4QVZA

Fmrp n-terminal domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
200
structure length
194
Chain Sequence
b'EELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPDRQIPFHDVRFPPPVGYNKDINESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYANEIVTIERLRSVNPNKPATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fragile X mental retardation protein 1
molecule tags Translation
source organism Homo sapiens
publication title Human FMRP contains an integral tandem Agenet (Tudor) and KH motif in the amino terminal domain.
pubmed doi rcsb
total genus 35
structure length 194
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF17904 KH_9 FMRP KH0 domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qvzA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qvzA02
1N27A 2X4YA 3BDLA 1RI0A 3LGLA 2WACA 3PFSA 3OYJA 4BDYA 5KCOA 2RJDA 2D9TA 2XK0A 3QIIA 2RHYA 4QQDA 3L42A 2EQMA 3ASKA 2M0OA 2X4XA 3E9GA 3ME9A 2DIQA 3C4SA 4B9WA 3OS1A 4QVZA 2RHUA 3DB3A 1G5VA 3OS2A 2LDMA 3LX7A 3LGFA 2GFAA 4E7JA 4A4FA 3QJ6A 4FU6A 3LLRA 3MEAA 3S3OA 2VYTA 3OYIA 4N4GA 2B8AA 2P0KA 4C5HA 2XDPA 3FEOA 3UWNA 2O4XB 4UC4A 2RI2A 2L3RA 5FRNA 4N4IA 1XNIA 2JTFA 3P8HA 3L2QA 3L2VA 2R5MA 3L2UA 3S3MA 2GF7A 3P8DA 3KUFA 4ZTJA 5KE3A 3L2WA 4BE0A 4N4HA 2GFUA 3META 3OMCA 4EDUA 3OYEA 2K3XA 1SSFA 4HCZA 3FC3A 1H3ZA 3ZEHA 2LVMA 3L2RA 2LRQA 4IURA 3S6WA 4QQ6A 4Q5WA 3QKJA 2RJEA 3MP6A 4IUTA 3OS0A 3LYIA 4Z02A 1OYXA 2E5QA 2MWPA 5C6SA 2NLUA 2EQUA 4BDZA 2HQXA 3OYHA 2BUDA 3DLMA 3QBYA 2EQKA 4PLIA 3F70A 5D6WA 3OB9A 4BE1A 3MO8A 2BIVA 4OVAA 2HQEA 2LTOA 3M9QA 4LD6A 2X35A 3PMIA 4A4HA 4GY5A 4BE2A 2BKDN 2RHXA 3E9FA 3NTHA 5D6XA 4C5EA 4E7HA 2F5KA 3OMGA 3OYLA 2R57A 5IAYA 4E7KA 1WGSA 4FL6A 2R58A 2L89A 3DB4A 3LH0A 2LCCA 2L8DA 2RJFA 2DAQA 3H6ZA 3OYGA 2RJCA 4QQGA 5C0MA 2EKOA 1OI1A 2PQWA 2RO0A 1MHNA 4L59A 4PL6A 4C5GA 3OYMA 1OZ3A 4NS5A 2QQRA 2K3YA 3OYBA 2RHIA 4IUPA 3OYDA 4IUVA 4E7IA 4BACA 2M16A 3FDRA 4CRIA 3OYFA 1WJRA 5KCHA 4IUQA 3H8ZA 4C5IA 5M9OA 3OYCA 2DIGA 3SD4A 4II1A 5CIUA 5FRMA 1WJQA 3PMTA 2MWOA 2G3RA 3OY9A 4A4EA 2IG0A 5J26A 3O8VA 4E7LA 2M1HA 2O4XA 4BD3A 3Q1JA 4X34A 4B9XA 2QQSA 4QW2A 3OQ5A 1KHCA 2JZ2A 3MEVA 4A4GA 3PNWC 3OYKA 3OA6A 4IUUA 3MP1A 4RG2A 5D6YA 2RHZA 4PLLA 1WJSA 5KE2A 2R5AA 2RI3A 4ZTFA 3OYNA 2X4WA 2EQJA 3UT1A 5J39A 3MP8A 2RI5A 3EAEA 3NTKA 3CEYA 2E6NA 3S3NA 3NTIA 3MEUA 2CKKA 2EFIA 2YRVA 2FHDA 5IN1A 3GOXA 1OZ2A 5FROA 3MEWA 4IKFA 3OYAA 3FLGA 5KH6A
chains in the Genus database with same CATH superfamily
2IPOB 2X4YA 2P84A 3CBMA 2XK0A 4RTWA 2KQWA 2Y4YA 3UA7A 3E9GA 3CXCP 3CCST 1JJ2P 1YJWQ 2CDTA 4AFSC 2JMCA 3JCMh 3LGFA 2GFAA 1WXUA 1X01A 1XTDA 1XOVA 3AT1B 2ZPFB 3ER0A 4FSSA 1I81A 2O4XB 3VUBA 4OMQA 2QDLA 1WZOA 5GMKm 2C0IA 1G3YA 2AKKA 3MKDA 2J06A 2K5FA 4QQ6A 5CKFA 3JAME 2BE7D 3M0UA 3H41A 2ZAEA 4C8QE 3TREA 2HQXA 3PGGA 3CCJQ 1N9SA 3OB9A 1YI2Q 4M78B 2RQTA 2OTJT 4D8KA 1M1KU 2BKDN 1VIFA 1Q7YC 3FIFA 4RTXA 3H0HA 2YLBA 4NS5A 2ZPBB 3UPUA 5CKHA 3CPWA 1Q81C 4ELZC 3LWIA 3CCET 2QA4Q 1Y7XA 2ATCB 3V8LA 4C5IA 4J8OA 2DJQA 3ZBDA 4ORZA 1OPKA 3CPFA 5LJ5f 3V8JA 2FEIA 1M2VB 3TQ7P 4C92D 1W2BS 3CBPA 3VS6A 5GAMd 1NG2A 4M78E 3CMET 2CP2A 3CCRQ 2YRVA 1MMAA 1ZSZB 2LP5A 3JSCA 2NWMA 4IKFA 4DOWA 2DE0X 3PFSA 4BDYA 1UFFA 2DIQA 2KGTA 1T0HA 1YHQT 3X24B 4IIMA 4DBHA 3REBB 3QJ6A 4FU6A 5IT9E 3CCUQ 2QEXA 3UWNA 3FB9A 2RI2A 3KFVA 1VQ5Q 4KBMB 3M55A 5I2SA 3CCMA 1M1KR 3G1JA 3OMCA 3OYEA 3BFMA 4M78G 2DLPA 4PJJA 1I5LA 1UGRB 2MF2A 2RJEA 3MP6A 3LYIA 1JXMA 3N5BB 3HKSA 2BUDA 4L6V5 2NUZA 2JTEA 1S1NA 4C92E 1FMWA 3PMIA 1VQOT 1YBYA 1QWFA 1E6HA 3RBBB 2HAXA 3NTHA 2RQUA 1BI0A 3M4YA 2F2VA 4J9DA 3DB4A 2RJFA 2L2PA 3H6ZA 4AFQC 4M75G 2QQRA 4IUPA 1HSQA 2DVEA 2EJGA 2FZGB 2XG8D 2WSFE 2ZPIB 3OBYA 3CCUA 4JS5A 1RACB 2HSEB 2G3RA 2O01E 3C95A 1QCNA 4XQ3A 1NEGA 2XD0A 4M7DD 1YP5A 2DL7A 3OA6A 1KQ1A 1UE9A 4PLLA 3I56A 3OYNA 2F2XA 2E6NA 3CEYA 2E1HA 3CC2A 2ENMA 1OZ2A 3M0QA 3OYAA 2ECZA 3VU3C 4LDVA 2DBKA 1YNZA 4LUDA 1GFCA 2COWA 3G4ST 1QKWA 2EQMA 1M1FA 2DM1A 3QUIA 1YHQQ 1NE8A 2QQ9A 3NMZC 4F7UA 3G6ET 2ESWA 3MEAA 1LOJA 2MOXA 1G2BA 4ATOA 3FJ5A 2X51A 3CMAA 1RLPC 5EG2A 3CCJA 2QA4A 2YUNA 1XNIA 2CT3A 4JDSA 1GXIE 3SHWA 4DBFA 3E19A 4LDWA 2P4TA 3GNFB 2KRSA 3META 2K3XA 2O9SA 4CC7A 4E7ZA 2LT1A 5GAN5 1VQLT 3QKJA 2K2VA 4AG2C 2MWPA 1XQHA 9ATCB 2HQEA 4XTWA 4M7AC 1D1BA 4E6RA 1IRXA 4XAXB 2M02A 2EYYA 2CZ0B 3GP8A 1YFNA 8ATCB 4FL6A 5LJ3f 2L89A 3CCSA 3NGPA 4OMOA 3OYMA 4C5GA 2VXFA 2KXDA 3OYBA 1YJNQ 4DBRA 1N8RU 1B07A 1OU8A 1Z9QA 3H8ZA 3QXEB 3CPWP 3SD4A 5LJ3h 3IQLA 2XICA 4LDXA 4A4EA 3O8VA 4ZGJB 1ABQA 4EMKC 3G7ZA 1O9SA 2J6OA 1WQ7A 4JJCA 4JRKA 4CC2A 3OYKA 1Q82U 4PJOB 1YCSB 2RHZA 2J6FA 3RUXA 1KC8R 4ELYC 5GAMj 4O6JA 2K3BA 3JCMe 4HXJA 3S3NA 2K7AA 2CUDA 1VQOQ 4M7DA 5LJ5h 1M90R 2J05A 2D8HA 3ASKA 4C0DB 1GCQC 1B34B 1RL2A 4J9BA 3RKYA 1H92A 2E41A 2JM9A 1YIJT 1K8AC 1K0SA 2DZCA 1SRMA 2A0FB 3GPLA 1HK9A 2LX7A 4N4IA 1GCPA 1Q7YR 4F04B 1QCFA 5HKCA 2MI6A 1ARKA 1IXDA 3SWNC 5DLOA 2LMJA 1KD1C 1QCOA 4IURA 2CREA 4Z8AA 1F1BB 2MMPA 3CD6A 4X9CA 4NL2A 1BCMA 5LL6S 3H0IA 1EFNA 1IHWA 5A0LA 1WIEA 2Y4XA 1VQ6A 3OBWA 1M90U 4JPBW 2YRCA 2ZGWA 4OGEA 4JRIA 4BE2A 4NL3A 4GLMA 3OYLA 4C92G 1KQSA 1QWEA 4XU1A 3JCMP 4M7AA 3JCMX 1VQ8T 1WXBA 2EJFA 3LH0A 1PCXA 4X9DA 3G4SA 1M27C 2RQVA 1U8RA 3I55A 4GBQA 2QYZA 3CCVA 1M3BA 4PNOA 2DKGA 1B34A 1IZ6A 2QDYB 2C0OA 4M77C 3CC2Q 2MIOA 2QQAA 5GMKl 2RA2A 1TSFA 3PNWC 3MP1A 3M0SA 4RG2A 2OJ2A 2CT4A 1M2VA 1LVKA 1Y71A 4KGZB 2YRDA 2LC4A 1BI1A 5J3BA 1I07A 4MZMA 1H8KA 1G3WA 4EMHA 2VASA 4OF1A 4ZN1A 1LPLA 4F7UG 3HFOA 1CSKA 4KH0B 3OSSC 3E2UA 2YHTA 3JB9D 4B9WA 1WHJA 2MK5A 3DB3A 2DZ9A 2P0QA 2LDMA 4HVUA 1YJ9T 4M7DG 2QI2A 2RK1A 2CSIA 2YUQA 5FU7C 2OTLT 3EFOA 3FEOA 1RUWA 3VV0A 2K9GA 5GAOm 4DQ2A 2QQBA 1PSFA 2A36A 4HCBA 2FG0A 2GNCA 3PIOA 3L2RA 3HPWA 1MMNA 1RAGB 1ZSGA 5C6SA 1G83A 2D0NA 3SEMA 5IHNA 4RTVA 4B6MA 2DL4A 4A4HA 4TVRA 2OTLA 4E7HA 2ZPHB 2F5KA 5IAYA 1ZLMA 4E7KA 1VQ4A 3I5RA 1SEMA 3LWHA 3LW5E 4M78D 3E1SA 4M75B 4L59A 1OI1A 1VQMQ 2CP6A 2DRMA 1RLQC 3CCQA 5CCAA 2AT1B 1X2KA 1RAAB 1VYTA 3CMEA 5GAMe 2DF6A 1VIEA 2H3JA 3G71T 4IIOA 2JNGA 3CCLA 3OY9A 5J26A 2D8JA 1TXQA 4CC3A 2A08A 2FRWA 4M78A 5GANf 3Q1JA 4PFPA 2XU8A 1RAEB 4A4GA 5GMKi 1RABB 2LCSA 4DA4A 2F69A 4OMNA 1H3HA 4HA8A 2RI3A 1PC0A 1VYUA 2JT4A 1HYOA 5FROA 2JM8A 2EW3A 3LGLA 3OYJA 2WACA 4J9HA 1PM3A 4ESRA 1WHMA 1K73C 1WLPB 2K57A 4E7SA 2YLCA 2CP5A 1UTIA 1AWWA 4KRTA 5KYYB 3OS1A 2RNAA 1G3TA 1X75C 4A4FA 1NJIC 1M30A 2OTJA 2DNUA 3V7CA 5HK3A 4PJOD 3L2QA 4C92B 1M5Q1 4HT9A 2CZ7B 2GFUA 1HD3A 4M75F 3ZEHA 4XTVA 1VQLQ 3RNJA 4QKUA 1U1SA 4ZGDB 2DERA 4M7DF 5AT1B 2RPNA 1EX4A 2NLUA 2F2WA 1FXXA 3F70A 1PRMC 1QQJA 5LJ5j 4N0AC 3A5ZB 4OVAA 1AHJB 3DLLA 1SRLA 2X35A 1Q82C 5IHIA 2PU9B 3JB9F 1C6VX 5FWCA 1D3BA 1K9MR 4HKEA 5KYNA 1K9MU 1BYMA 2YUPA 1K0XA 3VS4A 1JRIA 1OQKA 2K3YA 1NYGA 1GBQA 2DO3A 1M90C 4M77F 4RCBA 5IXFA 1QVFP 2DIGA 3NHNA 1MNEA 3VUZA 2VWFA 3CCVT 2M1HA 4BD3A 4Y28E 4BUGA 3JB9I 4NOYA 3MEVA 4M7AD 3VYHB 1VQPQ 1D0XA 1SPKA 2KROA 2KI7A 3EAEA 1WQWA 1WXTA 4WCIA 1LNXA 1S72Q 2EFIA 1IB8A 2XI9A 2EGAA 1ABOA 3GIBA 1TUGB 2IVWA 5GANe 3WVEB 4M4ZA 1X43A 2GCXA 4M7DB 1VQ7T 1YWPA 2HBWA 5IHKA 3LX7A 2FPDA 2DMOA 4RTTA 3QYHB 3UF4A 1WA7A 3VS5A 3VJPA 2HBPA 4UC4A 3HRSA 2KRMA 3WXMB 4EDUA 2E64A 3UDCA 2AHJB 2LVMA 3I35A 1NLOC 5L8RE 3OS0A 1FYNA 3M54A 1GL5A 1OU9A 3OYHA 4LXCA 3VYGA 1LCKA 1JEGA 1V29B 5FU6C 2VB6A 4XTYA 1M9SA 5A0GA 2LCLA 4KUIA 4JRPA 1WGSA 1KSWA 3RKXA 1Y96B 5CKBA 2ED0A 1PG5B 2FZCB 1GBRA 1UGSB 1E7OA 1W2BP 1FX7A 2QGGA 4YTLA 4FYWB 4RMOA 1VQ5A 2QGFB 1RADB 3BE3A 3FDRA 4IUQA 3HTRA 5KYXA 3I55Q 4M75D 3JB9G 4XK8E 1VOMA 2HNIA 3CXCA 1JJ2A 1TU0B 4PJOG 1NPRA 2WSEE 4B9XA 2A3LA 2ZPEB 2DD5A 4Y92A 4Z89A 1ACMB 2EQJA 3D7SB 1GRIA 4FW2A 3VRZA 1YITT 3EHQA 3NTIA 1O75A 2E4HA 4CI0C 3JCMJ 2V1RA 2JMAA 4V2SA 2OTJQ 1XJWB 4MZPA 1HXDA 5GAMf 2QEXQ 1WHHA 4F7UE 4OB2B 5A0DA 2D9TA 3QIIA 4E47A 3A8LB 2X4XA 2OX7A 1K73R 4R0KA 3EH2A 2O9VA 4RTYA 1TOVA 3V8KA 1YI2A 3MPUB 1Y96A 3QYGB 3REAB 2E10A 2PZ1A 4XU2A 1TWBA 4C92F 2DXBA 3I9QA 1N8RR 3RMSA 2KRNA 4Y91A 5LJ5e 3SB2A 5KYXB 1OX8A 3G6EA 4PKCC 1H3ZA 1SSHA 3SWNA 2RF0A 3QZ9B 4KUDK 3CC7T 1BU1A 2QTXA 1S72T 3M53A 3JV3A 2PUOB 3PIPA 3JB9H 3VS0A 3VS3A 2JOYA 3RKWA 1VQNT 3KBGA 2CGHA 5CQYA 5LJ3e 4C0DC 4XU0A 1KG1A 1VUBA 5GAN6 1M4ZA 1YJWT 2YXYA 2L8DA 4A4KA 1KHIA 2ABLA 1QMCA 1K9MC 3BDUA 3VKIA 4ANJA 2AIRB 1G8XA 1TUDA 1EIFA 4EMGA 1U3OA 3URGA 3OYCA 2LQ8A 2DTIA 1IGQA 5GAOl 4PJOC 1W6XA 5CK9A 4ZNXA 4PJOF 5DY9A 2X9HA 1JO8A 2Z0WA 3OQ5A 1KHCA 1OX9A 2X3WD 4FCYA 4BY6B 1PHTA 3UT1A 2DVJA 1ZUUA 3NTKA 3THKA 1A0NB 3MEUA 2CKKA 1M3AA 1MV0B 2EGEA 2CSQA 3M57A 5GAN3 5KH6A 2DRKA 2JTMA 2YUOA 3J80E 4RCCA 1AWXA 3CCSQ 3L1AA 2HL3A 1M8MA 3C12A 1Z9ZA 1QP2A 3A8MB 4OMLA 3LLRA 1D0YA 2VYTA 2B8AA 4C5HA 2VC8A 3EGXA 2GGRA 3FJPA 2M51A 3I55T 2JTFA 3X28B 1KC8U 3HRTA 4KGXB 4HCZA 3TVTA 1FMVA 2EBPA 3EGDB 1B7TA 3S6WA 4AFZC 2BE9B 2EQUA 1N6AA 3CMEQ 1W1FA 3M4GA 2G6FX 3GBQA 3CCMQ 1YI2T 3M58A 3A8OB 4JJDA 5KYYA 4R55A 1Q86R 3CQTA 2R57A 3EG0A 4J7FA 5GAN7 1YHQA 5KYWA 4J9IA 5GJWB 4BI4A 2W10A 1NBEB 1NZ9A 1ZSZA 2QXFA 2RJCA 3VS1A 2RO0A 1NEBA 1JXOA 1YJNT 4AT1B 1D09B 3J81E 4FYXB 2QTVA 2ROLA 2RQWA 2RQRA 3LH5A 1WI7A 4OMPA 3OYYA 1ZBXA 2XHCA 1BBZA 3PMTA 4JZ4A 4E7LA 1T0JA 4X34A 2E3IA 2HSPA 2L3QA 5D6YA 1BI3A 2P4RA 2XKOC 3MP8A 1D1CA 3QZ5B 3EGDA 3CCRT 4DBQA 3JCMb 3CCLQ 3GOXA 1UGPB 1YITA 1ZA2B 2ZZDA 4A63B 1D3BB 3BDLA 2HDAA 4F7UF 1UUEA 2LNVA 2DILA 2EIFA 1VQ8A 1X2QA 4JS4A 2M0OA 5GANj 1KQSS 3CD6T 2EGCA 1PKTA 3I56Q 4QVZA 1Q86C 3H9NA 2JN0A 2I0NA 4E7JA 1K76A 1ZBJA 2D1XA 1MV3A 2C0TA 4C8QF 3SFMA 4JUVA 1VQ5T 1PKSA 3X25B 1I8FA 2H8HA 5DLQE 2L3RA 3CC4T 1YJNA 4JRQA 3CC4Q 1RAIB 2GF7A 3P8DA 2CS7A 4M77G 1UECA 3L2WA 2ZCFB 3ULRB 5CR2A 1TH7A 1X6GA 2AKLA 1B3QA 4JZ3A 1VQ7A 2CZ6B 1M8VA 1NJIR 3EG2A 3JCMf 2E5QA 1WPYA 2A7YA 3RDVA 2K6DA 3CCJT 5CKEA 4ZGEB 2L3PA 5GANg 1VYVA 2K5LA 3INZA 4HCKA 2HEQA 3M9QA 4PK4A 1K9AA 1QVGA 1KQSP 1UG1A 1LJOA 2FPFA 4MMLA 4LDUA 4C92A 5GAOn 5C0MA 2CH4W 2AK5A 1M3CA 1C1AA 2OAWA 1NLPC 1OZ3A 3M0RA 4M75C 3OYDA 1RI9A 4J9CA 2DX1A 5GAN8 1ZSZC 3JRZA 1AEYA 2CP7A 4OB1B 2KAFA 4BI3A 3CCRA 2K2MA 4PFOA 1TUCA 4FT2A 1JU5C 3AHUA 2QQSA 2K79A 4WTOB 2DEUA 1K8AR 3RMQA 2SEMA 4FW1A 1PRLC 1M2OA 3CCLT 1QVGP 2COYA 1KD1U 5ECAA 2E12A 1QW1A 5I22A 3MEWA 2LT4A 1VQNQ 2QASA 1W4SA 1OV3A 2KNBB 2DXCA 2WSCE 4KH1B 7AT1B 3PTAA 3P8BB 1D1AA 3QJYA 1ZA1B 3CD6Q 2NUTB 4QQDA 2DPPB 4R56A 2A37A 2H3EB 4JJBA 2XIDA 2RN8A 3OW2A 3RERA 1WFWA 3G6EQ 2DBMA 1VQOA 3S3OA 1YIJQ 1OOTA 2XDBA 2BZ8A 2C06A 2PTKA 1R8OB 2FO0A 6AT1B 3EG3A 2OAUA 2KR3A 2L3SA 3NFCA 2LQKA 3H0FA 1AWOA 5LJ3d 2FZKB 3ZFJA 2K5IA 4IUTA 1VQ4Q 3SWNB 3BW1A 1VQKQ 1Q81U 2CP0A 5GAN4 3MO8A 2P0PA 2E5KA 1SF9A 2MYSA 3CXCS 1JJ2S 1NYFA 3C0CA 3GF5A 4M77B 2MPXC 3JB9J 3X20B 5D6XA 3OMGA 1R77A 3I56T 3JCMV 2R58A 4FT4A 2BZYA 2DD4A 2RHIA 3HL8A 4C8QG 1I0CA 1SKUB 2LJ3A 4F14A 4XTXA 1TTHB 4II1A 4PFZA 1CKAA 1WHLA 1H641 4BB7A 2FL7A 2O31A 5GMKj 3OSVA 1UHCA 1JQQA 3M0TA 4J9GA 3A8GB 1U06A 2JUFA 1MNDA 1UJYA 2YDLA 2KT8A 1UDLA 4J83A 5KE2A 1K4US 2V26A 3G71A 4EMKB 2KDSA 2W0ZA 2DFUA 4C0ZA 4M77E 4RUGA 2BZXA 4N0AA 4P5NA 1N27A 8AT1B 4MZTA 1WYXA 3TSWA 3HHTB 4D8DA 2RHYA 2E70A 3CC7A 1T3SA 2HZYA 1KJWA 4C8QC 1KD1R 2E65A 2DEQA 3M59A 4M77D 5HK0A 3GNGA 3OYIA 4M7AF 2DJZA 2JS2A 2X3XD 4M7AB 3CCQQ 3PE0A 3QHSA 2VXEA 1R0BG 3L2VA 5DM7R 2V8IA 4ZTJA 5KE3A 3RIRA 2KBTA 4N4HA 1AWJA 2FRYA 2ZPGB 3RESA 1N5ZA 1AVZC 3RR6A 1Y57A 4Z02A 1WDXA 4M7DC 2HL5C 5D7UA 2DETA 4PLIA 2HCKA 1KQ2A 3QG1A 3NPFA 3KXTA 4VUBA 2RHXA 3E9FA 4C8QA 1M1GA 3JCMd 1YJ9A 4PJOE 1ZQ1A 3EG9B 4RKUE 2JW4A 2VUBA 1AOJA 4E2FB 4EIKA 2LZ6B 3EGXB 2PQWA 1YWOA 3V7SA 2RMOA 2KT1A 3QO3A 4QVDA 3VRYA 4M7AE 1PNJA 3O5ZA 1BIBA 1UGVA 2O88A 5M9OA 2KY9A 2FVUA 5FW9A 5FRMA 1WJQA 1ZHIA 2KE9A 3EGUA 2FPEA 1X27A 4J9EA 2HD0A 2EYXA 1BCOA 4BI8B 2KXCA 4J5YA 2CH4A 2X4WA 2DXTA 5J39A 4DOVA 2DTOA 2JVVA 2FHDA 1VQKA 1E6GA 2OI3A 4F17A 4BY6C 1NPPA 2EPDA 1PD1A 2EYQA 3TEEA 2EYWA 3R6OA 4FYVB 4O5VA 2RHUA 2GTOA 2QK0A 1TS9A 2COZA 3EFOB 3DKMA 4RG8A 3T9NA 3TCJA 2BTTA 3BY7A 2PVOB 1GCQA 4OP0A 2KMTA 3A8HB 2YT6A 3U23A 2F1LA 4LE9A 1SSFA 4LNPA 4LUEA 3FC3A 2ROTA 5GAMg 2KEAA 2HKQB 5GAOp 1OYXA 3C94A 1QVFA 2LQWA 1K1ZA 2PUKB 1WX6A 4KULA 2LTOA 1ZUKA 2EQIA 5LJ3j 1YIJA 2D0QB 2HKNA 5GAN2 2CZ1B 4C5EA 2VVKA 1KFZA 2VKNA 2GQVA 4D6WA 1Y07A 2LCCA 5GMKe 4C0FA 4QQGA 2EKOA 3QDFA 3X26B 2J7IA 4E7IA 4BACA 2M16A 4DEYA 1NJIU 5KCHA 1IO6A 3G71Q 2KYBA 3CC2T 3TSZA 3CMAQ 1BK2A 5FWBA 2O4XA 2VGMA 4RTZA 1VQPA 2EJ9A 1T3LA 1K8AU 1TG0A 2PVDB 3EG1A 1QKXA 1IGUA 2RI5A 5KYWB 2V1QA 1VQ9Q 1BIAA 3CPWS 4M75A 3VS2A 1X69A 1MUZA 4OB3B 1UJ0A 3FRNA 4HT8A 3PVLA 5GANh 5CKDA 1QLYA 3HFNA 5I21A 1HJDA 2J6KA 2KVQG 2LJ0A 1VQMA 3C4SA 4J6WA 1G5VA 1WNLA 1FWZA 4CC4B 1YCYA 4M78C 2LQNA 4ME7A 3HP9A 5CO7A 5IH2A 5FRNA 2L0AA 3P8HA 3L2UA 2FB7A 2L5QA 1SHFA 4FM4B 4QVCA 4Q5WA 1EZZB 2CUBA 2GTJA 3EHRA 4K11A 4JJNK 5LJ5g 1WHGA 2RM4A 3CC4A 3I5SA 2KSSA 3M56A 3M5AA 5KYUB 1VQ9A 4GY5A 1Q95G 1ZUYA 4HVVA 1V1CA 2KYMA 2MCNA 3CBOA 2XDDA 4GLKA 2CYZB 3HSBA 1VQ7Q 1VQ8Q 2DAQA 3OW2S 4PL6A 2GQIA 3SDZA 4KGVB 4RTUA 1R0CB 2DTHA 4IUVA 3OS5A 4J6YA 5GMKh 1KC8C 1YN8A 1WJRA 3JCMg 2FYKA 1I1JA 4JLIA 1DJ7B 4FSXA 1QP3A 3CCVQ 2EAYA 4X1VA 1AD5A 2E6ZA 3M0PA 5GJVB 4FIBA 5CQXA 2V8JA 4M75E 4QW2A 2JZ2A 1VA7A 1WJSA 4ZTFA 2B86A 1VQ4T 1C0MA 1W70A 4FYYB 4M78F 3UA6A 5HCKA 4J7IA 5IN1A 3MJXA 2M0YA 2RD1A 1MGQA 1J3TA 5FU6B 3OW2P 3JCMQ 2QG9B 5KCOA 2RJDA 5KYUA 2VGNA 4WF2A 1PD0A 3ME9A 2JS0A 2EWNA 3A1PA 3OS2A 4M7DE 3VS7A 2IIMA 1K73U 1BB9A 1Q86U 2LNHB 3EH1A 1AZGB 1VQNA 3QWXX 2DL8A 4L5GA 2XDPA 3CCQT 1JB0E 1X6BA 2NYSA 2QA4T 1Q81R 3CMAT 2DYBA 3TU4K 2EKHA 5I2MA 5GAOq 2F5TX 3KUFA 2DYIA 3MCAB 5GAMh 5HY6A 4EMKA 5LJ3g 2K4YA 4A53A 1UB4A 2I2LA 5LJ5d 3HRUA 4OMFB 4A54A 1VQ9T 2NUTA 3CCMT 3DLMA 3QDRB 2EQKA 4MDWA 2BIVA 1UGQB 4LD6A 2QEXT 2HQHA 2Y90A 1OPLA 2CP3A 4XTUA 2QAZA 2LX9A 1GFDA 3MHXA 4M7AG 1RAFB 2O2OA 3PVQA 1U1TA 1G3SA 2VV5A 2YSQA 5GANd 3A98A 4OB0B 2JXBA 4PJMA 2YWWA 2DL3A 2DA9A 4LDYA 4CRIA 3OYFA 1N9RA 3CCUT 1OEBA 1BI2A 4AFUC 5CIUA 2AZSA 4JLGA 4KT0E 1JBMA 2PNIA 2IG0A 1KIKA 1BKBA 2GBQA 2SRCA 3V7RA 1P92A 5AYFA 2MAMA 4M77A 4LN2A 1M1KC 3QWYA 4IUUA 1VQPT 4EPCA 1I4K1 5FLXE 1YJWA 3QSUA 2HMAA 1VQ6Q 4J9FA 2EYZA 4PJLA 4C8QB 4C0GA 1IREB 3EG9A 5CVIA 5IXBA 1RI0A 2PVGB 2KK4A 1AZEA 3G4SQ 1W2BA 5EC7A 3L42A 4XU3A 4F16A 3GLXA 1PWTA 4OGCA 1WHKA 4F7UB 1D0ZA 2DL5A 1YJ9Q 2E3HA 4MDXA 3EFSA 4Z88A 1RAHB 2RB6A 4J6XA 2RK2A 4N4GA 2P0KA 5A2QE 1AT1B 3CCEQ 1X6OA 5I11A 1S72A 4PJNA 3S3MA 4C92C 2R5MA 2NUPA 2D6FA 1PSEA 2DXUA 4BE0A 1SG5A 2LRQA 3JCMc 4HVWA 1V76A 3WVDB 2XMFA 4BDZA 1Q82R 4QT7A 3QBYA 1VQ6T 2DK3A 1Q7YU 4DEXA 4PJOA 1UEBA 5D6WA 4BE1A 3PT9A 1N8RC 3L2ZA 3QPHA 4XTZA 2LJ1A 1VQLA 1NM7A 1SHGA 1QVGS 3ZL7C 1Y0MA 5L23A 1KK7A 2RH2A 3UATA 2EVRA 1U5SA 1VQMT 2M9UA 3OYGA 1QVPA 1MHNA 4LD9K 1IHVA 5GAOr 2AZVA 2OTLQ 1MMGA 2A28A 5FU7B 1I5OB 1MMDA 1UHFA 2X4JA 5CAIA 2ED1A 2V8KA 4OMMA 2MWOA 3CCEA 1ZX6A 4ZN3A 4AG1C 2JJ9A 3J7AF 4C8QD 2NUPB 1FMKA 2R5AA 1YITQ 3EFRA 3CC7Q 4AMCA 1CKBA 1VQKT 4HCCA 1QVFS 3JCMW 3R6NA 3FLGA 4MMKA 1OULA
chains in the Genus database with same CATH topology
1G3WA 4EMHA 2X4YA 4BY6C 2JTMA 3J80E 4OF1A 4RCCA 1NPPA 4ZN1A 3CBMA 2XK0A 2KQWA 3HFOA 4F7UG 2EYQA 2Y4YA 3OSSC 2YHTA 3E9GA 3CCST 3JB9D 3TEEA 4B9WA 3L1AA 3R6OA 4O5VA 2RHUA 3DB3A 2DZ9A 2P0QA 3C12A 2LDMA 1YJ9T 3JCMh 4M7DG 2QI2A 2RK1A 2GFAA 3LGFA 1QP2A 1X01A 3A8MB 3DKMA 1XTDA 3LLRA 5FU7C 2OTLT 2VYTA 4RG8A 1XOVA 2B8AA 3T9NA 3TCJA 4C5HA 2VC8A 3BY7A 2PVOB 2ZPFB 3ER0A 3FEOA 3FJPA 3VV0A 3I55T 1I81A 2O4XB 5GAOm 4OP0A 2QQBA 4DQ2A 3VUBA 2KMTA 3A8HB 2JTFA 1PSFA 3X28B 5GMKm 4HCBA 1G3YA 1KC8U 3HRTA 1SSFA 4HCZA 3FC3A 3PIOA 3L2RA 2K5FA 3S6WA 4QQ6A 3HPWA 5GAMg 5CKFA 3JAME 5GAOp 1OYXA 3C94A 5C6SA 1QVFA 4C8QE 2EQUA 3TREA 1N6AA 2HQXA 3M4GA 3PGGA 1N9SA 3OB9A 2PUKB 4KULA 2LTOA 4M78B 2OTJT 4A4HA 5LJ3j 1YI2T 1YIJA 1M1KU 2D0QB 2BKDN 5GAN2 3M58A 3A8OB 2CZ1B 1VIFA 4TVRA 2OTLA 4C5EA 4E7HA 2ZPHB 2F5KA 4R55A 2GQVA 4J7FA 2R57A 5IAYA 5GAN7 4E7KA 1VQ4A 1YHQA 1Q7YC 4D6WA 1Y07A 3FIFA 3LWHA 4BI4A 3LW5E 2LCCA 5GMKe 4M78D 4C0FA 3E1SA 1NZ9A 2QXFA 2RJCA 2YLBA 4M75B 2EKOA 1OI1A 2RO0A 4L59A 4QQGA 4NS5A 3X26B 1YJNT 2ZPBB 3UPUA 5CKHA 3CPWA 3CCQA 4ELZC 3J81E 4BACA 2M16A 4E7IA 3LWIA 5CCAA 1Q81C 3CCET 1Y7XA 3CMEA 1NJIU 5KCHA 3V8LA 4C5IA 4J8OA 5GAMe 1VIEA 2H3JA 3ZBDA 3CC2T 3G71T 3OYYA 2JNGA 1ZBXA 2XHCA 3PMTA 3CCLA 3OY9A 3CPFA 5J26A 4E7LA 2O4XA 2VGMA 1VQPA 5GANf 4M78A 2EJ9A 3Q1JA 4X34A 5LJ5f 2PVDB 3V8JA 1K8AU 2XU8A 4A4GA 5GMKi 4DA4A 2F69A 5D6YA 1BI3A 4C92D 4HA8A 2RI3A 1W2BS 2XKOC 3MP8A 2RI5A 3QZ5B 3CBPA 3CCRT 5GAMd 4M78E 1BIAA 3JCMb 3CMET 2YRVA 3CPWS 4M75A 1UGPB 3JSCA 3GOXA 5FROA 1YITA 2ZZDA 4IKFA 4DOWA 4OB3B 1D3BB 3FRNA 4HT8A 3BDLA 3LGLA 4F7UF 2WACA 3PFSA 5GANh 3OYJA 4BDYA 5CKDA 2LNVA 1K73C 2K57A 2YLCA 2EIFA 1VQ8A 3HFNA 5I21A 4JS4A 2KVQG 2M0OA 5GANj 1VQMA 2DIQA 3C4SA 1KQSS 4J6WA 3OS1A 4QVZA 3CD6T 1Q86C 1G5VA 1WNLA 2JN0A 1YHQT 3X24B 4E7JA 1G3TA 1X75C 4A4FA 3QJ6A 4FU6A 4C8QF 1FWZA 5IT9E 3SFMA 4JUVA 1NJIC 1YCYA 2QEXA 1VQ5T 3UWNA 3FB9A 2OTJA 4M78C 2RI2A 4ME7A 1I8FA 3HP9A 5DLQE 2L3RA 5CO7A 3V7CA 4KBMB 3X25B 5HK3A 3CC4T 1YJNA 4JRQA 3P8HA 3L2QA 4C92B 3L2UA 3M55A 4PJOD 5I2SA 1M5Q1 3CCMA 2GF7A 3P8DA 4HT9A 2CS7A 4M77G 2CZ7B 3L2WA 2ZCFB 2GFUA 3OMCA 2FB7A 4M75F 3OYEA 3BFMA 4M78G 5CR2A 3ZEHA 2L5QA 4XTVA 1TH7A 1U1SA 4FM4B 4QVCA 4ZGDB 1I5LA 1UGRB 2MF2A 4Q5WA 1VQ7A 2CZ6B 2RJEA 3MP6A 4M7DF 1M8VA 3JCMf 3LYIA 2E5QA 1WPYA 3N5BB 2A7YA 2NLUA 3HKSA 1FXXA 4JJNK 5LJ5g 3CCJT 5CKEA 2BUDA 2RM4A 4L6V5 4ZGEB 3CC4A 5GANg 2K5LA 2KSSA 3F70A 3M56A 5LJ5j 3INZA 4N0AC 3A5ZB 4OVAA 4C92E 1AHJB 3M5AA 3M9QA 3DLLA 1VQ9A 2X35A 3PMIA 1VQOT 1YBYA 4GY5A 1Q82C 1QVGA 2HAXA 3NTHA 2PU9B 3JB9F 1BI0A 1LJOA 3M4YA 3CBOA 2XDDA 4GLKA 2CYZB 4MMLA 1D3BA 3HSBA 4HKEA 4LDUA 3DB4A 4C92A 5FRNA 2RJFA 5GAOn 2DAQA 3H6ZA 3OW2S 1K9MU 5C0MA 1BYMA 4PL6A 4M75G 1OZ3A 1JRIA 2QQRA 2K3YA 3SDZA 4M75C 2DTHA 4IUPA 3OYDA 4IUVA 3OS5A 2DO3A 4J6YA 5GAN8 2DVEA 2EJGA 5GMKh 1KC8C 1M90C 2XG8D 1WJRA 2WSFE 2ZPIB 3JRZA 4M77F 4OB1B 4RCBA 2FYKA 2KAFA 2DIGA 3JCMg 4BI3A 3CCRA 4JLIA 1DJ7B 3OBYA 3CCUA 3VUZA 4FSXA 1QP3A 4JS5A 2EAYA 2O01E 2G3RA 3C95A 3CCVT 4FT2A 4XQ3A 2E6ZA 2M1HA 4Y28E 4BD3A 2XD0A 4M7DD 3AHUA 4FIBA 5CQXA 4BUGA 2V8JA 4M75E 3JB9I 2QQSA 4QW2A 4NOYA 3MEVA 2JZ2A 4M7AD 3OA6A 1KQ1A 3VYHB 3RMQA 4PLLA 1WJSA 4ZTFA 3I56A 3OYNA 1VQ4T 3EAEA 1WQWA 3CCLT 3CEYA 2E6NA 1LNXA 2E1HA 2EFIA 4M78F 1KD1U 3CC2A 5IN1A 4J7IA 1OZ2A 2E12A 1QW1A 2XI9A 3MEWA 3OYAA 2LT4A 2RD1A 3VU3C 3GIBA 1MGQA 1W4SA 5FU6B 4LDVA 2DXCA 2IVWA 2WSCE 3WVEB 5GANe 3JCMQ 5KCOA 2GCXA 3PTAA 3G4ST 2RJDA 4M7DB 3P8BB 2VGNA 3QJYA 4WF2A 4QQDA 2DPPB 4R56A 2EQMA 1M1FA 3QUIA 3ME9A 4BB7A 2EWNA 1VQ7T 2XIDA 3OS2A 3OW2A 3RERA 4M7DE 1NE8A 1K73U 2QQ9A 3LX7A 1Q86U 4F7UA 3G6ET 3QYHB 1VQOA 3MEAA 3S3OA 1LOJA 1VQNA 4L5GA 2XDPA 4ATOA 2XDBA 3CCQT 3VJPA 1JB0E 2C06A 2HBPA 4UC4A 3CMAA 2QA4T 5EG2A 3CCJA 2QA4A 3CMAT 1XNIA 3HRSA 4JDSA 3TU4K 1GXIE 1R8OB 3E19A 4LDWA 5I2MA 5GAOq 2F5TX 3WXMB 3KUFA 2P4TA 2OAUA 3GNFB 3NFCA 2E64A 3META 4EDUA 3MCAB 5GAMh 2K3XA 5HY6A 2LQKA 3UDCA 5LJ3d 4EMKA 5LJ3g 2AHJB 2LVMA 1W2BA 2K4YA 4A53A 1UB4A 2LT1A 2I2LA 3ZFJA 5LJ5d 5GAN5 3QKJA 2K5IA 2K2VA 5L8RE 4IUTA 3HRUA 4OMFB 3OS0A 1VQLT 3M54A 2MWPA 3SWNB 4A54A 3BW1A 1VQ9T 1Q81U 3OYHA 3CCMT 3DLMA 3QDRB 3VYGA 2EQKA 1XQHA 5GAN4 3MO8A 2P0PA 2BIVA 4MDWA 2HQEA 1UGQB 4XTWA 4LD6A 4M7AC 3CXCS 1JJ2S 1V29B 3GF5A 4XAXB 2Y90A 5FU6C 2QEXT 4XTYA 4M77B 1M9SA 3JB9J 5A0GA 3X20B 5D6XA 2CZ0B 2LCLA 4KUIA 4XTUA 3GP8A 3OMGA 4JRPA 2LX9A 3MHXA 1WGSA 3I56T 4FL6A 4M7AG 5LJ3f 3JCMV 2R58A 2L89A 4FT4A 1U1TA 1G3SA 2VV5A 3RKXA 1Y96B 5CKBA 3CCSA 5GANd 2DD4A 3OYMA 4C5GA 4OB0B 2VXFA 1UGSB 3OYBA 2RHIA 3HL8A 1FX7A 4YTLA 4RMOA 4C8QG 1VQ5A 1N8RU 3FDRA 4LDYA 4CRIA 3OYFA 1N9RA 3CCUT 4IUQA 3H8ZA 3QXEB 1BI2A 4XTXA 3SD4A 4II1A 5CIUA 4M75D 5LJ3h 4JLGA 1H641 2HNIA 2FL7A 2XICA 4KT0E 3OSVA 4XK8E 4PJOG 1JBMA 5GMKj 3CXCA 1JJ2A 4A4EA 1NPRA 2IG0A 3O8VA 4ZGJB 3A8GB 4LDXA 4EMKC 3G7ZA 1O9SA 1BKBA 2JUFA 2WSEE 1WQ7A 3V7RA 1P92A 4JRKA 2A3LA 5AYFA 4B9XA 2MAMA 3OYKA 4M77A 1M1KC 4J83A 4IUUA 1VQPT 1Q82U 2ZPEB 4EPCA 2DD5A 1I4K1 4PJOB 2RHZA 3RUXA 5FLXE 5KE2A 1YJWA 4ELYC 2EQJA 4O6JA 5GAMj 3G71A 4EMKB 2KDSA 3QSUA 1YITT 3JCMe 3S3NA 3NTIA 1O75A 4CI0C 4C8QB 3JB9G 4C0ZA 4C0GA 4M77E 3JCMJ 1IREB 4N0AA 4P5NA 1N27A 4M7DA 5LJ5h 4V2SA 4MZPA 1HXDA 5CVIA 5GAMf 1RI0A 2PVGB 4MZTA 4F7UE 4OB2B 2KK4A 3HHTB 5A0DA 2D9TA 3QIIA 4E47A 2RHYA 2E70A 3A8LB 3L42A 4XU3A 3GLXA 3ASKA 2X4XA 4OGCA 3CC7A 4C0DB 4F7UB 4C8QC 2E65A 1B34B 2DEQA 3M59A 4MDXA 1RL2A 3EFSA 4M77D 3RKYA 5HK0A 2E41A 3V8KA 1YI2A 1YIJT 2RB6A 3GNGA 4J6XA 2RK2A 1K8AC 3OYIA 1Y96A 2P0KA 3QYGB 4N4GA 5A2QE 4M7AF 2DJZA 2E10A 2DZCA 4M7AB 4XU2A 4C92F 3GPLA 1HK9A 1X6OA 2DXBA 3QHSA 1S72A 4N4IA 3S3MA 2VXEA 4C92C 3L2VA 2R5MA 5DM7R 2D6FA 5HKCA 1PSEA 2MI6A 3RMSA 2V8IA 4Y91A 5LJ5e 5KE3A 3SB2A 3RIRA 2DXUA 4N4HA 3SWNC 5DLOA 3G6EA 4BE0A 1KD1C 4PKCC 2ZPGB 1H3ZA 1KQSA 3SWNA 2LRQA 4IURA 3RESA 3JCMc 3QZ9B 2MMPA 3WVDB 4KUDK 3CD6A 4X9CA 4Z02A 4NL2A 3CC7T 2QTXA 4BDZA 1S72T 5LL6S 3M53A 4M7DC 3QBYA 1VQ6T 5A0LA 2DK3A 4PLIA 1Q7YU 4PJOA 1UEBA 2Y4XA 3OBWA 5D6WA 4BE1A 3PT9A 1N8RC 1M90U 1KQ2A 3QG1A 1VQ6A 2PUOB 3PIPA 3KXTA 3L2ZA 2ZGWA 4OGEA 4JRIA 4VUBA 4BE2A 3JB9H 3QPHA 4XTZA 2JOYA 2RHXA 3E9FA 3RKWA 1VQLA 1VQNT 4NL3A 3KBGA 2CGHA 4C8QA 1QVGS 3OYLA 4C92G 1M1GA 5CQYA 4XU1A 4C0DC 5LJ3e 4XU0A 3JCMd 3JCMP 3JCMX 1YJ9A 4M7AA 4PJOE 1KG1A 1VUBA 1ZQ1A 1M4ZA 2RH2A 5GAN6 1YJWT 4RKUE 1VQ8T 3LH0A 2EJFA 2L8DA 2VUBA 4A4KA 1VQMT 1KHIA 4X9DA 3G4SA 2M9UA 3OYGA 1QVPA 2PQWA 1MHNA 1K9MC 4LD9K 3BDUA 3VKIA 3V7SA 1U8RA 3QO3A 5GAOr 4QVDA 3I55A 4M7AE 3CCVA 1EIFA 4EMGA 4PNOA 2DKGA 3URGA 1B34A 1IZ6A 2QDYB 5FU7B 2X4JA 1BIBA 5CAIA 3OYCA 5M9OA 2KY9A 2FVUA 2LQ8A 2V8KA 2DTIA 5FRMA 1WJQA 4M77C 2MWOA 1ZHIA 3CCEA 5GAOl 4PJOC 4ZN3A 5CK9A 4PJOF 3J7AF 2QQAA 5DY9A 2HD0A 4C8QD 5GMKl 2RA2A 4ZTJA 3OQ5A 4BI8B 1KHCA 3PNWC 3MP1A 4RG2A 4J5YA 4BY6B 2R5AA 2X4WA 3UT1A 1Y71A 2DXTA 5J39A 3EFRA 2DTOA 2JVVA 3NTKA 2LC4A 4DOVA 1VQKT 3MEUA 2CKKA 4HCCA 1QVFS 1BI1A 2FHDA 1VQKA 3M57A 5J3BA 4MZMA 3JCMW 5GAN3 3FLGA 4MMKA 5KH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N27 A;  2X4Y A;  3BDL A;  1RI0 A;  3LGL A;  2WAC A;  3PFS A;  3OYJ A;  4BDY A;  5KCO A;  2RJD A;  2D9T A;  2XK0 A;  3QII A;  2RHY A;  4QQD A;  3L42 A;  2EQM A;  3ASK A;  2M0O A;  2X4X A;  3E9G A;  3ME9 A;  2DIQ A;  3C4S A;  4B9W A;  3OS1 A;  4QVZ A;  2RHU A;  3DB3 A;  1G5V A;  3OS2 A;  2LDM A;  3LX7 A;  3LGF A;  2GFA A;  4E7J A;  4A4F A;  3QJ6 A;  4FU6 A;  3LLR A;  3MEA A;  3S3O A;  2VYT A;  3OYI A;  4N4G A;  2B8A A;  2P0K A;  4C5H A;  2XDP A;  3FEO A;  3UWN A;  2O4X B;  4UC4 A;  2RI2 A;  2L3R A;  5FRN A;  4N4I A;  1XNI A;  2JTF A;  3P8H A;  3L2Q A;  3L2V A;  2R5M A;  3L2U A;  3S3M A;  2GF7 A;  3P8D A;  3KUF A;  4ZTJ A;  5KE3 A;  3L2W A;  4BE0 A;  4N4H A;  2GFU A;  3MET A;  3OMC A;  4EDU A;  3OYE A;  2K3X A;  1SSF A;  4HCZ A;  3FC3 A;  1H3Z A;  3ZEH A;  2LVM A;  3L2R A;  2LRQ A;  4IUR A;  3S6W A;  4QQ6 A;  4Q5W A;  3QKJ A;  2RJE A;  3MP6 A;  4IUT A;  3OS0 A;  3LYI A;  4Z02 A;  1OYX A;  2E5Q A;  2MWP A;  5C6S A;  2NLU A;  2EQU A;  4BDZ A;  2HQX A;  3OYH A;  2BUD A;  3DLM A;  3QBY A;  2EQK A;  4PLI A;  3F70 A;  5D6W A;  3OB9 A;  4BE1 A;  3MO8 A;  2BIV A;  4OVA A;  2HQE A;  2LTO A;  3M9Q A;  4LD6 A;  2X35 A;  3PMI A;  4A4H A;  4GY5 A;  4BE2 A;  2BKD N;  2RHX A;  3E9F A;  3NTH A;  5D6X A;  4C5E A;  4E7H A;  2F5K A;  3OMG A;  3OYL A;  2R57 A;  5IAY A;  4E7K A;  1WGS A;  4FL6 A;  2R58 A;  2L89 A;  3DB4 A;  3LH0 A;  2LCC A;  2L8D A;  2RJF A;  2DAQ A;  3H6Z A;  3OYG A;  2RJC A;  4QQG A;  5C0M A;  2EKO A;  1OI1 A;  2PQW A;  2RO0 A;  1MHN A;  4L59 A;  4PL6 A;  4C5G A;  3OYM A;  1OZ3 A;  4NS5 A;  2QQR A;  2K3Y A;  3OYB A;  2RHI A;  4IUP A;  3OYD A;  4IUV A;  4E7I A;  4BAC A;  2M16 A;  3FDR A;  4CRI A;  3OYF A;  1WJR A;  5KCH A;  4IUQ A;  3H8Z A;  4C5I A;  5M9O A;  3OYC A;  2DIG A;  3SD4 A;  4II1 A;  5CIU A;  5FRM A;  1WJQ A;  3PMT A;  2MWO A;  2G3R A;  3OY9 A;  4A4E A;  2IG0 A;  5J26 A;  3O8V A;  4E7L A;  2M1H A;  2O4X A;  4BD3 A;  3Q1J A;  4X34 A;  4B9X A;  2QQS A;  4QW2 A;  3OQ5 A;  1KHC A;  2JZ2 A;  3MEV A;  4A4G A;  3PNW C;  3OYK A;  3OA6 A;  4IUU A;  3MP1 A;  4RG2 A;  5D6Y A;  2RHZ A;  4PLL A;  1WJS A;  5KE2 A;  2R5A A;  2RI3 A;  4ZTF A;  3OYN A;  2X4W A;  2EQJ A;  3UT1 A;  5J39 A;  3MP8 A;  2RI5 A;  3EAE A;  3NTK A;  3CEY A;  2E6N A;  3S3N A;  3NTI A;  3MEU A;  2CKK A;  2EFI A;  2YRV A;  2FHD A;  5IN1 A;  3GOX A;  1OZ2 A;  5FRO A;  3MEW A;  4IKF A;  3OYA A;  3FLG A;  5KH6 A; 
#chains in the Genus database with same CATH topology
 2IPO B;  2X4Y A;  2P84 A;  3CBM A;  2XK0 A;  4RTW A;  2KQW A;  2Y4Y A;  3UA7 A;  3E9G A;  3CXC P;  3CCS T;  1JJ2 P;  1YJW Q;  2CDT A;  4AFS C;  2JMC A;  3JCM h;  3LGF A;  2GFA A;  1WXU A;  1X01 A;  1XTD A;  1XOV A;  3AT1 B;  2ZPF B;  3ER0 A;  4FSS A;  1I81 A;  2O4X B;  3VUB A;  4OMQ A;  2QDL A;  1WZO A;  5GMK m;  2C0I A;  1G3Y A;  2AKK A;  3MKD A;  2J06 A;  2K5F A;  4QQ6 A;  5CKF A;  3JAM E;  2BE7 D;  3M0U A;  3H41 A;  2ZAE A;  4C8Q E;  3TRE A;  2HQX A;  3PGG A;  3CCJ Q;  1N9S A;  3OB9 A;  1YI2 Q;  4M78 B;  2RQT A;  2OTJ T;  4D8K A;  1M1K U;  2BKD N;  1VIF A;  1Q7Y C;  3FIF A;  4RTX A;  3H0H A;  2YLB A;  4NS5 A;  2ZPB B;  3UPU A;  5CKH A;  3CPW A;  1Q81 C;  4ELZ C;  3LWI A;  3CCE T;  2QA4 Q;  1Y7X A;  2ATC B;  3V8L A;  4C5I A;  4J8O A;  2DJQ A;  3ZBD A;  4ORZ A;  1OPK A;  3CPF A;  5LJ5 f;  3V8J A;  2FEI A;  1M2V B;  3TQ7 P;  4C92 D;  1W2B S;  3CBP A;  3VS6 A;  5GAM d;  1NG2 A;  4M78 E;  3CME T;  2CP2 A;  3CCR Q;  2YRV A;  1MMA A;  1ZSZ B;  2LP5 A;  3JSC A;  2NWM A;  4IKF A;  4DOW A;  2DE0 X;  3PFS A;  4BDY A;  1UFF A;  2DIQ A;  2KGT A;  1T0H A;  1YHQ T;  3X24 B;  4IIM A;  4DBH A;  3REB B;  3QJ6 A;  4FU6 A;  5IT9 E;  3CCU Q;  2QEX A;  3UWN A;  3FB9 A;  2RI2 A;  3KFV A;  1VQ5 Q;  4KBM B;  3M55 A;  5I2S A;  3CCM A;  1M1K R;  3G1J A;  3OMC A;  3OYE A;  3BFM A;  4M78 G;  2DLP A;  4PJJ A;  1I5L A;  1UGR B;  2MF2 A;  2RJE A;  3MP6 A;  3LYI A;  1JXM A;  3N5B B;  3HKS A;  2BUD A;  4L6V 5;  2NUZ A;  2JTE A;  1S1N A;  4C92 E;  1FMW A;  3PMI A;  1VQO T;  1YBY A;  1QWF A;  1E6H A;  3RBB B;  2HAX A;  3NTH A;  2RQU A;  1BI0 A;  3M4Y A;  2F2V A;  4J9D A;  3DB4 A;  2RJF A;  2L2P A;  3H6Z A;  4AFQ C;  4M75 G;  2QQR A;  4IUP A;  1HSQ A;  2DVE A;  2EJG A;  2FZG B;  2XG8 D;  2WSF E;  2ZPI B;  3OBY A;  3CCU A;  4JS5 A;  1RAC B;  2HSE B;  2G3R A;  2O01 E;  3C95 A;  1QCN A;  4XQ3 A;  1NEG A;  2XD0 A;  4M7D D;  1YP5 A;  2DL7 A;  3OA6 A;  1KQ1 A;  1UE9 A;  4PLL A;  3I56 A;  3OYN A;  2F2X A;  2E6N A;  3CEY A;  2E1H A;  3CC2 A;  2ENM A;  1OZ2 A;  3M0Q A;  3OYA A;  2ECZ A;  3VU3 C;  4LDV A;  2DBK A;  1YNZ A;  4LUD A;  1GFC A;  2COW A;  3G4S T;  1QKW A;  2EQM A;  1M1F A;  2DM1 A;  3QUI A;  1YHQ Q;  1NE8 A;  2QQ9 A;  3NMZ C;  4F7U A;  3G6E T;  2ESW A;  3MEA A;  1LOJ A;  2MOX A;  1G2B A;  4ATO A;  3FJ5 A;  2X51 A;  3CMA A;  1RLP C;  5EG2 A;  3CCJ A;  2QA4 A;  2YUN A;  1XNI A;  2CT3 A;  4JDS A;  1GXI E;  3SHW A;  4DBF A;  3E19 A;  4LDW A;  2P4T A;  3GNF B;  2KRS A;  3MET A;  2K3X A;  2O9S A;  4CC7 A;  4E7Z A;  2LT1 A;  5GAN 5;  1VQL T;  3QKJ A;  2K2V A;  4AG2 C;  2MWP A;  1XQH A;  9ATC B;  2HQE A;  4XTW A;  4M7A C;  1D1B A;  4E6R A;  1IRX A;  4XAX B;  2M02 A;  2EYY A;  2CZ0 B;  3GP8 A;  1YFN A;  8ATC B;  4FL6 A;  5LJ3 f;  2L89 A;  3CCS A;  3NGP A;  4OMO A;  3OYM A;  4C5G A;  2VXF A;  2KXD A;  3OYB A;  1YJN Q;  4DBR A;  1N8R U;  1B07 A;  1OU8 A;  1Z9Q A;  3H8Z A;  3QXE B;  3CPW P;  3SD4 A;  5LJ3 h;  3IQL A;  2XIC A;  4LDX A;  4A4E A;  3O8V A;  4ZGJ B;  1ABQ A;  4EMK C;  3G7Z A;  1O9S A;  2J6O A;  1WQ7 A;  4JJC A;  4JRK A;  4CC2 A;  3OYK A;  1Q82 U;  4PJO B;  1YCS B;  2RHZ A;  2J6F A;  3RUX A;  1KC8 R;  4ELY C;  5GAM j;  4O6J A;  2K3B A;  3JCM e;  4HXJ A;  3S3N A;  2K7A A;  2CUD A;  1VQO Q;  4M7D A;  5LJ5 h;  1M90 R;  2J05 A;  2D8H A;  3ASK A;  4C0D B;  1GCQ C;  1B34 B;  1RL2 A;  4J9B A;  3RKY A;  1H92 A;  2E41 A;  2JM9 A;  1YIJ T;  1K8A C;  1K0S A;  2DZC A;  1SRM A;  2A0F B;  3GPL A;  1HK9 A;  2LX7 A;  4N4I A;  1GCP A;  1Q7Y R;  4F04 B;  1QCF A;  5HKC A;  2MI6 A;  1ARK A;  1IXD A;  3SWN C;  5DLO A;  2LMJ A;  1KD1 C;  1QCO A;  4IUR A;  2CRE A;  4Z8A A;  1F1B B;  2MMP A;  3CD6 A;  4X9C A;  4NL2 A;  1BCM A;  5LL6 S;  3H0I A;  1EFN A;  1IHW A;  5A0L A;  1WIE A;  2Y4X A;  1VQ6 A;  3OBW A;  1M90 U;  4JPB W;  2YRC A;  2ZGW A;  4OGE A;  4JRI A;  4BE2 A;  4NL3 A;  4GLM A;  3OYL A;  4C92 G;  1KQS A;  1QWE A;  4XU1 A;  3JCM P;  4M7A A;  3JCM X;  1VQ8 T;  1WXB A;  2EJF A;  3LH0 A;  1PCX A;  4X9D A;  3G4S A;  1M27 C;  2RQV A;  1U8R A;  3I55 A;  4GBQ A;  2QYZ A;  3CCV A;  1M3B A;  4PNO A;  2DKG A;  1B34 A;  1IZ6 A;  2QDY B;  2C0O A;  4M77 C;  3CC2 Q;  2MIO A;  2QQA A;  5GMK l;  2RA2 A;  1TSF A;  3PNW C;  3MP1 A;  3M0S A;  4RG2 A;  2OJ2 A;  2CT4 A;  1M2V A;  1LVK A;  1Y71 A;  4KGZ B;  2YRD A;  2LC4 A;  1BI1 A;  5J3B A;  1I07 A;  4MZM A;  1H8K A;  1G3W A;  4EMH A;  2VAS A;  4OF1 A;  4ZN1 A;  1LPL A;  4F7U G;  3HFO A;  1CSK A;  4KH0 B;  3OSS C;  3E2U A;  2YHT A;  3JB9 D;  4B9W A;  1WHJ A;  2MK5 A;  3DB3 A;  2DZ9 A;  2P0Q A;  2LDM A;  4HVU A;  1YJ9 T;  4M7D G;  2QI2 A;  2RK1 A;  2CSI A;  2YUQ A;  5FU7 C;  2OTL T;  3EFO A;  3FEO A;  1RUW A;  3VV0 A;  2K9G A;  5GAO m;  4DQ2 A;  2QQB A;  1PSF A;  2A36 A;  4HCB A;  2FG0 A;  2GNC A;  3PIO A;  3L2R A;  3HPW A;  1MMN A;  1RAG B;  1ZSG A;  5C6S A;  1G83 A;  2D0N A;  3SEM A;  5IHN A;  4RTV A;  4B6M A;  2DL4 A;  4A4H A;  4TVR A;  2OTL A;  4E7H A;  2ZPH B;  2F5K A;  5IAY A;  1ZLM A;  4E7K A;  1VQ4 A;  3I5R A;  1SEM A;  3LWH A;  3LW5 E;  4M78 D;  3E1S A;  4M75 B;  4L59 A;  1OI1 A;  1VQM Q;  2CP6 A;  2DRM A;  1RLQ C;  3CCQ A;  5CCA A;  2AT1 B;  1X2K A;  1RAA B;  1VYT A;  3CME A;  5GAM e;  2DF6 A;  1VIE A;  2H3J A;  3G71 T;  4IIO A;  2JNG A;  3CCL A;  3OY9 A;  5J26 A;  2D8J A;  1TXQ A;  4CC3 A;  2A08 A;  2FRW A;  4M78 A;  5GAN f;  3Q1J A;  4PFP A;  2XU8 A;  1RAE B;  4A4G A;  5GMK i;  1RAB B;  2LCS A;  4DA4 A;  2F69 A;  4OMN A;  1H3H A;  4HA8 A;  2RI3 A;  1PC0 A;  1VYU A;  2JT4 A;  1HYO A;  5FRO A;  2JM8 A;  2EW3 A;  3LGL A;  3OYJ A;  2WAC A;  4J9H A;  1PM3 A;  4ESR A;  1WHM A;  1K73 C;  1WLP B;  2K57 A;  4E7S A;  2YLC A;  2CP5 A;  1UTI A;  1AWW A;  4KRT A;  5KYY B;  3OS1 A;  2RNA A;  1G3T A;  1X75 C;  4A4F A;  1NJI C;  1M30 A;  2OTJ A;  2DNU A;  3V7C A;  5HK3 A;  4PJO D;  3L2Q A;  4C92 B;  1M5Q 1;  4HT9 A;  2CZ7 B;  2GFU A;  1HD3 A;  4M75 F;  3ZEH A;  4XTV A;  1VQL Q;  3RNJ A;  4QKU A;  1U1S A;  4ZGD B;  2DER A;  4M7D F;  5AT1 B;  2RPN A;  1EX4 A;  2NLU A;  2F2W A;  1FXX A;  3F70 A;  1PRM C;  1QQJ A;  5LJ5 j;  4N0A C;  3A5Z B;  4OVA A;  1AHJ B;  3DLL A;  1SRL A;  2X35 A;  1Q82 C;  5IHI A;  2PU9 B;  3JB9 F;  1C6V X;  5FWC A;  1D3B A;  1K9M R;  4HKE A;  5KYN A;  1K9M U;  1BYM A;  2YUP A;  1K0X A;  3VS4 A;  1JRI A;  1OQK A;  2K3Y A;  1NYG A;  1GBQ A;  2DO3 A;  1M90 C;  4M77 F;  4RCB A;  5IXF A;  1QVF P;  2DIG A;  3NHN A;  1MNE A;  3VUZ A;  2VWF A;  3CCV T;  2M1H A;  4BD3 A;  4Y28 E;  4BUG A;  3JB9 I;  4NOY A;  3MEV A;  4M7A D;  3VYH B;  1VQP Q;  1D0X A;  1SPK A;  2KRO A;  2KI7 A;  3EAE A;  1WQW A;  1WXT A;  4WCI A;  1LNX A;  1S72 Q;  2EFI A;  1IB8 A;  2XI9 A;  2EGA A;  1ABO A;  3GIB A;  1TUG B;  2IVW A;  5GAN e;  3WVE B;  4M4Z A;  1X43 A;  2GCX A;  4M7D B;  1VQ7 T;  1YWP A;  2HBW A;  5IHK A;  3LX7 A;  2FPD A;  2DMO A;  4RTT A;  3QYH B;  3UF4 A;  1WA7 A;  3VS5 A;  3VJP A;  2HBP A;  4UC4 A;  3HRS A;  2KRM A;  3WXM B;  4EDU A;  2E64 A;  3UDC A;  2AHJ B;  2LVM A;  3I35 A;  1NLO C;  5L8R E;  3OS0 A;  1FYN A;  3M54 A;  1GL5 A;  1OU9 A;  3OYH A;  4LXC A;  3VYG A;  1LCK A;  1JEG A;  1V29 B;  5FU6 C;  2VB6 A;  4XTY A;  1M9S A;  5A0G A;  2LCL A;  4KUI A;  4JRP A;  1WGS A;  1KSW A;  3RKX A;  1Y96 B;  5CKB A;  2ED0 A;  1PG5 B;  2FZC B;  1GBR A;  1UGS B;  1E7O A;  1W2B P;  1FX7 A;  2QGG A;  4YTL A;  4FYW B;  4RMO A;  1VQ5 A;  2QGF B;  1RAD B;  3BE3 A;  3FDR A;  4IUQ A;  3HTR A;  5KYX A;  3I55 Q;  4M75 D;  3JB9 G;  4XK8 E;  1VOM A;  2HNI A;  3CXC A;  1JJ2 A;  1TU0 B;  4PJO G;  1NPR A;  2WSE E;  4B9X A;  2A3L A;  2ZPE B;  2DD5 A;  4Y92 A;  4Z89 A;  1ACM B;  2EQJ A;  3D7S B;  1GRI A;  4FW2 A;  3VRZ A;  1YIT T;  3EHQ A;  3NTI A;  1O75 A;  2E4H A;  4CI0 C;  3JCM J;  2V1R A;  2JMA A;  4V2S A;  2OTJ Q;  1XJW B;  4MZP A;  1HXD A;  5GAM f;  2QEX Q;  1WHH A;  4F7U E;  4OB2 B;  5A0D A;  2D9T A;  3QII A;  4E47 A;  3A8L B;  2X4X A;  2OX7 A;  1K73 R;  4R0K A;  3EH2 A;  2O9V A;  4RTY A;  1TOV A;  3V8K A;  1YI2 A;  3MPU B;  1Y96 A;  3QYG B;  3REA B;  2E10 A;  2PZ1 A;  4XU2 A;  1TWB A;  4C92 F;  2DXB A;  3I9Q A;  1N8R R;  3RMS A;  2KRN A;  4Y91 A;  5LJ5 e;  3SB2 A;  5KYX B;  1OX8 A;  3G6E A;  4PKC C;  1H3Z A;  1SSH A;  3SWN A;  2RF0 A;  3QZ9 B;  4KUD K;  3CC7 T;  1BU1 A;  2QTX A;  1S72 T;  3M53 A;  3JV3 A;  2PUO B;  3PIP A;  3JB9 H;  3VS0 A;  3VS3 A;  2JOY A;  3RKW A;  1VQN T;  3KBG A;  2CGH A;  5CQY A;  5LJ3 e;  4C0D C;  4XU0 A;  1KG1 A;  1VUB A;  5GAN 6;  1M4Z A;  1YJW T;  2YXY A;  2L8D A;  4A4K A;  1KHI A;  2ABL A;  1QMC A;  1K9M C;  3BDU A;  3VKI A;  4ANJ A;  2AIR B;  1G8X A;  1TUD A;  1EIF A;  4EMG A;  1U3O A;  3URG A;  3OYC A;  2LQ8 A;  2DTI A;  1IGQ A;  5GAO l;  4PJO C;  1W6X A;  5CK9 A;  4ZNX A;  4PJO F;  5DY9 A;  2X9H A;  1JO8 A;  2Z0W A;  3OQ5 A;  1KHC A;  1OX9 A;  2X3W D;  4FCY A;  4BY6 B;  1PHT A;  3UT1 A;  2DVJ A;  1ZUU A;  3NTK A;  3THK A;  1A0N B;  3MEU A;  2CKK A;  1M3A A;  1MV0 B;  2EGE A;  2CSQ A;  3M57 A;  5GAN 3;  5KH6 A;  2DRK A;  2JTM A;  2YUO A;  3J80 E;  4RCC A;  1AWX A;  3CCS Q;  3L1A A;  2HL3 A;  1M8M A;  3C12 A;  1Z9Z A;  1QP2 A;  3A8M B;  4OML A;  3LLR A;  1D0Y A;  2VYT A;  2B8A A;  4C5H A;  2VC8 A;  3EGX A;  2GGR A;  3FJP A;  2M51 A;  3I55 T;  2JTF A;  3X28 B;  1KC8 U;  3HRT A;  4KGX B;  4HCZ A;  3TVT A;  1FMV A;  2EBP A;  3EGD B;  1B7T A;  3S6W A;  4AFZ C;  2BE9 B;  2EQU A;  1N6A A;  3CME Q;  1W1F A;  3M4G A;  2G6F X;  3GBQ A;  3CCM Q;  1YI2 T;  3M58 A;  3A8O B;  4JJD A;  5KYY A;  4R55 A;  1Q86 R;  3CQT A;  2R57 A;  3EG0 A;  4J7F A;  5GAN 7;  1YHQ A;  5KYW A;  4J9I A;  5GJW B;  4BI4 A;  2W10 A;  1NBE B;  1NZ9 A;  1ZSZ A;  2QXF A;  2RJC A;  3VS1 A;  2RO0 A;  1NEB A;  1JXO A;  1YJN T;  4AT1 B;  1D09 B;  3J81 E;  4FYX B;  2QTV A;  2ROL A;  2RQW A;  2RQR A;  3LH5 A;  1WI7 A;  4OMP A;  3OYY A;  1ZBX A;  2XHC A;  1BBZ A;  3PMT A;  4JZ4 A;  4E7L A;  1T0J A;  4X34 A;  2E3I A;  2HSP A;  2L3Q A;  5D6Y A;  1BI3 A;  2P4R A;  2XKO C;  3MP8 A;  1D1C A;  3QZ5 B;  3EGD A;  3CCR T;  4DBQ A;  3JCM b;  3CCL Q;  3GOX A;  1UGP B;  1YIT A;  1ZA2 B;  2ZZD A;  4A63 B;  1D3B B;  3BDL A;  2HDA A;  4F7U F;  1UUE A;  2LNV A;  2DIL A;  2EIF A;  1VQ8 A;  1X2Q A;  4JS4 A;  2M0O A;  5GAN j;  1KQS S;  3CD6 T;  2EGC A;  1PKT A;  3I56 Q;  4QVZ A;  1Q86 C;  3H9N A;  2JN0 A;  2I0N A;  4E7J A;  1K76 A;  1ZBJ A;  2D1X A;  1MV3 A;  2C0T A;  4C8Q F;  3SFM A;  4JUV A;  1VQ5 T;  1PKS A;  3X25 B;  1I8F A;  2H8H A;  5DLQ E;  2L3R A;  3CC4 T;  1YJN A;  4JRQ A;  3CC4 Q;  1RAI B;  2GF7 A;  3P8D A;  2CS7 A;  4M77 G;  1UEC A;  3L2W A;  2ZCF B;  3ULR B;  5CR2 A;  1TH7 A;  1X6G A;  2AKL A;  1B3Q A;  4JZ3 A;  1VQ7 A;  2CZ6 B;  1M8V A;  1NJI R;  3EG2 A;  3JCM f;  2E5Q A;  1WPY A;  2A7Y A;  3RDV A;  2K6D A;  3CCJ T;  5CKE A;  4ZGE B;  2L3P A;  5GAN g;  1VYV A;  2K5L A;  3INZ A;  4HCK A;  2HEQ A;  3M9Q A;  4PK4 A;  1K9A A;  1QVG A;  1KQS P;  1UG1 A;  1LJO A;  2FPF A;  4MML A;  4LDU A;  4C92 A;  5GAO n;  5C0M A;  2CH4 W;  2AK5 A;  1M3C A;  1C1A A;  2OAW A;  1NLP C;  1OZ3 A;  3M0R A;  4M75 C;  3OYD A;  1RI9 A;  4J9C A;  2DX1 A;  5GAN 8;  1ZSZ C;  3JRZ A;  1AEY A;  2CP7 A;  4OB1 B;  2KAF A;  4BI3 A;  3CCR A;  2K2M A;  4PFO A;  1TUC A;  4FT2 A;  1JU5 C;  3AHU A;  2QQS A;  2K79 A;  4WTO B;  2DEU A;  1K8A R;  3RMQ A;  2SEM A;  4FW1 A;  1PRL C;  1M2O A;  3CCL T;  1QVG P;  2COY A;  1KD1 U;  5ECA A;  2E12 A;  1QW1 A;  5I22 A;  3MEW A;  2LT4 A;  1VQN Q;  2QAS A;  1W4S A;  1OV3 A;  2KNB B;  2DXC A;  2WSC E;  4KH1 B;  7AT1 B;  3PTA A;  3P8B B;  1D1A A;  3QJY A;  1ZA1 B;  3CD6 Q;  2NUT B;  4QQD A;  2DPP B;  4R56 A;  2A37 A;  2H3E B;  4JJB A;  2XID A;  2RN8 A;  3OW2 A;  3RER A;  1WFW A;  3G6E Q;  2DBM A;  1VQO A;  3S3O A;  1YIJ Q;  1OOT A;  2XDB A;  2BZ8 A;  2C06 A;  2PTK A;  1R8O B;  2FO0 A;  6AT1 B;  3EG3 A;  2OAU A;  2KR3 A;  2L3S A;  3NFC A;  2LQK A;  3H0F A;  1AWO A;  5LJ3 d;  2FZK B;  3ZFJ A;  2K5I A;  4IUT A;  1VQ4 Q;  3SWN B;  3BW1 A;  1VQK Q;  1Q81 U;  2CP0 A;  5GAN 4;  3MO8 A;  2P0P A;  2E5K A;  1SF9 A;  2MYS A;  3CXC S;  1JJ2 S;  1NYF A;  3C0C A;  3GF5 A;  4M77 B;  2MPX C;  3JB9 J;  3X20 B;  5D6X A;  3OMG A;  1R77 A;  3I56 T;  3JCM V;  2R58 A;  4FT4 A;  2BZY A;  2DD4 A;  2RHI A;  3HL8 A;  4C8Q G;  1I0C A;  1SKU B;  2LJ3 A;  4F14 A;  4XTX A;  1TTH B;  4II1 A;  4PFZ A;  1CKA A;  1WHL A;  1H64 1;  4BB7 A;  2FL7 A;  2O31 A;  5GMK j;  3OSV A;  1UHC A;  1JQQ A;  3M0T A;  4J9G A;  3A8G B;  1U06 A;  2JUF A;  1MND A;  1UJY A;  2YDL A;  2KT8 A;  1UDL A;  4J83 A;  5KE2 A;  1K4U S;  2V26 A;  3G71 A;  4EMK B;  2KDS A;  2W0Z A;  2DFU A;  4C0Z A;  4M77 E;  4RUG A;  2BZX A;  4N0A A;  4P5N A;  1N27 A;  8AT1 B;  4MZT A;  1WYX A;  3TSW A;  3HHT B;  4D8D A;  2RHY A;  2E70 A;  3CC7 A;  1T3S A;  2HZY A;  1KJW A;  4C8Q C;  1KD1 R;  2E65 A;  2DEQ A;  3M59 A;  4M77 D;  5HK0 A;  3GNG A;  3OYI A;  4M7A F;  2DJZ A;  2JS2 A;  2X3X D;  4M7A B;  3CCQ Q;  3PE0 A;  3QHS A;  2VXE A;  1R0B G;  3L2V A;  5DM7 R;  2V8I A;  4ZTJ A;  5KE3 A;  3RIR A;  2KBT A;  4N4H A;  1AWJ A;  2FRY A;  2ZPG B;  3RES A;  1N5Z A;  1AVZ C;  3RR6 A;  1Y57 A;  4Z02 A;  1WDX A;  4M7D C;  2HL5 C;  5D7U A;  2DET A;  4PLI A;  2HCK A;  1KQ2 A;  3QG1 A;  3NPF A;  3KXT A;  4VUB A;  2RHX A;  3E9F A;  4C8Q A;  1M1G A;  3JCM d;  1YJ9 A;  4PJO E;  1ZQ1 A;  3EG9 B;  4RKU E;  2JW4 A;  2VUB A;  1AOJ A;  4E2F B;  4EIK A;  2LZ6 B;  3EGX B;  2PQW A;  1YWO A;  3V7S A;  2RMO A;  2KT1 A;  3QO3 A;  4QVD A;  3VRY A;  4M7A E;  1PNJ A;  3O5Z A;  1BIB A;  1UGV A;  2O88 A;  5M9O A;  2KY9 A;  2FVU A;  5FW9 A;  5FRM A;  1WJQ A;  1ZHI A;  2KE9 A;  3EGU A;  2FPE A;  1X27 A;  4J9E A;  2HD0 A;  2EYX A;  1BCO A;  4BI8 B;  2KXC A;  4J5Y A;  2CH4 A;  2X4W A;  2DXT A;  5J39 A;  4DOV A;  2DTO A;  2JVV A;  2FHD A;  1VQK A;  1E6G A;  2OI3 A;  4F17 A;  4BY6 C;  1NPP A;  2EPD A;  1PD1 A;  2EYQ A;  3TEE A;  2EYW A;  3R6O A;  4FYV B;  4O5V A;  2RHU A;  2GTO A;  2QK0 A;  1TS9 A;  2COZ A;  3EFO B;  3DKM A;  4RG8 A;  3T9N A;  3TCJ A;  2BTT A;  3BY7 A;  2PVO B;  1GCQ A;  4OP0 A;  2KMT A;  3A8H B;  2YT6 A;  3U23 A;  2F1L A;  4LE9 A;  1SSF A;  4LNP A;  4LUE A;  3FC3 A;  2ROT A;  5GAM g;  2KEA A;  2HKQ B;  5GAO p;  1OYX A;  3C94 A;  1QVF A;  2LQW A;  1K1Z A;  2PUK B;  1WX6 A;  4KUL A;  2LTO A;  1ZUK A;  2EQI A;  5LJ3 j;  1YIJ A;  2D0Q B;  2HKN A;  5GAN 2;  2CZ1 B;  4C5E A;  2VVK A;  1KFZ A;  2VKN A;  2GQV A;  4D6W A;  1Y07 A;  2LCC A;  5GMK e;  4C0F A;  4QQG A;  2EKO A;  3QDF A;  3X26 B;  2J7I A;  4E7I A;  4BAC A;  2M16 A;  4DEY A;  1NJI U;  5KCH A;  1IO6 A;  3G71 Q;  2KYB A;  3CC2 T;  3TSZ A;  3CMA Q;  1BK2 A;  5FWB A;  2O4X A;  2VGM A;  4RTZ A;  1VQP A;  2EJ9 A;  1T3L A;  1K8A U;  1TG0 A;  2PVD B;  3EG1 A;  1QKX A;  1IGU A;  2RI5 A;  5KYW B;  2V1Q A;  1VQ9 Q;  1BIA A;  3CPW S;  4M75 A;  3VS2 A;  1X69 A;  1MUZ A;  4OB3 B;  1UJ0 A;  3FRN A;  4HT8 A;  3PVL A;  5GAN h;  5CKD A;  1QLY A;  3HFN A;  5I21 A;  1HJD A;  2J6K A;  2KVQ G;  2LJ0 A;  1VQM A;  3C4S A;  4J6W A;  1G5V A;  1WNL A;  1FWZ A;  4CC4 B;  1YCY A;  4M78 C;  2LQN A;  4ME7 A;  3HP9 A;  5CO7 A;  5IH2 A;  5FRN A;  2L0A A;  3P8H A;  3L2U A;  2FB7 A;  2L5Q A;  1SHF A;  4FM4 B;  4QVC A;  4Q5W A;  1EZZ B;  2CUB A;  2GTJ A;  3EHR A;  4K11 A;  4JJN K;  5LJ5 g;  1WHG A;  2RM4 A;  3CC4 A;  3I5S A;  2KSS A;  3M56 A;  3M5A A;  5KYU B;  1VQ9 A;  4GY5 A;  1Q95 G;  1ZUY A;  4HVV A;  1V1C A;  2KYM A;  2MCN A;  3CBO A;  2XDD A;  4GLK A;  2CYZ B;  3HSB A;  1VQ7 Q;  1VQ8 Q;  2DAQ A;  3OW2 S;  4PL6 A;  2GQI A;  3SDZ A;  4KGV B;  4RTU A;  1R0C B;  2DTH A;  4IUV A;  3OS5 A;  4J6Y A;  5GMK h;  1KC8 C;  1YN8 A;  1WJR A;  3JCM g;  2FYK A;  1I1J A;  4JLI A;  1DJ7 B;  4FSX A;  1QP3 A;  3CCV Q;  2EAY A;  4X1V A;  1AD5 A;  2E6Z A;  3M0P A;  5GJV B;  4FIB A;  5CQX A;  2V8J A;  4M75 E;  4QW2 A;  2JZ2 A;  1VA7 A;  1WJS A;  4ZTF A;  2B86 A;  1VQ4 T;  1C0M A;  1W70 A;  4FYY B;  4M78 F;  3UA6 A;  5HCK A;  4J7I A;  5IN1 A;  3MJX A;  2M0Y A;  2RD1 A;  1MGQ A;  1J3T A;  5FU6 B;  3OW2 P;  3JCM Q;  2QG9 B;  5KCO A;  2RJD A;  5KYU A;  2VGN A;  4WF2 A;  1PD0 A;  3ME9 A;  2JS0 A;  2EWN A;  3A1P A;  3OS2 A;  4M7D E;  3VS7 A;  2IIM A;  1K73 U;  1BB9 A;  1Q86 U;  2LNH B;  3EH1 A;  1AZG B;  1VQN A;  3QWX X;  2DL8 A;  4L5G A;  2XDP A;  3CCQ T;  1JB0 E;  1X6B A;  2NYS A;  2QA4 T;  1Q81 R;  3CMA T;  2DYB A;  3TU4 K;  2EKH A;  5I2M A;  5GAO q;  2F5T X;  3KUF A;  2DYI A;  3MCA B;  5GAM h;  5HY6 A;  4EMK A;  5LJ3 g;  2K4Y A;  4A53 A;  1UB4 A;  2I2L A;  5LJ5 d;  3HRU A;  4OMF B;  4A54 A;  1VQ9 T;  2NUT A;  3CCM T;  3DLM A;  3QDR B;  2EQK A;  4MDW A;  2BIV A;  1UGQ B;  4LD6 A;  2QEX T;  2HQH A;  2Y90 A;  1OPL A;  2CP3 A;  4XTU A;  2QAZ A;  2LX9 A;  1GFD A;  3MHX A;  4M7A G;  1RAF B;  2O2O A;  3PVQ A;  1U1T A;  1G3S A;  2VV5 A;  2YSQ A;  5GAN d;  3A98 A;  4OB0 B;  2JXB A;  4PJM A;  2YWW A;  2DL3 A;  2DA9 A;  4LDY A;  4CRI A;  3OYF A;  1N9R A;  3CCU T;  1OEB A;  1BI2 A;  4AFU C;  5CIU A;  2AZS A;  4JLG A;  4KT0 E;  1JBM A;  2PNI A;  2IG0 A;  1KIK A;  1BKB A;  2GBQ A;  2SRC A;  3V7R A;  1P92 A;  5AYF A;  2MAM A;  4M77 A;  4LN2 A;  1M1K C;  3QWY A;  4IUU A;  1VQP T;  4EPC A;  1I4K 1;  5FLX E;  1YJW A;  3QSU A;  2HMA A;  1VQ6 Q;  4J9F A;  2EYZ A;  4PJL A;  4C8Q B;  4C0G A;  1IRE B;  3EG9 A;  5CVI A;  5IXB A;  1RI0 A;  2PVG B;  2KK4 A;  1AZE A;  3G4S Q;  1W2B A;  5EC7 A;  3L42 A;  4XU3 A;  4F16 A;  3GLX A;  1PWT A;  4OGC A;  1WHK A;  4F7U B;  1D0Z A;  2DL5 A;  1YJ9 Q;  2E3H A;  4MDX A;  3EFS A;  4Z88 A;  1RAH B;  2RB6 A;  4J6X A;  2RK2 A;  4N4G A;  2P0K A;  5A2Q E;  1AT1 B;  3CCE Q;  1X6O A;  5I11 A;  1S72 A;  4PJN A;  3S3M A;  4C92 C;  2R5M A;  2NUP A;  2D6F A;  1PSE A;  2DXU A;  4BE0 A;  1SG5 A;  2LRQ A;  3JCM c;  4HVW A;  1V76 A;  3WVD B;  2XMF A;  4BDZ A;  1Q82 R;  4QT7 A;  3QBY A;  1VQ6 T;  2DK3 A;  1Q7Y U;  4DEX A;  4PJO A;  1UEB A;  5D6W A;  4BE1 A;  3PT9 A;  1N8R C;  3L2Z A;  3QPH A;  4XTZ A;  2LJ1 A;  1VQL A;  1NM7 A;  1SHG A;  1QVG S;  3ZL7 C;  1Y0M A;  5L23 A;  1KK7 A;  2RH2 A;  3UAT A;  2EVR A;  1U5S A;  1VQM T;  2M9U A;  3OYG A;  1QVP A;  1MHN A;  4LD9 K;  1IHV A;  5GAO r;  2AZV A;  2OTL Q;  1MMG A;  2A28 A;  5FU7 B;  1I5O B;  1MMD A;  1UHF A;  2X4J A;  5CAI A;  2ED1 A;  2V8K A;  4OMM A;  2MWO A;  3CCE A;  1ZX6 A;  4ZN3 A;  4AG1 C;  2JJ9 A;  3J7A F;  4C8Q D;  2NUP B;  1FMK A;  2R5A A;  1YIT Q;  3EFR A;  3CC7 Q;  4AMC A;  1CKB A;  1VQK T;  4HCC A;  1QVF S;  3JCM W;  3R6N A;  3FLG A;  4MMK A;  1OUL A; 
#chains in the Genus database with same CATH homology
 1G3W A;  4EMH A;  2X4Y A;  4BY6 C;  2JTM A;  3J80 E;  4OF1 A;  4RCC A;  1NPP A;  4ZN1 A;  3CBM A;  2XK0 A;  2KQW A;  3HFO A;  4F7U G;  2EYQ A;  2Y4Y A;  3OSS C;  2YHT A;  3E9G A;  3CCS T;  3JB9 D;  3TEE A;  4B9W A;  3L1A A;  3R6O A;  4O5V A;  2RHU A;  3DB3 A;  2DZ9 A;  2P0Q A;  3C12 A;  2LDM A;  1YJ9 T;  3JCM h;  4M7D G;  2QI2 A;  2RK1 A;  2GFA A;  3LGF A;  1QP2 A;  1X01 A;  3A8M B;  3DKM A;  1XTD A;  3LLR A;  5FU7 C;  2OTL T;  2VYT A;  4RG8 A;  1XOV A;  2B8A A;  3T9N A;  3TCJ A;  4C5H A;  2VC8 A;  3BY7 A;  2PVO B;  2ZPF B;  3ER0 A;  3FEO A;  3FJP A;  3VV0 A;  3I55 T;  1I81 A;  2O4X B;  5GAO m;  4OP0 A;  2QQB A;  4DQ2 A;  3VUB A;  2KMT A;  3A8H B;  2JTF A;  1PSF A;  3X28 B;  5GMK m;  4HCB A;  1G3Y A;  1KC8 U;  3HRT A;  1SSF A;  4HCZ A;  3FC3 A;  3PIO A;  3L2R A;  2K5F A;  3S6W A;  4QQ6 A;  3HPW A;  5GAM g;  5CKF A;  3JAM E;  5GAO p;  1OYX A;  3C94 A;  5C6S A;  1QVF A;  4C8Q E;  2EQU A;  3TRE A;  1N6A A;  2HQX A;  3M4G A;  3PGG A;  1N9S A;  3OB9 A;  2PUK B;  4KUL A;  2LTO A;  4M78 B;  2OTJ T;  4A4H A;  5LJ3 j;  1YI2 T;  1YIJ A;  1M1K U;  2D0Q B;  2BKD N;  5GAN 2;  3M58 A;  3A8O B;  2CZ1 B;  1VIF A;  4TVR A;  2OTL A;  4C5E A;  4E7H A;  2ZPH B;  2F5K A;  4R55 A;  2GQV A;  4J7F A;  2R57 A;  5IAY A;  5GAN 7;  4E7K A;  1VQ4 A;  1YHQ A;  1Q7Y C;  4D6W A;  1Y07 A;  3FIF A;  3LWH A;  4BI4 A;  3LW5 E;  2LCC A;  5GMK e;  4M78 D;  4C0F A;  3E1S A;  1NZ9 A;  2QXF A;  2RJC A;  2YLB A;  4M75 B;  2EKO A;  1OI1 A;  2RO0 A;  4L59 A;  4QQG A;  4NS5 A;  3X26 B;  1YJN T;  2ZPB B;  3UPU A;  5CKH A;  3CPW A;  3CCQ A;  4ELZ C;  3J81 E;  4BAC A;  2M16 A;  4E7I A;  3LWI A;  5CCA A;  1Q81 C;  3CCE T;  1Y7X A;  3CME A;  1NJI U;  5KCH A;  3V8L A;  4C5I A;  4J8O A;  5GAM e;  1VIE A;  2H3J A;  3ZBD A;  3CC2 T;  3G71 T;  3OYY A;  2JNG A;  1ZBX A;  2XHC A;  3PMT A;  3CCL A;  3OY9 A;  3CPF A;  5J26 A;  4E7L A;  2O4X A;  2VGM A;  1VQP A;  5GAN f;  4M78 A;  2EJ9 A;  3Q1J A;  4X34 A;  5LJ5 f;  2PVD B;  3V8J A;  1K8A U;  2XU8 A;  4A4G A;  5GMK i;  4DA4 A;  2F69 A;  5D6Y A;  1BI3 A;  4C92 D;  4HA8 A;  2RI3 A;  1W2B S;  2XKO C;  3MP8 A;  2RI5 A;  3QZ5 B;  3CBP A;  3CCR T;  5GAM d;  4M78 E;  1BIA A;  3JCM b;  3CME T;  2YRV A;  3CPW S;  4M75 A;  1UGP B;  3JSC A;  3GOX A;  5FRO A;  1YIT A;  2ZZD A;  4IKF A;  4DOW A;  4OB3 B;  1D3B B;  3FRN A;  4HT8 A;  3BDL A;  3LGL A;  4F7U F;  2WAC A;  3PFS A;  5GAN h;  3OYJ A;  4BDY A;  5CKD A;  2LNV A;  1K73 C;  2K57 A;  2YLC A;  2EIF A;  1VQ8 A;  3HFN A;  5I21 A;  4JS4 A;  2KVQ G;  2M0O A;  5GAN j;  1VQM A;  2DIQ A;  3C4S A;  1KQS S;  4J6W A;  3OS1 A;  4QVZ A;  3CD6 T;  1Q86 C;  1G5V A;  1WNL A;  2JN0 A;  1YHQ T;  3X24 B;  4E7J A;  1G3T A;  1X75 C;  4A4F A;  3QJ6 A;  4FU6 A;  4C8Q F;  1FWZ A;  5IT9 E;  3SFM A;  4JUV A;  1NJI C;  1YCY A;  2QEX A;  1VQ5 T;  3UWN A;  3FB9 A;  2OTJ A;  4M78 C;  2RI2 A;  4ME7 A;  1I8F A;  3HP9 A;  5DLQ E;  2L3R A;  5CO7 A;  3V7C A;  4KBM B;  3X25 B;  5HK3 A;  3CC4 T;  1YJN A;  4JRQ A;  3P8H A;  3L2Q A;  4C92 B;  3L2U A;  3M55 A;  4PJO D;  5I2S A;  1M5Q 1;  3CCM A;  2GF7 A;  3P8D A;  4HT9 A;  2CS7 A;  4M77 G;  2CZ7 B;  3L2W A;  2ZCF B;  2GFU A;  3OMC A;  2FB7 A;  4M75 F;  3OYE A;  3BFM A;  4M78 G;  5CR2 A;  3ZEH A;  2L5Q A;  4XTV A;  1TH7 A;  1U1S A;  4FM4 B;  4QVC A;  4ZGD B;  1I5L A;  1UGR B;  2MF2 A;  4Q5W A;  1VQ7 A;  2CZ6 B;  2RJE A;  3MP6 A;  4M7D F;  1M8V A;  3JCM f;  3LYI A;  2E5Q A;  1WPY A;  3N5B B;  2A7Y A;  2NLU A;  3HKS A;  1FXX A;  4JJN K;  5LJ5 g;  3CCJ T;  5CKE A;  2BUD A;  2RM4 A;  4L6V 5;  4ZGE B;  3CC4 A;  5GAN g;  2K5L A;  2KSS A;  3F70 A;  3M56 A;  5LJ5 j;  3INZ A;  4N0A C;  3A5Z B;  4OVA A;  4C92 E;  1AHJ B;  3M5A A;  3M9Q A;  3DLL A;  1VQ9 A;  2X35 A;  3PMI A;  1VQO T;  1YBY A;  4GY5 A;  1Q82 C;  1QVG A;  2HAX A;  3NTH A;  2PU9 B;  3JB9 F;  1BI0 A;  1LJO A;  3M4Y A;  3CBO A;  2XDD A;  4GLK A;  2CYZ B;  4MML A;  1D3B A;  3HSB A;  4HKE A;  4LDU A;  3DB4 A;  4C92 A;  5FRN A;  2RJF A;  5GAO n;  2DAQ A;  3H6Z A;  3OW2 S;  1K9M U;  5C0M A;  1BYM A;  4PL6 A;  4M75 G;  1OZ3 A;  1JRI A;  2QQR A;  2K3Y A;  3SDZ A;  4M75 C;  2DTH A;  4IUP A;  3OYD A;  4IUV A;  3OS5 A;  2DO3 A;  4J6Y A;  5GAN 8;  2DVE A;  2EJG A;  5GMK h;  1KC8 C;  1M90 C;  2XG8 D;  1WJR A;  2WSF E;  2ZPI B;  3JRZ A;  4M77 F;  4OB1 B;  4RCB A;  2FYK A;  2KAF A;  2DIG A;  3JCM g;  4BI3 A;  3CCR A;  4JLI A;  1DJ7 B;  3OBY A;  3CCU A;  3VUZ A;  4FSX A;  1QP3 A;  4JS5 A;  2EAY A;  2O01 E;  2G3R A;  3C95 A;  3CCV T;  4FT2 A;  4XQ3 A;  2E6Z A;  2M1H A;  4Y28 E;  4BD3 A;  2XD0 A;  4M7D D;  3AHU A;  4FIB A;  5CQX A;  4BUG A;  2V8J A;  4M75 E;  3JB9 I;  2QQS A;  4QW2 A;  4NOY A;  3MEV A;  2JZ2 A;  4M7A D;  3OA6 A;  1KQ1 A;  3VYH B;  3RMQ A;  4PLL A;  1WJS A;  4ZTF A;  3I56 A;  3OYN A;  1VQ4 T;  3EAE A;  1WQW A;  3CCL T;  3CEY A;  2E6N A;  1LNX A;  2E1H A;  2EFI A;  4M78 F;  1KD1 U;  3CC2 A;  5IN1 A;  4J7I A;  1OZ2 A;  2E12 A;  1QW1 A;  2XI9 A;  3MEW A;  3OYA A;  2LT4 A;  2RD1 A;  3VU3 C;  3GIB A;  1MGQ A;  1W4S A;  5FU6 B;  4LDV A;  2DXC A;  2IVW A;  2WSC E;  3WVE B;  5GAN e;  3JCM Q;  5KCO A;  2GCX A;  3PTA A;  3G4S T;  2RJD A;  4M7D B;  3P8B B;  2VGN A;  3QJY A;  4WF2 A;  4QQD A;  2DPP B;  4R56 A;  2EQM A;  1M1F A;  3QUI A;  3ME9 A;  4BB7 A;  2EWN A;  1VQ7 T;  2XID A;  3OS2 A;  3OW2 A;  3RER A;  4M7D E;  1NE8 A;  1K73 U;  2QQ9 A;  3LX7 A;  1Q86 U;  4F7U A;  3G6E T;  3QYH B;  1VQO A;  3MEA A;  3S3O A;  1LOJ A;  1VQN A;  4L5G A;  2XDP A;  4ATO A;  2XDB A;  3CCQ T;  3VJP A;  1JB0 E;  2C06 A;  2HBP A;  4UC4 A;  3CMA A;  2QA4 T;  5EG2 A;  3CCJ A;  2QA4 A;  3CMA T;  1XNI A;  3HRS A;  4JDS A;  3TU4 K;  1GXI E;  1R8O B;  3E19 A;  4LDW A;  5I2M A;  5GAO q;  2F5T X;  3WXM B;  3KUF A;  2P4T A;  2OAU A;  3GNF B;  3NFC A;  2E64 A;  3MET A;  4EDU A;  3MCA B;  5GAM h;  2K3X A;  5HY6 A;  2LQK A;  3UDC A;  5LJ3 d;  4EMK A;  5LJ3 g;  2AHJ B;  2LVM A;  1W2B A;  2K4Y A;  4A53 A;  1UB4 A;  2LT1 A;  2I2L A;  3ZFJ A;  5LJ5 d;  5GAN 5;  3QKJ A;  2K5I A;  2K2V A;  5L8R E;  4IUT A;  3HRU A;  4OMF B;  3OS0 A;  1VQL T;  3M54 A;  2MWP A;  3SWN B;  4A54 A;  3BW1 A;  1VQ9 T;  1Q81 U;  3OYH A;  3CCM T;  3DLM A;  3QDR B;  3VYG A;  2EQK A;  1XQH A;  5GAN 4;  3MO8 A;  2P0P A;  2BIV A;  4MDW A;  2HQE A;  1UGQ B;  4XTW A;  4LD6 A;  4M7A C;  3CXC S;  1JJ2 S;  1V29 B;  3GF5 A;  4XAX B;  2Y90 A;  5FU6 C;  2QEX T;  4XTY A;  4M77 B;  1M9S A;  3JB9 J;  5A0G A;  3X20 B;  5D6X A;  2CZ0 B;  2LCL A;  4KUI A;  4XTU A;  3GP8 A;  3OMG A;  4JRP A;  2LX9 A;  3MHX A;  1WGS A;  3I56 T;  4FL6 A;  4M7A G;  5LJ3 f;  3JCM V;  2R58 A;  2L89 A;  4FT4 A;  1U1T A;  1G3S A;  2VV5 A;  3RKX A;  1Y96 B;  5CKB A;  3CCS A;  5GAN d;  2DD4 A;  3OYM A;  4C5G A;  4OB0 B;  2VXF A;  1UGS B;  3OYB A;  2RHI A;  3HL8 A;  1FX7 A;  4YTL A;  4RMO A;  4C8Q G;  1VQ5 A;  1N8R U;  3FDR A;  4LDY A;  4CRI A;  3OYF A;  1N9R A;  3CCU T;  4IUQ A;  3H8Z A;  3QXE B;  1BI2 A;  4XTX A;  3SD4 A;  4II1 A;  5CIU A;  4M75 D;  5LJ3 h;  4JLG A;  1H64 1;  2HNI A;  2FL7 A;  2XIC A;  4KT0 E;  3OSV A;  4XK8 E;  4PJO G;  1JBM A;  5GMK j;  3CXC A;  1JJ2 A;  4A4E A;  1NPR A;  2IG0 A;  3O8V A;  4ZGJ B;  3A8G B;  4LDX A;  4EMK C;  3G7Z A;  1O9S A;  1BKB A;  2JUF A;  2WSE E;  1WQ7 A;  3V7R A;  1P92 A;  4JRK A;  2A3L A;  5AYF A;  4B9X A;  2MAM A;  3OYK A;  4M77 A;  1M1K C;  4J83 A;  4IUU A;  1VQP T;  1Q82 U;  2ZPE B;  4EPC A;  2DD5 A;  1I4K 1;  4PJO B;  2RHZ A;  3RUX A;  5FLX E;  5KE2 A;  1YJW A;  4ELY C;  2EQJ A;  4O6J A;  5GAM j;  3G71 A;  4EMK B;  2KDS A;  3QSU A;  1YIT T;  3JCM e;  3S3N A;  3NTI A;  1O75 A;  4CI0 C;  4C8Q B;  3JB9 G;  4C0Z A;  4C0G A;  4M77 E;  3JCM J;  1IRE B;  4N0A A;  4P5N A;  1N27 A;  4M7D A;  5LJ5 h;  4V2S A;  4MZP A;  1HXD A;  5CVI A;  5GAM f;  1RI0 A;  2PVG B;  4MZT A;  4F7U E;  4OB2 B;  2KK4 A;  3HHT B;  5A0D A;  2D9T A;  3QII A;  4E47 A;  2RHY A;  2E70 A;  3A8L B;  3L42 A;  4XU3 A;  3GLX A;  3ASK A;  2X4X A;  4OGC A;  3CC7 A;  4C0D B;  4F7U B;  4C8Q C;  2E65 A;  1B34 B;  2DEQ A;  3M59 A;  4MDX A;  1RL2 A;  3EFS A;  4M77 D;  3RKY A;  5HK0 A;  2E41 A;  3V8K A;  1YI2 A;  1YIJ T;  2RB6 A;  3GNG A;  4J6X A;  2RK2 A;  1K8A C;  3OYI A;  1Y96 A;  2P0K A;  3QYG B;  4N4G A;  5A2Q E;  4M7A F;  2DJZ A;  2E10 A;  2DZC A;  4M7A B;  4XU2 A;  4C92 F;  3GPL A;  1HK9 A;  1X6O A;  2DXB A;  3QHS A;  1S72 A;  4N4I A;  3S3M A;  2VXE A;  4C92 C;  3L2V A;  2R5M A;  5DM7 R;  2D6F A;  5HKC A;  1PSE A;  2MI6 A;  3RMS A;  2V8I A;  4Y91 A;  5LJ5 e;  5KE3 A;  3SB2 A;  3RIR A;  2DXU A;  4N4H A;  3SWN C;  5DLO A;  3G6E A;  4BE0 A;  1KD1 C;  4PKC C;  2ZPG B;  1H3Z A;  1KQS A;  3SWN A;  2LRQ A;  4IUR A;  3RES A;  3JCM c;  3QZ9 B;  2MMP A;  3WVD B;  4KUD K;  3CD6 A;  4X9C A;  4Z02 A;  4NL2 A;  3CC7 T;  2QTX A;  4BDZ A;  1S72 T;  5LL6 S;  3M53 A;  4M7D C;  3QBY A;  1VQ6 T;  5A0L A;  2DK3 A;  4PLI A;  1Q7Y U;  4PJO A;  1UEB A;  2Y4X A;  3OBW A;  5D6W A;  4BE1 A;  3PT9 A;  1N8R C;  1M90 U;  1KQ2 A;  3QG1 A;  1VQ6 A;  2PUO B;  3PIP A;  3KXT A;  3L2Z A;  2ZGW A;  4OGE A;  4JRI A;  4VUB A;  4BE2 A;  3JB9 H;  3QPH A;  4XTZ A;  2JOY A;  2RHX A;  3E9F A;  3RKW A;  1VQL A;  1VQN T;  4NL3 A;  3KBG A;  2CGH A;  4C8Q A;  1QVG S;  3OYL A;  4C92 G;  1M1G A;  5CQY A;  4XU1 A;  4C0D C;  5LJ3 e;  4XU0 A;  3JCM d;  3JCM P;  3JCM X;  1YJ9 A;  4M7A A;  4PJO E;  1KG1 A;  1VUB A;  1ZQ1 A;  1M4Z A;  2RH2 A;  5GAN 6;  1YJW T;  4RKU E;  1VQ8 T;  3LH0 A;  2EJF A;  2L8D A;  2VUB A;  4A4K A;  1VQM T;  1KHI A;  4X9D A;  3G4S A;  2M9U A;  3OYG A;  1QVP A;  2PQW A;  1MHN A;  1K9M C;  4LD9 K;  3BDU A;  3VKI A;  3V7S A;  1U8R A;  3QO3 A;  5GAO r;  4QVD A;  3I55 A;  4M7A E;  3CCV A;  1EIF A;  4EMG A;  4PNO A;  2DKG A;  3URG A;  1B34 A;  1IZ6 A;  2QDY B;  5FU7 B;  2X4J A;  1BIB A;  5CAI A;  3OYC A;  5M9O A;  2KY9 A;  2FVU A;  2LQ8 A;  2V8K A;  2DTI A;  5FRM A;  1WJQ A;  4M77 C;  2MWO A;  1ZHI A;  3CCE A;  5GAO l;  4PJO C;  4ZN3 A;  5CK9 A;  4PJO F;  3J7A F;  2QQA A;  5DY9 A;  2HD0 A;  4C8Q D;  5GMK l;  2RA2 A;  4ZTJ A;  3OQ5 A;  4BI8 B;  1KHC A;  3PNW C;  3MP1 A;  4RG2 A;  4J5Y A;  4BY6 B;  2R5A A;  2X4W A;  3UT1 A;  1Y71 A;  2DXT A;  5J39 A;  3EFR A;  2DTO A;  2JVV A;  3NTK A;  2LC4 A;  4DOV A;  1VQK T;  3MEU A;  2CKK A;  4HCC A;  1QVF S;  1BI1 A;  2FHD A;  1VQK A;  3M57 A;  5J3B A;  4MZM A;  3JCM W;  5GAN 3;  3FLG A;  4MMK A;  5KH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...