4LN2A

The second sh3 domain from cap/ponsin in complex with proline rich peptide from vinculin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sorbin and SH3 domain-containing protein 1
publication title Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ln2A00
2DL8A 2DL5A 1ABQA 1BU1A 3A98A 1TUCA 2FO0A 4OMNA 1E7OA 3TVTA 1QWFA 2K2MA 3EG2A 3VS6A 2DBKA 3M0PA 2P4RA 2KRMA 3UATA 2L3QA 2EPDA 2LNHB 2XMFA 3EHRA 3EG3A 1VYVA 1NM7A 1UHFA 3M0QA 2BTTA 1UJ0A 2FRYA 2RQRA 4LE9A 2RF0A 3REAB 4JJBA 1W6XA 4ZNXA 1KFZA 2RQUA 5IHKA 4AG1C 2LJ1A 5IXBA 2GQIA 1K76A 2C0IA 5IXFA 1X6GA 1B3QA 2IIMA 2KEAA 2F2WA 1WXBA 1GBRA 2LJ3A 2C0OA 2DL7A 4RTWA 3M0TA 1AWWA 1X2QA 1H92A 1WXTA 3PVQA 3VS7A 2KT8A 4A63B 2D1XA 2X3XD 2O2OA 3NHNA 1QWEA 2GTOA 4GBQA 3M0UA 4LUDA 1YN8A 1JXOA 1K9AA 1MV0B 2SRCA 1JO8A 2KNBB 4F16A 2O9SA 4LNPA 2FRWA 1OPLA 1VYTA 5I22A 2EGCA 2J6OA 1VYUA 3VS1A 4J9BA 1RUWA 2BZ8A 1EFNA 2JS2A 1X43A 5EC7A 1CKBA 2RN8A 2RPNA 2EGEA 4JJCA 2DNUA 1NLOC 3EGUA 3H0FA 3TSWA 2PZ1A 4X1VA 1AZGB 1BBZA 2RQWA 2A36A 1WLPB 1GL5A 4J9DA 1U06A 1I07A 1UUEA 2ABLA 1JXMA 4RTXA 5FWCA 3QWXX 2ENMA 2JM8A 3TSZA 1XOVA 1X69A 3NMZC 4HVVA 3QWYA 2KE9A 2EYZA 2JM9A 2A08A 2KR3A 1WFWA 4HXJA 2YUNA 1E6HA 2E5KA 2DYBA 4JJDA 1MUZA 1IO6A 1M3CA 4EIKA 1RI9A 3U23A 2V1QA 2YUQA 2CDTA 4D8KA 1GFDA 1TG0A 4RUGA 2FPFA 3H0HA 2HSPA 2DMOA 2DL4A 1M30A 2K7AA 1YWPA 3UF4A 3I5RA 2F2VA 2KXDA 5GJVB 1NLPC 2PNIA 4RTYA 2L3SA 3JV3A 4WCIA 1QKWA 2J6KA 2DLPA 1ZUUA 1AD5A 2FG0A 1WA7A 1FYNA 2EYYA 3I35A 4AG2C 4JZ4A 1Y0MA 2CUDA 1PWTA 1NYFA 1AOJA 2DRKA 1UFFA 4AFQC 3GBQA 1T3SA 5FWBA 3LH5A 1K4US 4AFSC 1A0NB 2SEMA 1ARKA 2GTJA 4J9FA 5L23A 5GJWB 2YT6A 1GCPA 4Z88A 3VRYA 2HDAA 2FPDA 2HBWA 1HSQA 2OAWA 2RQTA 2VVKA 4Z89A 2L3PA 1WXUA 4J9GA 1KSWA 3NPFA 1RLQC 2KRNA 3IQLA 1UE9A 5IH2A 4JZ3A 2CUBA 1ZUYA 2O31A 4CC2A 2ROLA 2EW3A 1ABOA 2LP5A 2JS0A 4OMMA 4J9IA 3ULRB 1AWOA 1FMKA 2LJ0A 4J9CA 4RTVA 2EYWA 2KGTA 2I0NA 3O5ZA 2EYXA 2CH4A 1M3AA 1PKTA 1NEBA 4J9HA 2OJ2A 4D8DA 2DVJA 1MV3A 1SHFA 1YWOA 2GBQA 2KBTA 1AZEA 2D8HA 2LCSA 4R0KA 4CC4B 1W70A 3VS0A 4M4ZA 3SEMA 2W10A 2VWFA 1GBQA 2FPEA 1Y57A 2J6FA 3C0CA 4FSSA 4HCKA 2O88A 2KYMA 1Z9QA 1LCKA 3VS2A 1K0SA 1G83A 1X6BA 1AWXA 1WDXA 2CH4W 2RNAA 2AKLA 2DJQA 4RTTA 1AWJA 2DRMA 3M0RA 1PRLC 1T3LA 2L2PA 1SHGA 3I9QA 3RBBB 2CT4A 1OOTA 1YNZA 3THKA 2JW4A 3UA7A 2GGRA 2EQIA 1UJYA 2KYBA 3M0SA 1X27A 4IIOA 2EVRA 3UA6A 3FJ5A 4OMPA 4E6RA 1ZX6A 4LN2A 2MCNA 2CSQA 1NYGA 5HCKA 1T0JA 1JQQA 1NG2A 2B86A 2KRSA 1PNJA 1Z9ZA 1H3HA 4HVWA 4CC7A 4AFUC 1ZSGA 1WIEA 1M3BA 4RTZA 1SRMA 1J3TA 4KRTA 2MIOA 2VKNA 2RQVA 1S1NA 3KFVA 2NWMA 2YUOA 1UGVA 2K6DA 1ZBJA 4F14A 1YP5A 2JXBA 4HVUA 1SEMA 2KROA 1I1JA 2EKHA 4DEXA 1VA7A 1ZLMA 2JT4A 1SRLA 1KIKA 1V1CA 4QT7A 5FW9A 1I0CA 2KT1A 2M0YA 2DILA 4CC3A 5IHNA 1KJWA 1JEGA 2O9VA 2CREA 3EG1A 2CSIA 1N5ZA 1ZUKA 1SSHA 4GLMA 1RLPC 2C0TA 2JMAA 2A37A 3PE0A 4K11A 2A28A 1UTIA 2ED1A 2W0ZA 1HD3A 1K0XA 1GCQC 2JMCA 4JPBW 1U3OA 3PVLA 1UG1A 2EBPA 3VS3A 5ECAA 2HEQA 2DX1A 2ESWA 3EG0A 2J7IA 1CSKA 1TUDA 1JU5C 2BZXA 2ECZA 3ZL7C 4IIMA 4F17A 2YSQA 2AZSA 3H0IA 2LQWA 3RNJA 3SHWA 1UHCA 1X2KA 2LZ6B 1YCSB 1K1ZA 2D0NA 1HJDA 3CQTA 1BK2A 2GNCA 2ROTA 3VS5A 2YUPA 1PHTA 4J9EA 2KXCA 3VS4A 1CKAA 1NEGA 2AKKA 2DE0X 2JTEA 2CT3A 2LMJA 4Z8AA 2LQNA 4RTUA 1PRMC 1AVZC 2K3BA 3I5SA 4OMOA 2G6FX 2V1RA 1W1FA 1PKSA 1GFCA 2DBMA 2MOXA 2OI3A 2FEIA 1QKXA 1WYXA 2DL3A 2LX7A 1WX6A 1UECA 1M8MA 2K9GA 1GCQA 1OV3A 1T0HA 2NUZA 2AZVA 1QLYA 2AK5A 3EHQA 2D8JA 1WI7A 4OMQA 1B07A 2EGAA 2J05A 3R6NA 2DF6A 1OEBA 4OMLA 2RMOA 1M27C 1BB9A 2YDLA 1AEYA 2QDLA 2BZYA 2H8HA 1H8KA 1OPKA 2F2XA 2PTKA 2ED0A 5I11A 3H41A 1UDLA 2M51A 4ESRA 2X3WD 1G2BA 4ORZA 4DEYA 2DM1A 1U5SA 1SPKA 4AFZC 2K79A 5IHIA 4LUEA 3VRZA 3NGPA 4Y92A 3REBB 2HCKA 1GRIA 2DA9A 2J06A 1QCFA 2L0AA 1E6GA
chains in the Genus database with same CATH superfamily
2LQ8A 3A98A 1TUCA 5AT1B 3G71A 3M4YA 4M77E 4J83A 2X4XA 1TOVA 1E7OA 2QQAA 1YFNA 1IB8A 3FRNA 1OU9A 3NTIA 4M7AG 1MMAA 1NM7A 2M9UA 5GAOr 2BTTA 3MP8A 4FYVB 2OTLT 2RQUA 4BI8B 2LJ1A 1B34B 3RMQA 5GAN5 1NJIC 5IXFA 2KEAA 2QA4A 1QVFA 2PU9B 3M0TA 4L59A 4LDWA 1G3SA 3DLLA 1TH7A 1WXTA 3PVQA 4A63B 1Y7XA 2X3XD 2O2OA 3NHNA 5LJ5f 1M1FA 4IUVA 2A3LA 4M75D 1QVFP 3CMAT 4M7DC 3MKDA 2K5IA 4JJNK 1JXOA 2YHTA 2SRCA 3EG9B 4F16A 3O8VA 1OPLA 3V7RA 4C8QF 2EGCA 1MMNA 1XJWB 3VS1A 4MMKA 5FLXE 2E12A 8AT1B 3JCMJ 8ATCB 2O4XB 2JS2A 4PL6A 5EC7A 1CKBA 2RN8A 3J7AF 2DNUA 3PIOA 3JCMc 3TU4K 1WLPB 4J9DA 4E7HA 1I07A 1JXMA 4RTXA 5HKCA 3DB3A 2ENMA 4M78C 5FRMA 2JM8A 3TSZA 2D9TA 2E6NA 1VQLQ 1M8VA 1X69A 4HT8A 2QDYB 4HVVA 3OMGA 2P4TA 2OTLA 2EYZA 2MF2A 2HMAA 3NTKA 1M2VB 3MEWA 3JCMW 3RKXA 4JJDA 1MUZA 4E7IA 4C8QE 2OTJT 3A8GB 2R57A 2DERA 2OAUA 2QI2A 1HK9A 3M59A 3H0HA 2PQWA 3CMAA 4M75B 3I5RA 1VQ6Q 2F2VA 1NLPC 3BE3A 4D6WA 3MCAB 1QKWA 4RCBA 2FB7A 4QKUA 3V8JA 1R0CB 3C94A 2QEXA 4JLIA 4ME7A 2XI9A 1BIBA 3GBQA 4PFOA 5FWBA 3OA6A 4M7DB 2SEMA 3QZ9B 2AT1B 3LGFA 2O01E 2LCLA 5L23A 1R0BG 5HK0A 4BACA 2F69A 4N0AA 2RHXA 2I2LA 4LDUA 4Z89A 3M5AA 1WXUA 3OSSC 5A0GA 1YITQ 3LLRA 3QHSA 1BIAA 2KRNA 1PG5B 1GXIE 1UE9A 1G3YA 2CP6A 1BCOA 1W2BS 3JB9D 2ROLA 3CCVQ 4PJOF 1VQ4Q 3GP8A 3PMTA 2E4HA 1KHIA 4OMMA 2K2VA 3GNFB 5I2MA 3JCMh 3ULRB 4J9CA 1KQ1A 4RTVA 3S3OA 3OYDA 2KVQG 3O5ZA 3CC4Q 1FWZA 2XKOC 4M78F 1YJ9T 1X6OA 1WNLA 2G3RA 5DLQE 2OJ2A 3CXCS 2M16A 4M7AC 4A54A 3G6EQ 1YWOA 2E3IA 2GBQA 2KBTA 2D8HA 5D6YA 3QPHA 4OB0B 3VS0A 3OS5A 2XICA 3EH2A 1K73U 3RR6A 2E41A 2EKOA 3DB4A 2KYMA 4XTUA 3Q1JA 3CCET 1LCKA 4FW2A 3VS2A 1G83A 2VC8A 1X6BA 2CH4W 4PJOE 1WZOA 1SSFA 1BI1A 4RTTA 1ZBXA 2KI7A 5IN1A 3QUIA 3I9QA 1UGSB 1Q86U 1OOTA 1PSEA 2DIQA 4M78E 4MZMA 1TXQA 2GGRA 2EQKA 3X25B 5EG2A 3M4GA 1X27A 4IIOA 4LD6A 2E1HA 4OMPA 3OYEA 3E9GA 2DJZA 3T9NA 1QVFS 2HNIA 2MPXC 5HCKA 3CCQT 2DYIA 2F5KA 4KGVB 2B86A 3CCRT 4A4EA 1B7TA 1MMDA 1YJ9A 1WIEA 5GAMf 3OYBA 2KSSA 1VQ5Q 1OZ2A 3CBOA 5FU7B 4FM4B 2NWMA 2KAFA 4MDXA 4X9CA 4C0GA 5D6WA 3G4ST 1SEMA 2KROA 2EKHA 4DEXA 3LH0A 1SRLA 3CCEA 3MP1A 2M0YA 3BW1A 2P0QA 2KK4A 2DKGA 5IHNA 2CREA 4BI4A 2QEXQ 1N5ZA 2HL5C 1SSHA 1RLPC 2DD5A 2W0ZA 3QBYA 1HD3A 4M77A 1QP3A 1K0XA 2GQVA 3HSBA 2RJFA 1EZZB 4M7AF 1K73C 4X34A 4ATOA 3VS3A 2DK3A 4B9XA 1G3TA 1SF9A 5ECAA 2WSFE 5GAN6 1OYXA 2F1LA 1CSKA 5CKEA 1Y96A 3S3MA 5CKBA 2DXTA 4R56A 2YSQA 1OX9A 4JUVA 3J81E 4E7JA 3SHWA 3CCRA 1Q86C 2ZAEA 1YCSB 2K4YA 4C0ZA 3FIFA 2D0NA 2PVDB 1BK2A 2GNCA 2L89A 4CI0C 3VS4A 1CKAA 2V26A 3MO8A 1AVZC 1Y07A 2M1HA 4A4GA 4KGXB 2G6FX 2V1RA 4HCZA 5GANf 1W1FA 3UWNA 1PKSA 2MOXA 3QYGB 1XQHA 2CP0A 1WJQA 2LX9A 3G4SA 2CZ0B 4M7AE 1WX6A 3CPFA 5GAN7 2K9GA 1GCQA 2X4JA 1K73R 2AK5A 4QW2A 1R8OB 3P8HA 2D8JA 3HRUA 2JTFA 3MHXA 2FZCB 1HXDA 1JB0E 1XTDA 2RMOA 1BB9A 1M27C 2BZYA 3M57A 2F2XA 3MEAA 4M77C 5I11A 3H41A 1UDLA 2M51A 3GOXA 1VQLT 4PLIA 3VV0A 3RKWA 2Y90A 3S6WA 4ZN3A 4LUEA 3VRZA 4EPCA 3D7SB 4PJMA 3REBB 2L0AA 2EAYA 1UGPB 3HP9A 5DLOA 1D1BA 2DD4A 1UGRB 2R58A 4IUUA 1NPRA 3OQ5A 1R77A 4C8QA 2PVOB 2VB6A 4F7UG 3OYCA 3OS2A 1PC0A 2LNHB 1VQ6T 2RJCA 1WQWA 1OU8A 3EG9A 4FL6A 1UHFA 4XK8E 2CKKA 1UJ0A 2K3YA 1F1BB 1VQ9A 2RF0A 3REAB 1M1GA 2QYZA 1D0YA 1ACMB 4ZNXA 2Z0WA 2JN0A 1X6GA 1B3QA 2F2WA 3OS0A 2O4XA 1GBRA 2RO0A 1OULA 2DL7A 2YLCA 3L2ZA 4RTWA 2ZPFB 5L8RE 5GMKi 2EQMA 4XTXA 2LDMA 2KT8A 2X4YA 2RHZA 2CP2A 3FDRA 5CAIA 1VQ7A 1PM3A 4LUDA 1YN8A 1YITT 1K9AA 4IUPA 4LDXA 1O9SA 2P0KA 3JCMV 5IT9E 2FRWA 1VYTA 4PNOA 5I22A 3HRSA 2E65A 1VYUA 3JAME 2FVUA 1D1CA 3CCVT 1RUWA 3ZEHA 1VQ4T 3GLXA 4XU2A 4M77B 1RAIB 4NS5A 4ZGEB 3JB9I 2EGEA 3H0FA 3EGUA 1W2BA 1UGQB 2X51A 4C0DB 4FCYA 1SKUB 2QTXA 2RQWA 1YHQQ 3CC4T 4KULA 4XTWA 3JB9J 1VQ6A 5FWCA 4N4GA 2JTMA 5LJ3e 1Y96B 4BDZA 4QQGA 5M9OA 3QWYA 1W2BP 2RHYA 2KE9A 3A8LB 3G6ET 2JM9A 2A08A 4C8QD 2KR3A 1WFWA 3CXCA 3HL8A 2FZGB 3PIPA 2LRQA 1M3CA 4KGZB 1RI9A 3U23A 2XG8D 2VGNA 1M5Q1 2YUQA 3CPWA 2DFUA 3JB9G 2JUFA 2FPFA 2HSPA 3QZ5B 2DMOA 2DL4A 5GMKl 1M90C 1YITA 1KK7A 3PFSA 2PNIA 2L3SA 1BKBA 1I81A 4WCIA 1S72Q 3L1AA 4LXCA 1M2OA 5GAOp 3CPWP 1Y0MA 2VV5A 2ZPGB 5HY6A 3CCVA 1VQ4A 4M78A 2VXEA 1BI3A 1VQMA 2RI5A 1RAGB 4Z88A 3TEEA 2DZCA 2P0PA 1RAAB 3CC4A 2OAWA 2VVKA 5I2SA 4FYYB 3OYYA 1VUBA 1KSWA 4XQ3A 3NPFA 1VQ5T 2XDBA 3G6EA 1LVKA 4JZ3A 3OY9A 4PKCC 4JS4A 4C8QB 1M90R 1TU0B 4E7KA 4CC2A 2HZYA 4JDSA 1C1AA 4DBQA 3CCLA 2LP5A 1NBEB 1FMWA 5DM7R 4BE2A 2K5LA 5LJ5e 3MJXA 2LJ0A 3OBWA 1VQ9Q 2QEXT 5FROA 5KYUA 2EYXA 4OB3B 4M7DD 3JCMg 4PJOC 2Y4XA 1JBMA 1SHFA 5C0MA 2HSEB 1W70A 3X24B 3OYLA 1VQ7Q 1ZQ1A 3SEMA 4P5NA 4FW1A 1Y57A 2J6FA 4OGEA 5KYNA 3X26B 1Z9QA 4VUBA 4L6V5 2B8AA 1YIJQ 4Z02A 3G7ZA 4KBMB 5D7UA 1OZ3A 2AKLA 4NOYA 3FB9A 3OW2S 1T3LA 2DZ9A 3ME9A 4M78D 3OYMA 1VQ5A 3GNGA 2CT4A 1X75C 1YNZA 3THKA 2JW4A 3UA7A 1W4SA 2K3XA 4EMGA 2EFIA 3M0SA 4ZTJA 3V8KA 2XDPA 3UA6A 4C92G 3FJ5A 3LWHA 2KY9A 4QQDA 1ZX6A 4LN2A 4E6RA 1QVGP 1NYGA 4M7AA 1T0JA 3OYKA 1DJ7B 1H3HA 4HVWA 4E7SA 1ZSGA 1M3BA 2JVVA 1J3TA 3VYHB 3OB9A 3CC7A 1MNDA 1N8RU 2RQVA 3KFVA 1D0XA 3OYJA 3HTRA 3QKJA 3CC2A 2QXFA 3F70A 1TTHB 1YP5A 5A0DA 1WHLA 1YCYA 3CBMA 1KIKA 2R5MA 5LJ3g 5FW9A 4PJOB 6AT1B 2HBPA 4GY5A 2CSIA 2EIFA 5IAYA 4GLMA 3JCMd 2JMAA 2A37A 3DLMA 4F7UF 4J7FA 4EMKC 1WHHA 2JMCA 5FRNA 4JPBW 4M78B 1U3OA 3AHUA 1UG1A 2VUBA 1VQMQ 3WXMB 1ZSZC 3MEUA 1U1TA 4WF2A 5CKFA 2ESWA 2J7IA 2YRCA 1TUDA 3I55Q 2ZPHB 2QAZA 3C12A 5HK3A 1MGQA 3H0IA 2HD0A 2PUKB 4XTZA 2IVWA 1X2KA 2LZ6B 3VYGA 1QW1A 4YTLA 2M0OA 3V7CA 1HJDA 3CQTA 3OS1A 2DTHA 4KUIA 2CP3A 1PHTA 2WACA 5GMKe 3CPWS 4J9EA 4QVDA 2KXCA 3P8BB 1NEGA 1MNEA 2DE0X 3QJYA 2JTEA 4BI3A 1QQJA 2AHJB 4Z8AA 3CCLQ 2RHIA 4RTUA 1KD1U 1D09B 3EGDA 4J6YA 4M7AD 4F7UE 1I8FA 2E70A 2ZCFB 3BDUA 2OI3A 2FEIA 1WYXA 2LX7A 2RHUA 5KYUB 1OV3A 2AZVA 3QDFA 3M54A 3EHQA 2AIRB 1YJNA 2PVGB 1WI7A 3SWNC 1B07A 3I56Q 2BKDN 2EGAA 1VQ8Q 3VUBA 2DIGA 1OEBA 1AEYA 1YHQT 5CCAA 1N8RC 3MPUB 2H8HA 4QVCA 4J8OA 5KH6A 1WQ7A 2X3WD 4XTVA 1TSFA 4ORZA 5LJ5g 2DM1A 2K79A 3A8MB 2RJDA 2ZGWA 5LJ3d 2ZZDA 5DY9A 2HAXA 2DA9A 2J06A 5KCHA 4X9DA 1P92A 3OYGA 2DL5A 1D0ZA 1ABQA 2C06A 5AYFA 2FO0A 5LJ3h 2HL3A 5GAMe 1LOJA 3CCJQ 1I4K1 3TVTA 1V29B 2MWPA 2DBKA 3M0PA 4ZTFA 2JOYA 2RM4A 3ER0A 2HKQB 2BUDA 2L3QA 2RA2A 3META 5CR2A 2MMPA 3M0QA 1S72T 1FMVA 4FYWB 2FRYA 4LE9A 4M7AB 1W6XA 1JJ2A 2DXBA 1WGSA 1KFZA 1N8RR 2GQIA 2C0IA 1KQ2A 1D3BA 1WXBA 2C0OA 1RACB 1AWWA 4BD3A 1KQSS 3QG1A 1KC8U 4C92C 1KD1C 3SDZA 1YHQA 1JJ2P 3CC7Q 2H3EB 2LNVA 2D1XA 4KUDK 3CC2Q 1QWEA 4ELYC 1RAFB 4GBQA 3M0UA 4MZPA 2KNBB 1BI0A 4GLKA 1VQOQ 1QVGS 1OQKA 1UB4A 2J6OA 4RG8A 2LTOA 1PD1A 2QGFB 5CIUA 1EFNA 2PUOB 2EQUA 5D6XA 3CEYA 2RPNA 5C6SA 1NLOC 4OGCA 1AHJB 1N27A 1VQ9T 1BCMA 4A4KA 4DA4A 2YRVA 1Q95G 2LT4A 1GL5A 3A8HB 1U06A 4C5EA 2ABLA 1VQNA 5GANe 5LJ5d 4AT1B 1QVPA 2A0FB 1S72A 2VYTA 1KD1R 1FX7A 1M1KU 4OMFB 3CD6Q 2QTVA 5LJ5h 4C0FA 5J3BA 4PFZA 2JNGA 3OBYA 1VQ7T 2E5KA 4N4IA 4C5IA 1M9SA 3S3NA 3JCMQ 4O5VA 1YIJT 2D0QB 3EGDB 4BUGA 2IG0A 2CDTA 4M75G 2LT1A 1GFDA 3BDLA 3OMCA 2MWOA 2QQSA 2DETA 2DXCA 3OYIA 1WHMA 3QSUA 1M30A 2K7AA 1YWPA 4M77D 4MZTA 4HKEA 5GJVB 2RJEA 4C5GA 4C5HA 4R55A 1OX8A 3JV3A 3JCMb 1YJNQ 2YLBA 2RK1A 4J6WA 4JZ4A 1KC8C 3OW2A 2CUDA 1PWTA 1NYFA 4M7DG 1AOJA 3JSCA 1UFFA 2RI2A 1RABB 1T3SA 3LH5A 4JS5A 4AFSC 1A0NB 1ARKA 2Y4YA 3EH1A 4C92F 1RAHB 5KCOA 2GTJA 3OYHA 5GJWB 2YT6A 2QQ9A 3VRYA 5FU6C 2LCCA 3OW2P 1IGQA 2HDAA 1M90U 1N9RA 2CGHA 2CZ1B 4J7IA 1KG1A 2GF7A 3HFNA 2L3PA 3PNWC 4J9GA 2ZPEB 3MEVA 3L2RA 2XD0A 3IQLA 4KT0E 5IH2A 3URGA 4DBRA 1Q82U 4QQ6A 5GAN3 2EW3A 1ABOA 2XDDA 2JS0A 2HQXA 3A8OB 1YIJA 1AWOA 1KC8R 1VOMA 2ZPIB 1M1KC 2EYWA 4C92E 2I0NA 3C4SA 1M3AA 3LYIA 1EIFA 4FIBA 4ANJA 1D3BB 2D6FA 1NEBA 4J9HA 2KMTA 2V8KA 1VQMT 4D8DA 4MDWA 2DVJA 2JZ2A 1AZEA 1OI1A 5GAMg 4R0KA 7AT1B 3FEOA 3I55T 4A4FA 3EGXA 2W10A 5KYYB 2XHCA 2RH2A 1GBQA 1G8XA 3PT9A 2QGGA 4CRIA 2E10A 1IHVA 4MMLA 1NE8A 3CCMQ 2DPPB 1WDXA 2RNAA 4HT9A 5GAOn 1TS9A 3EFOA 2QG9B 5GAOl 2GCXA 3CCLT 4NL3A 4FYXB 4IUTA 2E6ZA 3OYNA 2VASA 3R6OA 1YI2Q 3X20B 2MI6A 3L2WA 1M1KR 2EQIA 1UJYA 1WHGA 5CQYA 2M02A 3MP6A 4N4HA 1JJ2S 2KQWA 4A53A 1VQNQ 4F7UA 4E2FB 4PJOA 2MCNA 5GMKh 2CSQA 1VIFA 2CP7A 2BE7D 2VXFA 1JQQA 3I56T 1VQ8T 2COZA 4OP0A 2KRSA 1Z9ZA 4BDYA 1PD0A 2R5AA 2BE9B 4RTZA 2EQJA 1Q82C 1FXXA 1JRIA 1SRMA 4KRTA 2MIOA 2L3RA 3HRTA 3ZFJA 2VKNA 1UEBA 3I55A 4IKFA 1UGVA 1C0MA 1ZBJA 2JXBA 3CMEA 4E7ZA 1IZ6A 1VA7A 2JT4A 1V1CA 4QT7A 5GANg 1KHCA 3DKMA 3RKYA 1I0CA 3SFMA 2DILA 4CC3A 2CYZB 3BY7A 3HPWA 3CCJT 4RG2A 4K11A 2A28A 1UTIA 2ED1A 4M75C 2CS7A 2F5TX 2NLUA 5GAMd 1TWBA 1C6VX 3CBPA 2BIVA 2HEQA 2VGMA 3EG0A 3N5BB 4L5GA 1IGUA 4AMCA 5GAMh 4FT4A 1Q82R 1WHKA 2BZXA 2ECZA 3ZL7C 1PSFA 4F17A 2HQHA 4UC4A 3CCSA 2AZSA 2LQWA 1ZA2B 3RNJA 1AT1B 2HQEA 1VQPA 3I56A 1VQ8A 1UHCA 3A1PA 3VUZA 3GIBA 4IURA 3CC7T 1VQKQ 1IHWA 3VJPA 2YWWA 3VS5A 3CC2T 4XU3A 1KQSA 2CT3A 1LPLA 4PJOD 3NFCA 1PRMC 2K3BA 3RIRA 3E19A 4OMOA 3H6ZA 1VQOT 2NUTA 2RB6A 3OYAA 2DBMA 1NJIR 3J80E 3UPUA 1QKXA 2DXUA 4PLLA 2FZKB 3L2VA 3KXTA 1M8MA 4EMKA 1WJRA 1KQSP 1QLYA 1QVGA 3WVDB 1ZSZA 4LD9K 3CCJA 4II1A 3E9FA 3R6NA 5CVIA 4ELZC 2DF6A 2QDLA 5GAN4 1MMGA 2DEUA 3BFMA 2ED0A 3EGXB 2IPOB 4ESRA 3CCUQ 4PJNA 1M4ZA 1G2BA 4DEYA 2E5QA 3A5ZB 3CD6T 4AFZC 1U5SA 1SPKA 5LJ3j 2QK0A 2CP5A 2V8IA 3SD4A 3NGPA 1YJWQ 5GANd 2HCKA 2DAQA 1QCFA 3JB9H 3EFOB 2FYKA 2DL8A 2DTOA 1D1AA 1BU1A 2FHDA 5GANh 2LVMA 4OMNA 4RKUE 2RI3A 1QWFA 2K2MA 3EG2A 4M75F 1RL2A 3VS6A 1X01A 2P4RA 3NTHA 2EJFA 2KRMA 3UATA 5J39A 2EPDA 2XMFA 3M9QA 3EHRA 3TCJA 5CQXA 4F7UB 3EG3A 1VYVA 2L8DA 3E2UA 5KYWA 1VQOA 3SWNA 3FC3A 1YJNT 2RQRA 4XU1A 1H3ZA 4JJBA 5IHKA 4AG1C 3G1JA 5IXBA 2QASA 1K76A 2X9HA 4M7DF 2IIMA 3L42A 2EJGA 5GAOm 2LJ3A 4LDVA 1NPPA 3UDCA 4KH0B 5CKDA 1WHJA 1X2QA 3G71Q 1H92A 2CZ6B 3VS7A 1LJOA 2MYSA 2GTOA 5GMKm 4ZGJB 3CMEQ 2OTJA 1MV0B 1JO8A 4M75E 3CD6A 2LQKA 4QVZA 3TREA 1I5OB 2O9SA 4LNPA 5FU7C 2CZ7B 4JRPA 4M77G 1Q81U 3GPLA 4J9BA 2QA4Q 2BZ8A 5A0LA 3RDVA 2COYA 1X43A 4M7DE 4JJCA 1G3WA 5LL6S 3TSWA 2PZ1A 4X1VA 1AZGB 1BBZA 3H9NA 2A36A 2KDSA 5LJ5j 3M58A 3QYHB 1UUEA 3WVEB 1QMCA 4OB1B 3KBGA 3JCMP 3QWXX 3RESA 2RK2A 1XOVA 2E64A 4RCCA 3CCSQ 2XU8A 4C92A 3NMZC 2WSCE 1Q7YU 1VQPQ 3HKSA 5A2QE 4N0AC 1K8AU 3HFOA 4HXJA 3OSVA 2YUNA 1E6HA 2DYBA 4PK4A 1ZA1B 2NUPA 4J5YA 1IO6A 4EIKA 4Q5WA 3CCMT 5CKHA 2V1QA 2ZPBB 2NUTB 4D8KA 4BB7A 1TG0A 4RUGA 1RI0A 3TQ7P 2GFUA 5GAN8 3UF4A 4JLGA 4RMOA 2KXDA 3RUXA 4RTYA 4EMKB 3LW5E 5KYXA 2J6KA 1YI2T 2DLPA 1ZUUA 3H8ZA 1AD5A 1ZSZB 1WA7A 1FYNA 2EYYA 2FG0A 3I35A 4AG2C 2OTLQ 3JB9F 2DRKA 3KUFA 4AFQC 4WTOB 5KE3A 4E47A 4BY6C 1VQNT 1K4US 4HCCA 3FLGA 4J9FA 1PCXA 1GCPA 3L2UA 2MAMA 4JRIA 2P84A 2FPDA 2HBWA 1HSQA 3RERA 1VIEA 2RQTA 3QIIA 3CMAQ 4BE1A 4J6XA 3PMIA 1Q81C 1RLQC 1N9SA 2X35A 4C8QG 2ATCB 2DO3A 2CUBA 2K5FA 5KYYA 1ZUYA 2RD1A 2O31A 3OYFA 5GAOq 1U8RA 1QP2A 1YBYA 2HKNA 1K9MU 3CCMA 4J9IA 4C92D 5KYWB 1FMKA 2DTIA 4B9WA 4NL2A 3SWNB 1Q7YC 1MHNA 2KGTA 1ZHIA 3UT1A 3PTAA 2V8JA 4FSXA 2CH4A 4ZGDB 5KE2A 2K57A 1K8AC 1PKTA 1WJSA 1YI2A 3CCQA 2WSEE 3EFSA 1MV3A 4XAXB 4IUQA 1RADB 2A7YA 2LCSA 4CC4B 4KH1B 4OB2B 3EFRA 4M4ZA 2COWA 1U1SA 1Q81R 2VWFA 2FPEA 4JRQA 3M55A 3JCMX 4Y28E 2QQBA 3C0CA 2OTJQ 4FSSA 4HCKA 2O88A 2YRDA 4Y91A 2NYSA 1K0SA 5I21A 1AWXA 1VQKT 4TVRA 2XIDA 4F04B 1IREB 1G5VA 2DJQA 1AWJA 3V7SA 2DRMA 3M0RA 1PRLC 2L2PA 1SHGA 3EAEA 4BY6B 2EWNA 3RBBB 4DBHA 4PFPA 1N6AA 4V2SA 5GMKj 4B6MA 1Q7YR 4PJLA 2KYBA 1K8AR 4XU0A 2QQRA 2EVRA 1IXDA 2E3HA 1Q86R 3JCMf 2H3JA 3M56A 4LDYA 1NG2A 4C92B 4C0DC 1PNJA 1B34A 4CC7A 4AFUC 3L2QA 3RMSA 3JCMe 3E1SA 2NUPB 3CCUT 1K9MC 3PGGA 3HHTB 4DQ2A 1S1NA 2YUOA 3QXEB 2K6DA 1YJWT 4F14A 4PJOG 4HVUA 4EDUA 1I1JA 3QO3A 1ZLMA 4E7LA 5CO7A 2KT1A 5KYXB 1VQKA 1KJWA 1JEGA 2O9VA 3P8DA 3EG1A 4EMHA 1ZUKA 2C0TA 4M78G 3PE0A 3VKIA 1YJ9Q 5GAMj 1TUGB 1GCQC 4OVAA 1QCOA 3PVLA 3FJPA 1O75A 2EBPA 1QCNA 1SG5A 1LNXA 2DX1A 2EJ9A 4DBFA 1WPYA 3LWIA 3ZBDA 1JU5C 2L5QA 4FT2A 3JRZA 4HCBA 1HYOA 4IIMA 1VQLA 4OF1A 1K9MR 3M53A 2OX7A 3CCEQ 2X4WA 3G71T 1EX4A 9ATCB 1IRXA 1K1ZA 1M2VA 1NJIU 3QDRB 3LGLA 3AT1B 2ROTA 2MK5A 2YUPA 1H641 5GAN2 3GF5A 2DEQA 4DOVA 3CMET 2AKKA 5J26A 3CCUA 2LMJA 1XNIA 2LQNA 3I5SA 2FL7A 5LJ3f 3SB2A 1GFCA 1YJWA 4PJJA 4A4HA 4DOWA 4C8QC 2JJ9A 2DL3A 1NZ9A 4M75A 4M77F 1UECA 1Y71A 3V8LA 1T0HA 2NUZA 2QA4T 2YXYA 4HA8A 4O6JA 4XTYA 3CCQQ 4OMQA 3ASKA 5CK9A 2J05A 5FU6B 3CCRQ 3VU3C 4BE0A 3X28B 2XK0A 4OMLA 2YDLA 2LC4A 2EYQA 1BYMA 1BI2A 1H8KA 3C95A 1OPKA 4M7DA 2PTKA 4FU6A 3CCST 3INZA 3QJ6A 4JRKA 1VQPT 5GANj 5IHIA 1V76A 3LX7A 4Y92A 2GFAA 2DVEA 1RAEB 1GRIA 3G4SQ 3CXCP 1I5LA 1E6GA 4ZN1A
chains in the Genus database with same CATH topology
2DL8A 2DL5A 1ABQA 1BU1A 3A98A 1TUCA 2FO0A 4OMNA 1E7OA 3TVTA 1QWFA 2K2MA 3EG2A 3VS6A 2DBKA 3M0PA 2P4RA 2KRMA 3UATA 2L3QA 2EPDA 2LNHB 2XMFA 3EHRA 3EG3A 1VYVA 1NM7A 1UHFA 3M0QA 2BTTA 1UJ0A 2FRYA 2RQRA 4LE9A 2RF0A 3REAB 4JJBA 1W6XA 4ZNXA 1KFZA 2RQUA 5IHKA 4AG1C 2LJ1A 5IXBA 2GQIA 1K76A 2C0IA 5IXFA 1X6GA 1B3QA 2IIMA 2KEAA 2F2WA 1WXBA 1GBRA 2LJ3A 2C0OA 2DL7A 4RTWA 3M0TA 1AWWA 1X2QA 1H92A 1WXTA 3PVQA 3VS7A 2KT8A 4A63B 2D1XA 2X3XD 2O2OA 3NHNA 1QWEA 2GTOA 4GBQA 3M0UA 4LUDA 1YN8A 1JXOA 1K9AA 1MV0B 2SRCA 1JO8A 2KNBB 4F16A 2O9SA 4LNPA 2FRWA 1OPLA 1VYTA 5I22A 2EGCA 2J6OA 1VYUA 3VS1A 4J9BA 1RUWA 2BZ8A 1EFNA 2JS2A 1X43A 5EC7A 1CKBA 2RN8A 2RPNA 2EGEA 4JJCA 2DNUA 1NLOC 3EGUA 3H0FA 3TSWA 2PZ1A 4X1VA 1AZGB 1BBZA 2RQWA 2A36A 1WLPB 1GL5A 4J9DA 1U06A 1I07A 1UUEA 2ABLA 1JXMA 4RTXA 5FWCA 3QWXX 2ENMA 2JM8A 3TSZA 1XOVA 1X69A 3NMZC 4HVVA 3QWYA 2KE9A 2EYZA 2JM9A 2A08A 2KR3A 1WFWA 4HXJA 2YUNA 1E6HA 2E5KA 2DYBA 4JJDA 1MUZA 1IO6A 1M3CA 4EIKA 1RI9A 3U23A 2V1QA 2YUQA 2CDTA 4D8KA 1GFDA 1TG0A 4RUGA 2FPFA 3H0HA 2HSPA 2DMOA 2DL4A 1M30A 2K7AA 1YWPA 3UF4A 3I5RA 2F2VA 2KXDA 5GJVB 1NLPC 2PNIA 4RTYA 2L3SA 3JV3A 4WCIA 1QKWA 2J6KA 2DLPA 1ZUUA 1AD5A 2FG0A 1WA7A 1FYNA 2EYYA 3I35A 4AG2C 4JZ4A 1Y0MA 2CUDA 1PWTA 1NYFA 1AOJA 2DRKA 1UFFA 4AFQC 3GBQA 1T3SA 5FWBA 3LH5A 1K4US 4AFSC 1A0NB 2SEMA 1ARKA 2GTJA 4J9FA 5L23A 5GJWB 2YT6A 1GCPA 4Z88A 3VRYA 2HDAA 2FPDA 2HBWA 1HSQA 2OAWA 2RQTA 2VVKA 4Z89A 2L3PA 1WXUA 4J9GA 1KSWA 3NPFA 1RLQC 2KRNA 3IQLA 1UE9A 5IH2A 4JZ3A 2CUBA 1ZUYA 2O31A 4CC2A 2ROLA 2EW3A 1ABOA 2LP5A 2JS0A 4OMMA 4J9IA 3ULRB 1AWOA 1FMKA 2LJ0A 4J9CA 4RTVA 2EYWA 2KGTA 2I0NA 3O5ZA 2EYXA 2CH4A 1M3AA 1PKTA 1NEBA 4J9HA 2OJ2A 4D8DA 2DVJA 1MV3A 1SHFA 1YWOA 2GBQA 2KBTA 1AZEA 2D8HA 2LCSA 4R0KA 4CC4B 1W70A 3VS0A 4M4ZA 3SEMA 2W10A 2VWFA 1GBQA 2FPEA 1Y57A 2J6FA 3C0CA 4FSSA 4HCKA 2O88A 2KYMA 1Z9QA 1LCKA 3VS2A 1K0SA 1G83A 1X6BA 1AWXA 1WDXA 2CH4W 2RNAA 2AKLA 2DJQA 4RTTA 1AWJA 2DRMA 3M0RA 1PRLC 1T3LA 2L2PA 1SHGA 3I9QA 3RBBB 2CT4A 1OOTA 1YNZA 3THKA 2JW4A 3UA7A 2GGRA 2EQIA 1UJYA 2KYBA 3M0SA 1X27A 4IIOA 2EVRA 3UA6A 3FJ5A 4OMPA 4E6RA 1ZX6A 4LN2A 2MCNA 2CSQA 1NYGA 5HCKA 1T0JA 1JQQA 1NG2A 2B86A 2KRSA 1PNJA 1Z9ZA 1H3HA 4HVWA 4CC7A 4AFUC 1ZSGA 1WIEA 1M3BA 4RTZA 1SRMA 1J3TA 4KRTA 2MIOA 2VKNA 2RQVA 1S1NA 3KFVA 2NWMA 2YUOA 1UGVA 2K6DA 1ZBJA 4F14A 1YP5A 2JXBA 4HVUA 1SEMA 2KROA 1I1JA 2EKHA 4DEXA 1VA7A 1ZLMA 2JT4A 1SRLA 1KIKA 1V1CA 4QT7A 5FW9A 1I0CA 2KT1A 2M0YA 2DILA 4CC3A 5IHNA 1KJWA 1JEGA 2O9VA 2CREA 3EG1A 2CSIA 1N5ZA 1ZUKA 1SSHA 4GLMA 1RLPC 2C0TA 2JMAA 2A37A 3PE0A 4K11A 2A28A 1UTIA 2ED1A 2W0ZA 1HD3A 1K0XA 1GCQC 2JMCA 4JPBW 1U3OA 3PVLA 1UG1A 2EBPA 3VS3A 5ECAA 2HEQA 2DX1A 2ESWA 3EG0A 2J7IA 1CSKA 1TUDA 1JU5C 2BZXA 2ECZA 3ZL7C 4IIMA 4F17A 2YSQA 2AZSA 3H0IA 2LQWA 3RNJA 3SHWA 1UHCA 1X2KA 2LZ6B 1YCSB 1K1ZA 2D0NA 1HJDA 3CQTA 1BK2A 2GNCA 2ROTA 3VS5A 2YUPA 1PHTA 4J9EA 2KXCA 3VS4A 1CKAA 1NEGA 2AKKA 2DE0X 2JTEA 2CT3A 2LMJA 4Z8AA 2LQNA 4RTUA 1PRMC 1AVZC 2K3BA 3I5SA 4OMOA 2G6FX 2V1RA 1W1FA 1PKSA 1GFCA 2DBMA 2MOXA 2OI3A 2FEIA 1QKXA 1WYXA 2DL3A 2LX7A 1WX6A 1UECA 1M8MA 2K9GA 1GCQA 1OV3A 1T0HA 2NUZA 2AZVA 1QLYA 2AK5A 3EHQA 2D8JA 1WI7A 4OMQA 1B07A 2EGAA 2J05A 3R6NA 2DF6A 1OEBA 4OMLA 2RMOA 1M27C 1BB9A 2YDLA 1AEYA 2QDLA 2BZYA 2H8HA 1H8KA 1OPKA 2F2XA 2PTKA 2ED0A 5I11A 3H41A 1UDLA 2M51A 4ESRA 2X3WD 1G2BA 4ORZA 4DEYA 2DM1A 1U5SA 1SPKA 4AFZC 2K79A 5IHIA 4LUEA 3VRZA 3NGPA 4Y92A 3REBB 2HCKA 1GRIA 2DA9A 2J06A 1QCFA 2L0AA 1E6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL8 A;  2DL5 A;  1ABQ A;  1BU1 A;  3A98 A;  1TUC A;  2FO0 A;  4OMN A;  1E7O A;  3TVT A;  1QWF A;  2K2M A;  3EG2 A;  3VS6 A;  2DBK A;  3M0P A;  2P4R A;  2KRM A;  3UAT A;  2L3Q A;  2EPD A;  2LNH B;  2XMF A;  3EHR A;  3EG3 A;  1VYV A;  1NM7 A;  1UHF A;  3M0Q A;  2BTT A;  1UJ0 A;  2FRY A;  2RQR A;  4LE9 A;  2RF0 A;  3REA B;  4JJB A;  1W6X A;  4ZNX A;  1KFZ A;  2RQU A;  5IHK A;  4AG1 C;  2LJ1 A;  5IXB A;  2GQI A;  1K76 A;  2C0I A;  5IXF A;  1X6G A;  1B3Q A;  2IIM A;  2KEA A;  2F2W A;  1WXB A;  1GBR A;  2LJ3 A;  2C0O A;  2DL7 A;  4RTW A;  3M0T A;  1AWW A;  1X2Q A;  1H92 A;  1WXT A;  3PVQ A;  3VS7 A;  2KT8 A;  4A63 B;  2D1X A;  2X3X D;  2O2O A;  3NHN A;  1QWE A;  2GTO A;  4GBQ A;  3M0U A;  4LUD A;  1YN8 A;  1JXO A;  1K9A A;  1MV0 B;  2SRC A;  1JO8 A;  2KNB B;  4F16 A;  2O9S A;  4LNP A;  2FRW A;  1OPL A;  1VYT A;  5I22 A;  2EGC A;  2J6O A;  1VYU A;  3VS1 A;  4J9B A;  1RUW A;  2BZ8 A;  1EFN A;  2JS2 A;  1X43 A;  5EC7 A;  1CKB A;  2RN8 A;  2RPN A;  2EGE A;  4JJC A;  2DNU A;  1NLO C;  3EGU A;  3H0F A;  3TSW A;  2PZ1 A;  4X1V A;  1AZG B;  1BBZ A;  2RQW A;  2A36 A;  1WLP B;  1GL5 A;  4J9D A;  1U06 A;  1I07 A;  1UUE A;  2ABL A;  1JXM A;  4RTX A;  5FWC A;  3QWX X;  2ENM A;  2JM8 A;  3TSZ A;  1XOV A;  1X69 A;  3NMZ C;  4HVV A;  3QWY A;  2KE9 A;  2EYZ A;  2JM9 A;  2A08 A;  2KR3 A;  1WFW A;  4HXJ A;  2YUN A;  1E6H A;  2E5K A;  2DYB A;  4JJD A;  1MUZ A;  1IO6 A;  1M3C A;  4EIK A;  1RI9 A;  3U23 A;  2V1Q A;  2YUQ A;  2CDT A;  4D8K A;  1GFD A;  1TG0 A;  4RUG A;  2FPF A;  3H0H A;  2HSP A;  2DMO A;  2DL4 A;  1M30 A;  2K7A A;  1YWP A;  3UF4 A;  3I5R A;  2F2V A;  2KXD A;  5GJV B;  1NLP C;  2PNI A;  4RTY A;  2L3S A;  3JV3 A;  4WCI A;  1QKW A;  2J6K A;  2DLP A;  1ZUU A;  1AD5 A;  2FG0 A;  1WA7 A;  1FYN A;  2EYY A;  3I35 A;  4AG2 C;  4JZ4 A;  1Y0M A;  2CUD A;  1PWT A;  1NYF A;  1AOJ A;  2DRK A;  1UFF A;  4AFQ C;  3GBQ A;  1T3S A;  5FWB A;  3LH5 A;  1K4U S;  4AFS C;  1A0N B;  2SEM A;  1ARK A;  2GTJ A;  4J9F A;  5L23 A;  5GJW B;  2YT6 A;  1GCP A;  4Z88 A;  3VRY A;  2HDA A;  2FPD A;  2HBW A;  1HSQ A;  2OAW A;  2RQT A;  2VVK A;  4Z89 A;  2L3P A;  1WXU A;  4J9G A;  1KSW A;  3NPF A;  1RLQ C;  2KRN A;  3IQL A;  1UE9 A;  5IH2 A;  4JZ3 A;  2CUB A;  1ZUY A;  2O31 A;  4CC2 A;  2ROL A;  2EW3 A;  1ABO A;  2LP5 A;  2JS0 A;  4OMM A;  4J9I A;  3ULR B;  1AWO A;  1FMK A;  2LJ0 A;  4J9C A;  4RTV A;  2EYW A;  2KGT A;  2I0N A;  3O5Z A;  2EYX A;  2CH4 A;  1M3A A;  1PKT A;  1NEB A;  4J9H A;  2OJ2 A;  4D8D A;  2DVJ A;  1MV3 A;  1SHF A;  1YWO A;  2GBQ A;  2KBT A;  1AZE A;  2D8H A;  2LCS A;  4R0K A;  4CC4 B;  1W70 A;  3VS0 A;  4M4Z A;  3SEM A;  2W10 A;  2VWF A;  1GBQ A;  2FPE A;  1Y57 A;  2J6F A;  3C0C A;  4FSS A;  4HCK A;  2O88 A;  2KYM A;  1Z9Q A;  1LCK A;  3VS2 A;  1K0S A;  1G83 A;  1X6B A;  1AWX A;  1WDX A;  2CH4 W;  2RNA A;  2AKL A;  2DJQ A;  4RTT A;  1AWJ A;  2DRM A;  3M0R A;  1PRL C;  1T3L A;  2L2P A;  1SHG A;  3I9Q A;  3RBB B;  2CT4 A;  1OOT A;  1YNZ A;  3THK A;  2JW4 A;  3UA7 A;  2GGR A;  2EQI A;  1UJY A;  2KYB A;  3M0S A;  1X27 A;  4IIO A;  2EVR A;  3UA6 A;  3FJ5 A;  4OMP A;  4E6R A;  1ZX6 A;  4LN2 A;  2MCN A;  2CSQ A;  1NYG A;  5HCK A;  1T0J A;  1JQQ A;  1NG2 A;  2B86 A;  2KRS A;  1PNJ A;  1Z9Z A;  1H3H A;  4HVW A;  4CC7 A;  4AFU C;  1ZSG A;  1WIE A;  1M3B A;  4RTZ A;  1SRM A;  1J3T A;  4KRT A;  2MIO A;  2VKN A;  2RQV A;  1S1N A;  3KFV A;  2NWM A;  2YUO A;  1UGV A;  2K6D A;  1ZBJ A;  4F14 A;  1YP5 A;  2JXB A;  4HVU A;  1SEM A;  2KRO A;  1I1J A;  2EKH A;  4DEX A;  1VA7 A;  1ZLM A;  2JT4 A;  1SRL A;  1KIK A;  1V1C A;  4QT7 A;  5FW9 A;  1I0C A;  2KT1 A;  2M0Y A;  2DIL A;  4CC3 A;  5IHN A;  1KJW A;  1JEG A;  2O9V A;  2CRE A;  3EG1 A;  2CSI A;  1N5Z A;  1ZUK A;  1SSH A;  4GLM A;  1RLP C;  2C0T A;  2JMA A;  2A37 A;  3PE0 A;  4K11 A;  2A28 A;  1UTI A;  2ED1 A;  2W0Z A;  1HD3 A;  1K0X A;  1GCQ C;  2JMC A;  4JPB W;  1U3O A;  3PVL A;  1UG1 A;  2EBP A;  3VS3 A;  5ECA A;  2HEQ A;  2DX1 A;  2ESW A;  3EG0 A;  2J7I A;  1CSK A;  1TUD A;  1JU5 C;  2BZX A;  2ECZ A;  3ZL7 C;  4IIM A;  4F17 A;  2YSQ A;  2AZS A;  3H0I A;  2LQW A;  3RNJ A;  3SHW A;  1UHC A;  1X2K A;  2LZ6 B;  1YCS B;  1K1Z A;  2D0N A;  1HJD A;  3CQT A;  1BK2 A;  2GNC A;  2ROT A;  3VS5 A;  2YUP A;  1PHT A;  4J9E A;  2KXC A;  3VS4 A;  1CKA A;  1NEG A;  2AKK A;  2DE0 X;  2JTE A;  2CT3 A;  2LMJ A;  4Z8A A;  2LQN A;  4RTU A;  1PRM C;  1AVZ C;  2K3B A;  3I5S A;  4OMO A;  2G6F X;  2V1R A;  1W1F A;  1PKS A;  1GFC A;  2DBM A;  2MOX A;  2OI3 A;  2FEI A;  1QKX A;  1WYX A;  2DL3 A;  2LX7 A;  1WX6 A;  1UEC A;  1M8M A;  2K9G A;  1GCQ A;  1OV3 A;  1T0H A;  2NUZ A;  2AZV A;  1QLY A;  2AK5 A;  3EHQ A;  2D8J A;  1WI7 A;  4OMQ A;  1B07 A;  2EGA A;  2J05 A;  3R6N A;  2DF6 A;  1OEB A;  4OML A;  2RMO A;  1M27 C;  1BB9 A;  2YDL A;  1AEY A;  2QDL A;  2BZY A;  2H8H A;  1H8K A;  1OPK A;  2F2X A;  2PTK A;  2ED0 A;  5I11 A;  3H41 A;  1UDL A;  2M51 A;  4ESR A;  2X3W D;  1G2B A;  4ORZ A;  4DEY A;  2DM1 A;  1U5S A;  1SPK A;  4AFZ C;  2K79 A;  5IHI A;  4LUE A;  3VRZ A;  3NGP A;  4Y92 A;  3REB B;  2HCK A;  1GRI A;  2DA9 A;  2J06 A;  1QCF A;  2L0A A;  1E6G A; 
#chains in the Genus database with same CATH topology
 2LQ8 A;  3A98 A;  1TUC A;  5AT1 B;  3G71 A;  3M4Y A;  4M77 E;  4J83 A;  2X4X A;  1TOV A;  1E7O A;  2QQA A;  1YFN A;  1IB8 A;  3FRN A;  1OU9 A;  3NTI A;  4M7A G;  1MMA A;  1NM7 A;  2M9U A;  5GAO r;  2BTT A;  3MP8 A;  4FYV B;  2OTL T;  2RQU A;  4BI8 B;  2LJ1 A;  1B34 B;  3RMQ A;  5GAN 5;  1NJI C;  5IXF A;  2KEA A;  2QA4 A;  1QVF A;  2PU9 B;  3M0T A;  4L59 A;  4LDW A;  1G3S A;  3DLL A;  1TH7 A;  1WXT A;  3PVQ A;  4A63 B;  1Y7X A;  2X3X D;  2O2O A;  3NHN A;  5LJ5 f;  1M1F A;  4IUV A;  2A3L A;  4M75 D;  1QVF P;  3CMA T;  4M7D C;  3MKD A;  2K5I A;  4JJN K;  1JXO A;  2YHT A;  2SRC A;  3EG9 B;  4F16 A;  3O8V A;  1OPL A;  3V7R A;  4C8Q F;  2EGC A;  1MMN A;  1XJW B;  3VS1 A;  4MMK A;  5FLX E;  2E12 A;  8AT1 B;  3JCM J;  8ATC B;  2O4X B;  2JS2 A;  4PL6 A;  5EC7 A;  1CKB A;  2RN8 A;  3J7A F;  2DNU A;  3PIO A;  3JCM c;  3TU4 K;  1WLP B;  4J9D A;  4E7H A;  1I07 A;  1JXM A;  4RTX A;  5HKC A;  3DB3 A;  2ENM A;  4M78 C;  5FRM A;  2JM8 A;  3TSZ A;  2D9T A;  2E6N A;  1VQL Q;  1M8V A;  1X69 A;  4HT8 A;  2QDY B;  4HVV A;  3OMG A;  2P4T A;  2OTL A;  2EYZ A;  2MF2 A;  2HMA A;  3NTK A;  1M2V B;  3MEW A;  3JCM W;  3RKX A;  4JJD A;  1MUZ A;  4E7I A;  4C8Q E;  2OTJ T;  3A8G B;  2R57 A;  2DER A;  2OAU A;  2QI2 A;  1HK9 A;  3M59 A;  3H0H A;  2PQW A;  3CMA A;  4M75 B;  3I5R A;  1VQ6 Q;  2F2V A;  1NLP C;  3BE3 A;  4D6W A;  3MCA B;  1QKW A;  4RCB A;  2FB7 A;  4QKU A;  3V8J A;  1R0C B;  3C94 A;  2QEX A;  4JLI A;  4ME7 A;  2XI9 A;  1BIB A;  3GBQ A;  4PFO A;  5FWB A;  3OA6 A;  4M7D B;  2SEM A;  3QZ9 B;  2AT1 B;  3LGF A;  2O01 E;  2LCL A;  5L23 A;  1R0B G;  5HK0 A;  4BAC A;  2F69 A;  4N0A A;  2RHX A;  2I2L A;  4LDU A;  4Z89 A;  3M5A A;  1WXU A;  3OSS C;  5A0G A;  1YIT Q;  3LLR A;  3QHS A;  1BIA A;  2KRN A;  1PG5 B;  1GXI E;  1UE9 A;  1G3Y A;  2CP6 A;  1BCO A;  1W2B S;  3JB9 D;  2ROL A;  3CCV Q;  4PJO F;  1VQ4 Q;  3GP8 A;  3PMT A;  2E4H A;  1KHI A;  4OMM A;  2K2V A;  3GNF B;  5I2M A;  3JCM h;  3ULR B;  4J9C A;  1KQ1 A;  4RTV A;  3S3O A;  3OYD A;  2KVQ G;  3O5Z A;  3CC4 Q;  1FWZ A;  2XKO C;  4M78 F;  1YJ9 T;  1X6O A;  1WNL A;  2G3R A;  5DLQ E;  2OJ2 A;  3CXC S;  2M16 A;  4M7A C;  4A54 A;  3G6E Q;  1YWO A;  2E3I A;  2GBQ A;  2KBT A;  2D8H A;  5D6Y A;  3QPH A;  4OB0 B;  3VS0 A;  3OS5 A;  2XIC A;  3EH2 A;  1K73 U;  3RR6 A;  2E41 A;  2EKO A;  3DB4 A;  2KYM A;  4XTU A;  3Q1J A;  3CCE T;  1LCK A;  4FW2 A;  3VS2 A;  1G83 A;  2VC8 A;  1X6B A;  2CH4 W;  4PJO E;  1WZO A;  1SSF A;  1BI1 A;  4RTT A;  1ZBX A;  2KI7 A;  5IN1 A;  3QUI A;  3I9Q A;  1UGS B;  1Q86 U;  1OOT A;  1PSE A;  2DIQ A;  4M78 E;  4MZM A;  1TXQ A;  2GGR A;  2EQK A;  3X25 B;  5EG2 A;  3M4G A;  1X27 A;  4IIO A;  4LD6 A;  2E1H A;  4OMP A;  3OYE A;  3E9G A;  2DJZ A;  3T9N A;  1QVF S;  2HNI A;  2MPX C;  5HCK A;  3CCQ T;  2DYI A;  2F5K A;  4KGV B;  2B86 A;  3CCR T;  4A4E A;  1B7T A;  1MMD A;  1YJ9 A;  1WIE A;  5GAM f;  3OYB A;  2KSS A;  1VQ5 Q;  1OZ2 A;  3CBO A;  5FU7 B;  4FM4 B;  2NWM A;  2KAF A;  4MDX A;  4X9C A;  4C0G A;  5D6W A;  3G4S T;  1SEM A;  2KRO A;  2EKH A;  4DEX A;  3LH0 A;  1SRL A;  3CCE A;  3MP1 A;  2M0Y A;  3BW1 A;  2P0Q A;  2KK4 A;  2DKG A;  5IHN A;  2CRE A;  4BI4 A;  2QEX Q;  1N5Z A;  2HL5 C;  1SSH A;  1RLP C;  2DD5 A;  2W0Z A;  3QBY A;  1HD3 A;  4M77 A;  1QP3 A;  1K0X A;  2GQV A;  3HSB A;  2RJF A;  1EZZ B;  4M7A F;  1K73 C;  4X34 A;  4ATO A;  3VS3 A;  2DK3 A;  4B9X A;  1G3T A;  1SF9 A;  5ECA A;  2WSF E;  5GAN 6;  1OYX A;  2F1L A;  1CSK A;  5CKE A;  1Y96 A;  3S3M A;  5CKB A;  2DXT A;  4R56 A;  2YSQ A;  1OX9 A;  4JUV A;  3J81 E;  4E7J A;  3SHW A;  3CCR A;  1Q86 C;  2ZAE A;  1YCS B;  2K4Y A;  4C0Z A;  3FIF A;  2D0N A;  2PVD B;  1BK2 A;  2GNC A;  2L89 A;  4CI0 C;  3VS4 A;  1CKA A;  2V26 A;  3MO8 A;  1AVZ C;  1Y07 A;  2M1H A;  4A4G A;  4KGX B;  2G6F X;  2V1R A;  4HCZ A;  5GAN f;  1W1F A;  3UWN A;  1PKS A;  2MOX A;  3QYG B;  1XQH A;  2CP0 A;  1WJQ A;  2LX9 A;  3G4S A;  2CZ0 B;  4M7A E;  1WX6 A;  3CPF A;  5GAN 7;  2K9G A;  1GCQ A;  2X4J A;  1K73 R;  2AK5 A;  4QW2 A;  1R8O B;  3P8H A;  2D8J A;  3HRU A;  2JTF A;  3MHX A;  2FZC B;  1HXD A;  1JB0 E;  1XTD A;  2RMO A;  1BB9 A;  1M27 C;  2BZY A;  3M57 A;  2F2X A;  3MEA A;  4M77 C;  5I11 A;  3H41 A;  1UDL A;  2M51 A;  3GOX A;  1VQL T;  4PLI A;  3VV0 A;  3RKW A;  2Y90 A;  3S6W A;  4ZN3 A;  4LUE A;  3VRZ A;  4EPC A;  3D7S B;  4PJM A;  3REB B;  2L0A A;  2EAY A;  1UGP B;  3HP9 A;  5DLO A;  1D1B A;  2DD4 A;  1UGR B;  2R58 A;  4IUU A;  1NPR A;  3OQ5 A;  1R77 A;  4C8Q A;  2PVO B;  2VB6 A;  4F7U G;  3OYC A;  3OS2 A;  1PC0 A;  2LNH B;  1VQ6 T;  2RJC A;  1WQW A;  1OU8 A;  3EG9 A;  4FL6 A;  1UHF A;  4XK8 E;  2CKK A;  1UJ0 A;  2K3Y A;  1F1B B;  1VQ9 A;  2RF0 A;  3REA B;  1M1G A;  2QYZ A;  1D0Y A;  1ACM B;  4ZNX A;  2Z0W A;  2JN0 A;  1X6G A;  1B3Q A;  2F2W A;  3OS0 A;  2O4X A;  1GBR A;  2RO0 A;  1OUL A;  2DL7 A;  2YLC A;  3L2Z A;  4RTW A;  2ZPF B;  5L8R E;  5GMK i;  2EQM A;  4XTX A;  2LDM A;  2KT8 A;  2X4Y A;  2RHZ A;  2CP2 A;  3FDR A;  5CAI A;  1VQ7 A;  1PM3 A;  4LUD A;  1YN8 A;  1YIT T;  1K9A A;  4IUP A;  4LDX A;  1O9S A;  2P0K A;  3JCM V;  5IT9 E;  2FRW A;  1VYT A;  4PNO A;  5I22 A;  3HRS A;  2E65 A;  1VYU A;  3JAM E;  2FVU A;  1D1C A;  3CCV T;  1RUW A;  3ZEH A;  1VQ4 T;  3GLX A;  4XU2 A;  4M77 B;  1RAI B;  4NS5 A;  4ZGE B;  3JB9 I;  2EGE A;  3H0F A;  3EGU A;  1W2B A;  1UGQ B;  2X51 A;  4C0D B;  4FCY A;  1SKU B;  2QTX A;  2RQW A;  1YHQ Q;  3CC4 T;  4KUL A;  4XTW A;  3JB9 J;  1VQ6 A;  5FWC A;  4N4G A;  2JTM A;  5LJ3 e;  1Y96 B;  4BDZ A;  4QQG A;  5M9O A;  3QWY A;  1W2B P;  2RHY A;  2KE9 A;  3A8L B;  3G6E T;  2JM9 A;  2A08 A;  4C8Q D;  2KR3 A;  1WFW A;  3CXC A;  3HL8 A;  2FZG B;  3PIP A;  2LRQ A;  1M3C A;  4KGZ B;  1RI9 A;  3U23 A;  2XG8 D;  2VGN A;  1M5Q 1;  2YUQ A;  3CPW A;  2DFU A;  3JB9 G;  2JUF A;  2FPF A;  2HSP A;  3QZ5 B;  2DMO A;  2DL4 A;  5GMK l;  1M90 C;  1YIT A;  1KK7 A;  3PFS A;  2PNI A;  2L3S A;  1BKB A;  1I81 A;  4WCI A;  1S72 Q;  3L1A A;  4LXC A;  1M2O A;  5GAO p;  3CPW P;  1Y0M A;  2VV5 A;  2ZPG B;  5HY6 A;  3CCV A;  1VQ4 A;  4M78 A;  2VXE A;  1BI3 A;  1VQM A;  2RI5 A;  1RAG B;  4Z88 A;  3TEE A;  2DZC A;  2P0P A;  1RAA B;  3CC4 A;  2OAW A;  2VVK A;  5I2S A;  4FYY B;  3OYY A;  1VUB A;  1KSW A;  4XQ3 A;  3NPF A;  1VQ5 T;  2XDB A;  3G6E A;  1LVK A;  4JZ3 A;  3OY9 A;  4PKC C;  4JS4 A;  4C8Q B;  1M90 R;  1TU0 B;  4E7K A;  4CC2 A;  2HZY A;  4JDS A;  1C1A A;  4DBQ A;  3CCL A;  2LP5 A;  1NBE B;  1FMW A;  5DM7 R;  4BE2 A;  2K5L A;  5LJ5 e;  3MJX A;  2LJ0 A;  3OBW A;  1VQ9 Q;  2QEX T;  5FRO A;  5KYU A;  2EYX A;  4OB3 B;  4M7D D;  3JCM g;  4PJO C;  2Y4X A;  1JBM A;  1SHF A;  5C0M A;  2HSE B;  1W70 A;  3X24 B;  3OYL A;  1VQ7 Q;  1ZQ1 A;  3SEM A;  4P5N A;  4FW1 A;  1Y57 A;  2J6F A;  4OGE A;  5KYN A;  3X26 B;  1Z9Q A;  4VUB A;  4L6V 5;  2B8A A;  1YIJ Q;  4Z02 A;  3G7Z A;  4KBM B;  5D7U A;  1OZ3 A;  2AKL A;  4NOY A;  3FB9 A;  3OW2 S;  1T3L A;  2DZ9 A;  3ME9 A;  4M78 D;  3OYM A;  1VQ5 A;  3GNG A;  2CT4 A;  1X75 C;  1YNZ A;  3THK A;  2JW4 A;  3UA7 A;  1W4S A;  2K3X A;  4EMG A;  2EFI A;  3M0S A;  4ZTJ A;  3V8K A;  2XDP A;  3UA6 A;  4C92 G;  3FJ5 A;  3LWH A;  2KY9 A;  4QQD A;  1ZX6 A;  4LN2 A;  4E6R A;  1QVG P;  1NYG A;  4M7A A;  1T0J A;  3OYK A;  1DJ7 B;  1H3H A;  4HVW A;  4E7S A;  1ZSG A;  1M3B A;  2JVV A;  1J3T A;  3VYH B;  3OB9 A;  3CC7 A;  1MND A;  1N8R U;  2RQV A;  3KFV A;  1D0X A;  3OYJ A;  3HTR A;  3QKJ A;  3CC2 A;  2QXF A;  3F70 A;  1TTH B;  1YP5 A;  5A0D A;  1WHL A;  1YCY A;  3CBM A;  1KIK A;  2R5M A;  5LJ3 g;  5FW9 A;  4PJO B;  6AT1 B;  2HBP A;  4GY5 A;  2CSI A;  2EIF A;  5IAY A;  4GLM A;  3JCM d;  2JMA A;  2A37 A;  3DLM A;  4F7U F;  4J7F A;  4EMK C;  1WHH A;  2JMC A;  5FRN A;  4JPB W;  4M78 B;  1U3O A;  3AHU A;  1UG1 A;  2VUB A;  1VQM Q;  3WXM B;  1ZSZ C;  3MEU A;  1U1T A;  4WF2 A;  5CKF A;  2ESW A;  2J7I A;  2YRC A;  1TUD A;  3I55 Q;  2ZPH B;  2QAZ A;  3C12 A;  5HK3 A;  1MGQ A;  3H0I A;  2HD0 A;  2PUK B;  4XTZ A;  2IVW A;  1X2K A;  2LZ6 B;  3VYG A;  1QW1 A;  4YTL A;  2M0O A;  3V7C A;  1HJD A;  3CQT A;  3OS1 A;  2DTH A;  4KUI A;  2CP3 A;  1PHT A;  2WAC A;  5GMK e;  3CPW S;  4J9E A;  4QVD A;  2KXC A;  3P8B B;  1NEG A;  1MNE A;  2DE0 X;  3QJY A;  2JTE A;  4BI3 A;  1QQJ A;  2AHJ B;  4Z8A A;  3CCL Q;  2RHI A;  4RTU A;  1KD1 U;  1D09 B;  3EGD A;  4J6Y A;  4M7A D;  4F7U E;  1I8F A;  2E70 A;  2ZCF B;  3BDU A;  2OI3 A;  2FEI A;  1WYX A;  2LX7 A;  2RHU A;  5KYU B;  1OV3 A;  2AZV A;  3QDF A;  3M54 A;  3EHQ A;  2AIR B;  1YJN A;  2PVG B;  1WI7 A;  3SWN C;  1B07 A;  3I56 Q;  2BKD N;  2EGA A;  1VQ8 Q;  3VUB A;  2DIG A;  1OEB A;  1AEY A;  1YHQ T;  5CCA A;  1N8R C;  3MPU B;  2H8H A;  4QVC A;  4J8O A;  5KH6 A;  1WQ7 A;  2X3W D;  4XTV A;  1TSF A;  4ORZ A;  5LJ5 g;  2DM1 A;  2K79 A;  3A8M B;  2RJD A;  2ZGW A;  5LJ3 d;  2ZZD A;  5DY9 A;  2HAX A;  2DA9 A;  2J06 A;  5KCH A;  4X9D A;  1P92 A;  3OYG A;  2DL5 A;  1D0Z A;  1ABQ A;  2C06 A;  5AYF A;  2FO0 A;  5LJ3 h;  2HL3 A;  5GAM e;  1LOJ A;  3CCJ Q;  1I4K 1;  3TVT A;  1V29 B;  2MWP A;  2DBK A;  3M0P A;  4ZTF A;  2JOY A;  2RM4 A;  3ER0 A;  2HKQ B;  2BUD A;  2L3Q A;  2RA2 A;  3MET A;  5CR2 A;  2MMP A;  3M0Q A;  1S72 T;  1FMV A;  4FYW B;  2FRY A;  4LE9 A;  4M7A B;  1W6X A;  1JJ2 A;  2DXB A;  1WGS A;  1KFZ A;  1N8R R;  2GQI A;  2C0I A;  1KQ2 A;  1D3B A;  1WXB A;  2C0O A;  1RAC B;  1AWW A;  4BD3 A;  1KQS S;  3QG1 A;  1KC8 U;  4C92 C;  1KD1 C;  3SDZ A;  1YHQ A;  1JJ2 P;  3CC7 Q;  2H3E B;  2LNV A;  2D1X A;  4KUD K;  3CC2 Q;  1QWE A;  4ELY C;  1RAF B;  4GBQ A;  3M0U A;  4MZP A;  2KNB B;  1BI0 A;  4GLK A;  1VQO Q;  1QVG S;  1OQK A;  1UB4 A;  2J6O A;  4RG8 A;  2LTO A;  1PD1 A;  2QGF B;  5CIU A;  1EFN A;  2PUO B;  2EQU A;  5D6X A;  3CEY A;  2RPN A;  5C6S A;  1NLO C;  4OGC A;  1AHJ B;  1N27 A;  1VQ9 T;  1BCM A;  4A4K A;  4DA4 A;  2YRV A;  1Q95 G;  2LT4 A;  1GL5 A;  3A8H B;  1U06 A;  4C5E A;  2ABL A;  1VQN A;  5GAN e;  5LJ5 d;  4AT1 B;  1QVP A;  2A0F B;  1S72 A;  2VYT A;  1KD1 R;  1FX7 A;  1M1K U;  4OMF B;  3CD6 Q;  2QTV A;  5LJ5 h;  4C0F A;  5J3B A;  4PFZ A;  2JNG A;  3OBY A;  1VQ7 T;  2E5K A;  4N4I A;  4C5I A;  1M9S A;  3S3N A;  3JCM Q;  4O5V A;  1YIJ T;  2D0Q B;  3EGD B;  4BUG A;  2IG0 A;  2CDT A;  4M75 G;  2LT1 A;  1GFD A;  3BDL A;  3OMC A;  2MWO A;  2QQS A;  2DET A;  2DXC A;  3OYI A;  1WHM A;  3QSU A;  1M30 A;  2K7A A;  1YWP A;  4M77 D;  4MZT A;  4HKE A;  5GJV B;  2RJE A;  4C5G A;  4C5H A;  4R55 A;  1OX8 A;  3JV3 A;  3JCM b;  1YJN Q;  2YLB A;  2RK1 A;  4J6W A;  4JZ4 A;  1KC8 C;  3OW2 A;  2CUD A;  1PWT A;  1NYF A;  4M7D G;  1AOJ A;  3JSC A;  1UFF A;  2RI2 A;  1RAB B;  1T3S A;  3LH5 A;  4JS5 A;  4AFS C;  1A0N B;  1ARK A;  2Y4Y A;  3EH1 A;  4C92 F;  1RAH B;  5KCO A;  2GTJ A;  3OYH A;  5GJW B;  2YT6 A;  2QQ9 A;  3VRY A;  5FU6 C;  2LCC A;  3OW2 P;  1IGQ A;  2HDA A;  1M90 U;  1N9R A;  2CGH A;  2CZ1 B;  4J7I A;  1KG1 A;  2GF7 A;  3HFN A;  2L3P A;  3PNW C;  4J9G A;  2ZPE B;  3MEV A;  3L2R A;  2XD0 A;  3IQL A;  4KT0 E;  5IH2 A;  3URG A;  4DBR A;  1Q82 U;  4QQ6 A;  5GAN 3;  2EW3 A;  1ABO A;  2XDD A;  2JS0 A;  2HQX A;  3A8O B;  1YIJ A;  1AWO A;  1KC8 R;  1VOM A;  2ZPI B;  1M1K C;  2EYW A;  4C92 E;  2I0N A;  3C4S A;  1M3A A;  3LYI A;  1EIF A;  4FIB A;  4ANJ A;  1D3B B;  2D6F A;  1NEB A;  4J9H A;  2KMT A;  2V8K A;  1VQM T;  4D8D A;  4MDW A;  2DVJ A;  2JZ2 A;  1AZE A;  1OI1 A;  5GAM g;  4R0K A;  7AT1 B;  3FEO A;  3I55 T;  4A4F A;  3EGX A;  2W10 A;  5KYY B;  2XHC A;  2RH2 A;  1GBQ A;  1G8X A;  3PT9 A;  2QGG A;  4CRI A;  2E10 A;  1IHV A;  4MML A;  1NE8 A;  3CCM Q;  2DPP B;  1WDX A;  2RNA A;  4HT9 A;  5GAO n;  1TS9 A;  3EFO A;  2QG9 B;  5GAO l;  2GCX A;  3CCL T;  4NL3 A;  4FYX B;  4IUT A;  2E6Z A;  3OYN A;  2VAS A;  3R6O A;  1YI2 Q;  3X20 B;  2MI6 A;  3L2W A;  1M1K R;  2EQI A;  1UJY A;  1WHG A;  5CQY A;  2M02 A;  3MP6 A;  4N4H A;  1JJ2 S;  2KQW A;  4A53 A;  1VQN Q;  4F7U A;  4E2F B;  4PJO A;  2MCN A;  5GMK h;  2CSQ A;  1VIF A;  2CP7 A;  2BE7 D;  2VXF A;  1JQQ A;  3I56 T;  1VQ8 T;  2COZ A;  4OP0 A;  2KRS A;  1Z9Z A;  4BDY A;  1PD0 A;  2R5A A;  2BE9 B;  4RTZ A;  2EQJ A;  1Q82 C;  1FXX A;  1JRI A;  1SRM A;  4KRT A;  2MIO A;  2L3R A;  3HRT A;  3ZFJ A;  2VKN A;  1UEB A;  3I55 A;  4IKF A;  1UGV A;  1C0M A;  1ZBJ A;  2JXB A;  3CME A;  4E7Z A;  1IZ6 A;  1VA7 A;  2JT4 A;  1V1C A;  4QT7 A;  5GAN g;  1KHC A;  3DKM A;  3RKY A;  1I0C A;  3SFM A;  2DIL A;  4CC3 A;  2CYZ B;  3BY7 A;  3HPW A;  3CCJ T;  4RG2 A;  4K11 A;  2A28 A;  1UTI A;  2ED1 A;  4M75 C;  2CS7 A;  2F5T X;  2NLU A;  5GAM d;  1TWB A;  1C6V X;  3CBP A;  2BIV A;  2HEQ A;  2VGM A;  3EG0 A;  3N5B B;  4L5G A;  1IGU A;  4AMC A;  5GAM h;  4FT4 A;  1Q82 R;  1WHK A;  2BZX A;  2ECZ A;  3ZL7 C;  1PSF A;  4F17 A;  2HQH A;  4UC4 A;  3CCS A;  2AZS A;  2LQW A;  1ZA2 B;  3RNJ A;  1AT1 B;  2HQE A;  1VQP A;  3I56 A;  1VQ8 A;  1UHC A;  3A1P A;  3VUZ A;  3GIB A;  4IUR A;  3CC7 T;  1VQK Q;  1IHW A;  3VJP A;  2YWW A;  3VS5 A;  3CC2 T;  4XU3 A;  1KQS A;  2CT3 A;  1LPL A;  4PJO D;  3NFC A;  1PRM C;  2K3B A;  3RIR A;  3E19 A;  4OMO A;  3H6Z A;  1VQO T;  2NUT A;  2RB6 A;  3OYA A;  2DBM A;  1NJI R;  3J80 E;  3UPU A;  1QKX A;  2DXU A;  4PLL A;  2FZK B;  3L2V A;  3KXT A;  1M8M A;  4EMK A;  1WJR A;  1KQS P;  1QLY A;  1QVG A;  3WVD B;  1ZSZ A;  4LD9 K;  3CCJ A;  4II1 A;  3E9F A;  3R6N A;  5CVI A;  4ELZ C;  2DF6 A;  2QDL A;  5GAN 4;  1MMG A;  2DEU A;  3BFM A;  2ED0 A;  3EGX B;  2IPO B;  4ESR A;  3CCU Q;  4PJN A;  1M4Z A;  1G2B A;  4DEY A;  2E5Q A;  3A5Z B;  3CD6 T;  4AFZ C;  1U5S A;  1SPK A;  5LJ3 j;  2QK0 A;  2CP5 A;  2V8I A;  3SD4 A;  3NGP A;  1YJW Q;  5GAN d;  2HCK A;  2DAQ A;  1QCF A;  3JB9 H;  3EFO B;  2FYK A;  2DL8 A;  2DTO A;  1D1A A;  1BU1 A;  2FHD A;  5GAN h;  2LVM A;  4OMN A;  4RKU E;  2RI3 A;  1QWF A;  2K2M A;  3EG2 A;  4M75 F;  1RL2 A;  3VS6 A;  1X01 A;  2P4R A;  3NTH A;  2EJF A;  2KRM A;  3UAT A;  5J39 A;  2EPD A;  2XMF A;  3M9Q A;  3EHR A;  3TCJ A;  5CQX A;  4F7U B;  3EG3 A;  1VYV A;  2L8D A;  3E2U A;  5KYW A;  1VQO A;  3SWN A;  3FC3 A;  1YJN T;  2RQR A;  4XU1 A;  1H3Z A;  4JJB A;  5IHK A;  4AG1 C;  3G1J A;  5IXB A;  2QAS A;  1K76 A;  2X9H A;  4M7D F;  2IIM A;  3L42 A;  2EJG A;  5GAO m;  2LJ3 A;  4LDV A;  1NPP A;  3UDC A;  4KH0 B;  5CKD A;  1WHJ A;  1X2Q A;  3G71 Q;  1H92 A;  2CZ6 B;  3VS7 A;  1LJO A;  2MYS A;  2GTO A;  5GMK m;  4ZGJ B;  3CME Q;  2OTJ A;  1MV0 B;  1JO8 A;  4M75 E;  3CD6 A;  2LQK A;  4QVZ A;  3TRE A;  1I5O B;  2O9S A;  4LNP A;  5FU7 C;  2CZ7 B;  4JRP A;  4M77 G;  1Q81 U;  3GPL A;  4J9B A;  2QA4 Q;  2BZ8 A;  5A0L A;  3RDV A;  2COY A;  1X43 A;  4M7D E;  4JJC A;  1G3W A;  5LL6 S;  3TSW A;  2PZ1 A;  4X1V A;  1AZG B;  1BBZ A;  3H9N A;  2A36 A;  2KDS A;  5LJ5 j;  3M58 A;  3QYH B;  1UUE A;  3WVE B;  1QMC A;  4OB1 B;  3KBG A;  3JCM P;  3QWX X;  3RES A;  2RK2 A;  1XOV A;  2E64 A;  4RCC A;  3CCS Q;  2XU8 A;  4C92 A;  3NMZ C;  2WSC E;  1Q7Y U;  1VQP Q;  3HKS A;  5A2Q E;  4N0A C;  1K8A U;  3HFO A;  4HXJ A;  3OSV A;  2YUN A;  1E6H A;  2DYB A;  4PK4 A;  1ZA1 B;  2NUP A;  4J5Y A;  1IO6 A;  4EIK A;  4Q5W A;  3CCM T;  5CKH A;  2V1Q A;  2ZPB B;  2NUT B;  4D8K A;  4BB7 A;  1TG0 A;  4RUG A;  1RI0 A;  3TQ7 P;  2GFU A;  5GAN 8;  3UF4 A;  4JLG A;  4RMO A;  2KXD A;  3RUX A;  4RTY A;  4EMK B;  3LW5 E;  5KYX A;  2J6K A;  1YI2 T;  2DLP A;  1ZUU A;  3H8Z A;  1AD5 A;  1ZSZ B;  1WA7 A;  1FYN A;  2EYY A;  2FG0 A;  3I35 A;  4AG2 C;  2OTL Q;  3JB9 F;  2DRK A;  3KUF A;  4AFQ C;  4WTO B;  5KE3 A;  4E47 A;  4BY6 C;  1VQN T;  1K4U S;  4HCC A;  3FLG A;  4J9F A;  1PCX A;  1GCP A;  3L2U A;  2MAM A;  4JRI A;  2P84 A;  2FPD A;  2HBW A;  1HSQ A;  3RER A;  1VIE A;  2RQT A;  3QII A;  3CMA Q;  4BE1 A;  4J6X A;  3PMI A;  1Q81 C;  1RLQ C;  1N9S A;  2X35 A;  4C8Q G;  2ATC B;  2DO3 A;  2CUB A;  2K5F A;  5KYY A;  1ZUY A;  2RD1 A;  2O31 A;  3OYF A;  5GAO q;  1U8R A;  1QP2 A;  1YBY A;  2HKN A;  1K9M U;  3CCM A;  4J9I A;  4C92 D;  5KYW B;  1FMK A;  2DTI A;  4B9W A;  4NL2 A;  3SWN B;  1Q7Y C;  1MHN A;  2KGT A;  1ZHI A;  3UT1 A;  3PTA A;  2V8J A;  4FSX A;  2CH4 A;  4ZGD B;  5KE2 A;  2K57 A;  1K8A C;  1PKT A;  1WJS A;  1YI2 A;  3CCQ A;  2WSE E;  3EFS A;  1MV3 A;  4XAX B;  4IUQ A;  1RAD B;  2A7Y A;  2LCS A;  4CC4 B;  4KH1 B;  4OB2 B;  3EFR A;  4M4Z A;  2COW A;  1U1S A;  1Q81 R;  2VWF A;  2FPE A;  4JRQ A;  3M55 A;  3JCM X;  4Y28 E;  2QQB A;  3C0C A;  2OTJ Q;  4FSS A;  4HCK A;  2O88 A;  2YRD A;  4Y91 A;  2NYS A;  1K0S A;  5I21 A;  1AWX A;  1VQK T;  4TVR A;  2XID A;  4F04 B;  1IRE B;  1G5V A;  2DJQ A;  1AWJ A;  3V7S A;  2DRM A;  3M0R A;  1PRL C;  2L2P A;  1SHG A;  3EAE A;  4BY6 B;  2EWN A;  3RBB B;  4DBH A;  4PFP A;  1N6A A;  4V2S A;  5GMK j;  4B6M A;  1Q7Y R;  4PJL A;  2KYB A;  1K8A R;  4XU0 A;  2QQR A;  2EVR A;  1IXD A;  2E3H A;  1Q86 R;  3JCM f;  2H3J A;  3M56 A;  4LDY A;  1NG2 A;  4C92 B;  4C0D C;  1PNJ A;  1B34 A;  4CC7 A;  4AFU C;  3L2Q A;  3RMS A;  3JCM e;  3E1S A;  2NUP B;  3CCU T;  1K9M C;  3PGG A;  3HHT B;  4DQ2 A;  1S1N A;  2YUO A;  3QXE B;  2K6D A;  1YJW T;  4F14 A;  4PJO G;  4HVU A;  4EDU A;  1I1J A;  3QO3 A;  1ZLM A;  4E7L A;  5CO7 A;  2KT1 A;  5KYX B;  1VQK A;  1KJW A;  1JEG A;  2O9V A;  3P8D A;  3EG1 A;  4EMH A;  1ZUK A;  2C0T A;  4M78 G;  3PE0 A;  3VKI A;  1YJ9 Q;  5GAM j;  1TUG B;  1GCQ C;  4OVA A;  1QCO A;  3PVL A;  3FJP A;  1O75 A;  2EBP A;  1QCN A;  1SG5 A;  1LNX A;  2DX1 A;  2EJ9 A;  4DBF A;  1WPY A;  3LWI A;  3ZBD A;  1JU5 C;  2L5Q A;  4FT2 A;  3JRZ A;  4HCB A;  1HYO A;  4IIM A;  1VQL A;  4OF1 A;  1K9M R;  3M53 A;  2OX7 A;  3CCE Q;  2X4W A;  3G71 T;  1EX4 A;  9ATC B;  1IRX A;  1K1Z A;  1M2V A;  1NJI U;  3QDR B;  3LGL A;  3AT1 B;  2ROT A;  2MK5 A;  2YUP A;  1H64 1;  5GAN 2;  3GF5 A;  2DEQ A;  4DOV A;  3CME T;  2AKK A;  5J26 A;  3CCU A;  2LMJ A;  1XNI A;  2LQN A;  3I5S A;  2FL7 A;  5LJ3 f;  3SB2 A;  1GFC A;  1YJW A;  4PJJ A;  4A4H A;  4DOW A;  4C8Q C;  2JJ9 A;  2DL3 A;  1NZ9 A;  4M75 A;  4M77 F;  1UEC A;  1Y71 A;  3V8L A;  1T0H A;  2NUZ A;  2QA4 T;  2YXY A;  4HA8 A;  4O6J A;  4XTY A;  3CCQ Q;  4OMQ A;  3ASK A;  5CK9 A;  2J05 A;  5FU6 B;  3CCR Q;  3VU3 C;  4BE0 A;  3X28 B;  2XK0 A;  4OML A;  2YDL A;  2LC4 A;  2EYQ A;  1BYM A;  1BI2 A;  1H8K A;  3C95 A;  1OPK A;  4M7D A;  2PTK A;  4FU6 A;  3CCS T;  3INZ A;  3QJ6 A;  4JRK A;  1VQP T;  5GAN j;  5IHI A;  1V76 A;  3LX7 A;  4Y92 A;  2GFA A;  2DVE A;  1RAE B;  1GRI A;  3G4S Q;  3CXC P;  1I5L A;  1E6G A;  4ZN1 A; 
#chains in the Genus database with same CATH homology
 2DL8 A;  2DL5 A;  1ABQ A;  1BU1 A;  3A98 A;  1TUC A;  2FO0 A;  4OMN A;  1E7O A;  3TVT A;  1QWF A;  2K2M A;  3EG2 A;  3VS6 A;  2DBK A;  3M0P A;  2P4R A;  2KRM A;  3UAT A;  2L3Q A;  2EPD A;  2LNH B;  2XMF A;  3EHR A;  3EG3 A;  1VYV A;  1NM7 A;  1UHF A;  3M0Q A;  2BTT A;  1UJ0 A;  2FRY A;  2RQR A;  4LE9 A;  2RF0 A;  3REA B;  4JJB A;  1W6X A;  4ZNX A;  1KFZ A;  2RQU A;  5IHK A;  4AG1 C;  2LJ1 A;  5IXB A;  2GQI A;  1K76 A;  2C0I A;  5IXF A;  1X6G A;  1B3Q A;  2IIM A;  2KEA A;  2F2W A;  1WXB A;  1GBR A;  2LJ3 A;  2C0O A;  2DL7 A;  4RTW A;  3M0T A;  1AWW A;  1X2Q A;  1H92 A;  1WXT A;  3PVQ A;  3VS7 A;  2KT8 A;  4A63 B;  2D1X A;  2X3X D;  2O2O A;  3NHN A;  1QWE A;  2GTO A;  4GBQ A;  3M0U A;  4LUD A;  1YN8 A;  1JXO A;  1K9A A;  1MV0 B;  2SRC A;  1JO8 A;  2KNB B;  4F16 A;  2O9S A;  4LNP A;  2FRW A;  1OPL A;  1VYT A;  5I22 A;  2EGC A;  2J6O A;  1VYU A;  3VS1 A;  4J9B A;  1RUW A;  2BZ8 A;  1EFN A;  2JS2 A;  1X43 A;  5EC7 A;  1CKB A;  2RN8 A;  2RPN A;  2EGE A;  4JJC A;  2DNU A;  1NLO C;  3EGU A;  3H0F A;  3TSW A;  2PZ1 A;  4X1V A;  1AZG B;  1BBZ A;  2RQW A;  2A36 A;  1WLP B;  1GL5 A;  4J9D A;  1U06 A;  1I07 A;  1UUE A;  2ABL A;  1JXM A;  4RTX A;  5FWC A;  3QWX X;  2ENM A;  2JM8 A;  3TSZ A;  1XOV A;  1X69 A;  3NMZ C;  4HVV A;  3QWY A;  2KE9 A;  2EYZ A;  2JM9 A;  2A08 A;  2KR3 A;  1WFW A;  4HXJ A;  2YUN A;  1E6H A;  2E5K A;  2DYB A;  4JJD A;  1MUZ A;  1IO6 A;  1M3C A;  4EIK A;  1RI9 A;  3U23 A;  2V1Q A;  2YUQ A;  2CDT A;  4D8K A;  1GFD A;  1TG0 A;  4RUG A;  2FPF A;  3H0H A;  2HSP A;  2DMO A;  2DL4 A;  1M30 A;  2K7A A;  1YWP A;  3UF4 A;  3I5R A;  2F2V A;  2KXD A;  5GJV B;  1NLP C;  2PNI A;  4RTY A;  2L3S A;  3JV3 A;  4WCI A;  1QKW A;  2J6K A;  2DLP A;  1ZUU A;  1AD5 A;  2FG0 A;  1WA7 A;  1FYN A;  2EYY A;  3I35 A;  4AG2 C;  4JZ4 A;  1Y0M A;  2CUD A;  1PWT A;  1NYF A;  1AOJ A;  2DRK A;  1UFF A;  4AFQ C;  3GBQ A;  1T3S A;  5FWB A;  3LH5 A;  1K4U S;  4AFS C;  1A0N B;  2SEM A;  1ARK A;  2GTJ A;  4J9F A;  5L23 A;  5GJW B;  2YT6 A;  1GCP A;  4Z88 A;  3VRY A;  2HDA A;  2FPD A;  2HBW A;  1HSQ A;  2OAW A;  2RQT A;  2VVK A;  4Z89 A;  2L3P A;  1WXU A;  4J9G A;  1KSW A;  3NPF A;  1RLQ C;  2KRN A;  3IQL A;  1UE9 A;  5IH2 A;  4JZ3 A;  2CUB A;  1ZUY A;  2O31 A;  4CC2 A;  2ROL A;  2EW3 A;  1ABO A;  2LP5 A;  2JS0 A;  4OMM A;  4J9I A;  3ULR B;  1AWO A;  1FMK A;  2LJ0 A;  4J9C A;  4RTV A;  2EYW A;  2KGT A;  2I0N A;  3O5Z A;  2EYX A;  2CH4 A;  1M3A A;  1PKT A;  1NEB A;  4J9H A;  2OJ2 A;  4D8D A;  2DVJ A;  1MV3 A;  1SHF A;  1YWO A;  2GBQ A;  2KBT A;  1AZE A;  2D8H A;  2LCS A;  4R0K A;  4CC4 B;  1W70 A;  3VS0 A;  4M4Z A;  3SEM A;  2W10 A;  2VWF A;  1GBQ A;  2FPE A;  1Y57 A;  2J6F A;  3C0C A;  4FSS A;  4HCK A;  2O88 A;  2KYM A;  1Z9Q A;  1LCK A;  3VS2 A;  1K0S A;  1G83 A;  1X6B A;  1AWX A;  1WDX A;  2CH4 W;  2RNA A;  2AKL A;  2DJQ A;  4RTT A;  1AWJ A;  2DRM A;  3M0R A;  1PRL C;  1T3L A;  2L2P A;  1SHG A;  3I9Q A;  3RBB B;  2CT4 A;  1OOT A;  1YNZ A;  3THK A;  2JW4 A;  3UA7 A;  2GGR A;  2EQI A;  1UJY A;  2KYB A;  3M0S A;  1X27 A;  4IIO A;  2EVR A;  3UA6 A;  3FJ5 A;  4OMP A;  4E6R A;  1ZX6 A;  4LN2 A;  2MCN A;  2CSQ A;  1NYG A;  5HCK A;  1T0J A;  1JQQ A;  1NG2 A;  2B86 A;  2KRS A;  1PNJ A;  1Z9Z A;  1H3H A;  4HVW A;  4CC7 A;  4AFU C;  1ZSG A;  1WIE A;  1M3B A;  4RTZ A;  1SRM A;  1J3T A;  4KRT A;  2MIO A;  2VKN A;  2RQV A;  1S1N A;  3KFV A;  2NWM A;  2YUO A;  1UGV A;  2K6D A;  1ZBJ A;  4F14 A;  1YP5 A;  2JXB A;  4HVU A;  1SEM A;  2KRO A;  1I1J A;  2EKH A;  4DEX A;  1VA7 A;  1ZLM A;  2JT4 A;  1SRL A;  1KIK A;  1V1C A;  4QT7 A;  5FW9 A;  1I0C A;  2KT1 A;  2M0Y A;  2DIL A;  4CC3 A;  5IHN A;  1KJW A;  1JEG A;  2O9V A;  2CRE A;  3EG1 A;  2CSI A;  1N5Z A;  1ZUK A;  1SSH A;  4GLM A;  1RLP C;  2C0T A;  2JMA A;  2A37 A;  3PE0 A;  4K11 A;  2A28 A;  1UTI A;  2ED1 A;  2W0Z A;  1HD3 A;  1K0X A;  1GCQ C;  2JMC A;  4JPB W;  1U3O A;  3PVL A;  1UG1 A;  2EBP A;  3VS3 A;  5ECA A;  2HEQ A;  2DX1 A;  2ESW A;  3EG0 A;  2J7I A;  1CSK A;  1TUD A;  1JU5 C;  2BZX A;  2ECZ A;  3ZL7 C;  4IIM A;  4F17 A;  2YSQ A;  2AZS A;  3H0I A;  2LQW A;  3RNJ A;  3SHW A;  1UHC A;  1X2K A;  2LZ6 B;  1YCS B;  1K1Z A;  2D0N A;  1HJD A;  3CQT A;  1BK2 A;  2GNC A;  2ROT A;  3VS5 A;  2YUP A;  1PHT A;  4J9E A;  2KXC A;  3VS4 A;  1CKA A;  1NEG A;  2AKK A;  2DE0 X;  2JTE A;  2CT3 A;  2LMJ A;  4Z8A A;  2LQN A;  4RTU A;  1PRM C;  1AVZ C;  2K3B A;  3I5S A;  4OMO A;  2G6F X;  2V1R A;  1W1F A;  1PKS A;  1GFC A;  2DBM A;  2MOX A;  2OI3 A;  2FEI A;  1QKX A;  1WYX A;  2DL3 A;  2LX7 A;  1WX6 A;  1UEC A;  1M8M A;  2K9G A;  1GCQ A;  1OV3 A;  1T0H A;  2NUZ A;  2AZV A;  1QLY A;  2AK5 A;  3EHQ A;  2D8J A;  1WI7 A;  4OMQ A;  1B07 A;  2EGA A;  2J05 A;  3R6N A;  2DF6 A;  1OEB A;  4OML A;  2RMO A;  1M27 C;  1BB9 A;  2YDL A;  1AEY A;  2QDL A;  2BZY A;  2H8H A;  1H8K A;  1OPK A;  2F2X A;  2PTK A;  2ED0 A;  5I11 A;  3H41 A;  1UDL A;  2M51 A;  4ESR A;  2X3W D;  1G2B A;  4ORZ A;  4DEY A;  2DM1 A;  1U5S A;  1SPK A;  4AFZ C;  2K79 A;  5IHI A;  4LUE A;  3VRZ A;  3NGP A;  4Y92 A;  3REB B;  2HCK A;  1GRI A;  2DA9 A;  2J06 A;  1QCF A;  2L0A A;  1E6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...