4Y92A

Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain e97t-q128r mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
MTFVALYDYESRTTTDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Protein-tyrosine kinase
publication title Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain E97T-Q128R mutant
rcsb
source organism Avian sarcoma virus pr2257/16
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4y92A00
1UE9A 1V1CA 2FG0A 3H0HA 4GLMA 1BBZA 2RQUA 2O2OA 2GTOA 4JJBA 2KXDA 3VS3A 1SHFA 1KJWA 1T0HA 2PNIA 1JQQA 1AWXA 1NG2A 2GNCA 1BK2A 1J3TA 4R0KA 1Y0MA 3M0QA 2HDAA 2LQWA 1PWTA 4CC4B 3I5SA 5HCKA 2LNHB 3EG1A 2L2PA 2EYYA 1YWPA 3SHWA 1WI7A 2DVJA 2RF0A 2ROLA 3H41A 2CSIA 2O88A 1E6GA 2F2VA 4J9CA 2YUOA 2PTKA 1GRIA 1FMKA 4Z88A 4AG2C 1VYUA 1X43A 2AZVA 5IHNA 1WX6A 2G6FX 3FJ5A 1T0JA 5GJWB 3PVLA 2LP5A 4CC7A 2GGRA 2JW4A 1K4US 1UDLA 2K79A 2JM9A 2KE9A 1ABQA 1SHGA 1MV0B 5IH2A 1MV3A 2HSPA 3ZL7C 4QT7A 3EG2A 1SEMA 1GBRA 1NEGA 2FRYA 1PKSA 1UHFA 2DJQA 2ED0A 1QCFA 2YUPA 4HXJA 1WIEA 4FSSA 1KFZA 4EIKA 5IXFA 1PNJA 2JMCA 2J6FA 1M3AA 1WXTA 1K1ZA 4ESRA 1I1JA 1YNZA 1JO8A 2AKLA 1UECA 4K11A 2DX1A 2KEAA 1AVZC 1JXMA 1UJ0A 3UATA 3TSZA 3NMZC 1BU1A 2DL7A 2ENMA 2YUQA 1YN8A 1QWFA 1VA7A 3EG0A 1XOVA 5EC7A 5GJVB 1IO6A 2GTJA 4HVVA 1EFNA 3M0TA 2VVKA 1SRMA 2O9VA 1SRLA 1M8MA 5FW9A 1A0NB 2K9GA 2KGTA 2DMOA 2JXBA 2L0AA 1NYFA 1PRLC 2MCNA 1W1FA 1Y57A 1GBQA 4OMLA 2KROA 4OMPA 3UA6A 3I5RA 3EG3A 3UA7A 2ED1A 2YT6A 2F2WA 2EPDA 2JMAA 1AOJA 3REAB 1G2BA 4D8KA 1UHCA 4J9FA 2CREA 2F2XA 3VS2A 1YWOA 2LMJA 4J9BA 2K7AA 3REBB 1VYVA 2ESWA 4AFUC 1VYTA 3M0PA 2DL4A 1B07A 2C0TA 3EGUA 2PZ1A 4ORZA 1RI9A 1RLQC 1E6HA 4J9HA 3NGPA 2HEQA 2AZSA 2FRWA 4LN2A 2DBKA 3ULRB 2LJ3A 4F16A 1ZBJA 2EQIA 4JJDA 3U23A 1X2KA 2LJ1A 2L3SA 3TSWA 4RTUA 3RBBB 2O31A 2DL3A 1UUEA 4OMOA 2K3BA 1H92A 1RUWA 2J7IA 1AZGB 3SEMA 3CQTA 1UTIA 2CSQA 4A63B 3PE0A 3EHRA 4RTZA 3JV3A 2DYBA 3A98A 1ZUUA 2BZYA 2L3PA 2DLPA 2L3QA 2EYWA 2KNBB 2SEMA 2JTEA 3UF4A 3GBQA 2A36A 3H0IA 2BZXA 2CUBA 1H8KA 1Z9ZA 2BTTA 3PVQA 5IHKA 2OI3A 2JS0A 2GQIA 2OJ2A 2CH4W 2W10A 1UFFA 1T3LA 1ZUYA 2AK5A 3VRYA 1OPLA 4JZ4A 1M27C 2A37A 3M0UA 1GFDA 2X3XD 1AD5A 2ECZA 1K9AA 1GCQA 2A08A 1QLYA 4DEYA 4D8DA 2RPNA 1ZSGA 2JM8A 2FPDA 1PHTA 2KYBA 2M51A 1UJYA 1GL5A 1TUCA 4OMNA 1NEBA 2KYMA 2ROTA 2EGAA 1X2QA 1WFWA 2B86A 1U3OA 4Z89A 4IIOA 5IXBA 4LNPA 4JPBW 1U5SA 2CH4A 2EBPA 1RLPC 2AKKA 2D8HA 4OMQA 4Z8AA 2FEIA 2CT4A 1W70A 1H3HA 2DILA 1OPKA 4HVUA 1UG1A 1FYNA 2RNAA 4F17A 1BB9A 4J9EA 4ZNXA 2JS2A 1LCKA 2SRCA 4CC2A 1ARKA 3M0SA 1WYXA 2EVRA 3RNJA 4RTWA 2M0YA 4AFQC 4LUDA 1AWJA 2O9SA 1ZLMA 1WXBA 1X69A 3EHQA 5ECAA 4F14A 2HBWA 2KBTA 5I11A 2KRSA 3M0RA 4CC3A 2RN8A 3I9QA 2MIOA 2RQTA 3LH5A 1AWOA 4WCIA 2CT3A 2X3WD 4LUEA 2E5KA 2DRMA 2YSQA 2VKNA 2I0NA 1K76A 2H8HA 2V1RA 3NHNA 2J06A 5FWCA 2HCKA 4RTVA 2LJ0A 2DA9A 1I07A 2A28A 2DM1A 5FWBA 4J9GA 2EGEA 1YCSB 3VS6A 3H0FA 1AWWA 2JT4A 2D8JA 1AEYA 3O5ZA 1NLOC 3QWXX 4X1VA 2FPEA 1K0SA 1NM7A 4LE9A 1NLPC 2K6DA 4RTTA 3QWYA 2EYZA 2C0OA 3TVTA 2CUDA 1WA7A 2KXCA 1QKWA 1WLPB 2VWFA 2FO0A 4RTXA 3VRZA 4RTYA 2EW3A 2V1QA 2DRKA 3IQLA 2LCSA 1E7OA 1HSQA 2BZ8A 3VS1A 1SSHA 4RUGA 2LQNA 2RMOA 1QWEA 1CKAA 1YP5A 2DL5A 5IHIA 2C0IA 1JU5C 1OEBA 1X6BA 2W0ZA 1ZX6A 2QDLA 4Y92A 1I0CA 2RQRA 2EKHA 2DF6A 2DNUA 1N5ZA 4OMMA 2EYXA 2CDTA 2KRNA 1CKBA 2D1XA 1ZUKA 1X6GA 1PKTA 2XMFA 1UGVA 1M30A 2GBQA 3C0CA 4JJCA 2EGCA 1B3QA 1OV3A 3NPFA 2IIMA 2NWMA 4DEXA 2DL8A 3KFVA 1WXUA 1Z9QA 1HJDA 3VS5A 3R6NA 2DE0X 2NUZA 4GBQA 1MUZA 1OOTA 4IIMA 1S1NA 1TG0A 2RQWA 3VS7A 1AZEA 4J9IA 3VS0A 1QKXA 4J9DA 4JZ3A 4M4ZA 2K2MA 2D0NA 2MOXA 4HVWA 3VS4A 1K0XA 1HD3A 1T3SA 2J6KA 4AFSC 2ABLA 4AG1C 2YUNA 1W6XA 2J05A 2J6OA 1X27A 4AFZC 5I22A 1JXOA 1SPKA 2RQVA 1NYGA 1WDXA 4HCKA 1KSWA 3I35A 1GCPA 1TUDA 2KRMA 2P4RA 1M3CA 2KT1A 2YDLA 1KIKA 4KRTA 1PRMC 1GCQC 2LX7A 1JEGA 2DBMA 1M3BA 2KR3A 3THKA 1CSKA 1GFCA 5L23A 2FPFA 2OAWA 4E6RA 2KT8A 1ABOA 1U06A 2LZ6B 1G83A
chains in the Genus database with same CATH superfamily
3JB9I 3EH1A 4DA4A 2RQUA 1VQLQ 5HK3A 1BKBA 5CCAA 5GAMj 4C92B 4JJBA 2RI5A 3NTHA 1BYMA 3OYKA 1NG2A 3GNFB 5CKFA 1BK2A 2MF2A 1Y0MA 2WSEE 3CCUT 4PFPA 2JTMA 2LQWA 2XDBA 3EG1A 1QMCA 1YWPA 3SHWA 5KE2A 3CCLT 2IPOB 4XAXB 2E10A 1E6GA 1W2BS 2GQVA 2QA4Q 4OP0A 3KXTA 1X43A 2AZVA 5IHNA 1D09B 2NUPA 1KHCA 2G6FX 3FJ5A 2QAZA 3BDUA 3V7CA 3PVLA 3EGDA 3M4YA 3QO3A 1QCNA 1K4US 1NPRA 2JM9A 3SWNB 1MV0B 3QYHB 3ZL7C 2KI7A 2E6NA 2PVGB 5CR2A 2QK0A 5FU6B 3CCEQ 2OTJQ 1OYXA 2DJZA 1Q7YR 3OW2P 2LX9A 2RH2A 2CKKA 1KFZA 5C6SA 1PNJA 3TU4K 1H3ZA 3OYDA 4B9XA 5LJ3g 2K5LA 5GAN3 1D3BA 4K11A 5CVIA 2X4WA 4BDYA 5GANf 1VOMA 2YUQA 3HRUA 1M5Q1 1QWFA 4DBRA 5GANe 3EG0A 1XOVA 2DIGA 4FL6A 1IO6A 4QQ6A 3LWIA 1M1KC 2ZPBB 4D6WA 4C0ZA 2JN0A 4M78A 1TS9A 1A0NB 2K9GA 1I8FA 3MJXA 1VQ8T 2YLCA 2OAUA 4C92A 2L8DA 1GBQA 4OMLA 2KROA 3ASKA 3MEWA 3A8HB 1VQ7A 2P4TA 3J80E 4M7DB 4MZPA 3REAB 3OW2A 5KYUA 1C0MA 3VS2A 2IVWA 1KC8U 3QJYA 2RJEA 3REBB 4MZTA 1P92A 2ESWA 4AFUC 1Q86U 4M7AC 3BW1A 1UGRB 3M0PA 3MP6A 3DLLA 2C0TA 4KBMB 1E6HA 1FWZA 4MMKA 4PL6A 3LGLA 5IT9E 1VQNQ 3CD6A 4M75A 3QYGB 2D9TA 5DM7R 3J81E 4BE2A 5GAN2 1ZBJA 4E7SA 1K73U 2EQIA 4XU1A 2HKQB 2LJ1A 3M56A 1Y96A 4XTWA 3JAME 1YHQA 3RBBB 1VQ6Q 1Q81C 2O31A 2DXTA 5LJ3d 3JCMg 1UUEA 1ZQ1A 2K3BA 4OMOA 3CQTA 3URGA 2QYZA 1YJNA 1UTIA 1WJRA 1VQPA 4XU3A 2RHIA 3GOXA 1PG5B 1OU9A 2DLPA 2KNBB 2P0QA 5FROA 3H0IA 3RDVA 2BZXA 1FMWA 4BE0A 2X4XA 1IREB 5LJ5h 1UFFA 1ZUYA 2H3JA 3CC7Q 1BI0A 4JZ4A 4LD6A 1M27C 2Z0WA 4MMLA 5CKEA 6AT1B 1K8AR 2X3XD 3EFSA 5IN1A 1GCQA 1QLYA 1D1AA 3G71Q 3OYNA 3HHTB 1M90C 2HD0A 2KYBA 5LJ5f 1GL5A 1NJIU 1WZOA 8ATCB 1RAAB 1U3OA 3EFRA 3OYFA 3CCJT 2PQWA 4C5HA 3OYGA 1N6AA 2AKKA 1N8RR 4OMQA 3GNGA 1SSFA 3HRTA 3QDRB 2A0FB 1W70A 4JUVA 3DB4A 1OPKA 1ZA1B 2LQKA 4FT4A 5GAOp 4HVUA 4J9EA 4L6V5 5AT1B 4M77C 4PJOB 3META 3CCMA 1JRIA 4RMOA 2M0YA 2RK2A 4KH1B 4AFQC 3MPUB 2FB7A 4A4KA 1AWJA 3RESA 1R8OB 1ZLMA 4F14A 2KBTA 2KRSA 4CC3A 1WQWA 2P0KA 2MIOA 7AT1B 2RQTA 5KYNA 1VUBA 2Y4YA 1AWOA 3JCMd 3HKSA 2DRMA 4DOVA 2VKNA 3GPLA 3RMQA 5GAMg 1G5VA 1MNEA 4LDYA 2HCKA 4RTVA 4IUQA 2DXBA 5CO7A 5FU7C 1YCSB 3VS6A 5A0LA 4M7AG 1Q7YU 1AEYA 2DIQA 3QWXX 4X1VA 3FIFA 4EMKB 1YITT 1W2BP 1NLPC 2K6DA 1BIBA 2X4YA 4O6JA 5DY9A 3CCUA 2KXCA 2HMAA 2VWFA 1LPLA 4BY6B 3VRZA 1TXQA 2EW3A 2DRKA 1NE8A 3QXEB 1HYOA 2DO3A 3CCLA 5CKBA 2BZ8A 2GF7A 3OYAA 3PT9A 1M1GA 4FCYA 2AT1B 3VJPA 1SF9A 1U8RA 2LVMA 1C1AA 3VUBA 2LQNA 2EQKA 4F04B 2E3HA 1CKAA 3VU3C 1ZHIA 2DL5A 5I21A 1JU5C 1LJOA 2K2VA 1ZX6A 1G3SA 1PD1A 4M7AF 2LQ8A 3Q1JA 4OMMA 2D1XA 1ZUKA 1X6GA 1PKTA 2XMFA 4PFOA 3V7RA 1M30A 3PIPA 2DXUA 5LJ3j 3NPFA 3BY7A 2IIMA 1JB0E 3CXCP 3KFVA 1YJWQ 5CK9A 1OX8A 2NYSA 2NLUA 2R5MA 1TU0B 2XI9A 3G4SA 1RAIB 2PUOB 3ZFJA 2LCCA 3VS7A 1AZEA 1W2BA 1QKXA 3EGXB 4J9DA 1C6VX 1VQ5A 1U1SA 4M4ZA 2K2MA 1YBYA 1HD3A 4BD3A 2J6KA 3V8LA 4AG1C 1VQMT 5GAMd 4KH0B 1JXOA 4A4EA 4FW2A 2RQVA 4M7AD 1WGSA 4HCKA 1KSWA 4J6XA 5KYXB 2KT1A 2XHCA 4J5YA 4A54A 3S6WA 3JCMW 1MGQA 1PRMC 2K3YA 3I55T 5FLXE 1N9SA 1M3BA 2KR3A 3EG9A 3THKA 1KQSP 4X9CA 4JDSA 2FL7A 2EKOA 5L23A 2FPFA 4M77G 2ZGWA 2XKOC 4PJNA 1ABOA 4A53A 2LZ6B 1VQ8A 1VQ7Q 5KYYA 4J8OA 1V1CA 2V26A 4GLMA 1Q81U 2O2OA 2KXDA 3CXCA 1KJWA 1JQQA 1WHJA 1AWXA 3CCRT 3DLMA 2GNCA 1YHQT 4LDUA 1XNIA 1J3TA 2HDAA 3OMCA 3JSCA 3I5SA 4FIBA 5D6WA 4M77F 3CD6Q 3FB9A 3OMGA 4MZMA 2DVJA 2XG8D 2EIFA 2JOYA 5GAN8 1VQPT 4N0AA 1GRIA 1FMKA 1K8AU 3H9NA 2EYQA 1H641 2QASA 4Z88A 1M8VA 1ZSZA 4JLIA 1T0JA 5GJWB 1EIFA 1KG1A 2HL3A 1Q86R 3QPHA 1M90U 2K79A 1YJNQ 1ABQA 5IH2A 1MV3A 2BIVA 4M7AE 2NUPB 4QT7A 1KQSA 2F5TX 1YI2T 2XD0A 1N8RU 2RJCA 1NEGA 2E65A 2WSCE 3OBWA 3CCST 2HKNA 1K73R 1YFNA 1QQJA 1QCFA 2YUPA 4HXJA 1WIEA 1TH7A 4PK4A 2J6FA 1M3AA 1WXTA 4AMCA 3LGFA 3EGXA 1BCMA 3LH0A 4M77D 2RI2A 2YXYA 1YNZA 1JO8A 1B34B 4PLIA 1M1FA 2GFUA 2HQHA 2KEAA 1MMNA 4L5GA 1JXMA 1UJ0A 4DBQA 2MI6A 3UATA 3NMZC 2COZA 1D3BB 3HTRA 3CCQA 4E47A 3J7AF 2ZPEB 2A7YA 2RA2A 1WHLA 2ZPGB 3M0TA 5KCOA 3CMET 3CCJA 2YHTA 2KDSA 4V2SA 2BKDN 1TUGB 1UB4A 5FW9A 1OU8A 1FX7A 1YCYA 2DMOA 2XICA 2L0AA 1PRLC 3CCMQ 1IHWA 1YIJT 5GAN4 2JTFA 1NJIR 3UA6A 4XK8E 4FYYB 2RHUA 2KQWA 2EPDA 4MDWA 1G2BA 1WHMA 2RD1A 1VQ4T 3OYMA 2K5FA 3A5ZB 3P8DA 1YWOA 2LMJA 3A1PA 1U1TA 4F7UG 2DPPB 1VYTA 2ZPHB 4C5EA 5KYUB 3HFOA 2PZ1A 2QQRA 4ORZA 1RI9A 1RLQC 4HT8A 3OYEA 3OQ5A 3VV0A 4M77E 2HNIA 3JRZA 2FRWA 2X35A 1JJ2P 2AHJB 5M9OA 2DBKA 4TVRA 3RKWA 3ULRB 4OGCA 3M4GA 2X51A 2QEXQ 3JCMV 3M53A 4EMHA 4PJMA 4BI8B 2E5QA 3FEOA 4JJDA 4DBFA 4M75B 1F1BB 3CCUQ 5DLQE 3V8JA 4F7UF 2LCLA 3JCMc 1YITA 4BE1A 1H92A 3CCLQ 3CBMA 9ATCB 5GMKl 4N4HA 1Y96B 3PNWC 1WPYA 2DYBA 2GFAA 3A98A 2Y4XA 4C8QG 1ZUUA 2BZYA 2L3PA 3QJ6A 4OB3B 2PVOB 4HCCA 1X6OA 4KUDK 5LJ3f 1K9MC 2A36A 4JS5A 2DVEA 3JB9J 1B34A 2HQEA 1RAEB 5LJ3e 5GANh 3G4ST 3TEEA 3CMAT 2OJ2A 5CKDA 3SWNC 5GAOn 3CXCS 4ME7A 3VRYA 1M2VA 4KGVB 4XTUA 3M0UA 1VQ5T 1GFDA 1S72T 1X01A 4DEYA 3PTAA 4RG8A 3PMIA 1ZSGA 2FPDA 1D0YA 3MP8A 1JJ2A 2F1LA 3MEAA 1WFWA 2QQ9A 2B86A 3MEUA 2DK3A 4YTLA 1U5SA 2COYA 2CT4A 2EJFA 3FRNA 2DILA 2DFUA 2YRDA 2RNAA 4F17A 1BB9A 1BI1A 3ZEHA 2QG9B 4CC2A 1ARKA 1VQMA 1UGSB 1KQSS 2O4XA 4Z02A 4RKUE 1O75A 2MWPA 3JB9G 1WXBA 3OS2A 3EH2A 1VIEA 3M0RA 3I55A 2RI3A 3SFMA 3QSUA 3QDFA 4GY5A 3LH5A 5HK0A 1VQ8Q 2CT3A 5CIUA 1QVFS 3AT1B 2K57A 2YSQA 2DTHA 2CP7A 2H8HA 5A2QE 2KAFA 3HPWA 1M9SA 4UC4A 1UGQB 3QBYA 2EQJA 3V7SA 1I07A 1LNXA 2A28A 3JCMf 4M7DC 2XU8A 5FWBA 2EGEA 4KUIA 4J6WA 4LDWA 3O5ZA 1NLOC 4C0DB 3VKIA 3CCRA 3JCMe 4LE9A 2VXFA 4RTTA 4FU6A 4M78G 3TVTA 1WA7A 1KQ1A 2FO0A 2V1QA 4F7UE 1Q81R 2QQSA 5GAN7 3BDLA 2LCSA 1B7TA 4C92G 1SSHA 3TREA 4RUGA 3GLXA 1QWEA 5GMKe 4FM4B 3PGGA 2W0ZA 1I0CA 3C12A 2DF6A 2EYXA 2E3IA 1MMDA 2CP3A 3CBOA 3C0CA 2EGCA 2LT4A 1YI2A 3L2WA 4ZGDB 2COWA 3CC2T 1OI1A 2M02A 4DEXA 3CCSA 1VQKT 4VUBA 3LWHA 3JCMP 3X26B 3CCQT 2KY9A 1WXUA 3M5AA 3R6NA 1M90R 3OSSC 2FZCB 2NUZA 5GAOm 4C5IA 2CP0A 2E1HA 4GBQA 2OTLT 2O01E 1RAFB 2CS7A 1S1NA 3LW5E 2MYSA 3CBPA 3LX7A 3VS0A 4A4GA 2YLBA 2E6ZA 2MOXA 2LTOA 3BFMA 1T3SA 3MP1A 3FLGA 2YUNA 1W6XA 2J6OA 4J6YA 5I22A 3P8HA 1VQOA 1D0XA 1NYGA 2RHZA 4M7AA 3KBGA 1NPPA 2P4RA 4KRTA 1RACB 2BE7D 2EAYA 2CP2A 3GIBA 3QZ5B 4ZGEB 2D0QB 1N9RA 3CMEA 2QTVA 3O8VA 5GAMf 2EQMA 3H6ZA 1N27A 2ZCFB 2OAWA 4IURA 2VYTA 3E1SA 5GAMe 2DEUA 1YIJA 3I56T 3EG9B 1BBZA 4PJOC 4N4GA 4E7IA 3C4SA 4ZGJB 4N4IA 1VQLA 2GTOA 4EPCA 3OYHA 1ZA2B 1LVKA 1T0HA 4IKFA 5KYYB 3AHUA 2VGNA 1VQ4A 1Q82C 5CQYA 2IG0A 4R0KA 3CPFA 3WXMB 3HFNA 5HCKA 1JJ2S 4HCBA 2LNHB 4PJJA 3X28B 2DETA 2L2PA 3H41A 2CSIA 1MNDA 4M7DG 2YUOA 2PTKA 3OYBA 5I2MA 1EZZB 1VYUA 1WNLA 3HRSA 1YITQ 2I2LA 2LP5A 2R5AA 4IUUA 5GAOq 2JW4A 3QUIA 5KE3A 2HL5C 1UDLA 1V29B 3RMSA 4EMKC 1SHGA 1TSFA 1PSFA 5AYFA 1GXIE 1ZSZB 1EX4A 3EG2A 1SEMA 1PKSA 1M1KU 2DJQA 4M7DF 2KVQG 2ED0A 1PCXA 2RB6A 2X4JA 4Y28E 3CCVT 2OTJA 4HA8A 2JMCA 2E4HA 1KHIA 1I1JA 4M77A 1FMVA 2DKGA 3WVEB 3CMAA 1WHHA 1UECA 3CC4T 1BI2A 1S72A 1NBEB 2M16A 1YJ9T 5IAYA 4C0FA 4FSXA 3TSZA 3N5BB 3OBYA 2C06A 2DL7A 1OX9A 5KH6A 1VA7A 5GJVB 2B8AA 3E9GA 5EC7A 4KULA 1AHJB 2GTJA 4HVVA 2DZCA 2RM4A 1G8XA 1IGUA 2PUKB 5D6YA 1EFNA 5GANj 3V8KA 1M8MA 1RABB 3LLRA 1O9SA 1NYFA 4M7DD 3RKXA 1VQMQ 2MCNA 3OS5A 1W1FA 1WHGA 4OMPA 3I5RA 3C94A 3UA7A 3E2UA 4E7JA 2ED1A 3R6OA 4WF2A 1QVFP 2D6FA 5A0DA 3I55Q 2VXEA 4D8KA 1UHCA 4J9FA 4ANJA 1XTDA 2KSSA 3GP8A 2CREA 2F2XA 1QW1A 4ATOA 4QVDA 1Q95G 4J9BA 2K7AA 2DZ9A 4QQDA 1VYVA 2HQXA 4R56A 4E2FB 1PM3A 2DL4A 1ZBXA 1B07A 3EGUA 1RADB 2QTXA 2HSEB 4PJOG 1M4ZA 4FW1A 4E7LA 4LN2A 5GAN6 3L2VA 3M57A 4KT0E 4II1A 3CCRQ 1X2KA 2JVVA 4C8QC 1YHQQ 2L3SA 3X25B 3TSWA 2E70A 4RTUA 2H3EB 2MMPA 2EFIA 5J3BA 4HCZA 1WQ7A 1KK7A 2J7IA 1AZGB 3MHXA 3SEMA 4A63B 1VQPQ 4PJOF 3EHRA 1R77A 4RTZA 3G6ET 1KC8C 3E19A 1Q86C 4LDVA 2NUTA 2L3QA 2EYWA 2L3RA 2JTEA 1RAGB 1RL2A 4BI4A 3GBQA 4DOWA 3OS1A 4M7DE 2CUBA 1H8KA 1QVFA 3ER0A 4PKCC 2JS0A 2CH4W 1T3LA 1QP3A 1QCOA 1K73C 2WSFE 1YI2Q 2A37A 3PFSA 3CCSQ 4D8DA 4ELZC 4FYXB 2JM8A 1TWBA 3ME9A 3CC2A 1VQOT 1M2VB 3WVDB 4NS5A 1VQKA 4OMNA 3RERA 1VQ9T 1X2QA 4F7UA 4Z89A 4IIOA 5IXBA 4LNPA 3OYCA 4JPBW 1D1BA 1G3TA 2CP5A 3S3NA 2EBPA 1RLPC 1IHVA 2XK0A 4PJOD 2FEIA 2PU9B 2OTLA 4JLGA 4PLLA 5LJ5j 1H3HA 1FYNA 2VV5A 2RHYA 2V8IA 5J26A 1Y07A 4ZNXA 2JS2A 4QVZA 1Q82U 3DB3A 1DJ7B 3VYHB 1KD1C 2RJDA 2EVRA 1WJQA 3RNJA 4RTWA 4R55A 1VQLT 1MMAA 3CMEQ 3INZA 1X69A 3EHQA 5ECAA 5DLOA 1NJIC 2RN8A 1R0BG 3I9QA 1PC0A 2O4XB 4WCIA 4LUEA 2E5KA 2MWOA 1OZ2A 2CZ7B 1YIJQ 3CPWP 4BB7A 2LRQA 1QVGP 4JS4A 3NHNA 4M78C 5FWCA 3JCMQ 3I56A 2DA9A 1D0ZA 2QEXT 1VQ4Q 2QA4T 4QVCA 1G3YA 2MK5A 2RK1A 2EJGA 2ZZDA 4J9GA 3H0FA 3M59A 4C92C 4FT2A 2JT4A 2D8JA 3UWNA 4XTVA 1K0SA 2CZ0B 2EYZA 3FJPA 5LJ3h 1OULA 4RTXA 4RTYA 4OGEA 2L5QA 3OY9A 2JUFA 1E7OA 5GMKi 1HSQA 1PSEA 4Q5WA 4JRPA 4XU2A 4PJOE 1KQ2A 3CCET 2OTJT 2RMOA 3NTIA 4XTXA 1YP5A 3JCMX 4ZTJA 1M2OA 2QQBA 1OEBA 1X6BA 3L42A 1I4K1 3KUFA 2DEQA 3L1AA 3BE3A 4M75C 1K9MR 1N5ZA 2KRNA 1CKBA 8AT1B 3TQ7P 5FRNA 2CYZB 2GBQA 1Q7YC 1B3QA 2FHDA 2RHXA 3CPWA 2DERA 3X20B 2DL8A 1QVGA 4C8QF 4NL3A 2BUDA 5FU6C 4HT9A 2P84A 5GAN5 3CCVA 1HJDA 1YJWA 2JZ2A 2RJFA 3G4SQ 3CMAQ 4EMGA 4EDUA 1OOTA 1TG0A 2RQWA 5L8RE 1BIAA 1VQ5Q 4IUVA 1S72Q 3SB2A 3P8BB 1M1KR 4X9DA 2D0NA 1K0XA 4HVWA 3CC4A 4OB2B 5FRMA 2ABLA 2J05A 2CZ1B 3OYIA 3MCAB 1YJ9A 1WDXA 4C0GA 3I35A 4ZN1A 2KRMA 4DBHA 2YDLA 5GANg 1KIKA 1GCQC 1UEBA 1JEGA 3S3OA 3LYIA 4OB1B 2DBMA 5HY6A 4M7AB 5KCHA 5A0GA 3JCMh 2HZYA 1U06A 4C8QD 2ZAEA 1G83A 1UE9A 1WHKA 2VASA 3S3MA 2R58A 2FG0A 1LOJA 4OF1A 3H0HA 5CKHA 3TCJA 1VQNT 2F69A 3FC3A 1X75C 2E12A 2P0PA 3VS3A 1SHFA 2PVDB 2PNIA 3OB9A 2LC4A 1IRXA 2CGHA 3GF5A 5C0MA 4HKEA 3JB9F 3MO8A 2ATCB 5GMKh 3M0QA 1PWTA 4CC4B 5D6XA 1VQ6T 4XU0A 3OA6A 3JB9H 2EYYA 1WI7A 1FXXA 3RIRA 2RF0A 2ROLA 4XQ3A 2VGMA 4JRQA 2VB6A 2O88A 4RG2A 2F2VA 4J9CA 2FYKA 2JNGA 3HSBA 3SWNA 4AG2C 3PIOA 2DXCA 3SDZA 1SG5A 1WX6A 3A8LB 3NFCA 4QKUA 4NOYA 4CC7A 2GGRA 2ZPIB 5LL6S 2KE9A 3SD4A 4C0DC 2HSPA 3CC7T 4M78F 3D7SB 2XDDA 1GBRA 1PD0A 2XIDA 2VUBA 2FRYA 3OSVA 3G6EA 1R0CB 1UHFA 3A8MB 3MEVA 4BACA 3G71T 4C92F 1UGPB 3M58A 3UT1A 1BCOA 3JB9D 4M75G 4FSSA 5HKCA 4EIKA 5IXFA 5GANd 4Y91A 1TTHB 4C8QE 2QGFB 1K1ZA 4ESRA 1KD1U 1K8AC 2K3XA 5EG2A 2DTOA 2AKLA 4FYWB 2V8JA 3EAEA 1I5OB 2DX1A 4J83A 2EQUA 3CC2Q 4M77B 1AVZC 3VUZA 1VQKQ 3F70A 1ACMB 3CCQQ 1BU1A 2ENMA 4A4HA 5GAMh 1YN8A 2DTIA 4M75F 5LJ5e 1N8RC 1VQ9A 2AIRB 2WACA 5J39A 3CCJQ 2OTLQ 2DAQA 5LJ5g 4M78D 2VVKA 1SRMA 2O9VA 1SRLA 3OYJA 2KGTA 4X34A 4JRKA 2JXBA 4OVAA 5D7UA 4ZN3A 4M7DA 4C92D 1BI3A 1Y57A 2E64A 3EG3A 4DQ2A 2YT6A 1AT1B 2F2WA 2JMAA 4OB0B 1D1CA 5FU7B 1AOJA 4BI3A 2DYIA 3JCMJ 2QQAA 3CPWS 2L89A 3HP9A 1HK9A 1QVGS 3QIIA 4LXCA 1Q82R 3RUXA 2FZGB 4KGXB 4MDXA 1K9MU 1RI0A 3I56Q 3OS0A 2CP6A 2HAXA 4M75D 4WTOB 4J9HA 3NGPA 2HEQA 2AZSA 2CZ6B 1Y7XA 2LJ3A 4AT1B 4F16A 3C95A 2QEXA 2ZPFB 2YWWA 2QA4A 5GMKm 3U23A 2LT1A 4RCCA 2BE9B 2VC8A 2DL3A 3EFOB 1RUWA 2CSQA 4LDXA 3UDCA 3PE0A 3DKMA 5CQXA 3JV3A 4BY6C 3OYYA 1IB8A 4M78E 2SEMA 2DD4A 3UF4A 1QVPA 4BUGA 3CCEA 1YJWT 4C92E 1Z9ZA 2BTTA 3PVQA 5IHKA 2OI3A 5LJ5d 2NUTB 2GQIA 4N0AC 2W10A 2EJ9A 2AK5A 3OW2S 3NTKA 4JRIA 1OPLA 1AD5A 1ZSZC 2ECZA 4KGZB 4B6MA 1K9AA 2A08A 2K5IA 3X24B 3L2ZA 2RPNA 1PHTA 3E9FA 4OMFB 3CCVQ 2M51A 1UJYA 4IUTA 1JBMA 3FDRA 1TUCA 2E41A 1IZ6A 2YRVA 1NEBA 1XJWB 2KYMA 2ROTA 4E7ZA 2EGAA 3QHSA 1SKUB 4O5VA 3M55A 4RCBA 2CH4A 4XTYA 4M75E 4XTZA 2D8HA 4Z8AA 3ZBDA 5KYWB 4PJOA 3CC4Q 1HXDA 2LNVA 4F7UB 1MHNA 1UG1A 1YJ9Q 2M0OA 4PNOA 4IUPA 1LCKA 2SRCA 1VQ7T 3M0SA 1I5LA 1WYXA 4LUDA 2O9SA 1G3WA 3G7ZA 2HBWA 2QXFA 5I11A 3HL8A 1Y71A 4PJLA 2XDPA 5GAOr 2X3WD 3CD6T 2Y90A 2I0NA 1K76A 3MKDA 4BDZA 2V1RA 2FZKB 2K4YA 2J06A 3QKJA 4EMKA 2LJ0A 1VQNA 4C8QB 4A4FA 2DM1A 1QP2A 3EFOA 1AWWA 1NZ9A 2LDMA 2FPEA 1NM7A 3VYGA 3QWYA 1YJNT 2C0OA 2M9UA 2CUDA 4CRIA 1QKWA 1WLPB 5CAIA 1VQ6A 4J7FA 4PFZA 3L2RA 2YRCA 3IQLA 4E7HA 4LD9K 3RR6A 3L2QA 3VS1A 3A8GB 4P5NA 4FYVB 1KC8R 3G1JA 3UPUA 4ZTFA 2HBPA 2JJ9A 3QZ9B 5IHIA 2C0IA 2A3LA 2QI2A 2QDLA 4Y92A 2RO0A 2RQRA 2EKHA 4ELYC 2DNUA 1RAHB 2CDTA 5GMKj 2QGGA 3H8ZA 2QDYB 3M9QA 4B9WA 3QG1A 3RKYA 4C5GA 1OQKA 3G6EQ 3EGDB 1UGVA 3CC7A 4JJCA 1OV3A 2FVUA 2NWMA 2OX7A 4L59A 1IXDA 2MAMA 4QQGA 4NL2A 3G71A 1VIFA 5I2SA 2KMTA 1Z9QA 5KYWA 3VS5A 2DE0X 1I81A 1WJSA 1MUZA 1TOVA 1IGQA 3CEYA 2F5KA 4IIMA 4E7KA 3A8OB 4J9IA 4JZ3A 3VS4A 3T9NA 5KYXA 2R57A 4GLKA 4AFSC 5GAOl 3M54A 3OYLA 3CCMT 1VQOQ 1V76A 1X27A 3PMTA 4AFZC 2GCXA 2EWNA 1SPKA 2G3RA 1VQ9Q 1XQHA 2X9HA 1MMGA 1GCPA 1TUDA 4J7IA 1M3CA 2DD5A 1KD1R 2V8KA 1W4SA 2LX7A 4CI0C 2MPXC 4JJNK 1CSKA 4QW2A 3L2UA 3JCMb 1GFCA 2M1HA 1OZ3A 4E6RA 2KT8A 4M78B 4C8QA 2KK4A
chains in the Genus database with same CATH topology
1UE9A 1V1CA 2FG0A 3H0HA 4GLMA 1BBZA 2RQUA 2O2OA 2GTOA 4JJBA 2KXDA 3VS3A 1SHFA 1KJWA 1T0HA 2PNIA 1JQQA 1AWXA 1NG2A 2GNCA 1BK2A 1J3TA 4R0KA 1Y0MA 3M0QA 2HDAA 2LQWA 1PWTA 4CC4B 3I5SA 5HCKA 2LNHB 3EG1A 2L2PA 2EYYA 1YWPA 3SHWA 1WI7A 2DVJA 2RF0A 2ROLA 3H41A 2CSIA 2O88A 1E6GA 2F2VA 4J9CA 2YUOA 2PTKA 1GRIA 1FMKA 4Z88A 4AG2C 1VYUA 1X43A 2AZVA 5IHNA 1WX6A 2G6FX 3FJ5A 1T0JA 5GJWB 3PVLA 2LP5A 4CC7A 2GGRA 2JW4A 1K4US 1UDLA 2K79A 2JM9A 2KE9A 1ABQA 1SHGA 1MV0B 5IH2A 1MV3A 2HSPA 3ZL7C 4QT7A 3EG2A 1SEMA 1GBRA 1NEGA 2FRYA 1PKSA 1UHFA 2DJQA 2ED0A 1QCFA 2YUPA 4HXJA 1WIEA 4FSSA 1KFZA 4EIKA 5IXFA 1PNJA 2JMCA 2J6FA 1M3AA 1WXTA 1K1ZA 4ESRA 1I1JA 1YNZA 1JO8A 2AKLA 1UECA 4K11A 2DX1A 2KEAA 1AVZC 1JXMA 1UJ0A 3UATA 3TSZA 3NMZC 1BU1A 2DL7A 2ENMA 2YUQA 1YN8A 1QWFA 1VA7A 3EG0A 1XOVA 5EC7A 5GJVB 1IO6A 2GTJA 4HVVA 1EFNA 3M0TA 2VVKA 1SRMA 2O9VA 1SRLA 1M8MA 5FW9A 1A0NB 2K9GA 2KGTA 2DMOA 2JXBA 2L0AA 1NYFA 1PRLC 2MCNA 1W1FA 1Y57A 1GBQA 4OMLA 2KROA 4OMPA 3UA6A 3I5RA 3EG3A 3UA7A 2ED1A 2YT6A 2F2WA 2EPDA 2JMAA 1AOJA 3REAB 1G2BA 4D8KA 1UHCA 4J9FA 2CREA 2F2XA 3VS2A 1YWOA 2LMJA 4J9BA 2K7AA 3REBB 1VYVA 2ESWA 4AFUC 1VYTA 3M0PA 2DL4A 1B07A 2C0TA 3EGUA 2PZ1A 4ORZA 1RI9A 1RLQC 1E6HA 4J9HA 3NGPA 2HEQA 2AZSA 2FRWA 4LN2A 2DBKA 3ULRB 2LJ3A 4F16A 1ZBJA 2EQIA 4JJDA 3U23A 1X2KA 2LJ1A 2L3SA 3TSWA 4RTUA 3RBBB 2O31A 2DL3A 1UUEA 4OMOA 2K3BA 1H92A 1RUWA 2J7IA 1AZGB 3SEMA 3CQTA 1UTIA 2CSQA 4A63B 3PE0A 3EHRA 4RTZA 3JV3A 2DYBA 3A98A 1ZUUA 2BZYA 2L3PA 2DLPA 2L3QA 2EYWA 2KNBB 2SEMA 2JTEA 3UF4A 3GBQA 2A36A 3H0IA 2BZXA 2CUBA 1H8KA 1Z9ZA 2BTTA 3PVQA 5IHKA 2OI3A 2JS0A 2GQIA 2OJ2A 2CH4W 2W10A 1UFFA 1T3LA 1ZUYA 2AK5A 3VRYA 1OPLA 4JZ4A 1M27C 2A37A 3M0UA 1GFDA 2X3XD 1AD5A 2ECZA 1K9AA 1GCQA 2A08A 1QLYA 4DEYA 4D8DA 2RPNA 1ZSGA 2JM8A 2FPDA 1PHTA 2KYBA 2M51A 1UJYA 1GL5A 1TUCA 4OMNA 1NEBA 2KYMA 2ROTA 2EGAA 1X2QA 1WFWA 2B86A 1U3OA 4Z89A 4IIOA 5IXBA 4LNPA 4JPBW 1U5SA 2CH4A 2EBPA 1RLPC 2AKKA 2D8HA 4OMQA 4Z8AA 2FEIA 2CT4A 1W70A 1H3HA 2DILA 1OPKA 4HVUA 1UG1A 1FYNA 2RNAA 4F17A 1BB9A 4J9EA 4ZNXA 2JS2A 1LCKA 2SRCA 4CC2A 1ARKA 3M0SA 1WYXA 2EVRA 3RNJA 4RTWA 2M0YA 4AFQC 4LUDA 1AWJA 2O9SA 1ZLMA 1WXBA 1X69A 3EHQA 5ECAA 4F14A 2HBWA 2KBTA 5I11A 2KRSA 3M0RA 4CC3A 2RN8A 3I9QA 2MIOA 2RQTA 3LH5A 1AWOA 4WCIA 2CT3A 2X3WD 4LUEA 2E5KA 2DRMA 2YSQA 2VKNA 2I0NA 1K76A 2H8HA 2V1RA 3NHNA 2J06A 5FWCA 2HCKA 4RTVA 2LJ0A 2DA9A 1I07A 2A28A 2DM1A 5FWBA 4J9GA 2EGEA 1YCSB 3VS6A 3H0FA 1AWWA 2JT4A 2D8JA 1AEYA 3O5ZA 1NLOC 3QWXX 4X1VA 2FPEA 1K0SA 1NM7A 4LE9A 1NLPC 2K6DA 4RTTA 3QWYA 2EYZA 2C0OA 3TVTA 2CUDA 1WA7A 2KXCA 1QKWA 1WLPB 2VWFA 2FO0A 4RTXA 3VRZA 4RTYA 2EW3A 2V1QA 2DRKA 3IQLA 2LCSA 1E7OA 1HSQA 2BZ8A 3VS1A 1SSHA 4RUGA 2LQNA 2RMOA 1QWEA 1CKAA 1YP5A 2DL5A 5IHIA 2C0IA 1JU5C 1OEBA 1X6BA 2W0ZA 1ZX6A 2QDLA 4Y92A 1I0CA 2RQRA 2EKHA 2DF6A 2DNUA 1N5ZA 4OMMA 2EYXA 2CDTA 2KRNA 1CKBA 2D1XA 1ZUKA 1X6GA 1PKTA 2XMFA 1UGVA 1M30A 2GBQA 3C0CA 4JJCA 2EGCA 1B3QA 1OV3A 3NPFA 2IIMA 2NWMA 4DEXA 2DL8A 3KFVA 1WXUA 1Z9QA 1HJDA 3VS5A 3R6NA 2DE0X 2NUZA 4GBQA 1MUZA 1OOTA 4IIMA 1S1NA 1TG0A 2RQWA 3VS7A 1AZEA 4J9IA 3VS0A 1QKXA 4J9DA 4JZ3A 4M4ZA 2K2MA 2D0NA 2MOXA 4HVWA 3VS4A 1K0XA 1HD3A 1T3SA 2J6KA 4AFSC 2ABLA 4AG1C 2YUNA 1W6XA 2J05A 2J6OA 1X27A 4AFZC 5I22A 1JXOA 1SPKA 2RQVA 1NYGA 1WDXA 4HCKA 1KSWA 3I35A 1GCPA 1TUDA 2KRMA 2P4RA 1M3CA 2KT1A 2YDLA 1KIKA 4KRTA 1PRMC 1GCQC 2LX7A 1JEGA 2DBMA 1M3BA 2KR3A 3THKA 1CSKA 1GFCA 5L23A 2FPFA 2OAWA 4E6RA 2KT8A 1ABOA 1U06A 2LZ6B 1G83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UE9 A;  1V1C A;  2FG0 A;  3H0H A;  4GLM A;  1BBZ A;  2RQU A;  2O2O A;  2GTO A;  4JJB A;  2KXD A;  3VS3 A;  1SHF A;  1KJW A;  1T0H A;  2PNI A;  1JQQ A;  1AWX A;  1NG2 A;  2GNC A;  1BK2 A;  1J3T A;  4R0K A;  1Y0M A;  3M0Q A;  2HDA A;  2LQW A;  1PWT A;  4CC4 B;  3I5S A;  5HCK A;  2LNH B;  3EG1 A;  2L2P A;  2EYY A;  1YWP A;  3SHW A;  1WI7 A;  2DVJ A;  2RF0 A;  2ROL A;  3H41 A;  2CSI A;  2O88 A;  1E6G A;  2F2V A;  4J9C A;  2YUO A;  2PTK A;  1GRI A;  1FMK A;  4Z88 A;  4AG2 C;  1VYU A;  1X43 A;  2AZV A;  5IHN A;  1WX6 A;  2G6F X;  3FJ5 A;  1T0J A;  5GJW B;  3PVL A;  2LP5 A;  4CC7 A;  2GGR A;  2JW4 A;  1K4U S;  1UDL A;  2K79 A;  2JM9 A;  2KE9 A;  1ABQ A;  1SHG A;  1MV0 B;  5IH2 A;  1MV3 A;  2HSP A;  3ZL7 C;  4QT7 A;  3EG2 A;  1SEM A;  1GBR A;  1NEG A;  2FRY A;  1PKS A;  1UHF A;  2DJQ A;  2ED0 A;  1QCF A;  2YUP A;  4HXJ A;  1WIE A;  4FSS A;  1KFZ A;  4EIK A;  5IXF A;  1PNJ A;  2JMC A;  2J6F A;  1M3A A;  1WXT A;  1K1Z A;  4ESR A;  1I1J A;  1YNZ A;  1JO8 A;  2AKL A;  1UEC A;  4K11 A;  2DX1 A;  2KEA A;  1AVZ C;  1JXM A;  1UJ0 A;  3UAT A;  3TSZ A;  3NMZ C;  1BU1 A;  2DL7 A;  2ENM A;  2YUQ A;  1YN8 A;  1QWF A;  1VA7 A;  3EG0 A;  1XOV A;  5EC7 A;  5GJV B;  1IO6 A;  2GTJ A;  4HVV A;  1EFN A;  3M0T A;  2VVK A;  1SRM A;  2O9V A;  1SRL A;  1M8M A;  5FW9 A;  1A0N B;  2K9G A;  2KGT A;  2DMO A;  2JXB A;  2L0A A;  1NYF A;  1PRL C;  2MCN A;  1W1F A;  1Y57 A;  1GBQ A;  4OML A;  2KRO A;  4OMP A;  3UA6 A;  3I5R A;  3EG3 A;  3UA7 A;  2ED1 A;  2YT6 A;  2F2W A;  2EPD A;  2JMA A;  1AOJ A;  3REA B;  1G2B A;  4D8K A;  1UHC A;  4J9F A;  2CRE A;  2F2X A;  3VS2 A;  1YWO A;  2LMJ A;  4J9B A;  2K7A A;  3REB B;  1VYV A;  2ESW A;  4AFU C;  1VYT A;  3M0P A;  2DL4 A;  1B07 A;  2C0T A;  3EGU A;  2PZ1 A;  4ORZ A;  1RI9 A;  1RLQ C;  1E6H A;  4J9H A;  3NGP A;  2HEQ A;  2AZS A;  2FRW A;  4LN2 A;  2DBK A;  3ULR B;  2LJ3 A;  4F16 A;  1ZBJ A;  2EQI A;  4JJD A;  3U23 A;  1X2K A;  2LJ1 A;  2L3S A;  3TSW A;  4RTU A;  3RBB B;  2O31 A;  2DL3 A;  1UUE A;  4OMO A;  2K3B A;  1H92 A;  1RUW A;  2J7I A;  1AZG B;  3SEM A;  3CQT A;  1UTI A;  2CSQ A;  4A63 B;  3PE0 A;  3EHR A;  4RTZ A;  3JV3 A;  2DYB A;  3A98 A;  1ZUU A;  2BZY A;  2L3P A;  2DLP A;  2L3Q A;  2EYW A;  2KNB B;  2SEM A;  2JTE A;  3UF4 A;  3GBQ A;  2A36 A;  3H0I A;  2BZX A;  2CUB A;  1H8K A;  1Z9Z A;  2BTT A;  3PVQ A;  5IHK A;  2OI3 A;  2JS0 A;  2GQI A;  2OJ2 A;  2CH4 W;  2W10 A;  1UFF A;  1T3L A;  1ZUY A;  2AK5 A;  3VRY A;  1OPL A;  4JZ4 A;  1M27 C;  2A37 A;  3M0U A;  1GFD A;  2X3X D;  1AD5 A;  2ECZ A;  1K9A A;  1GCQ A;  2A08 A;  1QLY A;  4DEY A;  4D8D A;  2RPN A;  1ZSG A;  2JM8 A;  2FPD A;  1PHT A;  2KYB A;  2M51 A;  1UJY A;  1GL5 A;  1TUC A;  4OMN A;  1NEB A;  2KYM A;  2ROT A;  2EGA A;  1X2Q A;  1WFW A;  2B86 A;  1U3O A;  4Z89 A;  4IIO A;  5IXB A;  4LNP A;  4JPB W;  1U5S A;  2CH4 A;  2EBP A;  1RLP C;  2AKK A;  2D8H A;  4OMQ A;  4Z8A A;  2FEI A;  2CT4 A;  1W70 A;  1H3H A;  2DIL A;  1OPK A;  4HVU A;  1UG1 A;  1FYN A;  2RNA A;  4F17 A;  1BB9 A;  4J9E A;  4ZNX A;  2JS2 A;  1LCK A;  2SRC A;  4CC2 A;  1ARK A;  3M0S A;  1WYX A;  2EVR A;  3RNJ A;  4RTW A;  2M0Y A;  4AFQ C;  4LUD A;  1AWJ A;  2O9S A;  1ZLM A;  1WXB A;  1X69 A;  3EHQ A;  5ECA A;  4F14 A;  2HBW A;  2KBT A;  5I11 A;  2KRS A;  3M0R A;  4CC3 A;  2RN8 A;  3I9Q A;  2MIO A;  2RQT A;  3LH5 A;  1AWO A;  4WCI A;  2CT3 A;  2X3W D;  4LUE A;  2E5K A;  2DRM A;  2YSQ A;  2VKN A;  2I0N A;  1K76 A;  2H8H A;  2V1R A;  3NHN A;  2J06 A;  5FWC A;  2HCK A;  4RTV A;  2LJ0 A;  2DA9 A;  1I07 A;  2A28 A;  2DM1 A;  5FWB A;  4J9G A;  2EGE A;  1YCS B;  3VS6 A;  3H0F A;  1AWW A;  2JT4 A;  2D8J A;  1AEY A;  3O5Z A;  1NLO C;  3QWX X;  4X1V A;  2FPE A;  1K0S A;  1NM7 A;  4LE9 A;  1NLP C;  2K6D A;  4RTT A;  3QWY A;  2EYZ A;  2C0O A;  3TVT A;  2CUD A;  1WA7 A;  2KXC A;  1QKW A;  1WLP B;  2VWF A;  2FO0 A;  4RTX A;  3VRZ A;  4RTY A;  2EW3 A;  2V1Q A;  2DRK A;  3IQL A;  2LCS A;  1E7O A;  1HSQ A;  2BZ8 A;  3VS1 A;  1SSH A;  4RUG A;  2LQN A;  2RMO A;  1QWE A;  1CKA A;  1YP5 A;  2DL5 A;  5IHI A;  2C0I A;  1JU5 C;  1OEB A;  1X6B A;  2W0Z A;  1ZX6 A;  2QDL A;  4Y92 A;  1I0C A;  2RQR A;  2EKH A;  2DF6 A;  2DNU A;  1N5Z A;  4OMM A;  2EYX A;  2CDT A;  2KRN A;  1CKB A;  2D1X A;  1ZUK A;  1X6G A;  1PKT A;  2XMF A;  1UGV A;  1M30 A;  2GBQ A;  3C0C A;  4JJC A;  2EGC A;  1B3Q A;  1OV3 A;  3NPF A;  2IIM A;  2NWM A;  4DEX A;  2DL8 A;  3KFV A;  1WXU A;  1Z9Q A;  1HJD A;  3VS5 A;  3R6N A;  2DE0 X;  2NUZ A;  4GBQ A;  1MUZ A;  1OOT A;  4IIM A;  1S1N A;  1TG0 A;  2RQW A;  3VS7 A;  1AZE A;  4J9I A;  3VS0 A;  1QKX A;  4J9D A;  4JZ3 A;  4M4Z A;  2K2M A;  2D0N A;  2MOX A;  4HVW A;  3VS4 A;  1K0X A;  1HD3 A;  1T3S A;  2J6K A;  4AFS C;  2ABL A;  4AG1 C;  2YUN A;  1W6X A;  2J05 A;  2J6O A;  1X27 A;  4AFZ C;  5I22 A;  1JXO A;  1SPK A;  2RQV A;  1NYG A;  1WDX A;  4HCK A;  1KSW A;  3I35 A;  1GCP A;  1TUD A;  2KRM A;  2P4R A;  1M3C A;  2KT1 A;  2YDL A;  1KIK A;  4KRT A;  1PRM C;  1GCQ C;  2LX7 A;  1JEG A;  2DBM A;  1M3B A;  2KR3 A;  3THK A;  1CSK A;  1GFC A;  5L23 A;  2FPF A;  2OAW A;  4E6R A;  2KT8 A;  1ABO A;  1U06 A;  2LZ6 B;  1G83 A; 
#chains in the Genus database with same CATH topology
 3JB9 I;  3EH1 A;  4DA4 A;  2RQU A;  1VQL Q;  5HK3 A;  1BKB A;  5CCA A;  5GAM j;  4C92 B;  4JJB A;  2RI5 A;  3NTH A;  1BYM A;  3OYK A;  1NG2 A;  3GNF B;  5CKF A;  1BK2 A;  2MF2 A;  1Y0M A;  2WSE E;  3CCU T;  4PFP A;  2JTM A;  2LQW A;  2XDB A;  3EG1 A;  1QMC A;  1YWP A;  3SHW A;  5KE2 A;  3CCL T;  2IPO B;  4XAX B;  2E10 A;  1E6G A;  1W2B S;  2GQV A;  2QA4 Q;  4OP0 A;  3KXT A;  1X43 A;  2AZV A;  5IHN A;  1D09 B;  2NUP A;  1KHC A;  2G6F X;  3FJ5 A;  2QAZ A;  3BDU A;  3V7C A;  3PVL A;  3EGD A;  3M4Y A;  3QO3 A;  1QCN A;  1K4U S;  1NPR A;  2JM9 A;  3SWN B;  1MV0 B;  3QYH B;  3ZL7 C;  2KI7 A;  2E6N A;  2PVG B;  5CR2 A;  2QK0 A;  5FU6 B;  3CCE Q;  2OTJ Q;  1OYX A;  2DJZ A;  1Q7Y R;  3OW2 P;  2LX9 A;  2RH2 A;  2CKK A;  1KFZ A;  5C6S A;  1PNJ A;  3TU4 K;  1H3Z A;  3OYD A;  4B9X A;  5LJ3 g;  2K5L A;  5GAN 3;  1D3B A;  4K11 A;  5CVI A;  2X4W A;  4BDY A;  5GAN f;  1VOM A;  2YUQ A;  3HRU A;  1M5Q 1;  1QWF A;  4DBR A;  5GAN e;  3EG0 A;  1XOV A;  2DIG A;  4FL6 A;  1IO6 A;  4QQ6 A;  3LWI A;  1M1K C;  2ZPB B;  4D6W A;  4C0Z A;  2JN0 A;  4M78 A;  1TS9 A;  1A0N B;  2K9G A;  1I8F A;  3MJX A;  1VQ8 T;  2YLC A;  2OAU A;  4C92 A;  2L8D A;  1GBQ A;  4OML A;  2KRO A;  3ASK A;  3MEW A;  3A8H B;  1VQ7 A;  2P4T A;  3J80 E;  4M7D B;  4MZP A;  3REA B;  3OW2 A;  5KYU A;  1C0M A;  3VS2 A;  2IVW A;  1KC8 U;  3QJY A;  2RJE A;  3REB B;  4MZT A;  1P92 A;  2ESW A;  4AFU C;  1Q86 U;  4M7A C;  3BW1 A;  1UGR B;  3M0P A;  3MP6 A;  3DLL A;  2C0T A;  4KBM B;  1E6H A;  1FWZ A;  4MMK A;  4PL6 A;  3LGL A;  5IT9 E;  1VQN Q;  3CD6 A;  4M75 A;  3QYG B;  2D9T A;  5DM7 R;  3J81 E;  4BE2 A;  5GAN 2;  1ZBJ A;  4E7S A;  1K73 U;  2EQI A;  4XU1 A;  2HKQ B;  2LJ1 A;  3M56 A;  1Y96 A;  4XTW A;  3JAM E;  1YHQ A;  3RBB B;  1VQ6 Q;  1Q81 C;  2O31 A;  2DXT A;  5LJ3 d;  3JCM g;  1UUE A;  1ZQ1 A;  2K3B A;  4OMO A;  3CQT A;  3URG A;  2QYZ A;  1YJN A;  1UTI A;  1WJR A;  1VQP A;  4XU3 A;  2RHI A;  3GOX A;  1PG5 B;  1OU9 A;  2DLP A;  2KNB B;  2P0Q A;  5FRO A;  3H0I A;  3RDV A;  2BZX A;  1FMW A;  4BE0 A;  2X4X A;  1IRE B;  5LJ5 h;  1UFF A;  1ZUY A;  2H3J A;  3CC7 Q;  1BI0 A;  4JZ4 A;  4LD6 A;  1M27 C;  2Z0W A;  4MML A;  5CKE A;  6AT1 B;  1K8A R;  2X3X D;  3EFS A;  5IN1 A;  1GCQ A;  1QLY A;  1D1A A;  3G71 Q;  3OYN A;  3HHT B;  1M90 C;  2HD0 A;  2KYB A;  5LJ5 f;  1GL5 A;  1NJI U;  1WZO A;  8ATC B;  1RAA B;  1U3O A;  3EFR A;  3OYF A;  3CCJ T;  2PQW A;  4C5H A;  3OYG A;  1N6A A;  2AKK A;  1N8R R;  4OMQ A;  3GNG A;  1SSF A;  3HRT A;  3QDR B;  2A0F B;  1W70 A;  4JUV A;  3DB4 A;  1OPK A;  1ZA1 B;  2LQK A;  4FT4 A;  5GAO p;  4HVU A;  4J9E A;  4L6V 5;  5AT1 B;  4M77 C;  4PJO B;  3MET A;  3CCM A;  1JRI A;  4RMO A;  2M0Y A;  2RK2 A;  4KH1 B;  4AFQ C;  3MPU B;  2FB7 A;  4A4K A;  1AWJ A;  3RES A;  1R8O B;  1ZLM A;  4F14 A;  2KBT A;  2KRS A;  4CC3 A;  1WQW A;  2P0K A;  2MIO A;  7AT1 B;  2RQT A;  5KYN A;  1VUB A;  2Y4Y A;  1AWO A;  3JCM d;  3HKS A;  2DRM A;  4DOV A;  2VKN A;  3GPL A;  3RMQ A;  5GAM g;  1G5V A;  1MNE A;  4LDY A;  2HCK A;  4RTV A;  4IUQ A;  2DXB A;  5CO7 A;  5FU7 C;  1YCS B;  3VS6 A;  5A0L A;  4M7A G;  1Q7Y U;  1AEY A;  2DIQ A;  3QWX X;  4X1V A;  3FIF A;  4EMK B;  1YIT T;  1W2B P;  1NLP C;  2K6D A;  1BIB A;  2X4Y A;  4O6J A;  5DY9 A;  3CCU A;  2KXC A;  2HMA A;  2VWF A;  1LPL A;  4BY6 B;  3VRZ A;  1TXQ A;  2EW3 A;  2DRK A;  1NE8 A;  3QXE B;  1HYO A;  2DO3 A;  3CCL A;  5CKB A;  2BZ8 A;  2GF7 A;  3OYA A;  3PT9 A;  1M1G A;  4FCY A;  2AT1 B;  3VJP A;  1SF9 A;  1U8R A;  2LVM A;  1C1A A;  3VUB A;  2LQN A;  2EQK A;  4F04 B;  2E3H A;  1CKA A;  3VU3 C;  1ZHI A;  2DL5 A;  5I21 A;  1JU5 C;  1LJO A;  2K2V A;  1ZX6 A;  1G3S A;  1PD1 A;  4M7A F;  2LQ8 A;  3Q1J A;  4OMM A;  2D1X A;  1ZUK A;  1X6G A;  1PKT A;  2XMF A;  4PFO A;  3V7R A;  1M30 A;  3PIP A;  2DXU A;  5LJ3 j;  3NPF A;  3BY7 A;  2IIM A;  1JB0 E;  3CXC P;  3KFV A;  1YJW Q;  5CK9 A;  1OX8 A;  2NYS A;  2NLU A;  2R5M A;  1TU0 B;  2XI9 A;  3G4S A;  1RAI B;  2PUO B;  3ZFJ A;  2LCC A;  3VS7 A;  1AZE A;  1W2B A;  1QKX A;  3EGX B;  4J9D A;  1C6V X;  1VQ5 A;  1U1S A;  4M4Z A;  2K2M A;  1YBY A;  1HD3 A;  4BD3 A;  2J6K A;  3V8L A;  4AG1 C;  1VQM T;  5GAM d;  4KH0 B;  1JXO A;  4A4E A;  4FW2 A;  2RQV A;  4M7A D;  1WGS A;  4HCK A;  1KSW A;  4J6X A;  5KYX B;  2KT1 A;  2XHC A;  4J5Y A;  4A54 A;  3S6W A;  3JCM W;  1MGQ A;  1PRM C;  2K3Y A;  3I55 T;  5FLX E;  1N9S A;  1M3B A;  2KR3 A;  3EG9 A;  3THK A;  1KQS P;  4X9C A;  4JDS A;  2FL7 A;  2EKO A;  5L23 A;  2FPF A;  4M77 G;  2ZGW A;  2XKO C;  4PJN A;  1ABO A;  4A53 A;  2LZ6 B;  1VQ8 A;  1VQ7 Q;  5KYY A;  4J8O A;  1V1C A;  2V26 A;  4GLM A;  1Q81 U;  2O2O A;  2KXD A;  3CXC A;  1KJW A;  1JQQ A;  1WHJ A;  1AWX A;  3CCR T;  3DLM A;  2GNC A;  1YHQ T;  4LDU A;  1XNI A;  1J3T A;  2HDA A;  3OMC A;  3JSC A;  3I5S A;  4FIB A;  5D6W A;  4M77 F;  3CD6 Q;  3FB9 A;  3OMG A;  4MZM A;  2DVJ A;  2XG8 D;  2EIF A;  2JOY A;  5GAN 8;  1VQP T;  4N0A A;  1GRI A;  1FMK A;  1K8A U;  3H9N A;  2EYQ A;  1H64 1;  2QAS A;  4Z88 A;  1M8V A;  1ZSZ A;  4JLI A;  1T0J A;  5GJW B;  1EIF A;  1KG1 A;  2HL3 A;  1Q86 R;  3QPH A;  1M90 U;  2K79 A;  1YJN Q;  1ABQ A;  5IH2 A;  1MV3 A;  2BIV A;  4M7A E;  2NUP B;  4QT7 A;  1KQS A;  2F5T X;  1YI2 T;  2XD0 A;  1N8R U;  2RJC A;  1NEG A;  2E65 A;  2WSC E;  3OBW A;  3CCS T;  2HKN A;  1K73 R;  1YFN A;  1QQJ A;  1QCF A;  2YUP A;  4HXJ A;  1WIE A;  1TH7 A;  4PK4 A;  2J6F A;  1M3A A;  1WXT A;  4AMC A;  3LGF A;  3EGX A;  1BCM A;  3LH0 A;  4M77 D;  2RI2 A;  2YXY A;  1YNZ A;  1JO8 A;  1B34 B;  4PLI A;  1M1F A;  2GFU A;  2HQH A;  2KEA A;  1MMN A;  4L5G A;  1JXM A;  1UJ0 A;  4DBQ A;  2MI6 A;  3UAT A;  3NMZ C;  2COZ A;  1D3B B;  3HTR A;  3CCQ A;  4E47 A;  3J7A F;  2ZPE B;  2A7Y A;  2RA2 A;  1WHL A;  2ZPG B;  3M0T A;  5KCO A;  3CME T;  3CCJ A;  2YHT A;  2KDS A;  4V2S A;  2BKD N;  1TUG B;  1UB4 A;  5FW9 A;  1OU8 A;  1FX7 A;  1YCY A;  2DMO A;  2XIC A;  2L0A A;  1PRL C;  3CCM Q;  1IHW A;  1YIJ T;  5GAN 4;  2JTF A;  1NJI R;  3UA6 A;  4XK8 E;  4FYY B;  2RHU A;  2KQW A;  2EPD A;  4MDW A;  1G2B A;  1WHM A;  2RD1 A;  1VQ4 T;  3OYM A;  2K5F A;  3A5Z B;  3P8D A;  1YWO A;  2LMJ A;  3A1P A;  1U1T A;  4F7U G;  2DPP B;  1VYT A;  2ZPH B;  4C5E A;  5KYU B;  3HFO A;  2PZ1 A;  2QQR A;  4ORZ A;  1RI9 A;  1RLQ C;  4HT8 A;  3OYE A;  3OQ5 A;  3VV0 A;  4M77 E;  2HNI A;  3JRZ A;  2FRW A;  2X35 A;  1JJ2 P;  2AHJ B;  5M9O A;  2DBK A;  4TVR A;  3RKW A;  3ULR B;  4OGC A;  3M4G A;  2X51 A;  2QEX Q;  3JCM V;  3M53 A;  4EMH A;  4PJM A;  4BI8 B;  2E5Q A;  3FEO A;  4JJD A;  4DBF A;  4M75 B;  1F1B B;  3CCU Q;  5DLQ E;  3V8J A;  4F7U F;  2LCL A;  3JCM c;  1YIT A;  4BE1 A;  1H92 A;  3CCL Q;  3CBM A;  9ATC B;  5GMK l;  4N4H A;  1Y96 B;  3PNW C;  1WPY A;  2DYB A;  2GFA A;  3A98 A;  2Y4X A;  4C8Q G;  1ZUU A;  2BZY A;  2L3P A;  3QJ6 A;  4OB3 B;  2PVO B;  4HCC A;  1X6O A;  4KUD K;  5LJ3 f;  1K9M C;  2A36 A;  4JS5 A;  2DVE A;  3JB9 J;  1B34 A;  2HQE A;  1RAE B;  5LJ3 e;  5GAN h;  3G4S T;  3TEE A;  3CMA T;  2OJ2 A;  5CKD A;  3SWN C;  5GAO n;  3CXC S;  4ME7 A;  3VRY A;  1M2V A;  4KGV B;  4XTU A;  3M0U A;  1VQ5 T;  1GFD A;  1S72 T;  1X01 A;  4DEY A;  3PTA A;  4RG8 A;  3PMI A;  1ZSG A;  2FPD A;  1D0Y A;  3MP8 A;  1JJ2 A;  2F1L A;  3MEA A;  1WFW A;  2QQ9 A;  2B86 A;  3MEU A;  2DK3 A;  4YTL A;  1U5S A;  2COY A;  2CT4 A;  2EJF A;  3FRN A;  2DIL A;  2DFU A;  2YRD A;  2RNA A;  4F17 A;  1BB9 A;  1BI1 A;  3ZEH A;  2QG9 B;  4CC2 A;  1ARK A;  1VQM A;  1UGS B;  1KQS S;  2O4X A;  4Z02 A;  4RKU E;  1O75 A;  2MWP A;  3JB9 G;  1WXB A;  3OS2 A;  3EH2 A;  1VIE A;  3M0R A;  3I55 A;  2RI3 A;  3SFM A;  3QSU A;  3QDF A;  4GY5 A;  3LH5 A;  5HK0 A;  1VQ8 Q;  2CT3 A;  5CIU A;  1QVF S;  3AT1 B;  2K57 A;  2YSQ A;  2DTH A;  2CP7 A;  2H8H A;  5A2Q E;  2KAF A;  3HPW A;  1M9S A;  4UC4 A;  1UGQ B;  3QBY A;  2EQJ A;  3V7S A;  1I07 A;  1LNX A;  2A28 A;  3JCM f;  4M7D C;  2XU8 A;  5FWB A;  2EGE A;  4KUI A;  4J6W A;  4LDW A;  3O5Z A;  1NLO C;  4C0D B;  3VKI A;  3CCR A;  3JCM e;  4LE9 A;  2VXF A;  4RTT A;  4FU6 A;  4M78 G;  3TVT A;  1WA7 A;  1KQ1 A;  2FO0 A;  2V1Q A;  4F7U E;  1Q81 R;  2QQS A;  5GAN 7;  3BDL A;  2LCS A;  1B7T A;  4C92 G;  1SSH A;  3TRE A;  4RUG A;  3GLX A;  1QWE A;  5GMK e;  4FM4 B;  3PGG A;  2W0Z A;  1I0C A;  3C12 A;  2DF6 A;  2EYX A;  2E3I A;  1MMD A;  2CP3 A;  3CBO A;  3C0C A;  2EGC A;  2LT4 A;  1YI2 A;  3L2W A;  4ZGD B;  2COW A;  3CC2 T;  1OI1 A;  2M02 A;  4DEX A;  3CCS A;  1VQK T;  4VUB A;  3LWH A;  3JCM P;  3X26 B;  3CCQ T;  2KY9 A;  1WXU A;  3M5A A;  3R6N A;  1M90 R;  3OSS C;  2FZC B;  2NUZ A;  5GAO m;  4C5I A;  2CP0 A;  2E1H A;  4GBQ A;  2OTL T;  2O01 E;  1RAF B;  2CS7 A;  1S1N A;  3LW5 E;  2MYS A;  3CBP A;  3LX7 A;  3VS0 A;  4A4G A;  2YLB A;  2E6Z A;  2MOX A;  2LTO A;  3BFM A;  1T3S A;  3MP1 A;  3FLG A;  2YUN A;  1W6X A;  2J6O A;  4J6Y A;  5I22 A;  3P8H A;  1VQO A;  1D0X A;  1NYG A;  2RHZ A;  4M7A A;  3KBG A;  1NPP A;  2P4R A;  4KRT A;  1RAC B;  2BE7 D;  2EAY A;  2CP2 A;  3GIB A;  3QZ5 B;  4ZGE B;  2D0Q B;  1N9R A;  3CME A;  2QTV A;  3O8V A;  5GAM f;  2EQM A;  3H6Z A;  1N27 A;  2ZCF B;  2OAW A;  4IUR A;  2VYT A;  3E1S A;  5GAM e;  2DEU A;  1YIJ A;  3I56 T;  3EG9 B;  1BBZ A;  4PJO C;  4N4G A;  4E7I A;  3C4S A;  4ZGJ B;  4N4I A;  1VQL A;  2GTO A;  4EPC A;  3OYH A;  1ZA2 B;  1LVK A;  1T0H A;  4IKF A;  5KYY B;  3AHU A;  2VGN A;  1VQ4 A;  1Q82 C;  5CQY A;  2IG0 A;  4R0K A;  3CPF A;  3WXM B;  3HFN A;  5HCK A;  1JJ2 S;  4HCB A;  2LNH B;  4PJJ A;  3X28 B;  2DET A;  2L2P A;  3H41 A;  2CSI A;  1MND A;  4M7D G;  2YUO A;  2PTK A;  3OYB A;  5I2M A;  1EZZ B;  1VYU A;  1WNL A;  3HRS A;  1YIT Q;  2I2L A;  2LP5 A;  2R5A A;  4IUU A;  5GAO q;  2JW4 A;  3QUI A;  5KE3 A;  2HL5 C;  1UDL A;  1V29 B;  3RMS A;  4EMK C;  1SHG A;  1TSF A;  1PSF A;  5AYF A;  1GXI E;  1ZSZ B;  1EX4 A;  3EG2 A;  1SEM A;  1PKS A;  1M1K U;  2DJQ A;  4M7D F;  2KVQ G;  2ED0 A;  1PCX A;  2RB6 A;  2X4J A;  4Y28 E;  3CCV T;  2OTJ A;  4HA8 A;  2JMC A;  2E4H A;  1KHI A;  1I1J A;  4M77 A;  1FMV A;  2DKG A;  3WVE B;  3CMA A;  1WHH A;  1UEC A;  3CC4 T;  1BI2 A;  1S72 A;  1NBE B;  2M16 A;  1YJ9 T;  5IAY A;  4C0F A;  4FSX A;  3TSZ A;  3N5B B;  3OBY A;  2C06 A;  2DL7 A;  1OX9 A;  5KH6 A;  1VA7 A;  5GJV B;  2B8A A;  3E9G A;  5EC7 A;  4KUL A;  1AHJ B;  2GTJ A;  4HVV A;  2DZC A;  2RM4 A;  1G8X A;  1IGU A;  2PUK B;  5D6Y A;  1EFN A;  5GAN j;  3V8K A;  1M8M A;  1RAB B;  3LLR A;  1O9S A;  1NYF A;  4M7D D;  3RKX A;  1VQM Q;  2MCN A;  3OS5 A;  1W1F A;  1WHG A;  4OMP A;  3I5R A;  3C94 A;  3UA7 A;  3E2U A;  4E7J A;  2ED1 A;  3R6O A;  4WF2 A;  1QVF P;  2D6F A;  5A0D A;  3I55 Q;  2VXE A;  4D8K A;  1UHC A;  4J9F A;  4ANJ A;  1XTD A;  2KSS A;  3GP8 A;  2CRE A;  2F2X A;  1QW1 A;  4ATO A;  4QVD A;  1Q95 G;  4J9B A;  2K7A A;  2DZ9 A;  4QQD A;  1VYV A;  2HQX A;  4R56 A;  4E2F B;  1PM3 A;  2DL4 A;  1ZBX A;  1B07 A;  3EGU A;  1RAD B;  2QTX A;  2HSE B;  4PJO G;  1M4Z A;  4FW1 A;  4E7L A;  4LN2 A;  5GAN 6;  3L2V A;  3M57 A;  4KT0 E;  4II1 A;  3CCR Q;  1X2K A;  2JVV A;  4C8Q C;  1YHQ Q;  2L3S A;  3X25 B;  3TSW A;  2E70 A;  4RTU A;  2H3E B;  2MMP A;  2EFI A;  5J3B A;  4HCZ A;  1WQ7 A;  1KK7 A;  2J7I A;  1AZG B;  3MHX A;  3SEM A;  4A63 B;  1VQP Q;  4PJO F;  3EHR A;  1R77 A;  4RTZ A;  3G6E T;  1KC8 C;  3E19 A;  1Q86 C;  4LDV A;  2NUT A;  2L3Q A;  2EYW A;  2L3R A;  2JTE A;  1RAG B;  1RL2 A;  4BI4 A;  3GBQ A;  4DOW A;  3OS1 A;  4M7D E;  2CUB A;  1H8K A;  1QVF A;  3ER0 A;  4PKC C;  2JS0 A;  2CH4 W;  1T3L A;  1QP3 A;  1QCO A;  1K73 C;  2WSF E;  1YI2 Q;  2A37 A;  3PFS A;  3CCS Q;  4D8D A;  4ELZ C;  4FYX B;  2JM8 A;  1TWB A;  3ME9 A;  3CC2 A;  1VQO T;  1M2V B;  3WVD B;  4NS5 A;  1VQK A;  4OMN A;  3RER A;  1VQ9 T;  1X2Q A;  4F7U A;  4Z89 A;  4IIO A;  5IXB A;  4LNP A;  3OYC A;  4JPB W;  1D1B A;  1G3T A;  2CP5 A;  3S3N A;  2EBP A;  1RLP C;  1IHV A;  2XK0 A;  4PJO D;  2FEI A;  2PU9 B;  2OTL A;  4JLG A;  4PLL A;  5LJ5 j;  1H3H A;  1FYN A;  2VV5 A;  2RHY A;  2V8I A;  5J26 A;  1Y07 A;  4ZNX A;  2JS2 A;  4QVZ A;  1Q82 U;  3DB3 A;  1DJ7 B;  3VYH B;  1KD1 C;  2RJD A;  2EVR A;  1WJQ A;  3RNJ A;  4RTW A;  4R55 A;  1VQL T;  1MMA A;  3CME Q;  3INZ A;  1X69 A;  3EHQ A;  5ECA A;  5DLO A;  1NJI C;  2RN8 A;  1R0B G;  3I9Q A;  1PC0 A;  2O4X B;  4WCI A;  4LUE A;  2E5K A;  2MWO A;  1OZ2 A;  2CZ7 B;  1YIJ Q;  3CPW P;  4BB7 A;  2LRQ A;  1QVG P;  4JS4 A;  3NHN A;  4M78 C;  5FWC A;  3JCM Q;  3I56 A;  2DA9 A;  1D0Z A;  2QEX T;  1VQ4 Q;  2QA4 T;  4QVC A;  1G3Y A;  2MK5 A;  2RK1 A;  2EJG A;  2ZZD A;  4J9G A;  3H0F A;  3M59 A;  4C92 C;  4FT2 A;  2JT4 A;  2D8J A;  3UWN A;  4XTV A;  1K0S A;  2CZ0 B;  2EYZ A;  3FJP A;  5LJ3 h;  1OUL A;  4RTX A;  4RTY A;  4OGE A;  2L5Q A;  3OY9 A;  2JUF A;  1E7O A;  5GMK i;  1HSQ A;  1PSE A;  4Q5W A;  4JRP A;  4XU2 A;  4PJO E;  1KQ2 A;  3CCE T;  2OTJ T;  2RMO A;  3NTI A;  4XTX A;  1YP5 A;  3JCM X;  4ZTJ A;  1M2O A;  2QQB A;  1OEB A;  1X6B A;  3L42 A;  1I4K 1;  3KUF A;  2DEQ A;  3L1A A;  3BE3 A;  4M75 C;  1K9M R;  1N5Z A;  2KRN A;  1CKB A;  8AT1 B;  3TQ7 P;  5FRN A;  2CYZ B;  2GBQ A;  1Q7Y C;  1B3Q A;  2FHD A;  2RHX A;  3CPW A;  2DER A;  3X20 B;  2DL8 A;  1QVG A;  4C8Q F;  4NL3 A;  2BUD A;  5FU6 C;  4HT9 A;  2P84 A;  5GAN 5;  3CCV A;  1HJD A;  1YJW A;  2JZ2 A;  2RJF A;  3G4S Q;  3CMA Q;  4EMG A;  4EDU A;  1OOT A;  1TG0 A;  2RQW A;  5L8R E;  1BIA A;  1VQ5 Q;  4IUV A;  1S72 Q;  3SB2 A;  3P8B B;  1M1K R;  4X9D A;  2D0N A;  1K0X A;  4HVW A;  3CC4 A;  4OB2 B;  5FRM A;  2ABL A;  2J05 A;  2CZ1 B;  3OYI A;  3MCA B;  1YJ9 A;  1WDX A;  4C0G A;  3I35 A;  4ZN1 A;  2KRM A;  4DBH A;  2YDL A;  5GAN g;  1KIK A;  1GCQ C;  1UEB A;  1JEG A;  3S3O A;  3LYI A;  4OB1 B;  2DBM A;  5HY6 A;  4M7A B;  5KCH A;  5A0G A;  3JCM h;  2HZY A;  1U06 A;  4C8Q D;  2ZAE A;  1G83 A;  1UE9 A;  1WHK A;  2VAS A;  3S3M A;  2R58 A;  2FG0 A;  1LOJ A;  4OF1 A;  3H0H A;  5CKH A;  3TCJ A;  1VQN T;  2F69 A;  3FC3 A;  1X75 C;  2E12 A;  2P0P A;  3VS3 A;  1SHF A;  2PVD B;  2PNI A;  3OB9 A;  2LC4 A;  1IRX A;  2CGH A;  3GF5 A;  5C0M A;  4HKE A;  3JB9 F;  3MO8 A;  2ATC B;  5GMK h;  3M0Q A;  1PWT A;  4CC4 B;  5D6X A;  1VQ6 T;  4XU0 A;  3OA6 A;  3JB9 H;  2EYY A;  1WI7 A;  1FXX A;  3RIR A;  2RF0 A;  2ROL A;  4XQ3 A;  2VGM A;  4JRQ A;  2VB6 A;  2O88 A;  4RG2 A;  2F2V A;  4J9C A;  2FYK A;  2JNG A;  3HSB A;  3SWN A;  4AG2 C;  3PIO A;  2DXC A;  3SDZ A;  1SG5 A;  1WX6 A;  3A8L B;  3NFC A;  4QKU A;  4NOY A;  4CC7 A;  2GGR A;  2ZPI B;  5LL6 S;  2KE9 A;  3SD4 A;  4C0D C;  2HSP A;  3CC7 T;  4M78 F;  3D7S B;  2XDD A;  1GBR A;  1PD0 A;  2XID A;  2VUB A;  2FRY A;  3OSV A;  3G6E A;  1R0C B;  1UHF A;  3A8M B;  3MEV A;  4BAC A;  3G71 T;  4C92 F;  1UGP B;  3M58 A;  3UT1 A;  1BCO A;  3JB9 D;  4M75 G;  4FSS A;  5HKC A;  4EIK A;  5IXF A;  5GAN d;  4Y91 A;  1TTH B;  4C8Q E;  2QGF B;  1K1Z A;  4ESR A;  1KD1 U;  1K8A C;  2K3X A;  5EG2 A;  2DTO A;  2AKL A;  4FYW B;  2V8J A;  3EAE A;  1I5O B;  2DX1 A;  4J83 A;  2EQU A;  3CC2 Q;  4M77 B;  1AVZ C;  3VUZ A;  1VQK Q;  3F70 A;  1ACM B;  3CCQ Q;  1BU1 A;  2ENM A;  4A4H A;  5GAM h;  1YN8 A;  2DTI A;  4M75 F;  5LJ5 e;  1N8R C;  1VQ9 A;  2AIR B;  2WAC A;  5J39 A;  3CCJ Q;  2OTL Q;  2DAQ A;  5LJ5 g;  4M78 D;  2VVK A;  1SRM A;  2O9V A;  1SRL A;  3OYJ A;  2KGT A;  4X34 A;  4JRK A;  2JXB A;  4OVA A;  5D7U A;  4ZN3 A;  4M7D A;  4C92 D;  1BI3 A;  1Y57 A;  2E64 A;  3EG3 A;  4DQ2 A;  2YT6 A;  1AT1 B;  2F2W A;  2JMA A;  4OB0 B;  1D1C A;  5FU7 B;  1AOJ A;  4BI3 A;  2DYI A;  3JCM J;  2QQA A;  3CPW S;  2L89 A;  3HP9 A;  1HK9 A;  1QVG S;  3QII A;  4LXC A;  1Q82 R;  3RUX A;  2FZG B;  4KGX B;  4MDX A;  1K9M U;  1RI0 A;  3I56 Q;  3OS0 A;  2CP6 A;  2HAX A;  4M75 D;  4WTO B;  4J9H A;  3NGP A;  2HEQ A;  2AZS A;  2CZ6 B;  1Y7X A;  2LJ3 A;  4AT1 B;  4F16 A;  3C95 A;  2QEX A;  2ZPF B;  2YWW A;  2QA4 A;  5GMK m;  3U23 A;  2LT1 A;  4RCC A;  2BE9 B;  2VC8 A;  2DL3 A;  3EFO B;  1RUW A;  2CSQ A;  4LDX A;  3UDC A;  3PE0 A;  3DKM A;  5CQX A;  3JV3 A;  4BY6 C;  3OYY A;  1IB8 A;  4M78 E;  2SEM A;  2DD4 A;  3UF4 A;  1QVP A;  4BUG A;  3CCE A;  1YJW T;  4C92 E;  1Z9Z A;  2BTT A;  3PVQ A;  5IHK A;  2OI3 A;  5LJ5 d;  2NUT B;  2GQI A;  4N0A C;  2W10 A;  2EJ9 A;  2AK5 A;  3OW2 S;  3NTK A;  4JRI A;  1OPL A;  1AD5 A;  1ZSZ C;  2ECZ A;  4KGZ B;  4B6M A;  1K9A A;  2A08 A;  2K5I A;  3X24 B;  3L2Z A;  2RPN A;  1PHT A;  3E9F A;  4OMF B;  3CCV Q;  2M51 A;  1UJY A;  4IUT A;  1JBM A;  3FDR A;  1TUC A;  2E41 A;  1IZ6 A;  2YRV A;  1NEB A;  1XJW B;  2KYM A;  2ROT A;  4E7Z A;  2EGA A;  3QHS A;  1SKU B;  4O5V A;  3M55 A;  4RCB A;  2CH4 A;  4XTY A;  4M75 E;  4XTZ A;  2D8H A;  4Z8A A;  3ZBD A;  5KYW B;  4PJO A;  3CC4 Q;  1HXD A;  2LNV A;  4F7U B;  1MHN A;  1UG1 A;  1YJ9 Q;  2M0O A;  4PNO A;  4IUP A;  1LCK A;  2SRC A;  1VQ7 T;  3M0S A;  1I5L A;  1WYX A;  4LUD A;  2O9S A;  1G3W A;  3G7Z A;  2HBW A;  2QXF A;  5I11 A;  3HL8 A;  1Y71 A;  4PJL A;  2XDP A;  5GAO r;  2X3W D;  3CD6 T;  2Y90 A;  2I0N A;  1K76 A;  3MKD A;  4BDZ A;  2V1R A;  2FZK B;  2K4Y A;  2J06 A;  3QKJ A;  4EMK A;  2LJ0 A;  1VQN A;  4C8Q B;  4A4F A;  2DM1 A;  1QP2 A;  3EFO A;  1AWW A;  1NZ9 A;  2LDM A;  2FPE A;  1NM7 A;  3VYG A;  3QWY A;  1YJN T;  2C0O A;  2M9U A;  2CUD A;  4CRI A;  1QKW A;  1WLP B;  5CAI A;  1VQ6 A;  4J7F A;  4PFZ A;  3L2R A;  2YRC A;  3IQL A;  4E7H A;  4LD9 K;  3RR6 A;  3L2Q A;  3VS1 A;  3A8G B;  4P5N A;  4FYV B;  1KC8 R;  3G1J A;  3UPU A;  4ZTF A;  2HBP A;  2JJ9 A;  3QZ9 B;  5IHI A;  2C0I A;  2A3L A;  2QI2 A;  2QDL A;  4Y92 A;  2RO0 A;  2RQR A;  2EKH A;  4ELY C;  2DNU A;  1RAH B;  2CDT A;  5GMK j;  2QGG A;  3H8Z A;  2QDY B;  3M9Q A;  4B9W A;  3QG1 A;  3RKY A;  4C5G A;  1OQK A;  3G6E Q;  3EGD B;  1UGV A;  3CC7 A;  4JJC A;  1OV3 A;  2FVU A;  2NWM A;  2OX7 A;  4L59 A;  1IXD A;  2MAM A;  4QQG A;  4NL2 A;  3G71 A;  1VIF A;  5I2S A;  2KMT A;  1Z9Q A;  5KYW A;  3VS5 A;  2DE0 X;  1I81 A;  1WJS A;  1MUZ A;  1TOV A;  1IGQ A;  3CEY A;  2F5K A;  4IIM A;  4E7K A;  3A8O B;  4J9I A;  4JZ3 A;  3VS4 A;  3T9N A;  5KYX A;  2R57 A;  4GLK A;  4AFS C;  5GAO l;  3M54 A;  3OYL A;  3CCM T;  1VQO Q;  1V76 A;  1X27 A;  3PMT A;  4AFZ C;  2GCX A;  2EWN A;  1SPK A;  2G3R A;  1VQ9 Q;  1XQH A;  2X9H A;  1MMG A;  1GCP A;  1TUD A;  4J7I A;  1M3C A;  2DD5 A;  1KD1 R;  2V8K A;  1W4S A;  2LX7 A;  4CI0 C;  2MPX C;  4JJN K;  1CSK A;  4QW2 A;  3L2U A;  3JCM b;  1GFC A;  2M1H A;  1OZ3 A;  4E6R A;  2KT8 A;  4M78 B;  4C8Q A;  2KK4 A; 
#chains in the Genus database with same CATH homology
 1UE9 A;  1V1C A;  2FG0 A;  3H0H A;  4GLM A;  1BBZ A;  2RQU A;  2O2O A;  2GTO A;  4JJB A;  2KXD A;  3VS3 A;  1SHF A;  1KJW A;  1T0H A;  2PNI A;  1JQQ A;  1AWX A;  1NG2 A;  2GNC A;  1BK2 A;  1J3T A;  4R0K A;  1Y0M A;  3M0Q A;  2HDA A;  2LQW A;  1PWT A;  4CC4 B;  3I5S A;  5HCK A;  2LNH B;  3EG1 A;  2L2P A;  2EYY A;  1YWP A;  3SHW A;  1WI7 A;  2DVJ A;  2RF0 A;  2ROL A;  3H41 A;  2CSI A;  2O88 A;  1E6G A;  2F2V A;  4J9C A;  2YUO A;  2PTK A;  1GRI A;  1FMK A;  4Z88 A;  4AG2 C;  1VYU A;  1X43 A;  2AZV A;  5IHN A;  1WX6 A;  2G6F X;  3FJ5 A;  1T0J A;  5GJW B;  3PVL A;  2LP5 A;  4CC7 A;  2GGR A;  2JW4 A;  1K4U S;  1UDL A;  2K79 A;  2JM9 A;  2KE9 A;  1ABQ A;  1SHG A;  1MV0 B;  5IH2 A;  1MV3 A;  2HSP A;  3ZL7 C;  4QT7 A;  3EG2 A;  1SEM A;  1GBR A;  1NEG A;  2FRY A;  1PKS A;  1UHF A;  2DJQ A;  2ED0 A;  1QCF A;  2YUP A;  4HXJ A;  1WIE A;  4FSS A;  1KFZ A;  4EIK A;  5IXF A;  1PNJ A;  2JMC A;  2J6F A;  1M3A A;  1WXT A;  1K1Z A;  4ESR A;  1I1J A;  1YNZ A;  1JO8 A;  2AKL A;  1UEC A;  4K11 A;  2DX1 A;  2KEA A;  1AVZ C;  1JXM A;  1UJ0 A;  3UAT A;  3TSZ A;  3NMZ C;  1BU1 A;  2DL7 A;  2ENM A;  2YUQ A;  1YN8 A;  1QWF A;  1VA7 A;  3EG0 A;  1XOV A;  5EC7 A;  5GJV B;  1IO6 A;  2GTJ A;  4HVV A;  1EFN A;  3M0T A;  2VVK A;  1SRM A;  2O9V A;  1SRL A;  1M8M A;  5FW9 A;  1A0N B;  2K9G A;  2KGT A;  2DMO A;  2JXB A;  2L0A A;  1NYF A;  1PRL C;  2MCN A;  1W1F A;  1Y57 A;  1GBQ A;  4OML A;  2KRO A;  4OMP A;  3UA6 A;  3I5R A;  3EG3 A;  3UA7 A;  2ED1 A;  2YT6 A;  2F2W A;  2EPD A;  2JMA A;  1AOJ A;  3REA B;  1G2B A;  4D8K A;  1UHC A;  4J9F A;  2CRE A;  2F2X A;  3VS2 A;  1YWO A;  2LMJ A;  4J9B A;  2K7A A;  3REB B;  1VYV A;  2ESW A;  4AFU C;  1VYT A;  3M0P A;  2DL4 A;  1B07 A;  2C0T A;  3EGU A;  2PZ1 A;  4ORZ A;  1RI9 A;  1RLQ C;  1E6H A;  4J9H A;  3NGP A;  2HEQ A;  2AZS A;  2FRW A;  4LN2 A;  2DBK A;  3ULR B;  2LJ3 A;  4F16 A;  1ZBJ A;  2EQI A;  4JJD A;  3U23 A;  1X2K A;  2LJ1 A;  2L3S A;  3TSW A;  4RTU A;  3RBB B;  2O31 A;  2DL3 A;  1UUE A;  4OMO A;  2K3B A;  1H92 A;  1RUW A;  2J7I A;  1AZG B;  3SEM A;  3CQT A;  1UTI A;  2CSQ A;  4A63 B;  3PE0 A;  3EHR A;  4RTZ A;  3JV3 A;  2DYB A;  3A98 A;  1ZUU A;  2BZY A;  2L3P A;  2DLP A;  2L3Q A;  2EYW A;  2KNB B;  2SEM A;  2JTE A;  3UF4 A;  3GBQ A;  2A36 A;  3H0I A;  2BZX A;  2CUB A;  1H8K A;  1Z9Z A;  2BTT A;  3PVQ A;  5IHK A;  2OI3 A;  2JS0 A;  2GQI A;  2OJ2 A;  2CH4 W;  2W10 A;  1UFF A;  1T3L A;  1ZUY A;  2AK5 A;  3VRY A;  1OPL A;  4JZ4 A;  1M27 C;  2A37 A;  3M0U A;  1GFD A;  2X3X D;  1AD5 A;  2ECZ A;  1K9A A;  1GCQ A;  2A08 A;  1QLY A;  4DEY A;  4D8D A;  2RPN A;  1ZSG A;  2JM8 A;  2FPD A;  1PHT A;  2KYB A;  2M51 A;  1UJY A;  1GL5 A;  1TUC A;  4OMN A;  1NEB A;  2KYM A;  2ROT A;  2EGA A;  1X2Q A;  1WFW A;  2B86 A;  1U3O A;  4Z89 A;  4IIO A;  5IXB A;  4LNP A;  4JPB W;  1U5S A;  2CH4 A;  2EBP A;  1RLP C;  2AKK A;  2D8H A;  4OMQ A;  4Z8A A;  2FEI A;  2CT4 A;  1W70 A;  1H3H A;  2DIL A;  1OPK A;  4HVU A;  1UG1 A;  1FYN A;  2RNA A;  4F17 A;  1BB9 A;  4J9E A;  4ZNX A;  2JS2 A;  1LCK A;  2SRC A;  4CC2 A;  1ARK A;  3M0S A;  1WYX A;  2EVR A;  3RNJ A;  4RTW A;  2M0Y A;  4AFQ C;  4LUD A;  1AWJ A;  2O9S A;  1ZLM A;  1WXB A;  1X69 A;  3EHQ A;  5ECA A;  4F14 A;  2HBW A;  2KBT A;  5I11 A;  2KRS A;  3M0R A;  4CC3 A;  2RN8 A;  3I9Q A;  2MIO A;  2RQT A;  3LH5 A;  1AWO A;  4WCI A;  2CT3 A;  2X3W D;  4LUE A;  2E5K A;  2DRM A;  2YSQ A;  2VKN A;  2I0N A;  1K76 A;  2H8H A;  2V1R A;  3NHN A;  2J06 A;  5FWC A;  2HCK A;  4RTV A;  2LJ0 A;  2DA9 A;  1I07 A;  2A28 A;  2DM1 A;  5FWB A;  4J9G A;  2EGE A;  1YCS B;  3VS6 A;  3H0F A;  1AWW A;  2JT4 A;  2D8J A;  1AEY A;  3O5Z A;  1NLO C;  3QWX X;  4X1V A;  2FPE A;  1K0S A;  1NM7 A;  4LE9 A;  1NLP C;  2K6D A;  4RTT A;  3QWY A;  2EYZ A;  2C0O A;  3TVT A;  2CUD A;  1WA7 A;  2KXC A;  1QKW A;  1WLP B;  2VWF A;  2FO0 A;  4RTX A;  3VRZ A;  4RTY A;  2EW3 A;  2V1Q A;  2DRK A;  3IQL A;  2LCS A;  1E7O A;  1HSQ A;  2BZ8 A;  3VS1 A;  1SSH A;  4RUG A;  2LQN A;  2RMO A;  1QWE A;  1CKA A;  1YP5 A;  2DL5 A;  5IHI A;  2C0I A;  1JU5 C;  1OEB A;  1X6B A;  2W0Z A;  1ZX6 A;  2QDL A;  4Y92 A;  1I0C A;  2RQR A;  2EKH A;  2DF6 A;  2DNU A;  1N5Z A;  4OMM A;  2EYX A;  2CDT A;  2KRN A;  1CKB A;  2D1X A;  1ZUK A;  1X6G A;  1PKT A;  2XMF A;  1UGV A;  1M30 A;  2GBQ A;  3C0C A;  4JJC A;  2EGC A;  1B3Q A;  1OV3 A;  3NPF A;  2IIM A;  2NWM A;  4DEX A;  2DL8 A;  3KFV A;  1WXU A;  1Z9Q A;  1HJD A;  3VS5 A;  3R6N A;  2DE0 X;  2NUZ A;  4GBQ A;  1MUZ A;  1OOT A;  4IIM A;  1S1N A;  1TG0 A;  2RQW A;  3VS7 A;  1AZE A;  4J9I A;  3VS0 A;  1QKX A;  4J9D A;  4JZ3 A;  4M4Z A;  2K2M A;  2D0N A;  2MOX A;  4HVW A;  3VS4 A;  1K0X A;  1HD3 A;  1T3S A;  2J6K A;  4AFS C;  2ABL A;  4AG1 C;  2YUN A;  1W6X A;  2J05 A;  2J6O A;  1X27 A;  4AFZ C;  5I22 A;  1JXO A;  1SPK A;  2RQV A;  1NYG A;  1WDX A;  4HCK A;  1KSW A;  3I35 A;  1GCP A;  1TUD A;  2KRM A;  2P4R A;  1M3C A;  2KT1 A;  2YDL A;  1KIK A;  4KRT A;  1PRM C;  1GCQ C;  2LX7 A;  1JEG A;  2DBM A;  1M3B A;  2KR3 A;  3THK A;  1CSK A;  1GFC A;  5L23 A;  2FPF A;  2OAW A;  4E6R A;  2KT8 A;  1ABO A;  1U06 A;  2LZ6 B;  1G83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...