4LN2A

The second sh3 domain from cap/ponsin in complex with proline rich peptide from vinculin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sorbin and SH3 domain-containing protein 1
publication title Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ln2A00
1W1FA 1OPLA 1SSHA 2D0NA 3NPFA 4D8DA 3VS7A 1GCQC 1OV3A 2KGTA 3I5SA 1UHFA 4Z88A 1RLPC 2SEMA 2J7IA 3TSZA 2DBKA 4F17A 2L3SA 1X43A 3VRZA 2C0TA 5IHKA 1FMKA 4AFUC 2VVKA 2ED0A 4JZ4A 2ROTA 3H0IA 1WI7A 2D8HA 2FEIA 3GBQA 1OPKA 2CDTA 1NEGA 2P4RA 4Y92A 4RTXA 1QLYA 1UJYA 4AG2C 4F16A 2DM1A 3TVTA 1JXOA 5L23A 5IXBA 2CH4A 2LCSA 1A0NB 3RNJA 1NM7A 1PRLC 2YSQA 1I07A 1ZUKA 5ECAA 1M30A 3PE0A 1ZBJA 2K3BA 4X1VA 1MUZA 1J3TA 1UGVA 2L0AA 2RN8A 1YWPA 2PTKA 2JM8A 2KT1A 1N5ZA 1WXUA 4ORZA 3H0FA 1PNJA 1I1JA 2IIMA 2A28A 2B86A 3M0TA 1VA7A 2CREA 2GGRA 4RTYA 3THKA 1ARKA 2DYBA 2RQWA 2HBWA 4JPBW 1CSKA 1T3SA 3VS4A 2MCNA 2K7AA 5I11A 2DRMA 4LE9A 2ECZA 1RUWA 2OI3A 4JJBA 1B07A 1GFCA 1U06A 3PVLA 5FWCA 1TUCA 1M27C 1K76A 1E6HA 1H3HA 3LH5A 2EYZA 2GTJA 4J9IA 2EVRA 4E6RA 2GNCA 2HSPA 3VS5A 4J9CA 4OMQA 2W0ZA 3O5ZA 3UATA 2KE9A 1PHTA 5HCKA 2J06A 4ZNXA 2DBMA 1CKBA 1G83A 1UECA 3SEMA 3KFVA 1ZUYA 5IHIA 2C0IA 1UDLA 2J6KA 1PRMC 4CC7A 1S1NA 1PKSA 2FPFA 1ZLMA 1BK2A 2A08A 1YNZA 4J9EA 3A98A 1QKWA 1SHGA 3M0PA 2DX1A 2RMOA 2KXDA 4AFZC 2SRCA 2EGEA 1RLQC 2LJ3A 3EGUA 1QWFA 4OMPA 1K1ZA 1I0CA 1MV0B 1TG0A 4LNPA 4GBQA 4GLMA 4RTZA 4OMNA 3TSWA 1SPKA 2BZYA 2KRSA 2D8JA 5FW9A 1JXMA 3EHRA 4AFSC 4RUGA 2EYXA 1CKAA 1HJDA 2J05A 3EG3A 2RF0A 5GJVB 1Y0MA 2KR3A 2DVJA 2CSIA 2DF6A 1WIEA 1WLPB 2DILA 2ED1A 2KEAA 1GBQA 1H92A 2F2XA 2ENMA 2BZXA 1KFZA 3CQTA 2LNHB 1PKTA 4FSSA 2CT4A 1TUDA 3I9QA 2ESWA 3C0CA 1PWTA 2DRKA 2V1RA 1HSQA 1JU5C 4DEXA 2AZSA 1E6GA 1SRLA 3QWYA 4OMOA 2CSQA 1W70A 5EC7A 1U5SA 2I0NA 4LUDA 1YN8A 4RTUA 2LX7A 2FPEA 3UA6A 2FG0A 4JJCA 1M3BA 4HVWA 5FWBA 5IHNA 2MOXA 4DEYA 2C0OA 2EGCA 3VS1A 2O88A 1T0HA 1AWJA 3RBBB 1HD3A 4HXJA 1K0SA 1GRIA 1K0XA 1SEMA 2KRMA 3EG2A 2RQTA 4JJDA 3JV3A 1GBRA 2F2WA 4OMLA 2LZ6B 1Z9QA 3M0QA 1UE9A 4IIOA 1AVZC 2K6DA 3I5RA 1GCPA 2KXCA 1SRMA 2QDLA 3ZL7C 2EKHA 1NLPC 2HDAA 2XMFA 3M0UA 2EW3A 5I22A 3FJ5A 2DL3A 4F14A 4AG1C 2CUBA 2H8HA 2LJ0A 1NEBA 3ULRB 2KYBA 3VS2A 3QWXX 2CUDA 1JO8A 1KJWA 4CC2A 1AWOA 4QT7A 1JEGA 1XOVA 1G2BA 3EG1A 3VS0A 3EG0A 1QKXA 2K9GA 4Z89A 1ZX6A 1AZGB 1FYNA 1BU1A 2YT6A 2ABLA 2NUZA 3M0SA 1M3AA 2DJQA 1X2QA 2F2VA 1GL5A 2OJ2A 1RI9A 1X6BA 2E5KA 1VYVA 2DMOA 2L3QA 3EHQA 2OAWA 2KYMA 2JMAA 2VWFA 1WDXA 2FRWA 2AKKA 2AZVA 4J9FA 4CC4B 1AWWA 4RTWA 2DL7A 2KRNA 1UG1A 1T3LA 2AK5A 1EFNA 2GQIA 1BB9A 1NYGA 1AD5A 1SHFA 2JXBA 3IQLA 2DL8A 1W6XA 1AWXA 4HCKA 1ZUUA 2W10A 3REAB 1X69A 2O31A 1KSWA 1AZEA 1WFWA 3NMZC 2BTTA 2JTEA 1B3QA 2RQUA 2VKNA 3VS3A 1VYUA 2O9VA 2AKLA 2CH4W 1T0JA 4CC3A 3I35A 4Z8AA 1E7OA 4AFQC 1BBZA 4J9DA 2KT8A 4R0KA 2DE0X 2O9SA 2MIOA 3SHWA 2FPDA 2EBPA 2M0YA 2O2OA 2DL5A 1K4US 2EYWA 2FRYA 4KRTA 3H0HA 4K11A 2NWMA 2CT3A 1ABOA 2J6FA 2A36A 1UJ0A 3PVQA 2DA9A 2EPDA 1WXTA 2JMCA 2HEQA 1GCQA 1Z9ZA 3REBB 1UHCA 2KNBB 1WXBA 4J9BA 2YUOA 2GBQA 2BZ8A 2ROLA 1YP5A 5GJWB 2YUPA 5IXFA 5IH2A 4M4ZA 2LJ1A 1H8KA 1JQQA 1ABQA 1M3CA 1UTIA 4RTVA 2JW4A 1X6GA 1MV3A 2LQWA 2PNIA 2J6OA 1OEBA 2D1XA 1VYTA 2A37A 3VRYA 2PZ1A 1UUEA 2KROA 1QWEA 2JT4A 4LUEA 1QCFA 1WYXA 4RTTA 1WX6A 1NYFA 1M8MA 2M51A 4EIKA 2G6FX 4LN2A 3NGPA 2EQIA 2L2PA 2JS2A 2RPNA 4A63B 4D8KA 1IO6A 2K2MA 2DLPA 2DNUA 3UF4A 2YUQA 4HVUA 2RQVA 1V1CA 1AEYA 2EGAA 2KBTA 4HVVA 1AOJA 2JM9A 1GFDA 2V1QA 2RQRA 1OOTA 1LCKA 1U3OA 4ESRA 2HCKA 2YUNA 2LQNA 4OMMA 2LMJA 3R6NA 1NG2A 2L3PA 1KIKA 1X27A 4J9HA 3UA7A 1YWOA 3U23A 1WA7A 2DL4A 2JS0A 1UFFA 1Y57A 3NHNA 2RNAA 1YCSB 2EYYA 2GTOA 2K79A 1X2KA 1NLOC 3H41A 4J9GA 2X3WD 2LP5A 2YDLA 2X3XD 1K9AA 3VS6A 3M0RA 4IIMA 4JZ3A 1ZSGA 2FO0A 4WCIA
chains in the Genus database with same CATH superfamily
1KQ2A 4QQDA 1VIFA 1GCQC 4OGCA 3I5SA 5GAOm 1KQSP 1QW1A 2J7IA 2LC4A 2A0FB 4F17A 2NUPB 2JN0A 3A1PA 1VQ6A 1Q81U 1RAIB 1Q81R 1VQLQ 4FYYB 1M2VB 3S3MA 1NJIU 2VVKA 2KK4A 1NJIR 2FEIA 2GFUA 1NEGA 2M9UA 1QLYA 4F16A 2HL3A 5L23A 4BB7A 5IXBA 3JCMb 2CH4A 1A0NB 3RNJA 1X01A 1I07A 3KXTA 4M75B 1M30A 3PE0A 4J6WA 4JRKA 1C0MA 1QCNA 3MP8A 1J3TA 3TU4K 1Y07A 3QPHA 8AT1B 2HQHA 3CMAQ 2KT1A 2V8KA 1N5ZA 1VOMA 3AT1B 3H0FA 1PNJA 1I1JA 2XD0A 3L1AA 2A28A 2V8IA 3UDCA 4DBRA 1S72A 1VA7A 4XTXA 2CREA 4XU0A 2DYBA 2QTVA 1QCOA 2LQKA 4JPBW 3CD6T 2H3JA 3A5ZB 5C0MA 2R5AA 5KCOA 3JRZA 4E7HA 2JOYA 2QQBA 4MMLA 1BKBA 2ECZA 4PNOA 4IURA 4BE0A 2OX7A 2DPPB 1E6HA 2LT4A 1ZA2B 2YRDA 1MMDA 4B6MA 2JTMA 3J80E 1VIEA 4B9XA 4RCCA 2NUTA 1YCYA 2GNCA 2HSPA 4II1A 4L5GA 5CKDA 4CRIA 3MEUA 3FEOA 3CPWP 1Q95G 2FZGB 1I81A 3MP6A 3BFMA 4E7SA 3CCSQ 2NYSA 3KFVA 5LJ5g 3OS1A 1ZUYA 2CP0A 4A53A 1YITA 2L5QA 4EMHA 3NTIA 5D6XA 3JB9D 1IHVA 1WQ7A 1VQ9A 1ZLMA 1BK2A 2A08A 1R77A 2RI2A 4C8QF 1YNZA 2D6FA 4C0DC 4J9EA 1X75C 3A98A 2DX1A 5J3BA 1RLQC 3I55A 3UPUA 1QWFA 1D1CA 4GBQA 4FW2A 4GLMA 4M78F 1QVGP 3JCMW 3E19A 4F04B 4RTZA 2A7YA 4DBHA 4OMNA 1SPKA 2IVWA 4C8QG 2QAZA 4LXCA 5FW9A 3QBYA 4AFSC 5FU6B 1R0BG 2EYXA 2WSCE 1HJDA 1H3ZA 2J05A 3V8KA 5GAN2 3L2WA 1KHIA 1O9SA 5GANf 2VV5A 4M78G 2KEAA 1H92A 2F2XA 4C5HA 2DD4A 4M77F 4BE1A 3LLRA 2QYZA 1TXQA 3G71A 3OS0A 3FDRA 1Y7XA 1TUDA 3HP9A 3S6WA 2RO0A 5FROA 1UGQB 2DRKA 3DLMA 4BY6C 2M02A 6AT1B 1JU5C 3CPFA 2YWWA 5GAOr 1LJOA 4BDZA 1QMCA 5HK0A 4LDYA 1JRIA 1YJWA 1BIAA 5FU7C 4V2SA 3GLXA 4M77G 1JJ2S 2LX7A 4M7AF 2CP6A 5CVIA 5FWBA 2C0OA 4E47A 1T0HA 2O88A 2QG9B 1AWJA 4E2FB 3RBBB 4JRQA 3FIFA 1K0SA 4BI8B 2E70A 2COYA 1SEMA 1Q82U 3CCEQ 1M2OA 3RIRA 2QTXA 5GANh 1Q82R 3CD6Q 2RK1A 1I5LA 1TWBA 4IIOA 3EFOA 5GAOl 2K6DA 2CZ6B 4D6WA 2PVGB 2EKHA 4ZGDB 3M0UA 3MEAA 3FJPA 2CUBA 2H8HA 2P0PA 3CMET 5LJ3f 1K9MC 3J7AF 2KYBA 4LDWA 3LWIA 5I2SA 2G3RA 4NL3A 4ZTJA 3SB2A 2CUDA 1KJWA 4FL6A 4QT7A 1W2BS 1XOVA 1JB0E 4YTLA 1Y71A 3QHSA 3EG0A 2K9GA 2WSFE 2EQMA 4JS4A 3JCMc 1EX4A 1BU1A 2F2VA 1WJRA 3C12A 2RM4A 2OTJT 1GL5A 1RI9A 1PC0A 3RESA 5D6WA 2A3LA 3R6OA 1WDXA 2FRWA 1G3WA 2AKKA 2DJZA 3EAEA 3NTHA 2DO3A 4J9FA 4PFOA 4O6JA 1BB9A 2K3YA 4PJMA 2X51A 3EGDB 1NPRA 1AT1B 2I2LA 3IQLA 4OB2B 3EGDA 5LJ3h 5GAMj 3QXEB 4M7DG 3KUFA 1R8OB 2LT1A 1WFWA 1AZEA 1MNDA 1OI1A 2IG0A 3QO3A 8ATCB 3RKYA 3CCVQ 5D7UA 2VC8A 1T0JA 4ZTFA 2MPXC 3I35A 1WHGA 3S3OA 4J9DA 1VQKA 5CKFA 2DFUA 4KGZB 3JB9J 3QJ6A 2EJFA 3SHWA 1MGQA 5A2QE 2O2OA 1VQ6T 4KRTA 4K11A 3P8BB 1M1KC 4KGXB 1MMGA 2J6FA 3O8VA 1Q7YU 5J26A 3PVQA 2DA9A 2JUFA 3CCMT 1Q7YR 2HEQA 1ZSZB 1P92A 1VQ5T 3REBB 3X28B 1WXBA 4J9BA 2VXEA 2GBQA 2ROLA 1YP5A 5CO7A 2XG8D 2OAUA 1OU8A 1KD1C 4IUQA 3RDVA 4EMGA 1M3CA 2MMPA 4MMKA 2EFIA 2ZZDA 1OX8A 2LQWA 5GMKh 1FWZA 2ZGWA 2EQUA 2EYQA 3SD4A 2ZCFB 1QWEA 2JT4A 3GIBA 1WYXA 2RJEA 1NYFA 2VXFA 2M51A 2FL7A 3MEWA 1D3BA 3PNWC 1S72T 2JS2A 1LVKA 3L2UA 2DNUA 3M9QA 4C92D 4HVUA 4HT9A 2HKNA 4A54A 1AOJA 2KVQG 4OF1A 3CMEQ 3CCLA 2QA4Q 4X9DA 4C5IA 4ELZC 3ME9A 2QK0A 5LJ5f 1GFDA 4M75G 1U3OA 1LCKA 4ESRA 3J81E 1N27A 2YUNA 3MKDA 2LQNA 3FC3A 2MWOA 3HRTA 3HSBA 3R6NA 2L3PA 4J9HA 3UA7A 3U23A 1Y96B 2JS0A 4M77B 2X4JA 3NHNA 3ZFJA 3LWHA 1YCSB 2EYYA 2GTOA 2PQWA 1X2KA 4J9GA 2BUDA 5CQXA 3VS6A 3M0RA 7AT1B 1SF9A 3CBMA 4JRPA 3BDUA 3NPFA 1SSHA 3OYLA 3JB9I 1UHFA 2K2VA 4M7AB 3META 2LQ8A 3TSZA 2DBKA 5KYWB 1YITT 1H641 3SFMA 2L3SA 2FZKB 3SDZA 2C0TA 3GOXA 3INZA 2DERA 1FMKA 1M1FA 2EQJA 5LJ5h 1VQ9T 1K8AC 2ROTA 3OW2S 2QEXT 3JB9F 3T9NA 5I2MA 3G6ET 3I55T 3TVTA 5CKEA 3HKSA 4MDXA 2K3XA 3VYGA 4BE2A 3CCUA 2XICA 2LCSA 2YSQA 2MF2A 2O4XA 2C06A 4Y28E 3JB9G 5ECAA 1VQ6Q 2K3BA 4X1VA 1MUZA 2L0AA 5IAYA 1YWPA 2KSSA 1WPYA 5FLXE 4C92C 2GQVA 2CZ0B 4QQGA 4BDYA 3LH0A 3JCMJ 1ARKA 5KYUB 4J5YA 3G71T 5AT1B 4HKEA 3MCAB 3VS4A 2K7AA 4OB3B 2DRMA 2OTJA 3TEEA 2OI3A 1M27C 4CI0C 5CKBA 2HBPA 2EYZA 4XQ3A 1PD0A 4PL6A 2R57A 1S72Q 4J9CA 2LTOA 2F69A 3CCRA 3F70A 2CP2A 1YIJA 3UATA 1WGSA 2PU9B 4PKCC 1SG5A 2E5QA 5HCKA 1N8RC 2J06A 2DBMA 1YJ9A 3MO8A 3H6ZA 4PFPA 2HAXA 1O75A 4PJOD 2C0IA 1UDLA 2J6KA 1PRMC 4QKUA 1PKSA 3UWNA 2DK3A 3PFSA 3CBOA 1K73C 1SHGA 1PG5B 1MMNA 3PMIA 1QVFA 1YI2T 2SRCA 2VYTA 2RB6A 2LJ3A 2RK2A 4OMPA 4HCCA 1TG0A 2QGGA 2YLBA 2DTHA 2BZYA 2LDMA 4F7UA 1JXMA 1QQJA 3X20B 1QP3A 2B8AA 2ZAEA 3CCMA 3ASKA 5GAMg 1YITQ 1VQ5A 3EG3A 1VQPA 2RF0A 4C0DB 1VQ9Q 2HNIA 2E3HA 2DF6A 2XU8A 3CBPA 4EMKC 3QUIA 1WLPB 1GBQA 3OW2A 2LNHB 3E1SA 3URGA 3I55Q 4FSSA 1SSFA 4DOVA 1PWTA 5A0DA 1HSQA 3X24B 4A4GA 3JCMd 4OMOA 1E6GA 1UGSB 1IGQA 2DD5A 1U5SA 4LUDA 4PJLA 1YN8A 1G5VA 2QQ9A 1U1SA 1JBMA 4FIBA 3OYJA 3RKXA 1VQKT 4BACA 2FZCB 1HD3A 1G3TA 1GRIA 4E7ZA 4J7IA 2KRMA 1D0YA 3EG2A 3G71Q 1BIBA 1RACB 4JJDA 4BY6B 3JV3A 4OMLA 4PJOC 3M0QA 1VQOA 4E7JA 2NUTB 5KYXA 3QIIA 2DEUA 2BE7D 3ZL7C 3L2RA 5FU7B 3VKIA 5CCAA 3E2UA 1YJWQ 4OP0A 3OS5A 3OQ5A 1OQKA 2LJ0A 3ULRB 4KT0E 3OSVA 3VS2A 3V8LA 4F7UE 1IHWA 5I21A 2Z0WA 5C6SA 4CC2A 2MYSA 5CKHA 3L2ZA 1G2BA 3EG1A 3OYYA 4FT4A 3VS0A 3DB3A 1QKXA 1Q81C 1AZGB 1FYNA 2YT6A 2RHYA 4KH0B 1M3AA 1NJIC 2OJ2A 2KMTA 1X6BA 2E5KA 2L3QA 2QEXA 2KYMA 1AWWA 4CC4B 1JJ2P 2KRNA 3G6EA 1UG1A 1TU0B 3CCLT 1T3LA 4N4GA 2HZYA 4J83A 2AK5A 1EFNA 1PSEA 4B9WA 3BY7A 1N9SA 1HYOA 3HL8A 1AD5A 4A4EA 3OYIA 2JXBA 1W6XA 4N4IA 4XK8E 1ZUUA 2CYZB 1RABB 4OGEA 4QVDA 1Q86U 2MI6A 2O31A 3HHTB 1Q86R 2AT1B 1WHHA 2BTTA 1IZ6A 1VQNT 3CMAA 1TS9A 2ZPGB 2R5MA 4CC3A 1C6VX 2DAQA 4Z8AA 4AFQC 1BBZA 3GP8A 3RMQA 2K5FA 5GANj 1N6AA 2DE0X 3DKMA 1VUBA 3CPWS 1NBEB 1V29B 1W2BP 1YHQA 1UB4A 1RAGB 3CC4T 2FRYA 3TQ7P 3VYHB 2GFAA 1D0ZA 2CT3A 1ZHIA 2A36A 1WXTA 2DEQA 3JCMQ 1Z9ZA 2EWNA 1UHCA 3S3NA 1WHJA 1VQ4T 3WVEB 3EFOB 1QVPA 5IH2A 4M4ZA 2BE9B 1UTIA 3CCUT 4M7AG 3QZ9B 1VQKQ 4N0AA 2J6OA 2D1XA 1BI0A 3VRYA 4FW1A 4QVCA 3LYIA 2BIVA 1TUGB 2PZ1A 4PJJA 3VUBA 3HRSA 3CCSA 1LOJA 1WHMA 3VJPA 5CR2A 1WX6A 3LX7A 4BI3A 4RG8A 3LGFA 3NGPA 2RH2A 2RPNA 4A63B 1KQSA 5CK9A 3MJXA 1RI0A 2K2MA 2QDYB 4J8OA 2F1LA 1YI2A 2DXBA 1ZBXA 4HVVA 2JM9A 4KGVB 1G3SA 2RQRA 5LJ3j 3OYDA 1WJQA 4LDUA 5KH6A 1X27A 4KUDK 1YWOA 2VB6A 2DL4A 5GMKi 3OSSC 1Y57A 4HCZA 4ANJA 3ER0A 4R55A 3CCRT 2X3WD 1YIJT 2YDLA 1D1AA 1K9AA 4ATOA 4IIMA 3CCLQ 3N5BB 3KBGA 5GANd 2KDSA 1W1FA 1YFNA 1YJ9T 1OV3A 2VGMA 9ATCB 5GAMf 2FYKA 4WTOB 2DTOA 5KYNA 5DM7R 4NOYA 4MDWA 3A8GB 1FXXA 4KUIA 3MHXA 3H0IA 4LD9K 2CDTA 2P4RA 4N0AC 3H8ZA 4Y92A 2KI7A 1UJYA 1FX7A 4DBFA 4NS5A 1Q82C 3OMGA 5EG2A 5GMKj 2M0OA 3FB9A 2EJGA 2DYIA 1PRLC 4F7UF 2CP5A 4XTVA 3ZEHA 3CC2A 1ZBJA 4ZGJB 1M90U 1UGVA 2AHJB 2RN8A 1VQPT 3CXCP 5KCHA 1KC8U 3CPWA 1M90R 4JRIA 2JM8A 1WXUA 1KC8R 2ZPIB 5GAMe 3M0TA 4F7UG 3CCQA 2GGRA 1WHLA 2RHUA 1D3BB 4N4HA 5GAN3 1GXIE 5LJ3d 3CCUQ 4AMCA 1RADB 4LE9A 4JJBA 1B07A 1GFCA 5FWCA 3PVLA 5HY6A 3EG9A 1TUCA 1EIFA 4C92B 1QVGA 1MHNA 1H3HA 3LH5A 2GTJA 4FSXA 2FB7A 4C92A 3VS5A 2CGHA 1VQ8T 3JAME 4OMQA 3OYCA 2W0ZA 2HD0A 4XTYA 3OYMA 4PFZA 1VQOT 1EZZB 3OYEA 4Q5WA 1G83A 3X26B 5A0LA 2E4HA 1QVFS 1ZA1B 3E9GA 5LJ5j 2OTJQ 3V7RA 3G4SA 2AIRB 1VQNA 1WQWA 2CP3A 4DBQA 2FPFA 4KH1B 5GAN5 3QSUA 2R58A 3A8HB 3G1JA 3H9NA 5CQYA 1F1BB 3MPUB 3M0PA 2QXFA 3M55A 3PGGA 2KXDA 2HQEA 4J7FA 2EGEA 3CCRQ 3EH1A 3EGUA 3X25B 1K1ZA 1I0CA 4LNPA 2X4YA 3CC4A 3TSWA 1UGPB 3RUXA 2VASA 2YXYA 1YJ9Q 1Q7YC 1TTHB 1IRXA 3EHRA 4KULA 3PMTA 1CKAA 2E1HA 2XI9A 1Y0MA 2KR3A 2DVJA 4FM4B 2COZA 2O4XB 3EFRA 1VQ4A 5GMKm 3BDLA 3OB9A 3OYNA 1VQMA 2YRCA 2ENMA 2BZXA 2QQSA 1ACMB 2K5LA 2CKKA 2QI2A 1IREB 4JJNK 1IGUA 1PKTA 2YHTA 4OB1B 3I9QA 5AYFA 2ESWA 1I5OB 2V1RA 1NE8A 2DVEA 4LDXA 4DEXA 2AZSA 4IUVA 1SRLA 4DA4A 5GAOn 2LVMA 3JB9H 1R0CB 1VQ7A 4C92E 3M59A 2ZPBB 4C8QC 3CCMQ 4C0GA 3CMAT 3C4SA 1VQ5Q 1VQPQ 1UEBA 2FPEA 4EMKB 5IHNA 1M3BA 4HVWA 3EGXB 4MZMA 3VS1A 4Z02A 1M9SA 4M78C 3A8MB 4EMKA 1YHQT 3EGXA 1YJNA 4L6V5 1GBRA 2F2WA 3WVDB 4E7KA 2LZ6B 1Z9QA 3JSCA 3V7SA 1UE9A 1AVZC 5GAN7 3I5RA 5LJ5d 1GCPA 3PIPA 1SRMA 2QDLA 1NLPC 5I22A 2DL3A 3SWNC 4HT8A 2DKGA 2VGNA 2MWPA 3QWXX 4NL2A 4M7DD 1JO8A 1JEGA 2LRQA 3QDFA 4M7DA 2HKQB 4PJOB 1ZX6A 3CCST 2ABLA 4RG2A 1XJWB 1VQOQ 1MMAA 2NUZA 3M0SA 4PK4A 1X2QA 3CC7A 2E3IA 4PJOA 3D7SB 5KE3A 3EHQA 2L8DA 4IKFA 3JCMe 2VWFA 3AHUA 4RTWA 4HA8A 2DL7A 2E10A 2QASA 2E64A 2VUBA 1NZ9A 3M53A 4F7UB 4JDSA 4KBMB 4OB0B 3M57A 4XU1A 2K4YA 2GF7A 3L42A 4QW2A 2QGFB 1SHFA 2DL8A 1KHCA 1AWXA 2L89A 3PIOA 2W10A 4E7IA 3OBWA 1RL2A 2DIGA 2K57A 3E9FA 1KSWA 5FRNA 2QEXQ 2RQUA 2VKNA 3VS3A 4QQ6A 1D1BA 2MAMA 2OTLA 2O9VA 2NUPA 4IUPA 3G6EQ 1E7OA 3BE3A 2RJDA 2F5TX 1M2VA 3PTAA 2KT8A 2XIDA 2NLUA 1M4ZA 4XU3A 2DXCA 4R0KA 2MIOA 4DOWA 2EBPA 2DL5A 1K4US 2EYWA 3H0HA 2NWMA 3RMSA 1OZ3A 1ABOA 2V26A 3PT9A 4JUVA 2EPDA 2JMCA 2XDBA 4ME7A 4M75D 2RHXA 2KNBB 3EH2A 4M7DC 2YUOA 4MZTA 4M7DE 4M75A 1VQ8A 4A4KA 1HK9A 2DZ9A 5L8RE 5DLOA 2YUPA 5IXFA 5KYXB 3CCJA 3OBYA 2P0QA 3L2VA 5DY9A 1W4SA 3OYHA 2JW4A 2X4WA 2HQXA 2XKOC 3A8LB 1X6GA 1MV3A 4PJOE 3JCMP 2PNIA 1KQSS 3CCET 4PLIA 3I56A 2DTIA 3JCMV 1OEBA 3CC2T 3GPLA 1YHQQ 1VYTA 2A37A 3GNFB 2P84A 2KROA 2V8JA 2PUKB 4RTTA 1M8MA 2LNVA 4XTZA 3DLLA 3FRNA 2F5KA 1XQHA 3CCQT 2Y4YA 4LDVA 4QVZA 2DLPA 3M56A 1BCOA 5GMKl 2P0KA 2M1HA 2RJFA 1B7TA 2V1QA 2EIFA 2HCKA 2QQAA 1D0XA 4OMFB 1NG2A 1WZOA 3QKJA 1VQLA 1M5Q1 3VU3C 1KIKA 1KG1A 4BD3A 1UFFA 3OA6A 2K79A 3VV0A 4C92F 2LP5A 2X3XD 1YI2Q 1K9MU 2K5IA 3LGLA 5DLQE 4WCIA 4XTUA 1K9MR 3OYKA 1OPLA 2D0NA 3QG1A 4X34A 2ATCB 2L3RA 4UC4A 3VS7A 4D8DA 4FCYA 2KGTA 4FYWB 4Z88A 1G8XA 1RLPC 2SEMA 4LD6A 4C92G 4RCBA 4M75C 1X43A 4JS5A 3VRZA 3G4ST 2PVDB 4M75E 2ZPHB 5IHKA 4P5NA 4AFUC 4J6XA 3EFSA 2ED0A 2XK0A 4JZ4A 1B34B 1WI7A 2D8HA 3GBQA 1HXDA 1OPKA 3OYGA 4RTXA 4AG2C 3CCVT 3MP1A 2DM1A 1B34A 2COWA 4HCBA 3M54A 1JXOA 1KQ1A 4C5GA 3QYHB 2FHDA 1NM7A 3VUZA 2EQKA 1ZUKA 1BI1A 1QP2A 4FYVB 2E6ZA 2PTKA 4FYXB 4ORZA 4GY5A 4JLIA 3HFOA 5GAN4 4BUGA 1X6OA 1KK7A 1PSFA 2IIMA 2FVUA 1VQMT 2B86A 2D9TA 4RTYA 3THKA 5IT9E 4ELYC 4A4HA 2RQWA 3HFNA 2HBWA 1QVGS 5GAN6 1OX9A 1CSKA 1T3SA 3JCMg 2MCNA 5I11A 1M8VA 1VQ7T 1RUWA 3TCJA 2JZ2A 2HL5C 3CC2Q 1M1KU 5M9OA 1U06A 1TOVA 5GANe 1M1KR 1K76A 1BI3A 4GLKA 2LX9A 3LW5E 3UT1A 3NTKA 4J9IA 2EVRA 4EPCA 4E6RA 3A8OB 2X35A 3M4YA 4TVRA 4ZGEB 4X9CA 3CCQQ 1YJNT 3O5ZA 2KE9A 1ZQ1A 2QA4T 1PM3A 2M16A 1KD1U 1PHTA 5KYYB 1KD1R 2PVOB 2Y90A 3OMCA 5CIUA 1DJ7B 4ZNXA 1U1TA 1Q86C 1CKBA 1UECA 3SEMA 2JNGA 5KYYA 1U8RA 4R56A 5IHIA 5HK3A 5GAOq 5FU6C 4CC7A 2HSEB 1S1NA 5CAIA 1IB8A 2DZCA 1QKWA 3QDRB 1BYMA 2RMOA 4AFZC 2EKOA 4M7DF 1MV0B 2HMAA 3C95A 3OS2A 3WXMB 3CC7T 2JJ9A 2KRSA 2D8JA 3GNGA 2KY9A 4RKUE 4PJOF 1XTDA 4RUGA 4Y91A 1I4K1 3G4SQ 5LJ3e 1VQNQ 1BI2A 5GJVB 4RMOA 4IUTA 2CSIA 1LPLA 2RD1A 1WIEA 2DILA 2ED1A 1KFZA 4PLLA 4PJOG 3P8HA 3CQTA 3CCEA 3TREA 2CT4A 3CD6A 3C0CA 3CC4Q 1I8FA 3QWYA 2CSQA 1W70A 5EC7A 2CP7A 2Y4XA 5LL6S 2DXUA 3BW1A 5GAMh 2BKDN 3OY9A 2I0NA 1QVFP 2GCXA 4RTUA 2OTLT 2YRVA 1K8AU 3UA6A 2KAFA 2FG0A 4JJCA 1K8AR 1VQ4Q 3JCMX 2MOXA 4DEYA 2EGCA 3GF5A 3V8JA 5D6YA 1VQMQ 1LNXA 2DIQA 3EG9B 4HXJA 2D0QB 1K0XA 1MNEA 1ZSZA 2RQTA 1JJ2A 5J39A 4PJNA 1NPPA 4XU2A 4C0FA 2CZ7B 2KXCA 5HKCA 4ZN1A 4C8QB 5GMKe 1VQ7Q 4L59A 2HDAA 2XMFA 2ZPFB 3OW2P 2EW3A 4C8QD 4XAXB 2IPOB 1RAEB 1OZ2A 3FJ5A 4F14A 4AG1C 4M75F 4C8QA 3CCJT 1NEBA 2X9HA 1YBYA 1V76A 4M78B 1AWOA 3I56T 4EDUA 1OULA 2QQRA 4FU6A 4M78D 5FRMA 3OYFA 1YJNQ 2LCCA 4Z89A 4M78A 3HPWA 1WHKA 2DJQA 4IUUA 1VYVA 2DMOA 3CXCS 3QYGB 5GAMd 2OAWA 1W2BA 3SWNB 1WNLA 2JMAA 2RI3A 2AZVA 3CCVA 4JLGA 2MK5A 1YIJQ 3OYAA 4M77D 4E7LA 1TH7A 2YLCA 3SWNA 2GQIA 5GAN8 1Y96A 4M77A 1RAHB 1BCMA 1NYGA 3G7ZA 1VQLT 4HCKA 3RR6A 1M90C 1N8RU 4WF2A 1KC8C 3REAB 1X69A 1N8RR 3CC7Q 2JTFA 4M7AD 4ZN3A 4C5EA 3RKWA 2RHZA 3MEVA 3NMZC 2JTEA 1B3QA 2E6NA 1ZSZC 1IXDA 4M7AA 2WSEE 2XDDA 1VYUA 5KYWA 2AKLA 2CH4W 5LJ5e 1K73U 3Q1JA 1PD1A 1K73R 5GANg 4MZPA 1OU9A 2O9SA 3CEYA 3M58A 1PCXA 2FPDA 2M0YA 1D09B 3FLGA 4AT1B 3M4GA 3V7CA 3M5AA 4C8QE 1N9RA 2JVVA 1UJ0A 2RJCA 1GCQA 5A0GA 2WACA 3HRUA 2E41A 2KQWA 1WJSA 3P8DA 2BZ8A 2DETA 2OTLQ 1RAFB 1XNIA 2E12A 5GJWB 4OVAA 4M78E 2XHCA 4FT2A 3JCMf 2EJ9A 2E65A 3CMEA 2LJ1A 2QA4A 1H8KA 1JQQA 1ABQA 2RA2A 4RTVA 1UGRB 4VUBA 5KE2A 4DQ2A 2X4XA 1SKUB 2CS7A 3L2QA 3C94A 1UUEA 3QJYA 2ZPEB 4LUEA 5KYUA 1QCFA 4C0ZA 4EIKA 1YJWT 4J6YA 2G6FX 4LN2A 4M77C 4M7DB 2EQIA 2L2PA 4M77E 4D8KA 2PUOB 1FMVA 1IO6A 2DXTA 3UF4A 2YUQA 4O5VA 1VQ8Q 3DB4A 2RQVA 1V1CA 1AEYA 2EGAA 2KBTA 3CCJQ 2O01E 1FMWA 3QZ5B 1OYXA 5LJ3g 1OOTA 3OYBA 3I56Q 1M1GA 4A4FA 3ZBDA 4OMMA 2LMJA 2RHIA 4M7AC 4M7AE 3JCMh 5IN1A 5GAOp 2XDPA 1WA7A 2H3EB 1TSFA 4BI4A 2EAYA 2RNAA 3RERA 1NLOC 3H41A 1AHJB 3HTRA 2P4TA 2CZ1B 4XTWA 1G3YA 2LCLA 3NFCA 3CXCA 2RI5A 4JZ3A 1ZSGA 1RAAB 2FO0A 1C1AA
chains in the Genus database with same CATH topology
1W1FA 1OPLA 1SSHA 2D0NA 3NPFA 4D8DA 3VS7A 1GCQC 1OV3A 2KGTA 3I5SA 1UHFA 4Z88A 1RLPC 2SEMA 2J7IA 3TSZA 2DBKA 4F17A 2L3SA 1X43A 3VRZA 2C0TA 5IHKA 1FMKA 4AFUC 2VVKA 2ED0A 4JZ4A 2ROTA 3H0IA 1WI7A 2D8HA 2FEIA 3GBQA 1OPKA 2CDTA 1NEGA 2P4RA 4Y92A 4RTXA 1QLYA 1UJYA 4AG2C 4F16A 2DM1A 3TVTA 1JXOA 5L23A 5IXBA 2CH4A 2LCSA 1A0NB 3RNJA 1NM7A 1PRLC 2YSQA 1I07A 1ZUKA 5ECAA 1M30A 3PE0A 1ZBJA 2K3BA 4X1VA 1MUZA 1J3TA 1UGVA 2L0AA 2RN8A 1YWPA 2PTKA 2JM8A 2KT1A 1N5ZA 1WXUA 4ORZA 3H0FA 1PNJA 1I1JA 2IIMA 2A28A 2B86A 3M0TA 1VA7A 2CREA 2GGRA 4RTYA 3THKA 1ARKA 2DYBA 2RQWA 2HBWA 4JPBW 1CSKA 1T3SA 3VS4A 2MCNA 2K7AA 5I11A 2DRMA 4LE9A 2ECZA 1RUWA 2OI3A 4JJBA 1B07A 1GFCA 1U06A 3PVLA 5FWCA 1TUCA 1M27C 1K76A 1E6HA 1H3HA 3LH5A 2EYZA 2GTJA 4J9IA 2EVRA 4E6RA 2GNCA 2HSPA 3VS5A 4J9CA 4OMQA 2W0ZA 3O5ZA 3UATA 2KE9A 1PHTA 5HCKA 2J06A 4ZNXA 2DBMA 1CKBA 1G83A 1UECA 3SEMA 3KFVA 1ZUYA 5IHIA 2C0IA 1UDLA 2J6KA 1PRMC 4CC7A 1S1NA 1PKSA 2FPFA 1ZLMA 1BK2A 2A08A 1YNZA 4J9EA 3A98A 1QKWA 1SHGA 3M0PA 2DX1A 2RMOA 2KXDA 4AFZC 2SRCA 2EGEA 1RLQC 2LJ3A 3EGUA 1QWFA 4OMPA 1K1ZA 1I0CA 1MV0B 1TG0A 4LNPA 4GBQA 4GLMA 4RTZA 4OMNA 3TSWA 1SPKA 2BZYA 2KRSA 2D8JA 5FW9A 1JXMA 3EHRA 4AFSC 4RUGA 2EYXA 1CKAA 1HJDA 2J05A 3EG3A 2RF0A 5GJVB 1Y0MA 2KR3A 2DVJA 2CSIA 2DF6A 1WIEA 1WLPB 2DILA 2ED1A 2KEAA 1GBQA 1H92A 2F2XA 2ENMA 2BZXA 1KFZA 3CQTA 2LNHB 1PKTA 4FSSA 2CT4A 1TUDA 3I9QA 2ESWA 3C0CA 1PWTA 2DRKA 2V1RA 1HSQA 1JU5C 4DEXA 2AZSA 1E6GA 1SRLA 3QWYA 4OMOA 2CSQA 1W70A 5EC7A 1U5SA 2I0NA 4LUDA 1YN8A 4RTUA 2LX7A 2FPEA 3UA6A 2FG0A 4JJCA 1M3BA 4HVWA 5FWBA 5IHNA 2MOXA 4DEYA 2C0OA 2EGCA 3VS1A 2O88A 1T0HA 1AWJA 3RBBB 1HD3A 4HXJA 1K0SA 1GRIA 1K0XA 1SEMA 2KRMA 3EG2A 2RQTA 4JJDA 3JV3A 1GBRA 2F2WA 4OMLA 2LZ6B 1Z9QA 3M0QA 1UE9A 4IIOA 1AVZC 2K6DA 3I5RA 1GCPA 2KXCA 1SRMA 2QDLA 3ZL7C 2EKHA 1NLPC 2HDAA 2XMFA 3M0UA 2EW3A 5I22A 3FJ5A 2DL3A 4F14A 4AG1C 2CUBA 2H8HA 2LJ0A 1NEBA 3ULRB 2KYBA 3VS2A 3QWXX 2CUDA 1JO8A 1KJWA 4CC2A 1AWOA 4QT7A 1JEGA 1XOVA 1G2BA 3EG1A 3VS0A 3EG0A 1QKXA 2K9GA 4Z89A 1ZX6A 1AZGB 1FYNA 1BU1A 2YT6A 2ABLA 2NUZA 3M0SA 1M3AA 2DJQA 1X2QA 2F2VA 1GL5A 2OJ2A 1RI9A 1X6BA 2E5KA 1VYVA 2DMOA 2L3QA 3EHQA 2OAWA 2KYMA 2JMAA 2VWFA 1WDXA 2FRWA 2AKKA 2AZVA 4J9FA 4CC4B 1AWWA 4RTWA 2DL7A 2KRNA 1UG1A 1T3LA 2AK5A 1EFNA 2GQIA 1BB9A 1NYGA 1AD5A 1SHFA 2JXBA 3IQLA 2DL8A 1W6XA 1AWXA 4HCKA 1ZUUA 2W10A 3REAB 1X69A 2O31A 1KSWA 1AZEA 1WFWA 3NMZC 2BTTA 2JTEA 1B3QA 2RQUA 2VKNA 3VS3A 1VYUA 2O9VA 2AKLA 2CH4W 1T0JA 4CC3A 3I35A 4Z8AA 1E7OA 4AFQC 1BBZA 4J9DA 2KT8A 4R0KA 2DE0X 2O9SA 2MIOA 3SHWA 2FPDA 2EBPA 2M0YA 2O2OA 2DL5A 1K4US 2EYWA 2FRYA 4KRTA 3H0HA 4K11A 2NWMA 2CT3A 1ABOA 2J6FA 2A36A 1UJ0A 3PVQA 2DA9A 2EPDA 1WXTA 2JMCA 2HEQA 1GCQA 1Z9ZA 3REBB 1UHCA 2KNBB 1WXBA 4J9BA 2YUOA 2GBQA 2BZ8A 2ROLA 1YP5A 5GJWB 2YUPA 5IXFA 5IH2A 4M4ZA 2LJ1A 1H8KA 1JQQA 1ABQA 1M3CA 1UTIA 4RTVA 2JW4A 1X6GA 1MV3A 2LQWA 2PNIA 2J6OA 1OEBA 2D1XA 1VYTA 2A37A 3VRYA 2PZ1A 1UUEA 2KROA 1QWEA 2JT4A 4LUEA 1QCFA 1WYXA 4RTTA 1WX6A 1NYFA 1M8MA 2M51A 4EIKA 2G6FX 4LN2A 3NGPA 2EQIA 2L2PA 2JS2A 2RPNA 4A63B 4D8KA 1IO6A 2K2MA 2DLPA 2DNUA 3UF4A 2YUQA 4HVUA 2RQVA 1V1CA 1AEYA 2EGAA 2KBTA 4HVVA 1AOJA 2JM9A 1GFDA 2V1QA 2RQRA 1OOTA 1LCKA 1U3OA 4ESRA 2HCKA 2YUNA 2LQNA 4OMMA 2LMJA 3R6NA 1NG2A 2L3PA 1KIKA 1X27A 4J9HA 3UA7A 1YWOA 3U23A 1WA7A 2DL4A 2JS0A 1UFFA 1Y57A 3NHNA 2RNAA 1YCSB 2EYYA 2GTOA 2K79A 1X2KA 1NLOC 3H41A 4J9GA 2X3WD 2LP5A 2YDLA 2X3XD 1K9AA 3VS6A 3M0RA 4IIMA 4JZ3A 1ZSGA 2FO0A 4WCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1F A;  1OPL A;  1SSH A;  2D0N A;  3NPF A;  4D8D A;  3VS7 A;  1GCQ C;  1OV3 A;  2KGT A;  3I5S A;  1UHF A;  4Z88 A;  1RLP C;  2SEM A;  2J7I A;  3TSZ A;  2DBK A;  4F17 A;  2L3S A;  1X43 A;  3VRZ A;  2C0T A;  5IHK A;  1FMK A;  4AFU C;  2VVK A;  2ED0 A;  4JZ4 A;  2ROT A;  3H0I A;  1WI7 A;  2D8H A;  2FEI A;  3GBQ A;  1OPK A;  2CDT A;  1NEG A;  2P4R A;  4Y92 A;  4RTX A;  1QLY A;  1UJY A;  4AG2 C;  4F16 A;  2DM1 A;  3TVT A;  1JXO A;  5L23 A;  5IXB A;  2CH4 A;  2LCS A;  1A0N B;  3RNJ A;  1NM7 A;  1PRL C;  2YSQ A;  1I07 A;  1ZUK A;  5ECA A;  1M30 A;  3PE0 A;  1ZBJ A;  2K3B A;  4X1V A;  1MUZ A;  1J3T A;  1UGV A;  2L0A A;  2RN8 A;  1YWP A;  2PTK A;  2JM8 A;  2KT1 A;  1N5Z A;  1WXU A;  4ORZ A;  3H0F A;  1PNJ A;  1I1J A;  2IIM A;  2A28 A;  2B86 A;  3M0T A;  1VA7 A;  2CRE A;  2GGR A;  4RTY A;  3THK A;  1ARK A;  2DYB A;  2RQW A;  2HBW A;  4JPB W;  1CSK A;  1T3S A;  3VS4 A;  2MCN A;  2K7A A;  5I11 A;  2DRM A;  4LE9 A;  2ECZ A;  1RUW A;  2OI3 A;  4JJB A;  1B07 A;  1GFC A;  1U06 A;  3PVL A;  5FWC A;  1TUC A;  1M27 C;  1K76 A;  1E6H A;  1H3H A;  3LH5 A;  2EYZ A;  2GTJ A;  4J9I A;  2EVR A;  4E6R A;  2GNC A;  2HSP A;  3VS5 A;  4J9C A;  4OMQ A;  2W0Z A;  3O5Z A;  3UAT A;  2KE9 A;  1PHT A;  5HCK A;  2J06 A;  4ZNX A;  2DBM A;  1CKB A;  1G83 A;  1UEC A;  3SEM A;  3KFV A;  1ZUY A;  5IHI A;  2C0I A;  1UDL A;  2J6K A;  1PRM C;  4CC7 A;  1S1N A;  1PKS A;  2FPF A;  1ZLM A;  1BK2 A;  2A08 A;  1YNZ A;  4J9E A;  3A98 A;  1QKW A;  1SHG A;  3M0P A;  2DX1 A;  2RMO A;  2KXD A;  4AFZ C;  2SRC A;  2EGE A;  1RLQ C;  2LJ3 A;  3EGU A;  1QWF A;  4OMP A;  1K1Z A;  1I0C A;  1MV0 B;  1TG0 A;  4LNP A;  4GBQ A;  4GLM A;  4RTZ A;  4OMN A;  3TSW A;  1SPK A;  2BZY A;  2KRS A;  2D8J A;  5FW9 A;  1JXM A;  3EHR A;  4AFS C;  4RUG A;  2EYX A;  1CKA A;  1HJD A;  2J05 A;  3EG3 A;  2RF0 A;  5GJV B;  1Y0M A;  2KR3 A;  2DVJ A;  2CSI A;  2DF6 A;  1WIE A;  1WLP B;  2DIL A;  2ED1 A;  2KEA A;  1GBQ A;  1H92 A;  2F2X A;  2ENM A;  2BZX A;  1KFZ A;  3CQT A;  2LNH B;  1PKT A;  4FSS A;  2CT4 A;  1TUD A;  3I9Q A;  2ESW A;  3C0C A;  1PWT A;  2DRK A;  2V1R A;  1HSQ A;  1JU5 C;  4DEX A;  2AZS A;  1E6G A;  1SRL A;  3QWY A;  4OMO A;  2CSQ A;  1W70 A;  5EC7 A;  1U5S A;  2I0N A;  4LUD A;  1YN8 A;  4RTU A;  2LX7 A;  2FPE A;  3UA6 A;  2FG0 A;  4JJC A;  1M3B A;  4HVW A;  5FWB A;  5IHN A;  2MOX A;  4DEY A;  2C0O A;  2EGC A;  3VS1 A;  2O88 A;  1T0H A;  1AWJ A;  3RBB B;  1HD3 A;  4HXJ A;  1K0S A;  1GRI A;  1K0X A;  1SEM A;  2KRM A;  3EG2 A;  2RQT A;  4JJD A;  3JV3 A;  1GBR A;  2F2W A;  4OML A;  2LZ6 B;  1Z9Q A;  3M0Q A;  1UE9 A;  4IIO A;  1AVZ C;  2K6D A;  3I5R A;  1GCP A;  2KXC A;  1SRM A;  2QDL A;  3ZL7 C;  2EKH A;  1NLP C;  2HDA A;  2XMF A;  3M0U A;  2EW3 A;  5I22 A;  3FJ5 A;  2DL3 A;  4F14 A;  4AG1 C;  2CUB A;  2H8H A;  2LJ0 A;  1NEB A;  3ULR B;  2KYB A;  3VS2 A;  3QWX X;  2CUD A;  1JO8 A;  1KJW A;  4CC2 A;  1AWO A;  4QT7 A;  1JEG A;  1XOV A;  1G2B A;  3EG1 A;  3VS0 A;  3EG0 A;  1QKX A;  2K9G A;  4Z89 A;  1ZX6 A;  1AZG B;  1FYN A;  1BU1 A;  2YT6 A;  2ABL A;  2NUZ A;  3M0S A;  1M3A A;  2DJQ A;  1X2Q A;  2F2V A;  1GL5 A;  2OJ2 A;  1RI9 A;  1X6B A;  2E5K A;  1VYV A;  2DMO A;  2L3Q A;  3EHQ A;  2OAW A;  2KYM A;  2JMA A;  2VWF A;  1WDX A;  2FRW A;  2AKK A;  2AZV A;  4J9F A;  4CC4 B;  1AWW A;  4RTW A;  2DL7 A;  2KRN A;  1UG1 A;  1T3L A;  2AK5 A;  1EFN A;  2GQI A;  1BB9 A;  1NYG A;  1AD5 A;  1SHF A;  2JXB A;  3IQL A;  2DL8 A;  1W6X A;  1AWX A;  4HCK A;  1ZUU A;  2W10 A;  3REA B;  1X69 A;  2O31 A;  1KSW A;  1AZE A;  1WFW A;  3NMZ C;  2BTT A;  2JTE A;  1B3Q A;  2RQU A;  2VKN A;  3VS3 A;  1VYU A;  2O9V A;  2AKL A;  2CH4 W;  1T0J A;  4CC3 A;  3I35 A;  4Z8A A;  1E7O A;  4AFQ C;  1BBZ A;  4J9D A;  2KT8 A;  4R0K A;  2DE0 X;  2O9S A;  2MIO A;  3SHW A;  2FPD A;  2EBP A;  2M0Y A;  2O2O A;  2DL5 A;  1K4U S;  2EYW A;  2FRY A;  4KRT A;  3H0H A;  4K11 A;  2NWM A;  2CT3 A;  1ABO A;  2J6F A;  2A36 A;  1UJ0 A;  3PVQ A;  2DA9 A;  2EPD A;  1WXT A;  2JMC A;  2HEQ A;  1GCQ A;  1Z9Z A;  3REB B;  1UHC A;  2KNB B;  1WXB A;  4J9B A;  2YUO A;  2GBQ A;  2BZ8 A;  2ROL A;  1YP5 A;  5GJW B;  2YUP A;  5IXF A;  5IH2 A;  4M4Z A;  2LJ1 A;  1H8K A;  1JQQ A;  1ABQ A;  1M3C A;  1UTI A;  4RTV A;  2JW4 A;  1X6G A;  1MV3 A;  2LQW A;  2PNI A;  2J6O A;  1OEB A;  2D1X A;  1VYT A;  2A37 A;  3VRY A;  2PZ1 A;  1UUE A;  2KRO A;  1QWE A;  2JT4 A;  4LUE A;  1QCF A;  1WYX A;  4RTT A;  1WX6 A;  1NYF A;  1M8M A;  2M51 A;  4EIK A;  2G6F X;  4LN2 A;  3NGP A;  2EQI A;  2L2P A;  2JS2 A;  2RPN A;  4A63 B;  4D8K A;  1IO6 A;  2K2M A;  2DLP A;  2DNU A;  3UF4 A;  2YUQ A;  4HVU A;  2RQV A;  1V1C A;  1AEY A;  2EGA A;  2KBT A;  4HVV A;  1AOJ A;  2JM9 A;  1GFD A;  2V1Q A;  2RQR A;  1OOT A;  1LCK A;  1U3O A;  4ESR A;  2HCK A;  2YUN A;  2LQN A;  4OMM A;  2LMJ A;  3R6N A;  1NG2 A;  2L3P A;  1KIK A;  1X27 A;  4J9H A;  3UA7 A;  1YWO A;  3U23 A;  1WA7 A;  2DL4 A;  2JS0 A;  1UFF A;  1Y57 A;  3NHN A;  2RNA A;  1YCS B;  2EYY A;  2GTO A;  2K79 A;  1X2K A;  1NLO C;  3H41 A;  4J9G A;  2X3W D;  2LP5 A;  2YDL A;  2X3X D;  1K9A A;  3VS6 A;  3M0R A;  4IIM A;  4JZ3 A;  1ZSG A;  2FO0 A;  4WCI A; 
#chains in the Genus database with same CATH topology
 1KQ2 A;  4QQD A;  1VIF A;  1GCQ C;  4OGC A;  3I5S A;  5GAO m;  1KQS P;  1QW1 A;  2J7I A;  2LC4 A;  2A0F B;  4F17 A;  2NUP B;  2JN0 A;  3A1P A;  1VQ6 A;  1Q81 U;  1RAI B;  1Q81 R;  1VQL Q;  4FYY B;  1M2V B;  3S3M A;  1NJI U;  2VVK A;  2KK4 A;  1NJI R;  2FEI A;  2GFU A;  1NEG A;  2M9U A;  1QLY A;  4F16 A;  2HL3 A;  5L23 A;  4BB7 A;  5IXB A;  3JCM b;  2CH4 A;  1A0N B;  3RNJ A;  1X01 A;  1I07 A;  3KXT A;  4M75 B;  1M30 A;  3PE0 A;  4J6W A;  4JRK A;  1C0M A;  1QCN A;  3MP8 A;  1J3T A;  3TU4 K;  1Y07 A;  3QPH A;  8AT1 B;  2HQH A;  3CMA Q;  2KT1 A;  2V8K A;  1N5Z A;  1VOM A;  3AT1 B;  3H0F A;  1PNJ A;  1I1J A;  2XD0 A;  3L1A A;  2A28 A;  2V8I A;  3UDC A;  4DBR A;  1S72 A;  1VA7 A;  4XTX A;  2CRE A;  4XU0 A;  2DYB A;  2QTV A;  1QCO A;  2LQK A;  4JPB W;  3CD6 T;  2H3J A;  3A5Z B;  5C0M A;  2R5A A;  5KCO A;  3JRZ A;  4E7H A;  2JOY A;  2QQB A;  4MML A;  1BKB A;  2ECZ A;  4PNO A;  4IUR A;  4BE0 A;  2OX7 A;  2DPP B;  1E6H A;  2LT4 A;  1ZA2 B;  2YRD A;  1MMD A;  4B6M A;  2JTM A;  3J80 E;  1VIE A;  4B9X A;  4RCC A;  2NUT A;  1YCY A;  2GNC A;  2HSP A;  4II1 A;  4L5G A;  5CKD A;  4CRI A;  3MEU A;  3FEO A;  3CPW P;  1Q95 G;  2FZG B;  1I81 A;  3MP6 A;  3BFM A;  4E7S A;  3CCS Q;  2NYS A;  3KFV A;  5LJ5 g;  3OS1 A;  1ZUY A;  2CP0 A;  4A53 A;  1YIT A;  2L5Q A;  4EMH A;  3NTI A;  5D6X A;  3JB9 D;  1IHV A;  1WQ7 A;  1VQ9 A;  1ZLM A;  1BK2 A;  2A08 A;  1R77 A;  2RI2 A;  4C8Q F;  1YNZ A;  2D6F A;  4C0D C;  4J9E A;  1X75 C;  3A98 A;  2DX1 A;  5J3B A;  1RLQ C;  3I55 A;  3UPU A;  1QWF A;  1D1C A;  4GBQ A;  4FW2 A;  4GLM A;  4M78 F;  1QVG P;  3JCM W;  3E19 A;  4F04 B;  4RTZ A;  2A7Y A;  4DBH A;  4OMN A;  1SPK A;  2IVW A;  4C8Q G;  2QAZ A;  4LXC A;  5FW9 A;  3QBY A;  4AFS C;  5FU6 B;  1R0B G;  2EYX A;  2WSC E;  1HJD A;  1H3Z A;  2J05 A;  3V8K A;  5GAN 2;  3L2W A;  1KHI A;  1O9S A;  5GAN f;  2VV5 A;  4M78 G;  2KEA A;  1H92 A;  2F2X A;  4C5H A;  2DD4 A;  4M77 F;  4BE1 A;  3LLR A;  2QYZ A;  1TXQ A;  3G71 A;  3OS0 A;  3FDR A;  1Y7X A;  1TUD A;  3HP9 A;  3S6W A;  2RO0 A;  5FRO A;  1UGQ B;  2DRK A;  3DLM A;  4BY6 C;  2M02 A;  6AT1 B;  1JU5 C;  3CPF A;  2YWW A;  5GAO r;  1LJO A;  4BDZ A;  1QMC A;  5HK0 A;  4LDY A;  1JRI A;  1YJW A;  1BIA A;  5FU7 C;  4V2S A;  3GLX A;  4M77 G;  1JJ2 S;  2LX7 A;  4M7A F;  2CP6 A;  5CVI A;  5FWB A;  2C0O A;  4E47 A;  1T0H A;  2O88 A;  2QG9 B;  1AWJ A;  4E2F B;  3RBB B;  4JRQ A;  3FIF A;  1K0S A;  4BI8 B;  2E70 A;  2COY A;  1SEM A;  1Q82 U;  3CCE Q;  1M2O A;  3RIR A;  2QTX A;  5GAN h;  1Q82 R;  3CD6 Q;  2RK1 A;  1I5L A;  1TWB A;  4IIO A;  3EFO A;  5GAO l;  2K6D A;  2CZ6 B;  4D6W A;  2PVG B;  2EKH A;  4ZGD B;  3M0U A;  3MEA A;  3FJP A;  2CUB A;  2H8H A;  2P0P A;  3CME T;  5LJ3 f;  1K9M C;  3J7A F;  2KYB A;  4LDW A;  3LWI A;  5I2S A;  2G3R A;  4NL3 A;  4ZTJ A;  3SB2 A;  2CUD A;  1KJW A;  4FL6 A;  4QT7 A;  1W2B S;  1XOV A;  1JB0 E;  4YTL A;  1Y71 A;  3QHS A;  3EG0 A;  2K9G A;  2WSF E;  2EQM A;  4JS4 A;  3JCM c;  1EX4 A;  1BU1 A;  2F2V A;  1WJR A;  3C12 A;  2RM4 A;  2OTJ T;  1GL5 A;  1RI9 A;  1PC0 A;  3RES A;  5D6W A;  2A3L A;  3R6O A;  1WDX A;  2FRW A;  1G3W A;  2AKK A;  2DJZ A;  3EAE A;  3NTH A;  2DO3 A;  4J9F A;  4PFO A;  4O6J A;  1BB9 A;  2K3Y A;  4PJM A;  2X51 A;  3EGD B;  1NPR A;  1AT1 B;  2I2L A;  3IQL A;  4OB2 B;  3EGD A;  5LJ3 h;  5GAM j;  3QXE B;  4M7D G;  3KUF A;  1R8O B;  2LT1 A;  1WFW A;  1AZE A;  1MND A;  1OI1 A;  2IG0 A;  3QO3 A;  8ATC B;  3RKY A;  3CCV Q;  5D7U A;  2VC8 A;  1T0J A;  4ZTF A;  2MPX C;  3I35 A;  1WHG A;  3S3O A;  4J9D A;  1VQK A;  5CKF A;  2DFU A;  4KGZ B;  3JB9 J;  3QJ6 A;  2EJF A;  3SHW A;  1MGQ A;  5A2Q E;  2O2O A;  1VQ6 T;  4KRT A;  4K11 A;  3P8B B;  1M1K C;  4KGX B;  1MMG A;  2J6F A;  3O8V A;  1Q7Y U;  5J26 A;  3PVQ A;  2DA9 A;  2JUF A;  3CCM T;  1Q7Y R;  2HEQ A;  1ZSZ B;  1P92 A;  1VQ5 T;  3REB B;  3X28 B;  1WXB A;  4J9B A;  2VXE A;  2GBQ A;  2ROL A;  1YP5 A;  5CO7 A;  2XG8 D;  2OAU A;  1OU8 A;  1KD1 C;  4IUQ A;  3RDV A;  4EMG A;  1M3C A;  2MMP A;  4MMK A;  2EFI A;  2ZZD A;  1OX8 A;  2LQW A;  5GMK h;  1FWZ A;  2ZGW A;  2EQU A;  2EYQ A;  3SD4 A;  2ZCF B;  1QWE A;  2JT4 A;  3GIB A;  1WYX A;  2RJE A;  1NYF A;  2VXF A;  2M51 A;  2FL7 A;  3MEW A;  1D3B A;  3PNW C;  1S72 T;  2JS2 A;  1LVK A;  3L2U A;  2DNU A;  3M9Q A;  4C92 D;  4HVU A;  4HT9 A;  2HKN A;  4A54 A;  1AOJ A;  2KVQ G;  4OF1 A;  3CME Q;  3CCL A;  2QA4 Q;  4X9D A;  4C5I A;  4ELZ C;  3ME9 A;  2QK0 A;  5LJ5 f;  1GFD A;  4M75 G;  1U3O A;  1LCK A;  4ESR A;  3J81 E;  1N27 A;  2YUN A;  3MKD A;  2LQN A;  3FC3 A;  2MWO A;  3HRT A;  3HSB A;  3R6N A;  2L3P A;  4J9H A;  3UA7 A;  3U23 A;  1Y96 B;  2JS0 A;  4M77 B;  2X4J A;  3NHN A;  3ZFJ A;  3LWH A;  1YCS B;  2EYY A;  2GTO A;  2PQW A;  1X2K A;  4J9G A;  2BUD A;  5CQX A;  3VS6 A;  3M0R A;  7AT1 B;  1SF9 A;  3CBM A;  4JRP A;  3BDU A;  3NPF A;  1SSH A;  3OYL A;  3JB9 I;  1UHF A;  2K2V A;  4M7A B;  3MET A;  2LQ8 A;  3TSZ A;  2DBK A;  5KYW B;  1YIT T;  1H64 1;  3SFM A;  2L3S A;  2FZK B;  3SDZ A;  2C0T A;  3GOX A;  3INZ A;  2DER A;  1FMK A;  1M1F A;  2EQJ A;  5LJ5 h;  1VQ9 T;  1K8A C;  2ROT A;  3OW2 S;  2QEX T;  3JB9 F;  3T9N A;  5I2M A;  3G6E T;  3I55 T;  3TVT A;  5CKE A;  3HKS A;  4MDX A;  2K3X A;  3VYG A;  4BE2 A;  3CCU A;  2XIC A;  2LCS A;  2YSQ A;  2MF2 A;  2O4X A;  2C06 A;  4Y28 E;  3JB9 G;  5ECA A;  1VQ6 Q;  2K3B A;  4X1V A;  1MUZ A;  2L0A A;  5IAY A;  1YWP A;  2KSS A;  1WPY A;  5FLX E;  4C92 C;  2GQV A;  2CZ0 B;  4QQG A;  4BDY A;  3LH0 A;  3JCM J;  1ARK A;  5KYU B;  4J5Y A;  3G71 T;  5AT1 B;  4HKE A;  3MCA B;  3VS4 A;  2K7A A;  4OB3 B;  2DRM A;  2OTJ A;  3TEE A;  2OI3 A;  1M27 C;  4CI0 C;  5CKB A;  2HBP A;  2EYZ A;  4XQ3 A;  1PD0 A;  4PL6 A;  2R57 A;  1S72 Q;  4J9C A;  2LTO A;  2F69 A;  3CCR A;  3F70 A;  2CP2 A;  1YIJ A;  3UAT A;  1WGS A;  2PU9 B;  4PKC C;  1SG5 A;  2E5Q A;  5HCK A;  1N8R C;  2J06 A;  2DBM A;  1YJ9 A;  3MO8 A;  3H6Z A;  4PFP A;  2HAX A;  1O75 A;  4PJO D;  2C0I A;  1UDL A;  2J6K A;  1PRM C;  4QKU A;  1PKS A;  3UWN A;  2DK3 A;  3PFS A;  3CBO A;  1K73 C;  1SHG A;  1PG5 B;  1MMN A;  3PMI A;  1QVF A;  1YI2 T;  2SRC A;  2VYT A;  2RB6 A;  2LJ3 A;  2RK2 A;  4OMP A;  4HCC A;  1TG0 A;  2QGG A;  2YLB A;  2DTH A;  2BZY A;  2LDM A;  4F7U A;  1JXM A;  1QQJ A;  3X20 B;  1QP3 A;  2B8A A;  2ZAE A;  3CCM A;  3ASK A;  5GAM g;  1YIT Q;  1VQ5 A;  3EG3 A;  1VQP A;  2RF0 A;  4C0D B;  1VQ9 Q;  2HNI A;  2E3H A;  2DF6 A;  2XU8 A;  3CBP A;  4EMK C;  3QUI A;  1WLP B;  1GBQ A;  3OW2 A;  2LNH B;  3E1S A;  3URG A;  3I55 Q;  4FSS A;  1SSF A;  4DOV A;  1PWT A;  5A0D A;  1HSQ A;  3X24 B;  4A4G A;  3JCM d;  4OMO A;  1E6G A;  1UGS B;  1IGQ A;  2DD5 A;  1U5S A;  4LUD A;  4PJL A;  1YN8 A;  1G5V A;  2QQ9 A;  1U1S A;  1JBM A;  4FIB A;  3OYJ A;  3RKX A;  1VQK T;  4BAC A;  2FZC B;  1HD3 A;  1G3T A;  1GRI A;  4E7Z A;  4J7I A;  2KRM A;  1D0Y A;  3EG2 A;  3G71 Q;  1BIB A;  1RAC B;  4JJD A;  4BY6 B;  3JV3 A;  4OML A;  4PJO C;  3M0Q A;  1VQO A;  4E7J A;  2NUT B;  5KYX A;  3QII A;  2DEU A;  2BE7 D;  3ZL7 C;  3L2R A;  5FU7 B;  3VKI A;  5CCA A;  3E2U A;  1YJW Q;  4OP0 A;  3OS5 A;  3OQ5 A;  1OQK A;  2LJ0 A;  3ULR B;  4KT0 E;  3OSV A;  3VS2 A;  3V8L A;  4F7U E;  1IHW A;  5I21 A;  2Z0W A;  5C6S A;  4CC2 A;  2MYS A;  5CKH A;  3L2Z A;  1G2B A;  3EG1 A;  3OYY A;  4FT4 A;  3VS0 A;  3DB3 A;  1QKX A;  1Q81 C;  1AZG B;  1FYN A;  2YT6 A;  2RHY A;  4KH0 B;  1M3A A;  1NJI C;  2OJ2 A;  2KMT A;  1X6B A;  2E5K A;  2L3Q A;  2QEX A;  2KYM A;  1AWW A;  4CC4 B;  1JJ2 P;  2KRN A;  3G6E A;  1UG1 A;  1TU0 B;  3CCL T;  1T3L A;  4N4G A;  2HZY A;  4J83 A;  2AK5 A;  1EFN A;  1PSE A;  4B9W A;  3BY7 A;  1N9S A;  1HYO A;  3HL8 A;  1AD5 A;  4A4E A;  3OYI A;  2JXB A;  1W6X A;  4N4I A;  4XK8 E;  1ZUU A;  2CYZ B;  1RAB B;  4OGE A;  4QVD A;  1Q86 U;  2MI6 A;  2O31 A;  3HHT B;  1Q86 R;  2AT1 B;  1WHH A;  2BTT A;  1IZ6 A;  1VQN T;  3CMA A;  1TS9 A;  2ZPG B;  2R5M A;  4CC3 A;  1C6V X;  2DAQ A;  4Z8A A;  4AFQ C;  1BBZ A;  3GP8 A;  3RMQ A;  2K5F A;  5GAN j;  1N6A A;  2DE0 X;  3DKM A;  1VUB A;  3CPW S;  1NBE B;  1V29 B;  1W2B P;  1YHQ A;  1UB4 A;  1RAG B;  3CC4 T;  2FRY A;  3TQ7 P;  3VYH B;  2GFA A;  1D0Z A;  2CT3 A;  1ZHI A;  2A36 A;  1WXT A;  2DEQ A;  3JCM Q;  1Z9Z A;  2EWN A;  1UHC A;  3S3N A;  1WHJ A;  1VQ4 T;  3WVE B;  3EFO B;  1QVP A;  5IH2 A;  4M4Z A;  2BE9 B;  1UTI A;  3CCU T;  4M7A G;  3QZ9 B;  1VQK Q;  4N0A A;  2J6O A;  2D1X A;  1BI0 A;  3VRY A;  4FW1 A;  4QVC A;  3LYI A;  2BIV A;  1TUG B;  2PZ1 A;  4PJJ A;  3VUB A;  3HRS A;  3CCS A;  1LOJ A;  1WHM A;  3VJP A;  5CR2 A;  1WX6 A;  3LX7 A;  4BI3 A;  4RG8 A;  3LGF A;  3NGP A;  2RH2 A;  2RPN A;  4A63 B;  1KQS A;  5CK9 A;  3MJX A;  1RI0 A;  2K2M A;  2QDY B;  4J8O A;  2F1L A;  1YI2 A;  2DXB A;  1ZBX A;  4HVV A;  2JM9 A;  4KGV B;  1G3S A;  2RQR A;  5LJ3 j;  3OYD A;  1WJQ A;  4LDU A;  5KH6 A;  1X27 A;  4KUD K;  1YWO A;  2VB6 A;  2DL4 A;  5GMK i;  3OSS C;  1Y57 A;  4HCZ A;  4ANJ A;  3ER0 A;  4R55 A;  3CCR T;  2X3W D;  1YIJ T;  2YDL A;  1D1A A;  1K9A A;  4ATO A;  4IIM A;  3CCL Q;  3N5B B;  3KBG A;  5GAN d;  2KDS A;  1W1F A;  1YFN A;  1YJ9 T;  1OV3 A;  2VGM A;  9ATC B;  5GAM f;  2FYK A;  4WTO B;  2DTO A;  5KYN A;  5DM7 R;  4NOY A;  4MDW A;  3A8G B;  1FXX A;  4KUI A;  3MHX A;  3H0I A;  4LD9 K;  2CDT A;  2P4R A;  4N0A C;  3H8Z A;  4Y92 A;  2KI7 A;  1UJY A;  1FX7 A;  4DBF A;  4NS5 A;  1Q82 C;  3OMG A;  5EG2 A;  5GMK j;  2M0O A;  3FB9 A;  2EJG A;  2DYI A;  1PRL C;  4F7U F;  2CP5 A;  4XTV A;  3ZEH A;  3CC2 A;  1ZBJ A;  4ZGJ B;  1M90 U;  1UGV A;  2AHJ B;  2RN8 A;  1VQP T;  3CXC P;  5KCH A;  1KC8 U;  3CPW A;  1M90 R;  4JRI A;  2JM8 A;  1WXU A;  1KC8 R;  2ZPI B;  5GAM e;  3M0T A;  4F7U G;  3CCQ A;  2GGR A;  1WHL A;  2RHU A;  1D3B B;  4N4H A;  5GAN 3;  1GXI E;  5LJ3 d;  3CCU Q;  4AMC A;  1RAD B;  4LE9 A;  4JJB A;  1B07 A;  1GFC A;  5FWC A;  3PVL A;  5HY6 A;  3EG9 A;  1TUC A;  1EIF A;  4C92 B;  1QVG A;  1MHN A;  1H3H A;  3LH5 A;  2GTJ A;  4FSX A;  2FB7 A;  4C92 A;  3VS5 A;  2CGH A;  1VQ8 T;  3JAM E;  4OMQ A;  3OYC A;  2W0Z A;  2HD0 A;  4XTY A;  3OYM A;  4PFZ A;  1VQO T;  1EZZ B;  3OYE A;  4Q5W A;  1G83 A;  3X26 B;  5A0L A;  2E4H A;  1QVF S;  1ZA1 B;  3E9G A;  5LJ5 j;  2OTJ Q;  3V7R A;  3G4S A;  2AIR B;  1VQN A;  1WQW A;  2CP3 A;  4DBQ A;  2FPF A;  4KH1 B;  5GAN 5;  3QSU A;  2R58 A;  3A8H B;  3G1J A;  3H9N A;  5CQY A;  1F1B B;  3MPU B;  3M0P A;  2QXF A;  3M55 A;  3PGG A;  2KXD A;  2HQE A;  4J7F A;  2EGE A;  3CCR Q;  3EH1 A;  3EGU A;  3X25 B;  1K1Z A;  1I0C A;  4LNP A;  2X4Y A;  3CC4 A;  3TSW A;  1UGP B;  3RUX A;  2VAS A;  2YXY A;  1YJ9 Q;  1Q7Y C;  1TTH B;  1IRX A;  3EHR A;  4KUL A;  3PMT A;  1CKA A;  2E1H A;  2XI9 A;  1Y0M A;  2KR3 A;  2DVJ A;  4FM4 B;  2COZ A;  2O4X B;  3EFR A;  1VQ4 A;  5GMK m;  3BDL A;  3OB9 A;  3OYN A;  1VQM A;  2YRC A;  2ENM A;  2BZX A;  2QQS A;  1ACM B;  2K5L A;  2CKK A;  2QI2 A;  1IRE B;  4JJN K;  1IGU A;  1PKT A;  2YHT A;  4OB1 B;  3I9Q A;  5AYF A;  2ESW A;  1I5O B;  2V1R A;  1NE8 A;  2DVE A;  4LDX A;  4DEX A;  2AZS A;  4IUV A;  1SRL A;  4DA4 A;  5GAO n;  2LVM A;  3JB9 H;  1R0C B;  1VQ7 A;  4C92 E;  3M59 A;  2ZPB B;  4C8Q C;  3CCM Q;  4C0G A;  3CMA T;  3C4S A;  1VQ5 Q;  1VQP Q;  1UEB A;  2FPE A;  4EMK B;  5IHN A;  1M3B A;  4HVW A;  3EGX B;  4MZM A;  3VS1 A;  4Z02 A;  1M9S A;  4M78 C;  3A8M B;  4EMK A;  1YHQ T;  3EGX A;  1YJN A;  4L6V 5;  1GBR A;  2F2W A;  3WVD B;  4E7K A;  2LZ6 B;  1Z9Q A;  3JSC A;  3V7S A;  1UE9 A;  1AVZ C;  5GAN 7;  3I5R A;  5LJ5 d;  1GCP A;  3PIP A;  1SRM A;  2QDL A;  1NLP C;  5I22 A;  2DL3 A;  3SWN C;  4HT8 A;  2DKG A;  2VGN A;  2MWP A;  3QWX X;  4NL2 A;  4M7D D;  1JO8 A;  1JEG A;  2LRQ A;  3QDF A;  4M7D A;  2HKQ B;  4PJO B;  1ZX6 A;  3CCS T;  2ABL A;  4RG2 A;  1XJW B;  1VQO Q;  1MMA A;  2NUZ A;  3M0S A;  4PK4 A;  1X2Q A;  3CC7 A;  2E3I A;  4PJO A;  3D7S B;  5KE3 A;  3EHQ A;  2L8D A;  4IKF A;  3JCM e;  2VWF A;  3AHU A;  4RTW A;  4HA8 A;  2DL7 A;  2E10 A;  2QAS A;  2E64 A;  2VUB A;  1NZ9 A;  3M53 A;  4F7U B;  4JDS A;  4KBM B;  4OB0 B;  3M57 A;  4XU1 A;  2K4Y A;  2GF7 A;  3L42 A;  4QW2 A;  2QGF B;  1SHF A;  2DL8 A;  1KHC A;  1AWX A;  2L89 A;  3PIO A;  2W10 A;  4E7I A;  3OBW A;  1RL2 A;  2DIG A;  2K57 A;  3E9F A;  1KSW A;  5FRN A;  2QEX Q;  2RQU A;  2VKN A;  3VS3 A;  4QQ6 A;  1D1B A;  2MAM A;  2OTL A;  2O9V A;  2NUP A;  4IUP A;  3G6E Q;  1E7O A;  3BE3 A;  2RJD A;  2F5T X;  1M2V A;  3PTA A;  2KT8 A;  2XID A;  2NLU A;  1M4Z A;  4XU3 A;  2DXC A;  4R0K A;  2MIO A;  4DOW A;  2EBP A;  2DL5 A;  1K4U S;  2EYW A;  3H0H A;  2NWM A;  3RMS A;  1OZ3 A;  1ABO A;  2V26 A;  3PT9 A;  4JUV A;  2EPD A;  2JMC A;  2XDB A;  4ME7 A;  4M75 D;  2RHX A;  2KNB B;  3EH2 A;  4M7D C;  2YUO A;  4MZT A;  4M7D E;  4M75 A;  1VQ8 A;  4A4K A;  1HK9 A;  2DZ9 A;  5L8R E;  5DLO A;  2YUP A;  5IXF A;  5KYX B;  3CCJ A;  3OBY A;  2P0Q A;  3L2V A;  5DY9 A;  1W4S A;  3OYH A;  2JW4 A;  2X4W A;  2HQX A;  2XKO C;  3A8L B;  1X6G A;  1MV3 A;  4PJO E;  3JCM P;  2PNI A;  1KQS S;  3CCE T;  4PLI A;  3I56 A;  2DTI A;  3JCM V;  1OEB A;  3CC2 T;  3GPL A;  1YHQ Q;  1VYT A;  2A37 A;  3GNF B;  2P84 A;  2KRO A;  2V8J A;  2PUK B;  4RTT A;  1M8M A;  2LNV A;  4XTZ A;  3DLL A;  3FRN A;  2F5K A;  1XQH A;  3CCQ T;  2Y4Y A;  4LDV A;  4QVZ A;  2DLP A;  3M56 A;  1BCO A;  5GMK l;  2P0K A;  2M1H A;  2RJF A;  1B7T A;  2V1Q A;  2EIF A;  2HCK A;  2QQA A;  1D0X A;  4OMF B;  1NG2 A;  1WZO A;  3QKJ A;  1VQL A;  1M5Q 1;  3VU3 C;  1KIK A;  1KG1 A;  4BD3 A;  1UFF A;  3OA6 A;  2K79 A;  3VV0 A;  4C92 F;  2LP5 A;  2X3X D;  1YI2 Q;  1K9M U;  2K5I A;  3LGL A;  5DLQ E;  4WCI A;  4XTU A;  1K9M R;  3OYK A;  1OPL A;  2D0N A;  3QG1 A;  4X34 A;  2ATC B;  2L3R A;  4UC4 A;  3VS7 A;  4D8D A;  4FCY A;  2KGT A;  4FYW B;  4Z88 A;  1G8X A;  1RLP C;  2SEM A;  4LD6 A;  4C92 G;  4RCB A;  4M75 C;  1X43 A;  4JS5 A;  3VRZ A;  3G4S T;  2PVD B;  4M75 E;  2ZPH B;  5IHK A;  4P5N A;  4AFU C;  4J6X A;  3EFS A;  2ED0 A;  2XK0 A;  4JZ4 A;  1B34 B;  1WI7 A;  2D8H A;  3GBQ A;  1HXD A;  1OPK A;  3OYG A;  4RTX A;  4AG2 C;  3CCV T;  3MP1 A;  2DM1 A;  1B34 A;  2COW A;  4HCB A;  3M54 A;  1JXO A;  1KQ1 A;  4C5G A;  3QYH B;  2FHD A;  1NM7 A;  3VUZ A;  2EQK A;  1ZUK A;  1BI1 A;  1QP2 A;  4FYV B;  2E6Z A;  2PTK A;  4FYX B;  4ORZ A;  4GY5 A;  4JLI A;  3HFO A;  5GAN 4;  4BUG A;  1X6O A;  1KK7 A;  1PSF A;  2IIM A;  2FVU A;  1VQM T;  2B86 A;  2D9T A;  4RTY A;  3THK A;  5IT9 E;  4ELY C;  4A4H A;  2RQW A;  3HFN A;  2HBW A;  1QVG S;  5GAN 6;  1OX9 A;  1CSK A;  1T3S A;  3JCM g;  2MCN A;  5I11 A;  1M8V A;  1VQ7 T;  1RUW A;  3TCJ A;  2JZ2 A;  2HL5 C;  3CC2 Q;  1M1K U;  5M9O A;  1U06 A;  1TOV A;  5GAN e;  1M1K R;  1K76 A;  1BI3 A;  4GLK A;  2LX9 A;  3LW5 E;  3UT1 A;  3NTK A;  4J9I A;  2EVR A;  4EPC A;  4E6R A;  3A8O B;  2X35 A;  3M4Y A;  4TVR A;  4ZGE B;  4X9C A;  3CCQ Q;  1YJN T;  3O5Z A;  2KE9 A;  1ZQ1 A;  2QA4 T;  1PM3 A;  2M16 A;  1KD1 U;  1PHT A;  5KYY B;  1KD1 R;  2PVO B;  2Y90 A;  3OMC A;  5CIU A;  1DJ7 B;  4ZNX A;  1U1T A;  1Q86 C;  1CKB A;  1UEC A;  3SEM A;  2JNG A;  5KYY A;  1U8R A;  4R56 A;  5IHI A;  5HK3 A;  5GAO q;  5FU6 C;  4CC7 A;  2HSE B;  1S1N A;  5CAI A;  1IB8 A;  2DZC A;  1QKW A;  3QDR B;  1BYM A;  2RMO A;  4AFZ C;  2EKO A;  4M7D F;  1MV0 B;  2HMA A;  3C95 A;  3OS2 A;  3WXM B;  3CC7 T;  2JJ9 A;  2KRS A;  2D8J A;  3GNG A;  2KY9 A;  4RKU E;  4PJO F;  1XTD A;  4RUG A;  4Y91 A;  1I4K 1;  3G4S Q;  5LJ3 e;  1VQN Q;  1BI2 A;  5GJV B;  4RMO A;  4IUT A;  2CSI A;  1LPL A;  2RD1 A;  1WIE A;  2DIL A;  2ED1 A;  1KFZ A;  4PLL A;  4PJO G;  3P8H A;  3CQT A;  3CCE A;  3TRE A;  2CT4 A;  3CD6 A;  3C0C A;  3CC4 Q;  1I8F A;  3QWY A;  2CSQ A;  1W70 A;  5EC7 A;  2CP7 A;  2Y4X A;  5LL6 S;  2DXU A;  3BW1 A;  5GAM h;  2BKD N;  3OY9 A;  2I0N A;  1QVF P;  2GCX A;  4RTU A;  2OTL T;  2YRV A;  1K8A U;  3UA6 A;  2KAF A;  2FG0 A;  4JJC A;  1K8A R;  1VQ4 Q;  3JCM X;  2MOX A;  4DEY A;  2EGC A;  3GF5 A;  3V8J A;  5D6Y A;  1VQM Q;  1LNX A;  2DIQ A;  3EG9 B;  4HXJ A;  2D0Q B;  1K0X A;  1MNE A;  1ZSZ A;  2RQT A;  1JJ2 A;  5J39 A;  4PJN A;  1NPP A;  4XU2 A;  4C0F A;  2CZ7 B;  2KXC A;  5HKC A;  4ZN1 A;  4C8Q B;  5GMK e;  1VQ7 Q;  4L59 A;  2HDA A;  2XMF A;  2ZPF B;  3OW2 P;  2EW3 A;  4C8Q D;  4XAX B;  2IPO B;  1RAE B;  1OZ2 A;  3FJ5 A;  4F14 A;  4AG1 C;  4M75 F;  4C8Q A;  3CCJ T;  1NEB A;  2X9H A;  1YBY A;  1V76 A;  4M78 B;  1AWO A;  3I56 T;  4EDU A;  1OUL A;  2QQR A;  4FU6 A;  4M78 D;  5FRM A;  3OYF A;  1YJN Q;  2LCC A;  4Z89 A;  4M78 A;  3HPW A;  1WHK A;  2DJQ A;  4IUU A;  1VYV A;  2DMO A;  3CXC S;  3QYG B;  5GAM d;  2OAW A;  1W2B A;  3SWN B;  1WNL A;  2JMA A;  2RI3 A;  2AZV A;  3CCV A;  4JLG A;  2MK5 A;  1YIJ Q;  3OYA A;  4M77 D;  4E7L A;  1TH7 A;  2YLC A;  3SWN A;  2GQI A;  5GAN 8;  1Y96 A;  4M77 A;  1RAH B;  1BCM A;  1NYG A;  3G7Z A;  1VQL T;  4HCK A;  3RR6 A;  1M90 C;  1N8R U;  4WF2 A;  1KC8 C;  3REA B;  1X69 A;  1N8R R;  3CC7 Q;  2JTF A;  4M7A D;  4ZN3 A;  4C5E A;  3RKW A;  2RHZ A;  3MEV A;  3NMZ C;  2JTE A;  1B3Q A;  2E6N A;  1ZSZ C;  1IXD A;  4M7A A;  2WSE E;  2XDD A;  1VYU A;  5KYW A;  2AKL A;  2CH4 W;  5LJ5 e;  1K73 U;  3Q1J A;  1PD1 A;  1K73 R;  5GAN g;  4MZP A;  1OU9 A;  2O9S A;  3CEY A;  3M58 A;  1PCX A;  2FPD A;  2M0Y A;  1D09 B;  3FLG A;  4AT1 B;  3M4G A;  3V7C A;  3M5A A;  4C8Q E;  1N9R A;  2JVV A;  1UJ0 A;  2RJC A;  1GCQ A;  5A0G A;  2WAC A;  3HRU A;  2E41 A;  2KQW A;  1WJS A;  3P8D A;  2BZ8 A;  2DET A;  2OTL Q;  1RAF B;  1XNI A;  2E12 A;  5GJW B;  4OVA A;  4M78 E;  2XHC A;  4FT2 A;  3JCM f;  2EJ9 A;  2E65 A;  3CME A;  2LJ1 A;  2QA4 A;  1H8K A;  1JQQ A;  1ABQ A;  2RA2 A;  4RTV A;  1UGR B;  4VUB A;  5KE2 A;  4DQ2 A;  2X4X A;  1SKU B;  2CS7 A;  3L2Q A;  3C94 A;  1UUE A;  3QJY A;  2ZPE B;  4LUE A;  5KYU A;  1QCF A;  4C0Z A;  4EIK A;  1YJW T;  4J6Y A;  2G6F X;  4LN2 A;  4M77 C;  4M7D B;  2EQI A;  2L2P A;  4M77 E;  4D8K A;  2PUO B;  1FMV A;  1IO6 A;  2DXT A;  3UF4 A;  2YUQ A;  4O5V A;  1VQ8 Q;  3DB4 A;  2RQV A;  1V1C A;  1AEY A;  2EGA A;  2KBT A;  3CCJ Q;  2O01 E;  1FMW A;  3QZ5 B;  1OYX A;  5LJ3 g;  1OOT A;  3OYB A;  3I56 Q;  1M1G A;  4A4F A;  3ZBD A;  4OMM A;  2LMJ A;  2RHI A;  4M7A C;  4M7A E;  3JCM h;  5IN1 A;  5GAO p;  2XDP A;  1WA7 A;  2H3E B;  1TSF A;  4BI4 A;  2EAY A;  2RNA A;  3RER A;  1NLO C;  3H41 A;  1AHJ B;  3HTR A;  2P4T A;  2CZ1 B;  4XTW A;  1G3Y A;  2LCL A;  3NFC A;  3CXC A;  2RI5 A;  4JZ3 A;  1ZSG A;  1RAA B;  2FO0 A;  1C1A A; 
#chains in the Genus database with same CATH homology
 1W1F A;  1OPL A;  1SSH A;  2D0N A;  3NPF A;  4D8D A;  3VS7 A;  1GCQ C;  1OV3 A;  2KGT A;  3I5S A;  1UHF A;  4Z88 A;  1RLP C;  2SEM A;  2J7I A;  3TSZ A;  2DBK A;  4F17 A;  2L3S A;  1X43 A;  3VRZ A;  2C0T A;  5IHK A;  1FMK A;  4AFU C;  2VVK A;  2ED0 A;  4JZ4 A;  2ROT A;  3H0I A;  1WI7 A;  2D8H A;  2FEI A;  3GBQ A;  1OPK A;  2CDT A;  1NEG A;  2P4R A;  4Y92 A;  4RTX A;  1QLY A;  1UJY A;  4AG2 C;  4F16 A;  2DM1 A;  3TVT A;  1JXO A;  5L23 A;  5IXB A;  2CH4 A;  2LCS A;  1A0N B;  3RNJ A;  1NM7 A;  1PRL C;  2YSQ A;  1I07 A;  1ZUK A;  5ECA A;  1M30 A;  3PE0 A;  1ZBJ A;  2K3B A;  4X1V A;  1MUZ A;  1J3T A;  1UGV A;  2L0A A;  2RN8 A;  1YWP A;  2PTK A;  2JM8 A;  2KT1 A;  1N5Z A;  1WXU A;  4ORZ A;  3H0F A;  1PNJ A;  1I1J A;  2IIM A;  2A28 A;  2B86 A;  3M0T A;  1VA7 A;  2CRE A;  2GGR A;  4RTY A;  3THK A;  1ARK A;  2DYB A;  2RQW A;  2HBW A;  4JPB W;  1CSK A;  1T3S A;  3VS4 A;  2MCN A;  2K7A A;  5I11 A;  2DRM A;  4LE9 A;  2ECZ A;  1RUW A;  2OI3 A;  4JJB A;  1B07 A;  1GFC A;  1U06 A;  3PVL A;  5FWC A;  1TUC A;  1M27 C;  1K76 A;  1E6H A;  1H3H A;  3LH5 A;  2EYZ A;  2GTJ A;  4J9I A;  2EVR A;  4E6R A;  2GNC A;  2HSP A;  3VS5 A;  4J9C A;  4OMQ A;  2W0Z A;  3O5Z A;  3UAT A;  2KE9 A;  1PHT A;  5HCK A;  2J06 A;  4ZNX A;  2DBM A;  1CKB A;  1G83 A;  1UEC A;  3SEM A;  3KFV A;  1ZUY A;  5IHI A;  2C0I A;  1UDL A;  2J6K A;  1PRM C;  4CC7 A;  1S1N A;  1PKS A;  2FPF A;  1ZLM A;  1BK2 A;  2A08 A;  1YNZ A;  4J9E A;  3A98 A;  1QKW A;  1SHG A;  3M0P A;  2DX1 A;  2RMO A;  2KXD A;  4AFZ C;  2SRC A;  2EGE A;  1RLQ C;  2LJ3 A;  3EGU A;  1QWF A;  4OMP A;  1K1Z A;  1I0C A;  1MV0 B;  1TG0 A;  4LNP A;  4GBQ A;  4GLM A;  4RTZ A;  4OMN A;  3TSW A;  1SPK A;  2BZY A;  2KRS A;  2D8J A;  5FW9 A;  1JXM A;  3EHR A;  4AFS C;  4RUG A;  2EYX A;  1CKA A;  1HJD A;  2J05 A;  3EG3 A;  2RF0 A;  5GJV B;  1Y0M A;  2KR3 A;  2DVJ A;  2CSI A;  2DF6 A;  1WIE A;  1WLP B;  2DIL A;  2ED1 A;  2KEA A;  1GBQ A;  1H92 A;  2F2X A;  2ENM A;  2BZX A;  1KFZ A;  3CQT A;  2LNH B;  1PKT A;  4FSS A;  2CT4 A;  1TUD A;  3I9Q A;  2ESW A;  3C0C A;  1PWT A;  2DRK A;  2V1R A;  1HSQ A;  1JU5 C;  4DEX A;  2AZS A;  1E6G A;  1SRL A;  3QWY A;  4OMO A;  2CSQ A;  1W70 A;  5EC7 A;  1U5S A;  2I0N A;  4LUD A;  1YN8 A;  4RTU A;  2LX7 A;  2FPE A;  3UA6 A;  2FG0 A;  4JJC A;  1M3B A;  4HVW A;  5FWB A;  5IHN A;  2MOX A;  4DEY A;  2C0O A;  2EGC A;  3VS1 A;  2O88 A;  1T0H A;  1AWJ A;  3RBB B;  1HD3 A;  4HXJ A;  1K0S A;  1GRI A;  1K0X A;  1SEM A;  2KRM A;  3EG2 A;  2RQT A;  4JJD A;  3JV3 A;  1GBR A;  2F2W A;  4OML A;  2LZ6 B;  1Z9Q A;  3M0Q A;  1UE9 A;  4IIO A;  1AVZ C;  2K6D A;  3I5R A;  1GCP A;  2KXC A;  1SRM A;  2QDL A;  3ZL7 C;  2EKH A;  1NLP C;  2HDA A;  2XMF A;  3M0U A;  2EW3 A;  5I22 A;  3FJ5 A;  2DL3 A;  4F14 A;  4AG1 C;  2CUB A;  2H8H A;  2LJ0 A;  1NEB A;  3ULR B;  2KYB A;  3VS2 A;  3QWX X;  2CUD A;  1JO8 A;  1KJW A;  4CC2 A;  1AWO A;  4QT7 A;  1JEG A;  1XOV A;  1G2B A;  3EG1 A;  3VS0 A;  3EG0 A;  1QKX A;  2K9G A;  4Z89 A;  1ZX6 A;  1AZG B;  1FYN A;  1BU1 A;  2YT6 A;  2ABL A;  2NUZ A;  3M0S A;  1M3A A;  2DJQ A;  1X2Q A;  2F2V A;  1GL5 A;  2OJ2 A;  1RI9 A;  1X6B A;  2E5K A;  1VYV A;  2DMO A;  2L3Q A;  3EHQ A;  2OAW A;  2KYM A;  2JMA A;  2VWF A;  1WDX A;  2FRW A;  2AKK A;  2AZV A;  4J9F A;  4CC4 B;  1AWW A;  4RTW A;  2DL7 A;  2KRN A;  1UG1 A;  1T3L A;  2AK5 A;  1EFN A;  2GQI A;  1BB9 A;  1NYG A;  1AD5 A;  1SHF A;  2JXB A;  3IQL A;  2DL8 A;  1W6X A;  1AWX A;  4HCK A;  1ZUU A;  2W10 A;  3REA B;  1X69 A;  2O31 A;  1KSW A;  1AZE A;  1WFW A;  3NMZ C;  2BTT A;  2JTE A;  1B3Q A;  2RQU A;  2VKN A;  3VS3 A;  1VYU A;  2O9V A;  2AKL A;  2CH4 W;  1T0J A;  4CC3 A;  3I35 A;  4Z8A A;  1E7O A;  4AFQ C;  1BBZ A;  4J9D A;  2KT8 A;  4R0K A;  2DE0 X;  2O9S A;  2MIO A;  3SHW A;  2FPD A;  2EBP A;  2M0Y A;  2O2O A;  2DL5 A;  1K4U S;  2EYW A;  2FRY A;  4KRT A;  3H0H A;  4K11 A;  2NWM A;  2CT3 A;  1ABO A;  2J6F A;  2A36 A;  1UJ0 A;  3PVQ A;  2DA9 A;  2EPD A;  1WXT A;  2JMC A;  2HEQ A;  1GCQ A;  1Z9Z A;  3REB B;  1UHC A;  2KNB B;  1WXB A;  4J9B A;  2YUO A;  2GBQ A;  2BZ8 A;  2ROL A;  1YP5 A;  5GJW B;  2YUP A;  5IXF A;  5IH2 A;  4M4Z A;  2LJ1 A;  1H8K A;  1JQQ A;  1ABQ A;  1M3C A;  1UTI A;  4RTV A;  2JW4 A;  1X6G A;  1MV3 A;  2LQW A;  2PNI A;  2J6O A;  1OEB A;  2D1X A;  1VYT A;  2A37 A;  3VRY A;  2PZ1 A;  1UUE A;  2KRO A;  1QWE A;  2JT4 A;  4LUE A;  1QCF A;  1WYX A;  4RTT A;  1WX6 A;  1NYF A;  1M8M A;  2M51 A;  4EIK A;  2G6F X;  4LN2 A;  3NGP A;  2EQI A;  2L2P A;  2JS2 A;  2RPN A;  4A63 B;  4D8K A;  1IO6 A;  2K2M A;  2DLP A;  2DNU A;  3UF4 A;  2YUQ A;  4HVU A;  2RQV A;  1V1C A;  1AEY A;  2EGA A;  2KBT A;  4HVV A;  1AOJ A;  2JM9 A;  1GFD A;  2V1Q A;  2RQR A;  1OOT A;  1LCK A;  1U3O A;  4ESR A;  2HCK A;  2YUN A;  2LQN A;  4OMM A;  2LMJ A;  3R6N A;  1NG2 A;  2L3P A;  1KIK A;  1X27 A;  4J9H A;  3UA7 A;  1YWO A;  3U23 A;  1WA7 A;  2DL4 A;  2JS0 A;  1UFF A;  1Y57 A;  3NHN A;  2RNA A;  1YCS B;  2EYY A;  2GTO A;  2K79 A;  1X2K A;  1NLO C;  3H41 A;  4J9G A;  2X3W D;  2LP5 A;  2YDL A;  2X3X D;  1K9A A;  3VS6 A;  3M0R A;  4IIM A;  4JZ3 A;  1ZSG A;  2FO0 A;  4WCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...