3BDUA

Crystal structure of protein q6d8g1 at the resolution 1.9 a. northeast structural genomics consortium target ewr22a.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
b'SSNYVLHTNDGRTIVAEGKPKVDDETGMISYTDAYGQQQQINRDNVKEMAKGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title Crystal structure of protein Q6D8G1 at the resolution 1.9 A.
rcsb
source organism Pectobacterium atrosepticum scri1043
molecule tags Lipoprotein
total genus 10
structure length 53
sequence length 53
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3bduA00
3L1AA 4M75C 1WPYA 4XQ3A 3BFMA 3FB9A 3JCMb 2I2LA 5GAMd 4M75G 4QVDA 4PNOA 2RD1A 4PJOG 5I21A 3EFRA 4PJOA 2JN0A 5GAOn 5GAN8 3JB9D 2DVEA 4A54A 2E41A 4RCCA 5GAOr 4M7DA 4M7AC 2YHTA 4M7AB 3JB9J 2DZ9A 4M75D 4PJOD 4M7AG 4M78C 3V8JA 4OP0A 1B34A 5LJ3g 4M78G 5GAN7 1HK9A 2DTHA 2DTIA 2RA2A 3SWNB 5CAIA 3JB9H 3QHSA 2DJZA 4C92F 2RB6A 1KQ1A 2DEQA 3EFSA 5LJ3h 3JCMc 4M7AD 5GANg 5DY9A 4M78D 4MMKA 2EJFA 4HT8A 3GIBA 2VXEA 4EMHA 4J6WA 3SB2A 4HA8A 5LJ3f 3BY7A 4XU3A 4F7UB 1N9SA 1D3BA 4C8QF 5GAMh 3RKXA 1I5LA 4C92A 5LJ5g 2EWNA 3JCMg 2VC8A 4PJOC 4M75B 5GANf 4PJOB 4XU2A 3FIFA 4DQ2A 3AHUA 4M7DC 4J5YA 5GMKe 5GAMf 5GAOp 3JB9I 4M7DB 4M77E 4M7DG 4JLIA 5LJ5d 4Y91A 4J6YA 3JCMd 1B34B 5GMKh 4C8QA 4C92E 2ZGWA 5GAN6 1YCYA 3M4GA 4M78B 3RESA 1HXDA 3RKWA 2EJ9A 1I4K1 4M77F 5LJ3e 4M7DD 4EMKA 5GAOm 2Y90A 2E10A 3JCMV 3VU3C 2EAYA 5GAN4 4X9CA 1TH7A 4WF2A 3HFOA 5GANe 2E65A 5GAOl 4C8QE 1Y96A 2RM4A 2K57A 3RUXA 5GAMe 4RCBA 1U1SA 5GANh 4M77G 4M77A 1I8FA 2EJGA 4C92C 2VXFA 4HT9A 3JCMP 1M5Q1 2E1HA 1JBMA 3RIRA 4C92G 4N0AA 1BIAA 3BDUA 5GAN5 1LJOA 2DXTA 5GMKj 1M8VA 3L2ZA 4XTVA 4XU0A 5LJ5h 4XTYA 4J6XA 4NOYA 2YLCA 3FJPA 4XTXA 2DXUA 3JCMh 2E64A 3PGGA 4XTUA 4C92D 4C8QC 2DZCA 3RERA 5LJ3j 5GAN3 4C8QG 1LNXA 3SWNA 3JB9F 5LJ5f 4EMKC 3JCMf 4NL2A 4M75F 2DKGA 4PJOF 5GANj 4M7AE 3HSBA 4C8QD 1H641 3RKYA 2DTOA 5GAMj 1N9RA 1WNLA 5GMKl 3BW1A 1X01A 4A53A 3JCMJ 1KQ2A 4M7AF 2FYKA 4M77C 2FB7A 4M77B 4M78F 1I81A 1D3BB 1WQ7A 5LJ5j 4N0AC 3QSUA 4M75A 4C92B 5GAN2 3INZA 4MMLA 3V8LA 5LJ5e 1WQWA 1MGQA 4JRIA 3JCMe 4M77D 3JCMX 4JUVA 3V7CA 4F7UE 2CGHA 3JCMQ 4M7AA 1U1TA 2QTXA 5GAOq 4M78A 3SWNC 4EMGA 5GMKi 4NL3A 4M75E 4C8QB 4PJOE 2HNIA 3QUIA 4XTWA 4F7UF 4JRKA 3V7SA 3V8KA 3QO3A 3HFNA 1BIBA 1JRIA 4XU1A 4EMKB 3JB9G 4M7DE 5LJ3d 5GMKm 1LOJA 4QVCA 5GAMg 2YLBA 4M78E 3JCMW 4M7DF 4V2SA 4XTZA 1Y96B 4X9DA 3V7RA 4F7UG 5GANd 4F7UA
chains in the Genus database with same CATH superfamily
3CCVQ 4XQ3A 3JCMb 2ROTA 1YJNT 5I21A 4PJOA 5KYNA 2RMOA 2ESWA 3AT1B 1VQ6Q 2BTTA 2MF2A 1JB0E 3NPFA 2DJZA 4Q5WA 2JS2A 4MMKA 2QA4Q 2OAUA 2E6NA 4J6WA 2FEIA 3UA6A 3VS4A 4DOWA 5FLXE 4JRQA 2QQRA 4R55A 3C12A 1ZSGA 3NMZC 3L2VA 1VQ9T 4ZNXA 4M7DC 1X75C 5HK0A 3LLRA 5KE2A 4RG8A 4ZTFA 1I4K1 2IVWA 1UHFA 1OX9A 4IIOA 2J05A 1QVGS 2X4WA 4F17A 3VU3C 3G4SQ 4KRTA 5CQXA 1UJ0A 2JVVA 1YIJT 3CCRA 3E19A 1YITA 1BBZA 4M77G 1D0YA 2KSSA 2RQWA 4QQ6A 2LJ3A 4KUIA 4KH0B 4ORZA 1E6GA 3CCVA 1M8VA 1YJNQ 5IHIA 2RJDA 1CKBA 3LGFA 2O4XB 1VQ6A 1I07A 4C8QG 3MPUB 5A0GA 4PJJA 4D8KA 1UGRB 4E7ZA 4HCKA 1IGQA 2DAQA 4AFSC 2QA4A 1BI0A 4FCYA 1MUZA 1N8RU 5AT1B 1VQ9Q 1W2BA 2A37A 1X6GA 4DBRA 4N4GA 5CO7A 2QEXT 5IN1A 2PUKB 3QO3A 4BI4A 9ATCB 2DL5A 2F2VA 3VKIA 2A3LA 3CCMA 3G4SA 1PD1A 1YIJQ 4F7UG 8ATCB 2XD0A 1PKTA 3GBQA 3FB9A 4BY6C 2LZ6B 1AWXA 4YTLA 2MPXC 4LD9K 4LUDA 1YCSB 1BCOA 3L2WA 1YJNA 2JM8A 5GAN7 2K6DA 1JU5C 3OYYA 1KQ1A 4HCZA 1A0NB 1KHCA 3OBYA 5IXFA 1QP2A 2VXEA 1VQ7T 2PVDB 1WI7A 2V26A 3A8HB 3HTRA 1WIEA 2W10A 4M75B 4X34A 4XAXB 2KEAA 3FIFA 2D0NA 2DO3A 1JEGA 3JB9I 3OS1A 1WHKA 2COZA 5LJ5d 2XICA 1VQ9A 2JZ2A 3VS0A 1TUDA 1WA7A 1WXUA 2FPDA 2QEXQ 2YRCA 1KHIA 4EPCA 2ZCFB 4FYWB 3I55T 1K73R 3MCAB 2KROA 1ZHIA 4CC2A 3QYHB 4HT9A 1YIJA 4DBFA 4IUUA 4J6XA 3SDZA 2LC4A 2XMFA 2RHXA 3M0TA 1K8AU 4M7AE 1H641 2Y4XA 2EIFA 4FSXA 5GMKl 1VQ7Q 4RTWA 4BI3A 1MNEA 2KRNA 2YRVA 2QDLA 2M16A 2E6ZA 4EIKA 1OYXA 2P0QA 1VQ4T 2X4JA 3QBYA 3HFNA 1RI0A 4EMKB 1JJ2P 2QEXA 5CCAA 3HPWA 2CP2A 1LOJA 1I1JA 2DYBA 3I55Q 4OMNA 1QVFS 4OMLA 1NLPC 3ER0A 1UGQB 1OI1A 1NEBA 1QVGA 4PJOG 2RD1A 3JRZA 2QGFB 5CKHA 2CP7A 4J9FA 3GOXA 4GY5A 8AT1B 1FWZA 4M7AG 1SF9A 2KY9A 1KQSP 4PK4A 1PSEA 2FO0A 2K3YA 2ZPHB 2DBMA 4HA8A 3X28B 1WHJA 1G3TA 4OB3B 1I5LA 1VQ7A 4J9CA 2V8JA 3LX7A 2NUZA 3OS0A 4BE0A 2GTJA 2ZGWA 3OW2P 1HXDA 1VQ4Q 3M55A 4JPBW 1W4SA 2CP0A 3NHNA 1Y96A 4RKUE 4RCBA 3I55A 4C92C 2HSPA 1BI1A 1M90U 1IZ6A 4N0AA 1VQLT 1H3ZA 3HRSA 3L2ZA 2QASA 2CUBA 4LDUA 1LNXA 2DETA 3CCEQ 1NYFA 3SEMA 2ED1A 3DB4A 1FYNA 4VUBA 4C0DB 2A28A 1D0XA 1OX8A 1X01A 2DL8A 2ZPGB 4A53A 1M3BA 3I5SA 1D3BB 1H8KA 2CP5A 3OYIA 3VUZA 3FC3A 2JOYA 3D7SB 1X6OA 2L2PA 3JCMX 3DLLA 2DIQA 2ABLA 1NPPA 2HQEA 3RBBB 1BIBA 3TSWA 3U23A 1VQ4A 4BACA 3QWYA 3PIOA 4V2SA 3WVDB 3CEYA 3MEUA 1VOMA 1FX7A 1M27C 2KYBA 3J80E 3PT9A 2HEQA 1VQLQ 2AZVA 2CZ6B 3M54A 1NE8A 1NEGA 1UEBA 2E3IA 3O5ZA 4P5NA 4MDXA 3QHSA 3CCEA 2AT1B 2R57A 2KNBB 3H0IA 4EMHA 3I56T 1GFDA 4XU3A 1IRXA 1M3CA 1IGUA 3GP8A 2F69A 2DK3A 1S72T 1KIKA 4QQDA 1LVKA 4M78B 1JO8A 1LCKA 1Y0MA 2Y90A 1KFZA 2X3WD 1VYUA 2RJEA 1N8RR 2D0QB 2XDPA 3VS7A 4HCCA 5C0MA 3QWXX 3OYMA 4BE1A 3TU4K 2RJCA 2DF6A 1VQKT 1VQLA 4C8QC 3OYJA 1XQHA 4WTOB 5I2SA 2MOXA 1R0BG 2CYZB 3MEWA 2YRDA 4IUVA 5GAMj 2HKNA 3PVLA 5KYXB 1N6AA 3OYGA 2HCKA 2X3XD 3I56Q 1BK2A 5IT9E 1T0JA 2PTKA 3OYHA 2PVGB 3INZA 4A4EA 3OYDA 3SD4A 2VYTA 3NGPA 2CH4W 2EYZA 4J9HA 5CIUA 2CT4A 4PFZA 1S72Q 2AKKA 2YSQA 2ECZA 4BDZA 2KXDA 1IXDA 1X2QA 3QZ9B 1SRLA 4RTUA 1VQMQ 2FPEA 5GAMd 3CCUT 1SKUB 2HQXA 4BDYA 4FT4A 1RACB 5CVIA 4OP0A 1R0CB 1X6BA 1U5SA 1ZUUA 4MZTA 2RI5A 3OMCA 2D6FA 3EFSA 4FIBA 3GPLA 2RO0A 2G6FX 2BZXA 3URGA 1YI2T 3QG1A 3GLXA 3UA7A 3I56A 3VRYA 4E7KA 1K8AR 2F5KA 4M7DB 4FL6A 2NLUA 1GCPA 2VV5A 1HSQA 4J6YA 4C92E 1VQOT 2QG9B 3C95A 1S72A 4M7DD 2HL3A 2KXCA 4X9CA 5GANe 1DJ7B 1ZQ1A 1W2BS 1UHCA 3EGXB 1FMVA 3BDUA 3A8LB 1VQMA 4KGVB 3CCUQ 2HL5C 4A4KA 2E12A 3ASKA 3EG3A 4FM4B 5FWBA 2DKGA 3CCRT 3M53A 4FYVB 2P4RA 2LCLA 3OSSC 3CD6T 7AT1B 3LH5A 1IHVA 2DJQA 5CKDA 2HKQB 1YI2Q 4MMLA 3SHWA 2ROLA 4JRIA 3JCMe 1PNJA 5GJVB 1FMWA 2CDTA 2HAXA 4II1A 3V8KA 1VQOQ 2ATCB 1KG1A 1BU1A 2YLBA 1QVPA 2R5MA 4MZPA 5LL6S 3OYCA 4M75G 2DVJA 1MNDA 2M0YA 3JB9D 4M7AC 1Y71A 3CCUA 3ME9A 2EGEA 4ZGJB 2J6FA 2EW3A 4L6V5 2DTIA 1M90R 1PKSA 2RB6A 3SFMA 1Q7YC 3CCMT 4AFQC 1NLOC 1T3LA 3CCRQ 2LQWA 1C6VX 3BE3A 3CD6Q 1B3QA 3JCMg 1AOJA 1ZSZA 2VC8A 3NFCA 5GANf 1AWJA 5GMKe 2DD5A 1YI2A 4JJBA 4M77E 3OY9A 2AHJB 1YJWA 3QXEB 3TVTA 4ME7A 2F1LA 4AFUC 2M1HA 4JDSA 3OS5A 3VS5A 2RPNA 1VYTA 1MV0B 1VQOA 2LTOA 5GAOl 4C8QE 2EKOA 1Q95G 2GQIA 2WACA 3M4YA 5KYXA 4J83A 1AT1B 3EFOB 2VWFA 3FJ5A 2GGRA 4JZ3A 2E4HA 3PMTA 4LN2A 3JCMh 2E64A 2C0TA 3SWNA 3JCMf 4C0FA 1RAAB 3CCMQ 2P0KA 3OS2A 3WVEB 4JS4A 3CXCP 4OB2B 1I81A 4FW2A 2DXBA 4XK8E 3CD6A 4F7UE 5GAOq 1K8AC 4D8DA 4KT0E 3CC4T 6AT1B 4XTWA 1KD1U 2QYZA 1JRIA 3FLGA 1GXIE 4QVCA 1G2BA 3EHQA 2OTJA 3VS3A 4M7DF 1Y96B 2DL3A 1KQSA 1RUWA 3MEVA 1AZEA 2J6OA 5GAN8 2K5FA 4RTTA 4RCCA 3FRNA 4M7DA 2LRQA 3JB9J 1SSFA 2VUBA 2B86A 2KI7A 1TWBA 2GTOA 3EH2A 1IREB 5CAIA 3JSCA 1OZ3A 2VKNA 1VQPT 3R6NA 4Z89A 3OW2A 1Q7YU 2L3PA 1PM3A 3EGXA 2BKDN 2ZPEB 3VS6A 2IPOB 5KE3A 4E47A 3UT1A 3PFSA 1V76A 4HVVA 3CC4Q 1PD0A 1WHLA 2A08A 1PG5B 4KGXB 2EAYA 1RLPC 1RLQC 2RM4A 3X20B 2KGTA 2EQKA 4AG2C 3EG0A 1M5Q1 3MHXA 2L3QA 4NOYA 4C92D 3MP1A 2AZSA 1WGSA 1ZA2B 1O9SA 3JB9F 3UATA 3FEOA 3M0PA 1P92A 3OYFA 1G5VA 1M90C 4A4HA 2KT1A 1VQPQ 3BW1A 2ENMA 2MAMA 4B9XA 1K76A 2VASA 2B8AA 3R6OA 1BYMA 5GAN2 2DL7A 3A98A 2ZPFB 2C0IA 4B6MA 2C0OA 1PWTA 4QKUA 1BCMA 2KQWA 3M0RA 1UE9A 3S3OA 1T3SA 5GMKi 4NL3A 2Z0WA 4PJOE 2HNIA 2DM1A 4QVZA 2DRMA 2JT4A 1WZOA 1N27A 3L2QA 3CC4A 1YWPA 1TUGB 3PVQA 2XG8D 3A8MB 2LDMA 1M2VA 5CQYA 2LT4A 2LT1A 5J26A 1AEYA 3O8VA 3C94A 4M78G 2XHCA 5KYYB 1TG0A 1K0XA 2GFUA 4PFOA 5DM7R 2RHZA 2DEQA 1TUCA 2GF7A 1KC8U 2D9TA 2SEMA 1X43A 1PSFA 2OAWA 3BY7A 4HVWA 1OQKA 1VQPA 4C5IA 3EFOA 2EKHA 4E7SA 1Y7XA 1V1CA 2M51A 3JV3A 5GAOp 3RDVA 5FRNA 4NS5A 4ZGDB 3CCET 2VGNA 2O01E 1PHTA 1ARKA 1G8XA 1E7OA 4ANJA 2E10A 2X9HA 4J9DA 1TXQA 1AWWA 3E9GA 2FVUA 2IIMA 4R0KA 2EJGA 2VXFA 1PCXA 3RIRA 2QXFA 3UF4A 1EX4A 4HXJA 2A36A 1WX6A 4NL2A 2EGCA 2P4TA 3M57A 4C8QD 2NUTB 5DLOA 5CK9A 3E9FA 1M9SA 2M9UA 3JAME 1GL5A 1QQJA 3BDLA 1G83A 3I9QA 5FWCA 4KGZB 2KR3A 1UTIA 3PE0A 4EMGA 2K5LA 1G3YA 1HJDA 1D1AA 1AWOA 2HBPA 1M4ZA 2DILA 1VIEA 2QDYB 1OEBA 4PKCC 5FU7B 4M75C 1QP3A 1V29B 2RI3A 4WCIA 2JXBA 2COWA 2E5KA 3M59A 2DNUA 5GAOr 2DZ9A 2JTEA 1QKWA 4OGCA 3ZL7C 2RHUA 3RMQA 4RG2A 2XDBA 1W70A 3JB9H 4C92F 3JCMc 2K3BA 4K11A 5FRMA 1G3WA 3E1SA 3SB2A 4PJLA 2ZPBB 4J7FA 3VUBA 1N9SA 2RHIA 4HVUA 4C92A 4ZTJA 2EQJA 3A8GB 1VQ8T 4L5GA 2LJ0A 2PQWA 2K9GA 1LPLA 2CP3A 1U3OA 1MMAA 3VRZA 5LJ3e 4PJNA 4RTVA 2R5AA 2KRMA 4QQGA 2RNAA 4A63B 2HD0A 5GAN4 1D0ZA 1SEMA 3HFOA 2YUQA 1W6XA 5KYWB 2K2VA 4IKFA 1KD1R 1ZUKA 2RI2A 5GJWB 2MWPA 2FRYA 3PGGA 2YUPA 5GAN3 2NYSA 3S3NA 4EMKC 2DIGA 3N5BB 3QDFA 1WJSA 4M77C 1VQMT 3QSUA 2XKOC 3C4SA 1ZSZB 1VQ8Q 4RTYA 2XIDA 1D09B 1Q7YR 4BB7A 4D6WA 3QUIA 1XTDA 5KYYA 1VIFA 2KAFA 3PTAA 2JTMA 3OMGA 1WHGA 1ZBXA 4J7IA 2F5TX 4XTZA 5FU6C 3UPUA 1TOVA 3QDRB 4OMQA 2EQMA 1RI9A 1RAHB 2PZ1A 4OVAA 4ELZC 2VVKA 3QIIA 2DVEA 3H0FA 2EBPA 2JJ9A 1M1KC 4M7AB 3CPWP 2AK5A 4PJOD 2EPDA 2LP5A 2HMAA 4GLKA 3QJYA 3SWNB 1SRMA 4M7AD 5LJ3h 2LMJA 1C1AA 3IQLA 2KE9A 2HQHA 2OX7A 5CKFA 4Z88A 4KULA 2QGGA 5LJ3f 1UUEA 4C8QF 1RL2A 1S1NA 5CKBA 4OGEA 1VYVA 3F70A 3VS2A 1ABOA 1NM7A 1OU9A 1W1FA 4Y91A 1VQ8A 2QQBA 1IO6A 4C8QA 1MMDA 3NTKA 1Q81U 4C0DC 1YBYA 2F2WA 1D1CA 2JTFA 1JJ2S 2EYQA 1Q86U 2NUTA 1O75A 3MEAA 1GCQC 1C0MA 4IUQA 4M4ZA 5C6SA 2CH4A 2E3HA 2A0FB 1I0CA 1JXOA 1ZX6A 2YWWA 5GAN5 3CCQT 3LW5E 1UGVA 3M0UA 1YJWT 1WLPB 3M0SA 2L8DA 4XU0A 2HZYA 3OB9A 1HD3A 1YJ9Q 2DZCA 3DB3A 3PIPA 2V1QA 3EG2A 3ZEHA 1KQSS 2O88A 4FU6A 3VJPA 3I35A 3H6ZA 4E7HA 2GFAA 1U8RA 1X69A 2X51A 4F16A 1N5ZA 5IXBA 1QLYA 2SRCA 4J9IA 1MGQA 2DYIA 2K3XA 5A0DA 2DLPA 2D8JA 2CP6A 1QWFA 2EYXA 3M58A 4M75E 3OW2S 3V7SA 3G1JA 4LXCA 2ED0A 4A4FA 3L1AA 2MIOA 3L2RA 2DFUA 1I5OB 2I2LA 4QVDA 1QCOA 5CR2A 1M1FA 4QW2A 2KYMA 2JN0A 4JZ4A 3CCQQ 2LNHB 1XOVA 1KJWA 1E6HA 1YJWQ 1KD1C 3CMAT 4M78C 3OBWA 3OYAA 1MMGA 1YJ9A 2OTJT 5GANg 1M1KU 4LNPA 1NJIU 2RQTA 2K79A 5KYWA 3KXTA 3WXMB 1MV3A 4IURA 1GBQA 4PJOC 2WSEE 4XU2A 4BY6B 2P0PA 3TCJA 3VV0A 3A5ZB 1Z9QA 3ZFJA 4N4IA 3M9QA 2I0NA 3P8DA 1SHFA 1WXBA 1QVFP 3S6WA 2K57A 4C5EA 4JJNK 1JQQA 1M1GA 3MP6A 5GANh 1OOTA 2WSFE 3OSVA 1M2VB 3CQTA 2JS0A 2AKLA 4FYYB 3CMET 2QAZA 3FJPA 3CCQA 3CC2T 3CMAQ 1F1BB 4L59A 3OYNA 4DA4A 3QYGB 2O9VA 3CBOA 4OMFB 5J39A 3T9NA 4J9EA 4PJOF 4CC4B 5GANj 1B7TA 3RKYA 2OTJQ 1KQ2A 2F2XA 4M7AF 2CZ1B 1YP5A 2D1XA 3OA6A 4GBQA 2ZPIB 4CI0C 5LJ5e 2EYWA 2VB6A 3PMIA 1VUBA 5KYUA 3A8OB 4M7AA 1WXTA 3I5RA 2RH2A 2DE0X 4JRKA 2RQUA 4XU1A 5J3BA 2JMAA 1FXXA 4ZN1A 3ULRB 4RTZA 2O2OA 5GANd 1K9MU 5KH6A 1WPYA 3BFMA 4PNOA 3REAB 3EFRA 1JJ2A 5GAOn 4IIMA 2E41A 3CMEQ 3EGDB 3HRUA 3CC2Q 3UDCA 2DTHA 3CMAA 2OTLT 3P8BB 4OMOA 5DY9A 3LYIA 2FG0A 2YUNA 2MI6A 4J9GA 1ABQA 2BZYA 3REBB 1BB9A 1YNZA 2L3RA 3RKXA 5LJ5g 3H0HA 3E2UA 1M8MA 3EGUA 3AHUA 2JMCA 4IUPA 5IH2A 4PLLA 3CPWS 3TQ7P 4CRIA 3H9NA 1B34B 2QK0A 1U06A 2RN8A 5GMKh 3JCMd 1KC8C 3M4GA 2AIRB 1NYGA 1Y57A 3G6ET 1TS9A 4LDWA 1K4US 2K4YA 1WYXA 4WF2A 3M0QA 2E70A 1M2OA 2X4YA 4MZMA 5EC7A 2DRKA 2EFIA 5D6YA 2FL7A 3JCMP 1WJQA 5GMKj 4OMMA 5LJ5h 1AHJB 1AD5A 3CMEA 3VYHB 2K7AA 5LJ5f 1EFNA 3CC2A 4O5VA 2OTLQ 5M9OA 4N4HA 1Q82U 4ESRA 1YN8A 1SG5A 2JUFA 1OZ2A 5LJ5j 4C0ZA 3CCLT 2V8IA 4C92B 3LWIA 2G3RA 3V8LA 1VQ5T 1WDXA 1CKAA 1QKXA 4ZN3A 1U1TA 2L5QA 3GNFB 4BE2A 3HRTA 1VQNT 5IHNA 2FPFA 3H8ZA 1EZZB 3G6EQ 2LCSA 4OB1B 4M78E 2RQVA 4OMPA 2FZCB 2DMOA 4Y92A 4J8OA 2LJ1A 2XI9A 1Q81R 1H92A 2DXCA 3G71T 2GBQA 3OYKA 1Q86R 1YFNA 4OB0B 1PC0A 3C0CA 2RK2A 1RABB 4M75D 4BUGA 3V8JA 2CKKA 1MHNA 1J3TA 3QZ5B 2RA2A 3CCJT 1NZ9A 2P84A 1QMCA 2FZGB 2DL4A 2FRWA 3FDRA 2CUDA 3GIBA 3G7ZA 3CPFA 4AMCA 2CS7A 2OTLA 1QCFA 3ZBDA 2HDAA 2EQUA 1K1ZA 3LGLA 1B07A 4F14A 2EWNA 5FW9A 2BE9B 2XDDA 2X4XA 3CCLQ 4DQ2A 1HYOA 4ZGEB 4JLIA 1VQ5Q 2DPPB 2OJ2A 1YCYA 5HY6A 2MCNA 3CC7T 1QW1A 4QT7A 5GAOm 1VQNQ 4Z02A 4JRPA 3G6EA 3RR6A 4PL6A 1OU8A 4FW1A 3HKSA 2DXTA 1UFFA 3G71Q 4LE9A 2MMPA 2CREA 4XTYA 2E5QA 2LQKA 4CC3A 2K5IA 2COYA 3CCJQ 3LH0A 2ZAEA 3HSBA 2NUPB 4DBHA 3OYEA 1ZBJA 1WNLA 3HHTB 4FSSA 3HP9A 3EG9B 2M02A 4M77B 4N0AC 4LDXA 2BIVA 3EH1A 1M1KR 3MO8A 1NJIR 4M77D 4JUVA 4C5GA 4O6JA 3CCLA 3EGDA 2CT3A 2QTXA 4E2FB 4C8QB 1VQ5A 4FYXB 4M7DE 4EDUA 3CC7Q 1VQNA 3CPWA 3KUFA 1WJRA 4X1VA 1W2BP 2EQIA 4X9DA 5I2MA 5FU6B 2H3JA 4BD3A 2WSCE 3NTHA 3LWHA 2MYSA 1M30A 4R56A 2O4XA 2LCCA 3G71A 1B34A 2JM9A 4PLIA 1WFWA 2R58A 2DX1A 2BUDA 3CCJA 2EJFA 4HT8A 2J7IA 1IHWA 5ECAA 4F7UB 1ZLMA 5DLQE 2LVMA 4Z8AA 3CXCS 4HKEA 4DEXA 5HK3A 3J7AF 2J6KA 2RK1A 5HKCA 4M7DG 1TSFA 3RESA 4DOVA 3M56A 3TREA 2EVRA 3P8HA 2NWMA 1K0SA 4JJDA 2MWOA 2O9SA 2K2MA 2E65A 3CC7A 5GAMe 3RMSA 1I8FA 2EGAA 2E1HA 2O31A 1MMNA 1BI2A 2L3SA 4XTVA 1Q81C 4XTXA 2YLCA 4BI8B 4XTUA 1RAIB 2QQ9A 1K9MR 2M0OA 1Q86C 4OF1A 3META 2DD4A 5L8RE 2CZ0B 5I22A 1PRMC 4M75F 4KBMB 3OQ5A 1RADB 3THKA 4DBQA 1K73C 2RJFA 1GFCA 3M5AA 1WQ7A 2ZZDA 4PFPA 4M75A 3X24B 1ACMB 1H3HA 1WQWA 4J9BA 3V7CA 2CGHA 2QQSA 1SPKA 4ATOA 1AZGB 1WHMA 2D8HA 3HL8A 2JW4A 4A4GA 5IHKA 1UJYA 1X27A 4UC4A 5GMKm 3DLMA 1VA7A 5GAMg 2QQAA 3RNJA 4TVRA 3JB9G 1R77A 5IAYA 2DEUA 4LUEA 1D1BA 4A54A 2LX9A 2YHTA 2KBTA 2H3EB 4HCBA 2YXYA 4AG1C 5LJ3g 1HK9A 4LD6A 2GCXA 3Q1JA 1G3SA 1YHQT 1QVGP 2VGMA 4M78D 3KFVA 2L0AA 4B9WA 3CBPA 4C0GA 1FMKA 2YDLA 1PRLC 1TTHB 5GAMh 3CCST 1AVZC 2IG0A 1EIFA 1Y07A 2KVQG 4LDYA 4PJOB 4E7JA 1Q82R 2HBWA 1QVFA 4F04B 5GAMf 5KYUB 4JJCA 1YJ9T 2LNVA 1NJIC 1UDLA 1RAGB 3RKWA 2W0ZA 4M77F 2V1RA 4EMKA 2KK4A 2KDSA 3JCMV 2NUPA 1TH7A 4C5HA 2XU8A 3EHRA 3X25B 3RUXA 3EG9A 4M77A 4AFZC 2EYYA 1JBMA 1CSKA 1BIAA 5AYFA 3PNWC 2KT8A 2FHDA 5D6XA 4E7IA 5A0LA 1OPLA 3DKMA 1UECA 2DERA 2C06A 1JXMA 2PNIA 3RERA 5LJ3j 3L42A 1WHHA 1KSWA 5D6WA 2CSIA 3TSZA 1YHQQ 2DTOA 3MP8A 3EAEA 2Y4YA 2V8KA 5FU7C 3JCMJ 4MDWA 2FYKA 1BI3A 4RMOA 4DEYA 3J81E 1GRIA 1OPKA 3CCSQ 2YT6A 3VYGA 5L23A 4RTXA 3X26B 1K73U 4ELYC 2H8HA 3JCMQ 3A1PA 1VQKQ 3CXCA 4LDVA 4F7UF 3NTIA 4PJMA 5LJ3d 2J06A 3VS1A 2LQ8A 2HSEB 1RAEB 5A2QE 3JCMW 4JS5A 5FROA 4F7UA 3GNGA 3L2UA 1YWOA 4FT2A 2DA9A 5EG2A 1X2KA 1M3AA 1KC8R 4E6RA 2GQVA 3MJXA 1QCNA 2MK5A 1SHGA 2RHYA 4RUGA 1R8OB 1K9MC 5HCKA 2X35A 1YHQA 1ZA1B 2JNGA 3EG1A 1D3BA 1GCQA 1XNIA 3S3MA 1UB4A 2BZ8A 2LX7A 2PUOB 3CCSA 4J5YA 1IB8A 1NG2A 1Z9ZA 1OV3A 1TU0B 2GNCA 5I11A 1T0HA 1K9AA 5GAN6 2DBKA 1ZUYA 2A7YA 2EJ9A 1VQKA 5KCOA 4E7LA 2QI2A 1XJWB 1YITT 3KBGA 1RAFB 4JLGA 1GBRA 2CSQA 2PU9B 4CC7A 2KRSA 1NBEB 3CCVT 1U1SA 2BE7D 5D7UA 4Y28E 2PVOB 1ZSZC 4C92G 2RF0A 2L89A 1LJOA 4KUDK 1VQ6T 1UGPB 2RQRA 4AT1B 1BKBA 2QTVA 4IUTA 2DXUA 3MKDA 3OYLA 3UWNA 1NPRA 1KK7A 2QA4T 1SSHA 2KMTA 3GF5A 2LQNA 3CBMA 4KH1B 1QWEA 1N9RA 5KCHA 1N8RC 2YUOA 2FB7A 1UG1A 4M78F 3QKJA 3H41A 5CKEA 2FZKB 4GLMA 3QPHA 1UGSB 2CZ7B 1Q82C 4M78A 3SWNC 3G4ST 3TEEA 3OYBA 1YITQ 2OI3A 1OULA 2XK0A 3V7RA 3QJ6A
chains in the Genus database with same CATH topology
4M75C 2XI9A 1QP3A 4XQ3A 2DXCA 3JCMb 5GAMd 3G71T 1V29B 2RI3A 3CCUT 5I21A 1YJNT 4PJOA 3OYKA 2HQXA 4BDYA 3M59A 4FT4A 4OB0B 5GAOr 2RK2A 5CVIA 2DZ9A 4M75D 4OGCA 2MF2A 4BUGA 2RHUA 2CKKA 4OP0A 1MHNA 1JB0E 3RMQA 3V8JA 4RG2A 3QZ5B 2RA2A 3CCJT 2XDBA 1NZ9A 2RI5A 4MZTA 3JB9H 2DJZA 3OMCA 4C92F 2D6FA 3EFSA 3JCMc 4Q5WA 3FDRA 4FIBA 4MMKA 5FRMA 1G3WA 3GPLA 3G7ZA 3CPFA 2OTLA 2CS7A 2OAUA 2E6NA 3E1SA 4J6WA 3SB2A 3ZBDA 2RO0A 2ZPBB 4DOWA 4J7FA 3VUBA 2EQUA 5FLXE 1N9SA 2RHIA 3LGLA 4JRQA 4C92A 2EWNA 2QQRA 3C12A 3URGA 4R55A 4ZTJA 2EQJA 3A8GB 2XDDA 3QG1A 1YI2T 3GLXA 2X4XA 3I56A 3L2VA 4L5GA 4E7KA 1VQ9T 1VQ8T 4DQ2A 4M7DC 2F5KA 1X75C 5HK0A 4M7DB 3LLRA 4FL6A 2NLUA 4ZGEB 2PQWA 4JLIA 2VV5A 5KE2A 4J6YA 4C92E 2DPPB 5HY6A 1YCYA 4RG8A 4ZTFA 1VQOT 3C95A 1I4K1 2IVWA 5LJ3e 1S72A 4M7DD 3CC7T 1QW1A 2R5AA 5GAOm 4QQGA 1QVGS 2X4WA 4Z02A 3VU3C 2HD0A 4X9CA 5CQXA 5GAN4 3HFOA 5GANe 4JRPA 2JVVA 3G6EA 1DJ7B 1YIJT 1ZQ1A 3E19A 3CCRA 1YITA 4PL6A 1W2BS 4M77G 2K2VA 4IKFA 2KSSA 4QQ6A 4KUIA 3BDUA 2RI2A 3A8LB 3HKSA 2DXTA 2MWPA 3CCVA 1VQMA 1M8VA 2MMPA 2RJDA 4A4KA 4XTYA 3LGFA 2E5QA 2LQKA 2O4XB 2E12A 3ASKA 4FM4B 3PGGA 1VQ6A 5GAN3 2K5IA 4C8QG 3S3NA 5A0GA 4EMKC 2DIGA 3N5BB 1UGRB 3LH0A 2DKGA 3CCRT 3M53A 3HSBA 2LCLA 3OYEA 1WNLA 3HHTB 2DAQA 1WJSA 2QA4A 3OSSC 4M77C 3HP9A 3CD6T 1BI0A 1VQMT 4M77B 3QSUA 4N0AC 4LDXA 2BIVA 2XKOC 3C4SA 5CKDA 4MMLA 3MO8A 4JRIA 3JCMe 4J8OA 1N8RU 4M77D 4JUVA 4C5GA 4O6JA 1W2BA 3CCLA 4N4GA 2QTXA 2XIDA 5CO7A 4BB7A 2QEXT 4C8QB 4D6WA 1VQ5A 3QUIA 2HAXA 1XTDA 5IN1A 1VIFA 2PUKB 2KAFA 4II1A 3QO3A 3V8KA 3PTAA 2JTMA 3OMGA 4M7DE 4BI4A 4EDUA 1KG1A 1VQNA 3CPWA 3VKIA 1ZBXA 2A3LA 1WJRA 2YLBA 3KUFA 3CCMA 3G4SA 4J7IA 2F5TX 4XTZA 4X9DA 2R5MA 1QVPA 5FU6C 5I2MA 4F7UG 5FU6B 3UPUA 3QDRB 2XD0A 2H3JA 4MZPA 4BD3A 2EQMA 2WSCE 3FB9A 5LL6S 4BY6C 4M75G 3OYCA 4OVAA 3NTHA 4ELZC 3LWHA 3JB9D 3QIIA 2DVEA 4YTLA 4LD9K 4R56A 2O4XA 4M7AC 2LCCA 1Y71A 3G71A 4M7AB 3ME9A 3L2WA 4ZGJB 3CCUA 1YJNA 1M1KC 4PJOD 1B34A 4L6V5 5GAN7 4PLIA 4GLKA 3QJYA 2DTIA 3SWNB 2R58A 3OYYA 2RB6A 1KQ1A 4HCZA 3SFMA 1KHCA 5LJ3h 3CCMT 1Q7YC 4M7AD 3OBYA 2BUDA 3CCJA 2EJFA 4HT8A 1QP2A 2VXEA 1VQ7T 5CKFA 4KULA 5LJ3f 2PVDB 3A8HB 5DLQE 4F7UB 2LVMA 4C8QF 3CXCS 4HKEA 3JCMg 2VC8A 1RL2A 5HK3A 4M75B 3NFCA 5CKBA 5GANf 4X34A 4XAXB 3FIFA 2DO3A 3JB9I 5GMKe 2DD5A 3J7AF 4OGEA 3OS1A 1YI2A 4M77E 2RK1A 3F70A 2AHJB 5HKCA 3OY9A 5LJ5d 1YJWA 4M7DG 2XICA 3QXEB 4Y91A 2QQBA 1VQ8A 2JZ2A 4C8QA 1VQ9A 3GIBA 3RESA 4DOVA 3M56A 3NTKA 4ME7A 3TREA 2M1HA 4JDSA 1KHIA 1Q81U 3P8HA 3OS5A 4C0DC 4EPCA 1YBYA 2ZCFB 3I55T 1VQOA 2JTFA 2MWOA 3MCAB 2EYQA 1Q86U 2LTOA 1JJ2S 2E65A 5GAOl 4C8QE 3CC7A 2EKOA 1O75A 2WACA 3M4YA 1ZHIA 5GAMe 3MEAA 4J83A 3QYHB 4IUQA 3RMSA 1I8FA 5C6SA 4HT9A 1YIJA 2E1HA 5GAN5 3CCQT 1BI2A 3LW5E 1YJWT 2L8DA 4XTVA 4XU0A 1Q81C 4IUUA 3PMTA 4J6XA 4XTXA 2YLCA 3OB9A 3JCMh 4BI8B 2E64A 4XTUA 2DZCA 2QQ9A 3SDZA 2M0OA 1Q86C 3SWNA 3DB3A 4OF1A 3PIPA 3META 2DD4A 5L8RE 3JCMf 2CZ0B 2LC4A 3ZEHA 4C0FA 4M75F 4KBMB 1KQSS 2RHXA 1K8AU 4M7AE 4FU6A 3OQ5A 3VJPA 1H641 2P0KA 2Y4XA 2EIFA 4E7HA 3H6ZA 4FSXA 3OS2A 2GFAA 5GMKl 1U8RA 3WVEB 1K73C 2RJFA 4JS4A 3M5AA 4OB2B 4BI3A 1I81A 1WQ7A 2ZZDA 2YRVA 4M75A 3X24B 2DXBA 4XK8E 3CD6A 1WQWA 1MGQA 2K3XA 5A0DA 2M16A 2E6ZA 2CGHA 2QQSA 3V7CA 4F7UE 1OYXA 2P0QA 5GAOq 1K8AC 1VQ4T 4ATOA 4KT0E 3M58A 4M75E 3CC4T 2X4JA 4XTWA 3QBYA 3HL8A 3OW2S 4A4GA 3V7SA 1KD1U 3HFNA 1JRIA 1RI0A 4EMKB 4UC4A 3FLGA 2QEXA 1GXIE 5CCAA 3HPWA 3DLMA 5GMKm 1LOJA 4QVCA 2QQAA 5GAMg 4A4FA 1QVFS 4M7DF 2OTJA 1Y96B 4TVRA 3ER0A 3JB9G 3L1AA 1KQSA 1UGQB 1OI1A 3L2RA 3MEVA 5IAYA 1QVGA 2I2LA 4QVDA 4PJOG 2RD1A 3JRZA 1M1FA 5CR2A 4QW2A 2JN0A 5CKHA 5GAN8 2K5FA 4A54A 3GOXA 4RCCA 3FRNA 2LX9A 1XOVA 1KD1C 3CMAT 2YHTA 4M7DA 2LRQA 4GY5A 3JB9J 1FWZA 1SSFA 2VUBA 4M7AG 4M78C 4HCBA 3OBWA 5LJ3g 1HK9A 3OYAA 1IREB 2KY9A 1YJ9A 4LD6A 5CAIA 2GCXA 3JSCA 3Q1JA 1G3SA 1YHQT 1OZ3A 2OTJT 5GANg 2VGMA 1PSEA 1M1KU 4M78D 1NJIU 1VQPT 4B9WA 2K3YA 3CBPA 2ZPHB 4HA8A 4C0GA 3X28B 3OW2A 3KXTA 1G3TA 1Q7YU 4OB3B 3WXMB 5GAMh 3CCST 1I5LA 2IG0A 4IURA 1VQ7A 1EIFA 4PJOC 1Y07A 2KVQG 4LDYA 4PJOB 2WSEE 4XU2A 4BY6B 2P0PA 2V8JA 3LX7A 4E7JA 1QVFA 2BKDN 2ZPEB 5GAMf 3TCJA 3OS0A 3VV0A 5KE3A 3A5ZB 1YJ9T 4E47A 3UT1A 3ZFJA 2LNVA 4BE0A 1NJIC 2ZGWA 3RKWA 1HXDA 3PFSA 4M77F 3M55A 4N4IA 3M9QA 4EMKA 2KK4A 2KDSA 3JCMV 2EAYA 3P8DA 1TH7A 1W4SA 4C5HA 2XU8A 3S6WA 1Y96A 2RM4A 2K57A 3X25B 4C5EA 3RUXA 1M1GA 4RKUE 3MP6A 4RCBA 5GANh 3I55A 4JJNK 2WSFE 4M77A 3X20B 3OSVA 4C92C 2EQKA 1BI1A 1M5Q1 1JBMA 1IZ6A 1M90U 4N0AA 1BIAA 1VQLT 5AYFA 3PNWC 1H3ZA 2FHDA 3HRSA 3MHXA 5D6XA 4E7IA 5A0LA 3CMET 3L2ZA 3DKMA 4NOYA 3FJPA 4LDUA 4C92D 3MP1A 3CCQA 3CC2T 1WGSA 2C06A 1O9SA 4L59A 3RERA 5LJ3j 3OYNA 4DA4A 1LNXA 3L42A 3QYGB 3JB9F 3CBOA 3FEOA 4OMFB 5J39A 3T9NA 3DB4A 5D6WA 4VUBA 1P92A 4PJOF 3OYFA 5GANj 4C0DB 3RKYA 1G5VA 1M90C 2DTOA 4A4HA 3MP8A 3EAEA 2Y4YA 2V8KA 3BW1A 1X01A 5FU7C 2ZPGB 4MDWA 4A53A 2FYKA 3JCMJ 1KQ2A 1BI3A 2MAMA 4RMOA 2CZ1B 4M7AF 4B9XA 3OA6A 1D3BB 2B8AA 3J81E 3R6OA 2ZPIB 5GAN2 3OYIA 1BYMA 2ZPFB 3VUZA 3FC3A 3VYGA 4CI0C 2JOYA 3X26B 5LJ5e 1X6OA 3PMIA 1VUBA 2KQWA 4ELYC 3JCMX 3A8OB 1K73U 3JCMQ 4M7AA 3DLLA 3S3OA 2DIQA 5GMKi 4NL3A 3CXCA 4PJOE 2HNIA 4LDVA 2RH2A 4QVZA 4F7UF 4JRKA 1NPPA 2HQEA 3NTIA 4XU1A 1BIBA 1VQ4A 5J3BA 1FXXA 4ZN1A 1N27A 3L2QA 4BACA 3CC4A 5LJ3d 3V7RA 2LQ8A 2XG8D 5A2QE 3A8MB 3PIOA 3JCMW 4V2SA 4JS5A 5FROA 3WVDB 2LDMA 3CEYA 5CQYA 4F7UA 3GNGA 5GANd 3L2UA 1K9MU 4FT2A 5KH6A 1WPYA 3MEUA 3BFMA 2LT4A 1FX7A 2LT1A 4PNOA 3J80E 3EFRA 3PT9A 5EG2A 5J26A 1JJ2A 5GAOn 2E41A 2GQVA 2CZ6B 3M54A 1NE8A 3O8VA 3HRUA 1UEBA 3C94A 4P5NA 4M78G 3UDCA 2XHCA 2DTHA 3CMAA 2OTLT 2GFUA 2RHYA 4MDXA 3QHSA 2RHZA 5DM7R 3CCEA 2DEQA 3P8BB 1R8OB 1K9MC 2R57A 3LYIA 5DY9A 2GF7A 2MI6A 1KC8U 2X35A 2D9TA 4EMHA 1YHQA 2L3RA 1PSFA 3I56T 2JNGA 3BY7A 4XU3A 1D3BA 1VQPA 4C5IA 1XNIA 3RKXA 5LJ5g 3S3MA 1UB4A 3GP8A 2PUOB 1Y7XA 3AHUA 3CCSA 4J5YA 2F69A 4IUPA 5GAOp 2DK3A 4PLLA 1S72T 5FRNA 3CPWS 4CRIA 4NS5A 3JCMd 1B34B 5GMKh 4ZGDB 3CCET 4QQDA 5GAN6 2VGNA 3M4GA 4M78B 1KC8C 2O01E 2A7YA 2EJ9A 1VQKA 5KCOA 4E7LA 2QI2A 3G6ET 4LDWA 2Y90A 1YITT 2E10A 2K4YA 3KBGA 2RJEA 4JLGA 2D0QB 2PU9B 4WF2A 2E70A 2XDPA 2X4YA 4MZMA 3E9GA 3CCVT 1U1SA 2EFIA 2FVUA 5C0MA 4HCCA 5D6YA 2EJGA 4Y28E 2VXFA 3OYMA 2PVOB 2FL7A 2RJCA 4BE1A 4C92G 3TU4K 3RIRA 1WJQA 2L89A 3JCMP 2QXFA 1LJOA 5GMKj 4KUDK 1VQ6T 1UGPB 5LJ5h 1BKBA 1AHJB 4IUTA 2DXUA 1VQKT 1VQLA 4C8QC 3OYLA 1XQHA 3OYJA 3UWNA 5I2SA 3CMEA 1NPRA 3VYHB 5LJ5f 2CYZB 4NL2A 4O5VA 3CC2A 2QA4T 2P4TA 3MEWA 2KMTA 3GF5A 3M57A 4N4HA 4C8QD 3CBMA 5M9OA 4IUVA 1Q82U 5DLOA 5CK9A 5GAMj 1N9RA 5KCHA 1N8RC 1N6AA 3E9FA 2FB7A 2JUFA 1M9SA 3OYGA 2M9UA 3JAME 4M78F 1OZ2A 5LJ5j 5IT9E 4C0ZA 3QKJA 3OYHA 2V8IA 4C92B 3BDLA 3CCLT 3LWIA 2G3RA 2PVGB 3INZA 5CKEA 3V8LA 3QPHA 1UGSB 4A4EA 3OYDA 1VQ5T 2CZ7B 3SD4A 2VYTA 4ZN3A 1U1TA 1Q82C 5CIUA 2L5QA 3GNFB 4M78A 3SWNC 2K5LA 4EMGA 4BE2A 3HRTA 1G3YA 1VQNT 3G4ST 3TEEA 4BDZA 3OYBA 3H8ZA 3QZ9B 4OB1B 2HBPA 4M78E 2XK0A 1M4ZA 1VIEA 2QDYB 3QJ6A 4PKCC 5FU7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1A A;  4M75 C;  1WPY A;  4XQ3 A;  3BFM A;  3FB9 A;  3JCM b;  2I2L A;  5GAM d;  4M75 G;  4QVD A;  4PNO A;  2RD1 A;  4PJO G;  5I21 A;  3EFR A;  4PJO A;  2JN0 A;  5GAO n;  5GAN 8;  3JB9 D;  2DVE A;  4A54 A;  2E41 A;  4RCC A;  5GAO r;  4M7D A;  4M7A C;  2YHT A;  4M7A B;  3JB9 J;  2DZ9 A;  4M75 D;  4PJO D;  4M7A G;  4M78 C;  3V8J A;  4OP0 A;  1B34 A;  5LJ3 g;  4M78 G;  5GAN 7;  1HK9 A;  2DTH A;  2DTI A;  2RA2 A;  3SWN B;  5CAI A;  3JB9 H;  3QHS A;  2DJZ A;  4C92 F;  2RB6 A;  1KQ1 A;  2DEQ A;  3EFS A;  5LJ3 h;  3JCM c;  4M7A D;  5GAN g;  5DY9 A;  4M78 D;  4MMK A;  2EJF A;  4HT8 A;  3GIB A;  2VXE A;  4EMH A;  4J6W A;  3SB2 A;  4HA8 A;  5LJ3 f;  3BY7 A;  4XU3 A;  4F7U B;  1N9S A;  1D3B A;  4C8Q F;  5GAM h;  3RKX A;  1I5L A;  4C92 A;  5LJ5 g;  2EWN A;  3JCM g;  2VC8 A;  4PJO C;  4M75 B;  5GAN f;  4PJO B;  4XU2 A;  3FIF A;  4DQ2 A;  3AHU A;  4M7D C;  4J5Y A;  5GMK e;  5GAM f;  5GAO p;  3JB9 I;  4M7D B;  4M77 E;  4M7D G;  4JLI A;  5LJ5 d;  4Y91 A;  4J6Y A;  3JCM d;  1B34 B;  5GMK h;  4C8Q A;  4C92 E;  2ZGW A;  5GAN 6;  1YCY A;  3M4G A;  4M78 B;  3RES A;  1HXD A;  3RKW A;  2EJ9 A;  1I4K 1;  4M77 F;  5LJ3 e;  4M7D D;  4EMK A;  5GAO m;  2Y90 A;  2E10 A;  3JCM V;  3VU3 C;  2EAY A;  5GAN 4;  4X9C A;  1TH7 A;  4WF2 A;  3HFO A;  5GAN e;  2E65 A;  5GAO l;  4C8Q E;  1Y96 A;  2RM4 A;  2K57 A;  3RUX A;  5GAM e;  4RCB A;  1U1S A;  5GAN h;  4M77 G;  4M77 A;  1I8F A;  2EJG A;  4C92 C;  2VXF A;  4HT9 A;  3JCM P;  1M5Q 1;  2E1H A;  1JBM A;  3RIR A;  4C92 G;  4N0A A;  1BIA A;  3BDU A;  5GAN 5;  1LJO A;  2DXT A;  5GMK j;  1M8V A;  3L2Z A;  4XTV A;  4XU0 A;  5LJ5 h;  4XTY A;  4J6X A;  4NOY A;  2YLC A;  3FJP A;  4XTX A;  2DXU A;  3JCM h;  2E64 A;  3PGG A;  4XTU A;  4C92 D;  4C8Q C;  2DZC A;  3RER A;  5LJ3 j;  5GAN 3;  4C8Q G;  1LNX A;  3SWN A;  3JB9 F;  5LJ5 f;  4EMK C;  3JCM f;  4NL2 A;  4M75 F;  2DKG A;  4PJO F;  5GAN j;  4M7A E;  3HSB A;  4C8Q D;  1H64 1;  3RKY A;  2DTO A;  5GAM j;  1N9R A;  1WNL A;  5GMK l;  3BW1 A;  1X01 A;  4A53 A;  3JCM J;  1KQ2 A;  4M7A F;  2FYK A;  4M77 C;  2FB7 A;  4M77 B;  4M78 F;  1I81 A;  1D3B B;  1WQ7 A;  5LJ5 j;  4N0A C;  3QSU A;  4M75 A;  4C92 B;  5GAN 2;  3INZ A;  4MML A;  3V8L A;  5LJ5 e;  1WQW A;  1MGQ A;  4JRI A;  3JCM e;  4M77 D;  3JCM X;  4JUV A;  3V7C A;  4F7U E;  2CGH A;  3JCM Q;  4M7A A;  1U1T A;  2QTX A;  5GAO q;  4M78 A;  3SWN C;  4EMG A;  5GMK i;  4NL3 A;  4M75 E;  4C8Q B;  4PJO E;  2HNI A;  3QUI A;  4XTW A;  4F7U F;  4JRK A;  3V7S A;  3V8K A;  3QO3 A;  3HFN A;  1BIB A;  1JRI A;  4XU1 A;  4EMK B;  3JB9 G;  4M7D E;  5LJ3 d;  5GMK m;  1LOJ A;  4QVC A;  5GAM g;  2YLB A;  4M78 E;  3JCM W;  4M7D F;  4V2S A;  4XTZ A;  1Y96 B;  4X9D A;  3V7R A;  4F7U G;  5GAN d;  4F7U A; 
#chains in the Genus database with same CATH topology
 3CCV Q;  4XQ3 A;  3JCM b;  2ROT A;  1YJN T;  5I21 A;  4PJO A;  5KYN A;  2RMO A;  2ESW A;  3AT1 B;  1VQ6 Q;  2BTT A;  2MF2 A;  1JB0 E;  3NPF A;  2DJZ A;  4Q5W A;  2JS2 A;  4MMK A;  2QA4 Q;  2OAU A;  2E6N A;  4J6W A;  2FEI A;  3UA6 A;  3VS4 A;  4DOW A;  5FLX E;  4JRQ A;  2QQR A;  4R55 A;  3C12 A;  1ZSG A;  3NMZ C;  3L2V A;  1VQ9 T;  4ZNX A;  4M7D C;  1X75 C;  5HK0 A;  3LLR A;  5KE2 A;  4RG8 A;  4ZTF A;  1I4K 1;  2IVW A;  1UHF A;  1OX9 A;  4IIO A;  2J05 A;  1QVG S;  2X4W A;  4F17 A;  3VU3 C;  3G4S Q;  4KRT A;  5CQX A;  1UJ0 A;  2JVV A;  1YIJ T;  3CCR A;  3E19 A;  1YIT A;  1BBZ A;  4M77 G;  1D0Y A;  2KSS A;  2RQW A;  4QQ6 A;  2LJ3 A;  4KUI A;  4KH0 B;  4ORZ A;  1E6G A;  3CCV A;  1M8V A;  1YJN Q;  5IHI A;  2RJD A;  1CKB A;  3LGF A;  2O4X B;  1VQ6 A;  1I07 A;  4C8Q G;  3MPU B;  5A0G A;  4PJJ A;  4D8K A;  1UGR B;  4E7Z A;  4HCK A;  1IGQ A;  2DAQ A;  4AFS C;  2QA4 A;  1BI0 A;  4FCY A;  1MUZ A;  1N8R U;  5AT1 B;  1VQ9 Q;  1W2B A;  2A37 A;  1X6G A;  4DBR A;  4N4G A;  5CO7 A;  2QEX T;  5IN1 A;  2PUK B;  3QO3 A;  4BI4 A;  9ATC B;  2DL5 A;  2F2V A;  3VKI A;  2A3L A;  3CCM A;  3G4S A;  1PD1 A;  1YIJ Q;  4F7U G;  8ATC B;  2XD0 A;  1PKT A;  3GBQ A;  3FB9 A;  4BY6 C;  2LZ6 B;  1AWX A;  4YTL A;  2MPX C;  4LD9 K;  4LUD A;  1YCS B;  1BCO A;  3L2W A;  1YJN A;  2JM8 A;  5GAN 7;  2K6D A;  1JU5 C;  3OYY A;  1KQ1 A;  4HCZ A;  1A0N B;  1KHC A;  3OBY A;  5IXF A;  1QP2 A;  2VXE A;  1VQ7 T;  2PVD B;  1WI7 A;  2V26 A;  3A8H B;  3HTR A;  1WIE A;  2W10 A;  4M75 B;  4X34 A;  4XAX B;  2KEA A;  3FIF A;  2D0N A;  2DO3 A;  1JEG A;  3JB9 I;  3OS1 A;  1WHK A;  2COZ A;  5LJ5 d;  2XIC A;  1VQ9 A;  2JZ2 A;  3VS0 A;  1TUD A;  1WA7 A;  1WXU A;  2FPD A;  2QEX Q;  2YRC A;  1KHI A;  4EPC A;  2ZCF B;  4FYW B;  3I55 T;  1K73 R;  3MCA B;  2KRO A;  1ZHI A;  4CC2 A;  3QYH B;  4HT9 A;  1YIJ A;  4DBF A;  4IUU A;  4J6X A;  3SDZ A;  2LC4 A;  2XMF A;  2RHX A;  3M0T A;  1K8A U;  4M7A E;  1H64 1;  2Y4X A;  2EIF A;  4FSX A;  5GMK l;  1VQ7 Q;  4RTW A;  4BI3 A;  1MNE A;  2KRN A;  2YRV A;  2QDL A;  2M16 A;  2E6Z A;  4EIK A;  1OYX A;  2P0Q A;  1VQ4 T;  2X4J A;  3QBY A;  3HFN A;  1RI0 A;  4EMK B;  1JJ2 P;  2QEX A;  5CCA A;  3HPW A;  2CP2 A;  1LOJ A;  1I1J A;  2DYB A;  3I55 Q;  4OMN A;  1QVF S;  4OML A;  1NLP C;  3ER0 A;  1UGQ B;  1OI1 A;  1NEB A;  1QVG A;  4PJO G;  2RD1 A;  3JRZ A;  2QGF B;  5CKH A;  2CP7 A;  4J9F A;  3GOX A;  4GY5 A;  8AT1 B;  1FWZ A;  4M7A G;  1SF9 A;  2KY9 A;  1KQS P;  4PK4 A;  1PSE A;  2FO0 A;  2K3Y A;  2ZPH B;  2DBM A;  4HA8 A;  3X28 B;  1WHJ A;  1G3T A;  4OB3 B;  1I5L A;  1VQ7 A;  4J9C A;  2V8J A;  3LX7 A;  2NUZ A;  3OS0 A;  4BE0 A;  2GTJ A;  2ZGW A;  3OW2 P;  1HXD A;  1VQ4 Q;  3M55 A;  4JPB W;  1W4S A;  2CP0 A;  3NHN A;  1Y96 A;  4RKU E;  4RCB A;  3I55 A;  4C92 C;  2HSP A;  1BI1 A;  1M90 U;  1IZ6 A;  4N0A A;  1VQL T;  1H3Z A;  3HRS A;  3L2Z A;  2QAS A;  2CUB A;  4LDU A;  1LNX A;  2DET A;  3CCE Q;  1NYF A;  3SEM A;  2ED1 A;  3DB4 A;  1FYN A;  4VUB A;  4C0D B;  2A28 A;  1D0X A;  1OX8 A;  1X01 A;  2DL8 A;  2ZPG B;  4A53 A;  1M3B A;  3I5S A;  1D3B B;  1H8K A;  2CP5 A;  3OYI A;  3VUZ A;  3FC3 A;  2JOY A;  3D7S B;  1X6O A;  2L2P A;  3JCM X;  3DLL A;  2DIQ A;  2ABL A;  1NPP A;  2HQE A;  3RBB B;  1BIB A;  3TSW A;  3U23 A;  1VQ4 A;  4BAC A;  3QWY A;  3PIO A;  4V2S A;  3WVD B;  3CEY A;  3MEU A;  1VOM A;  1FX7 A;  1M27 C;  2KYB A;  3J80 E;  3PT9 A;  2HEQ A;  1VQL Q;  2AZV A;  2CZ6 B;  3M54 A;  1NE8 A;  1NEG A;  1UEB A;  2E3I A;  3O5Z A;  4P5N A;  4MDX A;  3QHS A;  3CCE A;  2AT1 B;  2R57 A;  2KNB B;  3H0I A;  4EMH A;  3I56 T;  1GFD A;  4XU3 A;  1IRX A;  1M3C A;  1IGU A;  3GP8 A;  2F69 A;  2DK3 A;  1S72 T;  1KIK A;  4QQD A;  1LVK A;  4M78 B;  1JO8 A;  1LCK A;  1Y0M A;  2Y90 A;  1KFZ A;  2X3W D;  1VYU A;  2RJE A;  1N8R R;  2D0Q B;  2XDP A;  3VS7 A;  4HCC A;  5C0M A;  3QWX X;  3OYM A;  4BE1 A;  3TU4 K;  2RJC A;  2DF6 A;  1VQK T;  1VQL A;  4C8Q C;  3OYJ A;  1XQH A;  4WTO B;  5I2S A;  2MOX A;  1R0B G;  2CYZ B;  3MEW A;  2YRD A;  4IUV A;  5GAM j;  2HKN A;  3PVL A;  5KYX B;  1N6A A;  3OYG A;  2HCK A;  2X3X D;  3I56 Q;  1BK2 A;  5IT9 E;  1T0J A;  2PTK A;  3OYH A;  2PVG B;  3INZ A;  4A4E A;  3OYD A;  3SD4 A;  2VYT A;  3NGP A;  2CH4 W;  2EYZ A;  4J9H A;  5CIU A;  2CT4 A;  4PFZ A;  1S72 Q;  2AKK A;  2YSQ A;  2ECZ A;  4BDZ A;  2KXD A;  1IXD A;  1X2Q A;  3QZ9 B;  1SRL A;  4RTU A;  1VQM Q;  2FPE A;  5GAM d;  3CCU T;  1SKU B;  2HQX A;  4BDY A;  4FT4 A;  1RAC B;  5CVI A;  4OP0 A;  1R0C B;  1X6B A;  1U5S A;  1ZUU A;  4MZT A;  2RI5 A;  3OMC A;  2D6F A;  3EFS A;  4FIB A;  3GPL A;  2RO0 A;  2G6F X;  2BZX A;  3URG A;  1YI2 T;  3QG1 A;  3GLX A;  3UA7 A;  3I56 A;  3VRY A;  4E7K A;  1K8A R;  2F5K A;  4M7D B;  4FL6 A;  2NLU A;  1GCP A;  2VV5 A;  1HSQ A;  4J6Y A;  4C92 E;  1VQO T;  2QG9 B;  3C95 A;  1S72 A;  4M7D D;  2HL3 A;  2KXC A;  4X9C A;  5GAN e;  1DJ7 B;  1ZQ1 A;  1W2B S;  1UHC A;  3EGX B;  1FMV A;  3BDU A;  3A8L B;  1VQM A;  4KGV B;  3CCU Q;  2HL5 C;  4A4K A;  2E12 A;  3ASK A;  3EG3 A;  4FM4 B;  5FWB A;  2DKG A;  3CCR T;  3M53 A;  4FYV B;  2P4R A;  2LCL A;  3OSS C;  3CD6 T;  7AT1 B;  3LH5 A;  1IHV A;  2DJQ A;  5CKD A;  2HKQ B;  1YI2 Q;  4MML A;  3SHW A;  2ROL A;  4JRI A;  3JCM e;  1PNJ A;  5GJV B;  1FMW A;  2CDT A;  2HAX A;  4II1 A;  3V8K A;  1VQO Q;  2ATC B;  1KG1 A;  1BU1 A;  2YLB A;  1QVP A;  2R5M A;  4MZP A;  5LL6 S;  3OYC A;  4M75 G;  2DVJ A;  1MND A;  2M0Y A;  3JB9 D;  4M7A C;  1Y71 A;  3CCU A;  3ME9 A;  2EGE A;  4ZGJ B;  2J6F A;  2EW3 A;  4L6V 5;  2DTI A;  1M90 R;  1PKS A;  2RB6 A;  3SFM A;  1Q7Y C;  3CCM T;  4AFQ C;  1NLO C;  1T3L A;  3CCR Q;  2LQW A;  1C6V X;  3BE3 A;  3CD6 Q;  1B3Q A;  3JCM g;  1AOJ A;  1ZSZ A;  2VC8 A;  3NFC A;  5GAN f;  1AWJ A;  5GMK e;  2DD5 A;  1YI2 A;  4JJB A;  4M77 E;  3OY9 A;  2AHJ B;  1YJW A;  3QXE B;  3TVT A;  4ME7 A;  2F1L A;  4AFU C;  2M1H A;  4JDS A;  3OS5 A;  3VS5 A;  2RPN A;  1VYT A;  1MV0 B;  1VQO A;  2LTO A;  5GAO l;  4C8Q E;  2EKO A;  1Q95 G;  2GQI A;  2WAC A;  3M4Y A;  5KYX A;  4J83 A;  1AT1 B;  3EFO B;  2VWF A;  3FJ5 A;  2GGR A;  4JZ3 A;  2E4H A;  3PMT A;  4LN2 A;  3JCM h;  2E64 A;  2C0T A;  3SWN A;  3JCM f;  4C0F A;  1RAA B;  3CCM Q;  2P0K A;  3OS2 A;  3WVE B;  4JS4 A;  3CXC P;  4OB2 B;  1I81 A;  4FW2 A;  2DXB A;  4XK8 E;  3CD6 A;  4F7U E;  5GAO q;  1K8A C;  4D8D A;  4KT0 E;  3CC4 T;  6AT1 B;  4XTW A;  1KD1 U;  2QYZ A;  1JRI A;  3FLG A;  1GXI E;  4QVC A;  1G2B A;  3EHQ A;  2OTJ A;  3VS3 A;  4M7D F;  1Y96 B;  2DL3 A;  1KQS A;  1RUW A;  3MEV A;  1AZE A;  2J6O A;  5GAN 8;  2K5F A;  4RTT A;  4RCC A;  3FRN A;  4M7D A;  2LRQ A;  3JB9 J;  1SSF A;  2VUB A;  2B86 A;  2KI7 A;  1TWB A;  2GTO A;  3EH2 A;  1IRE B;  5CAI A;  3JSC A;  1OZ3 A;  2VKN A;  1VQP T;  3R6N A;  4Z89 A;  3OW2 A;  1Q7Y U;  2L3P A;  1PM3 A;  3EGX A;  2BKD N;  2ZPE B;  3VS6 A;  2IPO B;  5KE3 A;  4E47 A;  3UT1 A;  3PFS A;  1V76 A;  4HVV A;  3CC4 Q;  1PD0 A;  1WHL A;  2A08 A;  1PG5 B;  4KGX B;  2EAY A;  1RLP C;  1RLQ C;  2RM4 A;  3X20 B;  2KGT A;  2EQK A;  4AG2 C;  3EG0 A;  1M5Q 1;  3MHX A;  2L3Q A;  4NOY A;  4C92 D;  3MP1 A;  2AZS A;  1WGS A;  1ZA2 B;  1O9S A;  3JB9 F;  3UAT A;  3FEO A;  3M0P A;  1P92 A;  3OYF A;  1G5V A;  1M90 C;  4A4H A;  2KT1 A;  1VQP Q;  3BW1 A;  2ENM A;  2MAM A;  4B9X A;  1K76 A;  2VAS A;  2B8A A;  3R6O A;  1BYM A;  5GAN 2;  2DL7 A;  3A98 A;  2ZPF B;  2C0I A;  4B6M A;  2C0O A;  1PWT A;  4QKU A;  1BCM A;  2KQW A;  3M0R A;  1UE9 A;  3S3O A;  1T3S A;  5GMK i;  4NL3 A;  2Z0W A;  4PJO E;  2HNI A;  2DM1 A;  4QVZ A;  2DRM A;  2JT4 A;  1WZO A;  1N27 A;  3L2Q A;  3CC4 A;  1YWP A;  1TUG B;  3PVQ A;  2XG8 D;  3A8M B;  2LDM A;  1M2V A;  5CQY A;  2LT4 A;  2LT1 A;  5J26 A;  1AEY A;  3O8V A;  3C94 A;  4M78 G;  2XHC A;  5KYY B;  1TG0 A;  1K0X A;  2GFU A;  4PFO A;  5DM7 R;  2RHZ A;  2DEQ A;  1TUC A;  2GF7 A;  1KC8 U;  2D9T A;  2SEM A;  1X43 A;  1PSF A;  2OAW A;  3BY7 A;  4HVW A;  1OQK A;  1VQP A;  4C5I A;  3EFO A;  2EKH A;  4E7S A;  1Y7X A;  1V1C A;  2M51 A;  3JV3 A;  5GAO p;  3RDV A;  5FRN A;  4NS5 A;  4ZGD B;  3CCE T;  2VGN A;  2O01 E;  1PHT A;  1ARK A;  1G8X A;  1E7O A;  4ANJ A;  2E10 A;  2X9H A;  4J9D A;  1TXQ A;  1AWW A;  3E9G A;  2FVU A;  2IIM A;  4R0K A;  2EJG A;  2VXF A;  1PCX A;  3RIR A;  2QXF A;  3UF4 A;  1EX4 A;  4HXJ A;  2A36 A;  1WX6 A;  4NL2 A;  2EGC A;  2P4T A;  3M57 A;  4C8Q D;  2NUT B;  5DLO A;  5CK9 A;  3E9F A;  1M9S A;  2M9U A;  3JAM E;  1GL5 A;  1QQJ A;  3BDL A;  1G83 A;  3I9Q A;  5FWC A;  4KGZ B;  2KR3 A;  1UTI A;  3PE0 A;  4EMG A;  2K5L A;  1G3Y A;  1HJD A;  1D1A A;  1AWO A;  2HBP A;  1M4Z A;  2DIL A;  1VIE A;  2QDY B;  1OEB A;  4PKC C;  5FU7 B;  4M75 C;  1QP3 A;  1V29 B;  2RI3 A;  4WCI A;  2JXB A;  2COW A;  2E5K A;  3M59 A;  2DNU A;  5GAO r;  2DZ9 A;  2JTE A;  1QKW A;  4OGC A;  3ZL7 C;  2RHU A;  3RMQ A;  4RG2 A;  2XDB A;  1W70 A;  3JB9 H;  4C92 F;  3JCM c;  2K3B A;  4K11 A;  5FRM A;  1G3W A;  3E1S A;  3SB2 A;  4PJL A;  2ZPB B;  4J7F A;  3VUB A;  1N9S A;  2RHI A;  4HVU A;  4C92 A;  4ZTJ A;  2EQJ A;  3A8G B;  1VQ8 T;  4L5G A;  2LJ0 A;  2PQW A;  2K9G A;  1LPL A;  2CP3 A;  1U3O A;  1MMA A;  3VRZ A;  5LJ3 e;  4PJN A;  4RTV A;  2R5A A;  2KRM A;  4QQG A;  2RNA A;  4A63 B;  2HD0 A;  5GAN 4;  1D0Z A;  1SEM A;  3HFO A;  2YUQ A;  1W6X A;  5KYW B;  2K2V A;  4IKF A;  1KD1 R;  1ZUK A;  2RI2 A;  5GJW B;  2MWP A;  2FRY A;  3PGG A;  2YUP A;  5GAN 3;  2NYS A;  3S3N A;  4EMK C;  2DIG A;  3N5B B;  3QDF A;  1WJS A;  4M77 C;  1VQM T;  3QSU A;  2XKO C;  3C4S A;  1ZSZ B;  1VQ8 Q;  4RTY A;  2XID A;  1D09 B;  1Q7Y R;  4BB7 A;  4D6W A;  3QUI A;  1XTD A;  5KYY A;  1VIF A;  2KAF A;  3PTA A;  2JTM A;  3OMG A;  1WHG A;  1ZBX A;  4J7I A;  2F5T X;  4XTZ A;  5FU6 C;  3UPU A;  1TOV A;  3QDR B;  4OMQ A;  2EQM A;  1RI9 A;  1RAH B;  2PZ1 A;  4OVA A;  4ELZ C;  2VVK A;  3QII A;  2DVE A;  3H0F A;  2EBP A;  2JJ9 A;  1M1K C;  4M7A B;  3CPW P;  2AK5 A;  4PJO D;  2EPD A;  2LP5 A;  2HMA A;  4GLK A;  3QJY A;  3SWN B;  1SRM A;  4M7A D;  5LJ3 h;  2LMJ A;  1C1A A;  3IQL A;  2KE9 A;  2HQH A;  2OX7 A;  5CKF A;  4Z88 A;  4KUL A;  2QGG A;  5LJ3 f;  1UUE A;  4C8Q F;  1RL2 A;  1S1N A;  5CKB A;  4OGE A;  1VYV A;  3F70 A;  3VS2 A;  1ABO A;  1NM7 A;  1OU9 A;  1W1F A;  4Y91 A;  1VQ8 A;  2QQB A;  1IO6 A;  4C8Q A;  1MMD A;  3NTK A;  1Q81 U;  4C0D C;  1YBY A;  2F2W A;  1D1C A;  2JTF A;  1JJ2 S;  2EYQ A;  1Q86 U;  2NUT A;  1O75 A;  3MEA A;  1GCQ C;  1C0M A;  4IUQ A;  4M4Z A;  5C6S A;  2CH4 A;  2E3H A;  2A0F B;  1I0C A;  1JXO A;  1ZX6 A;  2YWW A;  5GAN 5;  3CCQ T;  3LW5 E;  1UGV A;  3M0U A;  1YJW T;  1WLP B;  3M0S A;  2L8D A;  4XU0 A;  2HZY A;  3OB9 A;  1HD3 A;  1YJ9 Q;  2DZC A;  3DB3 A;  3PIP A;  2V1Q A;  3EG2 A;  3ZEH A;  1KQS S;  2O88 A;  4FU6 A;  3VJP A;  3I35 A;  3H6Z A;  4E7H A;  2GFA A;  1U8R A;  1X69 A;  2X51 A;  4F16 A;  1N5Z A;  5IXB A;  1QLY A;  2SRC A;  4J9I A;  1MGQ A;  2DYI A;  2K3X A;  5A0D A;  2DLP A;  2D8J A;  2CP6 A;  1QWF A;  2EYX A;  3M58 A;  4M75 E;  3OW2 S;  3V7S A;  3G1J A;  4LXC A;  2ED0 A;  4A4F A;  3L1A A;  2MIO A;  3L2R A;  2DFU A;  1I5O B;  2I2L A;  4QVD A;  1QCO A;  5CR2 A;  1M1F A;  4QW2 A;  2KYM A;  2JN0 A;  4JZ4 A;  3CCQ Q;  2LNH B;  1XOV A;  1KJW A;  1E6H A;  1YJW Q;  1KD1 C;  3CMA T;  4M78 C;  3OBW A;  3OYA A;  1MMG A;  1YJ9 A;  2OTJ T;  5GAN g;  1M1K U;  4LNP A;  1NJI U;  2RQT A;  2K79 A;  5KYW A;  3KXT A;  3WXM B;  1MV3 A;  4IUR A;  1GBQ A;  4PJO C;  2WSE E;  4XU2 A;  4BY6 B;  2P0P A;  3TCJ A;  3VV0 A;  3A5Z B;  1Z9Q A;  3ZFJ A;  4N4I A;  3M9Q A;  2I0N A;  3P8D A;  1SHF A;  1WXB A;  1QVF P;  3S6W A;  2K57 A;  4C5E A;  4JJN K;  1JQQ A;  1M1G A;  3MP6 A;  5GAN h;  1OOT A;  2WSF E;  3OSV A;  1M2V B;  3CQT A;  2JS0 A;  2AKL A;  4FYY B;  3CME T;  2QAZ A;  3FJP A;  3CCQ A;  3CC2 T;  3CMA Q;  1F1B B;  4L59 A;  3OYN A;  4DA4 A;  3QYG B;  2O9V A;  3CBO A;  4OMF B;  5J39 A;  3T9N A;  4J9E A;  4PJO F;  4CC4 B;  5GAN j;  1B7T A;  3RKY A;  2OTJ Q;  1KQ2 A;  2F2X A;  4M7A F;  2CZ1 B;  1YP5 A;  2D1X A;  3OA6 A;  4GBQ A;  2ZPI B;  4CI0 C;  5LJ5 e;  2EYW A;  2VB6 A;  3PMI A;  1VUB A;  5KYU A;  3A8O B;  4M7A A;  1WXT A;  3I5R A;  2RH2 A;  2DE0 X;  4JRK A;  2RQU A;  4XU1 A;  5J3B A;  2JMA A;  1FXX A;  4ZN1 A;  3ULR B;  4RTZ A;  2O2O A;  5GAN d;  1K9M U;  5KH6 A;  1WPY A;  3BFM A;  4PNO A;  3REA B;  3EFR A;  1JJ2 A;  5GAO n;  4IIM A;  2E41 A;  3CME Q;  3EGD B;  3HRU A;  3CC2 Q;  3UDC A;  2DTH A;  3CMA A;  2OTL T;  3P8B B;  4OMO A;  5DY9 A;  3LYI A;  2FG0 A;  2YUN A;  2MI6 A;  4J9G A;  1ABQ A;  2BZY A;  3REB B;  1BB9 A;  1YNZ A;  2L3R A;  3RKX A;  5LJ5 g;  3H0H A;  3E2U A;  1M8M A;  3EGU A;  3AHU A;  2JMC A;  4IUP A;  5IH2 A;  4PLL A;  3CPW S;  3TQ7 P;  4CRI A;  3H9N A;  1B34 B;  2QK0 A;  1U06 A;  2RN8 A;  5GMK h;  3JCM d;  1KC8 C;  3M4G A;  2AIR B;  1NYG A;  1Y57 A;  3G6E T;  1TS9 A;  4LDW A;  1K4U S;  2K4Y A;  1WYX A;  4WF2 A;  3M0Q A;  2E70 A;  1M2O A;  2X4Y A;  4MZM A;  5EC7 A;  2DRK A;  2EFI A;  5D6Y A;  2FL7 A;  3JCM P;  1WJQ A;  5GMK j;  4OMM A;  5LJ5 h;  1AHJ B;  1AD5 A;  3CME A;  3VYH B;  2K7A A;  5LJ5 f;  1EFN A;  3CC2 A;  4O5V A;  2OTL Q;  5M9O A;  4N4H A;  1Q82 U;  4ESR A;  1YN8 A;  1SG5 A;  2JUF A;  1OZ2 A;  5LJ5 j;  4C0Z A;  3CCL T;  2V8I A;  4C92 B;  3LWI A;  2G3R A;  3V8L A;  1VQ5 T;  1WDX A;  1CKA A;  1QKX A;  4ZN3 A;  1U1T A;  2L5Q A;  3GNF B;  4BE2 A;  3HRT A;  1VQN T;  5IHN A;  2FPF A;  3H8Z A;  1EZZ B;  3G6E Q;  2LCS A;  4OB1 B;  4M78 E;  2RQV A;  4OMP A;  2FZC B;  2DMO A;  4Y92 A;  4J8O A;  2LJ1 A;  2XI9 A;  1Q81 R;  1H92 A;  2DXC A;  3G71 T;  2GBQ A;  3OYK A;  1Q86 R;  1YFN A;  4OB0 B;  1PC0 A;  3C0C A;  2RK2 A;  1RAB B;  4M75 D;  4BUG A;  3V8J A;  2CKK A;  1MHN A;  1J3T A;  3QZ5 B;  2RA2 A;  3CCJ T;  1NZ9 A;  2P84 A;  1QMC A;  2FZG B;  2DL4 A;  2FRW A;  3FDR A;  2CUD A;  3GIB A;  3G7Z A;  3CPF A;  4AMC A;  2CS7 A;  2OTL A;  1QCF A;  3ZBD A;  2HDA A;  2EQU A;  1K1Z A;  3LGL A;  1B07 A;  4F14 A;  2EWN A;  5FW9 A;  2BE9 B;  2XDD A;  2X4X A;  3CCL Q;  4DQ2 A;  1HYO A;  4ZGE B;  4JLI A;  1VQ5 Q;  2DPP B;  2OJ2 A;  1YCY A;  5HY6 A;  2MCN A;  3CC7 T;  1QW1 A;  4QT7 A;  5GAO m;  1VQN Q;  4Z02 A;  4JRP A;  3G6E A;  3RR6 A;  4PL6 A;  1OU8 A;  4FW1 A;  3HKS A;  2DXT A;  1UFF A;  3G71 Q;  4LE9 A;  2MMP A;  2CRE A;  4XTY A;  2E5Q A;  2LQK A;  4CC3 A;  2K5I A;  2COY A;  3CCJ Q;  3LH0 A;  2ZAE A;  3HSB A;  2NUP B;  4DBH A;  3OYE A;  1ZBJ A;  1WNL A;  3HHT B;  4FSS A;  3HP9 A;  3EG9 B;  2M02 A;  4M77 B;  4N0A C;  4LDX A;  2BIV A;  3EH1 A;  1M1K R;  3MO8 A;  1NJI R;  4M77 D;  4JUV A;  4C5G A;  4O6J A;  3CCL A;  3EGD A;  2CT3 A;  2QTX A;  4E2F B;  4C8Q B;  1VQ5 A;  4FYX B;  4M7D E;  4EDU A;  3CC7 Q;  1VQN A;  3CPW A;  3KUF A;  1WJR A;  4X1V A;  1W2B P;  2EQI A;  4X9D A;  5I2M A;  5FU6 B;  2H3J A;  4BD3 A;  2WSC E;  3NTH A;  3LWH A;  2MYS A;  1M30 A;  4R56 A;  2O4X A;  2LCC A;  3G71 A;  1B34 A;  2JM9 A;  4PLI A;  1WFW A;  2R58 A;  2DX1 A;  2BUD A;  3CCJ A;  2EJF A;  4HT8 A;  2J7I A;  1IHW A;  5ECA A;  4F7U B;  1ZLM A;  5DLQ E;  2LVM A;  4Z8A A;  3CXC S;  4HKE A;  4DEX A;  5HK3 A;  3J7A F;  2J6K A;  2RK1 A;  5HKC A;  4M7D G;  1TSF A;  3RES A;  4DOV A;  3M56 A;  3TRE A;  2EVR A;  3P8H A;  2NWM A;  1K0S A;  4JJD A;  2MWO A;  2O9S A;  2K2M A;  2E65 A;  3CC7 A;  5GAM e;  3RMS A;  1I8F A;  2EGA A;  2E1H A;  2O31 A;  1MMN A;  1BI2 A;  2L3S A;  4XTV A;  1Q81 C;  4XTX A;  2YLC A;  4BI8 B;  4XTU A;  1RAI B;  2QQ9 A;  1K9M R;  2M0O A;  1Q86 C;  4OF1 A;  3MET A;  2DD4 A;  5L8R E;  2CZ0 B;  5I22 A;  1PRM C;  4M75 F;  4KBM B;  3OQ5 A;  1RAD B;  3THK A;  4DBQ A;  1K73 C;  2RJF A;  1GFC A;  3M5A A;  1WQ7 A;  2ZZD A;  4PFP A;  4M75 A;  3X24 B;  1ACM B;  1H3H A;  1WQW A;  4J9B A;  3V7C A;  2CGH A;  2QQS A;  1SPK A;  4ATO A;  1AZG B;  1WHM A;  2D8H A;  3HL8 A;  2JW4 A;  4A4G A;  5IHK A;  1UJY A;  1X27 A;  4UC4 A;  5GMK m;  3DLM A;  1VA7 A;  5GAM g;  2QQA A;  3RNJ A;  4TVR A;  3JB9 G;  1R77 A;  5IAY A;  2DEU A;  4LUE A;  1D1B A;  4A54 A;  2LX9 A;  2YHT A;  2KBT A;  2H3E B;  4HCB A;  2YXY A;  4AG1 C;  5LJ3 g;  1HK9 A;  4LD6 A;  2GCX A;  3Q1J A;  1G3S A;  1YHQ T;  1QVG P;  2VGM A;  4M78 D;  3KFV A;  2L0A A;  4B9W A;  3CBP A;  4C0G A;  1FMK A;  2YDL A;  1PRL C;  1TTH B;  5GAM h;  3CCS T;  1AVZ C;  2IG0 A;  1EIF A;  1Y07 A;  2KVQ G;  4LDY A;  4PJO B;  4E7J A;  1Q82 R;  2HBW A;  1QVF A;  4F04 B;  5GAM f;  5KYU B;  4JJC A;  1YJ9 T;  2LNV A;  1NJI C;  1UDL A;  1RAG B;  3RKW A;  2W0Z A;  4M77 F;  2V1R A;  4EMK A;  2KK4 A;  2KDS A;  3JCM V;  2NUP A;  1TH7 A;  4C5H A;  2XU8 A;  3EHR A;  3X25 B;  3RUX A;  3EG9 A;  4M77 A;  4AFZ C;  2EYY A;  1JBM A;  1CSK A;  1BIA A;  5AYF A;  3PNW C;  2KT8 A;  2FHD A;  5D6X A;  4E7I A;  5A0L A;  1OPL A;  3DKM A;  1UEC A;  2DER A;  2C06 A;  1JXM A;  2PNI A;  3RER A;  5LJ3 j;  3L42 A;  1WHH A;  1KSW A;  5D6W A;  2CSI A;  3TSZ A;  1YHQ Q;  2DTO A;  3MP8 A;  3EAE A;  2Y4Y A;  2V8K A;  5FU7 C;  3JCM J;  4MDW A;  2FYK A;  1BI3 A;  4RMO A;  4DEY A;  3J81 E;  1GRI A;  1OPK A;  3CCS Q;  2YT6 A;  3VYG A;  5L23 A;  4RTX A;  3X26 B;  1K73 U;  4ELY C;  2H8H A;  3JCM Q;  3A1P A;  1VQK Q;  3CXC A;  4LDV A;  4F7U F;  3NTI A;  4PJM A;  5LJ3 d;  2J06 A;  3VS1 A;  2LQ8 A;  2HSE B;  1RAE B;  5A2Q E;  3JCM W;  4JS5 A;  5FRO A;  4F7U A;  3GNG A;  3L2U A;  1YWO A;  4FT2 A;  2DA9 A;  5EG2 A;  1X2K A;  1M3A A;  1KC8 R;  4E6R A;  2GQV A;  3MJX A;  1QCN A;  2MK5 A;  1SHG A;  2RHY A;  4RUG A;  1R8O B;  1K9M C;  5HCK A;  2X35 A;  1YHQ A;  1ZA1 B;  2JNG A;  3EG1 A;  1D3B A;  1GCQ A;  1XNI A;  3S3M A;  1UB4 A;  2BZ8 A;  2LX7 A;  2PUO B;  3CCS A;  4J5Y A;  1IB8 A;  1NG2 A;  1Z9Z A;  1OV3 A;  1TU0 B;  2GNC A;  5I11 A;  1T0H A;  1K9A A;  5GAN 6;  2DBK A;  1ZUY A;  2A7Y A;  2EJ9 A;  1VQK A;  5KCO A;  4E7L A;  2QI2 A;  1XJW B;  1YIT T;  3KBG A;  1RAF B;  4JLG A;  1GBR A;  2CSQ A;  2PU9 B;  4CC7 A;  2KRS A;  1NBE B;  3CCV T;  1U1S A;  2BE7 D;  5D7U A;  4Y28 E;  2PVO B;  1ZSZ C;  4C92 G;  2RF0 A;  2L89 A;  1LJO A;  4KUD K;  1VQ6 T;  1UGP B;  2RQR A;  4AT1 B;  1BKB A;  2QTV A;  4IUT A;  2DXU A;  3MKD A;  3OYL A;  3UWN A;  1NPR A;  1KK7 A;  2QA4 T;  1SSH A;  2KMT A;  3GF5 A;  2LQN A;  3CBM A;  4KH1 B;  1QWE A;  1N9R A;  5KCH A;  1N8R C;  2YUO A;  2FB7 A;  1UG1 A;  4M78 F;  3QKJ A;  3H41 A;  5CKE A;  2FZK B;  4GLM A;  3QPH A;  1UGS B;  2CZ7 B;  1Q82 C;  4M78 A;  3SWN C;  3G4S T;  3TEE A;  3OYB A;  1YIT Q;  2OI3 A;  1OUL A;  2XK0 A;  3V7R A;  3QJ6 A; 
#chains in the Genus database with same CATH homology
 4M75 C;  2XI9 A;  1QP3 A;  4XQ3 A;  2DXC A;  3JCM b;  5GAM d;  3G71 T;  1V29 B;  2RI3 A;  3CCU T;  5I21 A;  1YJN T;  4PJO A;  3OYK A;  2HQX A;  4BDY A;  3M59 A;  4FT4 A;  4OB0 B;  5GAO r;  2RK2 A;  5CVI A;  2DZ9 A;  4M75 D;  4OGC A;  2MF2 A;  4BUG A;  2RHU A;  2CKK A;  4OP0 A;  1MHN A;  1JB0 E;  3RMQ A;  3V8J A;  4RG2 A;  3QZ5 B;  2RA2 A;  3CCJ T;  2XDB A;  1NZ9 A;  2RI5 A;  4MZT A;  3JB9 H;  2DJZ A;  3OMC A;  4C92 F;  2D6F A;  3EFS A;  3JCM c;  4Q5W A;  3FDR A;  4FIB A;  4MMK A;  5FRM A;  1G3W A;  3GPL A;  3G7Z A;  3CPF A;  2OTL A;  2CS7 A;  2OAU A;  2E6N A;  3E1S A;  4J6W A;  3SB2 A;  3ZBD A;  2RO0 A;  2ZPB B;  4DOW A;  4J7F A;  3VUB A;  2EQU A;  5FLX E;  1N9S A;  2RHI A;  3LGL A;  4JRQ A;  4C92 A;  2EWN A;  2QQR A;  3C12 A;  3URG A;  4R55 A;  4ZTJ A;  2EQJ A;  3A8G B;  2XDD A;  3QG1 A;  1YI2 T;  3GLX A;  2X4X A;  3I56 A;  3L2V A;  4L5G A;  4E7K A;  1VQ9 T;  1VQ8 T;  4DQ2 A;  4M7D C;  2F5K A;  1X75 C;  5HK0 A;  4M7D B;  3LLR A;  4FL6 A;  2NLU A;  4ZGE B;  2PQW A;  4JLI A;  2VV5 A;  5KE2 A;  4J6Y A;  4C92 E;  2DPP B;  5HY6 A;  1YCY A;  4RG8 A;  4ZTF A;  1VQO T;  3C95 A;  1I4K 1;  2IVW A;  5LJ3 e;  1S72 A;  4M7D D;  3CC7 T;  1QW1 A;  2R5A A;  5GAO m;  4QQG A;  1QVG S;  2X4W A;  4Z02 A;  3VU3 C;  2HD0 A;  4X9C A;  5CQX A;  5GAN 4;  3HFO A;  5GAN e;  4JRP A;  2JVV A;  3G6E A;  1DJ7 B;  1YIJ T;  1ZQ1 A;  3E19 A;  3CCR A;  1YIT A;  4PL6 A;  1W2B S;  4M77 G;  2K2V A;  4IKF A;  2KSS A;  4QQ6 A;  4KUI A;  3BDU A;  2RI2 A;  3A8L B;  3HKS A;  2DXT A;  2MWP A;  3CCV A;  1VQM A;  1M8V A;  2MMP A;  2RJD A;  4A4K A;  4XTY A;  3LGF A;  2E5Q A;  2LQK A;  2O4X B;  2E12 A;  3ASK A;  4FM4 B;  3PGG A;  1VQ6 A;  5GAN 3;  2K5I A;  4C8Q G;  3S3N A;  5A0G A;  4EMK C;  2DIG A;  3N5B B;  1UGR B;  3LH0 A;  2DKG A;  3CCR T;  3M53 A;  3HSB A;  2LCL A;  3OYE A;  1WNL A;  3HHT B;  2DAQ A;  1WJS A;  2QA4 A;  3OSS C;  4M77 C;  3HP9 A;  3CD6 T;  1BI0 A;  1VQM T;  4M77 B;  3QSU A;  4N0A C;  4LDX A;  2BIV A;  2XKO C;  3C4S A;  5CKD A;  4MML A;  3MO8 A;  4JRI A;  3JCM e;  4J8O A;  1N8R U;  4M77 D;  4JUV A;  4C5G A;  4O6J A;  1W2B A;  3CCL A;  4N4G A;  2QTX A;  2XID A;  5CO7 A;  4BB7 A;  2QEX T;  4C8Q B;  4D6W A;  1VQ5 A;  3QUI A;  2HAX A;  1XTD A;  5IN1 A;  1VIF A;  2PUK B;  2KAF A;  4II1 A;  3QO3 A;  3V8K A;  3PTA A;  2JTM A;  3OMG A;  4M7D E;  4BI4 A;  4EDU A;  1KG1 A;  1VQN A;  3CPW A;  3VKI A;  1ZBX A;  2A3L A;  1WJR A;  2YLB A;  3KUF A;  3CCM A;  3G4S A;  4J7I A;  2F5T X;  4XTZ A;  4X9D A;  2R5M A;  1QVP A;  5FU6 C;  5I2M A;  4F7U G;  5FU6 B;  3UPU A;  3QDR B;  2XD0 A;  2H3J A;  4MZP A;  4BD3 A;  2EQM A;  2WSC E;  3FB9 A;  5LL6 S;  4BY6 C;  4M75 G;  3OYC A;  4OVA A;  3NTH A;  4ELZ C;  3LWH A;  3JB9 D;  3QII A;  2DVE A;  4YTL A;  4LD9 K;  4R56 A;  2O4X A;  4M7A C;  2LCC A;  1Y71 A;  3G71 A;  4M7A B;  3ME9 A;  3L2W A;  4ZGJ B;  3CCU A;  1YJN A;  1M1K C;  4PJO D;  1B34 A;  4L6V 5;  5GAN 7;  4PLI A;  4GLK A;  3QJY A;  2DTI A;  3SWN B;  2R58 A;  3OYY A;  2RB6 A;  1KQ1 A;  4HCZ A;  3SFM A;  1KHC A;  5LJ3 h;  3CCM T;  1Q7Y C;  4M7A D;  3OBY A;  2BUD A;  3CCJ A;  2EJF A;  4HT8 A;  1QP2 A;  2VXE A;  1VQ7 T;  5CKF A;  4KUL A;  5LJ3 f;  2PVD B;  3A8H B;  5DLQ E;  4F7U B;  2LVM A;  4C8Q F;  3CXC S;  4HKE A;  3JCM g;  2VC8 A;  1RL2 A;  5HK3 A;  4M75 B;  3NFC A;  5CKB A;  5GAN f;  4X34 A;  4XAX B;  3FIF A;  2DO3 A;  3JB9 I;  5GMK e;  2DD5 A;  3J7A F;  4OGE A;  3OS1 A;  1YI2 A;  4M77 E;  2RK1 A;  3F70 A;  2AHJ B;  5HKC A;  3OY9 A;  5LJ5 d;  1YJW A;  4M7D G;  2XIC A;  3QXE B;  4Y91 A;  2QQB A;  1VQ8 A;  2JZ2 A;  4C8Q A;  1VQ9 A;  3GIB A;  3RES A;  4DOV A;  3M56 A;  3NTK A;  4ME7 A;  3TRE A;  2M1H A;  4JDS A;  1KHI A;  1Q81 U;  3P8H A;  3OS5 A;  4C0D C;  4EPC A;  1YBY A;  2ZCF B;  3I55 T;  1VQO A;  2JTF A;  2MWO A;  3MCA B;  2EYQ A;  1Q86 U;  2LTO A;  1JJ2 S;  2E65 A;  5GAO l;  4C8Q E;  3CC7 A;  2EKO A;  1O75 A;  2WAC A;  3M4Y A;  1ZHI A;  5GAM e;  3MEA A;  4J83 A;  3QYH B;  4IUQ A;  3RMS A;  1I8F A;  5C6S A;  4HT9 A;  1YIJ A;  2E1H A;  5GAN 5;  3CCQ T;  1BI2 A;  3LW5 E;  1YJW T;  2L8D A;  4XTV A;  4XU0 A;  1Q81 C;  4IUU A;  3PMT A;  4J6X A;  4XTX A;  2YLC A;  3OB9 A;  3JCM h;  4BI8 B;  2E64 A;  4XTU A;  2DZC A;  2QQ9 A;  3SDZ A;  2M0O A;  1Q86 C;  3SWN A;  3DB3 A;  4OF1 A;  3PIP A;  3MET A;  2DD4 A;  5L8R E;  3JCM f;  2CZ0 B;  2LC4 A;  3ZEH A;  4C0F A;  4M75 F;  4KBM B;  1KQS S;  2RHX A;  1K8A U;  4M7A E;  4FU6 A;  3OQ5 A;  3VJP A;  1H64 1;  2P0K A;  2Y4X A;  2EIF A;  4E7H A;  3H6Z A;  4FSX A;  3OS2 A;  2GFA A;  5GMK l;  1U8R A;  3WVE B;  1K73 C;  2RJF A;  4JS4 A;  3M5A A;  4OB2 B;  4BI3 A;  1I81 A;  1WQ7 A;  2ZZD A;  2YRV A;  4M75 A;  3X24 B;  2DXB A;  4XK8 E;  3CD6 A;  1WQW A;  1MGQ A;  2K3X A;  5A0D A;  2M16 A;  2E6Z A;  2CGH A;  2QQS A;  3V7C A;  4F7U E;  1OYX A;  2P0Q A;  5GAO q;  1K8A C;  1VQ4 T;  4ATO A;  4KT0 E;  3M58 A;  4M75 E;  3CC4 T;  2X4J A;  4XTW A;  3QBY A;  3HL8 A;  3OW2 S;  4A4G A;  3V7S A;  1KD1 U;  3HFN A;  1JRI A;  1RI0 A;  4EMK B;  4UC4 A;  3FLG A;  2QEX A;  1GXI E;  5CCA A;  3HPW A;  3DLM A;  5GMK m;  1LOJ A;  4QVC A;  2QQA A;  5GAM g;  4A4F A;  1QVF S;  4M7D F;  2OTJ A;  1Y96 B;  4TVR A;  3ER0 A;  3JB9 G;  3L1A A;  1KQS A;  1UGQ B;  1OI1 A;  3L2R A;  3MEV A;  5IAY A;  1QVG A;  2I2L A;  4QVD A;  4PJO G;  2RD1 A;  3JRZ A;  1M1F A;  5CR2 A;  4QW2 A;  2JN0 A;  5CKH A;  5GAN 8;  2K5F A;  4A54 A;  3GOX A;  4RCC A;  3FRN A;  2LX9 A;  1XOV A;  1KD1 C;  3CMA T;  2YHT A;  4M7D A;  2LRQ A;  4GY5 A;  3JB9 J;  1FWZ A;  1SSF A;  2VUB A;  4M7A G;  4M78 C;  4HCB A;  3OBW A;  5LJ3 g;  1HK9 A;  3OYA A;  1IRE B;  2KY9 A;  1YJ9 A;  4LD6 A;  5CAI A;  2GCX A;  3JSC A;  3Q1J A;  1G3S A;  1YHQ T;  1OZ3 A;  2OTJ T;  5GAN g;  2VGM A;  1PSE A;  1M1K U;  4M78 D;  1NJI U;  1VQP T;  4B9W A;  2K3Y A;  3CBP A;  2ZPH B;  4HA8 A;  4C0G A;  3X28 B;  3OW2 A;  3KXT A;  1G3T A;  1Q7Y U;  4OB3 B;  3WXM B;  5GAM h;  3CCS T;  1I5L A;  2IG0 A;  4IUR A;  1VQ7 A;  1EIF A;  4PJO C;  1Y07 A;  2KVQ G;  4LDY A;  4PJO B;  2WSE E;  4XU2 A;  4BY6 B;  2P0P A;  2V8J A;  3LX7 A;  4E7J A;  1QVF A;  2BKD N;  2ZPE B;  5GAM f;  3TCJ A;  3OS0 A;  3VV0 A;  5KE3 A;  3A5Z B;  1YJ9 T;  4E47 A;  3UT1 A;  3ZFJ A;  2LNV A;  4BE0 A;  1NJI C;  2ZGW A;  3RKW A;  1HXD A;  3PFS A;  4M77 F;  3M55 A;  4N4I A;  3M9Q A;  4EMK A;  2KK4 A;  2KDS A;  3JCM V;  2EAY A;  3P8D A;  1TH7 A;  1W4S A;  4C5H A;  2XU8 A;  3S6W A;  1Y96 A;  2RM4 A;  2K57 A;  3X25 B;  4C5E A;  3RUX A;  1M1G A;  4RKU E;  3MP6 A;  4RCB A;  5GAN h;  3I55 A;  4JJN K;  2WSF E;  4M77 A;  3X20 B;  3OSV A;  4C92 C;  2EQK A;  1BI1 A;  1M5Q 1;  1JBM A;  1IZ6 A;  1M90 U;  4N0A A;  1BIA A;  1VQL T;  5AYF A;  3PNW C;  1H3Z A;  2FHD A;  3HRS A;  3MHX A;  5D6X A;  4E7I A;  5A0L A;  3CME T;  3L2Z A;  3DKM A;  4NOY A;  3FJP A;  4LDU A;  4C92 D;  3MP1 A;  3CCQ A;  3CC2 T;  1WGS A;  2C06 A;  1O9S A;  4L59 A;  3RER A;  5LJ3 j;  3OYN A;  4DA4 A;  1LNX A;  3L42 A;  3QYG B;  3JB9 F;  3CBO A;  3FEO A;  4OMF B;  5J39 A;  3T9N A;  3DB4 A;  5D6W A;  4VUB A;  1P92 A;  4PJO F;  3OYF A;  5GAN j;  4C0D B;  3RKY A;  1G5V A;  1M90 C;  2DTO A;  4A4H A;  3MP8 A;  3EAE A;  2Y4Y A;  2V8K A;  3BW1 A;  1X01 A;  5FU7 C;  2ZPG B;  4MDW A;  4A53 A;  2FYK A;  3JCM J;  1KQ2 A;  1BI3 A;  2MAM A;  4RMO A;  2CZ1 B;  4M7A F;  4B9X A;  3OA6 A;  1D3B B;  2B8A A;  3J81 E;  3R6O A;  2ZPI B;  5GAN 2;  3OYI A;  1BYM A;  2ZPF B;  3VUZ A;  3FC3 A;  3VYG A;  4CI0 C;  2JOY A;  3X26 B;  5LJ5 e;  1X6O A;  3PMI A;  1VUB A;  2KQW A;  4ELY C;  3JCM X;  3A8O B;  1K73 U;  3JCM Q;  4M7A A;  3DLL A;  3S3O A;  2DIQ A;  5GMK i;  4NL3 A;  3CXC A;  4PJO E;  2HNI A;  4LDV A;  2RH2 A;  4QVZ A;  4F7U F;  4JRK A;  1NPP A;  2HQE A;  3NTI A;  4XU1 A;  1BIB A;  1VQ4 A;  5J3B A;  1FXX A;  4ZN1 A;  1N27 A;  3L2Q A;  4BAC A;  3CC4 A;  5LJ3 d;  3V7R A;  2LQ8 A;  2XG8 D;  5A2Q E;  3A8M B;  3PIO A;  3JCM W;  4V2S A;  4JS5 A;  5FRO A;  3WVD B;  2LDM A;  3CEY A;  5CQY A;  4F7U A;  3GNG A;  5GAN d;  3L2U A;  1K9M U;  4FT2 A;  5KH6 A;  1WPY A;  3MEU A;  3BFM A;  2LT4 A;  1FX7 A;  2LT1 A;  4PNO A;  3J80 E;  3EFR A;  3PT9 A;  5EG2 A;  5J26 A;  1JJ2 A;  5GAO n;  2E41 A;  2GQV A;  2CZ6 B;  3M54 A;  1NE8 A;  3O8V A;  3HRU A;  1UEB A;  3C94 A;  4P5N A;  4M78 G;  3UDC A;  2XHC A;  2DTH A;  3CMA A;  2OTL T;  2GFU A;  2RHY A;  4MDX A;  3QHS A;  2RHZ A;  5DM7 R;  3CCE A;  2DEQ A;  3P8B B;  1R8O B;  1K9M C;  2R57 A;  3LYI A;  5DY9 A;  2GF7 A;  2MI6 A;  1KC8 U;  2X35 A;  2D9T A;  4EMH A;  1YHQ A;  2L3R A;  1PSF A;  3I56 T;  2JNG A;  3BY7 A;  4XU3 A;  1D3B A;  1VQP A;  4C5I A;  1XNI A;  3RKX A;  5LJ5 g;  3S3M A;  1UB4 A;  3GP8 A;  2PUO B;  1Y7X A;  3AHU A;  3CCS A;  4J5Y A;  2F69 A;  4IUP A;  5GAO p;  2DK3 A;  4PLL A;  1S72 T;  5FRN A;  3CPW S;  4CRI A;  4NS5 A;  3JCM d;  1B34 B;  5GMK h;  4ZGD B;  3CCE T;  4QQD A;  5GAN 6;  2VGN A;  3M4G A;  4M78 B;  1KC8 C;  2O01 E;  2A7Y A;  2EJ9 A;  1VQK A;  5KCO A;  4E7L A;  2QI2 A;  3G6E T;  4LDW A;  2Y90 A;  1YIT T;  2E10 A;  2K4Y A;  3KBG A;  2RJE A;  4JLG A;  2D0Q B;  2PU9 B;  4WF2 A;  2E70 A;  2XDP A;  2X4Y A;  4MZM A;  3E9G A;  3CCV T;  1U1S A;  2EFI A;  2FVU A;  5C0M A;  4HCC A;  5D6Y A;  2EJG A;  4Y28 E;  2VXF A;  3OYM A;  2PVO B;  2FL7 A;  2RJC A;  4BE1 A;  4C92 G;  3TU4 K;  3RIR A;  1WJQ A;  2L89 A;  3JCM P;  2QXF A;  1LJO A;  5GMK j;  4KUD K;  1VQ6 T;  1UGP B;  5LJ5 h;  1BKB A;  1AHJ B;  4IUT A;  2DXU A;  1VQK T;  1VQL A;  4C8Q C;  3OYL A;  1XQH A;  3OYJ A;  3UWN A;  5I2S A;  3CME A;  1NPR A;  3VYH B;  5LJ5 f;  2CYZ B;  4NL2 A;  4O5V A;  3CC2 A;  2QA4 T;  2P4T A;  3MEW A;  2KMT A;  3GF5 A;  3M57 A;  4N4H A;  4C8Q D;  3CBM A;  5M9O A;  4IUV A;  1Q82 U;  5DLO A;  5CK9 A;  5GAM j;  1N9R A;  5KCH A;  1N8R C;  1N6A A;  3E9F A;  2FB7 A;  2JUF A;  1M9S A;  3OYG A;  2M9U A;  3JAM E;  4M78 F;  1OZ2 A;  5LJ5 j;  5IT9 E;  4C0Z A;  3QKJ A;  3OYH A;  2V8I A;  4C92 B;  3BDL A;  3CCL T;  3LWI A;  2G3R A;  2PVG B;  3INZ A;  5CKE A;  3V8L A;  3QPH A;  1UGS B;  4A4E A;  3OYD A;  1VQ5 T;  2CZ7 B;  3SD4 A;  2VYT A;  4ZN3 A;  1U1T A;  1Q82 C;  5CIU A;  2L5Q A;  3GNF B;  4M78 A;  3SWN C;  2K5L A;  4EMG A;  4BE2 A;  3HRT A;  1G3Y A;  1VQN T;  3G4S T;  3TEE A;  4BDZ A;  3OYB A;  3H8Z A;  3QZ9 B;  4OB1 B;  2HBP A;  4M78 E;  2XK0 A;  1M4Z A;  1VIE A;  2QDY B;  3QJ6 A;  4PKC C;  5FU7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...