RCBA 2RI3A 5IAYA 1PG5B 1AEYA 1WZOA 2DD4A 1YITA 4FYWB 3EGUA 1QVFP 1GCQA 1KQ2A 5LL6S 2R5AA 1C1AA 5IN1A 1JJ2P 1VQ8T 2F2XA 1W2BP 4PJOE 1WIEA 2CP3A 4RTZA 1HSQA 4C5EA 1PC0A 4X9DA 4QVZA 1VQ9A 4F04B 3S6WA 4ZN1A 1OQKA 1KSWA 5HCKA 1BYMA 1IHVA 4C0ZA 2DJQA 4C5GA 4JJNK 4QVDA 4EIKA 1NJIU 1KFZA 2WACA 1IO6A 5IHKA 3RMSA 1RAEB 2C0OA 3VS0A 2E65A 3V7CA 1KQSA 1I81A 4FSXA 4DQ2A 4VUBA 2KAFA 2K9GA 1SSHA 2QQSA 4B9WA 3C0CA 2CSIA 4IIOA 1YHQT 4L6V5 1YITQ 3RUXA 1GFDA 1UGRB 3VS2A 3M0QA 4DBQA 4M78E 2OJ2A 3N5BB 2QYZA 4OMLA 2DPPB 2RM4A 4TVRA 2JJ9A 1IHWA 5HKCA 5CVIA 5KYXB 1VQ9Q 2EKHA 1YWOA 2PVDB 3PMIA 2RO0A 3D7SB 4M77F 4B9XA 2K2VA 2DJZA 1OYXA 2NUPA 2OTJT 1MMAA 4BDZA 3E9GA 4EMHA 4KULA 5KCOA 2RHXA 1YJWT 2DVJA 4M7AE 4J9EA 2MMPA 3M57A 1NPPA 3C4SA 1WQWA 3REBB 2FHDA 3PTAA 1TUGB 2BE7D 2L3QA 1M8MA 3DLMA 2OX7A 3M55A 2XIDA 5FU7C 2HNIA 2KROA 4HVWA 2FPEA 4A4GA 1KHCA 3JCMV 4J6WA 2D8JA 2FO0A 1SHFA 2ECZA 3T9NA 2QI2A 3DKMA 4JJCA 2L3PA 1O9SA 3LWHA 2Z0WA 2LJ0A 2C0TA 1I8FA 4OMFB 4JLIA 1X6OA 1K73U 1XNIA 4J6YA 2YHTA 1NJIR 4QQDA 1YFNA 2VASA 4Z89A 1QP3A 5KYWA 2BE9B 4M7DF 2F2VA 1IZ6A 5J3BA 2YLBA 2YUQA 1Y57A 3BE3A 3CMAA 5C0MA 4IIMA 2CZ0B 1BI0A 2COWA 2HD0A 4R55A 1ZBJA 4E6RA 3CMEA 2XD0A 2LC4A 1VQLT 2RD1A 2JVVA 1ZUYA 2GTOA 2LJ3A 2LNVA 4HVUA 4M75C 3H6ZA 4ME7A 2VGNA 3EGDA 3M0UA 2XI9A 3EFSA 4O6JA 3HP9A 3HFNA 1SF9A 3UA6A 4C8QC 1WFWA 2D6FA 2YLCA 5GAOl 3URGA 4PJOA 4GLKA 2X4JA 2D0NA 2AT1B 5D6XA 2HKQB 2QDLA 1AZGB 3CMAQ 2DXTA 5GAOr 3CBMA 1SRLA 4ZGEB 2J6KA 1WHLA 2DYIA 3CMEQ 3G1JA 3FJPA 3I5SA 4R0KA 2DKGA 3H0FA 3A8GB 2K5LA 5IHIA 2M16A 3MP1A 1Q95G 1MMGA 2HSEB 4BD3A 2KXCA 2J05A 1ZSZA 3JCMW 1K73R 1TUDA 1ZQ1A 3L42A 3OS0A 4ZGDB 1EIFA 4BUGA 4XU1A 2P0PA 4JRQA 3SWNA 1ZHIA 1PD0A 1ZBXA 5CCAA 3FB9A 1G3TA 1H3ZA 2EJ9A 2QQ9A 4IUPA 3TVTA 1PM3A 2KMTA 2V1QA 1W4SA 2O9SA 1YJ9A 1WHGA 4PJNA 1M3BA 4OMPA 4F7UB 2NUTB 2E70A 2L2PA 3KXTA 2VV5A 1MNDA 5LJ5h 3G71A 3SFMA 2EGEA 1OPLA 2LCCA 3L2ZA 5D6YA 2M0YA 2MWPA 3VU3C 3PVQA 2V8IA 2DIGA 2I2LA 4Z88A 5J26A 4GBQA 1K9AA 3BFMA 2G6FX 1KHIA 1X6GA 4II1A 1QVGS 2GQIA 1YJ9Q 3UPUA 2JOYA 3JCMP 2MK5A 1VQPA 2L5QA 4BI3A 4L59A 1K9MU 2VGMA 4C92E 3X24B 2MWOA 2QAZA 4J9BA 5J39A 1ZA2B 1VQMT 1VYTA 2BUDA 2X4XA 1AZEA 1EX4A 1K0XA 2K6DA 3G71Q 2DD5A 4L5GA 4N4IA 1ABQA 2ZGWA 2K3XA 2KDSA 2O31A 2FZGB 4J7IA 3SHWA 3UA7A 4JZ4A 2WSEE 1GRIA 2OI3A 1K0SA 1X6BA 1VQPQ 4XTUA 2MIOA 4UC4A 2JN0A 1VA7A 3GF5A 3QUIA 4M7DC 1NEBA 3M53A 2XHCA 3RMQA 1VIFA 5KYUA 2VB6A 4MDXA 2VXEA 2DRKA 1RAHB 4BI8B 1I4K1 5CIUA 4M7DB 1UGVA 3CC4A 1X01A 1FYNA 2QGFB 1WI7A 3NFCA 4KUDK 4FYVB 4LDXA 1M5Q1 3MO8A 2A28A 3QIIA 2GTJA 5A0LA 1H92A 3VKIA 1N27A 2HCKA 2Y4YA 5DLQE 4J7FA 4D8DA 1K9MR 3QYHB 1RI0A 1UUEA 3P8HA 2JS0A 1GL5A 3THKA 4C5HA 4ZNXA 4PFOA 4E7SA 2COZA 2RJFA 3CC4Q 3KUFA 4JJBA 3GP8A 2ATCB 3L2WA 1QCFA 1O75A 2BTTA 1YCYA 4KH1B 3CCJA 3RNJA 2E4HA 2QQAA 1QVGA 2LX9A 5KH6A 4EMKA 4OVAA 3CCST 3G6ET 4M75A 2O9VA 2QA4A 2KE9A 2DERA 2YUPA 3UDCA 3JB9I 4M7AF 4AG1C 4ORZA 4XK8E 2DEQA 3CEYA 3PVLA 3A8HB 5GAMh 4XQ3A 3LWIA 4PNOA 2QXFA 7AT1B 1WQ7A 3CCJQ 4YTLA 3CC7A 2AKLA 3I55T 3L2UA 2E1HA 1MUZA 3DLLA 3VUZA 1XQHA 1YJNT 1Y7XA 2O01E 4JJDA 2O88A 3QKJA 2QA4Q 2DVEA 4D6WA 3CD6T 5I22A 3O8VA 2OTLA 2X4WA 1X43A 3LYIA 1P92A 2YDLA 2YRCA 1TOVA 1SRMA 1PKSA 4RG2A 1SSFA 1V1CA 4LDUA 4N0AA 5GAN4 3GOXA 2DTIA 3GPLA 4C0FA 1Q82C 3L2VA 5LJ5e 1D0XA 3LLRA 3OYBA 3CC7Q 1U1SA 3CCVT 3M59A 1K8AU 4KBMB 1M1FA 3EGXA 2RN8A 3M54A 1B7TA 4C8QD 5CQYA 2OTLQ 2QEXA 4X9CA 4J9GA 3OYEA 4HKEA 3MKDA 4RCCA 2DL8A 2L8DA 4F14A 3QYGB 3PE0A 5LJ5j 3CCUA 4FYYB 1GXIE 1M3AA 2DXUA 3S3OA 2CKKA 1JO8A 1TS9A 2CDTA 1B3QA 1U3OA 4RMOA 4B6MA 1R77A 3OYAA 1EFNA 4M77A 2OAUA 2B86A 3CCQT 2EYXA 2W0ZA 2BZ8A 2DILA 4F7UG 2G3RA 5L23A 1VQNA 1N8RU 2ZPFB 2QEXQ 3J7AF 1R0CB 2K7AA 5A2QE 3BW1A 4MZMA 3CCUQ 5IXFA 1RLPC 2KEAA 2ROTA 4LN2A 4LDVA 1IGQA 1M90U 1LPLA 3OB9A 4OB2B 2JW4A 8AT1B 2DXCA 2DMOA 2I0NA 1PSFA 1D1CA 2P84A 2W10A 1KQSP 1YP5A 4PJOB 2EYWA 4N4HA 2Y90A 4BY6C 2P4TA 4M4ZA 2EQKA 4J83A 3RKXA 1VQNQ 2HBWA 4O5VA 1K8AR 4MMLA 1XJWB 3S3MA 1VQ5A 3CC2T 4FW1A 3META 1WJRA 1N9RA 4A63B 1KC8C 3CCEA 1VQ6A 1MV3A 1YI2T 4CC3A 2E12A 1JRIA 2JNGA 4WF2A 1NYFA 2F5KA 4M78B 2JUFA 4QVCA 1V29B 1MGQA 1RABB 1PD1A 4JPBW 5FU6B 3QJYA 1VIEA 1QVFS 4LUEA 1AVZC 5GAOm 1U1TA 3CXCA 3RKWA 4AMCA 3OYNA 3PFSA 2ZCFB 5GANh 4NL3A 4M7AC 1VQ5Q 1Q7YU 1B07A 1HYOA 2E6NA 3P8BB 5HY6A 2SRCA 1N8RR 3CCLA 4OB3B 2GCXA 1RLQC 2CZ6B 1FX7A 3CCEQ 4AT1B 1VQ6Q 4M7AB 5CAIA 4M7DG 2DBKA 3OYKA 1KD1C 2P0KA 2HZYA 1OI1A 1UTIA 2F1LA 1T0HA 2JTMA 1M90R 2HMAA 4KGXB 1VUBA 4F7UF 1K76A 4HCKA 1YIJT 1UDLA 2AZVA 2DL3A 5GAMe 2RK1A 2CGHA 2HKNA 2R58A 1RAGB 1N9SA 4M7DD 1S72A 2LZ6B 1KK7A 3TSZA 3CCLQ 3OYLA 1VYUA 4E7HA 3GNGA 1VQ4T 5I21A 4DEXA 2LJ1A 2DK3A 3PT9A 4A4HA 2DEUA 3LH5A 4MZTA 1YHQA 4XU3A 5GAMj 3MPUB 4A4FA 1GBRA 1RAFB 5IHNA 2HSPA 4OB0B 2RHUA 1GBQA 4J9IA 5LJ3h 1UG1A 2LCLA 3PIPA 1B34A 1SKUB 4HT9A 3EFOB 1S72Q 4J5YA 3JB9J 3TREA 2Y4XA 3LW5E 4HCBA 2KR3A 1W70A 1BI3A 2OTJA 1Q7YR 5A0DA 1C0MA 2AKKA 3HRUA 1YJWA 1NEGA 1YHQQ 2HQXA 1VQOA 4OB1B 4XTZA 2PUKB 1M9SA 4PLIA 1NPRA 4IUVA 1ZUKA 2RK2A 5CKDA 4ZTFA 1V76A 3CCMT 3VS6A 4KT0E 3BY7A 1JBMA 1QVFA 2FPDA 2XICA 1JJ2A 1FMKA 5KYYB 4XTWA 1W2BA 2OTJQ 2RI5A 3VUBA 2PVOB 3FDRA 2DL7A 3V7SA 2KYBA 1M4ZA 4DBHA 3E9FA 1UE9A 5IT9E 1G3YA 2CZ1B 2MI6A 1YJWQ 5GMKi 1VQOQ 4ATOA 2EQMA 2RQVA 5EC7A 4AFSC 4PKCC 1FMWA 4LNPA 3OW2P 2NWMA 3MEVA 5FWCA 2QASA 3VS4A 2DLPA 1OULA 4NOYA 2ROLA 2RHIA 3R6NA 1VQLA 2CREA
chains in the Genus database with same CATH topology
2YT6A 1K0SA 1PRMC 2ENMA 2DNUA 2KT8A 1X6BA 3M0TA 1X27A 2MIOA 3I5RA 2ESWA 2RMOA 2D1XA 1NYGA 1VA7A 2JM8A 2OAWA 2DL5A 2LMJA 4AFQC 2JMCA 1UECA 2E5KA 1NEBA 1JU5C 1QWEA 2FG0A 4CC2A 5GJVB 1PHTA 2C0IA 2HEQA 2K3BA 2LNHB 1JQQA 3NPFA 2DRKA 1G83A 3IQLA 3H0IA 1UGVA 1UHCA 1WXUA 1FYNA 1WI7A 2L3SA 5ECAA 2AZSA 1OEBA 2K2MA 3VS7A 2A28A 2A08A 2GTJA 1H92A 2CH4W 2KBTA 2HCKA 3H41A 2EYYA 2NUZA 1M3CA 1H8KA 1BB9A 2JTEA 4D8DA 1UUEA 3VRZA 1GFCA 2PTKA 2JS0A 2RQUA 4QT7A 3THKA 1GL5A 2HDAA 4ZNXA 1I1JA 1WX6A 2J7IA 4J9CA 2FRWA 5FW9A 4JJBA 2YUOA 2X3XD 3ZL7C 1QCFA 2LQWA 2BTTA 2AK5A 2CSQA 2GBQA 4RTWA 3VS3A 3I9QA 2RNAA 1J3TA 2YUNA 3VS1A 1X2KA 2ABLA 3RNJA 1I0CA 2KXDA 4OMQA 2JM9A 3NGPA 4X1VA 2MCNA 1W1FA 3QWYA 2O9VA 1X69A 1BU1A 2K79A 1YN8A 2KE9A 1WXTA 2YUPA 1PNJA 2FPFA 3QWXX 4AG1C 1ZLMA 2VVKA 4ORZA 1SEMA 3M0RA 4RTYA 1BBZA 3PVLA 1JEGA 3EHQA 2KNBB 1WXBA 2RPNA 1KJWA 1W6XA 2EVRA 1T3LA 4J9DA 3ULRB 1H3HA 3UF4A 4AFUC 1OOTA 1VYVA 2AKLA 2DA9A 4RTUA 1MUZA 4RUGA 1HJDA 2F2WA 4JJDA 4J9FA 1WDXA 2VKNA 2O88A 1K4US 1WLPB 3I35A 3UATA 3NHNA 2JS2A 2JMAA 5I22A 2KYMA 4GLMA 2CT3A 1ABOA 3JV3A 1SPKA 1X43A 4OMOA 2A36A 2J06A 1UJ0A 3SEMA 2DYBA 2YDLA 2VWFA 1SRMA 1PKSA 2RQWA 4LUDA 1V1CA 2PZ1A 2KRMA 1G2BA 2GNCA 1AEYA 2L0AA 3EGUA 1GCQA 2F2XA 2PNIA 2SEMA 1WIEA 4RTZA 2LX7A 1HSQA 3A98A 2EGAA 4Y92A 2LP5A 1RI9A 4CC4B 1A0NB 2RN8A 1KSWA 3RBBB 5HCKA 4JZ3A 4J9GA 2DJQA 2CUDA 1WA7A 3TSWA 4EIKA 1KFZA 5IHKA 1IO6A 2DL8A 4F14A 2C0OA 3VS0A 2FRYA 3EHRA 3PE0A 4HXJA 2K9GA 2RQTA 4RTTA 1SSHA 3C0CA 2CSIA 3M0SA 4IIOA 1M3AA 2FEIA 3EG2A 2KGTA 2V1RA 1MV0B 1GFDA 3VS2A 3M0QA 1JO8A 1NLOC 1Y0MA 2CDTA 2OJ2A 1B3QA 1U3OA 3GBQA 1E6HA 4OMLA 4ESRA 1EFNA 1TUCA 2B86A 2EKHA 1YWOA 1YWPA 2EYXA 2W0ZA 2BZ8A 2DILA 5L23A 1QKWA 2BZYA 1SHGA 2X3WD 2XMFA 2K7AA 4WCIA 1M27C 1GCQC 5IXFA 2DVJA 1RLPC 1E6GA 2KEAA 4J9EA 2IIMA 2J6OA 2O2OA 2ROTA 4LN2A 4F16A 2JW4A 2M51A 1LCKA 1JXMA 3REBB 2DMOA 2I0NA 2JXBA 1GCPA 2L3QA 2DBMA 2W10A 1M8MA 3VS5A 1YP5A 2EYWA 1UHFA 1S1NA 1CKAA 2LQNA 4M4ZA 2KROA 4HVWA 3VRYA 2FPEA 2DL4A 2HBWA 2D8JA 2FO0A 1SHFA 1U06A 1KIKA 1PRLC 2ECZA 4RTXA 1NM7A 1XOVA 4JJCA 2L3PA 1Z9ZA 2LJ0A 2C0TA 4A63B 2KRSA 1NLPC 1MV3A 4Z89A 4CC3A 2ED1A 2F2VA 2YUQA 1Y57A 5GJWB 1NYFA 1ZSGA 4Z8AA 4F17A 4IIMA 1AD5A 2CT4A 2DX1A 4JPBW 1PWTA 1Z9QA 1ZBJA 1ZX6A 4LUEA 1AVZC 4E6RA 2EBPA 1X2QA 2H8HA 3KFVA 5I11A 1ZUYA 2GTOA 1PKTA 1B07A 2LJ3A 4HVUA 1E7OA 2SRCA 3M0UA 1U5SA 4AG2C 3EG3A 1JXOA 4K11A 3FJ5A 4OMNA 1RLQC 3UA6A 1WFWA 2DBKA 2YSQA 2DM1A 5FWBA 3M0PA 2D0NA 1AWXA 1UTIA 2QDLA 1AZGB 2EGCA 1UFFA 1K1ZA 1T0HA 4D8KA 4OMMA 1K76A 4HCKA 1YCSB 1SRLA 2EW3A 2MOXA 2J6KA 1UDLA 2AZVA 2DL3A 2DRMA 3I5SA 4R0KA 3NMZC 3H0FA 5IHIA 2D8HA 3EG0A 1CKBA 1WYXA 1T0JA 2LZ6B 1I07A 3TSZA 1VYUA 1AWOA 3CQTA 4DEXA 2EQIA 2LJ1A 2KXCA 2KT1A 4AFZC 2J05A 2EYZA 1TUDA 3LH5A 2J6FA 2P4RA 1GBRA 1HD3A 5IHNA 3O5ZA 2HSPA 4KRTA 2CH4A 1GBQA 1OV3A 4J9IA 1UG1A 3TVTA 1BK2A 2V1QA 2ED0A 3U23A 2O9SA 4DEYA 4J9HA 2KR3A 1W70A 1AWJA 2DF6A 1M3BA 1AOJA 1OPKA 4OMPA 2KRNA 2AKKA 2LCSA 1M30A 1NEGA 1T3SA 2RF0A 2A37A 2L2PA 2GGRA 2CUBA 2EGEA 1OPLA 1ZUKA 1QWFA 2M0YA 2RQRA 1AWWA 1QLYA 3PVQA 1YNZA 3H0HA 3VS6A 2JT4A 4Z88A 4GBQA 3REAB 1K9AA 4RTVA 2G6FX 1X6GA 1ZUUA 2GQIA 4LE9A 2FPDA 1FMKA 2DL7A 2KYBA 1UE9A 1UJYA 2EPDA 1ARKA 4J9BA 1AZEA 1VYTA 2RQVA 5EC7A 4AFSC 1K0XA 2DE0X 2K6DA 1ABQA 5IXBA 2BZXA 2O31A 4CC7A 4LNPA 5IH2A 2NWMA 1N5ZA 5FWCA 3SHWA 3UA7A 1CSKA 1RUWA 4JZ4A 2DLPA 3EG1A 3VS4A 1GRIA 4HVVA 1TG0A 1QKXA 2ROLA 3R6NA 2CREA 2OI3A 1NG2A 4FSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT6 A;  1K0S A;  1PRM C;  2ENM A;  2DNU A;  2KT8 A;  1X6B A;  3M0T A;  1X27 A;  2MIO A;  3I5R A;  2ESW A;  2RMO A;  2D1X A;  1NYG A;  1VA7 A;  2JM8 A;  2OAW A;  2DL5 A;  2LMJ A;  4AFQ C;  2JMC A;  1UEC A;  2E5K A;  1NEB A;  1JU5 C;  1QWE A;  2FG0 A;  4CC2 A;  5GJV B;  1PHT A;  2C0I A;  2HEQ A;  2K3B A;  2LNH B;  1JQQ A;  3NPF A;  2DRK A;  1G83 A;  3IQL A;  3H0I A;  1UGV A;  1UHC A;  1WXU A;  1FYN A;  1WI7 A;  2L3S A;  5ECA A;  2AZS A;  1OEB A;  2K2M A;  3VS7 A;  2A28 A;  2A08 A;  2GTJ A;  1H92 A;  2CH4 W;  2KBT A;  2HCK A;  3H41 A;  2EYY A;  2NUZ A;  1M3C A;  1H8K A;  1BB9 A;  2JTE A;  4D8D A;  1UUE A;  3VRZ A;  1GFC A;  2PTK A;  2JS0 A;  2RQU A;  4QT7 A;  3THK A;  1GL5 A;  2HDA A;  4ZNX A;  1I1J A;  1WX6 A;  2J7I A;  4J9C A;  2FRW A;  5FW9 A;  4JJB A;  2YUO A;  2X3X D;  3ZL7 C;  1QCF A;  2LQW A;  2BTT A;  2AK5 A;  2CSQ A;  2GBQ A;  4RTW A;  3VS3 A;  3I9Q A;  2RNA A;  1J3T A;  2YUN A;  3VS1 A;  1X2K A;  2ABL A;  3RNJ A;  1I0C A;  2KXD A;  4OMQ A;  2JM9 A;  3NGP A;  4X1V A;  2MCN A;  1W1F A;  3QWY A;  2O9V A;  1X69 A;  1BU1 A;  2K79 A;  1YN8 A;  2KE9 A;  1WXT A;  2YUP A;  1PNJ A;  2FPF A;  3QWX X;  4AG1 C;  1ZLM A;  2VVK A;  4ORZ A;  1SEM A;  3M0R A;  4RTY A;  1BBZ A;  3PVL A;  1JEG A;  3EHQ A;  2KNB B;  1WXB A;  2RPN A;  1KJW A;  1W6X A;  2EVR A;  1T3L A;  4J9D A;  3ULR B;  1H3H A;  3UF4 A;  4AFU C;  1OOT A;  1VYV A;  2AKL A;  2DA9 A;  4RTU A;  1MUZ A;  4RUG A;  1HJD A;  2F2W A;  4JJD A;  4J9F A;  1WDX A;  2VKN A;  2O88 A;  1K4U S;  1WLP B;  3I35 A;  3UAT A;  3NHN A;  2JS2 A;  2JMA A;  5I22 A;  2KYM A;  4GLM A;  2CT3 A;  1ABO A;  3JV3 A;  1SPK A;  1X43 A;  4OMO A;  2A36 A;  2J06 A;  1UJ0 A;  3SEM A;  2DYB A;  2YDL A;  2VWF A;  1SRM A;  1PKS A;  2RQW A;  4LUD A;  1V1C A;  2PZ1 A;  2KRM A;  1G2B A;  2GNC A;  1AEY A;  2L0A A;  3EGU A;  1GCQ A;  2F2X A;  2PNI A;  2SEM A;  1WIE A;  4RTZ A;  2LX7 A;  1HSQ A;  3A98 A;  2EGA A;  4Y92 A;  2LP5 A;  1RI9 A;  4CC4 B;  1A0N B;  2RN8 A;  1KSW A;  3RBB B;  5HCK A;  4JZ3 A;  4J9G A;  2DJQ A;  2CUD A;  1WA7 A;  3TSW A;  4EIK A;  1KFZ A;  5IHK A;  1IO6 A;  2DL8 A;  4F14 A;  2C0O A;  3VS0 A;  2FRY A;  3EHR A;  3PE0 A;  4HXJ A;  2K9G A;  2RQT A;  4RTT A;  1SSH A;  3C0C A;  2CSI A;  3M0S A;  4IIO A;  1M3A A;  2FEI A;  3EG2 A;  2KGT A;  2V1R A;  1MV0 B;  1GFD A;  3VS2 A;  3M0Q A;  1JO8 A;  1NLO C;  1Y0M A;  2CDT A;  2OJ2 A;  1B3Q A;  1U3O A;  3GBQ A;  1E6H A;  4OML A;  4ESR A;  1EFN A;  1TUC A;  2B86 A;  2EKH A;  1YWO A;  1YWP A;  2EYX A;  2W0Z A;  2BZ8 A;  2DIL A;  5L23 A;  1QKW A;  2BZY A;  1SHG A;  2X3W D;  2XMF A;  2K7A A;  4WCI A;  1M27 C;  1GCQ C;  5IXF A;  2DVJ A;  1RLP C;  1E6G A;  2KEA A;  4J9E A;  2IIM A;  2J6O A;  2O2O A;  2ROT A;  4LN2 A;  4F16 A;  2JW4 A;  2M51 A;  1LCK A;  1JXM A;  3REB B;  2DMO A;  2I0N A;  2JXB A;  1GCP A;  2L3Q A;  2DBM A;  2W10 A;  1M8M A;  3VS5 A;  1YP5 A;  2EYW A;  1UHF A;  1S1N A;  1CKA A;  2LQN A;  4M4Z A;  2KRO A;  4HVW A;  3VRY A;  2FPE A;  2DL4 A;  2HBW A;  2D8J A;  2FO0 A;  1SHF A;  1U06 A;  1KIK A;  1PRL C;  2ECZ A;  4RTX A;  1NM7 A;  1XOV A;  4JJC A;  2L3P A;  1Z9Z A;  2LJ0 A;  2C0T A;  4A63 B;  2KRS A;  1NLP C;  1MV3 A;  4Z89 A;  4CC3 A;  2ED1 A;  2F2V A;  2YUQ A;  1Y57 A;  5GJW B;  1NYF A;  1ZSG A;  4Z8A A;  4F17 A;  4IIM A;  1AD5 A;  2CT4 A;  2DX1 A;  4JPB W;  1PWT A;  1Z9Q A;  1ZBJ A;  1ZX6 A;  4LUE A;  1AVZ C;  4E6R A;  2EBP A;  1X2Q A;  2H8H A;  3KFV A;  5I11 A;  1ZUY A;  2GTO A;  1PKT A;  1B07 A;  2LJ3 A;  4HVU A;  1E7O A;  2SRC A;  3M0U A;  1U5S A;  4AG2 C;  3EG3 A;  1JXO A;  4K11 A;  3FJ5 A;  4OMN A;  1RLQ C;  3UA6 A;  1WFW A;  2DBK A;  2YSQ A;  2DM1 A;  5FWB A;  3M0P A;  2D0N A;  1AWX A;  1UTI A;  2QDL A;  1AZG B;  2EGC A;  1UFF A;  1K1Z A;  1T0H A;  4D8K A;  4OMM A;  1K76 A;  4HCK A;  1YCS B;  1SRL A;  2EW3 A;  2MOX A;  2J6K A;  1UDL A;  2AZV A;  2DL3 A;  2DRM A;  3I5S A;  4R0K A;  3NMZ C;  3H0F A;  5IHI A;  2D8H A;  3EG0 A;  1CKB A;  1WYX A;  1T0J A;  2LZ6 B;  1I07 A;  3TSZ A;  1VYU A;  1AWO A;  3CQT A;  4DEX A;  2EQI A;  2LJ1 A;  2KXC A;  2KT1 A;  4AFZ C;  2J05 A;  2EYZ A;  1TUD A;  3LH5 A;  2J6F A;  2P4R A;  1GBR A;  1HD3 A;  5IHN A;  3O5Z A;  2HSP A;  4KRT A;  2CH4 A;  1GBQ A;  1OV3 A;  4J9I A;  1UG1 A;  3TVT A;  1BK2 A;  2V1Q A;  2ED0 A;  3U23 A;  2O9S A;  4DEY A;  4J9H A;  2KR3 A;  1W70 A;  1AWJ A;  2DF6 A;  1M3B A;  1AOJ A;  1OPK A;  4OMP A;  2KRN A;  2AKK A;  2LCS A;  1M30 A;  1NEG A;  1T3S A;  2RF0 A;  2A37 A;  2L2P A;  2GGR A;  2CUB A;  2EGE A;  1OPL A;  1ZUK A;  1QWF A;  2M0Y A;  2RQR A;  1AWW A;  1QLY A;  3PVQ A;  1YNZ A;  3H0H A;  3VS6 A;  2JT4 A;  4Z88 A;  4GBQ A;  3REA B;  1K9A A;  4RTV A;  2G6F X;  1X6G A;  1ZUU A;  2GQI A;  4LE9 A;  2FPD A;  1FMK A;  2DL7 A;  2KYB A;  1UE9 A;  1UJY A;  2EPD A;  1ARK A;  4J9B A;  1AZE A;  1VYT A;  2RQV A;  5EC7 A;  4AFS C;  1K0X A;  2DE0 X;  2K6D A;  1ABQ A;  5IXB A;  2BZX A;  2O31 A;  4CC7 A;  4LNP A;  5IH2 A;  2NWM A;  1N5Z A;  5FWC A;  3SHW A;  3UA7 A;  1CSK A;  1RUW A;  4JZ4 A;  2DLP A;  3EG1 A;  3VS4 A;  1GRI A;  4HVV A;  1TG0 A;  1QKX A;  2ROL A;  3R6N A;  2CRE A;  2OI3 A;  1NG2 A;  4FSS A; 
#chains in the Genus database with same CATH topology
 2YT6 A;  1D3B B;  3OYF A;  2ENM A;  2O4X B;  4C5I A;  3OYI A;  1K9M C;  1NYG A;  2JM8 A;  2NYS A;  2OAW A;  1TWB A;  2DL5 A;  2LMJ A;  4AFQ C;  2QTV A;  1UEC A;  2E5K A;  4V2S A;  1XTD A;  2IPO B;  1MMN A;  1QWE A;  4CC2 A;  5I2M A;  1PHT A;  2HEQ A;  2K3B A;  1JQQ A;  3H9N A;  3NPF A;  3JCM X;  1G83 A;  4EMG A;  1WXU A;  3BDU A;  4IUT A;  3CPF A;  1VQL Q;  1Y96 A;  2FYK A;  2LTO A;  2K2M A;  4BE2 A;  3HHT B;  3JCM h;  1EZZ B;  2CH4 W;  4OP0 A;  2COY A;  4C92 B;  1WNL A;  1BB9 A;  2MYS A;  2JTE A;  3MEW A;  3V8K A;  3FLG A;  3X26 B;  5GAN e;  2EYQ A;  2MF2 A;  3R6O A;  1YBY A;  2J7I A;  3OSV A;  4PJM A;  4Y91 A;  1BI2 A;  1PSE A;  1WGS A;  4PJO G;  2RI2 A;  2YUO A;  1M1K U;  2X3X D;  1YJ9 T;  4XU2 A;  1D1A A;  2ZPE B;  3OYJ A;  3OYG A;  5GAN j;  3QXE B;  3CBP A;  4M75 E;  3G71 T;  1YN8 A;  3M4G A;  1OU8 A;  4C8Q E;  3CPW S;  2XDD A;  3QWX X;  1ZLM A;  4RTY A;  3EGX B;  4DOW A;  4M78 G;  2EIF A;  3RES A;  3CPW P;  2XDB A;  1JEG A;  2RPN A;  1W6X A;  2EVR A;  1UGP B;  1VQP T;  4J9D A;  2HBP A;  4E2F B;  1VYV A;  4LD6 A;  2DA9 A;  4RUG A;  2F2W A;  2M9U A;  4J9F A;  2QTX A;  2VKN A;  4Z02 A;  1WLP B;  3NHN A;  2M02 A;  3QPH A;  5LJ3 e;  4M7A G;  2JMA A;  2KYM A;  1Q86 C;  4M78 D;  3PIO A;  3LGF A;  2XG8 D;  1ABO A;  3WXM B;  5FRM A;  2J06 A;  1C6V X;  1UJ0 A;  2EWN A;  3SEM A;  2H3E B;  2VWF A;  2RQW A;  1ACM B;  2PZ1 A;  1Q81 C;  2YRV A;  1NZ9 A;  2KRM A;  1VQ7 T;  3FC3 A;  4FCY A;  3ER0 A;  2L0A A;  1M1K R;  1Y07 A;  2EJG A;  3JAM E;  3WVE B;  5LJ3 j;  5D6W A;  2PNI A;  2SEM A;  2FZC B;  4M7A D;  2LX7 A;  1M8V A;  4Y92 A;  1RI9 A;  2ZPH B;  4MZP A;  3X25 B;  3OYY A;  1A0N B;  4JZ3 A;  4PJO F;  5GAO p;  3CC4 T;  1WA7 A;  3LX7 A;  3A8L B;  4J8O A;  5GAO n;  5C6S A;  2FRY A;  3EHR A;  5LJ5 f;  4HXJ A;  1N6A A;  4NL2 A;  3M0S A;  2QG9 B;  2FEI A;  3EG2 A;  3X20 B;  1OZ3 A;  1NLO C;  5FRN A;  4M77 E;  2RJD A;  4ZN3 A;  3QDR B;  4HCC A;  3CBO A;  1M2V B;  2YXY A;  4FM4 B;  4M78 F;  4LDY A;  1M27 C;  3A8M B;  2K5F A;  1GCQ C;  2MAM A;  3J81 E;  4BDY A;  1VQK A;  1E6G A;  1DJ7 B;  2J6O A;  3ZBD A;  1QVP A;  1LOJ A;  3GNF B;  4HCZ A;  1LCK A;  3JRZ A;  2JXB A;  3AT1 B;  4JRK A;  5LJ5 g;  4C8Q A;  1UHF A;  2QA4 T;  2VYT A;  1CKA A;  2LQN A;  2KY9 A;  1G5V A;  3A1P A;  3CCS A;  1LNX A;  2DL4 A;  3G6E A;  5L8R E;  1KIK A;  2KI7 A;  2DFU A;  4JUV A;  3JCM Q;  2EFI A;  2XK0 A;  1R8O B;  3JCM e;  3RKY A;  2PQW A;  3QSU A;  2KRS A;  1VQK Q;  4JLG A;  2GQV A;  4FIB A;  3CC7 T;  1PCX A;  1BI1 A;  3HRS A;  5CKF A;  5A0G A;  1ZSG A;  4Z8A A;  2QQB A;  1IRX A;  3I55 A;  1Z9Q A;  3CCS Q;  2OTL T;  1ZX6 A;  1YJN A;  3G6E Q;  2EBP A;  4C0D C;  5I11 A;  3MEU A;  2NUP B;  1PKT A;  2LQ8 A;  1E7O A;  2LVM A;  1U5S A;  3MCA B;  4XTV A;  4K11 A;  4OMN A;  4C0D B;  3VYG A;  1FMV A;  2YSQ A;  2DM1 A;  3PMT A;  5FWB A;  4F7U A;  2NUT A;  3M0P A;  3JB9 H;  2E41 A;  1UFF A;  4D8K A;  2DET A;  3M5A A;  1U8R A;  1YCS B;  2JTF A;  2EW3 A;  3I55 Q;  1YJN Q;  3I56 T;  2DRM A;  3A8O B;  4C92 G;  2DAQ A;  2E3I A;  3FEO A;  1Q7Y C;  2D8H A;  3CCR A;  2YRD A;  4FL6 A;  4PJJ A;  1I07 A;  2A3L A;  3QZ9 B;  1AWO A;  3CQT A;  1D09 B;  1AT1 B;  3CXC P;  3Q1J A;  5KYW B;  3QDF A;  2WSC E;  4AFZ C;  1UEB A;  2EYZ A;  4E7K A;  5DM7 R;  4MDW A;  2P4R A;  5GAM f;  1G3W A;  4C92 D;  1NJI C;  3G4S A;  1VQN T;  2E5Q A;  2WSF E;  2DZC A;  1KQS S;  5GAN 7;  3OBW A;  1OU9 A;  4PJO C;  3CCR Q;  2ED0 A;  3EGD B;  4J6X A;  2RHY A;  2L89 A;  1AWJ A;  3EFR A;  4BB7 A;  4DA4 A;  2K3Y A;  2DF6 A;  2LDM A;  3HFO A;  1OPK A;  2KRN A;  2RF0 A;  2QDY B;  3PNW C;  4ELY C;  3M58 A;  3JB9 G;  2GGR A;  1BIA A;  1QWF A;  3G4S Q;  5LJ5 d;  2RQR A;  4M7D A;  1QLY A;  2A7Y A;  1YNZ A;  2YWW A;  3H0H A;  3MHX A;  1VQ5 T;  4M78 C;  4RTV A;  2RJC A;  1D0Y A;  3ASK A;  5GAM g;  1H64 1;  1ZSZ C;  2CP5 A;  2XKO C;  2ZPB B;  5HK3 A;  3CCE T;  1VQ6 T;  5FU6 C;  4EPC A;  3CC2 A;  4JS5 A;  1Y96 B;  3QG1 A;  3JB9 D;  1UJY A;  1ZSZ B;  2FZK B;  2EPD A;  2EAY A;  1YI2 A;  1Q82 U;  4GY5 A;  1UGQ B;  1TU0 B;  3MJX A;  1NE8 A;  3OBY A;  1IGU A;  2FL7 A;  3SWN B;  4LXC A;  5IXB A;  2PVG B;  2BZX A;  4JS4 A;  4BI4 A;  4C92 F;  1WHM A;  3ME9 A;  1K73 C;  1CSK A;  1RUW A;  4HVV A;  1YIT T;  3OSS C;  3CCL T;  1WJS A;  3TU4 K;  1PRM C;  2AIR B;  3CC2 Q;  1NBE B;  2KT8 A;  3HRT A;  2XDP A;  1X27 A;  2ESW A;  4FW2 A;  2D1X A;  5DLO A;  1VQ9 T;  4PL6 A;  1VQ8 A;  1TH7 A;  2V8J A;  2JMC A;  1WHK A;  1YI2 Q;  2K5I A;  1JU5 C;  5GAN 5;  1ZA1 B;  2FG0 A;  3JSC A;  5GJV B;  2C0I A;  2LNH B;  1UHC A;  4E7L A;  1IXD A;  1YIJ A;  2L3S A;  5ECA A;  1S72 T;  2H3J A;  4E7I A;  3UWN A;  3OYM A;  3ZFJ A;  5EG2 A;  1TSF A;  6AT1 B;  3HL8 A;  2KBT A;  3PGG A;  3MP8 A;  2QK0 A;  3H41 A;  3JB9 F;  5CQX A;  1VQ4 A;  1VQ8 Q;  3MEA A;  1H8K A;  3TEE A;  3E19 A;  1OX9 A;  2EJF A;  3VRZ A;  1GFC A;  2PTK A;  4QT7 A;  2RQU A;  1LJO A;  3LH0 A;  2HDA A;  4RG8 A;  3WVD B;  1Q82 R;  2R57 A;  3L1A A;  4J9C A;  2FRW A;  4QQG A;  1QCO A;  1WPY A;  5FW9 A;  2L3R A;  2VUB A;  4XAX B;  1YIJ Q;  2ZPG B;  4JRI A;  2F5T X;  2AK5 A;  3LGL A;  2GBQ A;  4ELZ C;  2M1H A;  2RNA A;  1RAI B;  5GMK h;  1J3T A;  1Y71 A;  1X2K A;  1I0C A;  1VOM A;  2KXD A;  5GAN f;  4ZTJ A;  2JM9 A;  1KC8 U;  2HQH A;  3NGP A;  1VQ4 Q;  1VQO T;  2ZAE A;  4X1V A;  2MCN A;  1W1F A;  2E3H A;  3FIF A;  1BU1 A;  2RHZ A;  3L2R A;  1WXT A;  2X9H A;  5KYU B;  3HPW A;  4A54 A;  5GAN 3;  4IUU A;  1SEM A;  3OMG A;  4LDW A;  1TXQ A;  4C0G A;  1M1K C;  4ZGJ B;  2KNB B;  2RH2 A;  3CCM A;  4BE0 A;  4FT2 A;  2BKD N;  5FU7 B;  3EG9 A;  1T3L A;  1H3H A;  3OW2 S;  3CMA T;  1FWZ A;  5GAM d;  4AFU C;  1OOT A;  4DOV A;  2V26 A;  4PFP A;  4RTU A;  5GMK l;  1HJD A;  4QQ6 A;  1KD1 U;  3TQ7 P;  1WDX A;  3CME T;  3I35 A;  3UAT A;  3QHS A;  2JS2 A;  9ATC B;  1G3S A;  4GLM A;  3QJ6 A;  4PFZ A;  3JV3 A;  5GAN g;  1SPK A;  4OMO A;  2A36 A;  3J80 E;  2DYB A;  3RR6 A;  1UB4 A;  5FLX E;  1G2B A;  2DTO A;  3CCM Q;  2GNC A;  4LD9 K;  4EMK C;  2FB7 A;  3HKS A;  2KK4 A;  1KQ1 A;  3P8D A;  5LJ3 f;  1IB8 A;  4EMK B;  2BIV A;  1RL2 A;  3A98 A;  2EGA A;  4M75 B;  2LP5 A;  4CC4 B;  1KC8 R;  1HXD A;  4C8Q B;  3RBB B;  2CP7 A;  4XTX A;  2CUD A;  3TSW A;  4DBR A;  4C92 C;  5KCH A;  3NTH A;  3VV0 A;  2RQT A;  4RTT A;  3BDL A;  2KGT A;  4CI0 C;  2CS7 A;  2V1R A;  1MV0 B;  1Y0M A;  2LRQ A;  1I5O B;  3M4Y A;  3GBQ A;  1E6H A;  4ESR A;  4M78 A;  1I5L A;  5KE3 A;  1TUC A;  2LT4 A;  2GFU A;  1YWP A;  4N0A C;  4NS5 A;  1QKW A;  2BZY A;  1KD1 R;  1SHG A;  5LJ3 g;  2HQE A;  2X3W D;  3OA6 A;  2XMF A;  3VYH B;  4WCI A;  3M9Q A;  3HTR A;  4OGE A;  3MP6 A;  3OS1 A;  2IIM A;  2EQJ A;  2O2O A;  4JDS A;  5DY9 A;  2C06 A;  4M7A A;  4F16 A;  2PUO B;  1SG5 A;  2M51 A;  1UGS B;  1JXM A;  2D9T A;  5I2S A;  1GCP A;  2DBM A;  5GAO q;  3VS5 A;  4PJO D;  5CKB A;  3OW2 A;  3TCJ A;  1S1N A;  1QQJ A;  5CKH A;  2P0Q A;  3VRY A;  1JB0 E;  1QP2 A;  4PLL A;  1U06 A;  4E47 A;  3JCM c;  1PRL C;  4RTX A;  1NM7 A;  1WJQ A;  3SDZ A;  1XOV A;  3X28 B;  1Z9Z A;  3OYH A;  4KUI A;  1NLP C;  2GF7 A;  4CRI A;  2QQR A;  1RAA B;  4M77 C;  3OY9 A;  3INZ A;  1BIB A;  2X4Y A;  2ED1 A;  3OS5 A;  4OGC A;  5KYX A;  2JZ2 A;  3H8Z A;  2MPX C;  1WHH A;  5GJW B;  1BCO A;  3OS2 A;  2K57 A;  3V8J A;  4M77 B;  4F17 A;  1VQM A;  2NLU A;  2RB6 A;  1QVG P;  1AD5 A;  2CT4 A;  2DX1 A;  3DB4 A;  4XU0 A;  3JCM f;  2CP0 A;  3V8L A;  1PWT A;  3KBG A;  1X2Q A;  2H8H A;  3KFV A;  5GMK e;  3EFO A;  4AG2 C;  3EG3 A;  1JXO A;  2DIQ A;  2RA2 A;  3FJ5 A;  5GAN d;  4IUQ A;  3AHU A;  4F7U E;  2CP6 A;  1QCN A;  1VQ7 A;  1AWX A;  5D7U A;  1M2O A;  4RKU E;  2EGC A;  1K1Z A;  1IRE B;  4OMM A;  1VQM Q;  1AHJ B;  1MNE A;  4MMK A;  2MOX A;  4PK4 A;  5GMK j;  2IVW A;  2KQW A;  3NMZ C;  2LT1 A;  2RJE A;  4HA8 A;  3EG0 A;  1CKB A;  1WYX A;  1T0J A;  4FYX B;  4A4K A;  3OMC A;  3JCM g;  5KYY A;  4Q5W A;  2EQI A;  1VQ7 Q;  2KT1 A;  1K8A C;  2J6F A;  4WTO B;  2D0Q B;  3QZ5 B;  1HD3 A;  2ZZD A;  3O5Z A;  4KRT A;  3CPW A;  2XU8 A;  2M0O A;  3SB2 A;  2CH4 A;  1OV3 A;  5GAN 8;  1BKB A;  1BK2 A;  2CP2 A;  4N4G A;  1TTH B;  2V8K A;  3U23 A;  3CCJ T;  2LQK A;  4DEY A;  4J9H A;  5LJ3 d;  1VQK T;  5GAN 2;  1D3B A;  1QW1 A;  4PJL A;  2O4X A;  1AOJ A;  2LCS A;  5HK0 A;  4EDU A;  1M30 A;  3HSB A;  1T3S A;  3DB3 A;  4QKU A;  2A37 A;  5M9O A;  3NTI A;  3C94 A;  1N8R C;  1G8X A;  1RAD B;  2CUB A;  4M7D E;  1AWW A;  3L2Q A;  2JT4 A;  1Q86 U;  3REA B;  2VXF A;  1ZUU A;  1M90 C;  4LE9 A;  4R56 A;  3SD4 A;  2E64 A;  1HK9 A;  4QW2 A;  3E2U A;  1Q81 U;  3G7Z A;  2DTH A;  2E10 A;  4X34 A;  1D0Z A;  4ANJ A;  1ARK A;  2DXB A;  4C92 A;  3GLX A;  4HT8 A;  2EKO A;  3EH1 A;  3VJP A;  2DE0 X;  3CD6 A;  5AT1 B;  4CC7 A;  4IUR A;  5IH2 A;  1N5Z A;  3A5Z B;  3FRN A;  3EG1 A;  1X75 C;  4M75 G;  4BE1 A;  2VC8 A;  1B34 B;  1TG0 A;  1QKX A;  3OYC A;  1F1B B;  2E6Z A;  1NG2 A;  4FSS A;  5GAN 6;  4C8Q G;  2DNU A;  3M0T A;  3UT1 A;  1QMC A;  3I5R A;  5KYN A;  1KG1 A;  2RMO A;  2X35 A;  2B8A A;  3CCV A;  3S3N A;  5CR2 A;  2QEX T;  2CZ7 B;  5AYF A;  3ZEH A;  2R5M A;  3CXC S;  3M56 A;  3CD6 Q;  4M75 D;  2FVU A;  3IQL A;  3CCU T;  3H0I A;  3F70 A;  1FXX A;  4A53 A;  2F69 A;  3CCR T;  4P5N A;  2AZS A;  3RER A;  2HL5 C;  3I56 A;  1OEB A;  2DO3 A;  3VS7 A;  1Q86 R;  3JCM b;  4BAC A;  2A08 A;  1R0B G;  3EG9 B;  4Y28 E;  4E7J A;  2EYY A;  2NUZ A;  5CK9 A;  3JCM d;  1M3C A;  1M1G A;  3CCV Q;  4KH0 B;  1Q81 R;  2AHJ B;  5FRO A;  4KGZ B;  5CO7 A;  4FT4 A;  3G4S T;  3CCQ A;  1OX8 A;  1I1J A;  1MMD A;  1WX6 A;  2HAX A;  3RDV A;  8ATC B;  1RAC B;  1BCM A;  3ZL7 C;  3I56 Q;  2LQW A;  2EQU A;  2CSQ A;  4OF1 A;  2PU9 B;  3E1S A;  4RTW A;  3VS3 A;  3I9Q A;  3C95 A;  2YUN A;  3VS1 A;  2ABL A;  4OMQ A;  3QBY A;  1LVK A;  3QWY A;  1X69 A;  2K79 A;  3OYD A;  2A0F B;  4KGV B;  3CCQ Q;  1PNJ A;  4DBF A;  3V7R A;  2FPF A;  2VVK A;  4M75 F;  1D1B A;  3M0R A;  3JCM J;  1BBZ A;  4FU6 A;  3QO3 A;  5GMK m;  3C12 A;  4M77 G;  3EHQ A;  4C8Q F;  1WXB A;  1KJW A;  4JRP A;  3SWN C;  4BY6 B;  3ULR B;  4IKF A;  2HL3 A;  3EAE A;  3UF4 A;  3EH2 A;  3NTK A;  2DZ9 A;  2QGG A;  1WHJ A;  2KVQ G;  1OZ2 A;  1K4U S;  2K4Y A;  3RIR A;  4XTY A;  2GFA A;  1M2V A;  5KE2 A;  2ZPI B;  2CT3 A;  4M77 D;  4A4E A;  3OQ5 A;  2CYZ B;  4E7Z A;  5CKE A;  4LUD A;  1MHN A;  2X51 A;  1JJ2 S;  2KSS A;  1W2B S;  3GIB A;  2IG0 A;  4RCB A;  2RI3 A;  5IAY A;  1PG5 B;  1AEY A;  1WZO A;  2DD4 A;  1YIT A;  4FYW B;  3EGU A;  1QVF P;  1GCQ A;  1KQ2 A;  5LL6 S;  2R5A A;  1C1A A;  5IN1 A;  1JJ2 P;  1VQ8 T;  2F2X A;  1W2B P;  4PJO E;  1WIE A;  2CP3 A;  4RTZ A;  1HSQ A;  4C5E A;  1PC0 A;  4X9D A;  4QVZ A;  1VQ9 A;  4F04 B;  3S6W A;  4ZN1 A;  1OQK A;  1KSW A;  5HCK A;  1BYM A;  1IHV A;  4C0Z A;  2DJQ A;  4C5G A;  4JJN K;  4QVD A;  4EIK A;  1NJI U;  1KFZ A;  2WAC A;  1IO6 A;  5IHK A;  3RMS A;  1RAE B;  2C0O A;  3VS0 A;  2E65 A;  3V7C A;  1KQS A;  1I81 A;  4FSX A;  4DQ2 A;  4VUB A;  2KAF A;  2K9G A;  1SSH A;  2QQS A;  4B9W A;  3C0C A;  2CSI A;  4IIO A;  1YHQ T;  4L6V 5;  1YIT Q;  3RUX A;  1GFD A;  1UGR B;  3VS2 A;  3M0Q A;  4DBQ A;  4M78 E;  2OJ2 A;  3N5B B;  2QYZ A;  4OML A;  2DPP B;  2RM4 A;  4TVR A;  2JJ9 A;  1IHW A;  5HKC A;  5CVI A;  5KYX B;  1VQ9 Q;  2EKH A;  1YWO A;  2PVD B;  3PMI A;  2RO0 A;  3D7S B;  4M77 F;  4B9X A;  2K2V A;  2DJZ A;  1OYX A;  2NUP A;  2OTJ T;  1MMA A;  4BDZ A;  3E9G A;  4EMH A;  4KUL A;  5KCO A;  2RHX A;  1YJW T;  2DVJ A;  4M7A E;  4J9E A;  2MMP A;  3M57 A;  1NPP A;  3C4S A;  1WQW A;  3REB B;  2FHD A;  3PTA A;  1TUG B;  2BE7 D;  2L3Q A;  1M8M A;  3DLM A;  2OX7 A;  3M55 A;  2XID A;  5FU7 C;  2HNI A;  2KRO A;  4HVW A;  2FPE A;  4A4G A;  1KHC A;  3JCM V;  4J6W A;  2D8J A;  2FO0 A;  1SHF A;  2ECZ A;  3T9N A;  2QI2 A;  3DKM A;  4JJC A;  2L3P A;  1O9S A;  3LWH A;  2Z0W A;  2LJ0 A;  2C0T A;  1I8F A;  4OMF B;  4JLI A;  1X6O A;  1K73 U;  1XNI A;  4J6Y A;  2YHT A;  1NJI R;  4QQD A;  1YFN A;  2VAS A;  4Z89 A;  1QP3 A;  5KYW A;  2BE9 B;  4M7D F;  2F2V A;  1IZ6 A;  5J3B A;  2YLB A;  2YUQ A;  1Y57 A;  3BE3 A;  3CMA A;  5C0M A;  4IIM A;  2CZ0 B;  1BI0 A;  2COW A;  2HD0 A;  4R55 A;  1ZBJ A;  4E6R A;  3CME A;  2XD0 A;  2LC4 A;  1VQL T;  2RD1 A;  2JVV A;  1ZUY A;  2GTO A;  2LJ3 A;  2LNV A;  4HVU A;  4M75 C;  3H6Z A;  4ME7 A;  2VGN A;  3EGD A;  3M0U A;  2XI9 A;  3EFS A;  4O6J A;  3HP9 A;  3HFN A;  1SF9 A;  3UA6 A;  4C8Q C;  1WFW A;  2D6F A;  2YLC A;  5GAO l;  3URG A;  4PJO A;  4GLK A;  2X4J A;  2D0N A;  2AT1 B;  5D6X A;  2HKQ B;  2QDL A;  1AZG B;  3CMA Q;  2DXT A;  5GAO r;  3CBM A;  1SRL A;  4ZGE B;  2J6K A;  1WHL A;  2DYI A;  3CME Q;  3G1J A;  3FJP A;  3I5S A;  4R0K A;  2DKG A;  3H0F A;  3A8G B;  2K5L A;  5IHI A;  2M16 A;  3MP1 A;  1Q95 G;  1MMG A;  2HSE B;  4BD3 A;  2KXC A;  2J05 A;  1ZSZ A;  3JCM W;  1K73 R;  1TUD A;  1ZQ1 A;  3L42 A;  3OS0 A;  4ZGD B;  1EIF A;  4BUG A;  4XU1 A;  2P0P A;  4JRQ A;  3SWN A;  1ZHI A;  1PD0 A;  1ZBX A;  5CCA A;  3FB9 A;  1G3T A;  1H3Z A;  2EJ9 A;  2QQ9 A;  4IUP A;  3TVT A;  1PM3 A;  2KMT A;  2V1Q A;  1W4S A;  2O9S A;  1YJ9 A;  1WHG A;  4PJN A;  1M3B A;  4OMP A;  4F7U B;  2NUT B;  2E70 A;  2L2P A;  3KXT A;  2VV5 A;  1MND A;  5LJ5 h;  3G71 A;  3SFM A;  2EGE A;  1OPL A;  2LCC A;  3L2Z A;  5D6Y A;  2M0Y A;  2MWP A;  3VU3 C;  3PVQ A;  2V8I A;  2DIG A;  2I2L A;  4Z88 A;  5J26 A;  4GBQ A;  1K9A A;  3BFM A;  2G6F X;  1KHI A;  1X6G A;  4II1 A;  1QVG S;  2GQI A;  1YJ9 Q;  3UPU A;  2JOY A;  3JCM P;  2MK5 A;  1VQP A;  2L5Q A;  4BI3 A;  4L59 A;  1K9M U;  2VGM A;  4C92 E;  3X24 B;  2MWO A;  2QAZ A;  4J9B A;  5J39 A;  1ZA2 B;  1VQM T;  1VYT A;  2BUD A;  2X4X A;  1AZE A;  1EX4 A;  1K0X A;  2K6D A;  3G71 Q;  2DD5 A;  4L5G A;  4N4I A;  1ABQ A;  2ZGW A;  2K3X A;  2KDS A;  2O31 A;  2FZG B;  4J7I A;  3SHW A;  3UA7 A;  4JZ4 A;  2WSE E;  1GRI A;  2OI3 A;  1K0S A;  1X6B A;  1VQP Q;  4XTU A;  2MIO A;  4UC4 A;  2JN0 A;  1VA7 A;  3GF5 A;  3QUI A;  4M7D C;  1NEB A;  3M53 A;  2XHC A;  3RMQ A;  1VIF A;  5KYU A;  2VB6 A;  4MDX A;  2VXE A;  2DRK A;  1RAH B;  4BI8 B;  1I4K 1;  5CIU A;  4M7D B;  1UGV A;  3CC4 A;  1X01 A;  1FYN A;  2QGF B;  1WI7 A;  3NFC A;  4KUD K;  4FYV B;  4LDX A;  1M5Q 1;  3MO8 A;  2A28 A;  3QII A;  2GTJ A;  5A0L A;  1H92 A;  3VKI A;  1N27 A;  2HCK A;  2Y4Y A;  5DLQ E;  4J7F A;  4D8D A;  1K9M R;  3QYH B;  1RI0 A;  1UUE A;  3P8H A;  2JS0 A;  1GL5 A;  3THK A;  4C5H A;  4ZNX A;  4PFO A;  4E7S A;  2COZ A;  2RJF A;  3CC4 Q;  3KUF A;  4JJB A;  3GP8 A;  2ATC B;  3L2W A;  1QCF A;  1O75 A;  2BTT A;  1YCY A;  4KH1 B;  3CCJ A;  3RNJ A;  2E4H A;  2QQA A;  1QVG A;  2LX9 A;  5KH6 A;  4EMK A;  4OVA A;  3CCS T;  3G6E T;  4M75 A;  2O9V A;  2QA4 A;  2KE9 A;  2DER A;  2YUP A;  3UDC A;  3JB9 I;  4M7A F;  4AG1 C;  4ORZ A;  4XK8 E;  2DEQ A;  3CEY A;  3PVL A;  3A8H B;  5GAM h;  4XQ3 A;  3LWI A;  4PNO A;  2QXF A;  7AT1 B;  1WQ7 A;  3CCJ Q;  4YTL A;  3CC7 A;  2AKL A;  3I55 T;  3L2U A;  2E1H A;  1MUZ A;  3DLL A;  3VUZ A;  1XQH A;  1YJN T;  1Y7X A;  2O01 E;  4JJD A;  2O88 A;  3QKJ A;  2QA4 Q;  2DVE A;  4D6W A;  3CD6 T;  5I22 A;  3O8V A;  2OTL A;  2X4W A;  1X43 A;  3LYI A;  1P92 A;  2YDL A;  2YRC A;  1TOV A;  1SRM A;  1PKS A;  4RG2 A;  1SSF A;  1V1C A;  4LDU A;  4N0A A;  5GAN 4;  3GOX A;  2DTI A;  3GPL A;  4C0F A;  1Q82 C;  3L2V A;  5LJ5 e;  1D0X A;  3LLR A;  3OYB A;  3CC7 Q;  1U1S A;  3CCV T;  3M59 A;  1K8A U;  4KBM B;  1M1F A;  3EGX A;  2RN8 A;  3M54 A;  1B7T A;  4C8Q D;  5CQY A;  2OTL Q;  2QEX A;  4X9C A;  4J9G A;  3OYE A;  4HKE A;  3MKD A;  4RCC A;  2DL8 A;  2L8D A;  4F14 A;  3QYG B;  3PE0 A;  5LJ5 j;  3CCU A;  4FYY B;  1GXI E;  1M3A A;  2DXU A;  3S3O A;  2CKK A;  1JO8 A;  1TS9 A;  2CDT A;  1B3Q A;  1U3O A;  4RMO A;  4B6M A;  1R77 A;  3OYA A;  1EFN A;  4M77 A;  2OAU A;  2B86 A;  3CCQ T;  2EYX A;  2W0Z A;  2BZ8 A;  2DIL A;  4F7U G;  2G3R A;  5L23 A;  1VQN A;  1N8R U;  2ZPF B;  2QEX Q;  3J7A F;  1R0C B;  2K7A A;  5A2Q E;  3BW1 A;  4MZM A;  3CCU Q;  5IXF A;  1RLP C;  2KEA A;  2ROT A;  4LN2 A;  4LDV A;  1IGQ A;  1M90 U;  1LPL A;  3OB9 A;  4OB2 B;  2JW4 A;  8AT1 B;  2DXC A;  2DMO A;  2I0N A;  1PSF A;  1D1C A;  2P84 A;  2W10 A;  1KQS P;  1YP5 A;  4PJO B;  2EYW A;  4N4H A;  2Y90 A;  4BY6 C;  2P4T A;  4M4Z A;  2EQK A;  4J83 A;  3RKX A;  1VQN Q;  2HBW A;  4O5V A;  1K8A R;  4MML A;  1XJW B;  3S3M A;  1VQ5 A;  3CC2 T;  4FW1 A;  3MET A;  1WJR A;  1N9R A;  4A63 B;  1KC8 C;  3CCE A;  1VQ6 A;  1MV3 A;  1YI2 T;  4CC3 A;  2E12 A;  1JRI A;  2JNG A;  4WF2 A;  1NYF A;  2F5K A;  4M78 B;  2JUF A;  4QVC A;  1V29 B;  1MGQ A;  1RAB B;  1PD1 A;  4JPB W;  5FU6 B;  3QJY A;  1VIE A;  1QVF S;  4LUE A;  1AVZ C;  5GAO m;  1U1T A;  3CXC A;  3RKW A;  4AMC A;  3OYN A;  3PFS A;  2ZCF B;  5GAN h;  4NL3 A;  4M7A C;  1VQ5 Q;  1Q7Y U;  1B07 A;  1HYO A;  2E6N A;  3P8B B;  5HY6 A;  2SRC A;  1N8R R;  3CCL A;  4OB3 B;  2GCX A;  1RLQ C;  2CZ6 B;  1FX7 A;  3CCE Q;  4AT1 B;  1VQ6 Q;  4M7A B;  5CAI A;  4M7D G;  2DBK A;  3OYK A;  1KD1 C;  2P0K A;  2HZY A;  1OI1 A;  1UTI A;  2F1L A;  1T0H A;  2JTM A;  1M90 R;  2HMA A;  4KGX B;  1VUB A;  4F7U F;  1K76 A;  4HCK A;  1YIJ T;  1UDL A;  2AZV A;  2DL3 A;  5GAM e;  2RK1 A;  2CGH A;  2HKN A;  2R58 A;  1RAG B;  1N9S A;  4M7D D;  1S72 A;  2LZ6 B;  1KK7 A;  3TSZ A;  3CCL Q;  3OYL A;  1VYU A;  4E7H A;  3GNG A;  1VQ4 T;  5I21 A;  4DEX A;  2LJ1 A;  2DK3 A;  3PT9 A;  4A4H A;  2DEU A;  3LH5 A;  4MZT A;  1YHQ A;  4XU3 A;  5GAM j;  3MPU B;  4A4F A;  1GBR A;  1RAF B;  5IHN A;  2HSP A;  4OB0 B;  2RHU A;  1GBQ A;  4J9I A;  5LJ3 h;  1UG1 A;  2LCL A;  3PIP A;  1B34 A;  1SKU B;  4HT9 A;  3EFO B;  1S72 Q;  4J5Y A;  3JB9 J;  3TRE A;  2Y4X A;  3LW5 E;  4HCB A;  2KR3 A;  1W70 A;  1BI3 A;  2OTJ A;  1Q7Y R;  5A0D A;  1C0M A;  2AKK A;  3HRU A;  1YJW A;  1NEG A;  1YHQ Q;  2HQX A;  1VQO A;  4OB1 B;  4XTZ A;  2PUK B;  1M9S A;  4PLI A;  1NPR A;  4IUV A;  1ZUK A;  2RK2 A;  5CKD A;  4ZTF A;  1V76 A;  3CCM T;  3VS6 A;  4KT0 E;  3BY7 A;  1JBM A;  1QVF A;  2FPD A;  2XIC A;  1JJ2 A;  1FMK A;  5KYY B;  4XTW A;  1W2B A;  2OTJ Q;  2RI5 A;  3VUB A;  2PVO B;  3FDR A;  2DL7 A;  3V7S A;  2KYB A;  1M4Z A;  4DBH A;  3E9F A;  1UE9 A;  5IT9 E;  1G3Y A;  2CZ1 B;  2MI6 A;  1YJW Q;  5GMK i;  1VQO Q;  4ATO A;  2EQM A;  2RQV A;  5EC7 A;  4AFS C;  4PKC C;  1FMW A;  4LNP A;  3OW2 P;  2NWM A;  3MEV A;  5FWC A;  2QAS A;  3VS4 A;  2DLP A;  1OUL A;  4NOY A;  2ROL A;  2RHI A;  3R6N A;  1VQL A;  2CRE A; 
#chains in the Genus database with same CATH homology
 2YT6 A;  1K0S A;  1PRM C;  2ENM A;  2DNU A;  2KT8 A;  1X6B A;  3M0T A;  1X27 A;  2MIO A;  3I5R A;  2ESW A;  2RMO A;  2D1X A;  1NYG A;  1VA7 A;  2JM8 A;  2OAW A;  2DL5 A;  2LMJ A;  4AFQ C;  2JMC A;  1UEC A;  2E5K A;  1NEB A;  1JU5 C;  1QWE A;  2FG0 A;  4CC2 A;  5GJV B;  1PHT A;  2C0I A;  2HEQ A;  2K3B A;  2LNH B;  1JQQ A;  3NPF A;  2DRK A;  1G83 A;  3IQL A;  3H0I A;  1UGV A;  1UHC A;  1WXU A;  1FYN A;  1WI7 A;  2L3S A;  5ECA A;  2AZS A;  1OEB A;  2K2M A;  3VS7 A;  2A28 A;  2A08 A;  2GTJ A;  1H92 A;  2CH4 W;  2KBT A;  2HCK A;  3H41 A;  2EYY A;  2NUZ A;  1M3C A;  1H8K A;  1BB9 A;  2JTE A;  4D8D A;  1UUE A;  3VRZ A;  1GFC A;  2PTK A;  2JS0 A;  2RQU A;  4QT7 A;  3THK A;  1GL5 A;  2HDA A;  4ZNX A;  1I1J A;  1WX6 A;  2J7I A;  4J9C A;  2FRW A;  5FW9 A;  4JJB A;  2YUO A;  2X3X D;  3ZL7 C;  1QCF A;  2LQW A;  2BTT A;  2AK5 A;  2CSQ A;  2GBQ A;  4RTW A;  3VS3 A;  3I9Q A;  2RNA A;  1J3T A;  2YUN A;  3VS1 A;  1X2K A;  2ABL A;  3RNJ A;  1I0C A;  2KXD A;  4OMQ A;  2JM9 A;  3NGP A;  4X1V A;  2MCN A;  1W1F A;  3QWY A;  2O9V A;  1X69 A;  1BU1 A;  2K79 A;  1YN8 A;  2KE9 A;  1WXT A;  2YUP A;  1PNJ A;  2FPF A;  3QWX X;  4AG1 C;  1ZLM A;  2VVK A;  4ORZ A;  1SEM A;  3M0R A;  4RTY A;  1BBZ A;  3PVL A;  1JEG A;  3EHQ A;  2KNB B;  1WXB A;  2RPN A;  1KJW A;  1W6X A;  2EVR A;  1T3L A;  4J9D A;  3ULR B;  1H3H A;  3UF4 A;  4AFU C;  1OOT A;  1VYV A;  2AKL A;  2DA9 A;  4RTU A;  1MUZ A;  4RUG A;  1HJD A;  2F2W A;  4JJD A;  4J9F A;  1WDX A;  2VKN A;  2O88 A;  1K4U S;  1WLP B;  3I35 A;  3UAT A;  3NHN A;  2JS2 A;  2JMA A;  5I22 A;  2KYM A;  4GLM A;  2CT3 A;  1ABO A;  3JV3 A;  1SPK A;  1X43 A;  4OMO A;  2A36 A;  2J06 A;  1UJ0 A;  3SEM A;  2DYB A;  2YDL A;  2VWF A;  1SRM A;  1PKS A;  2RQW A;  4LUD A;  1V1C A;  2PZ1 A;  2KRM A;  1G2B A;  2GNC A;  1AEY A;  2L0A A;  3EGU A;  1GCQ A;  2F2X A;  2PNI A;  2SEM A;  1WIE A;  4RTZ A;  2LX7 A;  1HSQ A;  3A98 A;  2EGA A;  4Y92 A;  2LP5 A;  1RI9 A;  4CC4 B;  1A0N B;  2RN8 A;  1KSW A;  3RBB B;  5HCK A;  4JZ3 A;  4J9G A;  2DJQ A;  2CUD A;  1WA7 A;  3TSW A;  4EIK A;  1KFZ A;  5IHK A;  1IO6 A;  2DL8 A;  4F14 A;  2C0O A;  3VS0 A;  2FRY A;  3EHR A;  3PE0 A;  4HXJ A;  2K9G A;  2RQT A;  4RTT A;  1SSH A;  3C0C A;  2CSI A;  3M0S A;  4IIO A;  1M3A A;  2FEI A;  3EG2 A;  2KGT A;  2V1R A;  1MV0 B;  1GFD A;  3VS2 A;  3M0Q A;  1JO8 A;  1NLO C;  1Y0M A;  2CDT A;  2OJ2 A;  1B3Q A;  1U3O A;  3GBQ A;  1E6H A;  4OML A;  4ESR A;  1EFN A;  1TUC A;  2B86 A;  2EKH A;  1YWO A;  1YWP A;  2EYX A;  2W0Z A;  2BZ8 A;  2DIL A;  5L23 A;  1QKW A;  2BZY A;  1SHG A;  2X3W D;  2XMF A;  2K7A A;  4WCI A;  1M27 C;  1GCQ C;  5IXF A;  2DVJ A;  1RLP C;  1E6G A;  2KEA A;  4J9E A;  2IIM A;  2J6O A;  2O2O A;  2ROT A;  4LN2 A;  4F16 A;  2JW4 A;  2M51 A;  1LCK A;  1JXM A;  3REB B;  2DMO A;  2I0N A;  2JXB A;  1GCP A;  2L3Q A;  2DBM A;  2W10 A;  1M8M A;  3VS5 A;  1YP5 A;  2EYW A;  1UHF A;  1S1N A;  1CKA A;  2LQN A;  4M4Z A;  2KRO A;  4HVW A;  3VRY A;  2FPE A;  2DL4 A;  2HBW A;  2D8J A;  2FO0 A;  1SHF A;  1U06 A;  1KIK A;  1PRL C;  2ECZ A;  4RTX A;  1NM7 A;  1XOV A;  4JJC A;  2L3P A;  1Z9Z A;  2LJ0 A;  2C0T A;  4A63 B;  2KRS A;  1NLP C;  1MV3 A;  4Z89 A;  4CC3 A;  2ED1 A;  2F2V A;  2YUQ A;  1Y57 A;  5GJW B;  1NYF A;  1ZSG A;  4Z8A A;  4F17 A;  4IIM A;  1AD5 A;  2CT4 A;  2DX1 A;  4JPB W;  1PWT A;  1Z9Q A;  1ZBJ A;  1ZX6 A;  4LUE A;  1AVZ C;  4E6R A;  2EBP A;  1X2Q A;  2H8H A;  3KFV A;  5I11 A;  1ZUY A;  2GTO A;  1PKT A;  1B07 A;  2LJ3 A;  4HVU A;  1E7O A;  2SRC A;  3M0U A;  1U5S A;  4AG2 C;  3EG3 A;  1JXO A;  4K11 A;  3FJ5 A;  4OMN A;  1RLQ C;  3UA6 A;  1WFW A;  2DBK A;  2YSQ A;  2DM1 A;  5FWB A;  3M0P A;  2D0N A;  1AWX A;  1UTI A;  2QDL A;  1AZG B;  2EGC A;  1UFF A;  1K1Z A;  1T0H A;  4D8K A;  4OMM A;  1K76 A;  4HCK A;  1YCS B;  1SRL A;  2EW3 A;  2MOX A;  2J6K A;  1UDL A;  2AZV A;  2DL3 A;  2DRM A;  3I5S A;  4R0K A;  3NMZ C;  3H0F A;  5IHI A;  2D8H A;  3EG0 A;  1CKB A;  1WYX A;  1T0J A;  2LZ6 B;  1I07 A;  3TSZ A;  1VYU A;  1AWO A;  3CQT A;  4DEX A;  2EQI A;  2LJ1 A;  2KXC A;  2KT1 A;  4AFZ C;  2J05 A;  2EYZ A;  1TUD A;  3LH5 A;  2J6F A;  2P4R A;  1GBR A;  1HD3 A;  5IHN A;  3O5Z A;  2HSP A;  4KRT A;  2CH4 A;  1GBQ A;  1OV3 A;  4J9I A;  1UG1 A;  3TVT A;  1BK2 A;  2V1Q A;  2ED0 A;  3U23 A;  2O9S A;  4DEY A;  4J9H A;  2KR3 A;  1W70 A;  1AWJ A;  2DF6 A;  1M3B A;  1AOJ A;  1OPK A;  4OMP A;  2KRN A;  2AKK A;  2LCS A;  1M30 A;  1NEG A;  1T3S A;  2RF0 A;  2A37 A;  2L2P A;  2GGR A;  2CUB A;  2EGE A;  1OPL A;  1ZUK A;  1QWF A;  2M0Y A;  2RQR A;  1AWW A;  1QLY A;  3PVQ A;  1YNZ A;  3H0H A;  3VS6 A;  2JT4 A;  4Z88 A;  4GBQ A;  3REA B;  1K9A A;  4RTV A;  2G6F X;  1X6G A;  1ZUU A;  2GQI A;  4LE9 A;  2FPD A;  1FMK A;  2DL7 A;  2KYB A;  1UE9 A;  1UJY A;  2EPD A;  1ARK A;  4J9B A;  1AZE A;  1VYT A;  2RQV A;  5EC7 A;  4AFS C;  1K0X A;  2DE0 X;  2K6D A;  1ABQ A;  5IXB A;  2BZX A;  2O31 A;  4CC7 A;  4LNP A;  5IH2 A;  2NWM A;  1N5Z A;  5FWC A;  3SHW A;  3UA7 A;  1CSK A;  1RUW A;  4JZ4 A;  2DLP A;  3EG1 A;  3VS4 A;  1GRI A;  4HVV A;  1TG0 A;  1QKX A;  2ROL A;  3R6N A;  2CRE A;  2OI3 A;  1NG2 A;  4FSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...