4LN2A

The second sh3 domain from cap/ponsin in complex with proline rich peptide from vinculin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Sorbin and SH3 domain-containing protein 1
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ln2A00
4JJBA 2YDLA 2CSQA 3H0FA 2DVJA 4JJCA 1GCQC 1FYNA 4ESRA 4EIKA 1T0HA 2J6FA 4OMLA 1WXBA 3NPFA 4F14A 1MV3A 1M30A 1M3AA 4OMOA 4JPBW 2KRNA 1AOJA 3SEMA 3JV3A 4DEXA 2DRKA 1WXUA 3UA7A 2NWMA 4Z89A 2J05A 2SRCA 2PTKA 1UHFA 3M0QA 2ENMA 1GBQA 2KRSA 2DF6A 2RMOA 1PRMC 3R6NA 1UGVA 2B86A 1VYTA 2EYZA 1U3OA 2DX1A 2F2XA 2FO0A 5GJVB 4WCIA 5ECAA 1SHGA 1UECA 4CC7A 2J7IA 2D1XA 1WFWA 4GLMA 4OMMA 1X2QA 2GNCA 1U5SA 3VS5A 3TVTA 2JM8A 2M0YA 2OAWA 3I9QA 4QT7A 4HXJA 1AZGB 1PNJA 5I11A 2L2PA 1YNZA 1I07A 2LQWA 2OI3A 2EKHA 2CT4A 1AEYA 4RTUA 2CUDA 2LZ6B 4M4ZA 2O9VA 4IIOA 1YWPA 1GFDA 3VS2A 1PKSA 1NYGA 1VYUA 3EG2A 4J9EA 5IHKA 2GQIA 2ABLA 2A08A 2RNAA 1PHTA 4AG1C 2FG0A 1KJWA 1NM7A 1JO8A 2VKNA 4Y92A 1V1CA 1QKXA 4LE9A 2BZ8A 1I1JA 1NG2A 2YUNA 1ABOA 3EGUA 2DL5A 4RTYA 3M0SA 2RQWA 2JXBA 1TUDA 1RI9A 1H3HA 3H41A 2ED1A 1KSWA 2L0AA 2K3BA 2AKLA 2GTJA 2F2WA 2F2VA 2LJ1A 1H92A 2EPDA 4HVWA 1GL5A 1WI7A 2MCNA 2JMCA 1GCQA 1OV3A 4AG2C 1WA7A 4AFZC 4J9DA 1RUWA 1M3BA 4J9IA 1HJDA 2HCKA 2L3QA 3THKA 1K0XA 2HSPA 1WYXA 1X6GA 4AFQC 2DMOA 3ZL7C 4J9BA 4JZ3A 4D8KA 1NLPC 2CREA 1UE9A 1GRIA 4OMNA 2JTEA 4LUDA 1ZUYA 3NHNA 1A0NB 1UJYA 3PVQA 1B07A 1TG0A 2KROA 1SSHA 2RPNA 2M51A 2EVRA 2AZSA 2X3XD 4OMQA 1Z9ZA 1RLQC 3M0RA 2X3WD 2EGEA 4ORZA 2I0NA 1AWJA 1Z9QA 3UA6A 3CQTA 4RTWA 1HD3A 4D8DA 2LP5A 1QWEA 2AKKA 1BU1A 2KXDA 2DBMA 2MIOA 3M0TA 1SRLA 2DILA 1N5ZA 2RQUA 3VS7A 1GCPA 1B3QA 4LN2A 1NEBA 1G2BA 1K1ZA 4GBQA 4OMPA 3REBB 3VS1A 2LQNA 2CUBA 4J9GA 1T3LA 1TUCA 2A37A 2G6FX 1K0SA 1OEBA 2YUQA 2KT8A 2PNIA 4K11A 2OJ2A 1K4US 1ZSGA 2KR3A 2LJ3A 2J06A 1AD5A 2W0ZA 1ZUKA 4JJDA 2O88A 2L3SA 1UTIA 2FEIA 3EG0A 1U06A 1SRMA 1M27C 1GFCA 2A36A 3FJ5A 3TSWA 2ESWA 1KIKA 1E6HA 4X1VA 5IXBA 3H0IA 2O9SA 3EHRA 2O2OA 1MUZA 3VS3A 3I5SA 3ULRB 2K79A 1SEMA 5FWBA 5IXFA 1JU5C 3M0PA 1JXMA 2EQIA 1QKWA 1Y57A 2E5KA 1ZLMA 2IIMA 2KGTA 1NYFA 1HSQA 1AWXA 1PRLC 2XMFA 4CC2A 1CSKA 2LX7A 1UFFA 1KFZA 2JS0A 4IIMA 3QWYA 2CH4A 1WLPB 2JM9A 2RF0A 1YCSB 5IHNA 1S1NA 3U23A 4F17A 2C0TA 2CSIA 2C0OA 4F16A 1FMKA 1K9AA 1ZX6A 2K2MA 3REAB 1NLOC 2A28A 2BTTA 1K76A 1RLPC 1VYVA 2LJ0A 2YUPA 2AK5A 3I35A 1OPLA 1ZUUA 2KBTA 1W70A 1IO6A 1EFNA 2KNBB 4DEYA 4J9CA 1BB9A 2JT4A 4FSSA 5I22A 5HCKA 2SEMA 2KXCA 2EYWA 2DJQA 3M0UA 4RTTA 5IHIA 5L23A 3QWXX 2D0NA 2RN8A 1SPKA 2QDLA 1OPKA 1AWWA 1GBRA 2DBKA 1BBZA 1MV0B 4LUEA 1PWTA 2DE0X 3VRZA 2FPDA 3RBBB 1YWOA 3TSZA 1G83A 3VS0A 2DNUA 2HEQA 1UHCA 2L3PA 1I0CA 1JXOA 2FRWA 3KFVA 2ROTA 3SHWA 2AZVA 1UG1A 1WX6A 4RUGA 3LH5A 4E6RA 2HBWA 1X69A 5EC7A 2EGCA 5IH2A 4J9FA 2FPEA 3A98A 1X27A 2DM1A 2FRYA 2GGRA 2BZYA 2JW4A 2VWFA 1ABQA 2C0IA 4RTXA 3RNJA 4RTVA 2CT3A 2DYBA 1UJ0A 3O5ZA 2BZXA 1H8KA 3VS4A 2RQVA 1W1FA 4JZ4A 1X43A 3NMZC 4RTZA 2H8HA 1W6XA 2RQTA 1PKTA 2DL4A 2CDTA 2EYXA 1JQQA 2DA9A 3PVLA 1AVZC 2VVKA 1E6GA 2K6DA 2LNHB 4AFSC 2RQRA 4Z88A 1ARKA 2YUOA 2KYBA 4HCKA 4HVVA 1BK2A 2GBQA 2DLPA 2NUZA 2K7AA 5FW9A 2V1QA 3C0CA 2J6OA 2KE9A 2KEAA 4CC3A 2K9GA 1OOTA 2DL7A 2W10A 5GJWB 1QWFA 2ROLA 1M8MA 2KRMA 2JMAA 2MOXA 2FPFA 1WXTA 1QLYA 2EYYA 2LCSA 3UF4A 1WIEA 1SHFA 1M3CA 2GTOA 3I5RA 2D8HA 3IQLA 4KRTA 2CH4W 2ECZA 1LCKA 4ZNXA 1YP5A 3EG3A 2YSQA 4LNPA 2YT6A 4HVUA 1E7OA 2EBPA 2EGAA 1XOVA 3GBQA 2EW3A 2HDAA 4R0KA 1YN8A 1AZEA 1JEGA 1VA7A 2DL3A 3EHQA 2LMJA 4CC4B 4AFUC 1Y0MA 3VS6A 2ED0A 2KYMA 4A63B 1J3TA 1CKAA 1AWOA 3VRYA 3PE0A 1T3SA 2JS2A 2D8JA 3EG1A 1WDXA 1CKBA 2DRMA 1NEGA 2J6KA 2DL8A 1QCFA 1UUEA 5FWCA 1X6BA 3H0HA 2KT1A 1ZBJA 2O31A 2PZ1A 3UATA 1X2KA 1UDLA 2V1RA 2P4RA 4J9HA 3NGPA 1T0JA 4Z8AA
chains in the Genus database with same CATH superfamily
5GMKh 1D1BA 4PJMA 2XDPA 5A0LA 2XU8A 3MHXA 5CKHA 1G3YA 3A8OB 3SFMA 2DTOA 4EDUA 1Q81R 1YHQT 3OYFA 3CMAQ 2E5QA 3PGGA 4OGEA 2K5LA 2QEXA 3CC4T 3NPFA 4BI8B 3CCSQ 1MV3A 4F7UG 2KRNA 2CP7A 3LGFA 1AOJA 3SEMA 1MMDA 3CC4Q 1WXUA 2EWNA 4Z89A 3TCJA 1UHFA 3CMAT 4OP0A 3QJYA 4A4GA 2M16A 2CP5A 2RMOA 2LQKA 1YI2A 2B86A 2A0FB 2MWPA 4FYVB 4WCIA 5GANg 4XU3A 3EGXA 1I4K1 3PNWC 4R56A 1Q82U 4CC7A 2D1XA 4FM4B 4GLMA 3GNFB 2GNCA 5DLOA 1WHMA 4PFZA 4M78G 3VS5A 2M0YA 4B6MA 2AHJB 3I9QA 2ZPEB 4J6YA 2DD5A 2DEUA 3Q1JA 2MPXC 3FEOA 4JRPA 3QIIA 2CUDA 1N27A 1YWPA 4PL6A 1OI1A 5CAIA 3VJPA 1GFDA 1NYGA 4J9EA 1DJ7B 3CC7Q 2ABLA 1R0BG 2EKOA 5CIUA 1KJWA 1NM7A 2JN0A 1SKUB 5GAN8 2DJZA 4N0AC 5L8RE 1JO8A 4Y92A 1RACB 4O5VA 2EJFA 2BZ8A 5KE2A 1V76A 5FLXE 3EFOA 3M0SA 5D6YA 1KQ2A 4BE1A 1TUDA 3CC2T 5HK3A 2L0AA 2K3BA 2GTJA 2F2WA 3INZA 2EAYA 4MZTA 1JRIA 2D0QB 2DO3A 2MCNA 3M5AA 1D0XA 3G71Q 1N9SA 2HZYA 4C92F 4C8QG 1X6GA 4AFQC 2DMOA 2QQ9A 8AT1B 1BIAA 4GLKA 5DM7R 2RHZA 2JTEA 1ZBXA 1XTDA 1ZUYA 1A0NB 1BI0A 1VQNA 1B07A 2KROA 3DLLA 4BUGA 1SSHA 2RPNA 3RMSA 4OF1A 1F1BB 2X3XD 1M1KU 2X3WD 2OTLQ 1SG5A 3SDZA 2LCCA 4RKUE 4C0DC 2X4JA 2L8DA 5HK0A 2VASA 1IHVA 4PFPA 2R5MA 3MEWA 2AKKA 4C8QD 1Y07A 5LJ3e 1YJ9Q 1YHQA 1N5ZA 4JRKA 1VQ5Q 4X9CA 5KYWB 2HNIA 4LN2A 3CCSA 1U1SA 2FZGB 3GF5A 4BY6B 2RI2A 3LX7A 3HHTB 2HQHA 3REBB 2E4HA 3VS1A 3CCVA 5I2SA 1LVKA 1T3LA 2VC8A 2A37A 2JVVA 4C8QB 2QQSA 2YRCA 1KHCA 4AMCA 2Y4YA 2PNIA 4DBQA 1PD0A 2OJ2A 1ZSGA 3FJPA 1Q95G 2KR3A 2LJ3A 5A0GA 1YJNA 4NOYA 1ZUKA 4JJDA 3DB4A 3EG0A 4A54A 4PLIA 4PK4A 1M27C 2BUDA 2YXYA 2A36A 1Q81C 3LH0A 4QW2A 1UGSB 2A7YA 4ME7A 1O9SA 2O9SA 2O2OA 3A8GB 2COWA 2K79A 2KK4A 2X9HA 4XTZA 2DXTA 2MMPA 4LDYA 1JU5C 1OZ3A 3CBPA 4BI4A 2OTJQ 2E5KA 3MJXA 1NYFA 1HSQA 5KYXB 3RDVA 4M75C 3FRNA 1PSFA 2HKNA 2MYSA 3E9GA 1YCSB 2L89A 5IHNA 5J26A 3U23A 4F17A 1VQPQ 1NJIU 1Y7XA 3N5BB 2E6ZA 2LJ0A 3UPUA 1UGRB 4JJNK 1QCOA 1OPLA 2X4YA 4LDUA 1W70A 3VV0A 1VQKA 1EFNA 3DKMA 2H3JA 2I2LA 1KQSP 4J6WA 4FT2A 5HCKA 1R8OB 3NTHA 3HPWA 4RTTA 1VQ9T 3G71A 3QWXX 3QYHB 2QDLA 3FLGA 2DBKA 5GAN3 3CCQQ 3VRZA 3VUBA 1M2VB 4HCCA 3OS2A 5CVIA 1G83A 1UHCA 4OB0B 3LW5E 1JXOA 1YIJQ 1BI3A 2AZVA 1WX6A 4E6RA 5EC7A 5IH2A 1ZA1B 5FU6C 2FPEA 1X27A 1M9SA 2QXFA 4HKEA 1WZOA 3CCUA 2WSCE 2VWFA 1TUGB 1QQJA 1YCYA 3PIPA 3RNJA 3BW1A 2DYBA 3CCRA 1K8AU 1KQSS 1RAFB 6AT1B 2RHIA 3VS4A 1VQ6Q 3OYGA 3I55Q 1PKTA 3C4SA 1PD1A 2EYXA 1JQQA 2K6DA 3MKDA 4J7FA 4M7AB 3CPWS 4KH1B 3VU3C 2X4XA 4HVVA 1Q81U 4A4EA 3OS5A 3CXCS 2K7AA 3M4YA 1S72A 1Y96A 5GAOr 2LVMA 1BKBA 1VIEA 2HMAA 3CCRT 3L42A 2YLBA 2ROLA 4EPCA 2KRMA 3OYMA 4EMHA 2EQJA 3LYIA 4PJJA 4M75F 1UGQB 2XKOC 2H3EB 3I5RA 2WSFE 4AT1B 2EQMA 4J5YA 2CH4W 1B34B 5GANe 1C0MA 3G7ZA 1UEBA 3KBGA 1TU0B 2E70A 1M1FA 4BD3A 4PJOC 2YT6A 2EJGA 4XU1A 2KVQG 3GBQA 2HDAA 1YN8A 1AZEA 1JEGA 2DL3A 4M7AF 3LWIA 4OGCA 3OS1A 3VS6A 1B7TA 1CKAA 5LJ5g 1M1KC 1YJ9T 1D3BB 2D8JA 2DRMA 4Z02A 1Q82C 1NEGA 3G71T 4PKCC 2DL8A 4LDXA 3JCMQ 3CCMA 1VQKQ 2QQAA 2NUPB 4CRIA 3AHUA 1VQKT 1FXXA 2KT1A 3EH2A 4JRIA 1X2KA 1QMCA 3AT1B 4M7AA 4KGXB 1QW1A 4BACA 3MP8A 4RCCA 4XU2A 3JCMe 3QYGB 2YDLA 5GMKe 2CSQA 3H0FA 4M78A 5CKDA 2WACA 4JJCA 2PVOB 2JTMA 1YJWQ 4PJOD 2EIFA 4IUQA 3JCMf 2RK1A 1I81A 5AYFA 1T0HA 3PMIA 4UC4A 2PQWA 4OMLA 4C5IA 3SWNC 3BE3A 3CMEQ 1QVFA 1M30A 4OMOA 2JNGA 1ZSZC 3BFMA 3G6EA 3WXMB 3L2WA 3QDFA 5LJ5j 2NWMA 2ZGWA 4NS5A 3URGA 1GBQA 2FZKB 4M7DB 2DF6A 1VYTA 2RJEA 1LPLA 3I56A 4KH0B 1OZ2A 2RI5A 1TSFA 3OYCA 2CP0A 2COYA 1M90C 2JUFA 1WFWA 2LCLA 4JLIA 1H641 4OMMA 1X2QA 3CCLA 1U5SA 4BY6C 4BE2A 2MAMA 2LNVA 2JM8A 1W4SA 3BDUA 1YIJT 1OQKA 3UT1A 3TEEA 4HXJA 1AZGB 1PNJA 5I11A 1YNZA 3E9FA 2BE9B 2XDDA 3I55T 4M77G 1I07A 2LQWA 2EKHA 2CT4A 4XTUA 4RTUA 1AT1B 4J8OA 5CK9A 4IIOA 4ZN1A 4PJOG 3VS2A 1PKSA 1NPPA 4PJOE 5IHKA 1XQHA 5GAOl 4RG2A 1YITA 3G4SQ 3A1PA 1KD1U 1IGQA 1GXIE 1QKXA 4LE9A 4C0ZA 3F70A 5GMKj 4ELZC 1RI9A 3H41A 2ED1A 3WVEB 4EMKA 1JJ2S 3CCJQ 5GAMg 5GAN2 1WI7A 4FW1A 2JMCA 4MDXA 1MNEA 1WA7A 3OBWA 1YI2T 3ME9A 4J9DA 2LDMA 2HCKA 2L3QA 2DETA 1WYXA 2GFAA 3SB2A 3ZL7C 1NLPC 2VB6A 2VGNA 3CCMQ 1TS9A 3JCMV 3OYKA 3SWNB 1VQOT 2BKDN 2DYIA 1XNIA 3HRSA 4LUDA 4N4HA 3GPLA 3EH1A 1TG0A 4DBFA 3L2ZA 4QVCA 2GF7A 5GAMd 3HTRA 2QYZA 3RKYA 2EGEA 3UA6A 3TREA 5GAOn 2NUTB 1B34A 1M90U 2EQKA 1VQLQ 2F5TX 4C92B 3VS7A 1NE8A 4BI3A 5LL6S 1B3QA 1NEBA 1G2BA 2QQBA 5CKFA 2L5QA 2Y90A 4OMPA 3OW2A 2LQNA 2DIGA 3OYIA 2RB6A 3WVDB 4A53A 2G6FX 1OX8A 3C94A 3HFNA 2RD1A 3GP8A 1VQ5T 3JCMb 3GLXA 1K4US 3CMET 3CCEQ 2QTVA 4LD6A 1AD5A 2L3SA 1UTIA 2FEIA 2X51A 1U06A 3A8LB 1VQMA 2YRVA 3PTAA 4M75B 1VQ8A 5GAOq 2R5AA 3HP9A 1E6HA 4X1VA 4LDVA 2AIRB 4M77A 1ZSZA 1TXQA 1BYMA 4JUVA 3CCLQ 1MUZA 4LXCA 3I56T 4F7UF 5IXFA 4C92A 3EG9A 2ZZDA 1JBMA 3OYAA 1LOJA 2ZPHB 3NTIA 2K3YA 4QVDA 2E12A 3JCMh 1QVFS 1PRLC 5GANd 1UFFA 3JRZA 4M77F 2E1HA 4IIMA 1N9RA 4J6XA 2FL7A 1BI2A 4TVRA 1S1NA 5GANh 4WF2A 4ZGJB 2C0TA 3CCVT 1K8AC 4PLLA 2CSIA 2C0OA 1WNLA 1MMNA 1M5Q1 4F16A 1ZX6A 4ZGDB 3CC2Q 2K2MA 1MNDA 4C5EA 1NLOC 2BTTA 1K76A 2KAFA 2ZPBB 2OAUA 2YUPA 4V2SA 5FU6B 3CEYA 2KMTA 2COZA 3QSUA 4NL2A 2RHYA 4FSSA 2SEMA 3PT9A 1QVPA 4HA8A 1WPYA 2RN8A 2RO0A 1SPKA 2HBPA 5GAMe 2FB7A 1BBZA 1MV0B 3RBBB 3OYNA 3EGDA 2RJDA 1IB8A 3QO3A 4KBMB 2DNUA 1OX9A 3M53A 4DA4A 2E41A 3KFVA 4EMKB 4Q5WA 3KUFA 3LH5A 2QGGA 5C6SA 4FCYA 1X6OA 2DZ9A 4PJNA 3C12A 3S3NA 2VUBA 3A98A 2DM1A 2MF2A 5C0MA 2GGRA 2BZYA 2JW4A 1JJ2P 1ABQA 2M0OA 1W2BS 1H3ZA 4A4HA 2C0IA 3QZ5B 2XDBA 1UJ0A 3X26B 3QHSA 3RKXA 2BZXA 4XU0A 4KT0E 1W1FA 1X43A 3NMZC 3T9NA 1W6XA 2JOYA 1WHHA 2RQTA 1K9MU 2RK2A 3MEAA 2YRDA 2DA9A 3PVLA 3J81E 1AVZC 2VVKA 3LWHA 4XTVA 4RG8A 5CQXA 2FZCB 5J39A 3M4GA 4HCKA 5GAN4 1KQSA 5FW9A 3CCEA 3E19A 2JJ9A 2HL5C 1X75C 3C0CA 2P0QA 4A4KA 4F7UE 4CC3A 2R58A 2DL7A 4M77B 2W10A 1M8MA 1OYXA 4BDZA 1KHIA 2P84A 2MOXA 3DB3A 2FPFA 1QLYA 1BCOA 2EYYA 1R0CB 1SHFA 2VXEA 2D8HA 2RJFA 1QVGS 3PMTA 3EFRA 4ZNXA 2LRQA 3CCUT 2YSQA 5GAN7 5CR2A 4OB2B 1E7OA 4JS5A 2EGAA 4M78E 4R0KA 3P8DA 1VA7A 1VQNQ 2DTIA 1Y0MA 5EG2A 3ZBDA 3EGXB 1WHJA 2K3XA 2KYMA 3OBYA 1R77A 1T3SA 4PJLA 2KDSA 2ZCFB 1WDXA 1N8RU 1LNXA 3CC2A 3CXCA 2J6KA 3G1JA 1NZ9A 4E47A 1UUEA 1RAGB 1S72T 1RI0A 1X6BA 2CZ6B 3H0HA 2VGMA 4X9DA 2G3RA 3HKSA 5FRMA 3UATA 3V7SA 4DBRA 1T0JA 4C8QC 3X28B 3CCRQ 3KXTA 4FL6A 3JB9J 3NFCA 5KH6A 4JS4A 1FYNA 4ESRA 5IAYA 2M02A 4J83A 2J6FA 2ZPIB 2QK0A 4F14A 4PFOA 1QP2A 4E2FB 3OMCA 3JV3A 3UA7A 1S72Q 1M1GA 3OMGA 4MZPA 4DOVA 2J05A 2SRCA 2PTKA 4OB1B 2QA4Q 5LJ3g 1K8AR 2KRSA 2FHDA 2Z0WA 3R6NA 3A5ZB 1G8XA 1PSEA 1U3OA 1QVGA 3JSCA 4C5HA 1SHGA 5M9OA 5GMKl 2DD4A 1P92A 3L2QA 2YWWA 3VUZA 3A8HB 2EYQA 3H8ZA 1VQPA 1K9MR 2JTFA 2V8IA 2DFUA 2L2PA 5IT9E 5LJ3d 1AEYA 1HYOA 3QDRB 4M4ZA 4RCBA 2YLCA 2O9VA 3CCMT 1ACMB 4NL3A 1C1AA 4L5GA 1VYUA 4ATOA 1VQNT 3CD6T 2GQIA 2A08A 2RNAA 2HQXA 1VQ9Q 4B9WA 2FG0A 2KSSA 4P5NA 2K2VA 5I2MA 3CD6A 2VKNA 1RAIB 4M78F 4E7SA 2PUKB 3V8LA 3CCUQ 2ZPFB 1I1JA 1NG2A 3MPUB 4XTYA 1ABOA 3EGUA 5KYNA 3MEVA 1WHGA 4RTYA 1W2BA 2RQWA 2JXBA 4M7DG 3ZEHA 3RESA 4M75G 2DPPB 4VUBA 4ELYC 2DXBA 2F2VA 2EPDA 1YIJA 1GL5A 1K73C 3RR6A 1GCQA 1D3BA 1OV3A 4AG2C 1VQ4T 3O8VA 4AFZC 3L1AA 3JCMc 1VQ8T 3PIOA 4J9IA 2BIVA 4C8QE 3MCAB 3THKA 2VV5A 5FRNA 5A0DA 4JZ3A 2YHTA 1IGUA 1RL2A 4KGVB 1UE9A 3TQ7P 3JCMJ 1GRIA 1PC0A 3RUXA 3NHNA 4Y28E 2HSEB 5LJ5d 1OULA 1RLQC 3M0RA 1D09B 4M78B 1VQ6T 2I0NA 1AWJA 4IURA 1KD1R 4RTWA 1HD3A 1RAHB 2LP5A 1PM3A 3OB9A 1UB4A 1BU1A 2KXDA 4XQ3A 2DBMA 2MIOA 4X34A 1SRLA 2DILA 3ZFJA 2RQUA 3L2UA 1GCPA 2FYKA 2X4WA 3VYGA 2V8KA 4OB3B 4XTWA 2NUTA 2EQUA 1PG5B 1K1ZA 3C95A 5FU7C 2CUBA 4J9GA 3ASKA 1TWBA 1TUCA 1VQOA 1N8RR 1K0SA 1OEBA 4M75D 2KT8A 5D6WA 3QKJA 4K11A 2J06A 4M7AG 3ER0A 3CPFA 3S3MA 1PCXA 3FJ5A 1HXDA 3TSWA 2ESWA 3OYDA 1VQ7A 1Q86C 1KIKA 2ATCB 5GMKm 1D1AA 4M7DE 4QQGA 3OYYA 3VS3A 3ULRB 3CCJA 2GQVA 1SEMA 5FWBA 3SD4A 2P0KA 1JXMA 3V7RA 1Y57A 4C92D 2QQRA 1ZSZB 1MHNA 1WQWA 5FU7B 4MZMA 3CMAA 1ZLMA 2DAQA 3TU4K 2KGTA 3HL8A 2AT1B 1YJWA 1TH7A 2LT4A 2LX7A 3EG9B 3VYHB 1NPRA 2WSEE 4E7IA 3QWYA 4C8QA 4M7DC 2CH4A 3QG1A 1WLPB 2JM9A 2NYSA 3CC4A 2RF0A 1G3SA 4M77C 1VQ9A 2F1LA 2MI6A 3HRTA 1KQ1A 1Q7YU 3UWNA 1LJOA 3G6EQ 3DLMA 2K4YA 5KYUA 4N0AA 1FMKA 2CKKA 3REAB 2QI2A 2A28A 1RLPC 5KYWA 1VYVA 1OU8A 1V29B 1KK7A 2AK5A 3I35A 1ZUUA 3V8KA 1YFNA 1BB9A 2DTHA 4C8QF 2A3LA 2EYWA 2DJQA 5J3BA 5GAMj 3CCLT 2E3IA 4FYYB 5IHIA 2CYZB 2D0NA 4Y91A 5DY9A 1OPKA 3RMQA 3OY9A 1AWWA 1GBRA 4DQ2A 5GAMh 1VQ4Q 4LUEA 2DE0X 2E64A 2FPDA 3J7AF 4QVZA 4QQDA 4DOWA 1G3WA 1YWOA 3TSZA 1WHKA 3VS0A 5KE3A 2HEQA 1WJQA 4MMLA 1I0CA 4C92G 2FRWA 3JCMg 2ROTA 3QBYA 3SHWA 3CC7A 2HBWA 2EGCA 4J9FA 1M2OA 1JJ2A 1NJIR 2FRYA 5GAN6 1RAAB 3MEUA 1VQ8Q 4E7HA 3X25B 4RTVA 2CT3A 4M75A 1WJSA 4M7DA 3P8BB 3G6ET 4KUDK 4C5GA 2HAXA 3O5ZA 2QASA 1MMGA 3L2RA 4JZ4A 5FROA 3JCMP 4M77E 2DL4A 5KYYA 2QEXQ 2CDTA 1IREB 5GAN5 1E6GA 4EMKC 3MP1A 4AFSC 3EFSA 3M54A 1YITQ 4Z88A 8ATCB 4HCBA 3G4SA 4D6WA 2KYBA 4BB7A 1YHQQ 2DLPA 2V26A 3G4ST 2V1QA 2DZCA 2QG9B 4M7DD 5GANj 2J6OA 3HFOA 2K9GA 1OOTA 1EZZB 1VIFA 2E3HA 3GIBA 5GJWB 1M90R 1QWFA 3CCVQ 1WQ7A 1VOMA 4XAXB 1VQPT 1MGQA 1Q7YR 1KD1C 3CCQT 4MDWA 1WXTA 2LCSA 2ZAEA 1G3TA 4ZN3A 3QJ6A 3PFSA 1YJNQ 1QP3A 1YJ9A 1VQMT 2ECZA 3H9NA 1LCKA 2QDYB 2LTOA 4N4GA 1YP5A 3EG3A 4LNPA 3X24B 2DKGA 4YTLA 5LJ5f 2OX7A 1XOVA 3EHQA 4A4FA 3CBOA 4FIBA 4CC4B 4AFUC 4JRQA 2ED0A 4A63B 1J3TA 2EJ9A 1AWOA 3OW2P 3VRYA 2JS2A 1IXDA 4QQ6A 2QA4T 1UGPB 3RIRA 1KC8U 2CZ1B 1OU9A 4KGZB 1QCFA 5FWCA 3E2UA 3M9QA 1YJNT 3D7SB 2R57A 1TTHB 1YBYA 2O31A 2PZ1A 2K57A 1KC8R 4M77D 3NGPA 2OTJT 4Z8AA 4J7IA 2RI3A 3BY7A 5I21A 1YJWT 3E1SA 4JJBA 5LJ5e 2OTJA 1O75A 3M58A 4FW2A 4GY5A 2DVJA 3LLRA 3S6WA 4C0GA 3FDRA 1GCQC 4LD9K 5CQYA 4F7UB 4EIKA 2XI9A 3RKWA 1FX7A 1WXBA 1FWZA 2DIQA 1VQMQ 1M3AA 4JLGA 4JPBW 4JDSA 1X01A 3GNGA 4C92E 4M7AC 3CCQA 4FT4A 4DEXA 1Y71A 2DRKA 5LJ3j 2RJCA 5KYUB 3JB9G 4M78D 2HKQB 3M0QA 2ENMA 4IKFA 4WTOB 1PRMC 3JCMW 3FB9A 1UGVA 1SSFA 2EYZA 2DX1A 2F2XA 1K73R 2FO0A 5GJVB 4PNOA 5CKBA 5ECAA 1C6VX 2CP2A 4M7AD 1UECA 4DBHA 2J7IA 1VQ5A 2PVDB 4E7LA 2O4XB 2V8JA 1YITT 3A8MB 3TVTA 2LQ8A 3H6ZA 2OAWA 2ZPGB 3OSVA 1KC8C 2QAZA 4QT7A 1N8RC 2QEXT 2OTLT 3MP6A 1SF9A 2RHXA 2B8AA 5GMKi 1M8VA 4LDWA 3HRUA 5DLQE 4ZTFA 2OI3A 3OYHA 2P4TA 2LZ6B 2GCXA 5IN1A 3CPWA 3EG2A 5KYYB 2KQWA 1NBEB 1PHTA 3JCMd 4AG1C 2F5KA 1IHWA 9ATCB 4IUUA 1V1CA 2YUNA 4F04B 3JB9F 2DL5A 3L2VA 3FC3A 1M4ZA 1WHLA 1VQ6A 3I55A 1H3HA 1KSWA 2AKLA 2VXFA 1H92A 1TOVA 2LJ1A 5KYXA 4HVWA 4EMGA 3OS0A 3BDLA 3FIFA 3R6OA 4O6JA 5GAOp 1I5OB 4C0FA 1RUWA 4C92C 1M3BA 5GAMf 1HJDA 3QZ9B 5CKEA 1K0XA 2HSPA 4J9BA 4D8KA 2CREA 5KCOA 4OMNA 2XK0A 1UJYA 3LGLA 3PVQA 2XG8D 2M51A 2EVRA 2AZSA 4OMQA 4HCZA 1Z9ZA 1G5VA 2XICA 4ZGEB 3OW2S 4ORZA 1Z9QA 3CQTA 5GANf 4L6V5 4D8DA 1QWEA 4F7UA 5A2QE 3V7CA 3M0TA 3JCMX 1KG1A 5GAOm 2DXCA 1ZA2B 2CGHA 1HK9A 4BDYA 4GBQA 4KUIA 1U1TA 2Y4XA 3OYLA 2PVGB 4L59A 2PUOB 2NLUA 2YUQA 3M56A 3OYEA 2W0ZA 2O88A 1SRMA 3NTKA 2DK3A 2IPOB 1GFCA 5AT1B 2PU9B 5IXBA 3H0IA 3CPWP 1EX4A 2DXUA 5HKCA 4HT9A 3EHRA 3I5SA 4FYXB 1N6AA 2MK5A 4FU6A 1K9MC 3M0PA 2EQIA 1VQ7T 2KY9A 2F69A 2D9TA 1QKWA 2LT1A 4ANJA 3I56Q 2DERA 2IIMA 4MMKA 1IZ6A 4M78C 1AWXA 3CMEA 2XMFA 4CC2A 1CSKA 1Q86U 5LJ5h 1KFZA 2JS0A 3JAME 4OMFB 1RABB 1K73U 3CCET 3OSSC 1M1KR 5D7UA 1K9AA 1FMVA 1Q86R 4IUVA 2RA2A 4KULA 2VYTA 2CZ7B 1QVFP 2IG0A 5D6XA 2QTXA 2KBTA 1IO6A 4FSXA 4DEYA 2KNBB 2FVUA 4J9CA 2JT4A 5I22A 1I8FA 2NUPA 2KXCA 4IUPA 2HL3A 3M0UA 4OVAA 3EAEA 2XHCA 5L23A 3UDCA 4M75E 3OYBA 2CP3A 2O01E 1BIBA 1PWTA 1RADB 3RERA 1RAEB 2K5FA 3J80E 3META 3X20B 2QA4A 1D1CA 2HQEA 2L3PA 1Q7YC 2CS7A 5CCAA 1UG1A 4RUGA 2XD0A 1X69A 4M7AE 2CP6A 4BE0A 1VQOQ 1M2VA 4N4IA 1W2BP 2IVWA 5CO7A 3HSBA 3OYJA 4M7DF 1BI1A 2RH2A 5HY6A 4XK8E 2P0PA 3CBMA 1FMWA 4II1A 3CD6Q 4RTXA 3P8HA 2LC4A 3OA6A 1YI2Q 5LJ3f 1QCNA 2M1HA 3QXEB 3SWNA 1NJIC 1H8KA 3JB9D 2RQVA 3CCJT 2DEQA 4E7KA 4RTZA 2H8HA 3JB9H 1Y96B 1I5LA 2RHUA 4E7JA 2E65A 2LNHB 3OQ5A 4PJOB 2RQRA 2O4XA 2E10A 1ARKA 2YUOA 3CXCP 2M9UA 2HD0A 5KCHA 1BK2A 2GBQA 1WGSA 2JZ2A 1IRXA 2NUZA 4HT8A 1WJRA 2D6FA 7AT1B 1BCMA 3EFOB 2QGFB 2KE9A 2KEAA 4FYWB 4IUTA 4C0DB 4RMOA 1ZQ1A 3S3OA 5LJ3h 1D0ZA 3EGDB 2JMAA 2GFUA 2LX9A 2C06A 4B9XA 3UF4A 1WIEA 1ZHIA 1M3CA 2GTOA 3IQLA 4KRTA 1VQLA 1D0YA 3VKIA 3JB9I 2RM4A 1MMAA 1EIFA 1AHJB 3M59A 3GOXA 2EFIA 4HVUA 2EBPA 4PJOA 1VUBA 2EW3A 1VQ4A 2LMJA 3CC7T 2XIDA 2MWOA 1XJWB 2L3RA 3PE0A 1VQLT 1U8RA 3EG1A 1Q82R 1CKBA 4CI0C 2BE7D 1JB0E 2KI7A 2K5IA 3QPHA 1QVGP 4R55A 3QUIA 3M57A 2E6NA 4ZTJA 3V8JA 2DVEA 4PJOF 4E7ZA 1ZBJA 2X35A 3CCST 4QKUA 1UDLA 2V1RA 2P4RA 4J9HA 3M55A 1VQ7Q 2CZ0B 2OTLA 4XTXA 3MO8A
chains in the Genus database with same CATH topology
4JJBA 2YDLA 2CSQA 3H0FA 2DVJA 4JJCA 1GCQC 1FYNA 4ESRA 4EIKA 1T0HA 2J6FA 4OMLA 1WXBA 3NPFA 4F14A 1MV3A 1M30A 1M3AA 4OMOA 4JPBW 2KRNA 1AOJA 3SEMA 3JV3A 4DEXA 2DRKA 1WXUA 3UA7A 2NWMA 4Z89A 2J05A 2SRCA 2PTKA 1UHFA 3M0QA 2ENMA 1GBQA 2KRSA 2DF6A 2RMOA 1PRMC 3R6NA 1UGVA 2B86A 1VYTA 2EYZA 1U3OA 2DX1A 2F2XA 2FO0A 5GJVB 4WCIA 5ECAA 1SHGA 1UECA 4CC7A 2J7IA 2D1XA 1WFWA 4GLMA 4OMMA 1X2QA 2GNCA 1U5SA 3VS5A 3TVTA 2JM8A 2M0YA 2OAWA 3I9QA 4QT7A 4HXJA 1AZGB 1PNJA 5I11A 2L2PA 1YNZA 1I07A 2LQWA 2OI3A 2EKHA 2CT4A 1AEYA 4RTUA 2CUDA 2LZ6B 4M4ZA 2O9VA 4IIOA 1YWPA 1GFDA 3VS2A 1PKSA 1NYGA 1VYUA 3EG2A 4J9EA 5IHKA 2GQIA 2ABLA 2A08A 2RNAA 1PHTA 4AG1C 2FG0A 1KJWA 1NM7A 1JO8A 2VKNA 4Y92A 1V1CA 1QKXA 4LE9A 2BZ8A 1I1JA 1NG2A 2YUNA 1ABOA 3EGUA 2DL5A 4RTYA 3M0SA 2RQWA 2JXBA 1TUDA 1RI9A 1H3HA 3H41A 2ED1A 1KSWA 2L0AA 2K3BA 2AKLA 2GTJA 2F2WA 2F2VA 2LJ1A 1H92A 2EPDA 4HVWA 1GL5A 1WI7A 2MCNA 2JMCA 1GCQA 1OV3A 4AG2C 1WA7A 4AFZC 4J9DA 1RUWA 1M3BA 4J9IA 1HJDA 2HCKA 2L3QA 3THKA 1K0XA 2HSPA 1WYXA 1X6GA 4AFQC 2DMOA 3ZL7C 4J9BA 4JZ3A 4D8KA 1NLPC 2CREA 1UE9A 1GRIA 4OMNA 2JTEA 4LUDA 1ZUYA 3NHNA 1A0NB 1UJYA 3PVQA 1B07A 1TG0A 2KROA 1SSHA 2RPNA 2M51A 2EVRA 2AZSA 2X3XD 4OMQA 1Z9ZA 1RLQC 3M0RA 2X3WD 2EGEA 4ORZA 2I0NA 1AWJA 1Z9QA 3UA6A 3CQTA 4RTWA 1HD3A 4D8DA 2LP5A 1QWEA 2AKKA 1BU1A 2KXDA 2DBMA 2MIOA 3M0TA 1SRLA 2DILA 1N5ZA 2RQUA 3VS7A 1GCPA 1B3QA 4LN2A 1NEBA 1G2BA 1K1ZA 4GBQA 4OMPA 3REBB 3VS1A 2LQNA 2CUBA 4J9GA 1T3LA 1TUCA 2A37A 2G6FX 1K0SA 1OEBA 2YUQA 2KT8A 2PNIA 4K11A 2OJ2A 1K4US 1ZSGA 2KR3A 2LJ3A 2J06A 1AD5A 2W0ZA 1ZUKA 4JJDA 2O88A 2L3SA 1UTIA 2FEIA 3EG0A 1U06A 1SRMA 1M27C 1GFCA 2A36A 3FJ5A 3TSWA 2ESWA 1KIKA 1E6HA 4X1VA 5IXBA 3H0IA 2O9SA 3EHRA 2O2OA 1MUZA 3VS3A 3I5SA 3ULRB 2K79A 1SEMA 5FWBA 5IXFA 1JU5C 3M0PA 1JXMA 2EQIA 1QKWA 1Y57A 2E5KA 1ZLMA 2IIMA 2KGTA 1NYFA 1HSQA 1AWXA 1PRLC 2XMFA 4CC2A 1CSKA 2LX7A 1UFFA 1KFZA 2JS0A 4IIMA 3QWYA 2CH4A 1WLPB 2JM9A 2RF0A 1YCSB 5IHNA 1S1NA 3U23A 4F17A 2C0TA 2CSIA 2C0OA 4F16A 1FMKA 1K9AA 1ZX6A 2K2MA 3REAB 1NLOC 2A28A 2BTTA 1K76A 1RLPC 1VYVA 2LJ0A 2YUPA 2AK5A 3I35A 1OPLA 1ZUUA 2KBTA 1W70A 1IO6A 1EFNA 2KNBB 4DEYA 4J9CA 1BB9A 2JT4A 4FSSA 5I22A 5HCKA 2SEMA 2KXCA 2EYWA 2DJQA 3M0UA 4RTTA 5IHIA 5L23A 3QWXX 2D0NA 2RN8A 1SPKA 2QDLA 1OPKA 1AWWA 1GBRA 2DBKA 1BBZA 1MV0B 4LUEA 1PWTA 2DE0X 3VRZA 2FPDA 3RBBB 1YWOA 3TSZA 1G83A 3VS0A 2DNUA 2HEQA 1UHCA 2L3PA 1I0CA 1JXOA 2FRWA 3KFVA 2ROTA 3SHWA 2AZVA 1UG1A 1WX6A 4RUGA 3LH5A 4E6RA 2HBWA 1X69A 5EC7A 2EGCA 5IH2A 4J9FA 2FPEA 3A98A 1X27A 2DM1A 2FRYA 2GGRA 2BZYA 2JW4A 2VWFA 1ABQA 2C0IA 4RTXA 3RNJA 4RTVA 2CT3A 2DYBA 1UJ0A 3O5ZA 2BZXA 1H8KA 3VS4A 2RQVA 1W1FA 4JZ4A 1X43A 3NMZC 4RTZA 2H8HA 1W6XA 2RQTA 1PKTA 2DL4A 2CDTA 2EYXA 1JQQA 2DA9A 3PVLA 1AVZC 2VVKA 1E6GA 2K6DA 2LNHB 4AFSC 2RQRA 4Z88A 1ARKA 2YUOA 2KYBA 4HCKA 4HVVA 1BK2A 2GBQA 2DLPA 2NUZA 2K7AA 5FW9A 2V1QA 3C0CA 2J6OA 2KE9A 2KEAA 4CC3A 2K9GA 1OOTA 2DL7A 2W10A 5GJWB 1QWFA 2ROLA 1M8MA 2KRMA 2JMAA 2MOXA 2FPFA 1WXTA 1QLYA 2EYYA 2LCSA 3UF4A 1WIEA 1SHFA 1M3CA 2GTOA 3I5RA 2D8HA 3IQLA 4KRTA 2CH4W 2ECZA 1LCKA 4ZNXA 1YP5A 3EG3A 2YSQA 4LNPA 2YT6A 4HVUA 1E7OA 2EBPA 2EGAA 1XOVA 3GBQA 2EW3A 2HDAA 4R0KA 1YN8A 1AZEA 1JEGA 1VA7A 2DL3A 3EHQA 2LMJA 4CC4B 4AFUC 1Y0MA 3VS6A 2ED0A 2KYMA 4A63B 1J3TA 1CKAA 1AWOA 3VRYA 3PE0A 1T3SA 2JS2A 2D8JA 3EG1A 1WDXA 1CKBA 2DRMA 1NEGA 2J6KA 2DL8A 1QCFA 1UUEA 5FWCA 1X6BA 3H0HA 2KT1A 1ZBJA 2O31A 2PZ1A 3UATA 1X2KA 1UDLA 2V1RA 2P4RA 4J9HA 3NGPA 1T0JA 4Z8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJB A;  2YDL A;  2CSQ A;  3H0F A;  2DVJ A;  4JJC A;  1GCQ C;  1FYN A;  4ESR A;  4EIK A;  1T0H A;  2J6F A;  4OML A;  1WXB A;  3NPF A;  4F14 A;  1MV3 A;  1M30 A;  1M3A A;  4OMO A;  4JPB W;  2KRN A;  1AOJ A;  3SEM A;  3JV3 A;  4DEX A;  2DRK A;  1WXU A;  3UA7 A;  2NWM A;  4Z89 A;  2J05 A;  2SRC A;  2PTK A;  1UHF A;  3M0Q A;  2ENM A;  1GBQ A;  2KRS A;  2DF6 A;  2RMO A;  1PRM C;  3R6N A;  1UGV A;  2B86 A;  1VYT A;  2EYZ A;  1U3O A;  2DX1 A;  2F2X A;  2FO0 A;  5GJV B;  4WCI A;  5ECA A;  1SHG A;  1UEC A;  4CC7 A;  2J7I A;  2D1X A;  1WFW A;  4GLM A;  4OMM A;  1X2Q A;  2GNC A;  1U5S A;  3VS5 A;  3TVT A;  2JM8 A;  2M0Y A;  2OAW A;  3I9Q A;  4QT7 A;  4HXJ A;  1AZG B;  1PNJ A;  5I11 A;  2L2P A;  1YNZ A;  1I07 A;  2LQW A;  2OI3 A;  2EKH A;  2CT4 A;  1AEY A;  4RTU A;  2CUD A;  2LZ6 B;  4M4Z A;  2O9V A;  4IIO A;  1YWP A;  1GFD A;  3VS2 A;  1PKS A;  1NYG A;  1VYU A;  3EG2 A;  4J9E A;  5IHK A;  2GQI A;  2ABL A;  2A08 A;  2RNA A;  1PHT A;  4AG1 C;  2FG0 A;  1KJW A;  1NM7 A;  1JO8 A;  2VKN A;  4Y92 A;  1V1C A;  1QKX A;  4LE9 A;  2BZ8 A;  1I1J A;  1NG2 A;  2YUN A;  1ABO A;  3EGU A;  2DL5 A;  4RTY A;  3M0S A;  2RQW A;  2JXB A;  1TUD A;  1RI9 A;  1H3H A;  3H41 A;  2ED1 A;  1KSW A;  2L0A A;  2K3B A;  2AKL A;  2GTJ A;  2F2W A;  2F2V A;  2LJ1 A;  1H92 A;  2EPD A;  4HVW A;  1GL5 A;  1WI7 A;  2MCN A;  2JMC A;  1GCQ A;  1OV3 A;  4AG2 C;  1WA7 A;  4AFZ C;  4J9D A;  1RUW A;  1M3B A;  4J9I A;  1HJD A;  2HCK A;  2L3Q A;  3THK A;  1K0X A;  2HSP A;  1WYX A;  1X6G A;  4AFQ C;  2DMO A;  3ZL7 C;  4J9B A;  4JZ3 A;  4D8K A;  1NLP C;  2CRE A;  1UE9 A;  1GRI A;  4OMN A;  2JTE A;  4LUD A;  1ZUY A;  3NHN A;  1A0N B;  1UJY A;  3PVQ A;  1B07 A;  1TG0 A;  2KRO A;  1SSH A;  2RPN A;  2M51 A;  2EVR A;  2AZS A;  2X3X D;  4OMQ A;  1Z9Z A;  1RLQ C;  3M0R A;  2X3W D;  2EGE A;  4ORZ A;  2I0N A;  1AWJ A;  1Z9Q A;  3UA6 A;  3CQT A;  4RTW A;  1HD3 A;  4D8D A;  2LP5 A;  1QWE A;  2AKK A;  1BU1 A;  2KXD A;  2DBM A;  2MIO A;  3M0T A;  1SRL A;  2DIL A;  1N5Z A;  2RQU A;  3VS7 A;  1GCP A;  1B3Q A;  4LN2 A;  1NEB A;  1G2B A;  1K1Z A;  4GBQ A;  4OMP A;  3REB B;  3VS1 A;  2LQN A;  2CUB A;  4J9G A;  1T3L A;  1TUC A;  2A37 A;  2G6F X;  1K0S A;  1OEB A;  2YUQ A;  2KT8 A;  2PNI A;  4K11 A;  2OJ2 A;  1K4U S;  1ZSG A;  2KR3 A;  2LJ3 A;  2J06 A;  1AD5 A;  2W0Z A;  1ZUK A;  4JJD A;  2O88 A;  2L3S A;  1UTI A;  2FEI A;  3EG0 A;  1U06 A;  1SRM A;  1M27 C;  1GFC A;  2A36 A;  3FJ5 A;  3TSW A;  2ESW A;  1KIK A;  1E6H A;  4X1V A;  5IXB A;  3H0I A;  2O9S A;  3EHR A;  2O2O A;  1MUZ A;  3VS3 A;  3I5S A;  3ULR B;  2K79 A;  1SEM A;  5FWB A;  5IXF A;  1JU5 C;  3M0P A;  1JXM A;  2EQI A;  1QKW A;  1Y57 A;  2E5K A;  1ZLM A;  2IIM A;  2KGT A;  1NYF A;  1HSQ A;  1AWX A;  1PRL C;  2XMF A;  4CC2 A;  1CSK A;  2LX7 A;  1UFF A;  1KFZ A;  2JS0 A;  4IIM A;  3QWY A;  2CH4 A;  1WLP B;  2JM9 A;  2RF0 A;  1YCS B;  5IHN A;  1S1N A;  3U23 A;  4F17 A;  2C0T A;  2CSI A;  2C0O A;  4F16 A;  1FMK A;  1K9A A;  1ZX6 A;  2K2M A;  3REA B;  1NLO C;  2A28 A;  2BTT A;  1K76 A;  1RLP C;  1VYV A;  2LJ0 A;  2YUP A;  2AK5 A;  3I35 A;  1OPL A;  1ZUU A;  2KBT A;  1W70 A;  1IO6 A;  1EFN A;  2KNB B;  4DEY A;  4J9C A;  1BB9 A;  2JT4 A;  4FSS A;  5I22 A;  5HCK A;  2SEM A;  2KXC A;  2EYW A;  2DJQ A;  3M0U A;  4RTT A;  5IHI A;  5L23 A;  3QWX X;  2D0N A;  2RN8 A;  1SPK A;  2QDL A;  1OPK A;  1AWW A;  1GBR A;  2DBK A;  1BBZ A;  1MV0 B;  4LUE A;  1PWT A;  2DE0 X;  3VRZ A;  2FPD A;  3RBB B;  1YWO A;  3TSZ A;  1G83 A;  3VS0 A;  2DNU A;  2HEQ A;  1UHC A;  2L3P A;  1I0C A;  1JXO A;  2FRW A;  3KFV A;  2ROT A;  3SHW A;  2AZV A;  1UG1 A;  1WX6 A;  4RUG A;  3LH5 A;  4E6R A;  2HBW A;  1X69 A;  5EC7 A;  2EGC A;  5IH2 A;  4J9F A;  2FPE A;  3A98 A;  1X27 A;  2DM1 A;  2FRY A;  2GGR A;  2BZY A;  2JW4 A;  2VWF A;  1ABQ A;  2C0I A;  4RTX A;  3RNJ A;  4RTV A;  2CT3 A;  2DYB A;  1UJ0 A;  3O5Z A;  2BZX A;  1H8K A;  3VS4 A;  2RQV A;  1W1F A;  4JZ4 A;  1X43 A;  3NMZ C;  4RTZ A;  2H8H A;  1W6X A;  2RQT A;  1PKT A;  2DL4 A;  2CDT A;  2EYX A;  1JQQ A;  2DA9 A;  3PVL A;  1AVZ C;  2VVK A;  1E6G A;  2K6D A;  2LNH B;  4AFS C;  2RQR A;  4Z88 A;  1ARK A;  2YUO A;  2KYB A;  4HCK A;  4HVV A;  1BK2 A;  2GBQ A;  2DLP A;  2NUZ A;  2K7A A;  5FW9 A;  2V1Q A;  3C0C A;  2J6O A;  2KE9 A;  2KEA A;  4CC3 A;  2K9G A;  1OOT A;  2DL7 A;  2W10 A;  5GJW B;  1QWF A;  2ROL A;  1M8M A;  2KRM A;  2JMA A;  2MOX A;  2FPF A;  1WXT A;  1QLY A;  2EYY A;  2LCS A;  3UF4 A;  1WIE A;  1SHF A;  1M3C A;  2GTO A;  3I5R A;  2D8H A;  3IQL A;  4KRT A;  2CH4 W;  2ECZ A;  1LCK A;  4ZNX A;  1YP5 A;  3EG3 A;  2YSQ A;  4LNP A;  2YT6 A;  4HVU A;  1E7O A;  2EBP A;  2EGA A;  1XOV A;  3GBQ A;  2EW3 A;  2HDA A;  4R0K A;  1YN8 A;  1AZE A;  1JEG A;  1VA7 A;  2DL3 A;  3EHQ A;  2LMJ A;  4CC4 B;  4AFU C;  1Y0M A;  3VS6 A;  2ED0 A;  2KYM A;  4A63 B;  1J3T A;  1CKA A;  1AWO A;  3VRY A;  3PE0 A;  1T3S A;  2JS2 A;  2D8J A;  3EG1 A;  1WDX A;  1CKB A;  2DRM A;  1NEG A;  2J6K A;  2DL8 A;  1QCF A;  1UUE A;  5FWC A;  1X6B A;  3H0H A;  2KT1 A;  1ZBJ A;  2O31 A;  2PZ1 A;  3UAT A;  1X2K A;  1UDL A;  2V1R A;  2P4R A;  4J9H A;  3NGP A;  1T0J A;  4Z8A A; 
#chains in the Genus database with same CATH topology
 5GMK h;  1D1B A;  4PJM A;  2XDP A;  5A0L A;  2XU8 A;  3MHX A;  5CKH A;  1G3Y A;  3A8O B;  3SFM A;  2DTO A;  4EDU A;  1Q81 R;  1YHQ T;  3OYF A;  3CMA Q;  2E5Q A;  3PGG A;  4OGE A;  2K5L A;  2QEX A;  3CC4 T;  3NPF A;  4BI8 B;  3CCS Q;  1MV3 A;  4F7U G;  2KRN A;  2CP7 A;  3LGF A;  1AOJ A;  3SEM A;  1MMD A;  3CC4 Q;  1WXU A;  2EWN A;  4Z89 A;  3TCJ A;  1UHF A;  3CMA T;  4OP0 A;  3QJY A;  4A4G A;  2M16 A;  2CP5 A;  2RMO A;  2LQK A;  1YI2 A;  2B86 A;  2A0F B;  2MWP A;  4FYV B;  4WCI A;  5GAN g;  4XU3 A;  3EGX A;  1I4K 1;  3PNW C;  4R56 A;  1Q82 U;  4CC7 A;  2D1X A;  4FM4 B;  4GLM A;  3GNF B;  2GNC A;  5DLO A;  1WHM A;  4PFZ A;  4M78 G;  3VS5 A;  2M0Y A;  4B6M A;  2AHJ B;  3I9Q A;  2ZPE B;  4J6Y A;  2DD5 A;  2DEU A;  3Q1J A;  2MPX C;  3FEO A;  4JRP A;  3QII A;  2CUD A;  1N27 A;  1YWP A;  4PL6 A;  1OI1 A;  5CAI A;  3VJP A;  1GFD A;  1NYG A;  4J9E A;  1DJ7 B;  3CC7 Q;  2ABL A;  1R0B G;  2EKO A;  5CIU A;  1KJW A;  1NM7 A;  2JN0 A;  1SKU B;  5GAN 8;  2DJZ A;  4N0A C;  5L8R E;  1JO8 A;  4Y92 A;  1RAC B;  4O5V A;  2EJF A;  2BZ8 A;  5KE2 A;  1V76 A;  5FLX E;  3EFO A;  3M0S A;  5D6Y A;  1KQ2 A;  4BE1 A;  1TUD A;  3CC2 T;  5HK3 A;  2L0A A;  2K3B A;  2GTJ A;  2F2W A;  3INZ A;  2EAY A;  4MZT A;  1JRI A;  2D0Q B;  2DO3 A;  2MCN A;  3M5A A;  1D0X A;  3G71 Q;  1N9S A;  2HZY A;  4C92 F;  4C8Q G;  1X6G A;  4AFQ C;  2DMO A;  2QQ9 A;  8AT1 B;  1BIA A;  4GLK A;  5DM7 R;  2RHZ A;  2JTE A;  1ZBX A;  1XTD A;  1ZUY A;  1A0N B;  1BI0 A;  1VQN A;  1B07 A;  2KRO A;  3DLL A;  4BUG A;  1SSH A;  2RPN A;  3RMS A;  4OF1 A;  1F1B B;  2X3X D;  1M1K U;  2X3W D;  2OTL Q;  1SG5 A;  3SDZ A;  2LCC A;  4RKU E;  4C0D C;  2X4J A;  2L8D A;  5HK0 A;  2VAS A;  1IHV A;  4PFP A;  2R5M A;  3MEW A;  2AKK A;  4C8Q D;  1Y07 A;  5LJ3 e;  1YJ9 Q;  1YHQ A;  1N5Z A;  4JRK A;  1VQ5 Q;  4X9C A;  5KYW B;  2HNI A;  4LN2 A;  3CCS A;  1U1S A;  2FZG B;  3GF5 A;  4BY6 B;  2RI2 A;  3LX7 A;  3HHT B;  2HQH A;  3REB B;  2E4H A;  3VS1 A;  3CCV A;  5I2S A;  1LVK A;  1T3L A;  2VC8 A;  2A37 A;  2JVV A;  4C8Q B;  2QQS A;  2YRC A;  1KHC A;  4AMC A;  2Y4Y A;  2PNI A;  4DBQ A;  1PD0 A;  2OJ2 A;  1ZSG A;  3FJP A;  1Q95 G;  2KR3 A;  2LJ3 A;  5A0G A;  1YJN A;  4NOY A;  1ZUK A;  4JJD A;  3DB4 A;  3EG0 A;  4A54 A;  4PLI A;  4PK4 A;  1M27 C;  2BUD A;  2YXY A;  2A36 A;  1Q81 C;  3LH0 A;  4QW2 A;  1UGS B;  2A7Y A;  4ME7 A;  1O9S A;  2O9S A;  2O2O A;  3A8G B;  2COW A;  2K79 A;  2KK4 A;  2X9H A;  4XTZ A;  2DXT A;  2MMP A;  4LDY A;  1JU5 C;  1OZ3 A;  3CBP A;  4BI4 A;  2OTJ Q;  2E5K A;  3MJX A;  1NYF A;  1HSQ A;  5KYX B;  3RDV A;  4M75 C;  3FRN A;  1PSF A;  2HKN A;  2MYS A;  3E9G A;  1YCS B;  2L89 A;  5IHN A;  5J26 A;  3U23 A;  4F17 A;  1VQP Q;  1NJI U;  1Y7X A;  3N5B B;  2E6Z A;  2LJ0 A;  3UPU A;  1UGR B;  4JJN K;  1QCO A;  1OPL A;  2X4Y A;  4LDU A;  1W70 A;  3VV0 A;  1VQK A;  1EFN A;  3DKM A;  2H3J A;  2I2L A;  1KQS P;  4J6W A;  4FT2 A;  5HCK A;  1R8O B;  3NTH A;  3HPW A;  4RTT A;  1VQ9 T;  3G71 A;  3QWX X;  3QYH B;  2QDL A;  3FLG A;  2DBK A;  5GAN 3;  3CCQ Q;  3VRZ A;  3VUB A;  1M2V B;  4HCC A;  3OS2 A;  5CVI A;  1G83 A;  1UHC A;  4OB0 B;  3LW5 E;  1JXO A;  1YIJ Q;  1BI3 A;  2AZV A;  1WX6 A;  4E6R A;  5EC7 A;  5IH2 A;  1ZA1 B;  5FU6 C;  2FPE A;  1X27 A;  1M9S A;  2QXF A;  4HKE A;  1WZO A;  3CCU A;  2WSC E;  2VWF A;  1TUG B;  1QQJ A;  1YCY A;  3PIP A;  3RNJ A;  3BW1 A;  2DYB A;  3CCR A;  1K8A U;  1KQS S;  1RAF B;  6AT1 B;  2RHI A;  3VS4 A;  1VQ6 Q;  3OYG A;  3I55 Q;  1PKT A;  3C4S A;  1PD1 A;  2EYX A;  1JQQ A;  2K6D A;  3MKD A;  4J7F A;  4M7A B;  3CPW S;  4KH1 B;  3VU3 C;  2X4X A;  4HVV A;  1Q81 U;  4A4E A;  3OS5 A;  3CXC S;  2K7A A;  3M4Y A;  1S72 A;  1Y96 A;  5GAO r;  2LVM A;  1BKB A;  1VIE A;  2HMA A;  3CCR T;  3L42 A;  2YLB A;  2ROL A;  4EPC A;  2KRM A;  3OYM A;  4EMH A;  2EQJ A;  3LYI A;  4PJJ A;  4M75 F;  1UGQ B;  2XKO C;  2H3E B;  3I5R A;  2WSF E;  4AT1 B;  2EQM A;  4J5Y A;  2CH4 W;  1B34 B;  5GAN e;  1C0M A;  3G7Z A;  1UEB A;  3KBG A;  1TU0 B;  2E70 A;  1M1F A;  4BD3 A;  4PJO C;  2YT6 A;  2EJG A;  4XU1 A;  2KVQ G;  3GBQ A;  2HDA A;  1YN8 A;  1AZE A;  1JEG A;  2DL3 A;  4M7A F;  3LWI A;  4OGC A;  3OS1 A;  3VS6 A;  1B7T A;  1CKA A;  5LJ5 g;  1M1K C;  1YJ9 T;  1D3B B;  2D8J A;  2DRM A;  4Z02 A;  1Q82 C;  1NEG A;  3G71 T;  4PKC C;  2DL8 A;  4LDX A;  3JCM Q;  3CCM A;  1VQK Q;  2QQA A;  2NUP B;  4CRI A;  3AHU A;  1VQK T;  1FXX A;  2KT1 A;  3EH2 A;  4JRI A;  1X2K A;  1QMC A;  3AT1 B;  4M7A A;  4KGX B;  1QW1 A;  4BAC A;  3MP8 A;  4RCC A;  4XU2 A;  3JCM e;  3QYG B;  2YDL A;  5GMK e;  2CSQ A;  3H0F A;  4M78 A;  5CKD A;  2WAC A;  4JJC A;  2PVO B;  2JTM A;  1YJW Q;  4PJO D;  2EIF A;  4IUQ A;  3JCM f;  2RK1 A;  1I81 A;  5AYF A;  1T0H A;  3PMI A;  4UC4 A;  2PQW A;  4OML A;  4C5I A;  3SWN C;  3BE3 A;  3CME Q;  1QVF A;  1M30 A;  4OMO A;  2JNG A;  1ZSZ C;  3BFM A;  3G6E A;  3WXM B;  3L2W A;  3QDF A;  5LJ5 j;  2NWM A;  2ZGW A;  4NS5 A;  3URG A;  1GBQ A;  2FZK B;  4M7D B;  2DF6 A;  1VYT A;  2RJE A;  1LPL A;  3I56 A;  4KH0 B;  1OZ2 A;  2RI5 A;  1TSF A;  3OYC A;  2CP0 A;  2COY A;  1M90 C;  2JUF A;  1WFW A;  2LCL A;  4JLI A;  1H64 1;  4OMM A;  1X2Q A;  3CCL A;  1U5S A;  4BY6 C;  4BE2 A;  2MAM A;  2LNV A;  2JM8 A;  1W4S A;  3BDU A;  1YIJ T;  1OQK A;  3UT1 A;  3TEE A;  4HXJ A;  1AZG B;  1PNJ A;  5I11 A;  1YNZ A;  3E9F A;  2BE9 B;  2XDD A;  3I55 T;  4M77 G;  1I07 A;  2LQW A;  2EKH A;  2CT4 A;  4XTU A;  4RTU A;  1AT1 B;  4J8O A;  5CK9 A;  4IIO A;  4ZN1 A;  4PJO G;  3VS2 A;  1PKS A;  1NPP A;  4PJO E;  5IHK A;  1XQH A;  5GAO l;  4RG2 A;  1YIT A;  3G4S Q;  3A1P A;  1KD1 U;  1IGQ A;  1GXI E;  1QKX A;  4LE9 A;  4C0Z A;  3F70 A;  5GMK j;  4ELZ C;  1RI9 A;  3H41 A;  2ED1 A;  3WVE B;  4EMK A;  1JJ2 S;  3CCJ Q;  5GAM g;  5GAN 2;  1WI7 A;  4FW1 A;  2JMC A;  4MDX A;  1MNE A;  1WA7 A;  3OBW A;  1YI2 T;  3ME9 A;  4J9D A;  2LDM A;  2HCK A;  2L3Q A;  2DET A;  1WYX A;  2GFA A;  3SB2 A;  3ZL7 C;  1NLP C;  2VB6 A;  2VGN A;  3CCM Q;  1TS9 A;  3JCM V;  3OYK A;  3SWN B;  1VQO T;  2BKD N;  2DYI A;  1XNI A;  3HRS A;  4LUD A;  4N4H A;  3GPL A;  3EH1 A;  1TG0 A;  4DBF A;  3L2Z A;  4QVC A;  2GF7 A;  5GAM d;  3HTR A;  2QYZ A;  3RKY A;  2EGE A;  3UA6 A;  3TRE A;  5GAO n;  2NUT B;  1B34 A;  1M90 U;  2EQK A;  1VQL Q;  2F5T X;  4C92 B;  3VS7 A;  1NE8 A;  4BI3 A;  5LL6 S;  1B3Q A;  1NEB A;  1G2B A;  2QQB A;  5CKF A;  2L5Q A;  2Y90 A;  4OMP A;  3OW2 A;  2LQN A;  2DIG A;  3OYI A;  2RB6 A;  3WVD B;  4A53 A;  2G6F X;  1OX8 A;  3C94 A;  3HFN A;  2RD1 A;  3GP8 A;  1VQ5 T;  3JCM b;  3GLX A;  1K4U S;  3CME T;  3CCE Q;  2QTV A;  4LD6 A;  1AD5 A;  2L3S A;  1UTI A;  2FEI A;  2X51 A;  1U06 A;  3A8L B;  1VQM A;  2YRV A;  3PTA A;  4M75 B;  1VQ8 A;  5GAO q;  2R5A A;  3HP9 A;  1E6H A;  4X1V A;  4LDV A;  2AIR B;  4M77 A;  1ZSZ A;  1TXQ A;  1BYM A;  4JUV A;  3CCL Q;  1MUZ A;  4LXC A;  3I56 T;  4F7U F;  5IXF A;  4C92 A;  3EG9 A;  2ZZD A;  1JBM A;  3OYA A;  1LOJ A;  2ZPH B;  3NTI A;  2K3Y A;  4QVD A;  2E12 A;  3JCM h;  1QVF S;  1PRL C;  5GAN d;  1UFF A;  3JRZ A;  4M77 F;  2E1H A;  4IIM A;  1N9R A;  4J6X A;  2FL7 A;  1BI2 A;  4TVR A;  1S1N A;  5GAN h;  4WF2 A;  4ZGJ B;  2C0T A;  3CCV T;  1K8A C;  4PLL A;  2CSI A;  2C0O A;  1WNL A;  1MMN A;  1M5Q 1;  4F16 A;  1ZX6 A;  4ZGD B;  3CC2 Q;  2K2M A;  1MND A;  4C5E A;  1NLO C;  2BTT A;  1K76 A;  2KAF A;  2ZPB B;  2OAU A;  2YUP A;  4V2S A;  5FU6 B;  3CEY A;  2KMT A;  2COZ A;  3QSU A;  4NL2 A;  2RHY A;  4FSS A;  2SEM A;  3PT9 A;  1QVP A;  4HA8 A;  1WPY A;  2RN8 A;  2RO0 A;  1SPK A;  2HBP A;  5GAM e;  2FB7 A;  1BBZ A;  1MV0 B;  3RBB B;  3OYN A;  3EGD A;  2RJD A;  1IB8 A;  3QO3 A;  4KBM B;  2DNU A;  1OX9 A;  3M53 A;  4DA4 A;  2E41 A;  3KFV A;  4EMK B;  4Q5W A;  3KUF A;  3LH5 A;  2QGG A;  5C6S A;  4FCY A;  1X6O A;  2DZ9 A;  4PJN A;  3C12 A;  3S3N A;  2VUB A;  3A98 A;  2DM1 A;  2MF2 A;  5C0M A;  2GGR A;  2BZY A;  2JW4 A;  1JJ2 P;  1ABQ A;  2M0O A;  1W2B S;  1H3Z A;  4A4H A;  2C0I A;  3QZ5 B;  2XDB A;  1UJ0 A;  3X26 B;  3QHS A;  3RKX A;  2BZX A;  4XU0 A;  4KT0 E;  1W1F A;  1X43 A;  3NMZ C;  3T9N A;  1W6X A;  2JOY A;  1WHH A;  2RQT A;  1K9M U;  2RK2 A;  3MEA A;  2YRD A;  2DA9 A;  3PVL A;  3J81 E;  1AVZ C;  2VVK A;  3LWH A;  4XTV A;  4RG8 A;  5CQX A;  2FZC B;  5J39 A;  3M4G A;  4HCK A;  5GAN 4;  1KQS A;  5FW9 A;  3CCE A;  3E19 A;  2JJ9 A;  2HL5 C;  1X75 C;  3C0C A;  2P0Q A;  4A4K A;  4F7U E;  4CC3 A;  2R58 A;  2DL7 A;  4M77 B;  2W10 A;  1M8M A;  1OYX A;  4BDZ A;  1KHI A;  2P84 A;  2MOX A;  3DB3 A;  2FPF A;  1QLY A;  1BCO A;  2EYY A;  1R0C B;  1SHF A;  2VXE A;  2D8H A;  2RJF A;  1QVG S;  3PMT A;  3EFR A;  4ZNX A;  2LRQ A;  3CCU T;  2YSQ A;  5GAN 7;  5CR2 A;  4OB2 B;  1E7O A;  4JS5 A;  2EGA A;  4M78 E;  4R0K A;  3P8D A;  1VA7 A;  1VQN Q;  2DTI A;  1Y0M A;  5EG2 A;  3ZBD A;  3EGX B;  1WHJ A;  2K3X A;  2KYM A;  3OBY A;  1R77 A;  1T3S A;  4PJL A;  2KDS A;  2ZCF B;  1WDX A;  1N8R U;  1LNX A;  3CC2 A;  3CXC A;  2J6K A;  3G1J A;  1NZ9 A;  4E47 A;  1UUE A;  1RAG B;  1S72 T;  1RI0 A;  1X6B A;  2CZ6 B;  3H0H A;  2VGM A;  4X9D A;  2G3R A;  3HKS A;  5FRM A;  3UAT A;  3V7S A;  4DBR A;  1T0J A;  4C8Q C;  3X28 B;  3CCR Q;  3KXT A;  4FL6 A;  3JB9 J;  3NFC A;  5KH6 A;  4JS4 A;  1FYN A;  4ESR A;  5IAY A;  2M02 A;  4J83 A;  2J6F A;  2ZPI B;  2QK0 A;  4F14 A;  4PFO A;  1QP2 A;  4E2F B;  3OMC A;  3JV3 A;  3UA7 A;  1S72 Q;  1M1G A;  3OMG A;  4MZP A;  4DOV A;  2J05 A;  2SRC A;  2PTK A;  4OB1 B;  2QA4 Q;  5LJ3 g;  1K8A R;  2KRS A;  2FHD A;  2Z0W A;  3R6N A;  3A5Z B;  1G8X A;  1PSE A;  1U3O A;  1QVG A;  3JSC A;  4C5H A;  1SHG A;  5M9O A;  5GMK l;  2DD4 A;  1P92 A;  3L2Q A;  2YWW A;  3VUZ A;  3A8H B;  2EYQ A;  3H8Z A;  1VQP A;  1K9M R;  2JTF A;  2V8I A;  2DFU A;  2L2P A;  5IT9 E;  5LJ3 d;  1AEY A;  1HYO A;  3QDR B;  4M4Z A;  4RCB A;  2YLC A;  2O9V A;  3CCM T;  1ACM B;  4NL3 A;  1C1A A;  4L5G A;  1VYU A;  4ATO A;  1VQN T;  3CD6 T;  2GQI A;  2A08 A;  2RNA A;  2HQX A;  1VQ9 Q;  4B9W A;  2FG0 A;  2KSS A;  4P5N A;  2K2V A;  5I2M A;  3CD6 A;  2VKN A;  1RAI B;  4M78 F;  4E7S A;  2PUK B;  3V8L A;  3CCU Q;  2ZPF B;  1I1J A;  1NG2 A;  3MPU B;  4XTY A;  1ABO A;  3EGU A;  5KYN A;  3MEV A;  1WHG A;  4RTY A;  1W2B A;  2RQW A;  2JXB A;  4M7D G;  3ZEH A;  3RES A;  4M75 G;  2DPP B;  4VUB A;  4ELY C;  2DXB A;  2F2V A;  2EPD A;  1YIJ A;  1GL5 A;  1K73 C;  3RR6 A;  1GCQ A;  1D3B A;  1OV3 A;  4AG2 C;  1VQ4 T;  3O8V A;  4AFZ C;  3L1A A;  3JCM c;  1VQ8 T;  3PIO A;  4J9I A;  2BIV A;  4C8Q E;  3MCA B;  3THK A;  2VV5 A;  5FRN A;  5A0D A;  4JZ3 A;  2YHT A;  1IGU A;  1RL2 A;  4KGV B;  1UE9 A;  3TQ7 P;  3JCM J;  1GRI A;  1PC0 A;  3RUX A;  3NHN A;  4Y28 E;  2HSE B;  5LJ5 d;  1OUL A;  1RLQ C;  3M0R A;  1D09 B;  4M78 B;  1VQ6 T;  2I0N A;  1AWJ A;  4IUR A;  1KD1 R;  4RTW A;  1HD3 A;  1RAH B;  2LP5 A;  1PM3 A;  3OB9 A;  1UB4 A;  1BU1 A;  2KXD A;  4XQ3 A;  2DBM A;  2MIO A;  4X34 A;  1SRL A;  2DIL A;  3ZFJ A;  2RQU A;  3L2U A;  1GCP A;  2FYK A;  2X4W A;  3VYG A;  2V8K A;  4OB3 B;  4XTW A;  2NUT A;  2EQU A;  1PG5 B;  1K1Z A;  3C95 A;  5FU7 C;  2CUB A;  4J9G A;  3ASK A;  1TWB A;  1TUC A;  1VQO A;  1N8R R;  1K0S A;  1OEB A;  4M75 D;  2KT8 A;  5D6W A;  3QKJ A;  4K11 A;  2J06 A;  4M7A G;  3ER0 A;  3CPF A;  3S3M A;  1PCX A;  3FJ5 A;  1HXD A;  3TSW A;  2ESW A;  3OYD A;  1VQ7 A;  1Q86 C;  1KIK A;  2ATC B;  5GMK m;  1D1A A;  4M7D E;  4QQG A;  3OYY A;  3VS3 A;  3ULR B;  3CCJ A;  2GQV A;  1SEM A;  5FWB A;  3SD4 A;  2P0K A;  1JXM A;  3V7R A;  1Y57 A;  4C92 D;  2QQR A;  1ZSZ B;  1MHN A;  1WQW A;  5FU7 B;  4MZM A;  3CMA A;  1ZLM A;  2DAQ A;  3TU4 K;  2KGT A;  3HL8 A;  2AT1 B;  1YJW A;  1TH7 A;  2LT4 A;  2LX7 A;  3EG9 B;  3VYH B;  1NPR A;  2WSE E;  4E7I A;  3QWY A;  4C8Q A;  4M7D C;  2CH4 A;  3QG1 A;  1WLP B;  2JM9 A;  2NYS A;  3CC4 A;  2RF0 A;  1G3S A;  4M77 C;  1VQ9 A;  2F1L A;  2MI6 A;  3HRT A;  1KQ1 A;  1Q7Y U;  3UWN A;  1LJO A;  3G6E Q;  3DLM A;  2K4Y A;  5KYU A;  4N0A A;  1FMK A;  2CKK A;  3REA B;  2QI2 A;  2A28 A;  1RLP C;  5KYW A;  1VYV A;  1OU8 A;  1V29 B;  1KK7 A;  2AK5 A;  3I35 A;  1ZUU A;  3V8K A;  1YFN A;  1BB9 A;  2DTH A;  4C8Q F;  2A3L A;  2EYW A;  2DJQ A;  5J3B A;  5GAM j;  3CCL T;  2E3I A;  4FYY B;  5IHI A;  2CYZ B;  2D0N A;  4Y91 A;  5DY9 A;  1OPK A;  3RMQ A;  3OY9 A;  1AWW A;  1GBR A;  4DQ2 A;  5GAM h;  1VQ4 Q;  4LUE A;  2DE0 X;  2E64 A;  2FPD A;  3J7A F;  4QVZ A;  4QQD A;  4DOW A;  1G3W A;  1YWO A;  3TSZ A;  1WHK A;  3VS0 A;  5KE3 A;  2HEQ A;  1WJQ A;  4MML A;  1I0C A;  4C92 G;  2FRW A;  3JCM g;  2ROT A;  3QBY A;  3SHW A;  3CC7 A;  2HBW A;  2EGC A;  4J9F A;  1M2O A;  1JJ2 A;  1NJI R;  2FRY A;  5GAN 6;  1RAA B;  3MEU A;  1VQ8 Q;  4E7H A;  3X25 B;  4RTV A;  2CT3 A;  4M75 A;  1WJS A;  4M7D A;  3P8B B;  3G6E T;  4KUD K;  4C5G A;  2HAX A;  3O5Z A;  2QAS A;  1MMG A;  3L2R A;  4JZ4 A;  5FRO A;  3JCM P;  4M77 E;  2DL4 A;  5KYY A;  2QEX Q;  2CDT A;  1IRE B;  5GAN 5;  1E6G A;  4EMK C;  3MP1 A;  4AFS C;  3EFS A;  3M54 A;  1YIT Q;  4Z88 A;  8ATC B;  4HCB A;  3G4S A;  4D6W A;  2KYB A;  4BB7 A;  1YHQ Q;  2DLP A;  2V26 A;  3G4S T;  2V1Q A;  2DZC A;  2QG9 B;  4M7D D;  5GAN j;  2J6O A;  3HFO A;  2K9G A;  1OOT A;  1EZZ B;  1VIF A;  2E3H A;  3GIB A;  5GJW B;  1M90 R;  1QWF A;  3CCV Q;  1WQ7 A;  1VOM A;  4XAX B;  1VQP T;  1MGQ A;  1Q7Y R;  1KD1 C;  3CCQ T;  4MDW A;  1WXT A;  2LCS A;  2ZAE A;  1G3T A;  4ZN3 A;  3QJ6 A;  3PFS A;  1YJN Q;  1QP3 A;  1YJ9 A;  1VQM T;  2ECZ A;  3H9N A;  1LCK A;  2QDY B;  2LTO A;  4N4G A;  1YP5 A;  3EG3 A;  4LNP A;  3X24 B;  2DKG A;  4YTL A;  5LJ5 f;  2OX7 A;  1XOV A;  3EHQ A;  4A4F A;  3CBO A;  4FIB A;  4CC4 B;  4AFU C;  4JRQ A;  2ED0 A;  4A63 B;  1J3T A;  2EJ9 A;  1AWO A;  3OW2 P;  3VRY A;  2JS2 A;  1IXD A;  4QQ6 A;  2QA4 T;  1UGP B;  3RIR A;  1KC8 U;  2CZ1 B;  1OU9 A;  4KGZ B;  1QCF A;  5FWC A;  3E2U A;  3M9Q A;  1YJN T;  3D7S B;  2R57 A;  1TTH B;  1YBY A;  2O31 A;  2PZ1 A;  2K57 A;  1KC8 R;  4M77 D;  3NGP A;  2OTJ T;  4Z8A A;  4J7I A;  2RI3 A;  3BY7 A;  5I21 A;  1YJW T;  3E1S A;  4JJB A;  5LJ5 e;  2OTJ A;  1O75 A;  3M58 A;  4FW2 A;  4GY5 A;  2DVJ A;  3LLR A;  3S6W A;  4C0G A;  3FDR A;  1GCQ C;  4LD9 K;  5CQY A;  4F7U B;  4EIK A;  2XI9 A;  3RKW A;  1FX7 A;  1WXB A;  1FWZ A;  2DIQ A;  1VQM Q;  1M3A A;  4JLG A;  4JPB W;  4JDS A;  1X01 A;  3GNG A;  4C92 E;  4M7A C;  3CCQ A;  4FT4 A;  4DEX A;  1Y71 A;  2DRK A;  5LJ3 j;  2RJC A;  5KYU B;  3JB9 G;  4M78 D;  2HKQ B;  3M0Q A;  2ENM A;  4IKF A;  4WTO B;  1PRM C;  3JCM W;  3FB9 A;  1UGV A;  1SSF A;  2EYZ A;  2DX1 A;  2F2X A;  1K73 R;  2FO0 A;  5GJV B;  4PNO A;  5CKB A;  5ECA A;  1C6V X;  2CP2 A;  4M7A D;  1UEC A;  4DBH A;  2J7I A;  1VQ5 A;  2PVD B;  4E7L A;  2O4X B;  2V8J A;  1YIT T;  3A8M B;  3TVT A;  2LQ8 A;  3H6Z A;  2OAW A;  2ZPG B;  3OSV A;  1KC8 C;  2QAZ A;  4QT7 A;  1N8R C;  2QEX T;  2OTL T;  3MP6 A;  1SF9 A;  2RHX A;  2B8A A;  5GMK i;  1M8V A;  4LDW A;  3HRU A;  5DLQ E;  4ZTF A;  2OI3 A;  3OYH A;  2P4T A;  2LZ6 B;  2GCX A;  5IN1 A;  3CPW A;  3EG2 A;  5KYY B;  2KQW A;  1NBE B;  1PHT A;  3JCM d;  4AG1 C;  2F5K A;  1IHW A;  9ATC B;  4IUU A;  1V1C A;  2YUN A;  4F04 B;  3JB9 F;  2DL5 A;  3L2V A;  3FC3 A;  1M4Z A;  1WHL A;  1VQ6 A;  3I55 A;  1H3H A;  1KSW A;  2AKL A;  2VXF A;  1H92 A;  1TOV A;  2LJ1 A;  5KYX A;  4HVW A;  4EMG A;  3OS0 A;  3BDL A;  3FIF A;  3R6O A;  4O6J A;  5GAO p;  1I5O B;  4C0F A;  1RUW A;  4C92 C;  1M3B A;  5GAM f;  1HJD A;  3QZ9 B;  5CKE A;  1K0X A;  2HSP A;  4J9B A;  4D8K A;  2CRE A;  5KCO A;  4OMN A;  2XK0 A;  1UJY A;  3LGL A;  3PVQ A;  2XG8 D;  2M51 A;  2EVR A;  2AZS A;  4OMQ A;  4HCZ A;  1Z9Z A;  1G5V A;  2XIC A;  4ZGE B;  3OW2 S;  4ORZ A;  1Z9Q A;  3CQT A;  5GAN f;  4L6V 5;  4D8D A;  1QWE A;  4F7U A;  5A2Q E;  3V7C A;  3M0T A;  3JCM X;  1KG1 A;  5GAO m;  2DXC A;  1ZA2 B;  2CGH A;  1HK9 A;  4BDY A;  4GBQ A;  4KUI A;  1U1T A;  2Y4X A;  3OYL A;  2PVG B;  4L59 A;  2PUO B;  2NLU A;  2YUQ A;  3M56 A;  3OYE A;  2W0Z A;  2O88 A;  1SRM A;  3NTK A;  2DK3 A;  2IPO B;  1GFC A;  5AT1 B;  2PU9 B;  5IXB A;  3H0I A;  3CPW P;  1EX4 A;  2DXU A;  5HKC A;  4HT9 A;  3EHR A;  3I5S A;  4FYX B;  1N6A A;  2MK5 A;  4FU6 A;  1K9M C;  3M0P A;  2EQI A;  1VQ7 T;  2KY9 A;  2F69 A;  2D9T A;  1QKW A;  2LT1 A;  4ANJ A;  3I56 Q;  2DER A;  2IIM A;  4MMK A;  1IZ6 A;  4M78 C;  1AWX A;  3CME A;  2XMF A;  4CC2 A;  1CSK A;  1Q86 U;  5LJ5 h;  1KFZ A;  2JS0 A;  3JAM E;  4OMF B;  1RAB B;  1K73 U;  3CCE T;  3OSS C;  1M1K R;  5D7U A;  1K9A A;  1FMV A;  1Q86 R;  4IUV A;  2RA2 A;  4KUL A;  2VYT A;  2CZ7 B;  1QVF P;  2IG0 A;  5D6X A;  2QTX A;  2KBT A;  1IO6 A;  4FSX A;  4DEY A;  2KNB B;  2FVU A;  4J9C A;  2JT4 A;  5I22 A;  1I8F A;  2NUP A;  2KXC A;  4IUP A;  2HL3 A;  3M0U A;  4OVA A;  3EAE A;  2XHC A;  5L23 A;  3UDC A;  4M75 E;  3OYB A;  2CP3 A;  2O01 E;  1BIB A;  1PWT A;  1RAD B;  3RER A;  1RAE B;  2K5F A;  3J80 E;  3MET A;  3X20 B;  2QA4 A;  1D1C A;  2HQE A;  2L3P A;  1Q7Y C;  2CS7 A;  5CCA A;  1UG1 A;  4RUG A;  2XD0 A;  1X69 A;  4M7A E;  2CP6 A;  4BE0 A;  1VQO Q;  1M2V A;  4N4I A;  1W2B P;  2IVW A;  5CO7 A;  3HSB A;  3OYJ A;  4M7D F;  1BI1 A;  2RH2 A;  5HY6 A;  4XK8 E;  2P0P A;  3CBM A;  1FMW A;  4II1 A;  3CD6 Q;  4RTX A;  3P8H A;  2LC4 A;  3OA6 A;  1YI2 Q;  5LJ3 f;  1QCN A;  2M1H A;  3QXE B;  3SWN A;  1NJI C;  1H8K A;  3JB9 D;  2RQV A;  3CCJ T;  2DEQ A;  4E7K A;  4RTZ A;  2H8H A;  3JB9 H;  1Y96 B;  1I5L A;  2RHU A;  4E7J A;  2E65 A;  2LNH B;  3OQ5 A;  4PJO B;  2RQR A;  2O4X A;  2E10 A;  1ARK A;  2YUO A;  3CXC P;  2M9U A;  2HD0 A;  5KCH A;  1BK2 A;  2GBQ A;  1WGS A;  2JZ2 A;  1IRX A;  2NUZ A;  4HT8 A;  1WJR A;  2D6F A;  7AT1 B;  1BCM A;  3EFO B;  2QGF B;  2KE9 A;  2KEA A;  4FYW B;  4IUT A;  4C0D B;  4RMO A;  1ZQ1 A;  3S3O A;  5LJ3 h;  1D0Z A;  3EGD B;  2JMA A;  2GFU A;  2LX9 A;  2C06 A;  4B9X A;  3UF4 A;  1WIE A;  1ZHI A;  1M3C A;  2GTO A;  3IQL A;  4KRT A;  1VQL A;  1D0Y A;  3VKI A;  3JB9 I;  2RM4 A;  1MMA A;  1EIF A;  1AHJ B;  3M59 A;  3GOX A;  2EFI A;  4HVU A;  2EBP A;  4PJO A;  1VUB A;  2EW3 A;  1VQ4 A;  2LMJ A;  3CC7 T;  2XID A;  2MWO A;  1XJW B;  2L3R A;  3PE0 A;  1VQL T;  1U8R A;  3EG1 A;  1Q82 R;  1CKB A;  4CI0 C;  2BE7 D;  1JB0 E;  2KI7 A;  2K5I A;  3QPH A;  1QVG P;  4R55 A;  3QUI A;  3M57 A;  2E6N A;  4ZTJ A;  3V8J A;  2DVE A;  4PJO F;  4E7Z A;  1ZBJ A;  2X35 A;  3CCS T;  4QKU A;  1UDL A;  2V1R A;  2P4R A;  4J9H A;  3M55 A;  1VQ7 Q;  2CZ0 B;  2OTL A;  4XTX A;  3MO8 A; 
#chains in the Genus database with same CATH homology
 4JJB A;  2YDL A;  2CSQ A;  3H0F A;  2DVJ A;  4JJC A;  1GCQ C;  1FYN A;  4ESR A;  4EIK A;  1T0H A;  2J6F A;  4OML A;  1WXB A;  3NPF A;  4F14 A;  1MV3 A;  1M30 A;  1M3A A;  4OMO A;  4JPB W;  2KRN A;  1AOJ A;  3SEM A;  3JV3 A;  4DEX A;  2DRK A;  1WXU A;  3UA7 A;  2NWM A;  4Z89 A;  2J05 A;  2SRC A;  2PTK A;  1UHF A;  3M0Q A;  2ENM A;  1GBQ A;  2KRS A;  2DF6 A;  2RMO A;  1PRM C;  3R6N A;  1UGV A;  2B86 A;  1VYT A;  2EYZ A;  1U3O A;  2DX1 A;  2F2X A;  2FO0 A;  5GJV B;  4WCI A;  5ECA A;  1SHG A;  1UEC A;  4CC7 A;  2J7I A;  2D1X A;  1WFW A;  4GLM A;  4OMM A;  1X2Q A;  2GNC A;  1U5S A;  3VS5 A;  3TVT A;  2JM8 A;  2M0Y A;  2OAW A;  3I9Q A;  4QT7 A;  4HXJ A;  1AZG B;  1PNJ A;  5I11 A;  2L2P A;  1YNZ A;  1I07 A;  2LQW A;  2OI3 A;  2EKH A;  2CT4 A;  1AEY A;  4RTU A;  2CUD A;  2LZ6 B;  4M4Z A;  2O9V A;  4IIO A;  1YWP A;  1GFD A;  3VS2 A;  1PKS A;  1NYG A;  1VYU A;  3EG2 A;  4J9E A;  5IHK A;  2GQI A;  2ABL A;  2A08 A;  2RNA A;  1PHT A;  4AG1 C;  2FG0 A;  1KJW A;  1NM7 A;  1JO8 A;  2VKN A;  4Y92 A;  1V1C A;  1QKX A;  4LE9 A;  2BZ8 A;  1I1J A;  1NG2 A;  2YUN A;  1ABO A;  3EGU A;  2DL5 A;  4RTY A;  3M0S A;  2RQW A;  2JXB A;  1TUD A;  1RI9 A;  1H3H A;  3H41 A;  2ED1 A;  1KSW A;  2L0A A;  2K3B A;  2AKL A;  2GTJ A;  2F2W A;  2F2V A;  2LJ1 A;  1H92 A;  2EPD A;  4HVW A;  1GL5 A;  1WI7 A;  2MCN A;  2JMC A;  1GCQ A;  1OV3 A;  4AG2 C;  1WA7 A;  4AFZ C;  4J9D A;  1RUW A;  1M3B A;  4J9I A;  1HJD A;  2HCK A;  2L3Q A;  3THK A;  1K0X A;  2HSP A;  1WYX A;  1X6G A;  4AFQ C;  2DMO A;  3ZL7 C;  4J9B A;  4JZ3 A;  4D8K A;  1NLP C;  2CRE A;  1UE9 A;  1GRI A;  4OMN A;  2JTE A;  4LUD A;  1ZUY A;  3NHN A;  1A0N B;  1UJY A;  3PVQ A;  1B07 A;  1TG0 A;  2KRO A;  1SSH A;  2RPN A;  2M51 A;  2EVR A;  2AZS A;  2X3X D;  4OMQ A;  1Z9Z A;  1RLQ C;  3M0R A;  2X3W D;  2EGE A;  4ORZ A;  2I0N A;  1AWJ A;  1Z9Q A;  3UA6 A;  3CQT A;  4RTW A;  1HD3 A;  4D8D A;  2LP5 A;  1QWE A;  2AKK A;  1BU1 A;  2KXD A;  2DBM A;  2MIO A;  3M0T A;  1SRL A;  2DIL A;  1N5Z A;  2RQU A;  3VS7 A;  1GCP A;  1B3Q A;  4LN2 A;  1NEB A;  1G2B A;  1K1Z A;  4GBQ A;  4OMP A;  3REB B;  3VS1 A;  2LQN A;  2CUB A;  4J9G A;  1T3L A;  1TUC A;  2A37 A;  2G6F X;  1K0S A;  1OEB A;  2YUQ A;  2KT8 A;  2PNI A;  4K11 A;  2OJ2 A;  1K4U S;  1ZSG A;  2KR3 A;  2LJ3 A;  2J06 A;  1AD5 A;  2W0Z A;  1ZUK A;  4JJD A;  2O88 A;  2L3S A;  1UTI A;  2FEI A;  3EG0 A;  1U06 A;  1SRM A;  1M27 C;  1GFC A;  2A36 A;  3FJ5 A;  3TSW A;  2ESW A;  1KIK A;  1E6H A;  4X1V A;  5IXB A;  3H0I A;  2O9S A;  3EHR A;  2O2O A;  1MUZ A;  3VS3 A;  3I5S A;  3ULR B;  2K79 A;  1SEM A;  5FWB A;  5IXF A;  1JU5 C;  3M0P A;  1JXM A;  2EQI A;  1QKW A;  1Y57 A;  2E5K A;  1ZLM A;  2IIM A;  2KGT A;  1NYF A;  1HSQ A;  1AWX A;  1PRL C;  2XMF A;  4CC2 A;  1CSK A;  2LX7 A;  1UFF A;  1KFZ A;  2JS0 A;  4IIM A;  3QWY A;  2CH4 A;  1WLP B;  2JM9 A;  2RF0 A;  1YCS B;  5IHN A;  1S1N A;  3U23 A;  4F17 A;  2C0T A;  2CSI A;  2C0O A;  4F16 A;  1FMK A;  1K9A A;  1ZX6 A;  2K2M A;  3REA B;  1NLO C;  2A28 A;  2BTT A;  1K76 A;  1RLP C;  1VYV A;  2LJ0 A;  2YUP A;  2AK5 A;  3I35 A;  1OPL A;  1ZUU A;  2KBT A;  1W70 A;  1IO6 A;  1EFN A;  2KNB B;  4DEY A;  4J9C A;  1BB9 A;  2JT4 A;  4FSS A;  5I22 A;  5HCK A;  2SEM A;  2KXC A;  2EYW A;  2DJQ A;  3M0U A;  4RTT A;  5IHI A;  5L23 A;  3QWX X;  2D0N A;  2RN8 A;  1SPK A;  2QDL A;  1OPK A;  1AWW A;  1GBR A;  2DBK A;  1BBZ A;  1MV0 B;  4LUE A;  1PWT A;  2DE0 X;  3VRZ A;  2FPD A;  3RBB B;  1YWO A;  3TSZ A;  1G83 A;  3VS0 A;  2DNU A;  2HEQ A;  1UHC A;  2L3P A;  1I0C A;  1JXO A;  2FRW A;  3KFV A;  2ROT A;  3SHW A;  2AZV A;  1UG1 A;  1WX6 A;  4RUG A;  3LH5 A;  4E6R A;  2HBW A;  1X69 A;  5EC7 A;  2EGC A;  5IH2 A;  4J9F A;  2FPE A;  3A98 A;  1X27 A;  2DM1 A;  2FRY A;  2GGR A;  2BZY A;  2JW4 A;  2VWF A;  1ABQ A;  2C0I A;  4RTX A;  3RNJ A;  4RTV A;  2CT3 A;  2DYB A;  1UJ0 A;  3O5Z A;  2BZX A;  1H8K A;  3VS4 A;  2RQV A;  1W1F A;  4JZ4 A;  1X43 A;  3NMZ C;  4RTZ A;  2H8H A;  1W6X A;  2RQT A;  1PKT A;  2DL4 A;  2CDT A;  2EYX A;  1JQQ A;  2DA9 A;  3PVL A;  1AVZ C;  2VVK A;  1E6G A;  2K6D A;  2LNH B;  4AFS C;  2RQR A;  4Z88 A;  1ARK A;  2YUO A;  2KYB A;  4HCK A;  4HVV A;  1BK2 A;  2GBQ A;  2DLP A;  2NUZ A;  2K7A A;  5FW9 A;  2V1Q A;  3C0C A;  2J6O A;  2KE9 A;  2KEA A;  4CC3 A;  2K9G A;  1OOT A;  2DL7 A;  2W10 A;  5GJW B;  1QWF A;  2ROL A;  1M8M A;  2KRM A;  2JMA A;  2MOX A;  2FPF A;  1WXT A;  1QLY A;  2EYY A;  2LCS A;  3UF4 A;  1WIE A;  1SHF A;  1M3C A;  2GTO A;  3I5R A;  2D8H A;  3IQL A;  4KRT A;  2CH4 W;  2ECZ A;  1LCK A;  4ZNX A;  1YP5 A;  3EG3 A;  2YSQ A;  4LNP A;  2YT6 A;  4HVU A;  1E7O A;  2EBP A;  2EGA A;  1XOV A;  3GBQ A;  2EW3 A;  2HDA A;  4R0K A;  1YN8 A;  1AZE A;  1JEG A;  1VA7 A;  2DL3 A;  3EHQ A;  2LMJ A;  4CC4 B;  4AFU C;  1Y0M A;  3VS6 A;  2ED0 A;  2KYM A;  4A63 B;  1J3T A;  1CKA A;  1AWO A;  3VRY A;  3PE0 A;  1T3S A;  2JS2 A;  2D8J A;  3EG1 A;  1WDX A;  1CKB A;  2DRM A;  1NEG A;  2J6K A;  2DL8 A;  1QCF A;  1UUE A;  5FWC A;  1X6B A;  3H0H A;  2KT1 A;  1ZBJ A;  2O31 A;  2PZ1 A;  3UAT A;  1X2K A;  1UDL A;  2V1R A;  2P4R A;  4J9H A;  3NGP A;  1T0J A;  4Z8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...