4Y92A

Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain e97t-q128r mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
b'MTFVALYDYESRTTTDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein-tyrosine kinase
publication title Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain E97T-Q128R mutant
rcsb
source organism Avian sarcoma virus pr2257/16
molecule tags Transferase
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4y92A00
2O9VA 2RPNA 4Z8AA 2L3QA 1RI9A 1ABOA 1M3AA 1U3OA 2ABLA 4AG2C 1WYXA 2DRKA 2LQNA 2RQVA 2DRMA 1SSHA 1Z9ZA 2L3PA 2KYMA 3M0PA 1PKTA 4DEXA 2AKLA 2HCKA 2KXDA 3EHQA 4J9FA 2OI3A 2A28A 3UATA 5HCKA 1WX6A 1QCFA 2MIOA 2H8HA 2J05A 2EKHA 2LMJA 1I07A 3A98A 2DJQA 3CQTA 2CREA 2GGRA 2BZ8A 3VRYA 2YUPA 1VYUA 2GNCA 1U06A 1JEGA 1UG1A 1U5SA 1AD5A 2CH4W 4D8KA 4Z89A 2JW4A 2SRCA 1PKSA 2KNBB 1SPKA 4RUGA 2J6KA 1JXMA 2W0ZA 3REBB 2DBMA 1RLQC 2HEQA 2W10A 1PNJA 4AFZC 3M0SA 2JMCA 1AEYA 4LUDA 2KBTA 3U23A 1I0CA 2DF6A 3UA7A 5EC7A 1AZEA 2JXBA 1BU1A 2JM9A 2VWFA 2NWMA 4LNPA 1Y0MA 2KE9A 3ULRB 2MOXA 2KXCA 1AWXA 2D8HA 2EW3A 2L2PA 4CC3A 1WI7A 1AOJA 2KGTA 4AFUC 1QKWA 1NEGA 1RLPC 2D1XA 2EYZA 5GJVB 3THKA 3VS0A 1YNZA 3SHWA 2QDLA 2EGAA 2JMAA 1UE9A 1QWFA 4R0KA 3VS4A 4IIMA 1JQQA 4K11A 2D8JA 2LJ3A 3NPFA 1X69A 4J9DA 3R6NA 2PTKA 3EG0A 1SEMA 4OMQA 1G83A 4HVVA 3PVLA 2CT3A 1HSQA 2OJ2A 4E6RA 2J06A 1UJYA 3I35A 1M30A 1E6HA 1YCSB 2YDLA 2FPDA 2K6DA 3VS6A 1YN8A 1WXTA 5IXFA 1QWEA 1B3QA 1NM7A 4LE9A 1K4US 2FEIA 1BB9A 3JV3A 3VS3A 5FW9A 4OMLA 2LX7A 2FRWA 2K3BA 2RF0A 4LUEA 2NUZA 2BZYA 4F14A 1HJDA 1GFDA 2ENMA 1UECA 2RQTA 2RNAA 1HD3A 1M27C 1GCQC 2F2WA 3VRZA 2GBQA 3H0HA 3TSZA 4J9CA 2FPFA 4Z88A 4CC2A 1M8MA 1NLOC 1OEBA 1K76A 3VS2A 2MCNA 2V1RA 1UJ0A 2LJ0A 4A63B 4JPBW 2CUBA 1UGVA 4JZ3A 2LNHB 2DA9A 3KFVA 1ZUYA 4X1VA 1NEBA 4AFQC 2LCSA 2RMOA 1CKAA 4JJDA 1JO8A 5L23A 2LZ6B 1UFFA 4Y92A 2K2MA 2FG0A 3H0FA 5GJWB 1UHCA 3M0TA 1FMKA 5IHIA 1UTIA 2IIMA 1G2BA 1QKXA 2KRMA 1B07A 2DL7A 1X2QA 2C0OA 1QLYA 4J9GA 4OMOA 2BZXA 1WFWA 2JS2A 3M0QA 1E6GA 2ROTA 2YUQA 1K0SA 1EFNA 1UDLA 2ED1A 2O31A 2YUOA 2J6FA 1J3TA 4RTVA 3M0UA 1WXBA 4RTTA 3GBQA 2AKKA 3RNJA 2OAWA 2LQWA 5I11A 1LCKA 1M3BA 1YWOA 5FWBA 1PRMC 2VVKA 3H0IA 2E5KA 5IHNA 3REAB 1UUEA 4JZ4A 1ZBJA 4OMMA 2JS0A 1GCPA 1M3CA 4JJBA 2DYBA 2EBPA 1V1CA 1W6XA 1ABQA 1CKBA 1OOTA 1OV3A 4HXJA 1GL5A 1OPLA 3ZL7C 2B86A 3NGPA 2JM8A 1T3LA 2P4RA 1MV3A 3UF4A 2L0AA 4AG1C 4AFSC 1ARKA 4LN2A 2AK5A 1AWOA 1Z9QA 1VYVA 2DL3A 5ECAA 3PE0A 2DBKA 1WA7A 3SEMA 1GCQA 1TG0A 1WXUA 2KEAA 2M0YA 4HVWA 3TSWA 2PNIA 4CC4B 4HVUA 3EGUA 2DL4A 3LH5A 1MUZA 4EIKA 1AVZC 3H41A 1AZGB 4RTZA 2DE0X 2CT4A 1SRMA 1VYTA 2J6OA 4D8DA 2FPEA 2A37A 2J7IA 2DNUA 5IH2A 1X27A 4J9HA 4OMNA 5IXBA 2DLPA 2HBWA 4F17A 2KYBA 2F2XA 2PZ1A 2ED0A 3I9QA 1GBQA 2V1QA 4M4ZA 1NLPC 1BK2A 2D0NA 2RQWA 4DEYA 4OMPA 2EYXA 2RQUA 2CDTA 3I5SA 2CSQA 4RTWA 4ZNXA 2G6FX 1BBZA 1WDXA 3EG2A 2KT8A 4IIOA 1UHFA 4QT7A 2XMFA 4GBQA 2CSIA 2SEMA 2GTJA 3EHRA 1X2KA 3VS7A 2L3SA 2KRSA 4ORZA 2ECZA 1H92A 1XOVA 3C0CA 2BTTA 1AWJA 1X6BA 2LP5A 2KR3A 4FSSA 2HDAA 4HCKA 1K9AA 2KROA 2O88A 2HSPA 1SHGA 2CH4A 1AWWA 2EGCA 1Y57A 1ZLMA 2AZSA 1TUDA 1JXOA 2LJ1A 3EG1A 1SRLA 4ESRA 3TVTA 3QWXX 2C0TA 2GTOA 1WIEA 2K9GA 1MV0B 1JU5C 2RQRA 1K1ZA 3QWYA 2X3WD 2FRYA 3NHNA 4RTUA 1PHTA 1ZX6A 1PRLC 1NYGA 5FWCA 1N5ZA 4RTXA 1RUWA 1SHFA 1KIKA 2ROLA 3PVQA 5I22A 4J9EA 2O2OA 2JTEA 2EYWA 2A08A 2EQIA 1YP5A 2KRNA 2K79A 3VS1A 5IHKA 2KT1A 1KSWA 1YWPA 1GBRA 1I1JA 4JJCA 2M51A 1KFZA 1W1FA 2YUNA 1NG2A 1A0NB 1T0HA 2AZVA 4RTYA 2EGEA 2GQIA 1T0JA 1S1NA 1NYFA 2I0NA 1CSKA 1E7OA 2EPDA 1ZSGA 1H8KA 1IO6A 2K7AA 2JT4A 1K0XA 1PWTA 2DVJA 2EYYA 4GLMA 1X43A 3NMZC 2F2VA 1ZUUA 4WCIA 2DILA 1FYNA 2YT6A 2C0IA 1H3HA 3VS5A 4CC7A 1WLPB 2DL5A 4J9IA 1GFCA 4KRTA 1GRIA 2O9SA 3RBBB 2YSQA 2FO0A 3UA6A 2VKNA 3I5RA 4J9BA 1T3SA 1OPKA 1X6GA 2DX1A 2CUDA 2ESWA 2A36A 1TUCA 1KJWA 2DMOA 1W70A 3M0RA 2RN8A 3IQLA 1VA7A 3FJ5A 2DL8A 3O5ZA 1ZUKA 4F16A 3EG3A 2DM1A 2EVRA 2X3XD
chains in the Genus database with same CATH superfamily
4Z8AA 1XJWB 2RPNA 3HRTA 1RI9A 3MP6A 5LJ5j 2E6NA 4FYVB 1SSHA 1S72Q 5CQXA 4RCCA 1QQJA 3OYBA 3AT1B 3OYJA 1D0ZA 3CCLA 4PNOA 2A28A 4FU6A 2RB6A 1QVGA 2H8HA 2J05A 1ZHIA 3BDLA 2DEUA 3QHSA 2HKQB 3A98A 2EJFA 2LQ8A 5KYYB 3JB9F 2VGNA 2O4XA 4N4HA 3OSSC 3JCMW 2GNCA 4PJOB 1BIAA 4CRIA 3TREA 4CI0C 1U5SA 2CH4W 5KE3A 4QVCA 1G3WA 4PJNA 3CCRA 4FIBA 4RUGA 4D6WA 4Y28E 2YRVA 2VV5A 4C8QF 4M77F 2W10A 3GIBA 1YJ9T 2JMCA 2CZ1B 3U23A 5GMKj 1I0CA 2DF6A 3EGDA 4XU0A 3CC7Q 1YITA 4RCBA 1YJNQ 3CCLT 1RAAB 2JM9A 2VWFA 2NWMA 2V8IA 4EMHA 1NJIC 2KE9A 3ULRB 4IUVA 2L2PA 1K9MU 3UDCA 2HAXA 1NEGA 1RLPC 2EYZA 3QJYA 4BI4A 2QDLA 1QWFA 4MMKA 2JZ2A 1M90U 1K9MC 1R8OB 1JJ2A 4JDSA 4OB0B 2OTLT 4FCYA 3NPFA 1X69A 3X20B 3EG0A 3JCMP 1M90C 1QVGP 2WSCE 4F7UE 3PVLA 1X01A 4C0FA 1DJ7B 3EFOA 3VS6A 4UC4A 2VXFA 4FM4B 1IZ6A 3JAME 1XQHA 3RKXA 3UPUA 1WJQA 3LWHA 2FEIA 1I8FA 1X6OA 1BB9A 1O9SA 1D09B 3SWNB 3VS3A 2HSEB 1YCYA 2LX7A 2COWA 3CPFA 3I55T 1VQ4T 1HJDA 1GFDA 4FW1A 2AT1B 1GCQC 4M75G 4J9CA 3GP8A 2PU9B 3ZEHA 2D6FA 2V1RA 1UJ0A 2KSSA 4JLGA 4ZGJB 1Y7XA 2F5KA 3VUZA 2DA9A 4ELZC 4J7FA 1BCOA 5KYXB 1D3BA 3FB9A 1CKAA 1JJ2P 2M9UA 4JJDA 1JO8A 3P8HA 4HCBA 5AT1B 4MZPA 2ZGWA 5L23A 1UFFA 3NTKA 4BE1A 2K2MA 1MMAA 2FG0A 4M75D 5A2QE 4FL6A 1BYMA 2K3YA 4KBMB 4XU1A 5GANd 1QKXA 4PJOE 1YBYA 2DIGA 1B07A 2DL7A 2MK5A 2P4TA 1QLYA 2BZXA 1WFWA 5A0DA 4XTVA 3OB9A 4DBHA 4L6V5 1VQ7A 2XD0A 3OYAA 3RUXA 3O8VA 1J3TA 3OYFA 1O75A 5HK0A 1WXBA 4RTTA 3MEWA 5KYUB 4EPCA 2K4YA 1H641 5I11A 3WVEB 2GQVA 2X4YA 2HD0A 1IREB 4M7AG 3QUIA 2XDBA 2RHXA 5CVIA 1ZSZC 2QEXQ 5GANg 2VB6A 3OYDA 1ZBJA 1MMDA 4TVRA 2QGFB 3M53A 4MDWA 1GCPA 2COYA 2DTIA 3NTIA 1VQ8Q 2DYBA 3OSVA 1W6XA 4C92F 1KC8U 1CKBA 1OOTA 1VQ9T 1ZA1B 4C0ZA 1GL5A 3NFCA 1TS9A 4M7DC 3CXCA 3CC4Q 3CMET 1VQPQ 3NGPA 3UF4A 4F7UA 4AFSC 1ARKA 4DOVA 1H3ZA 1K73U 3MKDA 4QQGA 3PE0A 2DVEA 2DBKA 3SEMA 3PIPA 1WXUA 2CZ0B 2WSEE 5GAN2 1K73C 2CP6A 3OS2A 4LD6A 1VQ6T 1C6VX 3H41A 1AZGB 3CC2Q 5LJ5d 3OYNA 2A37A 9ATCB 1WQWA 3G7ZA 4O5VA 1JJ2S 1X27A 4OMNA 4F17A 4BACA 1Q86U 2P0PA 1KC8R 2K3XA 3I9QA 3QYHB 4OF1A 3PTAA 1NLPC 1Y96B 3OYLA 5CKDA 1S72A 2MMPA 1W2BA 2CDTA 2CSQA 4QW2A 2MWPA 4RTWA 4ZNXA 4R55A 3OMGA 2C06A 3DLMA 2NYSA 1YJ9Q 4QT7A 2XMFA 5GAN3 2RK2A 3QXEB 3EGXB 3CEYA 3HFNA 4C0DC 1KK7A 3EHRA 2YRCA 5LJ5g 1TU0B 4OB3B 2EKOA 2L3SA 2QQSA 1AT1B 3CCLQ 3X26B 4ORZA 2ECZA 1XOVA 3C0CA 4MDXA 5KYYA 2BTTA 1AWJA 1X6BA 3LGLA 2RJDA 4PJOA 4Z02A 2HSPA 1SHGA 3QG1A 3CD6A 1ZLMA 4E47A 3SD4A 1TUDA 2E65A 2O4XB 1Q86R 1JXOA 1SRLA 2DD4A 5GAN5 5GAOn 1N9RA 3QZ9B 4PJMA 3CC7A 2XDPA 2HZYA 2ZAEA 1WHGA 1K1ZA 1N9SA 2Y4XA 3QWYA 3CCRQ 2JTFA 2X3WD 4JJNK 2BKDN 3CCET 3NHNA 5GANh 5FWCA 3V8KA 3Q1JA 4OP0A 4M78G 1RUWA 1Q7YU 1KIKA 2CP7A 1YITQ 1NE8A 3QYGB 4J9EA 5CKFA 3JCMJ 2DZCA 4M75F 1Q7YC 1W2BP 2XK0A 5FU7C 1RAEB 2FHDA 1VQMT 3A5ZB 4J6XA 4C8QE 3I55Q 4E7JA 4ZGEB 1SG5A 3JCMd 4RTYA 4KH1B 2EGEA 3BE3A 1D0XA 2DEQA 2I0NA 3GPLA 4BB7A 1TTHB 2MPXC 2PUKB 2JT4A 1PWTA 1IXDA 2DVJA 3FLGA 1QW1A 1EIFA 3VKIA 5HK3A 5I2SA 4XTYA 1WHMA 4KRTA 3DB4A 1GRIA 2O9SA 4KULA 3SWNA 1Q7YR 2E5QA 3I56A 2FO0A 2HMAA 2VKNA 3EG9B 1B34B 2ESWA 3H8ZA 2RD1A 3HPWA 3JCMg 1VA7A 4IUPA 3FJ5A 5GAOm 1RACB 3QJ6A 5J26A 3EG3A 2DM1A 3CXCS 1EZZB 2M16A 2GF7A 4LDWA 2X3XD 3VJPA 4PJJA 3EAEA 4M7AF 5DLQE 1BKBA 2ABLA 4AG2C 5KYXA 4PFZA 4N0AA 5GAMe 1Z9ZA 2KYMA 3JB9I 5GMKi 3M5AA 4KGVB 1N8RU 4J9FA 2YLCA 5HCKA 2MIOA 2AHJB 1D1BA 4PKCC 1OX9A 1N8RC 1D0YA 4A4HA 2YWWA 3GOXA 1RAGB 1N6AA 2DJQA 4E7ZA 2YUPA 4LDYA 1RI0A 1VQOA 2X4XA 1W2BS 5IN1A 2PVGB 4EDUA 1BI1A 1VQ9Q 2GFAA 4Z89A 2SRCA 2KNBB 1VQ7Q 1ZSZB 2DBMA 4KUIA 3EH1A 5LJ3f 4AFZC 3M0SA 1AEYA 2EQKA 2IG0A 3M56A 2RK1A 5EC7A 1PG5B 5DM7R 5GMKh 1VOMA 4QVDA 1YHQT 4LNPA 1VQ8A 1Y0MA 2R5AA 3GNGA 2QTXA 5D6WA 2LX9A 5HKCA 2EYQA 4J6WA 1VQ6Q 4M7DB 1WI7A 4FSXA 1AOJA 3CMAA 4IKFA 1QKWA 2D1XA 5LJ3h 3THKA 2KAFA 2KI7A 3QZ5B 3VS4A 2KVQG 2K57A 4K11A 1D1CA 1TOVA 4J9DA 3R6NA 2PTKA 4KGZB 4P5NA 3A1PA 5GAOl 4E7IA 2Z0WA 1VQNT 4C8QC 2RI3A 4M77C 1M30A 2YDLA 2FPDA 2QAZA 3C4SA 1M1KU 4OB1B 4C5IA 3CCVT 2DTOA 1NPPA 3OYEA 2L3RA 4C92E 2O01E 2E6ZA 1M1KC 5IXFA 4DBRA 1NM7A 4LE9A 3FEOA 3JV3A 2FRWA 4KT0E 2RF0A 4LUEA 3UWNA 5GAMf 1Y96A 2R58A 3H0HA 3TSZA 4A4KA 2KK4A 2FVUA 3MCAB 1TUGB 4M78F 1RAIB 1NLOC 4C0DB 1M9SA 1YJ9A 1K76A 3VS2A 1NPRA 1MNDA 1PD1A 4A63B 2CUBA 3MEVA 1I4K1 1UGVA 3EGXA 4JZ3A 2LNHB 3EFSA 4X1VA 1NEBA 3HTRA 3CCEQ 1M1KR 2LCSA 2VUBA 1KQ2A 3E9GA 2EAYA 2HBPA 2VC8A 4LDVA 3OYIA 4B6MA 1UTIA 2IIMA 1G2BA 2MWOA 2KRMA 2QG9B 7AT1B 4HT8A 5GMKm 1PM3A 2OTLA 1WHJA 1UGQB 2DKGA 1VQMQ 5D6XA 2ROTA 1G5VA 3DLLA 2AIRB 3CD6Q 3TEEA 3META 4C5GA 3BW1A 3A8OB 2ED1A 2O31A 1YIJT 2J6FA 3OYKA 2EFIA 3J7AF 2YHTA 1YJWT 2MAMA 3A8LB 2EQMA 4RTVA 1M1FA 4II1A 2DXCA 2LQWA 2A0FB 5FU7B 1LCKA 3G71T 2LRQA 6AT1B 3RESA 2RHUA 1M3BA 4M7DE 1YWOA 5LJ3j 1HYOA 3I55A 4JZ4A 3FDRA 1VQ4A 1MGQA 4JUVA 4OMMA 2JS0A 4JJBA 1LVKA 2RJFA 1V1CA 2HNIA 2QASA 1Q95G 1OV3A 1OPLA 2FZCB 1UEBA 3EH2A 4XQ3A 2E3HA 3G6ET 1MV3A 3A8MB 3FC3A 3R6OA 4LN2A 2AK5A 3JB9H 4GY5A 1Z9QA 1MMGA 1UB4A 1WA7A 1GCQA 1M1GA 5GAOp 4HVWA 2KEAA 4CC4B 4XU2A 3EG9A 1B34A 1MUZA 5FU6C 3L2WA 4RTZA 3I56Q 2DE0X 2CT4A 1BIBA 1SRMA 4NL2A 2J6OA 2FPEA 1VQ5T 4EMKC 3TCJA 2RJEA 5IXBA 1NZ9A 3CBMA 1IGUA 2KYBA 1AHJB 4C92C 1TSFA 2PZ1A 2ZPHB 4HCCA 2JN0A 4M4ZA 1BI3A 4O6JA 4F7UG 1VIFA 4DEYA 2RQWA 4PFOA 5GMKl 1X75C 2EYXA 3WXMB 4M7DD 2RQUA 3I5SA 3ME9A 4IURA 1PD0A 2G6FX 1WDXA 2RH2A 3EG2A 2X35A 1UHFA 2GCXA 1LPLA 2GTJA 2HL5C 4XK8E 3RMQA 8AT1B 1VQKT 4FT2A 3HL8A 2MYSA 4QQ6A 1IB8A 2IVWA 2LP5A 1VQ9A 4FSSA 1XNIA 5CAIA 4M7AE 4HCKA 1HK9A 1K9AA 2KROA 2P84A 1IHVA 2RJCA 3CMEA 4ESRA 1VQOQ 3JSCA 1ZSZA 3X24B 3RERA 1WGSA 2E64A 2CZ7B 5GAN6 3JCMb 2P0KA 3CBOA 1KG1A 4OGEA 1VQNQ 1PRLC 4MZTA 3S3MA 4Y91A 1VQ6A 1JB0E 3CCVQ 1SHFA 2LC4A 4M7DA 2ROLA 4DBQA 2XHCA 5GANe 4PJOG 2JTEA 3QIIA 2EQIA 2KRNA 5IHKA 1YWPA 1I1JA 2VYTA 3CMAQ 4E7HA 1PCXA 1W4SA 2E41A 1KFZA 2LCCA 4M77B 4C8QB 1KC8C 3L2VA 2YUNA 2NLUA 1NG2A 4OMFB 2I2LA 1T0JA 1S1NA 1NYFA 4PLLA 3CCST 4RKUE 1ZSGA 1IO6A 2RI2A 2K7AA 1K0XA 2PUOB 1C1AA 2EYYA 5KCOA 1U8RA 2F2VA 4PJOD 1ZUUA 3CBPA 2YT6A 2DJZA 2DL5A 4V2SA 4BY6C 2ATCB 3I5RA 4J9BA 4HA8A 2Y90A 3PNWC 2FZKB 4M75C 1X6GA 2CUDA 1LJOA 2XDDA 2OX7A 5GAN8 1ZUKA 1Q86C 3HP9A 3UT1A 1I5OB 2EVRA 4HKEA 1KQSA 4AT1B 2M02A 5GAOr 3CCEA 2MF2A 1M3AA 1YIJQ 1VQLT 1U3OA 2DPPB 4XTUA 1YJWQ 2LQNA 2VGMA 3V7RA 3CCQT 4XTXA 2JVVA 3E19A 3M0PA 2QQAA 4DEXA 3M58A 2HCKA 3CXCP 3EHQA 1I5LA 1LNXA 5LJ5e 2OI3A 3G71Q 3UATA 5KH6A 2QA4T 5L8RE 4E7SA 1WX6A 1QCFA 1Q81U 2EKHA 4A54A 5CR2A 1VQMA 3A8GB 3RKWA 4M78E 2LMJA 2JTMA 1I07A 3CQTA 1I81A 2CREA 1WJSA 4BE2A 1XTDA 3LH0A 2OAUA 2DERA 2X9HA 2OTLQ 3QDRB 3P8BB 4QKUA 1U06A 2QTVA 1JEGA 1YFNA 3QBYA 5LJ3d 1AD5A 4D8KA 4NL3A 2DETA 2J6KA 2DZ9A 4M7AC 1JXMA 2W0ZA 3REBB 3M55A 2HEQA 1PNJA 4LUDA 2QQ9A 2KBTA 4ZGDB 1QVFA 1AZEA 5KYNA 1BU1A 1RL2A 2YRDA 3F70A 1AWXA 4F7UF 1Q81R 4M77E 1BI2A 2KGTA 5KYWA 1VQ4Q 5GJVB 4FYWB 3OW2A 3SHWA 1VQ5Q 2EGAA 2JMAA 3CCJT 4J8OA 4R0KA 4NOYA 5LJ3g 4QVZA 1C0MA 3N5BB 3V7CA 2D8JA 1IRXA 3DKMA 2X4WA 3QO3A 3MEUA 1FXXA 4OMQA 1G83A 4HVVA 2CT3A 1UGSB 1HSQA 4ELYC 5FU6B 1E6HA 2K6DA 2JUFA 4DQ2A 2M0OA 4EMKB 5KCHA 3L2RA 1Q82U 1KD1R 1PC0A 1YI2T 4XU3A 1YJNT 4C92B 3ZFJA 2CZ6B 1B3QA 1VQKQ 3H6ZA 1VUBA 2H3JA 3OYHA 2F5TX 1G8XA 1QP3A 4DOWA 2K3BA 3JCMe 2BZYA 2NUTB 2RQTA 2RNAA 1QVFP 1M27C 2F2WA 3L1AA 1M8VA 3CCMT 2FPFA 1WQ7A 4Z88A 4CC2A 3LYIA 3L2QA 2KDSA 2MCNA 2LJ0A 4JPBW 4PJOF 2V8KA 2RHIA 2QQRA 5FRMA 3OW2P 1ZUYA 1YHQA 4C8QD 4M77D 4AFQC 1M2VB 1Q82R 2DXUA 1N27A 4X9CA 4Y92A 3VYGA 3HSBA 3H0FA 1UHCA 3M0TA 4L5GA 1FMKA 5IHIA 2ZPFB 4E2FB 2C0OA 2WACA 1KQSS 3FRNA 1E6GA 4ME7A 2LTOA 4RG8A 1K0SA 2R57A 2RA2A 1EFNA 1UDLA 2YUOA 3CMEQ 1VQNA 4M78C 2RM4A 2G3RA 3M0UA 3OBWA 3CCVA 2PVDB 3OS1A 1G3SA 5DLOA 1G3TA 3H9NA 2E70A 3VV0A 4ZTFA 4HCZA 4BE0A 4BDZA 5FWBA 3KXTA 2E5KA 3OMCA 1BI0A 3J81E 2A3LA 5CO7A 4M77A 3RR6A 4C8QA 4BI3A 2H3EB 3RMSA 2FL7A 1ABQA 4HXJA 3CCUT 3G4SA 3V8JA 1K8AU 2B86A 4BY6B 4KGXB 3RIRA 2CP3A 1QVFS 4JRIA 2L0AA 4AG1C 4N4IA 3MPUB 1AWOA 4ZN3A 3JCMf 1K8AC 3FIFA 4MZMA 2BE7D 5ECAA 3VYHB 1TG0A 1WPYA 2M0YA 3MJXA 3TSWA 4HVUA 3EGUA 3PMIA 2ZPEB 3HRSA 5CKBA 1KHIA 3OYMA 3SFMA 3M59A 2QEXT 3OW2S 3EFRA 3S3OA 2XICA 5IH2A 3ZBDA 4C5HA 2DLPA 2Y4YA 1QMCA 3BFMA 1YIJA 1YJWA 2D0NA 3G4ST 4Q5WA 4HT9A 3TU4K 2DAQA 4J83A 3M57A 4KH0B 5J3BA 1K8AR 3CC4T 1UGPB 1VQPT 1VIEA 1HXDA 4ANJA 5GAMh 2DD5A 3G71A 1FMVA 3BDUA 3PT9A 4C92G 1M5Q1 2QI2A 2KT8A 1OI1A 5FRNA 5A0LA 2DYIA 4RG2A 2LT1A 3OA6A 1X2KA 2KRSA 2RHYA 2OTJT 1H92A 5AYFA 3CC2T 1R0BG 4BI8B 2KR3A 4E7KA 2HDAA 4M7AB 2RHZA 2CH4A 2EGCA 3ER0A 3OYCA 2LJ1A 3CCJQ 3G6EA 3MP1A 1UGRB 4C92D 3QWXX 2C0TA 1SKUB 2GTOA 1QVPA 2K9GA 4J7IA 1JU5C 2RQRA 2P0QA 2KY9A 2E1HA 4QQDA 2FRYA 1OU9A 1PSFA 2XIDA 2KQWA 4RTXA 3QSUA 3OYGA 3OBYA 1NJIU 3PVQA 3RKYA 5I22A 1YI2Q 1VQ5A 2V26A 4A4EA 2EYWA 1GXIE 4EMGA 5KYWB 2K79A 3VS1A 1KSWA 2ZPIB 1GBRA 4JJCA 5CKHA 2M51A 3P8DA 1W1FA 2EQJA 1V76A 2AZVA 1JBMA 2HL3A 2E10A 3VUBA 1OZ2A 1E7OA 2EPDA 3CCMQ 4M75E 2ZCFB 4RMOA 5KE2A 4EMKA 4GLMA 3CCRT 1X43A 3M9QA 4B9XA 4WCIA 1EX4A 2DILA 1FYNA 4M7DG 2L89A 2E12A 1M2OA 3VS5A 4CC7A 4C92A 1WLPB 1VQKA 1TH7A 1GFCA 2XU8A 3M4YA 3RBBB 3M4GA 3S3NA 1YITT 3UA6A 1NJIR 5FROA 3KBGA 1OPKA 3L42A 5M9OA 4PLIA 2NUTA 2D0QB 2B8AA 2RO0A 2DL8A 3NTHA 1ZBXA 4F16A 3PGGA 1K9MR 5GAMj 2HQEA 1UE9A 2O9VA 2R5MA 2WSFE 2L3QA 3OQ5A 1M90R 1QCOA 1ABOA 1NBEB 3KUFA 8ATCB 2X4JA 4NS5A 4LDXA 1M2VA 1WYXA 2DRKA 4PFPA 2PVOB 2RQVA 2DRMA 2F1LA 2L3PA 1OYXA 1PKTA 1MMNA 2AKLA 1ZQ1A 2QK0A 1G3YA 2JNGA 2CP0A 2KXDA 1YHQQ 4JLIA 4A4FA 4DBFA 2RI5A 3A8HB 4M78B 1P92A 2GGRA 2BZ8A 3VRYA 1VYUA 3CCSA 5D6YA 3OS0A 1R77A 2F69A 3J80E 5GAN4 1UG1A 2JW4A 1PKSA 1SPKA 1R0CB 4XTWA 3CCUQ 1RLQC 1WHKA 2DFUA 1IGQA 4L59A 4JRQA 3E2UA 4VUBA 2K5IA 3UA7A 2DO3A 2JXBA 2LT4A 3C12A 2XKOC 4FT4A 3L2ZA 1QVGS 2MOXA 2K5FA 2DXBA 4C0GA 2KXCA 2D8HA 2EW3A 4CC3A 2FZGB 4AFUC 3VS0A 1YNZA 2CP5A 1RADB 4IIMA 1JQQA 2ZPGB 2LJ3A 3PIOA 3D7SB 1VQLA 1M4ZA 1SEMA 4IUUA 2EWNA 1TWBA 4M75A 4JRPA 1F1BB 3G4SQ 3CCQA 1VQ7T 2KMTA 3JCMV 3OY9A 2OJ2A 4E6RA 2J06A 1UJYA 3I35A 1YCSB 4M7AD 3URGA 5C0MA 1YN8A 1OULA 4ZTJA 1WXTA 2QA4A 5CIUA 3JB9J 2NUPB 5D7UA 1QWEA 1K4US 5FW9A 4OMLA 3E1SA 2OTJQ 2QDYB 3JRZA 5DY9A 4KUDK 2NUZA 4F14A 1WJRA 2ENMA 1UECA 1RAFB 4OVAA 3FJPA 4PJLA 1HD3A 4PL6A 3GF5A 5LL6S 3OYYA 3VRZA 4R56A 2GBQA 4BDYA 1M8MA 1OEBA 1BCMA 1U1TA 2HKNA 4C5EA 3GNFB 4WTOB 3KFVA 3MO8A 3QDFA 2RMOA 1OZ3A 4JRKA 1K73R 3HFOA 3HHTB 2LZ6B 2CS7A 4M7AA 5GJWB 1Q81C 3CCJA 1MHNA 2ZPBB 3MHXA 1X2QA 3JCMQ 4A4GA 4J9GA 4FW2A 4OMOA 3WVDB 3HKSA 4GLKA 4B9WA 1IHWA 2JS2A 3M0QA 5GANf 4JS4A 4M7DF 2YUQA 5J39A 2QQBA 3SB2A 3G6EQ 1JRIA 2FYKA 1SF9A 1KD1U 3GBQA 2AKKA 3RNJA 5A0GA 2OAWA 1S72T 4PJOC 1YI2A 1WNLA 1YJNA 3PFSA 2X51A 2EJGA 3X28B 2DK3A 5I21A 1KQSP 1KD1C 3JCMc 2EJ9A 4OGCA 2BIVA 3EGDB 5GMKe 1PRMC 2VVKA 3H0IA 4F04B 1FMWA 5IHNA 1Y07A 3REAB 1UUEA 2CYZB 3VU3C 5FLXE 1M3CA 4BD3A 2CGHA 2EBPA 3L2UA 3CCMA 5LJ3e 2BUDA 3QPHA 3ZL7C 3CD6T 2D9TA 3S6WA 3LWIA 2JM8A 1T3LA 2P4RA 4IUTA 3CPWA 4JS5A 3JB9G 3G1JA 3CC7T 4M78D 1LOJA 2L8DA 1VYVA 2DL3A 1PSEA 1SSFA 2K5LA 1Q82C 2PNIA 3EFOB 1QCNA 2LNVA 5GAMd 2DL4A 3LH5A 4N4GA 3HRUA 2MI6A 3GLXA 4C8QG 4M77G 4EIKA 1AVZC 5GAOq 2LDMA 4J6YA 1VYTA 5CK9A 3X25B 2L5QA 4ZN1A 4D8DA 2J7IA 2DNUA 1B7TA 4J9HA 2DXTA 4LD9K 2HBWA 2A7YA 5LJ5f 2F2XA 3JB9D 2LQKA 3BY7A 2ED0A 1GBQA 5EG2A 2V1QA 3SWNC 1BK2A 1U1SA 2XI9A 4X34A 2HQHA 2DTHA 3M54A 1RAHB 1FX7A 4OMPA 2GFUA 5HY6A 2CKKA 3LW5E 3ASKA 3LX7A 4AMCA 1WZOA 1BBZA 2BE9B 5GAMg 5IAYA 5LJ5h 4IIOA 4GBQA 2FB7A 2CSIA 2SEMA 3AHUA 3VS7A 2K2VA 2EQUA 3V8LA 4M78A 1D3BB 1ZA2B 2IPOB 2JJ9A 3QKJA 1MNEA 3I56T 3CPWP 2CP2A 4N0AC 3LGFA 2O88A 1AWWA 1Y57A 2AZSA 4BUGA 3CCUA 5C6SA 3EG1A 3CCSQ 3TVTA 4YTLA 1WIEA 1MV0B 1KHCA 1Y71A 2E3IA 1RABB 4J5YA 3LLRA 5GANj 5KYUA 2VXEA 4WF2A 4RTUA 2VASA 1PHTA 5I2MA 1ZX6A 1NYGA 2ZZDA 1N5ZA 3C94A 4E7LA 3C95A 4XAXB 2QEXA 2QGGA 2JOYA 2PQWA 1KQ1A 4OB2B 1OU8A 2O2OA 3MEAA 3SDZA 1N8RR 2DIQA 2A08A 2EIFA 4DA4A 4LDUA 2LVMA 3DB3A 1YP5A 4FYXB 2XG8D 2KT1A 5CCAA 4ATOA 1V29B 1A0NB 1T0HA 3V7SA 3JCMX 4LXCA 2GQIA 4FYYB 3CC4A 1FWZA 3MP8A 1VQPA 1VQOT 1TXQA 1CSKA 4IUQA 2QXFA 1H8KA 1WHHA 1D1AA 4X9DA 1OX8A 4M75B 1VQLQ 4A53A 1WHLA 3CCQQ 2NUPA 3NMZC 3INZA 4XTZA 1H3HA 2C0IA 4F7UB 1OQKA 2YLBA 4J9IA 5GAN7 3RDVA 2V8JA 2OTJA 2QA4Q 1QP2A 1ACMB 3PMTA 2YSQA 4MMLA 3CC2A 2LCLA 2QYZA 1T3SA 3E9FA 2M1HA 5IT9E 1VQ8T 2DX1A 3JCMh 3OS5A 3TQ7P 2A36A 1TUCA 3T9NA 1KJWA 2DMOA 1W70A 4PK4A 3M0RA 2HQXA 2RN8A 3IQLA 2E4HA 3CMAT 3O5ZA 2YXYA 5CQYA 2COZA 5CKEA 3CPWS
chains in the Genus database with same CATH topology
2O9VA 2RPNA 4Z8AA 2L3QA 1RI9A 1ABOA 1M3AA 1U3OA 2ABLA 4AG2C 1WYXA 2DRKA 2LQNA 2RQVA 2DRMA 1SSHA 1Z9ZA 2L3PA 2KYMA 3M0PA 1PKTA 4DEXA 2AKLA 2HCKA 2KXDA 3EHQA 4J9FA 2OI3A 2A28A 3UATA 5HCKA 1WX6A 1QCFA 2MIOA 2H8HA 2J05A 2EKHA 2LMJA 1I07A 3A98A 2DJQA 3CQTA 2CREA 2GGRA 2BZ8A 3VRYA 2YUPA 1VYUA 2GNCA 1U06A 1JEGA 1UG1A 1U5SA 1AD5A 2CH4W 4D8KA 4Z89A 2JW4A 2SRCA 1PKSA 2KNBB 1SPKA 4RUGA 2J6KA 1JXMA 2W0ZA 3REBB 2DBMA 1RLQC 2HEQA 2W10A 1PNJA 4AFZC 3M0SA 2JMCA 1AEYA 4LUDA 2KBTA 3U23A 1I0CA 2DF6A 3UA7A 5EC7A 1AZEA 2JXBA 1BU1A 2JM9A 2VWFA 2NWMA 4LNPA 1Y0MA 2KE9A 3ULRB 2MOXA 2KXCA 1AWXA 2D8HA 2EW3A 2L2PA 4CC3A 1WI7A 1AOJA 2KGTA 4AFUC 1QKWA 1NEGA 1RLPC 2D1XA 2EYZA 5GJVB 3THKA 3VS0A 1YNZA 3SHWA 2QDLA 2EGAA 2JMAA 1UE9A 1QWFA 4R0KA 3VS4A 4IIMA 1JQQA 4K11A 2D8JA 2LJ3A 3NPFA 1X69A 4J9DA 3R6NA 2PTKA 3EG0A 1SEMA 4OMQA 1G83A 4HVVA 3PVLA 2CT3A 1HSQA 2OJ2A 4E6RA 2J06A 1UJYA 3I35A 1M30A 1E6HA 1YCSB 2YDLA 2FPDA 2K6DA 3VS6A 1YN8A 1WXTA 5IXFA 1QWEA 1B3QA 1NM7A 4LE9A 1K4US 2FEIA 1BB9A 3JV3A 3VS3A 5FW9A 4OMLA 2LX7A 2FRWA 2K3BA 2RF0A 4LUEA 2NUZA 2BZYA 4F14A 1HJDA 1GFDA 2ENMA 1UECA 2RQTA 2RNAA 1HD3A 1M27C 1GCQC 2F2WA 3VRZA 2GBQA 3H0HA 3TSZA 4J9CA 2FPFA 4Z88A 4CC2A 1M8MA 1NLOC 1OEBA 1K76A 3VS2A 2MCNA 2V1RA 1UJ0A 2LJ0A 4A63B 4JPBW 2CUBA 1UGVA 4JZ3A 2LNHB 2DA9A 3KFVA 1ZUYA 4X1VA 1NEBA 4AFQC 2LCSA 2RMOA 1CKAA 4JJDA 1JO8A 5L23A 2LZ6B 1UFFA 4Y92A 2K2MA 2FG0A 3H0FA 5GJWB 1UHCA 3M0TA 1FMKA 5IHIA 1UTIA 2IIMA 1G2BA 1QKXA 2KRMA 1B07A 2DL7A 1X2QA 2C0OA 1QLYA 4J9GA 4OMOA 2BZXA 1WFWA 2JS2A 3M0QA 1E6GA 2ROTA 2YUQA 1K0SA 1EFNA 1UDLA 2ED1A 2O31A 2YUOA 2J6FA 1J3TA 4RTVA 3M0UA 1WXBA 4RTTA 3GBQA 2AKKA 3RNJA 2OAWA 2LQWA 5I11A 1LCKA 1M3BA 1YWOA 5FWBA 1PRMC 2VVKA 3H0IA 2E5KA 5IHNA 3REAB 1UUEA 4JZ4A 1ZBJA 4OMMA 2JS0A 1GCPA 1M3CA 4JJBA 2DYBA 2EBPA 1V1CA 1W6XA 1ABQA 1CKBA 1OOTA 1OV3A 4HXJA 1GL5A 1OPLA 3ZL7C 2B86A 3NGPA 2JM8A 1T3LA 2P4RA 1MV3A 3UF4A 2L0AA 4AG1C 4AFSC 1ARKA 4LN2A 2AK5A 1AWOA 1Z9QA 1VYVA 2DL3A 5ECAA 3PE0A 2DBKA 1WA7A 3SEMA 1GCQA 1TG0A 1WXUA 2KEAA 2M0YA 4HVWA 3TSWA 2PNIA 4CC4B 4HVUA 3EGUA 2DL4A 3LH5A 1MUZA 4EIKA 1AVZC 3H41A 1AZGB 4RTZA 2DE0X 2CT4A 1SRMA 1VYTA 2J6OA 4D8DA 2FPEA 2A37A 2J7IA 2DNUA 5IH2A 1X27A 4J9HA 4OMNA 5IXBA 2DLPA 2HBWA 4F17A 2KYBA 2F2XA 2PZ1A 2ED0A 3I9QA 1GBQA 2V1QA 4M4ZA 1NLPC 1BK2A 2D0NA 2RQWA 4DEYA 4OMPA 2EYXA 2RQUA 2CDTA 3I5SA 2CSQA 4RTWA 4ZNXA 2G6FX 1BBZA 1WDXA 3EG2A 2KT8A 4IIOA 1UHFA 4QT7A 2XMFA 4GBQA 2CSIA 2SEMA 2GTJA 3EHRA 1X2KA 3VS7A 2L3SA 2KRSA 4ORZA 2ECZA 1H92A 1XOVA 3C0CA 2BTTA 1AWJA 1X6BA 2LP5A 2KR3A 4FSSA 2HDAA 4HCKA 1K9AA 2KROA 2O88A 2HSPA 1SHGA 2CH4A 1AWWA 2EGCA 1Y57A 1ZLMA 2AZSA 1TUDA 1JXOA 2LJ1A 3EG1A 1SRLA 4ESRA 3TVTA 3QWXX 2C0TA 2GTOA 1WIEA 2K9GA 1MV0B 1JU5C 2RQRA 1K1ZA 3QWYA 2X3WD 2FRYA 3NHNA 4RTUA 1PHTA 1ZX6A 1PRLC 1NYGA 5FWCA 1N5ZA 4RTXA 1RUWA 1SHFA 1KIKA 2ROLA 3PVQA 5I22A 4J9EA 2O2OA 2JTEA 2EYWA 2A08A 2EQIA 1YP5A 2KRNA 2K79A 3VS1A 5IHKA 2KT1A 1KSWA 1YWPA 1GBRA 1I1JA 4JJCA 2M51A 1KFZA 1W1FA 2YUNA 1NG2A 1A0NB 1T0HA 2AZVA 4RTYA 2EGEA 2GQIA 1T0JA 1S1NA 1NYFA 2I0NA 1CSKA 1E7OA 2EPDA 1ZSGA 1H8KA 1IO6A 2K7AA 2JT4A 1K0XA 1PWTA 2DVJA 2EYYA 4GLMA 1X43A 3NMZC 2F2VA 1ZUUA 4WCIA 2DILA 1FYNA 2YT6A 2C0IA 1H3HA 3VS5A 4CC7A 1WLPB 2DL5A 4J9IA 1GFCA 4KRTA 1GRIA 2O9SA 3RBBB 2YSQA 2FO0A 3UA6A 2VKNA 3I5RA 4J9BA 1T3SA 1OPKA 1X6GA 2DX1A 2CUDA 2ESWA 2A36A 1TUCA 1KJWA 2DMOA 1W70A 3M0RA 2RN8A 3IQLA 1VA7A 3FJ5A 2DL8A 3O5ZA 1ZUKA 4F16A 3EG3A 2DM1A 2EVRA 2X3XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9V A;  2RPN A;  4Z8A A;  2L3Q A;  1RI9 A;  1ABO A;  1M3A A;  1U3O A;  2ABL A;  4AG2 C;  1WYX A;  2DRK A;  2LQN A;  2RQV A;  2DRM A;  1SSH A;  1Z9Z A;  2L3P A;  2KYM A;  3M0P A;  1PKT A;  4DEX A;  2AKL A;  2HCK A;  2KXD A;  3EHQ A;  4J9F A;  2OI3 A;  2A28 A;  3UAT A;  5HCK A;  1WX6 A;  1QCF A;  2MIO A;  2H8H A;  2J05 A;  2EKH A;  2LMJ A;  1I07 A;  3A98 A;  2DJQ A;  3CQT A;  2CRE A;  2GGR A;  2BZ8 A;  3VRY A;  2YUP A;  1VYU A;  2GNC A;  1U06 A;  1JEG A;  1UG1 A;  1U5S A;  1AD5 A;  2CH4 W;  4D8K A;  4Z89 A;  2JW4 A;  2SRC A;  1PKS A;  2KNB B;  1SPK A;  4RUG A;  2J6K A;  1JXM A;  2W0Z A;  3REB B;  2DBM A;  1RLQ C;  2HEQ A;  2W10 A;  1PNJ A;  4AFZ C;  3M0S A;  2JMC A;  1AEY A;  4LUD A;  2KBT A;  3U23 A;  1I0C A;  2DF6 A;  3UA7 A;  5EC7 A;  1AZE A;  2JXB A;  1BU1 A;  2JM9 A;  2VWF A;  2NWM A;  4LNP A;  1Y0M A;  2KE9 A;  3ULR B;  2MOX A;  2KXC A;  1AWX A;  2D8H A;  2EW3 A;  2L2P A;  4CC3 A;  1WI7 A;  1AOJ A;  2KGT A;  4AFU C;  1QKW A;  1NEG A;  1RLP C;  2D1X A;  2EYZ A;  5GJV B;  3THK A;  3VS0 A;  1YNZ A;  3SHW A;  2QDL A;  2EGA A;  2JMA A;  1UE9 A;  1QWF A;  4R0K A;  3VS4 A;  4IIM A;  1JQQ A;  4K11 A;  2D8J A;  2LJ3 A;  3NPF A;  1X69 A;  4J9D A;  3R6N A;  2PTK A;  3EG0 A;  1SEM A;  4OMQ A;  1G83 A;  4HVV A;  3PVL A;  2CT3 A;  1HSQ A;  2OJ2 A;  4E6R A;  2J06 A;  1UJY A;  3I35 A;  1M30 A;  1E6H A;  1YCS B;  2YDL A;  2FPD A;  2K6D A;  3VS6 A;  1YN8 A;  1WXT A;  5IXF A;  1QWE A;  1B3Q A;  1NM7 A;  4LE9 A;  1K4U S;  2FEI A;  1BB9 A;  3JV3 A;  3VS3 A;  5FW9 A;  4OML A;  2LX7 A;  2FRW A;  2K3B A;  2RF0 A;  4LUE A;  2NUZ A;  2BZY A;  4F14 A;  1HJD A;  1GFD A;  2ENM A;  1UEC A;  2RQT A;  2RNA A;  1HD3 A;  1M27 C;  1GCQ C;  2F2W A;  3VRZ A;  2GBQ A;  3H0H A;  3TSZ A;  4J9C A;  2FPF A;  4Z88 A;  4CC2 A;  1M8M A;  1NLO C;  1OEB A;  1K76 A;  3VS2 A;  2MCN A;  2V1R A;  1UJ0 A;  2LJ0 A;  4A63 B;  4JPB W;  2CUB A;  1UGV A;  4JZ3 A;  2LNH B;  2DA9 A;  3KFV A;  1ZUY A;  4X1V A;  1NEB A;  4AFQ C;  2LCS A;  2RMO A;  1CKA A;  4JJD A;  1JO8 A;  5L23 A;  2LZ6 B;  1UFF A;  4Y92 A;  2K2M A;  2FG0 A;  3H0F A;  5GJW B;  1UHC A;  3M0T A;  1FMK A;  5IHI A;  1UTI A;  2IIM A;  1G2B A;  1QKX A;  2KRM A;  1B07 A;  2DL7 A;  1X2Q A;  2C0O A;  1QLY A;  4J9G A;  4OMO A;  2BZX A;  1WFW A;  2JS2 A;  3M0Q A;  1E6G A;  2ROT A;  2YUQ A;  1K0S A;  1EFN A;  1UDL A;  2ED1 A;  2O31 A;  2YUO A;  2J6F A;  1J3T A;  4RTV A;  3M0U A;  1WXB A;  4RTT A;  3GBQ A;  2AKK A;  3RNJ A;  2OAW A;  2LQW A;  5I11 A;  1LCK A;  1M3B A;  1YWO A;  5FWB A;  1PRM C;  2VVK A;  3H0I A;  2E5K A;  5IHN A;  3REA B;  1UUE A;  4JZ4 A;  1ZBJ A;  4OMM A;  2JS0 A;  1GCP A;  1M3C A;  4JJB A;  2DYB A;  2EBP A;  1V1C A;  1W6X A;  1ABQ A;  1CKB A;  1OOT A;  1OV3 A;  4HXJ A;  1GL5 A;  1OPL A;  3ZL7 C;  2B86 A;  3NGP A;  2JM8 A;  1T3L A;  2P4R A;  1MV3 A;  3UF4 A;  2L0A A;  4AG1 C;  4AFS C;  1ARK A;  4LN2 A;  2AK5 A;  1AWO A;  1Z9Q A;  1VYV A;  2DL3 A;  5ECA A;  3PE0 A;  2DBK A;  1WA7 A;  3SEM A;  1GCQ A;  1TG0 A;  1WXU A;  2KEA A;  2M0Y A;  4HVW A;  3TSW A;  2PNI A;  4CC4 B;  4HVU A;  3EGU A;  2DL4 A;  3LH5 A;  1MUZ A;  4EIK A;  1AVZ C;  3H41 A;  1AZG B;  4RTZ A;  2DE0 X;  2CT4 A;  1SRM A;  1VYT A;  2J6O A;  4D8D A;  2FPE A;  2A37 A;  2J7I A;  2DNU A;  5IH2 A;  1X27 A;  4J9H A;  4OMN A;  5IXB A;  2DLP A;  2HBW A;  4F17 A;  2KYB A;  2F2X A;  2PZ1 A;  2ED0 A;  3I9Q A;  1GBQ A;  2V1Q A;  4M4Z A;  1NLP C;  1BK2 A;  2D0N A;  2RQW A;  4DEY A;  4OMP A;  2EYX A;  2RQU A;  2CDT A;  3I5S A;  2CSQ A;  4RTW A;  4ZNX A;  2G6F X;  1BBZ A;  1WDX A;  3EG2 A;  2KT8 A;  4IIO A;  1UHF A;  4QT7 A;  2XMF A;  4GBQ A;  2CSI A;  2SEM A;  2GTJ A;  3EHR A;  1X2K A;  3VS7 A;  2L3S A;  2KRS A;  4ORZ A;  2ECZ A;  1H92 A;  1XOV A;  3C0C A;  2BTT A;  1AWJ A;  1X6B A;  2LP5 A;  2KR3 A;  4FSS A;  2HDA A;  4HCK A;  1K9A A;  2KRO A;  2O88 A;  2HSP A;  1SHG A;  2CH4 A;  1AWW A;  2EGC A;  1Y57 A;  1ZLM A;  2AZS A;  1TUD A;  1JXO A;  2LJ1 A;  3EG1 A;  1SRL A;  4ESR A;  3TVT A;  3QWX X;  2C0T A;  2GTO A;  1WIE A;  2K9G A;  1MV0 B;  1JU5 C;  2RQR A;  1K1Z A;  3QWY A;  2X3W D;  2FRY A;  3NHN A;  4RTU A;  1PHT A;  1ZX6 A;  1PRL C;  1NYG A;  5FWC A;  1N5Z A;  4RTX A;  1RUW A;  1SHF A;  1KIK A;  2ROL A;  3PVQ A;  5I22 A;  4J9E A;  2O2O A;  2JTE A;  2EYW A;  2A08 A;  2EQI A;  1YP5 A;  2KRN A;  2K79 A;  3VS1 A;  5IHK A;  2KT1 A;  1KSW A;  1YWP A;  1GBR A;  1I1J A;  4JJC A;  2M51 A;  1KFZ A;  1W1F A;  2YUN A;  1NG2 A;  1A0N B;  1T0H A;  2AZV A;  4RTY A;  2EGE A;  2GQI A;  1T0J A;  1S1N A;  1NYF A;  2I0N A;  1CSK A;  1E7O A;  2EPD A;  1ZSG A;  1H8K A;  1IO6 A;  2K7A A;  2JT4 A;  1K0X A;  1PWT A;  2DVJ A;  2EYY A;  4GLM A;  1X43 A;  3NMZ C;  2F2V A;  1ZUU A;  4WCI A;  2DIL A;  1FYN A;  2YT6 A;  2C0I A;  1H3H A;  3VS5 A;  4CC7 A;  1WLP B;  2DL5 A;  4J9I A;  1GFC A;  4KRT A;  1GRI A;  2O9S A;  3RBB B;  2YSQ A;  2FO0 A;  3UA6 A;  2VKN A;  3I5R A;  4J9B A;  1T3S A;  1OPK A;  1X6G A;  2DX1 A;  2CUD A;  2ESW A;  2A36 A;  1TUC A;  1KJW A;  2DMO A;  1W70 A;  3M0R A;  2RN8 A;  3IQL A;  1VA7 A;  3FJ5 A;  2DL8 A;  3O5Z A;  1ZUK A;  4F16 A;  3EG3 A;  2DM1 A;  2EVR A;  2X3X D; 
#chains in the Genus database with same CATH topology
 4Z8A A;  1XJW B;  2RPN A;  3HRT A;  1RI9 A;  3MP6 A;  5LJ5 j;  2E6N A;  4FYV B;  1SSH A;  1S72 Q;  5CQX A;  4RCC A;  1QQJ A;  3OYB A;  3AT1 B;  3OYJ A;  1D0Z A;  3CCL A;  4PNO A;  2A28 A;  4FU6 A;  2RB6 A;  1QVG A;  2H8H A;  2J05 A;  1ZHI A;  3BDL A;  2DEU A;  3QHS A;  2HKQ B;  3A98 A;  2EJF A;  2LQ8 A;  5KYY B;  3JB9 F;  2VGN A;  2O4X A;  4N4H A;  3OSS C;  3JCM W;  2GNC A;  4PJO B;  1BIA A;  4CRI A;  3TRE A;  4CI0 C;  1U5S A;  2CH4 W;  5KE3 A;  4QVC A;  1G3W A;  4PJN A;  3CCR A;  4FIB A;  4RUG A;  4D6W A;  4Y28 E;  2YRV A;  2VV5 A;  4C8Q F;  4M77 F;  2W10 A;  3GIB A;  1YJ9 T;  2JMC A;  2CZ1 B;  3U23 A;  5GMK j;  1I0C A;  2DF6 A;  3EGD A;  4XU0 A;  3CC7 Q;  1YIT A;  4RCB A;  1YJN Q;  3CCL T;  1RAA B;  2JM9 A;  2VWF A;  2NWM A;  2V8I A;  4EMH A;  1NJI C;  2KE9 A;  3ULR B;  4IUV A;  2L2P A;  1K9M U;  3UDC A;  2HAX A;  1NEG A;  1RLP C;  2EYZ A;  3QJY A;  4BI4 A;  2QDL A;  1QWF A;  4MMK A;  2JZ2 A;  1M90 U;  1K9M C;  1R8O B;  1JJ2 A;  4JDS A;  4OB0 B;  2OTL T;  4FCY A;  3NPF A;  1X69 A;  3X20 B;  3EG0 A;  3JCM P;  1M90 C;  1QVG P;  2WSC E;  4F7U E;  3PVL A;  1X01 A;  4C0F A;  1DJ7 B;  3EFO A;  3VS6 A;  4UC4 A;  2VXF A;  4FM4 B;  1IZ6 A;  3JAM E;  1XQH A;  3RKX A;  3UPU A;  1WJQ A;  3LWH A;  2FEI A;  1I8F A;  1X6O A;  1BB9 A;  1O9S A;  1D09 B;  3SWN B;  3VS3 A;  2HSE B;  1YCY A;  2LX7 A;  2COW A;  3CPF A;  3I55 T;  1VQ4 T;  1HJD A;  1GFD A;  4FW1 A;  2AT1 B;  1GCQ C;  4M75 G;  4J9C A;  3GP8 A;  2PU9 B;  3ZEH A;  2D6F A;  2V1R A;  1UJ0 A;  2KSS A;  4JLG A;  4ZGJ B;  1Y7X A;  2F5K A;  3VUZ A;  2DA9 A;  4ELZ C;  4J7F A;  1BCO A;  5KYX B;  1D3B A;  3FB9 A;  1CKA A;  1JJ2 P;  2M9U A;  4JJD A;  1JO8 A;  3P8H A;  4HCB A;  5AT1 B;  4MZP A;  2ZGW A;  5L23 A;  1UFF A;  3NTK A;  4BE1 A;  2K2M A;  1MMA A;  2FG0 A;  4M75 D;  5A2Q E;  4FL6 A;  1BYM A;  2K3Y A;  4KBM B;  4XU1 A;  5GAN d;  1QKX A;  4PJO E;  1YBY A;  2DIG A;  1B07 A;  2DL7 A;  2MK5 A;  2P4T A;  1QLY A;  2BZX A;  1WFW A;  5A0D A;  4XTV A;  3OB9 A;  4DBH A;  4L6V 5;  1VQ7 A;  2XD0 A;  3OYA A;  3RUX A;  3O8V A;  1J3T A;  3OYF A;  1O75 A;  5HK0 A;  1WXB A;  4RTT A;  3MEW A;  5KYU B;  4EPC A;  2K4Y A;  1H64 1;  5I11 A;  3WVE B;  2GQV A;  2X4Y A;  2HD0 A;  1IRE B;  4M7A G;  3QUI A;  2XDB A;  2RHX A;  5CVI A;  1ZSZ C;  2QEX Q;  5GAN g;  2VB6 A;  3OYD A;  1ZBJ A;  1MMD A;  4TVR A;  2QGF B;  3M53 A;  4MDW A;  1GCP A;  2COY A;  2DTI A;  3NTI A;  1VQ8 Q;  2DYB A;  3OSV A;  1W6X A;  4C92 F;  1KC8 U;  1CKB A;  1OOT A;  1VQ9 T;  1ZA1 B;  4C0Z A;  1GL5 A;  3NFC A;  1TS9 A;  4M7D C;  3CXC A;  3CC4 Q;  3CME T;  1VQP Q;  3NGP A;  3UF4 A;  4F7U A;  4AFS C;  1ARK A;  4DOV A;  1H3Z A;  1K73 U;  3MKD A;  4QQG A;  3PE0 A;  2DVE A;  2DBK A;  3SEM A;  3PIP A;  1WXU A;  2CZ0 B;  2WSE E;  5GAN 2;  1K73 C;  2CP6 A;  3OS2 A;  4LD6 A;  1VQ6 T;  1C6V X;  3H41 A;  1AZG B;  3CC2 Q;  5LJ5 d;  3OYN A;  2A37 A;  9ATC B;  1WQW A;  3G7Z A;  4O5V A;  1JJ2 S;  1X27 A;  4OMN A;  4F17 A;  4BAC A;  1Q86 U;  2P0P A;  1KC8 R;  2K3X A;  3I9Q A;  3QYH B;  4OF1 A;  3PTA A;  1NLP C;  1Y96 B;  3OYL A;  5CKD A;  1S72 A;  2MMP A;  1W2B A;  2CDT A;  2CSQ A;  4QW2 A;  2MWP A;  4RTW A;  4ZNX A;  4R55 A;  3OMG A;  2C06 A;  3DLM A;  2NYS A;  1YJ9 Q;  4QT7 A;  2XMF A;  5GAN 3;  2RK2 A;  3QXE B;  3EGX B;  3CEY A;  3HFN A;  4C0D C;  1KK7 A;  3EHR A;  2YRC A;  5LJ5 g;  1TU0 B;  4OB3 B;  2EKO A;  2L3S A;  2QQS A;  1AT1 B;  3CCL Q;  3X26 B;  4ORZ A;  2ECZ A;  1XOV A;  3C0C A;  4MDX A;  5KYY A;  2BTT A;  1AWJ A;  1X6B A;  3LGL A;  2RJD A;  4PJO A;  4Z02 A;  2HSP A;  1SHG A;  3QG1 A;  3CD6 A;  1ZLM A;  4E47 A;  3SD4 A;  1TUD A;  2E65 A;  2O4X B;  1Q86 R;  1JXO A;  1SRL A;  2DD4 A;  5GAN 5;  5GAO n;  1N9R A;  3QZ9 B;  4PJM A;  3CC7 A;  2XDP A;  2HZY A;  2ZAE A;  1WHG A;  1K1Z A;  1N9S A;  2Y4X A;  3QWY A;  3CCR Q;  2JTF A;  2X3W D;  4JJN K;  2BKD N;  3CCE T;  3NHN A;  5GAN h;  5FWC A;  3V8K A;  3Q1J A;  4OP0 A;  4M78 G;  1RUW A;  1Q7Y U;  1KIK A;  2CP7 A;  1YIT Q;  1NE8 A;  3QYG B;  4J9E A;  5CKF A;  3JCM J;  2DZC A;  4M75 F;  1Q7Y C;  1W2B P;  2XK0 A;  5FU7 C;  1RAE B;  2FHD A;  1VQM T;  3A5Z B;  4J6X A;  4C8Q E;  3I55 Q;  4E7J A;  4ZGE B;  1SG5 A;  3JCM d;  4RTY A;  4KH1 B;  2EGE A;  3BE3 A;  1D0X A;  2DEQ A;  2I0N A;  3GPL A;  4BB7 A;  1TTH B;  2MPX C;  2PUK B;  2JT4 A;  1PWT A;  1IXD A;  2DVJ A;  3FLG A;  1QW1 A;  1EIF A;  3VKI A;  5HK3 A;  5I2S A;  4XTY A;  1WHM A;  4KRT A;  3DB4 A;  1GRI A;  2O9S A;  4KUL A;  3SWN A;  1Q7Y R;  2E5Q A;  3I56 A;  2FO0 A;  2HMA A;  2VKN A;  3EG9 B;  1B34 B;  2ESW A;  3H8Z A;  2RD1 A;  3HPW A;  3JCM g;  1VA7 A;  4IUP A;  3FJ5 A;  5GAO m;  1RAC B;  3QJ6 A;  5J26 A;  3EG3 A;  2DM1 A;  3CXC S;  1EZZ B;  2M16 A;  2GF7 A;  4LDW A;  2X3X D;  3VJP A;  4PJJ A;  3EAE A;  4M7A F;  5DLQ E;  1BKB A;  2ABL A;  4AG2 C;  5KYX A;  4PFZ A;  4N0A A;  5GAM e;  1Z9Z A;  2KYM A;  3JB9 I;  5GMK i;  3M5A A;  4KGV B;  1N8R U;  4J9F A;  2YLC A;  5HCK A;  2MIO A;  2AHJ B;  1D1B A;  4PKC C;  1OX9 A;  1N8R C;  1D0Y A;  4A4H A;  2YWW A;  3GOX A;  1RAG B;  1N6A A;  2DJQ A;  4E7Z A;  2YUP A;  4LDY A;  1RI0 A;  1VQO A;  2X4X A;  1W2B S;  5IN1 A;  2PVG B;  4EDU A;  1BI1 A;  1VQ9 Q;  2GFA A;  4Z89 A;  2SRC A;  2KNB B;  1VQ7 Q;  1ZSZ B;  2DBM A;  4KUI A;  3EH1 A;  5LJ3 f;  4AFZ C;  3M0S A;  1AEY A;  2EQK A;  2IG0 A;  3M56 A;  2RK1 A;  5EC7 A;  1PG5 B;  5DM7 R;  5GMK h;  1VOM A;  4QVD A;  1YHQ T;  4LNP A;  1VQ8 A;  1Y0M A;  2R5A A;  3GNG A;  2QTX A;  5D6W A;  2LX9 A;  5HKC A;  2EYQ A;  4J6W A;  1VQ6 Q;  4M7D B;  1WI7 A;  4FSX A;  1AOJ A;  3CMA A;  4IKF A;  1QKW A;  2D1X A;  5LJ3 h;  3THK A;  2KAF A;  2KI7 A;  3QZ5 B;  3VS4 A;  2KVQ G;  2K57 A;  4K11 A;  1D1C A;  1TOV A;  4J9D A;  3R6N A;  2PTK A;  4KGZ B;  4P5N A;  3A1P A;  5GAO l;  4E7I A;  2Z0W A;  1VQN T;  4C8Q C;  2RI3 A;  4M77 C;  1M30 A;  2YDL A;  2FPD A;  2QAZ A;  3C4S A;  1M1K U;  4OB1 B;  4C5I A;  3CCV T;  2DTO A;  1NPP A;  3OYE A;  2L3R A;  4C92 E;  2O01 E;  2E6Z A;  1M1K C;  5IXF A;  4DBR A;  1NM7 A;  4LE9 A;  3FEO A;  3JV3 A;  2FRW A;  4KT0 E;  2RF0 A;  4LUE A;  3UWN A;  5GAM f;  1Y96 A;  2R58 A;  3H0H A;  3TSZ A;  4A4K A;  2KK4 A;  2FVU A;  3MCA B;  1TUG B;  4M78 F;  1RAI B;  1NLO C;  4C0D B;  1M9S A;  1YJ9 A;  1K76 A;  3VS2 A;  1NPR A;  1MND A;  1PD1 A;  4A63 B;  2CUB A;  3MEV A;  1I4K 1;  1UGV A;  3EGX A;  4JZ3 A;  2LNH B;  3EFS A;  4X1V A;  1NEB A;  3HTR A;  3CCE Q;  1M1K R;  2LCS A;  2VUB A;  1KQ2 A;  3E9G A;  2EAY A;  2HBP A;  2VC8 A;  4LDV A;  3OYI A;  4B6M A;  1UTI A;  2IIM A;  1G2B A;  2MWO A;  2KRM A;  2QG9 B;  7AT1 B;  4HT8 A;  5GMK m;  1PM3 A;  2OTL A;  1WHJ A;  1UGQ B;  2DKG A;  1VQM Q;  5D6X A;  2ROT A;  1G5V A;  3DLL A;  2AIR B;  3CD6 Q;  3TEE A;  3MET A;  4C5G A;  3BW1 A;  3A8O B;  2ED1 A;  2O31 A;  1YIJ T;  2J6F A;  3OYK A;  2EFI A;  3J7A F;  2YHT A;  1YJW T;  2MAM A;  3A8L B;  2EQM A;  4RTV A;  1M1F A;  4II1 A;  2DXC A;  2LQW A;  2A0F B;  5FU7 B;  1LCK A;  3G71 T;  2LRQ A;  6AT1 B;  3RES A;  2RHU A;  1M3B A;  4M7D E;  1YWO A;  5LJ3 j;  1HYO A;  3I55 A;  4JZ4 A;  3FDR A;  1VQ4 A;  1MGQ A;  4JUV A;  4OMM A;  2JS0 A;  4JJB A;  1LVK A;  2RJF A;  1V1C A;  2HNI A;  2QAS A;  1Q95 G;  1OV3 A;  1OPL A;  2FZC B;  1UEB A;  3EH2 A;  4XQ3 A;  2E3H A;  3G6E T;  1MV3 A;  3A8M B;  3FC3 A;  3R6O A;  4LN2 A;  2AK5 A;  3JB9 H;  4GY5 A;  1Z9Q A;  1MMG A;  1UB4 A;  1WA7 A;  1GCQ A;  1M1G A;  5GAO p;  4HVW A;  2KEA A;  4CC4 B;  4XU2 A;  3EG9 A;  1B34 A;  1MUZ A;  5FU6 C;  3L2W A;  4RTZ A;  3I56 Q;  2DE0 X;  2CT4 A;  1BIB A;  1SRM A;  4NL2 A;  2J6O A;  2FPE A;  1VQ5 T;  4EMK C;  3TCJ A;  2RJE A;  5IXB A;  1NZ9 A;  3CBM A;  1IGU A;  2KYB A;  1AHJ B;  4C92 C;  1TSF A;  2PZ1 A;  2ZPH B;  4HCC A;  2JN0 A;  4M4Z A;  1BI3 A;  4O6J A;  4F7U G;  1VIF A;  4DEY A;  2RQW A;  4PFO A;  5GMK l;  1X75 C;  2EYX A;  3WXM B;  4M7D D;  2RQU A;  3I5S A;  3ME9 A;  4IUR A;  1PD0 A;  2G6F X;  1WDX A;  2RH2 A;  3EG2 A;  2X35 A;  1UHF A;  2GCX A;  1LPL A;  2GTJ A;  2HL5 C;  4XK8 E;  3RMQ A;  8AT1 B;  1VQK T;  4FT2 A;  3HL8 A;  2MYS A;  4QQ6 A;  1IB8 A;  2IVW A;  2LP5 A;  1VQ9 A;  4FSS A;  1XNI A;  5CAI A;  4M7A E;  4HCK A;  1HK9 A;  1K9A A;  2KRO A;  2P84 A;  1IHV A;  2RJC A;  3CME A;  4ESR A;  1VQO Q;  3JSC A;  1ZSZ A;  3X24 B;  3RER A;  1WGS A;  2E64 A;  2CZ7 B;  5GAN 6;  3JCM b;  2P0K A;  3CBO A;  1KG1 A;  4OGE A;  1VQN Q;  1PRL C;  4MZT A;  3S3M A;  4Y91 A;  1VQ6 A;  1JB0 E;  3CCV Q;  1SHF A;  2LC4 A;  4M7D A;  2ROL A;  4DBQ A;  2XHC A;  5GAN e;  4PJO G;  2JTE A;  3QII A;  2EQI A;  2KRN A;  5IHK A;  1YWP A;  1I1J A;  2VYT A;  3CMA Q;  4E7H A;  1PCX A;  1W4S A;  2E41 A;  1KFZ A;  2LCC A;  4M77 B;  4C8Q B;  1KC8 C;  3L2V A;  2YUN A;  2NLU A;  1NG2 A;  4OMF B;  2I2L A;  1T0J A;  1S1N A;  1NYF A;  4PLL A;  3CCS T;  4RKU E;  1ZSG A;  1IO6 A;  2RI2 A;  2K7A A;  1K0X A;  2PUO B;  1C1A A;  2EYY A;  5KCO A;  1U8R A;  2F2V A;  4PJO D;  1ZUU A;  3CBP A;  2YT6 A;  2DJZ A;  2DL5 A;  4V2S A;  4BY6 C;  2ATC B;  3I5R A;  4J9B A;  4HA8 A;  2Y90 A;  3PNW C;  2FZK B;  4M75 C;  1X6G A;  2CUD A;  1LJO A;  2XDD A;  2OX7 A;  5GAN 8;  1ZUK A;  1Q86 C;  3HP9 A;  3UT1 A;  1I5O B;  2EVR A;  4HKE A;  1KQS A;  4AT1 B;  2M02 A;  5GAO r;  3CCE A;  2MF2 A;  1M3A A;  1YIJ Q;  1VQL T;  1U3O A;  2DPP B;  4XTU A;  1YJW Q;  2LQN A;  2VGM A;  3V7R A;  3CCQ T;  4XTX A;  2JVV A;  3E19 A;  3M0P A;  2QQA A;  4DEX A;  3M58 A;  2HCK A;  3CXC P;  3EHQ A;  1I5L A;  1LNX A;  5LJ5 e;  2OI3 A;  3G71 Q;  3UAT A;  5KH6 A;  2QA4 T;  5L8R E;  4E7S A;  1WX6 A;  1QCF A;  1Q81 U;  2EKH A;  4A54 A;  5CR2 A;  1VQM A;  3A8G B;  3RKW A;  4M78 E;  2LMJ A;  2JTM A;  1I07 A;  3CQT A;  1I81 A;  2CRE A;  1WJS A;  4BE2 A;  1XTD A;  3LH0 A;  2OAU A;  2DER A;  2X9H A;  2OTL Q;  3QDR B;  3P8B B;  4QKU A;  1U06 A;  2QTV A;  1JEG A;  1YFN A;  3QBY A;  5LJ3 d;  1AD5 A;  4D8K A;  4NL3 A;  2DET A;  2J6K A;  2DZ9 A;  4M7A C;  1JXM A;  2W0Z A;  3REB B;  3M55 A;  2HEQ A;  1PNJ A;  4LUD A;  2QQ9 A;  2KBT A;  4ZGD B;  1QVF A;  1AZE A;  5KYN A;  1BU1 A;  1RL2 A;  2YRD A;  3F70 A;  1AWX A;  4F7U F;  1Q81 R;  4M77 E;  1BI2 A;  2KGT A;  5KYW A;  1VQ4 Q;  5GJV B;  4FYW B;  3OW2 A;  3SHW A;  1VQ5 Q;  2EGA A;  2JMA A;  3CCJ T;  4J8O A;  4R0K A;  4NOY A;  5LJ3 g;  4QVZ A;  1C0M A;  3N5B B;  3V7C A;  2D8J A;  1IRX A;  3DKM A;  2X4W A;  3QO3 A;  3MEU A;  1FXX A;  4OMQ A;  1G83 A;  4HVV A;  2CT3 A;  1UGS B;  1HSQ A;  4ELY C;  5FU6 B;  1E6H A;  2K6D A;  2JUF A;  4DQ2 A;  2M0O A;  4EMK B;  5KCH A;  3L2R A;  1Q82 U;  1KD1 R;  1PC0 A;  1YI2 T;  4XU3 A;  1YJN T;  4C92 B;  3ZFJ A;  2CZ6 B;  1B3Q A;  1VQK Q;  3H6Z A;  1VUB A;  2H3J A;  3OYH A;  2F5T X;  1G8X A;  1QP3 A;  4DOW A;  2K3B A;  3JCM e;  2BZY A;  2NUT B;  2RQT A;  2RNA A;  1QVF P;  1M27 C;  2F2W A;  3L1A A;  1M8V A;  3CCM T;  2FPF A;  1WQ7 A;  4Z88 A;  4CC2 A;  3LYI A;  3L2Q A;  2KDS A;  2MCN A;  2LJ0 A;  4JPB W;  4PJO F;  2V8K A;  2RHI A;  2QQR A;  5FRM A;  3OW2 P;  1ZUY A;  1YHQ A;  4C8Q D;  4M77 D;  4AFQ C;  1M2V B;  1Q82 R;  2DXU A;  1N27 A;  4X9C A;  4Y92 A;  3VYG A;  3HSB A;  3H0F A;  1UHC A;  3M0T A;  4L5G A;  1FMK A;  5IHI A;  2ZPF B;  4E2F B;  2C0O A;  2WAC A;  1KQS S;  3FRN A;  1E6G A;  4ME7 A;  2LTO A;  4RG8 A;  1K0S A;  2R57 A;  2RA2 A;  1EFN A;  1UDL A;  2YUO A;  3CME Q;  1VQN A;  4M78 C;  2RM4 A;  2G3R A;  3M0U A;  3OBW A;  3CCV A;  2PVD B;  3OS1 A;  1G3S A;  5DLO A;  1G3T A;  3H9N A;  2E70 A;  3VV0 A;  4ZTF A;  4HCZ A;  4BE0 A;  4BDZ A;  5FWB A;  3KXT A;  2E5K A;  3OMC A;  1BI0 A;  3J81 E;  2A3L A;  5CO7 A;  4M77 A;  3RR6 A;  4C8Q A;  4BI3 A;  2H3E B;  3RMS A;  2FL7 A;  1ABQ A;  4HXJ A;  3CCU T;  3G4S A;  3V8J A;  1K8A U;  2B86 A;  4BY6 B;  4KGX B;  3RIR A;  2CP3 A;  1QVF S;  4JRI A;  2L0A A;  4AG1 C;  4N4I A;  3MPU B;  1AWO A;  4ZN3 A;  3JCM f;  1K8A C;  3FIF A;  4MZM A;  2BE7 D;  5ECA A;  3VYH B;  1TG0 A;  1WPY A;  2M0Y A;  3MJX A;  3TSW A;  4HVU A;  3EGU A;  3PMI A;  2ZPE B;  3HRS A;  5CKB A;  1KHI A;  3OYM A;  3SFM A;  3M59 A;  2QEX T;  3OW2 S;  3EFR A;  3S3O A;  2XIC A;  5IH2 A;  3ZBD A;  4C5H A;  2DLP A;  2Y4Y A;  1QMC A;  3BFM A;  1YIJ A;  1YJW A;  2D0N A;  3G4S T;  4Q5W A;  4HT9 A;  3TU4 K;  2DAQ A;  4J83 A;  3M57 A;  4KH0 B;  5J3B A;  1K8A R;  3CC4 T;  1UGP B;  1VQP T;  1VIE A;  1HXD A;  4ANJ A;  5GAM h;  2DD5 A;  3G71 A;  1FMV A;  3BDU A;  3PT9 A;  4C92 G;  1M5Q 1;  2QI2 A;  2KT8 A;  1OI1 A;  5FRN A;  5A0L A;  2DYI A;  4RG2 A;  2LT1 A;  3OA6 A;  1X2K A;  2KRS A;  2RHY A;  2OTJ T;  1H92 A;  5AYF A;  3CC2 T;  1R0B G;  4BI8 B;  2KR3 A;  4E7K A;  2HDA A;  4M7A B;  2RHZ A;  2CH4 A;  2EGC A;  3ER0 A;  3OYC A;  2LJ1 A;  3CCJ Q;  3G6E A;  3MP1 A;  1UGR B;  4C92 D;  3QWX X;  2C0T A;  1SKU B;  2GTO A;  1QVP A;  2K9G A;  4J7I A;  1JU5 C;  2RQR A;  2P0Q A;  2KY9 A;  2E1H A;  4QQD A;  2FRY A;  1OU9 A;  1PSF A;  2XID A;  2KQW A;  4RTX A;  3QSU A;  3OYG A;  3OBY A;  1NJI U;  3PVQ A;  3RKY A;  5I22 A;  1YI2 Q;  1VQ5 A;  2V26 A;  4A4E A;  2EYW A;  1GXI E;  4EMG A;  5KYW B;  2K79 A;  3VS1 A;  1KSW A;  2ZPI B;  1GBR A;  4JJC A;  5CKH A;  2M51 A;  3P8D A;  1W1F A;  2EQJ A;  1V76 A;  2AZV A;  1JBM A;  2HL3 A;  2E10 A;  3VUB A;  1OZ2 A;  1E7O A;  2EPD A;  3CCM Q;  4M75 E;  2ZCF B;  4RMO A;  5KE2 A;  4EMK A;  4GLM A;  3CCR T;  1X43 A;  3M9Q A;  4B9X A;  4WCI A;  1EX4 A;  2DIL A;  1FYN A;  4M7D G;  2L89 A;  2E12 A;  1M2O A;  3VS5 A;  4CC7 A;  4C92 A;  1WLP B;  1VQK A;  1TH7 A;  1GFC A;  2XU8 A;  3M4Y A;  3RBB B;  3M4G A;  3S3N A;  1YIT T;  3UA6 A;  1NJI R;  5FRO A;  3KBG A;  1OPK A;  3L42 A;  5M9O A;  4PLI A;  2NUT A;  2D0Q B;  2B8A A;  2RO0 A;  2DL8 A;  3NTH A;  1ZBX A;  4F16 A;  3PGG A;  1K9M R;  5GAM j;  2HQE A;  1UE9 A;  2O9V A;  2R5M A;  2WSF E;  2L3Q A;  3OQ5 A;  1M90 R;  1QCO A;  1ABO A;  1NBE B;  3KUF A;  8ATC B;  2X4J A;  4NS5 A;  4LDX A;  1M2V A;  1WYX A;  2DRK A;  4PFP A;  2PVO B;  2RQV A;  2DRM A;  2F1L A;  2L3P A;  1OYX A;  1PKT A;  1MMN A;  2AKL A;  1ZQ1 A;  2QK0 A;  1G3Y A;  2JNG A;  2CP0 A;  2KXD A;  1YHQ Q;  4JLI A;  4A4F A;  4DBF A;  2RI5 A;  3A8H B;  4M78 B;  1P92 A;  2GGR A;  2BZ8 A;  3VRY A;  1VYU A;  3CCS A;  5D6Y A;  3OS0 A;  1R77 A;  2F69 A;  3J80 E;  5GAN 4;  1UG1 A;  2JW4 A;  1PKS A;  1SPK A;  1R0C B;  4XTW A;  3CCU Q;  1RLQ C;  1WHK A;  2DFU A;  1IGQ A;  4L59 A;  4JRQ A;  3E2U A;  4VUB A;  2K5I A;  3UA7 A;  2DO3 A;  2JXB A;  2LT4 A;  3C12 A;  2XKO C;  4FT4 A;  3L2Z A;  1QVG S;  2MOX A;  2K5F A;  2DXB A;  4C0G A;  2KXC A;  2D8H A;  2EW3 A;  4CC3 A;  2FZG B;  4AFU C;  3VS0 A;  1YNZ A;  2CP5 A;  1RAD B;  4IIM A;  1JQQ A;  2ZPG B;  2LJ3 A;  3PIO A;  3D7S B;  1VQL A;  1M4Z A;  1SEM A;  4IUU A;  2EWN A;  1TWB A;  4M75 A;  4JRP A;  1F1B B;  3G4S Q;  3CCQ A;  1VQ7 T;  2KMT A;  3JCM V;  3OY9 A;  2OJ2 A;  4E6R A;  2J06 A;  1UJY A;  3I35 A;  1YCS B;  4M7A D;  3URG A;  5C0M A;  1YN8 A;  1OUL A;  4ZTJ A;  1WXT A;  2QA4 A;  5CIU A;  3JB9 J;  2NUP B;  5D7U A;  1QWE A;  1K4U S;  5FW9 A;  4OML A;  3E1S A;  2OTJ Q;  2QDY B;  3JRZ A;  5DY9 A;  4KUD K;  2NUZ A;  4F14 A;  1WJR A;  2ENM A;  1UEC A;  1RAF B;  4OVA A;  3FJP A;  4PJL A;  1HD3 A;  4PL6 A;  3GF5 A;  5LL6 S;  3OYY A;  3VRZ A;  4R56 A;  2GBQ A;  4BDY A;  1M8M A;  1OEB A;  1BCM A;  1U1T A;  2HKN A;  4C5E A;  3GNF B;  4WTO B;  3KFV A;  3MO8 A;  3QDF A;  2RMO A;  1OZ3 A;  4JRK A;  1K73 R;  3HFO A;  3HHT B;  2LZ6 B;  2CS7 A;  4M7A A;  5GJW B;  1Q81 C;  3CCJ A;  1MHN A;  2ZPB B;  3MHX A;  1X2Q A;  3JCM Q;  4A4G A;  4J9G A;  4FW2 A;  4OMO A;  3WVD B;  3HKS A;  4GLK A;  4B9W A;  1IHW A;  2JS2 A;  3M0Q A;  5GAN f;  4JS4 A;  4M7D F;  2YUQ A;  5J39 A;  2QQB A;  3SB2 A;  3G6E Q;  1JRI A;  2FYK A;  1SF9 A;  1KD1 U;  3GBQ A;  2AKK A;  3RNJ A;  5A0G A;  2OAW A;  1S72 T;  4PJO C;  1YI2 A;  1WNL A;  1YJN A;  3PFS A;  2X51 A;  2EJG A;  3X28 B;  2DK3 A;  5I21 A;  1KQS P;  1KD1 C;  3JCM c;  2EJ9 A;  4OGC A;  2BIV A;  3EGD B;  5GMK e;  1PRM C;  2VVK A;  3H0I A;  4F04 B;  1FMW A;  5IHN A;  1Y07 A;  3REA B;  1UUE A;  2CYZ B;  3VU3 C;  5FLX E;  1M3C A;  4BD3 A;  2CGH A;  2EBP A;  3L2U A;  3CCM A;  5LJ3 e;  2BUD A;  3QPH A;  3ZL7 C;  3CD6 T;  2D9T A;  3S6W A;  3LWI A;  2JM8 A;  1T3L A;  2P4R A;  4IUT A;  3CPW A;  4JS5 A;  3JB9 G;  3G1J A;  3CC7 T;  4M78 D;  1LOJ A;  2L8D A;  1VYV A;  2DL3 A;  1PSE A;  1SSF A;  2K5L A;  1Q82 C;  2PNI A;  3EFO B;  1QCN A;  2LNV A;  5GAM d;  2DL4 A;  3LH5 A;  4N4G A;  3HRU A;  2MI6 A;  3GLX A;  4C8Q G;  4M77 G;  4EIK A;  1AVZ C;  5GAO q;  2LDM A;  4J6Y A;  1VYT A;  5CK9 A;  3X25 B;  2L5Q A;  4ZN1 A;  4D8D A;  2J7I A;  2DNU A;  1B7T A;  4J9H A;  2DXT A;  4LD9 K;  2HBW A;  2A7Y A;  5LJ5 f;  2F2X A;  3JB9 D;  2LQK A;  3BY7 A;  2ED0 A;  1GBQ A;  5EG2 A;  2V1Q A;  3SWN C;  1BK2 A;  1U1S A;  2XI9 A;  4X34 A;  2HQH A;  2DTH A;  3M54 A;  1RAH B;  1FX7 A;  4OMP A;  2GFU A;  5HY6 A;  2CKK A;  3LW5 E;  3ASK A;  3LX7 A;  4AMC A;  1WZO A;  1BBZ A;  2BE9 B;  5GAM g;  5IAY A;  5LJ5 h;  4IIO A;  4GBQ A;  2FB7 A;  2CSI A;  2SEM A;  3AHU A;  3VS7 A;  2K2V A;  2EQU A;  3V8L A;  4M78 A;  1D3B B;  1ZA2 B;  2IPO B;  2JJ9 A;  3QKJ A;  1MNE A;  3I56 T;  3CPW P;  2CP2 A;  4N0A C;  3LGF A;  2O88 A;  1AWW A;  1Y57 A;  2AZS A;  4BUG A;  3CCU A;  5C6S A;  3EG1 A;  3CCS Q;  3TVT A;  4YTL A;  1WIE A;  1MV0 B;  1KHC A;  1Y71 A;  2E3I A;  1RAB B;  4J5Y A;  3LLR A;  5GAN j;  5KYU A;  2VXE A;  4WF2 A;  4RTU A;  2VAS A;  1PHT A;  5I2M A;  1ZX6 A;  1NYG A;  2ZZD A;  1N5Z A;  3C94 A;  4E7L A;  3C95 A;  4XAX B;  2QEX A;  2QGG A;  2JOY A;  2PQW A;  1KQ1 A;  4OB2 B;  1OU8 A;  2O2O A;  3MEA A;  3SDZ A;  1N8R R;  2DIQ A;  2A08 A;  2EIF A;  4DA4 A;  4LDU A;  2LVM A;  3DB3 A;  1YP5 A;  4FYX B;  2XG8 D;  2KT1 A;  5CCA A;  4ATO A;  1V29 B;  1A0N B;  1T0H A;  3V7S A;  3JCM X;  4LXC A;  2GQI A;  4FYY B;  3CC4 A;  1FWZ A;  3MP8 A;  1VQP A;  1VQO T;  1TXQ A;  1CSK A;  4IUQ A;  2QXF A;  1H8K A;  1WHH A;  1D1A A;  4X9D A;  1OX8 A;  4M75 B;  1VQL Q;  4A53 A;  1WHL A;  3CCQ Q;  2NUP A;  3NMZ C;  3INZ A;  4XTZ A;  1H3H A;  2C0I A;  4F7U B;  1OQK A;  2YLB A;  4J9I A;  5GAN 7;  3RDV A;  2V8J A;  2OTJ A;  2QA4 Q;  1QP2 A;  1ACM B;  3PMT A;  2YSQ A;  4MML A;  3CC2 A;  2LCL A;  2QYZ A;  1T3S A;  3E9F A;  2M1H A;  5IT9 E;  1VQ8 T;  2DX1 A;  3JCM h;  3OS5 A;  3TQ7 P;  2A36 A;  1TUC A;  3T9N A;  1KJW A;  2DMO A;  1W70 A;  4PK4 A;  3M0R A;  2HQX A;  2RN8 A;  3IQL A;  2E4H A;  3CMA T;  3O5Z A;  2YXY A;  5CQY A;  2COZ A;  5CKE A;  3CPW S; 
#chains in the Genus database with same CATH homology
 2O9V A;  2RPN A;  4Z8A A;  2L3Q A;  1RI9 A;  1ABO A;  1M3A A;  1U3O A;  2ABL A;  4AG2 C;  1WYX A;  2DRK A;  2LQN A;  2RQV A;  2DRM A;  1SSH A;  1Z9Z A;  2L3P A;  2KYM A;  3M0P A;  1PKT A;  4DEX A;  2AKL A;  2HCK A;  2KXD A;  3EHQ A;  4J9F A;  2OI3 A;  2A28 A;  3UAT A;  5HCK A;  1WX6 A;  1QCF A;  2MIO A;  2H8H A;  2J05 A;  2EKH A;  2LMJ A;  1I07 A;  3A98 A;  2DJQ A;  3CQT A;  2CRE A;  2GGR A;  2BZ8 A;  3VRY A;  2YUP A;  1VYU A;  2GNC A;  1U06 A;  1JEG A;  1UG1 A;  1U5S A;  1AD5 A;  2CH4 W;  4D8K A;  4Z89 A;  2JW4 A;  2SRC A;  1PKS A;  2KNB B;  1SPK A;  4RUG A;  2J6K A;  1JXM A;  2W0Z A;  3REB B;  2DBM A;  1RLQ C;  2HEQ A;  2W10 A;  1PNJ A;  4AFZ C;  3M0S A;  2JMC A;  1AEY A;  4LUD A;  2KBT A;  3U23 A;  1I0C A;  2DF6 A;  3UA7 A;  5EC7 A;  1AZE A;  2JXB A;  1BU1 A;  2JM9 A;  2VWF A;  2NWM A;  4LNP A;  1Y0M A;  2KE9 A;  3ULR B;  2MOX A;  2KXC A;  1AWX A;  2D8H A;  2EW3 A;  2L2P A;  4CC3 A;  1WI7 A;  1AOJ A;  2KGT A;  4AFU C;  1QKW A;  1NEG A;  1RLP C;  2D1X A;  2EYZ A;  5GJV B;  3THK A;  3VS0 A;  1YNZ A;  3SHW A;  2QDL A;  2EGA A;  2JMA A;  1UE9 A;  1QWF A;  4R0K A;  3VS4 A;  4IIM A;  1JQQ A;  4K11 A;  2D8J A;  2LJ3 A;  3NPF A;  1X69 A;  4J9D A;  3R6N A;  2PTK A;  3EG0 A;  1SEM A;  4OMQ A;  1G83 A;  4HVV A;  3PVL A;  2CT3 A;  1HSQ A;  2OJ2 A;  4E6R A;  2J06 A;  1UJY A;  3I35 A;  1M30 A;  1E6H A;  1YCS B;  2YDL A;  2FPD A;  2K6D A;  3VS6 A;  1YN8 A;  1WXT A;  5IXF A;  1QWE A;  1B3Q A;  1NM7 A;  4LE9 A;  1K4U S;  2FEI A;  1BB9 A;  3JV3 A;  3VS3 A;  5FW9 A;  4OML A;  2LX7 A;  2FRW A;  2K3B A;  2RF0 A;  4LUE A;  2NUZ A;  2BZY A;  4F14 A;  1HJD A;  1GFD A;  2ENM A;  1UEC A;  2RQT A;  2RNA A;  1HD3 A;  1M27 C;  1GCQ C;  2F2W A;  3VRZ A;  2GBQ A;  3H0H A;  3TSZ A;  4J9C A;  2FPF A;  4Z88 A;  4CC2 A;  1M8M A;  1NLO C;  1OEB A;  1K76 A;  3VS2 A;  2MCN A;  2V1R A;  1UJ0 A;  2LJ0 A;  4A63 B;  4JPB W;  2CUB A;  1UGV A;  4JZ3 A;  2LNH B;  2DA9 A;  3KFV A;  1ZUY A;  4X1V A;  1NEB A;  4AFQ C;  2LCS A;  2RMO A;  1CKA A;  4JJD A;  1JO8 A;  5L23 A;  2LZ6 B;  1UFF A;  4Y92 A;  2K2M A;  2FG0 A;  3H0F A;  5GJW B;  1UHC A;  3M0T A;  1FMK A;  5IHI A;  1UTI A;  2IIM A;  1G2B A;  1QKX A;  2KRM A;  1B07 A;  2DL7 A;  1X2Q A;  2C0O A;  1QLY A;  4J9G A;  4OMO A;  2BZX A;  1WFW A;  2JS2 A;  3M0Q A;  1E6G A;  2ROT A;  2YUQ A;  1K0S A;  1EFN A;  1UDL A;  2ED1 A;  2O31 A;  2YUO A;  2J6F A;  1J3T A;  4RTV A;  3M0U A;  1WXB A;  4RTT A;  3GBQ A;  2AKK A;  3RNJ A;  2OAW A;  2LQW A;  5I11 A;  1LCK A;  1M3B A;  1YWO A;  5FWB A;  1PRM C;  2VVK A;  3H0I A;  2E5K A;  5IHN A;  3REA B;  1UUE A;  4JZ4 A;  1ZBJ A;  4OMM A;  2JS0 A;  1GCP A;  1M3C A;  4JJB A;  2DYB A;  2EBP A;  1V1C A;  1W6X A;  1ABQ A;  1CKB A;  1OOT A;  1OV3 A;  4HXJ A;  1GL5 A;  1OPL A;  3ZL7 C;  2B86 A;  3NGP A;  2JM8 A;  1T3L A;  2P4R A;  1MV3 A;  3UF4 A;  2L0A A;  4AG1 C;  4AFS C;  1ARK A;  4LN2 A;  2AK5 A;  1AWO A;  1Z9Q A;  1VYV A;  2DL3 A;  5ECA A;  3PE0 A;  2DBK A;  1WA7 A;  3SEM A;  1GCQ A;  1TG0 A;  1WXU A;  2KEA A;  2M0Y A;  4HVW A;  3TSW A;  2PNI A;  4CC4 B;  4HVU A;  3EGU A;  2DL4 A;  3LH5 A;  1MUZ A;  4EIK A;  1AVZ C;  3H41 A;  1AZG B;  4RTZ A;  2DE0 X;  2CT4 A;  1SRM A;  1VYT A;  2J6O A;  4D8D A;  2FPE A;  2A37 A;  2J7I A;  2DNU A;  5IH2 A;  1X27 A;  4J9H A;  4OMN A;  5IXB A;  2DLP A;  2HBW A;  4F17 A;  2KYB A;  2F2X A;  2PZ1 A;  2ED0 A;  3I9Q A;  1GBQ A;  2V1Q A;  4M4Z A;  1NLP C;  1BK2 A;  2D0N A;  2RQW A;  4DEY A;  4OMP A;  2EYX A;  2RQU A;  2CDT A;  3I5S A;  2CSQ A;  4RTW A;  4ZNX A;  2G6F X;  1BBZ A;  1WDX A;  3EG2 A;  2KT8 A;  4IIO A;  1UHF A;  4QT7 A;  2XMF A;  4GBQ A;  2CSI A;  2SEM A;  2GTJ A;  3EHR A;  1X2K A;  3VS7 A;  2L3S A;  2KRS A;  4ORZ A;  2ECZ A;  1H92 A;  1XOV A;  3C0C A;  2BTT A;  1AWJ A;  1X6B A;  2LP5 A;  2KR3 A;  4FSS A;  2HDA A;  4HCK A;  1K9A A;  2KRO A;  2O88 A;  2HSP A;  1SHG A;  2CH4 A;  1AWW A;  2EGC A;  1Y57 A;  1ZLM A;  2AZS A;  1TUD A;  1JXO A;  2LJ1 A;  3EG1 A;  1SRL A;  4ESR A;  3TVT A;  3QWX X;  2C0T A;  2GTO A;  1WIE A;  2K9G A;  1MV0 B;  1JU5 C;  2RQR A;  1K1Z A;  3QWY A;  2X3W D;  2FRY A;  3NHN A;  4RTU A;  1PHT A;  1ZX6 A;  1PRL C;  1NYG A;  5FWC A;  1N5Z A;  4RTX A;  1RUW A;  1SHF A;  1KIK A;  2ROL A;  3PVQ A;  5I22 A;  4J9E A;  2O2O A;  2JTE A;  2EYW A;  2A08 A;  2EQI A;  1YP5 A;  2KRN A;  2K79 A;  3VS1 A;  5IHK A;  2KT1 A;  1KSW A;  1YWP A;  1GBR A;  1I1J A;  4JJC A;  2M51 A;  1KFZ A;  1W1F A;  2YUN A;  1NG2 A;  1A0N B;  1T0H A;  2AZV A;  4RTY A;  2EGE A;  2GQI A;  1T0J A;  1S1N A;  1NYF A;  2I0N A;  1CSK A;  1E7O A;  2EPD A;  1ZSG A;  1H8K A;  1IO6 A;  2K7A A;  2JT4 A;  1K0X A;  1PWT A;  2DVJ A;  2EYY A;  4GLM A;  1X43 A;  3NMZ C;  2F2V A;  1ZUU A;  4WCI A;  2DIL A;  1FYN A;  2YT6 A;  2C0I A;  1H3H A;  3VS5 A;  4CC7 A;  1WLP B;  2DL5 A;  4J9I A;  1GFC A;  4KRT A;  1GRI A;  2O9S A;  3RBB B;  2YSQ A;  2FO0 A;  3UA6 A;  2VKN A;  3I5R A;  4J9B A;  1T3S A;  1OPK A;  1X6G A;  2DX1 A;  2CUD A;  2ESW A;  2A36 A;  1TUC A;  1KJW A;  2DMO A;  1W70 A;  3M0R A;  2RN8 A;  3IQL A;  1VA7 A;  3FJ5 A;  2DL8 A;  3O5Z A;  1ZUK A;  4F16 A;  3EG3 A;  2DM1 A;  2EVR A;  2X3X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...