4QVZA

Fmrp n-terminal domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
200
structure length
194
Chain Sequence
EELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPDRQIPFHDVRFPPPVGYNKDINESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYANEIVTIERLRSVNPNKPATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fragile X mental retardation protein 1
publication title Human FMRP contains an integral tandem Agenet (Tudor) and KH motif in the amino terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 35
structure length 194
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF17904 KH_9 FMRP KH0 domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qvzA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qvzA02
3OS2A 2RI2A 2JTFA 2RHZA 4BE2A 4A4EA 2RJDA 3MEUA 5KCOA 3OYGA 3P8HA 4N4HA 4PLLA 4Z02A 2BKDN 4ZTFA 4C5EA 2LTOA 2LRQA 2PQWA 2VYTA 3LYIA 3OMCA 2DAQA 2DIGA 2P0KA 3QIIA 4HCZA 2EKOA 4LD6A 3DB3A 4QQGA 3OB9A 3Q1JA 4QVZA 3OYHA 2XK0A 3OYEA 4IURA 3L2WA 2LDMA 2RJEA 2F5KA 3E9FA 2B8AA 2RHIA 3EAEA 4C5IA 5C0MA 2MWPA 4B9XA 5KH6A 3PMIA 4C5GA 2EQMA 3PMTA 3L2QA 3NTIA 5D6XA 1OZ2A 1WJSA 2EQKA 3LGFA 2YRVA 4N4GA 3OY9A 4FL6A 4QW2A 3S3NA 3S3OA 2K3XA 1G5VA 1OZ3A 1WGSA 2XDPA 3OS0A 2M1HA 3OMGA 1OI1A 3DLMA 4L59A 3H8ZA 3MP1A 3OYCA 5KCHA 2R58A 2FHDA 3MP8A 4BE1A 3LH0A 3ASKA 1H3ZA 3L2VA 4BE0A 4C5HA 3OYKA 3L42A 1WJQA 2K3YA 4ZTJA 4IKFA 3L2UA 4UC4A 3OYMA 3MEWA 3OYDA 4BACA 4PL6A 3OA6A 4NS5A 2L3RA 2DIQA 3FLGA 2LVMA 2RO0A 2EQUA 4II1A 5D6YA 5IN1A 3META 5CIUA 2GFUA 3QBYA 3LLRA 2EQJA 4E7KA 2BUDA 4IUPA 4IUTA 2GFAA 2R57A 3MEVA 2JZ2A 2EFIA 3BDLA 2X4WA 5C6SA 3DB4A 3OYLA 3UWNA 4E7IA 3NTHA 5J39A 2IG0A 1WJRA 2E6NA 1OYXA 4RG2A 3SD4A 3NTKA 4IUUA 3C4SA 3ZEHA 1MHNA 3KUFA 2R5MA 4A4FA 3F70A 5FRMA 3OYNA 3OYBA 2RI3A 5KE3A 3MO8A 4BDYA 3UT1A 4GY5A 4Q5WA 4B9WA 3OYFA 2GF7A 2WACA 3MEAA 4E7JA 3LX7A 3M9QA 3ME9A 1XNIA 2CKKA 4OVAA 4A4GA 1N27A 3QKJA 3LGLA 2X4XA 4CRIA 5FRNA 4BDZA 3O8VA 2RHXA 5KE2A 4E7LA 4BD3A 3H6ZA 4QQDA 5D6WA 3GOXA 3OYIA 3FDRA 5IAYA 5J26A 3FEOA 3PNWC 4PLIA 2X35A 3MP6A 2G3RA 1SSFA 3OQ5A 2HQXA 2RI5A 2L89A 3QJ6A 4A4HA 3OYJA 3P8DA 1RI0A 2O4XB 2LCCA 2M16A 3E9GA 4IUVA 2QQRA 2L8DA 3CEYA 2RHYA 2X4YA 5FROA 2E5QA 2QQSA 4X34A 2MWOA 2RJFA 4QQ6A 4EDUA 2RHUA 3PFSA 3S3MA 2M0OA 3OYAA 4FU6A 4IUQA 3L2RA 1KHCA 3OS1A 2R5AA 3S6WA 2NLUA 2D9TA 3FC3A 2BIVA 5M9OA 2HQEA 2RJCA 4E7HA 4N4IA 2O4XA
chains in the Genus database with same CATH superfamily
4BB7A 3A5ZB 2RHZA 2DZ9A 2VUBA 4FYWB 3TVTA 4XK8E 5KCOA 1T0HA 2F2VA 5I22A 3CCLT 4OMPA 3C12A 2RB6A 1MNEA 1UHCA 3BDUA 3OMCA 2DEUA 2DIGA 4F16A 1VQLQ 2LJ0A 2PZ1A 3HRUA 5GMKl 5IH2A 3QWXX 3VS6A 2M9UA 2NUPB 1KJWA 2V8KA 2EPDA 2HSEB 3IQLA 2FRWA 3ZBDA 2P4RA 3UA7A 2JXBA 2LT4A 3OMGA 5LJ5j 3MP8A 2MYSA 2BZ8A 4BE0A 2QA4T 2O9SA 2EQUA 1YI2A 2QQBA 3VS2A 2BUDA 3REBB 3NFCA 1M1GA 1M1FA 1RACB 4J9CA 1VQ6A 4JZ4A 3G4SA 1H8KA 2DXTA 1OOTA 2YRCA 2JT4A 2ESWA 5GAOn 3CCSA 2J6FA 1X6GA 3RBBB 4DBQA 1WDXA 4A53A 4DBRA 2VGNA 4Y28E 2JMAA 2RHXA 1V29B 3I55T 4EMKC 2E65A 4ATOA 3OYIA 4TVRA 3OBYA 5GAMf 1WHJA 1IXDA 1SSFA 4MDXA 2LCCA 2K4YA 9ATCB 1UDLA 1SF9A 2KYBA 2EYYA 4FW2A 4PJOD 1R0CB 1Y96A 3EG1A 4E7ZA 3PFSA 1ZUUA 3CCVQ 4N4IA 2DEQA 4BE2A 4C92F 1PNJA 1TUDA 3N5BB 2HKQB 4F7UB 3FJ5A 3MCAB 4J5YA 3HL8A 4R56A 1JB0E 3L2WA 3OYEA 2DMOA 1AEYA 2MPXC 1MMGA 2FYKA 2QDLA 5GAN8 2LC4A 3QZ5B 3QDRB 4FL6A 2O9VA 2Z0WA 1JU5C 4BI4A 1NPRA 4OB3B 1FX7A 1CKAA 1NJIU 2AHJB 1WJQA 4QT7A 2A28A 3OA6A 4QVCA 3MHXA 3A8GB 3JB9F 1FMVA 1M2VB 2QTXA 2KDSA 2EQJA 2FZGB 4E7KA 1NJIR 1U06A 3AHUA 1A0NB 1KQSS 2CH4A 5CCAA 3OYLA 3LWHA 4F7UA 3OW2P 4GLMA 4KH1B 4JRPA 5GAN5 4BY6B 4A4FA 2R5MA 2E70A 5HK3A 2HAXA 2MCNA 3UF4A 2LMJA 1JEGA 4GY5A 4E2FB 3M0RA 4KH0B 2LZ6B 2WSCE 1UG1A 2ZPEB 3O8VA 4AFSC 1VQ5A 2L2PA 1QVGS 5GAN7 1KHIA 2EAYA 2QEXQ 3CC4T 3JCMX 2X3WD 4J9HA 1AOJA 2ROLA 1WFWA 2HL3A 2JM8A 2CREA 3E9GA 5GANe 2GBQA 2HDAA 3QJYA 1NJIC 2YUQA 1ZUKA 4XTWA 1IZ6A 1M2VA 3KXTA 3OW2S 2CP0A 2L0AA 1WIEA 3A1PA 4AG1C 2RJCA 2Y4XA 2CS7A 1K76A 4FIBA 2DXCA 4OMFB 2P0PA 3MEUA 2J6KA 2K7AA 5FWCA 3O5ZA 4XU2A 2AT1B 2DL5A 1K4US 2D1XA 2OTJQ 2NUZA 1QQJA 1TWBA 1G5VA 3JB9I 4RTUA 1MMAA 2RQRA 4EMKA 1QCOA 4KRTA 3VS5A 4M7DE 1OPLA 4J9FA 5LJ3e 2KQWA 3OYMA 3MEWA 2VKNA 4PL6A 4ORZA 2COYA 3META 1V76A 5KYUB 1M90U 4J7FA 1W2BP 5HY6A 4GBQA 2GFAA 3MPUB 3BDLA 4ZGJB 1VQ9Q 3C0CA 3PE0A 1VQ5T 1BIAA 2RMOA 4E7IA 3SDZA 4M7AE 4HT8A 2RQTA 2EBPA 3C4SA 3M58A 3CCEA 1M90R 2RQUA 1G8XA 1UUEA 4IIMA 3UT1A 1QWFA 4JLIA 4JS4A 1LNXA 1TUCA 5HKCA 3M5AA 4C8QE 4A4GA 4MZPA 5FRNA 1Z9QA 3CC2T 5KE2A 2M51A 5GANf 4QQDA 4L5GA 5GMKi 4KGZB 2CUBA 2L3QA 3J7AF 1FMWA 3CD6A 2COWA 1VQLA 4CC3A 2F2XA 4YTLA 1W2BS 1I5LA 2E3HA 5KYUA 1E6GA 3VUZA 2AK5A 1K9MU 1M90C 3I5RA 1WXBA 1JJ2P 2DLPA 2EJ9A 3RMQA 2HQEA 3LH5A 5I21A 5GAOm 1Y57A 1YN8A 3M0UA 1K9MR 3VS3A 3UPUA 3I9QA 1YBYA 2O88A 2LTOA 2DAQA 1D1AA 3REAB 5CKHA 2FO0A 4IURA 1ABOA 1X43A 1RAAB 3U23A 1RABB 3QWYA 4LDWA 1EX4A 1BI0A 1OULA 5LJ3f 1QVFA 3X28B 2EQIA 2QGFB 4M7AG 1AHJB 3BW1A 3RKXA 2YRDA 4N0AC 4L59A 2FG0A 2ATCB 1I1JA 5FU6B 4LDXA 3THKA 1LOJA 1O75A 2EW3A 1RAHB 2LT1A 4D8DA 1IHWA 3WVDB 1BU1A 4RTTA 4M77B 3QBYA 2HSPA 3JCMc 2RK1A 1VQKQ 4DA4A 4OMMA 1K9MC 4RG8A 4PJLA 5IHKA 3V7SA 1P92A 2CT3A 2KE9A 2IG0A 5DY9A 2YDLA 4FYYB 1MHNA 1N9RA 4X9CA 1VQLT 1RL2A 4O5VA 1D1CA 3LX7A 1ZX6A 1D3BB 3CCVA 1N27A 1ZSZC 2IVWA 5GAOp 3EGUA 4XTXA 4OB2B 1Y7XA 3GOXA 2LCLA 2KR3A 1PSEA 3CPWP 1PCXA 2QXFA 1M3AA 3QJ6A 4KULA 3OYJA 2DTIA 1D0YA 4IUVA 2RHYA 3V8JA 4FM4B 4OB1B 2W0ZA 2XDDA 4M77A 2VB6A 4EIKA 3NHNA 1LPLA 2KEAA 4C92E 1WA7A 2P4TA 4EDUA 2DERA 4OP0A 1D1BA 1G3TA 1KHCA 2E1HA 1TU0B 2XD0A 4JS5A 1XQHA 1BI3A 4C0DC 3HKSA 5DLOA 1YJ9A 3JCMW 3WVEB 3LYIA 1D3BA 4J9BA 2RJEA 5L8RE 1YITA 4LD9K 3H0IA 3CPWS 3J80E 2BZXA 2KT1A 4FYVB 2I2LA 2GCXA 4CI0C 3PMTA 3X26B 1XOVA 2WSFE 2PNIA 4JRQA 2YRVA 4N4GA 2EYZA 2FEIA 3L1AA 3HPWA 2ED0A 5FU7C 1IGUA 1Y07A 4XTUA 1PWTA 4IKFA 1NG2A 4K11A 4M75B 2FZCB 4II1A 2K57A 4MZMA 1NPPA 3G6EA 3CCVT 2QEXA 2P84A 3PT9A 1C6VX 3CC2Q 2JJ9A 1YCSB 5AYFA 2K2MA 3WXMB 5GAOl 2MF2A 2MAMA 1TSFA 3M56A 2Y4YA 4HXJA 4D8KA 3MO8A 1K1ZA 2GGRA 1BI1A 4C92G 4XU1A 1QWEA 4LE9A 4OVAA 3GF5A 3E19A 3NPFA 2EWNA 3R6NA 2ZPBB 3A8HB 4E7LA 5D6WA 1G83A 3V8KA 4F7UF 2A37A 2JW4A 4R0KA 2DVJA 5HK0A 3CXCP 1VQPQ 4ZN3A 1LJOA 3EHQA 4JDSA 4M75A 1KQ1A 2OTJA 3JCMg 1SRMA 2JVVA 4C0GA 4QQ6A 2DJZA 3OYAA 2DVEA 3OS1A 3SFMA 1MUZA 3FC3A 2GTJA 4A63B 1WXUA 1AWWA 4N4HA 1GFDA 1NEBA 1KIKA 2FPDA 3QIIA 3A8LB 3OYHA 4LNPA 2K9GA 3PIOA 2F5KA 2RQWA 2D0QB 4M78B 1VQ9A 3I55A 3PMIA 1YJWQ 4PFZA 5AT1B 4BUGA 4HKEA 2FZKB 5D6XA 1XJWB 3X24B 5A0DA 3OY9A 3CMEQ 2KROA 2QEXT 2QTVA 5KYYB 2RM4A 3QUIA 1H3ZA 4KBMB 3HRSA 3I35A 2VVKA 3GLXA 4BACA 1O9SA 4M7DC 4OGEA 1UECA 2HEQA 4M77G 1UGQB 1X75C 2BE7D 2DK3A 2XG8D 5I11A 3PVLA 4OF1A 2CZ6B 4E6RA 1G3YA 1WHKA 3C94A 3PVQA 1GBQA 2DL8A 4J7IA 2JNGA 2VXEA 2NUTB 2X51A 3M54A 2LCSA 3OYNA 1GFCA 3JB9H 2X3XD 5ECAA 1TS9A 2EGEA 4M78A 1ZLMA 4M7AC 3M9QA 3VJPA 2OTJT 3VU3C 2X4XA 2CSQA 3CBOA 2J05A 1Y96B 5KYYA 3JCMb 4O6JA 1WPYA 3CPFA 4C8QC 3MP6A 2DNUA 2QYZA 2KAFA 1NM7A 3A8OB 5GJWB 5A0GA 1VQOQ 3LW5E 4FU6A 1VQ9T 2D9TA 1HSQA 1X01A 4QVZA 2FL7A 2NUTA 1JBMA 1VQ7Q 1RADB 2DILA 1SPKA 2DL7A 2J7IA 2YWWA 4PJOB 3DKMA 2LRQA 1WX6A 2MI6A 4HCZA 4LD6A 2RQVA 3HP9A 4HVWA 3QXEB 4BI3A 4LDUA 3JCMP 2JUFA 3UATA 1VYVA 3S3OA 1YIJQ 1QLYA 3JSCA 1X69A 3CC4A 1KK7A 2LQWA 4HT9A 3CCQQ 1OI1A 1C0MA 2QG9B 3MP1A 2FHDA 3X20B 3L2VA 4KT0E 1KQSP 2PVGB 1ZSGA 5CKFA 4M75G 4NS5A 4PK4A 4E7SA 3CCJQ 1KD1U 2GFUA 2XDBA 4RTXA 4LDVA 3JAME 4KUIA 3GNGA 3H41A 4C0ZA 4M7DD 4EMHA 5J39A 4DQ2A 4PJOA 1E7OA 1PD0A 2DRMA 1KD1R 1MV0B 5IHIA 1BCOA 1VQMQ 2LNVA 1QVGP 4B6MA 2HNIA 4RUGA 1LCKA 3QKJA 2OJ2A 5A0LA 1YHQQ 1AZGB 1OV3A 1M8MA 1IHVA 5IAYA 1G3WA 3SHWA 4PLIA 2X35A 3T9NA 2CYZB 4M7AD 2RI5A 1BCMA 2ZPFB 1Z9ZA 4FYXB 2A08A 2Y90A 2E5QA 2ZPIB 4C8QD 3CBPA 2KRSA 4X34A 5J3BA 2RHUA 1HJDA 1VQKT 1KD1C 3TCJA 1AWJA 1AD5A 5GJVB 1WYXA 5M9OA 3H9NA 1QVFS 1QP2A 2MK5A 4PJJA 4L6V5 2VC8A 2KK4A 4EMKB 2DXUA 4M77F 1UGRB 4X1VA 4R55A 3NGPA 1S72Q 4J6YA 1W1FA 1OPKA 4M78G 3CC2A 5KH6A 3GIBA 4C5GA 2CDTA 1HD3A 1UEBA 2DO3A 1NE8A 1EZZB 4QW2A 1CSKA 4RMOA 2FPEA 1BIBA 1R8OB 3EFOB 3RESA 3SWNC 4JJNK 2RN8A 4BE1A 3LH0A 2EJGA 2GQIA 3TREA 3A98A 1JXOA 5FWBA 2EYXA 1PD1A 3KFVA 7AT1B 2DD4A 2XMFA 2CP6A 2P0QA 2AIRB 2MIOA 1Q81U 3M0QA 3G71Q 2DA9A 2F2WA 4J9EA 2XICA 4J9IA 3UDCA 2CZ1B 4IUTA 4HCCA 1GCQC 1PM3A 2CZ0B 3NTHA 4RTVA 2G6FX 2HQHA 2LQNA 3I56Q 1Q81R 2KGTA 3ZEHA 3CBMA 3TSWA 1B3QA 1D09B 1RLQC 2V8IA 4PFOA 4F7UE 4C0FA 4XU3A 2X4JA 4E7JA 1PG5B 1RI9A 1TUGB 2YHTA 1I4K1 1UE9A 4XQ3A 2ROTA 4HVVA 3FB9A 3CCUQ 2EIFA 3EFOA 5IXFA 1QKWA 3VS7A 2O31A 1U8RA 3UA6A 3M0SA 3QPHA 2AZSA 2DZCA 3OBWA 4DOVA 4LUEA 2GTOA 2L8DA 5GAMg 1YJWA 1WHMA 3M53A 1SG5A 5GMKe 3OSVA 1YP5A 2M0OA 3X25B 3DLLA 2A36A 6AT1B 4ZN1A 4M4ZA 2F5TX 2DF6A 2BIVA 2YUOA 5CQXA 4A54A 2DPPB 2RI2A 1ZA2B 2J06A 3EG2A 4M75F 2CH4W 1T3LA 4PJOG 2DX1A 4PKCC 1OQKA 1ZUYA 4ZTFA 1SHFA 2VYTA 4IIOA 1WNLA 3Q1JA 1Y71A 3EGDA 2LP5A 4C92D 4C5IA 4B9XA 4FCYA 1SRLA 4JRIA 3L2QA 1SHGA 5GAN4 1QP3A 1K8AU 1VQPT 2DRKA 4RTYA 2PUKB 4AFZC 1YJNQ 2HBWA 2CSIA 4F7UG 2LQKA 1QCFA 3URGA 2AKKA 1K8AR 1UGSB 2CP2A 3JCMV 5IN1A 5CIUA 1UJYA 8ATCB 1YI2Q 2H3EB 1WHLA 2EGCA 1U1TA 4KGXB 1QVPA 4RG2A 1JXMA 3JB9D 2NYSA 1VQOA 1NLOC 3G4SQ 2QQAA 1M4ZA 2SEMA 2ZGWA 3C95A 2FRYA 3ME9A 5GAOq 3CCSQ 1YJWT 2DETA 3LGLA 1OEBA 3CCRT 1VQ7A 1RLPC 1M3BA 3CMET 1QMCA 2D0NA 2DM1A 5GMKh 1K8AC 2YUNA 4CC2A 4PNOA 4HVUA 4A4HA 1Q7YU 1NYGA 3P8DA 1RI0A 2E4HA 3TU4K 2JTEA 4M78F 3VRYA 1PRLC 3V8LA 4FSSA 2HCKA 5FROA 1BI2A 2JMCA 1TXQA 1FWZA 1Q7YR 3S3MA 2EVRA 3OS2A 4V2SA 1EIFA 1ARKA 3HSBA 4FT2A 4JUVA 1GCQA 2L3SA 2C0OA 4J9GA 2PVOB 3PGGA 1VA7A 4NL2A 3J81E 1M27C 5KCHA 2P0KA 2EKOA 2C06A 4F14A 2AKLA 3JCMd 2DXBA 4ME7A 1RAGB 1AZEA 1MMDA 2V1RA 3LGFA 3S3NA 1JRIA 3L2ZA 3OS0A 2EGAA 3PTAA 3RMSA 2RA2A 4ZGDB 2HMAA 1TG0A 2CUDA 2KXCA 5FW9A 1VQOT 2V26A 1W4SA 3G7ZA 3L2UA 4UC4A 3AT1B 1VQNQ 1H92A 2K5FA 1I5OB 4J6WA 2OAWA 1IB8A 4RTZA 5I2MA 1VQ7T 2XHCA 3DB4A 5GAN2 2HD0A 4IUUA 2XKOC 1VYUA 5CKBA 2DYBA 3OYBA 2X9HA 5LL6S 4Q5WA 1XNIA 1YIJT 4PJOF 1M8VA 3CCQT 1YWOA 3GNFB 4PJNA 1R77A 3TSZA 1QKXA 5GANg 4FT4A 4CC7A 2QQRA 2KRMA 1UFFA 1OX8A 1D0XA 2X4YA 4J6XA 3CCJT 4MZTA 2E3IA 2DTHA 3EHRA 4IUQA 1E6HA 1VOMA 4M77E 3PIPA 2RH2A 2O4XA 2CP3A 5CO7A 1ZSZB 2LJ1A 1OU9A 4A4EA 1VQMT 4JLGA 4BI8B 3VRZA 3VYGA 4MDWA 4N0AA 1HYOA 1UJ0A 2BKDN 4C5EA 3G71A 5GMKj 4OB0B 3QG1A 2OTLT 1YHQT 2MWPA 3VKIA 4HA8A 3NTIA 1OZ2A 3HFNA 3I56A 2IPOB 4MMKA 5A2QE 2K79A 4J8OA 4AFQC 5LJ3g 1PSFA 5LJ5d 1JJ2A 8AT1B 1ABQA 4C0DB 1NYFA 2L3RA 3FLGA 5KYXB 4AMCA 2ZZDA 4QVDA 1YNZA 2V8JA 3EFSA 3CCRQ 2H8HA 1ZSZA 2YLBA 4OMOA 2R57A 2JZ2A 3EH1A 1B07A 1Q86U 4JPBW 4XU0A 3NTKA 3CCMQ 3RR6A 1X27A 1BK2A 3G1JA 1UB4A 3CCEQ 3HTRA 4B9WA 1S72T 3MEAA 5GAN6 5FU7B 1ZHIA 1Q86R 4RKUE 4JRKA 1FMKA 5GAN3 5CQYA 4XAXB 4BDZA 2QAZA 5CR2A 1WI7A 3FDRA 3E1SA 5CKDA 3CC7T 1NEGA 2DL4A 3V7CA 1SSHA 1CKBA 4J83A 2HQXA 4Z89A 1NLPC 1WQ7A 3CD6Q 1FYNA 2E12A 2M16A 3CEYA 2CT4A 3JCMQ 5KYXA 1BKBA 1W6XA 3QDFA 1UTIA 2KRNA 3G71T 2MWOA 3MJXA 1I8FA 4M75E 3HFOA 1X6BA 4NL3A 2R5AA 2EYWA 2KY9A 3ULRB 1K0SA 1YJNA 3RNJA 3RDVA 3I56T 2VXFA 3ZL7C 2ZAEA 1M1KU 1Q86C 3EG9B 2HBPA 2ZPHB 4KGVB 1N5ZA 4Z02A 5L23A 4AFUC 2DKGA 3CPWA 3OB9A 1BBZA 2B8AA 1M1KR 2E6ZA 2EQMA 1KQ2A 2JS2A 3CCUT 4BY6C 5IXBA 2K3XA 1GXIE 1WGSA 3KBGA 4D6WA 2J6OA 1K9AA 2VGMA 1IGQA 1GCPA 4DEYA 5LJ5g 1MGQA 2RK2A 2GNCA 3JB9J 1M3CA 4RCCA 2NUPA 1TOVA 2BZYA 5D6YA 1VQKA 2HZYA 1MNDA 5GAMh 3MEVA 3H0FA 3EG9A 2C0IA 2EYQA 2A7YA 1IREB 3UWNA 1VQ4Q 1D0ZA 1OYXA 3GPLA 1M1KC 4ZGEB 2CGHA 1M5Q1 5KE3A 4DBFA 1C1AA 3OYFA 2GF7A 1I0CA 2M02A 2DBKA 2F1LA 2KYMA 1VQ8Q 2QI2A 2QQ9A 2DD5A 5CK9A 4M78E 2H3JA 2K5IA 4M7DB 5J26A 1X2QA 3QYHB 3LWIA 1YJNT 2L89A 4ZNXA 2JTMA 2K6DA 4LN2A 3P8BB 5IT9E 2HKNA 1QVFP 3RERA 2PUOB 2CP7A 2OTLQ 2ENMA 1ACMB 3INZA 1YI2T 3A8MB 1I07A 1GBRA 4M7AB 1NZ9A 2KMTA 2LJ3A 1RAFB 2ZPGB 2RJDA 1VQ6T 2DE0X 1VQNA 3G4ST 4PLLA 2K3BA 4GLKA 4C8QB 5GAMd 1QCNA 1TTHB 3CXCA 1YJ9Q 5D7UA 3CCST 1SEMA 5C0MA 1N6AA 5I2SA 3TEEA 4M7DA 3QHSA 4Z88A 5EC7A 4X9DA 1YITQ 3CMAQ 5KYNA 4J9DA 1OZ3A 2KBTA 2XDPA 2M1HA 4C92C 3H8ZA 2E41A 1NBEB 3OSSC 3GP8A 3ASKA 1AWOA 4XTVA 2PVDB 1U5SA 1EFNA 2DIQA 2NWMA 3HRTA 4WTOB 4M7AA 2LQ8A 2BTTA 4IUPA 3EFRA 2D8JA 3G6EQ 4RTWA 2BE9B 5CVIA 3CC7Q 4ANJA 2ABLA 3M4GA 4C8QA 2QK0A 2COZA 3CCLQ 3QZ9B 1KC8U 2RI3A 1N9SA 2JN0A 3EG3A 1J3TA 3VYHB 4PJOE 2LNHB 1GL5A 2CKKA 2ZCFB 1WXTA 4ESRA 2KNBB 5EG2A 4CRIA 4LUDA 2QDYB 2FB7A 3VUBA 1KC8R 2M0YA 4BD3A 1VQPA 4LDYA 1BB9A 2OX7A 1Y0MA 2I0NA 3PNWC 3VS0A 1T0JA 4DEXA 2RF0A 1ZQ1A 2E10A 2EKHA 1SKUB 5GAMj 3EGXB 4RCBA 4MMLA 3H0HA 2V1QA 1VQNT 4JJBA 2QA4Q 2QQSA 3JCMe 1UHFA 5FLXE 3EGDB 3S6WA 4OMNA 4KUDK 5FU6C 1PKTA 5CAIA 4PFPA 3D7SB 3QYGB 1WZOA 2MOXA 1ZA1B 2FPFA 2ED1A 1AVZC 4M77C 1YFNA 2CZ7B 2RPNA 1KC8C 3DB3A 2DTOA 4JZ3A 3M55A 4ELYC 3CCRA 2RHIA 2KI7A 3RUXA 3CMEA 4E47A 2EQKA 1U1SA 1Q81C 5KYWB 3I55Q 3CCMA 1B7TA 2AZVA 4ELZC 1Q95G 3EGXA 2B86A 3OYCA 4C5HA 1T3SA 3OYKA 2QASA 4DBHA 4C92B 3OYDA 2A0FB 1B34B 1F1BB 5GANh 1AT1B 2O2OA 1IO6A 3LLRA 3HHTB 2YSQA 4Y92A 1BYMA 2X4WA 3BE3A 4NOYA 1H3HA 1WJRA 2E6NA 3GBQA 3M0TA 1VIEA 1KFZA 4Z8AA 4F17A 3KUFA 1YCYA 1ZBXA 1G2BA 2GQVA 3FRNA 1H641 1M2OA 4OMQA 3SWNB 2D6FA 4VUBA 5KYWA 1WQWA 1KQSA 4M7DG 3JCMh 4FW1A 3FEOA 4LXCA 2JS0A 3RKWA 5CKEA 2WSEE 3JCMf 2IIMA 3ER0A 4C92A 3M4YA 2DJQA 2XIDA 3OYYA 1PRMC 1VUBA 4F04B 1VQ6Q 3R6OA 1B34A 2F69A 3ZFJA 1UGVA 1X6OA 3EG0A 5LJ3h 1QVGA 3SEMA 1N8RU 1M9SA 4E7HA 2A3LA 2YUPA 1X2KA 2XI9A 3CCMT 4M75C 3OYGA 1OU8A 5LJ5e 5GANd 3CCET 4C8QG 1N8RR 3SWNA 1V1CA 3TQ7P 1JJ2S 2CP5A 2XK0A 1QW1A 2LDMA 2OI3A 3OW2A 1G3SA 1DJ7B 1YIJA 2DYIA 1VQ4A 1PC0A 1WJSA 4M77D 3VS1A 5DLQE 2W10A 3CCQA 4CC4B 1KG1A 3JV3A 3DLMA 4HCKA 3CC4Q 3CD6T 2R58A 2XU8A 3EH2A 1K73U 2C0TA 2PU9B 3L42A 4Y91A 1VQ8A 2K3YA 2MMPA 3CCJA 4ZTJA 1HK9A 1OX9A 2RO0A 3QO3A 4XTZA 1K73R 1W70A 2EFIA 1ZBJA 1N8RC 5C6SA 1VQMA 2YT6A 1AWXA 2VWFA 5LJ3d 3F70A 4XTYA 1Q7YC 4PJMA 2OTLA 4BDYA 5GMKm 1IRXA 2WACA 1YHQA 3CQTA 2PTKA 3QSUA 1UGPB 2OAUA 4HCBA 2SRCA 2DL3A 4FSXA 2JOYA 1U3OA 3H6ZA 2LX9A 1PKSA 1M30A 4OMLA 1S1NA 2RD1A 2G3RA 5GANj 2O4XB 1WLPB 4M78C 3M57A 2KVQG 1K73C 2FVUA 3OS5A 3CMAA 3M0PA 1K0XA 2RJFA 5LJ5h 1HXDA 3L2RA 2E5KA 2KT8A 2NLUA 5LJ5f 2QGGA 3I5SA 1VQ4T 2JTFA 4OGCA 1VQ5Q 3VV0A 3P8HA 1W2BA 3RKYA 4EMGA 2EJFA 1KSWA 1RAEB 1S72A 2DBMA 2PQWA 4QQGA 1LVKA 1VQ8T 3E9FA 3EAEA 4M75D 1I81A 3CC7A 5IHNA 2VV5A 3VS4A 3MKDA 4DOWA 3CCLA 5LJ3j 3BY7A 2JM9A 2KSSA 2E64A 4P5NA 1XTDA 2O01E 1JO8A 1GRIA 4JJCA 1TH7A 1WHGA 4M7DF 1PHTA 2LVMA 5GAOr 3E2UA 1Q82U 1MV3A 3SB2A 4QKUA 2HL5C 1FXXA 1JQQA 4A4KA 2RNAA 3SD4A 2K2VA 1MMNA 1Q82R 1RUWA 2QA4A 5FRMA 1YJ9T 4WCIA 2ECZA 2YXYA 3M59A 1VIFA 4M7AF 3FJPA 3V7RA 2LX7A 2L3PA 2K5LA 1YITT 3CMAT 3CCUA 2YLCA 3RIRA 1VYTA 1YWPA 2DFUA 4PJOC 3JB9G 4C8QF 2L5QA 3NMZC 4EPCA 3OQ5A 3JRZA 4AG2C 2KXDA 4AT1B 1R0BG 5DM7R 5GAMe 4WF2A 1WHHA 3FIFA 2D8HA 3CXCS 3JCMJ 3BFMA 1RAIB 4M78D 5HCKA 2VASA 1Q82C 3G6ET 4JJDA
chains in the Genus database with same CATH topology
5CQXA 4BB7A 4A54A 2DPPB 2RI2A 2KMTA 2RHZA 3A5ZB 2DZ9A 2VUBA 4C0DC 2ZPGB 2RJDA 3HKSA 4M75F 4XK8E 5KCOA 1VQ6T 1VQNA 3CCLT 3C12A 4PJOG 5DLOA 3G4ST 4PKCC 4PLLA 1YJ9A 2RB6A 3JCMW 4ZTFA 3WVEB 3LYIA 3BDUA 4GLKA 2VYTA 3OMCA 4C8QB 2DIGA 1D3BA 5GAMd 1WNLA 3HRUA 3Q1JA 5GMKl 3CXCA 1Y71A 3CCST 2RJEA 5L8RE 4C92D 1N6AA 5C0MA 4C5IA 5I2SA 3CPWS 3J80E 2M9UA 4LD9K 3TEEA 4B9XA 2I2LA 2GCXA 4M7DA 3QHSA 4CI0C 4JRIA 3PMTA 4X9DA 3X26B 3L2QA 1XOVA 2V8KA 2WSFE 4JRQA 2YRVA 4N4GA 3ZBDA 5GAN4 1QP3A 1K8AU 3L1AA 3HPWA 1OZ3A 1VQPT 2XDPA 2LT4A 2M1HA 3OMGA 5LJ5j 4C92C 2PUKB 3H8ZA 5FU7C 2E41A 3OSSC 3GP8A 3MP8A 3ASKA 1Y07A 4XTUA 4F7UG 4BE0A 2LQKA 3URGA 4XTVA 2PVDB 2C06A 2QA4T 4IKFA 4M75B 2DIQA 1UGSB 4II1A 2EQUA 3HRTA 3JCMV 2K57A 4MZMA 5IN1A 1YI2A 2QQBA 5CIUA 1NPPA 4M7AA 3G6EA 2LQ8A 3CCVT 2QEXA 3PT9A 2BUDA 4IUPA 3EFRA 5AYFA 3NFCA 1M1GA 1M1FA 5CVIA 1VQ6A 3WXMB 1U1TA 1QVPA 3M4GA 4RG2A 5GAOl 3G4SA 2MF2A 2MAMA 3M56A 3JB9D 4C8QA 1VQOA 2DXTA 2Y4YA 3QZ9B 1KC8U 2RI3A 2QQAA 3MO8A 1N9SA 1BI1A 1M4ZA 2JN0A 3VYHB 4C92G 5GAOn 3CCSA 4PJOE 2ZGWA 3C95A 4XU1A 3ME9A 2CKKA 4OVAA 2ZCFB 3GF5A 3E19A 5GAOq 4A53A 1YJWT 2EWNA 3LGLA 5EG2A 3CCRT 4CRIA 2ZPBB 2VGNA 2QDYB 3A8HB 1VQ7A 4Y28E 2FB7A 1V29B 2RHXA 3VUBA 3I55T 4E7LA 4EMKC 3CMET 4BD3A 2E65A 1VQPA 4LDYA 5D6WA 4ATOA 3V8KA 3OYIA 4F7UF 5GMKh 4TVRA 3PNWC 3OBYA 5GAMf 5HK0A 1K8AC 1SSFA 4PNOA 4A4HA 1ZQ1A 2E10A 3P8DA 1RI0A 4ZN3A 3TU4K 1Q7YU 4MDXA 5GAMj 1LJOA 2LCCA 4JDSA 4RCBA 2K4YA 4M78F 4M75A 4MMLA 3V8LA 1VQNT 1KQ1A 4PJOD 5FROA 2OTJA 1BI2A 3JCMg 2QQSA 3JCMe 1FWZA 2JVVA 1Y96A 4QQ6A 2DJZA 4C0GA 5FLXE 3PFSA 3S3MA 3OYAA 2DVEA 3OS1A 3SFMA 3S6WA 4KUDK 3FC3A 5FU6C 4N4IA 2DEQA 3OS2A 5CAIA 4V2SA 1EIFA 4BE2A 3HSBA 4FT2A 4JUVA 4C92F 3N5BB 2PVOB 3QYGB 3PGGA 4N4HA 4NL2A 4F7UB 3MCAB 4M77C 3J81E 5KCHA 2P0KA 2CZ7B 3HL8A 3QIIA 2EKOA 3A8LB 3DB3A 2DTOA 4J5YA 4R56A 3OYHA 1JB0E 3L2WA 3OYEA 1KC8C 3JCMd 3M55A 4ELYC 3CCRA 3PIOA 2F5KA 2RHIA 2D0QB 4M78B 2FYKA 1VQ9A 3RUXA 2DXBA 3I55A 3PMIA 4ME7A 2LC4A 4E47A 5GAN8 3CMEA 3QZ5B 4BUGA 4HKEA 5D6XA 2EQKA 1U1SA 1Q81C 3QDRB 3X24B 3LGFA 5A0DA 3OY9A 3S3NA 4FL6A 3CCMA 1JRIA 2QEXT 3L2ZA 4ELZC 3OS0A 3PTAA 3RMSA 2RA2A 4BI4A 2RM4A 3QUIA 3OYCA 4ZGDB 1NPRA 1H3ZA 4KBMB 4OB3B 1FX7A 3HRSA 4C5HA 1NJIU 3OYKA 1VQOT 2AHJB 1WJQA 1W4SA 3G7ZA 4C92B 3L2UA 4UC4A 3GLXA 3OYDA 1O9SA 4BACA 4M7DC 2K5FA 4OGEA 4QVCA 3MHXA 3OA6A 1B34B 3A8GB 4J6WA 5GANh 4M77G 3JB9F 1UGQB 1X75C 2QTXA 3LLRA 2KDSA 3HHTB 2DK3A 2XG8D 2EQJA 4E7KA 5I2MA 4OF1A 2CZ6B 3AHUA 1KQSS 1VQ7T 1G3YA 3C94A 1BYMA 5CCAA 2X4WA 4J7IA 2XHCA 2JNGA 3DB4A 3OYLA 3LWHA 4NOYA 5GAN2 2VXEA 4F7UA 2HD0A 1WJRA 2E6NA 4IUUA 1VIEA 4JRPA 5GAN5 2XKOC 3M54A 3KUFA 2R5MA 4A4FA 4BY6B 5CKBA 3OYNA 3OYBA 2E70A 1YCYA 1ZBXA 5HK3A 2HAXA 5LL6S 3JB9H 2GQVA 4GY5A 4Q5WA 4M78A 3FRNA 1H641 2WSCE 3SWNB 4M7AC 3M9QA 3VJPA 1XNIA 2OTJT 3VU3C 2D6FA 4VUBA 2X4XA 3CBOA 1WQWA 1KQSA 2ZPEB 3O8VA 1VQ5A 1QVGS 4M7DG 5GAN7 1YIJT 1Y96B 3JCMb 4O6JA 3JCMh 4PJOF 1M8VA 3FEOA 1KHIA 3CCQT 1WPYA 3CPFA 4C8QC 2EAYA 3MP6A 3RKWA 3CC4T 3GNFB 5CKEA 2WSEE 3JCMf 3JCMX 3ER0A 4C92A 3M4YA 2XIDA 5GANg 3OYYA 4FT4A 1VUBA 3E9GA 5GANe 2QQRA 3R6OA 1B34A 3QJYA 2KAFA 2F69A 3A8OB 5A0GA 2X4YA 1NJIC 3ZFJA 4XTWA 1YITA 4J6XA 1IZ6A 1X6OA 3CCJT 5LJ3h 4MZTA 3KXTA 1QVGA 3LW5E 2DTHA 4FU6A 3OW2S 4IUQA 1VQ9T 1N8RU 2D9TA 4M77E 3PIPA 1X01A 1M9SA 2RJCA 4QVZA 2RH2A 2FL7A 2A3LA 1JBMA 2O4XA 2CS7A 2Y4XA 4E7HA 4FIBA 5CO7A 2DXCA 4OMFB 2P0PA 2XI9A 3CCMT 4A4EA 1VQMT 3MEUA 4M75C 4JLGA 3OYGA 4BI8B 3VYGA 4MDWA 4N0AA 5LJ5e 5GANd 4PJOB 3CCET 2BKDN 4C5EA 3DKMA 2LRQA 3SWNA 4C8QG 2MI6A 4HCZA 4LD6A 3G71A 5GMKj 4OB0B 4XU2A 3HP9A 3QG1A 1JJ2S 2OTLT 2XK0A 1QW1A 2LDMA 3QXEB 3OW2A 1YHQT 1G3SA 1DJ7B 4BI3A 2MWPA 4LDUA 3VKIA 3JCMP 1YIJA 4HA8A 1VQ4A 3NTIA 1OZ2A 1WJSA 4M77D 2JUFA 3HFNA 5DLQE 3JB9I 3I56A 3CCQA 3S3OA 1G5VA 3JSCA 4EMKA 3CC4A 4MMKA 1KG1A 4HT9A 4M7DE 5A2QE 1OI1A 3DLMA 3MP1A 3CD6T 2R58A 4J8OA 2FHDA 5LJ3g 1PSFA 5LJ5d 1JJ2A 2XU8A 3X20B 3L2VA 1K73U 5LJ3e 4KT0E 2KQWA 2PU9B 2PVGB 3L42A 5CKFA 4Y91A 4C0DB 1VQ8A 2K3YA 2MMPA 3CCJA 4M75G 4ZTJA 3OYMA 3MEWA 4PL6A 4NS5A 2L3RA 1HK9A 3FLGA 2RO0A 2ZZDA 1KD1U 4QVDA 3META 2GFUA 3QO3A 4XTZA 1M90U 4J7FA 2XDBA 4LDVA 2V8JA 3EFSA 5HY6A 3JAME 4KUIA 2YLBA 2GFAA 2R57A 3GNGA 2EFIA 2JZ2A 3BDLA 4C0ZA 4ZGJB 1VQ5T 1N8RC 1BIAA 5C6SA 1VQMA 4M7DD 1Q86U 4E7IA 4EMHA 4XU0A 3SDZA 4DQ2A 5J39A 4HT8A 4M7AE 4PJOA 3NTKA 3C4SA 3M58A 3CCEA 2LNVA 5LJ3d 3F70A 4XTYA 2HNIA 1Q7YC 2OTLA 1UB4A 3UT1A 5GMKm 4BDYA 4B9WA 4JLIA 1S72T 2WACA 3MEAA 4JS4A 1YHQA 5GAN6 1LNXA 5FU7B 1ZHIA 5HKCA 3M5AA 4C8QE 3QSUA 4RKUE 4JRKA 1UGPB 4MZPA 4A4GA 2OAUA 3QKJA 4HCBA 5A0LA 5GAN3 4FSXA 5CQYA 5FRNA 4XAXB 4BDZA 2JOYA 3CC2T 5KE2A 5GANf 3H6ZA 4QQDA 5CR2A 4L5GA 5GMKi 2LX9A 3FDRA 3E1SA 5CKDA 1G3WA 5IAYA 3CC7T 4PLIA 3J7AF 3V7CA 2RD1A 2X35A 3T9NA 2CYZB 3CD6A 4M7AD 2G3RA 5GANj 4J83A 2HQXA 2RI5A 1VQLA 2O4XB 1WQ7A 4M78C 2E12A 2M16A 2ZPFB 3M57A 4YTLA 2KVQG 1W2BS 3CEYA 3JCMQ 1K73C 1I5LA 1BKBA 2FVUA 2Y90A 3OS5A 2E5QA 2ZPIB 3CMAA 4C8QD 3CBPA 4X34A 2MWOA 2RJFA 5J3BA 5LJ5h 3G71T 1I8FA 1HXDA 2RHUA 4M75E 3VUZA 3HFOA 1K9MU 1VQKT 3L2RA 1KD1C 3TCJA 2R5AA 4NL3A 5LJ5f 2NLUA 1M90C 3RMQA 2EJ9A 2KY9A 5M9OA 2HQEA 1YJNA 1VQ4T 5I21A 1QVFS 1QP2A 2JTFA 4OGCA 3I56T 4L6V5 2VC8A 3VV0A 2VXFA 5GAOm 1M1KU 1Q86C 3P8HA 1W2BA 2KK4A 2HBPA 4EMKB 2ZPHB 3UPUA 3RKYA 4EMGA 1YBYA 2EJFA 4Z02A 2DXUA 1S72A 4M77F 2LTOA 1UGRB 2DKGA 2PQWA 4R55A 2DAQA 3CPWA 4QQGA 3OB9A 5CKHA 4IURA 4J6YA 1VQ8T 3E9FA 2B8AA 3EAEA 4M78G 4M75D 3CC2A 1I81A 5KH6A 4LDWA 2E6ZA 4C5GA 3GIBA 2EQMA 1KQ2A 1UEBA 1BI0A 2DO3A 1NE8A 1QVFA 5LJ3f 3CC7A 3X28B 3CCUT 4BY6C 4QW2A 2VV5A 1GXIE 2K3XA 4DOWA 4M7AG 4RMOA 1WGSA 3CCLA 1AHJB 3BW1A 5LJ3j 3KBGA 3BY7A 4N0AC 4L59A 3RKXA 1BIBA 1R8OB 4D6WA 3RESA 3SWNC 2KSSA 4JJNK 2E64A 2VGMA 4BE1A 3LH0A 2EJGA 5FU6B 1MGQA 4P5NA 5LJ5g 3TREA 2RK2A 1XTDA 4LDXA 3JB9J 2O01E 1TH7A 4RCCA 2DD4A 1LOJA 4M7DF 1O75A 2P0QA 2LT1A 2LVMA 5D6YA 1VQKA 3WVDB 1Q81U 4M77B 5GAOr 3QBYA 1Q82U 2XICA 5GAMh 3UDCA 3JCMc 2RK1A 3SB2A 2CZ1B 4DA4A 1K9MC 4IUTA 3MEVA 4RG8A 1FXXA 4HCCA 3V7SA 2EYQA 2CZ0B 2A7YA 1IREB 1P92A 3UWNA 3NTHA 2IG0A 4A4KA 1OYXA 5DY9A 3SD4A 3GPLA 2K2VA 3ZEHA 3CBMA 1MHNA 1M1KC 1N9RA 4ZGEB 2QA4A 5FRMA 4X9CA 2CGHA 1VQLT 1M5Q1 2V8IA 5KE3A 1YJ9T 1RL2A 3OYFA 4F7UE 2GF7A 4C0FA 4O5VA 4XU3A 2X4JA 4E7JA 3LX7A 4M7AF 3M59A 1VIFA 1D3BB 3CCVA 1N27A 3FJPA 3V7RA 2IVWA 2QI2A 2QQ9A 2DD5A 2K5LA 5GAOp 1YITT 3CMAT 2YHTA 4XTXA 3CCUA 2YLCA 5CK9A 4OB2B 1I4K1 4M78E 2H3JA 2K5IA 4XQ3A 1Y7XA 3RIRA 4M7DB 3GOXA 2LCLA 3FB9A 4PJOC 1PSEA 5J26A 2EIFA 3JB9G 4C8QF 2L5QA 3QYHB 2QXFA 4EPCA 3LWIA 3OQ5A 3QJ6A 1YJNT 1U8RA 2L89A 4KULA 3OYJA 2JTMA 3QPHA 2DTIA 3JRZA 2DZCA 3OBWA 4DOVA 4IUVA 3P8BB 2L8DA 5IT9E 2RHYA 3V8JA 5GAMg 4FM4B 3RERA 5DM7R 4OB1B 2PUOB 2XDDA 5GAMe 1YJWA 4M77A 4WF2A 3FIFA 3M53A 4C92E 5GMKe 2P4TA 3OSVA 4EDUA 3CXCS 2M0OA 4OP0A 3X25B 3DLLA 1G3TA 3JCMJ 1KHCA 3BFMA 3INZA 4ZN1A 4M78D 1YI2T 2E1HA 2F5TX 3A8MB 1Q82C 2XD0A 3G6ET 2BIVA 4JS5A 1XQHA 4M7AB 1NZ9A 1BI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OS2 A;  2RI2 A;  2JTF A;  2RHZ A;  4BE2 A;  4A4E A;  2RJD A;  3MEU A;  5KCO A;  3OYG A;  3P8H A;  4N4H A;  4PLL A;  4Z02 A;  2BKD N;  4ZTF A;  4C5E A;  2LTO A;  2LRQ A;  2PQW A;  2VYT A;  3LYI A;  3OMC A;  2DAQ A;  2DIG A;  2P0K A;  3QII A;  4HCZ A;  2EKO A;  4LD6 A;  3DB3 A;  4QQG A;  3OB9 A;  3Q1J A;  4QVZ A;  3OYH A;  2XK0 A;  3OYE A;  4IUR A;  3L2W A;  2LDM A;  2RJE A;  2F5K A;  3E9F A;  2B8A A;  2RHI A;  3EAE A;  4C5I A;  5C0M A;  2MWP A;  4B9X A;  5KH6 A;  3PMI A;  4C5G A;  2EQM A;  3PMT A;  3L2Q A;  3NTI A;  5D6X A;  1OZ2 A;  1WJS A;  2EQK A;  3LGF A;  2YRV A;  4N4G A;  3OY9 A;  4FL6 A;  4QW2 A;  3S3N A;  3S3O A;  2K3X A;  1G5V A;  1OZ3 A;  1WGS A;  2XDP A;  3OS0 A;  2M1H A;  3OMG A;  1OI1 A;  3DLM A;  4L59 A;  3H8Z A;  3MP1 A;  3OYC A;  5KCH A;  2R58 A;  2FHD A;  3MP8 A;  4BE1 A;  3LH0 A;  3ASK A;  1H3Z A;  3L2V A;  4BE0 A;  4C5H A;  3OYK A;  3L42 A;  1WJQ A;  2K3Y A;  4ZTJ A;  4IKF A;  3L2U A;  4UC4 A;  3OYM A;  3MEW A;  3OYD A;  4BAC A;  4PL6 A;  3OA6 A;  4NS5 A;  2L3R A;  2DIQ A;  3FLG A;  2LVM A;  2RO0 A;  2EQU A;  4II1 A;  5D6Y A;  5IN1 A;  3MET A;  5CIU A;  2GFU A;  3QBY A;  3LLR A;  2EQJ A;  4E7K A;  2BUD A;  4IUP A;  4IUT A;  2GFA A;  2R57 A;  3MEV A;  2JZ2 A;  2EFI A;  3BDL A;  2X4W A;  5C6S A;  3DB4 A;  3OYL A;  3UWN A;  4E7I A;  3NTH A;  5J39 A;  2IG0 A;  1WJR A;  2E6N A;  1OYX A;  4RG2 A;  3SD4 A;  3NTK A;  4IUU A;  3C4S A;  3ZEH A;  1MHN A;  3KUF A;  2R5M A;  4A4F A;  3F70 A;  5FRM A;  3OYN A;  3OYB A;  2RI3 A;  5KE3 A;  3MO8 A;  4BDY A;  3UT1 A;  4GY5 A;  4Q5W A;  4B9W A;  3OYF A;  2GF7 A;  2WAC A;  3MEA A;  4E7J A;  3LX7 A;  3M9Q A;  3ME9 A;  1XNI A;  2CKK A;  4OVA A;  4A4G A;  1N27 A;  3QKJ A;  3LGL A;  2X4X A;  4CRI A;  5FRN A;  4BDZ A;  3O8V A;  2RHX A;  5KE2 A;  4E7L A;  4BD3 A;  3H6Z A;  4QQD A;  5D6W A;  3GOX A;  3OYI A;  3FDR A;  5IAY A;  5J26 A;  3FEO A;  3PNW C;  4PLI A;  2X35 A;  3MP6 A;  2G3R A;  1SSF A;  3OQ5 A;  2HQX A;  2RI5 A;  2L89 A;  3QJ6 A;  4A4H A;  3OYJ A;  3P8D A;  1RI0 A;  2O4X B;  2LCC A;  2M16 A;  3E9G A;  4IUV A;  2QQR A;  2L8D A;  3CEY A;  2RHY A;  2X4Y A;  5FRO A;  2E5Q A;  2QQS A;  4X34 A;  2MWO A;  2RJF A;  4QQ6 A;  4EDU A;  2RHU A;  3PFS A;  3S3M A;  2M0O A;  3OYA A;  4FU6 A;  4IUQ A;  3L2R A;  1KHC A;  3OS1 A;  2R5A A;  3S6W A;  2NLU A;  2D9T A;  3FC3 A;  2BIV A;  5M9O A;  2HQE A;  2RJC A;  4E7H A;  4N4I A;  2O4X A; 
#chains in the Genus database with same CATH topology
 4BB7 A;  3A5Z B;  2RHZ A;  2DZ9 A;  2VUB A;  4FYW B;  3TVT A;  4XK8 E;  5KCO A;  1T0H A;  2F2V A;  5I22 A;  3CCL T;  4OMP A;  3C12 A;  2RB6 A;  1MNE A;  1UHC A;  3BDU A;  3OMC A;  2DEU A;  2DIG A;  4F16 A;  1VQL Q;  2LJ0 A;  2PZ1 A;  3HRU A;  5GMK l;  5IH2 A;  3QWX X;  3VS6 A;  2M9U A;  2NUP B;  1KJW A;  2V8K A;  2EPD A;  2HSE B;  3IQL A;  2FRW A;  3ZBD A;  2P4R A;  3UA7 A;  2JXB A;  2LT4 A;  3OMG A;  5LJ5 j;  3MP8 A;  2MYS A;  2BZ8 A;  4BE0 A;  2QA4 T;  2O9S A;  2EQU A;  1YI2 A;  2QQB A;  3VS2 A;  2BUD A;  3REB B;  3NFC A;  1M1G A;  1M1F A;  1RAC B;  4J9C A;  1VQ6 A;  4JZ4 A;  3G4S A;  1H8K A;  2DXT A;  1OOT A;  2YRC A;  2JT4 A;  2ESW A;  5GAO n;  3CCS A;  2J6F A;  1X6G A;  3RBB B;  4DBQ A;  1WDX A;  4A53 A;  4DBR A;  2VGN A;  4Y28 E;  2JMA A;  2RHX A;  1V29 B;  3I55 T;  4EMK C;  2E65 A;  4ATO A;  3OYI A;  4TVR A;  3OBY A;  5GAM f;  1WHJ A;  1IXD A;  1SSF A;  4MDX A;  2LCC A;  2K4Y A;  9ATC B;  1UDL A;  1SF9 A;  2KYB A;  2EYY A;  4FW2 A;  4PJO D;  1R0C B;  1Y96 A;  3EG1 A;  4E7Z A;  3PFS A;  1ZUU A;  3CCV Q;  4N4I A;  2DEQ A;  4BE2 A;  4C92 F;  1PNJ A;  1TUD A;  3N5B B;  2HKQ B;  4F7U B;  3FJ5 A;  3MCA B;  4J5Y A;  3HL8 A;  4R56 A;  1JB0 E;  3L2W A;  3OYE A;  2DMO A;  1AEY A;  2MPX C;  1MMG A;  2FYK A;  2QDL A;  5GAN 8;  2LC4 A;  3QZ5 B;  3QDR B;  4FL6 A;  2O9V A;  2Z0W A;  1JU5 C;  4BI4 A;  1NPR A;  4OB3 B;  1FX7 A;  1CKA A;  1NJI U;  2AHJ B;  1WJQ A;  4QT7 A;  2A28 A;  3OA6 A;  4QVC A;  3MHX A;  3A8G B;  3JB9 F;  1FMV A;  1M2V B;  2QTX A;  2KDS A;  2EQJ A;  2FZG B;  4E7K A;  1NJI R;  1U06 A;  3AHU A;  1A0N B;  1KQS S;  2CH4 A;  5CCA A;  3OYL A;  3LWH A;  4F7U A;  3OW2 P;  4GLM A;  4KH1 B;  4JRP A;  5GAN 5;  4BY6 B;  4A4F A;  2R5M A;  2E70 A;  5HK3 A;  2HAX A;  2MCN A;  3UF4 A;  2LMJ A;  1JEG A;  4GY5 A;  4E2F B;  3M0R A;  4KH0 B;  2LZ6 B;  2WSC E;  1UG1 A;  2ZPE B;  3O8V A;  4AFS C;  1VQ5 A;  2L2P A;  1QVG S;  5GAN 7;  1KHI A;  2EAY A;  2QEX Q;  3CC4 T;  3JCM X;  2X3W D;  4J9H A;  1AOJ A;  2ROL A;  1WFW A;  2HL3 A;  2JM8 A;  2CRE A;  3E9G A;  5GAN e;  2GBQ A;  2HDA A;  3QJY A;  1NJI C;  2YUQ A;  1ZUK A;  4XTW A;  1IZ6 A;  1M2V A;  3KXT A;  3OW2 S;  2CP0 A;  2L0A A;  1WIE A;  3A1P A;  4AG1 C;  2RJC A;  2Y4X A;  2CS7 A;  1K76 A;  4FIB A;  2DXC A;  4OMF B;  2P0P A;  3MEU A;  2J6K A;  2K7A A;  5FWC A;  3O5Z A;  4XU2 A;  2AT1 B;  2DL5 A;  1K4U S;  2D1X A;  2OTJ Q;  2NUZ A;  1QQJ A;  1TWB A;  1G5V A;  3JB9 I;  4RTU A;  1MMA A;  2RQR A;  4EMK A;  1QCO A;  4KRT A;  3VS5 A;  4M7D E;  1OPL A;  4J9F A;  5LJ3 e;  2KQW A;  3OYM A;  3MEW A;  2VKN A;  4PL6 A;  4ORZ A;  2COY A;  3MET A;  1V76 A;  5KYU B;  1M90 U;  4J7F A;  1W2B P;  5HY6 A;  4GBQ A;  2GFA A;  3MPU B;  3BDL A;  4ZGJ B;  1VQ9 Q;  3C0C A;  3PE0 A;  1VQ5 T;  1BIA A;  2RMO A;  4E7I A;  3SDZ A;  4M7A E;  4HT8 A;  2RQT A;  2EBP A;  3C4S A;  3M58 A;  3CCE A;  1M90 R;  2RQU A;  1G8X A;  1UUE A;  4IIM A;  3UT1 A;  1QWF A;  4JLI A;  4JS4 A;  1LNX A;  1TUC A;  5HKC A;  3M5A A;  4C8Q E;  4A4G A;  4MZP A;  5FRN A;  1Z9Q A;  3CC2 T;  5KE2 A;  2M51 A;  5GAN f;  4QQD A;  4L5G A;  5GMK i;  4KGZ B;  2CUB A;  2L3Q A;  3J7A F;  1FMW A;  3CD6 A;  2COW A;  1VQL A;  4CC3 A;  2F2X A;  4YTL A;  1W2B S;  1I5L A;  2E3H A;  5KYU A;  1E6G A;  3VUZ A;  2AK5 A;  1K9M U;  1M90 C;  3I5R A;  1WXB A;  1JJ2 P;  2DLP A;  2EJ9 A;  3RMQ A;  2HQE A;  3LH5 A;  5I21 A;  5GAO m;  1Y57 A;  1YN8 A;  3M0U A;  1K9M R;  3VS3 A;  3UPU A;  3I9Q A;  1YBY A;  2O88 A;  2LTO A;  2DAQ A;  1D1A A;  3REA B;  5CKH A;  2FO0 A;  4IUR A;  1ABO A;  1X43 A;  1RAA B;  3U23 A;  1RAB B;  3QWY A;  4LDW A;  1EX4 A;  1BI0 A;  1OUL A;  5LJ3 f;  1QVF A;  3X28 B;  2EQI A;  2QGF B;  4M7A G;  1AHJ B;  3BW1 A;  3RKX A;  2YRD A;  4N0A C;  4L59 A;  2FG0 A;  2ATC B;  1I1J A;  5FU6 B;  4LDX A;  3THK A;  1LOJ A;  1O75 A;  2EW3 A;  1RAH B;  2LT1 A;  4D8D A;  1IHW A;  3WVD B;  1BU1 A;  4RTT A;  4M77 B;  3QBY A;  2HSP A;  3JCM c;  2RK1 A;  1VQK Q;  4DA4 A;  4OMM A;  1K9M C;  4RG8 A;  4PJL A;  5IHK A;  3V7S A;  1P92 A;  2CT3 A;  2KE9 A;  2IG0 A;  5DY9 A;  2YDL A;  4FYY B;  1MHN A;  1N9R A;  4X9C A;  1VQL T;  1RL2 A;  4O5V A;  1D1C A;  3LX7 A;  1ZX6 A;  1D3B B;  3CCV A;  1N27 A;  1ZSZ C;  2IVW A;  5GAO p;  3EGU A;  4XTX A;  4OB2 B;  1Y7X A;  3GOX A;  2LCL A;  2KR3 A;  1PSE A;  3CPW P;  1PCX A;  2QXF A;  1M3A A;  3QJ6 A;  4KUL A;  3OYJ A;  2DTI A;  1D0Y A;  4IUV A;  2RHY A;  3V8J A;  4FM4 B;  4OB1 B;  2W0Z A;  2XDD A;  4M77 A;  2VB6 A;  4EIK A;  3NHN A;  1LPL A;  2KEA A;  4C92 E;  1WA7 A;  2P4T A;  4EDU A;  2DER A;  4OP0 A;  1D1B A;  1G3T A;  1KHC A;  2E1H A;  1TU0 B;  2XD0 A;  4JS5 A;  1XQH A;  1BI3 A;  4C0D C;  3HKS A;  5DLO A;  1YJ9 A;  3JCM W;  3WVE B;  3LYI A;  1D3B A;  4J9B A;  2RJE A;  5L8R E;  1YIT A;  4LD9 K;  3H0I A;  3CPW S;  3J80 E;  2BZX A;  2KT1 A;  4FYV B;  2I2L A;  2GCX A;  4CI0 C;  3PMT A;  3X26 B;  1XOV A;  2WSF E;  2PNI A;  4JRQ A;  2YRV A;  4N4G A;  2EYZ A;  2FEI A;  3L1A A;  3HPW A;  2ED0 A;  5FU7 C;  1IGU A;  1Y07 A;  4XTU A;  1PWT A;  4IKF A;  1NG2 A;  4K11 A;  4M75 B;  2FZC B;  4II1 A;  2K57 A;  4MZM A;  1NPP A;  3G6E A;  3CCV T;  2QEX A;  2P84 A;  3PT9 A;  1C6V X;  3CC2 Q;  2JJ9 A;  1YCS B;  5AYF A;  2K2M A;  3WXM B;  5GAO l;  2MF2 A;  2MAM A;  1TSF A;  3M56 A;  2Y4Y A;  4HXJ A;  4D8K A;  3MO8 A;  1K1Z A;  2GGR A;  1BI1 A;  4C92 G;  4XU1 A;  1QWE A;  4LE9 A;  4OVA A;  3GF5 A;  3E19 A;  3NPF A;  2EWN A;  3R6N A;  2ZPB B;  3A8H B;  4E7L A;  5D6W A;  1G83 A;  3V8K A;  4F7U F;  2A37 A;  2JW4 A;  4R0K A;  2DVJ A;  5HK0 A;  3CXC P;  1VQP Q;  4ZN3 A;  1LJO A;  3EHQ A;  4JDS A;  4M75 A;  1KQ1 A;  2OTJ A;  3JCM g;  1SRM A;  2JVV A;  4C0G A;  4QQ6 A;  2DJZ A;  3OYA A;  2DVE A;  3OS1 A;  3SFM A;  1MUZ A;  3FC3 A;  2GTJ A;  4A63 B;  1WXU A;  1AWW A;  4N4H A;  1GFD A;  1NEB A;  1KIK A;  2FPD A;  3QII A;  3A8L B;  3OYH A;  4LNP A;  2K9G A;  3PIO A;  2F5K A;  2RQW A;  2D0Q B;  4M78 B;  1VQ9 A;  3I55 A;  3PMI A;  1YJW Q;  4PFZ A;  5AT1 B;  4BUG A;  4HKE A;  2FZK B;  5D6X A;  1XJW B;  3X24 B;  5A0D A;  3OY9 A;  3CME Q;  2KRO A;  2QEX T;  2QTV A;  5KYY B;  2RM4 A;  3QUI A;  1H3Z A;  4KBM B;  3HRS A;  3I35 A;  2VVK A;  3GLX A;  4BAC A;  1O9S A;  4M7D C;  4OGE A;  1UEC A;  2HEQ A;  4M77 G;  1UGQ B;  1X75 C;  2BE7 D;  2DK3 A;  2XG8 D;  5I11 A;  3PVL A;  4OF1 A;  2CZ6 B;  4E6R A;  1G3Y A;  1WHK A;  3C94 A;  3PVQ A;  1GBQ A;  2DL8 A;  4J7I A;  2JNG A;  2VXE A;  2NUT B;  2X51 A;  3M54 A;  2LCS A;  3OYN A;  1GFC A;  3JB9 H;  2X3X D;  5ECA A;  1TS9 A;  2EGE A;  4M78 A;  1ZLM A;  4M7A C;  3M9Q A;  3VJP A;  2OTJ T;  3VU3 C;  2X4X A;  2CSQ A;  3CBO A;  2J05 A;  1Y96 B;  5KYY A;  3JCM b;  4O6J A;  1WPY A;  3CPF A;  4C8Q C;  3MP6 A;  2DNU A;  2QYZ A;  2KAF A;  1NM7 A;  3A8O B;  5GJW B;  5A0G A;  1VQO Q;  3LW5 E;  4FU6 A;  1VQ9 T;  2D9T A;  1HSQ A;  1X01 A;  4QVZ A;  2FL7 A;  2NUT A;  1JBM A;  1VQ7 Q;  1RAD B;  2DIL A;  1SPK A;  2DL7 A;  2J7I A;  2YWW A;  4PJO B;  3DKM A;  2LRQ A;  1WX6 A;  2MI6 A;  4HCZ A;  4LD6 A;  2RQV A;  3HP9 A;  4HVW A;  3QXE B;  4BI3 A;  4LDU A;  3JCM P;  2JUF A;  3UAT A;  1VYV A;  3S3O A;  1YIJ Q;  1QLY A;  3JSC A;  1X69 A;  3CC4 A;  1KK7 A;  2LQW A;  4HT9 A;  3CCQ Q;  1OI1 A;  1C0M A;  2QG9 B;  3MP1 A;  2FHD A;  3X20 B;  3L2V A;  4KT0 E;  1KQS P;  2PVG B;  1ZSG A;  5CKF A;  4M75 G;  4NS5 A;  4PK4 A;  4E7S A;  3CCJ Q;  1KD1 U;  2GFU A;  2XDB A;  4RTX A;  4LDV A;  3JAM E;  4KUI A;  3GNG A;  3H41 A;  4C0Z A;  4M7D D;  4EMH A;  5J39 A;  4DQ2 A;  4PJO A;  1E7O A;  1PD0 A;  2DRM A;  1KD1 R;  1MV0 B;  5IHI A;  1BCO A;  1VQM Q;  2LNV A;  1QVG P;  4B6M A;  2HNI A;  4RUG A;  1LCK A;  3QKJ A;  2OJ2 A;  5A0L A;  1YHQ Q;  1AZG B;  1OV3 A;  1M8M A;  1IHV A;  5IAY A;  1G3W A;  3SHW A;  4PLI A;  2X35 A;  3T9N A;  2CYZ B;  4M7A D;  2RI5 A;  1BCM A;  2ZPF B;  1Z9Z A;  4FYX B;  2A08 A;  2Y90 A;  2E5Q A;  2ZPI B;  4C8Q D;  3CBP A;  2KRS A;  4X34 A;  5J3B A;  2RHU A;  1HJD A;  1VQK T;  1KD1 C;  3TCJ A;  1AWJ A;  1AD5 A;  5GJV B;  1WYX A;  5M9O A;  3H9N A;  1QVF S;  1QP2 A;  2MK5 A;  4PJJ A;  4L6V 5;  2VC8 A;  2KK4 A;  4EMK B;  2DXU A;  4M77 F;  1UGR B;  4X1V A;  4R55 A;  3NGP A;  1S72 Q;  4J6Y A;  1W1F A;  1OPK A;  4M78 G;  3CC2 A;  5KH6 A;  3GIB A;  4C5G A;  2CDT A;  1HD3 A;  1UEB A;  2DO3 A;  1NE8 A;  1EZZ B;  4QW2 A;  1CSK A;  4RMO A;  2FPE A;  1BIB A;  1R8O B;  3EFO B;  3RES A;  3SWN C;  4JJN K;  2RN8 A;  4BE1 A;  3LH0 A;  2EJG A;  2GQI A;  3TRE A;  3A98 A;  1JXO A;  5FWB A;  2EYX A;  1PD1 A;  3KFV A;  7AT1 B;  2DD4 A;  2XMF A;  2CP6 A;  2P0Q A;  2AIR B;  2MIO A;  1Q81 U;  3M0Q A;  3G71 Q;  2DA9 A;  2F2W A;  4J9E A;  2XIC A;  4J9I A;  3UDC A;  2CZ1 B;  4IUT A;  4HCC A;  1GCQ C;  1PM3 A;  2CZ0 B;  3NTH A;  4RTV A;  2G6F X;  2HQH A;  2LQN A;  3I56 Q;  1Q81 R;  2KGT A;  3ZEH A;  3CBM A;  3TSW A;  1B3Q A;  1D09 B;  1RLQ C;  2V8I A;  4PFO A;  4F7U E;  4C0F A;  4XU3 A;  2X4J A;  4E7J A;  1PG5 B;  1RI9 A;  1TUG B;  2YHT A;  1I4K 1;  1UE9 A;  4XQ3 A;  2ROT A;  4HVV A;  3FB9 A;  3CCU Q;  2EIF A;  3EFO A;  5IXF A;  1QKW A;  3VS7 A;  2O31 A;  1U8R A;  3UA6 A;  3M0S A;  3QPH A;  2AZS A;  2DZC A;  3OBW A;  4DOV A;  4LUE A;  2GTO A;  2L8D A;  5GAM g;  1YJW A;  1WHM A;  3M53 A;  1SG5 A;  5GMK e;  3OSV A;  1YP5 A;  2M0O A;  3X25 B;  3DLL A;  2A36 A;  6AT1 B;  4ZN1 A;  4M4Z A;  2F5T X;  2DF6 A;  2BIV A;  2YUO A;  5CQX A;  4A54 A;  2DPP B;  2RI2 A;  1ZA2 B;  2J06 A;  3EG2 A;  4M75 F;  2CH4 W;  1T3L A;  4PJO G;  2DX1 A;  4PKC C;  1OQK A;  1ZUY A;  4ZTF A;  1SHF A;  2VYT A;  4IIO A;  1WNL A;  3Q1J A;  1Y71 A;  3EGD A;  2LP5 A;  4C92 D;  4C5I A;  4B9X A;  4FCY A;  1SRL A;  4JRI A;  3L2Q A;  1SHG A;  5GAN 4;  1QP3 A;  1K8A U;  1VQP T;  2DRK A;  4RTY A;  2PUK B;  4AFZ C;  1YJN Q;  2HBW A;  2CSI A;  4F7U G;  2LQK A;  1QCF A;  3URG A;  2AKK A;  1K8A R;  1UGS B;  2CP2 A;  3JCM V;  5IN1 A;  5CIU A;  1UJY A;  8ATC B;  1YI2 Q;  2H3E B;  1WHL A;  2EGC A;  1U1T A;  4KGX B;  1QVP A;  4RG2 A;  1JXM A;  3JB9 D;  2NYS A;  1VQO A;  1NLO C;  3G4S Q;  2QQA A;  1M4Z A;  2SEM A;  2ZGW A;  3C95 A;  2FRY A;  3ME9 A;  5GAO q;  3CCS Q;  1YJW T;  2DET A;  3LGL A;  1OEB A;  3CCR T;  1VQ7 A;  1RLP C;  1M3B A;  3CME T;  1QMC A;  2D0N A;  2DM1 A;  5GMK h;  1K8A C;  2YUN A;  4CC2 A;  4PNO A;  4HVU A;  4A4H A;  1Q7Y U;  1NYG A;  3P8D A;  1RI0 A;  2E4H A;  3TU4 K;  2JTE A;  4M78 F;  3VRY A;  1PRL C;  3V8L A;  4FSS A;  2HCK A;  5FRO A;  1BI2 A;  2JMC A;  1TXQ A;  1FWZ A;  1Q7Y R;  3S3M A;  2EVR A;  3OS2 A;  4V2S A;  1EIF A;  1ARK A;  3HSB A;  4FT2 A;  4JUV A;  1GCQ A;  2L3S A;  2C0O A;  4J9G A;  2PVO B;  3PGG A;  1VA7 A;  4NL2 A;  3J81 E;  1M27 C;  5KCH A;  2P0K A;  2EKO A;  2C06 A;  4F14 A;  2AKL A;  3JCM d;  2DXB A;  4ME7 A;  1RAG B;  1AZE A;  1MMD A;  2V1R A;  3LGF A;  3S3N A;  1JRI A;  3L2Z A;  3OS0 A;  2EGA A;  3PTA A;  3RMS A;  2RA2 A;  4ZGD B;  2HMA A;  1TG0 A;  2CUD A;  2KXC A;  5FW9 A;  1VQO T;  2V26 A;  1W4S A;  3G7Z A;  3L2U A;  4UC4 A;  3AT1 B;  1VQN Q;  1H92 A;  2K5F A;  1I5O B;  4J6W A;  2OAW A;  1IB8 A;  4RTZ A;  5I2M A;  1VQ7 T;  2XHC A;  3DB4 A;  5GAN 2;  2HD0 A;  4IUU A;  2XKO C;  1VYU A;  5CKB A;  2DYB A;  3OYB A;  2X9H A;  5LL6 S;  4Q5W A;  1XNI A;  1YIJ T;  4PJO F;  1M8V A;  3CCQ T;  1YWO A;  3GNF B;  4PJN A;  1R77 A;  3TSZ A;  1QKX A;  5GAN g;  4FT4 A;  4CC7 A;  2QQR A;  2KRM A;  1UFF A;  1OX8 A;  1D0X A;  2X4Y A;  4J6X A;  3CCJ T;  4MZT A;  2E3I A;  2DTH A;  3EHR A;  4IUQ A;  1E6H A;  1VOM A;  4M77 E;  3PIP A;  2RH2 A;  2O4X A;  2CP3 A;  5CO7 A;  1ZSZ B;  2LJ1 A;  1OU9 A;  4A4E A;  1VQM T;  4JLG A;  4BI8 B;  3VRZ A;  3VYG A;  4MDW A;  4N0A A;  1HYO A;  1UJ0 A;  2BKD N;  4C5E A;  3G71 A;  5GMK j;  4OB0 B;  3QG1 A;  2OTL T;  1YHQ T;  2MWP A;  3VKI A;  4HA8 A;  3NTI A;  1OZ2 A;  3HFN A;  3I56 A;  2IPO B;  4MMK A;  5A2Q E;  2K79 A;  4J8O A;  4AFQ C;  5LJ3 g;  1PSF A;  5LJ5 d;  1JJ2 A;  8AT1 B;  1ABQ A;  4C0D B;  1NYF A;  2L3R A;  3FLG A;  5KYX B;  4AMC A;  2ZZD A;  4QVD A;  1YNZ A;  2V8J A;  3EFS A;  3CCR Q;  2H8H A;  1ZSZ A;  2YLB A;  4OMO A;  2R57 A;  2JZ2 A;  3EH1 A;  1B07 A;  1Q86 U;  4JPB W;  4XU0 A;  3NTK A;  3CCM Q;  3RR6 A;  1X27 A;  1BK2 A;  3G1J A;  1UB4 A;  3CCE Q;  3HTR A;  4B9W A;  1S72 T;  3MEA A;  5GAN 6;  5FU7 B;  1ZHI A;  1Q86 R;  4RKU E;  4JRK A;  1FMK A;  5GAN 3;  5CQY A;  4XAX B;  4BDZ A;  2QAZ A;  5CR2 A;  1WI7 A;  3FDR A;  3E1S A;  5CKD A;  3CC7 T;  1NEG A;  2DL4 A;  3V7C A;  1SSH A;  1CKB A;  4J83 A;  2HQX A;  4Z89 A;  1NLP C;  1WQ7 A;  3CD6 Q;  1FYN A;  2E12 A;  2M16 A;  3CEY A;  2CT4 A;  3JCM Q;  5KYX A;  1BKB A;  1W6X A;  3QDF A;  1UTI A;  2KRN A;  3G71 T;  2MWO A;  3MJX A;  1I8F A;  4M75 E;  3HFO A;  1X6B A;  4NL3 A;  2R5A A;  2EYW A;  2KY9 A;  3ULR B;  1K0S A;  1YJN A;  3RNJ A;  3RDV A;  3I56 T;  2VXF A;  3ZL7 C;  2ZAE A;  1M1K U;  1Q86 C;  3EG9 B;  2HBP A;  2ZPH B;  4KGV B;  1N5Z A;  4Z02 A;  5L23 A;  4AFU C;  2DKG A;  3CPW A;  3OB9 A;  1BBZ A;  2B8A A;  1M1K R;  2E6Z A;  2EQM A;  1KQ2 A;  2JS2 A;  3CCU T;  4BY6 C;  5IXB A;  2K3X A;  1GXI E;  1WGS A;  3KBG A;  4D6W A;  2J6O A;  1K9A A;  2VGM A;  1IGQ A;  1GCP A;  4DEY A;  5LJ5 g;  1MGQ A;  2RK2 A;  2GNC A;  3JB9 J;  1M3C A;  4RCC A;  2NUP A;  1TOV A;  2BZY A;  5D6Y A;  1VQK A;  2HZY A;  1MND A;  5GAM h;  3MEV A;  3H0F A;  3EG9 A;  2C0I A;  2EYQ A;  2A7Y A;  1IRE B;  3UWN A;  1VQ4 Q;  1D0Z A;  1OYX A;  3GPL A;  1M1K C;  4ZGE B;  2CGH A;  1M5Q 1;  5KE3 A;  4DBF A;  1C1A A;  3OYF A;  2GF7 A;  1I0C A;  2M02 A;  2DBK A;  2F1L A;  2KYM A;  1VQ8 Q;  2QI2 A;  2QQ9 A;  2DD5 A;  5CK9 A;  4M78 E;  2H3J A;  2K5I A;  4M7D B;  5J26 A;  1X2Q A;  3QYH B;  3LWI A;  1YJN T;  2L89 A;  4ZNX A;  2JTM A;  2K6D A;  4LN2 A;  3P8B B;  5IT9 E;  2HKN A;  1QVF P;  3RER A;  2PUO B;  2CP7 A;  2OTL Q;  2ENM A;  1ACM B;  3INZ A;  1YI2 T;  3A8M B;  1I07 A;  1GBR A;  4M7A B;  1NZ9 A;  2KMT A;  2LJ3 A;  1RAF B;  2ZPG B;  2RJD A;  1VQ6 T;  2DE0 X;  1VQN A;  3G4S T;  4PLL A;  2K3B A;  4GLK A;  4C8Q B;  5GAM d;  1QCN A;  1TTH B;  3CXC A;  1YJ9 Q;  5D7U A;  3CCS T;  1SEM A;  5C0M A;  1N6A A;  5I2S A;  3TEE A;  4M7D A;  3QHS A;  4Z88 A;  5EC7 A;  4X9D A;  1YIT Q;  3CMA Q;  5KYN A;  4J9D A;  1OZ3 A;  2KBT A;  2XDP A;  2M1H A;  4C92 C;  3H8Z A;  2E41 A;  1NBE B;  3OSS C;  3GP8 A;  3ASK A;  1AWO A;  4XTV A;  2PVD B;  1U5S A;  1EFN A;  2DIQ A;  2NWM A;  3HRT A;  4WTO B;  4M7A A;  2LQ8 A;  2BTT A;  4IUP A;  3EFR A;  2D8J A;  3G6E Q;  4RTW A;  2BE9 B;  5CVI A;  3CC7 Q;  4ANJ A;  2ABL A;  3M4G A;  4C8Q A;  2QK0 A;  2COZ A;  3CCL Q;  3QZ9 B;  1KC8 U;  2RI3 A;  1N9S A;  2JN0 A;  3EG3 A;  1J3T A;  3VYH B;  4PJO E;  2LNH B;  1GL5 A;  2CKK A;  2ZCF B;  1WXT A;  4ESR A;  2KNB B;  5EG2 A;  4CRI A;  4LUD A;  2QDY B;  2FB7 A;  3VUB A;  1KC8 R;  2M0Y A;  4BD3 A;  1VQP A;  4LDY A;  1BB9 A;  2OX7 A;  1Y0M A;  2I0N A;  3PNW C;  3VS0 A;  1T0J A;  4DEX A;  2RF0 A;  1ZQ1 A;  2E10 A;  2EKH A;  1SKU B;  5GAM j;  3EGX B;  4RCB A;  4MML A;  3H0H A;  2V1Q A;  1VQN T;  4JJB A;  2QA4 Q;  2QQS A;  3JCM e;  1UHF A;  5FLX E;  3EGD B;  3S6W A;  4OMN A;  4KUD K;  5FU6 C;  1PKT A;  5CAI A;  4PFP A;  3D7S B;  3QYG B;  1WZO A;  2MOX A;  1ZA1 B;  2FPF A;  2ED1 A;  1AVZ C;  4M77 C;  1YFN A;  2CZ7 B;  2RPN A;  1KC8 C;  3DB3 A;  2DTO A;  4JZ3 A;  3M55 A;  4ELY C;  3CCR A;  2RHI A;  2KI7 A;  3RUX A;  3CME A;  4E47 A;  2EQK A;  1U1S A;  1Q81 C;  5KYW B;  3I55 Q;  3CCM A;  1B7T A;  2AZV A;  4ELZ C;  1Q95 G;  3EGX A;  2B86 A;  3OYC A;  4C5H A;  1T3S A;  3OYK A;  2QAS A;  4DBH A;  4C92 B;  3OYD A;  2A0F B;  1B34 B;  1F1B B;  5GAN h;  1AT1 B;  2O2O A;  1IO6 A;  3LLR A;  3HHT B;  2YSQ A;  4Y92 A;  1BYM A;  2X4W A;  3BE3 A;  4NOY A;  1H3H A;  1WJR A;  2E6N A;  3GBQ A;  3M0T A;  1VIE A;  1KFZ A;  4Z8A A;  4F17 A;  3KUF A;  1YCY A;  1ZBX A;  1G2B A;  2GQV A;  3FRN A;  1H64 1;  1M2O A;  4OMQ A;  3SWN B;  2D6F A;  4VUB A;  5KYW A;  1WQW A;  1KQS A;  4M7D G;  3JCM h;  4FW1 A;  3FEO A;  4LXC A;  2JS0 A;  3RKW A;  5CKE A;  2WSE E;  3JCM f;  2IIM A;  3ER0 A;  4C92 A;  3M4Y A;  2DJQ A;  2XID A;  3OYY A;  1PRM C;  1VUB A;  4F04 B;  1VQ6 Q;  3R6O A;  1B34 A;  2F69 A;  3ZFJ A;  1UGV A;  1X6O A;  3EG0 A;  5LJ3 h;  1QVG A;  3SEM A;  1N8R U;  1M9S A;  4E7H A;  2A3L A;  2YUP A;  1X2K A;  2XI9 A;  3CCM T;  4M75 C;  3OYG A;  1OU8 A;  5LJ5 e;  5GAN d;  3CCE T;  4C8Q G;  1N8R R;  3SWN A;  1V1C A;  3TQ7 P;  1JJ2 S;  2CP5 A;  2XK0 A;  1QW1 A;  2LDM A;  2OI3 A;  3OW2 A;  1G3S A;  1DJ7 B;  1YIJ A;  2DYI A;  1VQ4 A;  1PC0 A;  1WJS A;  4M77 D;  3VS1 A;  5DLQ E;  2W10 A;  3CCQ A;  4CC4 B;  1KG1 A;  3JV3 A;  3DLM A;  4HCK A;  3CC4 Q;  3CD6 T;  2R58 A;  2XU8 A;  3EH2 A;  1K73 U;  2C0T A;  2PU9 B;  3L42 A;  4Y91 A;  1VQ8 A;  2K3Y A;  2MMP A;  3CCJ A;  4ZTJ A;  1HK9 A;  1OX9 A;  2RO0 A;  3QO3 A;  4XTZ A;  1K73 R;  1W70 A;  2EFI A;  1ZBJ A;  1N8R C;  5C6S A;  1VQM A;  2YT6 A;  1AWX A;  2VWF A;  5LJ3 d;  3F70 A;  4XTY A;  1Q7Y C;  4PJM A;  2OTL A;  4BDY A;  5GMK m;  1IRX A;  2WAC A;  1YHQ A;  3CQT A;  2PTK A;  3QSU A;  1UGP B;  2OAU A;  4HCB A;  2SRC A;  2DL3 A;  4FSX A;  2JOY A;  1U3O A;  3H6Z A;  2LX9 A;  1PKS A;  1M30 A;  4OML A;  1S1N A;  2RD1 A;  2G3R A;  5GAN j;  2O4X B;  1WLP B;  4M78 C;  3M57 A;  2KVQ G;  1K73 C;  2FVU A;  3OS5 A;  3CMA A;  3M0P A;  1K0X A;  2RJF A;  5LJ5 h;  1HXD A;  3L2R A;  2E5K A;  2KT8 A;  2NLU A;  5LJ5 f;  2QGG A;  3I5S A;  1VQ4 T;  2JTF A;  4OGC A;  1VQ5 Q;  3VV0 A;  3P8H A;  1W2B A;  3RKY A;  4EMG A;  2EJF A;  1KSW A;  1RAE B;  1S72 A;  2DBM A;  2PQW A;  4QQG A;  1LVK A;  1VQ8 T;  3E9F A;  3EAE A;  4M75 D;  1I81 A;  3CC7 A;  5IHN A;  2VV5 A;  3VS4 A;  3MKD A;  4DOW A;  3CCL A;  5LJ3 j;  3BY7 A;  2JM9 A;  2KSS A;  2E64 A;  4P5N A;  1XTD A;  2O01 E;  1JO8 A;  1GRI A;  4JJC A;  1TH7 A;  1WHG A;  4M7D F;  1PHT A;  2LVM A;  5GAO r;  3E2U A;  1Q82 U;  1MV3 A;  3SB2 A;  4QKU A;  2HL5 C;  1FXX A;  1JQQ A;  4A4K A;  2RNA A;  3SD4 A;  2K2V A;  1MMN A;  1Q82 R;  1RUW A;  2QA4 A;  5FRM A;  1YJ9 T;  4WCI A;  2ECZ A;  2YXY A;  3M59 A;  1VIF A;  4M7A F;  3FJP A;  3V7R A;  2LX7 A;  2L3P A;  2K5L A;  1YIT T;  3CMA T;  3CCU A;  2YLC A;  3RIR A;  1VYT A;  1YWP A;  2DFU A;  4PJO C;  3JB9 G;  4C8Q F;  2L5Q A;  3NMZ C;  4EPC A;  3OQ5 A;  3JRZ A;  4AG2 C;  2KXD A;  4AT1 B;  1R0B G;  5DM7 R;  5GAM e;  4WF2 A;  1WHH A;  3FIF A;  2D8H A;  3CXC S;  3JCM J;  3BFM A;  1RAI B;  4M78 D;  5HCK A;  2VAS A;  1Q82 C;  3G6E T;  4JJD A; 
#chains in the Genus database with same CATH homology
 5CQX A;  4BB7 A;  4A54 A;  2DPP B;  2RI2 A;  2KMT A;  2RHZ A;  3A5Z B;  2DZ9 A;  2VUB A;  4C0D C;  2ZPG B;  2RJD A;  3HKS A;  4M75 F;  4XK8 E;  5KCO A;  1VQ6 T;  1VQN A;  3CCL T;  3C12 A;  4PJO G;  5DLO A;  3G4S T;  4PKC C;  4PLL A;  1YJ9 A;  2RB6 A;  3JCM W;  4ZTF A;  3WVE B;  3LYI A;  3BDU A;  4GLK A;  2VYT A;  3OMC A;  4C8Q B;  2DIG A;  1D3B A;  5GAM d;  1WNL A;  3HRU A;  3Q1J A;  5GMK l;  3CXC A;  1Y71 A;  3CCS T;  2RJE A;  5L8R E;  4C92 D;  1N6A A;  5C0M A;  4C5I A;  5I2S A;  3CPW S;  3J80 E;  2M9U A;  4LD9 K;  3TEE A;  4B9X A;  2I2L A;  2GCX A;  4M7D A;  3QHS A;  4CI0 C;  4JRI A;  3PMT A;  4X9D A;  3X26 B;  3L2Q A;  1XOV A;  2V8K A;  2WSF E;  4JRQ A;  2YRV A;  4N4G A;  3ZBD A;  5GAN 4;  1QP3 A;  1K8A U;  3L1A A;  3HPW A;  1OZ3 A;  1VQP T;  2XDP A;  2LT4 A;  2M1H A;  3OMG A;  5LJ5 j;  4C92 C;  2PUK B;  3H8Z A;  5FU7 C;  2E41 A;  3OSS C;  3GP8 A;  3MP8 A;  3ASK A;  1Y07 A;  4XTU A;  4F7U G;  4BE0 A;  2LQK A;  3URG A;  4XTV A;  2PVD B;  2C06 A;  2QA4 T;  4IKF A;  4M75 B;  2DIQ A;  1UGS B;  4II1 A;  2EQU A;  3HRT A;  3JCM V;  2K57 A;  4MZM A;  5IN1 A;  1YI2 A;  2QQB A;  5CIU A;  1NPP A;  4M7A A;  3G6E A;  2LQ8 A;  3CCV T;  2QEX A;  3PT9 A;  2BUD A;  4IUP A;  3EFR A;  5AYF A;  3NFC A;  1M1G A;  1M1F A;  5CVI A;  1VQ6 A;  3WXM B;  1U1T A;  1QVP A;  3M4G A;  4RG2 A;  5GAO l;  3G4S A;  2MF2 A;  2MAM A;  3M56 A;  3JB9 D;  4C8Q A;  1VQO A;  2DXT A;  2Y4Y A;  3QZ9 B;  1KC8 U;  2RI3 A;  2QQA A;  3MO8 A;  1N9S A;  1BI1 A;  1M4Z A;  2JN0 A;  3VYH B;  4C92 G;  5GAO n;  3CCS A;  4PJO E;  2ZGW A;  3C95 A;  4XU1 A;  3ME9 A;  2CKK A;  4OVA A;  2ZCF B;  3GF5 A;  3E19 A;  5GAO q;  4A53 A;  1YJW T;  2EWN A;  3LGL A;  5EG2 A;  3CCR T;  4CRI A;  2ZPB B;  2VGN A;  2QDY B;  3A8H B;  1VQ7 A;  4Y28 E;  2FB7 A;  1V29 B;  2RHX A;  3VUB A;  3I55 T;  4E7L A;  4EMK C;  3CME T;  4BD3 A;  2E65 A;  1VQP A;  4LDY A;  5D6W A;  4ATO A;  3V8K A;  3OYI A;  4F7U F;  5GMK h;  4TVR A;  3PNW C;  3OBY A;  5GAM f;  5HK0 A;  1K8A C;  1SSF A;  4PNO A;  4A4H A;  1ZQ1 A;  2E10 A;  3P8D A;  1RI0 A;  4ZN3 A;  3TU4 K;  1Q7Y U;  4MDX A;  5GAM j;  1LJO A;  2LCC A;  4JDS A;  4RCB A;  2K4Y A;  4M78 F;  4M75 A;  4MML A;  3V8L A;  1VQN T;  1KQ1 A;  4PJO D;  5FRO A;  2OTJ A;  1BI2 A;  3JCM g;  2QQS A;  3JCM e;  1FWZ A;  2JVV A;  1Y96 A;  4QQ6 A;  2DJZ A;  4C0G A;  5FLX E;  3PFS A;  3S3M A;  3OYA A;  2DVE A;  3OS1 A;  3SFM A;  3S6W A;  4KUD K;  3FC3 A;  5FU6 C;  4N4I A;  2DEQ A;  3OS2 A;  5CAI A;  4V2S A;  1EIF A;  4BE2 A;  3HSB A;  4FT2 A;  4JUV A;  4C92 F;  3N5B B;  2PVO B;  3QYG B;  3PGG A;  4N4H A;  4NL2 A;  4F7U B;  3MCA B;  4M77 C;  3J81 E;  5KCH A;  2P0K A;  2CZ7 B;  3HL8 A;  3QII A;  2EKO A;  3A8L B;  3DB3 A;  2DTO A;  4J5Y A;  4R56 A;  3OYH A;  1JB0 E;  3L2W A;  3OYE A;  1KC8 C;  3JCM d;  3M55 A;  4ELY C;  3CCR A;  3PIO A;  2F5K A;  2RHI A;  2D0Q B;  4M78 B;  2FYK A;  1VQ9 A;  3RUX A;  2DXB A;  3I55 A;  3PMI A;  4ME7 A;  2LC4 A;  4E47 A;  5GAN 8;  3CME A;  3QZ5 B;  4BUG A;  4HKE A;  5D6X A;  2EQK A;  1U1S A;  1Q81 C;  3QDR B;  3X24 B;  3LGF A;  5A0D A;  3OY9 A;  3S3N A;  4FL6 A;  3CCM A;  1JRI A;  2QEX T;  3L2Z A;  4ELZ C;  3OS0 A;  3PTA A;  3RMS A;  2RA2 A;  4BI4 A;  2RM4 A;  3QUI A;  3OYC A;  4ZGD B;  1NPR A;  1H3Z A;  4KBM B;  4OB3 B;  1FX7 A;  3HRS A;  4C5H A;  1NJI U;  3OYK A;  1VQO T;  2AHJ B;  1WJQ A;  1W4S A;  3G7Z A;  4C92 B;  3L2U A;  4UC4 A;  3GLX A;  3OYD A;  1O9S A;  4BAC A;  4M7D C;  2K5F A;  4OGE A;  4QVC A;  3MHX A;  3OA6 A;  1B34 B;  3A8G B;  4J6W A;  5GAN h;  4M77 G;  3JB9 F;  1UGQ B;  1X75 C;  2QTX A;  3LLR A;  2KDS A;  3HHT B;  2DK3 A;  2XG8 D;  2EQJ A;  4E7K A;  5I2M A;  4OF1 A;  2CZ6 B;  3AHU A;  1KQS S;  1VQ7 T;  1G3Y A;  3C94 A;  1BYM A;  5CCA A;  2X4W A;  4J7I A;  2XHC A;  2JNG A;  3DB4 A;  3OYL A;  3LWH A;  4NOY A;  5GAN 2;  2VXE A;  4F7U A;  2HD0 A;  1WJR A;  2E6N A;  4IUU A;  1VIE A;  4JRP A;  5GAN 5;  2XKO C;  3M54 A;  3KUF A;  2R5M A;  4A4F A;  4BY6 B;  5CKB A;  3OYN A;  3OYB A;  2E70 A;  1YCY A;  1ZBX A;  5HK3 A;  2HAX A;  5LL6 S;  3JB9 H;  2GQV A;  4GY5 A;  4Q5W A;  4M78 A;  3FRN A;  1H64 1;  2WSC E;  3SWN B;  4M7A C;  3M9Q A;  3VJP A;  1XNI A;  2OTJ T;  3VU3 C;  2D6F A;  4VUB A;  2X4X A;  3CBO A;  1WQW A;  1KQS A;  2ZPE B;  3O8V A;  1VQ5 A;  1QVG S;  4M7D G;  5GAN 7;  1YIJ T;  1Y96 B;  3JCM b;  4O6J A;  3JCM h;  4PJO F;  1M8V A;  3FEO A;  1KHI A;  3CCQ T;  1WPY A;  3CPF A;  4C8Q C;  2EAY A;  3MP6 A;  3RKW A;  3CC4 T;  3GNF B;  5CKE A;  2WSE E;  3JCM f;  3JCM X;  3ER0 A;  4C92 A;  3M4Y A;  2XID A;  5GAN g;  3OYY A;  4FT4 A;  1VUB A;  3E9G A;  5GAN e;  2QQR A;  3R6O A;  1B34 A;  3QJY A;  2KAF A;  2F69 A;  3A8O B;  5A0G A;  2X4Y A;  1NJI C;  3ZFJ A;  4XTW A;  1YIT A;  4J6X A;  1IZ6 A;  1X6O A;  3CCJ T;  5LJ3 h;  4MZT A;  3KXT A;  1QVG A;  3LW5 E;  2DTH A;  4FU6 A;  3OW2 S;  4IUQ A;  1VQ9 T;  1N8R U;  2D9T A;  4M77 E;  3PIP A;  1X01 A;  1M9S A;  2RJC A;  4QVZ A;  2RH2 A;  2FL7 A;  2A3L A;  1JBM A;  2O4X A;  2CS7 A;  2Y4X A;  4E7H A;  4FIB A;  5CO7 A;  2DXC A;  4OMF B;  2P0P A;  2XI9 A;  3CCM T;  4A4E A;  1VQM T;  3MEU A;  4M75 C;  4JLG A;  3OYG A;  4BI8 B;  3VYG A;  4MDW A;  4N0A A;  5LJ5 e;  5GAN d;  4PJO B;  3CCE T;  2BKD N;  4C5E A;  3DKM A;  2LRQ A;  3SWN A;  4C8Q G;  2MI6 A;  4HCZ A;  4LD6 A;  3G71 A;  5GMK j;  4OB0 B;  4XU2 A;  3HP9 A;  3QG1 A;  1JJ2 S;  2OTL T;  2XK0 A;  1QW1 A;  2LDM A;  3QXE B;  3OW2 A;  1YHQ T;  1G3S A;  1DJ7 B;  4BI3 A;  2MWP A;  4LDU A;  3VKI A;  3JCM P;  1YIJ A;  4HA8 A;  1VQ4 A;  3NTI A;  1OZ2 A;  1WJS A;  4M77 D;  2JUF A;  3HFN A;  5DLQ E;  3JB9 I;  3I56 A;  3CCQ A;  3S3O A;  1G5V A;  3JSC A;  4EMK A;  3CC4 A;  4MMK A;  1KG1 A;  4HT9 A;  4M7D E;  5A2Q E;  1OI1 A;  3DLM A;  3MP1 A;  3CD6 T;  2R58 A;  4J8O A;  2FHD A;  5LJ3 g;  1PSF A;  5LJ5 d;  1JJ2 A;  2XU8 A;  3X20 B;  3L2V A;  1K73 U;  5LJ3 e;  4KT0 E;  2KQW A;  2PU9 B;  2PVG B;  3L42 A;  5CKF A;  4Y91 A;  4C0D B;  1VQ8 A;  2K3Y A;  2MMP A;  3CCJ A;  4M75 G;  4ZTJ A;  3OYM A;  3MEW A;  4PL6 A;  4NS5 A;  2L3R A;  1HK9 A;  3FLG A;  2RO0 A;  2ZZD A;  1KD1 U;  4QVD A;  3MET A;  2GFU A;  3QO3 A;  4XTZ A;  1M90 U;  4J7F A;  2XDB A;  4LDV A;  2V8J A;  3EFS A;  5HY6 A;  3JAM E;  4KUI A;  2YLB A;  2GFA A;  2R57 A;  3GNG A;  2EFI A;  2JZ2 A;  3BDL A;  4C0Z A;  4ZGJ B;  1VQ5 T;  1N8R C;  1BIA A;  5C6S A;  1VQM A;  4M7D D;  1Q86 U;  4E7I A;  4EMH A;  4XU0 A;  3SDZ A;  4DQ2 A;  5J39 A;  4HT8 A;  4M7A E;  4PJO A;  3NTK A;  3C4S A;  3M58 A;  3CCE A;  2LNV A;  5LJ3 d;  3F70 A;  4XTY A;  2HNI A;  1Q7Y C;  2OTL A;  1UB4 A;  3UT1 A;  5GMK m;  4BDY A;  4B9W A;  4JLI A;  1S72 T;  2WAC A;  3MEA A;  4JS4 A;  1YHQ A;  5GAN 6;  1LNX A;  5FU7 B;  1ZHI A;  5HKC A;  3M5A A;  4C8Q E;  3QSU A;  4RKU E;  4JRK A;  1UGP B;  4MZP A;  4A4G A;  2OAU A;  3QKJ A;  4HCB A;  5A0L A;  5GAN 3;  4FSX A;  5CQY A;  5FRN A;  4XAX B;  4BDZ A;  2JOY A;  3CC2 T;  5KE2 A;  5GAN f;  3H6Z A;  4QQD A;  5CR2 A;  4L5G A;  5GMK i;  2LX9 A;  3FDR A;  3E1S A;  5CKD A;  1G3W A;  5IAY A;  3CC7 T;  4PLI A;  3J7A F;  3V7C A;  2RD1 A;  2X35 A;  3T9N A;  2CYZ B;  3CD6 A;  4M7A D;  2G3R A;  5GAN j;  4J83 A;  2HQX A;  2RI5 A;  1VQL A;  2O4X B;  1WQ7 A;  4M78 C;  2E12 A;  2M16 A;  2ZPF B;  3M57 A;  4YTL A;  2KVQ G;  1W2B S;  3CEY A;  3JCM Q;  1K73 C;  1I5L A;  1BKB A;  2FVU A;  2Y90 A;  3OS5 A;  2E5Q A;  2ZPI B;  3CMA A;  4C8Q D;  3CBP A;  4X34 A;  2MWO A;  2RJF A;  5J3B A;  5LJ5 h;  3G71 T;  1I8F A;  1HXD A;  2RHU A;  4M75 E;  3VUZ A;  3HFO A;  1K9M U;  1VQK T;  3L2R A;  1KD1 C;  3TCJ A;  2R5A A;  4NL3 A;  5LJ5 f;  2NLU A;  1M90 C;  3RMQ A;  2EJ9 A;  2KY9 A;  5M9O A;  2HQE A;  1YJN A;  1VQ4 T;  5I21 A;  1QVF S;  1QP2 A;  2JTF A;  4OGC A;  3I56 T;  4L6V 5;  2VC8 A;  3VV0 A;  2VXF A;  5GAO m;  1M1K U;  1Q86 C;  3P8H A;  1W2B A;  2KK4 A;  2HBP A;  4EMK B;  2ZPH B;  3UPU A;  3RKY A;  4EMG A;  1YBY A;  2EJF A;  4Z02 A;  2DXU A;  1S72 A;  4M77 F;  2LTO A;  1UGR B;  2DKG A;  2PQW A;  4R55 A;  2DAQ A;  3CPW A;  4QQG A;  3OB9 A;  5CKH A;  4IUR A;  4J6Y A;  1VQ8 T;  3E9F A;  2B8A A;  3EAE A;  4M78 G;  4M75 D;  3CC2 A;  1I81 A;  5KH6 A;  4LDW A;  2E6Z A;  4C5G A;  3GIB A;  2EQM A;  1KQ2 A;  1UEB A;  1BI0 A;  2DO3 A;  1NE8 A;  1QVF A;  5LJ3 f;  3CC7 A;  3X28 B;  3CCU T;  4BY6 C;  4QW2 A;  2VV5 A;  1GXI E;  2K3X A;  4DOW A;  4M7A G;  4RMO A;  1WGS A;  3CCL A;  1AHJ B;  3BW1 A;  5LJ3 j;  3KBG A;  3BY7 A;  4N0A C;  4L59 A;  3RKX A;  1BIB A;  1R8O B;  4D6W A;  3RES A;  3SWN C;  2KSS A;  4JJN K;  2E64 A;  2VGM A;  4BE1 A;  3LH0 A;  2EJG A;  5FU6 B;  1MGQ A;  4P5N A;  5LJ5 g;  3TRE A;  2RK2 A;  1XTD A;  4LDX A;  3JB9 J;  2O01 E;  1TH7 A;  4RCC A;  2DD4 A;  1LOJ A;  4M7D F;  1O75 A;  2P0Q A;  2LT1 A;  2LVM A;  5D6Y A;  1VQK A;  3WVD B;  1Q81 U;  4M77 B;  5GAO r;  3QBY A;  1Q82 U;  2XIC A;  5GAM h;  3UDC A;  3JCM c;  2RK1 A;  3SB2 A;  2CZ1 B;  4DA4 A;  1K9M C;  4IUT A;  3MEV A;  4RG8 A;  1FXX A;  4HCC A;  3V7S A;  2EYQ A;  2CZ0 B;  2A7Y A;  1IRE B;  1P92 A;  3UWN A;  3NTH A;  2IG0 A;  4A4K A;  1OYX A;  5DY9 A;  3SD4 A;  3GPL A;  2K2V A;  3ZEH A;  3CBM A;  1MHN A;  1M1K C;  1N9R A;  4ZGE B;  2QA4 A;  5FRM A;  4X9C A;  2CGH A;  1VQL T;  1M5Q 1;  2V8I A;  5KE3 A;  1YJ9 T;  1RL2 A;  3OYF A;  4F7U E;  2GF7 A;  4C0F A;  4O5V A;  4XU3 A;  2X4J A;  4E7J A;  3LX7 A;  4M7A F;  3M59 A;  1VIF A;  1D3B B;  3CCV A;  1N27 A;  3FJP A;  3V7R A;  2IVW A;  2QI2 A;  2QQ9 A;  2DD5 A;  2K5L A;  5GAO p;  1YIT T;  3CMA T;  2YHT A;  4XTX A;  3CCU A;  2YLC A;  5CK9 A;  4OB2 B;  1I4K 1;  4M78 E;  2H3J A;  2K5I A;  4XQ3 A;  1Y7X A;  3RIR A;  4M7D B;  3GOX A;  2LCL A;  3FB9 A;  4PJO C;  1PSE A;  5J26 A;  2EIF A;  3JB9 G;  4C8Q F;  2L5Q A;  3QYH B;  2QXF A;  4EPC A;  3LWI A;  3OQ5 A;  3QJ6 A;  1YJN T;  1U8R A;  2L89 A;  4KUL A;  3OYJ A;  2JTM A;  3QPH A;  2DTI A;  3JRZ A;  2DZC A;  3OBW A;  4DOV A;  4IUV A;  3P8B B;  2L8D A;  5IT9 E;  2RHY A;  3V8J A;  5GAM g;  4FM4 B;  3RER A;  5DM7 R;  4OB1 B;  2PUO B;  2XDD A;  5GAM e;  1YJW A;  4M77 A;  4WF2 A;  3FIF A;  3M53 A;  4C92 E;  5GMK e;  2P4T A;  3OSV A;  4EDU A;  3CXC S;  2M0O A;  4OP0 A;  3X25 B;  3DLL A;  1G3T A;  3JCM J;  1KHC A;  3BFM A;  3INZ A;  4ZN1 A;  4M78 D;  1YI2 T;  2E1H A;  2F5T X;  3A8M B;  1Q82 C;  2XD0 A;  3G6E T;  2BIV A;  4JS5 A;  1XQH A;  4M7A B;  1NZ9 A;  1BI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...