4Y92A

Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain e97t-q128r mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
MTFVALYDYESRTTTDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain E97T-Q128R mutant
rcsb
source organism Avian sarcoma virus pr2257/16
molecule tags Transferase
molecule keywords Protein-tyrosine kinase
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4y92A00
1NYFA 1ZX6A 4AFSC 1NLPC 1OPLA 2HEQA 1X27A 1CSKA 1X6GA 3JV3A 3KFVA 4RTXA 1B3QA 1I1JA 1FYNA 3VS3A 1EFNA 1WYXA 1E6GA 2EYWA 4AFQC 2D8HA 2V1RA 1ARKA 3PE0A 3UF4A 3EGUA 3REBB 1M27C 2VVKA 2DL8A 1AWJA 2AK5A 1G2BA 2DF6A 1M3AA 2LQWA 1QWFA 2HSPA 4GBQA 1K1ZA 2EYXA 3FJ5A 3VS7A 1GCQC 1AZGB 1BB9A 1WX6A 1GCQA 2SEMA 2W0ZA 1X69A 1QKXA 1KJWA 2KGTA 3EG2A 2FRYA 1WXUA 1WDXA 2VKNA 1N5ZA 2LJ3A 1V1CA 1AVZC 1K76A 4Y92A 1RLPC 4Z88A 1YWOA 1M8MA 4F14A 4X1VA 2YUNA 2G6FX 4CC2A 1JO8A 1UUEA 2JW4A 2KR3A 1UG1A 2D8JA 2L3QA 1M30A 2J6KA 1ABOA 3UA6A 1HJDA 1I0CA 1RUWA 4J9CA 4JPBW 4DEYA 2EYYA 1GCPA 2FRWA 3C0CA 1K4US 2DE0X 2K9GA 4Z89A 3H0FA 1W70A 2DLPA 2L0AA 4HCKA 2E5KA 1YCSB 2J7IA 2KBTA 4AG1C 1XOVA 2GBQA 3H41A 2KEAA 4AFUC 1BBZA 1E7OA 2ROLA 1PKTA 2XMFA 1JEGA 2W10A 2V1QA 3EG3A 3TSWA 2DNUA 1SPKA 2YUQA 4CC3A 2J05A 4RTUA 1WFWA 1MV0B 2AKLA 2DMOA 2JM9A 2O88A 5FW9A 1NYGA 4RTYA 1T3SA 3TSZA 1SHGA 5I11A 5IHKA 1GRIA 4LN2A 2KT8A 2F2XA 4RTVA 2L3PA 2RN8A 2RQWA 2A36A 1CKBA 2RQUA 1SHFA 1UFFA 1UTIA 4J9DA 1SSHA 2CREA 2AZSA 2BTTA 4LUEA 1G83A 5I22A 1ZSGA 2D1XA 3R6NA 3IQLA 3REAB 4OMQA 2NWMA 1PRLC 2LZ6B 2FPEA 2C0OA 1TUCA 4JZ3A 2JT4A 4J9FA 2ED1A 2VWFA 1HD3A 2EGCA 3PVLA 2C0IA 3M0RA 2LMJA 1X2KA 4IIMA 2PNIA 3RBBB 2IIMA 2BZYA 1T0HA 2J6FA 2LQNA 2JM8A 4J9GA 2FEIA 3CQTA 5HCKA 4A63B 1JU5C 2A28A 2EVRA 4ZNXA 3ZL7C 5IH2A 1SRLA 2DJQA 2DL4A 2O31A 2CDTA 4WCIA 1AZEA 1KSWA 5GJWB 4GLMA 1T3LA 2CUBA 4E6RA 2J6OA 4D8KA 1JXMA 2O2OA 1UGVA 2RQVA 2X3WD 3VS6A 1RLQC 5IHNA 1QKWA 1ZUYA 1BK2A 2A08A 3I5SA 1H92A 2KYBA 3M0PA 2JS2A 3O5ZA 2HCKA 3EHRA 3M0TA 1UHCA 5L23A 2P4RA 4RTZA 2B86A 2GQIA 1T0JA 1BU1A 1VYUA 2F2WA 3I35A 2L3SA 4OMNA 4OMLA 3VS1A 1PRMC 2HDAA 2CSIA 1GBQA 1LCKA 1YWPA 2DA9A 2L2PA 1TG0A 2EYZA 2O9SA 1VYVA 2JMAA 2LJ0A 1U06A 4ESRA 1UE9A 1H3HA 5IXFA 4F17A 2BZ8A 2EGEA 1Z9ZA 5IHIA 1A0NB 1U5SA 2KROA 2JMCA 1HSQA 1K0XA 3VRZA 4AG2C 2J06A 2KXCA 4J9BA 2GNCA 1PHTA 2DRKA 2LNHB 2K79A 2ENMA 1Z9QA 2DYBA 2KYMA 1M3BA 1GBRA 1PKSA 1UECA 1WI7A 4JJDA 3SEMA 3QWYA 1FMKA 2K2MA 2FO0A 2KXDA 1YP5A 3QWXX 2KT1A 1I07A 2FG0A 4AFZC 3THKA 5ECAA 2CUDA 2FPFA 2JXBA 4FSSA 1B07A 4EIKA 2M51A 1QLYA 2K7AA 4KRTA 2LX7A 2K6DA 2RQTA 4HVWA 4DEXA 1UDLA 3I5RA 1NLOC 4IIOA 1TUDA 3VS2A 4F16A 2DILA 1ZLMA 2YSQA 2DBMA 2CSQA 1M3CA 1H8KA 2A37A 4M4ZA 1KIKA 4OMMA 1QCFA 2FPDA 4ORZA 2PZ1A 2C0TA 4LNPA 3VS0A 5EC7A 4OMPA 1Y57A 1U3OA 3H0HA 2HBWA 2JS0A 5GJVB 4JJBA 2EKHA 2YUPA 1J3TA 2OJ2A 1GFDA 4RTTA 1OV3A 1ZUKA 1JQQA 3GBQA 1KFZA 1WIEA 3EG1A 1YN8A 2DL5A 2EW3A 2RNAA 1AD5A 2DBKA 4LE9A 2M0YA 1VYTA 1X2QA 2KRNA 2RPNA 2GTJA 1SEMA 3SHWA 1AWOA 1OOTA 2OI3A 4HXJA 4K11A 3NHNA 3M0UA 2MIOA 1WXBA 3VS4A 3I9QA 3LH5A 1AEYA 3NGPA 2CH4W 2KNBB 2K3BA 5FWCA 5IXBA 1UJ0A 2I0NA 1W6XA 2ED0A 2ABLA 1NEGA 2DL3A 2CT4A 1IO6A 1ZUUA 1OPKA 1QWEA 1SRMA 2BZXA 3A98A 2DM1A 2EBPA 2AKKA 1NM7A 2QDLA 1W1FA 1UHFA 3EHQA 4JJCA 2RQRA 1UJYA 2JTEA 2YDLA 1E6HA 1PWTA 2EGAA 1Y0MA 2RF0A 1AOJA 2EPDA 2LJ1A 1NEBA 1WXTA 3M0QA 2DVJA 2EQIA 4RUGA 2X3XD 4J9EA 1YNZA 1VA7A 1X6BA 1MV3A 3PVQA 4LUDA 2GTOA 4CC7A 3TVTA 2KRSA 1GFCA 3U23A 3VRYA 1ZBJA 4RTWA 2DX1A 3EG0A 3RNJA 1ABQA 4QT7A 3NPFA 5FWBA 2DRMA 1K0SA 2ROTA 2ESWA 2GGRA 1MUZA 2KRMA 2CH4A 4R0KA 1CKAA 2LCSA 3VS5A 1RI9A 2SRCA 4CC4B 1NG2A 2CT3A 1AWXA 2O9VA 2YT6A 3H0IA 4OMOA 2OAWA 2H8HA 2MCNA 3UATA 1WLPB 1PNJA 2NUZA 3M0SA 2PTKA 4HVVA 4D8DA 1AWWA 2KE9A 1JXOA 2AZVA 4HVUA 4J9IA 2F2VA 2ECZA 1K9AA 3NMZC 4JZ4A 1X43A 1S1NA 2MOXA 2LP5A 3ULRB 4J9HA 4Z8AA 2DL7A 3UA7A 2YUOA 1GL5A 1WA7A 2D0NA 2RMOA 1OEBA
chains in the Genus database with same CATH superfamily
1NYFA 4AFSC 2HNIA 2R5AA 4BE1A 1NLPC 2DD4A 1X27A 5HK0A 1CSKA 1X6GA 2VXFA 4M7AE 2KK4A 3FIFA 3KFVA 4XTVA 5DY9A 1VQPA 5GAMg 1WHJA 2CS7A 1Q82U 4J8OA 5GAN3 2E65A 2BE7D 1M90R 2P0QA 1VQ7A 2V1RA 1G8XA 1W2BP 2VVKA 1VQ5A 5L8RE 3HFOA 1Q81U 4RMOA 3QHSA 3GP8A 4NL2A 5A0LA 1K1ZA 1KD1U 1YIJQ 3VS7A 1KC8C 3OSSC 4E7KA 3MEUA 4OB1B 2LT1A 3JCMh 1S72A 1BB9A 4F7UF 2W0ZA 4B9XA 4M7DE 4N4IA 1WPYA 5KYWB 1WXUA 3EH2A 1RADB 4XK8E 2VKNA 1X01A 1KQ2A 2LJ3A 2QTVA 1IGUA 3QIIA 3PMIA 4E7ZA 2NUTA 4X1VA 2JTFA 2M02A 1YITQ 1VQKT 3M9QA 2E3HA 4PJOE 2J6KA 1TOVA 2CGHA 2QQRA 4C5HA 1QVGA 1I0CA 4J9CA 1K8AC 2EFIA 3G71T 1K4US 3H0FA 2DLPA 4C8QA 1OX9A 2GQVA 2J7IA 2OX7A 4WTOB 3V7RA 2HSEB 4LD6A 3I56T 3AT1B 2V1QA 2C06A 2IG0A 4ANJA 4M77G 2O88A 3CCUA 1IHVA 2L3RA 5A0DA 2XIDA 4XTYA 5GAMj 3UWNA 5CCAA 4F7UE 1NJIR 1BI0A 4Y28E 3PTAA 2HKQB 5IHKA 4EMGA 4M77D 3A8OB 2HQXA 3CCMT 3CXCP 5GAN2 2CZ7B 2DXBA 1UTIA 4N4GA 2BTTA 1G83A 1UGRB 4X9CA 5KH6A 2NWMA 1PRLC 2LZ6B 5GAOm 4JZ3A 4QVCA 4E2FB 2KSSA 4KULA 9ATCB 1HD3A 3M56A 1VQ9Q 4IIMA 3OYNA 1T0HA 1VQ6T 2YWWA 4FCYA 2JM8A 4FM4B 3OBYA 1M1KR 3OS2A 1JU5C 2A28A 5IH2A 2XDDA 2D0QB 1I8FA 2DL4A 3GNFB 2O31A 5KYUA 5EG2A 3WVEB 2CP3A 1JXMA 1OYXA 2X3WD 3CCEA 1RLQC 3A8GB 5IHNA 2LVMA 4C8QC 1BK2A 5CQYA 2E41A 1YI2T 2K2VA 3NFCA 1UB4A 2HQHA 1VQOT 2QTXA 1Q7YC 2A0FB 3I35A 2RI5A 3DKMA 3EG9A 4M7DF 4OMLA 4X34A 3META 3CMAA 3L2UA 2V8KA 3JB9F 2LQKA 3X24B 2DEUA 1LCKA 2XG8D 1YWPA 1TG0A 2E6NA 1VYVA 2JMAA 2LJ0A 3PGGA 1U06A 2EKOA 2QQBA 4F17A 3M58A 1H641 5CR2A 1S72Q 3GLXA 3MP1A 5I2SA 1IREB 5GMKm 3M5AA 4QKUA 1D1AA 4KUDK 3MKDA 5GAOp 2J06A 4A4KA 2YRCA 2D9TA 2DRKA 2ENMA 4XU1A 3SEMA 1LOJA 2FO0A 2QA4T 1YP5A 3QWXX 2FG0A 4C0DB 4AFZC 1N9RA 1MMAA 2DTIA 1QP2A 4BE0A 1M1KC 4EIKA 5GAOr 2M51A 1QLYA 4C5GA 2JN0A 4M77C 1WHMA 3RERA 4IUTA 2CP5A 3CMEA 5GANh 1WQWA 1TUDA 1OX8A 2LRQA 4J83A 1H8KA 3EFOA 2VB6A 4OMMA 1QCFA 3UPUA 1K9MC 2PZ1A 3GNGA 4LXCA 2QQAA 2M9UA 3RKXA 4OMPA 4KT0E 3EAEA 5GAN5 4M78D 3TCJA 1M1GA 1TTHB 2OJ2A 4RTTA 4VUBA 5LJ3f 2JTMA 3A1PA 1JQQA 3FRNA 2A7YA 4M75D 1KK7A 3SDZA 2LX9A 3ZEHA 3SWNC 1QVGP 1D09B 2DERA 1JRIA 3CD6T 1B34B 3I56A 3ASKA 2GTJA 1SEMA 3E9FA 1NJIC 1NBEB 1PM3A 1OOTA 3M0UA 3G4SA 5FLXE 3JCMW 3NGPA 2RJFA 2QI2A 4RCCA 5CK9A 3VUBA 5GAOq 3L1AA 3M4GA 3CPWA 2RM4A 1QVFS 2QGFB 1D0XA 2DTOA 1RAIB 4P5NA 5GAMd 1ZUUA 1QWEA 5CKEA 4ZTJA 1WJSA 3OS0A 2AKKA 1YCYA 1NM7A 1WHLA 3N5BB 1RAAB 5GAN6 3CPWP 6AT1B 4JJCA 3OYGA 1JJ2P 3J81E 1N8RU 1E6HA 1UGSB 2RF0A 1AOJA 2EPDA 1NE8A 2VYTA 2EQKA 2K5FA 1NEBA 1AHJB 4R55A 3CBOA 2DVJA 4BD3A 1X6BA 2MPXC 4IKFA 4XAXB 1K73R 3QUIA 2WACA 3EG0A 3RNJA 2OTJT 4QT7A 3NPFA 1XTDA 3JCMf 1Q86R 4FT2A 4HA8A 2ESWA 1TSFA 2KRMA 3SWNA 1WHGA 2R5MA 5GAOl 1Q86C 4X9DA 2WSCE 2QEXQ 1SF9A 1RAGB 2CT3A 1AWXA 1LVKA 2FHDA 2RD1A 4OMOA 2OAWA 5FU6B 1M4ZA 1WLPB 4FL6A 1PNJA 3M0SA 4JDSA 2KE9A 1DJ7B 3CD6A 4EMHA 2HD0A 4JZ4A 1S1NA 2MOXA 2JZ2A 2FZGB 3AHUA 2CP7A 2YLBA 2DXCA 3E2UA 3QYGB 1KD1R 1OEBA 1Q86U 1D3BB 1ZX6A 2DEQA 1IXDA 3SWNB 1IHWA 5CQXA 5A0GA 3LX7A 1I1JA 3G6EA 3CC7A 1C1AA 5LJ5g 5FROA 3O8VA 1N6AA 2HKNA 3PE0A 3EGUA 1WHHA 3JB9I 2P0KA 1OULA 1ZSZA 1R0BG 5LJ3d 1VQKQ 1AWJA 2AK5A 1VQMQ 3TQ7P 5KE2A 5DLOA 1YITT 2LQWA 2E64A 1YHQQ 1QWFA 3V8LA 4CI0C 2M16A 2FB7A 3VUZA 3RKWA 2QA4A 1FMWA 3VJPA 3JB9J 1WX6A 1X69A 1QKXA 5D6YA 5M9OA 5GMKl 1KJWA 2KGTA 1Y71A 4LD9K 3MCAB 4UC4A 1G3TA 1WDXA 4M78F 2DVEA 1V1CA 5KYNA 4JS5A 1YWOA 4HT9A 1M8MA 3EFSA 4RG8A 1JO8A 1UUEA 2JW4A 2L3QA 1HXDA 3UA6A 1HJDA 2DIGA 4DEYA 2HQEA 1OZ3A 1YJNT 1PCXA 5GAN4 3OA6A 5KCHA 3C0CA 2H3JA 3CCLQ 3CCVQ 2IVWA 3PIPA 4HCKA 2E5KA 4NS5A 2DIQA 3G6EQ 2KBTA 4TVRA 2GBQA 4AFUC 2QQSA 4M7DG 1E7OA 4F04B 2VXEA 1YJWQ 1Q81C 1JEGA 1U8RA 5KCOA 5CKDA 5LJ5f 3EG9B 3CXCA 1SPKA 2E12A 3OS5A 2J05A 4RTUA 2QXFA 4PJOG 1NYGA 1TXQA 1T3SA 4FT4A 3TSZA 2FZCB 5I11A 1VQNQ 4LN2A 3M4YA 4E7LA 2XU8A 3SB2A 4RTVA 4ELYC 4PJJA 3EGXA 1M1KU 5D6WA 1JB0E 2MMPA 1CKBA 2RQUA 4F7UA 3CPWS 1UFFA 4J9DA 3CCRT 1RAEB 4ME7A 4FU6A 2CREA 2RHYA 2AZSA 4JRKA 4M77A 4M78C 4LUEA 2RH2A 1M90U 1QVGS 1PSEA 3R6NA 2DXUA 3CCQA 2ZPFB 3OYIA 2C0OA 3CCSQ 2DXTA 4J6YA 2ED1A 3CC7Q 4IURA 3HSBA 3PVLA 3M0RA 2LMJA 4M75B 2L89A 2PNIA 3RBBB 1Q7YR 2IIMA 1FMVA 2HZYA 2BZYA 2OTLT 4BUGA 5KE3A 4M78B 4C5EA 3MP6A 4PFZA 1JJ2A 5C6SA 2EVRA 3CD6Q 3J7AF 3RESA 4ZNXA 1D3BA 4XTZA 3HP9A 3ZL7C 2DJQA 1SKUB 2CDTA 3T9NA 1KSWA 5GJWB 4YTLA 5IN1A 2LC4A 2O2OA 3A8MB 1UGVA 1VQPQ 4BDYA 5DLQE 2E10A 3VS6A 1G3YA 1QKWA 3BDLA 3I5SA 4N0AC 2KYBA 3M0PA 1H92A 3VU3C 1K73C 3O5ZA 3EHRA 2ZAEA 2MYSA 4OP0A 5L23A 4M7DC 4DOWA 2B86A 2VV5A 1R77A 1BU1A 2X4XA 3S6WA 4OMNA 5CAIA 3VS1A 2GF7A 1PRMC 2HDAA 3JRZA 2RA2A 1Q82C 4M7DB 1Y07A 1GBQA 3LGFA 3V8KA 4KGVB 3JCMP 3FEOA 3NTIA 4C0ZA 2E5QA 4ESRA 2DD5A 3NTHA 4MZPA 2FZKB 1U5SA 2EQUA 2QA4Q 2JMCA 3LLRA 3CCRA 3C95A 4ZTFA 2CYZB 3PIOA 2VUBA 2EAYA 2JNGA 2K79A 3OBWA 2DYBA 1GBRA 1WI7A 4BB7A 3VYHB 2K2MA 2KXDA 5I2MA 1Y7XA 1YITA 1FWZA 1VQLA 3CCJQ 5ECAA 4R56A 2ZPGB 2COWA 2LX7A 2K6DA 2RHIA 1X6OA 3OS1A 3I5RA 2QDYB 4M78G 3D7SB 2DILA 3L2VA 3M54A 1M3CA 2EJFA 1VQMA 3OW2A 4M4ZA 2A37A 3HFNA 1D0ZA 1OZ2A 2FPDA 3VS0A 5EC7A 1N27A 3HTRA 1Y57A 2LDMA 3QYHB 2DZCA 1K8AR 1U3OA 2HBWA 2V8JA 2XKOC 4QVZA 3EGDA 4XU3A 4XU0A 4JJBA 1H3ZA 1SSFA 2EKHA 1ZA1B 1WGSA 3RDVA 5A2QE 4M77E 4PLLA 2DL5A 2DBKA 4LE9A 2GCXA 1VYTA 2RPNA 4PL6A 3G4ST 3BFMA 3RMQA 1VQ6Q 4HXJA 3NHNA 4M75E 1N8RR 4OF1A 3VS4A 1KC8R 1VQ9T 3CXCS 3LH5A 2DFUA 4PK4A 1YJWA 3OYLA 3FLGA 2CH4W 5FWCA 1JJ2S 1Q81R 3OYDA 2PVOB 2BKDN 2ZPBB 1VQ7T 1UGPB 2ED0A 3CCLA 1NEGA 2VGNA 2DL3A 3CCQQ 2CT4A 2NUTB 2M1HA 1OPKA 1V76A 1IZ6A 2EBPA 1VQLT 4F7UG 2XICA 4OVAA 2RQRA 2YDLA 1B7TA 4C92F 1KC8U 3BDUA 5LL6S 2LJ1A 3OQ5A 4A54A 4LDUA 2EQIA 2YHTA 5KYYB 1MMGA 4V2SA 2X4YA 4BY6C 4LUDA 1NZ9A 1QVPA 3CMAQ 1GFCA 3NTKA 4C92E 1I4K1 3DLMA 5FWBA 2CZ0B 5FU6C 3X26B 2XK0A 3OYCA 3QPHA 2DRMA 5C0MA 3LW5E 2ROTA 2GGRA 2CH4A 2LCSA 2MK5A 2MAMA 4CC4B 5LJ3j 1PD1A 1NG2A 3H0IA 2YT6A 1G3WA 2HL5C 2MCNA 1QVFA 4II1A 4DA4A 2COZA 3ME9A 1YFNA 4HVUA 4J9IA 1X43A 3QDRB 4ZN1A 2LP5A 2QGGA 2ZPEB 2KY9A 4C92D 3UA7A 2RMOA 5FU7C 4ELZC 5GAN7 1YJWT 1OPLA 2HEQA 2RJEA 5DM7R 5GAMe 1QVFP 3G6ET 3I55Q 3JV3A 4RTXA 3CCJA 1B3QA 1EFNA 3CCLT 1WYXA 1R0CB 3TEEA 3PMTA 1E6GA 4LDXA 2JVVA 2F5TX 1YJNQ 1BCMA 2D8HA 2F5KA 1ARKA 1BIAA 1IB8A 1M27C 2DL8A 5J3BA 1G2BA 2DF6A 4HCZA 4MDXA 1M3AA 3BE3A 3X25B 4M7AG 2DZ9A 4MZMA 2HSPA 1Q7YU 4PFOA 3OYAA 1M5Q1 2EYXA 3FJ5A 4M77B 3KBGA 4IUQA 1VOMA 5GAOn 4M7AC 3GPLA 2QQ9A 3R6OA 2RHXA 1GCQA 2SEMA 5GMKi 1IRXA 1W2BS 4FW1A 4C0DC 1YBYA 2R58A 3QBYA 1N5ZA 3G1JA 5LJ3h 1HK9A 1PG5B 3WVDB 1K9MU 3S3MA 4F14A 2YUNA 5GMKh 3ZBDA 1VQMT 2KR3A 3FJPA 4XU2A 1UG1A 1M30A 3ER0A 1ABOA 3UDCA 4PNOA 1RUWA 4NL3A 4JPBW 3OW2S 2V26A 2QASA 5LJ5j 2FRWA 4O5VA 4E7HA 5IT9E 4QW2A 2GFAA 3JB9D 1YI2A 2L0AA 1KQSS 1VQOA 5GANf 4AG1C 2ZGWA 2KEAA 3JAME 1VQ8T 1MNDA 5FRNA 1VQNA 2I2LA 3JB9G 2XMFA 5GMKj 2W10A 3CMAT 3TSWA 1WNLA 2RHUA 4IUVA 5GMKe 2DNUA 3VKIA 1BKBA 1VQ4Q 3RMSA 4CC3A 1BI2A 1WFWA 2PUKB 2AKLA 2DMOA 3BY7A 1GXIE 5FW9A 2O4XB 4RTYA 1OQKA 1SHGA 1TWBA 4Z02A 3TREA 3LH0A 1FXXA 2DJZA 4L59A 2F2XA 2CP0A 2L3PA 1V29B 2MI6A 3A5ZB 2RN8A 3V8JA 3OSVA 2A36A 3QXEB 3HRSA 1VQLQ 2OAUA 1XJWB 1SSHA 4DBQA 3C12A 2OTJQ 4PJOD 4LDVA 4M78A 5I22A 2RB6A 1FX7A 4PJOA 3V7SA 3RKYA 2K5LA 2B8AA 3MEVA 3CCQT 3A8LB 3OYBA 1ZA2B 4M75C 3MP8A 1VQ7Q 4KBMB 4DQ2A 2YRVA 4J9FA 2F69A 2VWFA 2CZ1B 3P8BB 2KAFA 1X2KA 4FYYB 5LJ3g 2EQMA 3E19A 2EWNA 2J6FA 2LQNA 3G4SQ 2FEIA 4PJNA 3CCUQ 5HCKA 4A63B 1SRLA 4A4GA 5GANg 3RIRA 4KGZB 1TUGB 4WCIA 2RI2A 3M53A 3EGXB 2K5IA 3GF5A 4E6RA 1VIFA 2ZCFB 2DTHA 4HCBA 2BE9B 2LNVA 3G71A 5HKCA 1ZUYA 4MZTA 2A08A 2KQWA 2JS2A 5KYUB 2BUDA 2HCKA 2YLCA 1P92A 2XD0A 1UHCA 4RTZA 2QG9B 2GQIA 1T0JA 3CC2Q 3CC4A 2F2WA 3TU4K 3OYHA 3CMEQ 4XQ3A 1W2BA 4C8QG 2CSIA 4IUPA 2DA9A 3DB3A 4XTXA 4EMKA 3JCMQ 2O9SA 2HAXA 4C8QB 1UE9A 4KGXB 2BZ8A 2EGEA 2KMTA 3E1SA 1KQSP 5IHIA 3CCJT 1A0NB 3PT9A 3QSUA 2KROA 1HSQA 1IGQA 1K0XA 2PVGB 2GNCA 3M55A 3CEYA 4ATOA 3QKJA 1Z9QA 2KYMA 1M3BA 1PKSA 1ZBXA 3QG1A 3OY9A 4PJOC 1U1TA 1VQ5Q 1FMKA 1K8AU 2FVUA 4QQ6A 8AT1B 1KQSA 4E47A 2KT1A 1I07A 5GANe 1MNEA 4EPCA 2CUDA 2JXBA 1OI1A 1B07A 5FU7B 4HVWA 1I5LA 4DEXA 1NLOC 5FRMA 2P4TA 4M7AB 2CSQA 5HK3A 3LGLA 3JB9H 1I81A 1M1FA 1KIKA 4MMKA 3E9GA 3MJXA 4E7SA 5GANj 2C0TA 4LNPA 3H8ZA 2DYIA 2RI3A 3QJYA 3H0HA 4EMKB 2ZZDA 4C92B 2QEXA 3HL8A 1KHCA 5J26A 1GFDA 1OV3A 4MMLA 1ZUKA 1RABB 3JCMg 1RACB 3GBQA 1KFZA 3EG1A 1MGQA 2EYQA 1BI3A 1YN8A 2RNAA 4BY6B 4QQGA 1AD5A 4WF2A 1HYOA 3KUFA 5J39A 4PJMA 3SHWA 2K57A 1AWOA 1JBMA 2OI3A 4K11A 2MIOA 1VQOQ 1B34A 3I9QA 4BI4A 4ZGJB 4KUIA 3CC7T 2E3IA 3LYIA 4M78E 3CCST 3FDRA 2PU9B 1M2OA 1AT1B 2ABLA 4A4FA 2HBPA 1EIFA 4M7AF 2HL3A 1SRMA 2BZXA 4FYWB 5KYWA 1WHKA 2QK0A 2KVQG 2D6FA 1O9SA 3FC3A 2AT1B 3C94A 2VC8A 2Z0WA 4J7FA 1UJYA 2QYZA 2DAQA 3CPFA 1K9MR 3X20B 2EGAA 2P0PA 2CP6A 4PKCC 4F7UB 2AHJB 5CIUA 1MMNA 3L2WA 3PVQA 4CC7A 2GTOA 1D1BA 1MMDA 4C8QE 4J5YA 2LQ8A 3JCMV 1ABQA 4M7DA 1YJNA 1Y96B 1MUZA 2XHCA 3CCVT 3VS5A 2SRCA 1Y96A 2O9VA 1VUBA 3JCMJ 4M7AD 2LTOA 1YJ9A 2H8HA 2X4WA 1O75A 4JUVA 3L2QA 1M90C 4D8DA 3I55A 1AWWA 1M2VB 1JXOA 2AZVA 2F2VA 1RL2A 1K9AA 3NMZC 1QCOA 1NJIU 4Q5WA 3ZFJA 3ULRB 3INZA 4J9HA 3CC4T 3J80E 2M0OA 4FYXB 3EFOB 3BW1A 2CZ6B 1GL5A 3S3OA 2DETA 1VQ8Q 4J6WA 1RI0A 1ZQ1A 3MEAA 2E6ZA 5CO7A 2WSFE 2MWPA 2Y4YA 2EIFA 1FYNA 3VS3A 3P8DA 1ACMB 3FB9A 2RK2A 3EFRA 2EYWA 3CBPA 3JCMd 4AFQC 3G71Q 1RAFB 3VYGA 1YHQT 3UF4A 4C92C 3REBB 4XTUA 1LPLA 4NOYA 4GBQA 1BYMA 4ZN3A 5D7UA 2BIVA 5LJ5h 5KYXA 1X75C 1GCQC 1AZGB 2L5QA 1F1BB 5CKFA 4RKUE 2OTLA 3EG2A 2FRYA 3M57A 4OB2B 2PQWA 1YIJT 1AVZC 1K76A 1UEBA 4Y92A 1RLPC 4Z88A 3CC4Q 2G6FX 3HHTB 4CC2A 4O6JA 5GAMf 2D8JA 1VQKA 2Y4XA 2FL7A 2EYYA 3V7CA 1GCPA 5LJ5e 2DE0X 2RHZA 5GANd 2RJDA 2MWOA 2PVDB 2QEXT 2K9GA 4DBHA 4Z89A 2K3XA 1W70A 3VV0A 1LJOA 1ZHIA 3OW2P 4EDUA 4N0AA 3I55T 2YXYA 1YCSB 4XTWA 1XOVA 3H41A 4J6XA 1BBZA 1SG5A 2ROLA 1M8VA 1PKTA 2DK3A 2EJGA 4PLIA 3EG3A 3RUXA 1UGQB 4B6MA 2DPPB 2YUQA 2H3EB 4KH0B 1MV0B 2JM9A 5D6XA 3MO8A 4LDWA 1N8RC 4OGCA 1KG1A 3DB4A 1MHNA 1U1SA 2JJ9A 4C92A 1PC0A 1GRIA 3OYFA 2LCLA 1W4SA 2CKKA 3QZ5B 4A4EA 2KT8A 1YJ9Q 3Q1JA 3MEWA 5KYYA 1YHQA 5HY6A 2RQWA 3CCEQ 1G5VA 3L2RA 4GY5A 1SHFA 1ZSZC 4OB0B 4C5IA 5CKBA 4HKEA 1R8OB 3QDFA 3JCMX 1ZSGA 4JS4A 3OMCA 4PFPA 2D1XA 4N4HA 3JCMb 2ATCB 3REAB 1BI1A 1PD0A 2E4HA 3IQLA 4OMQA 4JRPA 3PNWC 2FPEA 1NPRA 1EZZB 3HKSA 1TUCA 4C0FA 2JT4A 3H6ZA 2EGCA 2C0IA 5GAMh 2A3LA 4PJOF 3M59A 4BACA 2FYKA 1VQ4A 2O4XA 3OYYA 4PJOB 2X35A 4J9GA 3CQTA 2NLUA 2DKGA 4OGEA 3SD4A 4Y91A 2X51A 3C4SA 3WXMB 4BE2A 2ZPIB 4MDWA 4B9WA 3CC2A 4AMCA 1AZEA 3GOXA 4GLMA 1TH7A 1T3LA 2CUBA 3H9NA 2J6OA 4D8KA 3OYJA 4M7DD 2RQVA 4RCBA 2G3RA 3CCVA 1OU9A 2F1LA 3SFMA 3X28B 4RG2A 4HT8A 3L2ZA 1XNIA 4PJLA 3M0TA 4BI3A 2P4RA 1RAHB 3LWHA 1D0YA 4KH1B 4QVDA 1VYUA 1N9SA 2K4YA 2QAZA 2L3SA 2IPOB 4JRQA 4FYVB 3KXTA 2JUFA 2X9HA 1VQ9A 2L2PA 1Q82R 2EYZA 4M77F 1TS9A 7AT1B 4AT1B 1H3HA 3P8HA 5IXFA 1G3SA 1Z9ZA 3UT1A 1M9SA 3VRZA 4AG2C 1VQ5T 1C6VX 4C0GA 2KXCA 4J9BA 1PHTA 2LNHB 4C8QD 1WJQA 4FSXA 1UECA 4JJDA 5CVIA 2AIRB 3QO3A 4ZGEB 3QWYA 4IUUA 4JLIA 2CP2A 1C0MA 4J7IA 2L8DA 3RR6A 1PSFA 1S72T 4A53A 3THKA 2VASA 4L6V5 1KHIA 3JCMc 4M75F 2RO0A 2PUOB 2FPFA 4FSSA 2K7AA 5KYXB 4KRTA 2RQTA 3GIBA 1UDLA 1WZOA 4IIOA 3VS2A 4F16A 1ZLMA 2YSQA 2DBMA 1D1CA 4A4HA 3CMET 3EH1A 2EQJA 3JCMe 1YIJA 2K3YA 1QCNA 2X4JA 4M75G 1ZSZB 4ORZA 3MPUB 4DBFA 3CC2T 3PFSA 1KQ1A 1QW1A 2HMAA 2O01E 2E1HA 1NPPA 2DO3A 2JS0A 1YI2Q 5GJVB 1LNXA 1QMCA 4E7IA 3HRTA 5GAN8 1OU8A 2NUPB 2YUPA 1J3TA 4CRIA 4JRIA 1VIEA 2KDSA 3G7ZA 1WIEA 2RJCA 2XDBA 2RK1A 3L42A 2EW3A 4FIBA 4GLKA 1Q95G 5AT1B 1BIBA 4E7JA 3EGDB 2M0YA 1X2QA 2KRNA 3CCUT 8ATCB 3HPWA 2Y90A 1WXBA 4ZGDB 4OB3B 3MHXA 1AEYA 3CCSA 2KNBB 2K3BA 2V8IA 2YRDA 3CCMA 3OYMA 5IXBA 1TU0B 1UJ0A 2JOYA 2I0NA 1W6XA 5LJ5d 1VQPT 5AYFA 4L5GA 3A8HB 4M75A 1IO6A 5IAYA 4D6WA 4BDZA 3OB9A 4EMKC 4JLGA 4BI8B 4FW2A 2LCCA 3A98A 2DM1A 1WJRA 2QDLA 3JSCA 1W1FA 5I21A 4JJNK 1UHFA 3EHQA 3CCMQ 2OTLQ 2JTEA 3OYKA 1PWTA 2P84A 4LDYA 2KI7A 1Y0MA 3HRUA 5LJ3e 2GFUA 2VGMA 4DOVA 2WSEE 1WXTA 1BCOA 2ZPHB 3M0QA 1VQ6A 4RUGA 1EX4A 2X3XD 3CBMA 4J9EA 2XDPA 2R57A 5CKHA 3LWIA 1YNZA 1VA7A 3QZ9B 1VQ4T 1MV3A 3URGA 1M2VA 3TVTA 2KRSA 3OYEA 3U23A 3VRYA 1ZBJA 4RTWA 4OMFB 2DX1A 4HCCA 3I56Q 2EJ9A 3CCRQ 1QQJA 3DLLA 4DBRA 2OTJA 1K0SA 2COYA 2NYSA 3CCET 4R0KA 1CKAA 1RI9A 2NUPA 1YJ9T 2MF2A 3S3NA 1VQ8A 1VQNT 3UATA 1I5OB 2NUZA 2PTKA 4HVVA 3OMGA 4C92G 1XQHA 2ECZA 2LT4A 1QP3A 2XI9A 1WQ7A 2E70A 1K73U 3F70A 4Z8AA 2DL7A 2YUOA 1WA7A 2D0NA 3QJ6A 4QQDA 4M7AA 4C8QF 1KD1C
chains in the Genus database with same CATH topology
1NYFA 1ZX6A 4AFSC 1NLPC 1OPLA 2HEQA 1X27A 1CSKA 1X6GA 3JV3A 3KFVA 4RTXA 1B3QA 1I1JA 1FYNA 3VS3A 1EFNA 1WYXA 1E6GA 2EYWA 4AFQC 2D8HA 2V1RA 1ARKA 3PE0A 3UF4A 3EGUA 3REBB 1M27C 2VVKA 2DL8A 1AWJA 2AK5A 1G2BA 2DF6A 1M3AA 2LQWA 1QWFA 2HSPA 4GBQA 1K1ZA 2EYXA 3FJ5A 3VS7A 1GCQC 1AZGB 1BB9A 1WX6A 1GCQA 2SEMA 2W0ZA 1X69A 1QKXA 1KJWA 2KGTA 3EG2A 2FRYA 1WXUA 1WDXA 2VKNA 1N5ZA 2LJ3A 1V1CA 1AVZC 1K76A 4Y92A 1RLPC 4Z88A 1YWOA 1M8MA 4F14A 4X1VA 2YUNA 2G6FX 4CC2A 1JO8A 1UUEA 2JW4A 2KR3A 1UG1A 2D8JA 2L3QA 1M30A 2J6KA 1ABOA 3UA6A 1HJDA 1I0CA 1RUWA 4J9CA 4JPBW 4DEYA 2EYYA 1GCPA 2FRWA 3C0CA 1K4US 2DE0X 2K9GA 4Z89A 3H0FA 1W70A 2DLPA 2L0AA 4HCKA 2E5KA 1YCSB 2J7IA 2KBTA 4AG1C 1XOVA 2GBQA 3H41A 2KEAA 4AFUC 1BBZA 1E7OA 2ROLA 1PKTA 2XMFA 1JEGA 2W10A 2V1QA 3EG3A 3TSWA 2DNUA 1SPKA 2YUQA 4CC3A 2J05A 4RTUA 1WFWA 1MV0B 2AKLA 2DMOA 2JM9A 2O88A 5FW9A 1NYGA 4RTYA 1T3SA 3TSZA 1SHGA 5I11A 5IHKA 1GRIA 4LN2A 2KT8A 2F2XA 4RTVA 2L3PA 2RN8A 2RQWA 2A36A 1CKBA 2RQUA 1SHFA 1UFFA 1UTIA 4J9DA 1SSHA 2CREA 2AZSA 2BTTA 4LUEA 1G83A 5I22A 1ZSGA 2D1XA 3R6NA 3IQLA 3REAB 4OMQA 2NWMA 1PRLC 2LZ6B 2FPEA 2C0OA 1TUCA 4JZ3A 2JT4A 4J9FA 2ED1A 2VWFA 1HD3A 2EGCA 3PVLA 2C0IA 3M0RA 2LMJA 1X2KA 4IIMA 2PNIA 3RBBB 2IIMA 2BZYA 1T0HA 2J6FA 2LQNA 2JM8A 4J9GA 2FEIA 3CQTA 5HCKA 4A63B 1JU5C 2A28A 2EVRA 4ZNXA 3ZL7C 5IH2A 1SRLA 2DJQA 2DL4A 2O31A 2CDTA 4WCIA 1AZEA 1KSWA 5GJWB 4GLMA 1T3LA 2CUBA 4E6RA 2J6OA 4D8KA 1JXMA 2O2OA 1UGVA 2RQVA 2X3WD 3VS6A 1RLQC 5IHNA 1QKWA 1ZUYA 1BK2A 2A08A 3I5SA 1H92A 2KYBA 3M0PA 2JS2A 3O5ZA 2HCKA 3EHRA 3M0TA 1UHCA 5L23A 2P4RA 4RTZA 2B86A 2GQIA 1T0JA 1BU1A 1VYUA 2F2WA 3I35A 2L3SA 4OMNA 4OMLA 3VS1A 1PRMC 2HDAA 2CSIA 1GBQA 1LCKA 1YWPA 2DA9A 2L2PA 1TG0A 2EYZA 2O9SA 1VYVA 2JMAA 2LJ0A 1U06A 4ESRA 1UE9A 1H3HA 5IXFA 4F17A 2BZ8A 2EGEA 1Z9ZA 5IHIA 1A0NB 1U5SA 2KROA 2JMCA 1HSQA 1K0XA 3VRZA 4AG2C 2J06A 2KXCA 4J9BA 2GNCA 1PHTA 2DRKA 2LNHB 2K79A 2ENMA 1Z9QA 2DYBA 2KYMA 1M3BA 1GBRA 1PKSA 1UECA 1WI7A 4JJDA 3SEMA 3QWYA 1FMKA 2K2MA 2FO0A 2KXDA 1YP5A 3QWXX 2KT1A 1I07A 2FG0A 4AFZC 3THKA 5ECAA 2CUDA 2FPFA 2JXBA 4FSSA 1B07A 4EIKA 2M51A 1QLYA 2K7AA 4KRTA 2LX7A 2K6DA 2RQTA 4HVWA 4DEXA 1UDLA 3I5RA 1NLOC 4IIOA 1TUDA 3VS2A 4F16A 2DILA 1ZLMA 2YSQA 2DBMA 2CSQA 1M3CA 1H8KA 2A37A 4M4ZA 1KIKA 4OMMA 1QCFA 2FPDA 4ORZA 2PZ1A 2C0TA 4LNPA 3VS0A 5EC7A 4OMPA 1Y57A 1U3OA 3H0HA 2HBWA 2JS0A 5GJVB 4JJBA 2EKHA 2YUPA 1J3TA 2OJ2A 1GFDA 4RTTA 1OV3A 1ZUKA 1JQQA 3GBQA 1KFZA 1WIEA 3EG1A 1YN8A 2DL5A 2EW3A 2RNAA 1AD5A 2DBKA 4LE9A 2M0YA 1VYTA 1X2QA 2KRNA 2RPNA 2GTJA 1SEMA 3SHWA 1AWOA 1OOTA 2OI3A 4HXJA 4K11A 3NHNA 3M0UA 2MIOA 1WXBA 3VS4A 3I9QA 3LH5A 1AEYA 3NGPA 2CH4W 2KNBB 2K3BA 5FWCA 5IXBA 1UJ0A 2I0NA 1W6XA 2ED0A 2ABLA 1NEGA 2DL3A 2CT4A 1IO6A 1ZUUA 1OPKA 1QWEA 1SRMA 2BZXA 3A98A 2DM1A 2EBPA 2AKKA 1NM7A 2QDLA 1W1FA 1UHFA 3EHQA 4JJCA 2RQRA 1UJYA 2JTEA 2YDLA 1E6HA 1PWTA 2EGAA 1Y0MA 2RF0A 1AOJA 2EPDA 2LJ1A 1NEBA 1WXTA 3M0QA 2DVJA 2EQIA 4RUGA 2X3XD 4J9EA 1YNZA 1VA7A 1X6BA 1MV3A 3PVQA 4LUDA 2GTOA 4CC7A 3TVTA 2KRSA 1GFCA 3U23A 3VRYA 1ZBJA 4RTWA 2DX1A 3EG0A 3RNJA 1ABQA 4QT7A 3NPFA 5FWBA 2DRMA 1K0SA 2ROTA 2ESWA 2GGRA 1MUZA 2KRMA 2CH4A 4R0KA 1CKAA 2LCSA 3VS5A 1RI9A 2SRCA 4CC4B 1NG2A 2CT3A 1AWXA 2O9VA 2YT6A 3H0IA 4OMOA 2OAWA 2H8HA 2MCNA 3UATA 1WLPB 1PNJA 2NUZA 3M0SA 2PTKA 4HVVA 4D8DA 1AWWA 2KE9A 1JXOA 2AZVA 4HVUA 4J9IA 2F2VA 2ECZA 1K9AA 3NMZC 4JZ4A 1X43A 1S1NA 2MOXA 2LP5A 3ULRB 4J9HA 4Z8AA 2DL7A 3UA7A 2YUOA 1GL5A 1WA7A 2D0NA 2RMOA 1OEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYF A;  1ZX6 A;  4AFS C;  1NLP C;  1OPL A;  2HEQ A;  1X27 A;  1CSK A;  1X6G A;  3JV3 A;  3KFV A;  4RTX A;  1B3Q A;  1I1J A;  1FYN A;  3VS3 A;  1EFN A;  1WYX A;  1E6G A;  2EYW A;  4AFQ C;  2D8H A;  2V1R A;  1ARK A;  3PE0 A;  3UF4 A;  3EGU A;  3REB B;  1M27 C;  2VVK A;  2DL8 A;  1AWJ A;  2AK5 A;  1G2B A;  2DF6 A;  1M3A A;  2LQW A;  1QWF A;  2HSP A;  4GBQ A;  1K1Z A;  2EYX A;  3FJ5 A;  3VS7 A;  1GCQ C;  1AZG B;  1BB9 A;  1WX6 A;  1GCQ A;  2SEM A;  2W0Z A;  1X69 A;  1QKX A;  1KJW A;  2KGT A;  3EG2 A;  2FRY A;  1WXU A;  1WDX A;  2VKN A;  1N5Z A;  2LJ3 A;  1V1C A;  1AVZ C;  1K76 A;  4Y92 A;  1RLP C;  4Z88 A;  1YWO A;  1M8M A;  4F14 A;  4X1V A;  2YUN A;  2G6F X;  4CC2 A;  1JO8 A;  1UUE A;  2JW4 A;  2KR3 A;  1UG1 A;  2D8J A;  2L3Q A;  1M30 A;  2J6K A;  1ABO A;  3UA6 A;  1HJD A;  1I0C A;  1RUW A;  4J9C A;  4JPB W;  4DEY A;  2EYY A;  1GCP A;  2FRW A;  3C0C A;  1K4U S;  2DE0 X;  2K9G A;  4Z89 A;  3H0F A;  1W70 A;  2DLP A;  2L0A A;  4HCK A;  2E5K A;  1YCS B;  2J7I A;  2KBT A;  4AG1 C;  1XOV A;  2GBQ A;  3H41 A;  2KEA A;  4AFU C;  1BBZ A;  1E7O A;  2ROL A;  1PKT A;  2XMF A;  1JEG A;  2W10 A;  2V1Q A;  3EG3 A;  3TSW A;  2DNU A;  1SPK A;  2YUQ A;  4CC3 A;  2J05 A;  4RTU A;  1WFW A;  1MV0 B;  2AKL A;  2DMO A;  2JM9 A;  2O88 A;  5FW9 A;  1NYG A;  4RTY A;  1T3S A;  3TSZ A;  1SHG A;  5I11 A;  5IHK A;  1GRI A;  4LN2 A;  2KT8 A;  2F2X A;  4RTV A;  2L3P A;  2RN8 A;  2RQW A;  2A36 A;  1CKB A;  2RQU A;  1SHF A;  1UFF A;  1UTI A;  4J9D A;  1SSH A;  2CRE A;  2AZS A;  2BTT A;  4LUE A;  1G83 A;  5I22 A;  1ZSG A;  2D1X A;  3R6N A;  3IQL A;  3REA B;  4OMQ A;  2NWM A;  1PRL C;  2LZ6 B;  2FPE A;  2C0O A;  1TUC A;  4JZ3 A;  2JT4 A;  4J9F A;  2ED1 A;  2VWF A;  1HD3 A;  2EGC A;  3PVL A;  2C0I A;  3M0R A;  2LMJ A;  1X2K A;  4IIM A;  2PNI A;  3RBB B;  2IIM A;  2BZY A;  1T0H A;  2J6F A;  2LQN A;  2JM8 A;  4J9G A;  2FEI A;  3CQT A;  5HCK A;  4A63 B;  1JU5 C;  2A28 A;  2EVR A;  4ZNX A;  3ZL7 C;  5IH2 A;  1SRL A;  2DJQ A;  2DL4 A;  2O31 A;  2CDT A;  4WCI A;  1AZE A;  1KSW A;  5GJW B;  4GLM A;  1T3L A;  2CUB A;  4E6R A;  2J6O A;  4D8K A;  1JXM A;  2O2O A;  1UGV A;  2RQV A;  2X3W D;  3VS6 A;  1RLQ C;  5IHN A;  1QKW A;  1ZUY A;  1BK2 A;  2A08 A;  3I5S A;  1H92 A;  2KYB A;  3M0P A;  2JS2 A;  3O5Z A;  2HCK A;  3EHR A;  3M0T A;  1UHC A;  5L23 A;  2P4R A;  4RTZ A;  2B86 A;  2GQI A;  1T0J A;  1BU1 A;  1VYU A;  2F2W A;  3I35 A;  2L3S A;  4OMN A;  4OML A;  3VS1 A;  1PRM C;  2HDA A;  2CSI A;  1GBQ A;  1LCK A;  1YWP A;  2DA9 A;  2L2P A;  1TG0 A;  2EYZ A;  2O9S A;  1VYV A;  2JMA A;  2LJ0 A;  1U06 A;  4ESR A;  1UE9 A;  1H3H A;  5IXF A;  4F17 A;  2BZ8 A;  2EGE A;  1Z9Z A;  5IHI A;  1A0N B;  1U5S A;  2KRO A;  2JMC A;  1HSQ A;  1K0X A;  3VRZ A;  4AG2 C;  2J06 A;  2KXC A;  4J9B A;  2GNC A;  1PHT A;  2DRK A;  2LNH B;  2K79 A;  2ENM A;  1Z9Q A;  2DYB A;  2KYM A;  1M3B A;  1GBR A;  1PKS A;  1UEC A;  1WI7 A;  4JJD A;  3SEM A;  3QWY A;  1FMK A;  2K2M A;  2FO0 A;  2KXD A;  1YP5 A;  3QWX X;  2KT1 A;  1I07 A;  2FG0 A;  4AFZ C;  3THK A;  5ECA A;  2CUD A;  2FPF A;  2JXB A;  4FSS A;  1B07 A;  4EIK A;  2M51 A;  1QLY A;  2K7A A;  4KRT A;  2LX7 A;  2K6D A;  2RQT A;  4HVW A;  4DEX A;  1UDL A;  3I5R A;  1NLO C;  4IIO A;  1TUD A;  3VS2 A;  4F16 A;  2DIL A;  1ZLM A;  2YSQ A;  2DBM A;  2CSQ A;  1M3C A;  1H8K A;  2A37 A;  4M4Z A;  1KIK A;  4OMM A;  1QCF A;  2FPD A;  4ORZ A;  2PZ1 A;  2C0T A;  4LNP A;  3VS0 A;  5EC7 A;  4OMP A;  1Y57 A;  1U3O A;  3H0H A;  2HBW A;  2JS0 A;  5GJV B;  4JJB A;  2EKH A;  2YUP A;  1J3T A;  2OJ2 A;  1GFD A;  4RTT A;  1OV3 A;  1ZUK A;  1JQQ A;  3GBQ A;  1KFZ A;  1WIE A;  3EG1 A;  1YN8 A;  2DL5 A;  2EW3 A;  2RNA A;  1AD5 A;  2DBK A;  4LE9 A;  2M0Y A;  1VYT A;  1X2Q A;  2KRN A;  2RPN A;  2GTJ A;  1SEM A;  3SHW A;  1AWO A;  1OOT A;  2OI3 A;  4HXJ A;  4K11 A;  3NHN A;  3M0U A;  2MIO A;  1WXB A;  3VS4 A;  3I9Q A;  3LH5 A;  1AEY A;  3NGP A;  2CH4 W;  2KNB B;  2K3B A;  5FWC A;  5IXB A;  1UJ0 A;  2I0N A;  1W6X A;  2ED0 A;  2ABL A;  1NEG A;  2DL3 A;  2CT4 A;  1IO6 A;  1ZUU A;  1OPK A;  1QWE A;  1SRM A;  2BZX A;  3A98 A;  2DM1 A;  2EBP A;  2AKK A;  1NM7 A;  2QDL A;  1W1F A;  1UHF A;  3EHQ A;  4JJC A;  2RQR A;  1UJY A;  2JTE A;  2YDL A;  1E6H A;  1PWT A;  2EGA A;  1Y0M A;  2RF0 A;  1AOJ A;  2EPD A;  2LJ1 A;  1NEB A;  1WXT A;  3M0Q A;  2DVJ A;  2EQI A;  4RUG A;  2X3X D;  4J9E A;  1YNZ A;  1VA7 A;  1X6B A;  1MV3 A;  3PVQ A;  4LUD A;  2GTO A;  4CC7 A;  3TVT A;  2KRS A;  1GFC A;  3U23 A;  3VRY A;  1ZBJ A;  4RTW A;  2DX1 A;  3EG0 A;  3RNJ A;  1ABQ A;  4QT7 A;  3NPF A;  5FWB A;  2DRM A;  1K0S A;  2ROT A;  2ESW A;  2GGR A;  1MUZ A;  2KRM A;  2CH4 A;  4R0K A;  1CKA A;  2LCS A;  3VS5 A;  1RI9 A;  2SRC A;  4CC4 B;  1NG2 A;  2CT3 A;  1AWX A;  2O9V A;  2YT6 A;  3H0I A;  4OMO A;  2OAW A;  2H8H A;  2MCN A;  3UAT A;  1WLP B;  1PNJ A;  2NUZ A;  3M0S A;  2PTK A;  4HVV A;  4D8D A;  1AWW A;  2KE9 A;  1JXO A;  2AZV A;  4HVU A;  4J9I A;  2F2V A;  2ECZ A;  1K9A A;  3NMZ C;  4JZ4 A;  1X43 A;  1S1N A;  2MOX A;  2LP5 A;  3ULR B;  4J9H A;  4Z8A A;  2DL7 A;  3UA7 A;  2YUO A;  1GL5 A;  1WA7 A;  2D0N A;  2RMO A;  1OEB A; 
#chains in the Genus database with same CATH topology
 1NYF A;  4AFS C;  2HNI A;  2R5A A;  4BE1 A;  1NLP C;  2DD4 A;  1X27 A;  5HK0 A;  1CSK A;  1X6G A;  2VXF A;  4M7A E;  2KK4 A;  3FIF A;  3KFV A;  4XTV A;  5DY9 A;  1VQP A;  5GAM g;  1WHJ A;  2CS7 A;  1Q82 U;  4J8O A;  5GAN 3;  2E65 A;  2BE7 D;  1M90 R;  2P0Q A;  1VQ7 A;  2V1R A;  1G8X A;  1W2B P;  2VVK A;  1VQ5 A;  5L8R E;  3HFO A;  1Q81 U;  4RMO A;  3QHS A;  3GP8 A;  4NL2 A;  5A0L A;  1K1Z A;  1KD1 U;  1YIJ Q;  3VS7 A;  1KC8 C;  3OSS C;  4E7K A;  3MEU A;  4OB1 B;  2LT1 A;  3JCM h;  1S72 A;  1BB9 A;  4F7U F;  2W0Z A;  4B9X A;  4M7D E;  4N4I A;  1WPY A;  5KYW B;  1WXU A;  3EH2 A;  1RAD B;  4XK8 E;  2VKN A;  1X01 A;  1KQ2 A;  2LJ3 A;  2QTV A;  1IGU A;  3QII A;  3PMI A;  4E7Z A;  2NUT A;  4X1V A;  2JTF A;  2M02 A;  1YIT Q;  1VQK T;  3M9Q A;  2E3H A;  4PJO E;  2J6K A;  1TOV A;  2CGH A;  2QQR A;  4C5H A;  1QVG A;  1I0C A;  4J9C A;  1K8A C;  2EFI A;  3G71 T;  1K4U S;  3H0F A;  2DLP A;  4C8Q A;  1OX9 A;  2GQV A;  2J7I A;  2OX7 A;  4WTO B;  3V7R A;  2HSE B;  4LD6 A;  3I56 T;  3AT1 B;  2V1Q A;  2C06 A;  2IG0 A;  4ANJ A;  4M77 G;  2O88 A;  3CCU A;  1IHV A;  2L3R A;  5A0D A;  2XID A;  4XTY A;  5GAM j;  3UWN A;  5CCA A;  4F7U E;  1NJI R;  1BI0 A;  4Y28 E;  3PTA A;  2HKQ B;  5IHK A;  4EMG A;  4M77 D;  3A8O B;  2HQX A;  3CCM T;  3CXC P;  5GAN 2;  2CZ7 B;  2DXB A;  1UTI A;  4N4G A;  2BTT A;  1G83 A;  1UGR B;  4X9C A;  5KH6 A;  2NWM A;  1PRL C;  2LZ6 B;  5GAO m;  4JZ3 A;  4QVC A;  4E2F B;  2KSS A;  4KUL A;  9ATC B;  1HD3 A;  3M56 A;  1VQ9 Q;  4IIM A;  3OYN A;  1T0H A;  1VQ6 T;  2YWW A;  4FCY A;  2JM8 A;  4FM4 B;  3OBY A;  1M1K R;  3OS2 A;  1JU5 C;  2A28 A;  5IH2 A;  2XDD A;  2D0Q B;  1I8F A;  2DL4 A;  3GNF B;  2O31 A;  5KYU A;  5EG2 A;  3WVE B;  2CP3 A;  1JXM A;  1OYX A;  2X3W D;  3CCE A;  1RLQ C;  3A8G B;  5IHN A;  2LVM A;  4C8Q C;  1BK2 A;  5CQY A;  2E41 A;  1YI2 T;  2K2V A;  3NFC A;  1UB4 A;  2HQH A;  1VQO T;  2QTX A;  1Q7Y C;  2A0F B;  3I35 A;  2RI5 A;  3DKM A;  3EG9 A;  4M7D F;  4OML A;  4X34 A;  3MET A;  3CMA A;  3L2U A;  2V8K A;  3JB9 F;  2LQK A;  3X24 B;  2DEU A;  1LCK A;  2XG8 D;  1YWP A;  1TG0 A;  2E6N A;  1VYV A;  2JMA A;  2LJ0 A;  3PGG A;  1U06 A;  2EKO A;  2QQB A;  4F17 A;  3M58 A;  1H64 1;  5CR2 A;  1S72 Q;  3GLX A;  3MP1 A;  5I2S A;  1IRE B;  5GMK m;  3M5A A;  4QKU A;  1D1A A;  4KUD K;  3MKD A;  5GAO p;  2J06 A;  4A4K A;  2YRC A;  2D9T A;  2DRK A;  2ENM A;  4XU1 A;  3SEM A;  1LOJ A;  2FO0 A;  2QA4 T;  1YP5 A;  3QWX X;  2FG0 A;  4C0D B;  4AFZ C;  1N9R A;  1MMA A;  2DTI A;  1QP2 A;  4BE0 A;  1M1K C;  4EIK A;  5GAO r;  2M51 A;  1QLY A;  4C5G A;  2JN0 A;  4M77 C;  1WHM A;  3RER A;  4IUT A;  2CP5 A;  3CME A;  5GAN h;  1WQW A;  1TUD A;  1OX8 A;  2LRQ A;  4J83 A;  1H8K A;  3EFO A;  2VB6 A;  4OMM A;  1QCF A;  3UPU A;  1K9M C;  2PZ1 A;  3GNG A;  4LXC A;  2QQA A;  2M9U A;  3RKX A;  4OMP A;  4KT0 E;  3EAE A;  5GAN 5;  4M78 D;  3TCJ A;  1M1G A;  1TTH B;  2OJ2 A;  4RTT A;  4VUB A;  5LJ3 f;  2JTM A;  3A1P A;  1JQQ A;  3FRN A;  2A7Y A;  4M75 D;  1KK7 A;  3SDZ A;  2LX9 A;  3ZEH A;  3SWN C;  1QVG P;  1D09 B;  2DER A;  1JRI A;  3CD6 T;  1B34 B;  3I56 A;  3ASK A;  2GTJ A;  1SEM A;  3E9F A;  1NJI C;  1NBE B;  1PM3 A;  1OOT A;  3M0U A;  3G4S A;  5FLX E;  3JCM W;  3NGP A;  2RJF A;  2QI2 A;  4RCC A;  5CK9 A;  3VUB A;  5GAO q;  3L1A A;  3M4G A;  3CPW A;  2RM4 A;  1QVF S;  2QGF B;  1D0X A;  2DTO A;  1RAI B;  4P5N A;  5GAM d;  1ZUU A;  1QWE A;  5CKE A;  4ZTJ A;  1WJS A;  3OS0 A;  2AKK A;  1YCY A;  1NM7 A;  1WHL A;  3N5B B;  1RAA B;  5GAN 6;  3CPW P;  6AT1 B;  4JJC A;  3OYG A;  1JJ2 P;  3J81 E;  1N8R U;  1E6H A;  1UGS B;  2RF0 A;  1AOJ A;  2EPD A;  1NE8 A;  2VYT A;  2EQK A;  2K5F A;  1NEB A;  1AHJ B;  4R55 A;  3CBO A;  2DVJ A;  4BD3 A;  1X6B A;  2MPX C;  4IKF A;  4XAX B;  1K73 R;  3QUI A;  2WAC A;  3EG0 A;  3RNJ A;  2OTJ T;  4QT7 A;  3NPF A;  1XTD A;  3JCM f;  1Q86 R;  4FT2 A;  4HA8 A;  2ESW A;  1TSF A;  2KRM A;  3SWN A;  1WHG A;  2R5M A;  5GAO l;  1Q86 C;  4X9D A;  2WSC E;  2QEX Q;  1SF9 A;  1RAG B;  2CT3 A;  1AWX A;  1LVK A;  2FHD A;  2RD1 A;  4OMO A;  2OAW A;  5FU6 B;  1M4Z A;  1WLP B;  4FL6 A;  1PNJ A;  3M0S A;  4JDS A;  2KE9 A;  1DJ7 B;  3CD6 A;  4EMH A;  2HD0 A;  4JZ4 A;  1S1N A;  2MOX A;  2JZ2 A;  2FZG B;  3AHU A;  2CP7 A;  2YLB A;  2DXC A;  3E2U A;  3QYG B;  1KD1 R;  1OEB A;  1Q86 U;  1D3B B;  1ZX6 A;  2DEQ A;  1IXD A;  3SWN B;  1IHW A;  5CQX A;  5A0G A;  3LX7 A;  1I1J A;  3G6E A;  3CC7 A;  1C1A A;  5LJ5 g;  5FRO A;  3O8V A;  1N6A A;  2HKN A;  3PE0 A;  3EGU A;  1WHH A;  3JB9 I;  2P0K A;  1OUL A;  1ZSZ A;  1R0B G;  5LJ3 d;  1VQK Q;  1AWJ A;  2AK5 A;  1VQM Q;  3TQ7 P;  5KE2 A;  5DLO A;  1YIT T;  2LQW A;  2E64 A;  1YHQ Q;  1QWF A;  3V8L A;  4CI0 C;  2M16 A;  2FB7 A;  3VUZ A;  3RKW A;  2QA4 A;  1FMW A;  3VJP A;  3JB9 J;  1WX6 A;  1X69 A;  1QKX A;  5D6Y A;  5M9O A;  5GMK l;  1KJW A;  2KGT A;  1Y71 A;  4LD9 K;  3MCA B;  4UC4 A;  1G3T A;  1WDX A;  4M78 F;  2DVE A;  1V1C A;  5KYN A;  4JS5 A;  1YWO A;  4HT9 A;  1M8M A;  3EFS A;  4RG8 A;  1JO8 A;  1UUE A;  2JW4 A;  2L3Q A;  1HXD A;  3UA6 A;  1HJD A;  2DIG A;  4DEY A;  2HQE A;  1OZ3 A;  1YJN T;  1PCX A;  5GAN 4;  3OA6 A;  5KCH A;  3C0C A;  2H3J A;  3CCL Q;  3CCV Q;  2IVW A;  3PIP A;  4HCK A;  2E5K A;  4NS5 A;  2DIQ A;  3G6E Q;  2KBT A;  4TVR A;  2GBQ A;  4AFU C;  2QQS A;  4M7D G;  1E7O A;  4F04 B;  2VXE A;  1YJW Q;  1Q81 C;  1JEG A;  1U8R A;  5KCO A;  5CKD A;  5LJ5 f;  3EG9 B;  3CXC A;  1SPK A;  2E12 A;  3OS5 A;  2J05 A;  4RTU A;  2QXF A;  4PJO G;  1NYG A;  1TXQ A;  1T3S A;  4FT4 A;  3TSZ A;  2FZC B;  5I11 A;  1VQN Q;  4LN2 A;  3M4Y A;  4E7L A;  2XU8 A;  3SB2 A;  4RTV A;  4ELY C;  4PJJ A;  3EGX A;  1M1K U;  5D6W A;  1JB0 E;  2MMP A;  1CKB A;  2RQU A;  4F7U A;  3CPW S;  1UFF A;  4J9D A;  3CCR T;  1RAE B;  4ME7 A;  4FU6 A;  2CRE A;  2RHY A;  2AZS A;  4JRK A;  4M77 A;  4M78 C;  4LUE A;  2RH2 A;  1M90 U;  1QVG S;  1PSE A;  3R6N A;  2DXU A;  3CCQ A;  2ZPF B;  3OYI A;  2C0O A;  3CCS Q;  2DXT A;  4J6Y A;  2ED1 A;  3CC7 Q;  4IUR A;  3HSB A;  3PVL A;  3M0R A;  2LMJ A;  4M75 B;  2L89 A;  2PNI A;  3RBB B;  1Q7Y R;  2IIM A;  1FMV A;  2HZY A;  2BZY A;  2OTL T;  4BUG A;  5KE3 A;  4M78 B;  4C5E A;  3MP6 A;  4PFZ A;  1JJ2 A;  5C6S A;  2EVR A;  3CD6 Q;  3J7A F;  3RES A;  4ZNX A;  1D3B A;  4XTZ A;  3HP9 A;  3ZL7 C;  2DJQ A;  1SKU B;  2CDT A;  3T9N A;  1KSW A;  5GJW B;  4YTL A;  5IN1 A;  2LC4 A;  2O2O A;  3A8M B;  1UGV A;  1VQP Q;  4BDY A;  5DLQ E;  2E10 A;  3VS6 A;  1G3Y A;  1QKW A;  3BDL A;  3I5S A;  4N0A C;  2KYB A;  3M0P A;  1H92 A;  3VU3 C;  1K73 C;  3O5Z A;  3EHR A;  2ZAE A;  2MYS A;  4OP0 A;  5L23 A;  4M7D C;  4DOW A;  2B86 A;  2VV5 A;  1R77 A;  1BU1 A;  2X4X A;  3S6W A;  4OMN A;  5CAI A;  3VS1 A;  2GF7 A;  1PRM C;  2HDA A;  3JRZ A;  2RA2 A;  1Q82 C;  4M7D B;  1Y07 A;  1GBQ A;  3LGF A;  3V8K A;  4KGV B;  3JCM P;  3FEO A;  3NTI A;  4C0Z A;  2E5Q A;  4ESR A;  2DD5 A;  3NTH A;  4MZP A;  2FZK B;  1U5S A;  2EQU A;  2QA4 Q;  2JMC A;  3LLR A;  3CCR A;  3C95 A;  4ZTF A;  2CYZ B;  3PIO A;  2VUB A;  2EAY A;  2JNG A;  2K79 A;  3OBW A;  2DYB A;  1GBR A;  1WI7 A;  4BB7 A;  3VYH B;  2K2M A;  2KXD A;  5I2M A;  1Y7X A;  1YIT A;  1FWZ A;  1VQL A;  3CCJ Q;  5ECA A;  4R56 A;  2ZPG B;  2COW A;  2LX7 A;  2K6D A;  2RHI A;  1X6O A;  3OS1 A;  3I5R A;  2QDY B;  4M78 G;  3D7S B;  2DIL A;  3L2V A;  3M54 A;  1M3C A;  2EJF A;  1VQM A;  3OW2 A;  4M4Z A;  2A37 A;  3HFN A;  1D0Z A;  1OZ2 A;  2FPD A;  3VS0 A;  5EC7 A;  1N27 A;  3HTR A;  1Y57 A;  2LDM A;  3QYH B;  2DZC A;  1K8A R;  1U3O A;  2HBW A;  2V8J A;  2XKO C;  4QVZ A;  3EGD A;  4XU3 A;  4XU0 A;  4JJB A;  1H3Z A;  1SSF A;  2EKH A;  1ZA1 B;  1WGS A;  3RDV A;  5A2Q E;  4M77 E;  4PLL A;  2DL5 A;  2DBK A;  4LE9 A;  2GCX A;  1VYT A;  2RPN A;  4PL6 A;  3G4S T;  3BFM A;  3RMQ A;  1VQ6 Q;  4HXJ A;  3NHN A;  4M75 E;  1N8R R;  4OF1 A;  3VS4 A;  1KC8 R;  1VQ9 T;  3CXC S;  3LH5 A;  2DFU A;  4PK4 A;  1YJW A;  3OYL A;  3FLG A;  2CH4 W;  5FWC A;  1JJ2 S;  1Q81 R;  3OYD A;  2PVO B;  2BKD N;  2ZPB B;  1VQ7 T;  1UGP B;  2ED0 A;  3CCL A;  1NEG A;  2VGN A;  2DL3 A;  3CCQ Q;  2CT4 A;  2NUT B;  2M1H A;  1OPK A;  1V76 A;  1IZ6 A;  2EBP A;  1VQL T;  4F7U G;  2XIC A;  4OVA A;  2RQR A;  2YDL A;  1B7T A;  4C92 F;  1KC8 U;  3BDU A;  5LL6 S;  2LJ1 A;  3OQ5 A;  4A54 A;  4LDU A;  2EQI A;  2YHT A;  5KYY B;  1MMG A;  4V2S A;  2X4Y A;  4BY6 C;  4LUD A;  1NZ9 A;  1QVP A;  3CMA Q;  1GFC A;  3NTK A;  4C92 E;  1I4K 1;  3DLM A;  5FWB A;  2CZ0 B;  5FU6 C;  3X26 B;  2XK0 A;  3OYC A;  3QPH A;  2DRM A;  5C0M A;  3LW5 E;  2ROT A;  2GGR A;  2CH4 A;  2LCS A;  2MK5 A;  2MAM A;  4CC4 B;  5LJ3 j;  1PD1 A;  1NG2 A;  3H0I A;  2YT6 A;  1G3W A;  2HL5 C;  2MCN A;  1QVF A;  4II1 A;  4DA4 A;  2COZ A;  3ME9 A;  1YFN A;  4HVU A;  4J9I A;  1X43 A;  3QDR B;  4ZN1 A;  2LP5 A;  2QGG A;  2ZPE B;  2KY9 A;  4C92 D;  3UA7 A;  2RMO A;  5FU7 C;  4ELZ C;  5GAN 7;  1YJW T;  1OPL A;  2HEQ A;  2RJE A;  5DM7 R;  5GAM e;  1QVF P;  3G6E T;  3I55 Q;  3JV3 A;  4RTX A;  3CCJ A;  1B3Q A;  1EFN A;  3CCL T;  1WYX A;  1R0C B;  3TEE A;  3PMT A;  1E6G A;  4LDX A;  2JVV A;  2F5T X;  1YJN Q;  1BCM A;  2D8H A;  2F5K A;  1ARK A;  1BIA A;  1IB8 A;  1M27 C;  2DL8 A;  5J3B A;  1G2B A;  2DF6 A;  4HCZ A;  4MDX A;  1M3A A;  3BE3 A;  3X25 B;  4M7A G;  2DZ9 A;  4MZM A;  2HSP A;  1Q7Y U;  4PFO A;  3OYA A;  1M5Q 1;  2EYX A;  3FJ5 A;  4M77 B;  3KBG A;  4IUQ A;  1VOM A;  5GAO n;  4M7A C;  3GPL A;  2QQ9 A;  3R6O A;  2RHX A;  1GCQ A;  2SEM A;  5GMK i;  1IRX A;  1W2B S;  4FW1 A;  4C0D C;  1YBY A;  2R58 A;  3QBY A;  1N5Z A;  3G1J A;  5LJ3 h;  1HK9 A;  1PG5 B;  3WVD B;  1K9M U;  3S3M A;  4F14 A;  2YUN A;  5GMK h;  3ZBD A;  1VQM T;  2KR3 A;  3FJP A;  4XU2 A;  1UG1 A;  1M30 A;  3ER0 A;  1ABO A;  3UDC A;  4PNO A;  1RUW A;  4NL3 A;  4JPB W;  3OW2 S;  2V26 A;  2QAS A;  5LJ5 j;  2FRW A;  4O5V A;  4E7H A;  5IT9 E;  4QW2 A;  2GFA A;  3JB9 D;  1YI2 A;  2L0A A;  1KQS S;  1VQO A;  5GAN f;  4AG1 C;  2ZGW A;  2KEA A;  3JAM E;  1VQ8 T;  1MND A;  5FRN A;  1VQN A;  2I2L A;  3JB9 G;  2XMF A;  5GMK j;  2W10 A;  3CMA T;  3TSW A;  1WNL A;  2RHU A;  4IUV A;  5GMK e;  2DNU A;  3VKI A;  1BKB A;  1VQ4 Q;  3RMS A;  4CC3 A;  1BI2 A;  1WFW A;  2PUK B;  2AKL A;  2DMO A;  3BY7 A;  1GXI E;  5FW9 A;  2O4X B;  4RTY A;  1OQK A;  1SHG A;  1TWB A;  4Z02 A;  3TRE A;  3LH0 A;  1FXX A;  2DJZ A;  4L59 A;  2F2X A;  2CP0 A;  2L3P A;  1V29 B;  2MI6 A;  3A5Z B;  2RN8 A;  3V8J A;  3OSV A;  2A36 A;  3QXE B;  3HRS A;  1VQL Q;  2OAU A;  1XJW B;  1SSH A;  4DBQ A;  3C12 A;  2OTJ Q;  4PJO D;  4LDV A;  4M78 A;  5I22 A;  2RB6 A;  1FX7 A;  4PJO A;  3V7S A;  3RKY A;  2K5L A;  2B8A A;  3MEV A;  3CCQ T;  3A8L B;  3OYB A;  1ZA2 B;  4M75 C;  3MP8 A;  1VQ7 Q;  4KBM B;  4DQ2 A;  2YRV A;  4J9F A;  2F69 A;  2VWF A;  2CZ1 B;  3P8B B;  2KAF A;  1X2K A;  4FYY B;  5LJ3 g;  2EQM A;  3E19 A;  2EWN A;  2J6F A;  2LQN A;  3G4S Q;  2FEI A;  4PJN A;  3CCU Q;  5HCK A;  4A63 B;  1SRL A;  4A4G A;  5GAN g;  3RIR A;  4KGZ B;  1TUG B;  4WCI A;  2RI2 A;  3M53 A;  3EGX B;  2K5I A;  3GF5 A;  4E6R A;  1VIF A;  2ZCF B;  2DTH A;  4HCB A;  2BE9 B;  2LNV A;  3G71 A;  5HKC A;  1ZUY A;  4MZT A;  2A08 A;  2KQW A;  2JS2 A;  5KYU B;  2BUD A;  2HCK A;  2YLC A;  1P92 A;  2XD0 A;  1UHC A;  4RTZ A;  2QG9 B;  2GQI A;  1T0J A;  3CC2 Q;  3CC4 A;  2F2W A;  3TU4 K;  3OYH A;  3CME Q;  4XQ3 A;  1W2B A;  4C8Q G;  2CSI A;  4IUP A;  2DA9 A;  3DB3 A;  4XTX A;  4EMK A;  3JCM Q;  2O9S A;  2HAX A;  4C8Q B;  1UE9 A;  4KGX B;  2BZ8 A;  2EGE A;  2KMT A;  3E1S A;  1KQS P;  5IHI A;  3CCJ T;  1A0N B;  3PT9 A;  3QSU A;  2KRO A;  1HSQ A;  1IGQ A;  1K0X A;  2PVG B;  2GNC A;  3M55 A;  3CEY A;  4ATO A;  3QKJ A;  1Z9Q A;  2KYM A;  1M3B A;  1PKS A;  1ZBX A;  3QG1 A;  3OY9 A;  4PJO C;  1U1T A;  1VQ5 Q;  1FMK A;  1K8A U;  2FVU A;  4QQ6 A;  8AT1 B;  1KQS A;  4E47 A;  2KT1 A;  1I07 A;  5GAN e;  1MNE A;  4EPC A;  2CUD A;  2JXB A;  1OI1 A;  1B07 A;  5FU7 B;  4HVW A;  1I5L A;  4DEX A;  1NLO C;  5FRM A;  2P4T A;  4M7A B;  2CSQ A;  5HK3 A;  3LGL A;  3JB9 H;  1I81 A;  1M1F A;  1KIK A;  4MMK A;  3E9G A;  3MJX A;  4E7S A;  5GAN j;  2C0T A;  4LNP A;  3H8Z A;  2DYI A;  2RI3 A;  3QJY A;  3H0H A;  4EMK B;  2ZZD A;  4C92 B;  2QEX A;  3HL8 A;  1KHC A;  5J26 A;  1GFD A;  1OV3 A;  4MML A;  1ZUK A;  1RAB B;  3JCM g;  1RAC B;  3GBQ A;  1KFZ A;  3EG1 A;  1MGQ A;  2EYQ A;  1BI3 A;  1YN8 A;  2RNA A;  4BY6 B;  4QQG A;  1AD5 A;  4WF2 A;  1HYO A;  3KUF A;  5J39 A;  4PJM A;  3SHW A;  2K57 A;  1AWO A;  1JBM A;  2OI3 A;  4K11 A;  2MIO A;  1VQO Q;  1B34 A;  3I9Q A;  4BI4 A;  4ZGJ B;  4KUI A;  3CC7 T;  2E3I A;  3LYI A;  4M78 E;  3CCS T;  3FDR A;  2PU9 B;  1M2O A;  1AT1 B;  2ABL A;  4A4F A;  2HBP A;  1EIF A;  4M7A F;  2HL3 A;  1SRM A;  2BZX A;  4FYW B;  5KYW A;  1WHK A;  2QK0 A;  2KVQ G;  2D6F A;  1O9S A;  3FC3 A;  2AT1 B;  3C94 A;  2VC8 A;  2Z0W A;  4J7F A;  1UJY A;  2QYZ A;  2DAQ A;  3CPF A;  1K9M R;  3X20 B;  2EGA A;  2P0P A;  2CP6 A;  4PKC C;  4F7U B;  2AHJ B;  5CIU A;  1MMN A;  3L2W A;  3PVQ A;  4CC7 A;  2GTO A;  1D1B A;  1MMD A;  4C8Q E;  4J5Y A;  2LQ8 A;  3JCM V;  1ABQ A;  4M7D A;  1YJN A;  1Y96 B;  1MUZ A;  2XHC A;  3CCV T;  3VS5 A;  2SRC A;  1Y96 A;  2O9V A;  1VUB A;  3JCM J;  4M7A D;  2LTO A;  1YJ9 A;  2H8H A;  2X4W A;  1O75 A;  4JUV A;  3L2Q A;  1M90 C;  4D8D A;  3I55 A;  1AWW A;  1M2V B;  1JXO A;  2AZV A;  2F2V A;  1RL2 A;  1K9A A;  3NMZ C;  1QCO A;  1NJI U;  4Q5W A;  3ZFJ A;  3ULR B;  3INZ A;  4J9H A;  3CC4 T;  3J80 E;  2M0O A;  4FYX B;  3EFO B;  3BW1 A;  2CZ6 B;  1GL5 A;  3S3O A;  2DET A;  1VQ8 Q;  4J6W A;  1RI0 A;  1ZQ1 A;  3MEA A;  2E6Z A;  5CO7 A;  2WSF E;  2MWP A;  2Y4Y A;  2EIF A;  1FYN A;  3VS3 A;  3P8D A;  1ACM B;  3FB9 A;  2RK2 A;  3EFR A;  2EYW A;  3CBP A;  3JCM d;  4AFQ C;  3G71 Q;  1RAF B;  3VYG A;  1YHQ T;  3UF4 A;  4C92 C;  3REB B;  4XTU A;  1LPL A;  4NOY A;  4GBQ A;  1BYM A;  4ZN3 A;  5D7U A;  2BIV A;  5LJ5 h;  5KYX A;  1X75 C;  1GCQ C;  1AZG B;  2L5Q A;  1F1B B;  5CKF A;  4RKU E;  2OTL A;  3EG2 A;  2FRY A;  3M57 A;  4OB2 B;  2PQW A;  1YIJ T;  1AVZ C;  1K76 A;  1UEB A;  4Y92 A;  1RLP C;  4Z88 A;  3CC4 Q;  2G6F X;  3HHT B;  4CC2 A;  4O6J A;  5GAM f;  2D8J A;  1VQK A;  2Y4X A;  2FL7 A;  2EYY A;  3V7C A;  1GCP A;  5LJ5 e;  2DE0 X;  2RHZ A;  5GAN d;  2RJD A;  2MWO A;  2PVD B;  2QEX T;  2K9G A;  4DBH A;  4Z89 A;  2K3X A;  1W70 A;  3VV0 A;  1LJO A;  1ZHI A;  3OW2 P;  4EDU A;  4N0A A;  3I55 T;  2YXY A;  1YCS B;  4XTW A;  1XOV A;  3H41 A;  4J6X A;  1BBZ A;  1SG5 A;  2ROL A;  1M8V A;  1PKT A;  2DK3 A;  2EJG A;  4PLI A;  3EG3 A;  3RUX A;  1UGQ B;  4B6M A;  2DPP B;  2YUQ A;  2H3E B;  4KH0 B;  1MV0 B;  2JM9 A;  5D6X A;  3MO8 A;  4LDW A;  1N8R C;  4OGC A;  1KG1 A;  3DB4 A;  1MHN A;  1U1S A;  2JJ9 A;  4C92 A;  1PC0 A;  1GRI A;  3OYF A;  2LCL A;  1W4S A;  2CKK A;  3QZ5 B;  4A4E A;  2KT8 A;  1YJ9 Q;  3Q1J A;  3MEW A;  5KYY A;  1YHQ A;  5HY6 A;  2RQW A;  3CCE Q;  1G5V A;  3L2R A;  4GY5 A;  1SHF A;  1ZSZ C;  4OB0 B;  4C5I A;  5CKB A;  4HKE A;  1R8O B;  3QDF A;  3JCM X;  1ZSG A;  4JS4 A;  3OMC A;  4PFP A;  2D1X A;  4N4H A;  3JCM b;  2ATC B;  3REA B;  1BI1 A;  1PD0 A;  2E4H A;  3IQL A;  4OMQ A;  4JRP A;  3PNW C;  2FPE A;  1NPR A;  1EZZ B;  3HKS A;  1TUC A;  4C0F A;  2JT4 A;  3H6Z A;  2EGC A;  2C0I A;  5GAM h;  2A3L A;  4PJO F;  3M59 A;  4BAC A;  2FYK A;  1VQ4 A;  2O4X A;  3OYY A;  4PJO B;  2X35 A;  4J9G A;  3CQT A;  2NLU A;  2DKG A;  4OGE A;  3SD4 A;  4Y91 A;  2X51 A;  3C4S A;  3WXM B;  4BE2 A;  2ZPI B;  4MDW A;  4B9W A;  3CC2 A;  4AMC A;  1AZE A;  3GOX A;  4GLM A;  1TH7 A;  1T3L A;  2CUB A;  3H9N A;  2J6O A;  4D8K A;  3OYJ A;  4M7D D;  2RQV A;  4RCB A;  2G3R A;  3CCV A;  1OU9 A;  2F1L A;  3SFM A;  3X28 B;  4RG2 A;  4HT8 A;  3L2Z A;  1XNI A;  4PJL A;  3M0T A;  4BI3 A;  2P4R A;  1RAH B;  3LWH A;  1D0Y A;  4KH1 B;  4QVD A;  1VYU A;  1N9S A;  2K4Y A;  2QAZ A;  2L3S A;  2IPO B;  4JRQ A;  4FYV B;  3KXT A;  2JUF A;  2X9H A;  1VQ9 A;  2L2P A;  1Q82 R;  2EYZ A;  4M77 F;  1TS9 A;  7AT1 B;  4AT1 B;  1H3H A;  3P8H A;  5IXF A;  1G3S A;  1Z9Z A;  3UT1 A;  1M9S A;  3VRZ A;  4AG2 C;  1VQ5 T;  1C6V X;  4C0G A;  2KXC A;  4J9B A;  1PHT A;  2LNH B;  4C8Q D;  1WJQ A;  4FSX A;  1UEC A;  4JJD A;  5CVI A;  2AIR B;  3QO3 A;  4ZGE B;  3QWY A;  4IUU A;  4JLI A;  2CP2 A;  1C0M A;  4J7I A;  2L8D A;  3RR6 A;  1PSF A;  1S72 T;  4A53 A;  3THK A;  2VAS A;  4L6V 5;  1KHI A;  3JCM c;  4M75 F;  2RO0 A;  2PUO B;  2FPF A;  4FSS A;  2K7A A;  5KYX B;  4KRT A;  2RQT A;  3GIB A;  1UDL A;  1WZO A;  4IIO A;  3VS2 A;  4F16 A;  1ZLM A;  2YSQ A;  2DBM A;  1D1C A;  4A4H A;  3CME T;  3EH1 A;  2EQJ A;  3JCM e;  1YIJ A;  2K3Y A;  1QCN A;  2X4J A;  4M75 G;  1ZSZ B;  4ORZ A;  3MPU B;  4DBF A;  3CC2 T;  3PFS A;  1KQ1 A;  1QW1 A;  2HMA A;  2O01 E;  2E1H A;  1NPP A;  2DO3 A;  2JS0 A;  1YI2 Q;  5GJV B;  1LNX A;  1QMC A;  4E7I A;  3HRT A;  5GAN 8;  1OU8 A;  2NUP B;  2YUP A;  1J3T A;  4CRI A;  4JRI A;  1VIE A;  2KDS A;  3G7Z A;  1WIE A;  2RJC A;  2XDB A;  2RK1 A;  3L42 A;  2EW3 A;  4FIB A;  4GLK A;  1Q95 G;  5AT1 B;  1BIB A;  4E7J A;  3EGD B;  2M0Y A;  1X2Q A;  2KRN A;  3CCU T;  8ATC B;  3HPW A;  2Y90 A;  1WXB A;  4ZGD B;  4OB3 B;  3MHX A;  1AEY A;  3CCS A;  2KNB B;  2K3B A;  2V8I A;  2YRD A;  3CCM A;  3OYM A;  5IXB A;  1TU0 B;  1UJ0 A;  2JOY A;  2I0N A;  1W6X A;  5LJ5 d;  1VQP T;  5AYF A;  4L5G A;  3A8H B;  4M75 A;  1IO6 A;  5IAY A;  4D6W A;  4BDZ A;  3OB9 A;  4EMK C;  4JLG A;  4BI8 B;  4FW2 A;  2LCC A;  3A98 A;  2DM1 A;  1WJR A;  2QDL A;  3JSC A;  1W1F A;  5I21 A;  4JJN K;  1UHF A;  3EHQ A;  3CCM Q;  2OTL Q;  2JTE A;  3OYK A;  1PWT A;  2P84 A;  4LDY A;  2KI7 A;  1Y0M A;  3HRU A;  5LJ3 e;  2GFU A;  2VGM A;  4DOV A;  2WSE E;  1WXT A;  1BCO A;  2ZPH B;  3M0Q A;  1VQ6 A;  4RUG A;  1EX4 A;  2X3X D;  3CBM A;  4J9E A;  2XDP A;  2R57 A;  5CKH A;  3LWI A;  1YNZ A;  1VA7 A;  3QZ9 B;  1VQ4 T;  1MV3 A;  3URG A;  1M2V A;  3TVT A;  2KRS A;  3OYE A;  3U23 A;  3VRY A;  1ZBJ A;  4RTW A;  4OMF B;  2DX1 A;  4HCC A;  3I56 Q;  2EJ9 A;  3CCR Q;  1QQJ A;  3DLL A;  4DBR A;  2OTJ A;  1K0S A;  2COY A;  2NYS A;  3CCE T;  4R0K A;  1CKA A;  1RI9 A;  2NUP A;  1YJ9 T;  2MF2 A;  3S3N A;  1VQ8 A;  1VQN T;  3UAT A;  1I5O B;  2NUZ A;  2PTK A;  4HVV A;  3OMG A;  4C92 G;  1XQH A;  2ECZ A;  2LT4 A;  1QP3 A;  2XI9 A;  1WQ7 A;  2E70 A;  1K73 U;  3F70 A;  4Z8A A;  2DL7 A;  2YUO A;  1WA7 A;  2D0N A;  3QJ6 A;  4QQD A;  4M7A A;  4C8Q F;  1KD1 C; 
#chains in the Genus database with same CATH homology
 1NYF A;  1ZX6 A;  4AFS C;  1NLP C;  1OPL A;  2HEQ A;  1X27 A;  1CSK A;  1X6G A;  3JV3 A;  3KFV A;  4RTX A;  1B3Q A;  1I1J A;  1FYN A;  3VS3 A;  1EFN A;  1WYX A;  1E6G A;  2EYW A;  4AFQ C;  2D8H A;  2V1R A;  1ARK A;  3PE0 A;  3UF4 A;  3EGU A;  3REB B;  1M27 C;  2VVK A;  2DL8 A;  1AWJ A;  2AK5 A;  1G2B A;  2DF6 A;  1M3A A;  2LQW A;  1QWF A;  2HSP A;  4GBQ A;  1K1Z A;  2EYX A;  3FJ5 A;  3VS7 A;  1GCQ C;  1AZG B;  1BB9 A;  1WX6 A;  1GCQ A;  2SEM A;  2W0Z A;  1X69 A;  1QKX A;  1KJW A;  2KGT A;  3EG2 A;  2FRY A;  1WXU A;  1WDX A;  2VKN A;  1N5Z A;  2LJ3 A;  1V1C A;  1AVZ C;  1K76 A;  4Y92 A;  1RLP C;  4Z88 A;  1YWO A;  1M8M A;  4F14 A;  4X1V A;  2YUN A;  2G6F X;  4CC2 A;  1JO8 A;  1UUE A;  2JW4 A;  2KR3 A;  1UG1 A;  2D8J A;  2L3Q A;  1M30 A;  2J6K A;  1ABO A;  3UA6 A;  1HJD A;  1I0C A;  1RUW A;  4J9C A;  4JPB W;  4DEY A;  2EYY A;  1GCP A;  2FRW A;  3C0C A;  1K4U S;  2DE0 X;  2K9G A;  4Z89 A;  3H0F A;  1W70 A;  2DLP A;  2L0A A;  4HCK A;  2E5K A;  1YCS B;  2J7I A;  2KBT A;  4AG1 C;  1XOV A;  2GBQ A;  3H41 A;  2KEA A;  4AFU C;  1BBZ A;  1E7O A;  2ROL A;  1PKT A;  2XMF A;  1JEG A;  2W10 A;  2V1Q A;  3EG3 A;  3TSW A;  2DNU A;  1SPK A;  2YUQ A;  4CC3 A;  2J05 A;  4RTU A;  1WFW A;  1MV0 B;  2AKL A;  2DMO A;  2JM9 A;  2O88 A;  5FW9 A;  1NYG A;  4RTY A;  1T3S A;  3TSZ A;  1SHG A;  5I11 A;  5IHK A;  1GRI A;  4LN2 A;  2KT8 A;  2F2X A;  4RTV A;  2L3P A;  2RN8 A;  2RQW A;  2A36 A;  1CKB A;  2RQU A;  1SHF A;  1UFF A;  1UTI A;  4J9D A;  1SSH A;  2CRE A;  2AZS A;  2BTT A;  4LUE A;  1G83 A;  5I22 A;  1ZSG A;  2D1X A;  3R6N A;  3IQL A;  3REA B;  4OMQ A;  2NWM A;  1PRL C;  2LZ6 B;  2FPE A;  2C0O A;  1TUC A;  4JZ3 A;  2JT4 A;  4J9F A;  2ED1 A;  2VWF A;  1HD3 A;  2EGC A;  3PVL A;  2C0I A;  3M0R A;  2LMJ A;  1X2K A;  4IIM A;  2PNI A;  3RBB B;  2IIM A;  2BZY A;  1T0H A;  2J6F A;  2LQN A;  2JM8 A;  4J9G A;  2FEI A;  3CQT A;  5HCK A;  4A63 B;  1JU5 C;  2A28 A;  2EVR A;  4ZNX A;  3ZL7 C;  5IH2 A;  1SRL A;  2DJQ A;  2DL4 A;  2O31 A;  2CDT A;  4WCI A;  1AZE A;  1KSW A;  5GJW B;  4GLM A;  1T3L A;  2CUB A;  4E6R A;  2J6O A;  4D8K A;  1JXM A;  2O2O A;  1UGV A;  2RQV A;  2X3W D;  3VS6 A;  1RLQ C;  5IHN A;  1QKW A;  1ZUY A;  1BK2 A;  2A08 A;  3I5S A;  1H92 A;  2KYB A;  3M0P A;  2JS2 A;  3O5Z A;  2HCK A;  3EHR A;  3M0T A;  1UHC A;  5L23 A;  2P4R A;  4RTZ A;  2B86 A;  2GQI A;  1T0J A;  1BU1 A;  1VYU A;  2F2W A;  3I35 A;  2L3S A;  4OMN A;  4OML A;  3VS1 A;  1PRM C;  2HDA A;  2CSI A;  1GBQ A;  1LCK A;  1YWP A;  2DA9 A;  2L2P A;  1TG0 A;  2EYZ A;  2O9S A;  1VYV A;  2JMA A;  2LJ0 A;  1U06 A;  4ESR A;  1UE9 A;  1H3H A;  5IXF A;  4F17 A;  2BZ8 A;  2EGE A;  1Z9Z A;  5IHI A;  1A0N B;  1U5S A;  2KRO A;  2JMC A;  1HSQ A;  1K0X A;  3VRZ A;  4AG2 C;  2J06 A;  2KXC A;  4J9B A;  2GNC A;  1PHT A;  2DRK A;  2LNH B;  2K79 A;  2ENM A;  1Z9Q A;  2DYB A;  2KYM A;  1M3B A;  1GBR A;  1PKS A;  1UEC A;  1WI7 A;  4JJD A;  3SEM A;  3QWY A;  1FMK A;  2K2M A;  2FO0 A;  2KXD A;  1YP5 A;  3QWX X;  2KT1 A;  1I07 A;  2FG0 A;  4AFZ C;  3THK A;  5ECA A;  2CUD A;  2FPF A;  2JXB A;  4FSS A;  1B07 A;  4EIK A;  2M51 A;  1QLY A;  2K7A A;  4KRT A;  2LX7 A;  2K6D A;  2RQT A;  4HVW A;  4DEX A;  1UDL A;  3I5R A;  1NLO C;  4IIO A;  1TUD A;  3VS2 A;  4F16 A;  2DIL A;  1ZLM A;  2YSQ A;  2DBM A;  2CSQ A;  1M3C A;  1H8K A;  2A37 A;  4M4Z A;  1KIK A;  4OMM A;  1QCF A;  2FPD A;  4ORZ A;  2PZ1 A;  2C0T A;  4LNP A;  3VS0 A;  5EC7 A;  4OMP A;  1Y57 A;  1U3O A;  3H0H A;  2HBW A;  2JS0 A;  5GJV B;  4JJB A;  2EKH A;  2YUP A;  1J3T A;  2OJ2 A;  1GFD A;  4RTT A;  1OV3 A;  1ZUK A;  1JQQ A;  3GBQ A;  1KFZ A;  1WIE A;  3EG1 A;  1YN8 A;  2DL5 A;  2EW3 A;  2RNA A;  1AD5 A;  2DBK A;  4LE9 A;  2M0Y A;  1VYT A;  1X2Q A;  2KRN A;  2RPN A;  2GTJ A;  1SEM A;  3SHW A;  1AWO A;  1OOT A;  2OI3 A;  4HXJ A;  4K11 A;  3NHN A;  3M0U A;  2MIO A;  1WXB A;  3VS4 A;  3I9Q A;  3LH5 A;  1AEY A;  3NGP A;  2CH4 W;  2KNB B;  2K3B A;  5FWC A;  5IXB A;  1UJ0 A;  2I0N A;  1W6X A;  2ED0 A;  2ABL A;  1NEG A;  2DL3 A;  2CT4 A;  1IO6 A;  1ZUU A;  1OPK A;  1QWE A;  1SRM A;  2BZX A;  3A98 A;  2DM1 A;  2EBP A;  2AKK A;  1NM7 A;  2QDL A;  1W1F A;  1UHF A;  3EHQ A;  4JJC A;  2RQR A;  1UJY A;  2JTE A;  2YDL A;  1E6H A;  1PWT A;  2EGA A;  1Y0M A;  2RF0 A;  1AOJ A;  2EPD A;  2LJ1 A;  1NEB A;  1WXT A;  3M0Q A;  2DVJ A;  2EQI A;  4RUG A;  2X3X D;  4J9E A;  1YNZ A;  1VA7 A;  1X6B A;  1MV3 A;  3PVQ A;  4LUD A;  2GTO A;  4CC7 A;  3TVT A;  2KRS A;  1GFC A;  3U23 A;  3VRY A;  1ZBJ A;  4RTW A;  2DX1 A;  3EG0 A;  3RNJ A;  1ABQ A;  4QT7 A;  3NPF A;  5FWB A;  2DRM A;  1K0S A;  2ROT A;  2ESW A;  2GGR A;  1MUZ A;  2KRM A;  2CH4 A;  4R0K A;  1CKA A;  2LCS A;  3VS5 A;  1RI9 A;  2SRC A;  4CC4 B;  1NG2 A;  2CT3 A;  1AWX A;  2O9V A;  2YT6 A;  3H0I A;  4OMO A;  2OAW A;  2H8H A;  2MCN A;  3UAT A;  1WLP B;  1PNJ A;  2NUZ A;  3M0S A;  2PTK A;  4HVV A;  4D8D A;  1AWW A;  2KE9 A;  1JXO A;  2AZV A;  4HVU A;  4J9I A;  2F2V A;  2ECZ A;  1K9A A;  3NMZ C;  4JZ4 A;  1X43 A;  1S1N A;  2MOX A;  2LP5 A;  3ULR B;  4J9H A;  4Z8A A;  2DL7 A;  3UA7 A;  2YUO A;  1GL5 A;  1WA7 A;  2D0N A;  2RMO A;  1OEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...