4Y92A

Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain e97t-q128r mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
MTFVALYDYESRTTTDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein-tyrosine kinase
publication title Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain E97T-Q128R mutant
rcsb
source organism Avian sarcoma virus pr2257/16
molecule tags Transferase
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4y92A00
2CUBA 4LE9A 2ABLA 1OEBA 2DL4A 2NUZA 1ZUYA 3I9QA 1CKAA 2EGAA 1X27A 1WX6A 4FSSA 1Y0MA 2PTKA 1PRLC 4ZNXA 2K2MA 2C0TA 4Y92A 4ORZA 2DL3A 2A37A 5EC7A 1M27C 1UHCA 1MUZA 2C0OA 2DA9A 1HSQA 2EPDA 2F2XA 2DF6A 1AEYA 2KT1A 2KYMA 4DEYA 1PRMC 2HEQA 1JEGA 5ECAA 2O9VA 4Z89A 1K9AA 2EGEA 5I11A 2DL5A 4AFUC 3UA6A 5IHIA 3VS1A 1AVZC 1GCPA 4CC2A 2DBMA 2G6FX 2I0NA 4OMPA 2KE9A 2FO0A 3H0IA 4LUDA 2JTEA 1ABQA 2JM9A 1TUCA 2V1QA 2A36A 2L3PA 4RTZA 3ULRB 1YNZA 4AG2C 2CDTA 4AFSC 5IHNA 2CT3A 1YWOA 4M4ZA 1UE9A 1ZSGA 1RLQC 2LNHB 1OPLA 2QDLA 2EKHA 4OMLA 1U06A 2F2WA 3JV3A 1GL5A 3H0HA 3NMZC 2JS2A 4QT7A 1S1NA 1H8KA 2RNAA 1WDXA 1GCQA 2LZ6B 2ENMA 1UJ0A 1Y57A 1KJWA 2YDLA 4JJCA 3REAB 3VRYA 1UJYA 1Z9ZA 3QWXX 1RI9A 1NLPC 2JS0A 2X3XD 2V1RA 2K9GA 1UG1A 3EHRA 4J9FA 2ROLA 4RTVA 1UTIA 1T3LA 2RF0A 4CC4B 1PWTA 2W10A 2KYBA 1GFDA 2LMJA 2NWMA 4OMOA 1WI7A 5FWBA 4D8KA 3VS0A 2AKLA 1CKBA 2RQVA 1EFNA 1NM7A 2YUQA 1ZBJA 2E5KA 3M0SA 1KFZA 3TVTA 4J9HA 2HSPA 1TG0A 1AZGB 5GJVB 2MOXA 4GLMA 1QCFA 5L23A 4J9DA 5IXBA 2CUDA 2SEMA 1JXOA 1V1CA 2HCKA 1NYGA 4IIOA 4LN2A 4CC3A 1SRMA 3M0QA 3TSWA 2ED0A 4LUEA 3M0TA 3UA7A 2KEAA 1AD5A 1WXTA 4F16A 4JPBW 2KBTA 2SRCA 1UFFA 5IH2A 1QLYA 1WIEA 2EVRA 2JW4A 1TUDA 3EGUA 3VS6A 1BBZA 3PVLA 4RUGA 1GBQA 2D1XA 2DL7A 1X6GA 4OMMA 4K11A 2W0ZA 4J9IA 1U3OA 2H8HA 3SHWA 4A63B 3EHQA 2K6DA 1RUWA 1WA7A 5IHKA 2ROTA 4LNPA 1ZUKA 4WCIA 1M30A 1CSKA 2DM1A 1NYFA 2AZSA 2PNIA 1PKTA 1K1ZA 3NPFA 2KR3A 1WYXA 2DL8A 2DYBA 2VKNA 1YWPA 1I07A 2J6FA 2YUPA 3EG2A 2KRNA 1K0SA 2BZXA 4KRTA 1KIKA 1YP5A 5IXFA 1PNJA 2JXBA 3VS2A 2KGTA 4IIMA 1UGVA 2EQIA 3NHNA 2LP5A 2O2OA 1OV3A 2LJ0A 2JMCA 2KXCA 2KXDA 1UHFA 2LJ3A 2J6OA 2C0IA 2ESWA 2PZ1A 3VS3A 3TSZA 1VYUA 1M8MA 2J6KA 2KNBB 1H92A 3A98A 1ZLMA 1BU1A 1WLPB 1UUEA 1SSHA 2CH4A 2CSQA 1JU5C 2DRMA 1AOJA 2FPFA 1ABOA 1FYNA 1HD3A 1QWFA 4CC7A 4AFQC 2DILA 1MV3A 1PKSA 1M3CA 4JJBA 1H3HA 2DRKA 3QWYA 2RPNA 2DVJA 1AZEA 2EGCA 4ESRA 2BZYA 3SEMA 2RQRA 4GBQA 3NGPA 4Z8AA 1SHGA 2RQWA 2BZ8A 3M0PA 1OOTA 2D8JA 3H0FA 3PVQA 4JZ4A 1J3TA 2M0YA 1AWJA 1G2BA 1NG2A 3EG0A 4RTUA 2RN8A 3VRZA 2FG0A 2DNUA 2KROA 1K4US 3H41A 2J05A 2EYYA 4JJDA 2EW3A 2CREA 2GTJA 5FWCA 3VS5A 1AWOA 4RTYA 2DX1A 1YCSB 1E6GA 1T3SA 2LQWA 5I22A 1Z9QA 1YN8A 2BTTA 3I35A 2LQNA 2CSIA 2RMOA 1W70A 2GTOA 1XOVA 2GBQA 2J06A 1JO8A 1PHTA 2VVKA 2ECZA 1SPKA 1QKXA 1T0HA 4HVUA 3I5SA 3THKA 1FMKA 1AWXA 2HDAA 1UECA 1SEMA 2O31A 2A28A 2YSQA 1GRIA 3M0UA 4RTXA 5FW9A 1NEBA 1JQQA 1A0NB 2CT4A 1K76A 2RQTA 2AZVA 2GGRA 1M3AA 4RTWA 3VS4A 5HCKA 4F17A 2FEIA 2JT4A 1X69A 1U5SA 2LX7A 3REBB 1AWWA 1B07A 1NEGA 2OJ2A 3EG1A 3RBBB 1MV0B 2K79A 4AFZC 2O88A 2AK5A 1BB9A 2K7AA 4J9EA 1VA7A 2D8HA 2DMOA 2FRWA 1B3QA 1QWEA 1I1JA 1N5ZA 2YT6A 1VYTA 2OAWA 4E6RA 4J9BA 4DEXA 1I0CA 2DE0X 1X6BA 2GQIA 2FPDA 1SHFA 4F14A 1X2QA 4HVWA 3I5RA 1X2KA 3LH5A 1ARKA 2L3QA 4OMNA 2FRYA 3VS7A 2KRSA 3RNJA 1T0JA 1ZUUA 1WFWA 5GJWB 1WXBA 3U23A 1JXMA 4X1VA 1E7OA 2B86A 2O9SA 2AKKA 3UF4A 1UDLA 4HCKA 4J9GA 1GBRA 2DBKA 3FJ5A 2JM8A 3R6NA 4HXJA 2P4RA 2LJ1A 2MIOA 2IIMA 2J7IA 2DLPA 2YUNA 2M51A 3CQTA 3O5ZA 1NLOC 3ZL7C 1K0XA 2KT8A 2JMAA 2RQUA 2K3BA 2GNCA 1W1FA 1BK2A 2HBWA 2VWFA 4D8DA 4J9CA 2D0NA 3KFVA 4HVVA 2FPEA 1GFCA 1RLPC 1OPKA 2EBPA 2OI3A 2YUOA 1IO6A 3C0CA 3PE0A 2MCNA 2L3SA 1VYVA 2EYXA 3GBQA 1GCQC 2ED1A 1M3BA 4JZ3A 2LCSA 1W6XA 4AG1C 1X43A 2KRMA 1E6HA 4OMQA 2X3WD 2CH4W 2A08A 2L0AA 2F2VA 4RTTA 1SRLA 4EIKA 1ZX6A 2EYZA 3UATA 3M0RA 4Z88A 1HJDA 4R0KA 1KSWA 2EYWA 1LCKA 1G83A 2DJQA 2XMFA 3IQLA 2L2PA 3EG3A 1QKWA 1WXUA
chains in the Genus database with same CATH superfamily
2CUBA 2EGAA 1KD1C 4B6MA 4OB0B 1WJSA 4M75C 2K2MA 2XHCA 2DPPB 1PD1A 5GAMd 1KQ2A 5EC7A 1QP2A 3A8MB 3OYGA 4DOWA 1VQ6Q 1PRMC 1OX8A 2O9VA 3M9QA 2MWPA 2EGEA 1R77A 2DL5A 4AFUC 4M7DG 1AVZC 1GCPA 1ZSZA 1VQ6T 4PJOC 1Y7XA 1HXDA 2V26A 2JM9A 2A36A 2L3PA 4IURA 4DOVA 2HL5C 2EYQA 1U1TA 4AG2C 1Q82C 1G3TA 2MPXC 4J6YA 4M4ZA 3BDUA 2LNHB 2QDLA 2IPOB 4OMLA 1PG5B 2LVMA 4QT7A 4ANJA 1NJIR 1H8KA 2RNAA 1GCQA 1Y57A 4KT0E 1KJWA 4DBHA 2YDLA 3REAB 4M77D 3VRYA 4DQ2A 4PFPA 2CP7A 1RI9A 1EZZB 1MGQA 2X3XD 1UG1A 3BDLA 3EHRA 4ELZC 3CC7Q 3JB9D 4FYXB 4ZTFA 4CC4B 4DA4A 4N0AA 5IN1A 4BE1A 1NBEB 2E12A 2X4WA 2XDBA 1OI1A 4KGZB 3ME9A 4C5HA 4J83A 4A54A 1OU8A 2CP3A 3HRUA 3ZEHA 4P5NA 4XU3A 2RK1A 1I4K1 3L2QA 5IT9E 1FMVA 3TVTA 2MAMA 1AZGB 5GJVB 4GLMA 2K5LA 4F7UG 1QCFA 1ZHIA 2DD5A 5IXBA 2CUDA 1VQPA 1M90U 4KUDK 2HCKA 4FSXA 4QKUA 1QVGA 1WJRA 2ED0A 1B34B 3OYIA 4F16A 4JJNK 4A4EA 1BIAA 2P84A 3CXCA 1I81A 4J6WA 2ZPBB 1QW1A 5CR2A 2RHXA 2EVRA 2QYZA 2JW4A 4QQ6A 5LJ3e 4M7AC 4J7IA 4PFOA 4DBFA 2FL7A 3CC7A 1GBQA 2DEUA 1M5Q1 5LJ5f 4ATOA 2DZCA 3FDRA 3H8ZA 5DY9A 2XIDA 2CZ6B 1U3OA 3MEAA 2NLUA 1RUWA 1QVGS 2CYZB 2RHYA 4LNPA 2RO0A 1ZUKA 4WCIA 2R58A 1CSKA 5LJ3j 2RD1A 1PM3A 3CXCS 1PKTA 1M2VA 4IUVA 1K1ZA 3NPFA 4A4GA 2PU9B 3HKSA 3CCUA 3X28B 1I07A 1BCMA 4KRTA 1MNEA 4M7AG 4R56A 1VQ4A 1IB8A 4A4FA 1K8AC 3CCLQ 3VS2A 4IIMA 3NHNA 3M57A 2LP5A 2DJZA 3KXTA 3E1SA 2E3IA 4FCYA 1M8MA 3CCLT 1W4SA 3V7CA 1ZLMA 3EFOB 3GOXA 1WLPB 1VIFA 1UUEA 2X4JA 5D6XA 1N27A 2QDYB 1JU5C 3CC2A 2BE9B 1D3BB 2DILA 1N9RA 4BE2A 2D6FA 1QP3A 1D09B 1MMAA 1C0MA 3X26B 1M3CA 4CI0C 2DRKA 2EGCA 2BZYA 2CP6A 3UWNA 3M0PA 2HSEB 3OMCA 4EMKC 2LQKA 2RH2A 2FZGB 2M0YA 1G2BA 4M7DD 1YIJQ 2JTFA 5LJ5h 4BDZA 1TWBA 4JS5A 3M4GA 2LT4A 2V8JA 4QQGA 2EYYA 3CCLA 2A7YA 3VS5A 3RR6A 2IG0A 1E6GA 4CRIA 1YIJT 5D7UA 2EJFA 1Z9QA 5A0LA 1VQNQ 5GAMg 3FLGA 4IUPA 5GAOn 3L2VA 3LWIA 2E1HA 1C6VX 3CBMA 2P0QA 4HVUA 3I5SA 3THKA 5AYFA 1UECA 2V8KA 2YSQA 3ZBDA 3ER0A 1VQNT 4KH0B 1KC8R 4UC4A 2K57A 4HT9A 4C5EA 1QQJA 2JNGA 2EWNA 5I21A 3CCVQ 3OYMA 2QTVA 3VS4A 5HCKA 5C0MA 4C8QD 2RI5A 2JT4A 1U5SA 1MMDA 3LGLA 1BYMA 3PTAA 3CMAA 1YIJA 3EG1A 3RBBB 3INZA 2WACA 1PSEA 2K79A 4AFZC 1KQSS 1QVFA 2O88A 2Y4YA 2AK5A 5C6SA 3CCVT 1D0YA 5LJ3h 3OYCA 2XD0A 1N5ZA 4X9CA 2YT6A 1JJ2P 2BKDN 7AT1B 3I55A 1VQNA 2DE0X 2OAUA 4F14A 3QJ6A 1M2VB 1KG1A 1X6OA 4D6WA 4PJNA 3HP9A 3PNWC 5FRMA 1OU9A 2FRYA 4OMNA 3VJPA 4E7SA 1QVFS 3CCJA 2D9TA 1T0JA 3GNFB 1ZUUA 3QO3A 1WFWA 4C92A 3VUBA 1E7OA 2WSCE 4C92E 3SDZA 2AKKA 4Q5WA 3T9NA 3UF4A 2F69A 2GCXA 3BFMA 4J9GA 1GBRA 3FJ5A 5GAN2 2JM8A 4O6JA 3OYAA 1W2BP 1VQLQ 4XTXA 1YCYA 1XTDA 3RIRA 3SFMA 3RESA 1ZSZC 1S72A 1K73U 1P92A 2DLPA 3E9GA 2DZ9A 3O5ZA 1NLOC 4OGCA 2K2VA 4M77C 4C92D 1K0XA 2RQUA 1YJNQ 1VQLT 1VQ8Q 2D0NA 1X75C 3C95A 4HVVA 1VUBA 1RAAB 1OPKA 2OI3A 3JCMc 4MDWA 4L5GA 4BY6C 4B9XA 4XTUA 2L3SA 3OYEA 2DVEA 2EYXA 3RKYA 1GCQC 4A4HA 1YJNT 1WHKA 1Y71A 1VQ8T 4AG1C 3G71Q 2KRMA 2A08A 3A8HB 1VQ5Q 1WHHA 2V8IA 1RAIB 3OW2S 1ZX6A 2YRCA 4R0KA 2I2LA 1LCKA 1ZA1B 3G71T 2DTOA 3TQ7P 3E9FA 2VXEA 1VQ5T 4N0AC 3IQLA 4DBRA 3NTHA 2M0OA 1D1CA 3G7ZA 2L2PA 1G3WA 1WXUA 3SB2A 4LE9A 2ABLA 1OEBA 2DL4A 2NUZA 1ZUYA 5KYNA 3MHXA 2YLCA 1WX6A 3JB9G 1K8AU 1PSFA 1Y0MA 1TU0B 2KI7A 2C0TA 4ORZA 1FXXA 2A37A 1YJ9A 1YJNA 1M27C 4M75F 1VQ8A 1UHCA 2DA9A 3S3NA 2EPDA 5LJ3d 2QGGA 4EMHA 2KYMA 2QK0A 4EPCA 1JEGA 4FT4A 4PFZA 3I56Q 1K9AA 3V7RA 3UA6A 2E64A 3L1AA 3S6WA 3VU3C 2MWOA 3G71A 4L6V5 4BB7A 2G6FX 4NL2A 2H3EB 3E19A 3UDCA 3OMGA 5GANf 1VQ5A 4E2FB 3CPWA 4PJOF 4E47A 1Q7YC 3G4SA 4ELYC 3JCMb 3I56T 2YXYA 4E7ZA 2RK2A 4M78B 4GY5A 2DAQA 4ME7A 2OTJQ 4JDSA 3H9NA 1JBMA 1N9SA 2ZZDA 1OPLA 5FLXE 2HKNA 4FL6A 4B9WA 1U06A 4RKUE 2F2WA 1GL5A 3H0HA 1YITQ 3EGDA 1WDXA 3L2WA 4LDVA 3GF5A 1UJ0A 1MNDA 2LQ8A 2QGFB 2OTJT 3CBOA 2NUTB 1Z9ZA 3CPWS 4F7UF 1YITT 1M1KC 3BW1A 2K9GA 4XU0A 2HZYA 1ACMB 2E10A 3MJXA 4JS4A 1UTIA 2F5TX 2K3XA 2RF0A 2KVQG 2PVGB 1PWTA 2W10A 2KYBA 4O5VA 1UGQB 4OMOA 1WJQA 2VB6A 3OBYA 2VGMA 4C0GA 4D8KA 1M2OA 2AKLA 2CP5A 2FZCB 1NM7A 1B34A 2CZ1B 1ZBJA 2YUQA 3EAEA 3CCRQ 3JCMe 3EGXA 2CZ7B 4YTLA 4ZN1A 4J9DA 3OA6A 3MEWA 5CCAA 5GAOm 4OMFB 3WVEB 4M7DC 3PFSA 1JXOA 3CCRT 1W2BA 1K73R 4LD9K 5FROA 3FB9A 5FU6C 2YHTA 4LUEA 3UA7A 1AD5A 1K9MR 1LVKA 3Q1JA 2KBTA 3TU4K 3CCMQ 2X4YA 2XK0A 1WIEA 3EGUA 1TUDA 2E3HA 1ZA2B 3QYGB 3CCEQ 1VQ7Q 2DL7A 4M7AF 1X6GA 3X20B 4K11A 4J9IA 2H8HA 3A5ZB 1RACB 4IUTA 3EHQA 8ATCB 1WA7A 4BD3A 2ZPGB 1N6AA 1Q95G 2DM1A 3CCET 1TSFA 1VQ7T 3EFRA 2K5IA 1NYFA 1H3ZA 1YJWA 3RMSA 2L89A 3JB9I 3CCRA 5KYWB 4BI8B 2DXUA 4RMOA 4RCBA 1WYXA 4C8QC 2DL8A 2R57A 4OP0A 5J26A 3EFOA 1YWPA 2J6FA 2QEXA 1K0SA 2RM4A 2M02A 3JCMf 2FHDA 1D3BA 1PNJA 1VQPQ 2MI6A 2EQIA 2RB6A 2PQWA 2QG9B 2KXDA 5LJ5e 3CCMA 3X25B 1YBYA 9ATCB 1VQPT 3CCEA 1VQ7A 2QTXA 1EIFA 2P4TA 1SSHA 2CH4A 5DM7R 2FPFA 1FYNA 1QWFA 4JRKA 1N8RC 1MV3A 3SWNA 2QI2A 1PKSA 3EGDB 4C8QG 5HY6A 3UT1A 5LJ5j 3QWYA 2RPNA 2DVJA 4ESRA 3CC7T 3X24B 2LC4A 2FVUA 1OOTA 1J3TA 2DTHA 4X34A 1AWJA 1NG2A 2E41A 5GMKm 5CO7A 1KQSP 4RTUA 4C0DC 3R6OA 2WSEE 2A0FB 4FIBA 2J05A 5FU7B 3VUZA 3CCUQ 4C92C 4C0ZA 2EW3A 1Y07A 5FWCA 1AWOA 4RTYA 4XTYA 3SD4A 6AT1B 2RA2A 2QQ9A 2IVWA 5HKCA 3N5BB 2HAXA 4XTZA 1VQ4Q 3TEEA 3RKXA 1Y96B 3I35A 5KE3A 1JRIA 1W70A 2LNVA 2RI3A 4ZGDB 4NL3A 2CZ0B 2P0KA 4JLIA 5GAOl 3CCUT 5I2MA 1XOVA 2JUFA 3EGXB 2VVKA 1V29B 1SPKA 1QKXA 3DB3A 5LJ3g 2X51A 3QZ5B 1VQ4T 1YFNA 4HKEA 3WVDB 2M1HA 2HDAA 3JCMX 1Q7YU 4BI3A 1Q81C 1RABB 3JCMh 4RG2A 5HK0A 1GRIA 5CKFA 3CC2Q 5GAN8 1IRXA 1M1GA 4KULA 1VIEA 4RCCA 2VASA 1A0NB 3MEVA 2DETA 1G3SA 4C92G 1VQKA 1QMCA 2DIQA 2ZPEB 4F17A 2LX7A 3REBB 1B07A 3CC2T 3MP6A 3D7SB 1WHGA 4PKCC 1R0BG 3S3OA 1KHIA 2A3LA 5L8RE 1BB9A 1R0CB 5CQYA 1ZBXA 3QDRB 3S3MA 1Q86U 1VA7A 3CD6Q 2DMOA 2FRWA 2QQSA 5A0GA 5KCOA 3MCAB 3OSVA 3LGFA 1BKBA 4C0FA 5GAOr 2DTIA 2OAWA 8AT1B 1I0CA 4DBQA 2GQIA 2DO3A 2FPDA 3CD6T 2DERA 4XU2A 3OW2P 5GAN4 1ARKA 3OYHA 2KRSA 3RNJA 2DD4A 2L8DA 1WXBA 4MZMA 3MKDA 4BACA 5IAYA 2DBKA 4HXJA 2JJ9A 2P4RA 3FRNA 3JCMW 3JCMJ 1UB4A 2LJ1A 2IIMA 3BE3A 1I5LA 3H6ZA 4JUVA 3ZL7C 5CQXA 2QQBA 2JMAA 3NTKA 3CMAQ 1BK2A 2HBWA 1KD1U 4D8DA 4M77F 3NTIA 3CD6A 2FPEA 3SWNB 2R5MA 3C0CA 2MCNA 2LT1A 2ZPIB 3URGA 5GMKl 3JB9F 3G1JA 3CMAT 1IHVA 2COZA 1M3BA 2LRQA 4M75A 1E6HA 4OMQA 1NPPA 3LW5E 1MMNA 4M75E 3QUIA 2XG8D 3JRZA 3I55Q 2F2VA 4RTTA 5CKEA 3UATA 2ZGWA 1KK7A 3MEUA 2HQHA 4Z88A 4BI4A 1KSWA 4X9DA 3JCMd 4IUQA 1BI3A 3A8LB 3CCJQ 1SKUB 3I55T 2DJQA 3TCJA 5GAOq 4PJOA 3HL8A 4HCZA 4FU6A 5GAN3 1M4ZA 5GAMe 3QPHA 4PJOE 1Q82U 4C5IA 4L59A 3CCQA 3I9QA 1CKAA 4FSSA 3CCJT 2E5QA 2P0PA 3PIPA 4E7LA 4ZNXA 3LWHA 1S72Q 4ZGJB 4Y92A 1OYXA 4E7IA 1M90R 3OYKA 4M78A 2F2XA 4M78E 1DJ7B 2KT1A 2HEQA 5GAMj 4Z89A 1S72T 5I11A 4EDUA 1R8OB 5IHIA 2VXFA 4ZN3A 4CC2A 5GAOp 2DBMA 2I0NA 4OMPA 3META 4ZTJA 1M1FA 3J7AF 1VQOA 2CS7A 2FO0A 2NUTA 3H0IA 1Q7YR 4QVZA 2JTEA 3C4SA 5GMKe 3HTRA 4M78D 3JAME 1TUCA 3A8OB 4RTZA 4VUBA 3M59A 4HCBA 4XK8E 2RI2A 2CT3A 4LXCA 1UE9A 1RLQC 2Z0WA 1VQ9A 1BI1A 2EKHA 3GP8A 2JS2A 1TOVA 1AT1B 2LZ6B 2KMTA 1JB0E 5GMKj 3OYJA 4JJCA 2RJFA 3CMEQ 1RL2A 5A0DA 4PLLA 5CK9A 1Q86R 2ROLA 4OF1A 5GAMf 5LJ5d 4RTVA 1IGQA 2VUBA 1YJ9Q 3PMTA 3CMET 4FYVB 1GFDA 3ZFJA 2CP0A 2KK4A 5GANe 1WI7A 2O01E 3GLXA 5FWBA 1Q81U 2RQVA 3HSBA 4TVRA 1YJ9T 3OBWA 3C12A 4M7AA 2E5KA 2KAFA 3F70A 1PD0A 4M7AE 3OSSC 2ZPHB 2HQEA 3G4SQ 5D6WA 1XNIA 3GIBA 2D0QB 5GANj 1WHJA 5GMKi 2BIVA 3M55A 4LDWA 2XDPA 2MK5A 1NYGA 4M7DF 2DEQA 2FB7A 4LN2A 4CC3A 3P8DA 5KH6A 3G6EQ 1IREB 3G4ST 2KEAA 1WXTA 5AT1B 3OQ5A 3CMEA 4M75B 4JPBW 4FW2A 3A1PA 5IH2A 1FWZA 1QLYA 1SF9A 1KD1R 4AMCA 5KYWA 4NS5A 2L5QA 3G6ET 2D1XA 2B8AA 2W0ZA 1KC8C 3SHWA 1U1SA 3FJPA 2L3RA 5IHKA 4PJOB 2XDDA 2FYKA 1QCNA 2AZSA 2KQWA 2PNIA 2DYIA 3LX7A 2WSFE 3RDVA 2HQXA 4RG8A 4V2SA 2KR3A 4N4HA 5GAMh 2VYTA 3EH2A 3RKWA 2OTLA 2E6ZA 2RHIA 2DYBA 2X9HA 3TREA 2VKNA 4C8QF 1Q82R 2KRNA 2BZXA 1KIKA 2PUOB 1YP5A 3MO8A 3AHUA 3OS2A 2KGTA 3G6EA 2EJGA 4F7UB 4E7KA 1UGVA 2G3RA 4EMKA 1OV3A 2NYSA 2LJ3A 4IUUA 2ESWA 3VS3A 4R55A 2CGHA 3A8GB 4JRIA 4LD6A 2J6KA 4HCCA 3LH0A 2GQVA 3A98A 1BU1A 2FZKB 4BE0A 4LDYA 3PT9A 2EAYA 1RAFB 2QA4Q 2CSQA 2DRMA 4HT8A 1ABOA 1HD3A 1WNLA 5GMKh 1MHNA 4CC7A 2BUDA 2LDMA 1LOJA 1JJ2A 1H3HA 1AZEA 4LDXA 1V76A 3M4YA 1QVGP 3SEMA 1HK9A 4KGVB 2QA4T 4Z8AA 1Y96A 2RQWA 3PIOA 4JZ4A 1YJWQ 3KBGA 3CXCP 1LPLA 3EG0A 3JSCA 3P8BB 3QXEB 1I5OB 1TUGB 2DNUA 2PVOB 3DKMA 3JCMV 1YJWT 2QEXQ 5KYYA 4HA8A 2DX1A 1PC0A 1YCSB 1YHQA 1O75A 5KYUA 3OYFA 4C92F 2LQWA 2EQKA 2BTTA 2LQNA 1RAEB 2CSIA 2RMOA 4M7AB 1XQHA 2J06A 1JO8A 1PHTA 5GANh 2QEXT 2RJEA 3L42A 4AT1B 1T0HA 2QA4A 1FMKA 2A28A 2O4XB 3M0UA 4JLGA 3CCSA 4RTXA 3CCMT 1NEBA 3GPLA 1W2BS 2JOYA 2CT4A 1BI0A 2RQTA 3PGGA 5J39A 5I2SA 1VQMA 1AWWA 2C06A 2JTMA 1NEGA 3HPWA 5FRNA 2K7AA 4J9EA 1OX9A 3QIIA 1I1JA 1K8AR 2COWA 1VYTA 2RHZA 2Y4XA 4E6RA 2YRVA 2K4YA 3AT1B 1X6BA 3CC4A 3OYNA 5LJ5g 4M77A 1NE8A 4M77E 3I5RA 2MF2A 2NUPA 3LH5A 2KDSA 3QDFA 3VS7A 2RJDA 4M75G 4M78C 5GJWB 3U23A 1JXMA 2B86A 3HFOA 4KUIA 5HK3A 4N4GA 4EMKB 4MDXA 4MZTA 2MIOA 2QQAA 2J7IA 5M9OA 3CQTA 3UPUA 2HNIA 2F1LA 1VQKQ 2CKKA 4PJOG 4OB1B 4J7FA 1VQ6A 1WGSA 1F1BB 2KT8A 2RHUA 4JRQA 2GNCA 1W1FA 2HD0A 2VWFA 3EG9B 2QXFA 3O8VA 1LJOA 3JCMQ 1RLPC 2EBPA 2JN0A 1VQKT 2QASA 3GNGA 2Y90A 1AHJB 1VYVA 1KC8U 4M78G 2ED1A 1I8FA 4JZ3A 2MMPA 1X43A 1WQWA 1WZOA 3P8HA 3JB9J 5GANd 3MPUB 2CH4W 2L0AA 1SRLA 2EYZA 2HMAA 3CEYA 4II1A 2EYWA 1G83A 1QVFP 1K73C 4QVDA 2PUKB 3RERA 1KHCA 5KYYB 1YI2Q 5KYUB 4A4KA 3M56A 1K9MC 4QW2A 2F5KA 3OY9A 3L2RA 4BUGA 1X27A 1UGRB 2EFIA 5CVIA 1NPRA 2M16A 1IHWA 2PTKA 1PRLC 1YI2T 4JRPA 2DL3A 4EMGA 4GLKA 4PJJA 4KGXB 1MUZA 2C0OA 1HSQA 2DF6A 1AEYA 4QQDA 4DEYA 4WF2A 2R5AA 5ECAA 1M1KU 2EKOA 5CIUA 3M53A 1GXIE 5A2QE 4E7HA 3VS1A 3OYDA 3CBPA 2M9UA 1TXQA 2OX7A 2KE9A 4LUDA 3RMQA 1ABQA 2DXCA 2K5FA 3OB9A 4KBMB 1PCXA 2V1QA 5EG2A 1UGSB 3ULRB 4PK4A 1YNZA 2CDTA 4AFSC 5IHNA 3ASKA 1YWOA 1ZSGA 2YWWA 3V8LA 4OB2B 3VYHB 1YI2A 2DXTA 3JV3A 3JB9H 3NMZC 1S1NA 1NJIC 1ZSZB 2ENMA 2PVDB 4J8OA 3E2UA 3VYGA 1UJYA 3QSUA 2COYA 3NFCA 3PMIA 3QWXX 4M77B 3CCQQ 3EH1A 1NLPC 2JS0A 2V1RA 2NUPB 4J9FA 4M7DA 3QZ9B 1T3LA 4M7DE 4BY6B 2AHJB 5LJ3f 2LMJA 2NWMA 3CCQT 2MYSA 5KCHA 2GF7A 1RI0A 1QCOA 3QKJA 3VS0A 1CKBA 1EFNA 4N4IA 2EQJA 1WPYA 1H641 5KE2A 3MP8A 1XJWB 3M5AA 3J81E 3M0SA 1KFZA 2E4HA 4J9HA 2HSPA 1TG0A 1VQOQ 2VC8A 2MOXA 2DFUA 3QBYA 5L23A 2DK3A 2SEMA 1V1CA 3V8KA 4IIOA 5FU7C 3FC3A 1SRMA 3BY7A 1VQOT 1VQ9Q 3M0QA 5J3BA 1TH7A 3TSWA 4QVCA 3M0TA 4M75D 1VOMA 2RJCA 2KY9A 3V7SA 2SRCA 1UFFA 3OS0A 4C8QA 1KQSA 3VS6A 4C5GA 3CPWP 1BBZA 3PVLA 4RUGA 4C8QE 1VQ9T 1G8XA 4OMMA 3QJYA 3QHSA 1WHMA 4A63B 1WQ7A 2K6DA 4PJOD 4OB3B 2ROTA 1D1BA 4LDUA 1WHLA 1SG5A 1M30A 2DIGA 4F7UA 2AT1B 4F7UE 1N8RU 3M54A 5D6YA 1QVPA 2JZ2A 1C1AA 1D0XA 4FM4B 1EX4A 2YUPA 3EG2A 2GFAA 1M9SA 4FYWB 5IXFA 2JXBA 2XU8A 2O2OA 2LJ0A 2JMCA 2KXCA 1U8RA 1UHFA 3VV0A 1IZ6A 2J6OA 2C0IA 2PZ1A 3C94A 3DB4A 5DLQE 1OULA 3TSZA 1VYUA 3LLRA 1BIBA 1UEBA 2ZPFB 2HBPA 3OS1A 1OQKA 2KNBB 1H92A 2EQMA 1M1KR 3QYHB 2HL3A 4XTVA 4J6XA 1AOJA 4PJMA 4AFQC 1RADB 3FIFA 4JJBA 3J80E 1IXDA 2EJ9A 1IGUA 5GANg 3CCVA 1SSFA 2LCCA 2YLBA 2RQRA 4GBQA 3NGPA 1X01A 1SHGA 2BZ8A 3OW2A 2BE7D 2D8JA 3H0FA 3PVQA 1K9MU 2QAZA 5DLOA 3L2UA 2E65A 4BDYA 4M7DB 1MMGA 2DXBA 2RN8A 2EIFA 4ZGEB 3VRZA 2FG0A 2KROA 4PL6A 1K4US 3H41A 5FU6B 2OTLQ 4JJDA 2GTJA 2CREA 4FYYB 5KYXA 2K3YA 2O4XA 3DLLA 3WXMB 2CP2A 1D0ZA 4J5YA 5CKBA 1T3SA 3SWNC 5I22A 4M7AD 4KH1B 4A53A 1HYOA 1YN8A 2E6NA 5CKDA 4NOYA 2GTOA 2VGNA 2GBQA 2OTLT 5GAN6 1M8VA 4MMLA 4E7JA 2ECZA 2YRDA 2ZCFB 3CPFA 3OS5A 4PLIA 1AWXA 1SEMA 2O31A 4FT2A 4M77G 3OYLA 2H3JA 2ZAEA 5FW9A 1VQLA 1JQQA 1K76A 3VKIA 1RAGB 2AZVA 2GGRA 1M3AA 4RTWA 2FEIA 4MZPA 1OZ3A 1FMWA 1X69A 1NJIU 4C8QB 4FW1A 2E70A 3HRTA 2OJ2A 4XU1A 3RUXA 1M90C 1MV0B 4PNOA 1TTHB 2XI9A 4MMKA 4OVAA 2LCLA 4F04B 2D8HA 3LYIA 5CKHA 4WTOB 1B3QA 1QWEA 2AIRB 1YHQQ 1ZQ1A 3QG1A 1G5VA 4J9BA 4DEXA 1UGPB 2QQRA 1SHFA 1X2QA 1O9SA 4Y28E 4HVWA 5GAN7 1X2KA 1TS9A 2EQUA 2L3QA 1YHQT 3EFSA 3KUFA 1BCOA 3EG9A 4X1VA 2O9SA 1N8RR 4M78F 1G3YA 3V8JA 1UDLA 4XQ3A 4XAXB 2DKGA 4Y91A 2X35A 4HCKA 3CCSQ 1BI2A 3DLMA 2JVVA 3R6NA 2GFUA 4OGEA 2LTOA 2YUNA 2M51A 1Q86C 3MP1A 4C0DB 1NZ9A 1FX7A 1VQMQ 2KSSA 4XTWA 3HFNA 3CCST 5LL6S 3JCMg 2K3BA 2ATCB 4C92B 2LX9A 4J9CA 1B7TA 3OYBA 3KFVA 3I56A 4IKFA 1GFCA 1OZ2A 2X4XA 4Z02A 2YUOA 1IO6A 3PE0A 1VQMT 3HHTB 1KQ1A 1JJ2S 3GBQA 2XKOC 2HKQB 1LNXA 1W6XA 2LCSA 2X3WD 2XICA 1RAHB 4EIKA 3CC4Q 4PJLA 2OTJA 3FEOA 3M0RA 1HJDA 2VV5A 1D1AA 3M58A 3HRSA 3JCMP 3L2ZA 1YITA 5GAN5 5CAIA 3OYYA 5KYXB 1Q81R 2XMFA 3CC4T 3EG3A 1QKWA
chains in the Genus database with same CATH topology
2CUBA 4LE9A 2ABLA 1OEBA 2DL4A 2NUZA 1ZUYA 3I9QA 1CKAA 2EGAA 1X27A 1WX6A 4FSSA 1Y0MA 2PTKA 1PRLC 4ZNXA 2K2MA 2C0TA 4Y92A 4ORZA 2DL3A 2A37A 5EC7A 1M27C 1UHCA 1MUZA 2C0OA 2DA9A 1HSQA 2EPDA 2F2XA 2DF6A 1AEYA 2KT1A 2KYMA 4DEYA 1PRMC 2HEQA 1JEGA 5ECAA 2O9VA 4Z89A 1K9AA 2EGEA 5I11A 2DL5A 4AFUC 3UA6A 5IHIA 3VS1A 1AVZC 1GCPA 4CC2A 2DBMA 2G6FX 2I0NA 4OMPA 2KE9A 2FO0A 3H0IA 4LUDA 2JTEA 1ABQA 2JM9A 1TUCA 2V1QA 2A36A 2L3PA 4RTZA 3ULRB 1YNZA 4AG2C 2CDTA 4AFSC 5IHNA 2CT3A 1YWOA 4M4ZA 1UE9A 1ZSGA 1RLQC 2LNHB 1OPLA 2QDLA 2EKHA 4OMLA 1U06A 2F2WA 3JV3A 1GL5A 3H0HA 3NMZC 2JS2A 4QT7A 1S1NA 1H8KA 2RNAA 1WDXA 1GCQA 2LZ6B 2ENMA 1UJ0A 1Y57A 1KJWA 2YDLA 4JJCA 3REAB 3VRYA 1UJYA 1Z9ZA 3QWXX 1RI9A 1NLPC 2JS0A 2X3XD 2V1RA 2K9GA 1UG1A 3EHRA 4J9FA 2ROLA 4RTVA 1UTIA 1T3LA 2RF0A 4CC4B 1PWTA 2W10A 2KYBA 1GFDA 2LMJA 2NWMA 4OMOA 1WI7A 5FWBA 4D8KA 3VS0A 2AKLA 1CKBA 2RQVA 1EFNA 1NM7A 2YUQA 1ZBJA 2E5KA 3M0SA 1KFZA 3TVTA 4J9HA 2HSPA 1TG0A 1AZGB 5GJVB 2MOXA 4GLMA 1QCFA 5L23A 4J9DA 5IXBA 2CUDA 2SEMA 1JXOA 1V1CA 2HCKA 1NYGA 4IIOA 4LN2A 4CC3A 1SRMA 3M0QA 3TSWA 2ED0A 4LUEA 3M0TA 3UA7A 2KEAA 1AD5A 1WXTA 4F16A 4JPBW 2KBTA 2SRCA 1UFFA 5IH2A 1QLYA 1WIEA 2EVRA 2JW4A 1TUDA 3EGUA 3VS6A 1BBZA 3PVLA 4RUGA 1GBQA 2D1XA 2DL7A 1X6GA 4OMMA 4K11A 2W0ZA 4J9IA 1U3OA 2H8HA 3SHWA 4A63B 3EHQA 2K6DA 1RUWA 1WA7A 5IHKA 2ROTA 4LNPA 1ZUKA 4WCIA 1M30A 1CSKA 2DM1A 1NYFA 2AZSA 2PNIA 1PKTA 1K1ZA 3NPFA 2KR3A 1WYXA 2DL8A 2DYBA 2VKNA 1YWPA 1I07A 2J6FA 2YUPA 3EG2A 2KRNA 1K0SA 2BZXA 4KRTA 1KIKA 1YP5A 5IXFA 1PNJA 2JXBA 3VS2A 2KGTA 4IIMA 1UGVA 2EQIA 3NHNA 2LP5A 2O2OA 1OV3A 2LJ0A 2JMCA 2KXCA 2KXDA 1UHFA 2LJ3A 2J6OA 2C0IA 2ESWA 2PZ1A 3VS3A 3TSZA 1VYUA 1M8MA 2J6KA 2KNBB 1H92A 3A98A 1ZLMA 1BU1A 1WLPB 1UUEA 1SSHA 2CH4A 2CSQA 1JU5C 2DRMA 1AOJA 2FPFA 1ABOA 1FYNA 1HD3A 1QWFA 4CC7A 4AFQC 2DILA 1MV3A 1PKSA 1M3CA 4JJBA 1H3HA 2DRKA 3QWYA 2RPNA 2DVJA 1AZEA 2EGCA 4ESRA 2BZYA 3SEMA 2RQRA 4GBQA 3NGPA 4Z8AA 1SHGA 2RQWA 2BZ8A 3M0PA 1OOTA 2D8JA 3H0FA 3PVQA 4JZ4A 1J3TA 2M0YA 1AWJA 1G2BA 1NG2A 3EG0A 4RTUA 2RN8A 3VRZA 2FG0A 2DNUA 2KROA 1K4US 3H41A 2J05A 2EYYA 4JJDA 2EW3A 2CREA 2GTJA 5FWCA 3VS5A 1AWOA 4RTYA 2DX1A 1YCSB 1E6GA 1T3SA 2LQWA 5I22A 1Z9QA 1YN8A 2BTTA 3I35A 2LQNA 2CSIA 2RMOA 1W70A 2GTOA 1XOVA 2GBQA 2J06A 1JO8A 1PHTA 2VVKA 2ECZA 1SPKA 1QKXA 1T0HA 4HVUA 3I5SA 3THKA 1FMKA 1AWXA 2HDAA 1UECA 1SEMA 2O31A 2A28A 2YSQA 1GRIA 3M0UA 4RTXA 5FW9A 1NEBA 1JQQA 1A0NB 2CT4A 1K76A 2RQTA 2AZVA 2GGRA 1M3AA 4RTWA 3VS4A 5HCKA 4F17A 2FEIA 2JT4A 1X69A 1U5SA 2LX7A 3REBB 1AWWA 1B07A 1NEGA 2OJ2A 3EG1A 3RBBB 1MV0B 2K79A 4AFZC 2O88A 2AK5A 1BB9A 2K7AA 4J9EA 1VA7A 2D8HA 2DMOA 2FRWA 1B3QA 1QWEA 1I1JA 1N5ZA 2YT6A 1VYTA 2OAWA 4E6RA 4J9BA 4DEXA 1I0CA 2DE0X 1X6BA 2GQIA 2FPDA 1SHFA 4F14A 1X2QA 4HVWA 3I5RA 1X2KA 3LH5A 1ARKA 2L3QA 4OMNA 2FRYA 3VS7A 2KRSA 3RNJA 1T0JA 1ZUUA 1WFWA 5GJWB 1WXBA 3U23A 1JXMA 4X1VA 1E7OA 2B86A 2O9SA 2AKKA 3UF4A 1UDLA 4HCKA 4J9GA 1GBRA 2DBKA 3FJ5A 2JM8A 3R6NA 4HXJA 2P4RA 2LJ1A 2MIOA 2IIMA 2J7IA 2DLPA 2YUNA 2M51A 3CQTA 3O5ZA 1NLOC 3ZL7C 1K0XA 2KT8A 2JMAA 2RQUA 2K3BA 2GNCA 1W1FA 1BK2A 2HBWA 2VWFA 4D8DA 4J9CA 2D0NA 3KFVA 4HVVA 2FPEA 1GFCA 1RLPC 1OPKA 2EBPA 2OI3A 2YUOA 1IO6A 3C0CA 3PE0A 2MCNA 2L3SA 1VYVA 2EYXA 3GBQA 1GCQC 2ED1A 1M3BA 4JZ3A 2LCSA 1W6XA 4AG1C 1X43A 2KRMA 1E6HA 4OMQA 2X3WD 2CH4W 2A08A 2L0AA 2F2VA 4RTTA 1SRLA 4EIKA 1ZX6A 2EYZA 3UATA 3M0RA 4Z88A 1HJDA 4R0KA 1KSWA 2EYWA 1LCKA 1G83A 2DJQA 2XMFA 3IQLA 2L2PA 3EG3A 1QKWA 1WXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUB A;  4LE9 A;  2ABL A;  1OEB A;  2DL4 A;  2NUZ A;  1ZUY A;  3I9Q A;  1CKA A;  2EGA A;  1X27 A;  1WX6 A;  4FSS A;  1Y0M A;  2PTK A;  1PRL C;  4ZNX A;  2K2M A;  2C0T A;  4Y92 A;  4ORZ A;  2DL3 A;  2A37 A;  5EC7 A;  1M27 C;  1UHC A;  1MUZ A;  2C0O A;  2DA9 A;  1HSQ A;  2EPD A;  2F2X A;  2DF6 A;  1AEY A;  2KT1 A;  2KYM A;  4DEY A;  1PRM C;  2HEQ A;  1JEG A;  5ECA A;  2O9V A;  4Z89 A;  1K9A A;  2EGE A;  5I11 A;  2DL5 A;  4AFU C;  3UA6 A;  5IHI A;  3VS1 A;  1AVZ C;  1GCP A;  4CC2 A;  2DBM A;  2G6F X;  2I0N A;  4OMP A;  2KE9 A;  2FO0 A;  3H0I A;  4LUD A;  2JTE A;  1ABQ A;  2JM9 A;  1TUC A;  2V1Q A;  2A36 A;  2L3P A;  4RTZ A;  3ULR B;  1YNZ A;  4AG2 C;  2CDT A;  4AFS C;  5IHN A;  2CT3 A;  1YWO A;  4M4Z A;  1UE9 A;  1ZSG A;  1RLQ C;  2LNH B;  1OPL A;  2QDL A;  2EKH A;  4OML A;  1U06 A;  2F2W A;  3JV3 A;  1GL5 A;  3H0H A;  3NMZ C;  2JS2 A;  4QT7 A;  1S1N A;  1H8K A;  2RNA A;  1WDX A;  1GCQ A;  2LZ6 B;  2ENM A;  1UJ0 A;  1Y57 A;  1KJW A;  2YDL A;  4JJC A;  3REA B;  3VRY A;  1UJY A;  1Z9Z A;  3QWX X;  1RI9 A;  1NLP C;  2JS0 A;  2X3X D;  2V1R A;  2K9G A;  1UG1 A;  3EHR A;  4J9F A;  2ROL A;  4RTV A;  1UTI A;  1T3L A;  2RF0 A;  4CC4 B;  1PWT A;  2W10 A;  2KYB A;  1GFD A;  2LMJ A;  2NWM A;  4OMO A;  1WI7 A;  5FWB A;  4D8K A;  3VS0 A;  2AKL A;  1CKB A;  2RQV A;  1EFN A;  1NM7 A;  2YUQ A;  1ZBJ A;  2E5K A;  3M0S A;  1KFZ A;  3TVT A;  4J9H A;  2HSP A;  1TG0 A;  1AZG B;  5GJV B;  2MOX A;  4GLM A;  1QCF A;  5L23 A;  4J9D A;  5IXB A;  2CUD A;  2SEM A;  1JXO A;  1V1C A;  2HCK A;  1NYG A;  4IIO A;  4LN2 A;  4CC3 A;  1SRM A;  3M0Q A;  3TSW A;  2ED0 A;  4LUE A;  3M0T A;  3UA7 A;  2KEA A;  1AD5 A;  1WXT A;  4F16 A;  4JPB W;  2KBT A;  2SRC A;  1UFF A;  5IH2 A;  1QLY A;  1WIE A;  2EVR A;  2JW4 A;  1TUD A;  3EGU A;  3VS6 A;  1BBZ A;  3PVL A;  4RUG A;  1GBQ A;  2D1X A;  2DL7 A;  1X6G A;  4OMM A;  4K11 A;  2W0Z A;  4J9I A;  1U3O A;  2H8H A;  3SHW A;  4A63 B;  3EHQ A;  2K6D A;  1RUW A;  1WA7 A;  5IHK A;  2ROT A;  4LNP A;  1ZUK A;  4WCI A;  1M30 A;  1CSK A;  2DM1 A;  1NYF A;  2AZS A;  2PNI A;  1PKT A;  1K1Z A;  3NPF A;  2KR3 A;  1WYX A;  2DL8 A;  2DYB A;  2VKN A;  1YWP A;  1I07 A;  2J6F A;  2YUP A;  3EG2 A;  2KRN A;  1K0S A;  2BZX A;  4KRT A;  1KIK A;  1YP5 A;  5IXF A;  1PNJ A;  2JXB A;  3VS2 A;  2KGT A;  4IIM A;  1UGV A;  2EQI A;  3NHN A;  2LP5 A;  2O2O A;  1OV3 A;  2LJ0 A;  2JMC A;  2KXC A;  2KXD A;  1UHF A;  2LJ3 A;  2J6O A;  2C0I A;  2ESW A;  2PZ1 A;  3VS3 A;  3TSZ A;  1VYU A;  1M8M A;  2J6K A;  2KNB B;  1H92 A;  3A98 A;  1ZLM A;  1BU1 A;  1WLP B;  1UUE A;  1SSH A;  2CH4 A;  2CSQ A;  1JU5 C;  2DRM A;  1AOJ A;  2FPF A;  1ABO A;  1FYN A;  1HD3 A;  1QWF A;  4CC7 A;  4AFQ C;  2DIL A;  1MV3 A;  1PKS A;  1M3C A;  4JJB A;  1H3H A;  2DRK A;  3QWY A;  2RPN A;  2DVJ A;  1AZE A;  2EGC A;  4ESR A;  2BZY A;  3SEM A;  2RQR A;  4GBQ A;  3NGP A;  4Z8A A;  1SHG A;  2RQW A;  2BZ8 A;  3M0P A;  1OOT A;  2D8J A;  3H0F A;  3PVQ A;  4JZ4 A;  1J3T A;  2M0Y A;  1AWJ A;  1G2B A;  1NG2 A;  3EG0 A;  4RTU A;  2RN8 A;  3VRZ A;  2FG0 A;  2DNU A;  2KRO A;  1K4U S;  3H41 A;  2J05 A;  2EYY A;  4JJD A;  2EW3 A;  2CRE A;  2GTJ A;  5FWC A;  3VS5 A;  1AWO A;  4RTY A;  2DX1 A;  1YCS B;  1E6G A;  1T3S A;  2LQW A;  5I22 A;  1Z9Q A;  1YN8 A;  2BTT A;  3I35 A;  2LQN A;  2CSI A;  2RMO A;  1W70 A;  2GTO A;  1XOV A;  2GBQ A;  2J06 A;  1JO8 A;  1PHT A;  2VVK A;  2ECZ A;  1SPK A;  1QKX A;  1T0H A;  4HVU A;  3I5S A;  3THK A;  1FMK A;  1AWX A;  2HDA A;  1UEC A;  1SEM A;  2O31 A;  2A28 A;  2YSQ A;  1GRI A;  3M0U A;  4RTX A;  5FW9 A;  1NEB A;  1JQQ A;  1A0N B;  2CT4 A;  1K76 A;  2RQT A;  2AZV A;  2GGR A;  1M3A A;  4RTW A;  3VS4 A;  5HCK A;  4F17 A;  2FEI A;  2JT4 A;  1X69 A;  1U5S A;  2LX7 A;  3REB B;  1AWW A;  1B07 A;  1NEG A;  2OJ2 A;  3EG1 A;  3RBB B;  1MV0 B;  2K79 A;  4AFZ C;  2O88 A;  2AK5 A;  1BB9 A;  2K7A A;  4J9E A;  1VA7 A;  2D8H A;  2DMO A;  2FRW A;  1B3Q A;  1QWE A;  1I1J A;  1N5Z A;  2YT6 A;  1VYT A;  2OAW A;  4E6R A;  4J9B A;  4DEX A;  1I0C A;  2DE0 X;  1X6B A;  2GQI A;  2FPD A;  1SHF A;  4F14 A;  1X2Q A;  4HVW A;  3I5R A;  1X2K A;  3LH5 A;  1ARK A;  2L3Q A;  4OMN A;  2FRY A;  3VS7 A;  2KRS A;  3RNJ A;  1T0J A;  1ZUU A;  1WFW A;  5GJW B;  1WXB A;  3U23 A;  1JXM A;  4X1V A;  1E7O A;  2B86 A;  2O9S A;  2AKK A;  3UF4 A;  1UDL A;  4HCK A;  4J9G A;  1GBR A;  2DBK A;  3FJ5 A;  2JM8 A;  3R6N A;  4HXJ A;  2P4R A;  2LJ1 A;  2MIO A;  2IIM A;  2J7I A;  2DLP A;  2YUN A;  2M51 A;  3CQT A;  3O5Z A;  1NLO C;  3ZL7 C;  1K0X A;  2KT8 A;  2JMA A;  2RQU A;  2K3B A;  2GNC A;  1W1F A;  1BK2 A;  2HBW A;  2VWF A;  4D8D A;  4J9C A;  2D0N A;  3KFV A;  4HVV A;  2FPE A;  1GFC A;  1RLP C;  1OPK A;  2EBP A;  2OI3 A;  2YUO A;  1IO6 A;  3C0C A;  3PE0 A;  2MCN A;  2L3S A;  1VYV A;  2EYX A;  3GBQ A;  1GCQ C;  2ED1 A;  1M3B A;  4JZ3 A;  2LCS A;  1W6X A;  4AG1 C;  1X43 A;  2KRM A;  1E6H A;  4OMQ A;  2X3W D;  2CH4 W;  2A08 A;  2L0A A;  2F2V A;  4RTT A;  1SRL A;  4EIK A;  1ZX6 A;  2EYZ A;  3UAT A;  3M0R A;  4Z88 A;  1HJD A;  4R0K A;  1KSW A;  2EYW A;  1LCK A;  1G83 A;  2DJQ A;  2XMF A;  3IQL A;  2L2P A;  3EG3 A;  1QKW A;  1WXU A; 
#chains in the Genus database with same CATH topology
 2CUB A;  2EGA A;  1KD1 C;  4B6M A;  4OB0 B;  1WJS A;  4M75 C;  2K2M A;  2XHC A;  2DPP B;  1PD1 A;  5GAM d;  1KQ2 A;  5EC7 A;  1QP2 A;  3A8M B;  3OYG A;  4DOW A;  1VQ6 Q;  1PRM C;  1OX8 A;  2O9V A;  3M9Q A;  2MWP A;  2EGE A;  1R77 A;  2DL5 A;  4AFU C;  4M7D G;  1AVZ C;  1GCP A;  1ZSZ A;  1VQ6 T;  4PJO C;  1Y7X A;  1HXD A;  2V26 A;  2JM9 A;  2A36 A;  2L3P A;  4IUR A;  4DOV A;  2HL5 C;  2EYQ A;  1U1T A;  4AG2 C;  1Q82 C;  1G3T A;  2MPX C;  4J6Y A;  4M4Z A;  3BDU A;  2LNH B;  2QDL A;  2IPO B;  4OML A;  1PG5 B;  2LVM A;  4QT7 A;  4ANJ A;  1NJI R;  1H8K A;  2RNA A;  1GCQ A;  1Y57 A;  4KT0 E;  1KJW A;  4DBH A;  2YDL A;  3REA B;  4M77 D;  3VRY A;  4DQ2 A;  4PFP A;  2CP7 A;  1RI9 A;  1EZZ B;  1MGQ A;  2X3X D;  1UG1 A;  3BDL A;  3EHR A;  4ELZ C;  3CC7 Q;  3JB9 D;  4FYX B;  4ZTF A;  4CC4 B;  4DA4 A;  4N0A A;  5IN1 A;  4BE1 A;  1NBE B;  2E12 A;  2X4W A;  2XDB A;  1OI1 A;  4KGZ B;  3ME9 A;  4C5H A;  4J83 A;  4A54 A;  1OU8 A;  2CP3 A;  3HRU A;  3ZEH A;  4P5N A;  4XU3 A;  2RK1 A;  1I4K 1;  3L2Q A;  5IT9 E;  1FMV A;  3TVT A;  2MAM A;  1AZG B;  5GJV B;  4GLM A;  2K5L A;  4F7U G;  1QCF A;  1ZHI A;  2DD5 A;  5IXB A;  2CUD A;  1VQP A;  1M90 U;  4KUD K;  2HCK A;  4FSX A;  4QKU A;  1QVG A;  1WJR A;  2ED0 A;  1B34 B;  3OYI A;  4F16 A;  4JJN K;  4A4E A;  1BIA A;  2P84 A;  3CXC A;  1I81 A;  4J6W A;  2ZPB B;  1QW1 A;  5CR2 A;  2RHX A;  2EVR A;  2QYZ A;  2JW4 A;  4QQ6 A;  5LJ3 e;  4M7A C;  4J7I A;  4PFO A;  4DBF A;  2FL7 A;  3CC7 A;  1GBQ A;  2DEU A;  1M5Q 1;  5LJ5 f;  4ATO A;  2DZC A;  3FDR A;  3H8Z A;  5DY9 A;  2XID A;  2CZ6 B;  1U3O A;  3MEA A;  2NLU A;  1RUW A;  1QVG S;  2CYZ B;  2RHY A;  4LNP A;  2RO0 A;  1ZUK A;  4WCI A;  2R58 A;  1CSK A;  5LJ3 j;  2RD1 A;  1PM3 A;  3CXC S;  1PKT A;  1M2V A;  4IUV A;  1K1Z A;  3NPF A;  4A4G A;  2PU9 B;  3HKS A;  3CCU A;  3X28 B;  1I07 A;  1BCM A;  4KRT A;  1MNE A;  4M7A G;  4R56 A;  1VQ4 A;  1IB8 A;  4A4F A;  1K8A C;  3CCL Q;  3VS2 A;  4IIM A;  3NHN A;  3M57 A;  2LP5 A;  2DJZ A;  3KXT A;  3E1S A;  2E3I A;  4FCY A;  1M8M A;  3CCL T;  1W4S A;  3V7C A;  1ZLM A;  3EFO B;  3GOX A;  1WLP B;  1VIF A;  1UUE A;  2X4J A;  5D6X A;  1N27 A;  2QDY B;  1JU5 C;  3CC2 A;  2BE9 B;  1D3B B;  2DIL A;  1N9R A;  4BE2 A;  2D6F A;  1QP3 A;  1D09 B;  1MMA A;  1C0M A;  3X26 B;  1M3C A;  4CI0 C;  2DRK A;  2EGC A;  2BZY A;  2CP6 A;  3UWN A;  3M0P A;  2HSE B;  3OMC A;  4EMK C;  2LQK A;  2RH2 A;  2FZG B;  2M0Y A;  1G2B A;  4M7D D;  1YIJ Q;  2JTF A;  5LJ5 h;  4BDZ A;  1TWB A;  4JS5 A;  3M4G A;  2LT4 A;  2V8J A;  4QQG A;  2EYY A;  3CCL A;  2A7Y A;  3VS5 A;  3RR6 A;  2IG0 A;  1E6G A;  4CRI A;  1YIJ T;  5D7U A;  2EJF A;  1Z9Q A;  5A0L A;  1VQN Q;  5GAM g;  3FLG A;  4IUP A;  5GAO n;  3L2V A;  3LWI A;  2E1H A;  1C6V X;  3CBM A;  2P0Q A;  4HVU A;  3I5S A;  3THK A;  5AYF A;  1UEC A;  2V8K A;  2YSQ A;  3ZBD A;  3ER0 A;  1VQN T;  4KH0 B;  1KC8 R;  4UC4 A;  2K57 A;  4HT9 A;  4C5E A;  1QQJ A;  2JNG A;  2EWN A;  5I21 A;  3CCV Q;  3OYM A;  2QTV A;  3VS4 A;  5HCK A;  5C0M A;  4C8Q D;  2RI5 A;  2JT4 A;  1U5S A;  1MMD A;  3LGL A;  1BYM A;  3PTA A;  3CMA A;  1YIJ A;  3EG1 A;  3RBB B;  3INZ A;  2WAC A;  1PSE A;  2K79 A;  4AFZ C;  1KQS S;  1QVF A;  2O88 A;  2Y4Y A;  2AK5 A;  5C6S A;  3CCV T;  1D0Y A;  5LJ3 h;  3OYC A;  2XD0 A;  1N5Z A;  4X9C A;  2YT6 A;  1JJ2 P;  2BKD N;  7AT1 B;  3I55 A;  1VQN A;  2DE0 X;  2OAU A;  4F14 A;  3QJ6 A;  1M2V B;  1KG1 A;  1X6O A;  4D6W A;  4PJN A;  3HP9 A;  3PNW C;  5FRM A;  1OU9 A;  2FRY A;  4OMN A;  3VJP A;  4E7S A;  1QVF S;  3CCJ A;  2D9T A;  1T0J A;  3GNF B;  1ZUU A;  3QO3 A;  1WFW A;  4C92 A;  3VUB A;  1E7O A;  2WSC E;  4C92 E;  3SDZ A;  2AKK A;  4Q5W A;  3T9N A;  3UF4 A;  2F69 A;  2GCX A;  3BFM A;  4J9G A;  1GBR A;  3FJ5 A;  5GAN 2;  2JM8 A;  4O6J A;  3OYA A;  1W2B P;  1VQL Q;  4XTX A;  1YCY A;  1XTD A;  3RIR A;  3SFM A;  3RES A;  1ZSZ C;  1S72 A;  1K73 U;  1P92 A;  2DLP A;  3E9G A;  2DZ9 A;  3O5Z A;  1NLO C;  4OGC A;  2K2V A;  4M77 C;  4C92 D;  1K0X A;  2RQU A;  1YJN Q;  1VQL T;  1VQ8 Q;  2D0N A;  1X75 C;  3C95 A;  4HVV A;  1VUB A;  1RAA B;  1OPK A;  2OI3 A;  3JCM c;  4MDW A;  4L5G A;  4BY6 C;  4B9X A;  4XTU A;  2L3S A;  3OYE A;  2DVE A;  2EYX A;  3RKY A;  1GCQ C;  4A4H A;  1YJN T;  1WHK A;  1Y71 A;  1VQ8 T;  4AG1 C;  3G71 Q;  2KRM A;  2A08 A;  3A8H B;  1VQ5 Q;  1WHH A;  2V8I A;  1RAI B;  3OW2 S;  1ZX6 A;  2YRC A;  4R0K A;  2I2L A;  1LCK A;  1ZA1 B;  3G71 T;  2DTO A;  3TQ7 P;  3E9F A;  2VXE A;  1VQ5 T;  4N0A C;  3IQL A;  4DBR A;  3NTH A;  2M0O A;  1D1C A;  3G7Z A;  2L2P A;  1G3W A;  1WXU A;  3SB2 A;  4LE9 A;  2ABL A;  1OEB A;  2DL4 A;  2NUZ A;  1ZUY A;  5KYN A;  3MHX A;  2YLC A;  1WX6 A;  3JB9 G;  1K8A U;  1PSF A;  1Y0M A;  1TU0 B;  2KI7 A;  2C0T A;  4ORZ A;  1FXX A;  2A37 A;  1YJ9 A;  1YJN A;  1M27 C;  4M75 F;  1VQ8 A;  1UHC A;  2DA9 A;  3S3N A;  2EPD A;  5LJ3 d;  2QGG A;  4EMH A;  2KYM A;  2QK0 A;  4EPC A;  1JEG A;  4FT4 A;  4PFZ A;  3I56 Q;  1K9A A;  3V7R A;  3UA6 A;  2E64 A;  3L1A A;  3S6W A;  3VU3 C;  2MWO A;  3G71 A;  4L6V 5;  4BB7 A;  2G6F X;  4NL2 A;  2H3E B;  3E19 A;  3UDC A;  3OMG A;  5GAN f;  1VQ5 A;  4E2F B;  3CPW A;  4PJO F;  4E47 A;  1Q7Y C;  3G4S A;  4ELY C;  3JCM b;  3I56 T;  2YXY A;  4E7Z A;  2RK2 A;  4M78 B;  4GY5 A;  2DAQ A;  4ME7 A;  2OTJ Q;  4JDS A;  3H9N A;  1JBM A;  1N9S A;  2ZZD A;  1OPL A;  5FLX E;  2HKN A;  4FL6 A;  4B9W A;  1U06 A;  4RKU E;  2F2W A;  1GL5 A;  3H0H A;  1YIT Q;  3EGD A;  1WDX A;  3L2W A;  4LDV A;  3GF5 A;  1UJ0 A;  1MND A;  2LQ8 A;  2QGF B;  2OTJ T;  3CBO A;  2NUT B;  1Z9Z A;  3CPW S;  4F7U F;  1YIT T;  1M1K C;  3BW1 A;  2K9G A;  4XU0 A;  2HZY A;  1ACM B;  2E10 A;  3MJX A;  4JS4 A;  1UTI A;  2F5T X;  2K3X A;  2RF0 A;  2KVQ G;  2PVG B;  1PWT A;  2W10 A;  2KYB A;  4O5V A;  1UGQ B;  4OMO A;  1WJQ A;  2VB6 A;  3OBY A;  2VGM A;  4C0G A;  4D8K A;  1M2O A;  2AKL A;  2CP5 A;  2FZC B;  1NM7 A;  1B34 A;  2CZ1 B;  1ZBJ A;  2YUQ A;  3EAE A;  3CCR Q;  3JCM e;  3EGX A;  2CZ7 B;  4YTL A;  4ZN1 A;  4J9D A;  3OA6 A;  3MEW A;  5CCA A;  5GAO m;  4OMF B;  3WVE B;  4M7D C;  3PFS A;  1JXO A;  3CCR T;  1W2B A;  1K73 R;  4LD9 K;  5FRO A;  3FB9 A;  5FU6 C;  2YHT A;  4LUE A;  3UA7 A;  1AD5 A;  1K9M R;  1LVK A;  3Q1J A;  2KBT A;  3TU4 K;  3CCM Q;  2X4Y A;  2XK0 A;  1WIE A;  3EGU A;  1TUD A;  2E3H A;  1ZA2 B;  3QYG B;  3CCE Q;  1VQ7 Q;  2DL7 A;  4M7A F;  1X6G A;  3X20 B;  4K11 A;  4J9I A;  2H8H A;  3A5Z B;  1RAC B;  4IUT A;  3EHQ A;  8ATC B;  1WA7 A;  4BD3 A;  2ZPG B;  1N6A A;  1Q95 G;  2DM1 A;  3CCE T;  1TSF A;  1VQ7 T;  3EFR A;  2K5I A;  1NYF A;  1H3Z A;  1YJW A;  3RMS A;  2L89 A;  3JB9 I;  3CCR A;  5KYW B;  4BI8 B;  2DXU A;  4RMO A;  4RCB A;  1WYX A;  4C8Q C;  2DL8 A;  2R57 A;  4OP0 A;  5J26 A;  3EFO A;  1YWP A;  2J6F A;  2QEX A;  1K0S A;  2RM4 A;  2M02 A;  3JCM f;  2FHD A;  1D3B A;  1PNJ A;  1VQP Q;  2MI6 A;  2EQI A;  2RB6 A;  2PQW A;  2QG9 B;  2KXD A;  5LJ5 e;  3CCM A;  3X25 B;  1YBY A;  9ATC B;  1VQP T;  3CCE A;  1VQ7 A;  2QTX A;  1EIF A;  2P4T A;  1SSH A;  2CH4 A;  5DM7 R;  2FPF A;  1FYN A;  1QWF A;  4JRK A;  1N8R C;  1MV3 A;  3SWN A;  2QI2 A;  1PKS A;  3EGD B;  4C8Q G;  5HY6 A;  3UT1 A;  5LJ5 j;  3QWY A;  2RPN A;  2DVJ A;  4ESR A;  3CC7 T;  3X24 B;  2LC4 A;  2FVU A;  1OOT A;  1J3T A;  2DTH A;  4X34 A;  1AWJ A;  1NG2 A;  2E41 A;  5GMK m;  5CO7 A;  1KQS P;  4RTU A;  4C0D C;  3R6O A;  2WSE E;  2A0F B;  4FIB A;  2J05 A;  5FU7 B;  3VUZ A;  3CCU Q;  4C92 C;  4C0Z A;  2EW3 A;  1Y07 A;  5FWC A;  1AWO A;  4RTY A;  4XTY A;  3SD4 A;  6AT1 B;  2RA2 A;  2QQ9 A;  2IVW A;  5HKC A;  3N5B B;  2HAX A;  4XTZ A;  1VQ4 Q;  3TEE A;  3RKX A;  1Y96 B;  3I35 A;  5KE3 A;  1JRI A;  1W70 A;  2LNV A;  2RI3 A;  4ZGD B;  4NL3 A;  2CZ0 B;  2P0K A;  4JLI A;  5GAO l;  3CCU T;  5I2M A;  1XOV A;  2JUF A;  3EGX B;  2VVK A;  1V29 B;  1SPK A;  1QKX A;  3DB3 A;  5LJ3 g;  2X51 A;  3QZ5 B;  1VQ4 T;  1YFN A;  4HKE A;  3WVD B;  2M1H A;  2HDA A;  3JCM X;  1Q7Y U;  4BI3 A;  1Q81 C;  1RAB B;  3JCM h;  4RG2 A;  5HK0 A;  1GRI A;  5CKF A;  3CC2 Q;  5GAN 8;  1IRX A;  1M1G A;  4KUL A;  1VIE A;  4RCC A;  2VAS A;  1A0N B;  3MEV A;  2DET A;  1G3S A;  4C92 G;  1VQK A;  1QMC A;  2DIQ A;  2ZPE B;  4F17 A;  2LX7 A;  3REB B;  1B07 A;  3CC2 T;  3MP6 A;  3D7S B;  1WHG A;  4PKC C;  1R0B G;  3S3O A;  1KHI A;  2A3L A;  5L8R E;  1BB9 A;  1R0C B;  5CQY A;  1ZBX A;  3QDR B;  3S3M A;  1Q86 U;  1VA7 A;  3CD6 Q;  2DMO A;  2FRW A;  2QQS A;  5A0G A;  5KCO A;  3MCA B;  3OSV A;  3LGF A;  1BKB A;  4C0F A;  5GAO r;  2DTI A;  2OAW A;  8AT1 B;  1I0C A;  4DBQ A;  2GQI A;  2DO3 A;  2FPD A;  3CD6 T;  2DER A;  4XU2 A;  3OW2 P;  5GAN 4;  1ARK A;  3OYH A;  2KRS A;  3RNJ A;  2DD4 A;  2L8D A;  1WXB A;  4MZM A;  3MKD A;  4BAC A;  5IAY A;  2DBK A;  4HXJ A;  2JJ9 A;  2P4R A;  3FRN A;  3JCM W;  3JCM J;  1UB4 A;  2LJ1 A;  2IIM A;  3BE3 A;  1I5L A;  3H6Z A;  4JUV A;  3ZL7 C;  5CQX A;  2QQB A;  2JMA A;  3NTK A;  3CMA Q;  1BK2 A;  2HBW A;  1KD1 U;  4D8D A;  4M77 F;  3NTI A;  3CD6 A;  2FPE A;  3SWN B;  2R5M A;  3C0C A;  2MCN A;  2LT1 A;  2ZPI B;  3URG A;  5GMK l;  3JB9 F;  3G1J A;  3CMA T;  1IHV A;  2COZ A;  1M3B A;  2LRQ A;  4M75 A;  1E6H A;  4OMQ A;  1NPP A;  3LW5 E;  1MMN A;  4M75 E;  3QUI A;  2XG8 D;  3JRZ A;  3I55 Q;  2F2V A;  4RTT A;  5CKE A;  3UAT A;  2ZGW A;  1KK7 A;  3MEU A;  2HQH A;  4Z88 A;  4BI4 A;  1KSW A;  4X9D A;  3JCM d;  4IUQ A;  1BI3 A;  3A8L B;  3CCJ Q;  1SKU B;  3I55 T;  2DJQ A;  3TCJ A;  5GAO q;  4PJO A;  3HL8 A;  4HCZ A;  4FU6 A;  5GAN 3;  1M4Z A;  5GAM e;  3QPH A;  4PJO E;  1Q82 U;  4C5I A;  4L59 A;  3CCQ A;  3I9Q A;  1CKA A;  4FSS A;  3CCJ T;  2E5Q A;  2P0P A;  3PIP A;  4E7L A;  4ZNX A;  3LWH A;  1S72 Q;  4ZGJ B;  4Y92 A;  1OYX A;  4E7I A;  1M90 R;  3OYK A;  4M78 A;  2F2X A;  4M78 E;  1DJ7 B;  2KT1 A;  2HEQ A;  5GAM j;  4Z89 A;  1S72 T;  5I11 A;  4EDU A;  1R8O B;  5IHI A;  2VXF A;  4ZN3 A;  4CC2 A;  5GAO p;  2DBM A;  2I0N A;  4OMP A;  3MET A;  4ZTJ A;  1M1F A;  3J7A F;  1VQO A;  2CS7 A;  2FO0 A;  2NUT A;  3H0I A;  1Q7Y R;  4QVZ A;  2JTE A;  3C4S A;  5GMK e;  3HTR A;  4M78 D;  3JAM E;  1TUC A;  3A8O B;  4RTZ A;  4VUB A;  3M59 A;  4HCB A;  4XK8 E;  2RI2 A;  2CT3 A;  4LXC A;  1UE9 A;  1RLQ C;  2Z0W A;  1VQ9 A;  1BI1 A;  2EKH A;  3GP8 A;  2JS2 A;  1TOV A;  1AT1 B;  2LZ6 B;  2KMT A;  1JB0 E;  5GMK j;  3OYJ A;  4JJC A;  2RJF A;  3CME Q;  1RL2 A;  5A0D A;  4PLL A;  5CK9 A;  1Q86 R;  2ROL A;  4OF1 A;  5GAM f;  5LJ5 d;  4RTV A;  1IGQ A;  2VUB A;  1YJ9 Q;  3PMT A;  3CME T;  4FYV B;  1GFD A;  3ZFJ A;  2CP0 A;  2KK4 A;  5GAN e;  1WI7 A;  2O01 E;  3GLX A;  5FWB A;  1Q81 U;  2RQV A;  3HSB A;  4TVR A;  1YJ9 T;  3OBW A;  3C12 A;  4M7A A;  2E5K A;  2KAF A;  3F70 A;  1PD0 A;  4M7A E;  3OSS C;  2ZPH B;  2HQE A;  3G4S Q;  5D6W A;  1XNI A;  3GIB A;  2D0Q B;  5GAN j;  1WHJ A;  5GMK i;  2BIV A;  3M55 A;  4LDW A;  2XDP A;  2MK5 A;  1NYG A;  4M7D F;  2DEQ A;  2FB7 A;  4LN2 A;  4CC3 A;  3P8D A;  5KH6 A;  3G6E Q;  1IRE B;  3G4S T;  2KEA A;  1WXT A;  5AT1 B;  3OQ5 A;  3CME A;  4M75 B;  4JPB W;  4FW2 A;  3A1P A;  5IH2 A;  1FWZ A;  1QLY A;  1SF9 A;  1KD1 R;  4AMC A;  5KYW A;  4NS5 A;  2L5Q A;  3G6E T;  2D1X A;  2B8A A;  2W0Z A;  1KC8 C;  3SHW A;  1U1S A;  3FJP A;  2L3R A;  5IHK A;  4PJO B;  2XDD A;  2FYK A;  1QCN A;  2AZS A;  2KQW A;  2PNI A;  2DYI A;  3LX7 A;  2WSF E;  3RDV A;  2HQX A;  4RG8 A;  4V2S A;  2KR3 A;  4N4H A;  5GAM h;  2VYT A;  3EH2 A;  3RKW A;  2OTL A;  2E6Z A;  2RHI A;  2DYB A;  2X9H A;  3TRE A;  2VKN A;  4C8Q F;  1Q82 R;  2KRN A;  2BZX A;  1KIK A;  2PUO B;  1YP5 A;  3MO8 A;  3AHU A;  3OS2 A;  2KGT A;  3G6E A;  2EJG A;  4F7U B;  4E7K A;  1UGV A;  2G3R A;  4EMK A;  1OV3 A;  2NYS A;  2LJ3 A;  4IUU A;  2ESW A;  3VS3 A;  4R55 A;  2CGH A;  3A8G B;  4JRI A;  4LD6 A;  2J6K A;  4HCC A;  3LH0 A;  2GQV A;  3A98 A;  1BU1 A;  2FZK B;  4BE0 A;  4LDY A;  3PT9 A;  2EAY A;  1RAF B;  2QA4 Q;  2CSQ A;  2DRM A;  4HT8 A;  1ABO A;  1HD3 A;  1WNL A;  5GMK h;  1MHN A;  4CC7 A;  2BUD A;  2LDM A;  1LOJ A;  1JJ2 A;  1H3H A;  1AZE A;  4LDX A;  1V76 A;  3M4Y A;  1QVG P;  3SEM A;  1HK9 A;  4KGV B;  2QA4 T;  4Z8A A;  1Y96 A;  2RQW A;  3PIO A;  4JZ4 A;  1YJW Q;  3KBG A;  3CXC P;  1LPL A;  3EG0 A;  3JSC A;  3P8B B;  3QXE B;  1I5O B;  1TUG B;  2DNU A;  2PVO B;  3DKM A;  3JCM V;  1YJW T;  2QEX Q;  5KYY A;  4HA8 A;  2DX1 A;  1PC0 A;  1YCS B;  1YHQ A;  1O75 A;  5KYU A;  3OYF A;  4C92 F;  2LQW A;  2EQK A;  2BTT A;  2LQN A;  1RAE B;  2CSI A;  2RMO A;  4M7A B;  1XQH A;  2J06 A;  1JO8 A;  1PHT A;  5GAN h;  2QEX T;  2RJE A;  3L42 A;  4AT1 B;  1T0H A;  2QA4 A;  1FMK A;  2A28 A;  2O4X B;  3M0U A;  4JLG A;  3CCS A;  4RTX A;  3CCM T;  1NEB A;  3GPL A;  1W2B S;  2JOY A;  2CT4 A;  1BI0 A;  2RQT A;  3PGG A;  5J39 A;  5I2S A;  1VQM A;  1AWW A;  2C06 A;  2JTM A;  1NEG A;  3HPW A;  5FRN A;  2K7A A;  4J9E A;  1OX9 A;  3QII A;  1I1J A;  1K8A R;  2COW A;  1VYT A;  2RHZ A;  2Y4X A;  4E6R A;  2YRV A;  2K4Y A;  3AT1 B;  1X6B A;  3CC4 A;  3OYN A;  5LJ5 g;  4M77 A;  1NE8 A;  4M77 E;  3I5R A;  2MF2 A;  2NUP A;  3LH5 A;  2KDS A;  3QDF A;  3VS7 A;  2RJD A;  4M75 G;  4M78 C;  5GJW B;  3U23 A;  1JXM A;  2B86 A;  3HFO A;  4KUI A;  5HK3 A;  4N4G A;  4EMK B;  4MDX A;  4MZT A;  2MIO A;  2QQA A;  2J7I A;  5M9O A;  3CQT A;  3UPU A;  2HNI A;  2F1L A;  1VQK Q;  2CKK A;  4PJO G;  4OB1 B;  4J7F A;  1VQ6 A;  1WGS A;  1F1B B;  2KT8 A;  2RHU A;  4JRQ A;  2GNC A;  1W1F A;  2HD0 A;  2VWF A;  3EG9 B;  2QXF A;  3O8V A;  1LJO A;  3JCM Q;  1RLP C;  2EBP A;  2JN0 A;  1VQK T;  2QAS A;  3GNG A;  2Y90 A;  1AHJ B;  1VYV A;  1KC8 U;  4M78 G;  2ED1 A;  1I8F A;  4JZ3 A;  2MMP A;  1X43 A;  1WQW A;  1WZO A;  3P8H A;  3JB9 J;  5GAN d;  3MPU B;  2CH4 W;  2L0A A;  1SRL A;  2EYZ A;  2HMA A;  3CEY A;  4II1 A;  2EYW A;  1G83 A;  1QVF P;  1K73 C;  4QVD A;  2PUK B;  3RER A;  1KHC A;  5KYY B;  1YI2 Q;  5KYU B;  4A4K A;  3M56 A;  1K9M C;  4QW2 A;  2F5K A;  3OY9 A;  3L2R A;  4BUG A;  1X27 A;  1UGR B;  2EFI A;  5CVI A;  1NPR A;  2M16 A;  1IHW A;  2PTK A;  1PRL C;  1YI2 T;  4JRP A;  2DL3 A;  4EMG A;  4GLK A;  4PJJ A;  4KGX B;  1MUZ A;  2C0O A;  1HSQ A;  2DF6 A;  1AEY A;  4QQD A;  4DEY A;  4WF2 A;  2R5A A;  5ECA A;  1M1K U;  2EKO A;  5CIU A;  3M53 A;  1GXI E;  5A2Q E;  4E7H A;  3VS1 A;  3OYD A;  3CBP A;  2M9U A;  1TXQ A;  2OX7 A;  2KE9 A;  4LUD A;  3RMQ A;  1ABQ A;  2DXC A;  2K5F A;  3OB9 A;  4KBM B;  1PCX A;  2V1Q A;  5EG2 A;  1UGS B;  3ULR B;  4PK4 A;  1YNZ A;  2CDT A;  4AFS C;  5IHN A;  3ASK A;  1YWO A;  1ZSG A;  2YWW A;  3V8L A;  4OB2 B;  3VYH B;  1YI2 A;  2DXT A;  3JV3 A;  3JB9 H;  3NMZ C;  1S1N A;  1NJI C;  1ZSZ B;  2ENM A;  2PVD B;  4J8O A;  3E2U A;  3VYG A;  1UJY A;  3QSU A;  2COY A;  3NFC A;  3PMI A;  3QWX X;  4M77 B;  3CCQ Q;  3EH1 A;  1NLP C;  2JS0 A;  2V1R A;  2NUP B;  4J9F A;  4M7D A;  3QZ9 B;  1T3L A;  4M7D E;  4BY6 B;  2AHJ B;  5LJ3 f;  2LMJ A;  2NWM A;  3CCQ T;  2MYS A;  5KCH A;  2GF7 A;  1RI0 A;  1QCO A;  3QKJ A;  3VS0 A;  1CKB A;  1EFN A;  4N4I A;  2EQJ A;  1WPY A;  1H64 1;  5KE2 A;  3MP8 A;  1XJW B;  3M5A A;  3J81 E;  3M0S A;  1KFZ A;  2E4H A;  4J9H A;  2HSP A;  1TG0 A;  1VQO Q;  2VC8 A;  2MOX A;  2DFU A;  3QBY A;  5L23 A;  2DK3 A;  2SEM A;  1V1C A;  3V8K A;  4IIO A;  5FU7 C;  3FC3 A;  1SRM A;  3BY7 A;  1VQO T;  1VQ9 Q;  3M0Q A;  5J3B A;  1TH7 A;  3TSW A;  4QVC A;  3M0T A;  4M75 D;  1VOM A;  2RJC A;  2KY9 A;  3V7S A;  2SRC A;  1UFF A;  3OS0 A;  4C8Q A;  1KQS A;  3VS6 A;  4C5G A;  3CPW P;  1BBZ A;  3PVL A;  4RUG A;  4C8Q E;  1VQ9 T;  1G8X A;  4OMM A;  3QJY A;  3QHS A;  1WHM A;  4A63 B;  1WQ7 A;  2K6D A;  4PJO D;  4OB3 B;  2ROT A;  1D1B A;  4LDU A;  1WHL A;  1SG5 A;  1M30 A;  2DIG A;  4F7U A;  2AT1 B;  4F7U E;  1N8R U;  3M54 A;  5D6Y A;  1QVP A;  2JZ2 A;  1C1A A;  1D0X A;  4FM4 B;  1EX4 A;  2YUP A;  3EG2 A;  2GFA A;  1M9S A;  4FYW B;  5IXF A;  2JXB A;  2XU8 A;  2O2O A;  2LJ0 A;  2JMC A;  2KXC A;  1U8R A;  1UHF A;  3VV0 A;  1IZ6 A;  2J6O A;  2C0I A;  2PZ1 A;  3C94 A;  3DB4 A;  5DLQ E;  1OUL A;  3TSZ A;  1VYU A;  3LLR A;  1BIB A;  1UEB A;  2ZPF B;  2HBP A;  3OS1 A;  1OQK A;  2KNB B;  1H92 A;  2EQM A;  1M1K R;  3QYH B;  2HL3 A;  4XTV A;  4J6X A;  1AOJ A;  4PJM A;  4AFQ C;  1RAD B;  3FIF A;  4JJB A;  3J80 E;  1IXD A;  2EJ9 A;  1IGU A;  5GAN g;  3CCV A;  1SSF A;  2LCC A;  2YLB A;  2RQR A;  4GBQ A;  3NGP A;  1X01 A;  1SHG A;  2BZ8 A;  3OW2 A;  2BE7 D;  2D8J A;  3H0F A;  3PVQ A;  1K9M U;  2QAZ A;  5DLO A;  3L2U A;  2E65 A;  4BDY A;  4M7D B;  1MMG A;  2DXB A;  2RN8 A;  2EIF A;  4ZGE B;  3VRZ A;  2FG0 A;  2KRO A;  4PL6 A;  1K4U S;  3H41 A;  5FU6 B;  2OTL Q;  4JJD A;  2GTJ A;  2CRE A;  4FYY B;  5KYX A;  2K3Y A;  2O4X A;  3DLL A;  3WXM B;  2CP2 A;  1D0Z A;  4J5Y A;  5CKB A;  1T3S A;  3SWN C;  5I22 A;  4M7A D;  4KH1 B;  4A53 A;  1HYO A;  1YN8 A;  2E6N A;  5CKD A;  4NOY A;  2GTO A;  2VGN A;  2GBQ A;  2OTL T;  5GAN 6;  1M8V A;  4MML A;  4E7J A;  2ECZ A;  2YRD A;  2ZCF B;  3CPF A;  3OS5 A;  4PLI A;  1AWX A;  1SEM A;  2O31 A;  4FT2 A;  4M77 G;  3OYL A;  2H3J A;  2ZAE A;  5FW9 A;  1VQL A;  1JQQ A;  1K76 A;  3VKI A;  1RAG B;  2AZV A;  2GGR A;  1M3A A;  4RTW A;  2FEI A;  4MZP A;  1OZ3 A;  1FMW A;  1X69 A;  1NJI U;  4C8Q B;  4FW1 A;  2E70 A;  3HRT A;  2OJ2 A;  4XU1 A;  3RUX A;  1M90 C;  1MV0 B;  4PNO A;  1TTH B;  2XI9 A;  4MMK A;  4OVA A;  2LCL A;  4F04 B;  2D8H A;  3LYI A;  5CKH A;  4WTO B;  1B3Q A;  1QWE A;  2AIR B;  1YHQ Q;  1ZQ1 A;  3QG1 A;  1G5V A;  4J9B A;  4DEX A;  1UGP B;  2QQR A;  1SHF A;  1X2Q A;  1O9S A;  4Y28 E;  4HVW A;  5GAN 7;  1X2K A;  1TS9 A;  2EQU A;  2L3Q A;  1YHQ T;  3EFS A;  3KUF A;  1BCO A;  3EG9 A;  4X1V A;  2O9S A;  1N8R R;  4M78 F;  1G3Y A;  3V8J A;  1UDL A;  4XQ3 A;  4XAX B;  2DKG A;  4Y91 A;  2X35 A;  4HCK A;  3CCS Q;  1BI2 A;  3DLM A;  2JVV A;  3R6N A;  2GFU A;  4OGE A;  2LTO A;  2YUN A;  2M51 A;  1Q86 C;  3MP1 A;  4C0D B;  1NZ9 A;  1FX7 A;  1VQM Q;  2KSS A;  4XTW A;  3HFN A;  3CCS T;  5LL6 S;  3JCM g;  2K3B A;  2ATC B;  4C92 B;  2LX9 A;  4J9C A;  1B7T A;  3OYB A;  3KFV A;  3I56 A;  4IKF A;  1GFC A;  1OZ2 A;  2X4X A;  4Z02 A;  2YUO A;  1IO6 A;  3PE0 A;  1VQM T;  3HHT B;  1KQ1 A;  1JJ2 S;  3GBQ A;  2XKO C;  2HKQ B;  1LNX A;  1W6X A;  2LCS A;  2X3W D;  2XIC A;  1RAH B;  4EIK A;  3CC4 Q;  4PJL A;  2OTJ A;  3FEO A;  3M0R A;  1HJD A;  2VV5 A;  1D1A A;  3M58 A;  3HRS A;  3JCM P;  3L2Z A;  1YIT A;  5GAN 5;  5CAI A;  3OYY A;  5KYX B;  1Q81 R;  2XMF A;  3CC4 T;  3EG3 A;  1QKW A; 
#chains in the Genus database with same CATH homology
 2CUB A;  4LE9 A;  2ABL A;  1OEB A;  2DL4 A;  2NUZ A;  1ZUY A;  3I9Q A;  1CKA A;  2EGA A;  1X27 A;  1WX6 A;  4FSS A;  1Y0M A;  2PTK A;  1PRL C;  4ZNX A;  2K2M A;  2C0T A;  4Y92 A;  4ORZ A;  2DL3 A;  2A37 A;  5EC7 A;  1M27 C;  1UHC A;  1MUZ A;  2C0O A;  2DA9 A;  1HSQ A;  2EPD A;  2F2X A;  2DF6 A;  1AEY A;  2KT1 A;  2KYM A;  4DEY A;  1PRM C;  2HEQ A;  1JEG A;  5ECA A;  2O9V A;  4Z89 A;  1K9A A;  2EGE A;  5I11 A;  2DL5 A;  4AFU C;  3UA6 A;  5IHI A;  3VS1 A;  1AVZ C;  1GCP A;  4CC2 A;  2DBM A;  2G6F X;  2I0N A;  4OMP A;  2KE9 A;  2FO0 A;  3H0I A;  4LUD A;  2JTE A;  1ABQ A;  2JM9 A;  1TUC A;  2V1Q A;  2A36 A;  2L3P A;  4RTZ A;  3ULR B;  1YNZ A;  4AG2 C;  2CDT A;  4AFS C;  5IHN A;  2CT3 A;  1YWO A;  4M4Z A;  1UE9 A;  1ZSG A;  1RLQ C;  2LNH B;  1OPL A;  2QDL A;  2EKH A;  4OML A;  1U06 A;  2F2W A;  3JV3 A;  1GL5 A;  3H0H A;  3NMZ C;  2JS2 A;  4QT7 A;  1S1N A;  1H8K A;  2RNA A;  1WDX A;  1GCQ A;  2LZ6 B;  2ENM A;  1UJ0 A;  1Y57 A;  1KJW A;  2YDL A;  4JJC A;  3REA B;  3VRY A;  1UJY A;  1Z9Z A;  3QWX X;  1RI9 A;  1NLP C;  2JS0 A;  2X3X D;  2V1R A;  2K9G A;  1UG1 A;  3EHR A;  4J9F A;  2ROL A;  4RTV A;  1UTI A;  1T3L A;  2RF0 A;  4CC4 B;  1PWT A;  2W10 A;  2KYB A;  1GFD A;  2LMJ A;  2NWM A;  4OMO A;  1WI7 A;  5FWB A;  4D8K A;  3VS0 A;  2AKL A;  1CKB A;  2RQV A;  1EFN A;  1NM7 A;  2YUQ A;  1ZBJ A;  2E5K A;  3M0S A;  1KFZ A;  3TVT A;  4J9H A;  2HSP A;  1TG0 A;  1AZG B;  5GJV B;  2MOX A;  4GLM A;  1QCF A;  5L23 A;  4J9D A;  5IXB A;  2CUD A;  2SEM A;  1JXO A;  1V1C A;  2HCK A;  1NYG A;  4IIO A;  4LN2 A;  4CC3 A;  1SRM A;  3M0Q A;  3TSW A;  2ED0 A;  4LUE A;  3M0T A;  3UA7 A;  2KEA A;  1AD5 A;  1WXT A;  4F16 A;  4JPB W;  2KBT A;  2SRC A;  1UFF A;  5IH2 A;  1QLY A;  1WIE A;  2EVR A;  2JW4 A;  1TUD A;  3EGU A;  3VS6 A;  1BBZ A;  3PVL A;  4RUG A;  1GBQ A;  2D1X A;  2DL7 A;  1X6G A;  4OMM A;  4K11 A;  2W0Z A;  4J9I A;  1U3O A;  2H8H A;  3SHW A;  4A63 B;  3EHQ A;  2K6D A;  1RUW A;  1WA7 A;  5IHK A;  2ROT A;  4LNP A;  1ZUK A;  4WCI A;  1M30 A;  1CSK A;  2DM1 A;  1NYF A;  2AZS A;  2PNI A;  1PKT A;  1K1Z A;  3NPF A;  2KR3 A;  1WYX A;  2DL8 A;  2DYB A;  2VKN A;  1YWP A;  1I07 A;  2J6F A;  2YUP A;  3EG2 A;  2KRN A;  1K0S A;  2BZX A;  4KRT A;  1KIK A;  1YP5 A;  5IXF A;  1PNJ A;  2JXB A;  3VS2 A;  2KGT A;  4IIM A;  1UGV A;  2EQI A;  3NHN A;  2LP5 A;  2O2O A;  1OV3 A;  2LJ0 A;  2JMC A;  2KXC A;  2KXD A;  1UHF A;  2LJ3 A;  2J6O A;  2C0I A;  2ESW A;  2PZ1 A;  3VS3 A;  3TSZ A;  1VYU A;  1M8M A;  2J6K A;  2KNB B;  1H92 A;  3A98 A;  1ZLM A;  1BU1 A;  1WLP B;  1UUE A;  1SSH A;  2CH4 A;  2CSQ A;  1JU5 C;  2DRM A;  1AOJ A;  2FPF A;  1ABO A;  1FYN A;  1HD3 A;  1QWF A;  4CC7 A;  4AFQ C;  2DIL A;  1MV3 A;  1PKS A;  1M3C A;  4JJB A;  1H3H A;  2DRK A;  3QWY A;  2RPN A;  2DVJ A;  1AZE A;  2EGC A;  4ESR A;  2BZY A;  3SEM A;  2RQR A;  4GBQ A;  3NGP A;  4Z8A A;  1SHG A;  2RQW A;  2BZ8 A;  3M0P A;  1OOT A;  2D8J A;  3H0F A;  3PVQ A;  4JZ4 A;  1J3T A;  2M0Y A;  1AWJ A;  1G2B A;  1NG2 A;  3EG0 A;  4RTU A;  2RN8 A;  3VRZ A;  2FG0 A;  2DNU A;  2KRO A;  1K4U S;  3H41 A;  2J05 A;  2EYY A;  4JJD A;  2EW3 A;  2CRE A;  2GTJ A;  5FWC A;  3VS5 A;  1AWO A;  4RTY A;  2DX1 A;  1YCS B;  1E6G A;  1T3S A;  2LQW A;  5I22 A;  1Z9Q A;  1YN8 A;  2BTT A;  3I35 A;  2LQN A;  2CSI A;  2RMO A;  1W70 A;  2GTO A;  1XOV A;  2GBQ A;  2J06 A;  1JO8 A;  1PHT A;  2VVK A;  2ECZ A;  1SPK A;  1QKX A;  1T0H A;  4HVU A;  3I5S A;  3THK A;  1FMK A;  1AWX A;  2HDA A;  1UEC A;  1SEM A;  2O31 A;  2A28 A;  2YSQ A;  1GRI A;  3M0U A;  4RTX A;  5FW9 A;  1NEB A;  1JQQ A;  1A0N B;  2CT4 A;  1K76 A;  2RQT A;  2AZV A;  2GGR A;  1M3A A;  4RTW A;  3VS4 A;  5HCK A;  4F17 A;  2FEI A;  2JT4 A;  1X69 A;  1U5S A;  2LX7 A;  3REB B;  1AWW A;  1B07 A;  1NEG A;  2OJ2 A;  3EG1 A;  3RBB B;  1MV0 B;  2K79 A;  4AFZ C;  2O88 A;  2AK5 A;  1BB9 A;  2K7A A;  4J9E A;  1VA7 A;  2D8H A;  2DMO A;  2FRW A;  1B3Q A;  1QWE A;  1I1J A;  1N5Z A;  2YT6 A;  1VYT A;  2OAW A;  4E6R A;  4J9B A;  4DEX A;  1I0C A;  2DE0 X;  1X6B A;  2GQI A;  2FPD A;  1SHF A;  4F14 A;  1X2Q A;  4HVW A;  3I5R A;  1X2K A;  3LH5 A;  1ARK A;  2L3Q A;  4OMN A;  2FRY A;  3VS7 A;  2KRS A;  3RNJ A;  1T0J A;  1ZUU A;  1WFW A;  5GJW B;  1WXB A;  3U23 A;  1JXM A;  4X1V A;  1E7O A;  2B86 A;  2O9S A;  2AKK A;  3UF4 A;  1UDL A;  4HCK A;  4J9G A;  1GBR A;  2DBK A;  3FJ5 A;  2JM8 A;  3R6N A;  4HXJ A;  2P4R A;  2LJ1 A;  2MIO A;  2IIM A;  2J7I A;  2DLP A;  2YUN A;  2M51 A;  3CQT A;  3O5Z A;  1NLO C;  3ZL7 C;  1K0X A;  2KT8 A;  2JMA A;  2RQU A;  2K3B A;  2GNC A;  1W1F A;  1BK2 A;  2HBW A;  2VWF A;  4D8D A;  4J9C A;  2D0N A;  3KFV A;  4HVV A;  2FPE A;  1GFC A;  1RLP C;  1OPK A;  2EBP A;  2OI3 A;  2YUO A;  1IO6 A;  3C0C A;  3PE0 A;  2MCN A;  2L3S A;  1VYV A;  2EYX A;  3GBQ A;  1GCQ C;  2ED1 A;  1M3B A;  4JZ3 A;  2LCS A;  1W6X A;  4AG1 C;  1X43 A;  2KRM A;  1E6H A;  4OMQ A;  2X3W D;  2CH4 W;  2A08 A;  2L0A A;  2F2V A;  4RTT A;  1SRL A;  4EIK A;  1ZX6 A;  2EYZ A;  3UAT A;  3M0R A;  4Z88 A;  1HJD A;  4R0K A;  1KSW A;  2EYW A;  1LCK A;  1G83 A;  2DJQ A;  2XMF A;  3IQL A;  2L2P A;  3EG3 A;  1QKW A;  1WXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...