4QVZA

Fmrp n-terminal domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
200
structure length
194
Chain Sequence
EELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPDRQIPFHDVRFPPPVGYNKDINESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYANEIVTIERLRSVNPNKPATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fragile X mental retardation protein 1
publication title Human FMRP contains an integral tandem Agenet (Tudor) and KH motif in the amino terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 35
structure length 194
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF17904 KH_9 FMRP KH0 domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qvzA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qvzA02
4CRIA 4E7KA 4A4FA 3MEVA 1RI0A 2L89A 2X4WA 3UWNA 3OY9A 3L2UA 2BIVA 3ASKA 4QQDA 1H3ZA 2X4XA 2HQEA 3MEAA 4X34A 2R58A 2RHZA 3DLMA 2LVMA 5FROA 2F5KA 2RHIA 3NTKA 4FL6A 4E7JA 2RJFA 4II1A 2RHUA 3LX7A 2RI5A 5D6YA 1MHNA 5KCHA 3OYHA 2HQXA 4PLIA 2VYTA 3LYIA 3OS1A 4IKFA 3PFSA 2XK0A 3PMIA 5CIUA 3L2QA 3H8ZA 3OMCA 4OVAA 3QIIA 3META 4PL6A 4N4IA 2L8DA 3CEYA 2O4XB 3P8HA 1G5VA 2DAQA 3DB4A 2GFAA 4N4HA 2LDMA 4Q5WA 2LCCA 2MWPA 2GFUA 5C0MA 3OYJA 2BUDA 5D6WA 5IAYA 2M16A 3FLGA 3OMGA 4N4GA 2E5QA 2RHXA 5FRMA 2K3XA 2M0OA 4ZTJA 1XNIA 5FRNA 4BDZA 1OZ3A 3DB3A 5IN1A 3FEOA 3L42A 2EKOA 3OYKA 3ZEHA 3OYMA 3OB9A 2DIQA 1WJQA 3OS2A 5C6SA 2B8AA 3EAEA 2FHDA 4HCZA 4IUVA 4RG2A 4C5GA 3OYAA 3S3OA 3ME9A 4IURA 5J39A 2WACA 2QQRA 4PLLA 3E9GA 5KE3A 4FU6A 2LRQA 4B9WA 4L59A 2EQMA 5D6XA 3E9FA 3OYBA 5J26A 3LLRA 1N27A 3OYDA 4E7HA 3L2RA 1WJSA 3GOXA 4NS5A 3H6ZA 2CKKA 5KH6A 3OYLA 1OZ2A 2BKDN 4BDYA 2JZ2A 1KHCA 2E6NA 4ZTFA 2EQJA 2R5MA 2X35A 3OYNA 3NTIA 3KUFA 2D9TA 3OA6A 3L2WA 2R57A 2EQKA 2XDPA 3S3NA 3PNWC 2RHYA 2LTOA 3QKJA 4Z02A 5M9OA 2G3RA 3UT1A 4GY5A 4C5EA 2X4YA 2RJEA 5KCOA 3L2VA 2O4XA 3LGLA 2NLUA 2QQSA 3PMTA 3BDLA 3SD4A 3MP8A 4BE0A 4E7LA 2K3YA 2RI3A 2PQWA 3MP6A 3OYIA 2RI2A 3MEWA 3NTHA 3MEUA 3OYCA 4IUQA 3F70A 3S6WA 4EDUA 1WJRA 4QQ6A 4QQGA 4BD3A 2YRVA 4IUTA 5KE2A 1OI1A 2EFIA 2P0KA 2M1HA 3OQ5A 4LD6A 2DIGA 4QVZA 4A4GA 4A4EA 2JTFA 3LGFA 4IUUA 4C5IA 3OYEA 3LH0A 4BE2A 3M9QA 3P8DA 4BE1A 2RO0A 3FDRA 2GF7A 2RJCA 4QW2A 2MWOA 3QBYA 1SSFA 3QJ6A 3OYFA 3MO8A 2RJDA 4E7IA 4BACA 1WGSA 2IG0A 3C4SA 3Q1JA 2R5AA 2L3RA 3O8VA 3FC3A 3S3MA 1OYXA 3OS0A 4A4HA 3OYGA 3MP1A 4IUPA 4UC4A 4C5HA 2EQUA 4B9XA
chains in the Genus database with same CATH superfamily
4E7KA 2O88A 2HQHA 1RI0A 3CMAT 2GCXA 4ELZC 4F7UG 2MOXA 1JEGA 1H8KA 5EC7A 1FX7A 1PNJA 3PMIA 3TU4K 4C8QB 2EJ9A 4OVAA 1ZBXA 4N4IA 3THKA 2XU8A 4PJOG 2AZVA 2GFAA 3RKYA 1YJWT 2VB6A 4Q5WA 3OSSC 1ZA2B 4M77B 2DX1A 4C8QD 3J81E 3I55A 2AIRB 3CCJA 1JJ2S 5GMKh 4GLMA 1B34A 2MCNA 2JTMA 2GQIA 3I9QA 1QKXA 1OULA 4XTWA 1AZEA 1LJOA 5LJ5d 4J9EA 4RTVA 1Y07A 2VWFA 2EYXA 2K2VA 3RIRA 5GAMe 4GBQA 4K11A 2HL3A 1Z9QA 2RQVA 3S3NA 4DA4A 2IIMA 5FW9A 2ZPGB 2HMAA 4KRTA 2G3RA 1KD1U 5CKDA 3L2VA 1BI1A 2YDLA 4DOWA 4MMLA 5GAOp 5CKFA 1WIEA 2K3YA 1GL5A 2K5FA 5LJ3d 2DXCA 1G83A 3CCJT 5LJ5g 1N8RU 1KQ1A 2RA2A 4M77F 4KGVB 1MNEA 1WX6A 1YCSB 4BE2A 1Y57A 3M9QA 1KQSA 2FPDA 5LJ5h 4FCYA 1CKBA 1RAHB 3CC4T 3OBWA 2QEXT 2E65A 3Q1JA 1VQ7Q 1PWTA 3JB9I 1NJIU 1C1AA 2K3BA 4FYWB 1OQKA 2QA4T 3CCET 3CC2Q 3M0QA 2LQ8A 4M77G 3UWNA 1K8AC 4QQDA 4F17A 1I8FA 3BW1A 3DLMA 5LJ3g 2F5KA 3CCRA 5KCHA 2JS2A 2VYTA 4JRQA 4JRIA 3QIIA 3EGDB 1ZUKA 5LJ3h 4F16A 4LDVA 3CCQT 5GAMf 4D8KA 3SFMA 2BUDA 4M75A 1YJ9Q 4WTOB 2AKKA 2P4RA 1GCQA 5GMKm 2FVUA 3OS2A 1WJQA 5KYWA 1U1TA 3ME9A 2K79A 2KT1A 3E9FA 1Q82R 1QP2A 1G2BA 3UF4A 3HPWA 4B6MA 4RCCA 4E7HA 2E5KA 3CMEA 3EH1A 1D1CA 4AT1B 1VIEA 5LJ5e 2R5MA 2VGMA 1W2BA 1WLPB 2XDPA 1K9MR 2OAUA 3MJXA 2CZ1B 3X20B 1YI2T 1G3YA 4RMOA 2BZXA 1H92A 3SD4A 1T3LA 1IREB 2J7IA 2A7YA 2VKNA 4J9CA 2CSQA 4EDUA 2JMAA 2JUFA 1BI2A 4F7UA 4DOVA 3A8HB 1K9MC 3J80E 1UDLA 1ZUYA 2RD1A 3VYHB 3OQ5A 1H641 2OX7A 3LGFA 3FB9A 1AT1B 4XTXA 4DQ2A 4PJOA 3MO8A 1RAAB 4J9GA 3VU3C 3FIFA 1UHFA 3EFRA 5L23A 1VQ4A 5GAMj 4C92B 4R0KA 1ABOA 4A4HA 4PFZA 3RKWA 2EQUA 5KYYB 2YRDA 4CRIA 1M90C 1WXBA 2E10A 1LVKA 4OB1B 2R58A 4F04B 3KFVA 4L5GA 4C0FA 4OF1A 2RHUA 4RTUA 1MHNA 2DILA 5FWBA 3LYIA 2LQNA 1VQLA 2MMPA 2FG0A 1VQ6Q 2COYA 2M9UA 4PL6A 2XHCA 2RNAA 3EG2A 1S72A 2KI7A 4OMOA 5LJ5f 5I22A 1D0YA 2K5LA 2DM1A 4HA8A 1I1JA 2YLBA 4BDZA 2D8HA 2EKOA 3JV3A 4FYVB 1A0NB 2FHDA 3OYAA 2DXUA 1C0MA 3CCSA 2G6FX 4GLKA 1GFCA 5D6XA 1VYVA 4A4KA 3OBYA 4PNOA 3GOXA 2FL7A 5KH6A 2DBKA 2FPEA 4C92F 1QCNA 5FU6B 2E6NA 1VOMA 1D0ZA 5CKBA 5LJ3f 3H41A 2DL4A 1O75A 1KHIA 2VXEA 1U1SA 4FSSA 4C8QA 3CCLQ 5KCOA 2QGGA 2FRWA 4ZGEB 2ZPEB 1JJ2P 2EW3A 3MP6A 4M77A 4QVCA 4C92G 2YSQA 3CXCP 4HCKA 2ZZDA 1UG1A 1NBEB 1VQ8A 1MMGA 1OX8A 3G7ZA 3EG0A 2LNVA 3QUIA 1UGQB 5IXFA 1RLPC 1NLPC 4X1VA 4BE1A 4PJLA 3QHSA 3OYFA 3VUZA 4Y91A 1YJNA 1GBQA 4V2SA 5LJ5j 1KQSS 4E47A 1CSKA 2KR3A 3LW5E 3V8KA 3C0CA 1PRMC 1R8OB 1H3ZA 2YT6A 1K73C 3CBOA 3EFSA 1LPLA 3L2ZA 3NPFA 2FPFA 2RI5A 1Q7YR 1YJWQ 2OTLA 3OYYA 2LJ1A 2O9VA 2XK0A 4BI3A 2X4JA 1JBMA 3URGA 4EMGA 2A37A 3SWNC 2KBTA 1VQ7T 3OMGA 2KAFA 4ZN3A 2M0OA 1HD3A 3CC7T 3VS5A 1OZ3A 1MMDA 3RBBB 2HSEB 2CGHA 3EAEA 4IUVA 1T0JA 2CT4A 2PZ1A 2ZCFB 4C5GA 1IGUA 1M3AA 2C06A 1UEBA 2FO0A 4KGZB 1MMAA 4D8DA 2Y4YA 2DXBA 1TUCA 3G4ST 3NTIA 2XDDA 2MYSA 3OW2P 1E7OA 3X26B 1W4SA 2CP5A 1VQOA 2VXFA 1B07A 3JCMe 1AWJA 3EGDA 4QKUA 3I55Q 4AFUC 1YJ9T 3JCMX 3CCJQ 1AVZC 3BDLA 2PVDB 5GAOq 2M51A 2MPXC 3NTHA 3MEUA 2OTJT 3SWNB 4M78E 4QQGA 4BD3A 2W0ZA 2KRMA 2E12A 3JCMW 4EPCA 2F5TX 4VUBA 3RMSA 1X27A 3QDRB 4JS4A 1RI9A 1Z9ZA 2KY9A 1WQWA 3CCEQ 2LT4A 1M1KU 1UUEA 1WGSA 4BACA 2IG0A 1UGRB 2DETA 1RUWA 1VQ9A 3RMQA 2DRKA 2RMOA 3BFMA 1SKUB 4JLIA 1NPPA 1TXQA 3JB9H 3CBMA 5IXBA 5CK9A 1PC0A 1Q86C 1VQPT 2ZPHB 4BI4A 3H8ZA 5A0GA 5LL6S 2A08A 3FLGA 1PD1A 4ZTJA 3CCUT 1OV3A 3TQ7P 3DB3A 5IN1A 2DPPB 3EHQA 3CD6A 4FT2A 2B8AA 4DBQA 4XK8E 4C92A 2QQRA 4PLLA 3E9GA 3PT9A 3H0HA 2Z0WA 4FU6A 3CCRQ 2E1HA 1VQMA 1P92A 5KYYA 1X6BA 2LQKA 3H6ZA 1YHQA 2E4HA 2EYZA 1WDXA 4ORZA 2O01E 3KUFA 4A54A 1YIJA 2RQRA 1RAFB 2ECZA 2COZA 4JS5A 3LGLA 1R77A 1X2QA 3M0PA 5HK0A 3MP8A 5A0LA 3I56A 5GAMd 4N0AA 2DEUA 3OYCA 4JDSA 2CP2A 1D0XA 2QYZA 5DLOA 3ZL7C 2KSSA 3HRTA 3QJ6A 2RJDA 1YWPA 1RL2A 4MZTA 1UGSB 4XQ3A 2L3RA 5DM7R 4HVVA 1YITA 3A8GB 4HKEA 1RACB 4L6V5 1QMCA 3M4GA 4EIKA 3QDFA 4A63B 2KGTA 2CP7A 3INZA 2RHZA 2J6KA 1M1GA 5CCAA 4TVRA 4FL6A 3CCMA 3ZFJA 1RAGB 4M78C 5GAMh 4PLIA 3L2QA 2EWNA 1JRIA 4BY6C 3M5AA 2LCSA 1QVGS 2JJ9A 3RERA 1VQ4Q 1K1ZA 2XIDA 3V7CA 1UFFA 2HEQA 2KVQG 5GAOr 2LJ3A 4HT9A 3VS4A 1KQSP 2JW4A 4HVWA 4LDXA 3GBQA 4ME7A 2C0OA 1N5ZA 4LD9K 4BB7A 1UECA 4PKCC 4BI8B 3M57A 2EQMA 1M4ZA 2HDAA 1PSFA 1NEBA 1WJSA 1VIFA 2VV5A 5CQXA 1NEGA 3MKDA 1WZOA 1OZ2A 1PM3A 4LDWA 5KYUA 4E7ZA 4RTXA 4E7SA 1Q82U 5CQYA 1KG1A 2PUKB 3NHNA 4E2FB 1G8XA 4OMPA 3BY7A 1WI7A 2CZ0B 3UT1A 5FU7C 4C5EA 1PSEA 3R6NA 1NLOC 1G3WA 2DYIA 5GAN8 4E7LA 1K9MU 4ATOA 4M78D 4Z88A 1VA7A 3CCSQ 2F69A 1QVFA 2MIOA 3G6EA 2IPOB 2MI6A 2HKNA 2LX9A 2YXYA 1OI1A 4NL2A 2JTFA 1I0CA 4JRKA 2V26A 3FDRA 2ESWA 1GBRA 4QW2A 2RPNA 4E7IA 4MDXA 1Y0MA 4HCBA 2AK5A 2X51A 1M90U 3SB2A 3RNJA 2ZGWA 3MP1A 3SDZA 2MF2A 4C8QF 3QG1A 3I55T 1W2BP 2QXFA 1ABQA 1VQKA 2EJFA 5FROA 1X69A 4CC3A 1K8AR 3M54A 1TTHB 3QPHA 3LX7A 1MUZA 2QQ9A 3EHRA 1SRMA 1OEBA 2EQIA 1K0SA 2LNHB 3RKXA 2JTEA 3M55A 3OMCA 7AT1B 1FMKA 1HSQA 2LX7A 4C8QG 1T3SA 1XJWB 2DAQA 3SWNA 3CC7Q 1AWOA 1NYGA 2GFUA 2EYQA 3EG3A 4JPBW 2RK2A 4RTYA 3OYMA 1MGQA 3VS7A 1BIBA 3G4SQ 2CZ6B 2VGNA 2OTLQ 4NS5A 3OYLA 3NFCA 3R6OA 4OMLA 2PUOB 2EQJA 2X35A 3QZ9B 4RUGA 2JMCA 2QG9B 2EAYA 2KMTA 4LNPA 4HVUA 2E70A 3EGXB 2BZYA 2OTJQ 2NLUA 1HYOA 2F1LA 3G71A 2NYSA 3OYIA 3KBGA 2XICA 1ZQ1A 4M7DD 1G3TA 2V8JA 1E6HA 2YRVA 4FYYB 4O5VA 3CCRT 4EMKC 1WXTA 1WYXA 3M0SA 4IUUA 3OYEA 3DKMA 2X3XD 2PNIA 3WVEB 3REBB 1VQOQ 4J8OA 4JZ3A 3O8VA 4PJJA 2FRYA 3A98A 3VRZA 1K73U 1W1FA 4OP0A 1VQPQ 2QGFB 3ASKA 2EYYA 2CUDA 3MEAA 4OB3B 1LCKA 1W70A 1M90R 2W10A 3PVLA 2AZSA 3JCMP 8AT1B 3CPWA 4LUEA 2K7AA 3CMET 1EFNA 3EFOB 2O4XB 4IIOA 3CCUQ 1SG5A 4J7IA 1Q7YU 2DK3A 2M16A 3PVQA 4N4GA 2E5QA 3QWYA 1VQ9Q 2HNIA 3X28B 3M4YA 5C6SA 4RG2A 2VASA 5CAIA 1LNXA 1MV0B 1KD1C 2YWWA 4F14A 4M7AD 1ACMB 4ANJA 5GAN7 4LN2A 4EMHA 2BKDN 2K5IA 1EZZB 4ZNXA 4LXCA 5IHNA 3PTAA 1WA7A 3LWHA 2R57A 3QYGB 5I2MA 1QVGP 1N8RC 1BU1A 1RAIB 2QTXA 1VQ4T 3TREA 2C0IA 4OGCA 2YUNA 2RK1A 5CKHA 5HK3A 4BE0A 3CD6Q 4M75E 3MEWA 3H0FA 1NJIC 2RQUA 3JCMd 3GP8A 1VQMQ 3E19A 3IQLA 2P0PA 2EFIA 3HKSA 4LD6A 1SHGA 2LCLA 3JCMb 3LH0A 1VQLT 2RO0A 1QVFS 1BI0A 1SSFA 1YIJQ 1VQ5A 1S72T 5GAOl 1QVPA 1BCOA 8ATCB 2F2WA 4J5YA 4UC4A 3EG9B 1EX4A 3OY9A 3VS6A 1Q86U 1RABB 3X25B 2SRCA 1X2KA 3RDVA 3CCST 2RHIA 2RJFA 5ECAA 1K73R 3JCMg 4NOYA 3JRZA 4XTZA 1DJ7B 3META 4F7UE 2RN8A 1PKSA 1KIKA 3JCMh 1B3QA 3HTRA 4R55A 2JXBA 5C0MA 1YITQ 4RKUE 1XNIA 3I5RA 4ELYC 1V1CA 1TOVA 2E6ZA 5KYUB 4XU1A 2KQWA 2KEAA 1QVGA 3CCVA 3CC2A 2EIFA 1IO6A 2A36A 4CC2A 3CCMQ 4YTLA 2DL7A 4HXJA 2DVEA 1VQ8T 2E3IA 3L2RA 2GTJA 3WXMB 2LT1A 3UDCA 2L2PA 2GQVA 3PNWC 1YJNT 3M0UA 3UA6A 2NUTB 2RJEA 1GFDA 2ZPFB 1IRXA 3PMTA 2KXDA 5IHIA 5FWCA 3PIPA 2H3JA 1UB4A 2DL5A 1I4K1 4OMNA 1WJRA 1N9SA 2DBMA 1UJ0A 3VV0A 2LC4A 3JCMc 2OTLT 4A4EA 1I5OB 4OB2B 5KYNA 1QCOA 3JAME 4QVDA 1ZBJA 2RJCA 1RLQC 4O6JA 4XU2A 1KC8C 1I5LA 2CZ7B 2O2OA 1G5VA 4B9XA 3MEVA 2X4WA 2CDTA 3M0RA 3L2UA 2OJ2A 2NUPB 4AG1C 3U23A 2CYZB 2LVMA 3EGXA 4M75C 3G6EQ 4E7JA 2LZ6B 3TEEA 1HXDA 2YHTA 1QCFA 2L5QA 2K4YA 4LE9A 1Q86R 3JB9J 1IZ6A 1K0XA 2HKQB 3EH2A 1O9SA 1QQJA 2KK4A 2JM9A 2L3QA 2KT8A 2HBWA 3OYJA 5IAYA 3CPWS 4KGXB 1VQOT 2XI9A 1M2OA 1NPRA 3KXTA 2KE9A 1IB8A 1RAEB 5GAN5 2FB7A 3ZEHA 3P8BB 5I21A 1KSWA 4IURA 5GAN2 4RTWA 5KE3A 1IGQA 2JNGA 1PHTA 3LLRA 2JT4A 1ZSZC 1UE9A 1NZ9A 1J3TA 1D3BB 5HKCA 5GJVB 1OOTA 1BKBA 1VQ6A 3HP9A 2M0YA 4X9DA 3JCMf 2DZCA 1OPKA 5J3BA 2QASA 1YP5A 3EFOA 2DZ9A 2O4XA 1VQ9T 4M75D 1B7TA 3SEMA 2CH4W 2MAMA 2RI3A 3UA7A 3CPFA 4BUGA 4PJMA 2DF6A 4AFZC 1XQHA 3HFOA 5KYXB 1IHVA 5GANe 3JB9D 4WCIA 1KK7A 2DIGA 3FJ5A 2V8IA 5DLQE 2J06A 1JO8A 3JCMV 3BDUA 1E6GA 4PJNA 2DRMA 3T9NA 1WHKA 4XTVA 1YN8A 1M1FA 2O9SA 4J9IA 3EGUA 4A4FA 1V76A 2HAXA 1WHJA 4JJBA 4M7DE 4OB0B 2D8JA 4D6WA 3CD6T 1TWBA 3HL8A 3CMEQ 2E64A 2RQWA 3I5SA 4J7FA 2CUBA 1XTDA 1VQMT 2HQXA 3OS1A 1JB0E 2XD0A 5CIUA 2RH2A 1WHMA 1YHQT 3CEYA 1ZHIA 1K8AU 1QVFP 2CSIA 1YIJT 4PJOD 2JM8A 1X75C 3A1PA 1ZSGA 3E2UA 3CMAA 3FEOA 1BB9A 4KT0E 3I56T 2ATCB 5L8RE 4E6RA 4LUDA 1KQ2A 4FM4B 5J39A 1AOJA 3PE0A 1I81A 3NGPA 3AHUA 5J26A 4ESRA 3EG9A 2BE9B 3OYDA 2RB6A 1UGPB 2CKKA 4HT8A 2EYWA 3FRNA 1X01A 1KHCA 1YJWA 3VUBA 4JJDA 1M3CA 3AT1B 2XDBA 3I35A 4OMFB 2IVWA 1VQNA 2WSFE 3VS3A 4Z02A 1MNDA 2A3LA 1YITT 1UJYA 2FZGB 2FZCB 1MV3A 2K57A 5HCKA 2DTHA 1M1KC 4FSXA 3V8JA 1VQLQ 3E1SA 3WVDB 2OI3A 2EGEA 4RTZA 4M7AE 1PRLC 3CCMT 2DA9A 1S72Q 2KXCA 4C92E 2CT3A 3V7RA 1D1AA 4M78B 1D09B 4WF2A 2GF7A 1TS9A 1N6AA 1SF9A 3GNGA 3LH5A 2Y4XA 4CC7A 4AMCA 2R5AA 3C95A 4BY6B 3NMZC 4MZMA 2L3PA 1VQNT 1OPLA 2BIVA 2HQEA 1JQQA 3X24B 1WXUA 1Y96B 4JLGA 4M77D 2NUTA 3CXCS 2P0QA 2ROLA 3VS2A 5D6YA 2A0FB 2EGAA 4DBRA 1VYUA 2ED0A 2EKHA 4KUIA 2GTOA 1M9SA 5DY9A 5GANj 3P8HA 3ZBDA 2X3WD 2HD0A 3CC4A 2QEXA 1VQ5Q 4N4HA 1FXXA 2DKGA 3JCMQ 4PK4A 2BE7D 2LJ0A 2QA4A 3CCEA 2B86A 2V1RA 4J6XA 3L42A 2F2VA 2VVKA 5FU7B 1VQ8Q 1ZLMA 1Q81R 2PTKA 1WNLA 1BIAA 3M0TA 4M7DC 4M78F 2DLPA 5IT9E 3OYBA 1ZA1B 1SEMA 3G6ET 2EBPA 1N27A 2P84A 1YJNQ 2EJGA 2JZ2A 3CCQA 2NUPA 3OYNA 1G3SA 3MCAB 5GAOm 1H3HA 1Q81C 4XTUA 5M9OA 3QYHB 3J7AF 4M78G 2I0NA 3CPWP 3M53A 2JOYA 2QQSA 4JRPA 3QWXX 2PQWA 4DEXA 3CCVQ 5GMKe 2P4TA 3F70A 1VQKT 3TSZA 3C12A 4QVZA 2M1HA 2CP6A 4RCBA 3H0IA 3P8DA 2J6FA 2KNBB 2VC8A 1Y71A 4M7DB 1U06A 1AWWA 1YI2A 3PIOA 3OW2S 2GNCA 4JZ4A 1K9AA 3A8LB 3OYGA 2DEQA 1PG5B 1D3BA 3HRUA 2L89A 4PFOA 5GMKi 4X34A 1JXMA 2EPDA 1PKTA 1K4US 1WHGA 4RTTA 4OMMA 1BYMA 3A8OB 3PFSA 4M7AC 2GBQA 4HCCA 2EVRA 4J9DA 4AFQC 4C92C 3A5ZB 4KH0B 5CVIA 3UATA 5A0DA 5KYXA 2KDSA 3RR6A 1M2VA 2DXTA 1QW1A 3L1AA 4Z89A 3M56A 1W6XA 1QLYA 3M58A 2LP5A 3OYKA 4CI0C 2QQBA 5CO7A 3G71T 1Q82C 1ARKA 2HCKA 2YUQA 2H3EB 2J05A 1ZSZA 2DD5A 4L59A 2OAWA 4M7DF 2DTOA 2K6DA 2GGRA 2NWMA 3D7SB 1KD1R 2HL5C 3QO3A 4N0AC 4OGEA 1TU0B 3M59A 1BK2A 4EMKB 2DL3A 1RADB 5I2SA 5LJ3e 1VYTA 4XAXB 2QQAA 2M02A 3OS5A 4M7AB 4M7DG 1N8RR 4XU0A 1TSFA 4CC4B 2DYBA 2RI2A 2DVJA 4FW1A 1S1NA 2K9GA 2K2MA 3G1JA 3MHXA 4DBHA 5FU6C 4C92D 1YWOA 2P0KA 1NJIR 5GAN6 1KC8U 3ER0A 2LQWA 2QTVA 4KBMB 2MWOA 2PVOB 3TSWA 1AZGB 2RM4A 2DL8A 1Q95G 5AT1B 2QK0A 1WHLA 3QZ5B 5EG2A 4Y28E 3CBPA 2I2LA 4R56A 2X4XA 2ZAEA 2EGCA 3NTKA 1YHQQ 4KULA 2L3SA 2HBPA 2WSEE 2A28A 4II1A 1U3OA 3UPUA 3OYHA 2DD4A 5GMKj 3TCJA 4Z8AA 5D7UA 1QWFA 2L8DA 4M7AF 1SPKA 4LDYA 3SHWA 3DB4A 1MMNA 2CP0A 2LDMA 1D1BA 2YUOA 4FT4A 4J9FA 3V7SA 3OSVA 2YUPA 3VS0A 5IH2A 3I56Q 3JSCA 2RHXA 4QT7A 2V8KA 4M78A 2FYKA 1AD5A 2KROA 3C94A 3OB9A 4AFSC 3QJYA 4HCZA 2CS7A 3HRSA 2BTTA 2WACA 3GPLA 4M7AG 1QP3A 2WSCE 3MPUB 4B9WA 1AEYA 3GNFB 3A8MB 1NE8A 3GLXA 1SHFA 3VS1A 2DE0X 1CKAA 2ZPBB 4BDYA 1UTIA 1Y96A 3OA6A 2FEIA 3L2WA 2EQKA 2D0QB 4PJOE 1FYNA 1VQ5T 1VQ7A 2LTOA 3QKJA 2AHJB 1EIFA 1SRLA 3CC7A 4ZGDB 1YCYA 2X4YA 2DTIA 4J83A 4C0DC 3CMAQ 1ZX6A 4MDWA 5GMKl 1X6OA 1GXIE 3PGGA 5I11A 2D1XA 4ZN1A 1FWZA 2V1QA 1GCPA 1K76A 5KE2A 1WPYA 1YFNA 2JN0A 4FIBA 2CH4A 1AHJB 3G4SA 4IIMA 2SEMA 3H9NA 2ROTA 2DJQA 1M8VA 2KRNA 2E41A 2QI2A 3QBYA 1B34B 3O5ZA 2C0TA 1VQNQ 4LDUA 1X43A 2KRSA 5GANd 3OS0A 1YJ9A 1KC8R 5LJ3j 3HFNA 2MK5A 4XTYA 3VKIA 1M30A 1IHWA 3REAB 2OTJA 1Q7YC 1F1BB 3CCVT 3CC2T 1PD0A 1GRIA 2RQTA 4C0DB 4IKFA 1BI3A 5GAOn 2Y90A 5AYFA 4MMKA 1M27C 2L0AA 1X6GA 1XOVA 3V8LA 2AT1B 1JJ2A 4AG2C 2PU9B 4DEYA 3CXCA 2KYBA 1FMVA 5D6WA 1TUGB 4J9HA 5GANg 1T0HA 2K3XA 4C8QE 1NM7A 4M7DA 2AKLA 4DBFA 4FW2A 2HSPA 1LOJA 1KJWA 4C0GA 1W2BS 3S3OA 5GANh 1GCQC 4M77E 3RESA 2PVGB 2VUBA 3QXEB 1VQPA 5GAN3 2DERA 1NYFA 5GJWB 1TUDA 4ZTFA 5CKEA 1QKWA 1HK9A 2D9TA 2DNUA 3CC4Q 2QEXQ 2DJZA 1JU5C 1QWEA 1YBYA 2RHYA 2YLCA 4GY5A 3CCUA 2QA4Q 3RUXA 2QDLA 2F2XA 1VQKQ 5FLXE 1BCMA 2DMOA 4P5NA 2D0NA 2X9HA 2FZKB 4RG8A 2NUZA 2DFUA 3DLLA 1WHHA 1UHCA 1VUBA 4M75B 3CCQQ 4M4ZA 1UGVA 2JVVA 4Y92A 5KYWB 2O31A 2J6OA 2RF0A 4JJCA 4PJOC 4J6YA 4KH1B 4NL3A 2XMFA 2HZYA 4IUPA 4EMKA 1ZUUA 1OU8A 1M5Q1 2QDYB 4KUDK 2XG8D 1BBZA 1FMWA 3OW2A 1M8MA 1M2VB 4M7AA 1PCXA 2XKOC 1IXDA 2YRCA 5HY6A 3VJPA 2BZ8A 1OU9A 4J9BA 3VRYA 1ZSZB 1R0CB 3BE3A 1YI2Q 2LCCA 2MWPA 1JXOA 1VQ6T 1YNZA 1OX9A 3N5BB 4JUVA 3G71Q 2COWA 2QAZA 4F7UB 3CCLA 5FRMA 2E3HA 5FRNA 3HHTB 2DO3A 5CR2A 1TG0A 2DIQA 4XU3A 4M75F 3LWIA 5GAN4 2D6FA 4PFPA 2CP3A 4PJOB 2LRQA 3ULRB 3CQTA 1TH7A 1NG2A 3JB9F 1Q81U 5IHKA 4C0ZA 5A2QE 1HJDA 3GIBA 3TVTA 4MZPA 2ZPIB 1U5SA 4M75G 4ZGJB 3QSUA 1WQ7A 1Y7XA 1N9RA 2ED1A 2LMJA 1SSHA 3GF5A 3FJPA 4J6WA 4C8QC 3JCMJ 2JS0A 3JB9G 3CCLT 3EG1A 4IUQA 3S6WA 1AWXA 4QQ6A 1M3BA 5GANf 1M1KR 5GAMg 4M77C 4IUTA 2ABLA 4JJNK 1R0BG 2KYMA 4A4GA 1C6VX 4C5IA 4OMQA 3HSBA 1V29B 4F7UF 1KFZA 2H8HA 4A53A 9ATCB 6AT1B 1U8RA 2ENMA 3C4SA 4FYXB 3FC3A 3S3MA 1OYXA 1I07A 3VYGA 4X9CA 1WFWA 2CREA 4PJOF 4C5HA
chains in the Genus database with same CATH topology
4E7KA 3BFMA 3HRUA 1RI0A 2L89A 4JLIA 3CMAT 3OY9A 1Q86U 2GCXA 1NPPA 4ELZC 3X25B 5GMKi 4X34A 3JB9H 4F7UG 3CBMA 3CCST 5CK9A 2RHIA 2RJFA 1Q86C 1VQPT 3JCMg 1FX7A 4NOYA 2ZPHB 1BYMA 3JRZA 4BI4A 3A8OB 4XTZA 3PFSA 3PMIA 3TU4K 1DJ7B 2EJ9A 3H8ZA 4OVAA 4C8QB 3META 1ZBXA 5A0GA 5LL6S 4HCCA 4N4IA 4F7UE 2XU8A 4PJOG 4C92C 3JCMh 2GFAA 3A5ZB 3RKYA 5CVIA 1YJWT 5A0DA 4R55A 4Q5WA 2KDSA 3OSSC 4M77B 5C0MA 4C8QD 3FLGA 4RKUE 3J81E 2DXTA 1QW1A 3L1AA 3I55A 4ZTJA 3M56A 1XNIA 3CCUT 4ELYC 3DB3A 5IN1A 3CCJA 2E6ZA 1JJ2S 5GMKh 2DPPB 3M58A 4XU1A 3OYKA 1B34A 4CI0C 3CD6A 2KQWA 4FT2A 2QQBA 2B8AA 2JTMA 5CO7A 3G71T 1Q82C 1QVGA 3CCVA 4XTWA 3CC2A 1LJOA 2EIFA 4XK8E 4C92A 2QQRA 4PLLA 3E9GA 3PT9A 4FU6A 5LJ5d 2DD5A 4L59A 4M7DF 2E1HA 4YTLA 1VQMA 1P92A 2DTOA 2DVEA 1VQ8T 1Y07A 2LQKA 3L2RA 3H6ZA 3QO3A 4N0AC 1YHQA 3WXMB 4OGEA 2K2VA 3RIRA 2LT1A 3M59A 5GAMe 4EMKB 2O01E 3KUFA 3UDCA 4A54A 1YIJA 5I2SA 5LJ3e 3S3NA 4DA4A 2GQVA 3PNWC 4XAXB 2ZPGB 1YJNT 2QQAA 3OS5A 2G3RA 1KD1U 4M7AB 2RJEA 2ZPFB 4JS5A 5CKDA 3L2VA 3PMTA 1BI1A 3LGLA 4M7DG 4XU0A 4DOWA 5HK0A 3MP8A 4MMLA 5A0LA 3I56A 5GAMd 4N0AA 5GAOp 3PIPA 5CKFA 2K3YA 2H3JA 2RI2A 1UB4A 2K5FA 5LJ3d 3OYCA 2DXCA 1I4K1 4JDSA 1WJRA 3CCJT 5LJ5g 1N9SA 3MHXA 5FU6C 1N8RU 5DLOA 4C92D 1KQ1A 2RA2A 3VV0A 2P0KA 4M77F 2LC4A 3JCMc 2OTLT 4A4EA 4OB2B 5GAN6 1KC8U 3ER0A 4BE2A 3M9QA 2KSSA 3HRTA 1KQSA 3JAME 4KBMB 4QVDA 2RJCA 5LJ5h 2MWOA 2PVOB 3QJ6A 2RJDA 2RM4A 4XU2A 4O6JA 1RL2A 3OBWA 4MZTA 3CC4T 2QEXT 1UGSB 2E65A 3Q1JA 4XQ3A 2L3RA 5DM7R 1YITA 3A8GB 3JB9I 4HKEA 1I5LA 1NJIU 2CZ7B 4L6V5 2QA4T 1G5VA 3CCET 3QZ5B 5EG2A 4B9XA 2LQ8A 3M4GA 3MEVA 4Y28E 4M77G 2X4WA 3UWNA 3L2UA 3CBPA 1K8AC 4QQDA 2I2LA 4R56A 1I8FA 2X4XA 3BW1A 3INZA 2RHZA 2CYZB 2LVMA 3DLMA 5LJ3g 2F5KA 1M1GA 4M75C 3NTKA 4TVRA 4FL6A 4KULA 5CCAA 2HBPA 2WSEE 4II1A 3ZFJA 3TEEA 3CCMA 1HXDA 2YHTA 4M78C 5KCHA 5GAMh 3UPUA 3OYHA 4PLIA 2DD4A 2VYTA 2L5QA 5GMKj 4JRQA 4JRIA 2K4YA 3L2QA 2EWNA 3QIIA 5LJ3h 3TCJA 3JB9J 1IZ6A 2L8DA 4M7AF 4LDYA 1JRIA 1O9SA 4LDVA 3DB4A 2KK4A 4BY6C 3CCQT 3M5AA 1QVGS 2LDMA 5GAMf 4FT4A 3V7SA 3OSVA 3SFMA 3OYJA 2BUDA 3RERA 5IAYA 3CPWS 2XIDA 3V7CA 1VQOT 2XI9A 3JSCA 4M75A 4PJOE 1NPRA 2RHXA 3KXTA 2KVQG 5GAOr 2V8KA 4M78A 4HT9A 2FYKA 4LDXA 5GMKm 5GAN5 2FB7A 4ME7A 3ZEHA 2FVUA 3C94A 3OB9A 1WJQA 3OS2A 3P8BB 3QJYA 1U1TA 4HCZA 5I21A 4LD9K 4BB7A 2CS7A 3ME9A 4IURA 3HRSA 5GAN2 2WACA 3GPLA 4M7AG 4PKCC 1QP3A 3M57A 4BI8B 2WSCE 5KE3A 4B9WA 2EQMA 1M4ZA 3E9FA 3GNFB 1QP2A 2JNGA 3LLRA 3A8MB 3HPWA 1NE8A 4RCCA 1PSFA 3GLXA 4E7HA 1WJSA 1VIFA 2VV5A 5CQXA 3CMEA 1NZ9A 1OZ2A 2ZPBB 1D3BB 4LDWA 5HKCA 1VIEA 4BDYA 5LJ5e 2R5MA 2VGMA 1W2BA 1Y96A 3OA6A 1BKBA 1VQ6A 3L2WA 3HP9A 2EQKA 1Q82U 5CQYA 2D0QB 2XDPA 2OAUA 4X9DA 2CZ1B 2DZCA 2PUKB 3JCMf 3X20B 1VQ5T 1VQ7A 2LTOA 3QKJA 5J3BA 2AHJB 3BY7A 1YI2T 2CZ0B 1EIFA 3UT1A 1G3YA 5FU7C 4C5EA 4RMOA 3CC7A 1PSEA 1YCYA 2X4YA 4ZGDB 2DTIA 2DZ9A 2O4XA 4J83A 4C0DC 1VQ9T 4M75D 1G3WA 3SD4A 1IREB 5GAN8 4E7LA 1K9MU 2A7YA 2MAMA 2RI3A 4ATOA 4M78D 4MDWA 5GMKl 1X6OA 3CPFA 1GXIE 3PGGA 4BUGA 2F69A 1QVFA 4EDUA 2JUFA 1BI2A 4F7UA 3G6EA 1XQHA 3A8HB 3HFOA 4DOVA 2MI6A 4ZN1A 3J80E 1K9MC 1FWZA 5GANe 3JB9D 2LX9A 2RD1A 3VYHB 1OI1A 5KE2A 4NL2A 3OQ5A 1H641 2DIGA 1WPYA 2JN0A 5DLQE 2V8IA 2JTFA 3LGFA 3FB9A 1AHJB 4FIBA 3G4SA 4XTXA 4JRKA 3FDRA 1M8VA 4QW2A 2E41A 2QI2A 3QBYA 4DQ2A 3JCMV 4PJOA 3BDUA 3MO8A 1B34B 4E7IA 3VU3C 4MDXA 3FIFA 3EFRA 4LDUA 4HCBA 1VQ4A 5GAMj 3T9NA 4C92B 1M90U 3SB2A 4XTVA 5GANd 2ZGWA 3OS0A 4A4HA 1YJ9A 3MP1A 5LJ3j 3SDZA 2MF2A 1M1FA 3RKWA 4C8QF 2EQUA 3QG1A 3I55T 4CRIA 3HFNA 4A4FA 2HAXA 4XTYA 3VKIA 1M90C 4M7DE 4OB0B 2QXFA 2E10A 2OTJA 2XD0A 4D6WA 1Q7YC 3CD6T 1VQKA 4OB1B 2EJFA 1KG1A 2R58A 5FROA 4ZTFA 3CCVT 3HL8A 3CC2T 2E64A 3M54A 4L5GA 4C0FA 3QPHA 4OF1A 2RHUA 3LX7A 4J7FA 1MHNA 2QQ9A 1XTDA 4C0DB 1VQMT 2HQXA 3RKXA 3LYIA 1JB0E 3M55A 1BI3A 2MMPA 5CIUA 5GAOn 3OS1A 2Y90A 1VQLA 3OMCA 2M9UA 2RH2A 4PL6A 4MMKA 2XHCA 5AYFA 1YHQT 3CEYA 1XOVA 3V8LA 4C8QG 2DAQA 3SWNA 1ZHIA 1S72A 1JJ2A 1K8AU 2PU9B 5LJ5f 1YIJT 3CXCA 2GFUA 2K5LA 5D6WA 4PJOD 4HA8A 5GANg 2EYQA 1X75C 2K3XA 2YLBA 4C8QE 4BDZA 3CMAA 3FEOA 2RK2A 4M7DA 2EKOA 4KT0E 3OYMA 1MGQA 1LOJA 2FHDA 4C0GA 3OYAA 3I56T 5L8RE 3S3OA 2DXUA 5GANh 3CCSA 4M77E 4FM4B 3RESA 5J39A 1KQ2A 2PVGB 2VUBA 4GLKA 3QXEB 1BIBA 1VQPA 5GAN3 1I81A 2CZ6B 5D6XA 3AHUA 2VGNA 5J26A 4A4KA 3OYDA 2RB6A 3OBYA 4PNOA 3GOXA 1UGPB 2FL7A 4NS5A 2CKKA 5KH6A 3FRNA 3OYLA 3CCRA 4HT8A 1X01A 4C92F 4JJNK 3NFCA 3R6OA 5FU6B 1KHCA 2E6NA 2PUOB 2EQJA 2X35A 3QZ9B 5CKBA 3VUBA 5CKEA 5LJ3f 2D9TA 1HK9A 1YJWA 2EAYA 2KMTA 2DJZA 2XDBA 1YBYA 2E70A 2IVWA 4OMFB 1VQNA 2RHYA 1O75A 2WSFE 4Z02A 1KHIA 2YLCA 2A3LA 4GY5A 2VXEA 1U1SA 3CCUA 3RUXA 4C8QA 1YITT 5KCOA 2NLUA 5FLXE 4ZGEB 2ZPEB 3G71A 2K57A 2DTHA 4P5NA 3OYIA 3KBGA 2XICA 3MP6A 4FSXA 1ZQ1A 4M77A 4QVCA 1M1KC 4C92G 4M7DD 1G3TA 2V8JA 3V8JA 2ZZDA 3E1SA 3WVDB 1VQ8A 4RG8A 2YRVA 4O5VA 4M7AE 3G7ZA 3CCRT 2LNVA 4EMKC 3DLLA 3CCMT 3QUIA 1UGQB 1VUBA 4M75B 3OYEA 4IUUA 4C92E 3DKMA 3V7RA 4BE1A 4M78B 4WF2A 2GF7A 3QHSA 1N6AA 3OYFA 2JVVA 3VUZA 4Y91A 3GNGA 3WVEB 1YJNA 2Y4XA 4V2SA 4J8OA 2R5AA 3O8VA 3C95A 5LJ5j 4BY6B 4PJOC 4J6YA 4NL3A 1KQSS 4E47A 1K73U 4IUPA 4MZMA 4EMKA 3LW5E 4OP0A 1M5Q1 1VQNT 2QDYB 3V8KA 2BIVA 3ASKA 1R8OB 4KUDK 1H3ZA 1K73C 2XG8D 2HQEA 3MEAA 4OB3B 3CBOA 3X24B 3EFSA 3OW2A 1Y96B 3L2ZA 4JLGA 4M77D 3CXCS 4M7AA 2P0QA 2RI5A 5D6YA 2XKOC 3JCMP 2OTLA 3OYYA 2XK0A 4KUIA 5HY6A 3VJPA 3CPWA 4M7AC 1M9SA 4BI3A 2X4JA 3CMET 2O4XB 5DY9A 5GANj 3P8HA 3ZBDA 2HD0A 3CC4A 2QEXA 4N4HA 1FXXA 1JBMA 4J7IA 3URGA 1Q7YU 2DKGA 2LCCA 2MWPA 4EMGA 3JCMQ 1VQ6T 2DK3A 4E7JA 3N5BB 4JUVA 2M16A 3SWNC 1VQ7T 3OMGA 2QA4A 4N4GA 2E5QA 4F7UB 3CCEA 2KAFA 3CCLA 4ZN3A 5FRMA 2M0OA 5FRNA 3CC7T 1KC8C 1OZ3A 4J6XA 3HHTB 2DO3A 3L42A 2CGHA 2HNIA 3X28B 5FU7B 5CR2A 1W2BS 3M4YA 2DIQA 5C6SA 3EAEA 4IUVA 1WNLA 2ZCFB 4RG2A 4XU3A 4C5GA 4M75F 5CAIA 1BIAA 1LNXA 3LWIA 5GAN4 2D6FA 4M7DC 2C06A 1UEBA 4M78F 1KD1C 4PJOB 2LRQA 5IT9E 3OYBA 3G6ET 1N27A 4M7AD 1TH7A 2Y4YA 5GAN7 3JB9F 4EMHA 1Q81U 2DXBA 2BKDN 2K5IA 2EJGA 2JZ2A 3CCQA 3G4ST 4C0ZA 3OYNA 3NTIA 1G3SA 5A2QE 2XDDA 3X26B 3PTAA 3MCAB 5GAOm 3LWHA 1W4SA 2R57A 3GIBA 4MZPA 1Q81C 2ZPIB 3QYGB 1VQOA 5I2MA 2VXFA 4XTUA 1N8RC 4M75G 4ZGJB 3JCMe 5M9OA 3QSUA 2QTXA 3QYHB 1WQ7A 3J7AF 1VQ4T 1Y7XA 3TREA 4M78G 4OGCA 3M53A 1N9RA 1YJ9T 2JOYA 2QQSA 3JCMX 3BDLA 4JRPA 4IKFA 3GF5A 2PVDB 2RK1A 3FJPA 5CKHA 4J6WA 4C8QC 5HK3A 5GAOq 4BE0A 3JCMJ 2PQWA 3JB9G 4M75E 3MEWA 3NTHA 3CCLT 3MEUA 5GMKe 4IUQA 2P4TA 3F70A 3S6WA 2OTJT 3SWNB 4M78E 4QQ6A 4QQGA 5GANf 4BD3A 1NJIC 1VQKT 3JCMd 4M77C 5GAMg 2E12A 3GP8A 3JCMW 3E19A 4IUTA 2P0PA 2F5TX 4VUBA 4EPCA 3C12A 2EFIA 3HKSA 2M1HA 3QDRB 4LD6A 4QVZA 3RMSA 4A4GA 2LCLA 4C5IA 4RCBA 3LH0A 3JCMb 4JS4A 1VQLT 3P8DA 1V29B 2RO0A 4F7UF 1QVFS 3HSBA 2VC8A 1Y71A 4M7DB 1BI0A 1SSFA 2KY9A 1VQ5A 1WQWA 4A53A 2LT4A 1M1KU 1YI2A 4BACA 1WGSA 1U8RA 3PIOA 3OW2S 1S72T 2IG0A 3C4SA 5GAOl 1QVPA 1UGRB 3FC3A 3S3MA 4J5YA 1OYXA 3A8LB 3OYGA 1VQ9A 2DEQA 3RMQA 3VYGA 1D3BA 4X9CA 4PJOF 4UC4A 4C5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CRI A;  4E7K A;  4A4F A;  3MEV A;  1RI0 A;  2L89 A;  2X4W A;  3UWN A;  3OY9 A;  3L2U A;  2BIV A;  3ASK A;  4QQD A;  1H3Z A;  2X4X A;  2HQE A;  3MEA A;  4X34 A;  2R58 A;  2RHZ A;  3DLM A;  2LVM A;  5FRO A;  2F5K A;  2RHI A;  3NTK A;  4FL6 A;  4E7J A;  2RJF A;  4II1 A;  2RHU A;  3LX7 A;  2RI5 A;  5D6Y A;  1MHN A;  5KCH A;  3OYH A;  2HQX A;  4PLI A;  2VYT A;  3LYI A;  3OS1 A;  4IKF A;  3PFS A;  2XK0 A;  3PMI A;  5CIU A;  3L2Q A;  3H8Z A;  3OMC A;  4OVA A;  3QII A;  3MET A;  4PL6 A;  4N4I A;  2L8D A;  3CEY A;  2O4X B;  3P8H A;  1G5V A;  2DAQ A;  3DB4 A;  2GFA A;  4N4H A;  2LDM A;  4Q5W A;  2LCC A;  2MWP A;  2GFU A;  5C0M A;  3OYJ A;  2BUD A;  5D6W A;  5IAY A;  2M16 A;  3FLG A;  3OMG A;  4N4G A;  2E5Q A;  2RHX A;  5FRM A;  2K3X A;  2M0O A;  4ZTJ A;  1XNI A;  5FRN A;  4BDZ A;  1OZ3 A;  3DB3 A;  5IN1 A;  3FEO A;  3L42 A;  2EKO A;  3OYK A;  3ZEH A;  3OYM A;  3OB9 A;  2DIQ A;  1WJQ A;  3OS2 A;  5C6S A;  2B8A A;  3EAE A;  2FHD A;  4HCZ A;  4IUV A;  4RG2 A;  4C5G A;  3OYA A;  3S3O A;  3ME9 A;  4IUR A;  5J39 A;  2WAC A;  2QQR A;  4PLL A;  3E9G A;  5KE3 A;  4FU6 A;  2LRQ A;  4B9W A;  4L59 A;  2EQM A;  5D6X A;  3E9F A;  3OYB A;  5J26 A;  3LLR A;  1N27 A;  3OYD A;  4E7H A;  3L2R A;  1WJS A;  3GOX A;  4NS5 A;  3H6Z A;  2CKK A;  5KH6 A;  3OYL A;  1OZ2 A;  2BKD N;  4BDY A;  2JZ2 A;  1KHC A;  2E6N A;  4ZTF A;  2EQJ A;  2R5M A;  2X35 A;  3OYN A;  3NTI A;  3KUF A;  2D9T A;  3OA6 A;  3L2W A;  2R57 A;  2EQK A;  2XDP A;  3S3N A;  3PNW C;  2RHY A;  2LTO A;  3QKJ A;  4Z02 A;  5M9O A;  2G3R A;  3UT1 A;  4GY5 A;  4C5E A;  2X4Y A;  2RJE A;  5KCO A;  3L2V A;  2O4X A;  3LGL A;  2NLU A;  2QQS A;  3PMT A;  3BDL A;  3SD4 A;  3MP8 A;  4BE0 A;  4E7L A;  2K3Y A;  2RI3 A;  2PQW A;  3MP6 A;  3OYI A;  2RI2 A;  3MEW A;  3NTH A;  3MEU A;  3OYC A;  4IUQ A;  3F70 A;  3S6W A;  4EDU A;  1WJR A;  4QQ6 A;  4QQG A;  4BD3 A;  2YRV A;  4IUT A;  5KE2 A;  1OI1 A;  2EFI A;  2P0K A;  2M1H A;  3OQ5 A;  4LD6 A;  2DIG A;  4QVZ A;  4A4G A;  4A4E A;  2JTF A;  3LGF A;  4IUU A;  4C5I A;  3OYE A;  3LH0 A;  4BE2 A;  3M9Q A;  3P8D A;  4BE1 A;  2RO0 A;  3FDR A;  2GF7 A;  2RJC A;  4QW2 A;  2MWO A;  3QBY A;  1SSF A;  3QJ6 A;  3OYF A;  3MO8 A;  2RJD A;  4E7I A;  4BAC A;  1WGS A;  2IG0 A;  3C4S A;  3Q1J A;  2R5A A;  2L3R A;  3O8V A;  3FC3 A;  3S3M A;  1OYX A;  3OS0 A;  4A4H A;  3OYG A;  3MP1 A;  4IUP A;  4UC4 A;  4C5H A;  2EQU A;  4B9X A; 
#chains in the Genus database with same CATH topology
 4E7K A;  2O88 A;  2HQH A;  1RI0 A;  3CMA T;  2GCX A;  4ELZ C;  4F7U G;  2MOX A;  1JEG A;  1H8K A;  5EC7 A;  1FX7 A;  1PNJ A;  3PMI A;  3TU4 K;  4C8Q B;  2EJ9 A;  4OVA A;  1ZBX A;  4N4I A;  3THK A;  2XU8 A;  4PJO G;  2AZV A;  2GFA A;  3RKY A;  1YJW T;  2VB6 A;  4Q5W A;  3OSS C;  1ZA2 B;  4M77 B;  2DX1 A;  4C8Q D;  3J81 E;  3I55 A;  2AIR B;  3CCJ A;  1JJ2 S;  5GMK h;  4GLM A;  1B34 A;  2MCN A;  2JTM A;  2GQI A;  3I9Q A;  1QKX A;  1OUL A;  4XTW A;  1AZE A;  1LJO A;  5LJ5 d;  4J9E A;  4RTV A;  1Y07 A;  2VWF A;  2EYX A;  2K2V A;  3RIR A;  5GAM e;  4GBQ A;  4K11 A;  2HL3 A;  1Z9Q A;  2RQV A;  3S3N A;  4DA4 A;  2IIM A;  5FW9 A;  2ZPG B;  2HMA A;  4KRT A;  2G3R A;  1KD1 U;  5CKD A;  3L2V A;  1BI1 A;  2YDL A;  4DOW A;  4MML A;  5GAO p;  5CKF A;  1WIE A;  2K3Y A;  1GL5 A;  2K5F A;  5LJ3 d;  2DXC A;  1G83 A;  3CCJ T;  5LJ5 g;  1N8R U;  1KQ1 A;  2RA2 A;  4M77 F;  4KGV B;  1MNE A;  1WX6 A;  1YCS B;  4BE2 A;  1Y57 A;  3M9Q A;  1KQS A;  2FPD A;  5LJ5 h;  4FCY A;  1CKB A;  1RAH B;  3CC4 T;  3OBW A;  2QEX T;  2E65 A;  3Q1J A;  1VQ7 Q;  1PWT A;  3JB9 I;  1NJI U;  1C1A A;  2K3B A;  4FYW B;  1OQK A;  2QA4 T;  3CCE T;  3CC2 Q;  3M0Q A;  2LQ8 A;  4M77 G;  3UWN A;  1K8A C;  4QQD A;  4F17 A;  1I8F A;  3BW1 A;  3DLM A;  5LJ3 g;  2F5K A;  3CCR A;  5KCH A;  2JS2 A;  2VYT A;  4JRQ A;  4JRI A;  3QII A;  3EGD B;  1ZUK A;  5LJ3 h;  4F16 A;  4LDV A;  3CCQ T;  5GAM f;  4D8K A;  3SFM A;  2BUD A;  4M75 A;  1YJ9 Q;  4WTO B;  2AKK A;  2P4R A;  1GCQ A;  5GMK m;  2FVU A;  3OS2 A;  1WJQ A;  5KYW A;  1U1T A;  3ME9 A;  2K79 A;  2KT1 A;  3E9F A;  1Q82 R;  1QP2 A;  1G2B A;  3UF4 A;  3HPW A;  4B6M A;  4RCC A;  4E7H A;  2E5K A;  3CME A;  3EH1 A;  1D1C A;  4AT1 B;  1VIE A;  5LJ5 e;  2R5M A;  2VGM A;  1W2B A;  1WLP B;  2XDP A;  1K9M R;  2OAU A;  3MJX A;  2CZ1 B;  3X20 B;  1YI2 T;  1G3Y A;  4RMO A;  2BZX A;  1H92 A;  3SD4 A;  1T3L A;  1IRE B;  2J7I A;  2A7Y A;  2VKN A;  4J9C A;  2CSQ A;  4EDU A;  2JMA A;  2JUF A;  1BI2 A;  4F7U A;  4DOV A;  3A8H B;  1K9M C;  3J80 E;  1UDL A;  1ZUY A;  2RD1 A;  3VYH B;  3OQ5 A;  1H64 1;  2OX7 A;  3LGF A;  3FB9 A;  1AT1 B;  4XTX A;  4DQ2 A;  4PJO A;  3MO8 A;  1RAA B;  4J9G A;  3VU3 C;  3FIF A;  1UHF A;  3EFR A;  5L23 A;  1VQ4 A;  5GAM j;  4C92 B;  4R0K A;  1ABO A;  4A4H A;  4PFZ A;  3RKW A;  2EQU A;  5KYY B;  2YRD A;  4CRI A;  1M90 C;  1WXB A;  2E10 A;  1LVK A;  4OB1 B;  2R58 A;  4F04 B;  3KFV A;  4L5G A;  4C0F A;  4OF1 A;  2RHU A;  4RTU A;  1MHN A;  2DIL A;  5FWB A;  3LYI A;  2LQN A;  1VQL A;  2MMP A;  2FG0 A;  1VQ6 Q;  2COY A;  2M9U A;  4PL6 A;  2XHC A;  2RNA A;  3EG2 A;  1S72 A;  2KI7 A;  4OMO A;  5LJ5 f;  5I22 A;  1D0Y A;  2K5L A;  2DM1 A;  4HA8 A;  1I1J A;  2YLB A;  4BDZ A;  2D8H A;  2EKO A;  3JV3 A;  4FYV B;  1A0N B;  2FHD A;  3OYA A;  2DXU A;  1C0M A;  3CCS A;  2G6F X;  4GLK A;  1GFC A;  5D6X A;  1VYV A;  4A4K A;  3OBY A;  4PNO A;  3GOX A;  2FL7 A;  5KH6 A;  2DBK A;  2FPE A;  4C92 F;  1QCN A;  5FU6 B;  2E6N A;  1VOM A;  1D0Z A;  5CKB A;  5LJ3 f;  3H41 A;  2DL4 A;  1O75 A;  1KHI A;  2VXE A;  1U1S A;  4FSS A;  4C8Q A;  3CCL Q;  5KCO A;  2QGG A;  2FRW A;  4ZGE B;  2ZPE B;  1JJ2 P;  2EW3 A;  3MP6 A;  4M77 A;  4QVC A;  4C92 G;  2YSQ A;  3CXC P;  4HCK A;  2ZZD A;  1UG1 A;  1NBE B;  1VQ8 A;  1MMG A;  1OX8 A;  3G7Z A;  3EG0 A;  2LNV A;  3QUI A;  1UGQ B;  5IXF A;  1RLP C;  1NLP C;  4X1V A;  4BE1 A;  4PJL A;  3QHS A;  3OYF A;  3VUZ A;  4Y91 A;  1YJN A;  1GBQ A;  4V2S A;  5LJ5 j;  1KQS S;  4E47 A;  1CSK A;  2KR3 A;  3LW5 E;  3V8K A;  3C0C A;  1PRM C;  1R8O B;  1H3Z A;  2YT6 A;  1K73 C;  3CBO A;  3EFS A;  1LPL A;  3L2Z A;  3NPF A;  2FPF A;  2RI5 A;  1Q7Y R;  1YJW Q;  2OTL A;  3OYY A;  2LJ1 A;  2O9V A;  2XK0 A;  4BI3 A;  2X4J A;  1JBM A;  3URG A;  4EMG A;  2A37 A;  3SWN C;  2KBT A;  1VQ7 T;  3OMG A;  2KAF A;  4ZN3 A;  2M0O A;  1HD3 A;  3CC7 T;  3VS5 A;  1OZ3 A;  1MMD A;  3RBB B;  2HSE B;  2CGH A;  3EAE A;  4IUV A;  1T0J A;  2CT4 A;  2PZ1 A;  2ZCF B;  4C5G A;  1IGU A;  1M3A A;  2C06 A;  1UEB A;  2FO0 A;  4KGZ B;  1MMA A;  4D8D A;  2Y4Y A;  2DXB A;  1TUC A;  3G4S T;  3NTI A;  2XDD A;  2MYS A;  3OW2 P;  1E7O A;  3X26 B;  1W4S A;  2CP5 A;  1VQO A;  2VXF A;  1B07 A;  3JCM e;  1AWJ A;  3EGD A;  4QKU A;  3I55 Q;  4AFU C;  1YJ9 T;  3JCM X;  3CCJ Q;  1AVZ C;  3BDL A;  2PVD B;  5GAO q;  2M51 A;  2MPX C;  3NTH A;  3MEU A;  2OTJ T;  3SWN B;  4M78 E;  4QQG A;  4BD3 A;  2W0Z A;  2KRM A;  2E12 A;  3JCM W;  4EPC A;  2F5T X;  4VUB A;  3RMS A;  1X27 A;  3QDR B;  4JS4 A;  1RI9 A;  1Z9Z A;  2KY9 A;  1WQW A;  3CCE Q;  2LT4 A;  1M1K U;  1UUE A;  1WGS A;  4BAC A;  2IG0 A;  1UGR B;  2DET A;  1RUW A;  1VQ9 A;  3RMQ A;  2DRK A;  2RMO A;  3BFM A;  1SKU B;  4JLI A;  1NPP A;  1TXQ A;  3JB9 H;  3CBM A;  5IXB A;  5CK9 A;  1PC0 A;  1Q86 C;  1VQP T;  2ZPH B;  4BI4 A;  3H8Z A;  5A0G A;  5LL6 S;  2A08 A;  3FLG A;  1PD1 A;  4ZTJ A;  3CCU T;  1OV3 A;  3TQ7 P;  3DB3 A;  5IN1 A;  2DPP B;  3EHQ A;  3CD6 A;  4FT2 A;  2B8A A;  4DBQ A;  4XK8 E;  4C92 A;  2QQR A;  4PLL A;  3E9G A;  3PT9 A;  3H0H A;  2Z0W A;  4FU6 A;  3CCR Q;  2E1H A;  1VQM A;  1P92 A;  5KYY A;  1X6B A;  2LQK A;  3H6Z A;  1YHQ A;  2E4H A;  2EYZ A;  1WDX A;  4ORZ A;  2O01 E;  3KUF A;  4A54 A;  1YIJ A;  2RQR A;  1RAF B;  2ECZ A;  2COZ A;  4JS5 A;  3LGL A;  1R77 A;  1X2Q A;  3M0P A;  5HK0 A;  3MP8 A;  5A0L A;  3I56 A;  5GAM d;  4N0A A;  2DEU A;  3OYC A;  4JDS A;  2CP2 A;  1D0X A;  2QYZ A;  5DLO A;  3ZL7 C;  2KSS A;  3HRT A;  3QJ6 A;  2RJD A;  1YWP A;  1RL2 A;  4MZT A;  1UGS B;  4XQ3 A;  2L3R A;  5DM7 R;  4HVV A;  1YIT A;  3A8G B;  4HKE A;  1RAC B;  4L6V 5;  1QMC A;  3M4G A;  4EIK A;  3QDF A;  4A63 B;  2KGT A;  2CP7 A;  3INZ A;  2RHZ A;  2J6K A;  1M1G A;  5CCA A;  4TVR A;  4FL6 A;  3CCM A;  3ZFJ A;  1RAG B;  4M78 C;  5GAM h;  4PLI A;  3L2Q A;  2EWN A;  1JRI A;  4BY6 C;  3M5A A;  2LCS A;  1QVG S;  2JJ9 A;  3RER A;  1VQ4 Q;  1K1Z A;  2XID A;  3V7C A;  1UFF A;  2HEQ A;  2KVQ G;  5GAO r;  2LJ3 A;  4HT9 A;  3VS4 A;  1KQS P;  2JW4 A;  4HVW A;  4LDX A;  3GBQ A;  4ME7 A;  2C0O A;  1N5Z A;  4LD9 K;  4BB7 A;  1UEC A;  4PKC C;  4BI8 B;  3M57 A;  2EQM A;  1M4Z A;  2HDA A;  1PSF A;  1NEB A;  1WJS A;  1VIF A;  2VV5 A;  5CQX A;  1NEG A;  3MKD A;  1WZO A;  1OZ2 A;  1PM3 A;  4LDW A;  5KYU A;  4E7Z A;  4RTX A;  4E7S A;  1Q82 U;  5CQY A;  1KG1 A;  2PUK B;  3NHN A;  4E2F B;  1G8X A;  4OMP A;  3BY7 A;  1WI7 A;  2CZ0 B;  3UT1 A;  5FU7 C;  4C5E A;  1PSE A;  3R6N A;  1NLO C;  1G3W A;  2DYI A;  5GAN 8;  4E7L A;  1K9M U;  4ATO A;  4M78 D;  4Z88 A;  1VA7 A;  3CCS Q;  2F69 A;  1QVF A;  2MIO A;  3G6E A;  2IPO B;  2MI6 A;  2HKN A;  2LX9 A;  2YXY A;  1OI1 A;  4NL2 A;  2JTF A;  1I0C A;  4JRK A;  2V26 A;  3FDR A;  2ESW A;  1GBR A;  4QW2 A;  2RPN A;  4E7I A;  4MDX A;  1Y0M A;  4HCB A;  2AK5 A;  2X51 A;  1M90 U;  3SB2 A;  3RNJ A;  2ZGW A;  3MP1 A;  3SDZ A;  2MF2 A;  4C8Q F;  3QG1 A;  3I55 T;  1W2B P;  2QXF A;  1ABQ A;  1VQK A;  2EJF A;  5FRO A;  1X69 A;  4CC3 A;  1K8A R;  3M54 A;  1TTH B;  3QPH A;  3LX7 A;  1MUZ A;  2QQ9 A;  3EHR A;  1SRM A;  1OEB A;  2EQI A;  1K0S A;  2LNH B;  3RKX A;  2JTE A;  3M55 A;  3OMC A;  7AT1 B;  1FMK A;  1HSQ A;  2LX7 A;  4C8Q G;  1T3S A;  1XJW B;  2DAQ A;  3SWN A;  3CC7 Q;  1AWO A;  1NYG A;  2GFU A;  2EYQ A;  3EG3 A;  4JPB W;  2RK2 A;  4RTY A;  3OYM A;  1MGQ A;  3VS7 A;  1BIB A;  3G4S Q;  2CZ6 B;  2VGN A;  2OTL Q;  4NS5 A;  3OYL A;  3NFC A;  3R6O A;  4OML A;  2PUO B;  2EQJ A;  2X35 A;  3QZ9 B;  4RUG A;  2JMC A;  2QG9 B;  2EAY A;  2KMT A;  4LNP A;  4HVU A;  2E70 A;  3EGX B;  2BZY A;  2OTJ Q;  2NLU A;  1HYO A;  2F1L A;  3G71 A;  2NYS A;  3OYI A;  3KBG A;  2XIC A;  1ZQ1 A;  4M7D D;  1G3T A;  2V8J A;  1E6H A;  2YRV A;  4FYY B;  4O5V A;  3CCR T;  4EMK C;  1WXT A;  1WYX A;  3M0S A;  4IUU A;  3OYE A;  3DKM A;  2X3X D;  2PNI A;  3WVE B;  3REB B;  1VQO Q;  4J8O A;  4JZ3 A;  3O8V A;  4PJJ A;  2FRY A;  3A98 A;  3VRZ A;  1K73 U;  1W1F A;  4OP0 A;  1VQP Q;  2QGF B;  3ASK A;  2EYY A;  2CUD A;  3MEA A;  4OB3 B;  1LCK A;  1W70 A;  1M90 R;  2W10 A;  3PVL A;  2AZS A;  3JCM P;  8AT1 B;  3CPW A;  4LUE A;  2K7A A;  3CME T;  1EFN A;  3EFO B;  2O4X B;  4IIO A;  3CCU Q;  1SG5 A;  4J7I A;  1Q7Y U;  2DK3 A;  2M16 A;  3PVQ A;  4N4G A;  2E5Q A;  3QWY A;  1VQ9 Q;  2HNI A;  3X28 B;  3M4Y A;  5C6S A;  4RG2 A;  2VAS A;  5CAI A;  1LNX A;  1MV0 B;  1KD1 C;  2YWW A;  4F14 A;  4M7A D;  1ACM B;  4ANJ A;  5GAN 7;  4LN2 A;  4EMH A;  2BKD N;  2K5I A;  1EZZ B;  4ZNX A;  4LXC A;  5IHN A;  3PTA A;  1WA7 A;  3LWH A;  2R57 A;  3QYG B;  5I2M A;  1QVG P;  1N8R C;  1BU1 A;  1RAI B;  2QTX A;  1VQ4 T;  3TRE A;  2C0I A;  4OGC A;  2YUN A;  2RK1 A;  5CKH A;  5HK3 A;  4BE0 A;  3CD6 Q;  4M75 E;  3MEW A;  3H0F A;  1NJI C;  2RQU A;  3JCM d;  3GP8 A;  1VQM Q;  3E19 A;  3IQL A;  2P0P A;  2EFI A;  3HKS A;  4LD6 A;  1SHG A;  2LCL A;  3JCM b;  3LH0 A;  1VQL T;  2RO0 A;  1QVF S;  1BI0 A;  1SSF A;  1YIJ Q;  1VQ5 A;  1S72 T;  5GAO l;  1QVP A;  1BCO A;  8ATC B;  2F2W A;  4J5Y A;  4UC4 A;  3EG9 B;  1EX4 A;  3OY9 A;  3VS6 A;  1Q86 U;  1RAB B;  3X25 B;  2SRC A;  1X2K A;  3RDV A;  3CCS T;  2RHI A;  2RJF A;  5ECA A;  1K73 R;  3JCM g;  4NOY A;  3JRZ A;  4XTZ A;  1DJ7 B;  3MET A;  4F7U E;  2RN8 A;  1PKS A;  1KIK A;  3JCM h;  1B3Q A;  3HTR A;  4R55 A;  2JXB A;  5C0M A;  1YIT Q;  4RKU E;  1XNI A;  3I5R A;  4ELY C;  1V1C A;  1TOV A;  2E6Z A;  5KYU B;  4XU1 A;  2KQW A;  2KEA A;  1QVG A;  3CCV A;  3CC2 A;  2EIF A;  1IO6 A;  2A36 A;  4CC2 A;  3CCM Q;  4YTL A;  2DL7 A;  4HXJ A;  2DVE A;  1VQ8 T;  2E3I A;  3L2R A;  2GTJ A;  3WXM B;  2LT1 A;  3UDC A;  2L2P A;  2GQV A;  3PNW C;  1YJN T;  3M0U A;  3UA6 A;  2NUT B;  2RJE A;  1GFD A;  2ZPF B;  1IRX A;  3PMT A;  2KXD A;  5IHI A;  5FWC A;  3PIP A;  2H3J A;  1UB4 A;  2DL5 A;  1I4K 1;  4OMN A;  1WJR A;  1N9S A;  2DBM A;  1UJ0 A;  3VV0 A;  2LC4 A;  3JCM c;  2OTL T;  4A4E A;  1I5O B;  4OB2 B;  5KYN A;  1QCO A;  3JAM E;  4QVD A;  1ZBJ A;  2RJC A;  1RLQ C;  4O6J A;  4XU2 A;  1KC8 C;  1I5L A;  2CZ7 B;  2O2O A;  1G5V A;  4B9X A;  3MEV A;  2X4W A;  2CDT A;  3M0R A;  3L2U A;  2OJ2 A;  2NUP B;  4AG1 C;  3U23 A;  2CYZ B;  2LVM A;  3EGX A;  4M75 C;  3G6E Q;  4E7J A;  2LZ6 B;  3TEE A;  1HXD A;  2YHT A;  1QCF A;  2L5Q A;  2K4Y A;  4LE9 A;  1Q86 R;  3JB9 J;  1IZ6 A;  1K0X A;  2HKQ B;  3EH2 A;  1O9S A;  1QQJ A;  2KK4 A;  2JM9 A;  2L3Q A;  2KT8 A;  2HBW A;  3OYJ A;  5IAY A;  3CPW S;  4KGX B;  1VQO T;  2XI9 A;  1M2O A;  1NPR A;  3KXT A;  2KE9 A;  1IB8 A;  1RAE B;  5GAN 5;  2FB7 A;  3ZEH A;  3P8B B;  5I21 A;  1KSW A;  4IUR A;  5GAN 2;  4RTW A;  5KE3 A;  1IGQ A;  2JNG A;  1PHT A;  3LLR A;  2JT4 A;  1ZSZ C;  1UE9 A;  1NZ9 A;  1J3T A;  1D3B B;  5HKC A;  5GJV B;  1OOT A;  1BKB A;  1VQ6 A;  3HP9 A;  2M0Y A;  4X9D A;  3JCM f;  2DZC A;  1OPK A;  5J3B A;  2QAS A;  1YP5 A;  3EFO A;  2DZ9 A;  2O4X A;  1VQ9 T;  4M75 D;  1B7T A;  3SEM A;  2CH4 W;  2MAM A;  2RI3 A;  3UA7 A;  3CPF A;  4BUG A;  4PJM A;  2DF6 A;  4AFZ C;  1XQH A;  3HFO A;  5KYX B;  1IHV A;  5GAN e;  3JB9 D;  4WCI A;  1KK7 A;  2DIG A;  3FJ5 A;  2V8I A;  5DLQ E;  2J06 A;  1JO8 A;  3JCM V;  3BDU A;  1E6G A;  4PJN A;  2DRM A;  3T9N A;  1WHK A;  4XTV A;  1YN8 A;  1M1F A;  2O9S A;  4J9I A;  3EGU A;  4A4F A;  1V76 A;  2HAX A;  1WHJ A;  4JJB A;  4M7D E;  4OB0 B;  2D8J A;  4D6W A;  3CD6 T;  1TWB A;  3HL8 A;  3CME Q;  2E64 A;  2RQW A;  3I5S A;  4J7F A;  2CUB A;  1XTD A;  1VQM T;  2HQX A;  3OS1 A;  1JB0 E;  2XD0 A;  5CIU A;  2RH2 A;  1WHM A;  1YHQ T;  3CEY A;  1ZHI A;  1K8A U;  1QVF P;  2CSI A;  1YIJ T;  4PJO D;  2JM8 A;  1X75 C;  3A1P A;  1ZSG A;  3E2U A;  3CMA A;  3FEO A;  1BB9 A;  4KT0 E;  3I56 T;  2ATC B;  5L8R E;  4E6R A;  4LUD A;  1KQ2 A;  4FM4 B;  5J39 A;  1AOJ A;  3PE0 A;  1I81 A;  3NGP A;  3AHU A;  5J26 A;  4ESR A;  3EG9 A;  2BE9 B;  3OYD A;  2RB6 A;  1UGP B;  2CKK A;  4HT8 A;  2EYW A;  3FRN A;  1X01 A;  1KHC A;  1YJW A;  3VUB A;  4JJD A;  1M3C A;  3AT1 B;  2XDB A;  3I35 A;  4OMF B;  2IVW A;  1VQN A;  2WSF E;  3VS3 A;  4Z02 A;  1MND A;  2A3L A;  1YIT T;  1UJY A;  2FZG B;  2FZC B;  1MV3 A;  2K57 A;  5HCK A;  2DTH A;  1M1K C;  4FSX A;  3V8J A;  1VQL Q;  3E1S A;  3WVD B;  2OI3 A;  2EGE A;  4RTZ A;  4M7A E;  1PRL C;  3CCM T;  2DA9 A;  1S72 Q;  2KXC A;  4C92 E;  2CT3 A;  3V7R A;  1D1A A;  4M78 B;  1D09 B;  4WF2 A;  2GF7 A;  1TS9 A;  1N6A A;  1SF9 A;  3GNG A;  3LH5 A;  2Y4X A;  4CC7 A;  4AMC A;  2R5A A;  3C95 A;  4BY6 B;  3NMZ C;  4MZM A;  2L3P A;  1VQN T;  1OPL A;  2BIV A;  2HQE A;  1JQQ A;  3X24 B;  1WXU A;  1Y96 B;  4JLG A;  4M77 D;  2NUT A;  3CXC S;  2P0Q A;  2ROL A;  3VS2 A;  5D6Y A;  2A0F B;  2EGA A;  4DBR A;  1VYU A;  2ED0 A;  2EKH A;  4KUI A;  2GTO A;  1M9S A;  5DY9 A;  5GAN j;  3P8H A;  3ZBD A;  2X3W D;  2HD0 A;  3CC4 A;  2QEX A;  1VQ5 Q;  4N4H A;  1FXX A;  2DKG A;  3JCM Q;  4PK4 A;  2BE7 D;  2LJ0 A;  2QA4 A;  3CCE A;  2B86 A;  2V1R A;  4J6X A;  3L42 A;  2F2V A;  2VVK A;  5FU7 B;  1VQ8 Q;  1ZLM A;  1Q81 R;  2PTK A;  1WNL A;  1BIA A;  3M0T A;  4M7D C;  4M78 F;  2DLP A;  5IT9 E;  3OYB A;  1ZA1 B;  1SEM A;  3G6E T;  2EBP A;  1N27 A;  2P84 A;  1YJN Q;  2EJG A;  2JZ2 A;  3CCQ A;  2NUP A;  3OYN A;  1G3S A;  3MCA B;  5GAO m;  1H3H A;  1Q81 C;  4XTU A;  5M9O A;  3QYH B;  3J7A F;  4M78 G;  2I0N A;  3CPW P;  3M53 A;  2JOY A;  2QQS A;  4JRP A;  3QWX X;  2PQW A;  4DEX A;  3CCV Q;  5GMK e;  2P4T A;  3F70 A;  1VQK T;  3TSZ A;  3C12 A;  4QVZ A;  2M1H A;  2CP6 A;  4RCB A;  3H0I A;  3P8D A;  2J6F A;  2KNB B;  2VC8 A;  1Y71 A;  4M7D B;  1U06 A;  1AWW A;  1YI2 A;  3PIO A;  3OW2 S;  2GNC A;  4JZ4 A;  1K9A A;  3A8L B;  3OYG A;  2DEQ A;  1PG5 B;  1D3B A;  3HRU A;  2L89 A;  4PFO A;  5GMK i;  4X34 A;  1JXM A;  2EPD A;  1PKT A;  1K4U S;  1WHG A;  4RTT A;  4OMM A;  1BYM A;  3A8O B;  3PFS A;  4M7A C;  2GBQ A;  4HCC A;  2EVR A;  4J9D A;  4AFQ C;  4C92 C;  3A5Z B;  4KH0 B;  5CVI A;  3UAT A;  5A0D A;  5KYX A;  2KDS A;  3RR6 A;  1M2V A;  2DXT A;  1QW1 A;  3L1A A;  4Z89 A;  3M56 A;  1W6X A;  1QLY A;  3M58 A;  2LP5 A;  3OYK A;  4CI0 C;  2QQB A;  5CO7 A;  3G71 T;  1Q82 C;  1ARK A;  2HCK A;  2YUQ A;  2H3E B;  2J05 A;  1ZSZ A;  2DD5 A;  4L59 A;  2OAW A;  4M7D F;  2DTO A;  2K6D A;  2GGR A;  2NWM A;  3D7S B;  1KD1 R;  2HL5 C;  3QO3 A;  4N0A C;  4OGE A;  1TU0 B;  3M59 A;  1BK2 A;  4EMK B;  2DL3 A;  1RAD B;  5I2S A;  5LJ3 e;  1VYT A;  4XAX B;  2QQA A;  2M02 A;  3OS5 A;  4M7A B;  4M7D G;  1N8R R;  4XU0 A;  1TSF A;  4CC4 B;  2DYB A;  2RI2 A;  2DVJ A;  4FW1 A;  1S1N A;  2K9G A;  2K2M A;  3G1J A;  3MHX A;  4DBH A;  5FU6 C;  4C92 D;  1YWO A;  2P0K A;  1NJI R;  5GAN 6;  1KC8 U;  3ER0 A;  2LQW A;  2QTV A;  4KBM B;  2MWO A;  2PVO B;  3TSW A;  1AZG B;  2RM4 A;  2DL8 A;  1Q95 G;  5AT1 B;  2QK0 A;  1WHL A;  3QZ5 B;  5EG2 A;  4Y28 E;  3CBP A;  2I2L A;  4R56 A;  2X4X A;  2ZAE A;  2EGC A;  3NTK A;  1YHQ Q;  4KUL A;  2L3S A;  2HBP A;  2WSE E;  2A28 A;  4II1 A;  1U3O A;  3UPU A;  3OYH A;  2DD4 A;  5GMK j;  3TCJ A;  4Z8A A;  5D7U A;  1QWF A;  2L8D A;  4M7A F;  1SPK A;  4LDY A;  3SHW A;  3DB4 A;  1MMN A;  2CP0 A;  2LDM A;  1D1B A;  2YUO A;  4FT4 A;  4J9F A;  3V7S A;  3OSV A;  2YUP A;  3VS0 A;  5IH2 A;  3I56 Q;  3JSC A;  2RHX A;  4QT7 A;  2V8K A;  4M78 A;  2FYK A;  1AD5 A;  2KRO A;  3C94 A;  3OB9 A;  4AFS C;  3QJY A;  4HCZ A;  2CS7 A;  3HRS A;  2BTT A;  2WAC A;  3GPL A;  4M7A G;  1QP3 A;  2WSC E;  3MPU B;  4B9W A;  1AEY A;  3GNF B;  3A8M B;  1NE8 A;  3GLX A;  1SHF A;  3VS1 A;  2DE0 X;  1CKA A;  2ZPB B;  4BDY A;  1UTI A;  1Y96 A;  3OA6 A;  2FEI A;  3L2W A;  2EQK A;  2D0Q B;  4PJO E;  1FYN A;  1VQ5 T;  1VQ7 A;  2LTO A;  3QKJ A;  2AHJ B;  1EIF A;  1SRL A;  3CC7 A;  4ZGD B;  1YCY A;  2X4Y A;  2DTI A;  4J83 A;  4C0D C;  3CMA Q;  1ZX6 A;  4MDW A;  5GMK l;  1X6O A;  1GXI E;  3PGG A;  5I11 A;  2D1X A;  4ZN1 A;  1FWZ A;  2V1Q A;  1GCP A;  1K76 A;  5KE2 A;  1WPY A;  1YFN A;  2JN0 A;  4FIB A;  2CH4 A;  1AHJ B;  3G4S A;  4IIM A;  2SEM A;  3H9N A;  2ROT A;  2DJQ A;  1M8V A;  2KRN A;  2E41 A;  2QI2 A;  3QBY A;  1B34 B;  3O5Z A;  2C0T A;  1VQN Q;  4LDU A;  1X43 A;  2KRS A;  5GAN d;  3OS0 A;  1YJ9 A;  1KC8 R;  5LJ3 j;  3HFN A;  2MK5 A;  4XTY A;  3VKI A;  1M30 A;  1IHW A;  3REA B;  2OTJ A;  1Q7Y C;  1F1B B;  3CCV T;  3CC2 T;  1PD0 A;  1GRI A;  2RQT A;  4C0D B;  4IKF A;  1BI3 A;  5GAO n;  2Y90 A;  5AYF A;  4MMK A;  1M27 C;  2L0A A;  1X6G A;  1XOV A;  3V8L A;  2AT1 B;  1JJ2 A;  4AG2 C;  2PU9 B;  4DEY A;  3CXC A;  2KYB A;  1FMV A;  5D6W A;  1TUG B;  4J9H A;  5GAN g;  1T0H A;  2K3X A;  4C8Q E;  1NM7 A;  4M7D A;  2AKL A;  4DBF A;  4FW2 A;  2HSP A;  1LOJ A;  1KJW A;  4C0G A;  1W2B S;  3S3O A;  5GAN h;  1GCQ C;  4M77 E;  3RES A;  2PVG B;  2VUB A;  3QXE B;  1VQP A;  5GAN 3;  2DER A;  1NYF A;  5GJW B;  1TUD A;  4ZTF A;  5CKE A;  1QKW A;  1HK9 A;  2D9T A;  2DNU A;  3CC4 Q;  2QEX Q;  2DJZ A;  1JU5 C;  1QWE A;  1YBY A;  2RHY A;  2YLC A;  4GY5 A;  3CCU A;  2QA4 Q;  3RUX A;  2QDL A;  2F2X A;  1VQK Q;  5FLX E;  1BCM A;  2DMO A;  4P5N A;  2D0N A;  2X9H A;  2FZK B;  4RG8 A;  2NUZ A;  2DFU A;  3DLL A;  1WHH A;  1UHC A;  1VUB A;  4M75 B;  3CCQ Q;  4M4Z A;  1UGV A;  2JVV A;  4Y92 A;  5KYW B;  2O31 A;  2J6O A;  2RF0 A;  4JJC A;  4PJO C;  4J6Y A;  4KH1 B;  4NL3 A;  2XMF A;  2HZY A;  4IUP A;  4EMK A;  1ZUU A;  1OU8 A;  1M5Q 1;  2QDY B;  4KUD K;  2XG8 D;  1BBZ A;  1FMW A;  3OW2 A;  1M8M A;  1M2V B;  4M7A A;  1PCX A;  2XKO C;  1IXD A;  2YRC A;  5HY6 A;  3VJP A;  2BZ8 A;  1OU9 A;  4J9B A;  3VRY A;  1ZSZ B;  1R0C B;  3BE3 A;  1YI2 Q;  2LCC A;  2MWP A;  1JXO A;  1VQ6 T;  1YNZ A;  1OX9 A;  3N5B B;  4JUV A;  3G71 Q;  2COW A;  2QAZ A;  4F7U B;  3CCL A;  5FRM A;  2E3H A;  5FRN A;  3HHT B;  2DO3 A;  5CR2 A;  1TG0 A;  2DIQ A;  4XU3 A;  4M75 F;  3LWI A;  5GAN 4;  2D6F A;  4PFP A;  2CP3 A;  4PJO B;  2LRQ A;  3ULR B;  3CQT A;  1TH7 A;  1NG2 A;  3JB9 F;  1Q81 U;  5IHK A;  4C0Z A;  5A2Q E;  1HJD A;  3GIB A;  3TVT A;  4MZP A;  2ZPI B;  1U5S A;  4M75 G;  4ZGJ B;  3QSU A;  1WQ7 A;  1Y7X A;  1N9R A;  2ED1 A;  2LMJ A;  1SSH A;  3GF5 A;  3FJP A;  4J6W A;  4C8Q C;  3JCM J;  2JS0 A;  3JB9 G;  3CCL T;  3EG1 A;  4IUQ A;  3S6W A;  1AWX A;  4QQ6 A;  1M3B A;  5GAN f;  1M1K R;  5GAM g;  4M77 C;  4IUT A;  2ABL A;  4JJN K;  1R0B G;  2KYM A;  4A4G A;  1C6V X;  4C5I A;  4OMQ A;  3HSB A;  1V29 B;  4F7U F;  1KFZ A;  2H8H A;  4A53 A;  9ATC B;  6AT1 B;  1U8R A;  2ENM A;  3C4S A;  4FYX B;  3FC3 A;  3S3M A;  1OYX A;  1I07 A;  3VYG A;  4X9C A;  1WFW A;  2CRE A;  4PJO F;  4C5H A; 
#chains in the Genus database with same CATH homology
 4E7K A;  3BFM A;  3HRU A;  1RI0 A;  2L89 A;  4JLI A;  3CMA T;  3OY9 A;  1Q86 U;  2GCX A;  1NPP A;  4ELZ C;  3X25 B;  5GMK i;  4X34 A;  3JB9 H;  4F7U G;  3CBM A;  3CCS T;  5CK9 A;  2RHI A;  2RJF A;  1Q86 C;  1VQP T;  3JCM g;  1FX7 A;  4NOY A;  2ZPH B;  1BYM A;  3JRZ A;  4BI4 A;  3A8O B;  4XTZ A;  3PFS A;  3PMI A;  3TU4 K;  1DJ7 B;  2EJ9 A;  3H8Z A;  4OVA A;  4C8Q B;  3MET A;  1ZBX A;  5A0G A;  5LL6 S;  4HCC A;  4N4I A;  4F7U E;  2XU8 A;  4PJO G;  4C92 C;  3JCM h;  2GFA A;  3A5Z B;  3RKY A;  5CVI A;  1YJW T;  5A0D A;  4R55 A;  4Q5W A;  2KDS A;  3OSS C;  4M77 B;  5C0M A;  4C8Q D;  3FLG A;  4RKU E;  3J81 E;  2DXT A;  1QW1 A;  3L1A A;  3I55 A;  4ZTJ A;  3M56 A;  1XNI A;  3CCU T;  4ELY C;  3DB3 A;  5IN1 A;  3CCJ A;  2E6Z A;  1JJ2 S;  5GMK h;  2DPP B;  3M58 A;  4XU1 A;  3OYK A;  1B34 A;  4CI0 C;  3CD6 A;  2KQW A;  4FT2 A;  2QQB A;  2B8A A;  2JTM A;  5CO7 A;  3G71 T;  1Q82 C;  1QVG A;  3CCV A;  4XTW A;  3CC2 A;  1LJO A;  2EIF A;  4XK8 E;  4C92 A;  2QQR A;  4PLL A;  3E9G A;  3PT9 A;  4FU6 A;  5LJ5 d;  2DD5 A;  4L59 A;  4M7D F;  2E1H A;  4YTL A;  1VQM A;  1P92 A;  2DTO A;  2DVE A;  1VQ8 T;  1Y07 A;  2LQK A;  3L2R A;  3H6Z A;  3QO3 A;  4N0A C;  1YHQ A;  3WXM B;  4OGE A;  2K2V A;  3RIR A;  2LT1 A;  3M59 A;  5GAM e;  4EMK B;  2O01 E;  3KUF A;  3UDC A;  4A54 A;  1YIJ A;  5I2S A;  5LJ3 e;  3S3N A;  4DA4 A;  2GQV A;  3PNW C;  4XAX B;  2ZPG B;  1YJN T;  2QQA A;  3OS5 A;  2G3R A;  1KD1 U;  4M7A B;  2RJE A;  2ZPF B;  4JS5 A;  5CKD A;  3L2V A;  3PMT A;  1BI1 A;  3LGL A;  4M7D G;  4XU0 A;  4DOW A;  5HK0 A;  3MP8 A;  4MML A;  5A0L A;  3I56 A;  5GAM d;  4N0A A;  5GAO p;  3PIP A;  5CKF A;  2K3Y A;  2H3J A;  2RI2 A;  1UB4 A;  2K5F A;  5LJ3 d;  3OYC A;  2DXC A;  1I4K 1;  4JDS A;  1WJR A;  3CCJ T;  5LJ5 g;  1N9S A;  3MHX A;  5FU6 C;  1N8R U;  5DLO A;  4C92 D;  1KQ1 A;  2RA2 A;  3VV0 A;  2P0K A;  4M77 F;  2LC4 A;  3JCM c;  2OTL T;  4A4E A;  4OB2 B;  5GAN 6;  1KC8 U;  3ER0 A;  4BE2 A;  3M9Q A;  2KSS A;  3HRT A;  1KQS A;  3JAM E;  4KBM B;  4QVD A;  2RJC A;  5LJ5 h;  2MWO A;  2PVO B;  3QJ6 A;  2RJD A;  2RM4 A;  4XU2 A;  4O6J A;  1RL2 A;  3OBW A;  4MZT A;  3CC4 T;  2QEX T;  1UGS B;  2E65 A;  3Q1J A;  4XQ3 A;  2L3R A;  5DM7 R;  1YIT A;  3A8G B;  3JB9 I;  4HKE A;  1I5L A;  1NJI U;  2CZ7 B;  4L6V 5;  2QA4 T;  1G5V A;  3CCE T;  3QZ5 B;  5EG2 A;  4B9X A;  2LQ8 A;  3M4G A;  3MEV A;  4Y28 E;  4M77 G;  2X4W A;  3UWN A;  3L2U A;  3CBP A;  1K8A C;  4QQD A;  2I2L A;  4R56 A;  1I8F A;  2X4X A;  3BW1 A;  3INZ A;  2RHZ A;  2CYZ B;  2LVM A;  3DLM A;  5LJ3 g;  2F5K A;  1M1G A;  4M75 C;  3NTK A;  4TVR A;  4FL6 A;  4KUL A;  5CCA A;  2HBP A;  2WSE E;  4II1 A;  3ZFJ A;  3TEE A;  3CCM A;  1HXD A;  2YHT A;  4M78 C;  5KCH A;  5GAM h;  3UPU A;  3OYH A;  4PLI A;  2DD4 A;  2VYT A;  2L5Q A;  5GMK j;  4JRQ A;  4JRI A;  2K4Y A;  3L2Q A;  2EWN A;  3QII A;  5LJ3 h;  3TCJ A;  3JB9 J;  1IZ6 A;  2L8D A;  4M7A F;  4LDY A;  1JRI A;  1O9S A;  4LDV A;  3DB4 A;  2KK4 A;  4BY6 C;  3CCQ T;  3M5A A;  1QVG S;  2LDM A;  5GAM f;  4FT4 A;  3V7S A;  3OSV A;  3SFM A;  3OYJ A;  2BUD A;  3RER A;  5IAY A;  3CPW S;  2XID A;  3V7C A;  1VQO T;  2XI9 A;  3JSC A;  4M75 A;  4PJO E;  1NPR A;  2RHX A;  3KXT A;  2KVQ G;  5GAO r;  2V8K A;  4M78 A;  4HT9 A;  2FYK A;  4LDX A;  5GMK m;  5GAN 5;  2FB7 A;  4ME7 A;  3ZEH A;  2FVU A;  3C94 A;  3OB9 A;  1WJQ A;  3OS2 A;  3P8B B;  3QJY A;  1U1T A;  4HCZ A;  5I21 A;  4LD9 K;  4BB7 A;  2CS7 A;  3ME9 A;  4IUR A;  3HRS A;  5GAN 2;  2WAC A;  3GPL A;  4M7A G;  4PKC C;  1QP3 A;  3M57 A;  4BI8 B;  2WSC E;  5KE3 A;  4B9W A;  2EQM A;  1M4Z A;  3E9F A;  3GNF B;  1QP2 A;  2JNG A;  3LLR A;  3A8M B;  3HPW A;  1NE8 A;  4RCC A;  1PSF A;  3GLX A;  4E7H A;  1WJS A;  1VIF A;  2VV5 A;  5CQX A;  3CME A;  1NZ9 A;  1OZ2 A;  2ZPB B;  1D3B B;  4LDW A;  5HKC A;  1VIE A;  4BDY A;  5LJ5 e;  2R5M A;  2VGM A;  1W2B A;  1Y96 A;  3OA6 A;  1BKB A;  1VQ6 A;  3L2W A;  3HP9 A;  2EQK A;  1Q82 U;  5CQY A;  2D0Q B;  2XDP A;  2OAU A;  4X9D A;  2CZ1 B;  2DZC A;  2PUK B;  3JCM f;  3X20 B;  1VQ5 T;  1VQ7 A;  2LTO A;  3QKJ A;  5J3B A;  2AHJ B;  3BY7 A;  1YI2 T;  2CZ0 B;  1EIF A;  3UT1 A;  1G3Y A;  5FU7 C;  4C5E A;  4RMO A;  3CC7 A;  1PSE A;  1YCY A;  2X4Y A;  4ZGD B;  2DTI A;  2DZ9 A;  2O4X A;  4J83 A;  4C0D C;  1VQ9 T;  4M75 D;  1G3W A;  3SD4 A;  1IRE B;  5GAN 8;  4E7L A;  1K9M U;  2A7Y A;  2MAM A;  2RI3 A;  4ATO A;  4M78 D;  4MDW A;  5GMK l;  1X6O A;  3CPF A;  1GXI E;  3PGG A;  4BUG A;  2F69 A;  1QVF A;  4EDU A;  2JUF A;  1BI2 A;  4F7U A;  3G6E A;  1XQH A;  3A8H B;  3HFO A;  4DOV A;  2MI6 A;  4ZN1 A;  3J80 E;  1K9M C;  1FWZ A;  5GAN e;  3JB9 D;  2LX9 A;  2RD1 A;  3VYH B;  1OI1 A;  5KE2 A;  4NL2 A;  3OQ5 A;  1H64 1;  2DIG A;  1WPY A;  2JN0 A;  5DLQ E;  2V8I A;  2JTF A;  3LGF A;  3FB9 A;  1AHJ B;  4FIB A;  3G4S A;  4XTX A;  4JRK A;  3FDR A;  1M8V A;  4QW2 A;  2E41 A;  2QI2 A;  3QBY A;  4DQ2 A;  3JCM V;  4PJO A;  3BDU A;  3MO8 A;  1B34 B;  4E7I A;  3VU3 C;  4MDX A;  3FIF A;  3EFR A;  4LDU A;  4HCB A;  1VQ4 A;  5GAM j;  3T9N A;  4C92 B;  1M90 U;  3SB2 A;  4XTV A;  5GAN d;  2ZGW A;  3OS0 A;  4A4H A;  1YJ9 A;  3MP1 A;  5LJ3 j;  3SDZ A;  2MF2 A;  1M1F A;  3RKW A;  4C8Q F;  2EQU A;  3QG1 A;  3I55 T;  4CRI A;  3HFN A;  4A4F A;  2HAX A;  4XTY A;  3VKI A;  1M90 C;  4M7D E;  4OB0 B;  2QXF A;  2E10 A;  2OTJ A;  2XD0 A;  4D6W A;  1Q7Y C;  3CD6 T;  1VQK A;  4OB1 B;  2EJF A;  1KG1 A;  2R58 A;  5FRO A;  4ZTF A;  3CCV T;  3HL8 A;  3CC2 T;  2E64 A;  3M54 A;  4L5G A;  4C0F A;  3QPH A;  4OF1 A;  2RHU A;  3LX7 A;  4J7F A;  1MHN A;  2QQ9 A;  1XTD A;  4C0D B;  1VQM T;  2HQX A;  3RKX A;  3LYI A;  1JB0 E;  3M55 A;  1BI3 A;  2MMP A;  5CIU A;  5GAO n;  3OS1 A;  2Y90 A;  1VQL A;  3OMC A;  2M9U A;  2RH2 A;  4PL6 A;  4MMK A;  2XHC A;  5AYF A;  1YHQ T;  3CEY A;  1XOV A;  3V8L A;  4C8Q G;  2DAQ A;  3SWN A;  1ZHI A;  1S72 A;  1JJ2 A;  1K8A U;  2PU9 B;  5LJ5 f;  1YIJ T;  3CXC A;  2GFU A;  2K5L A;  5D6W A;  4PJO D;  4HA8 A;  5GAN g;  2EYQ A;  1X75 C;  2K3X A;  2YLB A;  4C8Q E;  4BDZ A;  3CMA A;  3FEO A;  2RK2 A;  4M7D A;  2EKO A;  4KT0 E;  3OYM A;  1MGQ A;  1LOJ A;  2FHD A;  4C0G A;  3OYA A;  3I56 T;  5L8R E;  3S3O A;  2DXU A;  5GAN h;  3CCS A;  4M77 E;  4FM4 B;  3RES A;  5J39 A;  1KQ2 A;  2PVG B;  2VUB A;  4GLK A;  3QXE B;  1BIB A;  1VQP A;  5GAN 3;  1I81 A;  2CZ6 B;  5D6X A;  3AHU A;  2VGN A;  5J26 A;  4A4K A;  3OYD A;  2RB6 A;  3OBY A;  4PNO A;  3GOX A;  1UGP B;  2FL7 A;  4NS5 A;  2CKK A;  5KH6 A;  3FRN A;  3OYL A;  3CCR A;  4HT8 A;  1X01 A;  4C92 F;  4JJN K;  3NFC A;  3R6O A;  5FU6 B;  1KHC A;  2E6N A;  2PUO B;  2EQJ A;  2X35 A;  3QZ9 B;  5CKB A;  3VUB A;  5CKE A;  5LJ3 f;  2D9T A;  1HK9 A;  1YJW A;  2EAY A;  2KMT A;  2DJZ A;  2XDB A;  1YBY A;  2E70 A;  2IVW A;  4OMF B;  1VQN A;  2RHY A;  1O75 A;  2WSF E;  4Z02 A;  1KHI A;  2YLC A;  2A3L A;  4GY5 A;  2VXE A;  1U1S A;  3CCU A;  3RUX A;  4C8Q A;  1YIT T;  5KCO A;  2NLU A;  5FLX E;  4ZGE B;  2ZPE B;  3G71 A;  2K57 A;  2DTH A;  4P5N A;  3OYI A;  3KBG A;  2XIC A;  3MP6 A;  4FSX A;  1ZQ1 A;  4M77 A;  4QVC A;  1M1K C;  4C92 G;  4M7D D;  1G3T A;  2V8J A;  3V8J A;  2ZZD A;  3E1S A;  3WVD B;  1VQ8 A;  4RG8 A;  2YRV A;  4O5V A;  4M7A E;  3G7Z A;  3CCR T;  2LNV A;  4EMK C;  3DLL A;  3CCM T;  3QUI A;  1UGQ B;  1VUB A;  4M75 B;  3OYE A;  4IUU A;  4C92 E;  3DKM A;  3V7R A;  4BE1 A;  4M78 B;  4WF2 A;  2GF7 A;  3QHS A;  1N6A A;  3OYF A;  2JVV A;  3VUZ A;  4Y91 A;  3GNG A;  3WVE B;  1YJN A;  2Y4X A;  4V2S A;  4J8O A;  2R5A A;  3O8V A;  3C95 A;  5LJ5 j;  4BY6 B;  4PJO C;  4J6Y A;  4NL3 A;  1KQS S;  4E47 A;  1K73 U;  4IUP A;  4MZM A;  4EMK A;  3LW5 E;  4OP0 A;  1M5Q 1;  1VQN T;  2QDY B;  3V8K A;  2BIV A;  3ASK A;  1R8O B;  4KUD K;  1H3Z A;  1K73 C;  2XG8 D;  2HQE A;  3MEA A;  4OB3 B;  3CBO A;  3X24 B;  3EFS A;  3OW2 A;  1Y96 B;  3L2Z A;  4JLG A;  4M77 D;  3CXC S;  4M7A A;  2P0Q A;  2RI5 A;  5D6Y A;  2XKO C;  3JCM P;  2OTL A;  3OYY A;  2XK0 A;  4KUI A;  5HY6 A;  3VJP A;  3CPW A;  4M7A C;  1M9S A;  4BI3 A;  2X4J A;  3CME T;  2O4X B;  5DY9 A;  5GAN j;  3P8H A;  3ZBD A;  2HD0 A;  3CC4 A;  2QEX A;  4N4H A;  1FXX A;  1JBM A;  4J7I A;  3URG A;  1Q7Y U;  2DKG A;  2LCC A;  2MWP A;  4EMG A;  3JCM Q;  1VQ6 T;  2DK3 A;  4E7J A;  3N5B B;  4JUV A;  2M16 A;  3SWN C;  1VQ7 T;  3OMG A;  2QA4 A;  4N4G A;  2E5Q A;  4F7U B;  3CCE A;  2KAF A;  3CCL A;  4ZN3 A;  5FRM A;  2M0O A;  5FRN A;  3CC7 T;  1KC8 C;  1OZ3 A;  4J6X A;  3HHT B;  2DO3 A;  3L42 A;  2CGH A;  2HNI A;  3X28 B;  5FU7 B;  5CR2 A;  1W2B S;  3M4Y A;  2DIQ A;  5C6S A;  3EAE A;  4IUV A;  1WNL A;  2ZCF B;  4RG2 A;  4XU3 A;  4C5G A;  4M75 F;  5CAI A;  1BIA A;  1LNX A;  3LWI A;  5GAN 4;  2D6F A;  4M7D C;  2C06 A;  1UEB A;  4M78 F;  1KD1 C;  4PJO B;  2LRQ A;  5IT9 E;  3OYB A;  3G6E T;  1N27 A;  4M7A D;  1TH7 A;  2Y4Y A;  5GAN 7;  3JB9 F;  4EMH A;  1Q81 U;  2DXB A;  2BKD N;  2K5I A;  2EJG A;  2JZ2 A;  3CCQ A;  3G4S T;  4C0Z A;  3OYN A;  3NTI A;  1G3S A;  5A2Q E;  2XDD A;  3X26 B;  3PTA A;  3MCA B;  5GAO m;  3LWH A;  1W4S A;  2R57 A;  3GIB A;  4MZP A;  1Q81 C;  2ZPI B;  3QYG B;  1VQO A;  5I2M A;  2VXF A;  4XTU A;  1N8R C;  4M75 G;  4ZGJ B;  3JCM e;  5M9O A;  3QSU A;  2QTX A;  3QYH B;  1WQ7 A;  3J7A F;  1VQ4 T;  1Y7X A;  3TRE A;  4M78 G;  4OGC A;  3M53 A;  1N9R A;  1YJ9 T;  2JOY A;  2QQS A;  3JCM X;  3BDL A;  4JRP A;  4IKF A;  3GF5 A;  2PVD B;  2RK1 A;  3FJP A;  5CKH A;  4J6W A;  4C8Q C;  5HK3 A;  5GAO q;  4BE0 A;  3JCM J;  2PQW A;  3JB9 G;  4M75 E;  3MEW A;  3NTH A;  3CCL T;  3MEU A;  5GMK e;  4IUQ A;  2P4T A;  3F70 A;  3S6W A;  2OTJ T;  3SWN B;  4M78 E;  4QQ6 A;  4QQG A;  5GAN f;  4BD3 A;  1NJI C;  1VQK T;  3JCM d;  4M77 C;  5GAM g;  2E12 A;  3GP8 A;  3JCM W;  3E19 A;  4IUT A;  2P0P A;  2F5T X;  4VUB A;  4EPC A;  3C12 A;  2EFI A;  3HKS A;  2M1H A;  3QDR B;  4LD6 A;  4QVZ A;  3RMS A;  4A4G A;  2LCL A;  4C5I A;  4RCB A;  3LH0 A;  3JCM b;  4JS4 A;  1VQL T;  3P8D A;  1V29 B;  2RO0 A;  4F7U F;  1QVF S;  3HSB A;  2VC8 A;  1Y71 A;  4M7D B;  1BI0 A;  1SSF A;  2KY9 A;  1VQ5 A;  1WQW A;  4A53 A;  2LT4 A;  1M1K U;  1YI2 A;  4BAC A;  1WGS A;  1U8R A;  3PIO A;  3OW2 S;  1S72 T;  2IG0 A;  3C4S A;  5GAO l;  1QVP A;  1UGR B;  3FC3 A;  3S3M A;  4J5Y A;  1OYX A;  3A8L B;  3OYG A;  1VQ9 A;  2DEQ A;  3RMQ A;  3VYG A;  1D3B A;  4X9C A;  4PJO F;  4UC4 A;  4C5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...