4LN2A

The second sh3 domain from cap/ponsin in complex with proline rich peptide from vinculin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Sorbin and SH3 domain-containing protein 1
publication title Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ln2A00
2EBPA 1BK2A 2LQWA 1SHFA 4D8DA 1ZUUA 1ZUKA 2DL5A 2FG0A 1TUDA 2YDLA 1B3QA 1OPKA 2C0IA 2JM8A 2A08A 4E6RA 4LE9A 1Y57A 2KR3A 4AFUC 4ZNXA 5IH2A 1AWJA 2SRCA 1WX6A 2DRMA 2J6FA 4CC2A 4RUGA 2VVKA 2JW4A 2CUDA 2BTTA 3M0RA 1K0SA 2MOXA 3R6NA 1W70A 1PKSA 1UECA 1RI9A 2KGTA 1UJYA 1TUCA 1GCQA 2CT3A 2RQVA 1NLPC 3I5RA 1WI7A 1KJWA 3EG1A 4CC4B 1OPLA 1A0NB 1UHFA 1ZLMA 1QWEA 4OMMA 2KBTA 1E6GA 3EGUA 3ZL7C 1X6BA 1M3CA 4M4ZA 4WCIA 1CSKA 1M3AA 1JU5C 2CH4W 5HCKA 1PNJA 1W6XA 4JPBW 2D0NA 2F2VA 3VS4A 2DMOA 1H3HA 4J9HA 1WFWA 1BB9A 3JV3A 1LCKA 2KYMA 1VYTA 1JEGA 3H0FA 3M0PA 1B07A 1AZEA 3H0IA 1NLOC 1K1ZA 2YT6A 1U06A 1PHTA 2RQUA 1IO6A 2YSQA 2OJ2A 1GBRA 2BZYA 4AG2C 1PKTA 2J05A 4OMLA 4FSSA 1GFDA 2RPNA 1X2KA 4ORZA 4HVUA 1MUZA 3FJ5A 4JJDA 4RTTA 1OOTA 4GLMA 1YWPA 1X69A 1HJDA 3EHQA 2FPDA 1NM7A 1WDXA 2NWMA 2KRSA 1T3SA 2K79A 4ESRA 2OI3A 5IXFA 2YUQA 2K3BA 1MV0B 4RTZA 1WLPB 2AZSA 2X3WD 4CC7A 2OAWA 4RTYA 5GJVB 1X2QA 4HVVA 1KIKA 1I0CA 1W1FA 4J9EA 2LMJA 4Z88A 3RBBB 1PRMC 1RLQC 1UHCA 2PZ1A 3RNJA 3VS6A 1AOJA 5FW9A 2A28A 4RTVA 2GTOA 1M27C 1CKBA 4LUEA 2P4RA 4J9IA 1VYUA 2EYXA 1M3BA 1AWWA 5I22A 2DE0X 2LX7A 3H41A 2J7IA 1N5ZA 1NYGA 2EYYA 1QLYA 2O9SA 4X1VA 2L3QA 5IHNA 2AKKA 1BU1A 1X43A 1PRLC 1YCSB 1NYFA 2DL7A 1JXMA 3NPFA 2JMAA 1UTIA 2A36A 2LJ0A 1GRIA 1UFFA 4AFSC 3PVLA 4Y92A 2K7AA 2LZ6B 4J9BA 4HVWA 2I0NA 1VYVA 4LN2A 2K9GA 4DEXA 2O31A 2F2WA 4RTXA 2LCSA 1WXTA 2YUNA 2FRYA 1S1NA 3VS3A 2GGRA 2ROLA 3GBQA 1YWOA 1OV3A 2VKNA 1G2BA 4F17A 2RMOA 2JMCA 4F14A 3PVQA 3QWXX 2KYBA 5ECAA 1SPKA 4KRTA 3TSZA 3ULRB 3EG3A 1SSHA 1T0HA 3REAB 2J6OA 2KXCA 1V1CA 2KE9A 2AZVA 3UATA 2EKHA 2FEIA 5FWCA 4RTUA 2DRKA 2ENMA 2BZXA 4Z89A 1FMKA 2YUPA 1JXOA 2AK5A 2EPDA 3THKA 2CSIA 1NEGA 3M0TA 2JT4A 1U5SA 2KRNA 2DBKA 3I9QA 2KNBB 1QKXA 2K6DA 1QWFA 3LH5A 2GQIA 1ABQA 4QT7A 3KFVA 2PNIA 3M0UA 2CH4A 2EGCA 4J9DA 2HEQA 2DYBA 1H92A 2B86A 1AWOA 2J6KA 1SRMA 4EIKA 1X27A 3UA6A 1ZBJA 3U23A 2C0TA 2EGEA 1JO8A 2DL8A 4IIOA 1GFCA 2EYZA 3M0SA 2O9VA 2KEAA 2DM1A 1UJ0A 2LJ3A 2EQIA 4LUDA 3PE0A 2JXBA 4A63B 1GL5A 2RF0A 2HCKA 4CC3A 4J9FA 2FPFA 2ED1A 4K11A 1CKAA 1AVZC 1QKWA 4JZ4A 2CUBA 2HDAA 4RTWA 2DBMA 5GJWB 1UG1A 2L0AA 2DA9A 5EC7A 1SEMA 1GCPA 2M0YA 1TG0A 3A98A 3VS1A 4OMQA 3CQTA 1FYNA 1NG2A 1K76A 2DILA 4F16A 1I07A 2E5KA 2FO0A 2CSQA 4JJBA 2L2PA 2GTJA 2KROA 2O88A 3H0HA 2KT1A 4J9CA 4OMOA 2MIOA 5IXBA 1H8KA 1M8MA 1PWTA 3VS0A 2K2MA 2NUZA 2RN8A 2DJQA 4AFZC 2O2OA 1WA7A 1E6HA 1I1JA 2QDLA 2H8HA 2W0ZA 4LNPA 1HSQA 1QCFA 3UF4A 2GNCA 2ROTA 3M0QA 1AD5A 1WXBA 2HBWA 4HXJA 2X3XD 5I11A 2DF6A 1EFNA 1UE9A 2PTKA 3SHWA 2DVJA 1JQQA 4J9GA 2ESWA 3C0CA 2LJ1A 1NEBA 1UDLA 1AWXA 2D8JA 1SHGA 2CT4A 1YNZA 3EG0A 2DX1A 1RLPC 1J3TA 1AZGB 1KFZA 1YN8A 1RUWA 4AG1C 1WIEA 1Z9ZA 2EGAA 2EYWA 3VS7A 4D8KA 3VS2A 2FPEA 5IHKA 1G83A 2DL4A 2RQRA 2CDTA 4HCKA 1SRLA 2JS0A 2J06A 2LQNA 4JZ3A 1ZUYA 3IQLA 4OMNA 2C0OA 3EHRA 2D1XA 2AKLA 3TSWA 1T3LA 2A37A 3VS5A 5IHIA 4R0KA 3NHNA 1WYXA 1GBQA 2L3SA 2RQTA 1YP5A 3NMZC 1UUEA 1X6GA 1ZSGA 2XMFA 1KSWA 2W10A 4JJCA 2V1QA 1ARKA 1BBZA 4DEYA 2V1RA 2IIMA 1Y0MA 5FWBA 2KT8A 2D8HA 2JS2A 1AEYA 4GBQA 3VRZA 1WXUA 2DL3A 3VRYA 1HD3A 2KRMA 1K4US 2MCNA 3NGPA 3I5SA 4Z8AA 2DLPA 1E7OA 4AFQC 2JM9A 2HSPA 1ABOA 2YUOA 3TVTA 1XOVA 3REBB 2M51A 2ECZA 2SEMA 1MV3A 2L3PA 1M30A 3SEMA 5L23A 2DNUA 1K9AA 2CREA 2VWFA 3EG2A 2JTEA 1U3OA 2LP5A 2BZ8A 3O5ZA 3I35A 2EW3A 3UA7A 2ED0A 1Z9QA 2FRWA 1K0XA 1ZX6A 1T0JA 2ABLA 2RNAA 4IIMA 2LNHB 2GBQA 1OEBA 2EVRA 2RQWA 4OMPA 2G6FX 1VA7A 1GCQC 1UGVA 3QWYA 2KXDA 2F2XA
chains in the Genus database with same CATH superfamily
2Z0WA 1ZUUA 5KYXA 1K73C 3OBYA 2YDLA 4BDZA 2C0IA 1B7TA 4CI0C 2QEXA 4XTYA 2L3RA 4AFUC 2CP3A 3JCMV 5IH2A 1AWJA 3CPWP 3AHUA 2VXEA 2JN0A 8ATCB 5GAMg 2CUDA 4X34A 5FU6B 2MOXA 4NOYA 3BY7A 2ZPGB 3R6NA 1PKSA 1UECA 2ZPFB 2KGTA 1UJYA 2XKOC 3G71T 3HKSA 4BY6C 3CCET 2RQVA 1XJWB 1OPLA 3EGDA 3OMGA 1UHFA 1ZLMA 4M7AE 2DK3A 2KBTA 1E6GA 2QEXQ 4IUQA 1M3CA 3HSBA 2FVUA 1JU5C 1WJSA 2CP0A 3OYLA 2JUFA 2CP6A 3CMAA 1OU8A 4XK8E 4RCCA 1IZ6A 2GF7A 3X20B 2DTIA 1H3HA 2MAMA 4N4HA 1WFWA 1K8AR 1LCKA 2K3YA 2VC8A 3LX7A 1K8AC 2GFAA 1IO6A 1GBRA 2BZYA 3RKWA 2NLUA 4OMLA 5KYWB 1VQ9A 1GFDA 2DD4A 3A8MB 2LVMA 1NPPA 3VKIA 4BB7A 4Z02A 1MUZA 2JTMA 5D6WA 3CMAQ 2VGNA 4D6WA 3CXCP 2DKGA 1HJDA 2PVGB 4KH1B 1FMWA 3EHQA 2FPDA 4OGEA 1NZ9A 1D3BA 3RKXA 3E9FA 4BI8B 4A4GA 1NM7A 4QQGA 5LJ5j 4HT9A 1WPYA 4RG2A 2WACA 5IXFA 4OGCA 4RTZA 2HQEA 5GAN2 1WLPB 3QO3A 4EMKB 2X3WD 2FZGB 4FU6A 3VUBA 1VQ9Q 2OAWA 5GJVB 1TWBA 3QUIA 2QAZA 4J9EA 1Q81R 5KYYB 3RBBB 1PRMC 3GNFB 1QVFA 4C8QB 2PZ1A 2KDSA 4J6XA 4A54A 3VS6A 1AOJA 1Q81C 3I56A 1KQSS 2XDBA 1OX9A 3JB9H 1M3BA 5LJ5e 2DE0X 2LX7A 5C0MA 1VIFA 2DVEA 4FL6A 4C0FA 1S72T 2RI5A 1MHNA 2DXCA 1VUBA 3OYFA 1PRLC 1YCSB 5FROA 1G3SA 4M77E 2CZ7B 2Y4YA 3A8OB 2X35A 2LJ0A 2VV5A 5KYUA 4HVWA 3I56Q 2K9GA 2JZ2A 2LCSA 4BI3A 2YUNA 1M1FA 2K2VA 3VS3A 1MMAA 2GGRA 3GBQA 4M78E 1OV3A 2VKNA 1G2BA 4F17A 4E7JA 2RMOA 3JCMh 4XTZA 2MYSA 1TUGB 3UPUA 3QWXX 2Y90A 2PUOB 1VQ6A 4KRTA 3JCMW 1BI3A 2QQSA 3L1AA 4OB3B 1XTDA 2EIFA 4Y91A 4PJOE 3URGA 2HL5C 3H8ZA 2RI2A 2EKHA 4N4IA 2B8AA 1W4SA 2M16A 5FWCA 2K5IA 2JNGA 2BZXA 2VB6A 4Z89A 2EPDA 3THKA 4J6YA 3BDUA 3LYIA 2CSIA 3M0TA 2DBKA 4F7UG 4O6JA 2D9TA 2F5TX 3LH5A 5GAOr 1ABQA 4WTOB 2EGCA 1R8OB 2XICA 3J7AF 2HZYA 4X9DA 3NTHA 1JJ2S 1H92A 4M78B 3DB3A 2J6KA 3SFMA 5GAMh 4BUGA 1WNLA 1X27A 3UA6A 1ZBJA 2ZPHB 3U23A 2C0TA 2VXFA 1JO8A 2IVWA 1WHKA 4PJOB 1QW1A 2EQIA 3HRTA 2QQRA 1VQLQ 1GL5A 3CCMA 1KQSA 2HCKA 4CC3A 1ZQ1A 5D6YA 1QKWA 2CUBA 2HDAA 3WVDB 2RHXA 2DBMA 5C6SA 1K73R 3CCUA 3PGGA 2HKQB 3MEUA 1M5Q1 1N8RR 3FEOA 5GAN5 3A98A 1N8RC 1NG2A 3LH0A 1K76A 3CD6A 1TU0B 2IG0A 5CQXA 4RCBA 3OS0A 2DEQA 2FO0A 1MGQA 5LL6S 3CCMQ 3CCJQ 3H0HA 2KT1A 4J9CA 4EMKA 1PWTA 3VS0A 2K2MA 1VQ5A 2DJQA 3C95A 4DOVA 4M7DB 3V8LA 2I2LA 4P5NA 3CCUQ 1HSQA 3UF4A 5KYYA 4C8QA 1AD5A 2CZ6B 3LW5E 5LJ3f 2K5FA 1VQMT 2X3XD 1O75A 5I11A 1YCYA 3PT9A 4DQ2A 1EFNA 3CD6Q 4VUBA 4HCZA 5IAYA 1HXDA 4C0DB 2X4JA 2ESWA 1X6OA 1UDLA 3OYEA 3HRUA 1J3TA 1KFZA 1B34B 5CO7A 1VQ5Q 2P0KA 1AT1B 1Z9ZA 2EGAA 2HQHA 3VS2A 2V26A 2OX7A 1G83A 2RQRA 2CDTA 2JS0A 2OTJT 4R55A 2P0PA 1H641 3EHRA 5GAOq 2AKLA 2RJEA 2A37A 1JJ2A 1C1AA 1PSFA 1BCOA 4ZGEB 1VQ7A 1GBQA 2L3SA 2C06A 2LTOA 1X6GA 4ZN3A 5AT1B 1ZSGA 2V8KA 3CC4Q 4Q5WA 3V7SA 2V1QA 1TH7A 4ZTJA 1BBZA 4DEYA 3UWNA 2JS2A 1PG5B 1AEYA 2FHDA 3VRYA 1U8RA 3QIIA 4CRIA 3FRNA 1HD3A 5LJ5h 2QGFB 3G4SA 1BI1A 1SSFA 3CCLQ 4ATOA 2LNVA 5CK9A 4EMHA 1JB0E 4AMCA 4C92B 4E7KA 1YJWA 1VQ7Q 3A1PA 2HSPA 3TVTA 1M90U 1XOVA 3QZ5B 1MV3A 3RUXA 1M30A 1K9AA 1RAHB 2CREA 1U3OA 2LP5A 1W2BA 4BE2A 3OYAA 1N9SA 4GY5A 1UGPB 5LJ3g 2CZ1B 1K0XA 1ZX6A 2E64A 5GANf 3G4SQ 2LNHB 2GBQA 3CBMA 1OEBA 2EVRA 4OMPA 4LDVA 2G6FX 1GCQC 1NBEB 1MMGA 4E7LA 1UGQB 4XAXB 2EBPA 1BK2A 1R77A 4D8DA 1ZUKA 2FG0A 4IUTA 1TUDA 1B3QA 1OPKA 1YITT 1K9MU 1OU9A 1BCMA 4MMLA 1VQ4T 2DO3A 2KR3A 4ZNXA 1BI2A 2SRCA 2RHYA 1WJRA 4RUGA 2YHTA 2JW4A 5FU7B 2EJFA 3EH1A 1YJ9A 5LJ3d 3CCSA 1K0SA 2O4XA 1ZA1B 2E5QA 4KBMB 2QG9B 3CCRT 1RI9A 2DERA 3ZEHA 4E7SA 1TUCA 2RK1A 1IB8A 1GCQA 1NLPC 3HRSA 1P92A 3RMSA 4C0DC 1KJWA 3SB2A 5L8RE 1AHJB 3EGUA 1X6BA 2RHZA 3L2VA 2JVVA 2NUPB 3QYHB 3UT1A 1RI0A 3DLMA 3I55T 4XTWA 1YI2A 5HCKA 3Q1JA 1Q86R 3S3OA 4JPBW 3ZBDA 2F2VA 4M7DA 5KCOA 2BUDA 1YHQA 1G5VA 1Q86C 1YJ9Q 4F7UA 3CCSQ 4B6MA 3NTIA 2RH2A 3G6EA 4QW2A 3DKMA 2K3XA 4XU3A 1QCOA 3M0PA 1IRXA 2FZKB 2DIQA 4LDXA 3JCMe 2CP2A 2RQUA 1VQPT 4JJNK 1O9SA 2LQKA 3CPWS 2RPNA 1KQ2A 4IUPA 4ORZA 4PNOA 2XK0A 3QBYA 5GAMj 5HK0A 5FLXE 3PTAA 5D7UA 4M75E 1B34A 1YI2Q 4RTTA 4JJDA 1OZ2A 5GANg 4GLMA 4MZPA 1X69A 1YHQQ 3F70A 3GPLA 1N9RA 3JCMQ 1QVGS 3G6EQ 2K79A 4ESRA 4DOWA 4C92C 4DA4A 3CC7A 2R5AA 2IPOB 3EFOB 2JJ9A 2KAFA 3E1SA 5GAOn 5GAN7 1X2QA 3A8GB 3MEAA 1W1FA 4KUIA 5GAMe 4MZMA 3OYNA 4XU0A 1BYMA 5FW9A 2GTOA 4PK4A 2LDMA 4C8QD 4LUEA 2P4RA 4J9IA 4NS5A 2EYXA 1BIAA 1FMVA 1AWWA 2KMTA 4A53A 1UGSB 4LD9K 5CAIA 4JUVA 4XQ3A 1N5ZA 2QDYB 4C92A 3CC7Q 2EYYA 1LOJA 1QLYA 4X1VA 2HBPA 2RI3A 2QEXT 2L3QA 2KQWA 4FW2A 4LD6A 3VYGA 3A5ZB 2A7YA 3PFSA 3CXCS 3G1JA 1VQNQ 1UTIA 1Q7YR 2DETA 4A4FA 2HD0A 3PVLA 4Y92A 3LGLA 1Q7YC 2K7AA 3OS5A 1QCNA 2I0NA 3OSVA 1N6AA 4DEXA 2QQAA 2WSEE 2BE7D 4C8QG 1D1BA 1TXQA 2NYSA 2FRYA 3OYDA 1S1NA 4BE0A 1QVGP 3EGXB 3BDLA 4ME7A 2DAQA 2JMCA 1JBMA 5ECAA 3G71A 4J7FA 3TSZA 3CCEA 1SSHA 2CYZB 4OB1B 3CMAT 4N0AC 3UATA 4ELZC 4N4GA 4ELYC 1FMKA 5KCHA 1JXOA 1LNXA 2AK5A 3HL8A 4PLLA 2JT4A 1RADB 3MEVA 1QKXA 1QWFA 4QT7A 3SD4A 3MKDA 3M0UA 1VQ9T 3VU3C 2HEQA 2B86A 4M7AB 4EIKA 2NUPA 1PD1A 4M78D 4OVAA 4ZGJB 4N0AA 3M57A 4MDWA 4J7IA 4F04B 2EGEA 2VASA 5M9OA 2ATCB 4IIOA 5J26A 2MI6A 2ZCFB 3CBPA 2O9VA 4BDYA 2KEAA 3EH2A 1UJ0A 4PJOD 3PIOA 2JXBA 3M5AA 3CMEA 1OZ3A 4FCYA 1Y07A 1ZSZB 3OYYA 1ZBXA 2FPFA 2ED1A 1QP2A 1CKAA 4BD3A 4JZ4A 3QJ6A 2L0AA 4M78G 3S3NA 3I56T 1SEMA 1VQ8A 3LLRA 1GCPA 4L5GA 4BE1A 4J83A 2DD5A 3VS1A 3M58A 5IT9E 3CXCA 5KE2A 4C5GA 4RG8A 2DILA 5GMKl 3KBGA 3OYJA 4V2SA 2QQBA 2H3EB 2E5KA 1KQ1A 4PJOG 3L2QA 4JJBA 3CPFA 2R5MA 1UEBA 3CMEQ 3OYHA 1PC0A 1PD0A 2M9UA 3MP1A 3PMTA 4OMOA 3EFOA 5CKHA 1M8MA 1YIJA 5GANh 2NUZA 2MMPA 2RN8A 1WQWA 1NPRA 4PJJA 1E6HA 4FM4B 3R6OA 4B9WA 2H8HA 5FU6C 4FT4A 4FYXB 1QCFA 1VQ8Q 4M7DD 2GNCA 1M8VA 2ROTA 4F7UF 3M0QA 2F5KA 2LT4A 1UE9A 2QXFA 3M53A 1JQQA 3RKYA 3C0CA 1LPLA 1ACMB 3C4SA 3TQ7P 1RAEB 1IGQA 1AWXA 1SHGA 2QTXA 2E4HA 2M0OA 4C0ZA 1RLPC 3BE3A 2R58A 3DB4A 3CEYA 4FT2A 1YIJQ 2VUBA 3VS7A 2E3IA 4M77B 2LQNA 4JZ3A 3H9NA 4KGXB 4OMNA 1VQOA 2C0OA 3MPUB 2D1XA 4M7DG 4KT0E 3OYGA 3HP9A 1QVPA 2RHUA 4R0KA 3T9NA 3NHNA 2X9HA 1D0ZA 1WYXA 1VQLT 1VQ6Q 2RQTA 3NMZC 3EGXA 5KYNA 4JS5A 1ARKA 4PJMA 5DY9A 2V1RA 4ZN1A 2MK5A 2M1HA 2KT8A 2D8HA 2P4TA 1U1SA 2XI9A 2AHJB 4UC4A 5CKDA 4JLGA 1VQOQ 2KRMA 5CQYA 2JTFA 1I5OB 1K4US 1D1CA 3NGPA 4II1A 1MNDA 3JCMJ 2DLPA 3VV0A 1DJ7B 2CS7A 1V76A 4AFQC 4C92F 4EMKC 4C92D 1ABOA 2YUOA 3CCMT 5CVIA 1G3WA 3CCJT 2GCXA 4DBRA 5KYWA 2AT1B 2HKNA 2L3PA 5L23A 2PUKB 1ZSZC 2DTHA 2DXTA 2VWFA 4KUDK 2E65A 4C8QC 3O5ZA 4A4KA 3ME9A 5GMKi 3JB9F 3JB9D 1EIFA 4M7AA 1RL2A 2EW3A 3A8LB 3CCUT 3UA7A 2Y4XA 1Y7XA 2OAUA 3TU4K 2RNAA 4IIMA 1SKUB 2RQWA 3CD6T 2X4YA 4OMFB 1UGVA 2RJCA 1LVKA 2KXDA 2F2XA 4C92G 4QVDA 4NL3A 1SHFA 4NL2A 5CR2A 2PVDB 3V8KA 4E6RA 2JM8A 1IGUA 2A08A 2BIVA 4JRKA 1Y96B 1VQ5T 1IREB 4LE9A 1TSFA 3QDFA 4DBHA 4HT8A 1ZSZA 2EKOA 4C0GA 1X01A 1KC8U 2XG8D 4C5HA 2DRMA 3JB9G 2J6FA 4CC2A 4BACA 1YFNA 2MPXC 2BE9B 2D6FA 2CT3A 3EG1A 4CC4B 3CC4T 1QWEA 1PCXA 1M4ZA 1WHHA 2RK2A 4FIBA 3P8HA 5LJ3j 1CSKA 1M3AA 4A4EA 2QI2A 4M77C 1M1KR 3VS4A 3JB9J 1G3TA 3ER0A 3HHTB 3CCLT 5GAN6 1M1KC 4J9HA 2RHIA 1BB9A 1VQ7T 3JCMb 4PL6A 1VYTA 1JEGA 3H0FA 3QYGB 1AZEA 3H0IA 1WGSA 1K1ZA 2YT6A 4JS4A 1U06A 1PHTA 2OJ2A 2RB6A 3X26B 4AG2C 5A0GA 2J05A 4M78C 2MF2A 2MWPA 4FSSA 3TCJA 5LJ3e 3ASKA 2XU8A 2ZPIB 1WHJA 4M77A 3G4ST 4PJOC 3M55A 1WDXA 3PNWC 5FRNA 3M4GA 3CCVA 2KRSA 5I21A 4QQDA 4PKCC 3MJXA 3OQ5A 1YJNA 3CC2A 2G3RA 2AIRB 1OQKA 3SWNB 4MDXA 4M78A 2YLBA 4MMKA 3M59A 3UDCA 2DFUA 1I0CA 4KULA 4PJNA 2LMJA 1M90R 2FYKA 1RLQC 1UHCA 3L42A 3HPWA 2V8IA 1R0BG 1M90C 4O5VA 5IN1A 1VQKA 1YJWQ 4PJOA 1VYUA 3CCVQ 3VYHB 3OW2P 5I22A 4J8OA 3H41A 6AT1B 1RAAB 1UB4A 3GP8A 4X9CA 2YRDA 1F1BB 2O9SA 1YJNQ 4KGZB 5A0DA 3CC2Q 3TEEA 1NYFA 1QMCA 2DL7A 2E3HA 3NPFA 5GANj 2JMAA 4M7DC 2KSSA 2A36A 2JOYA 2NUTB 3CCQA 3RR6A 2LZ6B 3X25B 1YJ9T 1K9MR 1VQKQ 2LT1A 4RTXA 2ROLA 4E7IA 1Q82R 1YWOA 4QVZA 2KK4A 2QGGA 3JSCA 1Q82C 3CCRA 3PVQA 4ZGDB 1D0YA 4BY6B 1SPKA 8AT1B 2OTLA 2E6NA 3EG3A 5GANe 1T0HA 3EG9B 2J6OA 3GOXA 1YI2T 1Y96A 3GLXA 1C6VX 2KE9A 1M2OA 2FEIA 3CCQQ 4RTUA 1YHQT 1RACB 2YLCA 2YUPA 3I55A 2LC4A 1D3BB 5HY6A 1NEGA 3J80E 2KNBB 1KK7A 3QZ9B 1HYOA 3KFVA 2PNIA 1G3YA 2EFIA 4A4HA 2CH4A 3X24B 2XDDA 3FDRA 2OTLQ 2H3JA 4QQ6A 3V7CA 4M7AD 4L59A 2BKDN 1KD1U 1LJOA 5I2MA 1WHLA 1SG5A 2GQVA 2LQ8A 2E10A 3L2WA 2QA4A 4OF1A 1I81A 5EG2A 4LDUA 4ANJA 3CC7T 2LJ3A 2CKKA 3KXTA 1QP3A 4J9FA 5GMKj 2LRQA 2ZGWA 1VQNT 1AVZC 3HFNA 1IHVA 1WZOA 1EX4A 4RTWA 4R56A 4C8QF 1UG1A 2E1HA 2YRVA 1I8FA 1M9SA 2DA9A 2XHCA 4M7AG 4EPCA 4FSXA 1NJIR 1K73U 4M75B 2M0YA 3EAEA 4JDSA 4IUVA 1NJIC 4OMQA 3V7RA 2QA4Q 1I07A 2VYTA 5J3BA 2L2PA 3OYKA 2O88A 2RM4A 2E70A 1QVFS 2L5QA 2MIOA 4JRIA 1H8KA 5GMKe 3SWNA 2CP5A 4AFZC 2O2OA 3JB9I 1WA7A 2EJGA 5FU7C 1Q95G 3MHXA 3JCMd 2KVQG 2W0ZA 5I2SA 3M9QA 4C5EA 1WXBA 2HBWA 4HXJA 2HQXA 1C0MA 2DPPB 2F69A 1RABB 4OB0B 2PTKA 3SHWA 4FYWB 2DVJA 3N5BB 2LJ1A 2E6ZA 1I5LA 5HKCA 1NEBA 3QPHA 5LJ3h 3RDVA 1YNZA 1BI0A 1AZGB 4XTVA 1FXXA 3E19A 3JCMc 1TOVA 1K8AU 2FPEA 3CPWA 2DL4A 4HCKA 4M77F 3LGFA 4M77D 2NUTA 3OY9A 3JAME 3LWHA 4HKEA 5GAN4 3E2UA 3S3MA 2XIDA 3MCAB 4IKFA 2XD0A 5GAMd 5GMKm 1ZA2B 2EYQA 3G71Q 1UUEA 3CCEQ 5GAN8 1QVGA 2ZAEA 2W10A 5CIUA 5LJ5f 4M78F 3CBOA 1M2VB 4B9XA 1QVFP 1EZZB 4C8QE 1I4K1 3VUZA 3VRZA 2V8JA 3EG9A 2X51A 3A8HB 3V8JA 2COZA 2EAYA 4HCCA 4IUUA 4M77G 2D0QB 4LDYA 4PJOF 2L8DA 2MCNA 4Z8AA 1UGRB 4JRPA 1VOMA 2QTVA 1Q81U 3CMET 4FW1A 4GLKA 2M51A 2CZ0B 3DLLA 4E7ZA 1WHMA 2DNUA 3QJYA 3C12A 2PVOB 3EG2A 2JTEA 4KH0B 3GIBA 4QKUA 1YBYA 2ED0A 1VQ8T 2FRWA 1T0JA 1MMNA 3EFSA 4M75C 3L2UA 9ATCB 1RAFB 1VA7A 1D1AA 2X4WA 3D7SB 3FLGA 2LQWA 2DL5A 1S72A 1YIJT 4PFPA 1FX7A 5CKFA 1Y57A 4RMOA 2QYZA 2A0FB 2P84A 1U1TA 4M7DF 4PFZA 1WX6A 5A0LA 2FB7A 2VVKA 4EMGA 2BTTA 3M0RA 2QQ9A 5CKBA 2MWOA 1W70A 2HMAA 2X4XA 1SF9A 4E47A 4M75A 2A3LA 1TTHB 1VQ6T 1D0XA 2EQJA 5DLQE 5LJ5g 2DIGA 3I5RA 1WI7A 2DZCA 1A0NB 2DEUA 4OB2B 4OMMA 1WJQA 2FZCB 3OSSC 1S72Q 3C94A 3ZL7C 3OYCA 4IURA 4QVCA 4M4ZA 3OS2A 4WCIA 2CH4W 2EJ9A 1W6XA 2D0NA 1VQOT 2DMOA 1OX8A 4JLIA 1TS9A 5HK3A 2RA2A 3JV3A 2KYMA 1KQSP 1B07A 3JRZA 1NLOC 2YSQA 2COWA 3EFRA 1PKTA 5LJ5d 4M7AC 4ZTFA 3BFMA 5KE3A 1X2KA 3QDRB 1VQLA 4HVUA 1RAIB 3VJPA 2CGHA 3OYMA 1M1GA 2DZ9A 5D6XA 3OMCA 3FJ5A 1OOTA 1YWPA 2K4YA 3HTRA 3QKJA 2F1LA 2NWMA 3JCMX 5GAN3 1XQHA 1T3SA 2OI3A 3MP8A 3MEWA 2YUQA 4OP0A 1OI1A 1OYXA 2K3BA 1MV0B 5GMKh 2AZSA 1IHWA 4PFOA 5FRMA 4CC7A 3MO8A 4RTYA 1N8RU 1IXDA 2VGMA 3OS1A 4M7DE 1N27A 4HVVA 3CCJA 1KIKA 1JRIA 4F7UE 1G8XA 1M2VA 2DJZA 4Z88A 2EQUA 3RNJA 2A28A 5KH6A 2KI7A 4RTVA 1M27C 3G7ZA 1CKBA 3BW1A 2HSEB 5GAOm 1GXIE 2O4XB 2E12A 2J7IA 1KHCA 1NYGA 4XTUA 3FJPA 1W2BS 2EWNA 2COYA 2FL7A 5IHNA 2AKKA 1BU1A 1X43A 2EQMA 2M02A 1JXMA 1PM3A 2ZZDA 1V29B 1X75C 1GRIA 1UFFA 4AFSC 3WXMB 1JJ2P 4J9BA 3GNGA 5A2QE 3FB9A 2WSFE 1VYVA 4LN2A 2DXUA 1RAGB 2O31A 2F2WA 3L2ZA 4F7UB 1WXTA 1XNIA 1VQMA 3TREA 1KC8R 4WF2A 1MNEA 1D09B 5GAOp 1KC8C 4F14A 4YTLA 2KYBA 4PLIA 3ULRB 4HCBA 3REAB 2PQWA 3CC4A 2KXCA 1M1KU 4E2FB 1V1CA 4LXCA 5GAOl 2K57A 2AZVA 2RD1A 3OW2S 4DBFA 1HK9A 2DRKA 2ENMA 2OTJA 3H6ZA 2RJDA 4C92E 4LDWA 3QHSA 3FIFA 2P0QA 1VQMQ 1U5SA 2KRNA 5CKEA 3M56A 3I9QA 2K6DA 3CCLA 2GQIA 4J9DA 4J5YA 1W2BP 3RERA 2HL3A 2DYBA 3RIRA 1WHGA 4BI4A 3KUFA 1AWOA 1SRMA 4Y28E 1Y71A 1NE8A 4XU2A 3OA6A 1YJWT 2OTJQ 2DL8A 2LX9A 3CCVT 3S6WA 1GFCA 2EYZA 2DYIA 3M0SA 4RKUE 3LWIA 2K5LA 2DM1A 2XDPA 3NFCA 5KYXB 2YXYA 1YJNT 4LUDA 3CC2T 3PE0A 3FC3A 2HAXA 2R57A 4A63B 2RF0A 3HFOA 4K11A 2YRCA 4KGVB 2QASA 5GJWB 3L2RA 1WQ7A 3RMQA 2DTOA 1PSEA 4MZTA 1MMDA 5EC7A 1VQKT 3QSUA 4XU1A 1TG0A 2LCCA 4M75F 3CQTA 4M75D 1FYNA 4F16A 3EGDB 3NTKA 2CSQA 2GTJA 7AT1B 2KROA 5DLOA 4J6WA 1YITA 3E9GA 5IXBA 2EQKA 1BIBA 1VQ4A 3O8VA 3JCMf 3CCST 1I1JA 2QK0A 3J81E 3CCQT 3JCMP 2QDLA 2PU9B 4LNPA 1K9MC 3META 1Q82U 3PIPA 3M54A 4AT1B 4M75G 2DF6A 5AYFA 1VIEA 4PJLA 4J9GA 3OW2A 1Q86U 1KG1A 2D8JA 3EG0A 2CT4A 2DX1A 2OTLT 5J39A 3RESA 2RJFA 1YITQ 1YN8A 2HNIA 2ZPEB 4EDUA 1RUWA 2E41A 4AG1C 1WIEA 1VQ4Q 2EYWA 4D8KA 4TVRA 5IHKA 1KHIA 4XTXA 2L89A 3G6ET 4FYVB 1SRLA 2J06A 3QG1A 1ZUYA 3IQLA 2WSCE 3TSWA 1T3LA 3OYBA 3VS5A 1FWZA 2CP7A 2GFUA 5GAMf 3OB9A 5IHIA 1ZHIA 3CCRQ 2ZPBB 3OYIA 4E7HA 3P8DA 1YP5A 2O01E 1VQPA 2XMFA 1KSWA 1QQJA 5CCAA 4JJCA 4M7AF 1BKBA 5DM7R 2IIMA 1Y0MA 5FWBA 4GBQA 2DXBA 3I55Q 1WXUA 4HA8A 2DL3A 3OBWA 3AT1B 3P8BB 3I5SA 2QA4T 3ZFJA 2RO0A 3QXEB 4L6V5 4DBQA 1E7OA 2JM9A 1H3ZA 3MP6A 3SWNC 3REBB 1KD1R 2LCLA 1OULA 2ECZA 2SEMA 1VQPQ 3SEMA 3JCMg 3X28B 1KD1C 3WVEB 3GF5A 4FYYB 2BZ8A 1NJIU 5KYUB 3I35A 2KY9A 2YWWA 3M4YA 3SDZA 1VQNA 1Z9QA 2ABLA 4C5IA 4JRQA 1R0CB 3INZA 3PMIA 5GANd 1Q7YU 3QWYA 1PNJA
chains in the Genus database with same CATH topology
2EBPA 1BK2A 2LQWA 1SHFA 4D8DA 1ZUUA 1ZUKA 2DL5A 2FG0A 1TUDA 2YDLA 1B3QA 1OPKA 2C0IA 2JM8A 2A08A 4E6RA 4LE9A 1Y57A 2KR3A 4AFUC 4ZNXA 5IH2A 1AWJA 2SRCA 1WX6A 2DRMA 2J6FA 4CC2A 4RUGA 2VVKA 2JW4A 2CUDA 2BTTA 3M0RA 1K0SA 2MOXA 3R6NA 1W70A 1PKSA 1UECA 1RI9A 2KGTA 1UJYA 1TUCA 1GCQA 2CT3A 2RQVA 1NLPC 3I5RA 1WI7A 1KJWA 3EG1A 4CC4B 1OPLA 1A0NB 1UHFA 1ZLMA 1QWEA 4OMMA 2KBTA 1E6GA 3EGUA 3ZL7C 1X6BA 1M3CA 4M4ZA 4WCIA 1CSKA 1M3AA 1JU5C 2CH4W 5HCKA 1PNJA 1W6XA 4JPBW 2D0NA 2F2VA 3VS4A 2DMOA 1H3HA 4J9HA 1WFWA 1BB9A 3JV3A 1LCKA 2KYMA 1VYTA 1JEGA 3H0FA 3M0PA 1B07A 1AZEA 3H0IA 1NLOC 1K1ZA 2YT6A 1U06A 1PHTA 2RQUA 1IO6A 2YSQA 2OJ2A 1GBRA 2BZYA 4AG2C 1PKTA 2J05A 4OMLA 4FSSA 1GFDA 2RPNA 1X2KA 4ORZA 4HVUA 1MUZA 3FJ5A 4JJDA 4RTTA 1OOTA 4GLMA 1YWPA 1X69A 1HJDA 3EHQA 2FPDA 1NM7A 1WDXA 2NWMA 2KRSA 1T3SA 2K79A 4ESRA 2OI3A 5IXFA 2YUQA 2K3BA 1MV0B 4RTZA 1WLPB 2AZSA 2X3WD 4CC7A 2OAWA 4RTYA 5GJVB 1X2QA 4HVVA 1KIKA 1I0CA 1W1FA 4J9EA 2LMJA 4Z88A 3RBBB 1PRMC 1RLQC 1UHCA 2PZ1A 3RNJA 3VS6A 1AOJA 5FW9A 2A28A 4RTVA 2GTOA 1M27C 1CKBA 4LUEA 2P4RA 4J9IA 1VYUA 2EYXA 1M3BA 1AWWA 5I22A 2DE0X 2LX7A 3H41A 2J7IA 1N5ZA 1NYGA 2EYYA 1QLYA 2O9SA 4X1VA 2L3QA 5IHNA 2AKKA 1BU1A 1X43A 1PRLC 1YCSB 1NYFA 2DL7A 1JXMA 3NPFA 2JMAA 1UTIA 2A36A 2LJ0A 1GRIA 1UFFA 4AFSC 3PVLA 4Y92A 2K7AA 2LZ6B 4J9BA 4HVWA 2I0NA 1VYVA 4LN2A 2K9GA 4DEXA 2O31A 2F2WA 4RTXA 2LCSA 1WXTA 2YUNA 2FRYA 1S1NA 3VS3A 2GGRA 2ROLA 3GBQA 1YWOA 1OV3A 2VKNA 1G2BA 4F17A 2RMOA 2JMCA 4F14A 3PVQA 3QWXX 2KYBA 5ECAA 1SPKA 4KRTA 3TSZA 3ULRB 3EG3A 1SSHA 1T0HA 3REAB 2J6OA 2KXCA 1V1CA 2KE9A 2AZVA 3UATA 2EKHA 2FEIA 5FWCA 4RTUA 2DRKA 2ENMA 2BZXA 4Z89A 1FMKA 2YUPA 1JXOA 2AK5A 2EPDA 3THKA 2CSIA 1NEGA 3M0TA 2JT4A 1U5SA 2KRNA 2DBKA 3I9QA 2KNBB 1QKXA 2K6DA 1QWFA 3LH5A 2GQIA 1ABQA 4QT7A 3KFVA 2PNIA 3M0UA 2CH4A 2EGCA 4J9DA 2HEQA 2DYBA 1H92A 2B86A 1AWOA 2J6KA 1SRMA 4EIKA 1X27A 3UA6A 1ZBJA 3U23A 2C0TA 2EGEA 1JO8A 2DL8A 4IIOA 1GFCA 2EYZA 3M0SA 2O9VA 2KEAA 2DM1A 1UJ0A 2LJ3A 2EQIA 4LUDA 3PE0A 2JXBA 4A63B 1GL5A 2RF0A 2HCKA 4CC3A 4J9FA 2FPFA 2ED1A 4K11A 1CKAA 1AVZC 1QKWA 4JZ4A 2CUBA 2HDAA 4RTWA 2DBMA 5GJWB 1UG1A 2L0AA 2DA9A 5EC7A 1SEMA 1GCPA 2M0YA 1TG0A 3A98A 3VS1A 4OMQA 3CQTA 1FYNA 1NG2A 1K76A 2DILA 4F16A 1I07A 2E5KA 2FO0A 2CSQA 4JJBA 2L2PA 2GTJA 2KROA 2O88A 3H0HA 2KT1A 4J9CA 4OMOA 2MIOA 5IXBA 1H8KA 1M8MA 1PWTA 3VS0A 2K2MA 2NUZA 2RN8A 2DJQA 4AFZC 2O2OA 1WA7A 1E6HA 1I1JA 2QDLA 2H8HA 2W0ZA 4LNPA 1HSQA 1QCFA 3UF4A 2GNCA 2ROTA 3M0QA 1AD5A 1WXBA 2HBWA 4HXJA 2X3XD 5I11A 2DF6A 1EFNA 1UE9A 2PTKA 3SHWA 2DVJA 1JQQA 4J9GA 2ESWA 3C0CA 2LJ1A 1NEBA 1UDLA 1AWXA 2D8JA 1SHGA 2CT4A 1YNZA 3EG0A 2DX1A 1RLPC 1J3TA 1AZGB 1KFZA 1YN8A 1RUWA 4AG1C 1WIEA 1Z9ZA 2EGAA 2EYWA 3VS7A 4D8KA 3VS2A 2FPEA 5IHKA 1G83A 2DL4A 2RQRA 2CDTA 4HCKA 1SRLA 2JS0A 2J06A 2LQNA 4JZ3A 1ZUYA 3IQLA 4OMNA 2C0OA 3EHRA 2D1XA 2AKLA 3TSWA 1T3LA 2A37A 3VS5A 5IHIA 4R0KA 3NHNA 1WYXA 1GBQA 2L3SA 2RQTA 1YP5A 3NMZC 1UUEA 1X6GA 1ZSGA 2XMFA 1KSWA 2W10A 4JJCA 2V1QA 1ARKA 1BBZA 4DEYA 2V1RA 2IIMA 1Y0MA 5FWBA 2KT8A 2D8HA 2JS2A 1AEYA 4GBQA 3VRZA 1WXUA 2DL3A 3VRYA 1HD3A 2KRMA 1K4US 2MCNA 3NGPA 3I5SA 4Z8AA 2DLPA 1E7OA 4AFQC 2JM9A 2HSPA 1ABOA 2YUOA 3TVTA 1XOVA 3REBB 2M51A 2ECZA 2SEMA 1MV3A 2L3PA 1M30A 3SEMA 5L23A 2DNUA 1K9AA 2CREA 2VWFA 3EG2A 2JTEA 1U3OA 2LP5A 2BZ8A 3O5ZA 3I35A 2EW3A 3UA7A 2ED0A 1Z9QA 2FRWA 1K0XA 1ZX6A 1T0JA 2ABLA 2RNAA 4IIMA 2LNHB 2GBQA 1OEBA 2EVRA 2RQWA 4OMPA 2G6FX 1VA7A 1GCQC 1UGVA 3QWYA 2KXDA 2F2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBP A;  1BK2 A;  2LQW A;  1SHF A;  4D8D A;  1ZUU A;  1ZUK A;  2DL5 A;  2FG0 A;  1TUD A;  2YDL A;  1B3Q A;  1OPK A;  2C0I A;  2JM8 A;  2A08 A;  4E6R A;  4LE9 A;  1Y57 A;  2KR3 A;  4AFU C;  4ZNX A;  5IH2 A;  1AWJ A;  2SRC A;  1WX6 A;  2DRM A;  2J6F A;  4CC2 A;  4RUG A;  2VVK A;  2JW4 A;  2CUD A;  2BTT A;  3M0R A;  1K0S A;  2MOX A;  3R6N A;  1W70 A;  1PKS A;  1UEC A;  1RI9 A;  2KGT A;  1UJY A;  1TUC A;  1GCQ A;  2CT3 A;  2RQV A;  1NLP C;  3I5R A;  1WI7 A;  1KJW A;  3EG1 A;  4CC4 B;  1OPL A;  1A0N B;  1UHF A;  1ZLM A;  1QWE A;  4OMM A;  2KBT A;  1E6G A;  3EGU A;  3ZL7 C;  1X6B A;  1M3C A;  4M4Z A;  4WCI A;  1CSK A;  1M3A A;  1JU5 C;  2CH4 W;  5HCK A;  1PNJ A;  1W6X A;  4JPB W;  2D0N A;  2F2V A;  3VS4 A;  2DMO A;  1H3H A;  4J9H A;  1WFW A;  1BB9 A;  3JV3 A;  1LCK A;  2KYM A;  1VYT A;  1JEG A;  3H0F A;  3M0P A;  1B07 A;  1AZE A;  3H0I A;  1NLO C;  1K1Z A;  2YT6 A;  1U06 A;  1PHT A;  2RQU A;  1IO6 A;  2YSQ A;  2OJ2 A;  1GBR A;  2BZY A;  4AG2 C;  1PKT A;  2J05 A;  4OML A;  4FSS A;  1GFD A;  2RPN A;  1X2K A;  4ORZ A;  4HVU A;  1MUZ A;  3FJ5 A;  4JJD A;  4RTT A;  1OOT A;  4GLM A;  1YWP A;  1X69 A;  1HJD A;  3EHQ A;  2FPD A;  1NM7 A;  1WDX A;  2NWM A;  2KRS A;  1T3S A;  2K79 A;  4ESR A;  2OI3 A;  5IXF A;  2YUQ A;  2K3B A;  1MV0 B;  4RTZ A;  1WLP B;  2AZS A;  2X3W D;  4CC7 A;  2OAW A;  4RTY A;  5GJV B;  1X2Q A;  4HVV A;  1KIK A;  1I0C A;  1W1F A;  4J9E A;  2LMJ A;  4Z88 A;  3RBB B;  1PRM C;  1RLQ C;  1UHC A;  2PZ1 A;  3RNJ A;  3VS6 A;  1AOJ A;  5FW9 A;  2A28 A;  4RTV A;  2GTO A;  1M27 C;  1CKB A;  4LUE A;  2P4R A;  4J9I A;  1VYU A;  2EYX A;  1M3B A;  1AWW A;  5I22 A;  2DE0 X;  2LX7 A;  3H41 A;  2J7I A;  1N5Z A;  1NYG A;  2EYY A;  1QLY A;  2O9S A;  4X1V A;  2L3Q A;  5IHN A;  2AKK A;  1BU1 A;  1X43 A;  1PRL C;  1YCS B;  1NYF A;  2DL7 A;  1JXM A;  3NPF A;  2JMA A;  1UTI A;  2A36 A;  2LJ0 A;  1GRI A;  1UFF A;  4AFS C;  3PVL A;  4Y92 A;  2K7A A;  2LZ6 B;  4J9B A;  4HVW A;  2I0N A;  1VYV A;  4LN2 A;  2K9G A;  4DEX A;  2O31 A;  2F2W A;  4RTX A;  2LCS A;  1WXT A;  2YUN A;  2FRY A;  1S1N A;  3VS3 A;  2GGR A;  2ROL A;  3GBQ A;  1YWO A;  1OV3 A;  2VKN A;  1G2B A;  4F17 A;  2RMO A;  2JMC A;  4F14 A;  3PVQ A;  3QWX X;  2KYB A;  5ECA A;  1SPK A;  4KRT A;  3TSZ A;  3ULR B;  3EG3 A;  1SSH A;  1T0H A;  3REA B;  2J6O A;  2KXC A;  1V1C A;  2KE9 A;  2AZV A;  3UAT A;  2EKH A;  2FEI A;  5FWC A;  4RTU A;  2DRK A;  2ENM A;  2BZX A;  4Z89 A;  1FMK A;  2YUP A;  1JXO A;  2AK5 A;  2EPD A;  3THK A;  2CSI A;  1NEG A;  3M0T A;  2JT4 A;  1U5S A;  2KRN A;  2DBK A;  3I9Q A;  2KNB B;  1QKX A;  2K6D A;  1QWF A;  3LH5 A;  2GQI A;  1ABQ A;  4QT7 A;  3KFV A;  2PNI A;  3M0U A;  2CH4 A;  2EGC A;  4J9D A;  2HEQ A;  2DYB A;  1H92 A;  2B86 A;  1AWO A;  2J6K A;  1SRM A;  4EIK A;  1X27 A;  3UA6 A;  1ZBJ A;  3U23 A;  2C0T A;  2EGE A;  1JO8 A;  2DL8 A;  4IIO A;  1GFC A;  2EYZ A;  3M0S A;  2O9V A;  2KEA A;  2DM1 A;  1UJ0 A;  2LJ3 A;  2EQI A;  4LUD A;  3PE0 A;  2JXB A;  4A63 B;  1GL5 A;  2RF0 A;  2HCK A;  4CC3 A;  4J9F A;  2FPF A;  2ED1 A;  4K11 A;  1CKA A;  1AVZ C;  1QKW A;  4JZ4 A;  2CUB A;  2HDA A;  4RTW A;  2DBM A;  5GJW B;  1UG1 A;  2L0A A;  2DA9 A;  5EC7 A;  1SEM A;  1GCP A;  2M0Y A;  1TG0 A;  3A98 A;  3VS1 A;  4OMQ A;  3CQT A;  1FYN A;  1NG2 A;  1K76 A;  2DIL A;  4F16 A;  1I07 A;  2E5K A;  2FO0 A;  2CSQ A;  4JJB A;  2L2P A;  2GTJ A;  2KRO A;  2O88 A;  3H0H A;  2KT1 A;  4J9C A;  4OMO A;  2MIO A;  5IXB A;  1H8K A;  1M8M A;  1PWT A;  3VS0 A;  2K2M A;  2NUZ A;  2RN8 A;  2DJQ A;  4AFZ C;  2O2O A;  1WA7 A;  1E6H A;  1I1J A;  2QDL A;  2H8H A;  2W0Z A;  4LNP A;  1HSQ A;  1QCF A;  3UF4 A;  2GNC A;  2ROT A;  3M0Q A;  1AD5 A;  1WXB A;  2HBW A;  4HXJ A;  2X3X D;  5I11 A;  2DF6 A;  1EFN A;  1UE9 A;  2PTK A;  3SHW A;  2DVJ A;  1JQQ A;  4J9G A;  2ESW A;  3C0C A;  2LJ1 A;  1NEB A;  1UDL A;  1AWX A;  2D8J A;  1SHG A;  2CT4 A;  1YNZ A;  3EG0 A;  2DX1 A;  1RLP C;  1J3T A;  1AZG B;  1KFZ A;  1YN8 A;  1RUW A;  4AG1 C;  1WIE A;  1Z9Z A;  2EGA A;  2EYW A;  3VS7 A;  4D8K A;  3VS2 A;  2FPE A;  5IHK A;  1G83 A;  2DL4 A;  2RQR A;  2CDT A;  4HCK A;  1SRL A;  2JS0 A;  2J06 A;  2LQN A;  4JZ3 A;  1ZUY A;  3IQL A;  4OMN A;  2C0O A;  3EHR A;  2D1X A;  2AKL A;  3TSW A;  1T3L A;  2A37 A;  3VS5 A;  5IHI A;  4R0K A;  3NHN A;  1WYX A;  1GBQ A;  2L3S A;  2RQT A;  1YP5 A;  3NMZ C;  1UUE A;  1X6G A;  1ZSG A;  2XMF A;  1KSW A;  2W10 A;  4JJC A;  2V1Q A;  1ARK A;  1BBZ A;  4DEY A;  2V1R A;  2IIM A;  1Y0M A;  5FWB A;  2KT8 A;  2D8H A;  2JS2 A;  1AEY A;  4GBQ A;  3VRZ A;  1WXU A;  2DL3 A;  3VRY A;  1HD3 A;  2KRM A;  1K4U S;  2MCN A;  3NGP A;  3I5S A;  4Z8A A;  2DLP A;  1E7O A;  4AFQ C;  2JM9 A;  2HSP A;  1ABO A;  2YUO A;  3TVT A;  1XOV A;  3REB B;  2M51 A;  2ECZ A;  2SEM A;  1MV3 A;  2L3P A;  1M30 A;  3SEM A;  5L23 A;  2DNU A;  1K9A A;  2CRE A;  2VWF A;  3EG2 A;  2JTE A;  1U3O A;  2LP5 A;  2BZ8 A;  3O5Z A;  3I35 A;  2EW3 A;  3UA7 A;  2ED0 A;  1Z9Q A;  2FRW A;  1K0X A;  1ZX6 A;  1T0J A;  2ABL A;  2RNA A;  4IIM A;  2LNH B;  2GBQ A;  1OEB A;  2EVR A;  2RQW A;  4OMP A;  2G6F X;  1VA7 A;  1GCQ C;  1UGV A;  3QWY A;  2KXD A;  2F2X A; 
#chains in the Genus database with same CATH topology
 2Z0W A;  1ZUU A;  5KYX A;  1K73 C;  3OBY A;  2YDL A;  4BDZ A;  2C0I A;  1B7T A;  4CI0 C;  2QEX A;  4XTY A;  2L3R A;  4AFU C;  2CP3 A;  3JCM V;  5IH2 A;  1AWJ A;  3CPW P;  3AHU A;  2VXE A;  2JN0 A;  8ATC B;  5GAM g;  2CUD A;  4X34 A;  5FU6 B;  2MOX A;  4NOY A;  3BY7 A;  2ZPG B;  3R6N A;  1PKS A;  1UEC A;  2ZPF B;  2KGT A;  1UJY A;  2XKO C;  3G71 T;  3HKS A;  4BY6 C;  3CCE T;  2RQV A;  1XJW B;  1OPL A;  3EGD A;  3OMG A;  1UHF A;  1ZLM A;  4M7A E;  2DK3 A;  2KBT A;  1E6G A;  2QEX Q;  4IUQ A;  1M3C A;  3HSB A;  2FVU A;  1JU5 C;  1WJS A;  2CP0 A;  3OYL A;  2JUF A;  2CP6 A;  3CMA A;  1OU8 A;  4XK8 E;  4RCC A;  1IZ6 A;  2GF7 A;  3X20 B;  2DTI A;  1H3H A;  2MAM A;  4N4H A;  1WFW A;  1K8A R;  1LCK A;  2K3Y A;  2VC8 A;  3LX7 A;  1K8A C;  2GFA A;  1IO6 A;  1GBR A;  2BZY A;  3RKW A;  2NLU A;  4OML A;  5KYW B;  1VQ9 A;  1GFD A;  2DD4 A;  3A8M B;  2LVM A;  1NPP A;  3VKI A;  4BB7 A;  4Z02 A;  1MUZ A;  2JTM A;  5D6W A;  3CMA Q;  2VGN A;  4D6W A;  3CXC P;  2DKG A;  1HJD A;  2PVG B;  4KH1 B;  1FMW A;  3EHQ A;  2FPD A;  4OGE A;  1NZ9 A;  1D3B A;  3RKX A;  3E9F A;  4BI8 B;  4A4G A;  1NM7 A;  4QQG A;  5LJ5 j;  4HT9 A;  1WPY A;  4RG2 A;  2WAC A;  5IXF A;  4OGC A;  4RTZ A;  2HQE A;  5GAN 2;  1WLP B;  3QO3 A;  4EMK B;  2X3W D;  2FZG B;  4FU6 A;  3VUB A;  1VQ9 Q;  2OAW A;  5GJV B;  1TWB A;  3QUI A;  2QAZ A;  4J9E A;  1Q81 R;  5KYY B;  3RBB B;  1PRM C;  3GNF B;  1QVF A;  4C8Q B;  2PZ1 A;  2KDS A;  4J6X A;  4A54 A;  3VS6 A;  1AOJ A;  1Q81 C;  3I56 A;  1KQS S;  2XDB A;  1OX9 A;  3JB9 H;  1M3B A;  5LJ5 e;  2DE0 X;  2LX7 A;  5C0M A;  1VIF A;  2DVE A;  4FL6 A;  4C0F A;  1S72 T;  2RI5 A;  1MHN A;  2DXC A;  1VUB A;  3OYF A;  1PRL C;  1YCS B;  5FRO A;  1G3S A;  4M77 E;  2CZ7 B;  2Y4Y A;  3A8O B;  2X35 A;  2LJ0 A;  2VV5 A;  5KYU A;  4HVW A;  3I56 Q;  2K9G A;  2JZ2 A;  2LCS A;  4BI3 A;  2YUN A;  1M1F A;  2K2V A;  3VS3 A;  1MMA A;  2GGR A;  3GBQ A;  4M78 E;  1OV3 A;  2VKN A;  1G2B A;  4F17 A;  4E7J A;  2RMO A;  3JCM h;  4XTZ A;  2MYS A;  1TUG B;  3UPU A;  3QWX X;  2Y90 A;  2PUO B;  1VQ6 A;  4KRT A;  3JCM W;  1BI3 A;  2QQS A;  3L1A A;  4OB3 B;  1XTD A;  2EIF A;  4Y91 A;  4PJO E;  3URG A;  2HL5 C;  3H8Z A;  2RI2 A;  2EKH A;  4N4I A;  2B8A A;  1W4S A;  2M16 A;  5FWC A;  2K5I A;  2JNG A;  2BZX A;  2VB6 A;  4Z89 A;  2EPD A;  3THK A;  4J6Y A;  3BDU A;  3LYI A;  2CSI A;  3M0T A;  2DBK A;  4F7U G;  4O6J A;  2D9T A;  2F5T X;  3LH5 A;  5GAO r;  1ABQ A;  4WTO B;  2EGC A;  1R8O B;  2XIC A;  3J7A F;  2HZY A;  4X9D A;  3NTH A;  1JJ2 S;  1H92 A;  4M78 B;  3DB3 A;  2J6K A;  3SFM A;  5GAM h;  4BUG A;  1WNL A;  1X27 A;  3UA6 A;  1ZBJ A;  2ZPH B;  3U23 A;  2C0T A;  2VXF A;  1JO8 A;  2IVW A;  1WHK A;  4PJO B;  1QW1 A;  2EQI A;  3HRT A;  2QQR A;  1VQL Q;  1GL5 A;  3CCM A;  1KQS A;  2HCK A;  4CC3 A;  1ZQ1 A;  5D6Y A;  1QKW A;  2CUB A;  2HDA A;  3WVD B;  2RHX A;  2DBM A;  5C6S A;  1K73 R;  3CCU A;  3PGG A;  2HKQ B;  3MEU A;  1M5Q 1;  1N8R R;  3FEO A;  5GAN 5;  3A98 A;  1N8R C;  1NG2 A;  3LH0 A;  1K76 A;  3CD6 A;  1TU0 B;  2IG0 A;  5CQX A;  4RCB A;  3OS0 A;  2DEQ A;  2FO0 A;  1MGQ A;  5LL6 S;  3CCM Q;  3CCJ Q;  3H0H A;  2KT1 A;  4J9C A;  4EMK A;  1PWT A;  3VS0 A;  2K2M A;  1VQ5 A;  2DJQ A;  3C95 A;  4DOV A;  4M7D B;  3V8L A;  2I2L A;  4P5N A;  3CCU Q;  1HSQ A;  3UF4 A;  5KYY A;  4C8Q A;  1AD5 A;  2CZ6 B;  3LW5 E;  5LJ3 f;  2K5F A;  1VQM T;  2X3X D;  1O75 A;  5I11 A;  1YCY A;  3PT9 A;  4DQ2 A;  1EFN A;  3CD6 Q;  4VUB A;  4HCZ A;  5IAY A;  1HXD A;  4C0D B;  2X4J A;  2ESW A;  1X6O A;  1UDL A;  3OYE A;  3HRU A;  1J3T A;  1KFZ A;  1B34 B;  5CO7 A;  1VQ5 Q;  2P0K A;  1AT1 B;  1Z9Z A;  2EGA A;  2HQH A;  3VS2 A;  2V26 A;  2OX7 A;  1G83 A;  2RQR A;  2CDT A;  2JS0 A;  2OTJ T;  4R55 A;  2P0P A;  1H64 1;  3EHR A;  5GAO q;  2AKL A;  2RJE A;  2A37 A;  1JJ2 A;  1C1A A;  1PSF A;  1BCO A;  4ZGE B;  1VQ7 A;  1GBQ A;  2L3S A;  2C06 A;  2LTO A;  1X6G A;  4ZN3 A;  5AT1 B;  1ZSG A;  2V8K A;  3CC4 Q;  4Q5W A;  3V7S A;  2V1Q A;  1TH7 A;  4ZTJ A;  1BBZ A;  4DEY A;  3UWN A;  2JS2 A;  1PG5 B;  1AEY A;  2FHD A;  3VRY A;  1U8R A;  3QII A;  4CRI A;  3FRN A;  1HD3 A;  5LJ5 h;  2QGF B;  3G4S A;  1BI1 A;  1SSF A;  3CCL Q;  4ATO A;  2LNV A;  5CK9 A;  4EMH A;  1JB0 E;  4AMC A;  4C92 B;  4E7K A;  1YJW A;  1VQ7 Q;  3A1P A;  2HSP A;  3TVT A;  1M90 U;  1XOV A;  3QZ5 B;  1MV3 A;  3RUX A;  1M30 A;  1K9A A;  1RAH B;  2CRE A;  1U3O A;  2LP5 A;  1W2B A;  4BE2 A;  3OYA A;  1N9S A;  4GY5 A;  1UGP B;  5LJ3 g;  2CZ1 B;  1K0X A;  1ZX6 A;  2E64 A;  5GAN f;  3G4S Q;  2LNH B;  2GBQ A;  3CBM A;  1OEB A;  2EVR A;  4OMP A;  4LDV A;  2G6F X;  1GCQ C;  1NBE B;  1MMG A;  4E7L A;  1UGQ B;  4XAX B;  2EBP A;  1BK2 A;  1R77 A;  4D8D A;  1ZUK A;  2FG0 A;  4IUT A;  1TUD A;  1B3Q A;  1OPK A;  1YIT T;  1K9M U;  1OU9 A;  1BCM A;  4MML A;  1VQ4 T;  2DO3 A;  2KR3 A;  4ZNX A;  1BI2 A;  2SRC A;  2RHY A;  1WJR A;  4RUG A;  2YHT A;  2JW4 A;  5FU7 B;  2EJF A;  3EH1 A;  1YJ9 A;  5LJ3 d;  3CCS A;  1K0S A;  2O4X A;  1ZA1 B;  2E5Q A;  4KBM B;  2QG9 B;  3CCR T;  1RI9 A;  2DER A;  3ZEH A;  4E7S A;  1TUC A;  2RK1 A;  1IB8 A;  1GCQ A;  1NLP C;  3HRS A;  1P92 A;  3RMS A;  4C0D C;  1KJW A;  3SB2 A;  5L8R E;  1AHJ B;  3EGU A;  1X6B A;  2RHZ A;  3L2V A;  2JVV A;  2NUP B;  3QYH B;  3UT1 A;  1RI0 A;  3DLM A;  3I55 T;  4XTW A;  1YI2 A;  5HCK A;  3Q1J A;  1Q86 R;  3S3O A;  4JPB W;  3ZBD A;  2F2V A;  4M7D A;  5KCO A;  2BUD A;  1YHQ A;  1G5V A;  1Q86 C;  1YJ9 Q;  4F7U A;  3CCS Q;  4B6M A;  3NTI A;  2RH2 A;  3G6E A;  4QW2 A;  3DKM A;  2K3X A;  4XU3 A;  1QCO A;  3M0P A;  1IRX A;  2FZK B;  2DIQ A;  4LDX A;  3JCM e;  2CP2 A;  2RQU A;  1VQP T;  4JJN K;  1O9S A;  2LQK A;  3CPW S;  2RPN A;  1KQ2 A;  4IUP A;  4ORZ A;  4PNO A;  2XK0 A;  3QBY A;  5GAM j;  5HK0 A;  5FLX E;  3PTA A;  5D7U A;  4M75 E;  1B34 A;  1YI2 Q;  4RTT A;  4JJD A;  1OZ2 A;  5GAN g;  4GLM A;  4MZP A;  1X69 A;  1YHQ Q;  3F70 A;  3GPL A;  1N9R A;  3JCM Q;  1QVG S;  3G6E Q;  2K79 A;  4ESR A;  4DOW A;  4C92 C;  4DA4 A;  3CC7 A;  2R5A A;  2IPO B;  3EFO B;  2JJ9 A;  2KAF A;  3E1S A;  5GAO n;  5GAN 7;  1X2Q A;  3A8G B;  3MEA A;  1W1F A;  4KUI A;  5GAM e;  4MZM A;  3OYN A;  4XU0 A;  1BYM A;  5FW9 A;  2GTO A;  4PK4 A;  2LDM A;  4C8Q D;  4LUE A;  2P4R A;  4J9I A;  4NS5 A;  2EYX A;  1BIA A;  1FMV A;  1AWW A;  2KMT A;  4A53 A;  1UGS B;  4LD9 K;  5CAI A;  4JUV A;  4XQ3 A;  1N5Z A;  2QDY B;  4C92 A;  3CC7 Q;  2EYY A;  1LOJ A;  1QLY A;  4X1V A;  2HBP A;  2RI3 A;  2QEX T;  2L3Q A;  2KQW A;  4FW2 A;  4LD6 A;  3VYG A;  3A5Z B;  2A7Y A;  3PFS A;  3CXC S;  3G1J A;  1VQN Q;  1UTI A;  1Q7Y R;  2DET A;  4A4F A;  2HD0 A;  3PVL A;  4Y92 A;  3LGL A;  1Q7Y C;  2K7A A;  3OS5 A;  1QCN A;  2I0N A;  3OSV A;  1N6A A;  4DEX A;  2QQA A;  2WSE E;  2BE7 D;  4C8Q G;  1D1B A;  1TXQ A;  2NYS A;  2FRY A;  3OYD A;  1S1N A;  4BE0 A;  1QVG P;  3EGX B;  3BDL A;  4ME7 A;  2DAQ A;  2JMC A;  1JBM A;  5ECA A;  3G71 A;  4J7F A;  3TSZ A;  3CCE A;  1SSH A;  2CYZ B;  4OB1 B;  3CMA T;  4N0A C;  3UAT A;  4ELZ C;  4N4G A;  4ELY C;  1FMK A;  5KCH A;  1JXO A;  1LNX A;  2AK5 A;  3HL8 A;  4PLL A;  2JT4 A;  1RAD B;  3MEV A;  1QKX A;  1QWF A;  4QT7 A;  3SD4 A;  3MKD A;  3M0U A;  1VQ9 T;  3VU3 C;  2HEQ A;  2B86 A;  4M7A B;  4EIK A;  2NUP A;  1PD1 A;  4M78 D;  4OVA A;  4ZGJ B;  4N0A A;  3M57 A;  4MDW A;  4J7I A;  4F04 B;  2EGE A;  2VAS A;  5M9O A;  2ATC B;  4IIO A;  5J26 A;  2MI6 A;  2ZCF B;  3CBP A;  2O9V A;  4BDY A;  2KEA A;  3EH2 A;  1UJ0 A;  4PJO D;  3PIO A;  2JXB A;  3M5A A;  3CME A;  1OZ3 A;  4FCY A;  1Y07 A;  1ZSZ B;  3OYY A;  1ZBX A;  2FPF A;  2ED1 A;  1QP2 A;  1CKA A;  4BD3 A;  4JZ4 A;  3QJ6 A;  2L0A A;  4M78 G;  3S3N A;  3I56 T;  1SEM A;  1VQ8 A;  3LLR A;  1GCP A;  4L5G A;  4BE1 A;  4J83 A;  2DD5 A;  3VS1 A;  3M58 A;  5IT9 E;  3CXC A;  5KE2 A;  4C5G A;  4RG8 A;  2DIL A;  5GMK l;  3KBG A;  3OYJ A;  4V2S A;  2QQB A;  2H3E B;  2E5K A;  1KQ1 A;  4PJO G;  3L2Q A;  4JJB A;  3CPF A;  2R5M A;  1UEB A;  3CME Q;  3OYH A;  1PC0 A;  1PD0 A;  2M9U A;  3MP1 A;  3PMT A;  4OMO A;  3EFO A;  5CKH A;  1M8M A;  1YIJ A;  5GAN h;  2NUZ A;  2MMP A;  2RN8 A;  1WQW A;  1NPR A;  4PJJ A;  1E6H A;  4FM4 B;  3R6O A;  4B9W A;  2H8H A;  5FU6 C;  4FT4 A;  4FYX B;  1QCF A;  1VQ8 Q;  4M7D D;  2GNC A;  1M8V A;  2ROT A;  4F7U F;  3M0Q A;  2F5K A;  2LT4 A;  1UE9 A;  2QXF A;  3M53 A;  1JQQ A;  3RKY A;  3C0C A;  1LPL A;  1ACM B;  3C4S A;  3TQ7 P;  1RAE B;  1IGQ A;  1AWX A;  1SHG A;  2QTX A;  2E4H A;  2M0O A;  4C0Z A;  1RLP C;  3BE3 A;  2R58 A;  3DB4 A;  3CEY A;  4FT2 A;  1YIJ Q;  2VUB A;  3VS7 A;  2E3I A;  4M77 B;  2LQN A;  4JZ3 A;  3H9N A;  4KGX B;  4OMN A;  1VQO A;  2C0O A;  3MPU B;  2D1X A;  4M7D G;  4KT0 E;  3OYG A;  3HP9 A;  1QVP A;  2RHU A;  4R0K A;  3T9N A;  3NHN A;  2X9H A;  1D0Z A;  1WYX A;  1VQL T;  1VQ6 Q;  2RQT A;  3NMZ C;  3EGX A;  5KYN A;  4JS5 A;  1ARK A;  4PJM A;  5DY9 A;  2V1R A;  4ZN1 A;  2MK5 A;  2M1H A;  2KT8 A;  2D8H A;  2P4T A;  1U1S A;  2XI9 A;  2AHJ B;  4UC4 A;  5CKD A;  4JLG A;  1VQO Q;  2KRM A;  5CQY A;  2JTF A;  1I5O B;  1K4U S;  1D1C A;  3NGP A;  4II1 A;  1MND A;  3JCM J;  2DLP A;  3VV0 A;  1DJ7 B;  2CS7 A;  1V76 A;  4AFQ C;  4C92 F;  4EMK C;  4C92 D;  1ABO A;  2YUO A;  3CCM T;  5CVI A;  1G3W A;  3CCJ T;  2GCX A;  4DBR A;  5KYW A;  2AT1 B;  2HKN A;  2L3P A;  5L23 A;  2PUK B;  1ZSZ C;  2DTH A;  2DXT A;  2VWF A;  4KUD K;  2E65 A;  4C8Q C;  3O5Z A;  4A4K A;  3ME9 A;  5GMK i;  3JB9 F;  3JB9 D;  1EIF A;  4M7A A;  1RL2 A;  2EW3 A;  3A8L B;  3CCU T;  3UA7 A;  2Y4X A;  1Y7X A;  2OAU A;  3TU4 K;  2RNA A;  4IIM A;  1SKU B;  2RQW A;  3CD6 T;  2X4Y A;  4OMF B;  1UGV A;  2RJC A;  1LVK A;  2KXD A;  2F2X A;  4C92 G;  4QVD A;  4NL3 A;  1SHF A;  4NL2 A;  5CR2 A;  2PVD B;  3V8K A;  4E6R A;  2JM8 A;  1IGU A;  2A08 A;  2BIV A;  4JRK A;  1Y96 B;  1VQ5 T;  1IRE B;  4LE9 A;  1TSF A;  3QDF A;  4DBH A;  4HT8 A;  1ZSZ A;  2EKO A;  4C0G A;  1X01 A;  1KC8 U;  2XG8 D;  4C5H A;  2DRM A;  3JB9 G;  2J6F A;  4CC2 A;  4BAC A;  1YFN A;  2MPX C;  2BE9 B;  2D6F A;  2CT3 A;  3EG1 A;  4CC4 B;  3CC4 T;  1QWE A;  1PCX A;  1M4Z A;  1WHH A;  2RK2 A;  4FIB A;  3P8H A;  5LJ3 j;  1CSK A;  1M3A A;  4A4E A;  2QI2 A;  4M77 C;  1M1K R;  3VS4 A;  3JB9 J;  1G3T A;  3ER0 A;  3HHT B;  3CCL T;  5GAN 6;  1M1K C;  4J9H A;  2RHI A;  1BB9 A;  1VQ7 T;  3JCM b;  4PL6 A;  1VYT A;  1JEG A;  3H0F A;  3QYG B;  1AZE A;  3H0I A;  1WGS A;  1K1Z A;  2YT6 A;  4JS4 A;  1U06 A;  1PHT A;  2OJ2 A;  2RB6 A;  3X26 B;  4AG2 C;  5A0G A;  2J05 A;  4M78 C;  2MF2 A;  2MWP A;  4FSS A;  3TCJ A;  5LJ3 e;  3ASK A;  2XU8 A;  2ZPI B;  1WHJ A;  4M77 A;  3G4S T;  4PJO C;  3M55 A;  1WDX A;  3PNW C;  5FRN A;  3M4G A;  3CCV A;  2KRS A;  5I21 A;  4QQD A;  4PKC C;  3MJX A;  3OQ5 A;  1YJN A;  3CC2 A;  2G3R A;  2AIR B;  1OQK A;  3SWN B;  4MDX A;  4M78 A;  2YLB A;  4MMK A;  3M59 A;  3UDC A;  2DFU A;  1I0C A;  4KUL A;  4PJN A;  2LMJ A;  1M90 R;  2FYK A;  1RLQ C;  1UHC A;  3L42 A;  3HPW A;  2V8I A;  1R0B G;  1M90 C;  4O5V A;  5IN1 A;  1VQK A;  1YJW Q;  4PJO A;  1VYU A;  3CCV Q;  3VYH B;  3OW2 P;  5I22 A;  4J8O A;  3H41 A;  6AT1 B;  1RAA B;  1UB4 A;  3GP8 A;  4X9C A;  2YRD A;  1F1B B;  2O9S A;  1YJN Q;  4KGZ B;  5A0D A;  3CC2 Q;  3TEE A;  1NYF A;  1QMC A;  2DL7 A;  2E3H A;  3NPF A;  5GAN j;  2JMA A;  4M7D C;  2KSS A;  2A36 A;  2JOY A;  2NUT B;  3CCQ A;  3RR6 A;  2LZ6 B;  3X25 B;  1YJ9 T;  1K9M R;  1VQK Q;  2LT1 A;  4RTX A;  2ROL A;  4E7I A;  1Q82 R;  1YWO A;  4QVZ A;  2KK4 A;  2QGG A;  3JSC A;  1Q82 C;  3CCR A;  3PVQ A;  4ZGD B;  1D0Y A;  4BY6 B;  1SPK A;  8AT1 B;  2OTL A;  2E6N A;  3EG3 A;  5GAN e;  1T0H A;  3EG9 B;  2J6O A;  3GOX A;  1YI2 T;  1Y96 A;  3GLX A;  1C6V X;  2KE9 A;  1M2O A;  2FEI A;  3CCQ Q;  4RTU A;  1YHQ T;  1RAC B;  2YLC A;  2YUP A;  3I55 A;  2LC4 A;  1D3B B;  5HY6 A;  1NEG A;  3J80 E;  2KNB B;  1KK7 A;  3QZ9 B;  1HYO A;  3KFV A;  2PNI A;  1G3Y A;  2EFI A;  4A4H A;  2CH4 A;  3X24 B;  2XDD A;  3FDR A;  2OTL Q;  2H3J A;  4QQ6 A;  3V7C A;  4M7A D;  4L59 A;  2BKD N;  1KD1 U;  1LJO A;  5I2M A;  1WHL A;  1SG5 A;  2GQV A;  2LQ8 A;  2E10 A;  3L2W A;  2QA4 A;  4OF1 A;  1I81 A;  5EG2 A;  4LDU A;  4ANJ A;  3CC7 T;  2LJ3 A;  2CKK A;  3KXT A;  1QP3 A;  4J9F A;  5GMK j;  2LRQ A;  2ZGW A;  1VQN T;  1AVZ C;  3HFN A;  1IHV A;  1WZO A;  1EX4 A;  4RTW A;  4R56 A;  4C8Q F;  1UG1 A;  2E1H A;  2YRV A;  1I8F A;  1M9S A;  2DA9 A;  2XHC A;  4M7A G;  4EPC A;  4FSX A;  1NJI R;  1K73 U;  4M75 B;  2M0Y A;  3EAE A;  4JDS A;  4IUV A;  1NJI C;  4OMQ A;  3V7R A;  2QA4 Q;  1I07 A;  2VYT A;  5J3B A;  2L2P A;  3OYK A;  2O88 A;  2RM4 A;  2E70 A;  1QVF S;  2L5Q A;  2MIO A;  4JRI A;  1H8K A;  5GMK e;  3SWN A;  2CP5 A;  4AFZ C;  2O2O A;  3JB9 I;  1WA7 A;  2EJG A;  5FU7 C;  1Q95 G;  3MHX A;  3JCM d;  2KVQ G;  2W0Z A;  5I2S A;  3M9Q A;  4C5E A;  1WXB A;  2HBW A;  4HXJ A;  2HQX A;  1C0M A;  2DPP B;  2F69 A;  1RAB B;  4OB0 B;  2PTK A;  3SHW A;  4FYW B;  2DVJ A;  3N5B B;  2LJ1 A;  2E6Z A;  1I5L A;  5HKC A;  1NEB A;  3QPH A;  5LJ3 h;  3RDV A;  1YNZ A;  1BI0 A;  1AZG B;  4XTV A;  1FXX A;  3E19 A;  3JCM c;  1TOV A;  1K8A U;  2FPE A;  3CPW A;  2DL4 A;  4HCK A;  4M77 F;  3LGF A;  4M77 D;  2NUT A;  3OY9 A;  3JAM E;  3LWH A;  4HKE A;  5GAN 4;  3E2U A;  3S3M A;  2XID A;  3MCA B;  4IKF A;  2XD0 A;  5GAM d;  5GMK m;  1ZA2 B;  2EYQ A;  3G71 Q;  1UUE A;  3CCE Q;  5GAN 8;  1QVG A;  2ZAE A;  2W10 A;  5CIU A;  5LJ5 f;  4M78 F;  3CBO A;  1M2V B;  4B9X A;  1QVF P;  1EZZ B;  4C8Q E;  1I4K 1;  3VUZ A;  3VRZ A;  2V8J A;  3EG9 A;  2X51 A;  3A8H B;  3V8J A;  2COZ A;  2EAY A;  4HCC A;  4IUU A;  4M77 G;  2D0Q B;  4LDY A;  4PJO F;  2L8D A;  2MCN A;  4Z8A A;  1UGR B;  4JRP A;  1VOM A;  2QTV A;  1Q81 U;  3CME T;  4FW1 A;  4GLK A;  2M51 A;  2CZ0 B;  3DLL A;  4E7Z A;  1WHM A;  2DNU A;  3QJY A;  3C12 A;  2PVO B;  3EG2 A;  2JTE A;  4KH0 B;  3GIB A;  4QKU A;  1YBY A;  2ED0 A;  1VQ8 T;  2FRW A;  1T0J A;  1MMN A;  3EFS A;  4M75 C;  3L2U A;  9ATC B;  1RAF B;  1VA7 A;  1D1A A;  2X4W A;  3D7S B;  3FLG A;  2LQW A;  2DL5 A;  1S72 A;  1YIJ T;  4PFP A;  1FX7 A;  5CKF A;  1Y57 A;  4RMO A;  2QYZ A;  2A0F B;  2P84 A;  1U1T A;  4M7D F;  4PFZ A;  1WX6 A;  5A0L A;  2FB7 A;  2VVK A;  4EMG A;  2BTT A;  3M0R A;  2QQ9 A;  5CKB A;  2MWO A;  1W70 A;  2HMA A;  2X4X A;  1SF9 A;  4E47 A;  4M75 A;  2A3L A;  1TTH B;  1VQ6 T;  1D0X A;  2EQJ A;  5DLQ E;  5LJ5 g;  2DIG A;  3I5R A;  1WI7 A;  2DZC A;  1A0N B;  2DEU A;  4OB2 B;  4OMM A;  1WJQ A;  2FZC B;  3OSS C;  1S72 Q;  3C94 A;  3ZL7 C;  3OYC A;  4IUR A;  4QVC A;  4M4Z A;  3OS2 A;  4WCI A;  2CH4 W;  2EJ9 A;  1W6X A;  2D0N A;  1VQO T;  2DMO A;  1OX8 A;  4JLI A;  1TS9 A;  5HK3 A;  2RA2 A;  3JV3 A;  2KYM A;  1KQS P;  1B07 A;  3JRZ A;  1NLO C;  2YSQ A;  2COW A;  3EFR A;  1PKT A;  5LJ5 d;  4M7A C;  4ZTF A;  3BFM A;  5KE3 A;  1X2K A;  3QDR B;  1VQL A;  4HVU A;  1RAI B;  3VJP A;  2CGH A;  3OYM A;  1M1G A;  2DZ9 A;  5D6X A;  3OMC A;  3FJ5 A;  1OOT A;  1YWP A;  2K4Y A;  3HTR A;  3QKJ A;  2F1L A;  2NWM A;  3JCM X;  5GAN 3;  1XQH A;  1T3S A;  2OI3 A;  3MP8 A;  3MEW A;  2YUQ A;  4OP0 A;  1OI1 A;  1OYX A;  2K3B A;  1MV0 B;  5GMK h;  2AZS A;  1IHW A;  4PFO A;  5FRM A;  4CC7 A;  3MO8 A;  4RTY A;  1N8R U;  1IXD A;  2VGM A;  3OS1 A;  4M7D E;  1N27 A;  4HVV A;  3CCJ A;  1KIK A;  1JRI A;  4F7U E;  1G8X A;  1M2V A;  2DJZ A;  4Z88 A;  2EQU A;  3RNJ A;  2A28 A;  5KH6 A;  2KI7 A;  4RTV A;  1M27 C;  3G7Z A;  1CKB A;  3BW1 A;  2HSE B;  5GAO m;  1GXI E;  2O4X B;  2E12 A;  2J7I A;  1KHC A;  1NYG A;  4XTU A;  3FJP A;  1W2B S;  2EWN A;  2COY A;  2FL7 A;  5IHN A;  2AKK A;  1BU1 A;  1X43 A;  2EQM A;  2M02 A;  1JXM A;  1PM3 A;  2ZZD A;  1V29 B;  1X75 C;  1GRI A;  1UFF A;  4AFS C;  3WXM B;  1JJ2 P;  4J9B A;  3GNG A;  5A2Q E;  3FB9 A;  2WSF E;  1VYV A;  4LN2 A;  2DXU A;  1RAG B;  2O31 A;  2F2W A;  3L2Z A;  4F7U B;  1WXT A;  1XNI A;  1VQM A;  3TRE A;  1KC8 R;  4WF2 A;  1MNE A;  1D09 B;  5GAO p;  1KC8 C;  4F14 A;  4YTL A;  2KYB A;  4PLI A;  3ULR B;  4HCB A;  3REA B;  2PQW A;  3CC4 A;  2KXC A;  1M1K U;  4E2F B;  1V1C A;  4LXC A;  5GAO l;  2K57 A;  2AZV A;  2RD1 A;  3OW2 S;  4DBF A;  1HK9 A;  2DRK A;  2ENM A;  2OTJ A;  3H6Z A;  2RJD A;  4C92 E;  4LDW A;  3QHS A;  3FIF A;  2P0Q A;  1VQM Q;  1U5S A;  2KRN A;  5CKE A;  3M56 A;  3I9Q A;  2K6D A;  3CCL A;  2GQI A;  4J9D A;  4J5Y A;  1W2B P;  3RER A;  2HL3 A;  2DYB A;  3RIR A;  1WHG A;  4BI4 A;  3KUF A;  1AWO A;  1SRM A;  4Y28 E;  1Y71 A;  1NE8 A;  4XU2 A;  3OA6 A;  1YJW T;  2OTJ Q;  2DL8 A;  2LX9 A;  3CCV T;  3S6W A;  1GFC A;  2EYZ A;  2DYI A;  3M0S A;  4RKU E;  3LWI A;  2K5L A;  2DM1 A;  2XDP A;  3NFC A;  5KYX B;  2YXY A;  1YJN T;  4LUD A;  3CC2 T;  3PE0 A;  3FC3 A;  2HAX A;  2R57 A;  4A63 B;  2RF0 A;  3HFO A;  4K11 A;  2YRC A;  4KGV B;  2QAS A;  5GJW B;  3L2R A;  1WQ7 A;  3RMQ A;  2DTO A;  1PSE A;  4MZT A;  1MMD A;  5EC7 A;  1VQK T;  3QSU A;  4XU1 A;  1TG0 A;  2LCC A;  4M75 F;  3CQT A;  4M75 D;  1FYN A;  4F16 A;  3EGD B;  3NTK A;  2CSQ A;  2GTJ A;  7AT1 B;  2KRO A;  5DLO A;  4J6W A;  1YIT A;  3E9G A;  5IXB A;  2EQK A;  1BIB A;  1VQ4 A;  3O8V A;  3JCM f;  3CCS T;  1I1J A;  2QK0 A;  3J81 E;  3CCQ T;  3JCM P;  2QDL A;  2PU9 B;  4LNP A;  1K9M C;  3MET A;  1Q82 U;  3PIP A;  3M54 A;  4AT1 B;  4M75 G;  2DF6 A;  5AYF A;  1VIE A;  4PJL A;  4J9G A;  3OW2 A;  1Q86 U;  1KG1 A;  2D8J A;  3EG0 A;  2CT4 A;  2DX1 A;  2OTL T;  5J39 A;  3RES A;  2RJF A;  1YIT Q;  1YN8 A;  2HNI A;  2ZPE B;  4EDU A;  1RUW A;  2E41 A;  4AG1 C;  1WIE A;  1VQ4 Q;  2EYW A;  4D8K A;  4TVR A;  5IHK A;  1KHI A;  4XTX A;  2L89 A;  3G6E T;  4FYV B;  1SRL A;  2J06 A;  3QG1 A;  1ZUY A;  3IQL A;  2WSC E;  3TSW A;  1T3L A;  3OYB A;  3VS5 A;  1FWZ A;  2CP7 A;  2GFU A;  5GAM f;  3OB9 A;  5IHI A;  1ZHI A;  3CCR Q;  2ZPB B;  3OYI A;  4E7H A;  3P8D A;  1YP5 A;  2O01 E;  1VQP A;  2XMF A;  1KSW A;  1QQJ A;  5CCA A;  4JJC A;  4M7A F;  1BKB A;  5DM7 R;  2IIM A;  1Y0M A;  5FWB A;  4GBQ A;  2DXB A;  3I55 Q;  1WXU A;  4HA8 A;  2DL3 A;  3OBW A;  3AT1 B;  3P8B B;  3I5S A;  2QA4 T;  3ZFJ A;  2RO0 A;  3QXE B;  4L6V 5;  4DBQ A;  1E7O A;  2JM9 A;  1H3Z A;  3MP6 A;  3SWN C;  3REB B;  1KD1 R;  2LCL A;  1OUL A;  2ECZ A;  2SEM A;  1VQP Q;  3SEM A;  3JCM g;  3X28 B;  1KD1 C;  3WVE B;  3GF5 A;  4FYY B;  2BZ8 A;  1NJI U;  5KYU B;  3I35 A;  2KY9 A;  2YWW A;  3M4Y A;  3SDZ A;  1VQN A;  1Z9Q A;  2ABL A;  4C5I A;  4JRQ A;  1R0C B;  3INZ A;  3PMI A;  5GAN d;  1Q7Y U;  3QWY A;  1PNJ A; 
#chains in the Genus database with same CATH homology
 2EBP A;  1BK2 A;  2LQW A;  1SHF A;  4D8D A;  1ZUU A;  1ZUK A;  2DL5 A;  2FG0 A;  1TUD A;  2YDL A;  1B3Q A;  1OPK A;  2C0I A;  2JM8 A;  2A08 A;  4E6R A;  4LE9 A;  1Y57 A;  2KR3 A;  4AFU C;  4ZNX A;  5IH2 A;  1AWJ A;  2SRC A;  1WX6 A;  2DRM A;  2J6F A;  4CC2 A;  4RUG A;  2VVK A;  2JW4 A;  2CUD A;  2BTT A;  3M0R A;  1K0S A;  2MOX A;  3R6N A;  1W70 A;  1PKS A;  1UEC A;  1RI9 A;  2KGT A;  1UJY A;  1TUC A;  1GCQ A;  2CT3 A;  2RQV A;  1NLP C;  3I5R A;  1WI7 A;  1KJW A;  3EG1 A;  4CC4 B;  1OPL A;  1A0N B;  1UHF A;  1ZLM A;  1QWE A;  4OMM A;  2KBT A;  1E6G A;  3EGU A;  3ZL7 C;  1X6B A;  1M3C A;  4M4Z A;  4WCI A;  1CSK A;  1M3A A;  1JU5 C;  2CH4 W;  5HCK A;  1PNJ A;  1W6X A;  4JPB W;  2D0N A;  2F2V A;  3VS4 A;  2DMO A;  1H3H A;  4J9H A;  1WFW A;  1BB9 A;  3JV3 A;  1LCK A;  2KYM A;  1VYT A;  1JEG A;  3H0F A;  3M0P A;  1B07 A;  1AZE A;  3H0I A;  1NLO C;  1K1Z A;  2YT6 A;  1U06 A;  1PHT A;  2RQU A;  1IO6 A;  2YSQ A;  2OJ2 A;  1GBR A;  2BZY A;  4AG2 C;  1PKT A;  2J05 A;  4OML A;  4FSS A;  1GFD A;  2RPN A;  1X2K A;  4ORZ A;  4HVU A;  1MUZ A;  3FJ5 A;  4JJD A;  4RTT A;  1OOT A;  4GLM A;  1YWP A;  1X69 A;  1HJD A;  3EHQ A;  2FPD A;  1NM7 A;  1WDX A;  2NWM A;  2KRS A;  1T3S A;  2K79 A;  4ESR A;  2OI3 A;  5IXF A;  2YUQ A;  2K3B A;  1MV0 B;  4RTZ A;  1WLP B;  2AZS A;  2X3W D;  4CC7 A;  2OAW A;  4RTY A;  5GJV B;  1X2Q A;  4HVV A;  1KIK A;  1I0C A;  1W1F A;  4J9E A;  2LMJ A;  4Z88 A;  3RBB B;  1PRM C;  1RLQ C;  1UHC A;  2PZ1 A;  3RNJ A;  3VS6 A;  1AOJ A;  5FW9 A;  2A28 A;  4RTV A;  2GTO A;  1M27 C;  1CKB A;  4LUE A;  2P4R A;  4J9I A;  1VYU A;  2EYX A;  1M3B A;  1AWW A;  5I22 A;  2DE0 X;  2LX7 A;  3H41 A;  2J7I A;  1N5Z A;  1NYG A;  2EYY A;  1QLY A;  2O9S A;  4X1V A;  2L3Q A;  5IHN A;  2AKK A;  1BU1 A;  1X43 A;  1PRL C;  1YCS B;  1NYF A;  2DL7 A;  1JXM A;  3NPF A;  2JMA A;  1UTI A;  2A36 A;  2LJ0 A;  1GRI A;  1UFF A;  4AFS C;  3PVL A;  4Y92 A;  2K7A A;  2LZ6 B;  4J9B A;  4HVW A;  2I0N A;  1VYV A;  4LN2 A;  2K9G A;  4DEX A;  2O31 A;  2F2W A;  4RTX A;  2LCS A;  1WXT A;  2YUN A;  2FRY A;  1S1N A;  3VS3 A;  2GGR A;  2ROL A;  3GBQ A;  1YWO A;  1OV3 A;  2VKN A;  1G2B A;  4F17 A;  2RMO A;  2JMC A;  4F14 A;  3PVQ A;  3QWX X;  2KYB A;  5ECA A;  1SPK A;  4KRT A;  3TSZ A;  3ULR B;  3EG3 A;  1SSH A;  1T0H A;  3REA B;  2J6O A;  2KXC A;  1V1C A;  2KE9 A;  2AZV A;  3UAT A;  2EKH A;  2FEI A;  5FWC A;  4RTU A;  2DRK A;  2ENM A;  2BZX A;  4Z89 A;  1FMK A;  2YUP A;  1JXO A;  2AK5 A;  2EPD A;  3THK A;  2CSI A;  1NEG A;  3M0T A;  2JT4 A;  1U5S A;  2KRN A;  2DBK A;  3I9Q A;  2KNB B;  1QKX A;  2K6D A;  1QWF A;  3LH5 A;  2GQI A;  1ABQ A;  4QT7 A;  3KFV A;  2PNI A;  3M0U A;  2CH4 A;  2EGC A;  4J9D A;  2HEQ A;  2DYB A;  1H92 A;  2B86 A;  1AWO A;  2J6K A;  1SRM A;  4EIK A;  1X27 A;  3UA6 A;  1ZBJ A;  3U23 A;  2C0T A;  2EGE A;  1JO8 A;  2DL8 A;  4IIO A;  1GFC A;  2EYZ A;  3M0S A;  2O9V A;  2KEA A;  2DM1 A;  1UJ0 A;  2LJ3 A;  2EQI A;  4LUD A;  3PE0 A;  2JXB A;  4A63 B;  1GL5 A;  2RF0 A;  2HCK A;  4CC3 A;  4J9F A;  2FPF A;  2ED1 A;  4K11 A;  1CKA A;  1AVZ C;  1QKW A;  4JZ4 A;  2CUB A;  2HDA A;  4RTW A;  2DBM A;  5GJW B;  1UG1 A;  2L0A A;  2DA9 A;  5EC7 A;  1SEM A;  1GCP A;  2M0Y A;  1TG0 A;  3A98 A;  3VS1 A;  4OMQ A;  3CQT A;  1FYN A;  1NG2 A;  1K76 A;  2DIL A;  4F16 A;  1I07 A;  2E5K A;  2FO0 A;  2CSQ A;  4JJB A;  2L2P A;  2GTJ A;  2KRO A;  2O88 A;  3H0H A;  2KT1 A;  4J9C A;  4OMO A;  2MIO A;  5IXB A;  1H8K A;  1M8M A;  1PWT A;  3VS0 A;  2K2M A;  2NUZ A;  2RN8 A;  2DJQ A;  4AFZ C;  2O2O A;  1WA7 A;  1E6H A;  1I1J A;  2QDL A;  2H8H A;  2W0Z A;  4LNP A;  1HSQ A;  1QCF A;  3UF4 A;  2GNC A;  2ROT A;  3M0Q A;  1AD5 A;  1WXB A;  2HBW A;  4HXJ A;  2X3X D;  5I11 A;  2DF6 A;  1EFN A;  1UE9 A;  2PTK A;  3SHW A;  2DVJ A;  1JQQ A;  4J9G A;  2ESW A;  3C0C A;  2LJ1 A;  1NEB A;  1UDL A;  1AWX A;  2D8J A;  1SHG A;  2CT4 A;  1YNZ A;  3EG0 A;  2DX1 A;  1RLP C;  1J3T A;  1AZG B;  1KFZ A;  1YN8 A;  1RUW A;  4AG1 C;  1WIE A;  1Z9Z A;  2EGA A;  2EYW A;  3VS7 A;  4D8K A;  3VS2 A;  2FPE A;  5IHK A;  1G83 A;  2DL4 A;  2RQR A;  2CDT A;  4HCK A;  1SRL A;  2JS0 A;  2J06 A;  2LQN A;  4JZ3 A;  1ZUY A;  3IQL A;  4OMN A;  2C0O A;  3EHR A;  2D1X A;  2AKL A;  3TSW A;  1T3L A;  2A37 A;  3VS5 A;  5IHI A;  4R0K A;  3NHN A;  1WYX A;  1GBQ A;  2L3S A;  2RQT A;  1YP5 A;  3NMZ C;  1UUE A;  1X6G A;  1ZSG A;  2XMF A;  1KSW A;  2W10 A;  4JJC A;  2V1Q A;  1ARK A;  1BBZ A;  4DEY A;  2V1R A;  2IIM A;  1Y0M A;  5FWB A;  2KT8 A;  2D8H A;  2JS2 A;  1AEY A;  4GBQ A;  3VRZ A;  1WXU A;  2DL3 A;  3VRY A;  1HD3 A;  2KRM A;  1K4U S;  2MCN A;  3NGP A;  3I5S A;  4Z8A A;  2DLP A;  1E7O A;  4AFQ C;  2JM9 A;  2HSP A;  1ABO A;  2YUO A;  3TVT A;  1XOV A;  3REB B;  2M51 A;  2ECZ A;  2SEM A;  1MV3 A;  2L3P A;  1M30 A;  3SEM A;  5L23 A;  2DNU A;  1K9A A;  2CRE A;  2VWF A;  3EG2 A;  2JTE A;  1U3O A;  2LP5 A;  2BZ8 A;  3O5Z A;  3I35 A;  2EW3 A;  3UA7 A;  2ED0 A;  1Z9Q A;  2FRW A;  1K0X A;  1ZX6 A;  1T0J A;  2ABL A;  2RNA A;  4IIM A;  2LNH B;  2GBQ A;  1OEB A;  2EVR A;  2RQW A;  4OMP A;  2G6F X;  1VA7 A;  1GCQ C;  1UGV A;  3QWY A;  2KXD A;  2F2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...