4QVZA

Fmrp n-terminal domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
200
structure length
194
Chain Sequence
EELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPDRQIPFHDVRFPPPVGYNKDINESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYANEIVTIERLRSVNPNKPATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Fragile X mental retardation protein 1
publication title Human FMRP contains an integral tandem Agenet (Tudor) and KH motif in the amino terminal domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 194
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF17904 KH_9 FMRP KH0 domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qvzA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qvzA02
5C6SA 2L3RA 2RJEA 4FL6A 2F5KA 4EDUA 3L2UA 4IKFA 2MWPA 2BKDN 2L8DA 2FHDA 4C5GA 2E5QA 2HQXA 2LVMA 3OA6A 1H3ZA 2XK0A 3GOXA 3PNWC 2M1HA 3LLRA 2M16A 4E7LA 2IG0A 1RI0A 2O4XA 4FU6A 3FDRA 2CKKA 3OS1A 4PLIA 2RJDA 2RHZA 5J26A 3UT1A 2R5MA 3OB9A 3L2VA 4ZTJA 3OYHA 2K3YA 5KH6A 3OQ5A 4PLLA 4QW2A 3OYAA 4IURA 1WJRA 3S6WA 5KE3A 5FROA 2X4YA 4LD6A 4QQDA 3L2QA 4Z02A 5KCHA 3MEUA 4C5IA 2WACA 5D6XA 3MEVA 2QQRA 3META 1G5VA 2EQJA 4IUUA 1WJSA 2K3XA 3F70A 2EQMA 3MP6A 3OMCA 4N4IA 4Q5WA 3OYNA 3OYGA 3Q1JA 2GF7A 3BDLA 3QKJA 2EQUA 5IAYA 1OI1A 2BIVA 2EKOA 2RHUA 3L2RA 4BACA 4BDZA 4QVZA 2RHYA 3OYLA 3OYFA 1OYXA 3FEOA 4E7IA 2HQEA 2RHIA 4GY5A 3DB3A 4X34A 4N4GA 3S3OA 2DAQA 2X4XA 5C0MA 2G3RA 1MHNA 1SSFA 4E7KA 2LDMA 4RG2A 4HCZA 3C4SA 2RHXA 1WGSA 4BE2A 2VYTA 2GFAA 2R58A 2EFIA 2R5AA 4C5EA 5KE2A 2L89A 3E9FA 5M9OA 3ME9A 3OMGA 3UWNA 4BDYA 3LYIA 1N27A 2RJCA 3OYCA 3FLGA 3L2WA 4E7HA 3SD4A 2LRQA 3PFSA 3EAEA 2RO0A 2DIQA 5FRNA 3NTHA 4L59A 4N4HA 5D6YA 4BD3A 3OYEA 2R57A 1WJQA 5IN1A 3ZEHA 4IUVA 3CEYA 5CIUA 3S3NA 3LX7A 1KHCA 2NLUA 3OY9A 3ASKA 2PQWA 3PMIA 2RI5A 4A4HA 4E7JA 2BUDA 3OYJA 2LTOA 3P8DA 5D6WA 3OYMA 3LGLA 2D9TA 2RI2A 2JTFA 2XDPA 3KUFA 3MEWA 4CRIA 3OYDA 2JZ2A 2EQKA 4IUTA 3OS2A 3QBYA 4OVAA 3QJ6A 4A4GA 3E9GA 3NTKA 4QQGA 2P0KA 5J39A 2QQSA 5KCOA 3O8VA 3DB4A 2X35A 2LCCA 2X4WA 3OS0A 3FC3A 3MP8A 4BE1A 3LGFA 3L42A 3MEAA 2DIGA 4UC4A 2RJFA 3OYBA 4B9WA 4IUQA 2MWOA 2E6NA 4IUPA 4BE0A 1XNIA 3PMTA 3H8ZA 3P8HA 4PL6A 3S3MA 3MP1A 3QIIA 4QQ6A 2M0OA 1OZ2A 4II1A 4A4FA 3OYKA 5FRMA 4A4EA 4C5HA 3LH0A 3OYIA 1OZ3A 3M9QA 2GFUA 2YRVA 3H6ZA 3NTIA 2B8AA 3DLMA 3MO8A 4B9XA 2O4XB 2RI3A 4NS5A 4ZTFA
chains in the Genus database with same CATH superfamily
3HRTA 5C6SA 2QASA 3DLLA 1H3HA 2JXBA 1RAFB 1W1FA 2QDLA 1PHTA 4BY6B 1K9MR 1M2VA 3ZBDA 2YRDA 4XTWA 5J26A 3UT1A 5KYYA 2FG0A 3TEEA 1R0BG 1KQ1A 4LD6A 1VQOT 3C95A 1UECA 2O31A 3VKIA 3A1PA 4NL3A 3EH1A 3TSZA 1WJSA 1PWTA 1SPKA 2NYSA 3JSCA 1MV3A 2EYQA 4R0KA 3RBBB 1VQOQ 3QO3A 3JCMd 1RLPC 1U8RA 3C4SA 4AG1C 2OJ2A 5LL6S 1TSFA 2VUBA 5GAN8 3L2WA 4E7HA 1YCYA 3UF4A 5GMKh 1M3BA 4C0DB 2HNIA 1I5LA 2C0TA 2NLUA 3G71A 3J81E 2PQWA 3CMAA 3QZ5B 3GP8A 4XTYA 2KAFA 2J6OA 2RI2A 2A37A 1H641 3CCEA 4J9HA 1CSKA 5FW9A 2LX7A 3VS0A 2D8HA 4FT2A 2PVGB 2LCCA 2HAXA 1WQ7A 1OQKA 4DBFA 1BBZA 2HBWA 4Z88A 1BCMA 4J83A 4J7FA 3VV0A 3OBYA 1G2BA 2FZCB 2DX1A 2RNAA 3QIIA 2PUOB 1Z9QA 3OYKA 1KG1A 4A4EA 2GFUA 1QVGA 3MO8A 1U1SA 2HDAA 4RMOA 2OAUA 3P8BB 2L8DA 4C5GA 1TTHB 4RTTA 4LXCA 2EVRA 2CKKA 2H8HA 2K4YA 1MMDA 2NWMA 2RHZA 2ATCB 2QXFA 2FL7A 2COZA 4XTZA 4MDWA 4PJOB 1VQ6A 3MEVA 1VA7A 3SDZA 3HP9A 4Q5WA 3PIOA 4M7AC 1KK7A 1QVGP 2BIVA 2M0YA 3JCMJ 2CT3A 3VS1A 4X34A 3UA6A 4X1VA 1AVZC 1FXXA 2YXYA 2WSEE 2COYA 4C92G 4C0FA 5GAOn 4AFUC 1I1JA 4BDYA 3ZFJA 2ECZA 2ENMA 3RKWA 2RO0A 2KDSA 3CCJA 2YUPA 5IHNA 2DXUA 2KK4A 5GAOr 2L5QA 3FB9A 3JB9D 2ZPGB 4QVCA 1VQ5A 4F7UB 1G8XA 3EGXA 2F2XA 4J6YA 3JCMe 1YP5A 4ANJA 4PNOA 4GLKA 2NUTA 1M1KC 2HEQA 1QVGS 4C0DC 1WXBA 1V29B 4LD9K 3BDUA 4OMFB 2Y4YA 5FU7B 1Q7YU 4BE0A 4C92E 4PL6A 1W6XA 2HSEB 3JB9F 2DF6A 2E12A 3QUIA 2JT4A 4EMGA 2L3RA 3G4SA 1KHIA 3L2ZA 1TOVA 1ZSZA 5CQXA 4OB1B 4MZPA 1WFWA 3ER0A 2LNVA 1K8AC 2L0AA 2YUOA 2BE7D 2M1HA 1Y96B 2AZVA 4RG8A 4C92D 5GANh 1IHWA 4JDSA 3RERA 2R5MA 2CH4A 2HL5C 2O01E 4XU1A 3CMEA 5KH6A 3S6WA 1NG2A 1K9MU 3SWNB 1C0MA 4C0GA 2AIRB 1N5ZA 5FWCA 5GMKi 2DLPA 2CP5A 4JJDA 2MF2A 4LE9A 3F70A 2VKNA 2DE0X 2LQNA 2QK0A 1TUGB 2KBTA 2E3IA 2ROLA 3JCMP 4C92F 4M7AG 3CPWA 1XJWB 1WA7A 1VQLA 4PJOC 1WGSA 1M3CA 2R5AA 3E9FA 1JXMA 2VXEA 2VB6A 2LRQA 3JB9H 5LJ3d 4OMNA 1YJNT 2KY9A 3LX7A 2FVUA 2YDLA 2LZ6B 3A8LB 4C8QC 4CC2A 2CZ6B 4CRIA 3KFVA 3VYHB 1Q82R 3SFMA 4V2SA 3CPWP 1VYVA 5KYNA 1I07A 4ZGJB 1AD5A 2DD4A 1AT1B 3VS4A 2CZ7B 2HL3A 4OB2B 4XK8E 2VV5A 1Q7YC 2DVJA 3MP8A 4M7AE 2JVVA 4ELZC 1M1FA 3G6EQ 2DERA 4IUQA 4IUPA 4Z89A 3CD6A 5GMKm 5CKHA 4FSSA 1F1BB 4EIKA 2DA9A 4II1A 1TUDA 5HCKA 4PJLA 2QDYB 1VQNA 1OZ3A 2C06A 1YJWT 3H41A 2OTLT 2AHJB 3E1SA 2FB7A 4FL6A 2HQHA 2BKDN 4M7AD 4BI3A 2HMAA 5CKBA 1ZQ1A 1LVKA 1MMNA 1YJWQ 2OTLQ 1WX6A 1K9MC 4M77C 3MKDA 1RAIB 2QTXA 2A3LA 3OSVA 1FX7A 3RR6A 3VS5A 1M1GA 1HSQA 4M75E 3CPWS 2EJGA 2D6FA 4D8DA 2O2OA 4GLMA 1ARKA 1X27A 2X3XD 1NPRA 3V8LA 1LJOA 4M7AF 1OOTA 4EMKB 2QA4A 3UPUA 4CI0C 6AT1B 1UJ0A 3I5RA 4BUGA 1NE8A 1MUZA 1UG1A 4OMMA 4ZNXA 4M75D 1NPPA 2JMAA 1N8RU 2CP3A 4C5EA 4HVUA 3ME9A 2JUFA 1N27A 2RA2A 1BB9A 1BK2A 2XD0A 4F16A 1X6OA 4PJOG 3JCMW 4N4HA 2DTOA 2E1HA 1QKXA 1IO6A 4OMLA 3NMZC 3PMIA 4J8OA 5J3BA 2CH4W 2JTFA 1S72A 5KYXB 2K2VA 4M75F 2KT8A 1FMVA 1IGQA 4QQGA 5GAOp 2V1QA 2QQSA 4C8QG 2ZCFB 2XICA 2X35A 2O9SA 4GBQA 4F7UA 5GAOq 3CCRA 2V1RA 4PK4A 1RAGB 1C6VX 2RH2A 2QGFB 5A0LA 1IRXA 4PJMA 3PMTA 5LJ3e 4QQ6A 2M0OA 1YJ9T 2K7AA 1K73R 2SRCA 1FYNA 1M30A 3M9QA 4B9XA 3CCVT 4HKEA 2RI3A 2XU8A 1RAAB 2RJEA 4QT7A 1YJ9Q 1N6AA 1Q86R 2NUPB 3CCSA 2KRNA 2B86A 2CGHA 3SHWA 1WXUA 1H92A 3OYHA 3A8MB 1Y96A 5KCHA 3X24B 4RTYA 3PGGA 4M77G 2EJFA 2QQRA 2EQJA 1D3BB 1GCQA 3EG2A 3VU3C 5CKEA 1EFNA 2GF7A 3QKJA 4KUDK 5LJ5j 2MK5A 3PVLA 4RTXA 3SWNA 1VQ4T 3WVEB 4LN2A 5LJ5h 3JV3A 2DAQA 2K5FA 2EGEA 4C92B 2RF0A 5D7UA 4A54A 1VQ4Q 1TH7A 2JTMA 1D0XA 4JLIA 3OYCA 1PRLC 2BTTA 1IZ6A 3EG3A 2KYBA 2KYMA 3I5SA 4KH1B 5FRNA 4EMKC 2R57A 3I55T 3RMQA 1GFCA 3ASKA 3RIRA 4M77E 1I81A 4C8QF 2VXFA 2CYZB 3OYDA 3I55Q 1WI7A 1JEGA 1M90U 4J5YA 5I2MA 2EWNA 4K11A 2F5TX 3UDCA 4M78E 1VQOA 2YSQA 2A28A 1Q82U 3OW2S 2DZCA 1XNIA 1OU9A 2LJ3A 4M77D 4Y91A 1OZ2A 3JCMV 1BI3A 1ZUYA 2MIOA 2FEIA 2L3SA 2KQWA 4OGCA 2RB6A 3DLMA 5GMKe 2MOXA 2FYKA 1FMKA 3OBWA 4PJJA 4EDUA 3L2UA 4M78D 2FRYA 2GNCA 5CQYA 2E5QA 1H3ZA 3GOXA 1M27C 2F2VA 3CCMT 2JM9A 1QWFA 3JAME 4FU6A 5DY9A 2CDTA 1PSEA 3PT9A 4TVRA 5IXFA 3OB9A 4M77F 1M8MA 4JUVA 3CCMQ 4LDXA 1WJRA 2E4HA 4LNPA 2H3JA 4Z02A 2IVWA 3M57A 2WACA 2CT4A 4JRQA 3TREA 4JS4A 1UGVA 3OYGA 3LWIA 4J6WA 4BDZA 2AZSA 3M59A 3OYLA 4M7AB 3M54A 2HCKA 3FEOA 4LDVA 1CKAA 2LJ1A 2ESWA 4DBQA 3V7CA 1ZUUA 4E7KA 5EG2A 2KVQG 2GTJA 1KQ2A 3SEMA 3EHRA 1I0CA 3V7RA 2VGNA 2J05A 4EMKA 2MPXC 3I56T 2MMPA 2DIQA 5D6YA 5FWBA 3CEYA 3EGUA 3M4GA 4C92C 8ATCB 3BFMA 1JB0E 2KT1A 1B7TA 2OI3A 5GAMg 3I56Q 4ME7A 1NM7A 1AZEA 2GCXA 2C0IA 2KEAA 3EG9B 1Y07A 2KRMA 1GCPA 1HXDA 1D0ZA 1QLYA 4OMPA 2DL4A 2DTIA 1Q82C 3GF5A 1RAHB 5GMKj 2X4WA 4AFQC 2YLCA 2DXTA 3FC3A 5KYXA 2RQTA 3QJYA 1T3LA 1GXIE 1WQWA 4NOYA 2L3QA 2K57A 4OMQA 2DXBA 3OYIA 2LQKA 4ZTFA 2DJQA 2ZPEB 4LDUA 1YN8A 4HT9A 1K73U 1R0CB 1Q81R 2JTEA 2CSQA 3R6OA 2MYSA 1UE9A 4OB3B 4FYXB 3X26B 2LNHB 3BW1A 1EIFA 2HKQB 4QW2A 3GPLA 1Q86U 3OS5A 2AT1B 1QVFA 3D7SB 7AT1B 4C5IA 3JB9G 1BI2A 4KH0B 1SKUB 4DA4A 2D1XA 2F2WA 3DKMA 1YI2T 1UGSB 1JBMA 2LQWA 3N5BB 4AT1B 5AYFA 2QEXT 1SHGA 1K1ZA 3VUZA 2VVKA 4J9EA 4J9CA 1D3BA 5IH2A 1Q95G 2RM4A 2E10A 1YI2Q 2XG8D 2P84A 2RHXA 2QEXQ 1LNXA 5GANg 2ZPBB 5GAMj 4C92A 5GAMh 1EZZB 1IHVA 1QVFP 5GANe 3QPHA 2DZ9A 1N8RR 1AWJA 5GAN3 4JJCA 4J7IA 4M7DC 1VQMT 1SG5A 8AT1B 2OAWA 2LC4A 4C8QB 4ZN1A 3PVQA 3QDRB 3E19A 1K76A 2VC8A 1M5Q1 5L23A 3HPWA 1VQMQ 1OX9A 1QCFA 2DFUA 3G71T 1KD1R 3CMAT 1X2QA 1WDXA 1SF9A 2EKHA 3GNFB 1KQSA 4AG2C 3MEAA 4A63B 4RCCA 3IQLA 2RQUA 3CMAQ 1B07A 4DEXA 1W70A 1TS9A 1YNZA 4M75C 1QMCA 1T0JA 2EGAA 4VUBA 1N9SA 1K73C 1P92A 3QZ9B 2XHCA 1UGRB 5A0GA 2AKLA 1BI0A 1PD0A 1QVFS 1G3WA 4FYYB 5IHIA 1ABOA 2EGCA 2ROTA 3GLXA 1TUCA 3QG1A 4OMOA 3LWHA 1Q86C 2EAYA 3FDRA 1M3AA 1JO8A 1PNJA 2DETA 1BKBA 4JJNK 1KQSP 1ZA2B 2KXDA 4O6JA 2RMOA 4M77B 3OYAA 4IURA 1B3QA 2DILA 1K4US 4XTUA 4FM4B 2KROA 1G5VA 4HCCA 2MCNA 1WHGA 1R8OB 1XQHA 4HA8A 4J9DA 1YFNA 4L5GA 3VRYA 3G6EA 3JCMb 5GANj 3M56A 3O5ZA 1MGQA 1MNDA 2DYBA 2G3RA 2CP0A 4XU2A 4RG2A 3QWYA 2HD0A 4YTLA 1IXDA 1KFZA 1C1AA 2DNUA 3V8KA 1YIJT 4M7AA 5LJ5d 3TSWA 4JRPA 2PVOB 3CQTA 1E6HA 5KYWB 2DYIA 4KUIA 1PRMC 2HSPA 2HBPA 1YIJQ 4PFZA 2O88A 1QCOA 1WJQA 2OTLA 2KSSA 3CCLT 1KHCA 1PKSA 2M9UA 1KQSS 2BUDA 1NBEB 4R56A 2DM1A 2NUZA 2J6FA 3CCLQ 4DBHA 2DVEA 4M7DG 5GAN5 2DD5A 1HJDA 3EG9A 5CKFA 3M55A 4RUGA 2DIGA 1BI1A 2GGRA 3M0TA 1M90R 2FZKB 3HFOA 1QKWA 3MP1A 2D8JA 3A8GB 3HKSA 1BIAA 4HVWA 1MMAA 1YJNQ 3NTIA 1OV3A 4F17A 4RTUA 1GFDA 4M75G 1V1CA 1WHJA 1FMWA 3CXCA 4ELYC 1W4SA 2ZAEA 3L2VA 4M7DE 1Q81U 3OQ5A 1A0NB 4RTWA 1U3OA 2QAZA 5D6XA 2DEQA 3META 3MP6A 2JNGA 4QKUA 2LT4A 3VS3A 1JJ2A 2EQUA 4MDXA 2EKOA 1Y71A 2FO0A 2X3WD 3FJPA 3CMET 1Y0MA 2EYYA 4A53A 1QP2A 3CC2T 1OEBA 2BZYA 4M7DD 3T9NA 3CXCP 4RKUE 4KULA 4C0ZA 3R6NA 1KJWA 4E47A 4FT4A 3CC2Q 4FW1A 1YHQT 3JCMf 1YJ9A 3UWNA 2DKGA 3A8OB 3URGA 1TU0B 4M78C 1GBRA 3RKYA 2ABLA 3CC7T 1KC8U 4X9DA 4A4KA 3OYEA 1YHQQ 2J6KA 2XDDA 4PJOA 1JJ2P 4D8KA 1LOJA 1R77A 3P8DA 3H0FA 2QQAA 4M7DF 1TWBA 3CC7Q 1QQJA 3M0UA 4LUDA 1ZUKA 1WIEA 1M2OA 3M0PA 3QBYA 2PUKB 5LJ5g 2M02A 1OPLA 1FWZA 3DB4A 5LJ5e 1X6GA 2K2MA 4C8QA 3EGDB 2GBQA 2E6NA 5FU6C 1WNLA 5GJWB 3H0IA 2AK5A 1KD1U 2P4RA 3CXCS 3PTAA 1UHFA 1NLPC 2VASA 1MMGA 3J80E 1RL2A 2WSFE 3MPUB 2RQWA 4HCBA 4B6MA 1AWXA 3LH5A 2RPNA 2M16A 2RK1A 1Q81C 1WHLA 2CP7A 5A0DA 5I22A 3M0QA 1JJ2S 1BYMA 2KRSA 2WSCE 3EFOB 1Y7XA 5KE3A 5FROA 4FIBA 3CCUT 2L2PA 2Y90A 5FLXE 1MNEA 3EH2A 3OW2A 3L2RA 4M77A 3CCUQ 3CCVQ 5CCAA 5GAN7 3OSSC 2EIFA 5I2SA 3S3OA 2EJ9A 2OTJT 1IGUA 1NZ9A 2ZPHB 5GAOl 2W0ZA 4JZ3A 2EQIA 3NFCA 1VQ7A 1B34B 1E6GA 3M53A 1G3YA 1RAEB 2OTJQ 1VQ9T 2J7IA 2K6DA 2CZ0B 2DPPB 2JOYA 2E41A 3EAEA 3UA7A 2RQRA 4IUVA 2COWA 3ZEHA 3S3NA 2HZYA 4FW2A 2I0NA 4HT8A 3OW2P 2DXCA 1VQ9Q 2JS0A 4A4HA 5KYWA 5GAMd 1JU5C 1UGQB 4M78G 5A2QE 2HKNA 3OYJA 4E7JA 1N8RC 2IIMA 2G6FX 3CCMA 4FYVB 2JN0A 2XKOC 4JRKA 4AMCA 2KR3A 2DL5A 3E9GA 2P0KA 3G1JA 4J6XA 2YWWA 1KD1C 3LGFA 3GBQA 3NHNA 2QQ9A 2MWOA 2CREA 2X9HA 3C94A 3M0RA 2QGGA 2SEMA 2E6ZA 4WF2A 1KIKA 2JM8A 1I8FA 1RI9A 1YWOA 1WYXA 2VGMA 3OA6A 1ZBXA 3RMSA 2ZPFB 3PNWC 5IHKA 5GAN4 1X69A 1RI0A 4WTOB 2KXCA 3TU4K 3I56A 2KI7A 3PE0A 1IB8A 2DL3A 1ZBJA 4QQDA 3AT1B 2YUQA 2Z0WA 2JJ9A 2J06A 2EQMA 3EGXB 3Q1JA 2ZGWA 3QYGB 1OI1A 2CP6A 2RHYA 3FJ5A 3RUXA 3MHXA 1XOVA 2X4XA 1NYGA 4E6RA 2V26A 2CZ1B 2EYWA 2L3PA 3TVTA 3A98A 4ORZA 2GFAA 3CC4T 2L89A 5GANd 4JZ4A 1UFFA 3LYIA 4KGVB 3HSBA 4R55A 1PKTA 4M78F 3CC4Q 3THKA 3JB9J 3RNJA 2QQBA 1I5OB 1M8VA 3EFRA 4AFSC 1H8KA 1ACMB 5CKDA 1ZSGA 3REBB 9ATCB 4M7DB 2D9TA 2XDPA 5LJ3f 1JXOA 3A5ZB 2EQKA 1NJIR 2KNBB 3I9QA 1VQPT 3MJXA 5GAN2 5J39A 3CCQT 1K0SA 2PVDB 4IIMA 2AKKA 1VQKT 1SRLA 1YITT 1VQPQ 3L42A 4RTZA 1CKBA 4M4ZA 3CCQQ 2EBPA 3CBOA 2DTHA 4ZGDB 1YI2A 3X25B 4FSXA 1VQKQ 1M90C 3X20B 1YITQ 1WHHA 2QEXA 3EGDA 3M5AA 4N0AC 1VUBA 5GAMe 1HD3A 4M75B 3H0HA 4IKFA 2CUDA 1G3SA 2XK0A 1E7OA 2K5IA 1QCNA 2IG0A 2EW3A 4JRIA 2D0QB 2JW4A 2K3YA 4PLLA 2RN8A 3VJPA 2X4YA 2PZ1A 1VQMA 3MEUA 1BIBA 3OYNA 3EFOA 2DMOA 4DBRA 1VOMA 5IAYA 2QTVA 1OX8A 1VQ8T 3HRSA 5KYUB 4JS5A 2E64A 2FPDA 2LDMA 3H9NA 4E7ZA 3WVDB 4WCIA 2NUPA 1UB4A 4KGXB 1VQ8Q 4ATOA 1GRIA 5KE2A 3RKXA 1D1AA 4JLGA 3C12A 3TQ7P 2ZZDA 4PKCC 2DRKA 2DK3A 2LX9A 1HK9A 3PFSA 3VS7A 1WXTA 2EPDA 1M1KU 4BD3A 1B34A 5CIUA 1BCOA 4P5NA 3RDVA 1QVPA 3LGLA 1RLQC 4EMHA 1TXQA 2JZ2A 4DQ2A 4KBMB 1KC8R 2X51A 4IUTA 1QWEA 2P0PA 4XU3A 1AWOA 2XI9A 1UUEA 1YCSB 2BZ8A 1ZSZC 3GNGA 3BY7A 1M4ZA 2RJFA 1K8AU 2CSIA 4N0AA 1VIEA 4J9IA 1SSHA 3P8HA 4BB7A 4BI8B 5FRMA 1RACB 1D0YA 1PC0A 4LDYA 2YRVA 2O4XB 1RADB 4F04B 1AOJA 4BY6C 2QG9B 1YIJA 1GL5A 1TG0A 2V8JA 3JRZA 3VUBA 3CCET 1LCKA 2RD1A 3NGPA 2C0OA 4JPBW 5DLOA 3G71Q 1PG5B 1WZOA 2MAMA 3CCLA 3A8HB 4DOWA 3L2QA 3CCEQ 3SB2A 5ECAA 3C0CA 1KSWA 1I4K1 2K3XA 4OP0A 1UJYA 3OMCA 3KBGA 4OGEA 3BDLA 3QWXX 4QVZA 1WHMA 2H3EB 4O5VA 3DB3A 3JCMg 1WPYA 3J7AF 1M9SA 2MI6A 1UEBA 2FPFA 1YJNA 2DO3A 2VYTA 2EFIA 3AHUA 1BU1A 2PNIA 2DBKA 5I11A 5GAMf 2LJ0A 3JB9I 4CC7A 1DJ7B 1OPKA 3M0SA 1D09B 4L59A 4M78B 4J9GA 3OY9A 5CK9A 5CO7A 5L8RE 5CR2A 2LTOA 1VQ6T 3EG1A 3NPFA 1PM3A 4Y28E 2CUBA 2IPOB 4QVDA 3MEWA 2I2LA 3HL8A 3I35A 4A4GA 4MMKA 2XIDA 1JRIA 3O8VA 1VQ6Q 2BZXA 5HY6A 3OS0A 4M7DA 4JJBA 1PSFA 1NJIU 1YJWA 4CC3A 2E5KA 1Y57A 4CC4B 3S3MA 4ESRA 5EC7A 5FU6B 4C5HA 1AEYA 4MMLA 1SEMA 3REAB 3CBMA 3CC2A 3ZL7C 1NLOC 2Y4XA 1D1CA 3QHSA 4DEYA 3CCJT 2LT1A 3M4YA 1IREB 2FHDA 2LVMA 4HXJA 1MV0B 1VQ5T 1YHQA 3TCJA 3LLRA 3EFSA 4E7LA 3CCJQ 3OS1A 4EPCA 2K9GA 4M75A 2LMJA 1G3TA 1YWPA 3MCAB 4PLIA 3CC7A 1VQ5Q 4F14A 1T0HA 1O9SA 2V8IA 4XTVA 4XU0A 3ULRB 2YHTA 2YUNA 2LCLA 4KT0E 4MZMA 3JCMh 2E3HA 5CVIA 1JQQA 2D0NA 2QI2A 3LW5E 3OYFA 1GBQA 2ED0A 2M51A 4DOVA 5GANf 1UHCA 4N4GA 2VWFA 3G4ST 4HCZA 4OF1A 2R58A 1X43A 3G6ET 2K5LA 2DRMA 1X6BA 3OMGA 5M9OA 4RTVA 5KYUA 3FLGA 4XTXA 3G4SQ 3SD4A 2RK2A 3JCMc 3JCMQ 3HRUA 1SHFA 2GQVA 3GIBA 2EYXA 2GQIA 4HCKA 2RI5A 2F1LA 5D6WA 4KRTA 1NEGA 3CMEQ 1N9RA 3G7ZA 3QJ6A 3NTKA 1VYTA 2A36A 1NJIC 5IXBA 4IIOA 1G83A 2P0QA 1W2BA 5GAN6 3CCUA 3CCVA 1X75C 5FU7C 4L6V5 4UC4A 1VQLT 3H8ZA 2A7YA 1D1BA 3UATA 1X2KA 2DL7A 1U5SA 2FPEA 1M2VB 1VQLQ 3H6ZA 2FRWA 3OYBA 4NS5A 4AFZC 1AZGB 4Y92A 5GJVB 2OTJA 1OU8A 3VS6A 2KMTA 1XTDA 2F5KA 5KYYB 1HYOA 2MWPA 4ZN3A 1SRMA 2HQXA 4FCYA 5GMKl 5DM7R 2YRCA 1GCQC 1ZA1B 3E2UA 3FIFA 2E70A 3CPFA 2O4XA 2A08A 1VQ9A 1W2BP 2K79A 2FZGB 2RJDA 2PTKA 3SWNC 4ZTJA 1UTIA 1OULA 2DL8A 4OB0B 3RESA 2PU9B 1VQ4A 3PIPA 5GAOm 2DEUA 3HHTB 4HVVA 4PFOA 4IUUA 3CD6T 2RHUA 4E7SA 2EYZA 1OYXA 4E7IA 2RHIA 1NYFA 1VQNT 3CD6Q 5C0MA 1PCXA 1SSFA 3V7SA 3BE3A 3I55A 1ABQA 4RCBA 2KE9A 3M58A 2LCSA 1VQNQ 3OYYA 4XAXB 4E2FB 4X9CA 2ED1A 3WXMB 2QYZA 2XMFA 1S1NA 5LJ3g 3INZA 1VYUA 5IN1A 3HFNA 1W2BS 3VRZA 1K9AA 1QP3A 2XDBA 3OYMA 3KXTA 3KUFA 1ZLMA 4M78A 4PJOE 4MZTA 5AT1B 4F7UG 4OVAA 3OS2A 1M1KR 2JMCA 2YLBA 5KCOA 1KC8C 2QA4T 1LPLA 4PFPA 3CBPA 4BE1A 2F69A 2RQVA 2X4JA 1ZHIA 5HK0A 4B9WA 1X01A 2GTOA 2QA4Q 1K0XA 1EX4A 4C8QE 3U23A 3LH0A 1RABB 4PJOD 1YBYA 3L1AA 5HK3A 3V8JA 2B8AA 4A4FA 1K8AR 1RUWA 2YT6A 4KGZB 1VIFA 3CC4A 2BE9B 1PD1A 3EHQA 2E65A 1UDLA 1S72T 5IT9E 4C8QD 1UGPB 1U06A 4F7UE 1ZX6A 4NL2A 3FRNA 2ZPIB 4PJOF 3CCRT 3EG0A 1S72Q 2CP2A 1V76A 3VS2A 4N4IA 4PJNA 1VQPA 4BACA 3QYHB 3CCRQ 2LQ8A 3CCQA 2KGTA 2HQEA 4GY5A 4LDWA 1VQKA 3QXEB 1O75A 1MHNA 1YITA 4D6WA 2DJZA 5LJ3j 1AHJB 4BE2A 5LJ3h 3QSUA 3CCST 2K3BA 5I21A 2OX7A 3X28B 2RJCA 2JS2A 3HTRA 3NTHA 1AWWA 5LJ5f 3CCSQ 4BI4A 4J9BA 1VQ7T 2DBMA 4FYWB 2NUTB 3VYGA 4Z8AA 4F7UF 2A0FB 4ZGEB 5CAIA 1T3SA 1VQ7Q 1U1TA 1Q7YR 2LP5A 1J3TA 3JCMX 2O9VA 5HKCA 2P4TA 1QW1A 1NEBA 1ZSZB 1WHKA 2CS7A 4J9FA 3QDFA 2W10A 1WLPB 1Z9ZA 1VQ8A 5DLQE 2V8KA 4XQ3A 4LUEA
chains in the Genus database with same CATH topology
3HRTA 5C6SA 3DLLA 2RJEA 4BY6C 1N6AA 1YIJA 4E7JA 4M75G 4BY6B 3CCSA 3CXCA 3ZBDA 2V8JA 3JRZA 3VUBA 3CCET 4ELYC 2CGHA 2RD1A 1W4SA 5DLOA 4XTWA 5J26A 3UT1A 3L2VA 4M7DE 1Q81U 3OYHA 3OQ5A 2MAMA 3A8MB 3TEEA 3CCLA 3A8HB 4DOWA 1KQ1A 3L2QA 4LD6A 1Y96A 3SB2A 5KCHA 1VQOT 3X24B 3C95A 3PGGA 4M77G 2EJFA 5D6XA 3VKIA 4NL3A 2QQRA 2DEQA 3META 1I4K1 1D3BB 1WJSA 2EQJA 2K3XA 2JNGA 3MP6A 3OMCA 4OP0A 3VU3C 5CKEA 3KBGA 4OGEA 2GF7A 3JSCA 2LT4A 3BDLA 3QKJA 2EQUA 1JJ2A 2EKOA 1Y71A 3CMET 4MDXA 3FJPA 4KUDK 2EYQA 4QVZA 5LJ5j 3SWNA 4A53A 1VQ4T 1QP2A 4O5VA 3WVEB 5LJ5h 3QO3A 3DB3A 3CC2T 3JCMg 3JCMd 1WPYA 2DAQA 4M7DD 2K5FA 4C92B 3J7AF 1M9SA 3T9NA 2MI6A 1BYMA 1UEBA 1U8RA 4RKUE 3C4SA 4KULA 1YJNA 2DO3A 4C0ZA 2VYTA 4E47A 4FT4A 2EFIA 4A54A 3AHUA 5LL6S 1YHQT 1TH7A 2JTMA 3JCMf 5GAMf 1YJ9A 3UWNA 4JLIA 2DKGA 2VUBA 5GAN8 3JB9I 3OYCA 3L2WA 3A8OB 4E7HA 1DJ7B 3URGA 1IZ6A 4M78C 1YCYA 3RKYA 5GMKh 3CC7T 5FRNA 1KC8U 4X9DA 4A4KA 4C0DB 2HNIA 4L59A 3OYEA 4M78B 4EMKC 2R57A 3I55T 3RMQA 1I5LA 2NLUA 3OY9A 2XDDA 5CK9A 3ASKA 3G71A 3J81E 4PJOA 2PQWA 5CO7A 3CMAA 3QZ5B 1LOJA 3RIRA 4XTYA 5L8RE 5CR2A 3GP8A 2LTOA 3P8DA 1VQ6T 2KAFA 2QQAA 4M7DF 4M77E 1I81A 4Y28E 4C8QF 4QVDA 2RI2A 2VXFA 1H641 2CYZB 2I2LA 3MEWA 3OYDA 3CCEA 3HL8A 3QBYA 4A4GA 1M90U 4J5YA 2PUKB 4MMKA 2XIDA 5I2MA 5LJ5g 4FT2A 2EWNA 1JRIA 1FWZA 3DB4A 3O8VA 2PVGB 2LCCA 2F5TX 2HAXA 1WQ7A 3UDCA 5LJ5e 5HY6A 3OS0A 4M7DA 4M78E 1VQOA 4C8QA 1PSFA 1Q82U 4J83A 1YJWA 4J7FA 3VV0A 3OBYA 3OW2S 1NJIU 2E6NA 5FU6C 2DZCA 1WNLA 1XNIA 4M77D 4Y91A 3S3MA 1KD1U 3QIIA 2PUOB 3OYKA 1OZ2A 3JCMV 3CXCS 1BI3A 5FU6B 3PTAA 1KG1A 4A4EA 4C5HA 4MMLA 3CBMA 3CC2A 2GFUA 2KQWA 4OGCA 2RB6A 3DLMA 3MO8A 2Y4XA 1QVGA 3J80E 5GMKe 2FYKA 1U1SA 3QHSA 3CCJT 1RL2A 2LT1A 3OBWA 2WSFE 3M4YA 4RMOA 2OAUA 1IREB 4EDUA 3P8BB 4M78D 2L8DA 3L2UA 2FHDA 4C5GA 5CQYA 2E5QA 2LVMA 1H3ZA 1VQ5T 1YHQA 3GOXA 4HCBA 3TCJA 3LLRA 3EFSA 3CCMT 2M16A 2RK1A 1Q81C 3JAME 4E7LA 4FU6A 3OS1A 2CKKA 4EPCA 5A0DA 4M75A 3MCAB 1G3TA 1PSEA 2K4YA 3PT9A 4PLIA 4TVRA 5DY9A 2RHZA 3CC7A 3OB9A 2WSCE 4M77F 1Y7XA 2QXFA 4JUVA 4LDXA 1WJRA 1O9SA 2V8IA 2FL7A 4XTVA 5FROA 4XTZA 2H3JA 4MDWA 4Z02A 4FIBA 4XU0A 2IVWA 3CCUT 4PJOB 2YHTA 2WACA 3M57A 1VQ6A 3MEVA 2Y90A 3SDZA 5FLXE 3HP9A 2LCLA 4JRQA 4KT0E 4Q5WA 3TREA 4MZMA 3JCMh 3OYGA 4JS4A 3PIOA 4M7AC 3LWIA 4J6WA 3OW2A 5CVIA 4BDZA 2BIVA 4M77A 3L2RA 3JCMJ 3M59A 3OYLA 4M7AB 2QI2A 3LW5E 3M54A 4DOVA 5CCAA 5GANf 3OYFA 3FEOA 4LDVA 5GAN7 3OSSC 2EIFA 4X34A 5I2SA 4N4GA 3S3OA 2EJ9A 2OTJT 3V7CA 1NZ9A 4E7KA 2ZPHB 3G4ST 5EG2A 1FXXA 2KVQG 4HCZA 5GAOl 2WSEE 1KQ2A 4OF1A 3NFCA 2R58A 4C0FA 4C92G 1B34B 5GAOn 3G6ET 1VQ7A 3V7RA 3M53A 2K5LA 2VGNA 1G3YA 5M9OA 3OMGA 4EMKA 4BDYA 3FLGA 3ZFJA 4XTXA 3SD4A 1VQ9T 2CZ0B 2DPPB 3RKWA 3I56T 2JOYA 2RK2A 2E41A 3JCMc 3JCMQ 2MMPA 3EAEA 2RO0A 2DIQA 2KDSA 3HRUA 5D6YA 4PJOE 3CCJA 3ZEHA 4IUVA 2DXUA 3CEYA 3M4GA 3S3NA 2GQVA 2KK4A 5GAOr 4C92C 3GIBA 2L5QA 3FB9A 3JB9D 4HT8A 3BFMA 1JB0E 2DXCA 2RI5A 4A4HA 5GAMd 5GAMg 1UGQB 4M78G 5A2QE 2ZPGB 4QVCA 3OYJA 5D6WA 4F7UB 4ME7A 1N8RC 1VQ5A 2GCXA 3CCMA 2JN0A 1N9RA 1Y07A 2XKOC 4J6YA 4JRKA 3JCMe 1HXDA 4PNOA 3G7ZA 3QJ6A 3E9GA 3NTKA 2P0KA 2DTIA 4GLKA 4J6XA 1Q82C 1NJIC 1M1KC 3GF5A 5GMKj 2P0QA 2X4WA 1W2BA 1QVGS 2YLCA 4C0DC 5GAN6 1V29B 2DXTA 3FC3A 3CCUA 4LD9K 3CCVA 1X75C 5FU7C 4L6V5 3LGFA 3BDUA 1KD1C 4OMFB 4UC4A 1VQLT 2QQ9A 2MWOA 2Y4YA 3QJYA 5FU7B 1Q7YU 4BE0A 3C94A 4C92E 4PL6A 3H8ZA 2A7YA 1WQWA 2E6ZA 4WF2A 3JB9F 1GXIE 4NOYA 1JJ2S 2K57A 2DXBA 3OYIA 2LQKA 3H6ZA 4ZTFA 2E12A 3QUIA 3OYBA 4NS5A 1I8FA 4EMGA 2OTJA 2L3RA 2ZPEB 4LDUA 3G4SA 1KHIA 2KMTA 3L2ZA 5CQXA 1XTDA 2F5KA 4HT9A 4OB1B 2MWPA 3ER0A 4MZPA 1K73U 4ZN3A 2LNVA 2HQXA 2VGMA 3OA6A 1K8AC 1ZBXA 3RMSA 2ZPFB 3PNWC 2M1HA 1Y96B 3R6OA 5GMKl 3FIFA 5DM7R 5GAN4 2E70A 3CPFA 2O4XA 1RI0A 4RG8A 4C92D 1VQ9A 5GANh 2RJDA 3TU4K 4OB3B 3I56A 4JDSA 3RERA 2R5MA 3X26B 3SWNC 3BW1A 3CMEA 2O01E 4ZTJA 4XU1A 1EIFA 4OB0B 4QW2A 5KH6A 3GPLA 3RESA 1Q86U 2PU9B 4V2SA 3OS5A 3S6WA 1K9MU 3SWNB 1VQ4A 4C0GA 1QVFA 4QQDA 3PIPA 5GAOm 4C5IA 5GMKi 3JB9G 3HHTB 2MF2A 1BI2A 4IUUA 3F70A 2EQMA 4DA4A 3CD6T 3Q1JA 2ZGWA 3QYGB 3DKMA 1OI1A 2RHUA 1YI2T 1UGSB 1JBMA 2RHYA 1OYXA 3N5BB 3RUXA 2RHIA 5AYFA 2QEXT 3MHXA 4E7IA 1VQNT 3JCMP 1XOVA 3VUZA 2X4XA 4C92F 4M7AG 1D3BA 2RM4A 5C0MA 2E10A 3CPWA 1SSFA 3V7SA 2CZ1B 2XG8D 4XQ3A 3I55A 1VQLA 4PJOC 2RHXA 1WGSA 4RCBA 2GFAA 2R5AA 3CC4T 1LNXA 3M58A 3OYYA 2L89A 4XAXB 5GANg 5GANd 3E9FA 2ZPBB 5GAMj 2VXEA 3LYIA 4X9CA 3WXMB 4C92A 3HSBA 4R55A 2LRQA 5GAMh 3JB9H 5GANe 3QPHA 2DZ9A 5LJ3d 4M78F 5LJ3g 3INZA 3JB9J 1YJNT 5IN1A 2QQBA 2KY9A 3HFNA 5GAN3 3LX7A 3EFRA 1W2BS 1M8VA 4J7IA 2FVUA 4M7DC 3A8LB 1QP3A 4C8QC 1VQMT 2XDBA 5CKDA 3OYMA 3KXTA 4M7DB 2CZ6B 2D9TA 2XDPA 4CRIA 2LC4A 3KUFA 5LJ3f 4C8QB 3A5ZB 4ZN1A 3VYHB 2EQKA 3QDRB 3E19A 4M78A 4MZTA 3SFMA 2VC8A 4OVAA 4F7UG 3OS2A 1VQPT 2YLBA 1M5Q1 5GAN2 3HPWA 5KCOA 5J39A 3CCQT 2PVDB 1KC8C 4ZGJB 2DD4A 3G71T 2CZ7B 4OB2B 3CMAT 2QA4T 4XK8E 2VV5A 1Q7YC 1VQKT 3MP8A 3GNFB 4M7AE 3CBPA 2JVVA 4ELZC 4BE1A 1YITT 2F69A 1KQSA 3L42A 2X4JA 1M1FA 1ZHIA 3MEAA 5HK0A 4B9WA 4IUQA 1X01A 4IUPA 4RCCA 3CD6A 5GMKm 5CKHA 3CBOA 2DTHA 4ZGDB 1YI2A 4II1A 3X25B 4FSXA 4C8QE 1M90C 3X20B 3LH0A 4PJOD 2QEXA 1YBYA 4M75C 2QDYB 1VQNA 3M5AA 1OZ3A 4N0AC 4VUBA 1N9SA 1VUBA 3L1AA 2B8AA 1P92A 3V8JA 5GAMe 5HK3A 4A4FA 1K73C 2C06A 1YJWT 3QZ9B 4M75B 2OTLT 2AHJB 3E1SA 2XHCA 2FB7A 1UGRB 4FL6A 5A0GA 4IKFA 1BI0A 1QVFS 2BKDN 4M7AD 1G3SA 1VIFA 1G3WA 3CC4A 4BI3A 2XK0A 3GLXA 5CKBA 1ZQ1A 3QG1A 2K5IA 3LWHA 2IG0A 2E65A 2EAYA 1Q86C 3FDRA 1S72T 1K9MC 4JRIA 4M77C 4C8QD 5IT9E 2QTXA 1UGPB 4F7UE 2D0QB 2A3LA 1BKBA 3OSVA 4JJNK 1FX7A 4NL2A 2K3YA 4O6JA 1M1GA 2ZPIB 3FRNA 4M77B 4PLLA 3VJPA 3OYAA 4IURA 2X4YA 4M75E 4PJOF 3CPWS 4XTUA 3CCRT 1VQMA 3MEUA 2EJGA 4FM4B 2D6FA 1G5VA 4N4IA 4HCCA 1BIBA 1R8OB 1XQHA 4HA8A 3OYNA 1NPRA 3V8LA 5IAYA 1LJOA 4BACA 1VQPA 4M7AF 4L5GA 3QYHB 3G6EA 2LQ8A 3JCMb 3CCQA 5GANj 2HQEA 1VQ8T 4GY5A 3HRSA 4EMKB 2QA4A 4LDWA 3M56A 4JS5A 3UPUA 4CI0C 1VQKA 3QXEB 2E64A 1MGQA 1O75A 1MHNA 2G3RA 4BUGA 2LDMA 4RG2A 4XU2A 1YITA 1NE8A 2HD0A 4YTLA 3WVDB 2DJZA 4D6WA 4M75D 5LJ3j 1AHJB 1NPPA 3V8KA 4BE2A 1YIJT 1UB4A 1N8RU 4C5EA 4ATOA 5LJ5d 4M7AA 5LJ3h 3QSUA 5KE2A 3RKXA 4JRPA 3CCST 2PVOB 5I21A 3ME9A 4JLGA 2JUFA 3X28B 1N27A 2RJCA 3C12A 2RA2A 4KUIA 2XD0A 2ZZDA 4PKCC 1X6OA 2DK3A 2HBPA 2LX9A 4PJOG 1HK9A 3PFSA 3JCMW 3NTHA 4N4HA 1M1KU 4BD3A 5LJ5f 2DTOA 1WJQA 2OTLA 2KSSA 2E1HA 1B34A 5CIUA 3CCLT 4BI4A 1KHCA 2M9UA 1VQ7T 4P5NA 1QVPA 3VYGA 3PMIA 1KQSS 2BUDA 4J8OA 4F7UF 5J3BA 4R56A 4ZGEB 3LGLA 5CAIA 2JTFA 4EMHA 2JZ2A 4DQ2A 4KBMB 1S72A 2K2VA 4IUTA 4M75F 1U1TA 2DVEA 2P0PA 4QQGA 4M7DG 5GAOp 4XU3A 2QQSA 4C8QG 2ZCFB 2XI9A 2XICA 5GAN5 2X35A 2DD5A 3JCMX 4F7UA 5HKCA 5GAOq 2P4TA 3CCRA 5CKFA 3M55A 2RH2A 1QW1A 3GNGA 2DIGA 1BI1A 1M4ZA 2RJFA 3BY7A 5A0LA 1K8AU 4N0AA 5KE3A 1VIEA 3HFOA 3PMTA 3P8HA 3MP1A 4BB7A 5LJ3e 2CS7A 4QQ6A 2M0OA 1YJ9T 4BI8B 5FRMA 3A8GB 3HKSA 1BIAA 1VQ8A 4LDYA 3M9QA 2YRVA 4B9XA 4HKEA 2V8KA 3NTIA 5DLQE 3CCVT 2O4XB 2RI3A 2XU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C6S A;  2L3R A;  2RJE A;  4FL6 A;  2F5K A;  4EDU A;  3L2U A;  4IKF A;  2MWP A;  2BKD N;  2L8D A;  2FHD A;  4C5G A;  2E5Q A;  2HQX A;  2LVM A;  3OA6 A;  1H3Z A;  2XK0 A;  3GOX A;  3PNW C;  2M1H A;  3LLR A;  2M16 A;  4E7L A;  2IG0 A;  1RI0 A;  2O4X A;  4FU6 A;  3FDR A;  2CKK A;  3OS1 A;  4PLI A;  2RJD A;  2RHZ A;  5J26 A;  3UT1 A;  2R5M A;  3OB9 A;  3L2V A;  4ZTJ A;  3OYH A;  2K3Y A;  5KH6 A;  3OQ5 A;  4PLL A;  4QW2 A;  3OYA A;  4IUR A;  1WJR A;  3S6W A;  5KE3 A;  5FRO A;  2X4Y A;  4LD6 A;  4QQD A;  3L2Q A;  4Z02 A;  5KCH A;  3MEU A;  4C5I A;  2WAC A;  5D6X A;  3MEV A;  2QQR A;  3MET A;  1G5V A;  2EQJ A;  4IUU A;  1WJS A;  2K3X A;  3F70 A;  2EQM A;  3MP6 A;  3OMC A;  4N4I A;  4Q5W A;  3OYN A;  3OYG A;  3Q1J A;  2GF7 A;  3BDL A;  3QKJ A;  2EQU A;  5IAY A;  1OI1 A;  2BIV A;  2EKO A;  2RHU A;  3L2R A;  4BAC A;  4BDZ A;  4QVZ A;  2RHY A;  3OYL A;  3OYF A;  1OYX A;  3FEO A;  4E7I A;  2HQE A;  2RHI A;  4GY5 A;  3DB3 A;  4X34 A;  4N4G A;  3S3O A;  2DAQ A;  2X4X A;  5C0M A;  2G3R A;  1MHN A;  1SSF A;  4E7K A;  2LDM A;  4RG2 A;  4HCZ A;  3C4S A;  2RHX A;  1WGS A;  4BE2 A;  2VYT A;  2GFA A;  2R58 A;  2EFI A;  2R5A A;  4C5E A;  5KE2 A;  2L89 A;  3E9F A;  5M9O A;  3ME9 A;  3OMG A;  3UWN A;  4BDY A;  3LYI A;  1N27 A;  2RJC A;  3OYC A;  3FLG A;  3L2W A;  4E7H A;  3SD4 A;  2LRQ A;  3PFS A;  3EAE A;  2RO0 A;  2DIQ A;  5FRN A;  3NTH A;  4L59 A;  4N4H A;  5D6Y A;  4BD3 A;  3OYE A;  2R57 A;  1WJQ A;  5IN1 A;  3ZEH A;  4IUV A;  3CEY A;  5CIU A;  3S3N A;  3LX7 A;  1KHC A;  2NLU A;  3OY9 A;  3ASK A;  2PQW A;  3PMI A;  2RI5 A;  4A4H A;  4E7J A;  2BUD A;  3OYJ A;  2LTO A;  3P8D A;  5D6W A;  3OYM A;  3LGL A;  2D9T A;  2RI2 A;  2JTF A;  2XDP A;  3KUF A;  3MEW A;  4CRI A;  3OYD A;  2JZ2 A;  2EQK A;  4IUT A;  3OS2 A;  3QBY A;  4OVA A;  3QJ6 A;  4A4G A;  3E9G A;  3NTK A;  4QQG A;  2P0K A;  5J39 A;  2QQS A;  5KCO A;  3O8V A;  3DB4 A;  2X35 A;  2LCC A;  2X4W A;  3OS0 A;  3FC3 A;  3MP8 A;  4BE1 A;  3LGF A;  3L42 A;  3MEA A;  2DIG A;  4UC4 A;  2RJF A;  3OYB A;  4B9W A;  4IUQ A;  2MWO A;  2E6N A;  4IUP A;  4BE0 A;  1XNI A;  3PMT A;  3H8Z A;  3P8H A;  4PL6 A;  3S3M A;  3MP1 A;  3QII A;  4QQ6 A;  2M0O A;  1OZ2 A;  4II1 A;  4A4F A;  3OYK A;  5FRM A;  4A4E A;  4C5H A;  3LH0 A;  3OYI A;  1OZ3 A;  3M9Q A;  2GFU A;  2YRV A;  3H6Z A;  3NTI A;  2B8A A;  3DLM A;  3MO8 A;  4B9X A;  2O4X B;  2RI3 A;  4NS5 A;  4ZTF A; 
#chains in the Genus database with same CATH topology
 3HRT A;  5C6S A;  2QAS A;  3DLL A;  1H3H A;  2JXB A;  1RAF B;  1W1F A;  2QDL A;  1PHT A;  4BY6 B;  1K9M R;  1M2V A;  3ZBD A;  2YRD A;  4XTW A;  5J26 A;  3UT1 A;  5KYY A;  2FG0 A;  3TEE A;  1R0B G;  1KQ1 A;  4LD6 A;  1VQO T;  3C95 A;  1UEC A;  2O31 A;  3VKI A;  3A1P A;  4NL3 A;  3EH1 A;  3TSZ A;  1WJS A;  1PWT A;  1SPK A;  2NYS A;  3JSC A;  1MV3 A;  2EYQ A;  4R0K A;  3RBB B;  1VQO Q;  3QO3 A;  3JCM d;  1RLP C;  1U8R A;  3C4S A;  4AG1 C;  2OJ2 A;  5LL6 S;  1TSF A;  2VUB A;  5GAN 8;  3L2W A;  4E7H A;  1YCY A;  3UF4 A;  5GMK h;  1M3B A;  4C0D B;  2HNI A;  1I5L A;  2C0T A;  2NLU A;  3G71 A;  3J81 E;  2PQW A;  3CMA A;  3QZ5 B;  3GP8 A;  4XTY A;  2KAF A;  2J6O A;  2RI2 A;  2A37 A;  1H64 1;  3CCE A;  4J9H A;  1CSK A;  5FW9 A;  2LX7 A;  3VS0 A;  2D8H A;  4FT2 A;  2PVG B;  2LCC A;  2HAX A;  1WQ7 A;  1OQK A;  4DBF A;  1BBZ A;  2HBW A;  4Z88 A;  1BCM A;  4J83 A;  4J7F A;  3VV0 A;  3OBY A;  1G2B A;  2FZC B;  2DX1 A;  2RNA A;  3QII A;  2PUO B;  1Z9Q A;  3OYK A;  1KG1 A;  4A4E A;  2GFU A;  1QVG A;  3MO8 A;  1U1S A;  2HDA A;  4RMO A;  2OAU A;  3P8B B;  2L8D A;  4C5G A;  1TTH B;  4RTT A;  4LXC A;  2EVR A;  2CKK A;  2H8H A;  2K4Y A;  1MMD A;  2NWM A;  2RHZ A;  2ATC B;  2QXF A;  2FL7 A;  2COZ A;  4XTZ A;  4MDW A;  4PJO B;  1VQ6 A;  3MEV A;  1VA7 A;  3SDZ A;  3HP9 A;  4Q5W A;  3PIO A;  4M7A C;  1KK7 A;  1QVG P;  2BIV A;  2M0Y A;  3JCM J;  2CT3 A;  3VS1 A;  4X34 A;  3UA6 A;  4X1V A;  1AVZ C;  1FXX A;  2YXY A;  2WSE E;  2COY A;  4C92 G;  4C0F A;  5GAO n;  4AFU C;  1I1J A;  4BDY A;  3ZFJ A;  2ECZ A;  2ENM A;  3RKW A;  2RO0 A;  2KDS A;  3CCJ A;  2YUP A;  5IHN A;  2DXU A;  2KK4 A;  5GAO r;  2L5Q A;  3FB9 A;  3JB9 D;  2ZPG B;  4QVC A;  1VQ5 A;  4F7U B;  1G8X A;  3EGX A;  2F2X A;  4J6Y A;  3JCM e;  1YP5 A;  4ANJ A;  4PNO A;  4GLK A;  2NUT A;  1M1K C;  2HEQ A;  1QVG S;  4C0D C;  1WXB A;  1V29 B;  4LD9 K;  3BDU A;  4OMF B;  2Y4Y A;  5FU7 B;  1Q7Y U;  4BE0 A;  4C92 E;  4PL6 A;  1W6X A;  2HSE B;  3JB9 F;  2DF6 A;  2E12 A;  3QUI A;  2JT4 A;  4EMG A;  2L3R A;  3G4S A;  1KHI A;  3L2Z A;  1TOV A;  1ZSZ A;  5CQX A;  4OB1 B;  4MZP A;  1WFW A;  3ER0 A;  2LNV A;  1K8A C;  2L0A A;  2YUO A;  2BE7 D;  2M1H A;  1Y96 B;  2AZV A;  4RG8 A;  4C92 D;  5GAN h;  1IHW A;  4JDS A;  3RER A;  2R5M A;  2CH4 A;  2HL5 C;  2O01 E;  4XU1 A;  3CME A;  5KH6 A;  3S6W A;  1NG2 A;  1K9M U;  3SWN B;  1C0M A;  4C0G A;  2AIR B;  1N5Z A;  5FWC A;  5GMK i;  2DLP A;  2CP5 A;  4JJD A;  2MF2 A;  4LE9 A;  3F70 A;  2VKN A;  2DE0 X;  2LQN A;  2QK0 A;  1TUG B;  2KBT A;  2E3I A;  2ROL A;  3JCM P;  4C92 F;  4M7A G;  3CPW A;  1XJW B;  1WA7 A;  1VQL A;  4PJO C;  1WGS A;  1M3C A;  2R5A A;  3E9F A;  1JXM A;  2VXE A;  2VB6 A;  2LRQ A;  3JB9 H;  5LJ3 d;  4OMN A;  1YJN T;  2KY9 A;  3LX7 A;  2FVU A;  2YDL A;  2LZ6 B;  3A8L B;  4C8Q C;  4CC2 A;  2CZ6 B;  4CRI A;  3KFV A;  3VYH B;  1Q82 R;  3SFM A;  4V2S A;  3CPW P;  1VYV A;  5KYN A;  1I07 A;  4ZGJ B;  1AD5 A;  2DD4 A;  1AT1 B;  3VS4 A;  2CZ7 B;  2HL3 A;  4OB2 B;  4XK8 E;  2VV5 A;  1Q7Y C;  2DVJ A;  3MP8 A;  4M7A E;  2JVV A;  4ELZ C;  1M1F A;  3G6E Q;  2DER A;  4IUQ A;  4IUP A;  4Z89 A;  3CD6 A;  5GMK m;  5CKH A;  4FSS A;  1F1B B;  4EIK A;  2DA9 A;  4II1 A;  1TUD A;  5HCK A;  4PJL A;  2QDY B;  1VQN A;  1OZ3 A;  2C06 A;  1YJW T;  3H41 A;  2OTL T;  2AHJ B;  3E1S A;  2FB7 A;  4FL6 A;  2HQH A;  2BKD N;  4M7A D;  4BI3 A;  2HMA A;  5CKB A;  1ZQ1 A;  1LVK A;  1MMN A;  1YJW Q;  2OTL Q;  1WX6 A;  1K9M C;  4M77 C;  3MKD A;  1RAI B;  2QTX A;  2A3L A;  3OSV A;  1FX7 A;  3RR6 A;  3VS5 A;  1M1G A;  1HSQ A;  4M75 E;  3CPW S;  2EJG A;  2D6F A;  4D8D A;  2O2O A;  4GLM A;  1ARK A;  1X27 A;  2X3X D;  1NPR A;  3V8L A;  1LJO A;  4M7A F;  1OOT A;  4EMK B;  2QA4 A;  3UPU A;  4CI0 C;  6AT1 B;  1UJ0 A;  3I5R A;  4BUG A;  1NE8 A;  1MUZ A;  1UG1 A;  4OMM A;  4ZNX A;  4M75 D;  1NPP A;  2JMA A;  1N8R U;  2CP3 A;  4C5E A;  4HVU A;  3ME9 A;  2JUF A;  1N27 A;  2RA2 A;  1BB9 A;  1BK2 A;  2XD0 A;  4F16 A;  1X6O A;  4PJO G;  3JCM W;  4N4H A;  2DTO A;  2E1H A;  1QKX A;  1IO6 A;  4OML A;  3NMZ C;  3PMI A;  4J8O A;  5J3B A;  2CH4 W;  2JTF A;  1S72 A;  5KYX B;  2K2V A;  4M75 F;  2KT8 A;  1FMV A;  1IGQ A;  4QQG A;  5GAO p;  2V1Q A;  2QQS A;  4C8Q G;  2ZCF B;  2XIC A;  2X35 A;  2O9S A;  4GBQ A;  4F7U A;  5GAO q;  3CCR A;  2V1R A;  4PK4 A;  1RAG B;  1C6V X;  2RH2 A;  2QGF B;  5A0L A;  1IRX A;  4PJM A;  3PMT A;  5LJ3 e;  4QQ6 A;  2M0O A;  1YJ9 T;  2K7A A;  1K73 R;  2SRC A;  1FYN A;  1M30 A;  3M9Q A;  4B9X A;  3CCV T;  4HKE A;  2RI3 A;  2XU8 A;  1RAA B;  2RJE A;  4QT7 A;  1YJ9 Q;  1N6A A;  1Q86 R;  2NUP B;  3CCS A;  2KRN A;  2B86 A;  2CGH A;  3SHW A;  1WXU A;  1H92 A;  3OYH A;  3A8M B;  1Y96 A;  5KCH A;  3X24 B;  4RTY A;  3PGG A;  4M77 G;  2EJF A;  2QQR A;  2EQJ A;  1D3B B;  1GCQ A;  3EG2 A;  3VU3 C;  5CKE A;  1EFN A;  2GF7 A;  3QKJ A;  4KUD K;  5LJ5 j;  2MK5 A;  3PVL A;  4RTX A;  3SWN A;  1VQ4 T;  3WVE B;  4LN2 A;  5LJ5 h;  3JV3 A;  2DAQ A;  2K5F A;  2EGE A;  4C92 B;  2RF0 A;  5D7U A;  4A54 A;  1VQ4 Q;  1TH7 A;  2JTM A;  1D0X A;  4JLI A;  3OYC A;  1PRL C;  2BTT A;  1IZ6 A;  3EG3 A;  2KYB A;  2KYM A;  3I5S A;  4KH1 B;  5FRN A;  4EMK C;  2R57 A;  3I55 T;  3RMQ A;  1GFC A;  3ASK A;  3RIR A;  4M77 E;  1I81 A;  4C8Q F;  2VXF A;  2CYZ B;  3OYD A;  3I55 Q;  1WI7 A;  1JEG A;  1M90 U;  4J5Y A;  5I2M A;  2EWN A;  4K11 A;  2F5T X;  3UDC A;  4M78 E;  1VQO A;  2YSQ A;  2A28 A;  1Q82 U;  3OW2 S;  2DZC A;  1XNI A;  1OU9 A;  2LJ3 A;  4M77 D;  4Y91 A;  1OZ2 A;  3JCM V;  1BI3 A;  1ZUY A;  2MIO A;  2FEI A;  2L3S A;  2KQW A;  4OGC A;  2RB6 A;  3DLM A;  5GMK e;  2MOX A;  2FYK A;  1FMK A;  3OBW A;  4PJJ A;  4EDU A;  3L2U A;  4M78 D;  2FRY A;  2GNC A;  5CQY A;  2E5Q A;  1H3Z A;  3GOX A;  1M27 C;  2F2V A;  3CCM T;  2JM9 A;  1QWF A;  3JAM E;  4FU6 A;  5DY9 A;  2CDT A;  1PSE A;  3PT9 A;  4TVR A;  5IXF A;  3OB9 A;  4M77 F;  1M8M A;  4JUV A;  3CCM Q;  4LDX A;  1WJR A;  2E4H A;  4LNP A;  2H3J A;  4Z02 A;  2IVW A;  3M57 A;  2WAC A;  2CT4 A;  4JRQ A;  3TRE A;  4JS4 A;  1UGV A;  3OYG A;  3LWI A;  4J6W A;  4BDZ A;  2AZS A;  3M59 A;  3OYL A;  4M7A B;  3M54 A;  2HCK A;  3FEO A;  4LDV A;  1CKA A;  2LJ1 A;  2ESW A;  4DBQ A;  3V7C A;  1ZUU A;  4E7K A;  5EG2 A;  2KVQ G;  2GTJ A;  1KQ2 A;  3SEM A;  3EHR A;  1I0C A;  3V7R A;  2VGN A;  2J05 A;  4EMK A;  2MPX C;  3I56 T;  2MMP A;  2DIQ A;  5D6Y A;  5FWB A;  3CEY A;  3EGU A;  3M4G A;  4C92 C;  8ATC B;  3BFM A;  1JB0 E;  2KT1 A;  1B7T A;  2OI3 A;  5GAM g;  3I56 Q;  4ME7 A;  1NM7 A;  1AZE A;  2GCX A;  2C0I A;  2KEA A;  3EG9 B;  1Y07 A;  2KRM A;  1GCP A;  1HXD A;  1D0Z A;  1QLY A;  4OMP A;  2DL4 A;  2DTI A;  1Q82 C;  3GF5 A;  1RAH B;  5GMK j;  2X4W A;  4AFQ C;  2YLC A;  2DXT A;  3FC3 A;  5KYX A;  2RQT A;  3QJY A;  1T3L A;  1GXI E;  1WQW A;  4NOY A;  2L3Q A;  2K57 A;  4OMQ A;  2DXB A;  3OYI A;  2LQK A;  4ZTF A;  2DJQ A;  2ZPE B;  4LDU A;  1YN8 A;  4HT9 A;  1K73 U;  1R0C B;  1Q81 R;  2JTE A;  2CSQ A;  3R6O A;  2MYS A;  1UE9 A;  4OB3 B;  4FYX B;  3X26 B;  2LNH B;  3BW1 A;  1EIF A;  2HKQ B;  4QW2 A;  3GPL A;  1Q86 U;  3OS5 A;  2AT1 B;  1QVF A;  3D7S B;  7AT1 B;  4C5I A;  3JB9 G;  1BI2 A;  4KH0 B;  1SKU B;  4DA4 A;  2D1X A;  2F2W A;  3DKM A;  1YI2 T;  1UGS B;  1JBM A;  2LQW A;  3N5B B;  4AT1 B;  5AYF A;  2QEX T;  1SHG A;  1K1Z A;  3VUZ A;  2VVK A;  4J9E A;  4J9C A;  1D3B A;  5IH2 A;  1Q95 G;  2RM4 A;  2E10 A;  1YI2 Q;  2XG8 D;  2P84 A;  2RHX A;  2QEX Q;  1LNX A;  5GAN g;  2ZPB B;  5GAM j;  4C92 A;  5GAM h;  1EZZ B;  1IHV A;  1QVF P;  5GAN e;  3QPH A;  2DZ9 A;  1N8R R;  1AWJ A;  5GAN 3;  4JJC A;  4J7I A;  4M7D C;  1VQM T;  1SG5 A;  8AT1 B;  2OAW A;  2LC4 A;  4C8Q B;  4ZN1 A;  3PVQ A;  3QDR B;  3E19 A;  1K76 A;  2VC8 A;  1M5Q 1;  5L23 A;  3HPW A;  1VQM Q;  1OX9 A;  1QCF A;  2DFU A;  3G71 T;  1KD1 R;  3CMA T;  1X2Q A;  1WDX A;  1SF9 A;  2EKH A;  3GNF B;  1KQS A;  4AG2 C;  3MEA A;  4A63 B;  4RCC A;  3IQL A;  2RQU A;  3CMA Q;  1B07 A;  4DEX A;  1W70 A;  1TS9 A;  1YNZ A;  4M75 C;  1QMC A;  1T0J A;  2EGA A;  4VUB A;  1N9S A;  1K73 C;  1P92 A;  3QZ9 B;  2XHC A;  1UGR B;  5A0G A;  2AKL A;  1BI0 A;  1PD0 A;  1QVF S;  1G3W A;  4FYY B;  5IHI A;  1ABO A;  2EGC A;  2ROT A;  3GLX A;  1TUC A;  3QG1 A;  4OMO A;  3LWH A;  1Q86 C;  2EAY A;  3FDR A;  1M3A A;  1JO8 A;  1PNJ A;  2DET A;  1BKB A;  4JJN K;  1KQS P;  1ZA2 B;  2KXD A;  4O6J A;  2RMO A;  4M77 B;  3OYA A;  4IUR A;  1B3Q A;  2DIL A;  1K4U S;  4XTU A;  4FM4 B;  2KRO A;  1G5V A;  4HCC A;  2MCN A;  1WHG A;  1R8O B;  1XQH A;  4HA8 A;  4J9D A;  1YFN A;  4L5G A;  3VRY A;  3G6E A;  3JCM b;  5GAN j;  3M56 A;  3O5Z A;  1MGQ A;  1MND A;  2DYB A;  2G3R A;  2CP0 A;  4XU2 A;  4RG2 A;  3QWY A;  2HD0 A;  4YTL A;  1IXD A;  1KFZ A;  1C1A A;  2DNU A;  3V8K A;  1YIJ T;  4M7A A;  5LJ5 d;  3TSW A;  4JRP A;  2PVO B;  3CQT A;  1E6H A;  5KYW B;  2DYI A;  4KUI A;  1PRM C;  2HSP A;  2HBP A;  1YIJ Q;  4PFZ A;  2O88 A;  1QCO A;  1WJQ A;  2OTL A;  2KSS A;  3CCL T;  1KHC A;  1PKS A;  2M9U A;  1KQS S;  2BUD A;  1NBE B;  4R56 A;  2DM1 A;  2NUZ A;  2J6F A;  3CCL Q;  4DBH A;  2DVE A;  4M7D G;  5GAN 5;  2DD5 A;  1HJD A;  3EG9 A;  5CKF A;  3M55 A;  4RUG A;  2DIG A;  1BI1 A;  2GGR A;  3M0T A;  1M90 R;  2FZK B;  3HFO A;  1QKW A;  3MP1 A;  2D8J A;  3A8G B;  3HKS A;  1BIA A;  4HVW A;  1MMA A;  1YJN Q;  3NTI A;  1OV3 A;  4F17 A;  4RTU A;  1GFD A;  4M75 G;  1V1C A;  1WHJ A;  1FMW A;  3CXC A;  4ELY C;  1W4S A;  2ZAE A;  3L2V A;  4M7D E;  1Q81 U;  3OQ5 A;  1A0N B;  4RTW A;  1U3O A;  2QAZ A;  5D6X A;  2DEQ A;  3MET A;  3MP6 A;  2JNG A;  4QKU A;  2LT4 A;  3VS3 A;  1JJ2 A;  2EQU A;  4MDX A;  2EKO A;  1Y71 A;  2FO0 A;  2X3W D;  3FJP A;  3CME T;  1Y0M A;  2EYY A;  4A53 A;  1QP2 A;  3CC2 T;  1OEB A;  2BZY A;  4M7D D;  3T9N A;  3CXC P;  4RKU E;  4KUL A;  4C0Z A;  3R6N A;  1KJW A;  4E47 A;  4FT4 A;  3CC2 Q;  4FW1 A;  1YHQ T;  3JCM f;  1YJ9 A;  3UWN A;  2DKG A;  3A8O B;  3URG A;  1TU0 B;  4M78 C;  1GBR A;  3RKY A;  2ABL A;  3CC7 T;  1KC8 U;  4X9D A;  4A4K A;  3OYE A;  1YHQ Q;  2J6K A;  2XDD A;  4PJO A;  1JJ2 P;  4D8K A;  1LOJ A;  1R77 A;  3P8D A;  3H0F A;  2QQA A;  4M7D F;  1TWB A;  3CC7 Q;  1QQJ A;  3M0U A;  4LUD A;  1ZUK A;  1WIE A;  1M2O A;  3M0P A;  3QBY A;  2PUK B;  5LJ5 g;  2M02 A;  1OPL A;  1FWZ A;  3DB4 A;  5LJ5 e;  1X6G A;  2K2M A;  4C8Q A;  3EGD B;  2GBQ A;  2E6N A;  5FU6 C;  1WNL A;  5GJW B;  3H0I A;  2AK5 A;  1KD1 U;  2P4R A;  3CXC S;  3PTA A;  1UHF A;  1NLP C;  2VAS A;  1MMG A;  3J80 E;  1RL2 A;  2WSF E;  3MPU B;  2RQW A;  4HCB A;  4B6M A;  1AWX A;  3LH5 A;  2RPN A;  2M16 A;  2RK1 A;  1Q81 C;  1WHL A;  2CP7 A;  5A0D A;  5I22 A;  3M0Q A;  1JJ2 S;  1BYM A;  2KRS A;  2WSC E;  3EFO B;  1Y7X A;  5KE3 A;  5FRO A;  4FIB A;  3CCU T;  2L2P A;  2Y90 A;  5FLX E;  1MNE A;  3EH2 A;  3OW2 A;  3L2R A;  4M77 A;  3CCU Q;  3CCV Q;  5CCA A;  5GAN 7;  3OSS C;  2EIF A;  5I2S A;  3S3O A;  2EJ9 A;  2OTJ T;  1IGU A;  1NZ9 A;  2ZPH B;  5GAO l;  2W0Z A;  4JZ3 A;  2EQI A;  3NFC A;  1VQ7 A;  1B34 B;  1E6G A;  3M53 A;  1G3Y A;  1RAE B;  2OTJ Q;  1VQ9 T;  2J7I A;  2K6D A;  2CZ0 B;  2DPP B;  2JOY A;  2E41 A;  3EAE A;  3UA7 A;  2RQR A;  4IUV A;  2COW A;  3ZEH A;  3S3N A;  2HZY A;  4FW2 A;  2I0N A;  4HT8 A;  3OW2 P;  2DXC A;  1VQ9 Q;  2JS0 A;  4A4H A;  5KYW A;  5GAM d;  1JU5 C;  1UGQ B;  4M78 G;  5A2Q E;  2HKN A;  3OYJ A;  4E7J A;  1N8R C;  2IIM A;  2G6F X;  3CCM A;  4FYV B;  2JN0 A;  2XKO C;  4JRK A;  4AMC A;  2KR3 A;  2DL5 A;  3E9G A;  2P0K A;  3G1J A;  4J6X A;  2YWW A;  1KD1 C;  3LGF A;  3GBQ A;  3NHN A;  2QQ9 A;  2MWO A;  2CRE A;  2X9H A;  3C94 A;  3M0R A;  2QGG A;  2SEM A;  2E6Z A;  4WF2 A;  1KIK A;  2JM8 A;  1I8F A;  1RI9 A;  1YWO A;  1WYX A;  2VGM A;  3OA6 A;  1ZBX A;  3RMS A;  2ZPF B;  3PNW C;  5IHK A;  5GAN 4;  1X69 A;  1RI0 A;  4WTO B;  2KXC A;  3TU4 K;  3I56 A;  2KI7 A;  3PE0 A;  1IB8 A;  2DL3 A;  1ZBJ A;  4QQD A;  3AT1 B;  2YUQ A;  2Z0W A;  2JJ9 A;  2J06 A;  2EQM A;  3EGX B;  3Q1J A;  2ZGW A;  3QYG B;  1OI1 A;  2CP6 A;  2RHY A;  3FJ5 A;  3RUX A;  3MHX A;  1XOV A;  2X4X A;  1NYG A;  4E6R A;  2V26 A;  2CZ1 B;  2EYW A;  2L3P A;  3TVT A;  3A98 A;  4ORZ A;  2GFA A;  3CC4 T;  2L89 A;  5GAN d;  4JZ4 A;  1UFF A;  3LYI A;  4KGV B;  3HSB A;  4R55 A;  1PKT A;  4M78 F;  3CC4 Q;  3THK A;  3JB9 J;  3RNJ A;  2QQB A;  1I5O B;  1M8V A;  3EFR A;  4AFS C;  1H8K A;  1ACM B;  5CKD A;  1ZSG A;  3REB B;  9ATC B;  4M7D B;  2D9T A;  2XDP A;  5LJ3 f;  1JXO A;  3A5Z B;  2EQK A;  1NJI R;  2KNB B;  3I9Q A;  1VQP T;  3MJX A;  5GAN 2;  5J39 A;  3CCQ T;  1K0S A;  2PVD B;  4IIM A;  2AKK A;  1VQK T;  1SRL A;  1YIT T;  1VQP Q;  3L42 A;  4RTZ A;  1CKB A;  4M4Z A;  3CCQ Q;  2EBP A;  3CBO A;  2DTH A;  4ZGD B;  1YI2 A;  3X25 B;  4FSX A;  1VQK Q;  1M90 C;  3X20 B;  1YIT Q;  1WHH A;  2QEX A;  3EGD A;  3M5A A;  4N0A C;  1VUB A;  5GAM e;  1HD3 A;  4M75 B;  3H0H A;  4IKF A;  2CUD A;  1G3S A;  2XK0 A;  1E7O A;  2K5I A;  1QCN A;  2IG0 A;  2EW3 A;  4JRI A;  2D0Q B;  2JW4 A;  2K3Y A;  4PLL A;  2RN8 A;  3VJP A;  2X4Y A;  2PZ1 A;  1VQM A;  3MEU A;  1BIB A;  3OYN A;  3EFO A;  2DMO A;  4DBR A;  1VOM A;  5IAY A;  2QTV A;  1OX8 A;  1VQ8 T;  3HRS A;  5KYU B;  4JS5 A;  2E64 A;  2FPD A;  2LDM A;  3H9N A;  4E7Z A;  3WVD B;  4WCI A;  2NUP A;  1UB4 A;  4KGX B;  1VQ8 Q;  4ATO A;  1GRI A;  5KE2 A;  3RKX A;  1D1A A;  4JLG A;  3C12 A;  3TQ7 P;  2ZZD A;  4PKC C;  2DRK A;  2DK3 A;  2LX9 A;  1HK9 A;  3PFS A;  3VS7 A;  1WXT A;  2EPD A;  1M1K U;  4BD3 A;  1B34 A;  5CIU A;  1BCO A;  4P5N A;  3RDV A;  1QVP A;  3LGL A;  1RLQ C;  4EMH A;  1TXQ A;  2JZ2 A;  4DQ2 A;  4KBM B;  1KC8 R;  2X51 A;  4IUT A;  1QWE A;  2P0P A;  4XU3 A;  1AWO A;  2XI9 A;  1UUE A;  1YCS B;  2BZ8 A;  1ZSZ C;  3GNG A;  3BY7 A;  1M4Z A;  2RJF A;  1K8A U;  2CSI A;  4N0A A;  1VIE A;  4J9I A;  1SSH A;  3P8H A;  4BB7 A;  4BI8 B;  5FRM A;  1RAC B;  1D0Y A;  1PC0 A;  4LDY A;  2YRV A;  2O4X B;  1RAD B;  4F04 B;  1AOJ A;  4BY6 C;  2QG9 B;  1YIJ A;  1GL5 A;  1TG0 A;  2V8J A;  3JRZ A;  3VUB A;  3CCE T;  1LCK A;  2RD1 A;  3NGP A;  2C0O A;  4JPB W;  5DLO A;  3G71 Q;  1PG5 B;  1WZO A;  2MAM A;  3CCL A;  3A8H B;  4DOW A;  3L2Q A;  3CCE Q;  3SB2 A;  5ECA A;  3C0C A;  1KSW A;  1I4K 1;  2K3X A;  4OP0 A;  1UJY A;  3OMC A;  3KBG A;  4OGE A;  3BDL A;  3QWX X;  4QVZ A;  1WHM A;  2H3E B;  4O5V A;  3DB3 A;  3JCM g;  1WPY A;  3J7A F;  1M9S A;  2MI6 A;  1UEB A;  2FPF A;  1YJN A;  2DO3 A;  2VYT A;  2EFI A;  3AHU A;  1BU1 A;  2PNI A;  2DBK A;  5I11 A;  5GAM f;  2LJ0 A;  3JB9 I;  4CC7 A;  1DJ7 B;  1OPK A;  3M0S A;  1D09 B;  4L59 A;  4M78 B;  4J9G A;  3OY9 A;  5CK9 A;  5CO7 A;  5L8R E;  5CR2 A;  2LTO A;  1VQ6 T;  3EG1 A;  3NPF A;  1PM3 A;  4Y28 E;  2CUB A;  2IPO B;  4QVD A;  3MEW A;  2I2L A;  3HL8 A;  3I35 A;  4A4G A;  4MMK A;  2XID A;  1JRI A;  3O8V A;  1VQ6 Q;  2BZX A;  5HY6 A;  3OS0 A;  4M7D A;  4JJB A;  1PSF A;  1NJI U;  1YJW A;  4CC3 A;  2E5K A;  1Y57 A;  4CC4 B;  3S3M A;  4ESR A;  5EC7 A;  5FU6 B;  4C5H A;  1AEY A;  4MML A;  1SEM A;  3REA B;  3CBM A;  3CC2 A;  3ZL7 C;  1NLO C;  2Y4X A;  1D1C A;  3QHS A;  4DEY A;  3CCJ T;  2LT1 A;  3M4Y A;  1IRE B;  2FHD A;  2LVM A;  4HXJ A;  1MV0 B;  1VQ5 T;  1YHQ A;  3TCJ A;  3LLR A;  3EFS A;  4E7L A;  3CCJ Q;  3OS1 A;  4EPC A;  2K9G A;  4M75 A;  2LMJ A;  1G3T A;  1YWP A;  3MCA B;  4PLI A;  3CC7 A;  1VQ5 Q;  4F14 A;  1T0H A;  1O9S A;  2V8I A;  4XTV A;  4XU0 A;  3ULR B;  2YHT A;  2YUN A;  2LCL A;  4KT0 E;  4MZM A;  3JCM h;  2E3H A;  5CVI A;  1JQQ A;  2D0N A;  2QI2 A;  3LW5 E;  3OYF A;  1GBQ A;  2ED0 A;  2M51 A;  4DOV A;  5GAN f;  1UHC A;  4N4G A;  2VWF A;  3G4S T;  4HCZ A;  4OF1 A;  2R58 A;  1X43 A;  3G6E T;  2K5L A;  2DRM A;  1X6B A;  3OMG A;  5M9O A;  4RTV A;  5KYU A;  3FLG A;  4XTX A;  3G4S Q;  3SD4 A;  2RK2 A;  3JCM c;  3JCM Q;  3HRU A;  1SHF A;  2GQV A;  3GIB A;  2EYX A;  2GQI A;  4HCK A;  2RI5 A;  2F1L A;  5D6W A;  4KRT A;  1NEG A;  3CME Q;  1N9R A;  3G7Z A;  3QJ6 A;  3NTK A;  1VYT A;  2A36 A;  1NJI C;  5IXB A;  4IIO A;  1G83 A;  2P0Q A;  1W2B A;  5GAN 6;  3CCU A;  3CCV A;  1X75 C;  5FU7 C;  4L6V 5;  4UC4 A;  1VQL T;  3H8Z A;  2A7Y A;  1D1B A;  3UAT A;  1X2K A;  2DL7 A;  1U5S A;  2FPE A;  1M2V B;  1VQL Q;  3H6Z A;  2FRW A;  3OYB A;  4NS5 A;  4AFZ C;  1AZG B;  4Y92 A;  5GJV B;  2OTJ A;  1OU8 A;  3VS6 A;  2KMT A;  1XTD A;  2F5K A;  5KYY B;  1HYO A;  2MWP A;  4ZN3 A;  1SRM A;  2HQX A;  4FCY A;  5GMK l;  5DM7 R;  2YRC A;  1GCQ C;  1ZA1 B;  3E2U A;  3FIF A;  2E70 A;  3CPF A;  2O4X A;  2A08 A;  1VQ9 A;  1W2B P;  2K79 A;  2FZG B;  2RJD A;  2PTK A;  3SWN C;  4ZTJ A;  1UTI A;  1OUL A;  2DL8 A;  4OB0 B;  3RES A;  2PU9 B;  1VQ4 A;  3PIP A;  5GAO m;  2DEU A;  3HHT B;  4HVV A;  4PFO A;  4IUU A;  3CD6 T;  2RHU A;  4E7S A;  2EYZ A;  1OYX A;  4E7I A;  2RHI A;  1NYF A;  1VQN T;  3CD6 Q;  5C0M A;  1PCX A;  1SSF A;  3V7S A;  3BE3 A;  3I55 A;  1ABQ A;  4RCB A;  2KE9 A;  3M58 A;  2LCS A;  1VQN Q;  3OYY A;  4XAX B;  4E2F B;  4X9C A;  2ED1 A;  3WXM B;  2QYZ A;  2XMF A;  1S1N A;  5LJ3 g;  3INZ A;  1VYU A;  5IN1 A;  3HFN A;  1W2B S;  3VRZ A;  1K9A A;  1QP3 A;  2XDB A;  3OYM A;  3KXT A;  3KUF A;  1ZLM A;  4M78 A;  4PJO E;  4MZT A;  5AT1 B;  4F7U G;  4OVA A;  3OS2 A;  1M1K R;  2JMC A;  2YLB A;  5KCO A;  1KC8 C;  2QA4 T;  1LPL A;  4PFP A;  3CBP A;  4BE1 A;  2F69 A;  2RQV A;  2X4J A;  1ZHI A;  5HK0 A;  4B9W A;  1X01 A;  2GTO A;  2QA4 Q;  1K0X A;  1EX4 A;  4C8Q E;  3U23 A;  3LH0 A;  1RAB B;  4PJO D;  1YBY A;  3L1A A;  5HK3 A;  3V8J A;  2B8A A;  4A4F A;  1K8A R;  1RUW A;  2YT6 A;  4KGZ B;  1VIF A;  3CC4 A;  2BE9 B;  1PD1 A;  3EHQ A;  2E65 A;  1UDL A;  1S72 T;  5IT9 E;  4C8Q D;  1UGP B;  1U06 A;  4F7U E;  1ZX6 A;  4NL2 A;  3FRN A;  2ZPI B;  4PJO F;  3CCR T;  3EG0 A;  1S72 Q;  2CP2 A;  1V76 A;  3VS2 A;  4N4I A;  4PJN A;  1VQP A;  4BAC A;  3QYH B;  3CCR Q;  2LQ8 A;  3CCQ A;  2KGT A;  2HQE A;  4GY5 A;  4LDW A;  1VQK A;  3QXE B;  1O75 A;  1MHN A;  1YIT A;  4D6W A;  2DJZ A;  5LJ3 j;  1AHJ B;  4BE2 A;  5LJ3 h;  3QSU A;  3CCS T;  2K3B A;  5I21 A;  2OX7 A;  3X28 B;  2RJC A;  2JS2 A;  3HTR A;  3NTH A;  1AWW A;  5LJ5 f;  3CCS Q;  4BI4 A;  4J9B A;  1VQ7 T;  2DBM A;  4FYW B;  2NUT B;  3VYG A;  4Z8A A;  4F7U F;  2A0F B;  4ZGE B;  5CAI A;  1T3S A;  1VQ7 Q;  1U1T A;  1Q7Y R;  2LP5 A;  1J3T A;  3JCM X;  2O9V A;  5HKC A;  2P4T A;  1QW1 A;  1NEB A;  1ZSZ B;  1WHK A;  2CS7 A;  4J9F A;  3QDF A;  2W10 A;  1WLP B;  1Z9Z A;  1VQ8 A;  5DLQ E;  2V8K A;  4XQ3 A;  4LUE A; 
#chains in the Genus database with same CATH homology
 3HRT A;  5C6S A;  3DLL A;  2RJE A;  4BY6 C;  1N6A A;  1YIJ A;  4E7J A;  4M75 G;  4BY6 B;  3CCS A;  3CXC A;  3ZBD A;  2V8J A;  3JRZ A;  3VUB A;  3CCE T;  4ELY C;  2CGH A;  2RD1 A;  1W4S A;  5DLO A;  4XTW A;  5J26 A;  3UT1 A;  3L2V A;  4M7D E;  1Q81 U;  3OYH A;  3OQ5 A;  2MAM A;  3A8M B;  3TEE A;  3CCL A;  3A8H B;  4DOW A;  1KQ1 A;  3L2Q A;  4LD6 A;  1Y96 A;  3SB2 A;  5KCH A;  1VQO T;  3X24 B;  3C95 A;  3PGG A;  4M77 G;  2EJF A;  5D6X A;  3VKI A;  4NL3 A;  2QQR A;  2DEQ A;  3MET A;  1I4K 1;  1D3B B;  1WJS A;  2EQJ A;  2K3X A;  2JNG A;  3MP6 A;  3OMC A;  4OP0 A;  3VU3 C;  5CKE A;  3KBG A;  4OGE A;  2GF7 A;  3JSC A;  2LT4 A;  3BDL A;  3QKJ A;  2EQU A;  1JJ2 A;  2EKO A;  1Y71 A;  3CME T;  4MDX A;  3FJP A;  4KUD K;  2EYQ A;  4QVZ A;  5LJ5 j;  3SWN A;  4A53 A;  1VQ4 T;  1QP2 A;  4O5V A;  3WVE B;  5LJ5 h;  3QO3 A;  3DB3 A;  3CC2 T;  3JCM g;  3JCM d;  1WPY A;  2DAQ A;  4M7D D;  2K5F A;  4C92 B;  3J7A F;  1M9S A;  3T9N A;  2MI6 A;  1BYM A;  1UEB A;  1U8R A;  4RKU E;  3C4S A;  4KUL A;  1YJN A;  2DO3 A;  4C0Z A;  2VYT A;  4E47 A;  4FT4 A;  2EFI A;  4A54 A;  3AHU A;  5LL6 S;  1YHQ T;  1TH7 A;  2JTM A;  3JCM f;  5GAM f;  1YJ9 A;  3UWN A;  4JLI A;  2DKG A;  2VUB A;  5GAN 8;  3JB9 I;  3OYC A;  3L2W A;  3A8O B;  4E7H A;  1DJ7 B;  3URG A;  1IZ6 A;  4M78 C;  1YCY A;  3RKY A;  5GMK h;  3CC7 T;  5FRN A;  1KC8 U;  4X9D A;  4A4K A;  4C0D B;  2HNI A;  4L59 A;  3OYE A;  4M78 B;  4EMK C;  2R57 A;  3I55 T;  3RMQ A;  1I5L A;  2NLU A;  3OY9 A;  2XDD A;  5CK9 A;  3ASK A;  3G71 A;  3J81 E;  4PJO A;  2PQW A;  5CO7 A;  3CMA A;  3QZ5 B;  1LOJ A;  3RIR A;  4XTY A;  5L8R E;  5CR2 A;  3GP8 A;  2LTO A;  3P8D A;  1VQ6 T;  2KAF A;  2QQA A;  4M7D F;  4M77 E;  1I81 A;  4Y28 E;  4C8Q F;  4QVD A;  2RI2 A;  2VXF A;  1H64 1;  2CYZ B;  2I2L A;  3MEW A;  3OYD A;  3CCE A;  3HL8 A;  3QBY A;  4A4G A;  1M90 U;  4J5Y A;  2PUK B;  4MMK A;  2XID A;  5I2M A;  5LJ5 g;  4FT2 A;  2EWN A;  1JRI A;  1FWZ A;  3DB4 A;  3O8V A;  2PVG B;  2LCC A;  2F5T X;  2HAX A;  1WQ7 A;  3UDC A;  5LJ5 e;  5HY6 A;  3OS0 A;  4M7D A;  4M78 E;  1VQO A;  4C8Q A;  1PSF A;  1Q82 U;  4J83 A;  1YJW A;  4J7F A;  3VV0 A;  3OBY A;  3OW2 S;  1NJI U;  2E6N A;  5FU6 C;  2DZC A;  1WNL A;  1XNI A;  4M77 D;  4Y91 A;  3S3M A;  1KD1 U;  3QII A;  2PUO B;  3OYK A;  1OZ2 A;  3JCM V;  3CXC S;  1BI3 A;  5FU6 B;  3PTA A;  1KG1 A;  4A4E A;  4C5H A;  4MML A;  3CBM A;  3CC2 A;  2GFU A;  2KQW A;  4OGC A;  2RB6 A;  3DLM A;  3MO8 A;  2Y4X A;  1QVG A;  3J80 E;  5GMK e;  2FYK A;  1U1S A;  3QHS A;  3CCJ T;  1RL2 A;  2LT1 A;  3OBW A;  2WSF E;  3M4Y A;  4RMO A;  2OAU A;  1IRE B;  4EDU A;  3P8B B;  4M78 D;  2L8D A;  3L2U A;  2FHD A;  4C5G A;  5CQY A;  2E5Q A;  2LVM A;  1H3Z A;  1VQ5 T;  1YHQ A;  3GOX A;  4HCB A;  3TCJ A;  3LLR A;  3EFS A;  3CCM T;  2M16 A;  2RK1 A;  1Q81 C;  3JAM E;  4E7L A;  4FU6 A;  3OS1 A;  2CKK A;  4EPC A;  5A0D A;  4M75 A;  3MCA B;  1G3T A;  1PSE A;  2K4Y A;  3PT9 A;  4PLI A;  4TVR A;  5DY9 A;  2RHZ A;  3CC7 A;  3OB9 A;  2WSC E;  4M77 F;  1Y7X A;  2QXF A;  4JUV A;  4LDX A;  1WJR A;  1O9S A;  2V8I A;  2FL7 A;  4XTV A;  5FRO A;  4XTZ A;  2H3J A;  4MDW A;  4Z02 A;  4FIB A;  4XU0 A;  2IVW A;  3CCU T;  4PJO B;  2YHT A;  2WAC A;  3M57 A;  1VQ6 A;  3MEV A;  2Y90 A;  3SDZ A;  5FLX E;  3HP9 A;  2LCL A;  4JRQ A;  4KT0 E;  4Q5W A;  3TRE A;  4MZM A;  3JCM h;  3OYG A;  4JS4 A;  3PIO A;  4M7A C;  3LWI A;  4J6W A;  3OW2 A;  5CVI A;  4BDZ A;  2BIV A;  4M77 A;  3L2R A;  3JCM J;  3M59 A;  3OYL A;  4M7A B;  2QI2 A;  3LW5 E;  3M54 A;  4DOV A;  5CCA A;  5GAN f;  3OYF A;  3FEO A;  4LDV A;  5GAN 7;  3OSS C;  2EIF A;  4X34 A;  5I2S A;  4N4G A;  3S3O A;  2EJ9 A;  2OTJ T;  3V7C A;  1NZ9 A;  4E7K A;  2ZPH B;  3G4S T;  5EG2 A;  1FXX A;  2KVQ G;  4HCZ A;  5GAO l;  2WSE E;  1KQ2 A;  4OF1 A;  3NFC A;  2R58 A;  4C0F A;  4C92 G;  1B34 B;  5GAO n;  3G6E T;  1VQ7 A;  3V7R A;  3M53 A;  2K5L A;  2VGN A;  1G3Y A;  5M9O A;  3OMG A;  4EMK A;  4BDY A;  3FLG A;  3ZFJ A;  4XTX A;  3SD4 A;  1VQ9 T;  2CZ0 B;  2DPP B;  3RKW A;  3I56 T;  2JOY A;  2RK2 A;  2E41 A;  3JCM c;  3JCM Q;  2MMP A;  3EAE A;  2RO0 A;  2DIQ A;  2KDS A;  3HRU A;  5D6Y A;  4PJO E;  3CCJ A;  3ZEH A;  4IUV A;  2DXU A;  3CEY A;  3M4G A;  3S3N A;  2GQV A;  2KK4 A;  5GAO r;  4C92 C;  3GIB A;  2L5Q A;  3FB9 A;  3JB9 D;  4HT8 A;  3BFM A;  1JB0 E;  2DXC A;  2RI5 A;  4A4H A;  5GAM d;  5GAM g;  1UGQ B;  4M78 G;  5A2Q E;  2ZPG B;  4QVC A;  3OYJ A;  5D6W A;  4F7U B;  4ME7 A;  1N8R C;  1VQ5 A;  2GCX A;  3CCM A;  2JN0 A;  1N9R A;  1Y07 A;  2XKO C;  4J6Y A;  4JRK A;  3JCM e;  1HXD A;  4PNO A;  3G7Z A;  3QJ6 A;  3E9G A;  3NTK A;  2P0K A;  2DTI A;  4GLK A;  4J6X A;  1Q82 C;  1NJI C;  1M1K C;  3GF5 A;  5GMK j;  2P0Q A;  2X4W A;  1W2B A;  1QVG S;  2YLC A;  4C0D C;  5GAN 6;  1V29 B;  2DXT A;  3FC3 A;  3CCU A;  4LD9 K;  3CCV A;  1X75 C;  5FU7 C;  4L6V 5;  3LGF A;  3BDU A;  1KD1 C;  4OMF B;  4UC4 A;  1VQL T;  2QQ9 A;  2MWO A;  2Y4Y A;  3QJY A;  5FU7 B;  1Q7Y U;  4BE0 A;  3C94 A;  4C92 E;  4PL6 A;  3H8Z A;  2A7Y A;  1WQW A;  2E6Z A;  4WF2 A;  3JB9 F;  1GXI E;  4NOY A;  1JJ2 S;  2K57 A;  2DXB A;  3OYI A;  2LQK A;  3H6Z A;  4ZTF A;  2E12 A;  3QUI A;  3OYB A;  4NS5 A;  1I8F A;  4EMG A;  2OTJ A;  2L3R A;  2ZPE B;  4LDU A;  3G4S A;  1KHI A;  2KMT A;  3L2Z A;  5CQX A;  1XTD A;  2F5K A;  4HT9 A;  4OB1 B;  2MWP A;  3ER0 A;  4MZP A;  1K73 U;  4ZN3 A;  2LNV A;  2HQX A;  2VGM A;  3OA6 A;  1K8A C;  1ZBX A;  3RMS A;  2ZPF B;  3PNW C;  2M1H A;  1Y96 B;  3R6O A;  5GMK l;  3FIF A;  5DM7 R;  5GAN 4;  2E70 A;  3CPF A;  2O4X A;  1RI0 A;  4RG8 A;  4C92 D;  1VQ9 A;  5GAN h;  2RJD A;  3TU4 K;  4OB3 B;  3I56 A;  4JDS A;  3RER A;  2R5M A;  3X26 B;  3SWN C;  3BW1 A;  3CME A;  2O01 E;  4ZTJ A;  4XU1 A;  1EIF A;  4OB0 B;  4QW2 A;  5KH6 A;  3GPL A;  3RES A;  1Q86 U;  2PU9 B;  4V2S A;  3OS5 A;  3S6W A;  1K9M U;  3SWN B;  1VQ4 A;  4C0G A;  1QVF A;  4QQD A;  3PIP A;  5GAO m;  4C5I A;  5GMK i;  3JB9 G;  3HHT B;  2MF2 A;  1BI2 A;  4IUU A;  3F70 A;  2EQM A;  4DA4 A;  3CD6 T;  3Q1J A;  2ZGW A;  3QYG B;  3DKM A;  1OI1 A;  2RHU A;  1YI2 T;  1UGS B;  1JBM A;  2RHY A;  1OYX A;  3N5B B;  3RUX A;  2RHI A;  5AYF A;  2QEX T;  3MHX A;  4E7I A;  1VQN T;  3JCM P;  1XOV A;  3VUZ A;  2X4X A;  4C92 F;  4M7A G;  1D3B A;  2RM4 A;  5C0M A;  2E10 A;  3CPW A;  1SSF A;  3V7S A;  2CZ1 B;  2XG8 D;  4XQ3 A;  3I55 A;  1VQL A;  4PJO C;  2RHX A;  1WGS A;  4RCB A;  2GFA A;  2R5A A;  3CC4 T;  1LNX A;  3M58 A;  3OYY A;  2L89 A;  4XAX B;  5GAN g;  5GAN d;  3E9F A;  2ZPB B;  5GAM j;  2VXE A;  3LYI A;  4X9C A;  3WXM B;  4C92 A;  3HSB A;  4R55 A;  2LRQ A;  5GAM h;  3JB9 H;  5GAN e;  3QPH A;  2DZ9 A;  5LJ3 d;  4M78 F;  5LJ3 g;  3INZ A;  3JB9 J;  1YJN T;  5IN1 A;  2QQB A;  2KY9 A;  3HFN A;  5GAN 3;  3LX7 A;  3EFR A;  1W2B S;  1M8V A;  4J7I A;  2FVU A;  4M7D C;  3A8L B;  1QP3 A;  4C8Q C;  1VQM T;  2XDB A;  5CKD A;  3OYM A;  3KXT A;  4M7D B;  2CZ6 B;  2D9T A;  2XDP A;  4CRI A;  2LC4 A;  3KUF A;  5LJ3 f;  4C8Q B;  3A5Z B;  4ZN1 A;  3VYH B;  2EQK A;  3QDR B;  3E19 A;  4M78 A;  4MZT A;  3SFM A;  2VC8 A;  4OVA A;  4F7U G;  3OS2 A;  1VQP T;  2YLB A;  1M5Q 1;  5GAN 2;  3HPW A;  5KCO A;  5J39 A;  3CCQ T;  2PVD B;  1KC8 C;  4ZGJ B;  2DD4 A;  3G71 T;  2CZ7 B;  4OB2 B;  3CMA T;  2QA4 T;  4XK8 E;  2VV5 A;  1Q7Y C;  1VQK T;  3MP8 A;  3GNF B;  4M7A E;  3CBP A;  2JVV A;  4ELZ C;  4BE1 A;  1YIT T;  2F69 A;  1KQS A;  3L42 A;  2X4J A;  1M1F A;  1ZHI A;  3MEA A;  5HK0 A;  4B9W A;  4IUQ A;  1X01 A;  4IUP A;  4RCC A;  3CD6 A;  5GMK m;  5CKH A;  3CBO A;  2DTH A;  4ZGD B;  1YI2 A;  4II1 A;  3X25 B;  4FSX A;  4C8Q E;  1M90 C;  3X20 B;  3LH0 A;  4PJO D;  2QEX A;  1YBY A;  4M75 C;  2QDY B;  1VQN A;  3M5A A;  1OZ3 A;  4N0A C;  4VUB A;  1N9S A;  1VUB A;  3L1A A;  2B8A A;  1P92 A;  3V8J A;  5GAM e;  5HK3 A;  4A4F A;  1K73 C;  2C06 A;  1YJW T;  3QZ9 B;  4M75 B;  2OTL T;  2AHJ B;  3E1S A;  2XHC A;  2FB7 A;  1UGR B;  4FL6 A;  5A0G A;  4IKF A;  1BI0 A;  1QVF S;  2BKD N;  4M7A D;  1G3S A;  1VIF A;  1G3W A;  3CC4 A;  4BI3 A;  2XK0 A;  3GLX A;  5CKB A;  1ZQ1 A;  3QG1 A;  2K5I A;  3LWH A;  2IG0 A;  2E65 A;  2EAY A;  1Q86 C;  3FDR A;  1S72 T;  1K9M C;  4JRI A;  4M77 C;  4C8Q D;  5IT9 E;  2QTX A;  1UGP B;  4F7U E;  2D0Q B;  2A3L A;  1BKB A;  3OSV A;  4JJN K;  1FX7 A;  4NL2 A;  2K3Y A;  4O6J A;  1M1G A;  2ZPI B;  3FRN A;  4M77 B;  4PLL A;  3VJP A;  3OYA A;  4IUR A;  2X4Y A;  4M75 E;  4PJO F;  3CPW S;  4XTU A;  3CCR T;  1VQM A;  3MEU A;  2EJG A;  4FM4 B;  2D6F A;  1G5V A;  4N4I A;  4HCC A;  1BIB A;  1R8O B;  1XQH A;  4HA8 A;  3OYN A;  1NPR A;  3V8L A;  5IAY A;  1LJO A;  4BAC A;  1VQP A;  4M7A F;  4L5G A;  3QYH B;  3G6E A;  2LQ8 A;  3JCM b;  3CCQ A;  5GAN j;  2HQE A;  1VQ8 T;  4GY5 A;  3HRS A;  4EMK B;  2QA4 A;  4LDW A;  3M56 A;  4JS5 A;  3UPU A;  4CI0 C;  1VQK A;  3QXE B;  2E64 A;  1MGQ A;  1O75 A;  1MHN A;  2G3R A;  4BUG A;  2LDM A;  4RG2 A;  4XU2 A;  1YIT A;  1NE8 A;  2HD0 A;  4YTL A;  3WVD B;  2DJZ A;  4D6W A;  4M75 D;  5LJ3 j;  1AHJ B;  1NPP A;  3V8K A;  4BE2 A;  1YIJ T;  1UB4 A;  1N8R U;  4C5E A;  4ATO A;  5LJ5 d;  4M7A A;  5LJ3 h;  3QSU A;  5KE2 A;  3RKX A;  4JRP A;  3CCS T;  2PVO B;  5I21 A;  3ME9 A;  4JLG A;  2JUF A;  3X28 B;  1N27 A;  2RJC A;  3C12 A;  2RA2 A;  4KUI A;  2XD0 A;  2ZZD A;  4PKC C;  1X6O A;  2DK3 A;  2HBP A;  2LX9 A;  4PJO G;  1HK9 A;  3PFS A;  3JCM W;  3NTH A;  4N4H A;  1M1K U;  4BD3 A;  5LJ5 f;  2DTO A;  1WJQ A;  2OTL A;  2KSS A;  2E1H A;  1B34 A;  5CIU A;  3CCL T;  4BI4 A;  1KHC A;  2M9U A;  1VQ7 T;  4P5N A;  1QVP A;  3VYG A;  3PMI A;  1KQS S;  2BUD A;  4J8O A;  4F7U F;  5J3B A;  4R56 A;  4ZGE B;  3LGL A;  5CAI A;  2JTF A;  4EMH A;  2JZ2 A;  4DQ2 A;  4KBM B;  1S72 A;  2K2V A;  4IUT A;  4M75 F;  1U1T A;  2DVE A;  2P0P A;  4QQG A;  4M7D G;  5GAO p;  4XU3 A;  2QQS A;  4C8Q G;  2ZCF B;  2XI9 A;  2XIC A;  5GAN 5;  2X35 A;  2DD5 A;  3JCM X;  4F7U A;  5HKC A;  5GAO q;  2P4T A;  3CCR A;  5CKF A;  3M55 A;  2RH2 A;  1QW1 A;  3GNG A;  2DIG A;  1BI1 A;  1M4Z A;  2RJF A;  3BY7 A;  5A0L A;  1K8A U;  4N0A A;  5KE3 A;  1VIE A;  3HFO A;  3PMT A;  3P8H A;  3MP1 A;  4BB7 A;  5LJ3 e;  2CS7 A;  4QQ6 A;  2M0O A;  1YJ9 T;  4BI8 B;  5FRM A;  3A8G B;  3HKS A;  1BIA A;  1VQ8 A;  4LDY A;  3M9Q A;  2YRV A;  4B9X A;  4HKE A;  2V8K A;  3NTI A;  5DLQ E;  3CCV T;  2O4X B;  2RI3 A;  2XU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...