4Y92A

Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain e97t-q128r mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
MTFVALYDYESRTTTDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein-tyrosine kinase
publication title Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain E97T-Q128R mutant
rcsb
source organism Avian sarcoma virus pr2257/16
molecule tags Transferase
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4y92A00
3PE0A 2FG0A 2DMOA 1UDLA 4JJCA 1KFZA 3ULRB 2EYWA 3NPFA 2CUDA 1ABOA 1PKSA 2D0NA 4EIKA 5GJWB 2EKHA 3TVTA 5FWCA 2DA9A 2W0ZA 1I1JA 3SHWA 1FMKA 1SPKA 1JXMA 1SEMA 2IIMA 2CDTA 1AZGB 1AWXA 1UJYA 2RF0A 2L3PA 2DILA 2AZSA 3TSWA 2RQUA 2JXBA 1U5SA 1WXBA 4J9GA 5EC7A 2JMCA 2MIOA 1W1FA 1N5ZA 2EW3A 4AFSC 2LMJA 5HCKA 5I11A 2B86A 3IQLA 2VWFA 4J9HA 4OMNA 1VYVA 1CSKA 2FEIA 2YSQA 1M27C 2AZVA 2A28A 1CKBA 2YUNA 5I22A 3KFVA 2GGRA 1AEYA 1SRLA 3U23A 3UATA 2XMFA 2L2PA 2CUBA 1SSHA 4DEYA 1W70A 1ZBJA 2RQWA 2LJ1A 4KRTA 2CSIA 1XOVA 1AWJA 2OJ2A 3M0UA 1M3CA 4WCIA 1SRMA 1T0JA 4RTZA 1HJDA 3VS2A 2J6KA 2ESWA 1JXOA 2K9GA 2LJ3A 2RN8A 1JU5C 2YDLA 2FRWA 1GBRA 2KRSA 1T0HA 4ZNXA 2J05A 2LQWA 3THKA 2CSQA 1UECA 3EHQA 2PZ1A 2KT8A 1HSQA 1GCQC 1W6XA 1S1NA 3PVLA 4LN2A 2X3XD 1X43A 5IH2A 2EGEA 2HSPA 2DVJA 1TG0A 2DX1A 4ESRA 2P4RA 1VA7A 2DRMA 1JQQA 2DJQA 2DL5A 2LZ6B 1WA7A 2FPFA 4JJDA 2NWMA 3VS0A 2GTJA 3VS3A 1JEGA 2F2WA 3TSZA 2LJ0A 2EPDA 1HD3A 4RTTA 1UJ0A 1GCPA 1NG2A 1MUZA 1NYFA 3M0PA 5ECAA 4AFQC 2EQIA 2DRKA 2RQRA 3JV3A 3VRZA 1GFCA 1QCFA 1OPLA 1IO6A 2LNHB 2F2VA 1H3HA 2M51A 1QWEA 1RLQC 2HCKA 1E7OA 3VS4A 4JZ4A 1E6HA 2KXDA 2O2OA 4Z88A 4JPBW 2D8HA 3UF4A 3I9QA 1KIKA 1PHTA 3QWYA 4CC4B 1GL5A 2KYMA 2C0OA 1GBQA 1Y57A 2LX7A 2J6OA 1U06A 1NM7A 5FWBA 4D8KA 2KRMA 2H8HA 5IXBA 4K11A 1QKXA 1EFNA 2DM1A 2ED1A 2RPNA 3EG2A 1NLOC 2D8JA 1U3OA 2V1RA 2KT1A 1X6GA 1X2KA 3QWXX 1ZLMA 2A08A 2PTKA 1UTIA 4OMMA 2GBQA 4J9BA 5IHKA 2DE0X 2KYBA 1ZUUA 4F17A 4OMLA 2SEMA 1RI9A 2BZ8A 1UG1A 1BK2A 1MV0B 2CREA 3M0RA 3SEMA 4CC2A 3EG1A 1KJWA 3VS5A 2DNUA 1AWOA 2X3WD 1PWTA 2YUQA 3VS1A 1AWWA 2JM9A 4RTUA 1UE9A 3RBBB 1H8KA 1NYGA 1B07A 1GRIA 1OPKA 1KSWA 4Z8AA 3EG3A 2EYZA 4LE9A 1T3SA 1PRMC 1QKWA 2KROA 1Z9QA 2DL8A 2FRYA 2EYXA 2O9VA 2O31A 2W10A 5L23A 2YT6A 1AD5A 3VS6A 1K4US 1B3QA 1OOTA 2BZYA 3NHNA 1WXTA 1UUEA 2ABLA 1UHFA 2CH4A 2LP5A 2MCNA 2EGCA 1TUCA 1UFFA 2EVRA 4OMQA 3H0IA 2L3SA 1UGVA 4RTYA 2EYYA 1M3AA 1Y0MA 2F2XA 5IXFA 2CT4A 1X2QA 4E6RA 1ABQA 1NLPC 1GFDA 1WYXA 2K7AA 4AFUC 2YUPA 2RMOA 1YWOA 4Y92A 2DL3A 1RLPC 1WFWA 2ECZA 2DYBA 4GBQA 3M0SA 1PNJA 2NUZA 2JW4A 2L3QA 2RQVA 2VVKA 4IIMA 5FW9A 2BTTA 1I0CA 2K3BA 2KXCA 2A37A 4GLMA 1RUWA 3CQTA 1LCKA 1K0XA 4DEXA 1V1CA 3NMZC 1PKTA 4X1VA 4HVVA 2PNIA 1J3TA 1WXUA 2EGAA 4RTXA 4AG2C 2KR3A 1K9AA 2ENMA 3FJ5A 1X27A 2RNAA 1BB9A 4F16A 2K2MA 3I35A 1A0NB 4OMPA 2JM8A 1QWFA 1K76A 1OEBA 2KE9A 3LH5A 2HBWA 4AG1C 4HVUA 2L0AA 1E6GA 2QDLA 3R6NA 2KBTA 1TUDA 1CKAA 2EBPA 1WI7A 1H92A 1M3BA 4HVWA 4JZ3A 2J7IA 2V1QA 3M0TA 2A36A 2CT3A 4JJBA 2KGTA 1FYNA 2D1XA 1WIEA 5GJVB 1ZX6A 3EG0A 4ORZA 5IHIA 2E5KA 3UA6A 1M30A 1AZEA 4Z89A 1T3LA 2LCSA 1QLYA 2CH4W 1I07A 1X6BA 1YN8A 3GBQA 1UHCA 2SRCA 2K6DA 3PVQA 2OAWA 2AKKA 3REAB 2LQNA 3H0HA 2MOXA 1M8MA 1K1ZA 4LUEA 4CC7A 4IIOA 3NGPA 2GTOA 2JS2A 2JS0A 3H41A 2C0TA 2RQTA 2J6FA 1G83A 4M4ZA 2AK5A 1ZUKA 4CC3A 1SHGA 3RNJA 4J9FA 2DL7A 2FPDA 4F14A 4HCKA 2HEQA 3EGUA 1ZSGA 1SHFA 3H0FA 2J06A 2M0YA 2JT4A 2KRNA 1YP5A 4RTWA 2YUOA 3VS7A 1AVZC 2KNBB 1WX6A 1BU1A 4D8DA 1ARKA 1Z9ZA 3I5SA 1JO8A 1MV3A 4FSSA 4AFZC 1GCQA 3REBB 4J9IA 2FPEA 2FO0A 3A98A 2DBMA 2ROTA 1X69A 3M0QA 3VRYA 1YWPA 2C0IA 1BBZA 4J9EA 5IHNA 2DL4A 2GQIA 1YCSB 4J9DA 4LUDA 4OMOA 2KEAA 1VYTA 3ZL7C 4LNPA 3I5RA 4R0KA 2G6FX 1VYUA 3O5ZA 2DLPA 2HDAA 4A63B 2ED0A 2DF6A 1ZUYA 2O9SA 2K79A 1K0SA 1NEBA 3UA7A 2ROLA 2BZXA 2JMAA 4QT7A 2VKNA 2GNCA 1YNZA 4HXJA 2DBKA 2OI3A 1AOJA 1WLPB 1G2BA 2JTEA 3EHRA 2AKLA 4RTVA 1NEGA 4J9CA 4RUGA 1WDXA 1OV3A 1PRLC 2I0NA 2O88A 3C0CA
chains in the Genus database with same CATH superfamily
4E7IA 3PE0A 1UDLA 2OTLA 1Q81U 3NPFA 2F5TX 3AT1B 4HCCA 4FT4A 2XD0A 2EKHA 3A5ZB 2W0ZA 3SHWA 1Q82R 3CD6A 5KYNA 1JXMA 4F7UG 2EQKA 5GAMf 2RF0A 1LPLA 2NUPA 5C6SA 5CKHA 2DILA 3TSWA 2K4YA 2DVEA 2RQUA 1QCNA 2KQWA 3OYEA 3N5BB 2E64A 3QDRB 4PJMA 2FB7A 2MIOA 3H8ZA 2CP6A 3G4SA 1JBMA 2LMJA 3CD6Q 4C92F 5IT9E 2XHCA 1KQ2A 3HP9A 3IQLA 4J9HA 1LNXA 4OVAA 3M9QA 5D6XA 4JRPA 2FEIA 4E7SA 1WNLA 3EAEA 1CKBA 3OYDA 2OAUA 4J5YA 1SRLA 2YXYA 1LOJA 3U23A 1ZBXA 2XMFA 1YI2A 2CUBA 2PUKB 1RAEB 4DEYA 5GMKj 2MK5A 4MMLA 3CCUT 3HKSA 1EX4A 2QA4A 2DTHA 3CMEQ 3M0UA 1I8FA 1SRMA 5GMKi 3X24B 3VS2A 2ESWA 2LJ3A 2KY9A 1OQKA 2YDLA 4XTWA 5GAN3 4XTYA 1VQ8Q 2KRSA 3HHTB 4C92B 2J05A 4E7LA 3QSUA 4BACA 2CZ1B 1BCOA 1YI2Q 2EJFA 2PZ1A 1GCQC 1IGUA 3PVLA 3OYLA 4X9CA 2DVJA 2P4RA 3OB9A 5L8RE 4C8QC 1QVFS 4PJNA 3M59A 1WA7A 2PVGB 5KYWB 4OB1B 1RAHB 4JJDA 1V76A 2P0PA 4PK4A 4C5GA 4L59A 2F2WA 3X25B 1GCPA 1OZ3A 4XU2A 4C5HA 1MUZA 2HKNA 2FZKB 4II1A 3L1AA 3VRZA 4N0AA 2WACA 1QCFA 1ZQ1A 1IO6A 1OULA 2F2VA 1RLQC 5DM7R 1E6HA 2KXDA 1TOVA 2D8HA 2ZPEB 3UF4A 1K9MR 4C0DB 3CPWA 1QVGA 2J6OA 1I4K1 2KRMA 5FU6B 4RMOA 5IXBA 1EFNA 3CCUA 2XK0A 1NLOC 5CQXA 1KHCA 3SD4A 2E3HA 2DTIA 1X6GA 3A8OB 2MI6A 3OYBA 4MMKA 1M90C 4BI8B 2PTKA 2L5QA 2QGFB 2ZPHB 2BUDA 3E9FA 4M75F 1RADB 2IVWA 4J9BA 5DY9A 4GY5A 2DE0X 5GANe 4EPCA 1VQKA 2R5MA 3BY7A 2BZ8A 5FU7B 3CC2T 4CC2A 4LD6A 2XKOC 3JCMP 1KJWA 1Q82C 1K73U 4XTVA 3CCVA 1WHGA 1AWOA 2E41A 2E1HA 1DJ7B 3LWIA 2YUQA 3VS1A 2V8IA 2AT1B 5LJ5h 5CAIA 8AT1B 2E6NA 2JJ9A 4RTUA 1XNIA 1NYGA 2LQ8A 2E3IA 5A0GA 4PLLA 4Z8AA 3EG3A 2EYZA 3CCLT 4LE9A 1T3SA 2DETA 2KROA 1I5LA 4M75B 2L89A 2EYXA 2O9VA 2O31A 4N4IA 5GAMd 4MDXA 1VQPA 1B3QA 1OOTA 1WHLA 2HL3A 2RI5A 1HXDA 1UUEA 4IKFA 2E12A 2CH4A 4NL2A 5GAN2 3OS2A 4IUVA 2EVRA 3QG1A 4XQ3A 3H0IA 5FRMA 4QQDA 3J7AF 2EYYA 1H3ZA 4OGCA 3PIOA 2BKDN 2LNVA 5IXFA 1VOMA 3OBWA 1KG1A 1PSFA 1N9RA 4AFUC 3VU3C 3OMCA 3OYGA 2YRCA 4ZGDB 1WFWA 1BKBA 2VYTA 4E7HA 1N9SA 3EG9A 3CC2A 4KH0B 1VIFA 1YJ9Q 1M1KU 3RUXA 2VVKA 1Y96B 2BTTA 2K3BA 4GLMA 2RJFA 2I2LA 3H6ZA 4X1VA 2RJDA 1J3TA 5CVIA 5LJ3j 4RTXA 2LCLA 2KR3A 3FJ5A 1YBYA 1BB9A 4F16A 2FVUA 1A0NB 1QWFA 2XIDA 5LJ5g 1OEBA 1N8RU 3CCLA 4LDXA 4AG1C 2Z0WA 4HVUA 2QDLA 4QKUA 3R6NA 2KBTA 1F1BB 1M3BA 1M2OA 3M58A 2CT3A 3UPUA 1FYNA 3UDCA 1ZX6A 2HD0A 3EG0A 4OB0B 3RKWA 2E5KA 2QXFA 3UA6A 3URGA 3VKIA 2EJ9A 3CXCP 4BI4A 1UGRB 4KULA 3A1PA 1YIJQ 3JSCA 3SFMA 3PVQA 3CCLQ 2VV5A 2DERA 3H0HA 4D6WA 6AT1B 2QASA 2DK3A 4LUEA 1K1ZA 3PT9A 4IIOA 1QP2A 3NGPA 3QYHB 4M78B 2KSSA 2GF7A 4Y91A 2JS0A 3H41A 2RQTA 2J6FA 1G83A 5CKDA 1ZUKA 4CC3A 3JCMf 3RNJA 4J9FA 4F14A 1QQJA 4BD3A 3CMAT 1SHFA 3H0FA 3J80E 2M0YA 4N4HA 4F7UF 3M57A 1YP5A 3TU4K 2ATCB 3I56T 4ZN3A 3I55Q 4OMFB 3LW5E 4HCBA 1ARKA 2JOYA 1YFNA 3I5SA 1JO8A 4FSSA 1GCQA 2RJEA 3REBB 2ZPGB 1D3BB 2GQVA 3JCMW 2FO0A 3SWNB 2DBMA 2MWOA 4C8QA 2ROTA 2YLBA 1X69A 2RK2A 3VRYA 1C1AA 5CIUA 4HT9A 3FB9A 4DBRA 4J9EA 3OMGA 4OP0A 4E47A 2K5IA 3L2WA 2OTJT 4XTXA 3SWNA 4KUDK 4PJJA 1VYTA 4B6MA 3ZL7C 4LNPA 2G3RA 3I5RA 4KH1B 1YJWA 1W2BP 2G6FX 2YRVA 1Q82U 3O5ZA 4F7UB 2DF6A 3JB9D 2CZ0B 3GF5A 5EG2A 3LX7A 1YNZA 2JVVA 4M7AA 2PU9B 3L2QA 2QEXA 2QAZA 2RJCA 2RD1A 2E70A 2EWNA 2AKLA 5KCHA 2RB6A 4J9CA 4JJNK 3A8GB 1OV3A 4N0AC 2O88A 4OB3B 3CCJA 3CMAA 4M77A 2KVQG 2DMOA 4DQ2A 1AT1B 5A2QE 3EGXB 1Q86U 2LRQA 3G6ET 5GANh 4XTUA 3I56A 5KCOA 1Y7XA 1YITA 1ZSZB 2DXCA 4ZGEB 2DA9A 2X35A 4AT1B 3OYAA 4J7FA 1RAIB 3EGXA 2CDTA 2EQJA 1QVFA 2VB6A 2XICA 1AZGB 4OGEA 1AWXA 3CMAQ 1ZSZA 5D6YA 3FDRA 4C0FA 5FU6C 2AZSA 5J3BA 4QVZA 1TTHB 2JXBA 3I56Q 4J9GA 4IUUA 5EC7A 2WSFE 2ZCFB 4FYXB 2JMCA 3DLMA 1N5ZA 4M7DA 2EW3A 3V8LA 3LH0A 4KGZB 3MEAA 1H641 2VWFA 3RKXA 1G3YA 1OX9A 1CSKA 3BE3A 1XTDA 2OTLT 5I22A 3KFVA 2GGRA 3JB9I 3C94A 2XDPA 1G8XA 3JAME 2OTJQ 2K57A 1G3SA 4MZTA 1W70A 4KRTA 2CSIA 3OYIA 2OJ2A 1WQWA 4NOYA 3NTIA 1T0JA 1IHWA 1BIBA 3G6EA 1JXOA 3ER0A 1K9MU 1SG5A 1GBRA 2A3LA 2DD4A 2CSQA 3EHQA 5GANg 3GOXA 4LN2A 1S1NA 3CCST 3CCET 1OX8A 2F5KA 1TG0A 1W4SA 1QP3A 2E6ZA 4ESRA 4C8QD 2DL5A 3E1SA 2QQ9A 3OQ5A 3EFOA 3VS0A 1JEGA 5CQYA 3JCMJ 2LJ0A 1NJIR 2ZPBB 3M0PA 4BY6B 2COZA 1SKUB 4J7IA 5GAN6 1M90R 1H3HA 4RCCA 2HCKA 2QA4T 4C8QG 3OYCA 3I9QA 1KIKA 4RCBA 4CC4B 2KYMA 2C0OA 1M8VA 1GBQA 1Y57A 3TEEA 5FWBA 2H3EB 2H8HA 4PJOB 4BDZA 2ED1A 2RPNA 3FJPA 1PD1A 4PL6A 1K8AR 1KQSP 2KDSA 2KT1A 2DO3A 3NFCA 3RR6A 5GAOl 1R0CB 4DBHA 2DD5A 2OTLQ 1UTIA 4OMMA 4FYYB 2BE7D 4F04B 3OS1A 2KYBA 1ZUUA 4F17A 1KC8C 1QVPA 4OF1A 4KT0E 2H3JA 3CCEA 3CCSA 3M0RA 2Y4XA 3V7CA 3CC7A 1PC0A 5IN1A 4LDWA 2X3WD 1PWTA 2D0QB 2M1HA 1AWWA 1D0XA 2JM9A 1MMAA 2EYQA 1MNEA 4A4GA 5CCAA 1B07A 3EH2A 1GRIA 3FEOA 3QYGB 4M7DD 2RA2A 3G71A 1SSFA 3CCSQ 1IRXA 3CCEQ 1VQ7T 3QDFA 3G4SQ 4O5VA 1PRMC 4B9XA 3TQ7P 1QKWA 4XU1A 2DL8A 2FRYA 3OSVA 4PFPA 3S3OA 2YT6A 1AD5A 4IURA 4M78C 4JLGA 4J8OA 2P84A 2ABLA 2LP5A 3RDVA 3RKYA 2EGCA 1KQ1A 5LJ5j 2O4XB 4OMQA 4FIBA 2L3SA 4RTYA 4FU6A 1UEBA 2RK1A 1VQKT 2LCCA 2XI9A 2LDMA 1BCMA 1G3WA 2QA4Q 2VGNA 2Y4YA 4BI3A 1NLPC 4PLIA 2KAFA 4C92A 4CI0C 3CCVT 1VQ9A 1RACB 3GLXA 1PCXA 3HSBA 2M9UA 7AT1B 4E7KA 2YRDA 1KD1R 1YJNT 3SWNC 3WVEB 1PNJA 5KYWA 5FW9A 1I0CA 1JRIA 3CQTA 1LCKA 3ZFJA 1N27A 1WHKA 1AHJB 3V8KA 1LVKA 1TXQA 1WXUA 2EGAA 1VQPT 3HL8A 5GMKl 2HKQB 5LJ3e 4M7AC 1K9AA 1QMCA 3TCJA 3E19A 2RH2A 4OMPA 2JM8A 1K76A 1VQ7A 1NJIC 2LTOA 1VQNT 3PMTA 1E6GA 4M77C 1CKAA 4XU0A 1WI7A 1G3TA 1IREB 2J7IA 2V1QA 3M0TA 4A4EA 4IUTA 1WIEA 5GJVB 5KYUB 1D1AA 1OU8A 3V7RA 1M30A 4JDSA 2CH4W 1I07A 4JS4A 3GBQA 3CCUQ 2B8AA 3QZ9B 2OAWA 1K8AC 3REAB 1Y07A 2IG0A 2JUFA 5HKCA 1ZSZC 2BE9B 3FLGA 1R0BG 3VJPA 4YTLA 2RI3A 1QCOA 1YJNA 5LJ3f 4LD9K 5KYXB 3MP1A 3OYYA 3JB9F 2C0TA 4FL6A 4M7DC 3MCAB 5GAOq 1VQKQ 1M9SA 1M2VB 4GLKA 9ATCB 4HCZA 3MHXA 1QW1A 3CBOA 4HCKA 5D7UA 2LT1A 1Q81R 4Z02A 3CXCS 3CCVQ 2RO0A 1FMWA 3OS5A 5CR2A 4RTWA 3VS7A 1IXDA 2PVDB 4LXCA 1BU1A 3H9NA 3GP8A 1MV3A 5GAMh 4M75A 1VQNA 3EGDB 4J9IA 2FPEA 4BUGA 2LVMA 3A98A 4KUIA 1TWBA 2MAMA 3S6WA 3M0QA 1YWPA 3BFMA 4J6YA 3JCMc 3QXEB 4BDYA 1YHQT 1VQPQ 1OI1A 1YCSB 3L2RA 4J9DA 2XDDA 1PSEA 2KEAA 2IPOB 2X4YA 3ASKA 3EH1A 4KGXB 1KK7A 2XU8A 2ED0A 4C0GA 3MKDA 1ZUYA 2O9SA 1K0SA 1NEBA 3UA7A 2ROLA 4DOWA 2BZXA 4QT7A 4R56A 1RL2A 2KMTA 3VUZA 2AIRB 2DEQA 2XG8D 2NUTB 4HXJA 1OZ2A 1BI0A 1MMDA 4O6JA 2MWPA 3E2UA 1Y96A 3GNFB 1MHNA 4WTOB 2JTEA 1IZ6A 4RTVA 1NEGA 2ZPFB 1M1FA 1WDXA 3L2ZA 5AYFA 2DKGA 3JCMe 2I0NA 1KD1C 3CC2Q 3C0CA 3MEWA 3FC3A 2FG0A 4JJCA 1KFZA 2DJZA 4CRIA 1WJQA 3ULRB 2EYWA 2FHDA 2DXUA 3OY9A 3NTKA 3RERA 1ABOA 1PKSA 1R77A 2D0NA 4EIKA 1W2BS 5GJWB 4C8QE 3A8MB 4FT2A 3TVTA 1TH7A 3CCMA 2JNGA 3DB4A 3OW2P 5GAOm 3AHUA 4JRKA 1SPKA 1SEMA 1YJWT 4N4GA 4JRIA 3P8BB 5GAMg 4DOVA 4PJOC 2K3XA 2O01E 1YHQA 1Q7YR 1IGQA 1ZA2B 1MGQA 2CP0A 5M9OA 3OA6A 5GANj 1U5SA 2DZ9A 4C8QF 3QZ5B 4L5GA 2QEXT 2COYA 1W1FA 1G5VA 1OYXA 1VQ5T 3OBYA 4M7AE 4UC4A 5HCKA 5I11A 5J26A 4JS5A 3M54A 4OMNA 3CCJT 2EIFA 2YSQA 1M27C 1VQLT 3UT1A 3OYFA 1AEYA 4M78A 4M77E 1YHQQ 3UATA 2L2PA 1SSHA 1YITT 1PD0A 4HT8A 2JTMA 1ZBJA 3QIIA 2LJ1A 2RHYA 2QQBA 5HK3A 2MYSA 1M90U 2FL7A 1XOVA 1M5Q1 1M3CA 4RTZA 1JU5C 4XAXB 4C5IA 3CEYA 1Q81C 3QHSA 2X4JA 4A4FA 2LQWA 1D3BA 5LJ3d 3THKA 1VQ4T 3X28B 5GAOn 5CKBA 4XTZA 1W6XA 2VC8A 1K8AU 1X43A 2A7YA 3ZBDA 2HSPA 4J83A 2DX1A 1V29B 2ZGWA 1WHJA 2DRMA 1GXIE 3HTRA 1P92A 3L2UA 2FPFA 3S3MA 4C92C 4M7DE 1IB8A 1U1TA 2NWMA 3OYMA 5LL6S 3BDUA 4BE0A 1WJRA 2EPDA 1HD3A 1UJ0A 1NG2A 2JN0A 8ATCB 4MZPA 2CKKA 4LDUA 4F7UA 4AFQC 1UB4A 1VQ5A 1WHHA 2RQRA 3OYHA 1WQ7A 1GFCA 1YJWQ 2M51A 1QWEA 2QDYB 2RHIA 4HKEA 3UWNA 3VS4A 1VQLA 2O2OA 4Z88A 5I2MA 1RAFB 2LC4A 3QWYA 3JB9G 4M7DF 1KC8R 2LX7A 3E9GA 2DEUA 1U06A 3WXMB 4D8KA 4K11A 1QKXA 2DM1A 5DLOA 1TU0B 2QEXQ 3ZEHA 2V1RA 1PG5B 4C0DC 3PNWC 3FRNA 1X2KA 3CCJQ 2F1LA 4QQ6A 2X4XA 4EMHA 2QQAA 4XK8E 2PVOB 4ELZC 1VQ4A 2DZCA 3L42A 3PFSA 4OMLA 2SEMA 3OYKA 1MMNA 1YITQ 1UG1A 4DBQA 1BK2A 1MV0B 1NE8A 4ELYC 2R58A 1QVGP 3EG1A 1O9SA 2WSCE 3CCRA 1Y71A 3VS5A 4QQGA 3G7ZA 2HNIA 3HFNA 2CP2A 1KQSS 3JRZA 5FU7C 2QK0A 2K2VA 1UE9A 3RBBB 1H8KA 3A8LB 1Q7YC 1KD1U 4PNOA 3OS0A 2X51A 5GMKe 3PMIA 2RI2A 4PKCC 3HRTA 3M56A 5HY6A 1I5OB 2DIQA 4AMCA 2YLCA 5CKFA 1Z9QA 3RESA 1BI3A 1U1SA 5L23A 2BIVA 1K4US 3JCMb 4BB7A 2BZYA 3MEVA 4M78D 3NHNA 1WXTA 2D6FA 1UHFA 2DPPB 1HYOA 1UFFA 1XQHA 2QG9B 2QYZA 3QBYA 3R6OA 5LJ5e 4PJOE 4M75C 3MO8A 2MF2A 4KGVB 2HBPA 3EFRA 4ANJA 3JCMd 1X2QA 1B34B 4BE1A 1ABQA 3CC7T 2COWA 1GFDA 4QVCA 2K7AA 3G6EQ 5IAYA 2LX9A 3ME9A 3HPWA 1RLPC 4XU3A 2YHTA 3SDZA 2ECZA 4M78G 2DYBA 5FRNA 3M4YA 2L3RA 1U8RA 1NPRA 2YWWA 2JW4A 4IIMA 1JB0E 2X9HA 2KXCA 3A8HB 3G71T 2A37A 2VUBA 1N6AA 1K0XA 4DEXA 3CXCA 3NMZC 2RHZA 4HVVA 4C0ZA 1BIAA 4M7AD 1X27A 2RNAA 2K2MA 2VGMA 5LJ5f 2XDBA 2KE9A 2HBWA 1HK9A 3HRSA 5A0LA 4M77D 3X26B 1TUDA 3VYHB 2LT4A 4HVWA 3M55A 4JRQA 2A36A 4JJBA 2KGTA 4PJOA 1VQ9T 2D1XA 2MPXC 5IHIA 2NUPB 3QJ6A 2MMPA 2P4TA 1XJWB 4C92E 1TUGB 4Z89A 4M7AG 1T3LA 1ZA1B 2EJGA 3GIBA 1X6BA 3MEUA 2K6DA 2HQHA 2AKKA 3EFSA 1RABB 4IUQA 4M77G 2MOXA 4RG2A 1M8MA 4CC7A 5C0MA 5HK0A 1MMGA 3DLLA 4X9DA 3CMEA 1IHVA 2V8JA 4M4ZA 2JTFA 2AK5A 1M1KC 3JCMg 1WZOA 1NZ9A 4ME7A 2DL7A 2GCXA 2CP3A 2HEQA 2CYZB 3CPFA 1Q86R 1ZSGA 1VQ8A 2J06A 3CC7Q 1D09B 1W2BA 2M0OA 2NLUA 2YUOA 4FM4B 4EMKB 1AVZC 3Q1JA 1WX6A 3LGLA 4AFZC 1D0YA 3G71Q 1N8RC 2VXEA 4M7DG 3V7SA 4EMKA 1EZZB 2C0IA 5IHNA 2O4XA 5FROA 2DL4A 3LYIA 2GQIA 4J6XA 4LUDA 4OMOA 3JCMX 2QI2A 5AT1B 3OYJA 2E5QA 4R0KA 2C06A 1VYUA 3QUIA 3RMQA 4A63B 4WF2A 5GAMj 3CBPA 1WJSA 2K79A 3P8DA 2CGHA 5KYYB 4DA4A 2L8DA 2JMAA 2VKNA 1VIEA 3LLRA 1Q7YU 3SB2A 2QQRA 1VQ9Q 2OI3A 4NL3A 1AOJA 5GAOr 1WLPB 2K5LA 1G2BA 1BYMA 4EDUA 1JJ2S 5KYYA 1PRLC 2QGGA 2FZCB 2R57A 2OX7A 3C95A 5DLQE 4M75E 2CUDA 2X4WA 3CC4T 5KE2A 1C0MA 2P0QA 5FWCA 3PTAA 2E10A 1I1JA 1YJ9T 2CP5A 2DIGA 2EAYA 2GFAA 4PFOA 1FMKA 1X75C 2IIMA 2K3YA 1R8OB 1VQ7Q 5D6WA 1UJYA 5KYUA 5GAN8 2L3PA 1WPYA 4PJOD 4ATOA 4RKUE 1VQOT 1I81A 1VQMT 4FYWB 5GMKh 1Q95G 4ZTFA 1VQ6T 1WXBA 1LJOA 1EIFA 5LJ5d 4AFSC 1KHIA 2B86A 1VYVA 2HMAA 2AZVA 2A28A 2YUNA 3O8VA 5KYXA 4VUBA 3OW2S 1QVFP 3M53A 2WSEE 4PJOG 1S72T 2DFUA 4JLIA 1M2VA 3CCMT 1YJNQ 1YIJT 4A54A 2RQWA 4EMGA 1AWJA 2JZ2A 3L2VA 4WCIA 2P0KA 1HJDA 2J6KA 1JJ2P 2K9GA 2RN8A 2PQWA 2FRWA 1X01A 4E7JA 1Q86C 3CC4A 3DB3A 1T0HA 4ZNXA 1KC8U 1YJ9A 3EGDA 5I21A 1FMVA 4OB2B 4A4HA 5GANf 1UECA 4MZMA 1HSQA 2KT8A 2X3XD 5IH2A 2EGEA 3DKMA 4X34A 3EG9B 5CKEA 1VA7A 1VQNQ 1JQQA 1NPPA 2DJQA 2LZ6B 4C92D 1KQSA 2GTJA 3VS3A 1VQOA 1VQMA 3I55T 1VQ6A 4RG8A 4C5EA 3TSZA 3CC4Q 2E4HA 4RTTA 4TVRA 3OYNA 4DBFA 1NYFA 5ECAA 3HRUA 5GAN7 2QTXA 2EQIA 2DRKA 4M78E 5KE3A 3JV3A 4E7ZA 3TREA 1OPLA 2LNHB 1X6OA 1E7OA 4Y28E 2NUTA 4JZ4A 3F70A 2RHUA 4JPBW 3PGGA 1PHTA 2EFIA 4BY6C 1GL5A 3MJXA 2FZGB 5CO7A 1S72A 3T9NA 4C92G 1VQOQ 1VQMQ 1NM7A 1VQ6Q 3EG2A 3GNGA 1YIJA 2Y90A 2D8JA 3CCQT 4MDWA 1U3OA 3MP6A 1UGSB 2QTVA 4M78F 5GAN5 3QWXX 2DTOA 1ZHIA 2V26A 1ZLMA 2A08A 5A0DA 3WVDB 2CZ7B 1FWZA 2GBQA 1K9MC 5IHKA 5GAOp 1S72Q 1RI9A 3CCMQ 2CREA 4A53A 2DAQA 3SEMA 2M02A 2AHJB 2DNUA 2DXTA 4F7UE 2NYSA 3QO3A 4ZTJA 3KBGA 3I55A 2V8KA 3J81E 3QPHA 2VXFA 4PJLA 1NJIU 3MP8A 1UGPB 1OPKA 1KSWA 2EKOA 4LDYA 5GAN4 3D7SB 1UGQB 2QQSA 1D0ZA 3JB9J 4M7AF 3PIPA 4BE2A 2W10A 3CBMA 1RAGB 3VS6A 3FIFA 4C8QB 3G1JA 4P5NA 1BI1A 4NS5A 3CPWS 4R55A 3META 2HL5C 2M16A 3OSSC 1QVGS 2MCNA 1TUCA 4M77F 3CCQA 1UGVA 4M75D 1M3AA 2KI7A 1Y0MA 2F2XA 2HQXA 1K73R 2CT4A 2LQKA 1TSFA 4E6RA 4EMKC 3CCRT 5LJ3h 1WYXA 4FCYA 2YUPA 4FYVB 2RMOA 1YWOA 4FSXA 4B9WA 4Y92A 2DL3A 4LDVA 1O75A 3RIRA 2KK4A 1M4ZA 4GBQA 4M7AB 3M0SA 2HAXA 4FW2A 2NUZA 3CCQQ 2L3QA 2RQVA 3M4GA 3HFOA 2HSEB 4QVDA 3BDLA 2ZPIB 3QJYA 1RUWA 2EQMA 4M75G 2A0FB 3VUBA 1RI0A 1V1CA 1PKTA 4J6WA 4M77B 5GMKm 2PNIA 2ZZDA 4AG2C 1FX7A 2ENMA 2E65A 3I35A 5J39A 5GANd 2R5AA 3LH5A 3C12A 2RHXA 1VQ5Q 1MNDA 2CP7A 2L0AA 3C4SA 1ACMB 2EBPA 1H92A 4JZ3A 2EQUA 2GFUA 5KH6A 1C6VX 1WHMA 2PUOB 1VQLQ 1RAAB 4ORZA 2DXBA 3P8HA 1AZEA 1YCYA 3M5AA 1TS9A 1M1KR 3JCMQ 2LCSA 1QLYA 1YN8A 3RMSA 3CPWP 4FW1A 1UHCA 4A4KA 2SRCA 4QW2A 1M1GA 4M7DB 4HA8A 4PFZA 2LQNA 2FYKA 2D9TA 2OTJA 2CZ6B 3MPUB 3NTHA 2RM4A 3LWHA 2GTOA 3QKJA 5LJ3g 2JS2A 4ZN1A 1JJ2A 1VQ4Q 3KXTA 3S3NA 1N8RR 4JUVA 1SHGA 2FPDA 3V8JA 3EGUA 4L6V5 5I2SA 3CCRQ 1B7TA 2F69A 1SF9A 2JT4A 2KRNA 3X20B 4IUPA 2KNBB 4E2FB 4D8DA 2HZYA 1Z9ZA 2DYIA 3CD6T 1WGSA 3BW1A 1D1CA 1NBEB 1FXXA 1OU9A 2VASA 1PM3A 1BBZA 4Q5WA 3VV0A 3JCMV 5CK9A 2CS7A 5FLXE 3EFOB 4ZGJB 3JCMh 4V2SA 3KUFA 1B34A 3G4ST 3GPLA 2DLPA 2HDAA 4PJOF 3CMET 3LGFA 2K5FA 5GAMe 2HQEA 4KBMB 1D1BA 2ZAEA 1VUBA 1K73C 3OW2A 2GNCA 1VQ8T 3INZA 2DBKA 1YI2T 3JB9H 3EHRA 4RUGA 1BI2A 3VYGA
chains in the Genus database with same CATH topology
3PE0A 2FG0A 2DMOA 1UDLA 4JJCA 1KFZA 3ULRB 2EYWA 3NPFA 2CUDA 1ABOA 1PKSA 2D0NA 4EIKA 5GJWB 2EKHA 3TVTA 5FWCA 2DA9A 2W0ZA 1I1JA 3SHWA 1FMKA 1SPKA 1JXMA 1SEMA 2IIMA 2CDTA 1AZGB 1AWXA 1UJYA 2RF0A 2L3PA 2DILA 2AZSA 3TSWA 2RQUA 2JXBA 1U5SA 1WXBA 4J9GA 5EC7A 2JMCA 2MIOA 1W1FA 1N5ZA 2EW3A 4AFSC 2LMJA 5HCKA 5I11A 2B86A 3IQLA 2VWFA 4J9HA 4OMNA 1VYVA 1CSKA 2FEIA 2YSQA 1M27C 2AZVA 2A28A 1CKBA 2YUNA 5I22A 3KFVA 2GGRA 1AEYA 1SRLA 3U23A 3UATA 2XMFA 2L2PA 2CUBA 1SSHA 4DEYA 1W70A 1ZBJA 2RQWA 2LJ1A 4KRTA 2CSIA 1XOVA 1AWJA 2OJ2A 3M0UA 1M3CA 4WCIA 1SRMA 1T0JA 4RTZA 1HJDA 3VS2A 2J6KA 2ESWA 1JXOA 2K9GA 2LJ3A 2RN8A 1JU5C 2YDLA 2FRWA 1GBRA 2KRSA 1T0HA 4ZNXA 2J05A 2LQWA 3THKA 2CSQA 1UECA 3EHQA 2PZ1A 2KT8A 1HSQA 1GCQC 1W6XA 1S1NA 3PVLA 4LN2A 2X3XD 1X43A 5IH2A 2EGEA 2HSPA 2DVJA 1TG0A 2DX1A 4ESRA 2P4RA 1VA7A 2DRMA 1JQQA 2DJQA 2DL5A 2LZ6B 1WA7A 2FPFA 4JJDA 2NWMA 3VS0A 2GTJA 3VS3A 1JEGA 2F2WA 3TSZA 2LJ0A 2EPDA 1HD3A 4RTTA 1UJ0A 1GCPA 1NG2A 1MUZA 1NYFA 3M0PA 5ECAA 4AFQC 2EQIA 2DRKA 2RQRA 3JV3A 3VRZA 1GFCA 1QCFA 1OPLA 1IO6A 2LNHB 2F2VA 1H3HA 2M51A 1QWEA 1RLQC 2HCKA 1E7OA 3VS4A 4JZ4A 1E6HA 2KXDA 2O2OA 4Z88A 4JPBW 2D8HA 3UF4A 3I9QA 1KIKA 1PHTA 3QWYA 4CC4B 1GL5A 2KYMA 2C0OA 1GBQA 1Y57A 2LX7A 2J6OA 1U06A 1NM7A 5FWBA 4D8KA 2KRMA 2H8HA 5IXBA 4K11A 1QKXA 1EFNA 2DM1A 2ED1A 2RPNA 3EG2A 1NLOC 2D8JA 1U3OA 2V1RA 2KT1A 1X6GA 1X2KA 3QWXX 1ZLMA 2A08A 2PTKA 1UTIA 4OMMA 2GBQA 4J9BA 5IHKA 2DE0X 2KYBA 1ZUUA 4F17A 4OMLA 2SEMA 1RI9A 2BZ8A 1UG1A 1BK2A 1MV0B 2CREA 3M0RA 3SEMA 4CC2A 3EG1A 1KJWA 3VS5A 2DNUA 1AWOA 2X3WD 1PWTA 2YUQA 3VS1A 1AWWA 2JM9A 4RTUA 1UE9A 3RBBB 1H8KA 1NYGA 1B07A 1GRIA 1OPKA 1KSWA 4Z8AA 3EG3A 2EYZA 4LE9A 1T3SA 1PRMC 1QKWA 2KROA 1Z9QA 2DL8A 2FRYA 2EYXA 2O9VA 2O31A 2W10A 5L23A 2YT6A 1AD5A 3VS6A 1K4US 1B3QA 1OOTA 2BZYA 3NHNA 1WXTA 1UUEA 2ABLA 1UHFA 2CH4A 2LP5A 2MCNA 2EGCA 1TUCA 1UFFA 2EVRA 4OMQA 3H0IA 2L3SA 1UGVA 4RTYA 2EYYA 1M3AA 1Y0MA 2F2XA 5IXFA 2CT4A 1X2QA 4E6RA 1ABQA 1NLPC 1GFDA 1WYXA 2K7AA 4AFUC 2YUPA 2RMOA 1YWOA 4Y92A 2DL3A 1RLPC 1WFWA 2ECZA 2DYBA 4GBQA 3M0SA 1PNJA 2NUZA 2JW4A 2L3QA 2RQVA 2VVKA 4IIMA 5FW9A 2BTTA 1I0CA 2K3BA 2KXCA 2A37A 4GLMA 1RUWA 3CQTA 1LCKA 1K0XA 4DEXA 1V1CA 3NMZC 1PKTA 4X1VA 4HVVA 2PNIA 1J3TA 1WXUA 2EGAA 4RTXA 4AG2C 2KR3A 1K9AA 2ENMA 3FJ5A 1X27A 2RNAA 1BB9A 4F16A 2K2MA 3I35A 1A0NB 4OMPA 2JM8A 1QWFA 1K76A 1OEBA 2KE9A 3LH5A 2HBWA 4AG1C 4HVUA 2L0AA 1E6GA 2QDLA 3R6NA 2KBTA 1TUDA 1CKAA 2EBPA 1WI7A 1H92A 1M3BA 4HVWA 4JZ3A 2J7IA 2V1QA 3M0TA 2A36A 2CT3A 4JJBA 2KGTA 1FYNA 2D1XA 1WIEA 5GJVB 1ZX6A 3EG0A 4ORZA 5IHIA 2E5KA 3UA6A 1M30A 1AZEA 4Z89A 1T3LA 2LCSA 1QLYA 2CH4W 1I07A 1X6BA 1YN8A 3GBQA 1UHCA 2SRCA 2K6DA 3PVQA 2OAWA 2AKKA 3REAB 2LQNA 3H0HA 2MOXA 1M8MA 1K1ZA 4LUEA 4CC7A 4IIOA 3NGPA 2GTOA 2JS2A 2JS0A 3H41A 2C0TA 2RQTA 2J6FA 1G83A 4M4ZA 2AK5A 1ZUKA 4CC3A 1SHGA 3RNJA 4J9FA 2DL7A 2FPDA 4F14A 4HCKA 2HEQA 3EGUA 1ZSGA 1SHFA 3H0FA 2J06A 2M0YA 2JT4A 2KRNA 1YP5A 4RTWA 2YUOA 3VS7A 1AVZC 2KNBB 1WX6A 1BU1A 4D8DA 1ARKA 1Z9ZA 3I5SA 1JO8A 1MV3A 4FSSA 4AFZC 1GCQA 3REBB 4J9IA 2FPEA 2FO0A 3A98A 2DBMA 2ROTA 1X69A 3M0QA 3VRYA 1YWPA 2C0IA 1BBZA 4J9EA 5IHNA 2DL4A 2GQIA 1YCSB 4J9DA 4LUDA 4OMOA 2KEAA 1VYTA 3ZL7C 4LNPA 3I5RA 4R0KA 2G6FX 1VYUA 3O5ZA 2DLPA 2HDAA 4A63B 2ED0A 2DF6A 1ZUYA 2O9SA 2K79A 1K0SA 1NEBA 3UA7A 2ROLA 2BZXA 2JMAA 4QT7A 2VKNA 2GNCA 1YNZA 4HXJA 2DBKA 2OI3A 1AOJA 1WLPB 1G2BA 2JTEA 3EHRA 2AKLA 4RTVA 1NEGA 4J9CA 4RUGA 1WDXA 1OV3A 1PRLC 2I0NA 2O88A 3C0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PE0 A;  2FG0 A;  2DMO A;  1UDL A;  4JJC A;  1KFZ A;  3ULR B;  2EYW A;  3NPF A;  2CUD A;  1ABO A;  1PKS A;  2D0N A;  4EIK A;  5GJW B;  2EKH A;  3TVT A;  5FWC A;  2DA9 A;  2W0Z A;  1I1J A;  3SHW A;  1FMK A;  1SPK A;  1JXM A;  1SEM A;  2IIM A;  2CDT A;  1AZG B;  1AWX A;  1UJY A;  2RF0 A;  2L3P A;  2DIL A;  2AZS A;  3TSW A;  2RQU A;  2JXB A;  1U5S A;  1WXB A;  4J9G A;  5EC7 A;  2JMC A;  2MIO A;  1W1F A;  1N5Z A;  2EW3 A;  4AFS C;  2LMJ A;  5HCK A;  5I11 A;  2B86 A;  3IQL A;  2VWF A;  4J9H A;  4OMN A;  1VYV A;  1CSK A;  2FEI A;  2YSQ A;  1M27 C;  2AZV A;  2A28 A;  1CKB A;  2YUN A;  5I22 A;  3KFV A;  2GGR A;  1AEY A;  1SRL A;  3U23 A;  3UAT A;  2XMF A;  2L2P A;  2CUB A;  1SSH A;  4DEY A;  1W70 A;  1ZBJ A;  2RQW A;  2LJ1 A;  4KRT A;  2CSI A;  1XOV A;  1AWJ A;  2OJ2 A;  3M0U A;  1M3C A;  4WCI A;  1SRM A;  1T0J A;  4RTZ A;  1HJD A;  3VS2 A;  2J6K A;  2ESW A;  1JXO A;  2K9G A;  2LJ3 A;  2RN8 A;  1JU5 C;  2YDL A;  2FRW A;  1GBR A;  2KRS A;  1T0H A;  4ZNX A;  2J05 A;  2LQW A;  3THK A;  2CSQ A;  1UEC A;  3EHQ A;  2PZ1 A;  2KT8 A;  1HSQ A;  1GCQ C;  1W6X A;  1S1N A;  3PVL A;  4LN2 A;  2X3X D;  1X43 A;  5IH2 A;  2EGE A;  2HSP A;  2DVJ A;  1TG0 A;  2DX1 A;  4ESR A;  2P4R A;  1VA7 A;  2DRM A;  1JQQ A;  2DJQ A;  2DL5 A;  2LZ6 B;  1WA7 A;  2FPF A;  4JJD A;  2NWM A;  3VS0 A;  2GTJ A;  3VS3 A;  1JEG A;  2F2W A;  3TSZ A;  2LJ0 A;  2EPD A;  1HD3 A;  4RTT A;  1UJ0 A;  1GCP A;  1NG2 A;  1MUZ A;  1NYF A;  3M0P A;  5ECA A;  4AFQ C;  2EQI A;  2DRK A;  2RQR A;  3JV3 A;  3VRZ A;  1GFC A;  1QCF A;  1OPL A;  1IO6 A;  2LNH B;  2F2V A;  1H3H A;  2M51 A;  1QWE A;  1RLQ C;  2HCK A;  1E7O A;  3VS4 A;  4JZ4 A;  1E6H A;  2KXD A;  2O2O A;  4Z88 A;  4JPB W;  2D8H A;  3UF4 A;  3I9Q A;  1KIK A;  1PHT A;  3QWY A;  4CC4 B;  1GL5 A;  2KYM A;  2C0O A;  1GBQ A;  1Y57 A;  2LX7 A;  2J6O A;  1U06 A;  1NM7 A;  5FWB A;  4D8K A;  2KRM A;  2H8H A;  5IXB A;  4K11 A;  1QKX A;  1EFN A;  2DM1 A;  2ED1 A;  2RPN A;  3EG2 A;  1NLO C;  2D8J A;  1U3O A;  2V1R A;  2KT1 A;  1X6G A;  1X2K A;  3QWX X;  1ZLM A;  2A08 A;  2PTK A;  1UTI A;  4OMM A;  2GBQ A;  4J9B A;  5IHK A;  2DE0 X;  2KYB A;  1ZUU A;  4F17 A;  4OML A;  2SEM A;  1RI9 A;  2BZ8 A;  1UG1 A;  1BK2 A;  1MV0 B;  2CRE A;  3M0R A;  3SEM A;  4CC2 A;  3EG1 A;  1KJW A;  3VS5 A;  2DNU A;  1AWO A;  2X3W D;  1PWT A;  2YUQ A;  3VS1 A;  1AWW A;  2JM9 A;  4RTU A;  1UE9 A;  3RBB B;  1H8K A;  1NYG A;  1B07 A;  1GRI A;  1OPK A;  1KSW A;  4Z8A A;  3EG3 A;  2EYZ A;  4LE9 A;  1T3S A;  1PRM C;  1QKW A;  2KRO A;  1Z9Q A;  2DL8 A;  2FRY A;  2EYX A;  2O9V A;  2O31 A;  2W10 A;  5L23 A;  2YT6 A;  1AD5 A;  3VS6 A;  1K4U S;  1B3Q A;  1OOT A;  2BZY A;  3NHN A;  1WXT A;  1UUE A;  2ABL A;  1UHF A;  2CH4 A;  2LP5 A;  2MCN A;  2EGC A;  1TUC A;  1UFF A;  2EVR A;  4OMQ A;  3H0I A;  2L3S A;  1UGV A;  4RTY A;  2EYY A;  1M3A A;  1Y0M A;  2F2X A;  5IXF A;  2CT4 A;  1X2Q A;  4E6R A;  1ABQ A;  1NLP C;  1GFD A;  1WYX A;  2K7A A;  4AFU C;  2YUP A;  2RMO A;  1YWO A;  4Y92 A;  2DL3 A;  1RLP C;  1WFW A;  2ECZ A;  2DYB A;  4GBQ A;  3M0S A;  1PNJ A;  2NUZ A;  2JW4 A;  2L3Q A;  2RQV A;  2VVK A;  4IIM A;  5FW9 A;  2BTT A;  1I0C A;  2K3B A;  2KXC A;  2A37 A;  4GLM A;  1RUW A;  3CQT A;  1LCK A;  1K0X A;  4DEX A;  1V1C A;  3NMZ C;  1PKT A;  4X1V A;  4HVV A;  2PNI A;  1J3T A;  1WXU A;  2EGA A;  4RTX A;  4AG2 C;  2KR3 A;  1K9A A;  2ENM A;  3FJ5 A;  1X27 A;  2RNA A;  1BB9 A;  4F16 A;  2K2M A;  3I35 A;  1A0N B;  4OMP A;  2JM8 A;  1QWF A;  1K76 A;  1OEB A;  2KE9 A;  3LH5 A;  2HBW A;  4AG1 C;  4HVU A;  2L0A A;  1E6G A;  2QDL A;  3R6N A;  2KBT A;  1TUD A;  1CKA A;  2EBP A;  1WI7 A;  1H92 A;  1M3B A;  4HVW A;  4JZ3 A;  2J7I A;  2V1Q A;  3M0T A;  2A36 A;  2CT3 A;  4JJB A;  2KGT A;  1FYN A;  2D1X A;  1WIE A;  5GJV B;  1ZX6 A;  3EG0 A;  4ORZ A;  5IHI A;  2E5K A;  3UA6 A;  1M30 A;  1AZE A;  4Z89 A;  1T3L A;  2LCS A;  1QLY A;  2CH4 W;  1I07 A;  1X6B A;  1YN8 A;  3GBQ A;  1UHC A;  2SRC A;  2K6D A;  3PVQ A;  2OAW A;  2AKK A;  3REA B;  2LQN A;  3H0H A;  2MOX A;  1M8M A;  1K1Z A;  4LUE A;  4CC7 A;  4IIO A;  3NGP A;  2GTO A;  2JS2 A;  2JS0 A;  3H41 A;  2C0T A;  2RQT A;  2J6F A;  1G83 A;  4M4Z A;  2AK5 A;  1ZUK A;  4CC3 A;  1SHG A;  3RNJ A;  4J9F A;  2DL7 A;  2FPD A;  4F14 A;  4HCK A;  2HEQ A;  3EGU A;  1ZSG A;  1SHF A;  3H0F A;  2J06 A;  2M0Y A;  2JT4 A;  2KRN A;  1YP5 A;  4RTW A;  2YUO A;  3VS7 A;  1AVZ C;  2KNB B;  1WX6 A;  1BU1 A;  4D8D A;  1ARK A;  1Z9Z A;  3I5S A;  1JO8 A;  1MV3 A;  4FSS A;  4AFZ C;  1GCQ A;  3REB B;  4J9I A;  2FPE A;  2FO0 A;  3A98 A;  2DBM A;  2ROT A;  1X69 A;  3M0Q A;  3VRY A;  1YWP A;  2C0I A;  1BBZ A;  4J9E A;  5IHN A;  2DL4 A;  2GQI A;  1YCS B;  4J9D A;  4LUD A;  4OMO A;  2KEA A;  1VYT A;  3ZL7 C;  4LNP A;  3I5R A;  4R0K A;  2G6F X;  1VYU A;  3O5Z A;  2DLP A;  2HDA A;  4A63 B;  2ED0 A;  2DF6 A;  1ZUY A;  2O9S A;  2K79 A;  1K0S A;  1NEB A;  3UA7 A;  2ROL A;  2BZX A;  2JMA A;  4QT7 A;  2VKN A;  2GNC A;  1YNZ A;  4HXJ A;  2DBK A;  2OI3 A;  1AOJ A;  1WLP B;  1G2B A;  2JTE A;  3EHR A;  2AKL A;  4RTV A;  1NEG A;  4J9C A;  4RUG A;  1WDX A;  1OV3 A;  1PRL C;  2I0N A;  2O88 A;  3C0C A; 
#chains in the Genus database with same CATH topology
 4E7I A;  3PE0 A;  1UDL A;  2OTL A;  1Q81 U;  3NPF A;  2F5T X;  3AT1 B;  4HCC A;  4FT4 A;  2XD0 A;  2EKH A;  3A5Z B;  2W0Z A;  3SHW A;  1Q82 R;  3CD6 A;  5KYN A;  1JXM A;  4F7U G;  2EQK A;  5GAM f;  2RF0 A;  1LPL A;  2NUP A;  5C6S A;  5CKH A;  2DIL A;  3TSW A;  2K4Y A;  2DVE A;  2RQU A;  1QCN A;  2KQW A;  3OYE A;  3N5B B;  2E64 A;  3QDR B;  4PJM A;  2FB7 A;  2MIO A;  3H8Z A;  2CP6 A;  3G4S A;  1JBM A;  2LMJ A;  3CD6 Q;  4C92 F;  5IT9 E;  2XHC A;  1KQ2 A;  3HP9 A;  3IQL A;  4J9H A;  1LNX A;  4OVA A;  3M9Q A;  5D6X A;  4JRP A;  2FEI A;  4E7S A;  1WNL A;  3EAE A;  1CKB A;  3OYD A;  2OAU A;  4J5Y A;  1SRL A;  2YXY A;  1LOJ A;  3U23 A;  1ZBX A;  2XMF A;  1YI2 A;  2CUB A;  2PUK B;  1RAE B;  4DEY A;  5GMK j;  2MK5 A;  4MML A;  3CCU T;  3HKS A;  1EX4 A;  2QA4 A;  2DTH A;  3CME Q;  3M0U A;  1I8F A;  1SRM A;  5GMK i;  3X24 B;  3VS2 A;  2ESW A;  2LJ3 A;  2KY9 A;  1OQK A;  2YDL A;  4XTW A;  5GAN 3;  4XTY A;  1VQ8 Q;  2KRS A;  3HHT B;  4C92 B;  2J05 A;  4E7L A;  3QSU A;  4BAC A;  2CZ1 B;  1BCO A;  1YI2 Q;  2EJF A;  2PZ1 A;  1GCQ C;  1IGU A;  3PVL A;  3OYL A;  4X9C A;  2DVJ A;  2P4R A;  3OB9 A;  5L8R E;  4C8Q C;  1QVF S;  4PJN A;  3M59 A;  1WA7 A;  2PVG B;  5KYW B;  4OB1 B;  1RAH B;  4JJD A;  1V76 A;  2P0P A;  4PK4 A;  4C5G A;  4L59 A;  2F2W A;  3X25 B;  1GCP A;  1OZ3 A;  4XU2 A;  4C5H A;  1MUZ A;  2HKN A;  2FZK B;  4II1 A;  3L1A A;  3VRZ A;  4N0A A;  2WAC A;  1QCF A;  1ZQ1 A;  1IO6 A;  1OUL A;  2F2V A;  1RLQ C;  5DM7 R;  1E6H A;  2KXD A;  1TOV A;  2D8H A;  2ZPE B;  3UF4 A;  1K9M R;  4C0D B;  3CPW A;  1QVG A;  2J6O A;  1I4K 1;  2KRM A;  5FU6 B;  4RMO A;  5IXB A;  1EFN A;  3CCU A;  2XK0 A;  1NLO C;  5CQX A;  1KHC A;  3SD4 A;  2E3H A;  2DTI A;  1X6G A;  3A8O B;  2MI6 A;  3OYB A;  4MMK A;  1M90 C;  4BI8 B;  2PTK A;  2L5Q A;  2QGF B;  2ZPH B;  2BUD A;  3E9F A;  4M75 F;  1RAD B;  2IVW A;  4J9B A;  5DY9 A;  4GY5 A;  2DE0 X;  5GAN e;  4EPC A;  1VQK A;  2R5M A;  3BY7 A;  2BZ8 A;  5FU7 B;  3CC2 T;  4CC2 A;  4LD6 A;  2XKO C;  3JCM P;  1KJW A;  1Q82 C;  1K73 U;  4XTV A;  3CCV A;  1WHG A;  1AWO A;  2E41 A;  2E1H A;  1DJ7 B;  3LWI A;  2YUQ A;  3VS1 A;  2V8I A;  2AT1 B;  5LJ5 h;  5CAI A;  8AT1 B;  2E6N A;  2JJ9 A;  4RTU A;  1XNI A;  1NYG A;  2LQ8 A;  2E3I A;  5A0G A;  4PLL A;  4Z8A A;  3EG3 A;  2EYZ A;  3CCL T;  4LE9 A;  1T3S A;  2DET A;  2KRO A;  1I5L A;  4M75 B;  2L89 A;  2EYX A;  2O9V A;  2O31 A;  4N4I A;  5GAM d;  4MDX A;  1VQP A;  1B3Q A;  1OOT A;  1WHL A;  2HL3 A;  2RI5 A;  1HXD A;  1UUE A;  4IKF A;  2E12 A;  2CH4 A;  4NL2 A;  5GAN 2;  3OS2 A;  4IUV A;  2EVR A;  3QG1 A;  4XQ3 A;  3H0I A;  5FRM A;  4QQD A;  3J7A F;  2EYY A;  1H3Z A;  4OGC A;  3PIO A;  2BKD N;  2LNV A;  5IXF A;  1VOM A;  3OBW A;  1KG1 A;  1PSF A;  1N9R A;  4AFU C;  3VU3 C;  3OMC A;  3OYG A;  2YRC A;  4ZGD B;  1WFW A;  1BKB A;  2VYT A;  4E7H A;  1N9S A;  3EG9 A;  3CC2 A;  4KH0 B;  1VIF A;  1YJ9 Q;  1M1K U;  3RUX A;  2VVK A;  1Y96 B;  2BTT A;  2K3B A;  4GLM A;  2RJF A;  2I2L A;  3H6Z A;  4X1V A;  2RJD A;  1J3T A;  5CVI A;  5LJ3 j;  4RTX A;  2LCL A;  2KR3 A;  3FJ5 A;  1YBY A;  1BB9 A;  4F16 A;  2FVU A;  1A0N B;  1QWF A;  2XID A;  5LJ5 g;  1OEB A;  1N8R U;  3CCL A;  4LDX A;  4AG1 C;  2Z0W A;  4HVU A;  2QDL A;  4QKU A;  3R6N A;  2KBT A;  1F1B B;  1M3B A;  1M2O A;  3M58 A;  2CT3 A;  3UPU A;  1FYN A;  3UDC A;  1ZX6 A;  2HD0 A;  3EG0 A;  4OB0 B;  3RKW A;  2E5K A;  2QXF A;  3UA6 A;  3URG A;  3VKI A;  2EJ9 A;  3CXC P;  4BI4 A;  1UGR B;  4KUL A;  3A1P A;  1YIJ Q;  3JSC A;  3SFM A;  3PVQ A;  3CCL Q;  2VV5 A;  2DER A;  3H0H A;  4D6W A;  6AT1 B;  2QAS A;  2DK3 A;  4LUE A;  1K1Z A;  3PT9 A;  4IIO A;  1QP2 A;  3NGP A;  3QYH B;  4M78 B;  2KSS A;  2GF7 A;  4Y91 A;  2JS0 A;  3H41 A;  2RQT A;  2J6F A;  1G83 A;  5CKD A;  1ZUK A;  4CC3 A;  3JCM f;  3RNJ A;  4J9F A;  4F14 A;  1QQJ A;  4BD3 A;  3CMA T;  1SHF A;  3H0F A;  3J80 E;  2M0Y A;  4N4H A;  4F7U F;  3M57 A;  1YP5 A;  3TU4 K;  2ATC B;  3I56 T;  4ZN3 A;  3I55 Q;  4OMF B;  3LW5 E;  4HCB A;  1ARK A;  2JOY A;  1YFN A;  3I5S A;  1JO8 A;  4FSS A;  1GCQ A;  2RJE A;  3REB B;  2ZPG B;  1D3B B;  2GQV A;  3JCM W;  2FO0 A;  3SWN B;  2DBM A;  2MWO A;  4C8Q A;  2ROT A;  2YLB A;  1X69 A;  2RK2 A;  3VRY A;  1C1A A;  5CIU A;  4HT9 A;  3FB9 A;  4DBR A;  4J9E A;  3OMG A;  4OP0 A;  4E47 A;  2K5I A;  3L2W A;  2OTJ T;  4XTX A;  3SWN A;  4KUD K;  4PJJ A;  1VYT A;  4B6M A;  3ZL7 C;  4LNP A;  2G3R A;  3I5R A;  4KH1 B;  1YJW A;  1W2B P;  2G6F X;  2YRV A;  1Q82 U;  3O5Z A;  4F7U B;  2DF6 A;  3JB9 D;  2CZ0 B;  3GF5 A;  5EG2 A;  3LX7 A;  1YNZ A;  2JVV A;  4M7A A;  2PU9 B;  3L2Q A;  2QEX A;  2QAZ A;  2RJC A;  2RD1 A;  2E70 A;  2EWN A;  2AKL A;  5KCH A;  2RB6 A;  4J9C A;  4JJN K;  3A8G B;  1OV3 A;  4N0A C;  2O88 A;  4OB3 B;  3CCJ A;  3CMA A;  4M77 A;  2KVQ G;  2DMO A;  4DQ2 A;  1AT1 B;  5A2Q E;  3EGX B;  1Q86 U;  2LRQ A;  3G6E T;  5GAN h;  4XTU A;  3I56 A;  5KCO A;  1Y7X A;  1YIT A;  1ZSZ B;  2DXC A;  4ZGE B;  2DA9 A;  2X35 A;  4AT1 B;  3OYA A;  4J7F A;  1RAI B;  3EGX A;  2CDT A;  2EQJ A;  1QVF A;  2VB6 A;  2XIC A;  1AZG B;  4OGE A;  1AWX A;  3CMA Q;  1ZSZ A;  5D6Y A;  3FDR A;  4C0F A;  5FU6 C;  2AZS A;  5J3B A;  4QVZ A;  1TTH B;  2JXB A;  3I56 Q;  4J9G A;  4IUU A;  5EC7 A;  2WSF E;  2ZCF B;  4FYX B;  2JMC A;  3DLM A;  1N5Z A;  4M7D A;  2EW3 A;  3V8L A;  3LH0 A;  4KGZ B;  3MEA A;  1H64 1;  2VWF A;  3RKX A;  1G3Y A;  1OX9 A;  1CSK A;  3BE3 A;  1XTD A;  2OTL T;  5I22 A;  3KFV A;  2GGR A;  3JB9 I;  3C94 A;  2XDP A;  1G8X A;  3JAM E;  2OTJ Q;  2K57 A;  1G3S A;  4MZT A;  1W70 A;  4KRT A;  2CSI A;  3OYI A;  2OJ2 A;  1WQW A;  4NOY A;  3NTI A;  1T0J A;  1IHW A;  1BIB A;  3G6E A;  1JXO A;  3ER0 A;  1K9M U;  1SG5 A;  1GBR A;  2A3L A;  2DD4 A;  2CSQ A;  3EHQ A;  5GAN g;  3GOX A;  4LN2 A;  1S1N A;  3CCS T;  3CCE T;  1OX8 A;  2F5K A;  1TG0 A;  1W4S A;  1QP3 A;  2E6Z A;  4ESR A;  4C8Q D;  2DL5 A;  3E1S A;  2QQ9 A;  3OQ5 A;  3EFO A;  3VS0 A;  1JEG A;  5CQY A;  3JCM J;  2LJ0 A;  1NJI R;  2ZPB B;  3M0P A;  4BY6 B;  2COZ A;  1SKU B;  4J7I A;  5GAN 6;  1M90 R;  1H3H A;  4RCC A;  2HCK A;  2QA4 T;  4C8Q G;  3OYC A;  3I9Q A;  1KIK A;  4RCB A;  4CC4 B;  2KYM A;  2C0O A;  1M8V A;  1GBQ A;  1Y57 A;  3TEE A;  5FWB A;  2H3E B;  2H8H A;  4PJO B;  4BDZ A;  2ED1 A;  2RPN A;  3FJP A;  1PD1 A;  4PL6 A;  1K8A R;  1KQS P;  2KDS A;  2KT1 A;  2DO3 A;  3NFC A;  3RR6 A;  5GAO l;  1R0C B;  4DBH A;  2DD5 A;  2OTL Q;  1UTI A;  4OMM A;  4FYY B;  2BE7 D;  4F04 B;  3OS1 A;  2KYB A;  1ZUU A;  4F17 A;  1KC8 C;  1QVP A;  4OF1 A;  4KT0 E;  2H3J A;  3CCE A;  3CCS A;  3M0R A;  2Y4X A;  3V7C A;  3CC7 A;  1PC0 A;  5IN1 A;  4LDW A;  2X3W D;  1PWT A;  2D0Q B;  2M1H A;  1AWW A;  1D0X A;  2JM9 A;  1MMA A;  2EYQ A;  1MNE A;  4A4G A;  5CCA A;  1B07 A;  3EH2 A;  1GRI A;  3FEO A;  3QYG B;  4M7D D;  2RA2 A;  3G71 A;  1SSF A;  3CCS Q;  1IRX A;  3CCE Q;  1VQ7 T;  3QDF A;  3G4S Q;  4O5V A;  1PRM C;  4B9X A;  3TQ7 P;  1QKW A;  4XU1 A;  2DL8 A;  2FRY A;  3OSV A;  4PFP A;  3S3O A;  2YT6 A;  1AD5 A;  4IUR A;  4M78 C;  4JLG A;  4J8O A;  2P84 A;  2ABL A;  2LP5 A;  3RDV A;  3RKY A;  2EGC A;  1KQ1 A;  5LJ5 j;  2O4X B;  4OMQ A;  4FIB A;  2L3S A;  4RTY A;  4FU6 A;  1UEB A;  2RK1 A;  1VQK T;  2LCC A;  2XI9 A;  2LDM A;  1BCM A;  1G3W A;  2QA4 Q;  2VGN A;  2Y4Y A;  4BI3 A;  1NLP C;  4PLI A;  2KAF A;  4C92 A;  4CI0 C;  3CCV T;  1VQ9 A;  1RAC B;  3GLX A;  1PCX A;  3HSB A;  2M9U A;  7AT1 B;  4E7K A;  2YRD A;  1KD1 R;  1YJN T;  3SWN C;  3WVE B;  1PNJ A;  5KYW A;  5FW9 A;  1I0C A;  1JRI A;  3CQT A;  1LCK A;  3ZFJ A;  1N27 A;  1WHK A;  1AHJ B;  3V8K A;  1LVK A;  1TXQ A;  1WXU A;  2EGA A;  1VQP T;  3HL8 A;  5GMK l;  2HKQ B;  5LJ3 e;  4M7A C;  1K9A A;  1QMC A;  3TCJ A;  3E19 A;  2RH2 A;  4OMP A;  2JM8 A;  1K76 A;  1VQ7 A;  1NJI C;  2LTO A;  1VQN T;  3PMT A;  1E6G A;  4M77 C;  1CKA A;  4XU0 A;  1WI7 A;  1G3T A;  1IRE B;  2J7I A;  2V1Q A;  3M0T A;  4A4E A;  4IUT A;  1WIE A;  5GJV B;  5KYU B;  1D1A A;  1OU8 A;  3V7R A;  1M30 A;  4JDS A;  2CH4 W;  1I07 A;  4JS4 A;  3GBQ A;  3CCU Q;  2B8A A;  3QZ9 B;  2OAW A;  1K8A C;  3REA B;  1Y07 A;  2IG0 A;  2JUF A;  5HKC A;  1ZSZ C;  2BE9 B;  3FLG A;  1R0B G;  3VJP A;  4YTL A;  2RI3 A;  1QCO A;  1YJN A;  5LJ3 f;  4LD9 K;  5KYX B;  3MP1 A;  3OYY A;  3JB9 F;  2C0T A;  4FL6 A;  4M7D C;  3MCA B;  5GAO q;  1VQK Q;  1M9S A;  1M2V B;  4GLK A;  9ATC B;  4HCZ A;  3MHX A;  1QW1 A;  3CBO A;  4HCK A;  5D7U A;  2LT1 A;  1Q81 R;  4Z02 A;  3CXC S;  3CCV Q;  2RO0 A;  1FMW A;  3OS5 A;  5CR2 A;  4RTW A;  3VS7 A;  1IXD A;  2PVD B;  4LXC A;  1BU1 A;  3H9N A;  3GP8 A;  1MV3 A;  5GAM h;  4M75 A;  1VQN A;  3EGD B;  4J9I A;  2FPE A;  4BUG A;  2LVM A;  3A98 A;  4KUI A;  1TWB A;  2MAM A;  3S6W A;  3M0Q A;  1YWP A;  3BFM A;  4J6Y A;  3JCM c;  3QXE B;  4BDY A;  1YHQ T;  1VQP Q;  1OI1 A;  1YCS B;  3L2R A;  4J9D A;  2XDD A;  1PSE A;  2KEA A;  2IPO B;  2X4Y A;  3ASK A;  3EH1 A;  4KGX B;  1KK7 A;  2XU8 A;  2ED0 A;  4C0G A;  3MKD A;  1ZUY A;  2O9S A;  1K0S A;  1NEB A;  3UA7 A;  2ROL A;  4DOW A;  2BZX A;  4QT7 A;  4R56 A;  1RL2 A;  2KMT A;  3VUZ A;  2AIR B;  2DEQ A;  2XG8 D;  2NUT B;  4HXJ A;  1OZ2 A;  1BI0 A;  1MMD A;  4O6J A;  2MWP A;  3E2U A;  1Y96 A;  3GNF B;  1MHN A;  4WTO B;  2JTE A;  1IZ6 A;  4RTV A;  1NEG A;  2ZPF B;  1M1F A;  1WDX A;  3L2Z A;  5AYF A;  2DKG A;  3JCM e;  2I0N A;  1KD1 C;  3CC2 Q;  3C0C A;  3MEW A;  3FC3 A;  2FG0 A;  4JJC A;  1KFZ A;  2DJZ A;  4CRI A;  1WJQ A;  3ULR B;  2EYW A;  2FHD A;  2DXU A;  3OY9 A;  3NTK A;  3RER A;  1ABO A;  1PKS A;  1R77 A;  2D0N A;  4EIK A;  1W2B S;  5GJW B;  4C8Q E;  3A8M B;  4FT2 A;  3TVT A;  1TH7 A;  3CCM A;  2JNG A;  3DB4 A;  3OW2 P;  5GAO m;  3AHU A;  4JRK A;  1SPK A;  1SEM A;  1YJW T;  4N4G A;  4JRI A;  3P8B B;  5GAM g;  4DOV A;  4PJO C;  2K3X A;  2O01 E;  1YHQ A;  1Q7Y R;  1IGQ A;  1ZA2 B;  1MGQ A;  2CP0 A;  5M9O A;  3OA6 A;  5GAN j;  1U5S A;  2DZ9 A;  4C8Q F;  3QZ5 B;  4L5G A;  2QEX T;  2COY A;  1W1F A;  1G5V A;  1OYX A;  1VQ5 T;  3OBY A;  4M7A E;  4UC4 A;  5HCK A;  5I11 A;  5J26 A;  4JS5 A;  3M54 A;  4OMN A;  3CCJ T;  2EIF A;  2YSQ A;  1M27 C;  1VQL T;  3UT1 A;  3OYF A;  1AEY A;  4M78 A;  4M77 E;  1YHQ Q;  3UAT A;  2L2P A;  1SSH A;  1YIT T;  1PD0 A;  4HT8 A;  2JTM A;  1ZBJ A;  3QII A;  2LJ1 A;  2RHY A;  2QQB A;  5HK3 A;  2MYS A;  1M90 U;  2FL7 A;  1XOV A;  1M5Q 1;  1M3C A;  4RTZ A;  1JU5 C;  4XAX B;  4C5I A;  3CEY A;  1Q81 C;  3QHS A;  2X4J A;  4A4F A;  2LQW A;  1D3B A;  5LJ3 d;  3THK A;  1VQ4 T;  3X28 B;  5GAO n;  5CKB A;  4XTZ A;  1W6X A;  2VC8 A;  1K8A U;  1X43 A;  2A7Y A;  3ZBD A;  2HSP A;  4J83 A;  2DX1 A;  1V29 B;  2ZGW A;  1WHJ A;  2DRM A;  1GXI E;  3HTR A;  1P92 A;  3L2U A;  2FPF A;  3S3M A;  4C92 C;  4M7D E;  1IB8 A;  1U1T A;  2NWM A;  3OYM A;  5LL6 S;  3BDU A;  4BE0 A;  1WJR A;  2EPD A;  1HD3 A;  1UJ0 A;  1NG2 A;  2JN0 A;  8ATC B;  4MZP A;  2CKK A;  4LDU A;  4F7U A;  4AFQ C;  1UB4 A;  1VQ5 A;  1WHH A;  2RQR A;  3OYH A;  1WQ7 A;  1GFC A;  1YJW Q;  2M51 A;  1QWE A;  2QDY B;  2RHI A;  4HKE A;  3UWN A;  3VS4 A;  1VQL A;  2O2O A;  4Z88 A;  5I2M A;  1RAF B;  2LC4 A;  3QWY A;  3JB9 G;  4M7D F;  1KC8 R;  2LX7 A;  3E9G A;  2DEU A;  1U06 A;  3WXM B;  4D8K A;  4K11 A;  1QKX A;  2DM1 A;  5DLO A;  1TU0 B;  2QEX Q;  3ZEH A;  2V1R A;  1PG5 B;  4C0D C;  3PNW C;  3FRN A;  1X2K A;  3CCJ Q;  2F1L A;  4QQ6 A;  2X4X A;  4EMH A;  2QQA A;  4XK8 E;  2PVO B;  4ELZ C;  1VQ4 A;  2DZC A;  3L42 A;  3PFS A;  4OML A;  2SEM A;  3OYK A;  1MMN A;  1YIT Q;  1UG1 A;  4DBQ A;  1BK2 A;  1MV0 B;  1NE8 A;  4ELY C;  2R58 A;  1QVG P;  3EG1 A;  1O9S A;  2WSC E;  3CCR A;  1Y71 A;  3VS5 A;  4QQG A;  3G7Z A;  2HNI A;  3HFN A;  2CP2 A;  1KQS S;  3JRZ A;  5FU7 C;  2QK0 A;  2K2V A;  1UE9 A;  3RBB B;  1H8K A;  3A8L B;  1Q7Y C;  1KD1 U;  4PNO A;  3OS0 A;  2X51 A;  5GMK e;  3PMI A;  2RI2 A;  4PKC C;  3HRT A;  3M56 A;  5HY6 A;  1I5O B;  2DIQ A;  4AMC A;  2YLC A;  5CKF A;  1Z9Q A;  3RES A;  1BI3 A;  1U1S A;  5L23 A;  2BIV A;  1K4U S;  3JCM b;  4BB7 A;  2BZY A;  3MEV A;  4M78 D;  3NHN A;  1WXT A;  2D6F A;  1UHF A;  2DPP B;  1HYO A;  1UFF A;  1XQH A;  2QG9 B;  2QYZ A;  3QBY A;  3R6O A;  5LJ5 e;  4PJO E;  4M75 C;  3MO8 A;  2MF2 A;  4KGV B;  2HBP A;  3EFR A;  4ANJ A;  3JCM d;  1X2Q A;  1B34 B;  4BE1 A;  1ABQ A;  3CC7 T;  2COW A;  1GFD A;  4QVC A;  2K7A A;  3G6E Q;  5IAY A;  2LX9 A;  3ME9 A;  3HPW A;  1RLP C;  4XU3 A;  2YHT A;  3SDZ A;  2ECZ A;  4M78 G;  2DYB A;  5FRN A;  3M4Y A;  2L3R A;  1U8R A;  1NPR A;  2YWW A;  2JW4 A;  4IIM A;  1JB0 E;  2X9H A;  2KXC A;  3A8H B;  3G71 T;  2A37 A;  2VUB A;  1N6A A;  1K0X A;  4DEX A;  3CXC A;  3NMZ C;  2RHZ A;  4HVV A;  4C0Z A;  1BIA A;  4M7A D;  1X27 A;  2RNA A;  2K2M A;  2VGM A;  5LJ5 f;  2XDB A;  2KE9 A;  2HBW A;  1HK9 A;  3HRS A;  5A0L A;  4M77 D;  3X26 B;  1TUD A;  3VYH B;  2LT4 A;  4HVW A;  3M55 A;  4JRQ A;  2A36 A;  4JJB A;  2KGT A;  4PJO A;  1VQ9 T;  2D1X A;  2MPX C;  5IHI A;  2NUP B;  3QJ6 A;  2MMP A;  2P4T A;  1XJW B;  4C92 E;  1TUG B;  4Z89 A;  4M7A G;  1T3L A;  1ZA1 B;  2EJG A;  3GIB A;  1X6B A;  3MEU A;  2K6D A;  2HQH A;  2AKK A;  3EFS A;  1RAB B;  4IUQ A;  4M77 G;  2MOX A;  4RG2 A;  1M8M A;  4CC7 A;  5C0M A;  5HK0 A;  1MMG A;  3DLL A;  4X9D A;  3CME A;  1IHV A;  2V8J A;  4M4Z A;  2JTF A;  2AK5 A;  1M1K C;  3JCM g;  1WZO A;  1NZ9 A;  4ME7 A;  2DL7 A;  2GCX A;  2CP3 A;  2HEQ A;  2CYZ B;  3CPF A;  1Q86 R;  1ZSG A;  1VQ8 A;  2J06 A;  3CC7 Q;  1D09 B;  1W2B A;  2M0O A;  2NLU A;  2YUO A;  4FM4 B;  4EMK B;  1AVZ C;  3Q1J A;  1WX6 A;  3LGL A;  4AFZ C;  1D0Y A;  3G71 Q;  1N8R C;  2VXE A;  4M7D G;  3V7S A;  4EMK A;  1EZZ B;  2C0I A;  5IHN A;  2O4X A;  5FRO A;  2DL4 A;  3LYI A;  2GQI A;  4J6X A;  4LUD A;  4OMO A;  3JCM X;  2QI2 A;  5AT1 B;  3OYJ A;  2E5Q A;  4R0K A;  2C06 A;  1VYU A;  3QUI A;  3RMQ A;  4A63 B;  4WF2 A;  5GAM j;  3CBP A;  1WJS A;  2K79 A;  3P8D A;  2CGH A;  5KYY B;  4DA4 A;  2L8D A;  2JMA A;  2VKN A;  1VIE A;  3LLR A;  1Q7Y U;  3SB2 A;  2QQR A;  1VQ9 Q;  2OI3 A;  4NL3 A;  1AOJ A;  5GAO r;  1WLP B;  2K5L A;  1G2B A;  1BYM A;  4EDU A;  1JJ2 S;  5KYY A;  1PRL C;  2QGG A;  2FZC B;  2R57 A;  2OX7 A;  3C95 A;  5DLQ E;  4M75 E;  2CUD A;  2X4W A;  3CC4 T;  5KE2 A;  1C0M A;  2P0Q A;  5FWC A;  3PTA A;  2E10 A;  1I1J A;  1YJ9 T;  2CP5 A;  2DIG A;  2EAY A;  2GFA A;  4PFO A;  1FMK A;  1X75 C;  2IIM A;  2K3Y A;  1R8O B;  1VQ7 Q;  5D6W A;  1UJY A;  5KYU A;  5GAN 8;  2L3P A;  1WPY A;  4PJO D;  4ATO A;  4RKU E;  1VQO T;  1I81 A;  1VQM T;  4FYW B;  5GMK h;  1Q95 G;  4ZTF A;  1VQ6 T;  1WXB A;  1LJO A;  1EIF A;  5LJ5 d;  4AFS C;  1KHI A;  2B86 A;  1VYV A;  2HMA A;  2AZV A;  2A28 A;  2YUN A;  3O8V A;  5KYX A;  4VUB A;  3OW2 S;  1QVF P;  3M53 A;  2WSE E;  4PJO G;  1S72 T;  2DFU A;  4JLI A;  1M2V A;  3CCM T;  1YJN Q;  1YIJ T;  4A54 A;  2RQW A;  4EMG A;  1AWJ A;  2JZ2 A;  3L2V A;  4WCI A;  2P0K A;  1HJD A;  2J6K A;  1JJ2 P;  2K9G A;  2RN8 A;  2PQW A;  2FRW A;  1X01 A;  4E7J A;  1Q86 C;  3CC4 A;  3DB3 A;  1T0H A;  4ZNX A;  1KC8 U;  1YJ9 A;  3EGD A;  5I21 A;  1FMV A;  4OB2 B;  4A4H A;  5GAN f;  1UEC A;  4MZM A;  1HSQ A;  2KT8 A;  2X3X D;  5IH2 A;  2EGE A;  3DKM A;  4X34 A;  3EG9 B;  5CKE A;  1VA7 A;  1VQN Q;  1JQQ A;  1NPP A;  2DJQ A;  2LZ6 B;  4C92 D;  1KQS A;  2GTJ A;  3VS3 A;  1VQO A;  1VQM A;  3I55 T;  1VQ6 A;  4RG8 A;  4C5E A;  3TSZ A;  3CC4 Q;  2E4H A;  4RTT A;  4TVR A;  3OYN A;  4DBF A;  1NYF A;  5ECA A;  3HRU A;  5GAN 7;  2QTX A;  2EQI A;  2DRK A;  4M78 E;  5KE3 A;  3JV3 A;  4E7Z A;  3TRE A;  1OPL A;  2LNH B;  1X6O A;  1E7O A;  4Y28 E;  2NUT A;  4JZ4 A;  3F70 A;  2RHU A;  4JPB W;  3PGG A;  1PHT A;  2EFI A;  4BY6 C;  1GL5 A;  3MJX A;  2FZG B;  5CO7 A;  1S72 A;  3T9N A;  4C92 G;  1VQO Q;  1VQM Q;  1NM7 A;  1VQ6 Q;  3EG2 A;  3GNG A;  1YIJ A;  2Y90 A;  2D8J A;  3CCQ T;  4MDW A;  1U3O A;  3MP6 A;  1UGS B;  2QTV A;  4M78 F;  5GAN 5;  3QWX X;  2DTO A;  1ZHI A;  2V26 A;  1ZLM A;  2A08 A;  5A0D A;  3WVD B;  2CZ7 B;  1FWZ A;  2GBQ A;  1K9M C;  5IHK A;  5GAO p;  1S72 Q;  1RI9 A;  3CCM Q;  2CRE A;  4A53 A;  2DAQ A;  3SEM A;  2M02 A;  2AHJ B;  2DNU A;  2DXT A;  4F7U E;  2NYS A;  3QO3 A;  4ZTJ A;  3KBG A;  3I55 A;  2V8K A;  3J81 E;  3QPH A;  2VXF A;  4PJL A;  1NJI U;  3MP8 A;  1UGP B;  1OPK A;  1KSW A;  2EKO A;  4LDY A;  5GAN 4;  3D7S B;  1UGQ B;  2QQS A;  1D0Z A;  3JB9 J;  4M7A F;  3PIP A;  4BE2 A;  2W10 A;  3CBM A;  1RAG B;  3VS6 A;  3FIF A;  4C8Q B;  3G1J A;  4P5N A;  1BI1 A;  4NS5 A;  3CPW S;  4R55 A;  3MET A;  2HL5 C;  2M16 A;  3OSS C;  1QVG S;  2MCN A;  1TUC A;  4M77 F;  3CCQ A;  1UGV A;  4M75 D;  1M3A A;  2KI7 A;  1Y0M A;  2F2X A;  2HQX A;  1K73 R;  2CT4 A;  2LQK A;  1TSF A;  4E6R A;  4EMK C;  3CCR T;  5LJ3 h;  1WYX A;  4FCY A;  2YUP A;  4FYV B;  2RMO A;  1YWO A;  4FSX A;  4B9W A;  4Y92 A;  2DL3 A;  4LDV A;  1O75 A;  3RIR A;  2KK4 A;  1M4Z A;  4GBQ A;  4M7A B;  3M0S A;  2HAX A;  4FW2 A;  2NUZ A;  3CCQ Q;  2L3Q A;  2RQV A;  3M4G A;  3HFO A;  2HSE B;  4QVD A;  3BDL A;  2ZPI B;  3QJY A;  1RUW A;  2EQM A;  4M75 G;  2A0F B;  3VUB A;  1RI0 A;  1V1C A;  1PKT A;  4J6W A;  4M77 B;  5GMK m;  2PNI A;  2ZZD A;  4AG2 C;  1FX7 A;  2ENM A;  2E65 A;  3I35 A;  5J39 A;  5GAN d;  2R5A A;  3LH5 A;  3C12 A;  2RHX A;  1VQ5 Q;  1MND A;  2CP7 A;  2L0A A;  3C4S A;  1ACM B;  2EBP A;  1H92 A;  4JZ3 A;  2EQU A;  2GFU A;  5KH6 A;  1C6V X;  1WHM A;  2PUO B;  1VQL Q;  1RAA B;  4ORZ A;  2DXB A;  3P8H A;  1AZE A;  1YCY A;  3M5A A;  1TS9 A;  1M1K R;  3JCM Q;  2LCS A;  1QLY A;  1YN8 A;  3RMS A;  3CPW P;  4FW1 A;  1UHC A;  4A4K A;  2SRC A;  4QW2 A;  1M1G A;  4M7D B;  4HA8 A;  4PFZ A;  2LQN A;  2FYK A;  2D9T A;  2OTJ A;  2CZ6 B;  3MPU B;  3NTH A;  2RM4 A;  3LWH A;  2GTO A;  3QKJ A;  5LJ3 g;  2JS2 A;  4ZN1 A;  1JJ2 A;  1VQ4 Q;  3KXT A;  3S3N A;  1N8R R;  4JUV A;  1SHG A;  2FPD A;  3V8J A;  3EGU A;  4L6V 5;  5I2S A;  3CCR Q;  1B7T A;  2F69 A;  1SF9 A;  2JT4 A;  2KRN A;  3X20 B;  4IUP A;  2KNB B;  4E2F B;  4D8D A;  2HZY A;  1Z9Z A;  2DYI A;  3CD6 T;  1WGS A;  3BW1 A;  1D1C A;  1NBE B;  1FXX A;  1OU9 A;  2VAS A;  1PM3 A;  1BBZ A;  4Q5W A;  3VV0 A;  3JCM V;  5CK9 A;  2CS7 A;  5FLX E;  3EFO B;  4ZGJ B;  3JCM h;  4V2S A;  3KUF A;  1B34 A;  3G4S T;  3GPL A;  2DLP A;  2HDA A;  4PJO F;  3CME T;  3LGF A;  2K5F A;  5GAM e;  2HQE A;  4KBM B;  1D1B A;  2ZAE A;  1VUB A;  1K73 C;  3OW2 A;  2GNC A;  1VQ8 T;  3INZ A;  2DBK A;  1YI2 T;  3JB9 H;  3EHR A;  4RUG A;  1BI2 A;  3VYG A; 
#chains in the Genus database with same CATH homology
 3PE0 A;  2FG0 A;  2DMO A;  1UDL A;  4JJC A;  1KFZ A;  3ULR B;  2EYW A;  3NPF A;  2CUD A;  1ABO A;  1PKS A;  2D0N A;  4EIK A;  5GJW B;  2EKH A;  3TVT A;  5FWC A;  2DA9 A;  2W0Z A;  1I1J A;  3SHW A;  1FMK A;  1SPK A;  1JXM A;  1SEM A;  2IIM A;  2CDT A;  1AZG B;  1AWX A;  1UJY A;  2RF0 A;  2L3P A;  2DIL A;  2AZS A;  3TSW A;  2RQU A;  2JXB A;  1U5S A;  1WXB A;  4J9G A;  5EC7 A;  2JMC A;  2MIO A;  1W1F A;  1N5Z A;  2EW3 A;  4AFS C;  2LMJ A;  5HCK A;  5I11 A;  2B86 A;  3IQL A;  2VWF A;  4J9H A;  4OMN A;  1VYV A;  1CSK A;  2FEI A;  2YSQ A;  1M27 C;  2AZV A;  2A28 A;  1CKB A;  2YUN A;  5I22 A;  3KFV A;  2GGR A;  1AEY A;  1SRL A;  3U23 A;  3UAT A;  2XMF A;  2L2P A;  2CUB A;  1SSH A;  4DEY A;  1W70 A;  1ZBJ A;  2RQW A;  2LJ1 A;  4KRT A;  2CSI A;  1XOV A;  1AWJ A;  2OJ2 A;  3M0U A;  1M3C A;  4WCI A;  1SRM A;  1T0J A;  4RTZ A;  1HJD A;  3VS2 A;  2J6K A;  2ESW A;  1JXO A;  2K9G A;  2LJ3 A;  2RN8 A;  1JU5 C;  2YDL A;  2FRW A;  1GBR A;  2KRS A;  1T0H A;  4ZNX A;  2J05 A;  2LQW A;  3THK A;  2CSQ A;  1UEC A;  3EHQ A;  2PZ1 A;  2KT8 A;  1HSQ A;  1GCQ C;  1W6X A;  1S1N A;  3PVL A;  4LN2 A;  2X3X D;  1X43 A;  5IH2 A;  2EGE A;  2HSP A;  2DVJ A;  1TG0 A;  2DX1 A;  4ESR A;  2P4R A;  1VA7 A;  2DRM A;  1JQQ A;  2DJQ A;  2DL5 A;  2LZ6 B;  1WA7 A;  2FPF A;  4JJD A;  2NWM A;  3VS0 A;  2GTJ A;  3VS3 A;  1JEG A;  2F2W A;  3TSZ A;  2LJ0 A;  2EPD A;  1HD3 A;  4RTT A;  1UJ0 A;  1GCP A;  1NG2 A;  1MUZ A;  1NYF A;  3M0P A;  5ECA A;  4AFQ C;  2EQI A;  2DRK A;  2RQR A;  3JV3 A;  3VRZ A;  1GFC A;  1QCF A;  1OPL A;  1IO6 A;  2LNH B;  2F2V A;  1H3H A;  2M51 A;  1QWE A;  1RLQ C;  2HCK A;  1E7O A;  3VS4 A;  4JZ4 A;  1E6H A;  2KXD A;  2O2O A;  4Z88 A;  4JPB W;  2D8H A;  3UF4 A;  3I9Q A;  1KIK A;  1PHT A;  3QWY A;  4CC4 B;  1GL5 A;  2KYM A;  2C0O A;  1GBQ A;  1Y57 A;  2LX7 A;  2J6O A;  1U06 A;  1NM7 A;  5FWB A;  4D8K A;  2KRM A;  2H8H A;  5IXB A;  4K11 A;  1QKX A;  1EFN A;  2DM1 A;  2ED1 A;  2RPN A;  3EG2 A;  1NLO C;  2D8J A;  1U3O A;  2V1R A;  2KT1 A;  1X6G A;  1X2K A;  3QWX X;  1ZLM A;  2A08 A;  2PTK A;  1UTI A;  4OMM A;  2GBQ A;  4J9B A;  5IHK A;  2DE0 X;  2KYB A;  1ZUU A;  4F17 A;  4OML A;  2SEM A;  1RI9 A;  2BZ8 A;  1UG1 A;  1BK2 A;  1MV0 B;  2CRE A;  3M0R A;  3SEM A;  4CC2 A;  3EG1 A;  1KJW A;  3VS5 A;  2DNU A;  1AWO A;  2X3W D;  1PWT A;  2YUQ A;  3VS1 A;  1AWW A;  2JM9 A;  4RTU A;  1UE9 A;  3RBB B;  1H8K A;  1NYG A;  1B07 A;  1GRI A;  1OPK A;  1KSW A;  4Z8A A;  3EG3 A;  2EYZ A;  4LE9 A;  1T3S A;  1PRM C;  1QKW A;  2KRO A;  1Z9Q A;  2DL8 A;  2FRY A;  2EYX A;  2O9V A;  2O31 A;  2W10 A;  5L23 A;  2YT6 A;  1AD5 A;  3VS6 A;  1K4U S;  1B3Q A;  1OOT A;  2BZY A;  3NHN A;  1WXT A;  1UUE A;  2ABL A;  1UHF A;  2CH4 A;  2LP5 A;  2MCN A;  2EGC A;  1TUC A;  1UFF A;  2EVR A;  4OMQ A;  3H0I A;  2L3S A;  1UGV A;  4RTY A;  2EYY A;  1M3A A;  1Y0M A;  2F2X A;  5IXF A;  2CT4 A;  1X2Q A;  4E6R A;  1ABQ A;  1NLP C;  1GFD A;  1WYX A;  2K7A A;  4AFU C;  2YUP A;  2RMO A;  1YWO A;  4Y92 A;  2DL3 A;  1RLP C;  1WFW A;  2ECZ A;  2DYB A;  4GBQ A;  3M0S A;  1PNJ A;  2NUZ A;  2JW4 A;  2L3Q A;  2RQV A;  2VVK A;  4IIM A;  5FW9 A;  2BTT A;  1I0C A;  2K3B A;  2KXC A;  2A37 A;  4GLM A;  1RUW A;  3CQT A;  1LCK A;  1K0X A;  4DEX A;  1V1C A;  3NMZ C;  1PKT A;  4X1V A;  4HVV A;  2PNI A;  1J3T A;  1WXU A;  2EGA A;  4RTX A;  4AG2 C;  2KR3 A;  1K9A A;  2ENM A;  3FJ5 A;  1X27 A;  2RNA A;  1BB9 A;  4F16 A;  2K2M A;  3I35 A;  1A0N B;  4OMP A;  2JM8 A;  1QWF A;  1K76 A;  1OEB A;  2KE9 A;  3LH5 A;  2HBW A;  4AG1 C;  4HVU A;  2L0A A;  1E6G A;  2QDL A;  3R6N A;  2KBT A;  1TUD A;  1CKA A;  2EBP A;  1WI7 A;  1H92 A;  1M3B A;  4HVW A;  4JZ3 A;  2J7I A;  2V1Q A;  3M0T A;  2A36 A;  2CT3 A;  4JJB A;  2KGT A;  1FYN A;  2D1X A;  1WIE A;  5GJV B;  1ZX6 A;  3EG0 A;  4ORZ A;  5IHI A;  2E5K A;  3UA6 A;  1M30 A;  1AZE A;  4Z89 A;  1T3L A;  2LCS A;  1QLY A;  2CH4 W;  1I07 A;  1X6B A;  1YN8 A;  3GBQ A;  1UHC A;  2SRC A;  2K6D A;  3PVQ A;  2OAW A;  2AKK A;  3REA B;  2LQN A;  3H0H A;  2MOX A;  1M8M A;  1K1Z A;  4LUE A;  4CC7 A;  4IIO A;  3NGP A;  2GTO A;  2JS2 A;  2JS0 A;  3H41 A;  2C0T A;  2RQT A;  2J6F A;  1G83 A;  4M4Z A;  2AK5 A;  1ZUK A;  4CC3 A;  1SHG A;  3RNJ A;  4J9F A;  2DL7 A;  2FPD A;  4F14 A;  4HCK A;  2HEQ A;  3EGU A;  1ZSG A;  1SHF A;  3H0F A;  2J06 A;  2M0Y A;  2JT4 A;  2KRN A;  1YP5 A;  4RTW A;  2YUO A;  3VS7 A;  1AVZ C;  2KNB B;  1WX6 A;  1BU1 A;  4D8D A;  1ARK A;  1Z9Z A;  3I5S A;  1JO8 A;  1MV3 A;  4FSS A;  4AFZ C;  1GCQ A;  3REB B;  4J9I A;  2FPE A;  2FO0 A;  3A98 A;  2DBM A;  2ROT A;  1X69 A;  3M0Q A;  3VRY A;  1YWP A;  2C0I A;  1BBZ A;  4J9E A;  5IHN A;  2DL4 A;  2GQI A;  1YCS B;  4J9D A;  4LUD A;  4OMO A;  2KEA A;  1VYT A;  3ZL7 C;  4LNP A;  3I5R A;  4R0K A;  2G6F X;  1VYU A;  3O5Z A;  2DLP A;  2HDA A;  4A63 B;  2ED0 A;  2DF6 A;  1ZUY A;  2O9S A;  2K79 A;  1K0S A;  1NEB A;  3UA7 A;  2ROL A;  2BZX A;  2JMA A;  4QT7 A;  2VKN A;  2GNC A;  1YNZ A;  4HXJ A;  2DBK A;  2OI3 A;  1AOJ A;  1WLP B;  1G2B A;  2JTE A;  3EHR A;  2AKL A;  4RTV A;  1NEG A;  4J9C A;  4RUG A;  1WDX A;  1OV3 A;  1PRL C;  2I0N A;  2O88 A;  3C0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...