3BDUA

Crystal structure of protein q6d8g1 at the resolution 1.9 a. northeast structural genomics consortium target ewr22a.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
SSNYVLHTNDGRTIVAEGKPKVDDETGMISYTDAYGQQQQINRDNVKEMAKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipoprotein
molecule keywords Putative lipoprotein
publication title Crystal structure of protein Q6D8G1 at the resolution 1.9 A.
rcsb
source organism Pectobacterium atrosepticum scri1043
total genus 10
structure length 53
sequence length 53
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3bduA00
5GAMf 4F7UA 3JB9J 4HT8A 3FIFA 3JCMe 2E41A 4M78C 1I4K1 4MMLA 3JCMJ 2JN0A 4OP0A 3JB9H 2DTIA 1MGQA 3HFOA 1B34B 3JCMg 3V7RA 4QVCA 2EAYA 4M7DB 4PJOB 1BIAA 4F7UG 4M7DE 4J5YA 4M78F 5LJ3f 5GAN8 4PJOE 4XTVA 2DVEA 2DZ9A 1Y96A 3INZA 3V7CA 4XU3A 4M78D 1HK9A 1HXDA 1WPYA 3SWNA 4PJOC 5GAMd 4M7DC 1I8FA 4MMKA 1X01A 1JRIA 1WQ7A 1YCYA 3HFNA 3SWNB 4C92A 4HT9A 1JBMA 4XU2A 3RERA 2K57A 3JB9I 4PJOF 5GAOl 4NL2A 2RB6A 4EMKA 5GAMh 2YLCA 4RCBA 1N9RA 5GMKh 4QVDA 5GAOr 2RD1A 4PJOD 4C92G 3SWNC 4M7DD 4HA8A 3AHUA 3V8JA 4C8QA 5DY9A 3QSUA 5GANf 3JB9G 4M77A 4M75A 4V2SA 3BY7A 4F7UB 1WNLA 3JCMc 4F7UE 2EJGA 2DEQA 2YLBA 1KQ2A 3EFRA 4J6WA 4C8QG 4DQ2A 5LJ5d 2EJ9A 4XTYA 3BW1A 4M77G 4XTUA 3V8KA 5GAMe 3JB9F 4XTZA 3RKXA 1WQWA 5GMKm 3JCMf 5GMKl 2VXEA 2DJZA 5GMKe 5LJ5h 3HSBA 1Y96B 2CGHA 1U1SA 2EJFA 5GAMg 2DZCA 3JB9D 3GIBA 4F7UF 2EWNA 2FYKA 5GMKj 4M7AA 4Y91A 4C92B 3RKYA 4NL3A 1I81A 5GAN3 4C92E 2DXTA 3V8LA 1LJOA 4PNOA 5LJ3d 4EMKB 4A54A 4M7AG 3FJPA 4C92C 4XU1A 1LNXA 5LJ3h 4C8QB 4JRIA 2HNIA 5LJ5e 4A53A 4C8QE 4EMKC 4EMGA 4EMHA 4M77B 4M75B 1D3BA 4C92F 4M77E 4M75E 5LJ5j 3JCMX 2DTOA 1TH7A 3RUXA 5LJ5g 4JLIA 5CAIA 4M75G 4C8QC 4C92D 2DTHA 5GANe 4M77C 4M75C 4M78A 4JUVA 2VC8A 4JRKA 4X9DA 5GAMj 3RKWA 3FB9A 3L1AA 3BFMA 4C8QF 2E64A 5GANd 5I21A 1LOJA 5GANg 3V7SA 3EFSA 5GAOq 4M77F 4M75F 5GAOn 5LJ3e 3M4GA 4C8QD 1N9SA 5GAOp 4M7AB 4M78G 3VU3C 5GANh 1M8VA 4M7AE 4M77D 4M75D 5LJ3j 3JCMW 4X9CA 5LJ3g 2RM4A 1B34A 4PJOA 4M7DA 3JCMV 3QO3A 3QUIA 5GAN7 5GAN6 4XU0A 3JCMd 2DKGA 3L2ZA 4J6XA 4M7AC 1KQ1A 2I2LA 4J6YA 2Y90A 4XQ3A 2E10A 1H641 3BDUA 4PJOG 4N0AA 2YHTA 3JCMh 4M7DG 1BIBA 4XTWA 3JCMQ 4M7AF 3JCMP 4WF2A 2VXFA 1D3BB 2RA2A 2ZGWA 5GMKi 2E1HA 2DXUA 3PGGA 2E65A 1U1TA 4M7AD 4XTXA 3JCMb 5GAN5 5GAN4 5LJ5f 5GAOm 4M7DF 1I5LA 5GANj 3RESA 4NOYA 4N0AC 1M5Q1 4M78B 3QHSA 5GAN2 3RIRA 2FB7A 4M78E 3SB2A 4RCCA 2QTXA
chains in the Genus database with same CATH superfamily
1YWOA 4XK8E 3VKIA 4PJMA 3REBB 1NLOC 1BIAA 3VS4A 2O4XA 2AK5A 5KYUB 4KH0B 4J8OA 1M2OA 1GFCA 3SWNB 2KQWA 1GCQC 2BZYA 3EHRA 4EMKA 2PUKB 2RB6A 4FYWB 4QT7A 3MPUB 4M7DD 2ZPEB 2QAZA 4MDWA 3L2UA 4M75A 4RKUE 1C6VX 3SFMA 2PQWA 1WDXA 3PT9A 3E9FA 1EFNA 2AIRB 3WVEB 5CKDA 3Q1JA 3GIBA 1PSEA 1VQ7A 3I55A 2YUQA 4LN2A 4BE1A 2HSPA 2F5KA 3EH1A 3QKJA 4C92C 3VUBA 1M2VA 1TOVA 4A53A 3G71A 2COWA 3LWIA 2BE7D 4OMMA 4J7IA 1T3LA 1OX8A 4OMOA 2DTHA 5CKEA 3CD6T 1LCKA 2KAFA 5CK9A 4A4FA 9ATCB 3A5ZB 1YNZA 3OYBA 3V7SA 1YWPA 2KROA 4IUQA 4M77F 1S1NA 1RAAB 2F2WA 4ZGJB 1M90R 3VJPA 3GPLA 4FYXB 3OYFA 1Q7YU 2EW3A 2I2LA 4BY6B 3CBMA 1WHLA 1ZSZA 6AT1B 4DBFA 2RK1A 1TTHB 2E1HA 2D8JA 2QQAA 4JLGA 1VQPA 8ATCB 1VQ4Q 4E7ZA 3CCSQ 4NOYA 3P8BB 5D7UA 1Q86R 1VQKA 1VQ8T 4F7UA 2GGRA 5LL6S 1RI9A 4RUGA 3G4ST 3MEWA 2KVQG 3CPWA 2X4JA 5GAN8 2LRQA 4BDZA 1BI3A 3SWNA 4UC4A 1JRIA 2JTEA 3OYHA 4HT9A 2CYZB 3LH0A 2RPNA 3E19A 1ACMB 2YLCA 4JDSA 3QYHB 4C92G 4ESRA 2AZVA 1N27A 1UGRB 2QASA 2LCLA 2PVDB 1JJ2S 1D0XA 1UJYA 2RJEA 2KXCA 4DA4A 1N8RU 3HSBA 2JUFA 2J7IA 1K73U 1JO8A 2CKKA 4KGXB 2L5QA 2HQEA 1EZZB 1H3HA 1T0JA 2K5IA 2KR3A 2DRKA 2Z0WA 5GAN3 2PTKA 4FM4B 1QMCA 3CXCS 3HRSA 3L42A 3M0RA 1GFDA 2J6FA 1IREB 1Q81U 5FLXE 1QQJA 1AT1B 1NG2A 4C8QC 4C92D 3M0SA 4N4HA 1W6XA 4Z89A 1I5OB 3I9QA 2CDTA 3OYNA 2E5QA 2RI2A 4BE0A 3BFMA 5CKBA 3NMZC 4AFQC 1K9MU 2K5LA 3CMEQ 2YUPA 1WLPB 3OYLA 4MZMA 3WXMB 2DILA 1ZQ1A 2EPDA 2DBKA 3CD6A 1KHCA 1MMNA 1BIBA 5FRMA 2DF6A 2ZPGB 2EFIA 2JTMA 3RESA 3WVDB 3RR6A 4HKEA 4LDVA 1M3BA 2QI2A 3SB2A 2NUTA 5C0MA 3CCJT 2VASA 2M0OA 4XTVA 1YHQT 2X35A 2NUPA 2M02A 4C0DC 4PJOC 2W10A 1VQ8A 1X01A 4J7FA 2QTVA 1VQ6T 1NYGA 4XU2A 2RI3A 4IUVA 1AZEA 1KJWA 4HVVA 2RD1A 2K6DA 4X1VA 2DL5A 2EKHA 3A8GB 2KT1A 2YXYA 3C4SA 4DBRA 3I55Q 3CC7T 4C8QG 4LE9A 4LD6A 4XTZA 3RKXA 3LLRA 1PM3A 4Z02A 1D1BA 1OX9A 1YIJT 2MPXC 3G71Q 3I5SA 3G6EA 2GQVA 4N4IA 3X24B 3H0FA 2A0FB 1YJWT 1UJ0A 1Q82C 2JNGA 1V76A 2C0TA 3EGDB 3CEYA 4HCCA 3VS7A 3M5AA 3QYGB 1G8XA 4MZTA 4EMHA 5CO7A 3CCMT 4RG2A 2XG8D 4RTXA 5D6WA 4M78A 3P8HA 3CCVA 2DL4A 4C8QD 4KT0E 1M8VA 2QEXT 1AWJA 2LC4A 3QO3A 3OBWA 3X28B 1H641 1WHJA 2P4RA 3CCRA 3PIPA 4PJOG 1LPLA 4F17A 1U3OA 4M7AF 4PKCC 1KFZA 1QVFA 3C12A 1ZUKA 5DLOA 2JXBA 2VKNA 4QQ6A 1LVKA 5L8RE 1UTIA 5HY6A 1Q7YR 3ZL7C 3TVTA 4J9GA 4OMNA 2QTXA 4LNPA 1KC8R 4HT8A 1T3SA 3FIFA 1YN8A 2O9SA 1U8RA 5D6XA 3GNGA 1V1CA 3HFOA 3ASKA 3JV3A 2QGFB 2P4TA 4J5YA 1TS9A 1BCOA 1ZBJA 3V7CA 2YT6A 5GAMd 1ZA2B 1A0NB 1JU5C 2XU8A 4JPBW 2IG0A 2FPDA 2HMAA 4RCBA 2RF0A 1PCXA 4Y92A 4C5HA 2KMTA 4PJOD 1VQLT 3SWNC 2MF2A 1W1FA 2JW4A 2XDBA 2J6OA 3SDZA 3OYYA 3LW5E 1XTDA 2RHIA 1VQ9A 3CMAT 2EJ9A 1SEMA 1RUWA 1Y96B 2CGHA 1U06A 1PKTA 3M57A 4B9WA 2DVJA 1HD3A 4QQGA 1FMWA 1YFNA 3CPWS 4D6WA 1K73R 2H8HA 3EG2A 2DTOA 4JLIA 1ARKA 5GANe 3ZFJA 4HVUA 4X9DA 3PVLA 2SRCA 3A98A 5I21A 2ZZDA 1M90C 1YP5A 2NWMA 1Q81R 3I56A 5KYXA 1OU8A 3HRTA 3JCMW 1KQSA 4E2FB 3JCMd 4J9BA 1V29B 2ZAEA 2IPOB 2VXFA 4C0FA 4F16A 1G83A 4BY6C 2E65A 1Q86C 3CXCP 1I5LA 3TCJA 5I11A 2NUZA 1NYFA 1VQNT 1RADB 3EG0A 2F2VA 1G3WA 2QYZA 2X4XA 1OYXA 1SPKA 3PNWC 1VQ8Q 4LUDA 1B34B 1JJ2A 1G3TA 4O5VA 2ED1A 3HTRA 3EFOA 3OYCA 3QJYA 1JBMA 2L3RA 3DKMA 5GAMh 1W2BA 2OTJT 3THKA 5HK3A 3DLLA 3OW2S 4JJBA 5CQYA 4M77A 5I2SA 3G6EQ 1TUCA 2DM1A 1KK7A 1Y07A 2RQWA 3BW1A 1GXIE 2FRWA 2O4XB 1M3CA 2VXEA 1VQLA 2CZ6B 1UHFA 4B9XA 1RLQC 2E3HA 2MK5A 3EH2A 3UT1A 4NL3A 2CP3A 2LCSA 4EMKB 3CCQT 1FWZA 3NTHA 3QWXX 2LQKA 2VYTA 2BKDN 2XMFA 4L6V5 5FW9A 4M75B 3CCVQ 2FZGB 4M75E 2V26A 1O75A 1ZSGA 2EGCA 2MI6A 2XD0A 5KH6A 1NJIU 1VIEA 3CCRQ 1R8OB 3M0TA 1AHJB 3TU4K 3LX7A 2ENMA 4PL6A 2A28A 2Y90A 3X20B 1GBQA 2RO0A 1M2VB 5A2QE 3JCMh 4TVRA 1OEBA 5FWCA 3VRZA 5IXBA 1MMDA 3ZEHA 4E47A 2YUOA 4DBHA 2G3RA 2DERA 3OYGA 1K8AR 1IHWA 1B7TA 5CR2A 3PVQA 5J26A 2HDAA 2KDSA 5IXFA 4MZPA 1AD5A 2LQNA 1VQ5A 2FRYA 1JEGA 2ROTA 3SHWA 1UFFA 1FXXA 2DX1A 4PFOA 1WJRA 2FZKB 1ZSZB 1VQNA 2FEIA 3GOXA 2FHDA 2K3XA 5DLQE 2VB6A 1X6BA 1KD1U 5IAYA 1VQ9Q 5GMKh 2LX9A 3CCLT 1QCNA 2XDDA 2RQUA 1VUBA 5J3BA 4F7UB 3T9NA 4F7UE 3MHXA 3REAB 4JRQA 1KIKA 2HKNA 2P0PA 3DLMA 3FDRA 4XTYA 3CCEQ 1QVFS 1HJDA 4XTUA 5GAMe 5GJWB 1NPPA 2EQMA 5GMKl 2DJZA 4LUEA 2VWFA 1I0CA 1WXBA 4PNOA 3CC2T 3RBBB 3OYKA 2GFAA 2G6FX 2VGMA 4OB3B 4XU1A 2OJ2A 2L3QA 1M1FA 4C92F 3KXTA 1M1GA 3QDFA 3I56Q 1E6GA 1SHGA 1OPLA 1H92A 1BB9A 3S6WA 5GANg 3EFSA 1MHNA 2PU9B 4F14A 1Y0MA 4ZN3A 1AWXA 2QK0A 3RDVA 1WHKA 3LGFA 2GF7A 4R55A 4OGCA 3NTKA 3GF5A 3H41A 1YI2T 2V1RA 3IQLA 4GBQA 4FW2A 1NBEB 2YRVA 2L2PA 2P84A 1PWTA 1KC8C 2MMPA 2CH4W 4RTWA 4C0ZA 3VRYA 3O8VA 2R5AA 3JB9J 5IHKA 1AEYA 2DE0X 3JCMe 2AT1B 4OP0A 2L0AA 1HSQA 1VA7A 3GNFB 2J06A 1SG5A 1HK9A 2PZ1A 4R0KA 2D6FA 1KHIA 2BIVA 1I8FA 1J3TA 4ZGDB 3HFNA 1BI2A 1XJWB 2K57A 3BDLA 1UB4A 2QDYB 1KQSS 2XDPA 4QVDA 1MV0B 4XAXB 4CC7A 4WTOB 1UGVA 2NUTB 3MJXA 3A8LB 4C0GA 1KQ2A 1OOTA 4MDXA 4PLLA 4RTYA 2ROLA 2DNUA 2VGNA 3LH5A 1YJNQ 3JCMf 5GMKe 3OYIA 2QG9B 2NUPB 4PLIA 1R77A 4DEYA 2EWNA 4NS5A 1K4US 1WXTA 4M7AA 1JB0E 2CP5A 2DXTA 4JS5A 4KULA 1G2BA 5AT1B 1K73C 4DBQA 3FJPA 2RN8A 2RHZA 1D3BA 2DA9A 3EGUA 2LNHB 5HCKA 1IXDA 2X9HA 2A08A 1NE8A 3M55A 3CC4T 4C8QF 3I5RA 5GANd 1W2BS 2GTJA 1MNDA 3TSWA 2KY9A 4JJNK 1D0ZA 2LJ3A 2RH2A 1BBZA 1IGUA 1C0MA 2E3IA 3N5BB 4E7HA 4RTVA 1XQHA 2M0YA 4J6XA 4RTTA 2LZ6B 1Z9QA 3BDUA 4EPCA 2YHTA 1CKAA 3H0IA 1NJIR 2RK2A 1X2KA 2ZPBB 5KYWB 2RA2A 3MEUA 2FPEA 1VQ5Q 1U1TA 4LDWA 1OZ3A 4M78B 2A7YA 4M78E 4Y28E 1VQNQ 3HPWA 3OW2A 3NTIA 1M8MA 1QLYA 3E9GA 3OA6A 2DZ9A 2DL8A 3CQTA 2RJCA 4XU3A 1HXDA 1UDLA 2KK4A 3L2RA 4FYYB 1PRLC 2LJ0A 4PJOF 1BU1A 3QG1A 4HA8A 2GTOA 4AT1B 3CPFA 2FL7A 3LWHA 4AFZC 2YWWA 3BY7A 4FCYA 2P0QA 3S3OA 5IN1A 5LJ5d 1WHMA 5GJVB 1GBRA 1OI1A 2DFUA 5HKCA 1VYTA 2V8IA 4LDYA 3JB9D 4BUGA 5GAMg 3VYHB 2DBMA 3G4SA 5KCOA 1MV3A 5LJ3d 1X43A 1BI0A 3A8OB 1DJ7B 4D8KA 2QA4T 1S72T 4ELYC 4EMKC 3M53A 1VQ7Q 2MWOA 3VS1A 4E7SA 2KI7A 1TH7A 2F5TX 2QGGA 5CAIA 2HSEB 4JZ4A 4M75C 2HKQB 1TXQA 4BDYA 2LTOA 5CKFA 1ZBXA 5A0DA 5HK0A 5GANh 3KFVA 1MMGA 4M7DA 4HCBA 3QZ9B 2DL7A 1W4SA 3EGXA 4E6RA 2K7AA 5KYWA 4O6JA 3TREA 2FPFA 2CSQA 3UDCA 1K8AC 2DK3A 2ZPIB 4OMPA 2EQJA 2L8DA 4K11A 2M9UA 5D6YA 3L2WA 4E7IA 4QW2A 2H3JA 4J83A 3EG9A 3HKSA 5KYXB 2JN0A 1VQPQ 3V7RA 3JCMg 2I0NA 1NPRA 1K1ZA 3J7AF 1PC0A 1UE9A 3NPFA 1VQKQ 1TSFA 2KEAA 1Q82U 1RAGB 3PIOA 2DEUA 4IUTA 3A8HB 3NFCA 1B07A 1ZSZC 1QWEA 3H9NA 3QDRB 3S3NA 3AHUA 1X6GA 2BZXA 4DOVA 2O01E 3BE3A 1WNLA 2KSSA 4DQ2A 1IZ6A 2QXFA 2O2OA 3M0UA 4IUPA 1WQWA 5LJ5h 5EG2A 1I1JA 2EYYA 1PSFA 1KSWA 1ZA1B 3EFOB 2KRNA 2FYKA 3OS1A 2Y4YA 2AKLA 3OSVA 3RKYA 4EIKA 3CCJA 5CCAA 2HL3A 3V8LA 2QQ9A 2MOXA 5FRNA 1QWFA 2KE9A 1YHQA 1M3AA 4AG1C 5LJ3h 5ECAA 4BI8B 4M77B 4OMFB 2DLPA 4OMLA 4M77E 2WSFE 4DEXA 1VQ6A 1YITT 1VQ4T 2ZPHB 1M1KU 1S72A 2O9VA 3M9QA 2L3PA 3GP8A 3MEAA 5GAOn 2JS2A 3M4GA 3X25B 2CS7A 1NZ9A 2DETA 1Z9ZA 2EYXA 8AT1B 4AG2C 4M75D 3CC7A 1SF9A 2RM4A 3JCMV 1N8RR 2GCXA 4ORZA 2R57A 2RJDA 1GCQA 1MUZA 4J6YA 3TSZA 2DIQA 1PG5B 1YIJA 4ZTJA 2VVKA 4PFZA 3U23A 3JCMQ 1D09B 1SSFA 2P0KA 2EQKA 4YTLA 2NYSA 1YJWA 2LVMA 5GAN4 3LGLA 2GBQA 1SRMA 2EIFA 5GAN2 2ED0A 3CD6Q 2FB7A 4GY5A 1RABB 1JJ2P 2X51A 3CCMA 1UEBA 1G3YA 1RAEB 2O88A 1RI0A 4FW1A 3NGPA 1QP3A 4F7UG 4CRIA 1K9MR 2D0NA 3INZA 4CC2A 1RLPC 1AWWA 4ATOA 4C92A 4CC3A 2QEXA 4LXCA 4NL2A 2CH4A 4IURA 3FC3A 4CI0C 2D1XA 4BACA 1QKWA 2EYWA 2EYQA 7AT1B 5GANf 4KH1B 4V2SA 1QVGA 5KCHA 1TUGB 1WZOA 1K9AA 3CBOA 3JCMc 2DYBA 3H8ZA 3VS3A 4ELZC 2KYBA 3G4SQ 5GMKm 1RAFB 3CMET 2HAXA 2A37A 1BYMA 1PNJA 4RMOA 1YJ9T 2J6KA 4A4KA 2HNIA 1EIFA 3OS5A 5LJ5e 4JS4A 1Q86U 1VQOT 4VUBA 2VV5A 2LQ8A 2DJQA 3PE0A 2PNIA 2V8KA 3VV0A 4FYVB 3VS6A 1GCPA 4JUVA 3L1AA 1QVPA 1LOJA 3MKDA 5DM7R 3RNJA 5LJ3e 1E7OA 1AZGB 3J80E 4JRPA 4J9DA 1RAHB 3CMAA 1ZX6A 1YITA 1WFWA 1NJIC 2K2MA 2JJ9A 1UHCA 2COYA 4PK4A 4QQDA 1KQ1A 4Z88A 1NM7A 1RL2A 4XTWA 2KNBB 2FG0A 1JQQA 4WF2A 5GMKi 2ZGWA 4KGZB 3PGGA 2L3SA 5LJ5f 1UGPB 1M5Q1 2JMCA 4FSSA 3CCUT 3EHQA 1E6HA 4M78C 1I4K1 4MMLA 1ZUUA 1D0YA 3M59A 1H8KA 5LJ3f 2XHCA 3KUFA 1G5VA 3A8MB 2ZCFB 2F69A 5KYYA 3G71T 3OSSC 2RJFA 1BK2A 3VYGA 4C8QA 4J9HA 2FO0A 4D8DA 2OTLT 1PHTA 2EBPA 3EFRA 2E6ZA 5KE2A 2A36A 1OQKA 3CCJQ 5IH2A 3V8KA 1WX6A 2B86A 2R5MA 5FU7B 1YHQQ 2DZCA 2LT4A 5GMKj 3PTAA 3PFSA 3PMTA 1VQ6Q 2QDLA 2V1QA 2GQIA 4LDUA 2WSCE 1TUDA 4RTZA 2V8JA 1LNXA 2K9GA 1S72Q 1K0XA 1BI1A 2KYMA 3RUXA 2DMOA 5I2MA 3OS0A 4JJCA 3CC7Q 4BB7A 2OTJA 5FWBA 4KBMB 1M30A 2VC8A 2K2VA 1NLPC 4JRKA 1O9SA 4QKUA 1YJ9A 5L23A 3OYDA 3M0QA 1YIJQ 2F2XA 4M7AB 4M78G 3VU3C 1VQOA 3CBPA 4M7AE 4X9CA 2YUNA 4PJOA 1M1KR 5GAN6 1YJWQ 2R58A 3URGA 4Q5WA 4A4HA 1R0BG 2JVVA 2PVOB 1D3BB 1WIEA 3CCMQ 2H3EB 1N6AA 3QWYA 2CP6A 4CC4B 3CCQA 3META 5A0LA 3OYEA 2KXDA 4KRTA 4BI4A 5GAMf 2K4YA 3VUZA 2E41A 1Y57A 1N5ZA 3FJ5A 4OVAA 2QEXQ 1YCSB 2ECZA 4QVCA 1TG0A 2X3XD 2CZ1B 3DB4A 4R56A 4C5GA 2DRMA 4M78D 2YSQA 3CCUA 2HD0A 4OB0B 3A1PA 1MNEA 1Q7YC 4F04B 3CPWP 4PFPA 2MCNA 1WGSA 2X4WA 2J05A 3SD4A 3UF4A 2YLBA 4PJNA 3EAEA 4J6WA 3C95A 5CKHA 3M58A 3I35A 3JB9F 1SSHA 5CQXA 4L59A 4Y91A 3MCAB 1M4ZA 2OTLA 1SHFA 2A3LA 1VIFA 3TQ7P 4E7KA 2XICA 4EDUA 3QXEB 1OV3A 2D0QB 1VQLQ 3R6NA 2M1HA 2DO3A 3AT1B 3MP8A 2E70A 1HYOA 1KC8U 3QPHA 2HQHA 5LJ5g 3CMAQ 4M77C 4LDXA 1YITQ 2XK0A 3CCLA 3PMIA 1PD0A 1N8RC 2YRDA 1QVGS 5LJ3g 3E1SA 4A4GA 1Y71A 3HP9A 5GAN7 2JOYA 3KBGA 3L2ZA 4OF1A 4FU6A 1WJSA 2F1LA 2E10A 2QQSA 4II1A 5KYUA 2YRCA 2C0IA 2LJ1A 4N0AA 1QCOA 1W70A 3JCMP 2L89A 4XTXA 3CC2A 2D9TA 4L5GA 3HRUA 1Q81C 4FSXA 3OW2P 1UG1A 4OB1B 1K0SA 3G6ET 1FMVA 1FYNA 5I22A 2CUBA 1K9MC 3OB9A 2DTIA 1MGQA 4HXJA 1X69A 4M7DB 4M7DE 2DL3A 2DVEA 4P5NA 3EGXB 1X27A 3M0PA 2CREA 3X26B 1YBYA 1WQ7A 3M56A 5FU6B 2COZA 3C94A 3VS0A 1X6OA 4A4EA 2CZ7B 1WJQA 1B3QA 2EKOA 2RQTA 3OMCA 1Q95G 5DY9A 2C06A 3QSUA 3JB9G 3CCVT 1YI2A 4FIBA 3C0CA 1UGQB 3EG9B 2EJGA 3J81E 2D8HA 5KYNA 1FX7A 4KGVB 1WYXA 4M77G 2JS0A 1WHHA 1M9SA 3CCRT 3M4YA 2NLUA 1H3ZA 2CP0A 3G7ZA 4GLKA 3D7SB 1OZ2A 2OTJQ 2CT4A 4JRIA 4IUUA 3VS5A 1YJ9Q 3UA7A 1AOJA 4RG8A 2HZYA 1KD1R 1VQOQ 5A0GA 1VQMT 2IVWA 1EX4A 1VOMA 2DD4A 2BTTA 2RI5A 4M75F 1QW1A 3P8DA 1X2QA 4ZN1A 4B6MA 5GAOp 2EGAA 4M77D 1MMAA 4C5IA 3GLXA 2BE9B 3QJ6A 2KT8A 3QUIA 3MEVA 3MP6A 5J39A 3G1JA 2AZSA 4IIOA 3CCQQ 1PRMC 2DXUA 5IT9E 1VQ9T 5IHNA 1BKBA 2HEQA 3RMQA 5GANj 2OX7A 3RIRA 3JSCA 2EVRA 2JMAA 2LP5A 2JZ2A 1IRXA 3MO8A 3CCUQ 3CCET 1QVFP 2BUDA 2LNVA 3JB9H 2EAYA 1RACB 5IHIA 2QQRA 5AYFA 1WHGA 3CC4A 2CZ0B 2WSEE 1M27C 3TEEA 3FEOA 4MMKA 2DYIA 1YCYA 3RERA 4AMCA 3VS2A 3QZ5B 3FRNA 2DAQA 2E4HA 1WA7A 4M4ZA 5GAOr 1JXOA 1PD1A 2W0ZA 2OI3A 1SKUB 3V8JA 4ZTFA 4OB2B 2AKKA 1ZLMA 3I56T 2MIOA 1P92A 2VUBA 4J9EA 2OTLQ 4C5EA 4JJDA 2SEMA 3OS2A 3ER0A 2JTFA 2O31A 1U1SA 4J9IA 1GRIA 2K3YA 4F7UF 2PVGB 4BD3A 5EC7A 4C92B 1I81A 4C92E 5FU7C 4E7JA 1LJOA 4A63B 3GBQA 2JT4A 1IB8A 1K8AU 3OY9A 3CCLQ 2X4YA 2CUDA 2M51A 5LJ5j 2AHJB 3ME9A 4M75G 3HL8A 2MWPA 2ABLA 2RNAA 4IKFA 5GAOq 3H0HA 1M1KC 5LJ3j 1NEGA 2KRSA 3LYIA 3HHTB 1OPKA 3CC2Q 4XU0A 1VQMA 2DKGA 2FZCB 4M7AC 1KG1A 3S3MA 1VYUA 1OU9A 1CKBA 1GL5A 2WACA 2EYZA 3CCST 2E6NA 3OMGA 1KQSP 5GAOm 2QA4A 2RMOA 3ZBDA 4N0AC 4PJJA 4HCZA 3JCMb 3L2VA 3RMSA 3JCMJ 1CSKA 3JRZA 1YJNT 1SRLA 2DD5A 1WI7A 1YI2Q 3JAME 3SEMA 1QVGP 2CSIA 3CCEA 2KBTA 4ZGEB 3EGDA 3OYJA 4GLMA 2ZPFB 2XKOC 3DB3A 1UGSB 3NHNA 1FMKA 2Y4XA 1WXUA 2LX7A 2LCCA 3M54A 1IO6A 2E5KA 2M16A 1G3SA 4ANJA 1W2BP 3QIIA 2EJFA 2JM9A 5KYYB 1ZUYA 1XNIA 3OBYA 1D1CA 2GFUA 2KRMA 1IGQA 4AFSC 4M7AG 2LQWA 3OQ5A 4C8QB 3MP1A 2FVUA 4C8QE 4ME7A 1TU0B 4OGEA 1VQ5T 1JXMA 2YDLA 3UWNA 1TWBA 3E2UA 2B8AA 1M90U 3F70A 3QBYA 2LMJA 4FT2A 5GAMj 2CP7A 3FB9A 2EGEA 4E7LA 4PJLA 2K5FA 1T0HA 2LDMA 2K3BA 2ESWA 2EQIA 2K79A 2KGTA 1UUEA 2CT3A 2QQBA 2LT1A 5CIUA 1ZHIA 1QP2A 2OAWA 4M7AD 3L2QA 4FL6A 3FLGA 4M7DF 2C0OA 2DPPB 3QHSA 1AVZC 4KUIA 5CVIA 3CC4Q 2JM8A 4RCCA 4HCKA 3CXCA 1QKXA 1VQ4A 3H6ZA 4C0DB 3R6OA 3CCSA 4PJOB 2GNCA 2X3WD 4PJOE 4ZNXA 4FT4A 4M78F 2EQUA 4RTUA 1Y96A 2OAUA 1WPYA 2MYSA 1UECA 1QCFA 1IHVA 4M7DC 2IIMA 4N4GA 2HL5C 3JB9I 2HBPA 5C6SA 5GAOl 3UA6A 1N9RA 4HVWA 5KE3A 2HCKA 1YJNA 5FU6C 1VQ7T 3OYAA 4BE2A 3I55T 3EG1A 4QVZA 3ULRB 2E12A 2ATCB 2DEQA 1PKSA 3EG3A 1VYVA 1RAIB 5FROA 4LD9K 1R0CB 4Z8AA 5M9OA 1D1AA 1OULA 2XI9A 2DIGA 1AWOA 2RHUA 1X75C 4WCIA 4A54A 1KD1C 4J9FA 1I07A 1Q82R 4JZ3A 4EMGA 3JCMX 2HQXA 2DXCA 1ABOA 1NEBA 2DXBA 4OMQA 3RKWA 1VQMQ 2E64A 4KUDK 3UATA 2RQVA 2RHYA 1ABQA 3OYMA 1N9SA 4DOWA 2BZ8A 1VQPT 1Y7XA 2RQRA 1K76A 4BI3A 1B34A 4J9CA 2HBWA 2PUOB 2XIDA 2QA4Q 1F1BB 4XQ3A 2MAMA 1VQKT 3CMEA 4M7DG 1U5SA 1XOVA 2CP2A 1BCMA 4AFUC 4IIMA 1C1AA 3O5ZA 5GAN5 2RHXA 4X34A 3UPUA
chains in the Genus database with same CATH topology
2X4XA 4J83A 4OB1B 3HKSA 1OYXA 3PNWC 3G6ET 4XK8E 1K9MC 2JN0A 3OB9A 3VKIA 2DTIA 1MGQA 3V7RA 1B34B 3JCMg 4M7DB 1NPRA 1BIAA 2O4XA 4M7DE 3J7AF 2DVEA 4P5NA 1JJ2A 1G3TA 4O5VA 4J8OA 3X26B 1YBYA 1Q82U 3PIOA 3OYCA 1WQ7A 3QJYA 3M56A 3SWNB 4IUTA 1JBMA 2KQWA 5FU6B 3A8HB 2L3RA 3NFCA 3DKMA 4EMKA 2PUKB 2RB6A 3C94A 5GAMh 1X6OA 1W2BA 2OTJT 4A4EA 2CZ7B 3QDRB 1WJQA 4QW2A 4M7DD 3S3NA 2EKOA 3OMCA 5HK3A 3DLLA 3OW2S 3AHUA 5DY9A 2ZPEB 2C06A 4DOVA 4MDWA 3L2UA 3QSUA 3JB9G 5CQYA 4M77A 4M75A 3CCVT 1YI2A 2O01E 4FIBA 1UGQB 1WNLA 2KSSA 4RKUE 2EJGA 3J81E 5I2SA 4DQ2A 3SFMA 1FX7A 2PQWA 1IZ6A 1Y07A 2QXFA 3BW1A 3E9FA 3PT9A 4M77G 1GXIE 2O4XB 4IUPA 3WVEB 1WQWA 5LJ5h 5EG2A 1M9SA 2VXEA 5CKDA 1VQLA 3Q1JA 3CCRT 3M4YA 1PSFA 3GIBA 1PSEA 1VQ7A 2CZ6B 3OS1A 2FYKA 2Y4YA 4B9XA 3I55A 2NLUA 3OSVA 3UT1A 3RKYA 3CCJA 4NL3A 1H3ZA 4BE1A 3G7ZA 4GLKA 5CCAA 3V8LA 2QQ9A 1OZ2A 4EMKB 2F5KA 5FRNA 3CCQT 1FWZA 3QKJA 3NTHA 4C92C 2LQKA 2VYTA 3VUBA 1YHQA 2BKDN 5LJ3h 4JRIA 4L6V5 4BI8B 4A53A 4IUUA 3G71A 3LWIA 4M77B 4M75B 4OMFB 4M77E 4J7IA 2WSFE 4M75E 4RG8A 1VQ6A 5A0GA 1YITT 1VQ4T 1O75A 2ZPHB 1VQMT 2IVWA 2DTHA 5CKEA 1M1KU 3CD6T 2MI6A 2KAFA 2XD0A 1S72A 5CK9A 4A4FA 3A5ZB 2DD4A 3M9QA 3V7SA 5KH6A 4IUQA 2RI5A 3OYBA 4M77F 3MEAA 1VIEA 4M75F 5GAOn 1QW1A 3M4GA 3P8DA 3GP8A 3X25B 1R8OB 1NZ9A 2CS7A 4ZN1A 5GAOp 4M77D 4M75D 4ZGJB 1AHJB 3CC7A 2RM4A 4C5IA 3GLXA 3QJ6A 3JCMV 3VJPA 3TU4K 3LX7A 3QUIA 3MEVA 2GCXA 4PL6A 3GPLA 3MP6A 5J39A 3OYFA 2R57A 2RJDA 1Q7YU 2I2LA 4J6YA 2Y90A 2DIQA 3CBMA 3X20B 2RO0A 4BY6B 1YIJA 5A2QE 4ZTJA 3JCMh 2RK1A 3JCMQ 4TVRA 1SSFA 2P0KA 2EQKA 4YTLA 2E1HA 2DXUA 2QQAA 4JLGA 5IT9E 3ZEHA 4E47A 1VQ9T 1VQPA 1YJWA 2LVMA 1BKBA 2G3RA 5GAN4 3RMQA 3LGLA 3OYGA 5GANj 4NOYA 2EIFA 5GAN2 3RIRA 2FB7A 3JSCA 3P8BB 5CR2A 1VQKA 5J26A 2JZ2A 4GY5A 1VQ8T 2KDSA 4F7UA 3MO8A 5LL6S 4MZPA 3CCMA 1VQ5A 1UEBA 1G3YA 3G4ST 3CCET 1RI0A 2BUDA 2LNVA 3MEWA 3JB9H 1QP3A 2EAYA 2KVQG 4F7UG 1FXXA 2QQRA 2X4JA 5AYFA 5GAN8 3CPWA 2CZ0B 2LRQA 1WJRA 4CRIA 3CC4A 2WSEE 3INZA 4BDZA 1VQNA 3GOXA 1BI3A 2FHDA 2K3XA 3FEOA 5DLQE 3SWNA 3TEEA 4MMKA 4UC4A 1JRIA 4ATOA 1YCYA 4C92A 3OYHA 4HT9A 2CYZB 2QEXA 3LH0A 3RERA 1KD1U 4NL2A 3E19A 3QZ5B 4IURA 5IAYA 3FRNA 3FC3A 2YLCA 2DAQA 4JDSA 4CI0C 3QYHB 4BACA 5GMKh 5GAOr 2LX9A 4C92G 2EYQA 3V8JA 3CCLT 4ZTFA 4OB2B 2XDDA 1N27A 5GANf 1UGRB 1VUBA 5J3BA 1QVGA 4V2SA 4F7UB 3T9NA 5KCHA 2LCLA 2PVDB 3CBOA 3MHXA 3JCMc 4F7UE 3I56T 4JRQA 1JJ2S 1P92A 2VUBA 3H8ZA 4ELZC 4C5EA 2P0PA 2RJEA 3DLMA 3FDRA 4XTYA 1QVFS 4XTUA 3OS2A 5GAMe 4DA4A 1N8RU 3ER0A 5GMKm 1NPPA 2EQMA 5GMKl 2DJZA 2JTFA 3HSBA 2JUFA 1U1SA 3CMET 2HAXA 2K3YA 1K73U 2CKKA 4F7UF 2L5QA 2HQEA 2PVGB 4BD3A 4C92B 2K5IA 1BYMA 1I81A 5GAN3 4C92E 5FU7C 4E7JA 1LJOA 4PNOA 3CC2T 4FM4B 3OYKA 3CXCS 2GFAA 3HRSA 4RMOA 2VGMA 1YJ9T 4OB3B 4XU1A 4A4KA 1K8AU 3OY9A 2HNIA 1EIFA 3L42A 3OS5A 5LJ5e 4JS4A 1Q86U 1VQOT 1M1FA 4VUBA 1IREB 2VV5A 2X4YA 2LQ8A 4C92F 1Q81U 5LJ5j 5FLXE 2AHJB 3KXTA 1M1GA 3ME9A 4M75G 4C8QC 4C92D 4N4HA 2V8KA 3HL8A 3VV0A 3OYNA 2E5QA 2MWPA 4JUVA 3S6WA 2RI2A 4BE0A 3L1AA 3BFMA 5CKBA 1QVPA 1LOJA 5GANg 1K9MU 4IKFA 3EFSA 5GAOq 1MHNA 2K5LA 5DM7R 5LJ3e 2PU9B 1M1KC 5LJ3j 3J80E 4JRPA 3OYLA 3LYIA 4MZMA 3WXMB 3CMAA 4ZN3A 1YITA 3HHTB 1ZQ1A 1NJIC 4XU0A 1VQMA 2DKGA 3LGFA 2GF7A 4QQDA 4R55A 1KQ1A 4M7AC 3CD6A 1KG1A 4OGCA 3NTKA 3GF5A 1KHCA 1RL2A 3S3MA 1BIBA 4XTWA 1YI2T 4WF2A 5GMKi 2ZGWA 5FRMA 2WACA 3PGGA 3CCST 2E6NA 2YRVA 2ZPGB 3OMGA 5GAOm 2EFIA 5LJ5f 2QA4A 1UGPB 2JTMA 1KC8C 3ZBDA 3RESA 4N0AC 1M5Q1 3WVDB 2MMPA 4HCZA 4HKEA 4LDVA 4C0ZA 2QI2A 3SB2A 3O8VA 3CCUT 3JCMb 2R5AA 3JB9J 3L2VA 5C0MA 3RMSA 3JCMe 4M78C 1I4K1 3CCJT 4MMLA 3JCMJ 4OP0A 3M59A 3JRZA 1YJNT 5LJ3f 2M0OA 2XHCA 3KUFA 1G5VA 4XTVA 3GNFB 1YHQT 3A8MB 2X35A 2ZCFB 4C0DC 1HK9A 2F69A 2D6FA 1KHIA 3G71T 4PJOC 2BIVA 1I8FA 2DD5A 3OSSC 1VQ8A 1X01A 2RJFA 4J7FA 3HFNA 4ZGDB 1BI2A 3JAME 4XU2A 1VQ6T 2RI3A 4IUVA 2K57A 3BDLA 3CCEA 1UB4A 1NJIU 2QDYB 4ZGEB 2XDPA 4QVDA 2RD1A 4XAXB 3VYGA 1KQSS 3OYJA 2ZPFB 4C8QA 2XKOC 3DB3A 1UGSB 3A8LB 3A8GB 2OTLT 3C4SA 4C0GA 2Y4XA 1KQ2A 4MDXA 3EFRA 4PLLA 2LCCA 2E6ZA 3M54A 4LD6A 4C8QG 5KE2A 3CC7T 2VGNA 3V8KA 2M16A 1G3SA 4XTZA 3RKXA 2R5MA 3JCMf 5GMKe 3LLRA 3QIIA 4Z02A 5FU7B 3OYIA 2EJFA 1YIJT 2DZCA 2LT4A 4PLIA 2EWNA 4NS5A 5GMKj 3PTAA 3PFSA 4M7AA 3G6EA 1XNIA 3PMTA 2GQVA 1JB0E 4N4IA 3X24B 3OBYA 2DXTA 4LDUA 2GFUA 4JS5A 4KULA 1YJWT 1K73C 1Q82C 2JNGA 4M7AG 2WSCE 3OQ5A 3FJPA 3CEYA 4HCCA 2V8JA 3M5AA 2RHZA 3QYGB 1LNXA 4C8QB 3MP1A 4MZTA 2FVUA 4C8QE 1BI1A 4ME7A 4EMHA 1D3BA 4OGEA 5CO7A 3CCMT 1VQ5T 3RUXA 4RG2A 2XG8D 3UWNA 5D6WA 1M90U 5I2MA 2B8AA 3F70A 3QBYA 3OS0A 4BB7A 2OTJA 1NE8A 3M55A 4KBMB 4M78A 2VC8A 2K2VA 4FT2A 4JRKA 5GAMj 3FB9A 3CC4T 4C8QF 5GANd 1O9SA 1W2BS 1YJ9A 3P8HA 2KY9A 3OYDA 4JJNK 3CCVA 4C8QD 2RH2A 4KT0E 4M78G 4M7AB 3VU3C 4E7LA 3CBPA 2K5FA 2QEXT 1VQOA 4M7AE 1M8VA 4X9CA 3N5BB 2LC4A 4E7HA 4PJOA 2LDMA 3QO3A 3OBWA 1XQHA 5GAN6 2R58A 3URGA 4J6XA 4Q5WA 4A4HA 3X28B 1H641 3BDUA 3CCRA 3PIPA 4EPCA 4PJOG 2YHTA 2JVVA 2RK2A 2PVOB 4PKCC 2ZPBB 4M7AF 1D3BB 2RA2A 2QQBA 3MEUA 1QVFA 2LT1A 3C12A 5CIUA 1U1TA 1QP2A 1ZHIA 4LDWA 4M7AD 1OZ3A 5DLOA 3L2QA 4FL6A 1N6AA 3FLGA 4QQ6A 4M7DF 5L8RE 3CCQA 3META 5HY6A 4M78B 2A7YA 2DPPB 3QHSA 5A0LA 4KUIA 5CVIA 4M78E 3OYEA 4Y28E 4RCCA 2QTXA 4BI4A 5GAMf 4HT8A 3HPWA 3FIFA 2K4YA 3VUZA 2E41A 3CXCA 1U8RA 5D6XA 3GNGA 1VQ4A 3H6ZA 3NTIA 4OVAA 3R6OA 4C0DB 3OW2A 3HFOA 3ASKA 3CCSA 4PJOB 4QVCA 2P4TA 4PJOE 4FT4A 4J5YA 4M78F 2CZ1B 2EQUA 3DB4A 3E9GA 3V7CA 2DZ9A 1Y96A 2OAUA 4C5GA 4R56A 2RJCA 4XU3A 3OA6A 4M78D 1HXDA 1WPYA 2KK4A 3L2RA 5GAMd 3CCUA 2HD0A 4OB0B 4M7DC 1Q7YC 4N4GA 2XU8A 3JB9I 2HBPA 2IG0A 4PJOF 5C6SA 5GAOl 4RCBA 1N9RA 4C5HA 5KE3A 3QG1A 2KMTA 4PJOD 1VQLT 3SWNC 1YJNA 4HA8A 2MF2A 5FU6C 1VQ7T 3CPFA 2FL7A 3OYAA 3LWHA 1WGSA 2X4WA 3I55T 3SD4A 3BY7A 4BE2A 4QVZA 2XDBA 2P0QA 3S3OA 2E12A 5IN1A 2DEQA 2YLBA 3EAEA 3OYYA 3SDZA 3LW5E 1XTDA 3C95A 2RHIA 4J6WA 5CKHA 5LJ5d 1VQ9A 3CMAT 2EJ9A 3M58A 1OI1A 3JB9F 5HKCA 2V8IA 5FROA 5CQXA 1Y96B 2CGHA 4LDYA 4BUGA 4L59A 5GAMg 3JB9D 4LD9K 3VYHB 5M9OA 4Y91A 3MCAB 3M57A 1M4ZA 2XI9A 2OTLA 4B9WA 2DIGA 3G4SA 2RHUA 2A3LA 1X75C 1VIFA 5KCOA 5LJ3d 1BI0A 3A8OB 1DJ7B 4A54A 2QA4T 4E7KA 2XICA 1S72T 4EDUA 3QXEB 4QQGA 2D0QB 1KD1C 3CPWS 4D6WA 2M1HA 4ELYC 2DO3A 3M53A 4EMKC 2MWOA 4EMGA 3MP8A 2E70A 1KC8U 3JCMX 2DTOA 1TH7A 3QPHA 5LJ5g 2F5TX 2HQXA 4JLIA 2DXCA 5CAIA 5GANe 2DXBA 4M77C 4M75C 3ZFJA 4LDXA 4X9DA 3RKWA 2XK0A 3CCLA 2E64A 3PMIA 5I21A 4KUDK 2ZZDA 1M90C 2RHYA 4BDYA 2LTOA 5CKFA 1N8RC 3OYMA 1N9SA 4DOWA 1ZBXA 5A0DA 5HK0A 5GANh 3I56A 1VQPT 1Y7XA 1QVGS 3HRTA 3JCMW 4BI3A 3E1SA 4A4GA 5LJ3g 1KQSA 1B34A 1Y71A 4M7DA 3HP9A 4HCBA 5GAN7 3JCMd 2JOYA 2PUOB 3KBGA 1V29B 2XIDA 3L2ZA 3QZ9B 1WJSA 4FU6A 4OF1A 1W4SA 2MAMA 2E10A 2QQSA 4II1A 4XQ3A 1VQKT 3CMEA 4N0AA 4M7DG 4O6JA 3TREA 1XOVA 3JCMP 2VXFA 2L89A 3UDCA 4C0FA 1K8AC 4BY6C 2E65A 2DK3A 2ZPIB 4XTXA 1Q86C 2EQJA 3CC2A 2D9TA 2L8DA 4L5GA 5GAN5 3HRUA 2M9UA 5D6YA 4FSXA 2RHXA 4X34A 1Q81C 3TCJA 1I5LA 1VQNT 3L2WA 3UPUA 4E7IA 1G3WA 2H3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM f;  4F7U A;  3JB9 J;  4HT8 A;  3FIF A;  3JCM e;  2E41 A;  4M78 C;  1I4K 1;  4MML A;  3JCM J;  2JN0 A;  4OP0 A;  3JB9 H;  2DTI A;  1MGQ A;  3HFO A;  1B34 B;  3JCM g;  3V7R A;  4QVC A;  2EAY A;  4M7D B;  4PJO B;  1BIA A;  4F7U G;  4M7D E;  4J5Y A;  4M78 F;  5LJ3 f;  5GAN 8;  4PJO E;  4XTV A;  2DVE A;  2DZ9 A;  1Y96 A;  3INZ A;  3V7C A;  4XU3 A;  4M78 D;  1HK9 A;  1HXD A;  1WPY A;  3SWN A;  4PJO C;  5GAM d;  4M7D C;  1I8F A;  4MMK A;  1X01 A;  1JRI A;  1WQ7 A;  1YCY A;  3HFN A;  3SWN B;  4C92 A;  4HT9 A;  1JBM A;  4XU2 A;  3RER A;  2K57 A;  3JB9 I;  4PJO F;  5GAO l;  4NL2 A;  2RB6 A;  4EMK A;  5GAM h;  2YLC A;  4RCB A;  1N9R A;  5GMK h;  4QVD A;  5GAO r;  2RD1 A;  4PJO D;  4C92 G;  3SWN C;  4M7D D;  4HA8 A;  3AHU A;  3V8J A;  4C8Q A;  5DY9 A;  3QSU A;  5GAN f;  3JB9 G;  4M77 A;  4M75 A;  4V2S A;  3BY7 A;  4F7U B;  1WNL A;  3JCM c;  4F7U E;  2EJG A;  2DEQ A;  2YLB A;  1KQ2 A;  3EFR A;  4J6W A;  4C8Q G;  4DQ2 A;  5LJ5 d;  2EJ9 A;  4XTY A;  3BW1 A;  4M77 G;  4XTU A;  3V8K A;  5GAM e;  3JB9 F;  4XTZ A;  3RKX A;  1WQW A;  5GMK m;  3JCM f;  5GMK l;  2VXE A;  2DJZ A;  5GMK e;  5LJ5 h;  3HSB A;  1Y96 B;  2CGH A;  1U1S A;  2EJF A;  5GAM g;  2DZC A;  3JB9 D;  3GIB A;  4F7U F;  2EWN A;  2FYK A;  5GMK j;  4M7A A;  4Y91 A;  4C92 B;  3RKY A;  4NL3 A;  1I81 A;  5GAN 3;  4C92 E;  2DXT A;  3V8L A;  1LJO A;  4PNO A;  5LJ3 d;  4EMK B;  4A54 A;  4M7A G;  3FJP A;  4C92 C;  4XU1 A;  1LNX A;  5LJ3 h;  4C8Q B;  4JRI A;  2HNI A;  5LJ5 e;  4A53 A;  4C8Q E;  4EMK C;  4EMG A;  4EMH A;  4M77 B;  4M75 B;  1D3B A;  4C92 F;  4M77 E;  4M75 E;  5LJ5 j;  3JCM X;  2DTO A;  1TH7 A;  3RUX A;  5LJ5 g;  4JLI A;  5CAI A;  4M75 G;  4C8Q C;  4C92 D;  2DTH A;  5GAN e;  4M77 C;  4M75 C;  4M78 A;  4JUV A;  2VC8 A;  4JRK A;  4X9D A;  5GAM j;  3RKW A;  3FB9 A;  3L1A A;  3BFM A;  4C8Q F;  2E64 A;  5GAN d;  5I21 A;  1LOJ A;  5GAN g;  3V7S A;  3EFS A;  5GAO q;  4M77 F;  4M75 F;  5GAO n;  5LJ3 e;  3M4G A;  4C8Q D;  1N9S A;  5GAO p;  4M7A B;  4M78 G;  3VU3 C;  5GAN h;  1M8V A;  4M7A E;  4M77 D;  4M75 D;  5LJ3 j;  3JCM W;  4X9C A;  5LJ3 g;  2RM4 A;  1B34 A;  4PJO A;  4M7D A;  3JCM V;  3QO3 A;  3QUI A;  5GAN 7;  5GAN 6;  4XU0 A;  3JCM d;  2DKG A;  3L2Z A;  4J6X A;  4M7A C;  1KQ1 A;  2I2L A;  4J6Y A;  2Y90 A;  4XQ3 A;  2E10 A;  1H64 1;  3BDU A;  4PJO G;  4N0A A;  2YHT A;  3JCM h;  4M7D G;  1BIB A;  4XTW A;  3JCM Q;  4M7A F;  3JCM P;  4WF2 A;  2VXF A;  1D3B B;  2RA2 A;  2ZGW A;  5GMK i;  2E1H A;  2DXU A;  3PGG A;  2E65 A;  1U1T A;  4M7A D;  4XTX A;  3JCM b;  5GAN 5;  5GAN 4;  5LJ5 f;  5GAO m;  4M7D F;  1I5L A;  5GAN j;  3RES A;  4NOY A;  4N0A C;  1M5Q 1;  4M78 B;  3QHS A;  5GAN 2;  3RIR A;  2FB7 A;  4M78 E;  3SB2 A;  4RCC A;  2QTX A; 
#chains in the Genus database with same CATH topology
 1YWO A;  4XK8 E;  3VKI A;  4PJM A;  3REB B;  1NLO C;  1BIA A;  3VS4 A;  2O4X A;  2AK5 A;  5KYU B;  4KH0 B;  4J8O A;  1M2O A;  1GFC A;  3SWN B;  2KQW A;  1GCQ C;  2BZY A;  3EHR A;  4EMK A;  2PUK B;  2RB6 A;  4FYW B;  4QT7 A;  3MPU B;  4M7D D;  2ZPE B;  2QAZ A;  4MDW A;  3L2U A;  4M75 A;  4RKU E;  1C6V X;  3SFM A;  2PQW A;  1WDX A;  3PT9 A;  3E9F A;  1EFN A;  2AIR B;  3WVE B;  5CKD A;  3Q1J A;  3GIB A;  1PSE A;  1VQ7 A;  3I55 A;  2YUQ A;  4LN2 A;  4BE1 A;  2HSP A;  2F5K A;  3EH1 A;  3QKJ A;  4C92 C;  3VUB A;  1M2V A;  1TOV A;  4A53 A;  3G71 A;  2COW A;  3LWI A;  2BE7 D;  4OMM A;  4J7I A;  1T3L A;  1OX8 A;  4OMO A;  2DTH A;  5CKE A;  3CD6 T;  1LCK A;  2KAF A;  5CK9 A;  4A4F A;  9ATC B;  3A5Z B;  1YNZ A;  3OYB A;  3V7S A;  1YWP A;  2KRO A;  4IUQ A;  4M77 F;  1S1N A;  1RAA B;  2F2W A;  4ZGJ B;  1M90 R;  3VJP A;  3GPL A;  4FYX B;  3OYF A;  1Q7Y U;  2EW3 A;  2I2L A;  4BY6 B;  3CBM A;  1WHL A;  1ZSZ A;  6AT1 B;  4DBF A;  2RK1 A;  1TTH B;  2E1H A;  2D8J A;  2QQA A;  4JLG A;  1VQP A;  8ATC B;  1VQ4 Q;  4E7Z A;  3CCS Q;  4NOY A;  3P8B B;  5D7U A;  1Q86 R;  1VQK A;  1VQ8 T;  4F7U A;  2GGR A;  5LL6 S;  1RI9 A;  4RUG A;  3G4S T;  3MEW A;  2KVQ G;  3CPW A;  2X4J A;  5GAN 8;  2LRQ A;  4BDZ A;  1BI3 A;  3SWN A;  4UC4 A;  1JRI A;  2JTE A;  3OYH A;  4HT9 A;  2CYZ B;  3LH0 A;  2RPN A;  3E19 A;  1ACM B;  2YLC A;  4JDS A;  3QYH B;  4C92 G;  4ESR A;  2AZV A;  1N27 A;  1UGR B;  2QAS A;  2LCL A;  2PVD B;  1JJ2 S;  1D0X A;  1UJY A;  2RJE A;  2KXC A;  4DA4 A;  1N8R U;  3HSB A;  2JUF A;  2J7I A;  1K73 U;  1JO8 A;  2CKK A;  4KGX B;  2L5Q A;  2HQE A;  1EZZ B;  1H3H A;  1T0J A;  2K5I A;  2KR3 A;  2DRK A;  2Z0W A;  5GAN 3;  2PTK A;  4FM4 B;  1QMC A;  3CXC S;  3HRS A;  3L42 A;  3M0R A;  1GFD A;  2J6F A;  1IRE B;  1Q81 U;  5FLX E;  1QQJ A;  1AT1 B;  1NG2 A;  4C8Q C;  4C92 D;  3M0S A;  4N4H A;  1W6X A;  4Z89 A;  1I5O B;  3I9Q A;  2CDT A;  3OYN A;  2E5Q A;  2RI2 A;  4BE0 A;  3BFM A;  5CKB A;  3NMZ C;  4AFQ C;  1K9M U;  2K5L A;  3CME Q;  2YUP A;  1WLP B;  3OYL A;  4MZM A;  3WXM B;  2DIL A;  1ZQ1 A;  2EPD A;  2DBK A;  3CD6 A;  1KHC A;  1MMN A;  1BIB A;  5FRM A;  2DF6 A;  2ZPG B;  2EFI A;  2JTM A;  3RES A;  3WVD B;  3RR6 A;  4HKE A;  4LDV A;  1M3B A;  2QI2 A;  3SB2 A;  2NUT A;  5C0M A;  3CCJ T;  2VAS A;  2M0O A;  4XTV A;  1YHQ T;  2X35 A;  2NUP A;  2M02 A;  4C0D C;  4PJO C;  2W10 A;  1VQ8 A;  1X01 A;  4J7F A;  2QTV A;  1VQ6 T;  1NYG A;  4XU2 A;  2RI3 A;  4IUV A;  1AZE A;  1KJW A;  4HVV A;  2RD1 A;  2K6D A;  4X1V A;  2DL5 A;  2EKH A;  3A8G B;  2KT1 A;  2YXY A;  3C4S A;  4DBR A;  3I55 Q;  3CC7 T;  4C8Q G;  4LE9 A;  4LD6 A;  4XTZ A;  3RKX A;  3LLR A;  1PM3 A;  4Z02 A;  1D1B A;  1OX9 A;  1YIJ T;  2MPX C;  3G71 Q;  3I5S A;  3G6E A;  2GQV A;  4N4I A;  3X24 B;  3H0F A;  2A0F B;  1YJW T;  1UJ0 A;  1Q82 C;  2JNG A;  1V76 A;  2C0T A;  3EGD B;  3CEY A;  4HCC A;  3VS7 A;  3M5A A;  3QYG B;  1G8X A;  4MZT A;  4EMH A;  5CO7 A;  3CCM T;  4RG2 A;  2XG8 D;  4RTX A;  5D6W A;  4M78 A;  3P8H A;  3CCV A;  2DL4 A;  4C8Q D;  4KT0 E;  1M8V A;  2QEX T;  1AWJ A;  2LC4 A;  3QO3 A;  3OBW A;  3X28 B;  1H64 1;  1WHJ A;  2P4R A;  3CCR A;  3PIP A;  4PJO G;  1LPL A;  4F17 A;  1U3O A;  4M7A F;  4PKC C;  1KFZ A;  1QVF A;  3C12 A;  1ZUK A;  5DLO A;  2JXB A;  2VKN A;  4QQ6 A;  1LVK A;  5L8R E;  1UTI A;  5HY6 A;  1Q7Y R;  3ZL7 C;  3TVT A;  4J9G A;  4OMN A;  2QTX A;  4LNP A;  1KC8 R;  4HT8 A;  1T3S A;  3FIF A;  1YN8 A;  2O9S A;  1U8R A;  5D6X A;  3GNG A;  1V1C A;  3HFO A;  3ASK A;  3JV3 A;  2QGF B;  2P4T A;  4J5Y A;  1TS9 A;  1BCO A;  1ZBJ A;  3V7C A;  2YT6 A;  5GAM d;  1ZA2 B;  1A0N B;  1JU5 C;  2XU8 A;  4JPB W;  2IG0 A;  2FPD A;  2HMA A;  4RCB A;  2RF0 A;  1PCX A;  4Y92 A;  4C5H A;  2KMT A;  4PJO D;  1VQL T;  3SWN C;  2MF2 A;  1W1F A;  2JW4 A;  2XDB A;  2J6O A;  3SDZ A;  3OYY A;  3LW5 E;  1XTD A;  2RHI A;  1VQ9 A;  3CMA T;  2EJ9 A;  1SEM A;  1RUW A;  1Y96 B;  2CGH A;  1U06 A;  1PKT A;  3M57 A;  4B9W A;  2DVJ A;  1HD3 A;  4QQG A;  1FMW A;  1YFN A;  3CPW S;  4D6W A;  1K73 R;  2H8H A;  3EG2 A;  2DTO A;  4JLI A;  1ARK A;  5GAN e;  3ZFJ A;  4HVU A;  4X9D A;  3PVL A;  2SRC A;  3A98 A;  5I21 A;  2ZZD A;  1M90 C;  1YP5 A;  2NWM A;  1Q81 R;  3I56 A;  5KYX A;  1OU8 A;  3HRT A;  3JCM W;  1KQS A;  4E2F B;  3JCM d;  4J9B A;  1V29 B;  2ZAE A;  2IPO B;  2VXF A;  4C0F A;  4F16 A;  1G83 A;  4BY6 C;  2E65 A;  1Q86 C;  3CXC P;  1I5L A;  3TCJ A;  5I11 A;  2NUZ A;  1NYF A;  1VQN T;  1RAD B;  3EG0 A;  2F2V A;  1G3W A;  2QYZ A;  2X4X A;  1OYX A;  1SPK A;  3PNW C;  1VQ8 Q;  4LUD A;  1B34 B;  1JJ2 A;  1G3T A;  4O5V A;  2ED1 A;  3HTR A;  3EFO A;  3OYC A;  3QJY A;  1JBM A;  2L3R A;  3DKM A;  5GAM h;  1W2B A;  2OTJ T;  3THK A;  5HK3 A;  3DLL A;  3OW2 S;  4JJB A;  5CQY A;  4M77 A;  5I2S A;  3G6E Q;  1TUC A;  2DM1 A;  1KK7 A;  1Y07 A;  2RQW A;  3BW1 A;  1GXI E;  2FRW A;  2O4X B;  1M3C A;  2VXE A;  1VQL A;  2CZ6 B;  1UHF A;  4B9X A;  1RLQ C;  2E3H A;  2MK5 A;  3EH2 A;  3UT1 A;  4NL3 A;  2CP3 A;  2LCS A;  4EMK B;  3CCQ T;  1FWZ A;  3NTH A;  3QWX X;  2LQK A;  2VYT A;  2BKD N;  2XMF A;  4L6V 5;  5FW9 A;  4M75 B;  3CCV Q;  2FZG B;  4M75 E;  2V26 A;  1O75 A;  1ZSG A;  2EGC A;  2MI6 A;  2XD0 A;  5KH6 A;  1NJI U;  1VIE A;  3CCR Q;  1R8O B;  3M0T A;  1AHJ B;  3TU4 K;  3LX7 A;  2ENM A;  4PL6 A;  2A28 A;  2Y90 A;  3X20 B;  1GBQ A;  2RO0 A;  1M2V B;  5A2Q E;  3JCM h;  4TVR A;  1OEB A;  5FWC A;  3VRZ A;  5IXB A;  1MMD A;  3ZEH A;  4E47 A;  2YUO A;  4DBH A;  2G3R A;  2DER A;  3OYG A;  1K8A R;  1IHW A;  1B7T A;  5CR2 A;  3PVQ A;  5J26 A;  2HDA A;  2KDS A;  5IXF A;  4MZP A;  1AD5 A;  2LQN A;  1VQ5 A;  2FRY A;  1JEG A;  2ROT A;  3SHW A;  1UFF A;  1FXX A;  2DX1 A;  4PFO A;  1WJR A;  2FZK B;  1ZSZ B;  1VQN A;  2FEI A;  3GOX A;  2FHD A;  2K3X A;  5DLQ E;  2VB6 A;  1X6B A;  1KD1 U;  5IAY A;  1VQ9 Q;  5GMK h;  2LX9 A;  3CCL T;  1QCN A;  2XDD A;  2RQU A;  1VUB A;  5J3B A;  4F7U B;  3T9N A;  4F7U E;  3MHX A;  3REA B;  4JRQ A;  1KIK A;  2HKN A;  2P0P A;  3DLM A;  3FDR A;  4XTY A;  3CCE Q;  1QVF S;  1HJD A;  4XTU A;  5GAM e;  5GJW B;  1NPP A;  2EQM A;  5GMK l;  2DJZ A;  4LUE A;  2VWF A;  1I0C A;  1WXB A;  4PNO A;  3CC2 T;  3RBB B;  3OYK A;  2GFA A;  2G6F X;  2VGM A;  4OB3 B;  4XU1 A;  2OJ2 A;  2L3Q A;  1M1F A;  4C92 F;  3KXT A;  1M1G A;  3QDF A;  3I56 Q;  1E6G A;  1SHG A;  1OPL A;  1H92 A;  1BB9 A;  3S6W A;  5GAN g;  3EFS A;  1MHN A;  2PU9 B;  4F14 A;  1Y0M A;  4ZN3 A;  1AWX A;  2QK0 A;  3RDV A;  1WHK A;  3LGF A;  2GF7 A;  4R55 A;  4OGC A;  3NTK A;  3GF5 A;  3H41 A;  1YI2 T;  2V1R A;  3IQL A;  4GBQ A;  4FW2 A;  1NBE B;  2YRV A;  2L2P A;  2P84 A;  1PWT A;  1KC8 C;  2MMP A;  2CH4 W;  4RTW A;  4C0Z A;  3VRY A;  3O8V A;  2R5A A;  3JB9 J;  5IHK A;  1AEY A;  2DE0 X;  3JCM e;  2AT1 B;  4OP0 A;  2L0A A;  1HSQ A;  1VA7 A;  3GNF B;  2J06 A;  1SG5 A;  1HK9 A;  2PZ1 A;  4R0K A;  2D6F A;  1KHI A;  2BIV A;  1I8F A;  1J3T A;  4ZGD B;  3HFN A;  1BI2 A;  1XJW B;  2K57 A;  3BDL A;  1UB4 A;  2QDY B;  1KQS S;  2XDP A;  4QVD A;  1MV0 B;  4XAX B;  4CC7 A;  4WTO B;  1UGV A;  2NUT B;  3MJX A;  3A8L B;  4C0G A;  1KQ2 A;  1OOT A;  4MDX A;  4PLL A;  4RTY A;  2ROL A;  2DNU A;  2VGN A;  3LH5 A;  1YJN Q;  3JCM f;  5GMK e;  3OYI A;  2QG9 B;  2NUP B;  4PLI A;  1R77 A;  4DEY A;  2EWN A;  4NS5 A;  1K4U S;  1WXT A;  4M7A A;  1JB0 E;  2CP5 A;  2DXT A;  4JS5 A;  4KUL A;  1G2B A;  5AT1 B;  1K73 C;  4DBQ A;  3FJP A;  2RN8 A;  2RHZ A;  1D3B A;  2DA9 A;  3EGU A;  2LNH B;  5HCK A;  1IXD A;  2X9H A;  2A08 A;  1NE8 A;  3M55 A;  3CC4 T;  4C8Q F;  3I5R A;  5GAN d;  1W2B S;  2GTJ A;  1MND A;  3TSW A;  2KY9 A;  4JJN K;  1D0Z A;  2LJ3 A;  2RH2 A;  1BBZ A;  1IGU A;  1C0M A;  2E3I A;  3N5B B;  4E7H A;  4RTV A;  1XQH A;  2M0Y A;  4J6X A;  4RTT A;  2LZ6 B;  1Z9Q A;  3BDU A;  4EPC A;  2YHT A;  1CKA A;  3H0I A;  1NJI R;  2RK2 A;  1X2K A;  2ZPB B;  5KYW B;  2RA2 A;  3MEU A;  2FPE A;  1VQ5 Q;  1U1T A;  4LDW A;  1OZ3 A;  4M78 B;  2A7Y A;  4M78 E;  4Y28 E;  1VQN Q;  3HPW A;  3OW2 A;  3NTI A;  1M8M A;  1QLY A;  3E9G A;  3OA6 A;  2DZ9 A;  2DL8 A;  3CQT A;  2RJC A;  4XU3 A;  1HXD A;  1UDL A;  2KK4 A;  3L2R A;  4FYY B;  1PRL C;  2LJ0 A;  4PJO F;  1BU1 A;  3QG1 A;  4HA8 A;  2GTO A;  4AT1 B;  3CPF A;  2FL7 A;  3LWH A;  4AFZ C;  2YWW A;  3BY7 A;  4FCY A;  2P0Q A;  3S3O A;  5IN1 A;  5LJ5 d;  1WHM A;  5GJV B;  1GBR A;  1OI1 A;  2DFU A;  5HKC A;  1VYT A;  2V8I A;  4LDY A;  3JB9 D;  4BUG A;  5GAM g;  3VYH B;  2DBM A;  3G4S A;  5KCO A;  1MV3 A;  5LJ3 d;  1X43 A;  1BI0 A;  3A8O B;  1DJ7 B;  4D8K A;  2QA4 T;  1S72 T;  4ELY C;  4EMK C;  3M53 A;  1VQ7 Q;  2MWO A;  3VS1 A;  4E7S A;  2KI7 A;  1TH7 A;  2F5T X;  2QGG A;  5CAI A;  2HSE B;  4JZ4 A;  4M75 C;  2HKQ B;  1TXQ A;  4BDY A;  2LTO A;  5CKF A;  1ZBX A;  5A0D A;  5HK0 A;  5GAN h;  3KFV A;  1MMG A;  4M7D A;  4HCB A;  3QZ9 B;  2DL7 A;  1W4S A;  3EGX A;  4E6R A;  2K7A A;  5KYW A;  4O6J A;  3TRE A;  2FPF A;  2CSQ A;  3UDC A;  1K8A C;  2DK3 A;  2ZPI B;  4OMP A;  2EQJ A;  2L8D A;  4K11 A;  2M9U A;  5D6Y A;  3L2W A;  4E7I A;  4QW2 A;  2H3J A;  4J83 A;  3EG9 A;  3HKS A;  5KYX B;  2JN0 A;  1VQP Q;  3V7R A;  3JCM g;  2I0N A;  1NPR A;  1K1Z A;  3J7A F;  1PC0 A;  1UE9 A;  3NPF A;  1VQK Q;  1TSF A;  2KEA A;  1Q82 U;  1RAG B;  3PIO A;  2DEU A;  4IUT A;  3A8H B;  3NFC A;  1B07 A;  1ZSZ C;  1QWE A;  3H9N A;  3QDR B;  3S3N A;  3AHU A;  1X6G A;  2BZX A;  4DOV A;  2O01 E;  3BE3 A;  1WNL A;  2KSS A;  4DQ2 A;  1IZ6 A;  2QXF A;  2O2O A;  3M0U A;  4IUP A;  1WQW A;  5LJ5 h;  5EG2 A;  1I1J A;  2EYY A;  1PSF A;  1KSW A;  1ZA1 B;  3EFO B;  2KRN A;  2FYK A;  3OS1 A;  2Y4Y A;  2AKL A;  3OSV A;  3RKY A;  4EIK A;  3CCJ A;  5CCA A;  2HL3 A;  3V8L A;  2QQ9 A;  2MOX A;  5FRN A;  1QWF A;  2KE9 A;  1YHQ A;  1M3A A;  4AG1 C;  5LJ3 h;  5ECA A;  4BI8 B;  4M77 B;  4OMF B;  2DLP A;  4OML A;  4M77 E;  2WSF E;  4DEX A;  1VQ6 A;  1YIT T;  1VQ4 T;  2ZPH B;  1M1K U;  1S72 A;  2O9V A;  3M9Q A;  2L3P A;  3GP8 A;  3MEA A;  5GAO n;  2JS2 A;  3M4G A;  3X25 B;  2CS7 A;  1NZ9 A;  2DET A;  1Z9Z A;  2EYX A;  8AT1 B;  4AG2 C;  4M75 D;  3CC7 A;  1SF9 A;  2RM4 A;  3JCM V;  1N8R R;  2GCX A;  4ORZ A;  2R57 A;  2RJD A;  1GCQ A;  1MUZ A;  4J6Y A;  3TSZ A;  2DIQ A;  1PG5 B;  1YIJ A;  4ZTJ A;  2VVK A;  4PFZ A;  3U23 A;  3JCM Q;  1D09 B;  1SSF A;  2P0K A;  2EQK A;  4YTL A;  2NYS A;  1YJW A;  2LVM A;  5GAN 4;  3LGL A;  2GBQ A;  1SRM A;  2EIF A;  5GAN 2;  2ED0 A;  3CD6 Q;  2FB7 A;  4GY5 A;  1RAB B;  1JJ2 P;  2X51 A;  3CCM A;  1UEB A;  1G3Y A;  1RAE B;  2O88 A;  1RI0 A;  4FW1 A;  3NGP A;  1QP3 A;  4F7U G;  4CRI A;  1K9M R;  2D0N A;  3INZ A;  4CC2 A;  1RLP C;  1AWW A;  4ATO A;  4C92 A;  4CC3 A;  2QEX A;  4LXC A;  4NL2 A;  2CH4 A;  4IUR A;  3FC3 A;  4CI0 C;  2D1X A;  4BAC A;  1QKW A;  2EYW A;  2EYQ A;  7AT1 B;  5GAN f;  4KH1 B;  4V2S A;  1QVG A;  5KCH A;  1TUG B;  1WZO A;  1K9A A;  3CBO A;  3JCM c;  2DYB A;  3H8Z A;  3VS3 A;  4ELZ C;  2KYB A;  3G4S Q;  5GMK m;  1RAF B;  3CME T;  2HAX A;  2A37 A;  1BYM A;  1PNJ A;  4RMO A;  1YJ9 T;  2J6K A;  4A4K A;  2HNI A;  1EIF A;  3OS5 A;  5LJ5 e;  4JS4 A;  1Q86 U;  1VQO T;  4VUB A;  2VV5 A;  2LQ8 A;  2DJQ A;  3PE0 A;  2PNI A;  2V8K A;  3VV0 A;  4FYV B;  3VS6 A;  1GCP A;  4JUV A;  3L1A A;  1QVP A;  1LOJ A;  3MKD A;  5DM7 R;  3RNJ A;  5LJ3 e;  1E7O A;  1AZG B;  3J80 E;  4JRP A;  4J9D A;  1RAH B;  3CMA A;  1ZX6 A;  1YIT A;  1WFW A;  1NJI C;  2K2M A;  2JJ9 A;  1UHC A;  2COY A;  4PK4 A;  4QQD A;  1KQ1 A;  4Z88 A;  1NM7 A;  1RL2 A;  4XTW A;  2KNB B;  2FG0 A;  1JQQ A;  4WF2 A;  5GMK i;  2ZGW A;  4KGZ B;  3PGG A;  2L3S A;  5LJ5 f;  1UGP B;  1M5Q 1;  2JMC A;  4FSS A;  3CCU T;  3EHQ A;  1E6H A;  4M78 C;  1I4K 1;  4MML A;  1ZUU A;  1D0Y A;  3M59 A;  1H8K A;  5LJ3 f;  2XHC A;  3KUF A;  1G5V A;  3A8M B;  2ZCF B;  2F69 A;  5KYY A;  3G71 T;  3OSS C;  2RJF A;  1BK2 A;  3VYG A;  4C8Q A;  4J9H A;  2FO0 A;  4D8D A;  2OTL T;  1PHT A;  2EBP A;  3EFR A;  2E6Z A;  5KE2 A;  2A36 A;  1OQK A;  3CCJ Q;  5IH2 A;  3V8K A;  1WX6 A;  2B86 A;  2R5M A;  5FU7 B;  1YHQ Q;  2DZC A;  2LT4 A;  5GMK j;  3PTA A;  3PFS A;  3PMT A;  1VQ6 Q;  2QDL A;  2V1Q A;  2GQI A;  4LDU A;  2WSC E;  1TUD A;  4RTZ A;  2V8J A;  1LNX A;  2K9G A;  1S72 Q;  1K0X A;  1BI1 A;  2KYM A;  3RUX A;  2DMO A;  5I2M A;  3OS0 A;  4JJC A;  3CC7 Q;  4BB7 A;  2OTJ A;  5FWB A;  4KBM B;  1M30 A;  2VC8 A;  2K2V A;  1NLP C;  4JRK A;  1O9S A;  4QKU A;  1YJ9 A;  5L23 A;  3OYD A;  3M0Q A;  1YIJ Q;  2F2X A;  4M7A B;  4M78 G;  3VU3 C;  1VQO A;  3CBP A;  4M7A E;  4X9C A;  2YUN A;  4PJO A;  1M1K R;  5GAN 6;  1YJW Q;  2R58 A;  3URG A;  4Q5W A;  4A4H A;  1R0B G;  2JVV A;  2PVO B;  1D3B B;  1WIE A;  3CCM Q;  2H3E B;  1N6A A;  3QWY A;  2CP6 A;  4CC4 B;  3CCQ A;  3MET A;  5A0L A;  3OYE A;  2KXD A;  4KRT A;  4BI4 A;  5GAM f;  2K4Y A;  3VUZ A;  2E41 A;  1Y57 A;  1N5Z A;  3FJ5 A;  4OVA A;  2QEX Q;  1YCS B;  2ECZ A;  4QVC A;  1TG0 A;  2X3X D;  2CZ1 B;  3DB4 A;  4R56 A;  4C5G A;  2DRM A;  4M78 D;  2YSQ A;  3CCU A;  2HD0 A;  4OB0 B;  3A1P A;  1MNE A;  1Q7Y C;  4F04 B;  3CPW P;  4PFP A;  2MCN A;  1WGS A;  2X4W A;  2J05 A;  3SD4 A;  3UF4 A;  2YLB A;  4PJN A;  3EAE A;  4J6W A;  3C95 A;  5CKH A;  3M58 A;  3I35 A;  3JB9 F;  1SSH A;  5CQX A;  4L59 A;  4Y91 A;  3MCA B;  1M4Z A;  2OTL A;  1SHF A;  2A3L A;  1VIF A;  3TQ7 P;  4E7K A;  2XIC A;  4EDU A;  3QXE B;  1OV3 A;  2D0Q B;  1VQL Q;  3R6N A;  2M1H A;  2DO3 A;  3AT1 B;  3MP8 A;  2E70 A;  1HYO A;  1KC8 U;  3QPH A;  2HQH A;  5LJ5 g;  3CMA Q;  4M77 C;  4LDX A;  1YIT Q;  2XK0 A;  3CCL A;  3PMI A;  1PD0 A;  1N8R C;  2YRD A;  1QVG S;  5LJ3 g;  3E1S A;  4A4G A;  1Y71 A;  3HP9 A;  5GAN 7;  2JOY A;  3KBG A;  3L2Z A;  4OF1 A;  4FU6 A;  1WJS A;  2F1L A;  2E10 A;  2QQS A;  4II1 A;  5KYU A;  2YRC A;  2C0I A;  2LJ1 A;  4N0A A;  1QCO A;  1W70 A;  3JCM P;  2L89 A;  4XTX A;  3CC2 A;  2D9T A;  4L5G A;  3HRU A;  1Q81 C;  4FSX A;  3OW2 P;  1UG1 A;  4OB1 B;  1K0S A;  3G6E T;  1FMV A;  1FYN A;  5I22 A;  2CUB A;  1K9M C;  3OB9 A;  2DTI A;  1MGQ A;  4HXJ A;  1X69 A;  4M7D B;  4M7D E;  2DL3 A;  2DVE A;  4P5N A;  3EGX B;  1X27 A;  3M0P A;  2CRE A;  3X26 B;  1YBY A;  1WQ7 A;  3M56 A;  5FU6 B;  2COZ A;  3C94 A;  3VS0 A;  1X6O A;  4A4E A;  2CZ7 B;  1WJQ A;  1B3Q A;  2EKO A;  2RQT A;  3OMC A;  1Q95 G;  5DY9 A;  2C06 A;  3QSU A;  3JB9 G;  3CCV T;  1YI2 A;  4FIB A;  3C0C A;  1UGQ B;  3EG9 B;  2EJG A;  3J81 E;  2D8H A;  5KYN A;  1FX7 A;  4KGV B;  1WYX A;  4M77 G;  2JS0 A;  1WHH A;  1M9S A;  3CCR T;  3M4Y A;  2NLU A;  1H3Z A;  2CP0 A;  3G7Z A;  4GLK A;  3D7S B;  1OZ2 A;  2OTJ Q;  2CT4 A;  4JRI A;  4IUU A;  3VS5 A;  1YJ9 Q;  3UA7 A;  1AOJ A;  4RG8 A;  2HZY A;  1KD1 R;  1VQO Q;  5A0G A;  1VQM T;  2IVW A;  1EX4 A;  1VOM A;  2DD4 A;  2BTT A;  2RI5 A;  4M75 F;  1QW1 A;  3P8D A;  1X2Q A;  4ZN1 A;  4B6M A;  5GAO p;  2EGA A;  4M77 D;  1MMA A;  4C5I A;  3GLX A;  2BE9 B;  3QJ6 A;  2KT8 A;  3QUI A;  3MEV A;  3MP6 A;  5J39 A;  3G1J A;  2AZS A;  4IIO A;  3CCQ Q;  1PRM C;  2DXU A;  5IT9 E;  1VQ9 T;  5IHN A;  1BKB A;  2HEQ A;  3RMQ A;  5GAN j;  2OX7 A;  3RIR A;  3JSC A;  2EVR A;  2JMA A;  2LP5 A;  2JZ2 A;  1IRX A;  3MO8 A;  3CCU Q;  3CCE T;  1QVF P;  2BUD A;  2LNV A;  3JB9 H;  2EAY A;  1RAC B;  5IHI A;  2QQR A;  5AYF A;  1WHG A;  3CC4 A;  2CZ0 B;  2WSE E;  1M27 C;  3TEE A;  3FEO A;  4MMK A;  2DYI A;  1YCY A;  3RER A;  4AMC A;  3VS2 A;  3QZ5 B;  3FRN A;  2DAQ A;  2E4H A;  1WA7 A;  4M4Z A;  5GAO r;  1JXO A;  1PD1 A;  2W0Z A;  2OI3 A;  1SKU B;  3V8J A;  4ZTF A;  4OB2 B;  2AKK A;  1ZLM A;  3I56 T;  2MIO A;  1P92 A;  2VUB A;  4J9E A;  2OTL Q;  4C5E A;  4JJD A;  2SEM A;  3OS2 A;  3ER0 A;  2JTF A;  2O31 A;  1U1S A;  4J9I A;  1GRI A;  2K3Y A;  4F7U F;  2PVG B;  4BD3 A;  5EC7 A;  4C92 B;  1I81 A;  4C92 E;  5FU7 C;  4E7J A;  1LJO A;  4A63 B;  3GBQ A;  2JT4 A;  1IB8 A;  1K8A U;  3OY9 A;  3CCL Q;  2X4Y A;  2CUD A;  2M51 A;  5LJ5 j;  2AHJ B;  3ME9 A;  4M75 G;  3HL8 A;  2MWP A;  2ABL A;  2RNA A;  4IKF A;  5GAO q;  3H0H A;  1M1K C;  5LJ3 j;  1NEG A;  2KRS A;  3LYI A;  3HHT B;  1OPK A;  3CC2 Q;  4XU0 A;  1VQM A;  2DKG A;  2FZC B;  4M7A C;  1KG1 A;  3S3M A;  1VYU A;  1OU9 A;  1CKB A;  1GL5 A;  2WAC A;  2EYZ A;  3CCS T;  2E6N A;  3OMG A;  1KQS P;  5GAO m;  2QA4 A;  2RMO A;  3ZBD A;  4N0A C;  4PJJ A;  4HCZ A;  3JCM b;  3L2V A;  3RMS A;  3JCM J;  1CSK A;  3JRZ A;  1YJN T;  1SRL A;  2DD5 A;  1WI7 A;  1YI2 Q;  3JAM E;  3SEM A;  1QVG P;  2CSI A;  3CCE A;  2KBT A;  4ZGE B;  3EGD A;  3OYJ A;  4GLM A;  2ZPF B;  2XKO C;  3DB3 A;  1UGS B;  3NHN A;  1FMK A;  2Y4X A;  1WXU A;  2LX7 A;  2LCC A;  3M54 A;  1IO6 A;  2E5K A;  2M16 A;  1G3S A;  4ANJ A;  1W2B P;  3QII A;  2EJF A;  2JM9 A;  5KYY B;  1ZUY A;  1XNI A;  3OBY A;  1D1C A;  2GFU A;  2KRM A;  1IGQ A;  4AFS C;  4M7A G;  2LQW A;  3OQ5 A;  4C8Q B;  3MP1 A;  2FVU A;  4C8Q E;  4ME7 A;  1TU0 B;  4OGE A;  1VQ5 T;  1JXM A;  2YDL A;  3UWN A;  1TWB A;  3E2U A;  2B8A A;  1M90 U;  3F70 A;  3QBY A;  2LMJ A;  4FT2 A;  5GAM j;  2CP7 A;  3FB9 A;  2EGE A;  4E7L A;  4PJL A;  2K5F A;  1T0H A;  2LDM A;  2K3B A;  2ESW A;  2EQI A;  2K79 A;  2KGT A;  1UUE A;  2CT3 A;  2QQB A;  2LT1 A;  5CIU A;  1ZHI A;  1QP2 A;  2OAW A;  4M7A D;  3L2Q A;  4FL6 A;  3FLG A;  4M7D F;  2C0O A;  2DPP B;  3QHS A;  1AVZ C;  4KUI A;  5CVI A;  3CC4 Q;  2JM8 A;  4RCC A;  4HCK A;  3CXC A;  1QKX A;  1VQ4 A;  3H6Z A;  4C0D B;  3R6O A;  3CCS A;  4PJO B;  2GNC A;  2X3W D;  4PJO E;  4ZNX A;  4FT4 A;  4M78 F;  2EQU A;  4RTU A;  1Y96 A;  2OAU A;  1WPY A;  2MYS A;  1UEC A;  1QCF A;  1IHV A;  4M7D C;  2IIM A;  4N4G A;  2HL5 C;  3JB9 I;  2HBP A;  5C6S A;  5GAO l;  3UA6 A;  1N9R A;  4HVW A;  5KE3 A;  2HCK A;  1YJN A;  5FU6 C;  1VQ7 T;  3OYA A;  4BE2 A;  3I55 T;  3EG1 A;  4QVZ A;  3ULR B;  2E12 A;  2ATC B;  2DEQ A;  1PKS A;  3EG3 A;  1VYV A;  1RAI B;  5FRO A;  4LD9 K;  1R0C B;  4Z8A A;  5M9O A;  1D1A A;  1OUL A;  2XI9 A;  2DIG A;  1AWO A;  2RHU A;  1X75 C;  4WCI A;  4A54 A;  1KD1 C;  4J9F A;  1I07 A;  1Q82 R;  4JZ3 A;  4EMG A;  3JCM X;  2HQX A;  2DXC A;  1ABO A;  1NEB A;  2DXB A;  4OMQ A;  3RKW A;  1VQM Q;  2E64 A;  4KUD K;  3UAT A;  2RQV A;  2RHY A;  1ABQ A;  3OYM A;  1N9S A;  4DOW A;  2BZ8 A;  1VQP T;  1Y7X A;  2RQR A;  1K76 A;  4BI3 A;  1B34 A;  4J9C A;  2HBW A;  2PUO B;  2XID A;  2QA4 Q;  1F1B B;  4XQ3 A;  2MAM A;  1VQK T;  3CME A;  4M7D G;  1U5S A;  1XOV A;  2CP2 A;  1BCM A;  4AFU C;  4IIM A;  1C1A A;  3O5Z A;  5GAN 5;  2RHX A;  4X34 A;  3UPU A; 
#chains in the Genus database with same CATH homology
 2X4X A;  4J83 A;  4OB1 B;  3HKS A;  1OYX A;  3PNW C;  3G6E T;  4XK8 E;  1K9M C;  2JN0 A;  3OB9 A;  3VKI A;  2DTI A;  1MGQ A;  3V7R A;  1B34 B;  3JCM g;  4M7D B;  1NPR A;  1BIA A;  2O4X A;  4M7D E;  3J7A F;  2DVE A;  4P5N A;  1JJ2 A;  1G3T A;  4O5V A;  4J8O A;  3X26 B;  1YBY A;  1Q82 U;  3PIO A;  3OYC A;  1WQ7 A;  3QJY A;  3M56 A;  3SWN B;  4IUT A;  1JBM A;  2KQW A;  5FU6 B;  3A8H B;  2L3R A;  3NFC A;  3DKM A;  4EMK A;  2PUK B;  2RB6 A;  3C94 A;  5GAM h;  1X6O A;  1W2B A;  2OTJ T;  4A4E A;  2CZ7 B;  3QDR B;  1WJQ A;  4QW2 A;  4M7D D;  3S3N A;  2EKO A;  3OMC A;  5HK3 A;  3DLL A;  3OW2 S;  3AHU A;  5DY9 A;  2ZPE B;  2C06 A;  4DOV A;  4MDW A;  3L2U A;  3QSU A;  3JB9 G;  5CQY A;  4M77 A;  4M75 A;  3CCV T;  1YI2 A;  2O01 E;  4FIB A;  1UGQ B;  1WNL A;  2KSS A;  4RKU E;  2EJG A;  3J81 E;  5I2S A;  4DQ2 A;  3SFM A;  1FX7 A;  2PQW A;  1IZ6 A;  1Y07 A;  2QXF A;  3BW1 A;  3E9F A;  3PT9 A;  4M77 G;  1GXI E;  2O4X B;  4IUP A;  3WVE B;  1WQW A;  5LJ5 h;  5EG2 A;  1M9S A;  2VXE A;  5CKD A;  1VQL A;  3Q1J A;  3CCR T;  3M4Y A;  1PSF A;  3GIB A;  1PSE A;  1VQ7 A;  2CZ6 B;  3OS1 A;  2FYK A;  2Y4Y A;  4B9X A;  3I55 A;  2NLU A;  3OSV A;  3UT1 A;  3RKY A;  3CCJ A;  4NL3 A;  1H3Z A;  4BE1 A;  3G7Z A;  4GLK A;  5CCA A;  3V8L A;  2QQ9 A;  1OZ2 A;  4EMK B;  2F5K A;  5FRN A;  3CCQ T;  1FWZ A;  3QKJ A;  3NTH A;  4C92 C;  2LQK A;  2VYT A;  3VUB A;  1YHQ A;  2BKD N;  5LJ3 h;  4JRI A;  4L6V 5;  4BI8 B;  4A53 A;  4IUU A;  3G71 A;  3LWI A;  4M77 B;  4M75 B;  4OMF B;  4M77 E;  4J7I A;  2WSF E;  4M75 E;  4RG8 A;  1VQ6 A;  5A0G A;  1YIT T;  1VQ4 T;  1O75 A;  2ZPH B;  1VQM T;  2IVW A;  2DTH A;  5CKE A;  1M1K U;  3CD6 T;  2MI6 A;  2KAF A;  2XD0 A;  1S72 A;  5CK9 A;  4A4F A;  3A5Z B;  2DD4 A;  3M9Q A;  3V7S A;  5KH6 A;  4IUQ A;  2RI5 A;  3OYB A;  4M77 F;  3MEA A;  1VIE A;  4M75 F;  5GAO n;  1QW1 A;  3M4G A;  3P8D A;  3GP8 A;  3X25 B;  1R8O B;  1NZ9 A;  2CS7 A;  4ZN1 A;  5GAO p;  4M77 D;  4M75 D;  4ZGJ B;  1AHJ B;  3CC7 A;  2RM4 A;  4C5I A;  3GLX A;  3QJ6 A;  3JCM V;  3VJP A;  3TU4 K;  3LX7 A;  3QUI A;  3MEV A;  2GCX A;  4PL6 A;  3GPL A;  3MP6 A;  5J39 A;  3OYF A;  2R57 A;  2RJD A;  1Q7Y U;  2I2L A;  4J6Y A;  2Y90 A;  2DIQ A;  3CBM A;  3X20 B;  2RO0 A;  4BY6 B;  1YIJ A;  5A2Q E;  4ZTJ A;  3JCM h;  2RK1 A;  3JCM Q;  4TVR A;  1SSF A;  2P0K A;  2EQK A;  4YTL A;  2E1H A;  2DXU A;  2QQA A;  4JLG A;  5IT9 E;  3ZEH A;  4E47 A;  1VQ9 T;  1VQP A;  1YJW A;  2LVM A;  1BKB A;  2G3R A;  5GAN 4;  3RMQ A;  3LGL A;  3OYG A;  5GAN j;  4NOY A;  2EIF A;  5GAN 2;  3RIR A;  2FB7 A;  3JSC A;  3P8B B;  5CR2 A;  1VQK A;  5J26 A;  2JZ2 A;  4GY5 A;  1VQ8 T;  2KDS A;  4F7U A;  3MO8 A;  5LL6 S;  4MZP A;  3CCM A;  1VQ5 A;  1UEB A;  1G3Y A;  3G4S T;  3CCE T;  1RI0 A;  2BUD A;  2LNV A;  3MEW A;  3JB9 H;  1QP3 A;  2EAY A;  2KVQ G;  4F7U G;  1FXX A;  2QQR A;  2X4J A;  5AYF A;  5GAN 8;  3CPW A;  2CZ0 B;  2LRQ A;  1WJR A;  4CRI A;  3CC4 A;  2WSE E;  3INZ A;  4BDZ A;  1VQN A;  3GOX A;  1BI3 A;  2FHD A;  2K3X A;  3FEO A;  5DLQ E;  3SWN A;  3TEE A;  4MMK A;  4UC4 A;  1JRI A;  4ATO A;  1YCY A;  4C92 A;  3OYH A;  4HT9 A;  2CYZ B;  2QEX A;  3LH0 A;  3RER A;  1KD1 U;  4NL2 A;  3E19 A;  3QZ5 B;  4IUR A;  5IAY A;  3FRN A;  3FC3 A;  2YLC A;  2DAQ A;  4JDS A;  4CI0 C;  3QYH B;  4BAC A;  5GMK h;  5GAO r;  2LX9 A;  4C92 G;  2EYQ A;  3V8J A;  3CCL T;  4ZTF A;  4OB2 B;  2XDD A;  1N27 A;  5GAN f;  1UGR B;  1VUB A;  5J3B A;  1QVG A;  4V2S A;  4F7U B;  3T9N A;  5KCH A;  2LCL A;  2PVD B;  3CBO A;  3MHX A;  3JCM c;  4F7U E;  3I56 T;  4JRQ A;  1JJ2 S;  1P92 A;  2VUB A;  3H8Z A;  4ELZ C;  4C5E A;  2P0P A;  2RJE A;  3DLM A;  3FDR A;  4XTY A;  1QVF S;  4XTU A;  3OS2 A;  5GAM e;  4DA4 A;  1N8R U;  3ER0 A;  5GMK m;  1NPP A;  2EQM A;  5GMK l;  2DJZ A;  2JTF A;  3HSB A;  2JUF A;  1U1S A;  3CME T;  2HAX A;  2K3Y A;  1K73 U;  2CKK A;  4F7U F;  2L5Q A;  2HQE A;  2PVG B;  4BD3 A;  4C92 B;  2K5I A;  1BYM A;  1I81 A;  5GAN 3;  4C92 E;  5FU7 C;  4E7J A;  1LJO A;  4PNO A;  3CC2 T;  4FM4 B;  3OYK A;  3CXC S;  2GFA A;  3HRS A;  4RMO A;  2VGM A;  1YJ9 T;  4OB3 B;  4XU1 A;  4A4K A;  1K8A U;  3OY9 A;  2HNI A;  1EIF A;  3L42 A;  3OS5 A;  5LJ5 e;  4JS4 A;  1Q86 U;  1VQO T;  1M1F A;  4VUB A;  1IRE B;  2VV5 A;  2X4Y A;  2LQ8 A;  4C92 F;  1Q81 U;  5LJ5 j;  5FLX E;  2AHJ B;  3KXT A;  1M1G A;  3ME9 A;  4M75 G;  4C8Q C;  4C92 D;  4N4H A;  2V8K A;  3HL8 A;  3VV0 A;  3OYN A;  2E5Q A;  2MWP A;  4JUV A;  3S6W A;  2RI2 A;  4BE0 A;  3L1A A;  3BFM A;  5CKB A;  1QVP A;  1LOJ A;  5GAN g;  1K9M U;  4IKF A;  3EFS A;  5GAO q;  1MHN A;  2K5L A;  5DM7 R;  5LJ3 e;  2PU9 B;  1M1K C;  5LJ3 j;  3J80 E;  4JRP A;  3OYL A;  3LYI A;  4MZM A;  3WXM B;  3CMA A;  4ZN3 A;  1YIT A;  3HHT B;  1ZQ1 A;  1NJI C;  4XU0 A;  1VQM A;  2DKG A;  3LGF A;  2GF7 A;  4QQD A;  4R55 A;  1KQ1 A;  4M7A C;  3CD6 A;  1KG1 A;  4OGC A;  3NTK A;  3GF5 A;  1KHC A;  1RL2 A;  3S3M A;  1BIB A;  4XTW A;  1YI2 T;  4WF2 A;  5GMK i;  2ZGW A;  5FRM A;  2WAC A;  3PGG A;  3CCS T;  2E6N A;  2YRV A;  2ZPG B;  3OMG A;  5GAO m;  2EFI A;  5LJ5 f;  2QA4 A;  1UGP B;  2JTM A;  1KC8 C;  3ZBD A;  3RES A;  4N0A C;  1M5Q 1;  3WVD B;  2MMP A;  4HCZ A;  4HKE A;  4LDV A;  4C0Z A;  2QI2 A;  3SB2 A;  3O8V A;  3CCU T;  3JCM b;  2R5A A;  3JB9 J;  3L2V A;  5C0M A;  3RMS A;  3JCM e;  4M78 C;  1I4K 1;  3CCJ T;  4MML A;  3JCM J;  4OP0 A;  3M59 A;  3JRZ A;  1YJN T;  5LJ3 f;  2M0O A;  2XHC A;  3KUF A;  1G5V A;  4XTV A;  3GNF B;  1YHQ T;  3A8M B;  2X35 A;  2ZCF B;  4C0D C;  1HK9 A;  2F69 A;  2D6F A;  1KHI A;  3G71 T;  4PJO C;  2BIV A;  1I8F A;  2DD5 A;  3OSS C;  1VQ8 A;  1X01 A;  2RJF A;  4J7F A;  3HFN A;  4ZGD B;  1BI2 A;  3JAM E;  4XU2 A;  1VQ6 T;  2RI3 A;  4IUV A;  2K57 A;  3BDL A;  3CCE A;  1UB4 A;  1NJI U;  2QDY B;  4ZGE B;  2XDP A;  4QVD A;  2RD1 A;  4XAX B;  3VYG A;  1KQS S;  3OYJ A;  2ZPF B;  4C8Q A;  2XKO C;  3DB3 A;  1UGS B;  3A8L B;  3A8G B;  2OTL T;  3C4S A;  4C0G A;  2Y4X A;  1KQ2 A;  4MDX A;  3EFR A;  4PLL A;  2LCC A;  2E6Z A;  3M54 A;  4LD6 A;  4C8Q G;  5KE2 A;  3CC7 T;  2VGN A;  3V8K A;  2M16 A;  1G3S A;  4XTZ A;  3RKX A;  2R5M A;  3JCM f;  5GMK e;  3LLR A;  3QII A;  4Z02 A;  5FU7 B;  3OYI A;  2EJF A;  1YIJ T;  2DZC A;  2LT4 A;  4PLI A;  2EWN A;  4NS5 A;  5GMK j;  3PTA A;  3PFS A;  4M7A A;  3G6E A;  1XNI A;  3PMT A;  2GQV A;  1JB0 E;  4N4I A;  3X24 B;  3OBY A;  2DXT A;  4LDU A;  2GFU A;  4JS5 A;  4KUL A;  1YJW T;  1K73 C;  1Q82 C;  2JNG A;  4M7A G;  2WSC E;  3OQ5 A;  3FJP A;  3CEY A;  4HCC A;  2V8J A;  3M5A A;  2RHZ A;  3QYG B;  1LNX A;  4C8Q B;  3MP1 A;  4MZT A;  2FVU A;  4C8Q E;  1BI1 A;  4ME7 A;  4EMH A;  1D3B A;  4OGE A;  5CO7 A;  3CCM T;  1VQ5 T;  3RUX A;  4RG2 A;  2XG8 D;  3UWN A;  5D6W A;  1M90 U;  5I2M A;  2B8A A;  3F70 A;  3QBY A;  3OS0 A;  4BB7 A;  2OTJ A;  1NE8 A;  3M55 A;  4KBM B;  4M78 A;  2VC8 A;  2K2V A;  4FT2 A;  4JRK A;  5GAM j;  3FB9 A;  3CC4 T;  4C8Q F;  5GAN d;  1O9S A;  1W2B S;  1YJ9 A;  3P8H A;  2KY9 A;  3OYD A;  4JJN K;  3CCV A;  4C8Q D;  2RH2 A;  4KT0 E;  4M78 G;  4M7A B;  3VU3 C;  4E7L A;  3CBP A;  2K5F A;  2QEX T;  1VQO A;  4M7A E;  1M8V A;  4X9C A;  3N5B B;  2LC4 A;  4E7H A;  4PJO A;  2LDM A;  3QO3 A;  3OBW A;  1XQH A;  5GAN 6;  2R58 A;  3URG A;  4J6X A;  4Q5W A;  4A4H A;  3X28 B;  1H64 1;  3BDU A;  3CCR A;  3PIP A;  4EPC A;  4PJO G;  2YHT A;  2JVV A;  2RK2 A;  2PVO B;  4PKC C;  2ZPB B;  4M7A F;  1D3B B;  2RA2 A;  2QQB A;  3MEU A;  1QVF A;  2LT1 A;  3C12 A;  5CIU A;  1U1T A;  1QP2 A;  1ZHI A;  4LDW A;  4M7A D;  1OZ3 A;  5DLO A;  3L2Q A;  4FL6 A;  1N6A A;  3FLG A;  4QQ6 A;  4M7D F;  5L8R E;  3CCQ A;  3MET A;  5HY6 A;  4M78 B;  2A7Y A;  2DPP B;  3QHS A;  5A0L A;  4KUI A;  5CVI A;  4M78 E;  3OYE A;  4Y28 E;  4RCC A;  2QTX A;  4BI4 A;  5GAM f;  4HT8 A;  3HPW A;  3FIF A;  2K4Y A;  3VUZ A;  2E41 A;  3CXC A;  1U8R A;  5D6X A;  3GNG A;  1VQ4 A;  3H6Z A;  3NTI A;  4OVA A;  3R6O A;  4C0D B;  3OW2 A;  3HFO A;  3ASK A;  3CCS A;  4PJO B;  4QVC A;  2P4T A;  4PJO E;  4FT4 A;  4J5Y A;  4M78 F;  2CZ1 B;  2EQU A;  3DB4 A;  3E9G A;  3V7C A;  2DZ9 A;  1Y96 A;  2OAU A;  4C5G A;  4R56 A;  2RJC A;  4XU3 A;  3OA6 A;  4M78 D;  1HXD A;  1WPY A;  2KK4 A;  3L2R A;  5GAM d;  3CCU A;  2HD0 A;  4OB0 B;  4M7D C;  1Q7Y C;  4N4G A;  2XU8 A;  3JB9 I;  2HBP A;  2IG0 A;  4PJO F;  5C6S A;  5GAO l;  4RCB A;  1N9R A;  4C5H A;  5KE3 A;  3QG1 A;  2KMT A;  4PJO D;  1VQL T;  3SWN C;  1YJN A;  4HA8 A;  2MF2 A;  5FU6 C;  1VQ7 T;  3CPF A;  2FL7 A;  3OYA A;  3LWH A;  1WGS A;  2X4W A;  3I55 T;  3SD4 A;  3BY7 A;  4BE2 A;  4QVZ A;  2XDB A;  2P0Q A;  3S3O A;  2E12 A;  5IN1 A;  2DEQ A;  2YLB A;  3EAE A;  3OYY A;  3SDZ A;  3LW5 E;  1XTD A;  3C95 A;  2RHI A;  4J6W A;  5CKH A;  5LJ5 d;  1VQ9 A;  3CMA T;  2EJ9 A;  3M58 A;  1OI1 A;  3JB9 F;  5HKC A;  2V8I A;  5FRO A;  5CQX A;  1Y96 B;  2CGH A;  4LDY A;  4BUG A;  4L59 A;  5GAM g;  3JB9 D;  4LD9 K;  3VYH B;  5M9O A;  4Y91 A;  3MCA B;  3M57 A;  1M4Z A;  2XI9 A;  2OTL A;  4B9W A;  2DIG A;  3G4S A;  2RHU A;  2A3L A;  1X75 C;  1VIF A;  5KCO A;  5LJ3 d;  1BI0 A;  3A8O B;  1DJ7 B;  4A54 A;  2QA4 T;  4E7K A;  2XIC A;  1S72 T;  4EDU A;  3QXE B;  4QQG A;  2D0Q B;  1KD1 C;  3CPW S;  4D6W A;  2M1H A;  4ELY C;  2DO3 A;  3M53 A;  4EMK C;  2MWO A;  4EMG A;  3MP8 A;  2E70 A;  1KC8 U;  3JCM X;  2DTO A;  1TH7 A;  3QPH A;  5LJ5 g;  2F5T X;  2HQX A;  4JLI A;  2DXC A;  5CAI A;  5GAN e;  2DXB A;  4M77 C;  4M75 C;  3ZFJ A;  4LDX A;  4X9D A;  3RKW A;  2XK0 A;  3CCL A;  2E64 A;  3PMI A;  5I21 A;  4KUD K;  2ZZD A;  1M90 C;  2RHY A;  4BDY A;  2LTO A;  5CKF A;  1N8R C;  3OYM A;  1N9S A;  4DOW A;  1ZBX A;  5A0D A;  5HK0 A;  5GAN h;  3I56 A;  1VQP T;  1Y7X A;  1QVG S;  3HRT A;  3JCM W;  4BI3 A;  3E1S A;  4A4G A;  5LJ3 g;  1KQS A;  1B34 A;  1Y71 A;  4M7D A;  3HP9 A;  4HCB A;  5GAN 7;  3JCM d;  2JOY A;  2PUO B;  3KBG A;  1V29 B;  2XID A;  3L2Z A;  3QZ9 B;  1WJS A;  4FU6 A;  4OF1 A;  1W4S A;  2MAM A;  2E10 A;  2QQS A;  4II1 A;  4XQ3 A;  1VQK T;  3CME A;  4N0A A;  4M7D G;  4O6J A;  3TRE A;  1XOV A;  3JCM P;  2VXF A;  2L89 A;  3UDC A;  4C0F A;  1K8A C;  4BY6 C;  2E65 A;  2DK3 A;  2ZPI B;  4XTX A;  1Q86 C;  2EQJ A;  3CC2 A;  2D9T A;  2L8D A;  4L5G A;  5GAN 5;  3HRU A;  2M9U A;  5D6Y A;  4FSX A;  2RHX A;  4X34 A;  1Q81 C;  3TCJ A;  1I5L A;  1VQN T;  3L2W A;  3UPU A;  4E7I A;  1G3W A;  2H3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...